5BY1A

H18 bat influenza ns1 rna binding domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
71
structure length
71
Chain Sequence
MESTPTTIAFQVDCYLWHLKKMLSLMGEVDAPFEDRLRREQKALKGRSMTLGIDIQAATKAGYYKIKSITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Novel Bat Influenza Virus NS1 Proteins Bind Double-Stranded RNA and Antagonize Host Innate Immunity.
pubmed doi rcsb
source organism Influenza a virus (a/flat-faced bat/peru/033/2010(h18n11))
molecule tags Viral protein
total genus 30
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5by1A00
4JI2O 3F5TA 3T1YO 1DK1A 2FKXA 3OTOO 4B3RO 2AGAA 1XMQO 1D2DA 4YHHO 1HNWO 4DR2O 2UXBO 3RT3C 4B3MO 1AILA 1HNXO 4AQYO 4B3SO 5BR8O 4LFCO 2DOSA 2F4VO 1XEQA 4OPHA 3O65A 2VQEO 4DR7O 2VQFO 1FYJA 4JV5O 4LF9O 2UUAO 2HHHO 1IBKO 4DV6O 1AB3A 4LFAO 1XNRO 2UUCO 4DV1O 5BXZA 1I94O 1HNZO 4GKJO 2DJVA 2ZM6O 4OX9O 4X65O 4DR1O 4JYAO 2N74A 5A2QN 5LL6Y 4A5UB 1N33O 1XNQO 1XMOO 5H5NA 4GKKO 4LFBO 1R1BA 4YY3O 3SDLA 2UUBO 4JI4O 4X66O 3J81N 4LF6O 4JI3O 1F7YA 2UU9O 1KUQA 2E5LO 4LF8O 4KHPO 4JI8O 1J5EO 5FLXN 4DR3O 1N32O 1G1XB 1IBMO 4LF4O 4JI6O 2ZKOA 2LW7A 1N34O 1HR0O 4JI1O 5LMNO 1YZBA 3J80N 2UXDO 1FKAO 1R6TA 4DV7O 1IBLO 4DR4O 4LF7O 4JI7O 5IT9N 2JRIA 3T1HO 4NXMO 3M8AA 5BY1A 4X62O 4B3TO 4LF5O 4OPAA 2Z0AA 5LMUO 4DV2O 4DV4O 4DUZO 3J7AU 1FJGO 4DV0O 4X64O 1NS1A 4JI0O 1A32A 4DV5O 2UXCO 1X59A 1N36O 4K0KO 4NXNO 5IWAO 4JI5O 4DR6O 4DV3O 3R66A 4DR5O 4DUYO 3JAMN
chains in the Genus database with same CATH superfamily
1PL0A 1K3EA 2W0FC 2M7WA 1HNWO 1PD3A 4DR7B 2A79B 3IAYA 1VQKV 1XBLA 3CC4V 3K9SA 2IH3C 3R65A 1QLNA 4BIUA 2XAGA 2V1DA 4B3SO 4DRXA 5KHIA 2EIJB 2PZSA 2QWNB 1VQ8V 4NTYA 4JYYA 1N33B 1BGYH 4I9QA 4QPKA 4LF5B 4GKKB 4FFBA 4RUFA 4C7UA 1F4MA 2UUCO 1VQNV 1H2KA 1GKFA 2IJIA 2ZR2A 3OTFA 2JGUA 3K5NA 3E35A 2ZM6O 5J9PC 3CYOA 3I55V 1BCCH 1JMKC 1M56B 2EILB 2Y69C 5KUMA 4FZ0A 2EULA 1UFIA 2QWOB 3OAAG 1V9PA 2CGOA 3AG3B 1Q5OA 5GONA 2Q4PA 2DWDC 1VF7A 5BMVA 3F7YC 3FAVA 5JJEB 4AHCA 3RYCA 1F4NA 1H2NA 4U3JA 1N8RW 4PDMA 5IT9N 1Z2GA 3T1HO 3F5WC 1PV0A 1LR1A 3ZMUA 4FIPC 5KMGA 1P4RA 2D3OW 4X64O 3SPGA 5B1BC 3JATB 1SESA 3A0RA 4CBCA 4X1IB 4DR6O 3HKEA 1FFTB 3ZHSA 3ETDA 4DR5O 5C93A 1AROP 1YDXA 3ABTA 3A0HZ 4IGGA 5IY5B 1KECA 1YSCA 2AHZA 1E79G 1LNQA 4YJ2B 5KA6A 2HHHB 2NN4A 4LFAB 3KZIZ 1Q81W 2GUZA 2LGQA 1JVMA 1ENVA 4JYBA 2F43G 2P67A 4OPHA 4YJ3A 1VQ4V 1GM8A 5J2UB 5KUKA 4P9OA 3C3SA 3G67A 5IYZB 3JD2A 4O4JA 4JV5O 1TA8A 1IBKO 2IBZH 3B09A 3SYQA 1R6KA 3K57A 1XNRO 4HYOA 5LP6C 4KHPB 1I7FA 3D36A 3ZRSA 4OX9O 4TV9B 1SQGA 2YI8A 1XL6A 1SA0A 3D3QA 3N2KA 2AW9A 3L9DA 1PNMA 4GZRB 1QCEA 3CSXA 1R1BA 2KKWA 3SDLA 3CS5A 1DLBA 3HKCB 4DV0B 4BWAA 2V4DA 5B1AB 3WB0A 2YIAA 3UT5B 1EZVH 1XILA 3VQWA 5IWAB 1E1RG 3OMAB 4IYIA 4LFCB 1FXKB 1PNLA 1VF6A 2JRIA 5JJJB 3RYFB 4NXMO 4B3TO 2MK3A 3CRAA 1YITV 3BEHA 3RVYA 4BIOA 1QLEB 4CZZA 1WLEA 2Q7GA 2D2CB 4OXSA 3LSUA 3E86A 5LXTB 4Z1MG 2JS5A 4DUYO 2JEUA 3F5TA 1NZ6A 1ZL8B 4I4TB 2CH7A 4HNAA 1D2DA 1PKXA 1JJOA 1ZTEA 4J10A 4LF9B 3CP1A 3VOUA 4MVSA 1RPRA 4DV1B 4FVMA 1S76D 2ZNJA 3I5DA 2OWOA 2ZIMA 1OCOB 1COWG 4CS4A 1XEQA 4TV8B 3SR2C 1KMIZ 1SQPH 4JZ2A 1S5LZ 4MVOA 3HB3B 3E89A 3L70H 2O57A 3ZHTA 3ZRXA 2VQFO 4UCOA 1XNQB 1XOUA 1FXVA 1NR7A 4DV4B 1VQ6V 4PDRA 4LF8B 1HNZO 1BSMA 3W7SA 3M7MX 4LF4B 3OEHG 4FPPA 3VBBA 2CGNA 4FM0A 4ZOLA 4BR6A 4MSWC 4PA6A 1ROPA 5H5NA 3CJHB 4YY3O 3KCXA 2GDSA 2Q0OC 3S3WA 2YIDA 4TQDA 4U7OA 1Y67A 1N4CA 1MNGA 2YIBA 4QPJA 4RQFA 3CE2A 2UXCB 5JVDA 1D5AA 1QHTA 2PGGA 3J80N 4CC6A 4O2BB 1FKAO 1R6TA 4JAVA 3OTOB 4LF7O 3DC6A 5F2VO 4WCEV 5EBMC 1FD9A 2LP7A 1WN7A 3K3WA 5HFMA 1AVMA 3STLC 5L3GA 1JPXA 3T4DA 4K8ZA 5L3DA 5LBQA 3APOA 3JAWA 1IVSA 1KQSU 3FYEB 5E79Z 1XI1A 2VRZA 4G27B 4QNHB 5KAFZ 3SPHA 1WAZA 3AEIA 4UCRA 1XMOB 3JD3A 2ADPA 3U10A 2OT5A 5D5QA 1NH2D 1VF5B 1AILA 1MMMA 4ZI7A 1S72V 4QE9A 3VQVA 4O4IB 1J95A 2CDYA 1IZ3A 2BSKA 1VEWA 1SQFA 1BQ0A 4JYAB 4Q20A 3ZHQA 5CA1A 3AG2C 3F7VC 2AZ0A 1WPXA 1ZLZA 3O9OA 3UCSC 3K9AA 2ZCEA 1G4YB 4LF6B 3OD4A 1AJNA 2CTPA 2E5LB 3CCLV 4KFMA 1I0HA 4WFFA 1EN6A 4JI6B 3DXRA 1BMFG 1BT8A 3SYCA 4JASA 4A5UB 4DV7B 2XNDG 1OCRB 4PELA 1NTZH 3DTUB 2IH1C 2UUBO 5IJ9B 2ODMA 2PF4E 4DUZB 2FYUH 3E2EA 1RM1B 3ZMVA 3LSQA 3C3TA 5H9CA 4DR3O 3W7TA 4NXNB 3LUTB 4CH3A 3E22A 3FFQA 5GONB 4EFBA 4JI2B 4LWSB 4X62O 2DYSC 3SJBC 3L71H 3NXSA 4LR3A 1SERA 4P2ZA 4W4LA 1M57C 1I08A 5CA0B 2WLKA 5KHHA 4PI2A 1AP5A 1U96A 1V55B 2P4VA 3A2FA 3JAKA 3JASB 3EFFK 4I0XA 2Y0IA 3LNMB 4KUMA 2WLNA 2EINB 2V7QG 2PUSA 1UPGA 1K5SA 2A9HA 4TSFG 4O2AB 2F4VO 3CWBH 2YEVB 5B5EZ 4XDLA 5JCOC 5JQGA 1RSOA 2DQ0A 2VQEO 4WF9V 3H1KH 2N04A 5LA6A 4FJCC 2EIJC 1K92A 3E8BA 1T5EA 1M90W 4DV6O 4PA4A 2ZE5A 1ZX3A 3TCUA 1AR1B 2XAJA 4DO2A 2JDIG 4X8AA 3H01A 2YIBD 1M9NA 3H1JH 2CE4A 1SETA 1EN4A 1QBZA 3ZHRA 2UXDB 2BTQA 5ITZA 1TAEA 4I55B 3K5MA 5EC2C 3BA8A 2WA3A 3E8GA 2Q8VA 1VQ7V 2ZD9A 4J41A 2YI9A 4IHJB 4E4EA 1L0NH 4JI0B 1GAXA 1Q6UA 2WLIA 3OMNB 1M56C 5IE9A 1M93A 4NYKA 2EILC 5AG2A 2HKOA 2ZR3A 1NVPB 4J80A 5LMNO 2F95B 4DXWA 3EXAA 3AG3C 4B7EA 3JARA 3JD1A 2GSMB 1Q6HA 3OR7C 1WB8A 5LGNA 1IXBA 2LW1A 3OEEG 3BY6A 2Z0AA 4UVCA 5C8YB 2AZ2A 2IJHA 3T2MA 4O4HA 3HKBA 4K3AA 2AXTZ 2QE7G 3GWOA 4LCUC 5LP6A 4RUEA 2Z5UA 2HJDA 3GB7C 3E8HA 1FFXA 3T1YO 2WLLA 3OM3B 2AGAA 1XMQO 4KL1A 1RFYA 1WJZA 2KG7A 4YHHO 4TUYB 2Q7HA 4DR2O 3P3NA 3PN1A 4WFAV 3CCMV 1S0VA 2YC0A 3L73H 4MW3A 2Y48A 2W6IG 1K7DA 5IY5C 2DQ3A 5EC1C 5GTIZ 4U7NA 4X65B 4UV8A 2G38A 3ZRWA 5FNVB 2BOBC 1DTOA 2JS3A 4DR7O 2ATKC 1CXZB 5LGUA 3H1IH 1FPOA 3JD4A 4X1KA 3JD0A 3SJCC 3RYHA 5J2TA 4JI8B 1TUBA 2DJVA 3MD0A 2HR3A 3AG4B 2ZE8A 1K97A 1MZEA 2OIGA 1AJPA 1E1QG 3HKDB 3ZJZA 4DW1A 1Z5WA 3GWKC 1N33O 4PA3A 4GKKO 4IIJA 1X4TA 1F7YA 2P4KA 1GRJA 3G4SV 4R8CA 3N2GB 1P49A 3OUSA 1HWYA 2HEPA 3ZMTA 1OHHG 4K0KB 4JI5B 1YI2V 3QO5A 1N0JA 4JTAB 1SQVH 1URFA 5B1AC 2X0LA 4PDVA 1YTFD 4WBNA 4AI8A 2VWKA 1OCCB 1XUQA 4G2KA 5DM6V 2EIMB 1FXKC 5KLVH 1K9MW 2XASA 1YXBA 1XDCA 1Y76A 2YDEA 3H9VA 4EB6B 1MSWD 4X1YB 4JTDB 1QLEC 2R70A 2PI4A 1QR8A 2LO1A 2EJ7A 3B77A 2YSUB 3B8NA 3K06A 4D7SA 1AR4A 1QVGU 5EZYA 1U97A 4N23A 3LDCA 5GW7A 2FB5A 1ORQC 1H2MA 2W0XA 5BR8O 5KAIZ 3IGAC 5CMUA 1S77D 5D5PA 1OZ0A 4I50A 3B4SA 2QM4A 1EBOA 1OCOC 4X20B 2BTOA 4LFBB 2HHHO 4CH6A 1LUWA 1AB3A 4LFAO 4X64B 3RYIA 1Z5VA 3ETEA 3UQ8A 3CC7V 5CBGA 5KHKA 1Q90D 4RO2A 5KX5A 2ZDIC 1PL4A 2JEXA 3ZS8C 4D7TA 4LNUA 1N34B 2N74A 2QDOA 2YXHA 3KG2A 4H0LB 1S3JA 4CH5A 4JI3O 3TK1A 3J81N 4PV1B 4KHPO 1YJNV 2E74B 5JWPA 4GYCB 1LUVA 1AJQA 3SGIA 2B1IA 1Q3EA 3Q4HA 1HR0O 4FMTA 1MA1A 1F23A 5LYJA 3G6BA 2R9AA 4UB8Z 3FKSG 5H6RA 3AK3A 1NQTA 2LJ2A 2FL4A 3WU2Z 4YIOA 5LHHA 1GN4A 2UXBB 4DV0O 4DW0A 2RJZA 2YXLA 5KA5A 2XOKG 4DV5O 4RWUA 2H94A 4AQYB 5IWAO 3ICXA 3SJAC 1P84F 1WA8B 5HFLA 2HJFC 5JH7B 2RQ6A 3JAMN 4LFCO 1JFFB 2Q6AA 1EZJA 1O9HA 1IX9A 3FYIB 4EFEA 5IJ0A 1TVKA 2XHBA 4WFEA 4P30A 3QTCA 2YUAA 3BVOA 3CXHF 2UUAB 2ITDC 2N05A 2H8PC 3JCUZ 2R72A 1K34A 4FZ1A 4BAYA 2FTKA 1R6NA 2GHYA 5K1PA 4ZHQA 5LOVA 1AR5A 1EFRG 1WP8A 3QO7A 4L87A 3WFVA 1JCHA 3ZCCA 2UXXA 5KHGA 4PA9A 2WWWA 3ZN1A 2F1MA 4LF9O 3JALA 3IFXA 4J42A 4DV1O 5EYPB 1WP7A 1JX9A 4ZIBA 4GX5A 4DUYB 1SQQH 3C90A 4JI1B 1NTKH 2QA4V 1XNQO 4AILC 1V54B 1YVWA 4F6RB 3ZBHA 2GTAA 4LF8O 4PA7A 1SZTA 4TWKA 4KXRA 3X2QC 1OCRC 1N36B 1S5JA 4LF4O 4K35A 1MABG 3ABMB 1SQXH 2BE3A 1B06A 2EBOA 3CB2A 2P06A 3ABUA 4ASUG 4FK5C 2OYQA 3OGIB 1RM1C 4TOIA 3FB6C 4B3RB 4WFBV 1Y66A 4FFKA 2VQFB 2NLJC 1GK9A 3ZX6A 3JSNA 3THOA 4H37A 2AHYA 2UXCO 3KCYA 4O4LB 2P22C 3L74H 3RGBA 3CCJV 4CS2A 4NKGB 2XAFA 3OW2U 3OTOO 4UFZA 2DMXA 1KYOF 2XAQA 1QQCA 3OMIB 4N21A 1OV9A 3SYPA 1TUEB 2LQTA 3N27A 1KU9A 1Q7YW 2EZPA 1V55C 1H2SB 2Q73A 3I56V 3ABLB 2RMKB 5CB4A 1BE3H 5LHIA 3LNNA 4HAMA 3A0BZ 2ZINA 4PHZA 2EINC 3EVKA 2YICA 3ZMZA 2Y4TA 5EK0A 4JZGA 1Y74B 3CRMA 3K5LA 4JI4B 1KC8W 2QJ1A 1OCZB 2OTLV 5IYBO 2ARHA 1IBMB 3BFRA 2OIEA 4JYAO 1QU7A 2DN9A 5A2QN 3OT7A 4DRXB 5A9GA 3JATA 1AI7A 4UCUA 3ZHUA 4X1IA 4LF6O 5LMUB 3SYOA 3D36C 2E5LO 2QWRB 3L75H 1J5EO 2ZXWB 1XL4A 4D6TH 4E2LA 3DC5A 3EHBB 4FFBB 4JI6O 2ZKOA 4DV3B 1B04A 2Q9LA 5B3SB 4YJ2A 1YJ9V 1G8MA 2GBOA 4DV7O 5BY1A 4LC1A 3X2QB 1HP8A 2QKAA 3OR6C 4DUZO 1R3JC 3WB2A 1M5IA 1MZFA 3U0ZA 2DWEC 3MHHC 4GT1A 5TISZ 3ETGA 3D3IA 5J2UA 1A32A 3K04A 5IYZA 4MVZA 4NXNO 1UJWB 3AG1C 2RCVA 3QF7A 3MDSA 4WFHA 2XT9A 1SC5B 3ZEDA 4JI2O 1H8HG 5DECA 2QWQB 5BMVB 1W0KG 3FAVB 3JSLA 2E3CA 2RNBA 3HPLC 4TV9A 3RYCB 1R3IC 1YCIA 4TT3G 4U3JB 3RT3C 1R3KC 1Q43A 4DYLA 3BCCH 1I94B 4GKJB 5KMGB 2HG5C 4MTGA 3D8CA 4PI0A 4NTXA 1VQLV 4DR1B 2LFRA 3HKCA 4PJ0Z 3HKEB 2F23A 3UT5A 3AK1A 4IL6Z 2BOCC 4X66B 2QWPB 2UU9B 2ZIOA 2FMLA 2QSAA 1FXKA 2L6LA 3RYFA 1K5QA 2GUZB 3ZIAG 1KD1W 5LL6Y 1L1FA 2P90A 1SQBH 2C2AA 2VWJA 1K73W 3AG4C 4YJ3B 1NBMG 4GX2A 1M4UA 5LXTA 4O4JB 4LH7A 1ZL8A 3L72H 4I4TA 3K0GA 1CEZA 1KP3A 1N0NA 1NR1A 1NH2B 1JR9A 2UXDO 2MW2B 2OTJV 2OCCB 4NTWA 4JI7O 3T4ZA 3Q4HB 5CBHA 2X6CA 1SA0B 4UV9A 3H1LH 3J7AU 2JJ1G 3N2KB 4DV6B 4TV8A 4BW5A 4JI0O 5L3BA 2WLJA 4B3MB 1AI4A 1HNXB 4B08A 4IYHA 4X88A 1HW7A 1OCCC 1ZAUA 2WLMA 1NTMH 1YIJV 2ZDIA 2EIMC 2YXYA 3DSQA 5FL7G 4FLVA 2X7RB 3P32A 4FLUA 3AG1B 4PDLA 2H3OA 5EIBC 1VQMV 5EIBD 1R3LC 3JCZA 2RDCA 3IC7A 4GX0A 4BW9A 3CJHA 1IURA 3O65A 4EEQA 1I5YA 4JTCB 4MVMA 1FYJA 2CTRA 4JGSA 3G80A 4ICGA 1GN6A 2CH7B 4HNAB 2XUMA 3E83A 4O2BA 4H44B 1PNKA 1K4CC 4X65O 3CEIA 1N32B 2ZNIA 4JPRA 3CRRA 1XMQB 4MVQA 5CA3A 2ZQMA 1IBLB 3LSSA 4DR4B 2Y4UA 3RBZA 4DR2B 4FM1A 3OGCC 4UXNA 4DV2B 1FJGB 1H2LA 2GTSA 4JI8O 2PY5A 1SKVA 4TQFA 2EX3A 1I5XA 2LFSA 3B8MA 3FX7A 2DYRB 3NR7A 3CXCU 1Q82W 4XBFA 2CAZC 1YZBA 4MS2A 1H38A 2P7TC 1MSDA 3QG5A 5H2FZ 1HDJA 1Y4MA 2HVJC 3B2EE 3CHXA 2YS8A 3RN4A 4LF5O 1HNWB 1QR9A 3DGEA 3WB1A 3TXQA 4ZOLB 5EBLC 4O4IA 1XHXA 5JJNB 4QE7A 2IW5A 3K5OA 5LGTA 2A7WA 4EKWA 1GN3A 1X59A 1VARA 4K0KO 4B3SB 4JI5O 2CTWA 3VQYA 2VS0A 2WA4A 2FKXA 3K59A 3CMAV 2W6JG 5JVDB 2E76B 2EIKB 2R9RB 5FPRA 2PTMA 1KKCA 2EZOA 2QKCA 1VQOV 2A06H 2UUCB 1B3QA 1EM1A 5FPOA 1KP2A 2ZM6B 3W7UA 1SZXA 5IJ9A 3ML0A 3T1CA 3ASNB 3CRQA 1PP9H 5CB4B 3JAWB 4QGPA 3MHSC 3M99B 4R6ZA 1THZA 1ZUQA 4MTOA 1L8DA 1GMGA 3W7XA 4LWSA 4UB6Z 3CCEV 1SF9A 2PYLA 1GTOA 4MVUA 2EJRA 2P5OA 5B1NA 3TXSA 4MW8A 4KP4A 4ZI7B 1BHAA 3T1HB 5CA0A 5CBFA 4LFBO 3CCVV 1KB9F 2BSKB 3A8TA 1YF2A 5CA1B 3ABKB 1M1KW 4FLTA 2QR4A 3JYCA 4CS3A 4GX1A 4CH4A 1WB7A 4LP8A 1V54C 1VQ5V 5BR8B 2PI5A 3K03A 3ZN0A 3JASA 2JIZG 4DR6B 3CCQV 1N34O 1FS0G 3HR0A 1BS3A 4DR5B 1VQPV 3WG7B 3UO3A 4OPAA 3DXRB 3ABMC 1H8EG 3H1HH 4O2AA 2YEVA 1AI5A 1SS3A 5IYCO 1XHZA 2HFEC 1AP6A 1WPBA 1GH6A 3SPJA 3K08A 3RW0A 4MTXA 4DK0A 1NI8A 4DK1A 2WAMA 1NU1H 2IJKA 3E22B 2ZT9B 4JV5B 2UXBO 1YHQV 4I5SA 4ABMA 4JI3B 4Z2WA 3P3PA 1IBKB 1NJIW 1XNRB 1BZKA 4AQYO 3U11A 4I55A 2QTSA 4OX9B 2JK5C 1HR0B 2IU3A 4J7JA 2JGDA 4LBEC 1GO3F 2KQXA 4IHJA 1R73A 1K33A 2KB1A 3BAAA 2IU0A 3CCRV 3ABLC 2HP8A 4H33A 4LH6A 2UUAO 2QM8A 1Y6XA 5B66Z 4Q6GA 5BZBA 1XREA 1TGOA 3KKYA 3JAKB 4I0XB 1YTFB 1Q8IA 4DV5B 2Y69B 4XDJA 5C8YA 1OCZC 1US6A 5LHGA 1G6UA 1VQ9V 4NXMB 4MVRA 4B3TB 5JQGB 3BPZA 1RSOB 3K79A 5GTHZ 4BIZA 4FLWA 5H6QA 5LA6B 5IYDO 5L3FA 4GCZA 2Q69A 1JQ0A 4TUYA 1S5HC 4JI1O 1BQZA 2R9IA 3S3XA 5B1BB 2K9PA 2A0LA 2ZXWC 3M8AA 5L3EA 4W4KA 5DN6G 4X9QA 4DV4O 3CCSV 3OFNG 4F6EA 5B3SC 2BTQB 5ITZB 4MTFA 4R7CA 3QNEA 4WFGA 5FNVA 2QGNA 1N36O 2WLHA 3SJQC 2Z3YA 2K1EA 2WLIB 4B3RO 5JCOA 3PJSK 1YJWV 4X89A 2XAHA 2Q7EA 2F66C 4UVBA 4GUNA 4K8XA 3CX5F 3JARB 4QJFB 4J11A 3CD6V 3HKDA 2QTOA 2F93B 1HNZB 3OE7G 4O4HB 3HKBB 3QO8A 3BRCA 5LP6B 3N2GA 1XQ8A 5L3CA 4U3FH 3UO2A 3FB5C 1AI6A 2GV9A 3STZC 4H13B 1CPYA 1FFXB 2WLLB 3G6EV 4YY3B 2Q67A 3UKMA 3UM7A 1QVFU 1DF5A 4JF3A 4RQEA 5BXZA 2KG7B 1JJ2U 3BA9A 3OUFA 3FB7C 3ETQA 3TETA 3TGUH 3BABA 2Q0AA 5EBWC 1PM9A 4F4LA 4LF7B 3G71V 4FLZA 1XMOO 1QNMA 2DE0X 4J7KA 4JI4O 3ZRWB 4EB6A 5KHJA 4XDKA 4X1YA 1WNSA 4ZBMA 2X6BA 4IT5A 4X1KB 1IBMO 3RYHB 1L0LH 5J2TB 2HVKC 4FLXA 1TUBB 1VMGA 3SPIA 1ZWIC 4NR1A 3IC9A 5LMUO 2HLDG 4J9YB 3RFRA 1NS1A 2PYJA 5CN0A 1KKDA 4UUJC 2OCCC 1NKDA 1CP9A 4IIJB 1GM7A 4DV3O 4X20A 2UXNA 3TJTA 1MG1A 1W2BU 1RP3B 3QVNA 2XTAA 1VIBA 4RAIA 3MAQA 3ZMSA 2NNUA 1W59A 4NB5A 1NVPD 4P9PA 1Q6IA 2QEXV 1ZSPA 1J5EB 4WBNB 1Q86W 2Y0PA 2DOSA 3CC2V 3RVZA 1W0JG 1VF6C 3ASOC 2WPDG 1Y76B 1OJHA 2ETNA 2UUBB 5B1OA 3P30A 3APQA 4L8JA 5K1XA 1B6QA 1I94O 4UCSA 4GKJO 3CPWU 3FB8C 2ADQB 2E75B 5EZYB 3LDEA 1FXHA 4DR3B 4DR1O 1JOYA 2P6JA 2DW4A 4QIWF 1P7BA 1JA8A 4B7KA 4UCTA 4X62B 1O9GA 4I7ZB 3SYAA 4X66O 4I50B 2UU9O 1WA8A 5JH7A 1JFFA 2IJJA 2CUGA 3LDDA 1MOFA 4PD4F 1G1XB 3RYIB 1P7GA 2ILMA 3GVMA 4JAUA 2B1GA 1KBHA 3AK2A 2M6YA 5KX5B 1RPOA 1SRYA 2BCCH 2DYRC 2WSSG 4LNUB 2NR5A 5E1AC 4J9ZB 2ZE7A 2OCHA 4I9WA 2X6AA 3R66A 5DEDA 1VP7A 2F4VB 1DK1A 2VQEB 3BHPA 1K4DC 5EYPA 1YEWA 4NVPA 3CMEV 5LYJB 3AG7A 2B5UA 4JYCA 2L35A 5IDJA 4B3MO 2KSDA 4UCVA 3AG2B 1HNXO 1GM9A 2EIKC 3SPCA 4F6RA 3IJ4A 3ZRVA 2LGWA 4OGQB 2Q68A 4FLYA 4GLXA 1K8AW 2QKSA 4JI7B 3ZHVA 4ZKIA 1BL8A 1IXMA 1D5NA 2JGDB 4YIPA 4JAAA 2B9ZA 4CC5A 4FM2A 4MT8A 3ASNC 4YXWG 3RWRD 5IJ0B 1TVKB 3ASOB 2ZE6A 1IDSA 3B40A 3E8FA 1NT2B 5LMNB 2RN9A 2QM7A 4ZHQB 5LOVB 1DF4A 3CCUV 2Q5ZA 4O4LA 3K0DA 3CRCA 2IM9A 1KUQA 2JJ2G 1DGSA 1PPJH 4R50A 2JVDA 1BHBA 2A3QA 1EN5A 3FD9A 5FLXN 2CK3G 3JALB 2DYSB 1N32O 2LW7A 1H2GA 2CTQA 1GN2A 3K58A 3ABKC 3T1YB 1IBLO 4DR4O 1M57B 1F51A 4J7ZA 4YHHB 4DV2O 1FJGO 2ITCC 4UVAA 4HZ3A 4HBNA 3VQXA 3WG7C 3W7WA 1Y74A 1FAFA 4Z1VA 4G28B
chains in the Genus database with same CATH topology
4JI2O 3F5TA 3T1YO 1DK1A 2FKXA 3OTOO 4B3RO 2AGAA 1XMQO 1D2DA 4YHHO 1HNWO 4DR2O 2UXBO 3RT3C 4B3MO 1AILA 1HNXO 4AQYO 4B3SO 5BR8O 4LFCO 2DOSA 2F4VO 1XEQA 4OPHA 3O65A 2VQEO 4DR7O 2VQFO 1FYJA 4JV5O 4LF9O 2UUAO 2HHHO 1IBKO 4DV6O 1AB3A 4LFAO 1XNRO 2UUCO 4DV1O 5BXZA 1I94O 1HNZO 4GKJO 2DJVA 2ZM6O 4OX9O 4X65O 4DR1O 4JYAO 2N74A 5A2QN 5LL6Y 4A5UB 1N33O 1XNQO 1XMOO 5H5NA 4GKKO 4LFBO 1R1BA 4YY3O 3SDLA 2UUBO 4JI4O 4X66O 3J81N 4LF6O 4JI3O 1F7YA 2UU9O 1KUQA 2E5LO 4LF8O 4KHPO 4JI8O 1J5EO 5FLXN 4DR3O 1N32O 1G1XB 1IBMO 4LF4O 4JI6O 2ZKOA 2LW7A 1N34O 1HR0O 4JI1O 5LMNO 1YZBA 3J80N 2UXDO 1FKAO 1R6TA 4DV7O 1IBLO 4DR4O 4LF7O 4JI7O 5IT9N 2JRIA 3T1HO 4NXMO 3M8AA 5BY1A 4X62O 4B3TO 4LF5O 4OPAA 2Z0AA 5LMUO 4DV2O 4DV4O 4DUZO 3J7AU 1FJGO 4DV0O 4X64O 1NS1A 4JI0O 1A32A 4DV5O 2UXCO 1X59A 1N36O 4K0KO 4NXNO 5IWAO 4JI5O 4DR6O 4DV3O 3R66A 4DR5O 4DUYO 3JAMN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 O;  3F5T A;  3T1Y O;  1DK1 A;  2FKX A;  3OTO O;  4B3R O;  2AGA A;  1XMQ O;  1D2D A;  4YHH O;  1HNW O;  4DR2 O;  2UXB O;  3RT3 C;  4B3M O;  1AIL A;  1HNX O;  4AQY O;  4B3S O;  5BR8 O;  4LFC O;  2DOS A;  2F4V O;  1XEQ A;  4OPH A;  3O65 A;  2VQE O;  4DR7 O;  2VQF O;  1FYJ A;  4JV5 O;  4LF9 O;  2UUA O;  2HHH O;  1IBK O;  4DV6 O;  1AB3 A;  4LFA O;  1XNR O;  2UUC O;  4DV1 O;  5BXZ A;  1I94 O;  1HNZ O;  4GKJ O;  2DJV A;  2ZM6 O;  4OX9 O;  4X65 O;  4DR1 O;  4JYA O;  2N74 A;  5A2Q N;  5LL6 Y;  4A5U B;  1N33 O;  1XNQ O;  1XMO O;  5H5N A;  4GKK O;  4LFB O;  1R1B A;  4YY3 O;  3SDL A;  2UUB O;  4JI4 O;  4X66 O;  3J81 N;  4LF6 O;  4JI3 O;  1F7Y A;  2UU9 O;  1KUQ A;  2E5L O;  4LF8 O;  4KHP O;  4JI8 O;  1J5E O;  5FLX N;  4DR3 O;  1N32 O;  1G1X B;  1IBM O;  4LF4 O;  4JI6 O;  2ZKO A;  2LW7 A;  1N34 O;  1HR0 O;  4JI1 O;  5LMN O;  1YZB A;  3J80 N;  2UXD O;  1FKA O;  1R6T A;  4DV7 O;  1IBL O;  4DR4 O;  4LF7 O;  4JI7 O;  5IT9 N;  2JRI A;  3T1H O;  4NXM O;  3M8A A;  5BY1 A;  4X62 O;  4B3T O;  4LF5 O;  4OPA A;  2Z0A A;  5LMU O;  4DV2 O;  4DV4 O;  4DUZ O;  3J7A U;  1FJG O;  4DV0 O;  4X64 O;  1NS1 A;  4JI0 O;  1A32 A;  4DV5 O;  2UXC O;  1X59 A;  1N36 O;  4K0K O;  4NXN O;  5IWA O;  4JI5 O;  4DR6 O;  4DV3 O;  3R66 A;  4DR5 O;  4DUY O;  3JAM N; 
#chains in the Genus database with same CATH topology
 1PL0 A;  1K3E A;  2W0F C;  2M7W A;  1HNW O;  1PD3 A;  4DR7 B;  2A79 B;  3IAY A;  1VQK V;  1XBL A;  3CC4 V;  3K9S A;  2IH3 C;  3R65 A;  1QLN A;  4BIU A;  2XAG A;  2V1D A;  4B3S O;  4DRX A;  5KHI A;  2EIJ B;  2PZS A;  2QWN B;  1VQ8 V;  4NTY A;  4JYY A;  1N33 B;  1BGY H;  4I9Q A;  4QPK A;  4LF5 B;  4GKK B;  4FFB A;  4RUF A;  4C7U A;  1F4M A;  2UUC O;  1VQN V;  1H2K A;  1GKF A;  2IJI A;  2ZR2 A;  3OTF A;  2JGU A;  3K5N A;  3E35 A;  2ZM6 O;  5J9P C;  3CYO A;  3I55 V;  1BCC H;  1JMK C;  1M56 B;  2EIL B;  2Y69 C;  5KUM A;  4FZ0 A;  2EUL A;  1UFI A;  2QWO B;  3OAA G;  1V9P A;  2CGO A;  3AG3 B;  1Q5O A;  5GON A;  2Q4P A;  2DWD C;  1VF7 A;  5BMV A;  3F7Y C;  3FAV A;  5JJE B;  4AHC A;  3RYC A;  1F4N A;  1H2N A;  4U3J A;  1N8R W;  4PDM A;  5IT9 N;  1Z2G A;  3T1H O;  3F5W C;  1PV0 A;  1LR1 A;  3ZMU A;  4FIP C;  5KMG A;  1P4R A;  2D3O W;  4X64 O;  3SPG A;  5B1B C;  3JAT B;  1SES A;  3A0R A;  4CBC A;  4X1I B;  4DR6 O;  3HKE A;  1FFT B;  3ZHS A;  3ETD A;  4DR5 O;  5C93 A;  1ARO P;  1YDX A;  3ABT A;  3A0H Z;  4IGG A;  5IY5 B;  1KEC A;  1YSC A;  2AHZ A;  1E79 G;  1LNQ A;  4YJ2 B;  5KA6 A;  2HHH B;  2NN4 A;  4LFA B;  3KZI Z;  1Q81 W;  2GUZ A;  2LGQ A;  1JVM A;  1ENV A;  4JYB A;  2F43 G;  2P67 A;  4OPH A;  4YJ3 A;  1VQ4 V;  1GM8 A;  5J2U B;  5KUK A;  4P9O A;  3C3S A;  3G67 A;  5IYZ B;  3JD2 A;  4O4J A;  4JV5 O;  1TA8 A;  1IBK O;  2IBZ H;  3B09 A;  3SYQ A;  1R6K A;  3K57 A;  1XNR O;  4HYO A;  5LP6 C;  4KHP B;  1I7F A;  3D36 A;  3ZRS A;  4OX9 O;  4TV9 B;  1SQG A;  2YI8 A;  1XL6 A;  1SA0 A;  3D3Q A;  3N2K A;  2AW9 A;  3L9D A;  1PNM A;  4GZR B;  1QCE A;  3CSX A;  1R1B A;  2KKW A;  3SDL A;  3CS5 A;  1DLB A;  3HKC B;  4DV0 B;  4BWA A;  2V4D A;  5B1A B;  3WB0 A;  2YIA A;  3UT5 B;  1EZV H;  1XIL A;  3VQW A;  5IWA B;  1E1R G;  3OMA B;  4IYI A;  4LFC B;  1FXK B;  1PNL A;  1VF6 A;  2JRI A;  5JJJ B;  3RYF B;  4NXM O;  4B3T O;  2MK3 A;  3CRA A;  1YIT V;  3BEH A;  3RVY A;  4BIO A;  1QLE B;  4CZZ A;  1WLE A;  2Q7G A;  2D2C B;  4OXS A;  3LSU A;  3E86 A;  5LXT B;  4Z1M G;  2JS5 A;  4DUY O;  2JEU A;  3F5T A;  1NZ6 A;  1ZL8 B;  4I4T B;  2CH7 A;  4HNA A;  1D2D A;  1PKX A;  1JJO A;  1ZTE A;  4J10 A;  4LF9 B;  3CP1 A;  3VOU A;  4MVS A;  1RPR A;  4DV1 B;  4FVM A;  1S76 D;  2ZNJ A;  3I5D A;  2OWO A;  2ZIM A;  1OCO B;  1COW G;  4CS4 A;  1XEQ A;  4TV8 B;  3SR2 C;  1KMI Z;  1SQP H;  4JZ2 A;  1S5L Z;  4MVO A;  3HB3 B;  3E89 A;  3L70 H;  2O57 A;  3ZHT A;  3ZRX A;  2VQF O;  4UCO A;  1XNQ B;  1XOU A;  1FXV A;  1NR7 A;  4DV4 B;  1VQ6 V;  4PDR A;  4LF8 B;  1HNZ O;  1BSM A;  3W7S A;  3M7M X;  4LF4 B;  3OEH G;  4FPP A;  3VBB A;  2CGN A;  4FM0 A;  4ZOL A;  4BR6 A;  4MSW C;  4PA6 A;  1ROP A;  5H5N A;  3CJH B;  4YY3 O;  3KCX A;  2GDS A;  2Q0O C;  3S3W A;  2YID A;  4TQD A;  4U7O A;  1Y67 A;  1N4C A;  1MNG A;  2YIB A;  4QPJ A;  4RQF A;  3CE2 A;  2UXC B;  5JVD A;  1D5A A;  1QHT A;  2PGG A;  3J80 N;  4CC6 A;  4O2B B;  1FKA O;  1R6T A;  4JAV A;  3OTO B;  4LF7 O;  3DC6 A;  5F2V O;  4WCE V;  5EBM C;  1FD9 A;  2LP7 A;  1WN7 A;  3K3W A;  5HFM A;  1AVM A;  3STL C;  5L3G A;  1JPX A;  3T4D A;  4K8Z A;  5L3D A;  5LBQ A;  3APO A;  3JAW A;  1IVS A;  1KQS U;  3FYE B;  5E79 Z;  1XI1 A;  2VRZ A;  4G27 B;  4QNH B;  5KAF Z;  3SPH A;  1WAZ A;  3AEI A;  4UCR A;  1XMO B;  3JD3 A;  2ADP A;  3U10 A;  2OT5 A;  5D5Q A;  1NH2 D;  1VF5 B;  1AIL A;  1MMM A;  4ZI7 A;  1S72 V;  4QE9 A;  3VQV A;  4O4I B;  1J95 A;  2CDY A;  1IZ3 A;  2BSK A;  1VEW A;  1SQF A;  1BQ0 A;  4JYA B;  4Q20 A;  3ZHQ A;  5CA1 A;  3AG2 C;  3F7V C;  2AZ0 A;  1WPX A;  1ZLZ A;  3O9O A;  3UCS C;  3K9A A;  2ZCE A;  1G4Y B;  4LF6 B;  3OD4 A;  1AJN A;  2CTP A;  2E5L B;  3CCL V;  4KFM A;  1I0H A;  4WFF A;  1EN6 A;  4JI6 B;  3DXR A;  1BMF G;  1BT8 A;  3SYC A;  4JAS A;  4A5U B;  4DV7 B;  2XND G;  1OCR B;  4PEL A;  1NTZ H;  3DTU B;  2IH1 C;  2UUB O;  5IJ9 B;  2ODM A;  2PF4 E;  4DUZ B;  2FYU H;  3E2E A;  1RM1 B;  3ZMV A;  3LSQ A;  3C3T A;  5H9C A;  4DR3 O;  3W7T A;  4NXN B;  3LUT B;  4CH3 A;  3E22 A;  3FFQ A;  5GON B;  4EFB A;  4JI2 B;  4LWS B;  4X62 O;  2DYS C;  3SJB C;  3L71 H;  3NXS A;  4LR3 A;  1SER A;  4P2Z A;  4W4L A;  1M57 C;  1I08 A;  5CA0 B;  2WLK A;  5KHH A;  4PI2 A;  1AP5 A;  1U96 A;  1V55 B;  2P4V A;  3A2F A;  3JAK A;  3JAS B;  3EFF K;  4I0X A;  2Y0I A;  3LNM B;  4KUM A;  2WLN A;  2EIN B;  2V7Q G;  2PUS A;  1UPG A;  1K5S A;  2A9H A;  4TSF G;  4O2A B;  2F4V O;  3CWB H;  2YEV B;  5B5E Z;  4XDL A;  5JCO C;  5JQG A;  1RSO A;  2DQ0 A;  2VQE O;  4WF9 V;  3H1K H;  2N04 A;  5LA6 A;  4FJC C;  2EIJ C;  1K92 A;  3E8B A;  1T5E A;  1M90 W;  4DV6 O;  4PA4 A;  2ZE5 A;  1ZX3 A;  3TCU A;  1AR1 B;  2XAJ A;  4DO2 A;  2JDI G;  4X8A A;  3H01 A;  2YIB D;  1M9N A;  3H1J H;  2CE4 A;  1SET A;  1EN4 A;  1QBZ A;  3ZHR A;  2UXD B;  2BTQ A;  5ITZ A;  1TAE A;  4I55 B;  3K5M A;  5EC2 C;  3BA8 A;  2WA3 A;  3E8G A;  2Q8V A;  1VQ7 V;  2ZD9 A;  4J41 A;  2YI9 A;  4IHJ B;  4E4E A;  1L0N H;  4JI0 B;  1GAX A;  1Q6U A;  2WLI A;  3OMN B;  1M56 C;  5IE9 A;  1M93 A;  4NYK A;  2EIL C;  5AG2 A;  2HKO A;  2ZR3 A;  1NVP B;  4J80 A;  5LMN O;  2F95 B;  4DXW A;  3EXA A;  3AG3 C;  4B7E A;  3JAR A;  3JD1 A;  2GSM B;  1Q6H A;  3OR7 C;  1WB8 A;  5LGN A;  1IXB A;  2LW1 A;  3OEE G;  3BY6 A;  2Z0A A;  4UVC A;  5C8Y B;  2AZ2 A;  2IJH A;  3T2M A;  4O4H A;  3HKB A;  4K3A A;  2AXT Z;  2QE7 G;  3GWO A;  4LCU C;  5LP6 A;  4RUE A;  2Z5U A;  2HJD A;  3GB7 C;  3E8H A;  1FFX A;  3T1Y O;  2WLL A;  3OM3 B;  2AGA A;  1XMQ O;  4KL1 A;  1RFY A;  1WJZ A;  2KG7 A;  4YHH O;  4TUY B;  2Q7H A;  4DR2 O;  3P3N A;  3PN1 A;  4WFA V;  3CCM V;  1S0V A;  2YC0 A;  3L73 H;  4MW3 A;  2Y48 A;  2W6I G;  1K7D A;  5IY5 C;  2DQ3 A;  5EC1 C;  5GTI Z;  4U7N A;  4X65 B;  4UV8 A;  2G38 A;  3ZRW A;  5FNV B;  2BOB C;  1DTO A;  2JS3 A;  4DR7 O;  2ATK C;  1CXZ B;  5LGU A;  3H1I H;  1FPO A;  3JD4 A;  4X1K A;  3JD0 A;  3SJC C;  3RYH A;  5J2T A;  4JI8 B;  1TUB A;  2DJV A;  3MD0 A;  2HR3 A;  3AG4 B;  2ZE8 A;  1K97 A;  1MZE A;  2OIG A;  1AJP A;  1E1Q G;  3HKD B;  3ZJZ A;  4DW1 A;  1Z5W A;  3GWK C;  1N33 O;  4PA3 A;  4GKK O;  4IIJ A;  1X4T A;  1F7Y A;  2P4K A;  1GRJ A;  3G4S V;  4R8C A;  3N2G B;  1P49 A;  3OUS A;  1HWY A;  2HEP A;  3ZMT A;  1OHH G;  4K0K B;  4JI5 B;  1YI2 V;  3QO5 A;  1N0J A;  4JTA B;  1SQV H;  1URF A;  5B1A C;  2X0L A;  4PDV A;  1YTF D;  4WBN A;  4AI8 A;  2VWK A;  1OCC B;  1XUQ A;  4G2K A;  5DM6 V;  2EIM B;  1FXK C;  5KLV H;  1K9M W;  2XAS A;  1YXB A;  1XDC A;  1Y76 A;  2YDE A;  3H9V A;  4EB6 B;  1MSW D;  4X1Y B;  4JTD B;  1QLE C;  2R70 A;  2PI4 A;  1QR8 A;  2LO1 A;  2EJ7 A;  3B77 A;  2YSU B;  3B8N A;  3K06 A;  4D7S A;  1AR4 A;  1QVG U;  5EZY A;  1U97 A;  4N23 A;  3LDC A;  5GW7 A;  2FB5 A;  1ORQ C;  1H2M A;  2W0X A;  5BR8 O;  5KAI Z;  3IGA C;  5CMU A;  1S77 D;  5D5P A;  1OZ0 A;  4I50 A;  3B4S A;  2QM4 A;  1EBO A;  1OCO C;  4X20 B;  2BTO A;  4LFB B;  2HHH O;  4CH6 A;  1LUW A;  1AB3 A;  4LFA O;  4X64 B;  3RYI A;  1Z5V A;  3ETE A;  3UQ8 A;  3CC7 V;  5CBG A;  5KHK A;  1Q90 D;  4RO2 A;  5KX5 A;  2ZDI C;  1PL4 A;  2JEX A;  3ZS8 C;  4D7T A;  4LNU A;  1N34 B;  2N74 A;  2QDO A;  2YXH A;  3KG2 A;  4H0L B;  1S3J A;  4CH5 A;  4JI3 O;  3TK1 A;  3J81 N;  4PV1 B;  4KHP O;  1YJN V;  2E74 B;  5JWP A;  4GYC B;  1LUV A;  1AJQ A;  3SGI A;  2B1I A;  1Q3E A;  3Q4H A;  1HR0 O;  4FMT A;  1MA1 A;  1F23 A;  5LYJ A;  3G6B A;  2R9A A;  4UB8 Z;  3FKS G;  5H6R A;  3AK3 A;  1NQT A;  2LJ2 A;  2FL4 A;  3WU2 Z;  4YIO A;  5LHH A;  1GN4 A;  2UXB B;  4DV0 O;  4DW0 A;  2RJZ A;  2YXL A;  5KA5 A;  2XOK G;  4DV5 O;  4RWU A;  2H94 A;  4AQY B;  5IWA O;  3ICX A;  3SJA C;  1P84 F;  1WA8 B;  5HFL A;  2HJF C;  5JH7 B;  2RQ6 A;  3JAM N;  4LFC O;  1JFF B;  2Q6A A;  1EZJ A;  1O9H A;  1IX9 A;  3FYI B;  4EFE A;  5IJ0 A;  1TVK A;  2XHB A;  4WFE A;  4P30 A;  3QTC A;  2YUA A;  3BVO A;  3CXH F;  2UUA B;  2ITD C;  2N05 A;  2H8P C;  3JCU Z;  2R72 A;  1K34 A;  4FZ1 A;  4BAY A;  2FTK A;  1R6N A;  2GHY A;  5K1P A;  4ZHQ A;  5LOV A;  1AR5 A;  1EFR G;  1WP8 A;  3QO7 A;  4L87 A;  3WFV A;  1JCH A;  3ZCC A;  2UXX A;  5KHG A;  4PA9 A;  2WWW A;  3ZN1 A;  2F1M A;  4LF9 O;  3JAL A;  3IFX A;  4J42 A;  4DV1 O;  5EYP B;  1WP7 A;  1JX9 A;  4ZIB A;  4GX5 A;  4DUY B;  1SQQ H;  3C90 A;  4JI1 B;  1NTK H;  2QA4 V;  1XNQ O;  4AIL C;  1V54 B;  1YVW A;  4F6R B;  3ZBH A;  2GTA A;  4LF8 O;  4PA7 A;  1SZT A;  4TWK A;  4KXR A;  3X2Q C;  1OCR C;  1N36 B;  1S5J A;  4LF4 O;  4K35 A;  1MAB G;  3ABM B;  1SQX H;  2BE3 A;  1B06 A;  2EBO A;  3CB2 A;  2P06 A;  3ABU A;  4ASU G;  4FK5 C;  2OYQ A;  3OGI B;  1RM1 C;  4TOI A;  3FB6 C;  4B3R B;  4WFB V;  1Y66 A;  4FFK A;  2VQF B;  2NLJ C;  1GK9 A;  3ZX6 A;  3JSN A;  3THO A;  4H37 A;  2AHY A;  2UXC O;  3KCY A;  4O4L B;  2P22 C;  3L74 H;  3RGB A;  3CCJ V;  4CS2 A;  4NKG B;  2XAF A;  3OW2 U;  3OTO O;  4UFZ A;  2DMX A;  1KYO F;  2XAQ A;  1QQC A;  3OMI B;  4N21 A;  1OV9 A;  3SYP A;  1TUE B;  2LQT A;  3N27 A;  1KU9 A;  1Q7Y W;  2EZP A;  1V55 C;  1H2S B;  2Q73 A;  3I56 V;  3ABL B;  2RMK B;  5CB4 A;  1BE3 H;  5LHI A;  3LNN A;  4HAM A;  3A0B Z;  2ZIN A;  4PHZ A;  2EIN C;  3EVK A;  2YIC A;  3ZMZ A;  2Y4T A;  5EK0 A;  4JZG A;  1Y74 B;  3CRM A;  3K5L A;  4JI4 B;  1KC8 W;  2QJ1 A;  1OCZ B;  2OTL V;  5IYB O;  2ARH A;  1IBM B;  3BFR A;  2OIE A;  4JYA O;  1QU7 A;  2DN9 A;  5A2Q N;  3OT7 A;  4DRX B;  5A9G A;  3JAT A;  1AI7 A;  4UCU A;  3ZHU A;  4X1I A;  4LF6 O;  5LMU B;  3SYO A;  3D36 C;  2E5L O;  2QWR B;  3L75 H;  1J5E O;  2ZXW B;  1XL4 A;  4D6T H;  4E2L A;  3DC5 A;  3EHB B;  4FFB B;  4JI6 O;  2ZKO A;  4DV3 B;  1B04 A;  2Q9L A;  5B3S B;  4YJ2 A;  1YJ9 V;  1G8M A;  2GBO A;  4DV7 O;  5BY1 A;  4LC1 A;  3X2Q B;  1HP8 A;  2QKA A;  3OR6 C;  4DUZ O;  1R3J C;  3WB2 A;  1M5I A;  1MZF A;  3U0Z A;  2DWE C;  3MHH C;  4GT1 A;  5TIS Z;  3ETG A;  3D3I A;  5J2U A;  1A32 A;  3K04 A;  5IYZ A;  4MVZ A;  4NXN O;  1UJW B;  3AG1 C;  2RCV A;  3QF7 A;  3MDS A;  4WFH A;  2XT9 A;  1SC5 B;  3ZED A;  4JI2 O;  1H8H G;  5DEC A;  2QWQ B;  5BMV B;  1W0K G;  3FAV B;  3JSL A;  2E3C A;  2RNB A;  3HPL C;  4TV9 A;  3RYC B;  1R3I C;  1YCI A;  4TT3 G;  4U3J B;  3RT3 C;  1R3K C;  1Q43 A;  4DYL A;  3BCC H;  1I94 B;  4GKJ B;  5KMG B;  2HG5 C;  4MTG A;  3D8C A;  4PI0 A;  4NTX A;  1VQL V;  4DR1 B;  2LFR A;  3HKC A;  4PJ0 Z;  3HKE B;  2F23 A;  3UT5 A;  3AK1 A;  4IL6 Z;  2BOC C;  4X66 B;  2QWP B;  2UU9 B;  2ZIO A;  2FML A;  2QSA A;  1FXK A;  2L6L A;  3RYF A;  1K5Q A;  2GUZ B;  3ZIA G;  1KD1 W;  5LL6 Y;  1L1F A;  2P90 A;  1SQB H;  2C2A A;  2VWJ A;  1K73 W;  3AG4 C;  4YJ3 B;  1NBM G;  4GX2 A;  1M4U A;  5LXT A;  4O4J B;  4LH7 A;  1ZL8 A;  3L72 H;  4I4T A;  3K0G A;  1CEZ A;  1KP3 A;  1N0N A;  1NR1 A;  1NH2 B;  1JR9 A;  2UXD O;  2MW2 B;  2OTJ V;  2OCC B;  4NTW A;  4JI7 O;  3T4Z A;  3Q4H B;  5CBH A;  2X6C A;  1SA0 B;  4UV9 A;  3H1L H;  3J7A U;  2JJ1 G;  3N2K B;  4DV6 B;  4TV8 A;  4BW5 A;  4JI0 O;  5L3B A;  2WLJ A;  4B3M B;  1AI4 A;  1HNX B;  4B08 A;  4IYH A;  4X88 A;  1HW7 A;  1OCC C;  1ZAU A;  2WLM A;  1NTM H;  1YIJ V;  2ZDI A;  2EIM C;  2YXY A;  3DSQ A;  5FL7 G;  4FLV A;  2X7R B;  3P32 A;  4FLU A;  3AG1 B;  4PDL A;  2H3O A;  5EIB C;  1VQM V;  5EIB D;  1R3L C;  3JCZ A;  2RDC A;  3IC7 A;  4GX0 A;  4BW9 A;  3CJH A;  1IUR A;  3O65 A;  4EEQ A;  1I5Y A;  4JTC B;  4MVM A;  1FYJ A;  2CTR A;  4JGS A;  3G80 A;  4ICG A;  1GN6 A;  2CH7 B;  4HNA B;  2XUM A;  3E83 A;  4O2B A;  4H44 B;  1PNK A;  1K4C C;  4X65 O;  3CEI A;  1N32 B;  2ZNI A;  4JPR A;  3CRR A;  1XMQ B;  4MVQ A;  5CA3 A;  2ZQM A;  1IBL B;  3LSS A;  4DR4 B;  2Y4U A;  3RBZ A;  4DR2 B;  4FM1 A;  3OGC C;  4UXN A;  4DV2 B;  1FJG B;  1H2L A;  2GTS A;  4JI8 O;  2PY5 A;  1SKV A;  4TQF A;  2EX3 A;  1I5X A;  2LFS A;  3B8M A;  3FX7 A;  2DYR B;  3NR7 A;  3CXC U;  1Q82 W;  4XBF A;  2CAZ C;  1YZB A;  4MS2 A;  1H38 A;  2P7T C;  1MSD A;  3QG5 A;  5H2F Z;  1HDJ A;  1Y4M A;  2HVJ C;  3B2E E;  3CHX A;  2YS8 A;  3RN4 A;  4LF5 O;  1HNW B;  1QR9 A;  3DGE A;  3WB1 A;  3TXQ A;  4ZOL B;  5EBL C;  4O4I A;  1XHX A;  5JJN B;  4QE7 A;  2IW5 A;  3K5O A;  5LGT A;  2A7W A;  4EKW A;  1GN3 A;  1X59 A;  1VAR A;  4K0K O;  4B3S B;  4JI5 O;  2CTW A;  3VQY A;  2VS0 A;  2WA4 A;  2FKX A;  3K59 A;  3CMA V;  2W6J G;  5JVD B;  2E76 B;  2EIK B;  2R9R B;  5FPR A;  2PTM A;  1KKC A;  2EZO A;  2QKC A;  1VQO V;  2A06 H;  2UUC B;  1B3Q A;  1EM1 A;  5FPO A;  1KP2 A;  2ZM6 B;  3W7U A;  1SZX A;  5IJ9 A;  3ML0 A;  3T1C A;  3ASN B;  3CRQ A;  1PP9 H;  5CB4 B;  3JAW B;  4QGP A;  3MHS C;  3M99 B;  4R6Z A;  1THZ A;  1ZUQ A;  4MTO A;  1L8D A;  1GMG A;  3W7X A;  4LWS A;  4UB6 Z;  3CCE V;  1SF9 A;  2PYL A;  1GTO A;  4MVU A;  2EJR A;  2P5O A;  5B1N A;  3TXS A;  4MW8 A;  4KP4 A;  4ZI7 B;  1BHA A;  3T1H B;  5CA0 A;  5CBF A;  4LFB O;  3CCV V;  1KB9 F;  2BSK B;  3A8T A;  1YF2 A;  5CA1 B;  3ABK B;  1M1K W;  4FLT A;  2QR4 A;  3JYC A;  4CS3 A;  4GX1 A;  4CH4 A;  1WB7 A;  4LP8 A;  1V54 C;  1VQ5 V;  5BR8 B;  2PI5 A;  3K03 A;  3ZN0 A;  3JAS A;  2JIZ G;  4DR6 B;  3CCQ V;  1N34 O;  1FS0 G;  3HR0 A;  1BS3 A;  4DR5 B;  1VQP V;  3WG7 B;  3UO3 A;  4OPA A;  3DXR B;  3ABM C;  1H8E G;  3H1H H;  4O2A A;  2YEV A;  1AI5 A;  1SS3 A;  5IYC O;  1XHZ A;  2HFE C;  1AP6 A;  1WPB A;  1GH6 A;  3SPJ A;  3K08 A;  3RW0 A;  4MTX A;  4DK0 A;  1NI8 A;  4DK1 A;  2WAM A;  1NU1 H;  2IJK A;  3E22 B;  2ZT9 B;  4JV5 B;  2UXB O;  1YHQ V;  4I5S A;  4ABM A;  4JI3 B;  4Z2W A;  3P3P A;  1IBK B;  1NJI W;  1XNR B;  1BZK A;  4AQY O;  3U11 A;  4I55 A;  2QTS A;  4OX9 B;  2JK5 C;  1HR0 B;  2IU3 A;  4J7J A;  2JGD A;  4LBE C;  1GO3 F;  2KQX A;  4IHJ A;  1R73 A;  1K33 A;  2KB1 A;  3BAA A;  2IU0 A;  3CCR V;  3ABL C;  2HP8 A;  4H33 A;  4LH6 A;  2UUA O;  2QM8 A;  1Y6X A;  5B66 Z;  4Q6G A;  5BZB A;  1XRE A;  1TGO A;  3KKY A;  3JAK B;  4I0X B;  1YTF B;  1Q8I A;  4DV5 B;  2Y69 B;  4XDJ A;  5C8Y A;  1OCZ C;  1US6 A;  5LHG A;  1G6U A;  1VQ9 V;  4NXM B;  4MVR A;  4B3T B;  5JQG B;  3BPZ A;  1RSO B;  3K79 A;  5GTH Z;  4BIZ A;  4FLW A;  5H6Q A;  5LA6 B;  5IYD O;  5L3F A;  4GCZ A;  2Q69 A;  1JQ0 A;  4TUY A;  1S5H C;  4JI1 O;  1BQZ A;  2R9I A;  3S3X A;  5B1B B;  2K9P A;  2A0L A;  2ZXW C;  3M8A A;  5L3E A;  4W4K A;  5DN6 G;  4X9Q A;  4DV4 O;  3CCS V;  3OFN G;  4F6E A;  5B3S C;  2BTQ B;  5ITZ B;  4MTF A;  4R7C A;  3QNE A;  4WFG A;  5FNV A;  2QGN A;  1N36 O;  2WLH A;  3SJQ C;  2Z3Y A;  2K1E A;  2WLI B;  4B3R O;  5JCO A;  3PJS K;  1YJW V;  4X89 A;  2XAH A;  2Q7E A;  2F66 C;  4UVB A;  4GUN A;  4K8X A;  3CX5 F;  3JAR B;  4QJF B;  4J11 A;  3CD6 V;  3HKD A;  2QTO A;  2F93 B;  1HNZ B;  3OE7 G;  4O4H B;  3HKB B;  3QO8 A;  3BRC A;  5LP6 B;  3N2G A;  1XQ8 A;  5L3C A;  4U3F H;  3UO2 A;  3FB5 C;  1AI6 A;  2GV9 A;  3STZ C;  4H13 B;  1CPY A;  1FFX B;  2WLL B;  3G6E V;  4YY3 B;  2Q67 A;  3UKM A;  3UM7 A;  1QVF U;  1DF5 A;  4JF3 A;  4RQE A;  5BXZ A;  2KG7 B;  1JJ2 U;  3BA9 A;  3OUF A;  3FB7 C;  3ETQ A;  3TET A;  3TGU H;  3BAB A;  2Q0A A;  5EBW C;  1PM9 A;  4F4L A;  4LF7 B;  3G71 V;  4FLZ A;  1XMO O;  1QNM A;  2DE0 X;  4J7K A;  4JI4 O;  3ZRW B;  4EB6 A;  5KHJ A;  4XDK A;  4X1Y A;  1WNS A;  4ZBM A;  2X6B A;  4IT5 A;  4X1K B;  1IBM O;  3RYH B;  1L0L H;  5J2T B;  2HVK C;  4FLX A;  1TUB B;  1VMG A;  3SPI A;  1ZWI C;  4NR1 A;  3IC9 A;  5LMU O;  2HLD G;  4J9Y B;  3RFR A;  1NS1 A;  2PYJ A;  5CN0 A;  1KKD A;  4UUJ C;  2OCC C;  1NKD A;  1CP9 A;  4IIJ B;  1GM7 A;  4DV3 O;  4X20 A;  2UXN A;  3TJT A;  1MG1 A;  1W2B U;  1RP3 B;  3QVN A;  2XTA A;  1VIB A;  4RAI A;  3MAQ A;  3ZMS A;  2NNU A;  1W59 A;  4NB5 A;  1NVP D;  4P9P A;  1Q6I A;  2QEX V;  1ZSP A;  1J5E B;  4WBN B;  1Q86 W;  2Y0P A;  2DOS A;  3CC2 V;  3RVZ A;  1W0J G;  1VF6 C;  3ASO C;  2WPD G;  1Y76 B;  1OJH A;  2ETN A;  2UUB B;  5B1O A;  3P30 A;  3APQ A;  4L8J A;  5K1X A;  1B6Q A;  1I94 O;  4UCS A;  4GKJ O;  3CPW U;  3FB8 C;  2ADQ B;  2E75 B;  5EZY B;  3LDE A;  1FXH A;  4DR3 B;  4DR1 O;  1JOY A;  2P6J A;  2DW4 A;  4QIW F;  1P7B A;  1JA8 A;  4B7K A;  4UCT A;  4X62 B;  1O9G A;  4I7Z B;  3SYA A;  4X66 O;  4I50 B;  2UU9 O;  1WA8 A;  5JH7 A;  1JFF A;  2IJJ A;  2CUG A;  3LDD A;  1MOF A;  4PD4 F;  1G1X B;  3RYI B;  1P7G A;  2ILM A;  3GVM A;  4JAU A;  2B1G A;  1KBH A;  3AK2 A;  2M6Y A;  5KX5 B;  1RPO A;  1SRY A;  2BCC H;  2DYR C;  2WSS G;  4LNU B;  2NR5 A;  5E1A C;  4J9Z B;  2ZE7 A;  2OCH A;  4I9W A;  2X6A A;  3R66 A;  5DED A;  1VP7 A;  2F4V B;  1DK1 A;  2VQE B;  3BHP A;  1K4D C;  5EYP A;  1YEW A;  4NVP A;  3CME V;  5LYJ B;  3AG7 A;  2B5U A;  4JYC A;  2L35 A;  5IDJ A;  4B3M O;  2KSD A;  4UCV A;  3AG2 B;  1HNX O;  1GM9 A;  2EIK C;  3SPC A;  4F6R A;  3IJ4 A;  3ZRV A;  2LGW A;  4OGQ B;  2Q68 A;  4FLY A;  4GLX A;  1K8A W;  2QKS A;  4JI7 B;  3ZHV A;  4ZKI A;  1BL8 A;  1IXM A;  1D5N A;  2JGD B;  4YIP A;  4JAA A;  2B9Z A;  4CC5 A;  4FM2 A;  4MT8 A;  3ASN C;  4YXW G;  3RWR D;  5IJ0 B;  1TVK B;  3ASO B;  2ZE6 A;  1IDS A;  3B40 A;  3E8F A;  1NT2 B;  5LMN B;  2RN9 A;  2QM7 A;  4ZHQ B;  5LOV B;  1DF4 A;  3CCU V;  2Q5Z A;  4O4L A;  3K0D A;  3CRC A;  2IM9 A;  1KUQ A;  2JJ2 G;  1DGS A;  1PPJ H;  4R50 A;  2JVD A;  1BHB A;  2A3Q A;  1EN5 A;  3FD9 A;  5FLX N;  2CK3 G;  3JAL B;  2DYS B;  1N32 O;  2LW7 A;  1H2G A;  2CTQ A;  1GN2 A;  3K58 A;  3ABK C;  3T1Y B;  1IBL O;  4DR4 O;  1M57 B;  1F51 A;  4J7Z A;  4YHH B;  4DV2 O;  1FJG O;  2ITC C;  4UVA A;  4HZ3 A;  4HBN A;  3VQX A;  3WG7 C;  3W7W A;  1Y74 A;  1FAF A;  4Z1V A;  4G28 B; 
#chains in the Genus database with same CATH homology
 4JI2 O;  3F5T A;  3T1Y O;  1DK1 A;  2FKX A;  3OTO O;  4B3R O;  2AGA A;  1XMQ O;  1D2D A;  4YHH O;  1HNW O;  4DR2 O;  2UXB O;  3RT3 C;  4B3M O;  1AIL A;  1HNX O;  4AQY O;  4B3S O;  5BR8 O;  4LFC O;  2DOS A;  2F4V O;  1XEQ A;  4OPH A;  3O65 A;  2VQE O;  4DR7 O;  2VQF O;  1FYJ A;  4JV5 O;  4LF9 O;  2UUA O;  2HHH O;  1IBK O;  4DV6 O;  1AB3 A;  4LFA O;  1XNR O;  2UUC O;  4DV1 O;  5BXZ A;  1I94 O;  1HNZ O;  4GKJ O;  2DJV A;  2ZM6 O;  4OX9 O;  4X65 O;  4DR1 O;  4JYA O;  2N74 A;  5A2Q N;  5LL6 Y;  4A5U B;  1N33 O;  1XNQ O;  1XMO O;  5H5N A;  4GKK O;  4LFB O;  1R1B A;  4YY3 O;  3SDL A;  2UUB O;  4JI4 O;  4X66 O;  3J81 N;  4LF6 O;  4JI3 O;  1F7Y A;  2UU9 O;  1KUQ A;  2E5L O;  4LF8 O;  4KHP O;  4JI8 O;  1J5E O;  5FLX N;  4DR3 O;  1N32 O;  1G1X B;  1IBM O;  4LF4 O;  4JI6 O;  2ZKO A;  2LW7 A;  1N34 O;  1HR0 O;  4JI1 O;  5LMN O;  1YZB A;  3J80 N;  2UXD O;  1FKA O;  1R6T A;  4DV7 O;  1IBL O;  4DR4 O;  4LF7 O;  4JI7 O;  5IT9 N;  2JRI A;  3T1H O;  4NXM O;  3M8A A;  5BY1 A;  4X62 O;  4B3T O;  4LF5 O;  4OPA A;  2Z0A A;  5LMU O;  4DV2 O;  4DV4 O;  4DUZ O;  3J7A U;  1FJG O;  4DV0 O;  4X64 O;  1NS1 A;  4JI0 O;  1A32 A;  4DV5 O;  2UXC O;  1X59 A;  1N36 O;  4K0K O;  4NXN O;  5IWA O;  4JI5 O;  4DR6 O;  4DV3 O;  3R66 A;  4DR5 O;  4DUY O;  3JAM N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...