5BY1A

H18 bat influenza ns1 rna binding domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
71
structure length
71
Chain Sequence
b'MESTPTTIAFQVDCYLWHLKKMLSLMGEVDAPFEDRLRREQKALKGRSMTLGIDIQAATKAGYYKIKSITE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Novel Bat Influenza Virus NS1 Proteins Bind Double-Stranded RNA and Antagonize Host Innate Immunity.
pubmed doi rcsb
source organism Influenza a virus (a/flat-faced bat/peru/033/2010(h18n11))
molecule tags Viral protein
total genus 30
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5by1A00
4DV1O 1IBKO 5BY1A 4DV7O 2UUBO 4DR3O 4JI3O 1KUQA 1XMQO 1HR0O 4YY3O 1YZBA 1HNZO 1G1XB 4DR2O 1FYJA 3O65A 4LF6O 4JI4O 4GKJO 1F7YA 1I94O 1X59A 4JI7O 4DR4O 4X62O 2JRIA 4K0KO 2UXBO 4KHPO 3RT3C 1R1BA 1A32A 4DUYO 4LFAO 2LW7A 4OX9O 2DOSA 1J5EO 1FKAO 2UUCO 4JI1O 4YHHO 1N33O 1XNQO 3J7AU 4JI0O 3F5TA 1N34O 4LF7O 4DR6O 4DV3O 3SDLA 4DR5O 4NXNO 5IWAO 4X64O 1AB3A 4B3TO 1XEQA 1FJGO 2N74A 4B3RO 3J81N 3OTOO 4LFCO 2VQEO 4JYAO 4DV0O 4JI5O 3T1HO 4B3MO 2Z0AA 3JAMN 2HHHO 4LF4O 2FKXA 4JI6O 5BXZA 1XMOO 2UXDO 2DJVA 2F4VO 2UU9O 5H5NA 2ZM6O 4B3SO 2VQFO 1XNRO 4DR1O 4DV4O 1IBLO 2AGAA 3R66A 1AILA 5LL6Y 4JI8O 1HNWO 4DV6O 1N36O 4DUZO 1N32O 4X66O 4DR7O 4JI2O 4DV2O 5A2QN 1R6TA 2UUAO 4LF9O 4GKKO 1NS1A 4AQYO 4LFBO 4OPAA 1IBMO 5BR8O 4LF5O 2UXCO 4OPHA 4LF8O 5FLXN 5LMUO 3T1YO 4A5UB 1DK1A 2ZKOA 3M8AA 3J80N 1HNXO 5LMNO 2E5LO 5IT9N 4X65O 4NXMO 4JV5O 1D2DA 4DV5O
chains in the Genus database with same CATH superfamily
2CH7A 3BAAA 2KSDA 4B7KA 1VQ6V 3ZEDA 2K9PA 1FYJA 2LFSA 1SQFA 3BVOA 3UT5A 2JK5C 3T2MA 3ZMTA 3ZRSA 5L3FA 3K79A 3OGIB 5LP6C 2BTQB 2EILB 1H8EG 2HP8A 5IY5B 2EULA 1JVMA 4K8XA 3HPLC 1CPYA 4UCOA 1FKAO 3WFVA 4YHHO 4Q6GA 1U97A 1FFTB 1EFRG 1M56C 1ORQC 2X6CA 2VRZA 2DYRB 4DR6O 4DV3O 2DQ3A 2DQ0A 3NXSA 3H1JH 1YITV 1XL6A 4WCEV 4FLUA 5AG2A 2PY5A 4NB5A 3JSLA 4RWUA 2VWJA 1GMGA 1Q6HA 1JOYA 3UO3A 4G28B 4I7ZB 2PZSA 4X62B 2EZPA 3A0BZ 1MA1A 5LYJA 3OD4A 5LMNB 4B3SO 2HJDA 4IT5A 2IH3C 1GN3A 1TVKA 3RGBA 1XNRO 4O4HA 5BMVB 1OCOB 2ATKC 2FTKA 2ZDIA 1EM1A 3ZJZA 1OCCC 1R73A 2FMLA 3OE7G 3AK1A 1JMKC 2BOCC 4JYYA 3VQWA 2ARHA 2QWOB 1D5AA 3FYEB 4JYCA 1EN6A 4YJ3A 5CA0A 4X88A 2X6AA 4LP8A 1MG1A 1NTZH 3TETA 1SETA 2QE7G 2ZKOA 3AG3B 3Q4HA 3DSQA 5IYZB 3B4SA 4UVAA 3JD1A 3A8TA 1JX9A 1BGYH 1WN7A 2EJRA 1KUQA 4F6RB 4YY3O 4P2ZA 1PL4A 3CC7V 5B3SC 2QTSA 5JVDB 1YF2A 5IYCO 2VQEB 4X66B 2R72A 1IDSA 3K03A 2V1DA 4B3MB 5J9PC 4LF4B 1EZJA 2KG7B 3SYQA 4EFEA 2LGWA 5B1BB 2WLIB 1J5EO 5CBFA 1H2MA 5D5QA 3ASOC 1GK9A 4JI0O 1QQCA 1SC5B 4ABMA 1VQ4V 1KKDA 4UUJC 1IVSA 1SZTA 4UCUA 4PA6A 5LOVA 2F23A 4DYLA 1FXHA 4CS3A 1CXZB 3SPJA 1Y6XA 1W59A 2ODMA 4DR2B 5ITZB 2RJZA 3TXSA 1E1QG 1FFXA 4TT3G 1X4TA 2LQTA 1TAEA 1YXBA 4K35A 2UU9O 3SYAA 1QLEC 1AI6A 5H5NA 2ZM6O 1JJ2U 4U3FH 1LNQA 3THOA 1KMIZ 2W0XA 3BPZA 4GX1A 4K8ZA 3ZCCA 4DR5B 3WG7B 4B3TB 2CAZC 5JH7B 4O2BB 1FXKC 4CH5A 1VQ8V 1PKXA 3I56V 4AQYO 2WPDG 4JI5B 4FM2A 5HFLA 3AK3A 4OPHA 3T1CA 3G6EV 4NR1A 3A0HZ 1K92A 2NR5A 1XMOB 2E5LO 5IT9N 4E4EA 1B06A 2AHYA 1K4DC 3L73H 2GV9A 3LSUA 4PV1B 3L74H 3OTFA 1HNWB 1Q82W 4GKJO 2GUZA 1ZWIC 2WLKA 2JS3A 1X59A 3K59A 4EEQA 1PNMA 4CS4A 3WB1A 5E79Z 2ITDC 5IYDO 5TISZ 4GKKB 1GO3F 2WA4A 3ASNB 4F6EA 2EIKB 3CCRV 3C3SA 2VQFB 3O9OA 2F1MA 3ETEA 3UM7A 4ICGA 2P90A 3P3PA 1FJGO 2LW1A 4DK1A 4TOIA 1AR1B 4DV0O 2ZE8A 1SA0A 2P4VA 3ZBHA 1NU1H 2HHHO 1XILA 3K04A 4LF5B 2BSKA 3JALA 4DW1A 1HDJA 4IHJB 4DRXA 4JYBA 1AJQA 1FD9A 4JV5B 1RPRA 5EZYA 2X6BA 1S5JA 2YEVB 2YXYA 3FAVA 3SYPA 3HR0A 4DR7O 3OR6C 3FB5C 1MSWD 2ZE7A 5EBWC 2YI9A 2KKWA 4X9QA 3X2QC 4NXNB 1QR8A 2PF4E 2QR4A 4ZHQA 1BMFG 3BRCA 4F4LA 1IBMO 3T1HB 1QLNA 5FLXN 3CCVV 4FPPA 1BHAA 4JI1B 1NZ6A 1DK1A 3BFRA 4H13B 2FB5A 1R6KA 2WSSG 3RWRD 4YJ2B 5DEDA 3W7XA 1HNZO 5CA0B 1NH2B 4DV4B 1WLEA 3ETGA 3B40A 4MSWC 4DV2B 2LJ2A 1GTOA 2O57A 2IU3A 3STLC 2BTQA 4KHPO 1F51A 1AROP 2CUGA 2GSMB 3OFNG 4TQDA 3RN4A 4EB6B 1XNQO 1NR1A 3F5TA 5LMUB 1Q5OA 3E2EA 1ZLZA 1H2SB 1G8MA 2MW2B 3OEEG 5DN6G 4X1IB 1S5LZ 1MZFA 5L3CA 3P30A 3I5DA 1QR9A 2EIJC 2XAJA 1K5QA 4X1YB 1AJPA 4NYKA 3OEHG 1OCZB 1CEZA 3ZMVA 4J80A 1S77D 1M1KW 3SPHA 2ZNIA 1UPGA 3ZN0A 4UV9A 3LNNA 4LWSA 1EN4A 5GONA 3K3WA 4FFBB 5LL6Y 4GX0A 1NT2B 1N36O 3ZN1A 4MTGA 4BW9A 4H0LB 4K3AA 5KMGB 3W7UA 5A2QN 4X8AA 1F4NA 2EIMB 4MW8A 3OTOB 3RBZA 1OCRC 2AXTZ 1PP9H 1Q81W 1MZEA 4LFAB 4A5UB 2YI8A 5LMNO 4RUEA 2UXDB 1XDCA 1AI4A 2K1EA 2OIEA 3CB2A 4LR3A 5IYZA 4KUMA 3FB7C 4XDJA 5H9CA 5H2FZ 1IBLB 4G2KA 2EINC 4F6RA 4JI4O 1N32B 5B1AC 3OW2U 4TSFG 4FLVA 1ZL8B 2Q8VA 2NLJC 3RYIB 1YHQV 1I08A 4YIOA 2QWQB 5EIBD 1EN5A 3VQXA 2YICA 4I50B 2F4VB 2KQXA 5BR8B 1VQ9V 3CEIA 3ABLB 1GN2A 2WLIA 5LHGA 5IJ0B 1XHZA 5EBMC 1BT8A 1IBKB 2PI4A 3K0GA 2ETNA 3J81N 5GTHZ 3B09A 2Q73A 3ABKB 4HAMA 4MW3A 2VQEO 2EILC 4B3MO 4LF4O 4GLXA 5ITZA 4J11A 2Q5ZA 2ADQB 4LH6A 3CYOA 5IE9A 3T4ZA 2H3OA 3CE2A 3CMAV 4DR1O 4TV8B 3GVMA 2AGAA 4FZ0A 1SA0B 2XHBA 1VQKV 3WU2Z 2IJIA 1JPXA 4JI2O 2QM7A 4RAIA 1Q86W 1PV0A 2P06A 3UO2A 4FLTA 1RPOA 4JYAB 5JH7A 1UFIA 2ZE6A 3AK2A 1Z2GA 4O2BA 3M7MX 3ZRWB 3FAVB 2IH1C 4QPKA 1AI7A 2ZCEA 1M57B 3QO8A 3EFFK 3AG2B 3ABTA 4TV9A 3H01A 4FZ1A 4O4IB 1PNKA 1V55B 1QU7A 2OCCC 3MD0A 4NVPA 1VQLV 4JGSA 5JCOA 1NR7A 4R50A 2CE4A 1BHBA 2UUAB 1K8AW 1L1FA 5LA6A 2N05A 3AG3C 2Y69B 2Q7HA 3OM3B 4NKGB 2QA4V 3ZMZA 3K57A 2QJ1A 2WLMA 1XEQA 4BIOA 2QGNA 1IXBA 3RYHB 3ZHVA 1QVGU 4MTOA 3RYCB 4BIZA 3JCUZ 1K97A 1KECA 1DF5A 4LFCO 3KKYA 1N8RW 4N21A 3D36A 3G4SV 1FPOA 4JI7B 5CBGA 1HNXB 3A2FA 3HKEA 3ZRVA 3L70H 4AILC 5K1PA 4IHJA 2VQFO 2UUCB 4DV7B 3R66A 1VF7A 4DR3B 3DC6A 1N34B 2YEVA 4BAYA 1S3JA 2F93B 5IWAB 3FYIB 2Q69A 3CRRA 3E35A 3LSSA 4LWSB 5GONB 3TK1A 1N0JA 4LFBO 4WFHA 4LF5O 3BHPA 4UVBA 5C8YA 1N33B 3E8FA 2NNUA 4NXMO 2ZXWB 3G6BA 4KP4A 4JV5O 1D2DA 4DV5O 3S3XA 4BR6A 1NTKH 4JTAB 2WLJA 3ZIAG 1V9PA 3LDEA 4N23A 3O65A 4YJ2A 1L0NH 4J7ZA 2GTAA 4GCZA 1F7YA 2AZ0A 4MVQA 2P6JA 4XBFA 3JAKB 3F7YC 2P22C 4UV8A 3H1KH 1GN4A 1S72V 4JI1O 1CP9A 2P67A 1QVFU 1EZVH 5KUMA 4EB6A 5JQGB 4JI8B 4CBCA 4DV6B 2XNDG 4X64O 2GDSA 3H1IH 2Q9LA 1EBOA 5B5EZ 4X1IA 2UUBB 4X1YA 2YDEA 4LF9B 1I5YA 2BCCH 3RYFA 1VQPV 2JGDB 5LP6B 1SS3A 3OT7A 4IL6Z 4UCVA 4XDKA 3T1YB 2KB1A 4K0KB 2UXBB 1S76D 2OCHA 1WA8B 4IIJA 3L75H 3CCUV 3B2EE 2QSAA 2V7QG 3IFXA 4O4JA 3H1HH 1HR0B 4J9YB 1Z5WA 1M56B 4FFBA 3CS5A 1QNMA 1AR5A 3S3WA 1VF6A 4CS2A 4WFAV 2PTMA 4O4LB 2RDCA 5B66Z 1URFA 5KMGA 4JAAA 3CJHA 2ZIOA 2HVJC 2HEPA 4P9PA 2X7RB 4L87A 2B1GA 1H38A 1HWYA 4X65O 4GX2A 4ZOLB 1ZUQA 1D5NA 5L3GA 1O9GA 2YIAA 5L3DA 1P7BA 2AW9A 4FMTA 3QO5A 4I0XB 2XAHA 3SJCC 2XAQA 1N0NA 2W0FC 1Q3EA 4RO2A 3SPGA 1OCCB 3UQ8A 4DR4O 2G38A 1ZL8A 1YTFD 1SERA 4LFAO 3OMAB 4TV9B 3RYIA 5J2TA 2ZDIC 2IJKA 1LR1A 2JEXA 4MVOA 1DTOA 1MABG 1ENVA 2RN9A 3B8MA 5E1AC 2DE0X 2DYSC 1K4CC 4I50A 1KC8W 3EVKA 1XUQA 3OAAG 1W2BU 4JPRA 1NVPD 5CA1B 2L35A 2Y48A 2N74A 4EKWA 3BA8A 5IJ0A 1VMGA 2DW4A 2OT5A 5LA6B 2ZIMA 1IZ3A 4DO2A 1TGOA 2E3CA 1VEWA 2HG5C 3AG7A 4JTCB 2F4VO 3ZHQA 4BWAA 2Q4PA 3D8CA 1Q6UA 2ZD9A 3CCSV 4J7JA 4R7CA 2ZR3A 1M4UA 3LNMB 3UKMA 5IYBO 2OIGA 4YHHB 2JJ2G 4JAUA 4UB6Z 2BOBC 3STZC 2DWEC 4TV8A 1NTMH 4C7UA 2PI5A 5CB4B 4DR6B 4DV3B 1SKVA 2OYQA 1GRJA 2D2CB 4RQFA 1I94B 5JJNB 3M99B 3PN1A 4FLWA 3HKEB 2QDOA 1MNGA 4LBEC 3FX7A 3JSNA 2HLDG 4LF8O 4U3JB 1T5EA 5IJ9B 3ZRWA 2Z5UA 1QLEB 2JDIG 2JIZG 2QWRB 3K5NA 3SR2C 1IXMA 1FAFA 3QVNA 4B3SB 1KD1W 3ZS8C 1XNRB 1PNLA 1RSOB 1E1RG 4CZZA 2DWDC 4O4IA 5C8YB 3FD9A 1IURA 3JD4A 1TUEB 1B04A 3TJTA 4JI6B 2Q0AA 4DUYO 3W7WA 1R3JC 4OX9O 1FXKB 3E89A 1H2GA 5FPRA 3F5WC 2OWOA 2QKSA 2QWNB 2ZE5A 4FK5C 3K5LA 1AVMA 2F66C 2JEUA 1BZKA 5KHGA 3QF7A 3JATB 4MVZA 1QCEA 4YY3B 4QE9A 3RYHA 2GBOA 4NTXA 3RYCA 2OTJV 3JAMN 1M9NA 3B77A 3AG1C 4LH7A 4Z1MG 4W4KA 5GTIZ 3E22A 4UVCA 1J5EB 4L8JA 1UJWB 3DTUB 4PA4A 3T4DA 4CC6A 5KHJA 4JI0B 3RYFB 4GZRB 5LXTA 2N04A 4GYCB 4CH6A 3ABKC 5LHHA 3AG4C 3IC9A 2YUAA 5KX5B 1KB9F 4IIJB 4OPAA 1M5IA 1FS0G 3OMNB 4O4JB 1NI8A 2YIDA 4BW5A 4IGGA 2XAFA 1HNXO 1RM1C 3JARA 2LO1A 1G4YB 4LF7B 3ZMSA 3BY6A 5KHIA 4DV7O 4DR3O 3LSQA 4BIUA 3SYCA 1YZBA 3OR7C 3CJHB 1DLBA 4PELA 4CH3A 1BE3H 3CMEV 3L9DA 1YDXA 1VQMV 3CCQV 3JCZA 4ZI7B 4PA7A 4X62O 3CC2V 3CWBH 4EFBA 4FM0A 2LW7A 3JAKA 2DOSA 4AQYB 1XI1A 2HJFC 1N33O 2R9IA 2JJ1G 1U96A 1SQVH 1M57C 3ABMC 1WPXA 5J2UB 1VF5B 5B1NA 2XASA 1I7FA 3DXRB 3SDLA 4D7TA 3L71H 5JQGA 3ETQA 5H6QA 4FJCC 2IBZH 5J2TB 4I9WA 1XOUA 3HKDA 3CCLV 4GKJB 1TUBB 1XBLA 1THZA 4U7NA 2UXCB 2DMXA 5LBQA 3GB7C 2JGDA 4PI2A 3BABA 1ZX3A 5JJEB 5LP6A 1B3QA 1KU9A 4KXRA 4H37A 3KCYA 4MT8A 4DV1B 1BCCH 4J42A 2A9HA 1WNSA 4JI8O 4JI3B 1WA8A 4DV6O 3WB0A 4MVSA 2CTQA 4X66O 5IY5C 3H1LH 2A06H 4NTYA 2EIJB 4J9ZB 1F23A 4HNAB 1AP5A 3FB6C 3GWKC 4QPJA 4LF9O 4O4LA 4DV0B 3SJQC 4QNHB 1BS3A 1ZAUA 2HHHB 3T1YO 4TUYA 4WFBV 2DYRC 3QTCA 3QO7A 2Y0PA 1XHXA 4E2LA 1KYOF 2Q0OC 2ITCC 4TWKA 4JTDB 1GM7A 4ZOLA 4LNUB 4PDVA 1HR0O 2A79B 4B3RB 2QM8A 5L3EA 4DR2O 3OUSA 5JWPA 4I0XA 2ILMA 1BQ0A 4I4TB 4DXWA 3GWOA 4DR7B 2CK3G 2CDYA 2B5UA 4ZIBA 5K1XA 2B9ZA 2BTOA 4KL1A 3N2KA 2PUSA 2CGNA 1OCRB 4JF3A 5HFMA 1IBMB 1OCOC 3CC4V 2XT9A 3HKCB 2H94A 3KCXA 2RCVA 1Y66A 4B08A 4DR5O 1AB3A 4DUZB 4B3TO 5CA1A 5DM6V 2XUMA 1HNZB 3MAQA 2V4DA 4Q20A 4JI5O 2WLHA 3WB2A 2EINB 1YIJV 3VOUA 1PD3A 5B1AB 1B6QA 1KKCA 3ZHUA 1H2KA 1Q7YW 1XMOO 4Z1VA 2HVKC 1XREA 4O2AB 1Q8IA 1NKDA 3IJ4A 3CRQA 2QKCA 3G67A 2VWKA 3ML0A 3LDCA 3SJAC 1M93A 1IX9A 1HNWO 3SJBC 3K58A 3OGCC 1XMQB 3NR7A 2IU0A 4X20B 4H33A 2PYLA 2AZ2A 5EYPB 1K5SA 1QHTA 4X1KB 5CB4A 4CH4A 1P49A 5B1BC 1V54B 5FPOA 3E22B 4FLXA 4AI8A 1YI2V 4GKKO 3APOA 3RVZA 1OJHA 2P7TC 4HYOA 3VQVA 3K08A 3M8AA 5LXTB 3UCSC 3U11A 4WF9V 3B8NA 4U3JA 5IJ9A 1YTFB 2PGGA 3N27A 2QWPB 1BSMA 1GN6A 2HR3A 1N36B 3FB8C 5KA6A 2LFRA 1I94O 1RSOA 1NVPB 3JASB 4UXNA 2JRIA 1ROPA 3JARB 3RT3C 1JQ0A 5BZBA 5B1OA 3K5OA 2D3OW 1FXKA 4IYHA 5A9GA 5EC2C 4ZBMA 2IM9A 4HZ3A 5KA5A 4NXNO 3WG7C 2AHZA 1N4CA 2FL4A 4AHCA 1SQBH 5LGNA 1Q6IA 1SRYA 2ZQMA 4QIWF 3T1HO 3KG2A 2FYUH 1Y74B 3JATA 2WLLB 4JI4B 2Z0AA 2C2AA 2OCCB 1I0HA 2XOKG 3SPIA 4JI6O 1H2NA 5BXZA 2Y4TA 3CD6V 1AI5A 1Y4MA 3W7TA 2EX3A 2DJVA 2Y0IA 2H8PC 1YCIA 1H2LA 3IAYA 2NN4A 3U0ZA 2LP7A 3E8GA 3CCJV 3HKDB 2EBOA 4DV4O 3G80A 1SF9A 1VP7A 3F7VC 3JAWB 5JCOC 3IC7A 4TQFA 4DV2O 4LF6B 5H6RA 4JASA 4PDRA 3FFQA 1RP3B 5FNVB 2JGUA 5KHKA 3LUTB 2E75B 1P7GA 3ASNC 1Y76B 5KX5A 1VQ5V 2EIKC 4MTXA 5LMUO 4WFGA 3ZMUA 1PM9A 3CHXA 3KZIZ 1VARA 2XTAA 4I55B 1WJZA 1KP2A 3D36C 3ZX6A 4DR1B 2RMKB 3C90A 4DK0A 4PHZA 1GM9A 5LHIA 1WPBA 4JI2B 4TUYB 4IYIA 4FM1A 2WWWA 3D3IA 1S5HC 3APQA 4JZGA 4WBNB 2DN9A 4ZI7A 1GM8A 3D3QA 2YSUB 3ICXA 2YXHA 3LDDA 4FFKA 2CTPA 2ZT9B 3HKBB 3VQYA 3N2GB 3RW0A 4LF7O 3CRMA 3QNEA 1OHHG 5EIBC 5J2UA 3DXRA 3SGIA 3N2KB 3K0DA 3ABUA 2P4KA 3OTOO 4RUFA 2A7WA 5JJJB 1O9HA 4H44B 3ZHSA 3RVYA 2F43G 3OUFA 2MK3A 2FKXA 1SESA 3HB3B 2UXDO 1TUBA 2YIBD 1WP8A 2CTRA 1JA8A 1PL0A 4YXWG 1I5XA 2W6IG 1IBLO 3E86A 1GKFA 1P84F 3PJSK 1N32O 1YJWV 1AR4A 5B3SB 1G6UA 2M6YA 4J10A 4WFEA 2GTSA 2WA3A 4DW0A 4LFCB 4HNAA 4MTFA 1JFFB 5BR8O 5KUKA 2UXCO 3TCUA 3U10A 1R3IC 5CN0A 3J80N 2WLNA 3ZHRA 2CH7B 3ASOB 3CCMV 1R3LC 3P3NA 3MHHC 3CP1A 4MVRA 4DV1O 1IBKO 5CBHA 2XAGA 2OTLV 1WB7A 3UT5B 4JI3O 1FXVA 4X89A 1W0JG 4PJ0Z 4LNUA 2QKAA 3C3TA 3JD2A 1OCZC 1Y67A 1J95A 1KQSU 1F4MA 5F2VO 4I4TA 1KP3A 1ZSPA 1ZTEA 1HP8A 1US6A 2B1IA 4MS2A 4LFBB 2VS0A 3FKSG 3J7AU 1VF6C 3CRCA 4PA9A 1E79G 3R65A 5CA3A 4NXMB 1MSDA 4MVUA 3HKCA 4DV5B 1RFYA 4B3RO 3BA9A 3K5MA 2EIMC 3VBBA 2BE3A 3EXAA 3CCEV 4JYAO 4UCSA 2IJJA 3DC5A 2GHYA 3W7SA 1XL4A 5LYJB 3CPWU 1MOFA 1K33A 1TVKB 2IW5A 4O4HB 4QGPA 2F95B 4O2AA 5KAIZ 4D6TH 1NBMG 2ZNJA 4P9OA 1R6NA 4UCRA 2DYSB 1VQNV 4DUZO 3DGEA 1GAXA 2JS5A 1VIBA 3AEIA 4X64B 4X20A 5EC1C 4YJ3B 5EYPA 1R6TA 2UUAO 2E74B 1BL8A 4X1KA 1NS1A 4D7SA 1DF4A 3CXCU 1K3EA 1BQZA 3Q4HB 4LC1A 2HFEC 3ABLC 2R70A 3E83A 2CGOA 3H9VA 2JVDA 4PD4F 3A0RA 4JZ2A 2R9RB 1K34A 2RNBA 2YXLA 4ZKIA 2QTOA 3OMIB 1XMQO 3CRAA 4QJFB 3EHBB 5DECA 5FL7G 3MDSA 4FIPC 3ZRXA 1WAZA 1OZ0A 1LUVA 2E76B 5KHHA 4B7EA 4JI7O 1YJ9V 5EBLC 4UCTA 1R1BA 1A32A 2Q68A 2YIBA 1SQPH 3JASA 5GW7A 3SPCA 2UU9B 4GT1A 4UB8Z 2YS8A 2UUCO 2ZM6B 4MVMA 4FLZA 4KFMA 2ZINA 1N34O 5LOVB 3BEHA 4X65B 5IWAO 2WAMA 4PI0A 3I55V 1NJIW 1YJNV 3X2QB 2HKOA 1FFXB 5BMVA 3L72H 4GUNA 3SYOA 1LUWA 1P4RA 1JJOA 2ADPA 2EJ7A 4WFFA 2W6JG 1Q90D 1Y74A 2UXXA 4DR4B 2WLLA 3E8HA 2IJHA 3AG2C 4J41A 2CTWA 3BCCH 2E5LB 1OV9A 4W4LA 5IDJA 1HW7A 1AILA 1V55C 2Y4UA 4HBNA 2UXNA 2A0LA 3JAWA 1JR9A 3JD3A 1VQOV 2RQ6A 4CC5A 1Q43A 2Z3YA 2M7WA 3K9AA 5FNVA 2ZR2A 3JYCA 5EK0A 2Q7EA 2Y69C 3ZHTA 5JVDA 1SZXA 1TA8A 4OGQB 1Y76A 1YEWA 3CSXA 2Q67A 3CX5F 1R3KC 1S0VA 3AG1B 1AJNA 4J7KA 2KG7A 4JAVA 5BY1A 2UUBO 1FJGB 2GUZB 1G1XB 4I55A 1Z5VA 4LF6O 3ETDA 4FVMA 1SQXH 4LCUC 1JCHA 1QBZA 1H8HG 4OXSA 1YVWA 1V54C 3K06A 4I9QA 4K0KO 3AG4B 3K9SA 1K73W 2UXBO 1L8DA 1SQQH 4GX5A 1NH2D 4WBNA 4UFZA 5C93A 4FLYA 3MHSC 2QEXV 1COWG 4LF8B 1RM1B 1SQGA 4U7OA 1KBHA 3P32A 3HKBA 2A3QA 3N2GA 4R6ZA 2R9AA 4Z2WA 4ASUG 2PYJA 1WB8A 1W0KG 4RQEA 2LGQA 2QM4A 4PA3A 5L3BA 1MMMA 4PDMA 2BSKB 5KAFZ 1K9MW 3JALB 4R8CA 3CXHF 4DRXB 3TXQA 2ZXWC 1YSCA 4PDLA 5EZYB 3IGAC 4DUYB 4G27B 4NTWA 4XDLA 4OX9B 1AP6A 5CMUA 3JD0A 2L6LA 3QG5A 5D5PA 1DGSA 1NQTA 2EZOA 3ABMB 2P5OA 4YIPA 1K7DA 5KLVH 1WP7A 4QE7A 4ZHQB 2X0LA 3TGUH 3E8BA 1GH6A 2Q7GA 5LGUA 2YC0A 1PPJH 4KHPB 3G71V 2Q6AA 1XQ8A 3RFRA 5LGTA 1L0LH 4I5SA 1JFFA 1XNQB 4P30A 1M90W 1VQ7V
chains in the Genus database with same CATH topology
4DV1O 1IBKO 5BY1A 4DV7O 2UUBO 4DR3O 4JI3O 1KUQA 1XMQO 1HR0O 4YY3O 1YZBA 1HNZO 1G1XB 4DR2O 1FYJA 3O65A 4LF6O 4JI4O 4GKJO 1F7YA 1I94O 1X59A 4JI7O 4DR4O 4X62O 2JRIA 4K0KO 2UXBO 4KHPO 3RT3C 1R1BA 1A32A 4DUYO 4LFAO 2LW7A 4OX9O 2DOSA 1J5EO 1FKAO 2UUCO 4JI1O 4YHHO 1N33O 1XNQO 3J7AU 4JI0O 3F5TA 1N34O 4LF7O 4DR6O 4DV3O 3SDLA 4DR5O 4NXNO 5IWAO 4X64O 1AB3A 4B3TO 1XEQA 1FJGO 2N74A 4B3RO 3J81N 3OTOO 4LFCO 2VQEO 4JYAO 4DV0O 4JI5O 3T1HO 4B3MO 2Z0AA 3JAMN 2HHHO 4LF4O 2FKXA 4JI6O 5BXZA 1XMOO 2UXDO 2DJVA 2F4VO 2UU9O 5H5NA 2ZM6O 4B3SO 2VQFO 1XNRO 4DR1O 4DV4O 1IBLO 2AGAA 3R66A 1AILA 5LL6Y 4JI8O 1HNWO 4DV6O 1N36O 4DUZO 1N32O 4X66O 4DR7O 4JI2O 4DV2O 5A2QN 1R6TA 2UUAO 4LF9O 4GKKO 1NS1A 4AQYO 4LFBO 4OPAA 1IBMO 5BR8O 4LF5O 2UXCO 4OPHA 4LF8O 5FLXN 5LMUO 3T1YO 4A5UB 1DK1A 2ZKOA 3M8AA 3J80N 1HNXO 5LMNO 2E5LO 5IT9N 4X65O 4NXMO 4JV5O 1D2DA 4DV5O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 O;  1IBK O;  5BY1 A;  4DV7 O;  2UUB O;  4DR3 O;  4JI3 O;  1KUQ A;  1XMQ O;  1HR0 O;  4YY3 O;  1YZB A;  1HNZ O;  1G1X B;  4DR2 O;  1FYJ A;  3O65 A;  4LF6 O;  4JI4 O;  4GKJ O;  1F7Y A;  1I94 O;  1X59 A;  4JI7 O;  4DR4 O;  4X62 O;  2JRI A;  4K0K O;  2UXB O;  4KHP O;  3RT3 C;  1R1B A;  1A32 A;  4DUY O;  4LFA O;  2LW7 A;  4OX9 O;  2DOS A;  1J5E O;  1FKA O;  2UUC O;  4JI1 O;  4YHH O;  1N33 O;  1XNQ O;  3J7A U;  4JI0 O;  3F5T A;  1N34 O;  4LF7 O;  4DR6 O;  4DV3 O;  3SDL A;  4DR5 O;  4NXN O;  5IWA O;  4X64 O;  1AB3 A;  4B3T O;  1XEQ A;  1FJG O;  2N74 A;  4B3R O;  3J81 N;  3OTO O;  4LFC O;  2VQE O;  4JYA O;  4DV0 O;  4JI5 O;  3T1H O;  4B3M O;  2Z0A A;  3JAM N;  2HHH O;  4LF4 O;  2FKX A;  4JI6 O;  5BXZ A;  1XMO O;  2UXD O;  2DJV A;  2F4V O;  2UU9 O;  5H5N A;  2ZM6 O;  4B3S O;  2VQF O;  1XNR O;  4DR1 O;  4DV4 O;  1IBL O;  2AGA A;  3R66 A;  1AIL A;  5LL6 Y;  4JI8 O;  1HNW O;  4DV6 O;  1N36 O;  4DUZ O;  1N32 O;  4X66 O;  4DR7 O;  4JI2 O;  4DV2 O;  5A2Q N;  1R6T A;  2UUA O;  4LF9 O;  4GKK O;  1NS1 A;  4AQY O;  4LFB O;  4OPA A;  1IBM O;  5BR8 O;  4LF5 O;  2UXC O;  4OPH A;  4LF8 O;  5FLX N;  5LMU O;  3T1Y O;  4A5U B;  1DK1 A;  2ZKO A;  3M8A A;  3J80 N;  1HNX O;  5LMN O;  2E5L O;  5IT9 N;  4X65 O;  4NXM O;  4JV5 O;  1D2D A;  4DV5 O; 
#chains in the Genus database with same CATH topology
 2CH7 A;  3BAA A;  2KSD A;  4B7K A;  1VQ6 V;  3ZED A;  2K9P A;  1FYJ A;  2LFS A;  1SQF A;  3BVO A;  3UT5 A;  2JK5 C;  3T2M A;  3ZMT A;  3ZRS A;  5L3F A;  3K79 A;  3OGI B;  5LP6 C;  2BTQ B;  2EIL B;  1H8E G;  2HP8 A;  5IY5 B;  2EUL A;  1JVM A;  4K8X A;  3HPL C;  1CPY A;  4UCO A;  1FKA O;  3WFV A;  4YHH O;  4Q6G A;  1U97 A;  1FFT B;  1EFR G;  1M56 C;  1ORQ C;  2X6C A;  2VRZ A;  2DYR B;  4DR6 O;  4DV3 O;  2DQ3 A;  2DQ0 A;  3NXS A;  3H1J H;  1YIT V;  1XL6 A;  4WCE V;  4FLU A;  5AG2 A;  2PY5 A;  4NB5 A;  3JSL A;  4RWU A;  2VWJ A;  1GMG A;  1Q6H A;  1JOY A;  3UO3 A;  4G28 B;  4I7Z B;  2PZS A;  4X62 B;  2EZP A;  3A0B Z;  1MA1 A;  5LYJ A;  3OD4 A;  5LMN B;  4B3S O;  2HJD A;  4IT5 A;  2IH3 C;  1GN3 A;  1TVK A;  3RGB A;  1XNR O;  4O4H A;  5BMV B;  1OCO B;  2ATK C;  2FTK A;  2ZDI A;  1EM1 A;  3ZJZ A;  1OCC C;  1R73 A;  2FML A;  3OE7 G;  3AK1 A;  1JMK C;  2BOC C;  4JYY A;  3VQW A;  2ARH A;  2QWO B;  1D5A A;  3FYE B;  4JYC A;  1EN6 A;  4YJ3 A;  5CA0 A;  4X88 A;  2X6A A;  4LP8 A;  1MG1 A;  1NTZ H;  3TET A;  1SET A;  2QE7 G;  2ZKO A;  3AG3 B;  3Q4H A;  3DSQ A;  5IYZ B;  3B4S A;  4UVA A;  3JD1 A;  3A8T A;  1JX9 A;  1BGY H;  1WN7 A;  2EJR A;  1KUQ A;  4F6R B;  4YY3 O;  4P2Z A;  1PL4 A;  3CC7 V;  5B3S C;  2QTS A;  5JVD B;  1YF2 A;  5IYC O;  2VQE B;  4X66 B;  2R72 A;  1IDS A;  3K03 A;  2V1D A;  4B3M B;  5J9P C;  4LF4 B;  1EZJ A;  2KG7 B;  3SYQ A;  4EFE A;  2LGW A;  5B1B B;  2WLI B;  1J5E O;  5CBF A;  1H2M A;  5D5Q A;  3ASO C;  1GK9 A;  4JI0 O;  1QQC A;  1SC5 B;  4ABM A;  1VQ4 V;  1KKD A;  4UUJ C;  1IVS A;  1SZT A;  4UCU A;  4PA6 A;  5LOV A;  2F23 A;  4DYL A;  1FXH A;  4CS3 A;  1CXZ B;  3SPJ A;  1Y6X A;  1W59 A;  2ODM A;  4DR2 B;  5ITZ B;  2RJZ A;  3TXS A;  1E1Q G;  1FFX A;  4TT3 G;  1X4T A;  2LQT A;  1TAE A;  1YXB A;  4K35 A;  2UU9 O;  3SYA A;  1QLE C;  1AI6 A;  5H5N A;  2ZM6 O;  1JJ2 U;  4U3F H;  1LNQ A;  3THO A;  1KMI Z;  2W0X A;  3BPZ A;  4GX1 A;  4K8Z A;  3ZCC A;  4DR5 B;  3WG7 B;  4B3T B;  2CAZ C;  5JH7 B;  4O2B B;  1FXK C;  4CH5 A;  1VQ8 V;  1PKX A;  3I56 V;  4AQY O;  2WPD G;  4JI5 B;  4FM2 A;  5HFL A;  3AK3 A;  4OPH A;  3T1C A;  3G6E V;  4NR1 A;  3A0H Z;  1K92 A;  2NR5 A;  1XMO B;  2E5L O;  5IT9 N;  4E4E A;  1B06 A;  2AHY A;  1K4D C;  3L73 H;  2GV9 A;  3LSU A;  4PV1 B;  3L74 H;  3OTF A;  1HNW B;  1Q82 W;  4GKJ O;  2GUZ A;  1ZWI C;  2WLK A;  2JS3 A;  1X59 A;  3K59 A;  4EEQ A;  1PNM A;  4CS4 A;  3WB1 A;  5E79 Z;  2ITD C;  5IYD O;  5TIS Z;  4GKK B;  1GO3 F;  2WA4 A;  3ASN B;  4F6E A;  2EIK B;  3CCR V;  3C3S A;  2VQF B;  3O9O A;  2F1M A;  3ETE A;  3UM7 A;  4ICG A;  2P90 A;  3P3P A;  1FJG O;  2LW1 A;  4DK1 A;  4TOI A;  1AR1 B;  4DV0 O;  2ZE8 A;  1SA0 A;  2P4V A;  3ZBH A;  1NU1 H;  2HHH O;  1XIL A;  3K04 A;  4LF5 B;  2BSK A;  3JAL A;  4DW1 A;  1HDJ A;  4IHJ B;  4DRX A;  4JYB A;  1AJQ A;  1FD9 A;  4JV5 B;  1RPR A;  5EZY A;  2X6B A;  1S5J A;  2YEV B;  2YXY A;  3FAV A;  3SYP A;  3HR0 A;  4DR7 O;  3OR6 C;  3FB5 C;  1MSW D;  2ZE7 A;  5EBW C;  2YI9 A;  2KKW A;  4X9Q A;  3X2Q C;  4NXN B;  1QR8 A;  2PF4 E;  2QR4 A;  4ZHQ A;  1BMF G;  3BRC A;  4F4L A;  1IBM O;  3T1H B;  1QLN A;  5FLX N;  3CCV V;  4FPP A;  1BHA A;  4JI1 B;  1NZ6 A;  1DK1 A;  3BFR A;  4H13 B;  2FB5 A;  1R6K A;  2WSS G;  3RWR D;  4YJ2 B;  5DED A;  3W7X A;  1HNZ O;  5CA0 B;  1NH2 B;  4DV4 B;  1WLE A;  3ETG A;  3B40 A;  4MSW C;  4DV2 B;  2LJ2 A;  1GTO A;  2O57 A;  2IU3 A;  3STL C;  2BTQ A;  4KHP O;  1F51 A;  1ARO P;  2CUG A;  2GSM B;  3OFN G;  4TQD A;  3RN4 A;  4EB6 B;  1XNQ O;  1NR1 A;  3F5T A;  5LMU B;  1Q5O A;  3E2E A;  1ZLZ A;  1H2S B;  1G8M A;  2MW2 B;  3OEE G;  5DN6 G;  4X1I B;  1S5L Z;  1MZF A;  5L3C A;  3P30 A;  3I5D A;  1QR9 A;  2EIJ C;  2XAJ A;  1K5Q A;  4X1Y B;  1AJP A;  4NYK A;  3OEH G;  1OCZ B;  1CEZ A;  3ZMV A;  4J80 A;  1S77 D;  1M1K W;  3SPH A;  2ZNI A;  1UPG A;  3ZN0 A;  4UV9 A;  3LNN A;  4LWS A;  1EN4 A;  5GON A;  3K3W A;  4FFB B;  5LL6 Y;  4GX0 A;  1NT2 B;  1N36 O;  3ZN1 A;  4MTG A;  4BW9 A;  4H0L B;  4K3A A;  5KMG B;  3W7U A;  5A2Q N;  4X8A A;  1F4N A;  2EIM B;  4MW8 A;  3OTO B;  3RBZ A;  1OCR C;  2AXT Z;  1PP9 H;  1Q81 W;  1MZE A;  4LFA B;  4A5U B;  2YI8 A;  5LMN O;  4RUE A;  2UXD B;  1XDC A;  1AI4 A;  2K1E A;  2OIE A;  3CB2 A;  4LR3 A;  5IYZ A;  4KUM A;  3FB7 C;  4XDJ A;  5H9C A;  5H2F Z;  1IBL B;  4G2K A;  2EIN C;  4F6R A;  4JI4 O;  1N32 B;  5B1A C;  3OW2 U;  4TSF G;  4FLV A;  1ZL8 B;  2Q8V A;  2NLJ C;  3RYI B;  1YHQ V;  1I08 A;  4YIO A;  2QWQ B;  5EIB D;  1EN5 A;  3VQX A;  2YIC A;  4I50 B;  2F4V B;  2KQX A;  5BR8 B;  1VQ9 V;  3CEI A;  3ABL B;  1GN2 A;  2WLI A;  5LHG A;  5IJ0 B;  1XHZ A;  5EBM C;  1BT8 A;  1IBK B;  2PI4 A;  3K0G A;  2ETN A;  3J81 N;  5GTH Z;  3B09 A;  2Q73 A;  3ABK B;  4HAM A;  4MW3 A;  2VQE O;  2EIL C;  4B3M O;  4LF4 O;  4GLX A;  5ITZ A;  4J11 A;  2Q5Z A;  2ADQ B;  4LH6 A;  3CYO A;  5IE9 A;  3T4Z A;  2H3O A;  3CE2 A;  3CMA V;  4DR1 O;  4TV8 B;  3GVM A;  2AGA A;  4FZ0 A;  1SA0 B;  2XHB A;  1VQK V;  3WU2 Z;  2IJI A;  1JPX A;  4JI2 O;  2QM7 A;  4RAI A;  1Q86 W;  1PV0 A;  2P06 A;  3UO2 A;  4FLT A;  1RPO A;  4JYA B;  5JH7 A;  1UFI A;  2ZE6 A;  3AK2 A;  1Z2G A;  4O2B A;  3M7M X;  3ZRW B;  3FAV B;  2IH1 C;  4QPK A;  1AI7 A;  2ZCE A;  1M57 B;  3QO8 A;  3EFF K;  3AG2 B;  3ABT A;  4TV9 A;  3H01 A;  4FZ1 A;  4O4I B;  1PNK A;  1V55 B;  1QU7 A;  2OCC C;  3MD0 A;  4NVP A;  1VQL V;  4JGS A;  5JCO A;  1NR7 A;  4R50 A;  2CE4 A;  1BHB A;  2UUA B;  1K8A W;  1L1F A;  5LA6 A;  2N05 A;  3AG3 C;  2Y69 B;  2Q7H A;  3OM3 B;  4NKG B;  2QA4 V;  3ZMZ A;  3K57 A;  2QJ1 A;  2WLM A;  1XEQ A;  4BIO A;  2QGN A;  1IXB A;  3RYH B;  3ZHV A;  1QVG U;  4MTO A;  3RYC B;  4BIZ A;  3JCU Z;  1K97 A;  1KEC A;  1DF5 A;  4LFC O;  3KKY A;  1N8R W;  4N21 A;  3D36 A;  3G4S V;  1FPO A;  4JI7 B;  5CBG A;  1HNX B;  3A2F A;  3HKE A;  3ZRV A;  3L70 H;  4AIL C;  5K1P A;  4IHJ A;  2VQF O;  2UUC B;  4DV7 B;  3R66 A;  1VF7 A;  4DR3 B;  3DC6 A;  1N34 B;  2YEV A;  4BAY A;  1S3J A;  2F93 B;  5IWA B;  3FYI B;  2Q69 A;  3CRR A;  3E35 A;  3LSS A;  4LWS B;  5GON B;  3TK1 A;  1N0J A;  4LFB O;  4WFH A;  4LF5 O;  3BHP A;  4UVB A;  5C8Y A;  1N33 B;  3E8F A;  2NNU A;  4NXM O;  2ZXW B;  3G6B A;  4KP4 A;  4JV5 O;  1D2D A;  4DV5 O;  3S3X A;  4BR6 A;  1NTK H;  4JTA B;  2WLJ A;  3ZIA G;  1V9P A;  3LDE A;  4N23 A;  3O65 A;  4YJ2 A;  1L0N H;  4J7Z A;  2GTA A;  4GCZ A;  1F7Y A;  2AZ0 A;  4MVQ A;  2P6J A;  4XBF A;  3JAK B;  3F7Y C;  2P22 C;  4UV8 A;  3H1K H;  1GN4 A;  1S72 V;  4JI1 O;  1CP9 A;  2P67 A;  1QVF U;  1EZV H;  5KUM A;  4EB6 A;  5JQG B;  4JI8 B;  4CBC A;  4DV6 B;  2XND G;  4X64 O;  2GDS A;  3H1I H;  2Q9L A;  1EBO A;  5B5E Z;  4X1I A;  2UUB B;  4X1Y A;  2YDE A;  4LF9 B;  1I5Y A;  2BCC H;  3RYF A;  1VQP V;  2JGD B;  5LP6 B;  1SS3 A;  3OT7 A;  4IL6 Z;  4UCV A;  4XDK A;  3T1Y B;  2KB1 A;  4K0K B;  2UXB B;  1S76 D;  2OCH A;  1WA8 B;  4IIJ A;  3L75 H;  3CCU V;  3B2E E;  2QSA A;  2V7Q G;  3IFX A;  4O4J A;  3H1H H;  1HR0 B;  4J9Y B;  1Z5W A;  1M56 B;  4FFB A;  3CS5 A;  1QNM A;  1AR5 A;  3S3W A;  1VF6 A;  4CS2 A;  4WFA V;  2PTM A;  4O4L B;  2RDC A;  5B66 Z;  1URF A;  5KMG A;  4JAA A;  3CJH A;  2ZIO A;  2HVJ C;  2HEP A;  4P9P A;  2X7R B;  4L87 A;  2B1G A;  1H38 A;  1HWY A;  4X65 O;  4GX2 A;  4ZOL B;  1ZUQ A;  1D5N A;  5L3G A;  1O9G A;  2YIA A;  5L3D A;  1P7B A;  2AW9 A;  4FMT A;  3QO5 A;  4I0X B;  2XAH A;  3SJC C;  2XAQ A;  1N0N A;  2W0F C;  1Q3E A;  4RO2 A;  3SPG A;  1OCC B;  3UQ8 A;  4DR4 O;  2G38 A;  1ZL8 A;  1YTF D;  1SER A;  4LFA O;  3OMA B;  4TV9 B;  3RYI A;  5J2T A;  2ZDI C;  2IJK A;  1LR1 A;  2JEX A;  4MVO A;  1DTO A;  1MAB G;  1ENV A;  2RN9 A;  3B8M A;  5E1A C;  2DE0 X;  2DYS C;  1K4C C;  4I50 A;  1KC8 W;  3EVK A;  1XUQ A;  3OAA G;  1W2B U;  4JPR A;  1NVP D;  5CA1 B;  2L35 A;  2Y48 A;  2N74 A;  4EKW A;  3BA8 A;  5IJ0 A;  1VMG A;  2DW4 A;  2OT5 A;  5LA6 B;  2ZIM A;  1IZ3 A;  4DO2 A;  1TGO A;  2E3C A;  1VEW A;  2HG5 C;  3AG7 A;  4JTC B;  2F4V O;  3ZHQ A;  4BWA A;  2Q4P A;  3D8C A;  1Q6U A;  2ZD9 A;  3CCS V;  4J7J A;  4R7C A;  2ZR3 A;  1M4U A;  3LNM B;  3UKM A;  5IYB O;  2OIG A;  4YHH B;  2JJ2 G;  4JAU A;  4UB6 Z;  2BOB C;  3STZ C;  2DWE C;  4TV8 A;  1NTM H;  4C7U A;  2PI5 A;  5CB4 B;  4DR6 B;  4DV3 B;  1SKV A;  2OYQ A;  1GRJ A;  2D2C B;  4RQF A;  1I94 B;  5JJN B;  3M99 B;  3PN1 A;  4FLW A;  3HKE B;  2QDO A;  1MNG A;  4LBE C;  3FX7 A;  3JSN A;  2HLD G;  4LF8 O;  4U3J B;  1T5E A;  5IJ9 B;  3ZRW A;  2Z5U A;  1QLE B;  2JDI G;  2JIZ G;  2QWR B;  3K5N A;  3SR2 C;  1IXM A;  1FAF A;  3QVN A;  4B3S B;  1KD1 W;  3ZS8 C;  1XNR B;  1PNL A;  1RSO B;  1E1R G;  4CZZ A;  2DWD C;  4O4I A;  5C8Y B;  3FD9 A;  1IUR A;  3JD4 A;  1TUE B;  1B04 A;  3TJT A;  4JI6 B;  2Q0A A;  4DUY O;  3W7W A;  1R3J C;  4OX9 O;  1FXK B;  3E89 A;  1H2G A;  5FPR A;  3F5W C;  2OWO A;  2QKS A;  2QWN B;  2ZE5 A;  4FK5 C;  3K5L A;  1AVM A;  2F66 C;  2JEU A;  1BZK A;  5KHG A;  3QF7 A;  3JAT B;  4MVZ A;  1QCE A;  4YY3 B;  4QE9 A;  3RYH A;  2GBO A;  4NTX A;  3RYC A;  2OTJ V;  3JAM N;  1M9N A;  3B77 A;  3AG1 C;  4LH7 A;  4Z1M G;  4W4K A;  5GTI Z;  3E22 A;  4UVC A;  1J5E B;  4L8J A;  1UJW B;  3DTU B;  4PA4 A;  3T4D A;  4CC6 A;  5KHJ A;  4JI0 B;  3RYF B;  4GZR B;  5LXT A;  2N04 A;  4GYC B;  4CH6 A;  3ABK C;  5LHH A;  3AG4 C;  3IC9 A;  2YUA A;  5KX5 B;  1KB9 F;  4IIJ B;  4OPA A;  1M5I A;  1FS0 G;  3OMN B;  4O4J B;  1NI8 A;  2YID A;  4BW5 A;  4IGG A;  2XAF A;  1HNX O;  1RM1 C;  3JAR A;  2LO1 A;  1G4Y B;  4LF7 B;  3ZMS A;  3BY6 A;  5KHI A;  4DV7 O;  4DR3 O;  3LSQ A;  4BIU A;  3SYC A;  1YZB A;  3OR7 C;  3CJH B;  1DLB A;  4PEL A;  4CH3 A;  1BE3 H;  3CME V;  3L9D A;  1YDX A;  1VQM V;  3CCQ V;  3JCZ A;  4ZI7 B;  4PA7 A;  4X62 O;  3CC2 V;  3CWB H;  4EFB A;  4FM0 A;  2LW7 A;  3JAK A;  2DOS A;  4AQY B;  1XI1 A;  2HJF C;  1N33 O;  2R9I A;  2JJ1 G;  1U96 A;  1SQV H;  1M57 C;  3ABM C;  1WPX A;  5J2U B;  1VF5 B;  5B1N A;  2XAS A;  1I7F A;  3DXR B;  3SDL A;  4D7T A;  3L71 H;  5JQG A;  3ETQ A;  5H6Q A;  4FJC C;  2IBZ H;  5J2T B;  4I9W A;  1XOU A;  3HKD A;  3CCL V;  4GKJ B;  1TUB B;  1XBL A;  1THZ A;  4U7N A;  2UXC B;  2DMX A;  5LBQ A;  3GB7 C;  2JGD A;  4PI2 A;  3BAB A;  1ZX3 A;  5JJE B;  5LP6 A;  1B3Q A;  1KU9 A;  4KXR A;  4H37 A;  3KCY A;  4MT8 A;  4DV1 B;  1BCC H;  4J42 A;  2A9H A;  1WNS A;  4JI8 O;  4JI3 B;  1WA8 A;  4DV6 O;  3WB0 A;  4MVS A;  2CTQ A;  4X66 O;  5IY5 C;  3H1L H;  2A06 H;  4NTY A;  2EIJ B;  4J9Z B;  1F23 A;  4HNA B;  1AP5 A;  3FB6 C;  3GWK C;  4QPJ A;  4LF9 O;  4O4L A;  4DV0 B;  3SJQ C;  4QNH B;  1BS3 A;  1ZAU A;  2HHH B;  3T1Y O;  4TUY A;  4WFB V;  2DYR C;  3QTC A;  3QO7 A;  2Y0P A;  1XHX A;  4E2L A;  1KYO F;  2Q0O C;  2ITC C;  4TWK A;  4JTD B;  1GM7 A;  4ZOL A;  4LNU B;  4PDV A;  1HR0 O;  2A79 B;  4B3R B;  2QM8 A;  5L3E A;  4DR2 O;  3OUS A;  5JWP A;  4I0X A;  2ILM A;  1BQ0 A;  4I4T B;  4DXW A;  3GWO A;  4DR7 B;  2CK3 G;  2CDY A;  2B5U A;  4ZIB A;  5K1X A;  2B9Z A;  2BTO A;  4KL1 A;  3N2K A;  2PUS A;  2CGN A;  1OCR B;  4JF3 A;  5HFM A;  1IBM B;  1OCO C;  3CC4 V;  2XT9 A;  3HKC B;  2H94 A;  3KCX A;  2RCV A;  1Y66 A;  4B08 A;  4DR5 O;  1AB3 A;  4DUZ B;  4B3T O;  5CA1 A;  5DM6 V;  2XUM A;  1HNZ B;  3MAQ A;  2V4D A;  4Q20 A;  4JI5 O;  2WLH A;  3WB2 A;  2EIN B;  1YIJ V;  3VOU A;  1PD3 A;  5B1A B;  1B6Q A;  1KKC A;  3ZHU A;  1H2K A;  1Q7Y W;  1XMO O;  4Z1V A;  2HVK C;  1XRE A;  4O2A B;  1Q8I A;  1NKD A;  3IJ4 A;  3CRQ A;  2QKC A;  3G67 A;  2VWK A;  3ML0 A;  3LDC A;  3SJA C;  1M93 A;  1IX9 A;  1HNW O;  3SJB C;  3K58 A;  3OGC C;  1XMQ B;  3NR7 A;  2IU0 A;  4X20 B;  4H33 A;  2PYL A;  2AZ2 A;  5EYP B;  1K5S A;  1QHT A;  4X1K B;  5CB4 A;  4CH4 A;  1P49 A;  5B1B C;  1V54 B;  5FPO A;  3E22 B;  4FLX A;  4AI8 A;  1YI2 V;  4GKK O;  3APO A;  3RVZ A;  1OJH A;  2P7T C;  4HYO A;  3VQV A;  3K08 A;  3M8A A;  5LXT B;  3UCS C;  3U11 A;  4WF9 V;  3B8N A;  4U3J A;  5IJ9 A;  1YTF B;  2PGG A;  3N27 A;  2QWP B;  1BSM A;  1GN6 A;  2HR3 A;  1N36 B;  3FB8 C;  5KA6 A;  2LFR A;  1I94 O;  1RSO A;  1NVP B;  3JAS B;  4UXN A;  2JRI A;  1ROP A;  3JAR B;  3RT3 C;  1JQ0 A;  5BZB A;  5B1O A;  3K5O A;  2D3O W;  1FXK A;  4IYH A;  5A9G A;  5EC2 C;  4ZBM A;  2IM9 A;  4HZ3 A;  5KA5 A;  4NXN O;  3WG7 C;  2AHZ A;  1N4C A;  2FL4 A;  4AHC A;  1SQB H;  5LGN A;  1Q6I A;  1SRY A;  2ZQM A;  4QIW F;  3T1H O;  3KG2 A;  2FYU H;  1Y74 B;  3JAT A;  2WLL B;  4JI4 B;  2Z0A A;  2C2A A;  2OCC B;  1I0H A;  2XOK G;  3SPI A;  4JI6 O;  1H2N A;  5BXZ A;  2Y4T A;  3CD6 V;  1AI5 A;  1Y4M A;  3W7T A;  2EX3 A;  2DJV A;  2Y0I A;  2H8P C;  1YCI A;  1H2L A;  3IAY A;  2NN4 A;  3U0Z A;  2LP7 A;  3E8G A;  3CCJ V;  3HKD B;  2EBO A;  4DV4 O;  3G80 A;  1SF9 A;  1VP7 A;  3F7V C;  3JAW B;  5JCO C;  3IC7 A;  4TQF A;  4DV2 O;  4LF6 B;  5H6R A;  4JAS A;  4PDR A;  3FFQ A;  1RP3 B;  5FNV B;  2JGU A;  5KHK A;  3LUT B;  2E75 B;  1P7G A;  3ASN C;  1Y76 B;  5KX5 A;  1VQ5 V;  2EIK C;  4MTX A;  5LMU O;  4WFG A;  3ZMU A;  1PM9 A;  3CHX A;  3KZI Z;  1VAR A;  2XTA A;  4I55 B;  1WJZ A;  1KP2 A;  3D36 C;  3ZX6 A;  4DR1 B;  2RMK B;  3C90 A;  4DK0 A;  4PHZ A;  1GM9 A;  5LHI A;  1WPB A;  4JI2 B;  4TUY B;  4IYI A;  4FM1 A;  2WWW A;  3D3I A;  1S5H C;  3APQ A;  4JZG A;  4WBN B;  2DN9 A;  4ZI7 A;  1GM8 A;  3D3Q A;  2YSU B;  3ICX A;  2YXH A;  3LDD A;  4FFK A;  2CTP A;  2ZT9 B;  3HKB B;  3VQY A;  3N2G B;  3RW0 A;  4LF7 O;  3CRM A;  3QNE A;  1OHH G;  5EIB C;  5J2U A;  3DXR A;  3SGI A;  3N2K B;  3K0D A;  3ABU A;  2P4K A;  3OTO O;  4RUF A;  2A7W A;  5JJJ B;  1O9H A;  4H44 B;  3ZHS A;  3RVY A;  2F43 G;  3OUF A;  2MK3 A;  2FKX A;  1SES A;  3HB3 B;  2UXD O;  1TUB A;  2YIB D;  1WP8 A;  2CTR A;  1JA8 A;  1PL0 A;  4YXW G;  1I5X A;  2W6I G;  1IBL O;  3E86 A;  1GKF A;  1P84 F;  3PJS K;  1N32 O;  1YJW V;  1AR4 A;  5B3S B;  1G6U A;  2M6Y A;  4J10 A;  4WFE A;  2GTS A;  2WA3 A;  4DW0 A;  4LFC B;  4HNA A;  4MTF A;  1JFF B;  5BR8 O;  5KUK A;  2UXC O;  3TCU A;  3U10 A;  1R3I C;  5CN0 A;  3J80 N;  2WLN A;  3ZHR A;  2CH7 B;  3ASO B;  3CCM V;  1R3L C;  3P3N A;  3MHH C;  3CP1 A;  4MVR A;  4DV1 O;  1IBK O;  5CBH A;  2XAG A;  2OTL V;  1WB7 A;  3UT5 B;  4JI3 O;  1FXV A;  4X89 A;  1W0J G;  4PJ0 Z;  4LNU A;  2QKA A;  3C3T A;  3JD2 A;  1OCZ C;  1Y67 A;  1J95 A;  1KQS U;  1F4M A;  5F2V O;  4I4T A;  1KP3 A;  1ZSP A;  1ZTE A;  1HP8 A;  1US6 A;  2B1I A;  4MS2 A;  4LFB B;  2VS0 A;  3FKS G;  3J7A U;  1VF6 C;  3CRC A;  4PA9 A;  1E79 G;  3R65 A;  5CA3 A;  4NXM B;  1MSD A;  4MVU A;  3HKC A;  4DV5 B;  1RFY A;  4B3R O;  3BA9 A;  3K5M A;  2EIM C;  3VBB A;  2BE3 A;  3EXA A;  3CCE V;  4JYA O;  4UCS A;  2IJJ A;  3DC5 A;  2GHY A;  3W7S A;  1XL4 A;  5LYJ B;  3CPW U;  1MOF A;  1K33 A;  1TVK B;  2IW5 A;  4O4H B;  4QGP A;  2F95 B;  4O2A A;  5KAI Z;  4D6T H;  1NBM G;  2ZNJ A;  4P9O A;  1R6N A;  4UCR A;  2DYS B;  1VQN V;  4DUZ O;  3DGE A;  1GAX A;  2JS5 A;  1VIB A;  3AEI A;  4X64 B;  4X20 A;  5EC1 C;  4YJ3 B;  5EYP A;  1R6T A;  2UUA O;  2E74 B;  1BL8 A;  4X1K A;  1NS1 A;  4D7S A;  1DF4 A;  3CXC U;  1K3E A;  1BQZ A;  3Q4H B;  4LC1 A;  2HFE C;  3ABL C;  2R70 A;  3E83 A;  2CGO A;  3H9V A;  2JVD A;  4PD4 F;  3A0R A;  4JZ2 A;  2R9R B;  1K34 A;  2RNB A;  2YXL A;  4ZKI A;  2QTO A;  3OMI B;  1XMQ O;  3CRA A;  4QJF B;  3EHB B;  5DEC A;  5FL7 G;  3MDS A;  4FIP C;  3ZRX A;  1WAZ A;  1OZ0 A;  1LUV A;  2E76 B;  5KHH A;  4B7E A;  4JI7 O;  1YJ9 V;  5EBL C;  4UCT A;  1R1B A;  1A32 A;  2Q68 A;  2YIB A;  1SQP H;  3JAS A;  5GW7 A;  3SPC A;  2UU9 B;  4GT1 A;  4UB8 Z;  2YS8 A;  2UUC O;  2ZM6 B;  4MVM A;  4FLZ A;  4KFM A;  2ZIN A;  1N34 O;  5LOV B;  3BEH A;  4X65 B;  5IWA O;  2WAM A;  4PI0 A;  3I55 V;  1NJI W;  1YJN V;  3X2Q B;  2HKO A;  1FFX B;  5BMV A;  3L72 H;  4GUN A;  3SYO A;  1LUW A;  1P4R A;  1JJO A;  2ADP A;  2EJ7 A;  4WFF A;  2W6J G;  1Q90 D;  1Y74 A;  2UXX A;  4DR4 B;  2WLL A;  3E8H A;  2IJH A;  3AG2 C;  4J41 A;  2CTW A;  3BCC H;  2E5L B;  1OV9 A;  4W4L A;  5IDJ A;  1HW7 A;  1AIL A;  1V55 C;  2Y4U A;  4HBN A;  2UXN A;  2A0L A;  3JAW A;  1JR9 A;  3JD3 A;  1VQO V;  2RQ6 A;  4CC5 A;  1Q43 A;  2Z3Y A;  2M7W A;  3K9A A;  5FNV A;  2ZR2 A;  3JYC A;  5EK0 A;  2Q7E A;  2Y69 C;  3ZHT A;  5JVD A;  1SZX A;  1TA8 A;  4OGQ B;  1Y76 A;  1YEW A;  3CSX A;  2Q67 A;  3CX5 F;  1R3K C;  1S0V A;  3AG1 B;  1AJN A;  4J7K A;  2KG7 A;  4JAV A;  5BY1 A;  2UUB O;  1FJG B;  2GUZ B;  1G1X B;  4I55 A;  1Z5V A;  4LF6 O;  3ETD A;  4FVM A;  1SQX H;  4LCU C;  1JCH A;  1QBZ A;  1H8H G;  4OXS A;  1YVW A;  1V54 C;  3K06 A;  4I9Q A;  4K0K O;  3AG4 B;  3K9S A;  1K73 W;  2UXB O;  1L8D A;  1SQQ H;  4GX5 A;  1NH2 D;  4WBN A;  4UFZ A;  5C93 A;  4FLY A;  3MHS C;  2QEX V;  1COW G;  4LF8 B;  1RM1 B;  1SQG A;  4U7O A;  1KBH A;  3P32 A;  3HKB A;  2A3Q A;  3N2G A;  4R6Z A;  2R9A A;  4Z2W A;  4ASU G;  2PYJ A;  1WB8 A;  1W0K G;  4RQE A;  2LGQ A;  2QM4 A;  4PA3 A;  5L3B A;  1MMM A;  4PDM A;  2BSK B;  5KAF Z;  1K9M W;  3JAL B;  4R8C A;  3CXH F;  4DRX B;  3TXQ A;  2ZXW C;  1YSC A;  4PDL A;  5EZY B;  3IGA C;  4DUY B;  4G27 B;  4NTW A;  4XDL A;  4OX9 B;  1AP6 A;  5CMU A;  3JD0 A;  2L6L A;  3QG5 A;  5D5P A;  1DGS A;  1NQT A;  2EZO A;  3ABM B;  2P5O A;  4YIP A;  1K7D A;  5KLV H;  1WP7 A;  4QE7 A;  4ZHQ B;  2X0L A;  3TGU H;  3E8B A;  1GH6 A;  2Q7G A;  5LGU A;  2YC0 A;  1PPJ H;  4KHP B;  3G71 V;  2Q6A A;  1XQ8 A;  3RFR A;  5LGT A;  1L0L H;  4I5S A;  1JFF A;  1XNQ B;  4P30 A;  1M90 W;  1VQ7 V; 
#chains in the Genus database with same CATH homology
 4DV1 O;  1IBK O;  5BY1 A;  4DV7 O;  2UUB O;  4DR3 O;  4JI3 O;  1KUQ A;  1XMQ O;  1HR0 O;  4YY3 O;  1YZB A;  1HNZ O;  1G1X B;  4DR2 O;  1FYJ A;  3O65 A;  4LF6 O;  4JI4 O;  4GKJ O;  1F7Y A;  1I94 O;  1X59 A;  4JI7 O;  4DR4 O;  4X62 O;  2JRI A;  4K0K O;  2UXB O;  4KHP O;  3RT3 C;  1R1B A;  1A32 A;  4DUY O;  4LFA O;  2LW7 A;  4OX9 O;  2DOS A;  1J5E O;  1FKA O;  2UUC O;  4JI1 O;  4YHH O;  1N33 O;  1XNQ O;  3J7A U;  4JI0 O;  3F5T A;  1N34 O;  4LF7 O;  4DR6 O;  4DV3 O;  3SDL A;  4DR5 O;  4NXN O;  5IWA O;  4X64 O;  1AB3 A;  4B3T O;  1XEQ A;  1FJG O;  2N74 A;  4B3R O;  3J81 N;  3OTO O;  4LFC O;  2VQE O;  4JYA O;  4DV0 O;  4JI5 O;  3T1H O;  4B3M O;  2Z0A A;  3JAM N;  2HHH O;  4LF4 O;  2FKX A;  4JI6 O;  5BXZ A;  1XMO O;  2UXD O;  2DJV A;  2F4V O;  2UU9 O;  5H5N A;  2ZM6 O;  4B3S O;  2VQF O;  1XNR O;  4DR1 O;  4DV4 O;  1IBL O;  2AGA A;  3R66 A;  1AIL A;  5LL6 Y;  4JI8 O;  1HNW O;  4DV6 O;  1N36 O;  4DUZ O;  1N32 O;  4X66 O;  4DR7 O;  4JI2 O;  4DV2 O;  5A2Q N;  1R6T A;  2UUA O;  4LF9 O;  4GKK O;  1NS1 A;  4AQY O;  4LFB O;  4OPA A;  1IBM O;  5BR8 O;  4LF5 O;  2UXC O;  4OPH A;  4LF8 O;  5FLX N;  5LMU O;  3T1Y O;  4A5U B;  1DK1 A;  2ZKO A;  3M8A A;  3J80 N;  1HNX O;  5LMN O;  2E5L O;  5IT9 N;  4X65 O;  4NXM O;  4JV5 O;  1D2D A;  4DV5 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...