5IYCO

Human core-pic in the initial transcribing state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
O PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5iycO01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 5iycO02
1YTFC 1NH2C 1NVPD 5IYBO 1RM1C 5IYCO 1RM1B 1NVPC 1NH2D 5IYDO 1YTFD
chains in the Genus database with same CATH superfamily
1VF5B 4HBNA 3T4DA 1EN4A 5JQGB 5KHJA 1KB9F 1SKVA 3ETDA 2YXLA 3LDDA 4F6RA 4PD4F 2QM8A 4DRXA 4I55A 4MS2A 2HHHB 3BFRA 4EB6B 1TUBA 2P7TC 2JJ1G 4TWKA 4X64O 1XUQA 2LGWA 1PV0A 4I5SA 3TETA 2VRZA 2R9RB 1Y74A 3G67A 4B7KA 1FXKA 1EN6A 5ITZA 4X65O 1G1XB 3CCEV 1NH2C 3P30A 3U11A 2EIKC 4IHJA 3OGIB 1NTKH 4F4LA 5LA6A 3D36C 3OGCC 5DM6V 2BSKB 1M4UA 2WLKA 2BOCC 1XL4A 2EJ7A 1WP8A 3PJSK 1EFRG 2IU3A 3IC7A 4MTOA 4PJ0Z 2ARHA 2DYSB 1KP2A 4IYHA 1IDSA 4OGQB 3CRAA 4O4IB 5JQGA 2IJIA 4J11A 1V9PA 5KUMA 1NT2B 2LQTA 3K0DA 4JI4B 2DQ0A 3CCJV 2VWKA 2CDYA 2BTQB 1KKCA 2P4VA 2EILC 2VQEB 2XAFA 2CGNA 3P32A 4EB6A 5LP6B 3L71H 2UXNA 4TQFA 3ZBHA 3CC4V 4GCZA 1HNXB 1SQGA 2XOKG 4I4TB 2E74B 2JGUA 2ZXWC 1ZWIC 2OCCB 4JV5O 5DN6G 2JJ2G 2PYJA 4W4KA 4DW1A 5LMUB 3CMAV 4GKJO 4DUZB 2QM7A 3R66A 1HP8A 3ABTA 1VQ7V 2BSKA 3ZRVA 1WB8A 2QA4V 4QPJA 4J80A 4JASA 1O9HA 1DTOA 3K9AA 5HFLA 3JD1A 1K7DA 2R72A 1IXMA 3CD6V 1PM9A 1YTFD 1VQ5V 2RJZA 3VQXA 3K0GA 3CCVV 2Q68A 5LOVB 4LBEC 1EBOA 1YJWV 3ABUA 5H5NA 5TISZ 3A0BZ 3LSQA 1M90W 5JJJB 4LFAB 1KYOF 1K3EA 1Q43A 2ZE6A 4LF4B 5EBMC 4G2KA 4E4EA 1QVFU 2EIJB 1GTOA 2BTQA 1G8MA 4FLUA 1YIJV 4LCUC 1OCRB 5LP6A 3ETQA 3JASB 2JGDB 4CS2A 5JCOA 1W59A 4I4TA 5B3SC 1XMQB 1GH6A 2UU9O 4WF9V 3RGBA 1S76D 4DR4B 1UJWB 3RYIB 1GO3F 2K1EA 1V55B 4NVPA 1X59A 4FJCC 3JARB 1J95A 3SYCA 5LBQA 4FLWA 1OV9A 1N34O 3L73H 3I56V 4H33A 3OMNB 3U10A 3ZHSA 4DR6O 4LFCO 1Q7YW 2Q7GA 3CWBH 2PI4A 1ZLZA 1YITV 3LUTB 3W7UA 4JYAO 4K0KO 2X6CA 2XNDG 4MVOA 5B1NA 1NR1A 1OCOB 1ZSPA 4ZIBA 2OTJV 3ASOB 4UCUA 1NU1H 5JVDB 3C90A 1F4NA 5FL7G 1US6A 1VQ4V 4OXSA 1M93A 2HJDA 2OWOA 3CCRV 1DF4A 2JGDA 2E76B 1QBZA 2XAJA 4CH4A 4DV0O 1IBLO 4H0LB 4UB6Z 3E8BA 1CXZB 1MNGA 4RQFA 5D5PA 2YIDA 4AI8A 3QTCA 2EJRA 3HKBB 1K33A 3FB7C 4J42A 1ENVA 3ZMUA 3OD4A 3RYIA 3OMAB 1J5EO 3ZHQA 2UXXA 3F7VC 1YTFC 1FYJA 1FXKC 4R6ZA 2EIMB 3ABLB 5C93A 3OR6C 1XBLA 3AK2A 1XILA 1D5AA 3K5LA 5JJNB 2AXTZ 4NTYA 3WB0A 3ABMC 4KXRA 1VF6A 3RYFB 1Q81W 2Q4PA 3A0RA 2G38A 2WLLB 4JI8B 1H8EG 1VQ8V 1HWYA 4IGGA 4YJ2A 4DR5O 5JH7B 5KLVH 4GX0A 1KKDA 2GDSA 4CH3A 4JI0B 4AILC 2K9PA 4RO2A 4NXMB 2N04A 3SPJA 5JVDA 4O4JB 1G6UA 1TA8A 1BT8A 3OTFA 1M1KW 4N21A 2AGAA 4DYLA 5CBGA 1R3KC 3K59A 3ICXA 2EULA 3OUFA 3VQYA 1AJPA 2CTQA 4FFKA 1NS1A 1OJHA 3WG7C 3B40A 3HKBA 4TSFG 4LF6O 3K79A 4ZHQA 2X0LA 2Q73A 1UPGA 1H8HG 3KG2A 3EHBB 5E1AC 4DUYO 2VWJA 3LNMB 4X62O 2FB5A 3VBBA 4TUYB 1R3LC 3CCMV 3HKEB 3ZHVA 3HKDA 1NKDA 3RYFA 4K35A 4DV2O 3X2QC 4HNAB 2WLLA 4CS4A 1VQ6V 3ZMSA 3RYCB 3SJBC 2Q0OC 2V4DA 1FKAO 5GTIZ 2Q7EA 3CS5A 4O4JA 4TV8B 2F66C 3UT5B 2QE7G 2DE0X 1Q86W 4YIPA 1R6NA 2DWDC 1BL8A 3KCXA 4DR3B 1AB3A 3M8AA 2M6YA 1NH2B 1I94B 2N74A 1M57C 2EIKB 2WLNA 1F4MA 1WB7A 1YSCA 1HNWB 5L3GA 2IH3C 4MVQA 4I9QA 1Y66A 2QKAA 1FJGO 1QR8A 3C3TA 3FAVA 5L3EA 3ZEDA 5BR8O 2Q7HA 4NYKA 5EBLC 1NVPD 1Z5VA 2R70A 5IY5B 3CRQA 4TUYA 1VQNV 3HKEA 4LNUB 3E83A 3FB5C 4IYIA 2IBZH 4UVAA 4HNAA 3H1JH 2QGNA 4JI5O 1VARA 4CBCA 3RYCA 1JJOA 1H2SB 2EILB 3B4SA 1AR1B 1F23A 2IM9A 4K8ZA 1ZUQA 1K5QA 3DC5A 2M7WA 1GMGA 4TV8A 3UT5A 4BR6A 4LFBO 1BSMA 4X1YB 3G6EV 4BWAA 4D6TH 3RW0A 3EFFK 2XHBA 2ZXWB 1PL4A 3O9OA 4B3TB 2BCCH 3D36A 4PA3A 1QLNA 4KHPO 1F7YA 3RBZA 4B3MB 3K06A 4I9WA 1BS3A 1H2MA 1R6KA 3LSSA 4MVRA 4FM0A 2PGGA 4TQDA 1NJIW 4DR7B 4GKKB 1KU9A 2Y48A 1WP7A 4EEQA 4U7NA 1AP6A 2Y4TA 4MW8A 5B5EZ 4LNUA 4FLVA 1V55C 3BCCH 3LSUA 4DV5B 1XHXA 3MDSA 3CC2V 2CTRA 5IYDO 3AG4C 1R1BA 4FVMA 4J9YB 5LHGA 1AI5A 1L8DA 1PP9H 4WBNB 3QVNA 1K5SA 2AW9A 2OYQA 4ZKIA 5HFMA 5GW7A 2UUCO 4Z2WA 4X1YA 1YI2V 1WPBA 4LP8A 3RVYA 4X20B 4DV3B 1LUWA 1HNZB 2X7RB 5B3SB 5CB4B 4DV4B 1YXBA 3UCSC 1KC8W 3W7XA 4DXWA 4WCEV 3CMEV 1XMOO 3K9SA 2A06H 1K4CC 1K34A 2ETNA 1NVPC 1VQOV 2YDEA 3BABA 2YI8A 2VQFO 1N32B 1Q90D 1VP7A 1AROP 3OUSA 3JSNA 4O2BB 2OIGA 1NI8A 2P6JA 1PKXA 1AILA 2ZDIC 4MVSA 1RPRA 4KFMA 2GBOA 4GX2A 4JYBA 1P7BA 3KCYA 3QF7A 4K3AA 1EZVH 3JD2A 3SYAA 5FLXN 2DWEC 2A0LA 2N05A 2Q69A 4JI3B 1ZTEA 2A79B 2RN9A 3JAKB 4C7UA 4B3RO 1OCZC 4JI7B 4YHHB 4L8JA 4X20A 1Z2GA 4JTCB 5CB4A 4L87A 2HVKC 1ORQC 1FD9A 3T2MA 2PUSA 2CGOA 1L0LH 3QO5A 3ZRSA 2IJHA 4FM2A 3P3NA 2QWNB 4FK5C 1YTFB 1FXKB 4QE9A 2H8PC 3J81N 2HHHO 4BW9A 2FKXA 1SETA 3ABMB 1NBMG 2ZIMA 4MVZA 4O2BA 1QQCA 3UM7A 2JS5A 4LF9B 5H6RA 4GUNA 5L3DA 3FX7A 3E89A 1DK1A 5KX5B 3AG7A 2KQXA 3CRCA 2QWQB 4RUEA 2HFEC 1M5IA 2CAZC 4YIOA 2FL4A 3J7AU 1XL6A 3JAKA 2F1MA 4BIUA 1OZ0A 4JYYA 1KUQA 4P9PA 4Z1VA 4JGSA 5KA5A 4YY3B 3WG7B 3AK3A 2DMXA 2ZT9B 3I5DA 3BA9A 3BVOA 4RQEA 3AG2C 1GN2A 4U3JB 4H13B 1GK9A 3TXSA 1N33O 3DSQA 4JI4O 1HR0B 4FM1A 1ZX3A 2BTOA 1G4YB 3OEHG 3ASNC 1SZXA 5EZYA 4DR1B 2QJ1A 3L74H 4OPAA 2R9AA 4WFGA 2QWRB 4JI2O 3X2QB 3S3XA 1HNXO 5KX5A 3CRRA 2PYLA 1VQLV 1LUVA 2F23A 5LMUO 1BCCH 3F5TA 5IY5C 4DV6B 4F6EA 1AJQA 1BHAA 1BQ0A 3ZHTA 1TGOA 1Y67A 4BAYA 1YJ9V 4Q20A 1NR7A 3H9VA 2DOSA 3Q4HA 1M57B 4X1IB 4CC5A 3SR2C 2QEXV 1N8RW 3TXQA 4JTDB 4U3JA 5BMVB 4LFAO 2Q67A 2RQ6A 4UCOA 4PDRA 4OX9B 4U3FH 3AK1A 4I0XB 4D7TA 1BGYH 1T5EA 5LXTA 2EINC 3W7SA 4DV7B 2LFRA 5JJEB 2P4KA 1KBHA 3N2KB 4UCSA 1XDCA 1XMQO 5BZBA 2QKCA 3L70H 3L9DA 5LL6Y 1SC5B 2JVDA 1QHTA 1Y76B 3DTUB 3OM3B 2YXHA 2ZE8A 3B8MA 4X1IA 1ZL8B 2ADPA 3T1HO 1N36O 4WFBV 2CH7B 2A7WA 2NN4A 2ZIOA 2XTAA 5BMVA 2ZQMA 2GTSA 3GWOA 1ROPA 3G6BA 1IBKB 1B3QA 3APOA 1PL0A 3RT3C 1EZJA 2UXDB 4RWUA 4I0XA 1NTMH 2L6LA 2UXBB 4DR2B 5IDJA 3UQ8A 3HKCB 3N2KA 5EYPB 4JI6B 3RYHB 1PNLA 5B1AC 2F93B 1NQTA 4JI1B 3AG4B 5CA0B 2RNBA 1YCIA 3OTOO 5KMGA 2A3QA 3VQWA 4P30A 3CPWU 3A8TA 5EC1C 4YJ2B 2CTPA 1H2NA 3SYQA 3FB8C 3CCUV 3CSXA 1Y76A 2H94A 3OR7C 2JIZG 4B3SO 4PI0A 4R7CA 1NVPB 1ZL8A 3JD3A 2CH7A 2NR5A 3AEIA 5C8YB 3H1HH 4D7SA 1P7GA 2WAMA 3LDCA 2UU9B 3I55V 2ZR2A 1QNMA 4ZHQB 1XNRB 1D5NA 3OW2U 2WSSG 2UXCB 3HKCA 2Q5ZA 3NXSA 5EYPA 3RYHA 2QTOA 5CA0A 3U0ZA 5H2FZ 2ZM6O 1PPJH 4LFCB 2V7QG 3HKDB 2EBOA 4CZZA 2XAHA 3ZRXA 1AI6A 4K0KB 1OCZB 1GAXA 3G71V 3E8FA 4A5UB 1WPXA 3T1YB 2HP8A 1MABG 4NTWA 1SRYA 1SA0B 4GZRB 1JPXA 1I08A 3E86A 3MHHC 2Z5UA 3OAAG 4QGPA 2OIEA 3APQA 1IBLB 1HW7A 4MTFA 5C8YA 2PTMA 1S5LZ 3LDEA 4FFBB 5A2QN 3DXRB 5EC2C 4NKGB 3CX5F 2YC0A 5J9PC 3CXHF 2CUGA 2ZDIA 2LJ2A 4B08A 4J7ZA 4DV1B 3CYOA 4JAVA 3CRMA 3FAVB 3ZX6A 2ZR3A 1MA1A 4DR3O 2HG5C 1SQFA 3ETEA 1P49A 1I94O 1SQBH 2JEUA 3TK1A 1NTZH 2Q6AA 4UVBA 2ZINA 1OCCC 2JEXA 5A9GA 3UO3A 3F5WC 4J10A 1VIBA 3SPIA 1UFIA 1PNMA 5FPOA 4Z1MG 2MW2B 5EBWC 1SA0A 1B04A 2F43G 1VMGA 4JF3A 3AG2B 2Z3YA 1AVMA 4ASUG 1EN5A 2R9IA 2B9ZA 4NB5A 2UUAB 1XHZA 2F4VB 2X6BA 3ASNB 1H38A 4FFBA 4ABMA 2PY5A 3K04A 2ZCEA 3DXRA 3D3QA 4NR1A 2DJVA 2GHYA 2RDCA 1VQPV 1FXVA 1XNQB 2NNUA 1B06A 5EIBD 1COWG 1N4CA 3M7MX 4CC6A 4X62B 1Y4MA 5LGNA 4NTXA 3K08A 3R65A 3ZMVA 4B3TO 1GM8A 1JOYA 1YJNV 3RN4A 5LHIA 4DV2B 5K1XA 2QKSA 3E35A 2CTWA 1TUEB 4B3MO 4UUJC 2C2AA 2Q9LA 4UVCA 1AR5A 4IT5A 4FIPC 4X66B 4DR7O 1BHBA 5DECA 1XOUA 1S5HC 1K8AW 3IC9A 5H9CA 3DGEA 2VS0A 4PDLA 3ZMTA 1YHQV 4DV5O 3SDLA 3OT7A 1FPOA 3SYOA 2D3OW 3CE2A 1S72V 2EINB 3JAWB 5LMNO 3ETGA 4LC1A 2ZE7A 3CCSV 2DN9A 4DV3O 3L75H 4CH5A 3ZHRA 4DV4O 1XQ8A 4X88A 1RSOA 5B1BC 5L3FA 1DGSA 3JYCA 4N23A 5L3BA 2W6JG 1P4RA 2D2CB 2BE3A 5CA3A 1VF7A 1Q82W 4J7JA 1AJNA 3JSLA 5CMUA 1N32O 3BA8A 1JCHA 1S0VA 1SS3A 2YI9A 3IFXA 3BAAA 2XUMA 1SQQH 1XREA 4PA6A 1Y6XA 4U7OA 1VEWA 4AQYB 2WLHA 4HZ3A 2Y69C 3KZIZ 1SERA 3K5OA 5L3CA 4JYCA 3E22B 2Z0AA 3ZMZA 2AZ0A 4NXNB 5EIBC 5AG2A 1JFFB 4FMTA 1BMFG 4JI3O 4KHPB 1S5JA 3JAWA 2GTAA 5CBHA 4QNHB 2Y0PA 5B1AB 4JI7O 4G27B 2WLIB 2IH1C 2WA4A 3MD0A 1K4DC 1GM7A 4WFAV 4W4LA 2PI5A 1SQPH 3TGUH 3RVZA 5GONB 4MTXA 2O57A 2RMKB 1YF2A 1L0NH 1PNKA 5EK0A 3THOA 4LF9O 4I50B 2LW1A 3WFVA 1NH2D 3WU2Z 2YIBD 2AHYA 4ZI7B 3K5NA 5IJ0B 2Y0IA 1AI7A 2E75B 3E22A 4GT1A 1XMOB 4LF7B 1MZEA 1L1FA 2ITDC 1JFFA 4QPKA 2LGQA 4WFFA 1W2BU 2WLMA 3T4ZA 1RPOA 3SJCC 2VQFB 2GSMB 2WLIA 4LF8B 3FYIB 2KG7B 4YY3O 4WFEA 5EZYB 2UUBB 2CE4A 5JWPA 3STLC 3D8CA 5B66Z 1IBMB 3CC7V 4JZGA 1R73A 1V54C 2NLJC 3ABKC 5GONA 1HR0O 2OT5A 4P9OA 4LF5B 4LWSA 1MOFA 1SQXH 1HDJA 2XAQA 4DR1O 1W0KG 4O4HB 3BHPA 1I5XA 4I50A 3SPHA 4MT8A 4PA9A 1MMMA 3FB6C 4ZI7A 4PI2A 3Q4HB 4MTGA 4RUFA 5IJ0A 2QWOB 4FLZA 5IWAB 1YEWA 4XBFA 4PA7A 4DV6O 1GKFA 2ZD9A 2E5LB 1LR1A 2ZKOA 1K9MW 5IT9N 1WJZA 5IJ9B 2QWPB 3QO8A 2GUZB 3B77A 4JZ2A 2LW7A 4PA4A 2KG7A 2VQEO 4GYCB 1VQMV 4PDVA 1VQKV 3TCUA 4JPRA 5LXTB 4UFZA 3KKYA 1FFXB 5LYJB 1OCCB 1MZFA 2WLJA 3FKSG 3H01A 2E3CA 4EKWA 1QLEC 4OX9O 2JK5C 4DUZO 2YUAA 3N27A 4O4HA 1W0JG 4DO2A 4DV7O 2OCHA 2IJKA 5KUKA 1O9GA 1QU7A 3JATB 4J9ZB 4LH6A 2LFSA 3GWKC 1I5YA 1OHHG 3CHXA 4X1KB 1ZAUA 3AG3C 4OPHA 2DW4A 1WAZA 1BQZA 5IYBO 3RWRD 4X64B 3PN1A 1FS0G 1KP3A 2W0XA 4GLXA 2B1IA 1N33B 1U97A 1YDXA 4X65B 2X6AA 5IJ9A 1GN3A 4LF4O 1E1RG 2GUZA 1YZBA 5E79Z 2AHZA 4K8XA 2YS8A 4JI2B 1FFXA 5LYJA 2KB1A 3RFRA 3F7YC 3A2FA 2YEVB 1BZKA 3UKMA 5KMGB 2B1GA 1IBKO 3OE7G 2UXDO 4DR4O 4P2ZA 2IU0A 3BEHA 4FLYA 1CEZA 2UXBO 4DR2O 4UB8Z 3CEIA 4YJ3B 5FNVB 2DYRC 1M56C 2FYUH 3BPZA 4JI6O 3JATA 5B1OA 5GTHZ 2KSDA 4JI1O 5LGUA 1MSWD 1GN4A 1QR9A 1S3JA 4MVMA 4X1KA 4O4IA 2AZ2A 1KD1W 3O65A 1RM1C 2XAGA 3B8NA 3E8HA 5KHGA 3E8GA 3JD0A 2ZNIA 4JV5B 3ZIAG 5B1BB 4GX5A 4GKJB 1JVMA 1SQVH 2QR4A 3J80N 2WA3A 3CXCU 2IW5A 2KKWA 3VOUA 2YEVA 1Q6HA 1WLEA 4FZ1A 1DF5A 3IJ4A 2V1DA 3G80A 2ATKC 4UV8A 4J7KA 1XNRO 1R3JC 2B5UA 2UXCO 4YJ3A 3JD4A 2RCVA 5FNVA 2Y69B 1PD3A 1K73W 3BRCA 4UXNA 3STZC 1IXBA 1S77D 3T1HB 3SGIA 1N36B 4FZ0A 4JTAB 4JI8O 5LOVA 5BY1A 2Q8VA 1I7FA 4JI0O 3T1YO 2WPDG 5KA6A 2Y4UA 2W6IG 4KL1A 4X9QA 4NXMO 3NR7A 1GM9A 1D2DA 1F51A 2ITCC 4B7EA 1H2LA 4FLTA 3ML0A 3JASA 1IVSA 3L72H 1N34B 2A9HA 5LHHA 2LO1A 2HKOA 2JRIA 4PHZA 3OTOB 4DR6B 1QCEA 2QTSA 3OMIB 5J2UB 2YICA 5LGTA 4ICGA 1AR4A 4JYAB 2EZOA 3JARA 4JAUA 3SJQC 1AP5A 4DV1O 3ZS8C 1DLBA 3A0HZ 1Q3EA 3CB2A 4O2AB 3ZCCA 4PELA 1R3IC 5IYZB 4B3SB 1FAFA 4XDLA 2HLDG 1CP9A 4UCRA 2P06A 4DK0A 4DV0B 4R50A 1VQ9V 4QIWF 1IURA 1KQSU 3AG1C 3FD9A 3HPLC 1H2KA 3GVMA 1A32A 1J5EB 1V54B 3ABKB 1SZTA 3CJHB 2UUAO 2YIAA 4E2LA 2HVJC 3K58A 2F4VO 5KAFZ 4I7ZB 3EXAA 2GV9A 4YXWG 2ZM6B 3ZN1A 4ZBMA 1HNWO 2QM4A 5KHKA 1RFYA 5J2UA 1MSDA 1XNQO 4DR5B 1WN7A 1TVKB 3OEEG 2ODMA 4GX1A 4PDMA 3SJAC 4O2AA 5IYZA 4MVUA 1JX9A 3FYEB 2ZE5A 1MG1A 3ZN0A 1Q6IA 2P67A 5JH7A 1E1QG 4ZOLB 3LNNA 2QDOA 2XASA 5H6QA 4X66O 2DYSC 4LF6B 5KAIZ 4IL6Z 4AHCA 3EVKA 4JAAA 2HEPA 1B6QA 3K03A 1N0NA 1QLEB 4DUYB 3CJHA 2P22C 1RSOB 5KHIA 1CPYA 5D5QA 3T1CA 1URFA 3ZHUA 4TV9B 1M9NA 3W7TA 5LP6C 2ILMA 2JDIG 3MHSC 1EM1A 1I0HA 4XDJA 5JCOC 3ZJZA 3N2GB 3WB1A 1Q6UA 1JA8A 5KHHA 1TVKA 2XT9A 4LH7A 2OCCC 2EX3A 2FTKA 4GKKO 2L35A 3AG3B 1RP3B 1YVWA 5BXZA 4RAIA 4MSWC 3CP1A 2OTLV 2Q0AA 3JAMN 5CBFA 1WA8B 2HJFC 2ADQB 4R8CA 4DW0A 3E2EA 1IZ3A 4ZOLA 4KP4A 4HYOA 3D3IA 2BOBC 3SYPA 3K3WA 3WB2A 3UO2A 4CS3A 4J41A 4IIJB 4X8AA 1FJGB 4AQYO 1HNZO 2PZSA 1LNQA 5BR8B 1NZ6A 4G28B 2EIJC 3JALB 4WFHA 4TV9A 2YIBA 4NXNO 1OCRC 2W0FC 2DQ3A 1JJ2U 1U96A 4HAMA 2DYRB 4TOIA 1M56B 1Z5WA 4QE7A 3CCLV 1SF9A 3N2GA 4JI5B 3W7WA 4MW3A 2YSUB 1Q5OA 4KUMA 3G4SV 4CH6A 3IGAC 3DC6A 4BIZA 4BIOA 5CA1B 4LFBB 1RM1B 3P3PA 2F95B 4TT3G 1WA8A 3B2EE 5IE9A 2P90A 2IJJA 5IYCO 3ZRWB 1THZA 5J2TB 1K97A 4LR3A 3SPGA 3MAQA 3S3WA 1Q8IA 1VF6C 5LMNB 4H37A 1FXHA 4IIJA 5CN0A 3IAYA 1OCOC 4YHHO 3M99B 3ASOC 1N0JA 1KMIZ 3JALA 2WWWA 1GN6A 2LP7A 2YXYA 3GB7C 2P5OA 4LF7O 1BE3H 3B09A 3JCUZ 4X89A 1AI4A 3QNEA 2CK3G 3H1KH 1GRJA 3QO7A 4Q6GA 1XI1A 2QSAA 4LWSB 1X4TA 3QG5A 4LF8O 1JMKC 4O4LB 1KECA 3OFNG 2UUBO 5CA1A 2EZPA 1IBMO 2UUCB 2HR3A 4XDKA 4EFEA 4BW5A 1R6TA 2H3OA 2EIMC 1K92A 3ABLC 2JS3A 4LF5O 3ZRWA 3FFQA 3K57A 5J2TA 3SPCA 4WBNA 4UV9A 4QJFB 5FPRA 4F6RB 2ZNJA 4DRXB 4I55B 1JQ0A 4UCVA 5F2VO 5K1PA 4UCTA 4EFBA 4DK1A 4FPPA 1TUBB 3H1LH 3VQVA 3TJTA 5IWAO 2FMLA 2E5LO 3HB3B 1SESA 1Y74B 3K5MA 5ITZB 4PV1B 4FLXA 3BY6A 1H2GA 4O4LA 4IHJB 5LA6B 1QVGU 3JCZA 2MK3A 1JR9A 1E79G 3C3SA 3HR0A 3H1IH 3CCQV 1IX9A 1P84F 5DEDA 4B3RB 2PF4E 1XEQA 1WNSA 3AG1B 4H44B 1TAEA 1FFTB
chains in the Genus database with same CATH topology
3E8GA 3JD0A 4MW8A 3ZIAG 3T4DA 1V55C 3CYOA 4JAVA 5B1BB 4GX5A 2ZR3A 3ETDA 3LDDA 3CC2V 2HG5C 1JVMA 2QM8A 3ETEA 3AG4C 5IYDO 4J9YB 5LHGA 1AI5A 3CXCU 2IW5A 3VOUA 4MS2A 1K5SA 2JEUA 2Q6AA 3TK1A 4UVBA 4ZKIA 5HFMA 2YEVA 1OCCC 2JEXA 5GW7A 2P7TC 3F5WC 1WLEA 2JJ1G 4TWKA 3SPIA 1PNMA 1YI2V 4LP8A 3RVYA 1DF5A 4Z1MG 5EBWC 2V1DA 4I5SA 2ATKC 2X7RB 4UV8A 5B3SB 3TETA 2R9RB 2F43G 1FXKA 4JF3A 1R3JC 3AG2B 2Z3YA 2B5UA 1KC8W 3W7XA 3JD4A 4ASUG 4DXWA 4WCEV 2R9IA 3CMEV 2Y69B 3CCEV 1NH2C 1K4CC 3P30A 2EIKC 4F4LA 1K34A 1PD3A 1NVPC 3OGCC 1VQOV 1K73W 4UXNA 3STZC 2X6BA 1S77D 5DM6V 3ASNB 1H38A 2WLKA 2BOCC 1XL4A 3K04A 1AROP 3PJSK 3OUSA 1EFRG 2GHYA 4JTAB 2IU3A 3IC7A 4MTOA 1VQPV 4U7NA 2P6JA 1PKXA 1FXVA 2DYSB 1KP2A 2NNUA 2WPDG 2ZDIC 5KA6A 4MVSA 1RPRA 2W6IG 2IJIA 1COWG 4KFMA 1GM9A 1F51A 2ITCC 5KUMA 1Y4MA 5LGNA 3K0DA 4JYBA 4GX2A 3ML0A 3K08A 3R65A 3ZMVA 1P7BA 2DQ0A 3CCJV 2A9HA 1GM8A 5LHHA 3JD2A 3SYAA 1JOYA 1YJNV 2DWEC 2A0LA 2Q69A 2EILC 5LHIA 2HKOA 2XAFA 2QKSA 3E35A 3P32A 2A79B 1TUEB 4UUJC 2C2AA 2UXNA 1OCZC 1QCEA 4UVCA 3CC4V 4GCZA 3OMIB 4FIPC 4JTCB 1BHBA 2XOKG 5LGTA 4L87A 2HVKC 2EZOA 1S5HC 4JAUA 1ORQC 1ZWIC 2OCCB 2ZXWC 3T2MA 5DN6G 3SJQC 1K8AW 2JJ2G 5H9CA 3QO5A 3ZRSA 1DLBA 3DGEA 4PDLA 3ZMTA 3CMAV 2IJHA 1YHQV 2QM7A 4FK5C 3SYOA 2D3OW 1YTFB 3ZCCA 1FXKB 3ABTA 1VQ7V 4PELA 4QE9A 1R3IC 4XDLA 3ZRVA 2QA4V 2HLDG 1CP9A 2H8PC 4QPJA 1S72V 2EINB 4JASA 4R50A 1VQ9V 4QIWF 1SETA 1DTOA 1KQSU 3ABMB 3AG1C 1NBMG 3ETGA 3K9AA 4MVZA 3JD1A 4LC1A 5HFLA 1K7DA 1IXMA 3UM7A 3CCSV 5H6RA 3CD6V 1YTFD 3HPLC 5L3DA 1VQ5V 3E89A 3K0GA 3CCVV 2Q68A 4X88A 5L3FA 5B1BC 3JYCA 4N23A 4LBEC 5L3BA 1EBOA 2W6JG 1YJWV 3ABUA 1P4RA 1V54B 3LSQA 4RUEA 1M90W 3ABKB 2HFEC 1K3EA 5EBMC 1SZTA 4G2KA 1QVFU 5CA3A 2EIJB 1GTOA 1Q82W 1G8MA 1AJNA 1XL6A 4LCUC 1OCRB 1YIJV 4E2LA 5CMUA 2HVJC 4BIUA 1OZ0A 4YXWG 3ZN1A 1S0VA 1JCHA 4ZBMA 4P9PA 3IFXA 4JGSA 5KA5A 3WG7B 5B3SC 4RQEA 4WF9V 4PA6A 1S76D 3AG2C 3OEEG 4U7OA 4GX1A 2WLHA 4HZ3A 4PDMA 2Y69C 1UJWB 1SERA 1GK9A 1GO3F 2K1EA 1V55B 4FJCC 4JYCA 3SYCA 1J95A 5L3CA 5LBQA 3ZMZA 4MVUA 1JX9A 3I56V 3FYEB 1G4YB 3OEHG 4H33A 1MG1A 3ZN0A 3OMNB 3ASNC 4FMTA 1BMFG 2P67A 5CBHA 1E1QG 4QNHB 4WFGA 5B1AB 4G27B 2WLIB 1Q7YW 3X2QB 2XASA 5H6QA 2DYSC 2PI4A 2IH1C 1YITV 3LUTB 3W7UA 2X6CA 2XNDG 3MD0A 4MVOA 5B1NA 1NR1A 1K4DC 1GM7A 1OCOB 4WFAV 1VQLV 2PI5A 2OTJV 3ASOB 1B6QA 5IY5C 3K03A 3RVZA 1AJQA 1BHAA 1QLEB 4BAYA 1CPYA 1YJ9V 1F4NA 4MTXA 5FL7G 3T1CA 1VQ4V 1M9NA 4OXSA 1NR7A 4Q20A 3W7TA 3CCRV 1DF4A 2JDIG 3MHSC 1QBZA 2XAJA 4XDJA 3E8BA 3ZJZA 1PNKA 1M57B 5EK0A 4RQFA 2EJRA 2QEXV 1K33A 2OCCC 3WFVA 1NH2D 3FB7C 1N8RW 2FTKA 1ENVA 2AHYA 4JTDB 3ZMUA 3AG3B 3OMAB 1AI7A 4RAIA 4MSWC 4GT1A 3CP1A 2OTLV 2UXXA 2Q67A 3F7VC 1YTFC 1FXKC 4PDRA 1L1FA 4R6ZA 2EIMB 2ITDC 5CBFA 3ABLB 5C93A 3OR6C 2HJFC 4QPKA 4WFFA 1W2BU 2WLMA 4R8CA 3E2EA 3T4ZA 2EINC 3W7SA 1RPOA 2LFRA 3ABMC 4KP4A 4HYOA 2GSMB 2WLIA 3D3IA 1Q81W 2BOBC 3FYIB 3SYPA 3A0RA 3K3WA 2WLLB 1H8EG 4WFEA 1VQ8V 1HWYA 3STLC 4GX0A 4X8AA 1KKDA 3CC7V 4RO2A 1R73A 1V54C 2NLJC 3ABKC 5BZBA 3SPJA 1LNQA 4G28B 2EIJC 4WFHA 2OT5A 4P9OA 1M1KW 1OCRC 2W0FC 4N21A 5CBGA 2DQ3A 1R3KC 1JJ2U 1MOFA 3OUFA 2XAQA 1W0KG 1AJPA 3DTUB 2DYRB 1M56B 3OM3B 4HAMA 4QE7A 3CCLV 3B8MA 3W7WA 3WG7C 1I5XA 4MW3A 3SPHA 4MT8A 4PA9A 4TSFG 2YSUB 4WFBV 3FB6C 4KUMA 3K79A 3G4SV 3IGAC 4BIZA 4MTGA 4RUFA 2X0LA 2ZQMA 3GWOA 1ROPA 4XBFA 4PA7A 1GKFA 2ZD9A 1PL0A 1H8HG 3KG2A 3EHBB 1RM1B 5E1AC 4TT3G 1EZJA 2P90A 3LNMB 1K9MW 2IJJA 3VBBA 5IYCO 1R3LC 3CCMV 3ZRWB 5IDJA 3QO8A 1THZA 1K97A 1NKDA 1PNLA 5B1AC 3B77A 1NQTA 4PA4A 3SPGA 3AG4B 1VQMV 3X2QC 4PDVA 2WLLA 1VQKV 3TCUA 4H37A 1FXHA 4JPRA 1VQ6V 3ZMSA 5CN0A 1OCOC 1OCCB 3M99B 4P30A 3CPWU 3ASOC 2WLJA 3FKSG 3H01A 5EC1C 4EKWA 1QLEC 2QE7G 2WWWA 2LP7A 1Q86W 3GB7C 3SYQA 1R6NA 3FB8C 1AI4A 2DWDC 1BL8A 2JK5C 4X89A 3CCUV 2H94A 1W0JG 3QNEA 4DO2A 2CK3G 3QO7A 3OR7C 2JIZG 2IJKA 1NH2B 5KUKA 1M57C 2EIKB 4R7CA 1NVPB 4J9ZB 2WLNA 2LFSA 1KECA 3JD3A 1F4MA 3OFNG 1YSCA 1I5YA 3AEIA 5L3GA 1OHHG 2IH3C 2EZPA 2WAMA 3LDCA 4MVQA 1Y66A 3AG3C 2DW4A 1QR8A 2HR3A 4XDKA 5IYBO 3I55V 2ZR2A 1FS0G 1KP3A 5L3EA 2B1IA 4BW5A 5EBLC 1NVPD 2EIMC 1K92A 3ABLC 5IY5B 1VQNV 3OW2U 2X6AA 2WSSG 3ZRWA 3E83A 3SPCA 3FB5C 3NXSA 4UV9A 1E1RG 4QJFB 4UVAA 2QTOA 4CBCA 2AHZA 1JQ0A 2EILB 2V7QG 1AR1B 1F23A 2EBOA 4CZZA 2XAHA 2KB1A 1AI6A 3ZRXA 3F7YC 2YEVB 1OCZB 4FPPA 1K5QA 2M7WA 1GMGA 3UKMA 3G71V 2B1GA 3E8FA 3G6EV 1WPXA 3OE7G 3RW0A 3HB3B 1MABG 3EFFK 1SRYA 4P2ZA 1SESA 3BEHA 2ZXWB 2IU0A 1CEZA 1JPXA 3E86A 3MHHC 2Z5UA 2DYRC 1M56C 3BY6A 3OAAG 3D36A 4PA3A 5B1OA 1H2GA 1QLNA 1QVGU 3JCZA 5LGUA 2MK3A 4MTFA 3RBZA 1MSWD 1E79G 3CCQV 1QR9A 3K06A 1S3JA 4MVMA 4I9WA 3LDEA 1R6KA 3AG1B 3LSSA 4MVRA 5EC2C 1KD1W 1NJIW 2Y48A 1RM1C 2XAGA 3B8NA 1FFTB 5J9PC 3E8HA 2ZDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTF C;  1NH2 C;  1NVP D;  5IYB O;  1RM1 C;  5IYC O;  1RM1 B;  1NVP C;  1NH2 D;  5IYD O;  1YTF D; 
#chains in the Genus database with same CATH topology
 1VF5 B;  4HBN A;  3T4D A;  1EN4 A;  5JQG B;  5KHJ A;  1KB9 F;  1SKV A;  3ETD A;  2YXL A;  3LDD A;  4F6R A;  4PD4 F;  2QM8 A;  4DRX A;  4I55 A;  4MS2 A;  2HHH B;  3BFR A;  4EB6 B;  1TUB A;  2P7T C;  2JJ1 G;  4TWK A;  4X64 O;  1XUQ A;  2LGW A;  1PV0 A;  4I5S A;  3TET A;  2VRZ A;  2R9R B;  1Y74 A;  3G67 A;  4B7K A;  1FXK A;  1EN6 A;  5ITZ A;  4X65 O;  1G1X B;  3CCE V;  1NH2 C;  3P30 A;  3U11 A;  2EIK C;  4IHJ A;  3OGI B;  1NTK H;  4F4L A;  5LA6 A;  3D36 C;  3OGC C;  5DM6 V;  2BSK B;  1M4U A;  2WLK A;  2BOC C;  1XL4 A;  2EJ7 A;  1WP8 A;  3PJS K;  1EFR G;  2IU3 A;  3IC7 A;  4MTO A;  4PJ0 Z;  2ARH A;  2DYS B;  1KP2 A;  4IYH A;  1IDS A;  4OGQ B;  3CRA A;  4O4I B;  5JQG A;  2IJI A;  4J11 A;  1V9P A;  5KUM A;  1NT2 B;  2LQT A;  3K0D A;  4JI4 B;  2DQ0 A;  3CCJ V;  2VWK A;  2CDY A;  2BTQ B;  1KKC A;  2P4V A;  2EIL C;  2VQE B;  2XAF A;  2CGN A;  3P32 A;  4EB6 A;  5LP6 B;  3L71 H;  2UXN A;  4TQF A;  3ZBH A;  3CC4 V;  4GCZ A;  1HNX B;  1SQG A;  2XOK G;  4I4T B;  2E74 B;  2JGU A;  2ZXW C;  1ZWI C;  2OCC B;  4JV5 O;  5DN6 G;  2JJ2 G;  2PYJ A;  4W4K A;  4DW1 A;  5LMU B;  3CMA V;  4GKJ O;  4DUZ B;  2QM7 A;  3R66 A;  1HP8 A;  3ABT A;  1VQ7 V;  2BSK A;  3ZRV A;  1WB8 A;  2QA4 V;  4QPJ A;  4J80 A;  4JAS A;  1O9H A;  1DTO A;  3K9A A;  5HFL A;  3JD1 A;  1K7D A;  2R72 A;  1IXM A;  3CD6 V;  1PM9 A;  1YTF D;  1VQ5 V;  2RJZ A;  3VQX A;  3K0G A;  3CCV V;  2Q68 A;  5LOV B;  4LBE C;  1EBO A;  1YJW V;  3ABU A;  5H5N A;  5TIS Z;  3A0B Z;  3LSQ A;  1M90 W;  5JJJ B;  4LFA B;  1KYO F;  1K3E A;  1Q43 A;  2ZE6 A;  4LF4 B;  5EBM C;  4G2K A;  4E4E A;  1QVF U;  2EIJ B;  1GTO A;  2BTQ A;  1G8M A;  4FLU A;  1YIJ V;  4LCU C;  1OCR B;  5LP6 A;  3ETQ A;  3JAS B;  2JGD B;  4CS2 A;  5JCO A;  1W59 A;  4I4T A;  5B3S C;  1XMQ B;  1GH6 A;  2UU9 O;  4WF9 V;  3RGB A;  1S76 D;  4DR4 B;  1UJW B;  3RYI B;  1GO3 F;  2K1E A;  1V55 B;  4NVP A;  1X59 A;  4FJC C;  3JAR B;  1J95 A;  3SYC A;  5LBQ A;  4FLW A;  1OV9 A;  1N34 O;  3L73 H;  3I56 V;  4H33 A;  3OMN B;  3U10 A;  3ZHS A;  4DR6 O;  4LFC O;  1Q7Y W;  2Q7G A;  3CWB H;  2PI4 A;  1ZLZ A;  1YIT V;  3LUT B;  3W7U A;  4JYA O;  4K0K O;  2X6C A;  2XND G;  4MVO A;  5B1N A;  1NR1 A;  1OCO B;  1ZSP A;  4ZIB A;  2OTJ V;  3ASO B;  4UCU A;  1NU1 H;  5JVD B;  3C90 A;  1F4N A;  5FL7 G;  1US6 A;  1VQ4 V;  4OXS A;  1M93 A;  2HJD A;  2OWO A;  3CCR V;  1DF4 A;  2JGD A;  2E76 B;  1QBZ A;  2XAJ A;  4CH4 A;  4DV0 O;  1IBL O;  4H0L B;  4UB6 Z;  3E8B A;  1CXZ B;  1MNG A;  4RQF A;  5D5P A;  2YID A;  4AI8 A;  3QTC A;  2EJR A;  3HKB B;  1K33 A;  3FB7 C;  4J42 A;  1ENV A;  3ZMU A;  3OD4 A;  3RYI A;  3OMA B;  1J5E O;  3ZHQ A;  2UXX A;  3F7V C;  1YTF C;  1FYJ A;  1FXK C;  4R6Z A;  2EIM B;  3ABL B;  5C93 A;  3OR6 C;  1XBL A;  3AK2 A;  1XIL A;  1D5A A;  3K5L A;  5JJN B;  2AXT Z;  4NTY A;  3WB0 A;  3ABM C;  4KXR A;  1VF6 A;  3RYF B;  1Q81 W;  2Q4P A;  3A0R A;  2G38 A;  2WLL B;  4JI8 B;  1H8E G;  1VQ8 V;  1HWY A;  4IGG A;  4YJ2 A;  4DR5 O;  5JH7 B;  5KLV H;  4GX0 A;  1KKD A;  2GDS A;  4CH3 A;  4JI0 B;  4AIL C;  2K9P A;  4RO2 A;  4NXM B;  2N04 A;  3SPJ A;  5JVD A;  4O4J B;  1G6U A;  1TA8 A;  1BT8 A;  3OTF A;  1M1K W;  4N21 A;  2AGA A;  4DYL A;  5CBG A;  1R3K C;  3K59 A;  3ICX A;  2EUL A;  3OUF A;  3VQY A;  1AJP A;  2CTQ A;  4FFK A;  1NS1 A;  1OJH A;  3WG7 C;  3B40 A;  3HKB A;  4TSF G;  4LF6 O;  3K79 A;  4ZHQ A;  2X0L A;  2Q73 A;  1UPG A;  1H8H G;  3KG2 A;  3EHB B;  5E1A C;  4DUY O;  2VWJ A;  3LNM B;  4X62 O;  2FB5 A;  3VBB A;  4TUY B;  1R3L C;  3CCM V;  3HKE B;  3ZHV A;  3HKD A;  1NKD A;  3RYF A;  4K35 A;  4DV2 O;  3X2Q C;  4HNA B;  2WLL A;  4CS4 A;  1VQ6 V;  3ZMS A;  3RYC B;  3SJB C;  2Q0O C;  2V4D A;  1FKA O;  5GTI Z;  2Q7E A;  3CS5 A;  4O4J A;  4TV8 B;  2F66 C;  3UT5 B;  2QE7 G;  2DE0 X;  1Q86 W;  4YIP A;  1R6N A;  2DWD C;  1BL8 A;  3KCX A;  4DR3 B;  1AB3 A;  3M8A A;  2M6Y A;  1NH2 B;  1I94 B;  2N74 A;  1M57 C;  2EIK B;  2WLN A;  1F4M A;  1WB7 A;  1YSC A;  1HNW B;  5L3G A;  2IH3 C;  4MVQ A;  4I9Q A;  1Y66 A;  2QKA A;  1FJG O;  1QR8 A;  3C3T A;  3FAV A;  5L3E A;  3ZED A;  5BR8 O;  2Q7H A;  4NYK A;  5EBL C;  1NVP D;  1Z5V A;  2R70 A;  5IY5 B;  3CRQ A;  4TUY A;  1VQN V;  3HKE A;  4LNU B;  3E83 A;  3FB5 C;  4IYI A;  2IBZ H;  4UVA A;  4HNA A;  3H1J H;  2QGN A;  4JI5 O;  1VAR A;  4CBC A;  3RYC A;  1JJO A;  1H2S B;  2EIL B;  3B4S A;  1AR1 B;  1F23 A;  2IM9 A;  4K8Z A;  1ZUQ A;  1K5Q A;  3DC5 A;  2M7W A;  1GMG A;  4TV8 A;  3UT5 A;  4BR6 A;  4LFB O;  1BSM A;  4X1Y B;  3G6E V;  4BWA A;  4D6T H;  3RW0 A;  3EFF K;  2XHB A;  2ZXW B;  1PL4 A;  3O9O A;  4B3T B;  2BCC H;  3D36 A;  4PA3 A;  1QLN A;  4KHP O;  1F7Y A;  3RBZ A;  4B3M B;  3K06 A;  4I9W A;  1BS3 A;  1H2M A;  1R6K A;  3LSS A;  4MVR A;  4FM0 A;  2PGG A;  4TQD A;  1NJI W;  4DR7 B;  4GKK B;  1KU9 A;  2Y48 A;  1WP7 A;  4EEQ A;  4U7N A;  1AP6 A;  2Y4T A;  4MW8 A;  5B5E Z;  4LNU A;  4FLV A;  1V55 C;  3BCC H;  3LSU A;  4DV5 B;  1XHX A;  3MDS A;  3CC2 V;  2CTR A;  5IYD O;  3AG4 C;  1R1B A;  4FVM A;  4J9Y B;  5LHG A;  1AI5 A;  1L8D A;  1PP9 H;  4WBN B;  3QVN A;  1K5S A;  2AW9 A;  2OYQ A;  4ZKI A;  5HFM A;  5GW7 A;  2UUC O;  4Z2W A;  4X1Y A;  1YI2 V;  1WPB A;  4LP8 A;  3RVY A;  4X20 B;  4DV3 B;  1LUW A;  1HNZ B;  2X7R B;  5B3S B;  5CB4 B;  4DV4 B;  1YXB A;  3UCS C;  1KC8 W;  3W7X A;  4DXW A;  4WCE V;  3CME V;  1XMO O;  3K9S A;  2A06 H;  1K4C C;  1K34 A;  2ETN A;  1NVP C;  1VQO V;  2YDE A;  3BAB A;  2YI8 A;  2VQF O;  1N32 B;  1Q90 D;  1VP7 A;  1ARO P;  3OUS A;  3JSN A;  4O2B B;  2OIG A;  1NI8 A;  2P6J A;  1PKX A;  1AIL A;  2ZDI C;  4MVS A;  1RPR A;  4KFM A;  2GBO A;  4GX2 A;  4JYB A;  1P7B A;  3KCY A;  3QF7 A;  4K3A A;  1EZV H;  3JD2 A;  3SYA A;  5FLX N;  2DWE C;  2A0L A;  2N05 A;  2Q69 A;  4JI3 B;  1ZTE A;  2A79 B;  2RN9 A;  3JAK B;  4C7U A;  4B3R O;  1OCZ C;  4JI7 B;  4YHH B;  4L8J A;  4X20 A;  1Z2G A;  4JTC B;  5CB4 A;  4L87 A;  2HVK C;  1ORQ C;  1FD9 A;  3T2M A;  2PUS A;  2CGO A;  1L0L H;  3QO5 A;  3ZRS A;  2IJH A;  4FM2 A;  3P3N A;  2QWN B;  4FK5 C;  1YTF B;  1FXK B;  4QE9 A;  2H8P C;  3J81 N;  2HHH O;  4BW9 A;  2FKX A;  1SET A;  3ABM B;  1NBM G;  2ZIM A;  4MVZ A;  4O2B A;  1QQC A;  3UM7 A;  2JS5 A;  4LF9 B;  5H6R A;  4GUN A;  5L3D A;  3FX7 A;  3E89 A;  1DK1 A;  5KX5 B;  3AG7 A;  2KQX A;  3CRC A;  2QWQ B;  4RUE A;  2HFE C;  1M5I A;  2CAZ C;  4YIO A;  2FL4 A;  3J7A U;  1XL6 A;  3JAK A;  2F1M A;  4BIU A;  1OZ0 A;  4JYY A;  1KUQ A;  4P9P A;  4Z1V A;  4JGS A;  5KA5 A;  4YY3 B;  3WG7 B;  3AK3 A;  2DMX A;  2ZT9 B;  3I5D A;  3BA9 A;  3BVO A;  4RQE A;  3AG2 C;  1GN2 A;  4U3J B;  4H13 B;  1GK9 A;  3TXS A;  1N33 O;  3DSQ A;  4JI4 O;  1HR0 B;  4FM1 A;  1ZX3 A;  2BTO A;  1G4Y B;  3OEH G;  3ASN C;  1SZX A;  5EZY A;  4DR1 B;  2QJ1 A;  3L74 H;  4OPA A;  2R9A A;  4WFG A;  2QWR B;  4JI2 O;  3X2Q B;  3S3X A;  1HNX O;  5KX5 A;  3CRR A;  2PYL A;  1VQL V;  1LUV A;  2F23 A;  5LMU O;  1BCC H;  3F5T A;  5IY5 C;  4DV6 B;  4F6E A;  1AJQ A;  1BHA A;  1BQ0 A;  3ZHT A;  1TGO A;  1Y67 A;  4BAY A;  1YJ9 V;  4Q20 A;  1NR7 A;  3H9V A;  2DOS A;  3Q4H A;  1M57 B;  4X1I B;  4CC5 A;  3SR2 C;  2QEX V;  1N8R W;  3TXQ A;  4JTD B;  4U3J A;  5BMV B;  4LFA O;  2Q67 A;  2RQ6 A;  4UCO A;  4PDR A;  4OX9 B;  4U3F H;  3AK1 A;  4I0X B;  4D7T A;  1BGY H;  1T5E A;  5LXT A;  2EIN C;  3W7S A;  4DV7 B;  2LFR A;  5JJE B;  2P4K A;  1KBH A;  3N2K B;  4UCS A;  1XDC A;  1XMQ O;  5BZB A;  2QKC A;  3L70 H;  3L9D A;  5LL6 Y;  1SC5 B;  2JVD A;  1QHT A;  1Y76 B;  3DTU B;  3OM3 B;  2YXH A;  2ZE8 A;  3B8M A;  4X1I A;  1ZL8 B;  2ADP A;  3T1H O;  1N36 O;  4WFB V;  2CH7 B;  2A7W A;  2NN4 A;  2ZIO A;  2XTA A;  5BMV A;  2ZQM A;  2GTS A;  3GWO A;  1ROP A;  3G6B A;  1IBK B;  1B3Q A;  3APO A;  1PL0 A;  3RT3 C;  1EZJ A;  2UXD B;  4RWU A;  4I0X A;  1NTM H;  2L6L A;  2UXB B;  4DR2 B;  5IDJ A;  3UQ8 A;  3HKC B;  3N2K A;  5EYP B;  4JI6 B;  3RYH B;  1PNL A;  5B1A C;  2F93 B;  1NQT A;  4JI1 B;  3AG4 B;  5CA0 B;  2RNB A;  1YCI A;  3OTO O;  5KMG A;  2A3Q A;  3VQW A;  4P30 A;  3CPW U;  3A8T A;  5EC1 C;  4YJ2 B;  2CTP A;  1H2N A;  3SYQ A;  3FB8 C;  3CCU V;  3CSX A;  1Y76 A;  2H94 A;  3OR7 C;  2JIZ G;  4B3S O;  4PI0 A;  4R7C A;  1NVP B;  1ZL8 A;  3JD3 A;  2CH7 A;  2NR5 A;  3AEI A;  5C8Y B;  3H1H H;  4D7S A;  1P7G A;  2WAM A;  3LDC A;  2UU9 B;  3I55 V;  2ZR2 A;  1QNM A;  4ZHQ B;  1XNR B;  1D5N A;  3OW2 U;  2WSS G;  2UXC B;  3HKC A;  2Q5Z A;  3NXS A;  5EYP A;  3RYH A;  2QTO A;  5CA0 A;  3U0Z A;  5H2F Z;  2ZM6 O;  1PPJ H;  4LFC B;  2V7Q G;  3HKD B;  2EBO A;  4CZZ A;  2XAH A;  3ZRX A;  1AI6 A;  4K0K B;  1OCZ B;  1GAX A;  3G71 V;  3E8F A;  4A5U B;  1WPX A;  3T1Y B;  2HP8 A;  1MAB G;  4NTW A;  1SRY A;  1SA0 B;  4GZR B;  1JPX A;  1I08 A;  3E86 A;  3MHH C;  2Z5U A;  3OAA G;  4QGP A;  2OIE A;  3APQ A;  1IBL B;  1HW7 A;  4MTF A;  5C8Y A;  2PTM A;  1S5L Z;  3LDE A;  4FFB B;  5A2Q N;  3DXR B;  5EC2 C;  4NKG B;  3CX5 F;  2YC0 A;  5J9P C;  3CXH F;  2CUG A;  2ZDI A;  2LJ2 A;  4B08 A;  4J7Z A;  4DV1 B;  3CYO A;  4JAV A;  3CRM A;  3FAV B;  3ZX6 A;  2ZR3 A;  1MA1 A;  4DR3 O;  2HG5 C;  1SQF A;  3ETE A;  1P49 A;  1I94 O;  1SQB H;  2JEU A;  3TK1 A;  1NTZ H;  2Q6A A;  4UVB A;  2ZIN A;  1OCC C;  2JEX A;  5A9G A;  3UO3 A;  3F5W C;  4J10 A;  1VIB A;  3SPI A;  1UFI A;  1PNM A;  5FPO A;  4Z1M G;  2MW2 B;  5EBW C;  1SA0 A;  1B04 A;  2F43 G;  1VMG A;  4JF3 A;  3AG2 B;  2Z3Y A;  1AVM A;  4ASU G;  1EN5 A;  2R9I A;  2B9Z A;  4NB5 A;  2UUA B;  1XHZ A;  2F4V B;  2X6B A;  3ASN B;  1H38 A;  4FFB A;  4ABM A;  2PY5 A;  3K04 A;  2ZCE A;  3DXR A;  3D3Q A;  4NR1 A;  2DJV A;  2GHY A;  2RDC A;  1VQP V;  1FXV A;  1XNQ B;  2NNU A;  1B06 A;  5EIB D;  1COW G;  1N4C A;  3M7M X;  4CC6 A;  4X62 B;  1Y4M A;  5LGN A;  4NTX A;  3K08 A;  3R65 A;  3ZMV A;  4B3T O;  1GM8 A;  1JOY A;  1YJN V;  3RN4 A;  5LHI A;  4DV2 B;  5K1X A;  2QKS A;  3E35 A;  2CTW A;  1TUE B;  4B3M O;  4UUJ C;  2C2A A;  2Q9L A;  4UVC A;  1AR5 A;  4IT5 A;  4FIP C;  4X66 B;  4DR7 O;  1BHB A;  5DEC A;  1XOU A;  1S5H C;  1K8A W;  3IC9 A;  5H9C A;  3DGE A;  2VS0 A;  4PDL A;  3ZMT A;  1YHQ V;  4DV5 O;  3SDL A;  3OT7 A;  1FPO A;  3SYO A;  2D3O W;  3CE2 A;  1S72 V;  2EIN B;  3JAW B;  5LMN O;  3ETG A;  4LC1 A;  2ZE7 A;  3CCS V;  2DN9 A;  4DV3 O;  3L75 H;  4CH5 A;  3ZHR A;  4DV4 O;  1XQ8 A;  4X88 A;  1RSO A;  5B1B C;  5L3F A;  1DGS A;  3JYC A;  4N23 A;  5L3B A;  2W6J G;  1P4R A;  2D2C B;  2BE3 A;  5CA3 A;  1VF7 A;  1Q82 W;  4J7J A;  1AJN A;  3JSL A;  5CMU A;  1N32 O;  3BA8 A;  1JCH A;  1S0V A;  1SS3 A;  2YI9 A;  3IFX A;  3BAA A;  2XUM A;  1SQQ H;  1XRE A;  4PA6 A;  1Y6X A;  4U7O A;  1VEW A;  4AQY B;  2WLH A;  4HZ3 A;  2Y69 C;  3KZI Z;  1SER A;  3K5O A;  5L3C A;  4JYC A;  3E22 B;  2Z0A A;  3ZMZ A;  2AZ0 A;  4NXN B;  5EIB C;  5AG2 A;  1JFF B;  4FMT A;  1BMF G;  4JI3 O;  4KHP B;  1S5J A;  3JAW A;  2GTA A;  5CBH A;  4QNH B;  2Y0P A;  5B1A B;  4JI7 O;  4G27 B;  2WLI B;  2IH1 C;  2WA4 A;  3MD0 A;  1K4D C;  1GM7 A;  4WFA V;  4W4L A;  2PI5 A;  1SQP H;  3TGU H;  3RVZ A;  5GON B;  4MTX A;  2O57 A;  2RMK B;  1YF2 A;  1L0N H;  1PNK A;  5EK0 A;  3THO A;  4LF9 O;  4I50 B;  2LW1 A;  3WFV A;  1NH2 D;  3WU2 Z;  2YIB D;  2AHY A;  4ZI7 B;  3K5N A;  5IJ0 B;  2Y0I A;  1AI7 A;  2E75 B;  3E22 A;  4GT1 A;  1XMO B;  4LF7 B;  1MZE A;  1L1F A;  2ITD C;  1JFF A;  4QPK A;  2LGQ A;  4WFF A;  1W2B U;  2WLM A;  3T4Z A;  1RPO A;  3SJC C;  2VQF B;  2GSM B;  2WLI A;  4LF8 B;  3FYI B;  2KG7 B;  4YY3 O;  4WFE A;  5EZY B;  2UUB B;  2CE4 A;  5JWP A;  3STL C;  3D8C A;  5B66 Z;  1IBM B;  3CC7 V;  4JZG A;  1R73 A;  1V54 C;  2NLJ C;  3ABK C;  5GON A;  1HR0 O;  2OT5 A;  4P9O A;  4LF5 B;  4LWS A;  1MOF A;  1SQX H;  1HDJ A;  2XAQ A;  4DR1 O;  1W0K G;  4O4H B;  3BHP A;  1I5X A;  4I50 A;  3SPH A;  4MT8 A;  4PA9 A;  1MMM A;  3FB6 C;  4ZI7 A;  4PI2 A;  3Q4H B;  4MTG A;  4RUF A;  5IJ0 A;  2QWO B;  4FLZ A;  5IWA B;  1YEW A;  4XBF A;  4PA7 A;  4DV6 O;  1GKF A;  2ZD9 A;  2E5L B;  1LR1 A;  2ZKO A;  1K9M W;  5IT9 N;  1WJZ A;  5IJ9 B;  2QWP B;  3QO8 A;  2GUZ B;  3B77 A;  4JZ2 A;  2LW7 A;  4PA4 A;  2KG7 A;  2VQE O;  4GYC B;  1VQM V;  4PDV A;  1VQK V;  3TCU A;  4JPR A;  5LXT B;  4UFZ A;  3KKY A;  1FFX B;  5LYJ B;  1OCC B;  1MZF A;  2WLJ A;  3FKS G;  3H01 A;  2E3C A;  4EKW A;  1QLE C;  4OX9 O;  2JK5 C;  4DUZ O;  2YUA A;  3N27 A;  4O4H A;  1W0J G;  4DO2 A;  4DV7 O;  2OCH A;  2IJK A;  5KUK A;  1O9G A;  1QU7 A;  3JAT B;  4J9Z B;  4LH6 A;  2LFS A;  3GWK C;  1I5Y A;  1OHH G;  3CHX A;  4X1K B;  1ZAU A;  3AG3 C;  4OPH A;  2DW4 A;  1WAZ A;  1BQZ A;  5IYB O;  3RWR D;  4X64 B;  3PN1 A;  1FS0 G;  1KP3 A;  2W0X A;  4GLX A;  2B1I A;  1N33 B;  1U97 A;  1YDX A;  4X65 B;  2X6A A;  5IJ9 A;  1GN3 A;  4LF4 O;  1E1R G;  2GUZ A;  1YZB A;  5E79 Z;  2AHZ A;  4K8X A;  2YS8 A;  4JI2 B;  1FFX A;  5LYJ A;  2KB1 A;  3RFR A;  3F7Y C;  3A2F A;  2YEV B;  1BZK A;  3UKM A;  5KMG B;  2B1G A;  1IBK O;  3OE7 G;  2UXD O;  4DR4 O;  4P2Z A;  2IU0 A;  3BEH A;  4FLY A;  1CEZ A;  2UXB O;  4DR2 O;  4UB8 Z;  3CEI A;  4YJ3 B;  5FNV B;  2DYR C;  1M56 C;  2FYU H;  3BPZ A;  4JI6 O;  3JAT A;  5B1O A;  5GTH Z;  2KSD A;  4JI1 O;  5LGU A;  1MSW D;  1GN4 A;  1QR9 A;  1S3J A;  4MVM A;  4X1K A;  4O4I A;  2AZ2 A;  1KD1 W;  3O65 A;  1RM1 C;  2XAG A;  3B8N A;  3E8H A;  5KHG A;  3E8G A;  3JD0 A;  2ZNI A;  4JV5 B;  3ZIA G;  5B1B B;  4GX5 A;  4GKJ B;  1JVM A;  1SQV H;  2QR4 A;  3J80 N;  2WA3 A;  3CXC U;  2IW5 A;  2KKW A;  3VOU A;  2YEV A;  1Q6H A;  1WLE A;  4FZ1 A;  1DF5 A;  3IJ4 A;  2V1D A;  3G80 A;  2ATK C;  4UV8 A;  4J7K A;  1XNR O;  1R3J C;  2B5U A;  2UXC O;  4YJ3 A;  3JD4 A;  2RCV A;  5FNV A;  2Y69 B;  1PD3 A;  1K73 W;  3BRC A;  4UXN A;  3STZ C;  1IXB A;  1S77 D;  3T1H B;  3SGI A;  1N36 B;  4FZ0 A;  4JTA B;  4JI8 O;  5LOV A;  5BY1 A;  2Q8V A;  1I7F A;  4JI0 O;  3T1Y O;  2WPD G;  5KA6 A;  2Y4U A;  2W6I G;  4KL1 A;  4X9Q A;  4NXM O;  3NR7 A;  1GM9 A;  1D2D A;  1F51 A;  2ITC C;  4B7E A;  1H2L A;  4FLT A;  3ML0 A;  3JAS A;  1IVS A;  3L72 H;  1N34 B;  2A9H A;  5LHH A;  2LO1 A;  2HKO A;  2JRI A;  4PHZ A;  3OTO B;  4DR6 B;  1QCE A;  2QTS A;  3OMI B;  5J2U B;  2YIC A;  5LGT A;  4ICG A;  1AR4 A;  4JYA B;  2EZO A;  3JAR A;  4JAU A;  3SJQ C;  1AP5 A;  4DV1 O;  3ZS8 C;  1DLB A;  3A0H Z;  1Q3E A;  3CB2 A;  4O2A B;  3ZCC A;  4PEL A;  1R3I C;  5IYZ B;  4B3S B;  1FAF A;  4XDL A;  2HLD G;  1CP9 A;  4UCR A;  2P06 A;  4DK0 A;  4DV0 B;  4R50 A;  1VQ9 V;  4QIW F;  1IUR A;  1KQS U;  3AG1 C;  3FD9 A;  3HPL C;  1H2K A;  3GVM A;  1A32 A;  1J5E B;  1V54 B;  3ABK B;  1SZT A;  3CJH B;  2UUA O;  2YIA A;  4E2L A;  2HVJ C;  3K58 A;  2F4V O;  5KAF Z;  4I7Z B;  3EXA A;  2GV9 A;  4YXW G;  2ZM6 B;  3ZN1 A;  4ZBM A;  1HNW O;  2QM4 A;  5KHK A;  1RFY A;  5J2U A;  1MSD A;  1XNQ O;  4DR5 B;  1WN7 A;  1TVK B;  3OEE G;  2ODM A;  4GX1 A;  4PDM A;  3SJA C;  4O2A A;  5IYZ A;  4MVU A;  1JX9 A;  3FYE B;  2ZE5 A;  1MG1 A;  3ZN0 A;  1Q6I A;  2P67 A;  5JH7 A;  1E1Q G;  4ZOL B;  3LNN A;  2QDO A;  2XAS A;  5H6Q A;  4X66 O;  2DYS C;  4LF6 B;  5KAI Z;  4IL6 Z;  4AHC A;  3EVK A;  4JAA A;  2HEP A;  1B6Q A;  3K03 A;  1N0N A;  1QLE B;  4DUY B;  3CJH A;  2P22 C;  1RSO B;  5KHI A;  1CPY A;  5D5Q A;  3T1C A;  1URF A;  3ZHU A;  4TV9 B;  1M9N A;  3W7T A;  5LP6 C;  2ILM A;  2JDI G;  3MHS C;  1EM1 A;  1I0H A;  4XDJ A;  5JCO C;  3ZJZ A;  3N2G B;  3WB1 A;  1Q6U A;  1JA8 A;  5KHH A;  1TVK A;  2XT9 A;  4LH7 A;  2OCC C;  2EX3 A;  2FTK A;  4GKK O;  2L35 A;  3AG3 B;  1RP3 B;  1YVW A;  5BXZ A;  4RAI A;  4MSW C;  3CP1 A;  2OTL V;  2Q0A A;  3JAM N;  5CBF A;  1WA8 B;  2HJF C;  2ADQ B;  4R8C A;  4DW0 A;  3E2E A;  1IZ3 A;  4ZOL A;  4KP4 A;  4HYO A;  3D3I A;  2BOB C;  3SYP A;  3K3W A;  3WB2 A;  3UO2 A;  4CS3 A;  4J41 A;  4IIJ B;  4X8A A;  1FJG B;  4AQY O;  1HNZ O;  2PZS A;  1LNQ A;  5BR8 B;  1NZ6 A;  4G28 B;  2EIJ C;  3JAL B;  4WFH A;  4TV9 A;  2YIB A;  4NXN O;  1OCR C;  2W0F C;  2DQ3 A;  1JJ2 U;  1U96 A;  4HAM A;  2DYR B;  4TOI A;  1M56 B;  1Z5W A;  4QE7 A;  3CCL V;  1SF9 A;  3N2G A;  4JI5 B;  3W7W A;  4MW3 A;  2YSU B;  1Q5O A;  4KUM A;  3G4S V;  4CH6 A;  3IGA C;  3DC6 A;  4BIZ A;  4BIO A;  5CA1 B;  4LFB B;  1RM1 B;  3P3P A;  2F95 B;  4TT3 G;  1WA8 A;  3B2E E;  5IE9 A;  2P90 A;  2IJJ A;  5IYC O;  3ZRW B;  1THZ A;  5J2T B;  1K97 A;  4LR3 A;  3SPG A;  3MAQ A;  3S3W A;  1Q8I A;  1VF6 C;  5LMN B;  4H37 A;  1FXH A;  4IIJ A;  5CN0 A;  3IAY A;  1OCO C;  4YHH O;  3M99 B;  3ASO C;  1N0J A;  1KMI Z;  3JAL A;  2WWW A;  1GN6 A;  2LP7 A;  2YXY A;  3GB7 C;  2P5O A;  4LF7 O;  1BE3 H;  3B09 A;  3JCU Z;  4X89 A;  1AI4 A;  3QNE A;  2CK3 G;  3H1K H;  1GRJ A;  3QO7 A;  4Q6G A;  1XI1 A;  2QSA A;  4LWS B;  1X4T A;  3QG5 A;  4LF8 O;  1JMK C;  4O4L B;  1KEC A;  3OFN G;  2UUB O;  5CA1 A;  2EZP A;  1IBM O;  2UUC B;  2HR3 A;  4XDK A;  4EFE A;  4BW5 A;  1R6T A;  2H3O A;  2EIM C;  1K92 A;  3ABL C;  2JS3 A;  4LF5 O;  3ZRW A;  3FFQ A;  3K57 A;  5J2T A;  3SPC A;  4WBN A;  4UV9 A;  4QJF B;  5FPR A;  4F6R B;  2ZNJ A;  4DRX B;  4I55 B;  1JQ0 A;  4UCV A;  5F2V O;  5K1P A;  4UCT A;  4EFB A;  4DK1 A;  4FPP A;  1TUB B;  3H1L H;  3VQV A;  3TJT A;  5IWA O;  2FML A;  2E5L O;  3HB3 B;  1SES A;  1Y74 B;  3K5M A;  5ITZ B;  4PV1 B;  4FLX A;  3BY6 A;  1H2G A;  4O4L A;  4IHJ B;  5LA6 B;  1QVG U;  3JCZ A;  2MK3 A;  1JR9 A;  1E79 G;  3C3S A;  3HR0 A;  3H1I H;  3CCQ V;  1IX9 A;  1P84 F;  5DED A;  4B3R B;  2PF4 E;  1XEQ A;  1WNS A;  3AG1 B;  4H44 B;  1TAE A;  1FFT B; 
#chains in the Genus database with same CATH homology
 3E8G A;  3JD0 A;  4MW8 A;  3ZIA G;  3T4D A;  1V55 C;  3CYO A;  4JAV A;  5B1B B;  4GX5 A;  2ZR3 A;  3ETD A;  3LDD A;  3CC2 V;  2HG5 C;  1JVM A;  2QM8 A;  3ETE A;  3AG4 C;  5IYD O;  4J9Y B;  5LHG A;  1AI5 A;  3CXC U;  2IW5 A;  3VOU A;  4MS2 A;  1K5S A;  2JEU A;  2Q6A A;  3TK1 A;  4UVB A;  4ZKI A;  5HFM A;  2YEV A;  1OCC C;  2JEX A;  5GW7 A;  2P7T C;  3F5W C;  1WLE A;  2JJ1 G;  4TWK A;  3SPI A;  1PNM A;  1YI2 V;  4LP8 A;  3RVY A;  1DF5 A;  4Z1M G;  5EBW C;  2V1D A;  4I5S A;  2ATK C;  2X7R B;  4UV8 A;  5B3S B;  3TET A;  2R9R B;  2F43 G;  1FXK A;  4JF3 A;  1R3J C;  3AG2 B;  2Z3Y A;  2B5U A;  1KC8 W;  3W7X A;  3JD4 A;  4ASU G;  4DXW A;  4WCE V;  2R9I A;  3CME V;  2Y69 B;  3CCE V;  1NH2 C;  1K4C C;  3P30 A;  2EIK C;  4F4L A;  1K34 A;  1PD3 A;  1NVP C;  3OGC C;  1VQO V;  1K73 W;  4UXN A;  3STZ C;  2X6B A;  1S77 D;  5DM6 V;  3ASN B;  1H38 A;  2WLK A;  2BOC C;  1XL4 A;  3K04 A;  1ARO P;  3PJS K;  3OUS A;  1EFR G;  2GHY A;  4JTA B;  2IU3 A;  3IC7 A;  4MTO A;  1VQP V;  4U7N A;  2P6J A;  1PKX A;  1FXV A;  2DYS B;  1KP2 A;  2NNU A;  2WPD G;  2ZDI C;  5KA6 A;  4MVS A;  1RPR A;  2W6I G;  2IJI A;  1COW G;  4KFM A;  1GM9 A;  1F51 A;  2ITC C;  5KUM A;  1Y4M A;  5LGN A;  3K0D A;  4JYB A;  4GX2 A;  3ML0 A;  3K08 A;  3R65 A;  3ZMV A;  1P7B A;  2DQ0 A;  3CCJ V;  2A9H A;  1GM8 A;  5LHH A;  3JD2 A;  3SYA A;  1JOY A;  1YJN V;  2DWE C;  2A0L A;  2Q69 A;  2EIL C;  5LHI A;  2HKO A;  2XAF A;  2QKS A;  3E35 A;  3P32 A;  2A79 B;  1TUE B;  4UUJ C;  2C2A A;  2UXN A;  1OCZ C;  1QCE A;  4UVC A;  3CC4 V;  4GCZ A;  3OMI B;  4FIP C;  4JTC B;  1BHB A;  2XOK G;  5LGT A;  4L87 A;  2HVK C;  2EZO A;  1S5H C;  4JAU A;  1ORQ C;  1ZWI C;  2OCC B;  2ZXW C;  3T2M A;  5DN6 G;  3SJQ C;  1K8A W;  2JJ2 G;  5H9C A;  3QO5 A;  3ZRS A;  1DLB A;  3DGE A;  4PDL A;  3ZMT A;  3CMA V;  2IJH A;  1YHQ V;  2QM7 A;  4FK5 C;  3SYO A;  2D3O W;  1YTF B;  3ZCC A;  1FXK B;  3ABT A;  1VQ7 V;  4PEL A;  4QE9 A;  1R3I C;  4XDL A;  3ZRV A;  2QA4 V;  2HLD G;  1CP9 A;  2H8P C;  4QPJ A;  1S72 V;  2EIN B;  4JAS A;  4R50 A;  1VQ9 V;  4QIW F;  1SET A;  1DTO A;  1KQS U;  3ABM B;  3AG1 C;  1NBM G;  3ETG A;  3K9A A;  4MVZ A;  3JD1 A;  4LC1 A;  5HFL A;  1K7D A;  1IXM A;  3UM7 A;  3CCS V;  5H6R A;  3CD6 V;  1YTF D;  3HPL C;  5L3D A;  1VQ5 V;  3E89 A;  3K0G A;  3CCV V;  2Q68 A;  4X88 A;  5L3F A;  5B1B C;  3JYC A;  4N23 A;  4LBE C;  5L3B A;  1EBO A;  2W6J G;  1YJW V;  3ABU A;  1P4R A;  1V54 B;  3LSQ A;  4RUE A;  1M90 W;  3ABK B;  2HFE C;  1K3E A;  5EBM C;  1SZT A;  4G2K A;  1QVF U;  5CA3 A;  2EIJ B;  1GTO A;  1Q82 W;  1G8M A;  1AJN A;  1XL6 A;  4LCU C;  1OCR B;  1YIJ V;  4E2L A;  5CMU A;  2HVJ C;  4BIU A;  1OZ0 A;  4YXW G;  3ZN1 A;  1S0V A;  1JCH A;  4ZBM A;  4P9P A;  3IFX A;  4JGS A;  5KA5 A;  3WG7 B;  5B3S C;  4RQE A;  4WF9 V;  4PA6 A;  1S76 D;  3AG2 C;  3OEE G;  4U7O A;  4GX1 A;  2WLH A;  4HZ3 A;  4PDM A;  2Y69 C;  1UJW B;  1SER A;  1GK9 A;  1GO3 F;  2K1E A;  1V55 B;  4FJC C;  4JYC A;  3SYC A;  1J95 A;  5L3C A;  5LBQ A;  3ZMZ A;  4MVU A;  1JX9 A;  3I56 V;  3FYE B;  1G4Y B;  3OEH G;  4H33 A;  1MG1 A;  3ZN0 A;  3OMN B;  3ASN C;  4FMT A;  1BMF G;  2P67 A;  5CBH A;  1E1Q G;  4QNH B;  4WFG A;  5B1A B;  4G27 B;  2WLI B;  1Q7Y W;  3X2Q B;  2XAS A;  5H6Q A;  2DYS C;  2PI4 A;  2IH1 C;  1YIT V;  3LUT B;  3W7U A;  2X6C A;  2XND G;  3MD0 A;  4MVO A;  5B1N A;  1NR1 A;  1K4D C;  1GM7 A;  1OCO B;  4WFA V;  1VQL V;  2PI5 A;  2OTJ V;  3ASO B;  1B6Q A;  5IY5 C;  3K03 A;  3RVZ A;  1AJQ A;  1BHA A;  1QLE B;  4BAY A;  1CPY A;  1YJ9 V;  1F4N A;  4MTX A;  5FL7 G;  3T1C A;  1VQ4 V;  1M9N A;  4OXS A;  1NR7 A;  4Q20 A;  3W7T A;  3CCR V;  1DF4 A;  2JDI G;  3MHS C;  1QBZ A;  2XAJ A;  4XDJ A;  3E8B A;  3ZJZ A;  1PNK A;  1M57 B;  5EK0 A;  4RQF A;  2EJR A;  2QEX V;  1K33 A;  2OCC C;  3WFV A;  1NH2 D;  3FB7 C;  1N8R W;  2FTK A;  1ENV A;  2AHY A;  4JTD B;  3ZMU A;  3AG3 B;  3OMA B;  1AI7 A;  4RAI A;  4MSW C;  4GT1 A;  3CP1 A;  2OTL V;  2UXX A;  2Q67 A;  3F7V C;  1YTF C;  1FXK C;  4PDR A;  1L1F A;  4R6Z A;  2EIM B;  2ITD C;  5CBF A;  3ABL B;  5C93 A;  3OR6 C;  2HJF C;  4QPK A;  4WFF A;  1W2B U;  2WLM A;  4R8C A;  3E2E A;  3T4Z A;  2EIN C;  3W7S A;  1RPO A;  2LFR A;  3ABM C;  4KP4 A;  4HYO A;  2GSM B;  2WLI A;  3D3I A;  1Q81 W;  2BOB C;  3FYI B;  3SYP A;  3A0R A;  3K3W A;  2WLL B;  1H8E G;  4WFE A;  1VQ8 V;  1HWY A;  3STL C;  4GX0 A;  4X8A A;  1KKD A;  3CC7 V;  4RO2 A;  1R73 A;  1V54 C;  2NLJ C;  3ABK C;  5BZB A;  3SPJ A;  1LNQ A;  4G28 B;  2EIJ C;  4WFH A;  2OT5 A;  4P9O A;  1M1K W;  1OCR C;  2W0F C;  4N21 A;  5CBG A;  2DQ3 A;  1R3K C;  1JJ2 U;  1MOF A;  3OUF A;  2XAQ A;  1W0K G;  1AJP A;  3DTU B;  2DYR B;  1M56 B;  3OM3 B;  4HAM A;  4QE7 A;  3CCL V;  3B8M A;  3W7W A;  3WG7 C;  1I5X A;  4MW3 A;  3SPH A;  4MT8 A;  4PA9 A;  4TSF G;  2YSU B;  4WFB V;  3FB6 C;  4KUM A;  3K79 A;  3G4S V;  3IGA C;  4BIZ A;  4MTG A;  4RUF A;  2X0L A;  2ZQM A;  3GWO A;  1ROP A;  4XBF A;  4PA7 A;  1GKF A;  2ZD9 A;  1PL0 A;  1H8H G;  3KG2 A;  3EHB B;  1RM1 B;  5E1A C;  4TT3 G;  1EZJ A;  2P90 A;  3LNM B;  1K9M W;  2IJJ A;  3VBB A;  5IYC O;  1R3L C;  3CCM V;  3ZRW B;  5IDJ A;  3QO8 A;  1THZ A;  1K97 A;  1NKD A;  1PNL A;  5B1A C;  3B77 A;  1NQT A;  4PA4 A;  3SPG A;  3AG4 B;  1VQM V;  3X2Q C;  4PDV A;  2WLL A;  1VQK V;  3TCU A;  4H37 A;  1FXH A;  4JPR A;  1VQ6 V;  3ZMS A;  5CN0 A;  1OCO C;  1OCC B;  3M99 B;  4P30 A;  3CPW U;  3ASO C;  2WLJ A;  3FKS G;  3H01 A;  5EC1 C;  4EKW A;  1QLE C;  2QE7 G;  2WWW A;  2LP7 A;  1Q86 W;  3GB7 C;  3SYQ A;  1R6N A;  3FB8 C;  1AI4 A;  2DWD C;  1BL8 A;  2JK5 C;  4X89 A;  3CCU V;  2H94 A;  1W0J G;  3QNE A;  4DO2 A;  2CK3 G;  3QO7 A;  3OR7 C;  2JIZ G;  2IJK A;  1NH2 B;  5KUK A;  1M57 C;  2EIK B;  4R7C A;  1NVP B;  4J9Z B;  2WLN A;  2LFS A;  1KEC A;  3JD3 A;  1F4M A;  3OFN G;  1YSC A;  1I5Y A;  3AEI A;  5L3G A;  1OHH G;  2IH3 C;  2EZP A;  2WAM A;  3LDC A;  4MVQ A;  1Y66 A;  3AG3 C;  2DW4 A;  1QR8 A;  2HR3 A;  4XDK A;  5IYB O;  3I55 V;  2ZR2 A;  1FS0 G;  1KP3 A;  5L3E A;  2B1I A;  4BW5 A;  5EBL C;  1NVP D;  2EIM C;  1K92 A;  3ABL C;  5IY5 B;  1VQN V;  3OW2 U;  2X6A A;  2WSS G;  3ZRW A;  3E83 A;  3SPC A;  3FB5 C;  3NXS A;  4UV9 A;  1E1R G;  4QJF B;  4UVA A;  2QTO A;  4CBC A;  2AHZ A;  1JQ0 A;  2EIL B;  2V7Q G;  1AR1 B;  1F23 A;  2EBO A;  4CZZ A;  2XAH A;  2KB1 A;  1AI6 A;  3ZRX A;  3F7Y C;  2YEV B;  1OCZ B;  4FPP A;  1K5Q A;  2M7W A;  1GMG A;  3UKM A;  3G71 V;  2B1G A;  3E8F A;  3G6E V;  1WPX A;  3OE7 G;  3RW0 A;  3HB3 B;  1MAB G;  3EFF K;  1SRY A;  4P2Z A;  1SES A;  3BEH A;  2ZXW B;  2IU0 A;  1CEZ A;  1JPX A;  3E86 A;  3MHH C;  2Z5U A;  2DYR C;  1M56 C;  3BY6 A;  3OAA G;  3D36 A;  4PA3 A;  5B1O A;  1H2G A;  1QLN A;  1QVG U;  3JCZ A;  5LGU A;  2MK3 A;  4MTF A;  3RBZ A;  1MSW D;  1E79 G;  3CCQ V;  1QR9 A;  3K06 A;  1S3J A;  4MVM A;  4I9W A;  3LDE A;  1R6K A;  3AG1 B;  3LSS A;  4MVR A;  5EC2 C;  1KD1 W;  1NJI W;  2Y48 A;  1RM1 C;  2XAG A;  3B8N A;  1FFT B;  5J9P C;  3E8H A;  2ZDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...