5IYCO

Human core-pic in the initial transcribing state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
O PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5iycO01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 5iycO02
1NVPC 1RM1C 1YTFD 1NVPD 1NH2D 5IYBO 1YTFC 5IYCO 5IYDO 1NH2C 1RM1B
chains in the Genus database with same CATH superfamily
2HLDG 1Q43A 2X6AA 2R9IA 4DV2B 4PJ0Z 1NS1A 4FVMA 3ZN1A 2EIJB 4HBNA 4NB5A 1ZAUA 4XDJA 3JAKA 1PKXA 3CRRA 3JARA 4I9QA 3W7SA 3CWBH 1NI8A 5C8YA 2B9ZA 5LGUA 1RSOA 3CE2A 2G38A 3D3IA 1AI7A 3F5TA 1BSMA 2IH1C 1N36O 1QR9A 3I55V 2ZR3A 4FK5C 2Q5ZA 4BWAA 3TXSA 1LNQA 1GM7A 1E79G 3P32A 3RFRA 4LF4B 1D2DA 3RYFB 4JI4O 3EHBB 1SQQH 1XREA 2QJ1A 2CGNA 5ITZA 1PNMA 1XMQO 3AK1A 2AGAA 4LF5O 2JS3A 1Y66A 2Y69C 4DV0O 1XOUA 3W7UA 3BVOA 1OHHG 3OEEG 1IBMB 1AR5A 1K3EA 5GTIZ 1Y76B 2GSMB 2W6JG 2CE4A 4R50A 5KAIZ 1IBLO 3CC7V 1Q81W 2FTKA 4B3TO 1BHAA 1K34A 1XNQO 4UVAA 4X8AA 1WLEA 3T2MA 3ZRWA 1YHQV 3VQVA 2WSSG 1Q6IA 2YSUB 1PP9H 4PA9A 4JV5B 5D5QA 3NXSA 1OCCB 3DXRB 4F6EA 2LFSA 4DR7B 1UFIA 2NN4A 5DN6G 4X89A 4H33A 1XUQA 4YY3O 4LH7A 2ZM6O 5CB4A 1L8DA 1Z5WA 2Y48A 3E8GA 2F66C 4W4LA 3G6BA 2CK3G 4RQFA 1VF7A 4TQDA 1VQ9V 1NTMH 3RBZA 3H1JH 1VQ6V 5FPOA 3ZHTA 3JD1A 3CRMA 4WFHA 4IIJA 3AG4C 3ASNB 5LXTA 1M93A 1Q6HA 3B2EE 4P9OA 2DJVA 1HDJA 1XILA 1N32B 2WLHA 1U96A 4FLYA 3BA9A 3JAMN 5IDJA 1ZSPA 4UCRA 5JWPA 1MG1A 1XNRB 4O4JA 3LSUA 2CTPA 3RYIA 2ZDIC 2ZKOA 4LF6B 1O9HA 2ITCC 2JVDA 2JGDB 4O4LB 4BAYA 3R65A 1GN6A 4K3AA 2XUMA 4MS2A 2Q69A 3CCLV 3DGEA 4N21A 2Z5UA 4R6ZA 4PV1B 1OCOB 3RYHB 5FPRA 2BSKB 2NR5A 1KB9F 3MHHC 4LFCO 4TSFG 5A2QN 4TV9B 2LW7A 4RUFA 3ZX6A 4O2BB 5H5NA 1THZA 4TV8A 2QWRB 1US6A 2HG5C 4YJ3A 1PV0A 1FKAO 1CPYA 3AK2A 2F4VB 4DV1O 5EBWC 1VQ5V 4X1KB 4J10A 2UUAO 2UXBO 3RVZA 5IYDO 3SJCC 4YY3B 2A79B 4EFEA 1KP3A 1MMMA 1SESA 2E5LB 3IAYA 2E76B 1KUQA 5CA3A 2A3QA 3RYFA 2HP8A 4DV4B 1BQZA 1QU7A 4NYKA 3SPGA 2Q68A 4H13B 2R9AA 4RWUA 1NQTA 3ZRXA 2OCCC 5KUMA 3J7AU 1KQSU 1Q90D 2CAZC 2DOSA 2R70A 3L74H 1WN7A 4DR1O 3H1LH 2KQXA 4U7NA 3FB5C 1YF2A 2X6CA 4JI3B 1B06A 2PTMA 2EZOA 1GMGA 3ZMVA 1NU1H 4WFBV 1S5LZ 3JD3A 3AK3A 5FNVA 1AROP 4HYOA 3ZBHA 4LFBO 2CDYA 4JYAB 5LP6A 3J80N 3CJHB 4JI6O 3THOA 1YTFB 4YHHB 3GB7C 2BTQA 1VF6C 4DR6B 2JK5C 2DWDC 4X1IA 3F7VC 4DW1A 2HJDA 2R72A 3N2KB 4ZI7A 1SETA 3QO5A 2QKAA 3QO8A 4WBNB 1MZFA 3K5LA 4QNHB 2YUAA 3X2QC 5J2UA 4JYBA 5JJEB 1TA8A 4YXWG 2WLIA 3JSLA 2EX3A 3C3TA 1AI4A 1W0JG 1WP7A 2MK3A 3CD6V 5LHHA 3ASOB 2A9HA 3OMAB 1SF9A 4OGQB 3SPHA 2IJKA 4FZ0A 4MW8A 3FB7C 1P7GA 5L3CA 3K57A 2DN9A 1A32A 5JJNB 4UCUA 3UM7A 4DR4B 1R6TA 3Q4HA 1OZ0A 4YIOA 1DLBA 4JI7O 3LSSA 2Y69B 3DTUB 1BQ0A 1ENVA 1TGOA 1R3JC 4OXSA 2ITDC 3OFNG 3P30A 3B8NA 2HR3A 3B09A 2QSAA 3K59A 2F4VO 2DYSC 2QKCA 3ZCCA 2CTQA 2RN9A 2ZT9B 1HNZB 2ZE6A 4IYHA 1Q3EA 2YEVA 3EFFK 2YC0A 3SPIA 4MVZA 3TETA 5KA6A 2LO1A 5J9PC 4UFZA 1G4YB 4GUNA 3BY6A 3N27A 1K4DC 1Q82W 1JQ0A 1N8RW 1TUEB 1URFA 2H3OA 5B1OA 4UB6Z 1K8AW 2QGNA 4DV6B 2KSDA 3TK1A 3AG2B 4XDKA 2YIAA 1F7YA 1FFXB 4DYLA 2VQEB 4EKWA 3GVMA 3IC9A 4PHZA 2K9PA 2MW2B 4KHPO 4PI2A 1I7FA 2YXYA 5DECA 5GONA 1JR9A 1XDCA 1R3LC 4CZZA 1PL0A 1JFFB 4LFCB 4I9WA 3D36C 1QR8A 1AR1B 1M4UA 3BPZA 2CH7A 1WP8A 5EZYB 1RM1C 1MOFA 3KG2A 3QNEA 3L75H 3ZHQA 4KFMA 3X2QB 5KUKA 4K0KB 4LNUB 3HPLC 1XEQA 3SYCA 4J9YB 1FAFA 3EVKA 4AI8A 1WAZA 3OGIB 4J7ZA 3B8MA 4TWKA 1H8HG 2A06H 4GX2A 2IJHA 1DF5A 5B1BB 2PYLA 1NVPB 2ZE7A 3UT5A 2FMLA 3NR7A 2IH3C 4LCUC 2GHYA 3JALB 2H94A 4I50A 1S77D 3L71H 5LA6B 1WNSA 5KX5B 2UXXA 1Z2GA 5L3BA 1GK9A 1Q7YW 1M90W 3L72H 2EJRA 2OIGA 5B66Z 4CBCA 4FLWA 3JCUZ 1L1FA 1QVFU 3ETDA 1TVKA 5LBQA 4X66O 2Q7EA 4X65B 4NTWA 3FB8C 1KKCA 3K58A 4DR5B 1K33A 3CCQV 3CMEV 5CA0B 4F4LA 2VS0A 4TOIA 5EBMC 4NVPA 3L9DA 1QHTA 1NH2C 1GN3A 4U7OA 4XBFA 4WBNA 2Q0AA 2RCVA 2Z0AA 4OX9O 4X88A 4J41A 3OT7A 2NLJC 1D5AA 2BOCC 1FYJA 2JJ1G 2AZ0A 5BXZA 3ABLC 4TV8B 2OIEA 3K79A 1AR4A 3CXCU 1XNQB 3G6EV 3BCCH 2GV9A 4I4TA 4TQFA 4H37A 4AILC 4DR4O 1YCIA 2XTAA 1OCOC 4O4HB 2ZQMA 5BR8B 2GDSA 4JAVA 1QVGU 1Y4MA 2VQFO 2HVKC 4DV3B 2UUBB 1NR1A 2EULA 2DWEC 4K8ZA 1JCHA 1BHBA 1HR0B 3FKSG 4G27B 4TV9A 4JYAO 4B3MB 4JI0B 2WA4A 2LW1A 1IBKB 1Q5OA 2XAJA 2E74B 2PYJA 1V55C 2Z3YA 4IHJB 2M6YA 5IE9A 4DUYB 1LR1A 1IXMA 1Z5VA 2UUCB 4LF8O 5B3SB 3AG7A 4JI6B 5JCOA 3BHPA 2HEPA 1QQCA 4J80A 1VMGA 4KUMA 1RFYA 4O2AA 1FFXA 1RPRA 3AG3C 5LMUO 3M8AA 4K35A 1AI5A 4DV2O 1JA8A 2P06A 1KKDA 1VARA 4PA6A 4DRXA 3RYCA 1AB3A 4B08A 3SYAA 1VQMV 1SQGA 2GUZB 1W59A 3N2GA 3ZEDA 1DF4A 4JI5O 3ETGA 3JD2A 2CTWA 2BOBC 1OCCC 1GN4A 1TAEA 2C2AA 2EZPA 2JS5A 3I5DA 3O65A 1OV9A 1WPBA 4E2LA 5IJ9B 1M9NA 2X6BA 3CHXA 3JD4A 4IT5A 2ADQB 5LMNB 1VEWA 4GCZA 1S3JA 1G6UA 2F23A 3RYIB 4LFAB 5LHIA 4LWSA 3R66A 4JI0O 3K5MA 2DYRB 4JI1O 3HKEB 1Q8IA 2WLJA 4QGPA 5CN0A 2E3CA 1XMOB 3F7YC 3S3WA 1EFRG 3JAWA 4WFEA 5IY5B 4JTDB 3BABA 2VRZA 5EK0A 5CB4B 1BGYH 5KX5A 5F2VO 5EIBC 1UPGA 2PI5A 3AG2C 4Z1VA 1KMIZ 1X4TA 3BEHA 4IL6Z 1KC8W 1VQ4V 4LF6O 1B3QA 2N05A 3N2KA 4J9ZB 1MSWD 4UCVA 4FZ1A 4N23A 1OCZB 1D5NA 4K0KO 2YIBD 4FPPA 1R1BA 3GWKC 1XNRO 2QM4A 4LC1A 1EBOA 2DYSB 3MDSA 2PY5A 3E83A 1K9MW 4DV7B 3SYQA 1R3IC 3SDLA 1WA8A 3UQ8A 4BIZA 3DC6A 4EEQA 4JPRA 2WPDG 2UXBB 2A7WA 2UXNA 5IY5C 4J42A 1N0NA 2QWNB 3JD0A 1H2GA 1YITV 3CCSV 5LGTA 4AQYB 2F95B 1G1XB 4YJ2A 2WAMA 1I94B 2KG7B 3F5WC 1MSDA 1SC5B 4QJFB 4A5UB 4LR3A 1LUVA 3FAVB 1MZEA 5KHKA 2Q7HA 2WLMA 1ORQC 3BRCA 2EIMB 2W6IG 3H01A 3SJQC 2YXLA 1RP3B 3T4ZA 3W7WA 4DW0A 3SJBC 1N34B 3U11A 4JAAA 2QE7G 3QO7A 5IYCO 3WG7B 5EC2C 3OD4A 4NXMB 1H2SB 3IJ4A 4DR3O 1XI1A 4U3JA 4MT8A 1IDSA 4JI8O 3JCZA 3OMIB 4FFKA 5KA5A 1NH2D 5C93A 4IHJA 3JASB 4EB6B 1FFTB 3K5NA 1MNGA 3ABMB 5B1NA 4F6RA 1JFFA 1XMQB 3JSNA 2ODMA 3ICXA 5B3SC 1HW7A 2YXHA 4DV5O 4HNAA 1JX9A 5LMNO 3K9AA 1B6QA 1S76D 2P4VA 4QE9A 2ZE5A 4I5SA 3CXHF 2UXDB 2NNUA 3ABUA 3C90A 3WU2Z 1F4NA 4B3MO 1EZVH 4WFFA 4LF5B 3OUSA 2ZXWC 5H9CA 5IJ9A 5LXTB 5KMGA 4FM0A 3ZJZA 5FL7G 4BW9A 4TT3G 1HP8A 4C7UA 3TCUA 3ZRWB 5BR8O 2HHHB 2IJIA 4NTXA 1SQPH 3T1YO 3CCVV 5FLXN 1PD3A 3JAWB 3AEIA 1R3KC 5CA0A 2JGDA 4DK0A 5K1XA 4UCTA 4D7SA 3KKYA 3ABLB 2YI8A 2JGUA 1FJGO 3SYOA 2N04A 4YJ3B 3CP1A 3MHSC 2L6LA 1H38A 1IURA 2WLIB 3SPCA 2H8PC 4MVMA 3JATB 5IYZB 1I08A 4E4EA 4ICGA 5GTHZ 5JH7B 2OWOA 4I55A 1SQBH 1E1QG 1YVWA 1GM9A 2IU3A 4UCSA 4CH4A 1EN6A 3JAKB 4GX1A 1SRYA 2RDCA 1WPXA 4CS3A 5BMVB 2BCCH 4PDVA 2EJ7A 4X1KA 3E2EA 1WA8B 3CC4V 4O2AB 4Z1MG 1IBKO 2ETNA 1IVSA 2F93B 4UV9A 1SZXA 1Y74B 3FB6C 1TUBA 4O4IB 1HNXO 4GX5A 3E35A 1YXBA 2F1MA 3ZIAG 5LYJA 1TUBB 1NVPC 5B1BC 3CMAV 1VF6A 4RUEA 1G8MA 3E86A 1O9GA 4DV5B 2D2CB 1ZL8B 4WCEV 2WWWA 1R6NA 3J81N 2QR4A 1ZUQA 4NR1A 1VQOV 4U3JB 1VQ7V 3CCRV 2ILMA 3PN1A 3ZRSA 1FD9A 3K04A 4DR5O 1P84F 3B4SA 1L0NH 3VBBA 4GKJB 5FNVB 1GN2A 3L73H 2CH7B 4MVUA 2RQ6A 4I50B 3W7TA 4CC5A 2X7RB 3OGCC 3CC2V 3LNMB 5K1PA 1YTFC 1N33O 2GUZA 2LP7A 4DR3B 2M7WA 1KD1W 3M99B 4X9QA 2YI9A 1DTOA 5CBGA 4AQYO 4MSWC 4DXWA 4DV6O 5HFMA 5LHGA 2UXCO 1H8EG 3CRCA 4JTCB 5CMUA 1E1RG 2QEXV 1QNMA 2JDIG 4RAIA 4TUYB 3UCSC 2BTQB 2Q8VA 3CPWU 2ADPA 3N2GB 4DR7O 1L0LH 3BAAA 2V7QG 2PI4A 2GBOA 4HNAB 4PA7A 1HNZO 1FXKC 3LNNA 5KHHA 3U0ZA 3HR0A 1NZ6A 3STZC 3WB1A 2Q9LA 5LGNA 1PM9A 4ASUG 1V55B 2ZNIA 2ARHA 4QIWF 1SQVH 4LF7O 3RWRD 1IBLB 5B1AC 2LJ2A 1RPOA 1F51A 2JJ2G 2OCHA 5J2TA 2ZIOA 4FM1A 4BIUA 2WA3A 2WLKA 1PNKA 2OT5A 5J2TB 4KHPB 2B5UA 1GO3F 5EIBD 1NBMG 2HKOA 2JEUA 3I56V 1XMOO 1K92A 3RVYA 1V54C 2AXTZ 3UO3A 1AJPA 2R9RB 2ZE8A 1YJNV 4B3RB 5CBFA 1ZL8A 2D3OW 4LH6A 2O57A 2QM7A 1VP7A 4DR2B 1YJWV 2Y0PA 4MVRA 3APOA 4H0LB 3E22A 4PD4F 4B3SB 4NKGB 3A8TA 1PL4A 5LOVB 5BZBA 3WB0A 3SYPA 1P49A 4YHHO 4O4HA 4NXNO 5JQGA 2Q0OC 2IM9A 2ZXWB 3S3XA 5CBHA 3H1HH 2IU0A 1RSOB 5JQGB 4WF9V 4X64B 4X1YA 5IJ0B 4D6TH 4FMTA 4LF9B 5GONB 3ZMUA 5EYPA 3ZHVA 1FJGB 4DV7O 4UVCA 2DQ3A 2FYUH 4G2KA 4ZOLB 1JJ2U 2V1DA 2YDEA 3STLC 3HKDB 4GKKB 2OTLV 1HWYA 3LDDA 4JAUA 3AG4B 3ASNC 3ABMC 4JF3A 4P9PA 3TJTA 5H6RA 5L3GA 4DUYO 5KAFZ 4NTYA 1BT8A 5JJJB 4ZHQB 2HHHO 3SR2C 2XAHA 4Q6GA 3ZMTA 2P4KA 1N4CA 5L3EA 1P7BA 5LMUB 1M5IA 1V9PA 3ZHUA 2ZNJA 4DR6O 4PA3A 4BW5A 4RQEA 4JZ2A 3JALA 5E1AC 1NJIW 3OM3B 4UVBA 3CCMV 1YDXA 1H2LA 4I0XA 4RO2A 4PDRA 3W7XA 3E8FA 3CSXA 2PZSA 3B77A 2UU9O 3PJSK 1S5HC 4DR1B 1Q86W 4UB8Z 1AVMA 5CA1A 1ZLZA 4DUZB 1N36B 1J5EO 2AHYA 5IWAB 3A0BZ 3OTOB 1IX9A 2CGOA 4LFBB 3JATA 3CB2A 1VQLV 3CEIA 1KBHA 2P90A 3MD0A 3T4DA 3VQXA 2A0LA 3QVNA 1DGSA 4MTFA 4UCOA 4DK1A 3DC5A 4JYCA 1NR7A 4ZKIA 1HNWO 5JVDB 4GYCB 4CC6A 4LF7B 3BFRA 4I7ZB 2AHZA 3ETQA 1S72V 4GLXA 3A0HZ 3OW2U 4DV4O 3ABTA 3AG1C 2VWKA 2UUCO 2Y4TA 1N32O 2RNBA 4J11A 2E5LO 3T1YB 3HKDA 3ETEA 2ZDIA 1K7DA 1OCRB 2P7TC 2RMKB 1I94O 3G80A 2V4DA 2WLLB 3ZHSA 2UUAB 1GH6A 4B3RO 1EN4A 1Y76A 1QLNA 2E75B 4JTAB 4DV1B 4WFGA 3QTCA 2W0FC 1S0VA 3ASOC 1BS3A 1SS3A 1N0JA 2UXDO 3ABKC 5C8YB 3CJHA 4F6RB 1COWG 1P4RA 1XHXA 3HB3B 3IGAC 3QF7A 3FD9A 4ABMA 4JI2B 4R7CA 2DE0X 2YIBA 1LUWA 4BIOA 4EB6A 5EZYA 3WB2A 4FFBA 1GAXA 5EYPB 2IW5A 1NKDA 1FPOA 3SGIA 1AILA 3ZS8C 2EINC 3CCJV 1UJWB 2YIDA 3UO2A 4JI8B 3CRQA 2ATKC 4P2ZA 1AP5A 5LYJB 2QWOB 2EIKC 4FLUA 1W0KG 1VQPV 3AG3B 5EC1C 2X0LA 1QCEA 4UUJC 2VQEO 1CXZB 2N74A 2W0XA 4ZHQA 2EILB 4FLTA 4JI2O 4OPAA 5JVDA 1F23A 3RW0A 4LF4O 4X66B 1TVKB 3T1CA 1YZBA 5E79Z 5TISZ 2ZM6B 4LP8A 5KHIA 4L8JA 2OTJV 2Q4PA 4J7JA 1NVPD 4G28B 1FXKA 3IC7A 4QE7A 3CRAA 4X20B 3P3PA 2WLNA 3OMNB 4MVOA 4X1IB 4J7KA 3K0DA 4GKJO 1SZTA 1Y6XA 4X20A 2UXCB 1ZTEA 2ZCEA 5IYBO 4Q20A 3D3QA 1SA0B 3KCXA 4IYIA 1BMFG 2ZIMA 5CA1B 5JH7A 2XNDG 1N33B 2DQ0A 2EIJC 4GT1A 4FM2A 5DEDA 4I0XB 4K8XA 4JGSA 2OYQA 4JASA 4O2BA 1HNXB 3K5OA 2AZ2A 5IWAO 4IGGA 2VWJA 3D8CA 3M7MX 2EIMC 3GWOA 1M57C 1HNWB 1JVMA 3ML0A 3OE7G 1I0HA 2PF4E 3LUTB 3CYOA 2WLLA 2L35A 5A9GA 4YJ2B 1K73W 2Q6AA 4FFBB 1YEWA 1Q6UA 3LDEA 2XOKG 4AHCA 1OJHA 1AJNA 1MABG 1B04A 1NTKH 4DUZO 1OCRC 1YI2V 4EFBA 4CH3A 4JI4B 1YIJV 2QM8A 1K5SA 4O4IA 2P22C 2QDOA 1XQ8A 2FKXA 1T5EA 2LGWA 2YEVB 3AG1B 1QLEC 1EN5A 3RYHA 3K08A 1XL4A 1AI6A 2LQTA 5EBLC 3HKBA 4B7KA 4GZRB 1ZWIC 1W2BU 1FXKB 1OCZC 2IJJA 5GW7A 4JI5B 4KP4A 5LOVA 4MW3A 4B7EA 1K97A 4PELA 1VF5B 5HFLA 1IZ3A 4MVQA 3A0RA 1EM1A 5DM6V 1IXBA 1FS0G 4GX0A 3SJAC 2BTOA 2JRIA 2EIKB 1JPXA 2GTAA 5LP6C 2XASA 1VQNV 2B1IA 3EXAA 3ZMZA 4UV8A 5H6QA 4CH6A 1SQFA 3TGUH 4MTGA 5LA6A 4JZGA 3C3SA 2BE3A 1R6KA 4OPHA 2EINB 3OR7C 1X59A 4GKKO 3OTOO 2DYRC 4X62O 1JJOA 3ZHRA 4LF8B 2HFEC 3ZRVA 1FXVA 4X65O 4FLXA 1BE3H 2LGQA 1RM1B 3K0GA 4LNUA 3RT3C 3U10A 4LF9O 2UU9B 3K06A 1FXHA 5KMGB 4CS4A 1WB8A 3MAQA 4TUYA 3T1HO 4DR2O 1BCCH 1NT2B 1SQXH 2GTSA 4I4TB 1XL6A 3H9VA 4FJCC 3HKCA 4NXNB 3DXRA 4MTOA 1YSCA 3O9OA 3UT5B 1HR0O 3OTFA 1YJ9V 3OEHG 4FIPC 1ROPA 2Y4UA 4DV3O 2UUBO 4ZBMA 4B3SO 2VQFB 4JI3O 4CS2A 4BR6A 2Q67A 2DW4A 3D36A 4L87A 1WB7A 1QBZA 2EBOA 4O4LA 1EZJA 1QLEB 3FYEB 1H2KA 4NXMO 1M56B 1NTZH 4FLZA 1GKFA 2P5OA 1N34O 5KLVH 3FX7A 1M56C 1I5YA 1SERA 3Q4HB 2AW9A 1SA0A 2XT9A 4LBEC 4CH5A 3WFVA 4X64O 3CCEV 3KCYA 3KZIZ 1DK1A 4KL1A 2BSKA 1BZKA 5IT9N 4QPJA 3K3WA 1Y74A 2KB1A 3LSQA 3H1KH 3RN4A 2Y0IA 4MVSA 3E89A 3JARB 4LFAO 4UXNA 2XAGA 3G71V 3T1HB 1H2MA 3OUFA 2K1EA 1VQ8V 4ZOLA 1F4MA 3B40A 4DO2A 1GTOA 3K9SA 2XAFA 1GM8A 4KXRA 3CS5A 1CEZA 2HVJC 1JOYA 4X1YB 5IJ0A 4X62B 2QTOA 3APQA 1VQKV 5D5PA 1V54B 1U97A 3K03A 5L3FA 3G4SV 3E22B 3TXQA 4ZIBA 4D7TA 4QPKA 4B3TB 5IYZA 3E8HA 2XHBA 1Y67A 4I55B 3CX5F 1NH2B 4LWSB 4MTXA 3JASA 4PA4A 1YTFD 1KU9A 4W4KA 5LP6B 3BA8A 1IBMO 2FB5A 1K5QA 1K4CC 2RJZA 4FLVA 5B1AB 3RGBA 2YS8A 2KKWA 2ZR2A 5BMVA 2F43G 2QA4V 1AP6A 3L70H 4JYYA 5KHJA 4XDLA 2QKSA 2OCCB 4WFAV 3OAAG 2QWQB 3ZN0A 2P6JA 3HKBB 5B5EZ 2JEXA 5ITZB 1AJQA 4JI1B 1J5EB 5KHGA 1KYOF 5BY1A 1M1KW 4HZ3A 1S5JA 4U3FH 4DRXB 3RYCB 2PUSA 4HAMA 2EILC 4Z2WA 3DSQA 1I5XA 5L3DA 4ZI7B 3E8BA 3HKEA 4YIPA 2XAQA 1XBLA 2DMXA 4DV0B 2Q73A 3G67A 5LL6Y 3UKMA 4IIJB 2ZD9A 4PDLA 1ZX3A 2CUGA 2QWPB 5J2UB 1R73A 2CTRA 2YICA 1KECA 4P30A 3LDCA 1SKVA 3FYIB 3H1IH 1XHZA 1J95A 1VIBA 1GRJA 4PI0A 3VOUA 3ZMSA 4PDMA 5H2FZ 2B1GA 1H2NA 3FFQA 3IFXA 4O4JB 2HJFC 2ZINA 3VQWA 2PGGA 1PPJH 3SPJA 2FL4A 3WG7C 2LFRA 4H44B 3OR6C 4R8CA 1WJZA 2IBZH 3QG5A 1KP2A 4JV5O 3VQYA 2Q7GA 1M57B 1MA1A 3JYCA 1JMKC 3P3NA 2KG7A 3A2FA 2QTSA 3FAVA 1CP9A 5AG2A 3HKCB 5JCOC 3CCUV 1BL8A 3ABKB 2P67A 4OX9B 4JI7B 1PNLA 2JIZG
chains in the Genus database with same CATH topology
3CCJV 2HLDG 2X6AA 2R9IA 3CP1A 3MHSC 1H38A 3B8MA 1UJWB 2WLIB 4TWKA 3SPCA 1H8HG 2ATKC 4GX2A 4P2ZA 2IJHA 1DF5A 2H8PC 4MVMA 3ZN1A 2EIJB 5B1BB 1NVPB 2EIKC 1VQPV 1W0KG 3AG3B 5EC1C 4XDJA 2X0LA 1QCEA 4UUJC 1PKXA 1E1QG 2IH3C 4LCUC 2GHYA 3W7SA 2H94A 1S77D 1GM9A 2IU3A 5LGUA 2EILB 2UXXA 3D3IA 1AI7A 1SRYA 4GX1A 1WPXA 5L3BA 2IH1C 1QR9A 1F23A 3RW0A 3I55V 2ZR3A 1GK9A 4FK5C 1Q7YW 3T1CA 1M90W 4LP8A 2EJRA 2OTJV 4PDVA 4CBCA 4G28B 1FXKA 1LNQA 3IC7A 1NVPD 1GM7A 1E79G 4QE7A 3P32A 3E2EA 1L1FA 1QVFU 3ETDA 3EHBB 3CC4V 2WLNA 4Z1MG 5LBQA 3OMNB 4MVOA 1PNMA 3FB8C 3K0DA 1SZTA 4UV9A 3FB6C 1K33A 5IYBO 1Y66A 4GX5A 3CCQV 2Y69C 3E35A 4Q20A 3CMEV 3ZIAG 1BMFG 4F4LA 3W7UA 2XNDG 1NVPC 1OHHG 2DQ0A 3OEEG 2EIJC 5B1BC 5EBMC 4GT1A 3CMAV 1K3EA 4RUEA 2GSMB 1G8MA 2W6JG 3E86A 1NH2C 4U7OA 4XBFA 4WCEV 4R50A 2WWWA 4JGSA 1R6NA 4X88A 2NLJC 3CC7V 1Q81W 2BOCC 2FTKA 4JASA 1BHAA 1K34A 1VQOV 2JJ1G 4UVAA 4X8AA 3ABLC 1WLEA 3T2MA 3ZRWA 3CCRV 1VQ7V 3ZRSA 3K04A 3K79A 1YHQV 3CXCU 2WSSG 3G6EV 2YSUB 3VBBA 4PA9A 2EIMC 3GWOA 1M57C 3NXSA 4H37A 4MVUA 1JVMA 3ML0A 3OE7G 1OCOC 1OCCB 3W7TA 2ZQMA 2LFSA 2X7RB 3OGCC 3CC2V 3LNMB 4JAVA 5DN6G 1Y4MA 3LUTB 1QVGU 4X89A 1YTFC 2HVKC 3CYOA 2WLLA 4H33A 1NR1A 2LP7A 2Y48A 2DWEC 2M7WA 2Q6AA 3E8GA 1K73W 1KD1W 3M99B 1JCHA 3LDEA 1DTOA 2CK3G 2XOKG 5CBGA 4RQFA 1BHBA 4MSWC 1VQ9V 4DXWA 3RBZA 1AJNA 5HFMA 5LHGA 1MABG 1H8EG 3FKSG 1VQ6V 4G27B 4JTCB 5CMUA 1E1RG 3JD1A 1OCRC 2QEXV 1YI2V 2JDIG 4WFHA 4RAIA 2XAJA 1YIJV 2QM8A 1K5SA 1V55C 3CPWU 2Z3YA 3AG4C 3ASNB 2V7QG 2PI4A 4PA7A 1FXKC 4P9OA 2YEVB 3AG1B 1QLEC 3K08A 1XL4A 1IXMA 2WLHA 3STZC 1AI6A 5LGNA 5IDJA 5EBLC 4ASUG 1MG1A 5B3SB 1V55B 1ZWIC 1W2BU 1FXKB 1OCZC 2IJJA 5GW7A 4QIWF 4KP4A 4MW3A 2ZDIC 1K97A 5B1AC 4KUMA 4PELA 5HFLA 1RPOA 3AG3C 1RPRA 1F51A 2JJ2G 4MVQA 3A0RA 1AI5A 2ITCC 5DM6V 1KKDA 4BIUA 1FS0G 4BAYA 4GX0A 2WLKA 3R65A 1PNKA 2OT5A 2EIKB 1JPXA 4PA6A 2XASA 1VQNV 2B1IA 2B5UA 3ZMZA 4UV8A 5H6QA 4MS2A 2Q69A 1GO3F 1NBMG 2HKOA 3CCLV 2JEUA 3I56V 4MTGA 3SYAA 1VQMV 1K92A 1R6KA 3RVYA 1V54C 1DF4A 2EINB 3DGEA 3ETGA 3OR7C 4N21A 1AJPA 2R9RB 2DYRC 2Z5UA 4R6ZA 3JD2A 1YJNV 2HFEC 3ZRVA 1FXVA 5CBFA 2BOBC 1OCCC 1OCOB 2C2AA 2EZPA 2D3OW 1RM1B 3K0GA 2QM7A 4E2LA 3MHHC 1YJWV 4TSFG 4MVRA 1M9NA 3K06A 4RUFA 1FXHA 2X6BA 1THZA 3JD4A 2HG5C 4GCZA 1S3JA 5BZBA 5LHIA 3SYPA 1CPYA 1XL6A 2DYRB 4FJCC 2WLJA 5EBWC 1VQ5V 4MTOA 5CN0A 1YSCA 2ZXWB 3F7YC 1EFRG 4WFEA 5IY5B 4JTDB 5CBHA 3OEHG 4FIPC 5EK0A 3RVZA 5IYDO 1YJ9V 1ROPA 2IU0A 2PI5A 2A79B 3AG2C 4WF9V 4ZBMA 1KP3A 4FMTA 1SESA 2Q67A 3BEHA 1KC8W 1VQ4V 2DW4A 3D36A 3ZMUA 4L87A 5CA3A 4J9ZB 1MSWD 4UVCA 2DQ3A 1QBZA 4G2KA 2EBOA 4N23A 1EZJA 1OCZB 1QLEB 3FYEB 1JJ2U 2V1DA 3STLC 4FPPA 3SPGA 2OTLV 1HWYA 1M56B 2Q68A 3LDDA 1GKFA 1NQTA 4JAUA 3AG4B 3ASNC 3ZRXA 2OCCC 3ABMC 1EBOA 4LC1A 4JF3A 2DYSB 5KUMA 1M56C 1I5YA 4P9PA 1SERA 3E83A 5H6RA 1K9MW 1KQSU 3SYQA 5L3GA 1R3IC 4LBEC 4U7NA 3FB5C 2XAHA 3WFVA 3ZMTA 2X6CA 4BIZA 3CCEV 5L3EA 2EZOA 1P7BA 1GMGA 3ZMVA 4WFBV 4QPJA 4JPRA 3JD3A 3K3WA 2WPDG 1AROP 4HYOA 2KB1A 2UXNA 3LSQA 4PA3A 4BW5A 5IY5C 3JD0A 1H2GA 4RQEA 4MVSA 1YTFB 1YITV 3CCSV 3GB7C 5LGTA 3E89A 2JK5C 2DWDC 5E1AC 3F7VC 3OM3B 1NJIW 4UVBA 3CCMV 2WAMA 4UXNA 2XAGA 3G71V 3OUFA 1SETA 2K1EA 4RO2A 3F5WC 1F4MA 3QO5A 3QO8A 4PDRA 4QJFB 1VQ8V 4DO2A 3W7XA 1GTOA 3E8FA 4QNHB 3X2QC 2XAFA 3B77A 2WLMA 3PJSK 1S5HC 1GM8A 1ORQC 4JYBA 2EIMB 2W6IG 1Q86W 1CEZA 3H01A 3SJQC 3T4ZA 2HVJC 2AHYA 1JOYA 3W7WA 2QTOA 4YXWG 1VQKV 1V54B 2WLIA 3K03A 5L3FA 3G4SV 1AI4A 2QE7G 1W0JG 3QO7A 2MK3A 3CD6V 5LHHA 3ASOB 2A9HA 5EC2C 3WG7B 3OMAB 5IYCO 4QPKA 1VQLV 3SPHA 3E8HA 2IJKA 2P90A 3MD0A 1NH2B 4MTXA 4PA4A 4MW8A 3FB7C 3T4DA 2A0LA 1YTFD 4MTFA 4MT8A 5L3CA 3JCZA 3OMIB 1K5QA 4JYCA 1NR7A 1K4CC 4ZKIA 5KA5A 3UM7A 5B1AB 1NH2D 5C93A 1OZ0A 1DLBA 3LSSA 2Y69B 2ZR2A 1FFTB 2F43G 2QA4V 3DTUB 1ENVA 1R3JC 2AHZA 4XDLA 1S72V 2QKSA 2OCCB 3ABMB 4OXSA 2ITDC 5B1NA 4WFAV 3OAAG 3OFNG 3P30A 3B8NA 3ZN0A 2P6JA 2HR3A 3OW2U 3ABTA 3AG1C 2JEXA 1AJQA 5B3SC 2DYSC 3ZCCA 1M1KW 4HZ3A 1JX9A 3K9AA 2YEVA 3EFFK 4HAMA 2EILC 1B6QA 4MVZA 3SPIA 3ETEA 5KA6A 3TETA 1S76D 4QE9A 5J9PC 1I5XA 4I5SA 2ZDIA 5L3DA 1G4YB 1K7DA 1OCRB 2P7TC 3E8BA 2XAQA 3BY6A 1K4DC 2NNUA 1Q82W 3UKMA 1JQ0A 3ABUA 2ZD9A 4PDLA 1F4NA 4WFFA 2WLLB 1N8RW 1TUEB 5B1OA 1K8AW 1R73A 3OUSA 2ZXWC 1KECA 4P30A 5H9CA 1QLNA 3TK1A 3AG2B 4XDKA 3LDCA 3FYIB 4JTAB 1J95A 4WFGA 4EKWA 3VOUA 3ZMSA 3ZJZA 4PDMA 5FL7G 2W0FC 1S0VA 3ASOC 4TT3G 2B1GA 3IFXA 3ABKC 3TCUA 2HJFC 3ZRWB 1R3LC 2IJIA 3SPJA 4CZZA 1COWG 1P4RA 1PL0A 3WG7C 2LFRA 3OR6C 3HB3B 3IGAC 4I9WA 4R8CA 3CCVV 1QR8A 1AR1B 1PD3A 3AEIA 4R7CA 1KP2A 1R3KC 1RM1C 1MOFA 1M57B 3JYCA 3KG2A 3QNEA 4KFMA 3X2QB 5KUKA 1CP9A 3HPLC 3CCUV 3ABLB 1BL8A 3ABKB 2P67A 2IW5A 3SYOA 1NKDA 3SYCA 4J9YB 1PNLA 2JIZG 2EINC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NVP C;  1RM1 C;  1YTF D;  1NVP D;  1NH2 D;  5IYB O;  1YTF C;  5IYC O;  5IYD O;  1NH2 C;  1RM1 B; 
#chains in the Genus database with same CATH topology
 2HLD G;  1Q43 A;  2X6A A;  2R9I A;  4DV2 B;  4PJ0 Z;  1NS1 A;  4FVM A;  3ZN1 A;  2EIJ B;  4HBN A;  4NB5 A;  1ZAU A;  4XDJ A;  3JAK A;  1PKX A;  3CRR A;  3JAR A;  4I9Q A;  3W7S A;  3CWB H;  1NI8 A;  5C8Y A;  2B9Z A;  5LGU A;  1RSO A;  3CE2 A;  2G38 A;  3D3I A;  1AI7 A;  3F5T A;  1BSM A;  2IH1 C;  1N36 O;  1QR9 A;  3I55 V;  2ZR3 A;  4FK5 C;  2Q5Z A;  4BWA A;  3TXS A;  1LNQ A;  1GM7 A;  1E79 G;  3P32 A;  3RFR A;  4LF4 B;  1D2D A;  3RYF B;  4JI4 O;  3EHB B;  1SQQ H;  1XRE A;  2QJ1 A;  2CGN A;  5ITZ A;  1PNM A;  1XMQ O;  3AK1 A;  2AGA A;  4LF5 O;  2JS3 A;  1Y66 A;  2Y69 C;  4DV0 O;  1XOU A;  3W7U A;  3BVO A;  1OHH G;  3OEE G;  1IBM B;  1AR5 A;  1K3E A;  5GTI Z;  1Y76 B;  2GSM B;  2W6J G;  2CE4 A;  4R50 A;  5KAI Z;  1IBL O;  3CC7 V;  1Q81 W;  2FTK A;  4B3T O;  1BHA A;  1K34 A;  1XNQ O;  4UVA A;  4X8A A;  1WLE A;  3T2M A;  3ZRW A;  1YHQ V;  3VQV A;  2WSS G;  1Q6I A;  2YSU B;  1PP9 H;  4PA9 A;  4JV5 B;  5D5Q A;  3NXS A;  1OCC B;  3DXR B;  4F6E A;  2LFS A;  4DR7 B;  1UFI A;  2NN4 A;  5DN6 G;  4X89 A;  4H33 A;  1XUQ A;  4YY3 O;  4LH7 A;  2ZM6 O;  5CB4 A;  1L8D A;  1Z5W A;  2Y48 A;  3E8G A;  2F66 C;  4W4L A;  3G6B A;  2CK3 G;  4RQF A;  1VF7 A;  4TQD A;  1VQ9 V;  1NTM H;  3RBZ A;  3H1J H;  1VQ6 V;  5FPO A;  3ZHT A;  3JD1 A;  3CRM A;  4WFH A;  4IIJ A;  3AG4 C;  3ASN B;  5LXT A;  1M93 A;  1Q6H A;  3B2E E;  4P9O A;  2DJV A;  1HDJ A;  1XIL A;  1N32 B;  2WLH A;  1U96 A;  4FLY A;  3BA9 A;  3JAM N;  5IDJ A;  1ZSP A;  4UCR A;  5JWP A;  1MG1 A;  1XNR B;  4O4J A;  3LSU A;  2CTP A;  3RYI A;  2ZDI C;  2ZKO A;  4LF6 B;  1O9H A;  2ITC C;  2JVD A;  2JGD B;  4O4L B;  4BAY A;  3R65 A;  1GN6 A;  4K3A A;  2XUM A;  4MS2 A;  2Q69 A;  3CCL V;  3DGE A;  4N21 A;  2Z5U A;  4R6Z A;  4PV1 B;  1OCO B;  3RYH B;  5FPR A;  2BSK B;  2NR5 A;  1KB9 F;  3MHH C;  4LFC O;  4TSF G;  5A2Q N;  4TV9 B;  2LW7 A;  4RUF A;  3ZX6 A;  4O2B B;  5H5N A;  1THZ A;  4TV8 A;  2QWR B;  1US6 A;  2HG5 C;  4YJ3 A;  1PV0 A;  1FKA O;  1CPY A;  3AK2 A;  2F4V B;  4DV1 O;  5EBW C;  1VQ5 V;  4X1K B;  4J10 A;  2UUA O;  2UXB O;  3RVZ A;  5IYD O;  3SJC C;  4YY3 B;  2A79 B;  4EFE A;  1KP3 A;  1MMM A;  1SES A;  2E5L B;  3IAY A;  2E76 B;  1KUQ A;  5CA3 A;  2A3Q A;  3RYF A;  2HP8 A;  4DV4 B;  1BQZ A;  1QU7 A;  4NYK A;  3SPG A;  2Q68 A;  4H13 B;  2R9A A;  4RWU A;  1NQT A;  3ZRX A;  2OCC C;  5KUM A;  3J7A U;  1KQS U;  1Q90 D;  2CAZ C;  2DOS A;  2R70 A;  3L74 H;  1WN7 A;  4DR1 O;  3H1L H;  2KQX A;  4U7N A;  3FB5 C;  1YF2 A;  2X6C A;  4JI3 B;  1B06 A;  2PTM A;  2EZO A;  1GMG A;  3ZMV A;  1NU1 H;  4WFB V;  1S5L Z;  3JD3 A;  3AK3 A;  5FNV A;  1ARO P;  4HYO A;  3ZBH A;  4LFB O;  2CDY A;  4JYA B;  5LP6 A;  3J80 N;  3CJH B;  4JI6 O;  3THO A;  1YTF B;  4YHH B;  3GB7 C;  2BTQ A;  1VF6 C;  4DR6 B;  2JK5 C;  2DWD C;  4X1I A;  3F7V C;  4DW1 A;  2HJD A;  2R72 A;  3N2K B;  4ZI7 A;  1SET A;  3QO5 A;  2QKA A;  3QO8 A;  4WBN B;  1MZF A;  3K5L A;  4QNH B;  2YUA A;  3X2Q C;  5J2U A;  4JYB A;  5JJE B;  1TA8 A;  4YXW G;  2WLI A;  3JSL A;  2EX3 A;  3C3T A;  1AI4 A;  1W0J G;  1WP7 A;  2MK3 A;  3CD6 V;  5LHH A;  3ASO B;  2A9H A;  3OMA B;  1SF9 A;  4OGQ B;  3SPH A;  2IJK A;  4FZ0 A;  4MW8 A;  3FB7 C;  1P7G A;  5L3C A;  3K57 A;  2DN9 A;  1A32 A;  5JJN B;  4UCU A;  3UM7 A;  4DR4 B;  1R6T A;  3Q4H A;  1OZ0 A;  4YIO A;  1DLB A;  4JI7 O;  3LSS A;  2Y69 B;  3DTU B;  1BQ0 A;  1ENV A;  1TGO A;  1R3J C;  4OXS A;  2ITD C;  3OFN G;  3P30 A;  3B8N A;  2HR3 A;  3B09 A;  2QSA A;  3K59 A;  2F4V O;  2DYS C;  2QKC A;  3ZCC A;  2CTQ A;  2RN9 A;  2ZT9 B;  1HNZ B;  2ZE6 A;  4IYH A;  1Q3E A;  2YEV A;  3EFF K;  2YC0 A;  3SPI A;  4MVZ A;  3TET A;  5KA6 A;  2LO1 A;  5J9P C;  4UFZ A;  1G4Y B;  4GUN A;  3BY6 A;  3N27 A;  1K4D C;  1Q82 W;  1JQ0 A;  1N8R W;  1TUE B;  1URF A;  2H3O A;  5B1O A;  4UB6 Z;  1K8A W;  2QGN A;  4DV6 B;  2KSD A;  3TK1 A;  3AG2 B;  4XDK A;  2YIA A;  1F7Y A;  1FFX B;  4DYL A;  2VQE B;  4EKW A;  3GVM A;  3IC9 A;  4PHZ A;  2K9P A;  2MW2 B;  4KHP O;  4PI2 A;  1I7F A;  2YXY A;  5DEC A;  5GON A;  1JR9 A;  1XDC A;  1R3L C;  4CZZ A;  1PL0 A;  1JFF B;  4LFC B;  4I9W A;  3D36 C;  1QR8 A;  1AR1 B;  1M4U A;  3BPZ A;  2CH7 A;  1WP8 A;  5EZY B;  1RM1 C;  1MOF A;  3KG2 A;  3QNE A;  3L75 H;  3ZHQ A;  4KFM A;  3X2Q B;  5KUK A;  4K0K B;  4LNU B;  3HPL C;  1XEQ A;  3SYC A;  4J9Y B;  1FAF A;  3EVK A;  4AI8 A;  1WAZ A;  3OGI B;  4J7Z A;  3B8M A;  4TWK A;  1H8H G;  2A06 H;  4GX2 A;  2IJH A;  1DF5 A;  5B1B B;  2PYL A;  1NVP B;  2ZE7 A;  3UT5 A;  2FML A;  3NR7 A;  2IH3 C;  4LCU C;  2GHY A;  3JAL B;  2H94 A;  4I50 A;  1S77 D;  3L71 H;  5LA6 B;  1WNS A;  5KX5 B;  2UXX A;  1Z2G A;  5L3B A;  1GK9 A;  1Q7Y W;  1M90 W;  3L72 H;  2EJR A;  2OIG A;  5B66 Z;  4CBC A;  4FLW A;  3JCU Z;  1L1F A;  1QVF U;  3ETD A;  1TVK A;  5LBQ A;  4X66 O;  2Q7E A;  4X65 B;  4NTW A;  3FB8 C;  1KKC A;  3K58 A;  4DR5 B;  1K33 A;  3CCQ V;  3CME V;  5CA0 B;  4F4L A;  2VS0 A;  4TOI A;  5EBM C;  4NVP A;  3L9D A;  1QHT A;  1NH2 C;  1GN3 A;  4U7O A;  4XBF A;  4WBN A;  2Q0A A;  2RCV A;  2Z0A A;  4OX9 O;  4X88 A;  4J41 A;  3OT7 A;  2NLJ C;  1D5A A;  2BOC C;  1FYJ A;  2JJ1 G;  2AZ0 A;  5BXZ A;  3ABL C;  4TV8 B;  2OIE A;  3K79 A;  1AR4 A;  3CXC U;  1XNQ B;  3G6E V;  3BCC H;  2GV9 A;  4I4T A;  4TQF A;  4H37 A;  4AIL C;  4DR4 O;  1YCI A;  2XTA A;  1OCO C;  4O4H B;  2ZQM A;  5BR8 B;  2GDS A;  4JAV A;  1QVG U;  1Y4M A;  2VQF O;  2HVK C;  4DV3 B;  2UUB B;  1NR1 A;  2EUL A;  2DWE C;  4K8Z A;  1JCH A;  1BHB A;  1HR0 B;  3FKS G;  4G27 B;  4TV9 A;  4JYA O;  4B3M B;  4JI0 B;  2WA4 A;  2LW1 A;  1IBK B;  1Q5O A;  2XAJ A;  2E74 B;  2PYJ A;  1V55 C;  2Z3Y A;  4IHJ B;  2M6Y A;  5IE9 A;  4DUY B;  1LR1 A;  1IXM A;  1Z5V A;  2UUC B;  4LF8 O;  5B3S B;  3AG7 A;  4JI6 B;  5JCO A;  3BHP A;  2HEP A;  1QQC A;  4J80 A;  1VMG A;  4KUM A;  1RFY A;  4O2A A;  1FFX A;  1RPR A;  3AG3 C;  5LMU O;  3M8A A;  4K35 A;  1AI5 A;  4DV2 O;  1JA8 A;  2P06 A;  1KKD A;  1VAR A;  4PA6 A;  4DRX A;  3RYC A;  1AB3 A;  4B08 A;  3SYA A;  1VQM V;  1SQG A;  2GUZ B;  1W59 A;  3N2G A;  3ZED A;  1DF4 A;  4JI5 O;  3ETG A;  3JD2 A;  2CTW A;  2BOB C;  1OCC C;  1GN4 A;  1TAE A;  2C2A A;  2EZP A;  2JS5 A;  3I5D A;  3O65 A;  1OV9 A;  1WPB A;  4E2L A;  5IJ9 B;  1M9N A;  2X6B A;  3CHX A;  3JD4 A;  4IT5 A;  2ADQ B;  5LMN B;  1VEW A;  4GCZ A;  1S3J A;  1G6U A;  2F23 A;  3RYI B;  4LFA B;  5LHI A;  4LWS A;  3R66 A;  4JI0 O;  3K5M A;  2DYR B;  4JI1 O;  3HKE B;  1Q8I A;  2WLJ A;  4QGP A;  5CN0 A;  2E3C A;  1XMO B;  3F7Y C;  3S3W A;  1EFR G;  3JAW A;  4WFE A;  5IY5 B;  4JTD B;  3BAB A;  2VRZ A;  5EK0 A;  5CB4 B;  1BGY H;  5KX5 A;  5F2V O;  5EIB C;  1UPG A;  2PI5 A;  3AG2 C;  4Z1V A;  1KMI Z;  1X4T A;  3BEH A;  4IL6 Z;  1KC8 W;  1VQ4 V;  4LF6 O;  1B3Q A;  2N05 A;  3N2K A;  4J9Z B;  1MSW D;  4UCV A;  4FZ1 A;  4N23 A;  1OCZ B;  1D5N A;  4K0K O;  2YIB D;  4FPP A;  1R1B A;  3GWK C;  1XNR O;  2QM4 A;  4LC1 A;  1EBO A;  2DYS B;  3MDS A;  2PY5 A;  3E83 A;  1K9M W;  4DV7 B;  3SYQ A;  1R3I C;  3SDL A;  1WA8 A;  3UQ8 A;  4BIZ A;  3DC6 A;  4EEQ A;  4JPR A;  2WPD G;  2UXB B;  2A7W A;  2UXN A;  5IY5 C;  4J42 A;  1N0N A;  2QWN B;  3JD0 A;  1H2G A;  1YIT V;  3CCS V;  5LGT A;  4AQY B;  2F95 B;  1G1X B;  4YJ2 A;  2WAM A;  1I94 B;  2KG7 B;  3F5W C;  1MSD A;  1SC5 B;  4QJF B;  4A5U B;  4LR3 A;  1LUV A;  3FAV B;  1MZE A;  5KHK A;  2Q7H A;  2WLM A;  1ORQ C;  3BRC A;  2EIM B;  2W6I G;  3H01 A;  3SJQ C;  2YXL A;  1RP3 B;  3T4Z A;  3W7W A;  4DW0 A;  3SJB C;  1N34 B;  3U11 A;  4JAA A;  2QE7 G;  3QO7 A;  5IYC O;  3WG7 B;  5EC2 C;  3OD4 A;  4NXM B;  1H2S B;  3IJ4 A;  4DR3 O;  1XI1 A;  4U3J A;  4MT8 A;  1IDS A;  4JI8 O;  3JCZ A;  3OMI B;  4FFK A;  5KA5 A;  1NH2 D;  5C93 A;  4IHJ A;  3JAS B;  4EB6 B;  1FFT B;  3K5N A;  1MNG A;  3ABM B;  5B1N A;  4F6R A;  1JFF A;  1XMQ B;  3JSN A;  2ODM A;  3ICX A;  5B3S C;  1HW7 A;  2YXH A;  4DV5 O;  4HNA A;  1JX9 A;  5LMN O;  3K9A A;  1B6Q A;  1S76 D;  2P4V A;  4QE9 A;  2ZE5 A;  4I5S A;  3CXH F;  2UXD B;  2NNU A;  3ABU A;  3C90 A;  3WU2 Z;  1F4N A;  4B3M O;  1EZV H;  4WFF A;  4LF5 B;  3OUS A;  2ZXW C;  5H9C A;  5IJ9 A;  5LXT B;  5KMG A;  4FM0 A;  3ZJZ A;  5FL7 G;  4BW9 A;  4TT3 G;  1HP8 A;  4C7U A;  3TCU A;  3ZRW B;  5BR8 O;  2HHH B;  2IJI A;  4NTX A;  1SQP H;  3T1Y O;  3CCV V;  5FLX N;  1PD3 A;  3JAW B;  3AEI A;  1R3K C;  5CA0 A;  2JGD A;  4DK0 A;  5K1X A;  4UCT A;  4D7S A;  3KKY A;  3ABL B;  2YI8 A;  2JGU A;  1FJG O;  3SYO A;  2N04 A;  4YJ3 B;  3CP1 A;  3MHS C;  2L6L A;  1H38 A;  1IUR A;  2WLI B;  3SPC A;  2H8P C;  4MVM A;  3JAT B;  5IYZ B;  1I08 A;  4E4E A;  4ICG A;  5GTH Z;  5JH7 B;  2OWO A;  4I55 A;  1SQB H;  1E1Q G;  1YVW A;  1GM9 A;  2IU3 A;  4UCS A;  4CH4 A;  1EN6 A;  3JAK B;  4GX1 A;  1SRY A;  2RDC A;  1WPX A;  4CS3 A;  5BMV B;  2BCC H;  4PDV A;  2EJ7 A;  4X1K A;  3E2E A;  1WA8 B;  3CC4 V;  4O2A B;  4Z1M G;  1IBK O;  2ETN A;  1IVS A;  2F93 B;  4UV9 A;  1SZX A;  1Y74 B;  3FB6 C;  1TUB A;  4O4I B;  1HNX O;  4GX5 A;  3E35 A;  1YXB A;  2F1M A;  3ZIA G;  5LYJ A;  1TUB B;  1NVP C;  5B1B C;  3CMA V;  1VF6 A;  4RUE A;  1G8M A;  3E86 A;  1O9G A;  4DV5 B;  2D2C B;  1ZL8 B;  4WCE V;  2WWW A;  1R6N A;  3J81 N;  2QR4 A;  1ZUQ A;  4NR1 A;  1VQO V;  4U3J B;  1VQ7 V;  3CCR V;  2ILM A;  3PN1 A;  3ZRS A;  1FD9 A;  3K04 A;  4DR5 O;  1P84 F;  3B4S A;  1L0N H;  3VBB A;  4GKJ B;  5FNV B;  1GN2 A;  3L73 H;  2CH7 B;  4MVU A;  2RQ6 A;  4I50 B;  3W7T A;  4CC5 A;  2X7R B;  3OGC C;  3CC2 V;  3LNM B;  5K1P A;  1YTF C;  1N33 O;  2GUZ A;  2LP7 A;  4DR3 B;  2M7W A;  1KD1 W;  3M99 B;  4X9Q A;  2YI9 A;  1DTO A;  5CBG A;  4AQY O;  4MSW C;  4DXW A;  4DV6 O;  5HFM A;  5LHG A;  2UXC O;  1H8E G;  3CRC A;  4JTC B;  5CMU A;  1E1R G;  2QEX V;  1QNM A;  2JDI G;  4RAI A;  4TUY B;  3UCS C;  2BTQ B;  2Q8V A;  3CPW U;  2ADP A;  3N2G B;  4DR7 O;  1L0L H;  3BAA A;  2V7Q G;  2PI4 A;  2GBO A;  4HNA B;  4PA7 A;  1HNZ O;  1FXK C;  3LNN A;  5KHH A;  3U0Z A;  3HR0 A;  1NZ6 A;  3STZ C;  3WB1 A;  2Q9L A;  5LGN A;  1PM9 A;  4ASU G;  1V55 B;  2ZNI A;  2ARH A;  4QIW F;  1SQV H;  4LF7 O;  3RWR D;  1IBL B;  5B1A C;  2LJ2 A;  1RPO A;  1F51 A;  2JJ2 G;  2OCH A;  5J2T A;  2ZIO A;  4FM1 A;  4BIU A;  2WA3 A;  2WLK A;  1PNK A;  2OT5 A;  5J2T B;  4KHP B;  2B5U A;  1GO3 F;  5EIB D;  1NBM G;  2HKO A;  2JEU A;  3I56 V;  1XMO O;  1K92 A;  3RVY A;  1V54 C;  2AXT Z;  3UO3 A;  1AJP A;  2R9R B;  2ZE8 A;  1YJN V;  4B3R B;  5CBF A;  1ZL8 A;  2D3O W;  4LH6 A;  2O57 A;  2QM7 A;  1VP7 A;  4DR2 B;  1YJW V;  2Y0P A;  4MVR A;  3APO A;  4H0L B;  3E22 A;  4PD4 F;  4B3S B;  4NKG B;  3A8T A;  1PL4 A;  5LOV B;  5BZB A;  3WB0 A;  3SYP A;  1P49 A;  4YHH O;  4O4H A;  4NXN O;  5JQG A;  2Q0O C;  2IM9 A;  2ZXW B;  3S3X A;  5CBH A;  3H1H H;  2IU0 A;  1RSO B;  5JQG B;  4WF9 V;  4X64 B;  4X1Y A;  5IJ0 B;  4D6T H;  4FMT A;  4LF9 B;  5GON B;  3ZMU A;  5EYP A;  3ZHV A;  1FJG B;  4DV7 O;  4UVC A;  2DQ3 A;  2FYU H;  4G2K A;  4ZOL B;  1JJ2 U;  2V1D A;  2YDE A;  3STL C;  3HKD B;  4GKK B;  2OTL V;  1HWY A;  3LDD A;  4JAU A;  3AG4 B;  3ASN C;  3ABM C;  4JF3 A;  4P9P A;  3TJT A;  5H6R A;  5L3G A;  4DUY O;  5KAF Z;  4NTY A;  1BT8 A;  5JJJ B;  4ZHQ B;  2HHH O;  3SR2 C;  2XAH A;  4Q6G A;  3ZMT A;  2P4K A;  1N4C A;  5L3E A;  1P7B A;  5LMU B;  1M5I A;  1V9P A;  3ZHU A;  2ZNJ A;  4DR6 O;  4PA3 A;  4BW5 A;  4RQE A;  4JZ2 A;  3JAL A;  5E1A C;  1NJI W;  3OM3 B;  4UVB A;  3CCM V;  1YDX A;  1H2L A;  4I0X A;  4RO2 A;  4PDR A;  3W7X A;  3E8F A;  3CSX A;  2PZS A;  3B77 A;  2UU9 O;  3PJS K;  1S5H C;  4DR1 B;  1Q86 W;  4UB8 Z;  1AVM A;  5CA1 A;  1ZLZ A;  4DUZ B;  1N36 B;  1J5E O;  2AHY A;  5IWA B;  3A0B Z;  3OTO B;  1IX9 A;  2CGO A;  4LFB B;  3JAT A;  3CB2 A;  1VQL V;  3CEI A;  1KBH A;  2P90 A;  3MD0 A;  3T4D A;  3VQX A;  2A0L A;  3QVN A;  1DGS A;  4MTF A;  4UCO A;  4DK1 A;  3DC5 A;  4JYC A;  1NR7 A;  4ZKI A;  1HNW O;  5JVD B;  4GYC B;  4CC6 A;  4LF7 B;  3BFR A;  4I7Z B;  2AHZ A;  3ETQ A;  1S72 V;  4GLX A;  3A0H Z;  3OW2 U;  4DV4 O;  3ABT A;  3AG1 C;  2VWK A;  2UUC O;  2Y4T A;  1N32 O;  2RNB A;  4J11 A;  2E5L O;  3T1Y B;  3HKD A;  3ETE A;  2ZDI A;  1K7D A;  1OCR B;  2P7T C;  2RMK B;  1I94 O;  3G80 A;  2V4D A;  2WLL B;  3ZHS A;  2UUA B;  1GH6 A;  4B3R O;  1EN4 A;  1Y76 A;  1QLN A;  2E75 B;  4JTA B;  4DV1 B;  4WFG A;  3QTC A;  2W0F C;  1S0V A;  3ASO C;  1BS3 A;  1SS3 A;  1N0J A;  2UXD O;  3ABK C;  5C8Y B;  3CJH A;  4F6R B;  1COW G;  1P4R A;  1XHX A;  3HB3 B;  3IGA C;  3QF7 A;  3FD9 A;  4ABM A;  4JI2 B;  4R7C A;  2DE0 X;  2YIB A;  1LUW A;  4BIO A;  4EB6 A;  5EZY A;  3WB2 A;  4FFB A;  1GAX A;  5EYP B;  2IW5 A;  1NKD A;  1FPO A;  3SGI A;  1AIL A;  3ZS8 C;  2EIN C;  3CCJ V;  1UJW B;  2YID A;  3UO2 A;  4JI8 B;  3CRQ A;  2ATK C;  4P2Z A;  1AP5 A;  5LYJ B;  2QWO B;  2EIK C;  4FLU A;  1W0K G;  1VQP V;  3AG3 B;  5EC1 C;  2X0L A;  1QCE A;  4UUJ C;  2VQE O;  1CXZ B;  2N74 A;  2W0X A;  4ZHQ A;  2EIL B;  4FLT A;  4JI2 O;  4OPA A;  5JVD A;  1F23 A;  3RW0 A;  4LF4 O;  4X66 B;  1TVK B;  3T1C A;  1YZB A;  5E79 Z;  5TIS Z;  2ZM6 B;  4LP8 A;  5KHI A;  4L8J A;  2OTJ V;  2Q4P A;  4J7J A;  1NVP D;  4G28 B;  1FXK A;  3IC7 A;  4QE7 A;  3CRA A;  4X20 B;  3P3P A;  2WLN A;  3OMN B;  4MVO A;  4X1I B;  4J7K A;  3K0D A;  4GKJ O;  1SZT A;  1Y6X A;  4X20 A;  2UXC B;  1ZTE A;  2ZCE A;  5IYB O;  4Q20 A;  3D3Q A;  1SA0 B;  3KCX A;  4IYI A;  1BMF G;  2ZIM A;  5CA1 B;  5JH7 A;  2XND G;  1N33 B;  2DQ0 A;  2EIJ C;  4GT1 A;  4FM2 A;  5DED A;  4I0X B;  4K8X A;  4JGS A;  2OYQ A;  4JAS A;  4O2B A;  1HNX B;  3K5O A;  2AZ2 A;  5IWA O;  4IGG A;  2VWJ A;  3D8C A;  3M7M X;  2EIM C;  3GWO A;  1M57 C;  1HNW B;  1JVM A;  3ML0 A;  3OE7 G;  1I0H A;  2PF4 E;  3LUT B;  3CYO A;  2WLL A;  2L35 A;  5A9G A;  4YJ2 B;  1K73 W;  2Q6A A;  4FFB B;  1YEW A;  1Q6U A;  3LDE A;  2XOK G;  4AHC A;  1OJH A;  1AJN A;  1MAB G;  1B04 A;  1NTK H;  4DUZ O;  1OCR C;  1YI2 V;  4EFB A;  4CH3 A;  4JI4 B;  1YIJ V;  2QM8 A;  1K5S A;  4O4I A;  2P22 C;  2QDO A;  1XQ8 A;  2FKX A;  1T5E A;  2LGW A;  2YEV B;  3AG1 B;  1QLE C;  1EN5 A;  3RYH A;  3K08 A;  1XL4 A;  1AI6 A;  2LQT A;  5EBL C;  3HKB A;  4B7K A;  4GZR B;  1ZWI C;  1W2B U;  1FXK B;  1OCZ C;  2IJJ A;  5GW7 A;  4JI5 B;  4KP4 A;  5LOV A;  4MW3 A;  4B7E A;  1K97 A;  4PEL A;  1VF5 B;  5HFL A;  1IZ3 A;  4MVQ A;  3A0R A;  1EM1 A;  5DM6 V;  1IXB A;  1FS0 G;  4GX0 A;  3SJA C;  2BTO A;  2JRI A;  2EIK B;  1JPX A;  2GTA A;  5LP6 C;  2XAS A;  1VQN V;  2B1I A;  3EXA A;  3ZMZ A;  4UV8 A;  5H6Q A;  4CH6 A;  1SQF A;  3TGU H;  4MTG A;  5LA6 A;  4JZG A;  3C3S A;  2BE3 A;  1R6K A;  4OPH A;  2EIN B;  3OR7 C;  1X59 A;  4GKK O;  3OTO O;  2DYR C;  4X62 O;  1JJO A;  3ZHR A;  4LF8 B;  2HFE C;  3ZRV A;  1FXV A;  4X65 O;  4FLX A;  1BE3 H;  2LGQ A;  1RM1 B;  3K0G A;  4LNU A;  3RT3 C;  3U10 A;  4LF9 O;  2UU9 B;  3K06 A;  1FXH A;  5KMG B;  4CS4 A;  1WB8 A;  3MAQ A;  4TUY A;  3T1H O;  4DR2 O;  1BCC H;  1NT2 B;  1SQX H;  2GTS A;  4I4T B;  1XL6 A;  3H9V A;  4FJC C;  3HKC A;  4NXN B;  3DXR A;  4MTO A;  1YSC A;  3O9O A;  3UT5 B;  1HR0 O;  3OTF A;  1YJ9 V;  3OEH G;  4FIP C;  1ROP A;  2Y4U A;  4DV3 O;  2UUB O;  4ZBM A;  4B3S O;  2VQF B;  4JI3 O;  4CS2 A;  4BR6 A;  2Q67 A;  2DW4 A;  3D36 A;  4L87 A;  1WB7 A;  1QBZ A;  2EBO A;  4O4L A;  1EZJ A;  1QLE B;  3FYE B;  1H2K A;  4NXM O;  1M56 B;  1NTZ H;  4FLZ A;  1GKF A;  2P5O A;  1N34 O;  5KLV H;  3FX7 A;  1M56 C;  1I5Y A;  1SER A;  3Q4H B;  2AW9 A;  1SA0 A;  2XT9 A;  4LBE C;  4CH5 A;  3WFV A;  4X64 O;  3CCE V;  3KCY A;  3KZI Z;  1DK1 A;  4KL1 A;  2BSK A;  1BZK A;  5IT9 N;  4QPJ A;  3K3W A;  1Y74 A;  2KB1 A;  3LSQ A;  3H1K H;  3RN4 A;  2Y0I A;  4MVS A;  3E89 A;  3JAR B;  4LFA O;  4UXN A;  2XAG A;  3G71 V;  3T1H B;  1H2M A;  3OUF A;  2K1E A;  1VQ8 V;  4ZOL A;  1F4M A;  3B40 A;  4DO2 A;  1GTO A;  3K9S A;  2XAF A;  1GM8 A;  4KXR A;  3CS5 A;  1CEZ A;  2HVJ C;  1JOY A;  4X1Y B;  5IJ0 A;  4X62 B;  2QTO A;  3APQ A;  1VQK V;  5D5P A;  1V54 B;  1U97 A;  3K03 A;  5L3F A;  3G4S V;  3E22 B;  3TXQ A;  4ZIB A;  4D7T A;  4QPK A;  4B3T B;  5IYZ A;  3E8H A;  2XHB A;  1Y67 A;  4I55 B;  3CX5 F;  1NH2 B;  4LWS B;  4MTX A;  3JAS A;  4PA4 A;  1YTF D;  1KU9 A;  4W4K A;  5LP6 B;  3BA8 A;  1IBM O;  2FB5 A;  1K5Q A;  1K4C C;  2RJZ A;  4FLV A;  5B1A B;  3RGB A;  2YS8 A;  2KKW A;  2ZR2 A;  5BMV A;  2F43 G;  2QA4 V;  1AP6 A;  3L70 H;  4JYY A;  5KHJ A;  4XDL A;  2QKS A;  2OCC B;  4WFA V;  3OAA G;  2QWQ B;  3ZN0 A;  2P6J A;  3HKB B;  5B5E Z;  2JEX A;  5ITZ B;  1AJQ A;  4JI1 B;  1J5E B;  5KHG A;  1KYO F;  5BY1 A;  1M1K W;  4HZ3 A;  1S5J A;  4U3F H;  4DRX B;  3RYC B;  2PUS A;  4HAM A;  2EIL C;  4Z2W A;  3DSQ A;  1I5X A;  5L3D A;  4ZI7 B;  3E8B A;  3HKE A;  4YIP A;  2XAQ A;  1XBL A;  2DMX A;  4DV0 B;  2Q73 A;  3G67 A;  5LL6 Y;  3UKM A;  4IIJ B;  2ZD9 A;  4PDL A;  1ZX3 A;  2CUG A;  2QWP B;  5J2U B;  1R73 A;  2CTR A;  2YIC A;  1KEC A;  4P30 A;  3LDC A;  1SKV A;  3FYI B;  3H1I H;  1XHZ A;  1J95 A;  1VIB A;  1GRJ A;  4PI0 A;  3VOU A;  3ZMS A;  4PDM A;  5H2F Z;  2B1G A;  1H2N A;  3FFQ A;  3IFX A;  4O4J B;  2HJF C;  2ZIN A;  3VQW A;  2PGG A;  1PPJ H;  3SPJ A;  2FL4 A;  3WG7 C;  2LFR A;  4H44 B;  3OR6 C;  4R8C A;  1WJZ A;  2IBZ H;  3QG5 A;  1KP2 A;  4JV5 O;  3VQY A;  2Q7G A;  1M57 B;  1MA1 A;  3JYC A;  1JMK C;  3P3N A;  2KG7 A;  3A2F A;  2QTS A;  3FAV A;  1CP9 A;  5AG2 A;  3HKC B;  5JCO C;  3CCU V;  1BL8 A;  3ABK B;  2P67 A;  4OX9 B;  4JI7 B;  1PNL A;  2JIZ G; 
#chains in the Genus database with same CATH homology
 3CCJ V;  2HLD G;  2X6A A;  2R9I A;  3CP1 A;  3MHS C;  1H38 A;  3B8M A;  1UJW B;  2WLI B;  4TWK A;  3SPC A;  1H8H G;  2ATK C;  4GX2 A;  4P2Z A;  2IJH A;  1DF5 A;  2H8P C;  4MVM A;  3ZN1 A;  2EIJ B;  5B1B B;  1NVP B;  2EIK C;  1VQP V;  1W0K G;  3AG3 B;  5EC1 C;  4XDJ A;  2X0L A;  1QCE A;  4UUJ C;  1PKX A;  1E1Q G;  2IH3 C;  4LCU C;  2GHY A;  3W7S A;  2H94 A;  1S77 D;  1GM9 A;  2IU3 A;  5LGU A;  2EIL B;  2UXX A;  3D3I A;  1AI7 A;  1SRY A;  4GX1 A;  1WPX A;  5L3B A;  2IH1 C;  1QR9 A;  1F23 A;  3RW0 A;  3I55 V;  2ZR3 A;  1GK9 A;  4FK5 C;  1Q7Y W;  3T1C A;  1M90 W;  4LP8 A;  2EJR A;  2OTJ V;  4PDV A;  4CBC A;  4G28 B;  1FXK A;  1LNQ A;  3IC7 A;  1NVP D;  1GM7 A;  1E79 G;  4QE7 A;  3P32 A;  3E2E A;  1L1F A;  1QVF U;  3ETD A;  3EHB B;  3CC4 V;  2WLN A;  4Z1M G;  5LBQ A;  3OMN B;  4MVO A;  1PNM A;  3FB8 C;  3K0D A;  1SZT A;  4UV9 A;  3FB6 C;  1K33 A;  5IYB O;  1Y66 A;  4GX5 A;  3CCQ V;  2Y69 C;  3E35 A;  4Q20 A;  3CME V;  3ZIA G;  1BMF G;  4F4L A;  3W7U A;  2XND G;  1NVP C;  1OHH G;  2DQ0 A;  3OEE G;  2EIJ C;  5B1B C;  5EBM C;  4GT1 A;  3CMA V;  1K3E A;  4RUE A;  2GSM B;  1G8M A;  2W6J G;  3E86 A;  1NH2 C;  4U7O A;  4XBF A;  4WCE V;  4R50 A;  2WWW A;  4JGS A;  1R6N A;  4X88 A;  2NLJ C;  3CC7 V;  1Q81 W;  2BOC C;  2FTK A;  4JAS A;  1BHA A;  1K34 A;  1VQO V;  2JJ1 G;  4UVA A;  4X8A A;  3ABL C;  1WLE A;  3T2M A;  3ZRW A;  3CCR V;  1VQ7 V;  3ZRS A;  3K04 A;  3K79 A;  1YHQ V;  3CXC U;  2WSS G;  3G6E V;  2YSU B;  3VBB A;  4PA9 A;  2EIM C;  3GWO A;  1M57 C;  3NXS A;  4H37 A;  4MVU A;  1JVM A;  3ML0 A;  3OE7 G;  1OCO C;  1OCC B;  3W7T A;  2ZQM A;  2LFS A;  2X7R B;  3OGC C;  3CC2 V;  3LNM B;  4JAV A;  5DN6 G;  1Y4M A;  3LUT B;  1QVG U;  4X89 A;  1YTF C;  2HVK C;  3CYO A;  2WLL A;  4H33 A;  1NR1 A;  2LP7 A;  2Y48 A;  2DWE C;  2M7W A;  2Q6A A;  3E8G A;  1K73 W;  1KD1 W;  3M99 B;  1JCH A;  3LDE A;  1DTO A;  2CK3 G;  2XOK G;  5CBG A;  4RQF A;  1BHB A;  4MSW C;  1VQ9 V;  4DXW A;  3RBZ A;  1AJN A;  5HFM A;  5LHG A;  1MAB G;  1H8E G;  3FKS G;  1VQ6 V;  4G27 B;  4JTC B;  5CMU A;  1E1R G;  3JD1 A;  1OCR C;  2QEX V;  1YI2 V;  2JDI G;  4WFH A;  4RAI A;  2XAJ A;  1YIJ V;  2QM8 A;  1K5S A;  1V55 C;  3CPW U;  2Z3Y A;  3AG4 C;  3ASN B;  2V7Q G;  2PI4 A;  4PA7 A;  1FXK C;  4P9O A;  2YEV B;  3AG1 B;  1QLE C;  3K08 A;  1XL4 A;  1IXM A;  2WLH A;  3STZ C;  1AI6 A;  5LGN A;  5IDJ A;  5EBL C;  4ASU G;  1MG1 A;  5B3S B;  1V55 B;  1ZWI C;  1W2B U;  1FXK B;  1OCZ C;  2IJJ A;  5GW7 A;  4QIW F;  4KP4 A;  4MW3 A;  2ZDI C;  1K97 A;  5B1A C;  4KUM A;  4PEL A;  5HFL A;  1RPO A;  3AG3 C;  1RPR A;  1F51 A;  2JJ2 G;  4MVQ A;  3A0R A;  1AI5 A;  2ITC C;  5DM6 V;  1KKD A;  4BIU A;  1FS0 G;  4BAY A;  4GX0 A;  2WLK A;  3R65 A;  1PNK A;  2OT5 A;  2EIK B;  1JPX A;  4PA6 A;  2XAS A;  1VQN V;  2B1I A;  2B5U A;  3ZMZ A;  4UV8 A;  5H6Q A;  4MS2 A;  2Q69 A;  1GO3 F;  1NBM G;  2HKO A;  3CCL V;  2JEU A;  3I56 V;  4MTG A;  3SYA A;  1VQM V;  1K92 A;  1R6K A;  3RVY A;  1V54 C;  1DF4 A;  2EIN B;  3DGE A;  3ETG A;  3OR7 C;  4N21 A;  1AJP A;  2R9R B;  2DYR C;  2Z5U A;  4R6Z A;  3JD2 A;  1YJN V;  2HFE C;  3ZRV A;  1FXV A;  5CBF A;  2BOB C;  1OCC C;  1OCO B;  2C2A A;  2EZP A;  2D3O W;  1RM1 B;  3K0G A;  2QM7 A;  4E2L A;  3MHH C;  1YJW V;  4TSF G;  4MVR A;  1M9N A;  3K06 A;  4RUF A;  1FXH A;  2X6B A;  1THZ A;  3JD4 A;  2HG5 C;  4GCZ A;  1S3J A;  5BZB A;  5LHI A;  3SYP A;  1CPY A;  1XL6 A;  2DYR B;  4FJC C;  2WLJ A;  5EBW C;  1VQ5 V;  4MTO A;  5CN0 A;  1YSC A;  2ZXW B;  3F7Y C;  1EFR G;  4WFE A;  5IY5 B;  4JTD B;  5CBH A;  3OEH G;  4FIP C;  5EK0 A;  3RVZ A;  5IYD O;  1YJ9 V;  1ROP A;  2IU0 A;  2PI5 A;  2A79 B;  3AG2 C;  4WF9 V;  4ZBM A;  1KP3 A;  4FMT A;  1SES A;  2Q67 A;  3BEH A;  1KC8 W;  1VQ4 V;  2DW4 A;  3D36 A;  3ZMU A;  4L87 A;  5CA3 A;  4J9Z B;  1MSW D;  4UVC A;  2DQ3 A;  1QBZ A;  4G2K A;  2EBO A;  4N23 A;  1EZJ A;  1OCZ B;  1QLE B;  3FYE B;  1JJ2 U;  2V1D A;  3STL C;  4FPP A;  3SPG A;  2OTL V;  1HWY A;  1M56 B;  2Q68 A;  3LDD A;  1GKF A;  1NQT A;  4JAU A;  3AG4 B;  3ASN C;  3ZRX A;  2OCC C;  3ABM C;  1EBO A;  4LC1 A;  4JF3 A;  2DYS B;  5KUM A;  1M56 C;  1I5Y A;  4P9P A;  1SER A;  3E83 A;  5H6R A;  1K9M W;  1KQS U;  3SYQ A;  5L3G A;  1R3I C;  4LBE C;  4U7N A;  3FB5 C;  2XAH A;  3WFV A;  3ZMT A;  2X6C A;  4BIZ A;  3CCE V;  5L3E A;  2EZO A;  1P7B A;  1GMG A;  3ZMV A;  4WFB V;  4QPJ A;  4JPR A;  3JD3 A;  3K3W A;  2WPD G;  1ARO P;  4HYO A;  2KB1 A;  2UXN A;  3LSQ A;  4PA3 A;  4BW5 A;  5IY5 C;  3JD0 A;  1H2G A;  4RQE A;  4MVS A;  1YTF B;  1YIT V;  3CCS V;  3GB7 C;  5LGT A;  3E89 A;  2JK5 C;  2DWD C;  5E1A C;  3F7V C;  3OM3 B;  1NJI W;  4UVB A;  3CCM V;  2WAM A;  4UXN A;  2XAG A;  3G71 V;  3OUF A;  1SET A;  2K1E A;  4RO2 A;  3F5W C;  1F4M A;  3QO5 A;  3QO8 A;  4PDR A;  4QJF B;  1VQ8 V;  4DO2 A;  3W7X A;  1GTO A;  3E8F A;  4QNH B;  3X2Q C;  2XAF A;  3B77 A;  2WLM A;  3PJS K;  1S5H C;  1GM8 A;  1ORQ C;  4JYB A;  2EIM B;  2W6I G;  1Q86 W;  1CEZ A;  3H01 A;  3SJQ C;  3T4Z A;  2HVJ C;  2AHY A;  1JOY A;  3W7W A;  2QTO A;  4YXW G;  1VQK V;  1V54 B;  2WLI A;  3K03 A;  5L3F A;  3G4S V;  1AI4 A;  2QE7 G;  1W0J G;  3QO7 A;  2MK3 A;  3CD6 V;  5LHH A;  3ASO B;  2A9H A;  5EC2 C;  3WG7 B;  3OMA B;  5IYC O;  4QPK A;  1VQL V;  3SPH A;  3E8H A;  2IJK A;  2P90 A;  3MD0 A;  1NH2 B;  4MTX A;  4PA4 A;  4MW8 A;  3FB7 C;  3T4D A;  2A0L A;  1YTF D;  4MTF A;  4MT8 A;  5L3C A;  3JCZ A;  3OMI B;  1K5Q A;  4JYC A;  1NR7 A;  1K4C C;  4ZKI A;  5KA5 A;  3UM7 A;  5B1A B;  1NH2 D;  5C93 A;  1OZ0 A;  1DLB A;  3LSS A;  2Y69 B;  2ZR2 A;  1FFT B;  2F43 G;  2QA4 V;  3DTU B;  1ENV A;  1R3J C;  2AHZ A;  4XDL A;  1S72 V;  2QKS A;  2OCC B;  3ABM B;  4OXS A;  2ITD C;  5B1N A;  4WFA V;  3OAA G;  3OFN G;  3P30 A;  3B8N A;  3ZN0 A;  2P6J A;  2HR3 A;  3OW2 U;  3ABT A;  3AG1 C;  2JEX A;  1AJQ A;  5B3S C;  2DYS C;  3ZCC A;  1M1K W;  4HZ3 A;  1JX9 A;  3K9A A;  2YEV A;  3EFF K;  4HAM A;  2EIL C;  1B6Q A;  4MVZ A;  3SPI A;  3ETE A;  5KA6 A;  3TET A;  1S76 D;  4QE9 A;  5J9P C;  1I5X A;  4I5S A;  2ZDI A;  5L3D A;  1G4Y B;  1K7D A;  1OCR B;  2P7T C;  3E8B A;  2XAQ A;  3BY6 A;  1K4D C;  2NNU A;  1Q82 W;  3UKM A;  1JQ0 A;  3ABU A;  2ZD9 A;  4PDL A;  1F4N A;  4WFF A;  2WLL B;  1N8R W;  1TUE B;  5B1O A;  1K8A W;  1R73 A;  3OUS A;  2ZXW C;  1KEC A;  4P30 A;  5H9C A;  1QLN A;  3TK1 A;  3AG2 B;  4XDK A;  3LDC A;  3FYI B;  4JTA B;  1J95 A;  4WFG A;  4EKW A;  3VOU A;  3ZMS A;  3ZJZ A;  4PDM A;  5FL7 G;  2W0F C;  1S0V A;  3ASO C;  4TT3 G;  2B1G A;  3IFX A;  3ABK C;  3TCU A;  2HJF C;  3ZRW B;  1R3L C;  2IJI A;  3SPJ A;  4CZZ A;  1COW G;  1P4R A;  1PL0 A;  3WG7 C;  2LFR A;  3OR6 C;  3HB3 B;  3IGA C;  4I9W A;  4R8C A;  3CCV V;  1QR8 A;  1AR1 B;  1PD3 A;  3AEI A;  4R7C A;  1KP2 A;  1R3K C;  1RM1 C;  1MOF A;  1M57 B;  3JYC A;  3KG2 A;  3QNE A;  4KFM A;  3X2Q B;  5KUK A;  1CP9 A;  3HPL C;  3CCU V;  3ABL B;  1BL8 A;  3ABK B;  2P67 A;  2IW5 A;  3SYO A;  1NKD A;  3SYC A;  4J9Y B;  1PNL A;  2JIZ G;  2EIN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...