5BY1A

H18 bat influenza ns1 rna binding domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
71
structure length
71
Chain Sequence
MESTPTTIAFQVDCYLWHLKKMLSLMGEVDAPFEDRLRREQKALKGRSMTLGIDIQAATKAGYYKIKSITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Bat Influenza Virus NS1 Proteins Bind Double-Stranded RNA and Antagonize Host Innate Immunity.
pubmed doi rcsb
source organism Influenza a virus (a/flat-faced bat/peru/033/2010(h18n11))
molecule tags Viral protein
molecule keywords Non-structural protein 1
total genus 30
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5by1A00
4X64O 2UU9O 4X66O 4DR6O 4B3RO 3JAMN 1FKAO 5LL6Y 3T1HO 3SDLA 3J80N 2FKXA 5FLXN 1AB3A 4DV7O 2ZM6O 4LFCO 4NXNO 4DUZO 1KUQA 4JI5O 4B3MO 4LF8O 3O65A 5BY1A 3OTOO 4DR1O 2UXBO 4LF4O 4KHPO 4K0KO 4LF9O 1G1XB 4A5UB 4LF5O 4JI2O 1DK1A 4OX9O 4DV1O 4JI4O 4DV3O 1NS1A 1R6TA 4YY3O 2UXDO 4DR3O 5BXZA 2N74A 4LFBO 2F4VO 1HR0O 1HNWO 4DR5O 1I94O 2UUAO 2VQEO 1N34O 1XNRO 4GKJO 2AGAA 1FYJA 4JI8O 4JI1O 2UXCO 1F7YA 4DR7O 5H5NA 2UUCO 3J7AU 4B3TO 2DOSA 1XMOO 2HHHO 1HNZO 4X65O 4LF6O 5A2QN 2Z0AA 2VQFO 4DUYO 4DR4O 2JRIA 4DV5O 4NXMO 1R1BA 2UUBO 4JYAO 4OPHA 1N32O 1X59A 3RT3C 1AILA 5BR8O 1N33O 4LFAO 4OPAA 4JI3O 1FJGO 1HNXO 1D2DA 4B3SO 3F5TA 2DJVA 2LW7A 4AQYO 4GKKO 4DR2O 4DV6O 4JV5O 4YHHO 4JI7O 3R66A 1A32A 5LMUO 1J5EO 3M8AA 2E5LO 1IBLO 5IT9N 1XMQO 1IBKO 1N36O 4DV2O 1YZBA 4JI0O 5IWAO 4DV0O 1XEQA 4DV4O 3J81N 1IBMO 3T1YO 4LF7O 2ZKOA 1XNQO 4JI6O 4X62O 5LMNO
chains in the Genus database with same CATH superfamily
1H2MA 3FB8C 2CGOA 2YXLA 2JS5A 4X66B 4LF6B 4LFCO 4JI5O 1IDSA 3B09A 2KG7A 2UXBO 3WB1A 3JSLA 3H1JH 1WPBA 2IH3C 3OTOB 2A0LA 3SJBC 5GW7A 1CP9A 3G80A 4RUEA 3ZHQA 1GN2A 2IU0A 2UXXA 3O9OA 1N34O 1G8MA 2D2CB 2B1IA 3DC5A 4X9QA 2X7RB 1O9GA 4PA7A 1RP3B 1GO3F 2PTMA 4YHHB 1V9PA 4PDVA 1AVMA 3QNEA 1L1FA 1R3JC 1K5SA 4CC6A 3STZC 2AZ2A 1R1BA 1FJGB 3BFRA 3IAYA 4UCOA 1Y74A 4BAYA 4LWSB 3ICXA 4LFAO 3HR0A 4IYHA 4CH5A 4UVBA 4PA3A 2X6CA 5GONA 4O4HA 5IWAB 3WFVA 5JCOA 1YXBA 1A32A 2CUGA 1K92A 1B06A 4DV2O 4U7OA 2EINC 3RYHB 2ZIOA 1EBOA 1XEQA 3OUFA 4YJ3A 2JIZG 5LGUA 5EBWC 5LMNO 5IYZB 2EIMB 1XREA 4CH6A 2UXCB 2WAMA 1MSWD 5IJ0B 4ZOLB 2FKXA 3GWKC 1WNSA 4BIOA 3ABUA 3OTOO 3E89A 4J9YB 1QLEC 5EK0A 5KA6A 2QEXV 4X1KB 1NTZH 4UFZA 4JYAB 2QTSA 1XNRB 1Z2GA 4F4LA 1EZVH 3T1CA 1SA0B 1SF9A 5LHGA 1K97A 1H38A 1GRJA 3ABKC 1S0VA 1BZKA 3CC7V 5JJEB 3SPHA 4JI8O 3K0DA 5CB4A 3FYIB 3L74H 3L72H 4ICGA 2ETNA 4XDLA 1EN4A 3ZHRA 2JJ1G 1H2NA 5LHIA 2VQFO 5KX5B 5FNVA 1YHQV 2EZPA 2PZSA 5JWPA 5LBQA 5FNVB 3FYEB 2VRZA 1YSCA 3ZMSA 3S3XA 3L73H 2BTOA 4O4IA 3CC4V 2YDEA 2A06H 3VBBA 1XI1A 2DW4A 4GX5A 2EX3A 4LNUA 2QKAA 5E1AC 1M90W 1GAXA 2WLIB 1UJWB 3JYCA 4J7JA 2XTAA 1NBMG 1XMQO 3SJAC 1FS0G 2YICA 4X89A 3L9DA 4TQDA 5L3CA 2UUCB 1KC8W 4LFBB 1THZA 4PV1B 3ZN1A 2DMXA 3BPZA 3TCUA 1PD3A 3OMNB 5ITZB 3T1HO 2Q7HA 5FLXN 4MVMA 4LNUB 3G4SV 4X1KA 1Q6IA 3QO8A 3O65A 3JSNA 3SYCA 2LQTA 4FMTA 4OX9O 1FPOA 1R6TA 2RNBA 2HVJC 2P90A 3KKYA 4U7NA 1KQSU 1OCZB 2QWNB 2DQ3A 2ZNIA 3JD2A 3ASNB 5CN0A 3X2QB 3T1YB 1EN6A 4QPJA 2VS0A 2BCCH 2EULA 4UCUA 3OM3B 4O2AB 3E8BA 2XAGA 2XAHA 3RYCB 5FL7G 5IYCO 3MD0A 5CA0B 3ABLB 4Q6GA 4RWUA 2YXHA 3DXRA 1HNZO 4LF6O 4GX1A 4DR1B 2Z0AA 3K06A 5IDJA 4DUYO 1MNGA 4YIOA 1XMOB 4I7ZB 5LXTB 3MHHC 3CCLV 3OGCC 1VQOV 3BA9A 3H1KH 1MA1A 2YUAA 1Q81W 3N2KB 4LF8B 2P67A 2JEXA 2VQEB 3ZRVA 1BQ0A 4QIWF 1QLEB 1FXKC 2OYQA 4GUNA 4DV6O 5B1BC 4LH6A 3D3QA 3CMEV 5A9GA 4DRXB 4X20B 3M8AA 3K03A 4GT1A 1TUEB 3H1HH 3L75H 2YIBA 1ZWIC 4X62O 3W7UA 4YJ2B 2Q68A 1XOUA 1NT2B 4QGPA 4WFFA 4FLTA 3AG3C 2DN9A 4ZBMA 5J2UA 1R3IC 5JJJB 2AW9A 5JH7B 3RYIB 2W0XA 3ETGA 1M93A 1KUQA 1CEZA 5IJ0A 4E2LA 1ZAUA 1HWYA 4WBNA 2IJJA 4JI2B 5KHKA 3BAAA 4WBNB 2ZQMA 1CXZB 1KYOF 4RUFA 5EIBD 3CRAA 3ZHVA 2CAZC 2N74A 1NH2D 1NU1H 2DQ0A 4IHJB 4JYCA 2YIBD 4DV0B 4DV4B 4I55B 1HNWO 1Y4MA 3B8MA 1S5HC 2UUAO 2RQ6A 3L70H 1VQ4V 4L87A 2LFRA 4G28B 4JF3A 3ZEDA 3CXHF 3CMAV 3E83A 4X65B 2KG7B 5GONB 1SZTA 3J7AU 3OE7G 3RWRD 4NXMB 3OW2U 4Z1MG 1JX9A 1ZUQA 3CCRV 4FK5C 3AEIA 4B3TB 3OMAB 2YXYA 3E2EA 2R70A 1NI8A 2JGDA 4DUYB 1SESA 2QTOA 3G71V 1N33O 3B40A 4LCUC 2MK3A 2DJVA 2AZ0A 2FB5A 4BW9A 4CS3A 4TT3G 1AR5A 4IYIA 2Y0PA 3OEEG 1QHTA 2PI4A 2MW2B 2EIJC 1RPRA 2M6YA 5LYJA 3T2MA 2AHYA 2XAQA 1YZBA 1TA8A 1YTFB 4JV5B 3APQA 2P6JA 3HKCA 1SQPH 5J9PC 3OR7C 4GLXA 2ADPA 3CB2A 2CK3G 4X64O 1DGSA 5LGNA 3JAMN 2HP8A 1DTOA 1AJQA 2Q6AA 2LFSA 1M4UA 4RQEA 3B8NA 5KHGA 1M56C 1R6NA 3AK1A 3HKDB 2BTQB 1WN7A 4KHPO 3TK1A 3ABTA 1AP5A 3OT7A 1QNMA 4U3JA 1QR9A 3RYHA 5B1BB 4UVCA 2UUBB 1DK1A 2PGGA 3OTFA 4U3FH 4DV1O 1BL8A 2UXDO 3ZMVA 4HAMA 1WA8A 2E75B 1AROP 4DR5O 1LUWA 4NR1A 1IURA 3F7YC 4DK0A 3FKSG 1G6UA 1TVKB 5B1NA 4XBFA 1PNKA 1S5JA 4FFKA 1Q43A 3IJ4A 2X0LA 4O4JA 4O2AA 5L3FA 1H2LA 1O9HA 1BHBA 2UXBB 1SERA 3CPWU 4X64B 1U96A 5EIBC 3RFRA 3ZBHA 4EFEA 1OCCC 5EZYA 5CBHA 3C90A 4X1YA 5EBLC 1N33B 3N27A 2OWOA 1K3EA 1PP9H 2EILB 1KECA 1VIBA 5CBGA 3SGIA 1QQCA 3JASA 1YITV 1SQXH 1W59A 2DWEC 4TUYA 4D7TA 3CCSV 2ZXWC 4K35A 4DV2B 1E1QG 5LMUO 1J5EO 1IBLO 1H8EG 1XHZA 2JEUA 3RGBA 2KSDA 1PV0A 2F23A 1I08A 5B3SB 4AILC 1NR7A 4PA9A 1NQTA 3KCXA 3K5OA 3OUSA 4NTWA 4MVUA 3CXCU 2ZCEA 5IY5C 3QO5A 1FFXB 3I55V 3D8CA 1VQLV 2JJ2G 2ZE6A 2N04A 2GDSA 2P7TC 2CTQA 3K9SA 3IC7A 1DLBA 5JH7A 4LF8O 3HKBB 4OXSA 3A0BZ 4W4KA 2EBOA 4JI2O 3C3TA 2IW5A 2RCVA 4I4TA 2UUAB 4TOIA 5BXZA 4GCZA 3CRRA 3JARB 4JYBA 1P4RA 1TVKA 4I0XB 1I94O 2HJDA 2VQEO 4O4LB 3JARA 4R7CA 1H2KA 1JR9A 3TJTA 4JZGA 5L3BA 4X62B 4J7ZA 3ABLC 3SPIA 4LH7A 2R9IA 4B3TO 5CA1B 3UQ8A 3CCUV 5JQGB 2R9AA 4CZZA 4LF7B 2EZOA 4RQFA 5TISZ 2V1DA 1SQFA 4LF4B 1GN3A 1K9MW 2EJRA 2ARHA 1Q7YW 3ML0A 3LDDA 1XQ8A 2LGWA 1S77D 2H3OA 1VQMV 1VQ6V 4J42A 3HPLC 2LP7A 4DV3B 3CRCA 3K57A 4UB8Z 1D2DA 4CS4A 3RVYA 1J5EB 1NZ6A 3RYIA 4JI7O 1I5XA 4TV9B 4ZIBA 1I0HA 1RSOB 4O4HB 1BCCH 3EXAA 1GN6A 3ZRWA 1ZLZA 5LXTA 5L3DA 3JAKB 5KHJA 5L3EA 2HG5C 3G67A 3CE2A 4J9ZB 1IBKB 3DC6A 1BGYH 4B3RO 3STLC 3DTUB 1N32B 4PDLA 4K0KB 3FB6C 1K33A 2BOBC 4NYKA 2IM9A 3E8HA 2ZM6O 1XL6A 4MVSA 1Y76A 1IXMA 1PNMA 2ZR2A 4PA6A 1QCEA 3AG4C 3WG7B 4A5UB 4UUJC 1WLEA 2ZNJA 1WJZA 2RDCA 4DV3O 4H13B 4JI1B 3D3IA 3LSQA 5DECA 1R3LC 1OZ0A 1XHXA 3CSXA 5J2UB 2DYRB 1GKFA 1U97A 2HLDG 3BA8A 1LR1A 4B3RB 2GUZA 3E86A 5EYPB 2EIJB 1RPOA 1GK9A 1XMOO 2HHHO 4B7KA 2ODMA 1F4NA 1K8AW 2IJIA 4PD4F 2XUMA 1Y6XA 1URFA 4JTCB 5LGTA 3LSUA 2LGQA 4N21A 4KXRA 1WP7A 1QBZA 4OPAA 3RYFA 2F4VB 4HZ3A 2XNDG 3H1IH 3M99B 3PN1A 2JVDA 2ZE5A 1US6A 4UXNA 1H2GA 3HKDA 3RVZA 1JFFB 3RW0A 3JASB 1VF6A 2HJFC 5LMNB 1LUVA 1HR0B 3GB7C 1BHAA 1E1RG 4IHJA 3HKCB 1MG1A 3D36C 2WLLB 3QVNA 3QF7A 4DYLA 3OEHG 4ZOLA 4GX2A 3T4DA 4LR3A 1FXHA 3OR6C 5FPRA 4K0KO 3ETDA 5JVDB 1UFIA 4WFBV 4H0LB 3S3WA 1HNWB 3AG3B 1P7BA 1AI4A 2Q9LA 2K9PA 1HR0O 3MDSA 2CTWA 5IE9A 2IU3A 4ASUG 1VF6C 2QWOB 5LP6A 4O4IB 1Q8IA 3CEIA 1JPXA 4L8JA 5B1AC 4CH4A 1AP6A 2DOSA 1E79G 1I7FA 2B9ZA 4QPKA 5CMUA 4ZI7A 5K1PA 4KHPB 4EFBA 1N0JA 3B77A 3CCMV 2YC0A 2E76B 4JYAO 3RYFB 1XUQA 2AXTZ 1PNLA 1VQ8V 1OCRB 4UB6Z 2R72A 4DR3B 2YEVB 4DUZB 1XMQB 3A2FA 3MAQA 2QM4A 2M7WA 1SKVA 3AG7A 4QNHB 1WP8A 1DF4A 1S5LZ 1COWG 1JJOA 2IJKA 5IYBO 4AQYB 1Q5OA 2F66C 1QLNA 1GM8A 4DXWA 4DR5B 4JI0O 2AHZA 3ZRXA 2QKSA 4CS2A 4NVPA 4P9PA 4LF7O 3CD6V 3SPJA 2NR5A 4AI8A 4X66O 3K04A 4O4LA 1AI7A 3JD1A 3G6EV 2WLHA 2A3QA 4DUZO 1FAFA 5BMVA 1ZTEA 2CDYA 3GVMA 5LOVB 1G1XB 1Y76B 3ZCCA 4Z1VA 4B7EA 4BW5A 3HKBA 2CTPA 4JI5B 4X88A 4MW3A 3WB2A 2GSMB 4KL1A 4TV8A 4PDRA 4WFGA 5D5PA 4PHZA 3E22A 4J7KA 5LMUB 1YCIA 1XL4A 5JJNB 2ADQB 1FD9A 1F7YA 1GM9A 3BABA 2ZT9B 2WLIA 3U0ZA 4X65O 5KHIA 2GUZB 2H94A 2A79B 3RYCA 5CA1A 3W7WA 3ETEA 4JI6B 3AK2A 2Q7GA 5IYDO 4UVAA 1MMMA 2GHYA 2EILC 4B3MB 2WPDG 4WF9V 1MZEA 1JQ0A 4PI0A 4K3AA 4JV5O 4NKGB 2WLKA 2A7WA 4JI4B 2ZDIC 4PELA 1L0NH 1Z5VA 3L71H 4I50A 4TV9A 1Q6HA 2IH1C 4DW1A 3RN4A 1S72V 2OIGA 1EM1A 1TUBA 3HKEB 3JD3A 1XNQO 4P30A 1FFXA 2ZM6B 2UU9O 1Q6UA 4I0XA 1SC5B 4LC1A 2P22C 1FKAO 3UKMA 2JDIG 3I56V 5F2VO 1MZFA 2PY5A 2QWRB 3APOA 2V7QG 4DR4B 1RSOA 2P4VA 2DWDC 3H9VA 3A0HZ 1P49A 4JGSA 4UCSA 3ASOC 2F95B 3E35A 1KKDA 2LJ2A 1VQ7V 4DV7B 1H2SB 1SRYA 3P3NA 4Z2WA 2A9HA 3BEHA 2QA4V 2OCCC 4JTAB 1KKCA 3NXSA 3E8FA 1V54C 4PDMA 2DYSB 3TXSA 2PUSA 1AI6A 1YVWA 4HNAB 2WLMA 2CGNA 3VOUA 1N36B 1GM7A 3CCJV 5BZBA 2KB1A 2ZXWB 2EJ7A 5A2QN 1SQVH 2WA3A 3X2QC 4FFBB 5IJ9B 4DV5O 5B1OA 2YIAA 1WB7A 2PF4E 1AR1B 4IIJB 4WFEA 2Z5UA 1R73A 3UM7A 2GV9A 5LHHA 2Q0AA 2F93B 4I9WA 5BR8O 1OHHG 2FMLA 4TWKA 1I5YA 2PI5A 3TETA 4ABMA 3K58A 3LNNA 3LSSA 4FZ0A 3CX5F 4WCEV 2Q67A 2QWQB 2R9RB 3K5NA 1ZSPA 4GKKB 3FAVA 4FVMA 1JCHA 4DV6B 4DV0O 4DV4O 1XDCA 5EC2C 3FX7A 4D6TH 2RJZA 1J95A 4LWSA 4F6RA 4YJ3B 2JK5C 2ATKC 1PKXA 3CRMA 1R6KA 4P9OA 1M1KW 3SPCA 3ABMB 2QR4A 4DR6B 2Y69C 4MTOA 3VQVA 4X1IA 1HNXB 3VQYA 4NXNO 2OT5A 1OCOC 1P84F 2RMKB 3EFFK 3LUTB 2P06A 3EHBB 2QE7G 3T1HB 4LF9O 3KCYA 5DN6G 2Y69B 1B6QA 1VQNV 1OCRC 5J2TA 5KMGA 4UV9A 3D36A 2Y4TA 4K8XA 3QG5A 5J2TB 5D5QA 4X1YB 2CTRA 3JD4A 2QSAA 4YY3B 2XOKG 3KZIZ 4UV8A 2YIDA 1PL0A 3CCQV 2Q0OC 2Y48A 4DR7O 2LO1A 4AHCA 5B3SC 1OV9A 2VWJA 3LDEA 4MSWC 1ZL8A 3C3SA 2WLNA 4IIJA 4LF9B 1NJIW 1JVMA 2E74B 5KAIZ 4K8ZA 5DEDA 4RAIA 2G38A 2X6AA 4IT5A 3JCUZ 3CS5A 2UXNA 4J11A 5K1XA 3FFQA 3IC9A 3RT3C 1AILA 1RM1B 1P7GA 3BRCA 4R8CA 4JI3O 3ZMUA 2ZINA 2NLJC 4KFMA 4EB6B 1GN4A 2BE3A 3P32A 2GTAA 3R66A 3WG7C 3AG4B 5BMVB 1W2BU 1BSMA 2ZD9A 3ZHSA 1TGOA 1ZL8B 2Y4UA 1IBKO 2WLJA 1KU9A 4FM0A 3CCVV 3HB3B 2BSKB 1ROPA 2EIMC 5IWAO 4ZKIA 3CP1A 1YEWA 4I4TB 3OAAG 1V55C 1V55B 2JGDB 2WSSG 4NTXA 2OCCB 4MW8A 2DYRC 3UT5B 4KP4A 2XAFA 2FTKA 3ASNC 4MTXA 5KA5A 1VARA 5JVDA 3ZHTA 4ZHQA 1MOFA 1K73W 1VQKV 4DR1O 1FXKB 3SPGA 5KMGB 4ZHQB 3TGUH 1I94B 5C8YA 5HFMA 1RM1C 3K3WA 4PI2A 2ZE7A 5H9CA 2HVKC 3B2EE 3AG1C 3UT5A 4R6ZA 1B04A 1UPGA 4LF5B 1KB9F 3AG2C 1F4MA 3CJHA 3JCZA 4DK1A 4DV1B 5B5EZ 2B5UA 4FM1A 5H6QA 2UXCO 3OFNG 4JPRA 2BTQA 1VQPV 1FXKA 1N4CA 5HFLA 4ZI7B 3KG2A 3ZRSA 4GKJB 4J10A 2OTJV 4DRXA 1KP2A 4GZRB 5KUKA 5GTHZ 1Y67A 3CCEV 4DR4O 3BVOA 5GTIZ 1D5NA 1QVFU 2UUBO 1K7DA 1WA8B 1SZXA 1YTFD 4OPHA 2F1MA 3UO3A 2ILMA 3K9AA 3SYOA 3H1LH 1PL4A 4O2BA 2B1GA 3BCCH 4B3SO 1IBLB 4O2BB 1S3JA 5CBFA 5EZYB 4PJ0Z 2VQFB 2Q69A 4I50B 1QU7A 5LA6B 1IBMO 2EIKC 4UCVA 1VP7A 1OJHA 4EKWA 1OCZC 1ORQC 5FPOA 1NVPB 2DE0X 1X4TA 5LL6Y 1IVSA 1FXVA 4HYOA 2LW1A 2N05A 1T5EA 2QDOA 4X20A 2FYUH 2WLLA 3IFXA 4FM2A 1LNQA 4H37A 1R3KC 4EEQA 2ITDC 3ABMC 1KBHA 1NH2B 1IZ3A 3JAWA 1W0JG 3PJSK 4IL6Z 5BR8B 4LFBO 2QGNA 1IXBA 1YI2V 2P4KA 3WB0A 4FLYA 5IY5B 1JOYA 3FD9A 2Y0IA 1M57B 3QO7A 4QJFB 3CWBH 3THOA 1VQ5V 3JD0A 4NXMO 5H2FZ 5LP6C 3JAWB 3DSQA 2C2AA 2W0FC 4UCRA 2HR3A 2XAJA 2HKOA 1SQQH 4JI3B 3U10A 1X59A 1M9NA 2YI9A 3AK3A 4D7SA 4TSFG 3F5TA 4LFAB 2LW7A 4UCTA 1JMKC 2WWWA 3VQWA 4FJCC 4JI0B 5JQGA 1JA8A 3BY6A 1ZX3A 1GH6A 4B3SB 1NKDA 4U3JB 4H33A 4Q20A 2VWKA 1WPXA 1N8RW 4P2ZA 3ZMTA 4JI7B 1V54B 3CHXA 3J81N 3T1YO 1YIJV 1K4DC 1SS3A 3AG1B 4JAVA 3Q4HB 1WB8A 4H44B 1EN5A 4GYCB 4GX0A 3SDLA 2GBOA 1XBLA 1AB3A 3G6BA 3I5DA 2Q4PA 4MS2A 1AI5A 3A8TA 5BY1A 4WFAV 3JALA 1MABG 4O4JB 4YIPA 2XASA 4LF5O 2XT9A 2W6JG 3GWOA 1OCOB 1NS1A 4G2KA 4JYYA 3CC2V 2F4VO 4OGQB 4YXWG 1Y74B 5E79Z 3ZN0A 4GKJO 2AGAA 1D5AA 1GMGA 2E5LB 2IJHA 2YEVA 3SYPA 5JCOC 1F51A 3W7SA 1M57C 1YF2A 2ZDIA 3IGAC 2XHBA 4I9QA 1BE3H 3ZS8C 2W6IG 3ETQA 3QTCA 1HNZB 1N0NA 4JAUA 3JATB 1G4YB 1SQGA 1VQ9V 2D3OW 1Q82W 1Z5WA 3P3PA 4J80A 3JATA 3SJCC 1BS3A 2CH7B 4FZ1A 4MVQA 2P5OA 1Q86W 5IYZA 4FLZA 1OCCB 3H01A 5LP6B 3LNMB 5H6RA 3F5WC 2PYLA 1IX9A 5EYPA 4GKKO 4DR2O 3ZIAG 4X1IB 4YHHO 4WFHA 1YJNV 3ASOB 5KLVH 1ENVA 4TUYB 3SR2C 4XDKA 4CH3A 2JS3A 4JZ2A 3P30A 5C8YB 4F6RB 3Q4HA 2BSKA 2YS8A 4FIPC 4BIUA 1XILA 1B3QA 5DM6V 2O57A 4DR6O 1BQZA 3W7TA 1TUBB 3E22B 4EB6A 3T4ZA 3CJHB 2ZR3A 1HP8A 2KKWA 4BR6A 3TXQA 1FFTB 1PPJH 3SJQC 3U11A 4FLWA 3JALB 2OCHA 5CB4B 1K4CC 1L0LH 5LYJB 3M7MX 4JAAA 1HW7A 5EBMC 4DR2B 3UCSC 4DW0A 3MHSC 4MVOA 2KQXA 3K0GA 4DR3O 2QM7A 3UO2A 1VF7A 4C7UA 1K5QA 1JJ2U 3FB5C 2WA4A 2BOCC 1FYJA 3WU2Z 1F23A 4TQFA 2HEPA 4JI1O 2Z3YA 3F7VC 2HHHB 1SETA 3NR7A 4J41A 2L6LA 2QKCA 4MT8A 5LOVA 2UUCO 2JGUA 4HNAA 3R65A 5B1AB 4DV5B 1PM9A 2FL4A 4HBNA 2Q73A 4NTYA 1RFYA 3N2GB 2JRIA 3DXRB 4PA4A 3DGEA 2E3CA 2H8PC 4FLXA 3K5MA 4W4LA 3JAKA 4BWAA 1SA0A 4MVZA 1QVGU 4F6EA 5IJ9A 1VF5B 3BHPA 2OIEA 2HFEC 4CC5A 1QR8A 4FLVA 1NTMH 3A0RA 1K34A 2Q8VA 4NB5A 3LDCA 1H8HG 3E8GA 1HDJA 4G27B 3ZJZA 5B66Z 4LBEC 4BIZA 5C93A 4DO2A 4KUMA 5KAFZ 2V4DA 3ZHUA 4I5SA 2PYJA 1N36O 3K08A 3FAVB 1M56B 1BT8A 3AG2B 3ZRWB 2X6BA 4JI8B 4LFCB 3K59A 3K5LA 1S76D 2K1EA 4LP8A 2QM8A 3RBZA 4B08A 2EIKB 4QE9A 1AJNA 3J80N 3OGIB 4X8AA 4DV7O 1YDXA 2QJ1A 2YI8A 1Y66A 3SYAA 4E4EA 4B3MO 4LF4O 1YJ9V 4MTFA 2UXDB 1KMIZ 4XDJA 2ITCC 1BMFG 1MSDA 4TV8B 5AG2A 4FLUA 2OTLV 2CE4A 5EC1C 4JI4O 4YY3O 1EZJA 3CYOA 2ZE8A 1Q3EA 1NTKH 2ZIMA 4QE7A 4OX9B 5ITZA 1XNRO 3N2KA 4DR7B 1Q90D 2EINB 3W7XA 4CBCA 4JASA 5KUMA 4RO2A 2F43G 5H5NA 3K79A 2YSUB 3N2GA 5KX5A 1JFFA 1DF5A 4R50A 2QWPB 1IBMB 1TAEA 4MTGA 1M5IA 3OD4A 5CA3A 3ZMZA 2NNUA 3OMIB 4N23A 4FPPA 2UU9B 3FB7C 5LA6A 4I55A 1VMGA 2NN4A 3ZX6A 1N32O 2DYSC 3ABKB 4YJ2A 5L3GA 2L35A 4IGGA 3EVKA 1FJGO 1YJWV 1AJPA 2CH7A 2GTSA 1HNXO 3B4SA 4NXNB 1KP3A 2RN9A 1W0KG 4JTDB 1NR1A 2Q7EA 1EFRG 4AQYO 4MVRA 1KD1W 5CA0A 1AR4A 1SQBH 2Q5ZA 2E5LO 3CRQA 5IT9N 3VQXA 4FFBA 5KHHA 1VEWA 1XNQB 3HKEA 1NVPD 1L8DA 3SYQA 1WAZA 1GTOA 2ZKOA 1CPYA 1N34B 4JI6O 2IBZH
chains in the Genus database with same CATH topology
4X64O 2UU9O 4X66O 4DR6O 4B3RO 3JAMN 1FKAO 5LL6Y 3T1HO 3SDLA 3J80N 2FKXA 5FLXN 1AB3A 4DV7O 2ZM6O 4LFCO 4NXNO 4DUZO 1KUQA 4JI5O 4B3MO 4LF8O 3O65A 5BY1A 3OTOO 4DR1O 2UXBO 4LF4O 4KHPO 4K0KO 4LF9O 1G1XB 4A5UB 4LF5O 4JI2O 1DK1A 4OX9O 4DV1O 4JI4O 4DV3O 1NS1A 1R6TA 4YY3O 2UXDO 4DR3O 5BXZA 2N74A 4LFBO 2F4VO 1HR0O 1HNWO 4DR5O 1I94O 2UUAO 2VQEO 1N34O 1XNRO 4GKJO 2AGAA 1FYJA 4JI8O 4JI1O 2UXCO 1F7YA 4DR7O 5H5NA 2UUCO 3J7AU 4B3TO 2DOSA 1XMOO 2HHHO 1HNZO 4X65O 4LF6O 5A2QN 2Z0AA 2VQFO 4DUYO 4DR4O 2JRIA 4DV5O 4NXMO 1R1BA 2UUBO 4JYAO 4OPHA 1N32O 1X59A 3RT3C 1AILA 5BR8O 1N33O 4LFAO 4OPAA 4JI3O 1FJGO 1HNXO 1D2DA 4B3SO 3F5TA 2DJVA 2LW7A 4AQYO 4GKKO 4DR2O 4DV6O 4JV5O 4YHHO 4JI7O 3R66A 1A32A 5LMUO 1J5EO 3M8AA 2E5LO 1IBLO 5IT9N 1XMQO 1IBKO 1N36O 4DV2O 1YZBA 4JI0O 5IWAO 4DV0O 1XEQA 4DV4O 3J81N 1IBMO 3T1YO 4LF7O 2ZKOA 1XNQO 4JI6O 4X62O 5LMNO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 O;  2UU9 O;  4X66 O;  4DR6 O;  4B3R O;  3JAM N;  1FKA O;  5LL6 Y;  3T1H O;  3SDL A;  3J80 N;  2FKX A;  5FLX N;  1AB3 A;  4DV7 O;  2ZM6 O;  4LFC O;  4NXN O;  4DUZ O;  1KUQ A;  4JI5 O;  4B3M O;  4LF8 O;  3O65 A;  5BY1 A;  3OTO O;  4DR1 O;  2UXB O;  4LF4 O;  4KHP O;  4K0K O;  4LF9 O;  1G1X B;  4A5U B;  4LF5 O;  4JI2 O;  1DK1 A;  4OX9 O;  4DV1 O;  4JI4 O;  4DV3 O;  1NS1 A;  1R6T A;  4YY3 O;  2UXD O;  4DR3 O;  5BXZ A;  2N74 A;  4LFB O;  2F4V O;  1HR0 O;  1HNW O;  4DR5 O;  1I94 O;  2UUA O;  2VQE O;  1N34 O;  1XNR O;  4GKJ O;  2AGA A;  1FYJ A;  4JI8 O;  4JI1 O;  2UXC O;  1F7Y A;  4DR7 O;  5H5N A;  2UUC O;  3J7A U;  4B3T O;  2DOS A;  1XMO O;  2HHH O;  1HNZ O;  4X65 O;  4LF6 O;  5A2Q N;  2Z0A A;  2VQF O;  4DUY O;  4DR4 O;  2JRI A;  4DV5 O;  4NXM O;  1R1B A;  2UUB O;  4JYA O;  4OPH A;  1N32 O;  1X59 A;  3RT3 C;  1AIL A;  5BR8 O;  1N33 O;  4LFA O;  4OPA A;  4JI3 O;  1FJG O;  1HNX O;  1D2D A;  4B3S O;  3F5T A;  2DJV A;  2LW7 A;  4AQY O;  4GKK O;  4DR2 O;  4DV6 O;  4JV5 O;  4YHH O;  4JI7 O;  3R66 A;  1A32 A;  5LMU O;  1J5E O;  3M8A A;  2E5L O;  1IBL O;  5IT9 N;  1XMQ O;  1IBK O;  1N36 O;  4DV2 O;  1YZB A;  4JI0 O;  5IWA O;  4DV0 O;  1XEQ A;  4DV4 O;  3J81 N;  1IBM O;  3T1Y O;  4LF7 O;  2ZKO A;  1XNQ O;  4JI6 O;  4X62 O;  5LMN O; 
#chains in the Genus database with same CATH topology
 1H2M A;  3FB8 C;  2CGO A;  2YXL A;  2JS5 A;  4X66 B;  4LF6 B;  4LFC O;  4JI5 O;  1IDS A;  3B09 A;  2KG7 A;  2UXB O;  3WB1 A;  3JSL A;  3H1J H;  1WPB A;  2IH3 C;  3OTO B;  2A0L A;  3SJB C;  5GW7 A;  1CP9 A;  3G80 A;  4RUE A;  3ZHQ A;  1GN2 A;  2IU0 A;  2UXX A;  3O9O A;  1N34 O;  1G8M A;  2D2C B;  2B1I A;  3DC5 A;  4X9Q A;  2X7R B;  1O9G A;  4PA7 A;  1RP3 B;  1GO3 F;  2PTM A;  4YHH B;  1V9P A;  4PDV A;  1AVM A;  3QNE A;  1L1F A;  1R3J C;  1K5S A;  4CC6 A;  3STZ C;  2AZ2 A;  1R1B A;  1FJG B;  3BFR A;  3IAY A;  4UCO A;  1Y74 A;  4BAY A;  4LWS B;  3ICX A;  4LFA O;  3HR0 A;  4IYH A;  4CH5 A;  4UVB A;  4PA3 A;  2X6C A;  5GON A;  4O4H A;  5IWA B;  3WFV A;  5JCO A;  1YXB A;  1A32 A;  2CUG A;  1K92 A;  1B06 A;  4DV2 O;  4U7O A;  2EIN C;  3RYH B;  2ZIO A;  1EBO A;  1XEQ A;  3OUF A;  4YJ3 A;  2JIZ G;  5LGU A;  5EBW C;  5LMN O;  5IYZ B;  2EIM B;  1XRE A;  4CH6 A;  2UXC B;  2WAM A;  1MSW D;  5IJ0 B;  4ZOL B;  2FKX A;  3GWK C;  1WNS A;  4BIO A;  3ABU A;  3OTO O;  3E89 A;  4J9Y B;  1QLE C;  5EK0 A;  5KA6 A;  2QEX V;  4X1K B;  1NTZ H;  4UFZ A;  4JYA B;  2QTS A;  1XNR B;  1Z2G A;  4F4L A;  1EZV H;  3T1C A;  1SA0 B;  1SF9 A;  5LHG A;  1K97 A;  1H38 A;  1GRJ A;  3ABK C;  1S0V A;  1BZK A;  3CC7 V;  5JJE B;  3SPH A;  4JI8 O;  3K0D A;  5CB4 A;  3FYI B;  3L74 H;  3L72 H;  4ICG A;  2ETN A;  4XDL A;  1EN4 A;  3ZHR A;  2JJ1 G;  1H2N A;  5LHI A;  2VQF O;  5KX5 B;  5FNV A;  1YHQ V;  2EZP A;  2PZS A;  5JWP A;  5LBQ A;  5FNV B;  3FYE B;  2VRZ A;  1YSC A;  3ZMS A;  3S3X A;  3L73 H;  2BTO A;  4O4I A;  3CC4 V;  2YDE A;  2A06 H;  3VBB A;  1XI1 A;  2DW4 A;  4GX5 A;  2EX3 A;  4LNU A;  2QKA A;  5E1A C;  1M90 W;  1GAX A;  2WLI B;  1UJW B;  3JYC A;  4J7J A;  2XTA A;  1NBM G;  1XMQ O;  3SJA C;  1FS0 G;  2YIC A;  4X89 A;  3L9D A;  4TQD A;  5L3C A;  2UUC B;  1KC8 W;  4LFB B;  1THZ A;  4PV1 B;  3ZN1 A;  2DMX A;  3BPZ A;  3TCU A;  1PD3 A;  3OMN B;  5ITZ B;  3T1H O;  2Q7H A;  5FLX N;  4MVM A;  4LNU B;  3G4S V;  4X1K A;  1Q6I A;  3QO8 A;  3O65 A;  3JSN A;  3SYC A;  2LQT A;  4FMT A;  4OX9 O;  1FPO A;  1R6T A;  2RNB A;  2HVJ C;  2P90 A;  3KKY A;  4U7N A;  1KQS U;  1OCZ B;  2QWN B;  2DQ3 A;  2ZNI A;  3JD2 A;  3ASN B;  5CN0 A;  3X2Q B;  3T1Y B;  1EN6 A;  4QPJ A;  2VS0 A;  2BCC H;  2EUL A;  4UCU A;  3OM3 B;  4O2A B;  3E8B A;  2XAG A;  2XAH A;  3RYC B;  5FL7 G;  5IYC O;  3MD0 A;  5CA0 B;  3ABL B;  4Q6G A;  4RWU A;  2YXH A;  3DXR A;  1HNZ O;  4LF6 O;  4GX1 A;  4DR1 B;  2Z0A A;  3K06 A;  5IDJ A;  4DUY O;  1MNG A;  4YIO A;  1XMO B;  4I7Z B;  5LXT B;  3MHH C;  3CCL V;  3OGC C;  1VQO V;  3BA9 A;  3H1K H;  1MA1 A;  2YUA A;  1Q81 W;  3N2K B;  4LF8 B;  2P67 A;  2JEX A;  2VQE B;  3ZRV A;  1BQ0 A;  4QIW F;  1QLE B;  1FXK C;  2OYQ A;  4GUN A;  4DV6 O;  5B1B C;  4LH6 A;  3D3Q A;  3CME V;  5A9G A;  4DRX B;  4X20 B;  3M8A A;  3K03 A;  4GT1 A;  1TUE B;  3H1H H;  3L75 H;  2YIB A;  1ZWI C;  4X62 O;  3W7U A;  4YJ2 B;  2Q68 A;  1XOU A;  1NT2 B;  4QGP A;  4WFF A;  4FLT A;  3AG3 C;  2DN9 A;  4ZBM A;  5J2U A;  1R3I C;  5JJJ B;  2AW9 A;  5JH7 B;  3RYI B;  2W0X A;  3ETG A;  1M93 A;  1KUQ A;  1CEZ A;  5IJ0 A;  4E2L A;  1ZAU A;  1HWY A;  4WBN A;  2IJJ A;  4JI2 B;  5KHK A;  3BAA A;  4WBN B;  2ZQM A;  1CXZ B;  1KYO F;  4RUF A;  5EIB D;  3CRA A;  3ZHV A;  2CAZ C;  2N74 A;  1NH2 D;  1NU1 H;  2DQ0 A;  4IHJ B;  4JYC A;  2YIB D;  4DV0 B;  4DV4 B;  4I55 B;  1HNW O;  1Y4M A;  3B8M A;  1S5H C;  2UUA O;  2RQ6 A;  3L70 H;  1VQ4 V;  4L87 A;  2LFR A;  4G28 B;  4JF3 A;  3ZED A;  3CXH F;  3CMA V;  3E83 A;  4X65 B;  2KG7 B;  5GON B;  1SZT A;  3J7A U;  3OE7 G;  3RWR D;  4NXM B;  3OW2 U;  4Z1M G;  1JX9 A;  1ZUQ A;  3CCR V;  4FK5 C;  3AEI A;  4B3T B;  3OMA B;  2YXY A;  3E2E A;  2R70 A;  1NI8 A;  2JGD A;  4DUY B;  1SES A;  2QTO A;  3G71 V;  1N33 O;  3B40 A;  4LCU C;  2MK3 A;  2DJV A;  2AZ0 A;  2FB5 A;  4BW9 A;  4CS3 A;  4TT3 G;  1AR5 A;  4IYI A;  2Y0P A;  3OEE G;  1QHT A;  2PI4 A;  2MW2 B;  2EIJ C;  1RPR A;  2M6Y A;  5LYJ A;  3T2M A;  2AHY A;  2XAQ A;  1YZB A;  1TA8 A;  1YTF B;  4JV5 B;  3APQ A;  2P6J A;  3HKC A;  1SQP H;  5J9P C;  3OR7 C;  4GLX A;  2ADP A;  3CB2 A;  2CK3 G;  4X64 O;  1DGS A;  5LGN A;  3JAM N;  2HP8 A;  1DTO A;  1AJQ A;  2Q6A A;  2LFS A;  1M4U A;  4RQE A;  3B8N A;  5KHG A;  1M56 C;  1R6N A;  3AK1 A;  3HKD B;  2BTQ B;  1WN7 A;  4KHP O;  3TK1 A;  3ABT A;  1AP5 A;  3OT7 A;  1QNM A;  4U3J A;  1QR9 A;  3RYH A;  5B1B B;  4UVC A;  2UUB B;  1DK1 A;  2PGG A;  3OTF A;  4U3F H;  4DV1 O;  1BL8 A;  2UXD O;  3ZMV A;  4HAM A;  1WA8 A;  2E75 B;  1ARO P;  4DR5 O;  1LUW A;  4NR1 A;  1IUR A;  3F7Y C;  4DK0 A;  3FKS G;  1G6U A;  1TVK B;  5B1N A;  4XBF A;  1PNK A;  1S5J A;  4FFK A;  1Q43 A;  3IJ4 A;  2X0L A;  4O4J A;  4O2A A;  5L3F A;  1H2L A;  1O9H A;  1BHB A;  2UXB B;  1SER A;  3CPW U;  4X64 B;  1U96 A;  5EIB C;  3RFR A;  3ZBH A;  4EFE A;  1OCC C;  5EZY A;  5CBH A;  3C90 A;  4X1Y A;  5EBL C;  1N33 B;  3N27 A;  2OWO A;  1K3E A;  1PP9 H;  2EIL B;  1KEC A;  1VIB A;  5CBG A;  3SGI A;  1QQC A;  3JAS A;  1YIT V;  1SQX H;  1W59 A;  2DWE C;  4TUY A;  4D7T A;  3CCS V;  2ZXW C;  4K35 A;  4DV2 B;  1E1Q G;  5LMU O;  1J5E O;  1IBL O;  1H8E G;  1XHZ A;  2JEU A;  3RGB A;  2KSD A;  1PV0 A;  2F23 A;  1I08 A;  5B3S B;  4AIL C;  1NR7 A;  4PA9 A;  1NQT A;  3KCX A;  3K5O A;  3OUS A;  4NTW A;  4MVU A;  3CXC U;  2ZCE A;  5IY5 C;  3QO5 A;  1FFX B;  3I55 V;  3D8C A;  1VQL V;  2JJ2 G;  2ZE6 A;  2N04 A;  2GDS A;  2P7T C;  2CTQ A;  3K9S A;  3IC7 A;  1DLB A;  5JH7 A;  4LF8 O;  3HKB B;  4OXS A;  3A0B Z;  4W4K A;  2EBO A;  4JI2 O;  3C3T A;  2IW5 A;  2RCV A;  4I4T A;  2UUA B;  4TOI A;  5BXZ A;  4GCZ A;  3CRR A;  3JAR B;  4JYB A;  1P4R A;  1TVK A;  4I0X B;  1I94 O;  2HJD A;  2VQE O;  4O4L B;  3JAR A;  4R7C A;  1H2K A;  1JR9 A;  3TJT A;  4JZG A;  5L3B A;  4X62 B;  4J7Z A;  3ABL C;  3SPI A;  4LH7 A;  2R9I A;  4B3T O;  5CA1 B;  3UQ8 A;  3CCU V;  5JQG B;  2R9A A;  4CZZ A;  4LF7 B;  2EZO A;  4RQF A;  5TIS Z;  2V1D A;  1SQF A;  4LF4 B;  1GN3 A;  1K9M W;  2EJR A;  2ARH A;  1Q7Y W;  3ML0 A;  3LDD A;  1XQ8 A;  2LGW A;  1S77 D;  2H3O A;  1VQM V;  1VQ6 V;  4J42 A;  3HPL C;  2LP7 A;  4DV3 B;  3CRC A;  3K57 A;  4UB8 Z;  1D2D A;  4CS4 A;  3RVY A;  1J5E B;  1NZ6 A;  3RYI A;  4JI7 O;  1I5X A;  4TV9 B;  4ZIB A;  1I0H A;  1RSO B;  4O4H B;  1BCC H;  3EXA A;  1GN6 A;  3ZRW A;  1ZLZ A;  5LXT A;  5L3D A;  3JAK B;  5KHJ A;  5L3E A;  2HG5 C;  3G67 A;  3CE2 A;  4J9Z B;  1IBK B;  3DC6 A;  1BGY H;  4B3R O;  3STL C;  3DTU B;  1N32 B;  4PDL A;  4K0K B;  3FB6 C;  1K33 A;  2BOB C;  4NYK A;  2IM9 A;  3E8H A;  2ZM6 O;  1XL6 A;  4MVS A;  1Y76 A;  1IXM A;  1PNM A;  2ZR2 A;  4PA6 A;  1QCE A;  3AG4 C;  3WG7 B;  4A5U B;  4UUJ C;  1WLE A;  2ZNJ A;  1WJZ A;  2RDC A;  4DV3 O;  4H13 B;  4JI1 B;  3D3I A;  3LSQ A;  5DEC A;  1R3L C;  1OZ0 A;  1XHX A;  3CSX A;  5J2U B;  2DYR B;  1GKF A;  1U97 A;  2HLD G;  3BA8 A;  1LR1 A;  4B3R B;  2GUZ A;  3E86 A;  5EYP B;  2EIJ B;  1RPO A;  1GK9 A;  1XMO O;  2HHH O;  4B7K A;  2ODM A;  1F4N A;  1K8A W;  2IJI A;  4PD4 F;  2XUM A;  1Y6X A;  1URF A;  4JTC B;  5LGT A;  3LSU A;  2LGQ A;  4N21 A;  4KXR A;  1WP7 A;  1QBZ A;  4OPA A;  3RYF A;  2F4V B;  4HZ3 A;  2XND G;  3H1I H;  3M99 B;  3PN1 A;  2JVD A;  2ZE5 A;  1US6 A;  4UXN A;  1H2G A;  3HKD A;  3RVZ A;  1JFF B;  3RW0 A;  3JAS B;  1VF6 A;  2HJF C;  5LMN B;  1LUV A;  1HR0 B;  3GB7 C;  1BHA A;  1E1R G;  4IHJ A;  3HKC B;  1MG1 A;  3D36 C;  2WLL B;  3QVN A;  3QF7 A;  4DYL A;  3OEH G;  4ZOL A;  4GX2 A;  3T4D A;  4LR3 A;  1FXH A;  3OR6 C;  5FPR A;  4K0K O;  3ETD A;  5JVD B;  1UFI A;  4WFB V;  4H0L B;  3S3W A;  1HNW B;  3AG3 B;  1P7B A;  1AI4 A;  2Q9L A;  2K9P A;  1HR0 O;  3MDS A;  2CTW A;  5IE9 A;  2IU3 A;  4ASU G;  1VF6 C;  2QWO B;  5LP6 A;  4O4I B;  1Q8I A;  3CEI A;  1JPX A;  4L8J A;  5B1A C;  4CH4 A;  1AP6 A;  2DOS A;  1E79 G;  1I7F A;  2B9Z A;  4QPK A;  5CMU A;  4ZI7 A;  5K1P A;  4KHP B;  4EFB A;  1N0J A;  3B77 A;  3CCM V;  2YC0 A;  2E76 B;  4JYA O;  3RYF B;  1XUQ A;  2AXT Z;  1PNL A;  1VQ8 V;  1OCR B;  4UB6 Z;  2R72 A;  4DR3 B;  2YEV B;  4DUZ B;  1XMQ B;  3A2F A;  3MAQ A;  2QM4 A;  2M7W A;  1SKV A;  3AG7 A;  4QNH B;  1WP8 A;  1DF4 A;  1S5L Z;  1COW G;  1JJO A;  2IJK A;  5IYB O;  4AQY B;  1Q5O A;  2F66 C;  1QLN A;  1GM8 A;  4DXW A;  4DR5 B;  4JI0 O;  2AHZ A;  3ZRX A;  2QKS A;  4CS2 A;  4NVP A;  4P9P A;  4LF7 O;  3CD6 V;  3SPJ A;  2NR5 A;  4AI8 A;  4X66 O;  3K04 A;  4O4L A;  1AI7 A;  3JD1 A;  3G6E V;  2WLH A;  2A3Q A;  4DUZ O;  1FAF A;  5BMV A;  1ZTE A;  2CDY A;  3GVM A;  5LOV B;  1G1X B;  1Y76 B;  3ZCC A;  4Z1V A;  4B7E A;  4BW5 A;  3HKB A;  2CTP A;  4JI5 B;  4X88 A;  4MW3 A;  3WB2 A;  2GSM B;  4KL1 A;  4TV8 A;  4PDR A;  4WFG A;  5D5P A;  4PHZ A;  3E22 A;  4J7K A;  5LMU B;  1YCI A;  1XL4 A;  5JJN B;  2ADQ B;  1FD9 A;  1F7Y A;  1GM9 A;  3BAB A;  2ZT9 B;  2WLI A;  3U0Z A;  4X65 O;  5KHI A;  2GUZ B;  2H94 A;  2A79 B;  3RYC A;  5CA1 A;  3W7W A;  3ETE A;  4JI6 B;  3AK2 A;  2Q7G A;  5IYD O;  4UVA A;  1MMM A;  2GHY A;  2EIL C;  4B3M B;  2WPD G;  4WF9 V;  1MZE A;  1JQ0 A;  4PI0 A;  4K3A A;  4JV5 O;  4NKG B;  2WLK A;  2A7W A;  4JI4 B;  2ZDI C;  4PEL A;  1L0N H;  1Z5V A;  3L71 H;  4I50 A;  4TV9 A;  1Q6H A;  2IH1 C;  4DW1 A;  3RN4 A;  1S72 V;  2OIG A;  1EM1 A;  1TUB A;  3HKE B;  3JD3 A;  1XNQ O;  4P30 A;  1FFX A;  2ZM6 B;  2UU9 O;  1Q6U A;  4I0X A;  1SC5 B;  4LC1 A;  2P22 C;  1FKA O;  3UKM A;  2JDI G;  3I56 V;  5F2V O;  1MZF A;  2PY5 A;  2QWR B;  3APO A;  2V7Q G;  4DR4 B;  1RSO A;  2P4V A;  2DWD C;  3H9V A;  3A0H Z;  1P49 A;  4JGS A;  4UCS A;  3ASO C;  2F95 B;  3E35 A;  1KKD A;  2LJ2 A;  1VQ7 V;  4DV7 B;  1H2S B;  1SRY A;  3P3N A;  4Z2W A;  2A9H A;  3BEH A;  2QA4 V;  2OCC C;  4JTA B;  1KKC A;  3NXS A;  3E8F A;  1V54 C;  4PDM A;  2DYS B;  3TXS A;  2PUS A;  1AI6 A;  1YVW A;  4HNA B;  2WLM A;  2CGN A;  3VOU A;  1N36 B;  1GM7 A;  3CCJ V;  5BZB A;  2KB1 A;  2ZXW B;  2EJ7 A;  5A2Q N;  1SQV H;  2WA3 A;  3X2Q C;  4FFB B;  5IJ9 B;  4DV5 O;  5B1O A;  2YIA A;  1WB7 A;  2PF4 E;  1AR1 B;  4IIJ B;  4WFE A;  2Z5U A;  1R73 A;  3UM7 A;  2GV9 A;  5LHH A;  2Q0A A;  2F93 B;  4I9W A;  5BR8 O;  1OHH G;  2FML A;  4TWK A;  1I5Y A;  2PI5 A;  3TET A;  4ABM A;  3K58 A;  3LNN A;  3LSS A;  4FZ0 A;  3CX5 F;  4WCE V;  2Q67 A;  2QWQ B;  2R9R B;  3K5N A;  1ZSP A;  4GKK B;  3FAV A;  4FVM A;  1JCH A;  4DV6 B;  4DV0 O;  4DV4 O;  1XDC A;  5EC2 C;  3FX7 A;  4D6T H;  2RJZ A;  1J95 A;  4LWS A;  4F6R A;  4YJ3 B;  2JK5 C;  2ATK C;  1PKX A;  3CRM A;  1R6K A;  4P9O A;  1M1K W;  3SPC A;  3ABM B;  2QR4 A;  4DR6 B;  2Y69 C;  4MTO A;  3VQV A;  4X1I A;  1HNX B;  3VQY A;  4NXN O;  2OT5 A;  1OCO C;  1P84 F;  2RMK B;  3EFF K;  3LUT B;  2P06 A;  3EHB B;  2QE7 G;  3T1H B;  4LF9 O;  3KCY A;  5DN6 G;  2Y69 B;  1B6Q A;  1VQN V;  1OCR C;  5J2T A;  5KMG A;  4UV9 A;  3D36 A;  2Y4T A;  4K8X A;  3QG5 A;  5J2T B;  5D5Q A;  4X1Y B;  2CTR A;  3JD4 A;  2QSA A;  4YY3 B;  2XOK G;  3KZI Z;  4UV8 A;  2YID A;  1PL0 A;  3CCQ V;  2Q0O C;  2Y48 A;  4DR7 O;  2LO1 A;  4AHC A;  5B3S C;  1OV9 A;  2VWJ A;  3LDE A;  4MSW C;  1ZL8 A;  3C3S A;  2WLN A;  4IIJ A;  4LF9 B;  1NJI W;  1JVM A;  2E74 B;  5KAI Z;  4K8Z A;  5DED A;  4RAI A;  2G38 A;  2X6A A;  4IT5 A;  3JCU Z;  3CS5 A;  2UXN A;  4J11 A;  5K1X A;  3FFQ A;  3IC9 A;  3RT3 C;  1AIL A;  1RM1 B;  1P7G A;  3BRC A;  4R8C A;  4JI3 O;  3ZMU A;  2ZIN A;  2NLJ C;  4KFM A;  4EB6 B;  1GN4 A;  2BE3 A;  3P32 A;  2GTA A;  3R66 A;  3WG7 C;  3AG4 B;  5BMV B;  1W2B U;  1BSM A;  2ZD9 A;  3ZHS A;  1TGO A;  1ZL8 B;  2Y4U A;  1IBK O;  2WLJ A;  1KU9 A;  4FM0 A;  3CCV V;  3HB3 B;  2BSK B;  1ROP A;  2EIM C;  5IWA O;  4ZKI A;  3CP1 A;  1YEW A;  4I4T B;  3OAA G;  1V55 C;  1V55 B;  2JGD B;  2WSS G;  4NTX A;  2OCC B;  4MW8 A;  2DYR C;  3UT5 B;  4KP4 A;  2XAF A;  2FTK A;  3ASN C;  4MTX A;  5KA5 A;  1VAR A;  5JVD A;  3ZHT A;  4ZHQ A;  1MOF A;  1K73 W;  1VQK V;  4DR1 O;  1FXK B;  3SPG A;  5KMG B;  4ZHQ B;  3TGU H;  1I94 B;  5C8Y A;  5HFM A;  1RM1 C;  3K3W A;  4PI2 A;  2ZE7 A;  5H9C A;  2HVK C;  3B2E E;  3AG1 C;  3UT5 A;  4R6Z A;  1B04 A;  1UPG A;  4LF5 B;  1KB9 F;  3AG2 C;  1F4M A;  3CJH A;  3JCZ A;  4DK1 A;  4DV1 B;  5B5E Z;  2B5U A;  4FM1 A;  5H6Q A;  2UXC O;  3OFN G;  4JPR A;  2BTQ A;  1VQP V;  1FXK A;  1N4C A;  5HFL A;  4ZI7 B;  3KG2 A;  3ZRS A;  4GKJ B;  4J10 A;  2OTJ V;  4DRX A;  1KP2 A;  4GZR B;  5KUK A;  5GTH Z;  1Y67 A;  3CCE V;  4DR4 O;  3BVO A;  5GTI Z;  1D5N A;  1QVF U;  2UUB O;  1K7D A;  1WA8 B;  1SZX A;  1YTF D;  4OPH A;  2F1M A;  3UO3 A;  2ILM A;  3K9A A;  3SYO A;  3H1L H;  1PL4 A;  4O2B A;  2B1G A;  3BCC H;  4B3S O;  1IBL B;  4O2B B;  1S3J A;  5CBF A;  5EZY B;  4PJ0 Z;  2VQF B;  2Q69 A;  4I50 B;  1QU7 A;  5LA6 B;  1IBM O;  2EIK C;  4UCV A;  1VP7 A;  1OJH A;  4EKW A;  1OCZ C;  1ORQ C;  5FPO A;  1NVP B;  2DE0 X;  1X4T A;  5LL6 Y;  1IVS A;  1FXV A;  4HYO A;  2LW1 A;  2N05 A;  1T5E A;  2QDO A;  4X20 A;  2FYU H;  2WLL A;  3IFX A;  4FM2 A;  1LNQ A;  4H37 A;  1R3K C;  4EEQ A;  2ITD C;  3ABM C;  1KBH A;  1NH2 B;  1IZ3 A;  3JAW A;  1W0J G;  3PJS K;  4IL6 Z;  5BR8 B;  4LFB O;  2QGN A;  1IXB A;  1YI2 V;  2P4K A;  3WB0 A;  4FLY A;  5IY5 B;  1JOY A;  3FD9 A;  2Y0I A;  1M57 B;  3QO7 A;  4QJF B;  3CWB H;  3THO A;  1VQ5 V;  3JD0 A;  4NXM O;  5H2F Z;  5LP6 C;  3JAW B;  3DSQ A;  2C2A A;  2W0F C;  4UCR A;  2HR3 A;  2XAJ A;  2HKO A;  1SQQ H;  4JI3 B;  3U10 A;  1X59 A;  1M9N A;  2YI9 A;  3AK3 A;  4D7S A;  4TSF G;  3F5T A;  4LFA B;  2LW7 A;  4UCT A;  1JMK C;  2WWW A;  3VQW A;  4FJC C;  4JI0 B;  5JQG A;  1JA8 A;  3BY6 A;  1ZX3 A;  1GH6 A;  4B3S B;  1NKD A;  4U3J B;  4H33 A;  4Q20 A;  2VWK A;  1WPX A;  1N8R W;  4P2Z A;  3ZMT A;  4JI7 B;  1V54 B;  3CHX A;  3J81 N;  3T1Y O;  1YIJ V;  1K4D C;  1SS3 A;  3AG1 B;  4JAV A;  3Q4H B;  1WB8 A;  4H44 B;  1EN5 A;  4GYC B;  4GX0 A;  3SDL A;  2GBO A;  1XBL A;  1AB3 A;  3G6B A;  3I5D A;  2Q4P A;  4MS2 A;  1AI5 A;  3A8T A;  5BY1 A;  4WFA V;  3JAL A;  1MAB G;  4O4J B;  4YIP A;  2XAS A;  4LF5 O;  2XT9 A;  2W6J G;  3GWO A;  1OCO B;  1NS1 A;  4G2K A;  4JYY A;  3CC2 V;  2F4V O;  4OGQ B;  4YXW G;  1Y74 B;  5E79 Z;  3ZN0 A;  4GKJ O;  2AGA A;  1D5A A;  1GMG A;  2E5L B;  2IJH A;  2YEV A;  3SYP A;  5JCO C;  1F51 A;  3W7S A;  1M57 C;  1YF2 A;  2ZDI A;  3IGA C;  2XHB A;  4I9Q A;  1BE3 H;  3ZS8 C;  2W6I G;  3ETQ A;  3QTC A;  1HNZ B;  1N0N A;  4JAU A;  3JAT B;  1G4Y B;  1SQG A;  1VQ9 V;  2D3O W;  1Q82 W;  1Z5W A;  3P3P A;  4J80 A;  3JAT A;  3SJC C;  1BS3 A;  2CH7 B;  4FZ1 A;  4MVQ A;  2P5O A;  1Q86 W;  5IYZ A;  4FLZ A;  1OCC B;  3H01 A;  5LP6 B;  3LNM B;  5H6R A;  3F5W C;  2PYL A;  1IX9 A;  5EYP A;  4GKK O;  4DR2 O;  3ZIA G;  4X1I B;  4YHH O;  4WFH A;  1YJN V;  3ASO B;  5KLV H;  1ENV A;  4TUY B;  3SR2 C;  4XDK A;  4CH3 A;  2JS3 A;  4JZ2 A;  3P30 A;  5C8Y B;  4F6R B;  3Q4H A;  2BSK A;  2YS8 A;  4FIP C;  4BIU A;  1XIL A;  1B3Q A;  5DM6 V;  2O57 A;  4DR6 O;  1BQZ A;  3W7T A;  1TUB B;  3E22 B;  4EB6 A;  3T4Z A;  3CJH B;  2ZR3 A;  1HP8 A;  2KKW A;  4BR6 A;  3TXQ A;  1FFT B;  1PPJ H;  3SJQ C;  3U11 A;  4FLW A;  3JAL B;  2OCH A;  5CB4 B;  1K4C C;  1L0L H;  5LYJ B;  3M7M X;  4JAA A;  1HW7 A;  5EBM C;  4DR2 B;  3UCS C;  4DW0 A;  3MHS C;  4MVO A;  2KQX A;  3K0G A;  4DR3 O;  2QM7 A;  3UO2 A;  1VF7 A;  4C7U A;  1K5Q A;  1JJ2 U;  3FB5 C;  2WA4 A;  2BOC C;  1FYJ A;  3WU2 Z;  1F23 A;  4TQF A;  2HEP A;  4JI1 O;  2Z3Y A;  3F7V C;  2HHH B;  1SET A;  3NR7 A;  4J41 A;  2L6L A;  2QKC A;  4MT8 A;  5LOV A;  2UUC O;  2JGU A;  4HNA A;  3R65 A;  5B1A B;  4DV5 B;  1PM9 A;  2FL4 A;  4HBN A;  2Q73 A;  4NTY A;  1RFY A;  3N2G B;  2JRI A;  3DXR B;  4PA4 A;  3DGE A;  2E3C A;  2H8P C;  4FLX A;  3K5M A;  4W4L A;  3JAK A;  4BWA A;  1SA0 A;  4MVZ A;  1QVG U;  4F6E A;  5IJ9 A;  1VF5 B;  3BHP A;  2OIE A;  2HFE C;  4CC5 A;  1QR8 A;  4FLV A;  1NTM H;  3A0R A;  1K34 A;  2Q8V A;  4NB5 A;  3LDC A;  1H8H G;  3E8G A;  1HDJ A;  4G27 B;  3ZJZ A;  5B66 Z;  4LBE C;  4BIZ A;  5C93 A;  4DO2 A;  4KUM A;  5KAF Z;  2V4D A;  3ZHU A;  4I5S A;  2PYJ A;  1N36 O;  3K08 A;  3FAV B;  1M56 B;  1BT8 A;  3AG2 B;  3ZRW B;  2X6B A;  4JI8 B;  4LFC B;  3K59 A;  3K5L A;  1S76 D;  2K1E A;  4LP8 A;  2QM8 A;  3RBZ A;  4B08 A;  2EIK B;  4QE9 A;  1AJN A;  3J80 N;  3OGI B;  4X8A A;  4DV7 O;  1YDX A;  2QJ1 A;  2YI8 A;  1Y66 A;  3SYA A;  4E4E A;  4B3M O;  4LF4 O;  1YJ9 V;  4MTF A;  2UXD B;  1KMI Z;  4XDJ A;  2ITC C;  1BMF G;  1MSD A;  4TV8 B;  5AG2 A;  4FLU A;  2OTL V;  2CE4 A;  5EC1 C;  4JI4 O;  4YY3 O;  1EZJ A;  3CYO A;  2ZE8 A;  1Q3E A;  1NTK H;  2ZIM A;  4QE7 A;  4OX9 B;  5ITZ A;  1XNR O;  3N2K A;  4DR7 B;  1Q90 D;  2EIN B;  3W7X A;  4CBC A;  4JAS A;  5KUM A;  4RO2 A;  2F43 G;  5H5N A;  3K79 A;  2YSU B;  3N2G A;  5KX5 A;  1JFF A;  1DF5 A;  4R50 A;  2QWP B;  1IBM B;  1TAE A;  4MTG A;  1M5I A;  3OD4 A;  5CA3 A;  3ZMZ A;  2NNU A;  3OMI B;  4N23 A;  4FPP A;  2UU9 B;  3FB7 C;  5LA6 A;  4I55 A;  1VMG A;  2NN4 A;  3ZX6 A;  1N32 O;  2DYS C;  3ABK B;  4YJ2 A;  5L3G A;  2L35 A;  4IGG A;  3EVK A;  1FJG O;  1YJW V;  1AJP A;  2CH7 A;  2GTS A;  1HNX O;  3B4S A;  4NXN B;  1KP3 A;  2RN9 A;  1W0K G;  4JTD B;  1NR1 A;  2Q7E A;  1EFR G;  4AQY O;  4MVR A;  1KD1 W;  5CA0 A;  1AR4 A;  1SQB H;  2Q5Z A;  2E5L O;  3CRQ A;  5IT9 N;  3VQX A;  4FFB A;  5KHH A;  1VEW A;  1XNQ B;  3HKE A;  1NVP D;  1L8D A;  3SYQ A;  1WAZ A;  1GTO A;  2ZKO A;  1CPY A;  1N34 B;  4JI6 O;  2IBZ H; 
#chains in the Genus database with same CATH homology
 4X64 O;  2UU9 O;  4X66 O;  4DR6 O;  4B3R O;  3JAM N;  1FKA O;  5LL6 Y;  3T1H O;  3SDL A;  3J80 N;  2FKX A;  5FLX N;  1AB3 A;  4DV7 O;  2ZM6 O;  4LFC O;  4NXN O;  4DUZ O;  1KUQ A;  4JI5 O;  4B3M O;  4LF8 O;  3O65 A;  5BY1 A;  3OTO O;  4DR1 O;  2UXB O;  4LF4 O;  4KHP O;  4K0K O;  4LF9 O;  1G1X B;  4A5U B;  4LF5 O;  4JI2 O;  1DK1 A;  4OX9 O;  4DV1 O;  4JI4 O;  4DV3 O;  1NS1 A;  1R6T A;  4YY3 O;  2UXD O;  4DR3 O;  5BXZ A;  2N74 A;  4LFB O;  2F4V O;  1HR0 O;  1HNW O;  4DR5 O;  1I94 O;  2UUA O;  2VQE O;  1N34 O;  1XNR O;  4GKJ O;  2AGA A;  1FYJ A;  4JI8 O;  4JI1 O;  2UXC O;  1F7Y A;  4DR7 O;  5H5N A;  2UUC O;  3J7A U;  4B3T O;  2DOS A;  1XMO O;  2HHH O;  1HNZ O;  4X65 O;  4LF6 O;  5A2Q N;  2Z0A A;  2VQF O;  4DUY O;  4DR4 O;  2JRI A;  4DV5 O;  4NXM O;  1R1B A;  2UUB O;  4JYA O;  4OPH A;  1N32 O;  1X59 A;  3RT3 C;  1AIL A;  5BR8 O;  1N33 O;  4LFA O;  4OPA A;  4JI3 O;  1FJG O;  1HNX O;  1D2D A;  4B3S O;  3F5T A;  2DJV A;  2LW7 A;  4AQY O;  4GKK O;  4DR2 O;  4DV6 O;  4JV5 O;  4YHH O;  4JI7 O;  3R66 A;  1A32 A;  5LMU O;  1J5E O;  3M8A A;  2E5L O;  1IBL O;  5IT9 N;  1XMQ O;  1IBK O;  1N36 O;  4DV2 O;  1YZB A;  4JI0 O;  5IWA O;  4DV0 O;  1XEQ A;  4DV4 O;  3J81 N;  1IBM O;  3T1Y O;  4LF7 O;  2ZKO A;  1XNQ O;  4JI6 O;  4X62 O;  5LMN O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...