5BY1A

H18 bat influenza ns1 rna binding domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
71
structure length
71
Chain Sequence
MESTPTTIAFQVDCYLWHLKKMLSLMGEVDAPFEDRLRREQKALKGRSMTLGIDIQAATKAGYYKIKSITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Non-structural protein 1
publication title Novel Bat Influenza Virus NS1 Proteins Bind Double-Stranded RNA and Antagonize Host Innate Immunity.
pubmed doi rcsb
source organism Influenza a virus (a/flat-faced bat/peru/033/2010(h18n11))
total genus 30
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5by1A00
2JRIA 3JAMN 4B3RO 1YZBA 3F5TA 1N33O 4DR4O 1HR0O 4JI1O 1F7YA 4JI6O 2FKXA 4OPAA 4DR6O 1IBLO 4JI5O 4K0KO 4GKJO 5BY1A 1A32A 4DV5O 4X64O 5IWAO 4LF9O 4DV3O 5LMUO 2ZKOA 1G1XB 1FJGO 3OTOO 3T1YO 4LFBO 4DR1O 2LW7A 4DUZO 4DV2O 4DR2O 2F4VO 4NXMO 4JI8O 5H5NA 4X66O 4YHHO 4LF5O 2AGAA 1HNWO 2UXCO 1HNXO 1X59A 1D2DA 3M8AA 5FLXN 3R66A 1N34O 4JI0O 2HHHO 1I94O 2Z0AA 4JYAO 1FKAO 1HNZO 2UXBO 5BXZA 4NXNO 4B3SO 4LFCO 2N74A 2UUAO 5LL6Y 1AILA 3J7AU 4LF6O 4DV6O 4DR7O 4B3TO 4DV4O 3T1HO 5IT9N 4OPHA 4KHPO 1XMOO 4DR3O 2VQFO 2E5LO 4JI3O 4JI2O 1XNQO 1FYJA 4X65O 3O65A 1NS1A 4JI7O 5BR8O 1N32O 2UXDO 4LF8O 3RT3C 2ZM6O 1IBMO 4DR5O 4DV0O 3J80N 4LF4O 1DK1A 2UU9O 1XNRO 1XEQA 1N36O 5LMNO 4DV1O 4LFAO 4OX9O 4AQYO 4YY3O 2DOSA 2DJVA 1R1BA 5A2QN 4LF7O 4DV7O 4JV5O 1IBKO 4DUYO 3J81N 4B3MO 4A5UB 1R6TA 1J5EO 4GKKO 2UUCO 4X62O 1XMQO 1KUQA 4JI4O 2VQEO 3SDLA 2UUBO 1AB3A
chains in the Genus database with same CATH superfamily
1XI1A 3ABTA 4B3RO 3CC4V 3F5TA 3SYCA 2IW5A 4XDKA 4J7JA 2YICA 1NKDA 1Y76A 4CZZA 1YTFB 3R65A 3FAVB 5BY1A 3AG3C 1N4CA 3AEIA 2NNUA 3SPIA 5L3EA 2F43G 1BHBA 4FLYA 4HBNA 4LFBO 1QCEA 4CH3A 1GAXA 5BMVA 4FFBA 2AXTZ 2CK3G 2KQXA 4R6ZA 1OHHG 3LSQA 1WNSA 4RUEA 4PDMA 1S5JA 1OCRB 1MMMA 4O4IA 3K58A 1HNWB 4GLXA 1TGOA 1SA0A 2YI9A 3B2EE 3G67A 4PDRA 4D6TH 1NT2B 4ZOLB 3BCCH 3UQ8A 2UXBO 2R9IA 3ZN1A 2IH3C 4H33A 5DECA 4DV6O 4DV4O 5CB4B 2XNDG 2H8PC 4MW8A 1GMGA 5C93A 3JATA 2EULA 3JARB 2VQFO 1P7GA 4NVPA 2ZE5A 1GH6A 3BA9A 2CE4A 3ASOC 3ZJZA 1TA8A 3ZHVA 4DXWA 3IFXA 5EIBC 4AILC 1JX9A 2EILB 2JEXA 3RBZA 1I5YA 1XUQA 2UU9B 1WP8A 1XEQA 5LMNO 4YJ2A 4U7OA 3HKEB 3IC9A 3ZRWB 1EZJA 1GM9A 1HWYA 2EJ7A 2EZOA 5JWPA 2FTKA 1RPRA 4GKKB 2RMKB 5JH7B 3QVNA 2NLJC 1N0NA 3CCSV 3ZCCA 3SGIA 1N33O 1VQPV 1S72V 3AG3B 3UT5B 4MT8A 2HVKC 4C7UA 2B1IA 1B6QA 3AG7A 5JJEB 4JI5B 3QO8A 1JFFB 3K0DA 4JAAA 4O2BB 4PHZA 2ZKOA 2A06H 4GX5A 3OTOB 4JPRA 1YI2V 4JYBA 2ZR3A 3RVZA 3S3WA 3ETQA 1BHAA 3RYIA 5FL7G 3DXRA 5EBMC 1GKFA 5B66Z 3AK1A 4X20A 2ZXWC 3IAYA 3N2KA 3A2FA 3CC2V 4ZHQA 5TISZ 4OXSA 1U96A 3CEIA 2HP8A 4RUFA 3CRQA 1FKAO 1CXZB 2EBOA 4MVOA 5EZYA 3JSNA 4H0LB 5JJJB 4LFCO 3C90A 2UUAB 4MVMA 2F93B 5FNVA 2WLIA 2BSKB 1TUEB 3HKBA 4DK0A 4O4JA 1IZ3A 4FMTA 2XASA 1SS3A 3ASOB 5EC1C 1K33A 4FM1A 2Z5UA 1XREA 2RQ6A 4LF8B 5LGUA 4X1KB 4LF4B 3BPZA 4I0XB 5LXTB 3LUTB 3SYPA 2P4KA 1JR9A 3OEHG 1IBKB 3ASNC 4J42A 1TAEA 5KMGB 1D5NA 2CTRA 2P4VA 4YJ3A 3HR0A 4KL1A 3SPGA 4B3RB 5ITZB 1ZUQA 3I5DA 3N2GB 4N23A 4UVAA 3RWRD 4IIJA 4FLVA 4FLTA 1QU7A 1KP3A 3KCYA 1XILA 1YDXA 1ORQC 1WP7A 1PNKA 3O9OA 1F4NA 1R73A 4G27B 4N21A 1SERA 1ZLZA 4LFBB 3GWKC 1VQ9V 4O4HA 4IHJA 2OIGA 4K3AA 3UO2A 1BZKA 4R8CA 3BABA 2GHYA 3VQWA 2W0FC 5IY5C 2R9RB 4U3FH 2IJIA 3E35A 3VBBA 1I94O 4H37A 2UXBB 3C3TA 1Y67A 2FL4A 3IC7A 5JVDA 2YDEA 4XBFA 2CTPA 1Q8IA 1AILA 1K4DC 4DV6B 4LF6O 2Q67A 1R3LC 4DV4B 1K97A 2Q7GA 3AG4B 3IGAC 3DSQA 4XDJA 2VQFB 2XAQA 1MZEA 5LGNA 1WAZA 1WLEA 2QJ1A 3L9DA 1QVFU 5J2TB 3PN1A 4CH5A 1VQ4V 3ZEDA 1CP9A 3F7VC 5B3SC 3WB0A 4JTDB 2ZNIA 3L70H 3AG2C 1GN4A 1XNRO 3LSSA 3ASNB 3B09A 4F6RB 3B40A 1R1BA 1K3EA 4UCSA 4P9OA 2QDOA 2Q9LA 1RSOB 1VQLV 3K9AA 4J80A 1AJPA 3WU2Z 4ZI7A 2LFRA 3BVOA 4FIPC 2QGNA 2HG5C 2RJZA 1I5XA 4K8ZA 5B1AC 2UUBO 2E74B 4DUZB 2HKOA 1ZSPA 3T1CA 1EN6A 4H44B 3JASB 1N33B 2CTQA 1L8DA 1G4YB 3LDDA 4Z1MG 3T2MA 2YIAA 1D5AA 1BMFG 3U10A 5KX5B 1M4UA 1DF5A 1IXMA 1AR1B 1N0JA 1SZXA 4TUYB 1EFRG 5LMUO 4KXRA 4KFMA 3CMEV 3CCQV 2ZT9B 3EXAA 5IY5B 3G71V 2BE3A 1HP8A 4I5SA 3K06A 2UXCO 3L71H 5IYDO 2ZNJA 5LGTA 4FJCC 1BL8A 4JYAO 1LUVA 3HKDB 3H1KH 4B3SO 2B5UA 3CJHA 4LFCB 3CE2A 4DR7O 3JYCA 3T1HO 4I4TB 4LH7A 1VQOV 3JD2A 1U97A 4O4LA 4JI3O 2QA4V 1DTOA 1M56C 3X2QC 2P6JA 3ZBHA 4BAYA 3QNEA 3D36C 5E1AC 2JJ1G 3RYFB 2OWOA 4DV1O 3OEEG 4YY3O 2NN4A 1BE3H 3B77A 5D5QA 5B1AB 3JSLA 4QJFB 3TXQA 1ZL8A 4O2AB 3VQXA 2RN9A 5KAFZ 2ADPA 5LA6B 2GSMB 4JAUA 3NXSA 1BT8A 4ICGA 2YUAA 5B1NA 3Q4HA 2AZ2A 2QWNB 4ABMA 2ZE6A 3D3IA 2DYSC 5CBGA 5IJ9B 2Y0IA 4YIOA 1I08A 2GDSA 3ZS8C 5LYJB 4WCEV 4LH6A 4U3JA 5KHHA 1VEWA 3B8MA 1LNQA 2JVDA 2QWRB 1KQSU 4DR2O 1EN4A 3CXCU 3K5LA 4FLXA 1FPOA 4LWSB 3UO3A 3OTFA 5CMUA 1VARA 3K0GA 1I94B 2QR4A 4FVMA 4B08A 3T4DA 5BMVB 4FFBB 2YXHA 2JGDB 4LF6B 3G6BA 3LNNA 4OPHA 3QO5A 3OGIB 4DR3O 3OT7A 1Z5VA 3E22B 5CN0A 4DO2A 1S3JA 1FYJA 3X2QB 1YIJV 1SA0B 4WFFA 1OCRC 3SPJA 3DTUB 3LSUA 1MABG 2B9ZA 1NTZH 2RDCA 3GB7C 1YCIA 1XNRB 3OE7G 2JEUA 4J10A 3W7TA 5IYZB 2FMLA 3DC6A 4YIPA 1TVKB 2XAHA 4BWAA 5CA0B 2PY5A 1MA1A 5DN6G 4YXWG 2LW1A 4PA6A 2IU0A 3JAWA 2BTQA 3UM7A 2UUBB 1J95A 1NZ6A 3RYCA 2R9AA 1GO3F 2QM4A 1NQTA 4JI1O 1Q7YW 2Q7EA 5JJNB 2PYJA 3HKCB 4FFKA 5B1OA 4D7TA 2IU3A 2H3OA 1PD3A 2DQ0A 3FX7A 1B06A 5LMUB 2LGWA 1JCHA 2Q7HA 2PYLA 4TQFA 2DWDC 4I9WA 1GN2A 2IJKA 1PNLA 5J2UB 3OR7C 2AGAA 2UXCB 1MSDA 1ZWIC 1XNQB 1K73W 2QKCA 3AK3A 1FXKC 2HHHO 1H2LA 3OGCC 1VQ6V 4PI2A 4JYAB 5FPRA 1HNZO 4X89A 1JVMA 4JASA 4B3SB 4HNAA 3MDSA 3J7AU 4DR7B 4B7KA 2KG7B 3T1HB 1E79G 3DXRB 1JA8A 3RYHA 3N2KB 1IX9A 1K5SA 4P30A 4JI3B 2WLLA 3OMAB 3SR2C 1BGYH 1H2KA 1V9PA 5LHHA 3BAAA 5EYPA 3SJCC 1Q86W 1GK9A 3P30A 1XMQB 1OV9A 1YITV 3K5MA 2ZDIA 1VQMV 1WB7A 5GONA 2EJRA 4DV1B 5JCOA 5LP6A 4YY3B 2ZE7A 3U11A 1YSCA 2WSSG 2UXXA 2WPDG 1IXBA 3MHHC 4EKWA 1JMKC 1VQ5V 1KMIZ 2A9HA 3BHPA 4JTAB 5KHKA 1EBOA 2ETNA 2DW4A 2JRIA 4JZ2A 1QR8A 2ZIMA 1PL4A 2GUZA 2HEPA 4JF3A 4CBCA 3A0RA 4NTYA 4J7ZA 4OGQB 2OCCC 4Q6GA 1BQ0A 2Q6AA 1B3QA 2WAMA 2L6LA 5AG2A 4ZBMA 2PZSA 4UV8A 4BR6A 3F5WC 1G1XB 4TWKA 1QLEC 4DUZO 1OZ0A 2W6IG 4DR2B 2F4VO 4WBNA 2HLDG 1FXKB 4G2KA 1VF6A 4HAMA 2ITDC 1XBLA 3TK1A 2JK5C 1SQVH 1Y74A 1PV0A 1KYOF 4BIZA 1FXHA 4IT5A 3WB2A 4TT3G 4I55A 4Q20A 1E1RG 5GW7A 4IL6Z 3BRCA 3K59A 5LL6Y 4IHJB 4UVCA 1VIBA 2HFEC 4DR3B 3FAVA 1NTKH 3JALB 1Y4MA 4J9ZB 1KECA 1ZTEA 5DM6V 2Q0AA 2X0LA 3ETEA 4Z2WA 5HFLA 3RT3C 2CAZC 2WLKA 2R70A 2WWWA 1VQNV 3FYIB 3S3XA 3J80N 2PUSA 2OTLV 2X6AA 3ZIAG 5CA1A 1FXVA 2JS3A 4AHCA 5JQGB 2WLHA 2X7RB 2P90A 1NVPD 5IJ0B 3D3QA 4KP4A 4NR1A 2OIEA 2F95B 3AG4C 4A5UB 1J5EO 4PV1B 2F66C 3ZRXA 1F51A 4NB5A 3ZRVA 5H2FZ 2OCCB 4FK5C 4E2LA 4AI8A 5CB4A 3JAMN 1AR5A 3CPWU 3JARA 1P84F 4JI1B 3MHSC 4GYCB 4K0KO 1QLEB 1SZTA 3ZHQA 1VMGA 2AZ0A 1OCZB 3CP1A 5IWAO 3K57A 1ROPA 2ZR2A 4ZI7B 4CS2A 1FFXA 3TETA 4DV2O 3VQYA 3ABLC 3SYOA 1T5EA 3HKEA 2AHZA 3ZRWA 1XHZA 1RPOA 4X66O 2LFSA 2XTAA 2MK3A 4LF5O 5L3BA 1HNXO 3CCJV 1FAFA 1NTMH 3TGUH 5KA5A 2EINB 5JH7A 4FM0A 2HHHB 4UUJC 2GTAA 4G28B 1HNZB 2IBZH 2MW2B 3VOUA 1S5HC 2A79B 3H1LH 4HYOA 4Z1VA 3UT5A 3JD1A 4F4LA 4LNUB 3C3SA 3JAKA 2CH7B 1M93A 2E75B 1VQ7V 3CHXA 4O2BA 4GT1A 1SC5B 3CC7V 1ENVA 1YJWV 3OMNB 2ZM6O 5F2VO 4DR5O 3K5NA 3CCRV 3VQVA 1VF7A 3CYOA 3G6EV 2B1GA 3P3PA 4WFHA 1NJIW 3L74H 4PELA 4RWUA 3BFRA 5LOVA 3DGEA 3H1HH 2P5OA 1YJ9V 1HW7A 3GWOA 1YJNV 2XOKG 4I9QA 5K1PA 1KUQA 1R3JC 2VQEO 2BSKA 3LDEA 2C2AA 1F7YA 1NH2D 1OCOC 1IVSA 2QWOB 4UFZA 4GKJO 4WFAV 3QO7A 4DV5O 4X1YB 3E86A 3FKSG 5HFMA 3CRRA 3ABLB 4I50B 4FZ1A 4QPJA 1H2NA 1PL0A 2XAFA 2DN9A 4PA9A 1O9HA 5B1BC 2F4VB 1AI5A 3CWBH 1YVWA 4CH6A 2Y4UA 5BZBA 2W6JG 1X59A 3U0ZA 3OM3B 1SKVA 3Q4HB 2E3CA 5KMGA 1Q5OA 5KLVH 4TV8A 1S76D 4JTCB 3M99B 3AG1B 1EM1A 2X6CA 2N74A 5ITZA 5DEDA 3N2GA 1EZVH 3HPLC 3FB6C 1WA8A 1H2SB 1S5LZ 4MW3A 3UKMA 4X1IB 1THZA 4NTXA 3K03A 3PJSK 3CXHF 3P3NA 1XL4A 1IDSA 2Z3YA 3ETGA 1TUBB 3OAAG 1XNQO 1KKDA 1WN7A 1F4MA 4NTWA 1WJZA 2XUMA 1N32O 4TV9B 3MAQA 4PDVA 2ARHA 2FB5A 3EVKA 1N36O 1JJ2U 4UCVA 1UFIA 4PJ0Z 3OMIB 2BCCH 2KSDA 1I7FA 4X8AA 4B3MO 2A7WA 1J5EB 1R6TA 4DW0A 4GZRB 1YXBA 1M57C 2ZQMA 4LP8A 3ETDA 3MD0A 4DRXB 1XMQO 1OCOB 1CEZA 2WLNA 2V1DA 1H2MA 4WF9V 3T4ZA 2DQ3A 3FB8C 1S0VA 3SPHA 4JI6O 4PD4F 4MVSA 4K0KB 1XHXA 3E89A 5J2TA 1Q6UA 5B1BB 5IWAB 2F23A 1KP2A 3T1YO 3CRMA 2HJFC 2HJDA 2PI5A 3SPCA 1SQQH 4DV2B 1JOYA 1QQCA 3H01A 1S77D 3ABMB 2IM9A 1FD9A 4F6RA 4JI8O 4X66B 4LF5B 3TCUA 1HNXB 1RSOA 2BTOA 2ODMA 4K8XA 1NI8A 4JI0O 1URFA 3H1IH 4GCZA 2Y69C 4ZKIA 2ZCEA 2DE0X 2DYRC 5C8YB 4FLWA 2Q68A 4EB6A 4GUNA 4B3TO 5IT9N 3SJQC 3APOA 1SESA 1LUWA 5KX5A 4LR3A 2M6YA 2H94A 4EEQA 1Y76B 4CC6A 4TUYA 1X4TA 2AW9A 1NS1A 2UXNA 1US6A 2Q0OC 1K8AW 1H38A 1NR1A 2ZM6B 1IBMO 4DR5B 5LHIA 5B5EZ 4HNAB 3WFVA 1Q6IA 3M7MX 1DK1A 4LFAO 3CMAV 3RFRA 1R3IC 2DJVA 3SJBC 4LF7O 2N05A 1M57B 4O4IB 2WLLB 3OFNG 3HKDA 3ZX6A 2QKAA 1RFYA 1G6UA 2EZPA 2VQEB 4I7ZB 3SDLA 4J7KA 4JI4O 2A0LA 1K92A 4I4TA 4PA3A 3RVYA 1P49A 1I0HA 1MZFA 3FB7C 1KD1W 4RO2A 3JATB 4GKJB 2NR5A 4DV5B 4X64O 4R7CA 1H8EG 1UPGA 3LNMB 3RYFA 2Q69A 3A0BZ 4GX0A 4NXMO 5KAIZ 2Y69B 4BW9A 3QG5A 4YJ2B 3WG7C 3I55V 4UCUA 1N34O 2DYRB 2P67A 1L0NH 3CCLV 2Z0AA 1Q3EA 2CUGA 4J41A 1QR9A 2E76B 2YS8A 1IURA 5LA6A 1M1KW 4PA7A 2YEVA 4W4LA 1E1QG 1SQPH 2LO1A 1WPXA 2QSAA 5KHJA 4JGSA 2JGUA 2E5LO 3CD6V 2PI4A 4MVRA 1SETA 5IJ9A 4X65O 1GN3A 5LYJA 3ZMZA 1V54B 1N32B 1KC8W 4MTGA 2L35A 2GV9A 1MG1A 1N36B 3H9VA 5K1XA 1BSMA 4LWSA 2OYQA 3RYIB 4OX9O 1K9MW 4X20B 5GTHZ 4BW5A 4JV5O 4ZHQB 4B3MB 3K04A 1VQKV 1DGSA 4ASUG 3ABUA 2ITCC 3HB3B 4L8JA 2ATKC 2JGDA 5EZYB 1M90W 3KZIZ 5FNVB 4YHHB 1NVPB 1AVMA 3E22A 2WLIB 1Q43A 3G4SV 5CA1B 4JI6B 3HKBB 4OPAA 4DR6O 1KBHA 1IBLO 4O4JB 3D36A 1JQ0A 1M5IA 1PP9H 4DV3O 2D3OW 3CRCA 3ZHRA 3T1YB 1YEWA 2WLJA 4UXNA 3L75H 3W7XA 1RM1B 1DLBA 1G8MA 3WG7B 4PDLA 4GX2A 2EX3A 4JI8B 5IYZA 2Q4PA 1D2DA 1TVKA 1Q90D 5CA0A 4D7SA 4JI0B 3ML0A 1VP7A 3BA8A 2JJ2G 1BCCH 5H6QA 3ZN0A 4W4KA 1CPYA 2XAJA 4RQFA 4YJ3B 4LC1A 1FFXB 1NU1H 4WFGA 2EIMC 1OCZC 2QE7G 4B3TB 2VRZA 5KHGA 1OCCB 4FM2A 3HKCA 4JYYA 3QTCA 5GTIZ 2P06A 2YIDA 1AJQA 4IIJB 3CCEV 2N04A 4JI2O 3A0HZ 4H13B 1XQ8A 2LQTA 4J11A 1GM7A 1IBMB 2A3QA 2EINC 1JJOA 5J2UA 4MSWC 1OJHA 3NR7A 4UCOA 4O4HB 3ICXA 4LFAB 3RW0A 1AP5A 3JAKB 1QHTA 1MSWD 2WLMA 3ABKC 4XDLA 1AI4A 4LBEC 1UJWB 4LF7B 1LR1A 3F7YC 3K79A 4DV7O 3DC5A 1H8HG 3OUFA 3J81N 1YTFD 3FB5C 2RCVA 5IE9A 1MOFA 1BS3A 4NYKA 3WB1A 5CBFA 3STLC 4JI4B 2JS5A 4EFBA 3RGBA 2KG7A 3OW2U 5JVDB 4DR4O 1HR0O 4JYCA 2ZINA 3BY6A 4KUMA 1YHQV 4BIOA 4B7EA 1NR7A 4QE7A 2YIBA 3CCVV 3E8HA 4ZOLA 1A32A 2W0XA 5LOVB 1R3KC 2K1EA 4X64B 2QWPB 1K7DA 4LF9O 1VF5B 2YI8A 2ILMA 3QF7A 3E2EA 3THOA 2YIBD 1MNGA 2XAGA 1NH2B 4FPPA 4NXMB 1SQGA 5J9PC 2VWKA 5KA6A 3D8CA 5L3FA 2DMXA 1PNMA 1N34B 1AJNA 1AR4A 2Q8VA 3CB2A 2EIMB 4L87A 3B8NA 5BXZA 1PKXA 2BOBC 3A8TA 2VS0A 3CS5A 1JPXA 1SQXH 1XMOO 1H2GA 2E5LB 5IYBO 4X65B 1VQ8V 1QVGU 5KUKA 2EIKC 4TV8B 5H6RA 2CGOA 4MTOA 3ZMTA 5BR8O 4JI7O 2UXDO 2OT5A 4MS2A 3ZMVA 2LJ2A 4CS4A 3ABKB 4DV0O 3K9SA 1FXKA 1XL6A 1R6KA 1W59A 1WA8B 4OX9B 4AQYO 3AG1C 2DOSA 1JFFA 4JV5B 2LP7A 4DUYO 1GTOA 3E8FA 2QM7A 1BQZA 2HR3A 3ZRSA 2QTSA 2UUCO 4X62O 2ZXWB 1AB3A 1AP6A 3JD3A 3CJHB 1KKCA 2Q5ZA 3SYQA 3JALA 1Z5WA 2LGQA 3APQA 1B04A 1HDJA 4DR6B 2FKXA 4CS3A 1IBLB 4FLUA 3B4SA 3FD9A 4O4LB 4FLZA 1Y66A 1GM8A 2IJJA 1Z2GA 3AK2A 4PI0A 4DV3B 1Q82W 2CTWA 4GX1A 1FJGO 2OCHA 4DR1O 2KKWA 2HVJC 3CX5F 5H5NA 5JQGA 1V55C 5LBQA 3K5OA 1FS0G 3OUSA 5IJ0A 2PF4E 1QNMA 3M8AA 1FFTB 4EFEA 3ZMUA 2PGGA 1XDCA 1YF2A 3L73H 2P7TC 4NXNO 1Q81W 3OD4A 4UCTA 5EIBD 2EIJC 4X1KA 1ZL8B 3K3WA 4I0XA 5LXTA 5LMNB 3E83A 3W7WA 4UVBA 4KHPO 2EIKB 2K9PA 4X9QA 4JI2B 4QPKA 1K4CC 1F23A 3ABMC 1SQBH 3O65A 3UCSC 4R50A 4TQDA 3KG2A 3SYAA 4U3JB 2YSUB 4UB8Z 2QM8A 4QGPA 5EC2C 4EB6B 4RAIA 2G38A 2JIZG 3CRAA 5A2QN 4DV7B 2PTMA 5L3DA 4MTXA 4IYIA 1KU9A 1SF9A 1PPJH 3SJAC 4QE9A 4LNUA 4WFEA 2CH7A 3L72H 2DWEC 4DR4B 1HR0B 3GVMA 4LCUC 4FZ0A 3N27A 3G80A 2FYUH 1Q6HA 4UV9A 1W2BU 3ZHTA 3E8BA 4LF9B 3TXSA 1L0LH 2QTOA 2IJHA 1V55B 3JCUZ 2Y48A 2LW7A 1O9GA 3FYEB 1QBZA 3K08A 1QLNA 4YHHO 4QNHB 1HNWO 1AI6A 2OTJV 2ZDIC 5B3SB 5FLXN 4MVZA 2EIJB 2Q73A 3H1JH 4DK1A 4UCRA 4CC5A 3AG2B 1K34A 2KB1A 2YXLA 2XT9A 4E4EA 2Y4TA 5LHGA 5LP6C 5JCOC 5EBWC 2QKSA 2GBOA 4NKGB 2V4DA 3JAWB 2BTQB 5FPOA 2R72A 3RYCB 4MVQA 4HZ3A 1XMOB 2M7WA 3JD4A 1KB9F 1WB8A 1M9NA 3ZHUA 1SQFA 4X1YA 3E8GA 4I50A 1RP3B 1W0JG 3CCUV 3OR6C 4JI7B 2X6BA 5BR8B 3IJ4A 2UXDB 4BIUA 3JASA 4DV0B 2VWJA 4MTFA 2UU9O 2QEXV 2YEVB 4DYLA 2ADQB 4AQYB 1R6NA 3KCXA 1AI7A 3EFFK 2ZIOA 3EHBB 4IYHA 4CH4A 4DUYB 3W7UA 2YXYA 5H9CA 4GKKO 2UUCB 1ZAUA 5L3GA 4X62B 1VF6C 4P9PA 2WA4A 4TOIA 4X1IA 1NBMG 2IH1C 1YZBA 1V54C 4JAVA 3BEHA 1TUBA 5KUMA 5IDJA 1L1FA 4RQEA 4PA4A 4JI5O 2F1MA 1W0KG 5CA3A 3RYHB 3W7SA 4TV9A 1FJGB 3OTOO 1K5QA 3ZMSA 5EYPB 4DW1A 4DR1B 2ZE8A 1GRJA 4TSFG 5EBLC 5GONB 4MVUA 2QWQB 3RN4A 2V7QG 2CGNA 4X88A 1M56B 3KKYA 4UB6Z 4U7NA 5LP6B 3JCZA 3R66A 2D2CB 1XOUA 3JD0A 4DRXA 3I56V 4NXNB 5E79Z 1Y6XA 1EN5A 4P2ZA 2UUAO 2RNBA 1SRYA 3CSXA 5CBHA 3LDCA 2BOCC 2P22C 2O57A 1P4RA 2Y0PA 1P7BA 2GUZB 3STZC 4KHPB 1ZX3A 2AHYA 4F6EA 2GTSA 1COWG 5A9GA 4JZGA 1RM1C 3CCMV 2CDYA 2JDIG 3FFQA 5KHIA 4O2AA 2WA3A 1AROP 1PM9A 1GN6A 4QIWF 4LF8O 4ZIBA 3TJTA 5EK0A 4J9YB 4LF4O 2XHBA 4WBNB 4IGGA 2DYSB 5L3CA 4WFBV 1DF4A 2EILC 5D5PA 3ZHSA 5IYCO 1IBKO 1OCCC 1WPBA 1Y74B 2YC0A 5C8YA 2ZD9A 1N8RW 4I55B 4K35A 3P32A
chains in the Genus database with same CATH topology
2JRIA 3JAMN 4B3RO 1YZBA 3F5TA 1N33O 4DR4O 1HR0O 4JI1O 1F7YA 4JI6O 2FKXA 4OPAA 4DR6O 1IBLO 4JI5O 4K0KO 4GKJO 5BY1A 1A32A 4DV5O 4X64O 5IWAO 4LF9O 4DV3O 5LMUO 2ZKOA 1G1XB 1FJGO 3OTOO 3T1YO 4LFBO 4DR1O 2LW7A 4DUZO 4DV2O 4DR2O 2F4VO 4NXMO 4JI8O 5H5NA 4X66O 4YHHO 4LF5O 2AGAA 1HNWO 2UXCO 1HNXO 1X59A 1D2DA 3M8AA 5FLXN 3R66A 1N34O 4JI0O 2HHHO 1I94O 2Z0AA 4JYAO 1FKAO 1HNZO 2UXBO 5BXZA 4NXNO 4B3SO 4LFCO 2N74A 2UUAO 5LL6Y 1AILA 3J7AU 4LF6O 4DV6O 4DR7O 4B3TO 4DV4O 3T1HO 5IT9N 4OPHA 4KHPO 1XMOO 4DR3O 2VQFO 2E5LO 4JI3O 4JI2O 1XNQO 1FYJA 4X65O 3O65A 1NS1A 4JI7O 5BR8O 1N32O 2UXDO 4LF8O 3RT3C 2ZM6O 1IBMO 4DR5O 4DV0O 3J80N 4LF4O 1DK1A 2UU9O 1XNRO 1XEQA 1N36O 5LMNO 4DV1O 4LFAO 4OX9O 4AQYO 4YY3O 2DOSA 2DJVA 1R1BA 5A2QN 4LF7O 4DV7O 4JV5O 1IBKO 4DUYO 3J81N 4B3MO 4A5UB 1R6TA 1J5EO 4GKKO 2UUCO 4X62O 1XMQO 1KUQA 4JI4O 2VQEO 3SDLA 2UUBO 1AB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRI A;  3JAM N;  4B3R O;  1YZB A;  3F5T A;  1N33 O;  4DR4 O;  1HR0 O;  4JI1 O;  1F7Y A;  4JI6 O;  2FKX A;  4OPA A;  4DR6 O;  1IBL O;  4JI5 O;  4K0K O;  4GKJ O;  5BY1 A;  1A32 A;  4DV5 O;  4X64 O;  5IWA O;  4LF9 O;  4DV3 O;  5LMU O;  2ZKO A;  1G1X B;  1FJG O;  3OTO O;  3T1Y O;  4LFB O;  4DR1 O;  2LW7 A;  4DUZ O;  4DV2 O;  4DR2 O;  2F4V O;  4NXM O;  4JI8 O;  5H5N A;  4X66 O;  4YHH O;  4LF5 O;  2AGA A;  1HNW O;  2UXC O;  1HNX O;  1X59 A;  1D2D A;  3M8A A;  5FLX N;  3R66 A;  1N34 O;  4JI0 O;  2HHH O;  1I94 O;  2Z0A A;  4JYA O;  1FKA O;  1HNZ O;  2UXB O;  5BXZ A;  4NXN O;  4B3S O;  4LFC O;  2N74 A;  2UUA O;  5LL6 Y;  1AIL A;  3J7A U;  4LF6 O;  4DV6 O;  4DR7 O;  4B3T O;  4DV4 O;  3T1H O;  5IT9 N;  4OPH A;  4KHP O;  1XMO O;  4DR3 O;  2VQF O;  2E5L O;  4JI3 O;  4JI2 O;  1XNQ O;  1FYJ A;  4X65 O;  3O65 A;  1NS1 A;  4JI7 O;  5BR8 O;  1N32 O;  2UXD O;  4LF8 O;  3RT3 C;  2ZM6 O;  1IBM O;  4DR5 O;  4DV0 O;  3J80 N;  4LF4 O;  1DK1 A;  2UU9 O;  1XNR O;  1XEQ A;  1N36 O;  5LMN O;  4DV1 O;  4LFA O;  4OX9 O;  4AQY O;  4YY3 O;  2DOS A;  2DJV A;  1R1B A;  5A2Q N;  4LF7 O;  4DV7 O;  4JV5 O;  1IBK O;  4DUY O;  3J81 N;  4B3M O;  4A5U B;  1R6T A;  1J5E O;  4GKK O;  2UUC O;  4X62 O;  1XMQ O;  1KUQ A;  4JI4 O;  2VQE O;  3SDL A;  2UUB O;  1AB3 A; 
#chains in the Genus database with same CATH topology
 1XI1 A;  3ABT A;  4B3R O;  3CC4 V;  3F5T A;  3SYC A;  2IW5 A;  4XDK A;  4J7J A;  2YIC A;  1NKD A;  1Y76 A;  4CZZ A;  1YTF B;  3R65 A;  3FAV B;  5BY1 A;  3AG3 C;  1N4C A;  3AEI A;  2NNU A;  3SPI A;  5L3E A;  2F43 G;  1BHB A;  4FLY A;  4HBN A;  4LFB O;  1QCE A;  4CH3 A;  1GAX A;  5BMV A;  4FFB A;  2AXT Z;  2CK3 G;  2KQX A;  4R6Z A;  1OHH G;  3LSQ A;  1WNS A;  4RUE A;  4PDM A;  1S5J A;  1OCR B;  1MMM A;  4O4I A;  3K58 A;  1HNW B;  4GLX A;  1TGO A;  1SA0 A;  2YI9 A;  3B2E E;  3G67 A;  4PDR A;  4D6T H;  1NT2 B;  4ZOL B;  3BCC H;  3UQ8 A;  2UXB O;  2R9I A;  3ZN1 A;  2IH3 C;  4H33 A;  5DEC A;  4DV6 O;  4DV4 O;  5CB4 B;  2XND G;  2H8P C;  4MW8 A;  1GMG A;  5C93 A;  3JAT A;  2EUL A;  3JAR B;  2VQF O;  1P7G A;  4NVP A;  2ZE5 A;  1GH6 A;  3BA9 A;  2CE4 A;  3ASO C;  3ZJZ A;  1TA8 A;  3ZHV A;  4DXW A;  3IFX A;  5EIB C;  4AIL C;  1JX9 A;  2EIL B;  2JEX A;  3RBZ A;  1I5Y A;  1XUQ A;  2UU9 B;  1WP8 A;  1XEQ A;  5LMN O;  4YJ2 A;  4U7O A;  3HKE B;  3IC9 A;  3ZRW B;  1EZJ A;  1GM9 A;  1HWY A;  2EJ7 A;  2EZO A;  5JWP A;  2FTK A;  1RPR A;  4GKK B;  2RMK B;  5JH7 B;  3QVN A;  2NLJ C;  1N0N A;  3CCS V;  3ZCC A;  3SGI A;  1N33 O;  1VQP V;  1S72 V;  3AG3 B;  3UT5 B;  4MT8 A;  2HVK C;  4C7U A;  2B1I A;  1B6Q A;  3AG7 A;  5JJE B;  4JI5 B;  3QO8 A;  1JFF B;  3K0D A;  4JAA A;  4O2B B;  4PHZ A;  2ZKO A;  2A06 H;  4GX5 A;  3OTO B;  4JPR A;  1YI2 V;  4JYB A;  2ZR3 A;  3RVZ A;  3S3W A;  3ETQ A;  1BHA A;  3RYI A;  5FL7 G;  3DXR A;  5EBM C;  1GKF A;  5B66 Z;  3AK1 A;  4X20 A;  2ZXW C;  3IAY A;  3N2K A;  3A2F A;  3CC2 V;  4ZHQ A;  5TIS Z;  4OXS A;  1U96 A;  3CEI A;  2HP8 A;  4RUF A;  3CRQ A;  1FKA O;  1CXZ B;  2EBO A;  4MVO A;  5EZY A;  3JSN A;  4H0L B;  5JJJ B;  4LFC O;  3C90 A;  2UUA B;  4MVM A;  2F93 B;  5FNV A;  2WLI A;  2BSK B;  1TUE B;  3HKB A;  4DK0 A;  4O4J A;  1IZ3 A;  4FMT A;  2XAS A;  1SS3 A;  3ASO B;  5EC1 C;  1K33 A;  4FM1 A;  2Z5U A;  1XRE A;  2RQ6 A;  4LF8 B;  5LGU A;  4X1K B;  4LF4 B;  3BPZ A;  4I0X B;  5LXT B;  3LUT B;  3SYP A;  2P4K A;  1JR9 A;  3OEH G;  1IBK B;  3ASN C;  4J42 A;  1TAE A;  5KMG B;  1D5N A;  2CTR A;  2P4V A;  4YJ3 A;  3HR0 A;  4KL1 A;  3SPG A;  4B3R B;  5ITZ B;  1ZUQ A;  3I5D A;  3N2G B;  4N23 A;  4UVA A;  3RWR D;  4IIJ A;  4FLV A;  4FLT A;  1QU7 A;  1KP3 A;  3KCY A;  1XIL A;  1YDX A;  1ORQ C;  1WP7 A;  1PNK A;  3O9O A;  1F4N A;  1R73 A;  4G27 B;  4N21 A;  1SER A;  1ZLZ A;  4LFB B;  3GWK C;  1VQ9 V;  4O4H A;  4IHJ A;  2OIG A;  4K3A A;  3UO2 A;  1BZK A;  4R8C A;  3BAB A;  2GHY A;  3VQW A;  2W0F C;  5IY5 C;  2R9R B;  4U3F H;  2IJI A;  3E35 A;  3VBB A;  1I94 O;  4H37 A;  2UXB B;  3C3T A;  1Y67 A;  2FL4 A;  3IC7 A;  5JVD A;  2YDE A;  4XBF A;  2CTP A;  1Q8I A;  1AIL A;  1K4D C;  4DV6 B;  4LF6 O;  2Q67 A;  1R3L C;  4DV4 B;  1K97 A;  2Q7G A;  3AG4 B;  3IGA C;  3DSQ A;  4XDJ A;  2VQF B;  2XAQ A;  1MZE A;  5LGN A;  1WAZ A;  1WLE A;  2QJ1 A;  3L9D A;  1QVF U;  5J2T B;  3PN1 A;  4CH5 A;  1VQ4 V;  3ZED A;  1CP9 A;  3F7V C;  5B3S C;  3WB0 A;  4JTD B;  2ZNI A;  3L70 H;  3AG2 C;  1GN4 A;  1XNR O;  3LSS A;  3ASN B;  3B09 A;  4F6R B;  3B40 A;  1R1B A;  1K3E A;  4UCS A;  4P9O A;  2QDO A;  2Q9L A;  1RSO B;  1VQL V;  3K9A A;  4J80 A;  1AJP A;  3WU2 Z;  4ZI7 A;  2LFR A;  3BVO A;  4FIP C;  2QGN A;  2HG5 C;  2RJZ A;  1I5X A;  4K8Z A;  5B1A C;  2UUB O;  2E74 B;  4DUZ B;  2HKO A;  1ZSP A;  3T1C A;  1EN6 A;  4H44 B;  3JAS B;  1N33 B;  2CTQ A;  1L8D A;  1G4Y B;  3LDD A;  4Z1M G;  3T2M A;  2YIA A;  1D5A A;  1BMF G;  3U10 A;  5KX5 B;  1M4U A;  1DF5 A;  1IXM A;  1AR1 B;  1N0J A;  1SZX A;  4TUY B;  1EFR G;  5LMU O;  4KXR A;  4KFM A;  3CME V;  3CCQ V;  2ZT9 B;  3EXA A;  5IY5 B;  3G71 V;  2BE3 A;  1HP8 A;  4I5S A;  3K06 A;  2UXC O;  3L71 H;  5IYD O;  2ZNJ A;  5LGT A;  4FJC C;  1BL8 A;  4JYA O;  1LUV A;  3HKD B;  3H1K H;  4B3S O;  2B5U A;  3CJH A;  4LFC B;  3CE2 A;  4DR7 O;  3JYC A;  3T1H O;  4I4T B;  4LH7 A;  1VQO V;  3JD2 A;  1U97 A;  4O4L A;  4JI3 O;  2QA4 V;  1DTO A;  1M56 C;  3X2Q C;  2P6J A;  3ZBH A;  4BAY A;  3QNE A;  3D36 C;  5E1A C;  2JJ1 G;  3RYF B;  2OWO A;  4DV1 O;  3OEE G;  4YY3 O;  2NN4 A;  1BE3 H;  3B77 A;  5D5Q A;  5B1A B;  3JSL A;  4QJF B;  3TXQ A;  1ZL8 A;  4O2A B;  3VQX A;  2RN9 A;  5KAF Z;  2ADP A;  5LA6 B;  2GSM B;  4JAU A;  3NXS A;  1BT8 A;  4ICG A;  2YUA A;  5B1N A;  3Q4H A;  2AZ2 A;  2QWN B;  4ABM A;  2ZE6 A;  3D3I A;  2DYS C;  5CBG A;  5IJ9 B;  2Y0I A;  4YIO A;  1I08 A;  2GDS A;  3ZS8 C;  5LYJ B;  4WCE V;  4LH6 A;  4U3J A;  5KHH A;  1VEW A;  3B8M A;  1LNQ A;  2JVD A;  2QWR B;  1KQS U;  4DR2 O;  1EN4 A;  3CXC U;  3K5L A;  4FLX A;  1FPO A;  4LWS B;  3UO3 A;  3OTF A;  5CMU A;  1VAR A;  3K0G A;  1I94 B;  2QR4 A;  4FVM A;  4B08 A;  3T4D A;  5BMV B;  4FFB B;  2YXH A;  2JGD B;  4LF6 B;  3G6B A;  3LNN A;  4OPH A;  3QO5 A;  3OGI B;  4DR3 O;  3OT7 A;  1Z5V A;  3E22 B;  5CN0 A;  4DO2 A;  1S3J A;  1FYJ A;  3X2Q B;  1YIJ V;  1SA0 B;  4WFF A;  1OCR C;  3SPJ A;  3DTU B;  3LSU A;  1MAB G;  2B9Z A;  1NTZ H;  2RDC A;  3GB7 C;  1YCI A;  1XNR B;  3OE7 G;  2JEU A;  4J10 A;  3W7T A;  5IYZ B;  2FML A;  3DC6 A;  4YIP A;  1TVK B;  2XAH A;  4BWA A;  5CA0 B;  2PY5 A;  1MA1 A;  5DN6 G;  4YXW G;  2LW1 A;  4PA6 A;  2IU0 A;  3JAW A;  2BTQ A;  3UM7 A;  2UUB B;  1J95 A;  1NZ6 A;  3RYC A;  2R9A A;  1GO3 F;  2QM4 A;  1NQT A;  4JI1 O;  1Q7Y W;  2Q7E A;  5JJN B;  2PYJ A;  3HKC B;  4FFK A;  5B1O A;  4D7T A;  2IU3 A;  2H3O A;  1PD3 A;  2DQ0 A;  3FX7 A;  1B06 A;  5LMU B;  2LGW A;  1JCH A;  2Q7H A;  2PYL A;  4TQF A;  2DWD C;  4I9W A;  1GN2 A;  2IJK A;  1PNL A;  5J2U B;  3OR7 C;  2AGA A;  2UXC B;  1MSD A;  1ZWI C;  1XNQ B;  1K73 W;  2QKC A;  3AK3 A;  1FXK C;  2HHH O;  1H2L A;  3OGC C;  1VQ6 V;  4PI2 A;  4JYA B;  5FPR A;  1HNZ O;  4X89 A;  1JVM A;  4JAS A;  4B3S B;  4HNA A;  3MDS A;  3J7A U;  4DR7 B;  4B7K A;  2KG7 B;  3T1H B;  1E79 G;  3DXR B;  1JA8 A;  3RYH A;  3N2K B;  1IX9 A;  1K5S A;  4P30 A;  4JI3 B;  2WLL A;  3OMA B;  3SR2 C;  1BGY H;  1H2K A;  1V9P A;  5LHH A;  3BAA A;  5EYP A;  3SJC C;  1Q86 W;  1GK9 A;  3P30 A;  1XMQ B;  1OV9 A;  1YIT V;  3K5M A;  2ZDI A;  1VQM V;  1WB7 A;  5GON A;  2EJR A;  4DV1 B;  5JCO A;  5LP6 A;  4YY3 B;  2ZE7 A;  3U11 A;  1YSC A;  2WSS G;  2UXX A;  2WPD G;  1IXB A;  3MHH C;  4EKW A;  1JMK C;  1VQ5 V;  1KMI Z;  2A9H A;  3BHP A;  4JTA B;  5KHK A;  1EBO A;  2ETN A;  2DW4 A;  2JRI A;  4JZ2 A;  1QR8 A;  2ZIM A;  1PL4 A;  2GUZ A;  2HEP A;  4JF3 A;  4CBC A;  3A0R A;  4NTY A;  4J7Z A;  4OGQ B;  2OCC C;  4Q6G A;  1BQ0 A;  2Q6A A;  1B3Q A;  2WAM A;  2L6L A;  5AG2 A;  4ZBM A;  2PZS A;  4UV8 A;  4BR6 A;  3F5W C;  1G1X B;  4TWK A;  1QLE C;  4DUZ O;  1OZ0 A;  2W6I G;  4DR2 B;  2F4V O;  4WBN A;  2HLD G;  1FXK B;  4G2K A;  1VF6 A;  4HAM A;  2ITD C;  1XBL A;  3TK1 A;  2JK5 C;  1SQV H;  1Y74 A;  1PV0 A;  1KYO F;  4BIZ A;  1FXH A;  4IT5 A;  3WB2 A;  4TT3 G;  4I55 A;  4Q20 A;  1E1R G;  5GW7 A;  4IL6 Z;  3BRC A;  3K59 A;  5LL6 Y;  4IHJ B;  4UVC A;  1VIB A;  2HFE C;  4DR3 B;  3FAV A;  1NTK H;  3JAL B;  1Y4M A;  4J9Z B;  1KEC A;  1ZTE A;  5DM6 V;  2Q0A A;  2X0L A;  3ETE A;  4Z2W A;  5HFL A;  3RT3 C;  2CAZ C;  2WLK A;  2R70 A;  2WWW A;  1VQN V;  3FYI B;  3S3X A;  3J80 N;  2PUS A;  2OTL V;  2X6A A;  3ZIA G;  5CA1 A;  1FXV A;  2JS3 A;  4AHC A;  5JQG B;  2WLH A;  2X7R B;  2P90 A;  1NVP D;  5IJ0 B;  3D3Q A;  4KP4 A;  4NR1 A;  2OIE A;  2F95 B;  3AG4 C;  4A5U B;  1J5E O;  4PV1 B;  2F66 C;  3ZRX A;  1F51 A;  4NB5 A;  3ZRV A;  5H2F Z;  2OCC B;  4FK5 C;  4E2L A;  4AI8 A;  5CB4 A;  3JAM N;  1AR5 A;  3CPW U;  3JAR A;  1P84 F;  4JI1 B;  3MHS C;  4GYC B;  4K0K O;  1QLE B;  1SZT A;  3ZHQ A;  1VMG A;  2AZ0 A;  1OCZ B;  3CP1 A;  5IWA O;  3K57 A;  1ROP A;  2ZR2 A;  4ZI7 B;  4CS2 A;  1FFX A;  3TET A;  4DV2 O;  3VQY A;  3ABL C;  3SYO A;  1T5E A;  3HKE A;  2AHZ A;  3ZRW A;  1XHZ A;  1RPO A;  4X66 O;  2LFS A;  2XTA A;  2MK3 A;  4LF5 O;  5L3B A;  1HNX O;  3CCJ V;  1FAF A;  1NTM H;  3TGU H;  5KA5 A;  2EIN B;  5JH7 A;  4FM0 A;  2HHH B;  4UUJ C;  2GTA A;  4G28 B;  1HNZ B;  2IBZ H;  2MW2 B;  3VOU A;  1S5H C;  2A79 B;  3H1L H;  4HYO A;  4Z1V A;  3UT5 A;  3JD1 A;  4F4L A;  4LNU B;  3C3S A;  3JAK A;  2CH7 B;  1M93 A;  2E75 B;  1VQ7 V;  3CHX A;  4O2B A;  4GT1 A;  1SC5 B;  3CC7 V;  1ENV A;  1YJW V;  3OMN B;  2ZM6 O;  5F2V O;  4DR5 O;  3K5N A;  3CCR V;  3VQV A;  1VF7 A;  3CYO A;  3G6E V;  2B1G A;  3P3P A;  4WFH A;  1NJI W;  3L74 H;  4PEL A;  4RWU A;  3BFR A;  5LOV A;  3DGE A;  3H1H H;  2P5O A;  1YJ9 V;  1HW7 A;  3GWO A;  1YJN V;  2XOK G;  4I9Q A;  5K1P A;  1KUQ A;  1R3J C;  2VQE O;  2BSK A;  3LDE A;  2C2A A;  1F7Y A;  1NH2 D;  1OCO C;  1IVS A;  2QWO B;  4UFZ A;  4GKJ O;  4WFA V;  3QO7 A;  4DV5 O;  4X1Y B;  3E86 A;  3FKS G;  5HFM A;  3CRR A;  3ABL B;  4I50 B;  4FZ1 A;  4QPJ A;  1H2N A;  1PL0 A;  2XAF A;  2DN9 A;  4PA9 A;  1O9H A;  5B1B C;  2F4V B;  1AI5 A;  3CWB H;  1YVW A;  4CH6 A;  2Y4U A;  5BZB A;  2W6J G;  1X59 A;  3U0Z A;  3OM3 B;  1SKV A;  3Q4H B;  2E3C A;  5KMG A;  1Q5O A;  5KLV H;  4TV8 A;  1S76 D;  4JTC B;  3M99 B;  3AG1 B;  1EM1 A;  2X6C A;  2N74 A;  5ITZ A;  5DED A;  3N2G A;  1EZV H;  3HPL C;  3FB6 C;  1WA8 A;  1H2S B;  1S5L Z;  4MW3 A;  3UKM A;  4X1I B;  1THZ A;  4NTX A;  3K03 A;  3PJS K;  3CXH F;  3P3N A;  1XL4 A;  1IDS A;  2Z3Y A;  3ETG A;  1TUB B;  3OAA G;  1XNQ O;  1KKD A;  1WN7 A;  1F4M A;  4NTW A;  1WJZ A;  2XUM A;  1N32 O;  4TV9 B;  3MAQ A;  4PDV A;  2ARH A;  2FB5 A;  3EVK A;  1N36 O;  1JJ2 U;  4UCV A;  1UFI A;  4PJ0 Z;  3OMI B;  2BCC H;  2KSD A;  1I7F A;  4X8A A;  4B3M O;  2A7W A;  1J5E B;  1R6T A;  4DW0 A;  4GZR B;  1YXB A;  1M57 C;  2ZQM A;  4LP8 A;  3ETD A;  3MD0 A;  4DRX B;  1XMQ O;  1OCO B;  1CEZ A;  2WLN A;  2V1D A;  1H2M A;  4WF9 V;  3T4Z A;  2DQ3 A;  3FB8 C;  1S0V A;  3SPH A;  4JI6 O;  4PD4 F;  4MVS A;  4K0K B;  1XHX A;  3E89 A;  5J2T A;  1Q6U A;  5B1B B;  5IWA B;  2F23 A;  1KP2 A;  3T1Y O;  3CRM A;  2HJF C;  2HJD A;  2PI5 A;  3SPC A;  1SQQ H;  4DV2 B;  1JOY A;  1QQC A;  3H01 A;  1S77 D;  3ABM B;  2IM9 A;  1FD9 A;  4F6R A;  4JI8 O;  4X66 B;  4LF5 B;  3TCU A;  1HNX B;  1RSO A;  2BTO A;  2ODM A;  4K8X A;  1NI8 A;  4JI0 O;  1URF A;  3H1I H;  4GCZ A;  2Y69 C;  4ZKI A;  2ZCE A;  2DE0 X;  2DYR C;  5C8Y B;  4FLW A;  2Q68 A;  4EB6 A;  4GUN A;  4B3T O;  5IT9 N;  3SJQ C;  3APO A;  1SES A;  1LUW A;  5KX5 A;  4LR3 A;  2M6Y A;  2H94 A;  4EEQ A;  1Y76 B;  4CC6 A;  4TUY A;  1X4T A;  2AW9 A;  1NS1 A;  2UXN A;  1US6 A;  2Q0O C;  1K8A W;  1H38 A;  1NR1 A;  2ZM6 B;  1IBM O;  4DR5 B;  5LHI A;  5B5E Z;  4HNA B;  3WFV A;  1Q6I A;  3M7M X;  1DK1 A;  4LFA O;  3CMA V;  3RFR A;  1R3I C;  2DJV A;  3SJB C;  4LF7 O;  2N05 A;  1M57 B;  4O4I B;  2WLL B;  3OFN G;  3HKD A;  3ZX6 A;  2QKA A;  1RFY A;  1G6U A;  2EZP A;  2VQE B;  4I7Z B;  3SDL A;  4J7K A;  4JI4 O;  2A0L A;  1K92 A;  4I4T A;  4PA3 A;  3RVY A;  1P49 A;  1I0H A;  1MZF A;  3FB7 C;  1KD1 W;  4RO2 A;  3JAT B;  4GKJ B;  2NR5 A;  4DV5 B;  4X64 O;  4R7C A;  1H8E G;  1UPG A;  3LNM B;  3RYF A;  2Q69 A;  3A0B Z;  4GX0 A;  4NXM O;  5KAI Z;  2Y69 B;  4BW9 A;  3QG5 A;  4YJ2 B;  3WG7 C;  3I55 V;  4UCU A;  1N34 O;  2DYR B;  2P67 A;  1L0N H;  3CCL V;  2Z0A A;  1Q3E A;  2CUG A;  4J41 A;  1QR9 A;  2E76 B;  2YS8 A;  1IUR A;  5LA6 A;  1M1K W;  4PA7 A;  2YEV A;  4W4L A;  1E1Q G;  1SQP H;  2LO1 A;  1WPX A;  2QSA A;  5KHJ A;  4JGS A;  2JGU A;  2E5L O;  3CD6 V;  2PI4 A;  4MVR A;  1SET A;  5IJ9 A;  4X65 O;  1GN3 A;  5LYJ A;  3ZMZ A;  1V54 B;  1N32 B;  1KC8 W;  4MTG A;  2L35 A;  2GV9 A;  1MG1 A;  1N36 B;  3H9V A;  5K1X A;  1BSM A;  4LWS A;  2OYQ A;  3RYI B;  4OX9 O;  1K9M W;  4X20 B;  5GTH Z;  4BW5 A;  4JV5 O;  4ZHQ B;  4B3M B;  3K04 A;  1VQK V;  1DGS A;  4ASU G;  3ABU A;  2ITC C;  3HB3 B;  4L8J A;  2ATK C;  2JGD A;  5EZY B;  1M90 W;  3KZI Z;  5FNV B;  4YHH B;  1NVP B;  1AVM A;  3E22 A;  2WLI B;  1Q43 A;  3G4S V;  5CA1 B;  4JI6 B;  3HKB B;  4OPA A;  4DR6 O;  1KBH A;  1IBL O;  4O4J B;  3D36 A;  1JQ0 A;  1M5I A;  1PP9 H;  4DV3 O;  2D3O W;  3CRC A;  3ZHR A;  3T1Y B;  1YEW A;  2WLJ A;  4UXN A;  3L75 H;  3W7X A;  1RM1 B;  1DLB A;  1G8M A;  3WG7 B;  4PDL A;  4GX2 A;  2EX3 A;  4JI8 B;  5IYZ A;  2Q4P A;  1D2D A;  1TVK A;  1Q90 D;  5CA0 A;  4D7S A;  4JI0 B;  3ML0 A;  1VP7 A;  3BA8 A;  2JJ2 G;  1BCC H;  5H6Q A;  3ZN0 A;  4W4K A;  1CPY A;  2XAJ A;  4RQF A;  4YJ3 B;  4LC1 A;  1FFX B;  1NU1 H;  4WFG A;  2EIM C;  1OCZ C;  2QE7 G;  4B3T B;  2VRZ A;  5KHG A;  1OCC B;  4FM2 A;  3HKC A;  4JYY A;  3QTC A;  5GTI Z;  2P06 A;  2YID A;  1AJQ A;  4IIJ B;  3CCE V;  2N04 A;  4JI2 O;  3A0H Z;  4H13 B;  1XQ8 A;  2LQT A;  4J11 A;  1GM7 A;  1IBM B;  2A3Q A;  2EIN C;  1JJO A;  5J2U A;  4MSW C;  1OJH A;  3NR7 A;  4UCO A;  4O4H B;  3ICX A;  4LFA B;  3RW0 A;  1AP5 A;  3JAK B;  1QHT A;  1MSW D;  2WLM A;  3ABK C;  4XDL A;  1AI4 A;  4LBE C;  1UJW B;  4LF7 B;  1LR1 A;  3F7Y C;  3K79 A;  4DV7 O;  3DC5 A;  1H8H G;  3OUF A;  3J81 N;  1YTF D;  3FB5 C;  2RCV A;  5IE9 A;  1MOF A;  1BS3 A;  4NYK A;  3WB1 A;  5CBF A;  3STL C;  4JI4 B;  2JS5 A;  4EFB A;  3RGB A;  2KG7 A;  3OW2 U;  5JVD B;  4DR4 O;  1HR0 O;  4JYC A;  2ZIN A;  3BY6 A;  4KUM A;  1YHQ V;  4BIO A;  4B7E A;  1NR7 A;  4QE7 A;  2YIB A;  3CCV V;  3E8H A;  4ZOL A;  1A32 A;  2W0X A;  5LOV B;  1R3K C;  2K1E A;  4X64 B;  2QWP B;  1K7D A;  4LF9 O;  1VF5 B;  2YI8 A;  2ILM A;  3QF7 A;  3E2E A;  3THO A;  2YIB D;  1MNG A;  2XAG A;  1NH2 B;  4FPP A;  4NXM B;  1SQG A;  5J9P C;  2VWK A;  5KA6 A;  3D8C A;  5L3F A;  2DMX A;  1PNM A;  1N34 B;  1AJN A;  1AR4 A;  2Q8V A;  3CB2 A;  2EIM B;  4L87 A;  3B8N A;  5BXZ A;  1PKX A;  2BOB C;  3A8T A;  2VS0 A;  3CS5 A;  1JPX A;  1SQX H;  1XMO O;  1H2G A;  2E5L B;  5IYB O;  4X65 B;  1VQ8 V;  1QVG U;  5KUK A;  2EIK C;  4TV8 B;  5H6R A;  2CGO A;  4MTO A;  3ZMT A;  5BR8 O;  4JI7 O;  2UXD O;  2OT5 A;  4MS2 A;  3ZMV A;  2LJ2 A;  4CS4 A;  3ABK B;  4DV0 O;  3K9S A;  1FXK A;  1XL6 A;  1R6K A;  1W59 A;  1WA8 B;  4OX9 B;  4AQY O;  3AG1 C;  2DOS A;  1JFF A;  4JV5 B;  2LP7 A;  4DUY O;  1GTO A;  3E8F A;  2QM7 A;  1BQZ A;  2HR3 A;  3ZRS A;  2QTS A;  2UUC O;  4X62 O;  2ZXW B;  1AB3 A;  1AP6 A;  3JD3 A;  3CJH B;  1KKC A;  2Q5Z A;  3SYQ A;  3JAL A;  1Z5W A;  2LGQ A;  3APQ A;  1B04 A;  1HDJ A;  4DR6 B;  2FKX A;  4CS3 A;  1IBL B;  4FLU A;  3B4S A;  3FD9 A;  4O4L B;  4FLZ A;  1Y66 A;  1GM8 A;  2IJJ A;  1Z2G A;  3AK2 A;  4PI0 A;  4DV3 B;  1Q82 W;  2CTW A;  4GX1 A;  1FJG O;  2OCH A;  4DR1 O;  2KKW A;  2HVJ C;  3CX5 F;  5H5N A;  5JQG A;  1V55 C;  5LBQ A;  3K5O A;  1FS0 G;  3OUS A;  5IJ0 A;  2PF4 E;  1QNM A;  3M8A A;  1FFT B;  4EFE A;  3ZMU A;  2PGG A;  1XDC A;  1YF2 A;  3L73 H;  2P7T C;  4NXN O;  1Q81 W;  3OD4 A;  4UCT A;  5EIB D;  2EIJ C;  4X1K A;  1ZL8 B;  3K3W A;  4I0X A;  5LXT A;  5LMN B;  3E83 A;  3W7W A;  4UVB A;  4KHP O;  2EIK B;  2K9P A;  4X9Q A;  4JI2 B;  4QPK A;  1K4C C;  1F23 A;  3ABM C;  1SQB H;  3O65 A;  3UCS C;  4R50 A;  4TQD A;  3KG2 A;  3SYA A;  4U3J B;  2YSU B;  4UB8 Z;  2QM8 A;  4QGP A;  5EC2 C;  4EB6 B;  4RAI A;  2G38 A;  2JIZ G;  3CRA A;  5A2Q N;  4DV7 B;  2PTM A;  5L3D A;  4MTX A;  4IYI A;  1KU9 A;  1SF9 A;  1PPJ H;  3SJA C;  4QE9 A;  4LNU A;  4WFE A;  2CH7 A;  3L72 H;  2DWE C;  4DR4 B;  1HR0 B;  3GVM A;  4LCU C;  4FZ0 A;  3N27 A;  3G80 A;  2FYU H;  1Q6H A;  4UV9 A;  1W2B U;  3ZHT A;  3E8B A;  4LF9 B;  3TXS A;  1L0L H;  2QTO A;  2IJH A;  1V55 B;  3JCU Z;  2Y48 A;  2LW7 A;  1O9G A;  3FYE B;  1QBZ A;  3K08 A;  1QLN A;  4YHH O;  4QNH B;  1HNW O;  1AI6 A;  2OTJ V;  2ZDI C;  5B3S B;  5FLX N;  4MVZ A;  2EIJ B;  2Q73 A;  3H1J H;  4DK1 A;  4UCR A;  4CC5 A;  3AG2 B;  1K34 A;  2KB1 A;  2YXL A;  2XT9 A;  4E4E A;  2Y4T A;  5LHG A;  5LP6 C;  5JCO C;  5EBW C;  2QKS A;  2GBO A;  4NKG B;  2V4D A;  3JAW B;  2BTQ B;  5FPO A;  2R72 A;  3RYC B;  4MVQ A;  4HZ3 A;  1XMO B;  2M7W A;  3JD4 A;  1KB9 F;  1WB8 A;  1M9N A;  3ZHU A;  1SQF A;  4X1Y A;  3E8G A;  4I50 A;  1RP3 B;  1W0J G;  3CCU V;  3OR6 C;  4JI7 B;  2X6B A;  5BR8 B;  3IJ4 A;  2UXD B;  4BIU A;  3JAS A;  4DV0 B;  2VWJ A;  4MTF A;  2UU9 O;  2QEX V;  2YEV B;  4DYL A;  2ADQ B;  4AQY B;  1R6N A;  3KCX A;  1AI7 A;  3EFF K;  2ZIO A;  3EHB B;  4IYH A;  4CH4 A;  4DUY B;  3W7U A;  2YXY A;  5H9C A;  4GKK O;  2UUC B;  1ZAU A;  5L3G A;  4X62 B;  1VF6 C;  4P9P A;  2WA4 A;  4TOI A;  4X1I A;  1NBM G;  2IH1 C;  1YZB A;  1V54 C;  4JAV A;  3BEH A;  1TUB A;  5KUM A;  5IDJ A;  1L1F A;  4RQE A;  4PA4 A;  4JI5 O;  2F1M A;  1W0K G;  5CA3 A;  3RYH B;  3W7S A;  4TV9 A;  1FJG B;  3OTO O;  1K5Q A;  3ZMS A;  5EYP B;  4DW1 A;  4DR1 B;  2ZE8 A;  1GRJ A;  4TSF G;  5EBL C;  5GON B;  4MVU A;  2QWQ B;  3RN4 A;  2V7Q G;  2CGN A;  4X88 A;  1M56 B;  3KKY A;  4UB6 Z;  4U7N A;  5LP6 B;  3JCZ A;  3R66 A;  2D2C B;  1XOU A;  3JD0 A;  4DRX A;  3I56 V;  4NXN B;  5E79 Z;  1Y6X A;  1EN5 A;  4P2Z A;  2UUA O;  2RNB A;  1SRY A;  3CSX A;  5CBH A;  3LDC A;  2BOC C;  2P22 C;  2O57 A;  1P4R A;  2Y0P A;  1P7B A;  2GUZ B;  3STZ C;  4KHP B;  1ZX3 A;  2AHY A;  4F6E A;  2GTS A;  1COW G;  5A9G A;  4JZG A;  1RM1 C;  3CCM V;  2CDY A;  2JDI G;  3FFQ A;  5KHI A;  4O2A A;  2WA3 A;  1ARO P;  1PM9 A;  1GN6 A;  4QIW F;  4LF8 O;  4ZIB A;  3TJT A;  5EK0 A;  4J9Y B;  4LF4 O;  2XHB A;  4WBN B;  4IGG A;  2DYS B;  5L3C A;  4WFB V;  1DF4 A;  2EIL C;  5D5P A;  3ZHS A;  5IYC O;  1IBK O;  1OCC C;  1WPB A;  1Y74 B;  2YC0 A;  5C8Y A;  2ZD9 A;  1N8R W;  4I55 B;  4K35 A;  3P32 A; 
#chains in the Genus database with same CATH homology
 2JRI A;  3JAM N;  4B3R O;  1YZB A;  3F5T A;  1N33 O;  4DR4 O;  1HR0 O;  4JI1 O;  1F7Y A;  4JI6 O;  2FKX A;  4OPA A;  4DR6 O;  1IBL O;  4JI5 O;  4K0K O;  4GKJ O;  5BY1 A;  1A32 A;  4DV5 O;  4X64 O;  5IWA O;  4LF9 O;  4DV3 O;  5LMU O;  2ZKO A;  1G1X B;  1FJG O;  3OTO O;  3T1Y O;  4LFB O;  4DR1 O;  2LW7 A;  4DUZ O;  4DV2 O;  4DR2 O;  2F4V O;  4NXM O;  4JI8 O;  5H5N A;  4X66 O;  4YHH O;  4LF5 O;  2AGA A;  1HNW O;  2UXC O;  1HNX O;  1X59 A;  1D2D A;  3M8A A;  5FLX N;  3R66 A;  1N34 O;  4JI0 O;  2HHH O;  1I94 O;  2Z0A A;  4JYA O;  1FKA O;  1HNZ O;  2UXB O;  5BXZ A;  4NXN O;  4B3S O;  4LFC O;  2N74 A;  2UUA O;  5LL6 Y;  1AIL A;  3J7A U;  4LF6 O;  4DV6 O;  4DR7 O;  4B3T O;  4DV4 O;  3T1H O;  5IT9 N;  4OPH A;  4KHP O;  1XMO O;  4DR3 O;  2VQF O;  2E5L O;  4JI3 O;  4JI2 O;  1XNQ O;  1FYJ A;  4X65 O;  3O65 A;  1NS1 A;  4JI7 O;  5BR8 O;  1N32 O;  2UXD O;  4LF8 O;  3RT3 C;  2ZM6 O;  1IBM O;  4DR5 O;  4DV0 O;  3J80 N;  4LF4 O;  1DK1 A;  2UU9 O;  1XNR O;  1XEQ A;  1N36 O;  5LMN O;  4DV1 O;  4LFA O;  4OX9 O;  4AQY O;  4YY3 O;  2DOS A;  2DJV A;  1R1B A;  5A2Q N;  4LF7 O;  4DV7 O;  4JV5 O;  1IBK O;  4DUY O;  3J81 N;  4B3M O;  4A5U B;  1R6T A;  1J5E O;  4GKK O;  2UUC O;  4X62 O;  1XMQ O;  1KUQ A;  4JI4 O;  2VQE O;  3SDL A;  2UUB O;  1AB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...