5BY1A

H18 bat influenza ns1 rna binding domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
71
structure length
71
Chain Sequence
MESTPTTIAFQVDCYLWHLKKMLSLMGEVDAPFEDRLRREQKALKGRSMTLGIDIQAATKAGYYKIKSITE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Bat Influenza Virus NS1 Proteins Bind Double-Stranded RNA and Antagonize Host Innate Immunity.
pubmed doi rcsb
source organism Influenza a virus (a/flat-faced bat/peru/033/2010(h18n11))
molecule tags Viral protein
molecule keywords Non-structural protein 1
total genus 30
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5by1A00
4AQYO 1FJGO 2UUCO 5IWAO 5LMNO 5LMUO 4LF9O 4K0KO 4X65O 2ZKOA 4YY3O 1IBKO 1D2DA 4JYAO 2FKXA 1HNXO 1N33O 1R6TA 1HNZO 1AB3A 1AILA 4JI0O 2UXCO 3J80N 1IBLO 1KUQA 4LF7O 1XNRO 1XEQA 1G1XB 1IBMO 4DV7O 5A2QN 2UUAO 4DR4O 1A32A 3JAMN 4OPHA 4B3SO 1X59A 3OTOO 4LF8O 4JI6O 1FYJA 4X66O 4B3RO 3M8AA 4DR2O 4NXMO 4LFBO 2UXBO 4GKJO 4JI7O 1DK1A 3T1HO 4LF4O 2F4VO 1FKAO 1XMOO 4B3TO 4DR1O 4LF5O 4JI5O 4X62O 2UU9O 2LW7A 4JI3O 4KHPO 4NXNO 4JI4O 2UXDO 5LL6Y 4DR5O 4DV4O 4LFCO 1XNQO 1N32O 4DV5O 3J81N 1YZBA 5BR8O 4OX9O 4DV2O 5H5NA 3R66A 4X64O 2DJVA 3SDLA 3F5TA 3O65A 2E5LO 3T1YO 1F7YA 1NS1A 4DR3O 5FLXN 1XMQO 5BXZA 4DR7O 4B3MO 2Z0AA 1N34O 3RT3C 4LF6O 2VQFO 4DV6O 4JV5O 4JI1O 4DR6O 4LFAO 4DUYO 2AGAA 2ZM6O 3J7AU 4DV0O 4OPAA 2VQEO 4DV1O 4JI2O 4A5UB 4GKKO 4JI8O 2UUBO 1I94O 4DV3O 2N74A 1J5EO 5IT9N 1N36O 2DOSA 1HNWO 5BY1A 2JRIA 1HR0O 2HHHO 4YHHO 1R1BA 4DUZO
chains in the Genus database with same CATH superfamily
5E79Z 4J9YB 1M93A 3SJQC 2P6JA 1R3JC 4PV1B 3L72H 3UT5A 2ZT9B 3CEIA 4K0KO 5IYCO 3OMNB 1LNQA 2E3CA 1H2GA 3L75H 2D2CB 3U0ZA 1CP9A 3SJCC 4JTCB 1G8MA 4QNHB 1Q7YW 1AI4A 3VQWA 2QWNB 2FL4A 1ENVA 3AG1B 3QO8A 3OTOO 2HKOA 1IBLB 5J2TB 2UU9B 3W7WA 3OEHG 2ATKC 4J7KA 3OMAB 4RAIA 2XNDG 3E86A 1SQVH 1XUQA 4DV4B 4B3TO 3JD4A 1EN5A 4JI6B 5CA1A 1NZ6A 5CB4B 4FLWA 2Y0PA 5B5EZ 1K3EA 4WBNB 3LNNA 2ZINA 4MT8A 1H2MA 3JD3A 1JPXA 4O2AB 3ZRWA 1XMOB 2F66C 5KHGA 5J2UB 2ADQB 3CHXA 4JAAA 4DR7B 2Q7GA 5BZBA 3SDLA 2YS8A 3IGAC 3CYOA 2DQ3A 3OUFA 2DYRB 5FLXN 1FXHA 2QE7G 4C7UA 4ZOLA 5DECA 3CWBH 1BHBA 4O4HB 2E5LB 4DUYO 2ZM6O 2H8PC 3J7AU 1Z5WA 3FX7A 2KB1A 2UUBO 4AHCA 1L1FA 1QLNA 1YJ9V 2DOSA 4DV0B 2Y69B 5KHIA 3OR6C 4FFKA 1YVWA 5BY1A 4GZRB 3E22B 4YHHO 4AI8A 1WAZA 3SR2C 2N04A 4PD4F 1XNRB 5KAFZ 2EZOA 2BE3A 3L74H 1HNZO 4QIWF 1RSOB 1EBOA 5JWPA 2ETNA 1BS3A 4FIPC 4G2KA 2ZXWC 3AG2C 5B1AC 2F23A 4L8JA 2GUZB 4MSWC 1YF2A 4DR2O 2OYQA 2LFRA 2UXDB 3FB8C 2P4VA 2W0XA 4CH6A 2CH7A 4FJCC 1YDXA 3ABMB 4PA3A 4CBCA 4NXNO 2Q9LA 5L3GA 1EM1A 3WG7B 1XMQB 3GWKC 4OX9O 5IJ0B 2VQFB 2YI8A 2WLNA 1WA8A 2EIKC 2WLIB 1OV9A 2AZ0A 2Q7HA 4K3AA 2B1GA 1M56B 5EK0A 1L8DA 4P30A 2EILC 1H8HG 2Q68A 2IW5A 4KXRA 3E22A 1QVFU 3WG7C 2C2AA 4QE7A 1K33A 5KA5A 4GLXA 2H3OA 3CS5A 5ITZA 1J5EO 3E2EA 1NBMG 2JRIA 1OCZB 3JAKB 3ZHVA 2UXNA 4DRXB 1NKDA 2GBOA 3JD0A 3BA8A 2YIAA 3HKEB 1DLBA 3DSQA 1KC8W 5FPRA 4O4LB 1WP7A 1WLEA 4JPRA 3HKBA 1KUQA 1Q82W 4LF7O 1U97A 3I56V 3QO7A 3H1KH 3N2KB 4QJFB 1SS3A 1Q6HA 1HDJA 5LYJA 3A0HZ 1EFRG 2AXTZ 3APOA 1AR4A 1WB7A 1VEWA 3HKCA 1DK1A 4LFCB 1GTOA 1IZ3A 4X66B 1Q3EA 4CZZA 5ITZB 2ODMA 4UCTA 4NKGB 2XASA 3FAVA 3HKEA 3T1YB 3RW0A 4BAYA 5L3FA 3QO5A 3JATA 4DRXA 4W4LA 1VARA 2R9RB 1JJ2U 4KHPB 4LF6B 5JQGB 4JI1B 3JSLA 2CK3G 3T1YO 4EEQA 3AG3B 2QR4A 1SESA 5BXZA 1NT2B 1TVKA 3IAYA 3ABKB 2JVDA 3N2GB 2YDEA 4TV9B 1LUVA 4FVMA 3QTCA 4E2LA 2ARHA 2QSAA 4YXWG 2CE4A 4YJ2A 1N34B 5EC2C 2PYLA 1W0KG 1KP2A 4EB6A 5LGUA 1TA8A 2V4DA 4F6RB 1OCZC 2M6YA 1B6QA 1TUBB 2DWDC 1SKVA 2VWKA 2NR5A 4PJ0Z 2Q4PA 2A0LA 2YEVA 2LJ2A 1F23A 3K79A 5JQGA 1K73W 3FYIB 1SA0B 2LW1A 2ZR2A 1SQGA 4DW0A 1HNXO 3TGUH 4WFHA 4UVBA 2X6AA 1QLEC 4RUFA 4AQYB 2W6IG 4I55B 4FM2A 4NXMB 3A2FA 1Q5OA 4LFBB 5EIBC 4FFBA 1BE3H 5B3SB 2WPDG 4H44B 3ICXA 3WB1A 2WWWA 1JX9A 5IYDO 2IJHA 5CBHA 5CA0B 5JH7B 4J11A 2CTRA 3K5OA 1B04A 3W7TA 3FB5C 4K8ZA 1K8AW 1K4DC 1XBLA 1NH2D 2RCVA 4B3TB 1V55C 4LF5B 5LA6A 1VP7A 2OIGA 1FXKC 1QQCA 1QHTA 4UVAA 4Z2WA 1F7YA 3MD0A 1B06A 4DV1B 4X89A 1AI5A 2DMXA 2PYJA 3AEIA 1AVMA 4HNAB 2RDCA 3QNEA 5LXTB 4B3MB 1N36B 1M4UA 4OPAA 2VQEO 3M99B 2QDOA 2BTOA 1K5QA 2EIJC 4TQDA 2N74A 4KFMA 5CMUA 2VRZA 4GX5A 1M90W 2YSUB 4J10A 2QWOB 4X65B 4I5SA 4LNUA 1HR0O 1R6KA 2GV9A 1WNSA 4UXNA 3IC9A 1GMGA 3JALB 1MSWD 5IJ9A 1FJGO 4IIJA 4R8CA 2ZR3A 1IX9A 3Q4HB 2WLKA 4JYAO 3DXRA 4R50A 2EJ7A 2LGQA 2KG7A 3GVMA 4JGSA 3QVNA 1Q6IA 3GB7C 2K9PA 2IJJA 1IBMO 1HW7A 3ZJZA 4DV7O 4FZ1A 3RWRD 1IURA 3ZX6A 1YEWA 3RGBA 5LXTA 1NR7A 2UXBO 1TGOA 2NLJC 2CTWA 3HKDB 1Q43A 1KD1W 1XMOO 2QEXV 2X0LA 3FFQA 4FZ0A 4O4JB 3HPLC 4I7ZB 1YJWV 4K35A 3OMIB 1V55B 4FLXA 4JI4O 1VF6A 5KUKA 2UXDO 5LL6Y 1VQ7V 1XNQO 3J81N 5B1OA 1T5EA 2IU3A 3VQVA 4FM0A 4LH6A 4J80A 1Q6UA 4D6TH 4NXNB 4L87A 5GW7A 1NS1A 2ZM6B 3EHBB 4PDRA 1VQNV 4JI8B 4IT5A 1XI1A 4N23A 1IVSA 4R6ZA 5TISZ 1PM9A 2EZPA 3RYCB 3AG7A 1VQMV 4LH7A 2QJ1A 4ZOLB 5J9PC 1OJHA 3W7UA 4G28B 4CC5A 4O4IA 2IH1C 1CEZA 2K1EA 3Q4HA 3LDDA 3K08A 3NXSA 5J2UA 2E76B 3CCRV 4H13B 2PY5A 3C3TA 4FLTA 4WF9V 4E4EA 3E8HA 1S77D 5JJEB 1VMGA 3RVZA 4H0LB 3LNMB 2YIBD 1YJNV 1N33O 2QTOA 4DUZB 2P06A 2JEXA 1FJGB 2GDSA 3DXRB 3R65A 3G80A 3LSUA 2QWRB 3OD4A 3E83A 4TOIA 1ZLZA 1JVMA 4FPPA 5FPOA 3RYCA 3ABUA 3CRQA 2Q69A 4WFGA 3T1CA 3CCLV 3RYIB 2UUAB 2ZDIA 4MTGA 4JI5O 4DV2B 2JGDA 3RYHB 4X64B 3HKDA 4I0XA 2UU9O 1AJQA 5C93A 2Q7EA 4P9OA 2G38A 3SYPA 2F4VB 3ZS8C 3T1HB 4NR1A 4DR1B 1KECA 4YIOA 2XAQA 1S5JA 2ADPA 1K92A 2DJVA 3ZHRA 2ZD9A 1VQ9V 3F5TA 2YUAA 1NR1A 1F4MA 2A9HA 2P4KA 4MVSA 3ETDA 5K1PA 5JCOC 5KX5B 1H2LA 4B3MO 4ABMA 3HKBB 2OWOA 3SPJA 3CRAA 2Q0AA 3OTFA 4LF6O 2R9IA 1PNMA 1K4CC 1F51A 2LFSA 2VQFO 2QA4V 4CC6A 1SC5B 3OT7A 1RPOA 4JV5O 3RYFB 2GUZA 4MW3A 2BSKB 4DR6O 3G6BA 5IE9A 1WPBA 2JJ1G 1AJPA 2EULA 3ETGA 1UPGA 4DV0O 5LYJB 1R3KC 3GWOA 1JA8A 2BTQA 3ZCCA 1KKDA 4I0XB 4WFAV 2EJRA 4MVUA 2JDIG 5KHHA 3K9AA 1LR1A 1FD9A 3L70H 4U3JA 1JFFA 1H8EG 5IY5B 2OCCB 2WLLB 3FAVB 4JZGA 1JOYA 1RFYA 4UVCA 1BSMA 3CB2A 2CGNA 3CCEV 2RN9A 1NQTA 2E74B 5LMNB 2F93B 2ZE6A 1G1XB 1Y66A 3L73H 1Q81W 2FTKA 1GM8A 2HLDG 4QE9A 4I9QA 1M5IA 3OFNG 2N05A 4O4LA 1VQ4V 5EYPB 1P4RA 5EBMC 4JYBA 1OHHG 5LOVB 4B3SB 2F1MA 3OR7C 2BOCC 3JAKA 4KUMA 1SRYA 4PI0A 3QF7A 1Y74A 4IL6Z 4DR3B 1BMFG 1ORQC 4LR3A 3G71V 2QM4A 1XDCA 3TETA 3CCJV 5IYZB 5D5QA 4ICGA 2DE0X 1Y76A 3JASB 5IYBO 4PA7A 4X1KA 4K8XA 4I55A 5H6RA 5KX5A 4DYLA 1Y6XA 4I50B 3LDEA 3FD9A 4EB6B 2XUMA 3E35A 5GTHZ 4NTWA 1EN6A 1PV0A 3ABLC 4BIZA 3TK1A 3RVYA 1PL0A 1XL4A 4FLZA 5LMUB 4TSFG 2IH3C 1K34A 5CBFA 3ZN1A 2QWQB 4DV3B 2JK5C 5JCOA 2WAMA 5H2FZ 4J7JA 2D3OW 3JCUZ 1YCIA 4D7SA 3BABA 4HBNA 4AILC 2PTMA 3STZC 1BL8A 1VQ8V 1Z5VA 1AB3A 4TV8A 4NVPA 4FFBB 1J95A 2ITCC 1VF5B 5B3SC 4F4LA 5JVDA 3A8TA 5CA0A 1ZAUA 2MW2B 3K3WA 3MAQA 2UUAO 4J42A 2KKWA 3U11A 4IGGA 1JQ0A 5EZYB 4JI7O 1PL4A 1FKAO 2A06H 4DR1O 1I7FA 1U96A 5HFMA 1E1RG 5C8YB 3VQYA 1OCRC 4B3RB 4X62O 4I9WA 2ZNIA 4CH4A 4MVZA 3B09A 1FFTB 1VIBA 2FMLA 5B1NA 1KQSU 3DC5A 2ZIOA 1Q8IA 3AG2B 5B1AB 1FPOA 3QG5A 1R73A 2P67A 5EC1C 4DV5B 4XBFA 1XMQO 3UM7A 1ZL8B 2DYSB 4Z1MG 4RUEA 2KG7B 1BGYH 1ZX3A 4B7KA 3SJBC 2YI9A 3ZHSA 1OZ0A 4IYIA 2PGGA 4LNUB 4HNAA 2LGWA 5L3BA 3AK3A 3LDCA 1VF6C 4GKKO 4JI8O 2Y69C 3B4SA 3SYAA 5IWAB 1QBZA 3CXCU 3JD2A 2ZCEA 4MVQA 4UB8Z 3CC7V 3EVKA 1N33B 2ZDIC 3ZMUA 2LQTA 1NH2B 1M56C 1P7GA 4LF9O 5LMUO 3ZRXA 3K5NA 3CJHB 3E8FA 3FYEB 4ZKIA 3AG4C 3BFRA 2UXCO 3JD1A 4LF9B 3CCMV 1O9GA 1XHZA 4RQEA 1ZL8A 2L35A 2JIZG 4LF8O 1KMIZ 2MK3A 2YC0A 2P90A 1P84F 1OCOC 4JI3B 4MTXA 3M8AA 1IBMB 1PPJH 4NXMO 4LFBO 2OTLV 4LF4O 2X6CA 3K58A 4LF5O 3K03A 3CPWU 1OCCC 1MMMA 1H2SB 1ZTEA 3BRCA 2GTAA 3AG4B 3M7MX 3C90A 2LW7A 4KHPO 4DR2B 2NN4A 4D7TA 4B7EA 4EFBA 3ASNC 4LF4B 5IJ9B 4JYYA 3B8MA 4DW1A 2DN9A 2Z5UA 2Y0IA 4MVOA 3K57A 4LP8A 4LFAB 2GHYA 1R3LC 2JS5A 1GAXA 3L9DA 3ETQA 5IJ0A 1GO3F 3E8GA 1FFXA 3W7XA 5KMGA 4UCOA 3H1JH 3MDSA 3U10A 2QKAA 4OXSA 3SPHA 4DV6B 4JAVA 3K9SA 2DW4A 2YXYA 1QR8A 2ZNJA 4X1IB 4B08A 3CJHA 1PNKA 4JTAB 3X2QC 5LBQA 2Q67A 5LHIA 2IM9A 1G6UA 3H01A 2B1IA 2YICA 3SPCA 4MTFA 4LCUC 1N0NA 3E89A 1FXKA 3JAWA 1FAFA 1THZA 3CD6V 2Q73A 4JI0O 4MW8A 5DM6V 3ZHUA 4WCEV 5K1XA 3SPIA 1XEQA 1NVPB 4HYOA 5A2QN 1E1QG 1S0VA 3JAMN 1L0LH 1XREA 2XAJA 1I5YA 4JI0B 4HZ3A 3B77A 3JARB 5KMGB 5B1BC 1B3QA 4BIUA 3D36A 2CTQA 4O4IB 1K7DA 1HP8A 1V54B 3ASOB 5LP6A 3WB0A 2AHYA 1AROP 3B40A 4CS4A 3F7VC 1JJOA 4X1IA 3ZHQA 5CA1B 4QPJA 1KU9A 4DV4O 1N32O 2HEPA 4X1YB 2P22C 5LP6C 5AG2A 1NI8A 3AG1C 5H5NA 4I4TB 4GT1A 1BCCH 1SQQH 3ZRWB 3RYFA 3SJAC 2HVJC 3BCCH 2OIEA 4GUNA 3KKYA 1WN7A 4MS2A 3VQXA 3L71H 3T4DA 1R3IC 1SQPH 3P3PA 2XAGA 1EZJA 1YITV 4DXWA 4LFAO 1M57B 4O4HA 4GX0A 4U7OA 2BSKA 3CCQV 3UCSC 1M57C 5GONB 1N8RW 1DF5A 3RYHA 1ZSPA 3DTUB 4DV3O 2GTSA 4YJ3A 5IT9N 2BTQB 2EIJB 4GX2A 1IDSA 2Q6AA 5FL7G 5IY5C 1GN3A 3D3IA 4PI2A 1E79G 1HNXB 2Q5ZA 2H94A 2Y4UA 4JF3A 5LHHA 4AQYO 3EXAA 3CRMA 3AK1A 1JR9A 5LMNO 4Q20A 1QR9A 4LWSB 2WLIA 3CMEV 5DN6G 4XDJA 3D36C 1NJIW 4MVRA 4X20A 1IBLO 2E75B 1WA8B 2ZE8A 4R7CA 3EFFK 4ZHQB 2HJFC 2EIMC 4IHJA 2ITDC 4B3SO 4WFFA 2R72A 1VQ5V 3KZIZ 5B1BB 1WJZA 4I50A 2A3QA 2IBZH 3CC4V 5EBLC 3UO2A 5F2VO 3OGCC 5GONA 4KP4A 1I08A 3KG2A 3RBZA 2UXXA 2Y48A 5IYZA 3OUSA 1AR5A 4GKJB 3ABMC 4UB6Z 4DV5O 5EYPA 1XOUA 1S5HC 5JH7A 4DV2O 3HR0A 2QKSA 1KKCA 1Z2GA 4X64O 4HAMA 2OCHA 5DEDA 4JI4B 3RFRA 1S76D 1XHXA 3FKSG 3K04A 5LHGA 2E5LO 4DR3O 5CN0A 2KQXA 3N2KA 1YHQV 2R9AA 2Z0AA 5JJNB 1JMKC 3F7YC 2WSSG 1Q86W 1AP6A 3VOUA 2AGAA 4U7NA 2JS3A 4TWKA 4WFEA 3SYQA 3D3QA 3SPGA 2HR3A 4A5UB 4DO2A 5B66Z 1SETA 3TJTA 1I94O 3B8NA 4DR6B 4UFZA 1SQFA 3ZEDA 3E8BA 4DK1A 2JEUA 1HNWO 2VQEB 3IC7A 1SF9A 1S5LZ 1Y4MA 5E1AC 1SQXH 3ZIAG 3SYOA 1LUWA 3K5LA 3ZN0A 3B2EE 1MZEA 1GM7A 1MG1A 4NTYA 1XQ8A 1HR0B 4EFEA 1Y76B 3ABTA 4H37A 1TVKB 1R6TA 4P9PA 1GH6A 2W6JG 2RMKB 4K0KB 2ZE5A 3ZMVA 4UCRA 1S72V 2HFEC 3ETEA 1A32A 3ZRVA 2EX3A 4LF7B 5L3DA 1O9HA 1CPYA 5KAIZ 5FNVB 3BY6A 4GKJO 1RM1B 1AR1B 3JATB 3G4SV 3T1HO 1XNQB 3SGIA 3H1IH 1MNGA 1KYOF 3CP1A 2WLLA 3N27A 3ZHTA 2QKCA 1WP8A 3DC6A 4FM1A 3AK2A 1FS0G 1VQ6V 4TV9A 1W0JG 2DYRC 4FLYA 5C8YA 5EIBD 4MVMA 5BR8B 4UCSA 4DR7O 4PDLA 1N34O 1GKFA 4FMTA 2ZIMA 1MSDA 3G67A 2JJ2G 5BMVA 4DV6O 4GKKB 1EN4A 1IXMA 1VQOV 3P32A 5D5PA 5KHJA 1J5EB 1TUEB 2XHBA 1NTZH 2O57A 2AHZA 5EBWC 2QM8A 1YXBA 3CX5F 4NTXA 4O2BA 2YEVB 2B5UA 3WFVA 5JJJB 3ABLB 1BQ0A 3KCYA 1KBHA 2LO1A 1Y74B 1RPRA 3OE7G 1WPXA 1I0HA 4IYHA 4X88A 3STLC 3CCUV 2ILMA 2WLJA 2UXCB 4PDMA 4O2AA 3CCVV 2KSDA 4GX1A 5IWAO 1V54C 3ASOC 4X1YA 1HNWB 2OT5A 4JTDB 3UQ8A 2OCCC 1OCCB 4YHHB 1AILA 1NVPD 2ZXWB 2UXBB 2R70A 2NNUA 2X6BA 2RNBA 1S3JA 1OCOB 5H9CA 2IJKA 3OAAG 2L6LA 1AP5A 1US6A 2Z3YA 2CTPA 4OGQB 2RQ6A 4MTOA 4BIOA 2F43G 1K97A 3D8CA 4JI3O 3VBBA 3ZRSA 1ZWIC 1SZXA 5CBGA 4IIJB 1YZBA 3CC2V 3OEEG 4RWUA 5BMVB 5HFLA 2PF4E 3MHSC 4JAUA 2M7WA 1N32B 3BHPA 1FXKB 2W0FC 3DGEA 1YTFD 3RT3C 2B9ZA 1UFIA 1GRJA 4JI2B 4JI1O 3G6EV 1I94B 1EZVH 3BEHA 1TAEA 1I5XA 4PELA 1SQBH 3W7SA 1FFXB 3SYCA 2GSMB 1QNMA 3LSSA 1DGSA 3NR7A 1XILA 4YIPA 2CUGA 1XL6A 4X8AA 3JAWB 1CXZB 2HHHO 2HJDA 1GK9A 2ZE7A 2XOKG 2XT9A 3K06A 4LBEC 2AZ2A 4UV8A 2UUCO 1QVGU 4BW9A 1Y67A 1BT8A 1VQKV 1RSOA 1D2DA 4UUJC 1OCRB 3I55V 4BWAA 4LF8B 3J80N 4CH5A 3K59A 1MA1A 2BCCH 3O9OA 2X7RB 4YY3B 1IBKB 1YIJV 4O4JA 2DQ0A 2JGUA 4DK0A 3JARA 4OPHA 1X59A 2VS0A 4XDKA 1HNZB 2PZSA 4JI5B 1K9MW 3UO3A 4QGPA 5CA3A 3JSNA 5IDJA 4DR4B 1R6NA 2QGNA 1UJWB 3IJ4A 4UV9A 1DF4A 4PA9A 3H9VA 2CGOA 1MOFA 5LP6B 4F6RA 4FK5C 4JI7B 4LFCO 2P7TC 3ZBHA 5BR8O 4UCVA 1VQPV 3LSQA 3R66A 3F5WC 4W4KA 3AG3C 1W59A 1W2BU 2A7WA 2WA3A 5KUMA 3O65A 4GCZA 3CE2A 3LUTB 1AI6A 3PN1A 4BW5A 1V9PA 3P30A 5LGNA 3TCUA 5J2TA 3TXSA 3HB3B 4CS2A 1HWYA 1GM9A 3IFXA 3UKMA 5KHKA 4DV1O 1YI2V 3K0GA 2EILB 2CDYA 2XAHA 4JV5B 2HP8A 4PA4A 3ZMSA 4JZ2A 3HKCB 3T2MA 2YXLA 4WBNA 2UUCB 3A0BZ 4ZI7B 1N36O 1F4NA 2OTJV 3PJSK 3BPZA 4JYAB 1GN4A 4PDVA 1R1BA 4QPKA 4J9ZB 1URFA 3OW2U 3CCSV 2XTAA 2CAZC 4IHJB 3H1LH 2HVKC 2V7QG 4X65O 4BR6A 3S3XA 3ZMTA 2ZKOA 3BA9A 2IU0A 4FLUA 1JCHA 3OM3B 1KP3A 3OTOB 4J7ZA 1VF7A 3ASNB 2Y4TA 1GN6A 4X20B 2VWJA 4X9QA 1L0NH 4JI6O 5EZYA 3P3NA 4RQFA 3FB6C 2IJIA 4X62B 2BOBC 2FB5A 1SZTA 1PP9H 4YJ3B 4ZHQA 4KL1A 2EBOA 4Q6GA 2EINB 4J41A 3RYIA 3CRCA 2WLHA 3TXQA 4ZI7A 1D5NA 2Q8VA 2JGDB 4DR5O 3CRRA 1H2KA 2WLMA 4ZBMA 3ZMZA 4NYKA 4LC1A 4UCUA 2EIKB 2Q0OC 5A9GA 4TQFA 1PNLA 1BZKA 5JVDB 1ROPA 1N0JA 2P5OA 1G4YB 1Q90D 1P7BA 4PA6A 1IXBA 1QCEA 3S3WA 2EINC 1NU1H 3H1HH 1COWG 3N2GA 4JI2O 5KA6A 1JFFB 2ZQMA 4U3JB 3T4ZA 1WB8A 3WU2Z 2CH7B 4F6EA 1K5SA 4TT3G 3I5DA 4DUYB 4NB5A 2AW9A 1KB9F 4H33A 1BHAA 4YJ2B 5LGTA 2DYSC 4I4TA 2UUBB 2QM7A 3X2QB 2DWEC 1RM1C 3BAAA 3A0RA 4DV7B 2YIBA 4YY3O 1X4TA 1IBKO 4G27B 3JASA 4JASA 2FKXA 1VQLV 2RJZA 2A79B 2LP7A 4X1KB 1SERA 2WA4A 3K5MA 1XNRO 5LOVA 1DTOA 3BVOA 4P2ZA 1P49A 3OGIB 4DR4O 1SA0A 4TUYB 2QWPB 1FYJA 4X66O 4GYCB 2YIDA 3CMAV 4B3RO 3CSXA 5L3CA 1D5AA 4JYCA 2F4VO 5KLVH 1N4CA 3K0DA 2QTSA 1YSCA 4OX9B 1TUBA 4EKWA 1AJNA 1GN2A 5GTIZ 1H38A 4PHZA 3UT5B 2HG5C 3APQA 4XDLA 4LWSA 1PKXA 4FLVA 5LA6B 3JYCA 2FYUH 4DR5B 3CXHF 2F95B 4O2BB 4TV8B 1AI7A 2V1DA 3JCZA 2PI4A 1QU7A 1YTFB 4Z1VA 1MABG 3KCXA 2YXHA 3WB2A 4CS3A 4U3FH 4CH3A 1H2NA 4N21A 5L3EA 3MHHC 4TUYA 1FXVA 5FNVA 4RO2A 3FB7C 4ASUG 1RP3B 3C3SA 1QLEB 2HHHB 3THOA 3JALA 1PD3A 3ML0A 3RN4A 2PUSA 2XAFA 2EIMB 1NTMH 4ZIBA 1ZUQA 1BQZA 5H6QA 1MZFA 5CB4A 1M1KW 1M9NA 1NTKH 4WFBV 4DUZO 2PI5A 3ABKC
chains in the Genus database with same CATH topology
4AQYO 1FJGO 2UUCO 5IWAO 5LMNO 5LMUO 4LF9O 4K0KO 4X65O 2ZKOA 4YY3O 1IBKO 1D2DA 4JYAO 2FKXA 1HNXO 1N33O 1R6TA 1HNZO 1AB3A 1AILA 4JI0O 2UXCO 3J80N 1IBLO 1KUQA 4LF7O 1XNRO 1XEQA 1G1XB 1IBMO 4DV7O 5A2QN 2UUAO 4DR4O 1A32A 3JAMN 4OPHA 4B3SO 1X59A 3OTOO 4LF8O 4JI6O 1FYJA 4X66O 4B3RO 3M8AA 4DR2O 4NXMO 4LFBO 2UXBO 4GKJO 4JI7O 1DK1A 3T1HO 4LF4O 2F4VO 1FKAO 1XMOO 4B3TO 4DR1O 4LF5O 4JI5O 4X62O 2UU9O 2LW7A 4JI3O 4KHPO 4NXNO 4JI4O 2UXDO 5LL6Y 4DR5O 4DV4O 4LFCO 1XNQO 1N32O 4DV5O 3J81N 1YZBA 5BR8O 4OX9O 4DV2O 5H5NA 3R66A 4X64O 2DJVA 3SDLA 3F5TA 3O65A 2E5LO 3T1YO 1F7YA 1NS1A 4DR3O 5FLXN 1XMQO 5BXZA 4DR7O 4B3MO 2Z0AA 1N34O 3RT3C 4LF6O 2VQFO 4DV6O 4JV5O 4JI1O 4DR6O 4LFAO 4DUYO 2AGAA 2ZM6O 3J7AU 4DV0O 4OPAA 2VQEO 4DV1O 4JI2O 4A5UB 4GKKO 4JI8O 2UUBO 1I94O 4DV3O 2N74A 1J5EO 5IT9N 1N36O 2DOSA 1HNWO 5BY1A 2JRIA 1HR0O 2HHHO 4YHHO 1R1BA 4DUZO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY O;  1FJG O;  2UUC O;  5IWA O;  5LMN O;  5LMU O;  4LF9 O;  4K0K O;  4X65 O;  2ZKO A;  4YY3 O;  1IBK O;  1D2D A;  4JYA O;  2FKX A;  1HNX O;  1N33 O;  1R6T A;  1HNZ O;  1AB3 A;  1AIL A;  4JI0 O;  2UXC O;  3J80 N;  1IBL O;  1KUQ A;  4LF7 O;  1XNR O;  1XEQ A;  1G1X B;  1IBM O;  4DV7 O;  5A2Q N;  2UUA O;  4DR4 O;  1A32 A;  3JAM N;  4OPH A;  4B3S O;  1X59 A;  3OTO O;  4LF8 O;  4JI6 O;  1FYJ A;  4X66 O;  4B3R O;  3M8A A;  4DR2 O;  4NXM O;  4LFB O;  2UXB O;  4GKJ O;  4JI7 O;  1DK1 A;  3T1H O;  4LF4 O;  2F4V O;  1FKA O;  1XMO O;  4B3T O;  4DR1 O;  4LF5 O;  4JI5 O;  4X62 O;  2UU9 O;  2LW7 A;  4JI3 O;  4KHP O;  4NXN O;  4JI4 O;  2UXD O;  5LL6 Y;  4DR5 O;  4DV4 O;  4LFC O;  1XNQ O;  1N32 O;  4DV5 O;  3J81 N;  1YZB A;  5BR8 O;  4OX9 O;  4DV2 O;  5H5N A;  3R66 A;  4X64 O;  2DJV A;  3SDL A;  3F5T A;  3O65 A;  2E5L O;  3T1Y O;  1F7Y A;  1NS1 A;  4DR3 O;  5FLX N;  1XMQ O;  5BXZ A;  4DR7 O;  4B3M O;  2Z0A A;  1N34 O;  3RT3 C;  4LF6 O;  2VQF O;  4DV6 O;  4JV5 O;  4JI1 O;  4DR6 O;  4LFA O;  4DUY O;  2AGA A;  2ZM6 O;  3J7A U;  4DV0 O;  4OPA A;  2VQE O;  4DV1 O;  4JI2 O;  4A5U B;  4GKK O;  4JI8 O;  2UUB O;  1I94 O;  4DV3 O;  2N74 A;  1J5E O;  5IT9 N;  1N36 O;  2DOS A;  1HNW O;  5BY1 A;  2JRI A;  1HR0 O;  2HHH O;  4YHH O;  1R1B A;  4DUZ O; 
#chains in the Genus database with same CATH topology
 5E79 Z;  4J9Y B;  1M93 A;  3SJQ C;  2P6J A;  1R3J C;  4PV1 B;  3L72 H;  3UT5 A;  2ZT9 B;  3CEI A;  4K0K O;  5IYC O;  3OMN B;  1LNQ A;  2E3C A;  1H2G A;  3L75 H;  2D2C B;  3U0Z A;  1CP9 A;  3SJC C;  4JTC B;  1G8M A;  4QNH B;  1Q7Y W;  1AI4 A;  3VQW A;  2QWN B;  2FL4 A;  1ENV A;  3AG1 B;  3QO8 A;  3OTO O;  2HKO A;  1IBL B;  5J2T B;  2UU9 B;  3W7W A;  3OEH G;  2ATK C;  4J7K A;  3OMA B;  4RAI A;  2XND G;  3E86 A;  1SQV H;  1XUQ A;  4DV4 B;  4B3T O;  3JD4 A;  1EN5 A;  4JI6 B;  5CA1 A;  1NZ6 A;  5CB4 B;  4FLW A;  2Y0P A;  5B5E Z;  1K3E A;  4WBN B;  3LNN A;  2ZIN A;  4MT8 A;  1H2M A;  3JD3 A;  1JPX A;  4O2A B;  3ZRW A;  1XMO B;  2F66 C;  5KHG A;  5J2U B;  2ADQ B;  3CHX A;  4JAA A;  4DR7 B;  2Q7G A;  5BZB A;  3SDL A;  2YS8 A;  3IGA C;  3CYO A;  2DQ3 A;  3OUF A;  2DYR B;  5FLX N;  1FXH A;  2QE7 G;  4C7U A;  4ZOL A;  5DEC A;  3CWB H;  1BHB A;  4O4H B;  2E5L B;  4DUY O;  2ZM6 O;  2H8P C;  3J7A U;  1Z5W A;  3FX7 A;  2KB1 A;  2UUB O;  4AHC A;  1L1F A;  1QLN A;  1YJ9 V;  2DOS A;  4DV0 B;  2Y69 B;  5KHI A;  3OR6 C;  4FFK A;  1YVW A;  5BY1 A;  4GZR B;  3E22 B;  4YHH O;  4AI8 A;  1WAZ A;  3SR2 C;  2N04 A;  4PD4 F;  1XNR B;  5KAF Z;  2EZO A;  2BE3 A;  3L74 H;  1HNZ O;  4QIW F;  1RSO B;  1EBO A;  5JWP A;  2ETN A;  1BS3 A;  4FIP C;  4G2K A;  2ZXW C;  3AG2 C;  5B1A C;  2F23 A;  4L8J A;  2GUZ B;  4MSW C;  1YF2 A;  4DR2 O;  2OYQ A;  2LFR A;  2UXD B;  3FB8 C;  2P4V A;  2W0X A;  4CH6 A;  2CH7 A;  4FJC C;  1YDX A;  3ABM B;  4PA3 A;  4CBC A;  4NXN O;  2Q9L A;  5L3G A;  1EM1 A;  3WG7 B;  1XMQ B;  3GWK C;  4OX9 O;  5IJ0 B;  2VQF B;  2YI8 A;  2WLN A;  1WA8 A;  2EIK C;  2WLI B;  1OV9 A;  2AZ0 A;  2Q7H A;  4K3A A;  2B1G A;  1M56 B;  5EK0 A;  1L8D A;  4P30 A;  2EIL C;  1H8H G;  2Q68 A;  2IW5 A;  4KXR A;  3E22 A;  1QVF U;  3WG7 C;  2C2A A;  4QE7 A;  1K33 A;  5KA5 A;  4GLX A;  2H3O A;  3CS5 A;  5ITZ A;  1J5E O;  3E2E A;  1NBM G;  2JRI A;  1OCZ B;  3JAK B;  3ZHV A;  2UXN A;  4DRX B;  1NKD A;  2GBO A;  3JD0 A;  3BA8 A;  2YIA A;  3HKE B;  1DLB A;  3DSQ A;  1KC8 W;  5FPR A;  4O4L B;  1WP7 A;  1WLE A;  4JPR A;  3HKB A;  1KUQ A;  1Q82 W;  4LF7 O;  1U97 A;  3I56 V;  3QO7 A;  3H1K H;  3N2K B;  4QJF B;  1SS3 A;  1Q6H A;  1HDJ A;  5LYJ A;  3A0H Z;  1EFR G;  2AXT Z;  3APO A;  1AR4 A;  1WB7 A;  1VEW A;  3HKC A;  1DK1 A;  4LFC B;  1GTO A;  1IZ3 A;  4X66 B;  1Q3E A;  4CZZ A;  5ITZ B;  2ODM A;  4UCT A;  4NKG B;  2XAS A;  3FAV A;  3HKE A;  3T1Y B;  3RW0 A;  4BAY A;  5L3F A;  3QO5 A;  3JAT A;  4DRX A;  4W4L A;  1VAR A;  2R9R B;  1JJ2 U;  4KHP B;  4LF6 B;  5JQG B;  4JI1 B;  3JSL A;  2CK3 G;  3T1Y O;  4EEQ A;  3AG3 B;  2QR4 A;  1SES A;  5BXZ A;  1NT2 B;  1TVK A;  3IAY A;  3ABK B;  2JVD A;  3N2G B;  2YDE A;  4TV9 B;  1LUV A;  4FVM A;  3QTC A;  4E2L A;  2ARH A;  2QSA A;  4YXW G;  2CE4 A;  4YJ2 A;  1N34 B;  5EC2 C;  2PYL A;  1W0K G;  1KP2 A;  4EB6 A;  5LGU A;  1TA8 A;  2V4D A;  4F6R B;  1OCZ C;  2M6Y A;  1B6Q A;  1TUB B;  2DWD C;  1SKV A;  2VWK A;  2NR5 A;  4PJ0 Z;  2Q4P A;  2A0L A;  2YEV A;  2LJ2 A;  1F23 A;  3K79 A;  5JQG A;  1K73 W;  3FYI B;  1SA0 B;  2LW1 A;  2ZR2 A;  1SQG A;  4DW0 A;  1HNX O;  3TGU H;  4WFH A;  4UVB A;  2X6A A;  1QLE C;  4RUF A;  4AQY B;  2W6I G;  4I55 B;  4FM2 A;  4NXM B;  3A2F A;  1Q5O A;  4LFB B;  5EIB C;  4FFB A;  1BE3 H;  5B3S B;  2WPD G;  4H44 B;  3ICX A;  3WB1 A;  2WWW A;  1JX9 A;  5IYD O;  2IJH A;  5CBH A;  5CA0 B;  5JH7 B;  4J11 A;  2CTR A;  3K5O A;  1B04 A;  3W7T A;  3FB5 C;  4K8Z A;  1K8A W;  1K4D C;  1XBL A;  1NH2 D;  2RCV A;  4B3T B;  1V55 C;  4LF5 B;  5LA6 A;  1VP7 A;  2OIG A;  1FXK C;  1QQC A;  1QHT A;  4UVA A;  4Z2W A;  1F7Y A;  3MD0 A;  1B06 A;  4DV1 B;  4X89 A;  1AI5 A;  2DMX A;  2PYJ A;  3AEI A;  1AVM A;  4HNA B;  2RDC A;  3QNE A;  5LXT B;  4B3M B;  1N36 B;  1M4U A;  4OPA A;  2VQE O;  3M99 B;  2QDO A;  2BTO A;  1K5Q A;  2EIJ C;  4TQD A;  2N74 A;  4KFM A;  5CMU A;  2VRZ A;  4GX5 A;  1M90 W;  2YSU B;  4J10 A;  2QWO B;  4X65 B;  4I5S A;  4LNU A;  1HR0 O;  1R6K A;  2GV9 A;  1WNS A;  4UXN A;  3IC9 A;  1GMG A;  3JAL B;  1MSW D;  5IJ9 A;  1FJG O;  4IIJ A;  4R8C A;  2ZR3 A;  1IX9 A;  3Q4H B;  2WLK A;  4JYA O;  3DXR A;  4R50 A;  2EJ7 A;  2LGQ A;  2KG7 A;  3GVM A;  4JGS A;  3QVN A;  1Q6I A;  3GB7 C;  2K9P A;  2IJJ A;  1IBM O;  1HW7 A;  3ZJZ A;  4DV7 O;  4FZ1 A;  3RWR D;  1IUR A;  3ZX6 A;  1YEW A;  3RGB A;  5LXT A;  1NR7 A;  2UXB O;  1TGO A;  2NLJ C;  2CTW A;  3HKD B;  1Q43 A;  1KD1 W;  1XMO O;  2QEX V;  2X0L A;  3FFQ A;  4FZ0 A;  4O4J B;  3HPL C;  4I7Z B;  1YJW V;  4K35 A;  3OMI B;  1V55 B;  4FLX A;  4JI4 O;  1VF6 A;  5KUK A;  2UXD O;  5LL6 Y;  1VQ7 V;  1XNQ O;  3J81 N;  5B1O A;  1T5E A;  2IU3 A;  3VQV A;  4FM0 A;  4LH6 A;  4J80 A;  1Q6U A;  4D6T H;  4NXN B;  4L87 A;  5GW7 A;  1NS1 A;  2ZM6 B;  3EHB B;  4PDR A;  1VQN V;  4JI8 B;  4IT5 A;  1XI1 A;  4N23 A;  1IVS A;  4R6Z A;  5TIS Z;  1PM9 A;  2EZP A;  3RYC B;  3AG7 A;  1VQM V;  4LH7 A;  2QJ1 A;  4ZOL B;  5J9P C;  1OJH A;  3W7U A;  4G28 B;  4CC5 A;  4O4I A;  2IH1 C;  1CEZ A;  2K1E A;  3Q4H A;  3LDD A;  3K08 A;  3NXS A;  5J2U A;  2E76 B;  3CCR V;  4H13 B;  2PY5 A;  3C3T A;  4FLT A;  4WF9 V;  4E4E A;  3E8H A;  1S77 D;  5JJE B;  1VMG A;  3RVZ A;  4H0L B;  3LNM B;  2YIB D;  1YJN V;  1N33 O;  2QTO A;  4DUZ B;  2P06 A;  2JEX A;  1FJG B;  2GDS A;  3DXR B;  3R65 A;  3G80 A;  3LSU A;  2QWR B;  3OD4 A;  3E83 A;  4TOI A;  1ZLZ A;  1JVM A;  4FPP A;  5FPO A;  3RYC A;  3ABU A;  3CRQ A;  2Q69 A;  4WFG A;  3T1C A;  3CCL V;  3RYI B;  2UUA B;  2ZDI A;  4MTG A;  4JI5 O;  4DV2 B;  2JGD A;  3RYH B;  4X64 B;  3HKD A;  4I0X A;  2UU9 O;  1AJQ A;  5C93 A;  2Q7E A;  4P9O A;  2G38 A;  3SYP A;  2F4V B;  3ZS8 C;  3T1H B;  4NR1 A;  4DR1 B;  1KEC A;  4YIO A;  2XAQ A;  1S5J A;  2ADP A;  1K92 A;  2DJV A;  3ZHR A;  2ZD9 A;  1VQ9 V;  3F5T A;  2YUA A;  1NR1 A;  1F4M A;  2A9H A;  2P4K A;  4MVS A;  3ETD A;  5K1P A;  5JCO C;  5KX5 B;  1H2L A;  4B3M O;  4ABM A;  3HKB B;  2OWO A;  3SPJ A;  3CRA A;  2Q0A A;  3OTF A;  4LF6 O;  2R9I A;  1PNM A;  1K4C C;  1F51 A;  2LFS A;  2VQF O;  2QA4 V;  4CC6 A;  1SC5 B;  3OT7 A;  1RPO A;  4JV5 O;  3RYF B;  2GUZ A;  4MW3 A;  2BSK B;  4DR6 O;  3G6B A;  5IE9 A;  1WPB A;  2JJ1 G;  1AJP A;  2EUL A;  3ETG A;  1UPG A;  4DV0 O;  5LYJ B;  1R3K C;  3GWO A;  1JA8 A;  2BTQ A;  3ZCC A;  1KKD A;  4I0X B;  4WFA V;  2EJR A;  4MVU A;  2JDI G;  5KHH A;  3K9A A;  1LR1 A;  1FD9 A;  3L70 H;  4U3J A;  1JFF A;  1H8E G;  5IY5 B;  2OCC B;  2WLL B;  3FAV B;  4JZG A;  1JOY A;  1RFY A;  4UVC A;  1BSM A;  3CB2 A;  2CGN A;  3CCE V;  2RN9 A;  1NQT A;  2E74 B;  5LMN B;  2F93 B;  2ZE6 A;  1G1X B;  1Y66 A;  3L73 H;  1Q81 W;  2FTK A;  1GM8 A;  2HLD G;  4QE9 A;  4I9Q A;  1M5I A;  3OFN G;  2N05 A;  4O4L A;  1VQ4 V;  5EYP B;  1P4R A;  5EBM C;  4JYB A;  1OHH G;  5LOV B;  4B3S B;  2F1M A;  3OR7 C;  2BOC C;  3JAK A;  4KUM A;  1SRY A;  4PI0 A;  3QF7 A;  1Y74 A;  4IL6 Z;  4DR3 B;  1BMF G;  1ORQ C;  4LR3 A;  3G71 V;  2QM4 A;  1XDC A;  3TET A;  3CCJ V;  5IYZ B;  5D5Q A;  4ICG A;  2DE0 X;  1Y76 A;  3JAS B;  5IYB O;  4PA7 A;  4X1K A;  4K8X A;  4I55 A;  5H6R A;  5KX5 A;  4DYL A;  1Y6X A;  4I50 B;  3LDE A;  3FD9 A;  4EB6 B;  2XUM A;  3E35 A;  5GTH Z;  4NTW A;  1EN6 A;  1PV0 A;  3ABL C;  4BIZ A;  3TK1 A;  3RVY A;  1PL0 A;  1XL4 A;  4FLZ A;  5LMU B;  4TSF G;  2IH3 C;  1K34 A;  5CBF A;  3ZN1 A;  2QWQ B;  4DV3 B;  2JK5 C;  5JCO A;  2WAM A;  5H2F Z;  4J7J A;  2D3O W;  3JCU Z;  1YCI A;  4D7S A;  3BAB A;  4HBN A;  4AIL C;  2PTM A;  3STZ C;  1BL8 A;  1VQ8 V;  1Z5V A;  1AB3 A;  4TV8 A;  4NVP A;  4FFB B;  1J95 A;  2ITC C;  1VF5 B;  5B3S C;  4F4L A;  5JVD A;  3A8T A;  5CA0 A;  1ZAU A;  2MW2 B;  3K3W A;  3MAQ A;  2UUA O;  4J42 A;  2KKW A;  3U11 A;  4IGG A;  1JQ0 A;  5EZY B;  4JI7 O;  1PL4 A;  1FKA O;  2A06 H;  4DR1 O;  1I7F A;  1U96 A;  5HFM A;  1E1R G;  5C8Y B;  3VQY A;  1OCR C;  4B3R B;  4X62 O;  4I9W A;  2ZNI A;  4CH4 A;  4MVZ A;  3B09 A;  1FFT B;  1VIB A;  2FML A;  5B1N A;  1KQS U;  3DC5 A;  2ZIO A;  1Q8I A;  3AG2 B;  5B1A B;  1FPO A;  3QG5 A;  1R73 A;  2P67 A;  5EC1 C;  4DV5 B;  4XBF A;  1XMQ O;  3UM7 A;  1ZL8 B;  2DYS B;  4Z1M G;  4RUE A;  2KG7 B;  1BGY H;  1ZX3 A;  4B7K A;  3SJB C;  2YI9 A;  3ZHS A;  1OZ0 A;  4IYI A;  2PGG A;  4LNU B;  4HNA A;  2LGW A;  5L3B A;  3AK3 A;  3LDC A;  1VF6 C;  4GKK O;  4JI8 O;  2Y69 C;  3B4S A;  3SYA A;  5IWA B;  1QBZ A;  3CXC U;  3JD2 A;  2ZCE A;  4MVQ A;  4UB8 Z;  3CC7 V;  3EVK A;  1N33 B;  2ZDI C;  3ZMU A;  2LQT A;  1NH2 B;  1M56 C;  1P7G A;  4LF9 O;  5LMU O;  3ZRX A;  3K5N A;  3CJH B;  3E8F A;  3FYE B;  4ZKI A;  3AG4 C;  3BFR A;  2UXC O;  3JD1 A;  4LF9 B;  3CCM V;  1O9G A;  1XHZ A;  4RQE A;  1ZL8 A;  2L35 A;  2JIZ G;  4LF8 O;  1KMI Z;  2MK3 A;  2YC0 A;  2P90 A;  1P84 F;  1OCO C;  4JI3 B;  4MTX A;  3M8A A;  1IBM B;  1PPJ H;  4NXM O;  4LFB O;  2OTL V;  4LF4 O;  2X6C A;  3K58 A;  4LF5 O;  3K03 A;  3CPW U;  1OCC C;  1MMM A;  1H2S B;  1ZTE A;  3BRC A;  2GTA A;  3AG4 B;  3M7M X;  3C90 A;  2LW7 A;  4KHP O;  4DR2 B;  2NN4 A;  4D7T A;  4B7E A;  4EFB A;  3ASN C;  4LF4 B;  5IJ9 B;  4JYY A;  3B8M A;  4DW1 A;  2DN9 A;  2Z5U A;  2Y0I A;  4MVO A;  3K57 A;  4LP8 A;  4LFA B;  2GHY A;  1R3L C;  2JS5 A;  1GAX A;  3L9D A;  3ETQ A;  5IJ0 A;  1GO3 F;  3E8G A;  1FFX A;  3W7X A;  5KMG A;  4UCO A;  3H1J H;  3MDS A;  3U10 A;  2QKA A;  4OXS A;  3SPH A;  4DV6 B;  4JAV A;  3K9S A;  2DW4 A;  2YXY A;  1QR8 A;  2ZNJ A;  4X1I B;  4B08 A;  3CJH A;  1PNK A;  4JTA B;  3X2Q C;  5LBQ A;  2Q67 A;  5LHI A;  2IM9 A;  1G6U A;  3H01 A;  2B1I A;  2YIC A;  3SPC A;  4MTF A;  4LCU C;  1N0N A;  3E89 A;  1FXK A;  3JAW A;  1FAF A;  1THZ A;  3CD6 V;  2Q73 A;  4JI0 O;  4MW8 A;  5DM6 V;  3ZHU A;  4WCE V;  5K1X A;  3SPI A;  1XEQ A;  1NVP B;  4HYO A;  5A2Q N;  1E1Q G;  1S0V A;  3JAM N;  1L0L H;  1XRE A;  2XAJ A;  1I5Y A;  4JI0 B;  4HZ3 A;  3B77 A;  3JAR B;  5KMG B;  5B1B C;  1B3Q A;  4BIU A;  3D36 A;  2CTQ A;  4O4I B;  1K7D A;  1HP8 A;  1V54 B;  3ASO B;  5LP6 A;  3WB0 A;  2AHY A;  1ARO P;  3B40 A;  4CS4 A;  3F7V C;  1JJO A;  4X1I A;  3ZHQ A;  5CA1 B;  4QPJ A;  1KU9 A;  4DV4 O;  1N32 O;  2HEP A;  4X1Y B;  2P22 C;  5LP6 C;  5AG2 A;  1NI8 A;  3AG1 C;  5H5N A;  4I4T B;  4GT1 A;  1BCC H;  1SQQ H;  3ZRW B;  3RYF A;  3SJA C;  2HVJ C;  3BCC H;  2OIE A;  4GUN A;  3KKY A;  1WN7 A;  4MS2 A;  3VQX A;  3L71 H;  3T4D A;  1R3I C;  1SQP H;  3P3P A;  2XAG A;  1EZJ A;  1YIT V;  4DXW A;  4LFA O;  1M57 B;  4O4H A;  4GX0 A;  4U7O A;  2BSK A;  3CCQ V;  3UCS C;  1M57 C;  5GON B;  1N8R W;  1DF5 A;  3RYH A;  1ZSP A;  3DTU B;  4DV3 O;  2GTS A;  4YJ3 A;  5IT9 N;  2BTQ B;  2EIJ B;  4GX2 A;  1IDS A;  2Q6A A;  5FL7 G;  5IY5 C;  1GN3 A;  3D3I A;  4PI2 A;  1E79 G;  1HNX B;  2Q5Z A;  2H94 A;  2Y4U A;  4JF3 A;  5LHH A;  4AQY O;  3EXA A;  3CRM A;  3AK1 A;  1JR9 A;  5LMN O;  4Q20 A;  1QR9 A;  4LWS B;  2WLI A;  3CME V;  5DN6 G;  4XDJ A;  3D36 C;  1NJI W;  4MVR A;  4X20 A;  1IBL O;  2E75 B;  1WA8 B;  2ZE8 A;  4R7C A;  3EFF K;  4ZHQ B;  2HJF C;  2EIM C;  4IHJ A;  2ITD C;  4B3S O;  4WFF A;  2R72 A;  1VQ5 V;  3KZI Z;  5B1B B;  1WJZ A;  4I50 A;  2A3Q A;  2IBZ H;  3CC4 V;  5EBL C;  3UO2 A;  5F2V O;  3OGC C;  5GON A;  4KP4 A;  1I08 A;  3KG2 A;  3RBZ A;  2UXX A;  2Y48 A;  5IYZ A;  3OUS A;  1AR5 A;  4GKJ B;  3ABM C;  4UB6 Z;  4DV5 O;  5EYP A;  1XOU A;  1S5H C;  5JH7 A;  4DV2 O;  3HR0 A;  2QKS A;  1KKC A;  1Z2G A;  4X64 O;  4HAM A;  2OCH A;  5DED A;  4JI4 B;  3RFR A;  1S76 D;  1XHX A;  3FKS G;  3K04 A;  5LHG A;  2E5L O;  4DR3 O;  5CN0 A;  2KQX A;  3N2K A;  1YHQ V;  2R9A A;  2Z0A A;  5JJN B;  1JMK C;  3F7Y C;  2WSS G;  1Q86 W;  1AP6 A;  3VOU A;  2AGA A;  4U7N A;  2JS3 A;  4TWK A;  4WFE A;  3SYQ A;  3D3Q A;  3SPG A;  2HR3 A;  4A5U B;  4DO2 A;  5B66 Z;  1SET A;  3TJT A;  1I94 O;  3B8N A;  4DR6 B;  4UFZ A;  1SQF A;  3ZED A;  3E8B A;  4DK1 A;  2JEU A;  1HNW O;  2VQE B;  3IC7 A;  1SF9 A;  1S5L Z;  1Y4M A;  5E1A C;  1SQX H;  3ZIA G;  3SYO A;  1LUW A;  3K5L A;  3ZN0 A;  3B2E E;  1MZE A;  1GM7 A;  1MG1 A;  4NTY A;  1XQ8 A;  1HR0 B;  4EFE A;  1Y76 B;  3ABT A;  4H37 A;  1TVK B;  1R6T A;  4P9P A;  1GH6 A;  2W6J G;  2RMK B;  4K0K B;  2ZE5 A;  3ZMV A;  4UCR A;  1S72 V;  2HFE C;  3ETE A;  1A32 A;  3ZRV A;  2EX3 A;  4LF7 B;  5L3D A;  1O9H A;  1CPY A;  5KAI Z;  5FNV B;  3BY6 A;  4GKJ O;  1RM1 B;  1AR1 B;  3JAT B;  3G4S V;  3T1H O;  1XNQ B;  3SGI A;  3H1I H;  1MNG A;  1KYO F;  3CP1 A;  2WLL A;  3N27 A;  3ZHT A;  2QKC A;  1WP8 A;  3DC6 A;  4FM1 A;  3AK2 A;  1FS0 G;  1VQ6 V;  4TV9 A;  1W0J G;  2DYR C;  4FLY A;  5C8Y A;  5EIB D;  4MVM A;  5BR8 B;  4UCS A;  4DR7 O;  4PDL A;  1N34 O;  1GKF A;  4FMT A;  2ZIM A;  1MSD A;  3G67 A;  2JJ2 G;  5BMV A;  4DV6 O;  4GKK B;  1EN4 A;  1IXM A;  1VQO V;  3P32 A;  5D5P A;  5KHJ A;  1J5E B;  1TUE B;  2XHB A;  1NTZ H;  2O57 A;  2AHZ A;  5EBW C;  2QM8 A;  1YXB A;  3CX5 F;  4NTX A;  4O2B A;  2YEV B;  2B5U A;  3WFV A;  5JJJ B;  3ABL B;  1BQ0 A;  3KCY A;  1KBH A;  2LO1 A;  1Y74 B;  1RPR A;  3OE7 G;  1WPX A;  1I0H A;  4IYH A;  4X88 A;  3STL C;  3CCU V;  2ILM A;  2WLJ A;  2UXC B;  4PDM A;  4O2A A;  3CCV V;  2KSD A;  4GX1 A;  5IWA O;  1V54 C;  3ASO C;  4X1Y A;  1HNW B;  2OT5 A;  4JTD B;  3UQ8 A;  2OCC C;  1OCC B;  4YHH B;  1AIL A;  1NVP D;  2ZXW B;  2UXB B;  2R70 A;  2NNU A;  2X6B A;  2RNB A;  1S3J A;  1OCO B;  5H9C A;  2IJK A;  3OAA G;  2L6L A;  1AP5 A;  1US6 A;  2Z3Y A;  2CTP A;  4OGQ B;  2RQ6 A;  4MTO A;  4BIO A;  2F43 G;  1K97 A;  3D8C A;  4JI3 O;  3VBB A;  3ZRS A;  1ZWI C;  1SZX A;  5CBG A;  4IIJ B;  1YZB A;  3CC2 V;  3OEE G;  4RWU A;  5BMV B;  5HFL A;  2PF4 E;  3MHS C;  4JAU A;  2M7W A;  1N32 B;  3BHP A;  1FXK B;  2W0F C;  3DGE A;  1YTF D;  3RT3 C;  2B9Z A;  1UFI A;  1GRJ A;  4JI2 B;  4JI1 O;  3G6E V;  1I94 B;  1EZV H;  3BEH A;  1TAE A;  1I5X A;  4PEL A;  1SQB H;  3W7S A;  1FFX B;  3SYC A;  2GSM B;  1QNM A;  3LSS A;  1DGS A;  3NR7 A;  1XIL A;  4YIP A;  2CUG A;  1XL6 A;  4X8A A;  3JAW B;  1CXZ B;  2HHH O;  2HJD A;  1GK9 A;  2ZE7 A;  2XOK G;  2XT9 A;  3K06 A;  4LBE C;  2AZ2 A;  4UV8 A;  2UUC O;  1QVG U;  4BW9 A;  1Y67 A;  1BT8 A;  1VQK V;  1RSO A;  1D2D A;  4UUJ C;  1OCR B;  3I55 V;  4BWA A;  4LF8 B;  3J80 N;  4CH5 A;  3K59 A;  1MA1 A;  2BCC H;  3O9O A;  2X7R B;  4YY3 B;  1IBK B;  1YIJ V;  4O4J A;  2DQ0 A;  2JGU A;  4DK0 A;  3JAR A;  4OPH A;  1X59 A;  2VS0 A;  4XDK A;  1HNZ B;  2PZS A;  4JI5 B;  1K9M W;  3UO3 A;  4QGP A;  5CA3 A;  3JSN A;  5IDJ A;  4DR4 B;  1R6N A;  2QGN A;  1UJW B;  3IJ4 A;  4UV9 A;  1DF4 A;  4PA9 A;  3H9V A;  2CGO A;  1MOF A;  5LP6 B;  4F6R A;  4FK5 C;  4JI7 B;  4LFC O;  2P7T C;  3ZBH A;  5BR8 O;  4UCV A;  1VQP V;  3LSQ A;  3R66 A;  3F5W C;  4W4K A;  3AG3 C;  1W59 A;  1W2B U;  2A7W A;  2WA3 A;  5KUM A;  3O65 A;  4GCZ A;  3CE2 A;  3LUT B;  1AI6 A;  3PN1 A;  4BW5 A;  1V9P A;  3P30 A;  5LGN A;  3TCU A;  5J2T A;  3TXS A;  3HB3 B;  4CS2 A;  1HWY A;  1GM9 A;  3IFX A;  3UKM A;  5KHK A;  4DV1 O;  1YI2 V;  3K0G A;  2EIL B;  2CDY A;  2XAH A;  4JV5 B;  2HP8 A;  4PA4 A;  3ZMS A;  4JZ2 A;  3HKC B;  3T2M A;  2YXL A;  4WBN A;  2UUC B;  3A0B Z;  4ZI7 B;  1N36 O;  1F4N A;  2OTJ V;  3PJS K;  3BPZ A;  4JYA B;  1GN4 A;  4PDV A;  1R1B A;  4QPK A;  4J9Z B;  1URF A;  3OW2 U;  3CCS V;  2XTA A;  2CAZ C;  4IHJ B;  3H1L H;  2HVK C;  2V7Q G;  4X65 O;  4BR6 A;  3S3X A;  3ZMT A;  2ZKO A;  3BA9 A;  2IU0 A;  4FLU A;  1JCH A;  3OM3 B;  1KP3 A;  3OTO B;  4J7Z A;  1VF7 A;  3ASN B;  2Y4T A;  1GN6 A;  4X20 B;  2VWJ A;  4X9Q A;  1L0N H;  4JI6 O;  5EZY A;  3P3N A;  4RQF A;  3FB6 C;  2IJI A;  4X62 B;  2BOB C;  2FB5 A;  1SZT A;  1PP9 H;  4YJ3 B;  4ZHQ A;  4KL1 A;  2EBO A;  4Q6G A;  2EIN B;  4J41 A;  3RYI A;  3CRC A;  2WLH A;  3TXQ A;  4ZI7 A;  1D5N A;  2Q8V A;  2JGD B;  4DR5 O;  3CRR A;  1H2K A;  2WLM A;  4ZBM A;  3ZMZ A;  4NYK A;  4LC1 A;  4UCU A;  2EIK B;  2Q0O C;  5A9G A;  4TQF A;  1PNL A;  1BZK A;  5JVD B;  1ROP A;  1N0J A;  2P5O A;  1G4Y B;  1Q90 D;  1P7B A;  4PA6 A;  1IXB A;  1QCE A;  3S3W A;  2EIN C;  1NU1 H;  3H1H H;  1COW G;  3N2G A;  4JI2 O;  5KA6 A;  1JFF B;  2ZQM A;  4U3J B;  3T4Z A;  1WB8 A;  3WU2 Z;  2CH7 B;  4F6E A;  1K5S A;  4TT3 G;  3I5D A;  4DUY B;  4NB5 A;  2AW9 A;  1KB9 F;  4H33 A;  1BHA A;  4YJ2 B;  5LGT A;  2DYS C;  4I4T A;  2UUB B;  2QM7 A;  3X2Q B;  2DWE C;  1RM1 C;  3BAA A;  3A0R A;  4DV7 B;  2YIB A;  4YY3 O;  1X4T A;  1IBK O;  4G27 B;  3JAS A;  4JAS A;  2FKX A;  1VQL V;  2RJZ A;  2A79 B;  2LP7 A;  4X1K B;  1SER A;  2WA4 A;  3K5M A;  1XNR O;  5LOV A;  1DTO A;  3BVO A;  4P2Z A;  1P49 A;  3OGI B;  4DR4 O;  1SA0 A;  4TUY B;  2QWP B;  1FYJ A;  4X66 O;  4GYC B;  2YID A;  3CMA V;  4B3R O;  3CSX A;  5L3C A;  1D5A A;  4JYC A;  2F4V O;  5KLV H;  1N4C A;  3K0D A;  2QTS A;  1YSC A;  4OX9 B;  1TUB A;  4EKW A;  1AJN A;  1GN2 A;  5GTI Z;  1H38 A;  4PHZ A;  3UT5 B;  2HG5 C;  3APQ A;  4XDL A;  4LWS A;  1PKX A;  4FLV A;  5LA6 B;  3JYC A;  2FYU H;  4DR5 B;  3CXH F;  2F95 B;  4O2B B;  4TV8 B;  1AI7 A;  2V1D A;  3JCZ A;  2PI4 A;  1QU7 A;  1YTF B;  4Z1V A;  1MAB G;  3KCX A;  2YXH A;  3WB2 A;  4CS3 A;  4U3F H;  4CH3 A;  1H2N A;  4N21 A;  5L3E A;  3MHH C;  4TUY A;  1FXV A;  5FNV A;  4RO2 A;  3FB7 C;  4ASU G;  1RP3 B;  3C3S A;  1QLE B;  2HHH B;  3THO A;  3JAL A;  1PD3 A;  3ML0 A;  3RN4 A;  2PUS A;  2XAF A;  2EIM B;  1NTM H;  4ZIB A;  1ZUQ A;  1BQZ A;  5H6Q A;  1MZF A;  5CB4 A;  1M1K W;  1M9N A;  1NTK H;  4WFB V;  4DUZ O;  2PI5 A;  3ABK C; 
#chains in the Genus database with same CATH homology
 4AQY O;  1FJG O;  2UUC O;  5IWA O;  5LMN O;  5LMU O;  4LF9 O;  4K0K O;  4X65 O;  2ZKO A;  4YY3 O;  1IBK O;  1D2D A;  4JYA O;  2FKX A;  1HNX O;  1N33 O;  1R6T A;  1HNZ O;  1AB3 A;  1AIL A;  4JI0 O;  2UXC O;  3J80 N;  1IBL O;  1KUQ A;  4LF7 O;  1XNR O;  1XEQ A;  1G1X B;  1IBM O;  4DV7 O;  5A2Q N;  2UUA O;  4DR4 O;  1A32 A;  3JAM N;  4OPH A;  4B3S O;  1X59 A;  3OTO O;  4LF8 O;  4JI6 O;  1FYJ A;  4X66 O;  4B3R O;  3M8A A;  4DR2 O;  4NXM O;  4LFB O;  2UXB O;  4GKJ O;  4JI7 O;  1DK1 A;  3T1H O;  4LF4 O;  2F4V O;  1FKA O;  1XMO O;  4B3T O;  4DR1 O;  4LF5 O;  4JI5 O;  4X62 O;  2UU9 O;  2LW7 A;  4JI3 O;  4KHP O;  4NXN O;  4JI4 O;  2UXD O;  5LL6 Y;  4DR5 O;  4DV4 O;  4LFC O;  1XNQ O;  1N32 O;  4DV5 O;  3J81 N;  1YZB A;  5BR8 O;  4OX9 O;  4DV2 O;  5H5N A;  3R66 A;  4X64 O;  2DJV A;  3SDL A;  3F5T A;  3O65 A;  2E5L O;  3T1Y O;  1F7Y A;  1NS1 A;  4DR3 O;  5FLX N;  1XMQ O;  5BXZ A;  4DR7 O;  4B3M O;  2Z0A A;  1N34 O;  3RT3 C;  4LF6 O;  2VQF O;  4DV6 O;  4JV5 O;  4JI1 O;  4DR6 O;  4LFA O;  4DUY O;  2AGA A;  2ZM6 O;  3J7A U;  4DV0 O;  4OPA A;  2VQE O;  4DV1 O;  4JI2 O;  4A5U B;  4GKK O;  4JI8 O;  2UUB O;  1I94 O;  4DV3 O;  2N74 A;  1J5E O;  5IT9 N;  1N36 O;  2DOS A;  1HNW O;  5BY1 A;  2JRI A;  1HR0 O;  2HHH O;  4YHH O;  1R1B A;  4DUZ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...