5IYCO

Human core-pic in the initial transcribing state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
O PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5iycO01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 5iycO02
5IYCO 1NVPD 1NVPC 5IYDO 1RM1C 1NH2C 5IYBO 1RM1B 1NH2D 1YTFC 1YTFD
chains in the Genus database with same CATH superfamily
4C7UA 4B3TO 2DYSB 4FM1A 1M4UA 3ZHVA 1KC8W 3K08A 1JQ0A 5GTHZ 3DXRB 1K5QA 1QLEB 2IJHA 3K59A 3L70H 4FLVA 3N2GA 2LFRA 3K79A 1GAXA 2X0LA 5IWAO 2X6AA 4P2ZA 4DR5O 1SESA 4DW0A 1Y66A 4ZHQB 2WSSG 2D2CB 3OUSA 3LSQA 3ETQA 4P30A 4AQYO 2BE3A 4PHZA 1Q7YW 2BTOA 2Q69A 3B4SA 4XDLA 1JX9A 1GK9A 1PP9H 2W6IG 3G6EV 2IW5A 4JTAB 1THZA 1Q8IA 5LMUB 1DLBA 1N34B 1RPRA 4HBNA 3QNEA 1OCZC 5IYZB 4WFGA 4BIZA 2BSKA 4Q6GA 1Y76B 3P32A 5JQGA 1RSOA 2WA4A 4DV5B 1VQ9V 4W4LA 3JSLA 1M56C 5B1AC 5JJJB 5IDJA 2EILC 3BABA 3BHPA 3FYEB 1NVPB 4UFZA 4UVBA 2E75B 5EIBC 1MMMA 2HJFC 1MA1A 3LSSA 1E1QG 4ABMA 4O2AB 1G6UA 1XL6A 2GSMB 2PI4A 3HR0A 4DRXA 3F7YC 5DN6G 2ADPA 4JI3B 4Z1MG 3LDCA 3IFXA 1GMGA 3OTFA 4JI7O 5CA1A 4TV9A 4LH7A 2F93B 2HLDG 4LC1A 1IBKB 2QKSA 4D7SA 1ZX3A 4G27B 4I9QA 1QCEA 1K5SA 3I56V 4GX5A 4O4HB 4R7CA 4HYOA 1KECA 2ZT9B 2QE7G 4QPKA 2FKXA 5KHKA 1EBOA 1NH2C 3CRAA 1EZVH 2Y0IA 4PV1B 2RCVA 3CMAV 1OCOC 1PL4A 1R1BA 3BA8A 1YTFB 4X1YA 2R9AA 1H2LA 1OCCB 2QM7A 1OHHG 2W6JG 5KHGA 2HFEC 2CTPA 3K0GA 1NKDA 1E1RG 4YJ3A 2QKAA 3G6BA 1H2MA 4BR6A 1H38A 2JK5C 1AR4A 3OMNB 4NXNB 3OMAB 1AI7A 3W7WA 1G8MA 3ICXA 4I50A 4LCUC 3RN4A 4FFBA 2JS3A 2QM8A 4LF4B 3R66A 5D5QA 5LMUO 2AW9A 4AI8A 2QWRB 1JJ2U 1N34O 2ZQMA 3A2FA 3CWBH 1GRJA 3JSNA 1CEZA 3C3TA 3J80N 5B3SB 4DV5O 2CTWA 3EXAA 3A0HZ 2F43G 3L73H 4EEQA 5F2VO 5CA3A 4UVAA 2ZXWC 4BWAA 3RT3C 2ETNA 1TUBA 3BFRA 1XHXA 2LJ2A 2RN9A 5EZYA 3SPJA 3TGUH 3BVOA 5IE9A 2Q0OC 3W7SA 1YIJV 3VQVA 4KUMA 5IJ0A 1M93A 4JAUA 3H1HH 2YICA 4H37A 3WG7C 4HNAA 4MSWC 3ASNB 4JI3O 2DJVA 1V55C 3M99B 5KHHA 2L35A 3E2EA 3CC7V 1W0KG 5LP6C 5K1XA 3N2KA 1IBKO 3QO8A 2K1EA 2KG7A 3ZCCA 3TXQA 4N21A 1GM7A 1SQGA 2FL4A 4OPAA 5LA6B 3CB2A 2HG5C 3SYPA 1P7GA 3THOA 3H1KH 2CGNA 4MTGA 1Y74A 5A2QN 1GN3A 4ZKIA 3GB7C 2QWNB 3CEIA 1P4RA 2ODMA 2FMLA 1XDCA 2EIMB 3SDLA 3RBZA 4BW9A 2OIEA 1OCZB 4X88A 2F66C 5IJ9A 1JR9A 2B1IA 2ZDIA 2ILMA 4DR4B 4RWUA 2YXHA 3M8AA 5H6RA 2QA4V 2PGGA 1VARA 1FD9A 4B3SB 4B3RO 1AI6A 5J2TB 2CK3G 3AG2C 5LOVA 5DM6V 4DV0B 1K9MW 3E83A 5B1AB 1URFA 3OEEG 4LF9B 2R9IA 2CTQA 5JCOA 3TXSA 5B1BC 3UCSC 2A06H 4FLZA 1COWG 1DGSA 3T1YB 3ZRSA 4X20A 1K92A 2DE0X 2BOBC 4FLUA 4LF4O 5C93A 4PA4A 1BS3A 1Z2GA 4N23A 3CRRA 1AR1B 2IU0A 3UM7A 1Y6XA 2VRZA 1V9PA 4B3MB 2JGUA 4O4LB 2CAZC 2AXTZ 2EJ7A 1RM1C 4FIPC 1SA0A 2QGNA 5LYJB 1R3KC 2HP8A 3ASOB 1NBMG 1K33A 2KQXA 2WLIB 1OCOB 5CB4A 4U3JB 3AG3C 4X66B 4NKGB 5KA6A 4CZZA 1T5EA 1VQ7V 2JIZG 1NTZH 2N05A 1GN6A 4W4KA 1XEQA 4HAMA 4QGPA 3K5OA 5CN0A 4CH3A 1N32B 3TK1A 1NU1H 3ABMC 4QIWF 2RJZA 3AEIA 3F5TA 3LSUA 4HNAB 1SRYA 1SQVH 3LDDA 1L1FA 3SJBC 2NLJC 2FYUH 3HKDA 1EFRG 1EN5A 1XNRB 1PM9A 3LUTB 1GM9A 1TUEB 3BA9A 1NZ6A 3N2KB 3ZMTA 1ROPA 1XL4A 1QVGU 3C3SA 2KG7B 2LO1A 1HNWB 3D36A 4DYLA 4X9QA 1YSCA 3OR7C 1UJWB 5FLXN 3RYCB 3ABLB 3UO3A 1VQ6V 4I4TB 4UCUA 2EIKC 3OEHG 2E74B 4JYCA 2ZIMA 3DXRA 4DUZO 3JASB 3CCEV 4MVRA 3TJTA 3W7TA 4RQEA 1VF6C 1WB8A 4DR4O 1P7BA 4TQDA 2QEXV 3DC5A 4B3SO 2F4VB 4DV0O 3W7XA 5KHJA 4ZHQA 1NI8A 1K3EA 2OTLV 4LF9O 1M5IA 5EC2C 4E2LA 1I0HA 3S3WA 2UXNA 4IYIA 1KBHA 4PI2A 3A0RA 2A7WA 5KA5A 3T1YO 2DYRC 2XAHA 4CH6A 1US6A 5IYZA 5LHGA 2VQEB 2MW2B 3BRCA 4YXWG 4YIPA 4RUFA 3T4DA 1VQMV 3FYIB 1Y76A 3OGCC 1N33B 3CCVV 4BIUA 5GW7A 4CS2A 4B3MO 3JALA 1L0NH 3ZJZA 3ZRWB 3ZHQA 4IHJB 2JRIA 4FM0A 3JATB 1PL0A 3OM3B 2FB5A 3T1HB 4JI8B 3JAWB 2P7TC 2FTKA 4OGQB 3K5NA 4B7KA 3HKBB 1K97A 1KQSU 4X64B 1IXBA 2IBZH 2Q9LA 3OTOB 4O2AA 4DV6B 3STLC 1LUVA 1SQQH 1P84F 4JAVA 5EC1C 4TUYB 1I5YA 3B2EE 2G38A 2Q7HA 4DK1A 1SQPH 3ZHUA 1N32O 2JVDA 2YIBA 1JA8A 1Y4MA 3H1LH 5GONB 4YIOA 3AK2A 3QF7A 3KG2A 4O4HA 1EZJA 1IDSA 3VQXA 3MD0A 1SZTA 2DMXA 2EBOA 1XNRO 3HPLC 1ZWIC 1GN4A 5FL7G 3DC6A 4FLXA 4PDLA 1V54C 3ZEDA 1HNWO 2Q4PA 1O9GA 4FLYA 4I5SA 4J7KA 2CE4A 3CSXA 2VQFB 1NS1A 5L3CA 2RNBA 4P9PA 3L72H 3E89A 1XMQB 1H2GA 3KCYA 4LP8A 2E3CA 2OCCB 1EM1A 4BAYA 3L74H 4MVZA 2K9PA 1HP8A 4NB5A 1L8DA 1FXVA 1BHAA 2PTMA 4AILC 2F4VO 4GYCB 2DQ0A 1BE3H 1AJQA 3W7UA 2LFSA 2UXXA 4YJ2B 1N36O 1K34A 4CS3A 1FAFA 1YEWA 4B7EA 3AG3B 4DUYB 1AR5A 2XAJA 1GM8A 4FZ0A 5EBMC 2B5UA 2VWKA 4MT8A 2EIJB 4UV8A 2X6BA 4GX2A 3J7AU 1JVMA 2VQEO 4IT5A 3CXHF 4U3FH 3ETGA 2DWDC 4UCSA 4LFAO 1N33O 3JD4A 1HNZB 1NJIW 2BTQB 1FXKC 1XI1A 3GWKC 3ZN1A 3FB7C 1XUQA 2DOSA 2XASA 1YZBA 1KKCA 1JJOA 3T1HO 3JALB 4JI8O 4JI2B 2LP7A 3PJSK 4X64O 2VS0A 2PYLA 1F51A 1W59A 2EIKB 3FB8C 3OTOO 4DV6O 4BIOA 4JTCB 3ZRXA 4WBNB 2IH3C 3NXSA 4JGSA 2QR4A 4LBEC 3CCQV 4CS4A 2C2AA 1R3JC 4QNHB 5LL6Y 1YCIA 1HWYA 3ZMVA 1BT8A 4NXMB 2XOKG 1ZUQA 2XAFA 2PZSA 4P9OA 4FK5C 1D5AA 1M90W 5LA6A 2LW7A 4NTYA 1QNMA 3OAAG 3SYOA 1VQOV 4LF5B 2V4DA 1N0NA 5LMNB 3R65A 4LFCB 2VQFO 1BL8A 3IGAC 1WN7A 1NTMH 1XMQO 4X65B 3HKEB 1Q6IA 4DR2B 4K8XA 1PV0A 3G71V 1WPXA 2ADQB 2NNUA 2RDCA 2XUMA 1B04A 4X89A 4H44B 1KUQA 3T4ZA 5J2TA 5BZBA 2ZE5A 1AI4A 4MVMA 2H8PC 2IH1C 3CCJV 4B3RB 2E76B 2WLMA 3ABKB 4QJFB 3C90A 5L3GA 3CYOA 3H01A 4JTDB 2XT9A 4Q20A 2HJDA 2R9RB 5KHIA 4DUYO 4L8JA 1Z5WA 2Q7GA 4L87A 1AVMA 3OT7A 5L3FA 4X62B 4O4LA 1TAEA 1JPXA 1HNZO 1VMGA 4KFMA 1A32A 1SC5B 1KMIZ 5LYJA 3G67A 1WPBA 4I0XB 2AGAA 3HKCB 4UV9A 2Q68A 4JI2O 1OJHA 5C8YB 3CRCA 5CMUA 3QO7A 2WLIA 2KSDA 1SQBH 4Z1VA 3FB6C 2N04A 3RYHA 2LW1A 4U3JA 1NVPD 2QJ1A 5B1NA 2WPDG 3AG4C 3CC4V 3ZN0A 4DR1B 1XILA 2WAMA 2N74A 3G4SV 2F95B 4DV1B 4E4EA 4UCRA 1AP5A 3ZMZA 2ZDIC 2WLNA 3RYIB 1JMKC 4NXMO 4KXRA 2HKOA 2WLLB 2YIBD 4GZRB 3JD2A 1Y67A 4FM2A 5FPOA 1KP3A 2P22C 1VQ8V 1Q6UA 1SQXH 4DK0A 4LF5O 4LWSA 3ZHSA 5B1OA 2WA3A 5CBFA 2HVJC 4UCOA 5LMNO 1FKAO 4KHPB 5KMGB 4GCZA 3P3NA 3RYCA 1K8AW 4R8CA 5LBQA 1GH6A 4I4TA 3E8FA 3E35A 4LFCO 3WB0A 2ZNJA 3WU2Z 4X65O 4XDKA 3JASA 1XREA 4DR2O 3ZMSA 5LHIA 4LF7B 4LFBB 3D3IA 1BGYH 1FXKB 1Q81W 1MSDA 4DUZB 2Q6AA 5ITZB 3CMEV 1O9HA 1SF9A 1HR0B 2AHZA 1VQ5V 1FFTB 3K9AA 2Z5UA 1NT2B 1AB3A 3CCUV 4K0KB 4R50A 1M56B 2WLJA 3SPIA 1TVKB 1R6NA 1Q82W 2EILB 2GDSA 3CC2V 3L9DA 3ETDA 4D6TH 1BQZA 3FFQA 2UXCB 4UB6Z 2JS5A 1PNMA 2WLHA 5LP6A 4X62O 2GTAA 1M57C 5BR8B 3CX5F 4X1KB 3ZRWA 1GTOA 5B66Z 5EBWC 4DXWA 2QDOA 4IHJA 5JVDB 4U7NA 5JJNB 3RGBA 2UXDB 1OZ0A 3JATA 5D5PA 5EYPB 4JAAA 3FAVB 3JAWA 3ML0A 2ZKOA 2A79B 1FPOA 3CXCU 3H1JH 3SJQC 3HKBA 2OTJV 4HZ3A 2BOCC 4JI6B 3VQYA 1ZSPA 2Y4UA 4TQFA 4CH5A 1KP2A 4PA6A 1NH2B 1MOFA 3CCLV 1B3QA 2EINC 4JASA 4TT3G 1KKDA 4TUYA 5H5NA 1FS0G 2GHYA 3CCMV 1YVWA 1R6KA 2CDYA 3P3PA 4ZOLB 4WFBV 3RYHB 4O2BB 4DR1O 1R3IC 4PD4F 3OD4A 5JH7A 2R70A 4DV1O 3ZIAG 1DTOA 5GONA 5KUKA 4J9YB 1SERA 4QE9A 1QHTA 3AK1A 2QWQB 1WNSA 1L0LH 1J95A 1S0VA 4ZIBA 2AZ2A 4PDVA 2IJJA 1BSMA 4KHPO 2O57A 4DR6B 4GX0A 4LWSB 1FJGB 3IJ4A 1VP7A 4R6ZA 2ITCC 2EX3A 4LR3A 1NR1A 1H2NA 1X59A 2F23A 3F7VC 4LF7O 4LFBO 4EKWA 4G2KA 2QWPB 4MVSA 3K0DA 5IY5C 1QLNA 5B5EZ 4I9WA 1F23A 4WFEA 1JFFB 2HR3A 4JI1B 3E8HA 1HR0O 3CJHB 4YJ2A 1JCHA 4A5UB 2RMKB 1I7FA 2XNDG 2W0XA 1NTKH 2ZXWB 4K0KO 1WP8A 1IZ3A 1B06A 2ARHA 1N36B 3CS5A 4DO2A 5EIBD 1DF5A 1IX9A 3ZHTA 2X6CA 2UXCO 4JYYA 4EB6B 5BMVB 3WFVA 3JD0A 3WG7B 2BTQA 5BR8O 1V55B 4IYHA 1MNGA 2YEVB 1ENVA 1Q6HA 5J2UB 3VOUA 2UXDO 4LFAB 4J7ZA 2ZCEA 3ABTA 5LP6B 3QVNA 3STZC 2BCCH 4GKJB 2JJ2G 3KKYA 3H1IH 4WCEV 4JI6O 2JEXA 2X7RB 5BY1A 4K3AA 2UXBB 2GUZB 4LF8B 4WFFA 4TWKA 4F6RA 1SKVA 2ZNIA 4WBNA 2OT5A 1VQKV 1HDJA 2M6YA 3SPCA 3BCCH 3O9OA 1MG1A 1VF6A 5EK0A 4X8AA 2CH7B 5LXTB 5KX5B 1R73A 3J81N 1OCCC 3BEHA 3E8BA 4TV8B 4YY3B 1WAZA 2ZR2A 3N27A 5FNVB 1YHQV 1MSWD 3H9VA 1ZL8B 2GBOA 5JH7B 4OX9B 3AG2B 1DK1A 3ABUA 1H8HG 3K06A 4JI5O 4UUJC 3APOA 1IURA 3X2QC 2Q0AA 4PA7A 3VQWA 4GX1A 5DEDA 5B1BB 4DR6O 4IIJA 1FJGO 3HKEA 4J7JA 1BQ0A 2Q73A 1KD1W 2Y4TA 4K35A 4MVQA 3WB1A 3B09A 4O4JB 4GLXA 4G28B 3MAQA 2NR5A 4GUNA 5FPRA 4XDJA 1IBLB 4PA3A 5H6QA 3RW0A 5B3SC 3EFFK 3CD6V 4MTFA 1RM1B 2YDEA 2XHBA 5L3DA 4JI1O 4FMTA 1G1XB 2EULA 5IYDO 4NVPA 2MK3A 3TCUA 2IU3A 2D3OW 4PJ0Z 4J11A 1I94B 3EHBB 1SS3A 4OPHA 1HNXB 4IL6Z 3E22B 3CE2A 4LF6B 1FXHA 5GTIZ 3ASNC 4MW8A 4DR7B 1S5JA 3JAKA 3APQA 2XAGA 1CXZB 3UT5B 4JYBA 3D3QA 3GVMA 1MZFA 3ABMB 3SYCA 4I0XA 4X1IB 3MDSA 3HKCA 2HVKC 2ZM6B 3D8CA 3EVKA 2EJRA 5C8YA 2DN9A 1Z5VA 2YI9A 4GKJO 2XTAA 3MHSC 4RUEA 1GKFA 2DQ3A 2LQTA 2YXLA 2W0FC 1QBZA 3K03A 2UXBO 3FX7A 4LF8O 2A3QA 3BPZA 3ZBHA 3BY6A 3G80A 4KP4A 4MW3A 2EIMC 4LH6A 2KKWA 3RVYA 3KCXA 1W2BU 1S5HC 2YC0A 1ZTEA 1UFIA 1TA8A 3RYIA 4F6RB 5IY5B 4LNUB 2KB1A 4YY3O 1R3LC 3OW2U 2WLLA 1GO3F 3ZX6A 2YIAA 4PDMA 1QR9A 4OX9O 1AJNA 1AILA 2JGDB 2EZOA 5TISZ 2ITDC 3B40A 2Q8VA 3AG1C 2QM4A 3DSQA 4FJCC 5KMGA 4BW5A 2PUSA 2Q7EA 3UO2A 1YF2A 2PF4E 3JARB 1CPYA 1QR8A 4O4IB 2LGQA 4I7ZB 3RYFB 4YHHB 2RQ6A 2NN4A 2ZD9A 2DYRB 2Y48A 1WP7A 2Q67A 1VEWA 1K4CC 4I55B 1BMFG 2YSUB 3JD1A 1FXKA 4IIJB 3JCUZ 3VBBA 2UUAB 3JCZA 2UUBB 2HHHB 5ITZA 2YIDA 3O65A 2VWJA 1IBLO 3OUFA 1ZAUA 3K04A 3Q4HB 1YITV 2YUAA 4MVOA 2P90A 1WA8B 3ASOC 1TVKA 1LNQA 2F1MA 4IGGA 1I94O 3IC7A 1LUWA 1HNXO 1KB9F 3CP1A 2PYJA 1AI5A 3SYQA 4WF9V 3QTCA 4JPRA 4LF6O 4J80A 4H13B 4DR7O 4X1KA 5JJEB 3RWRD 5H2FZ 1YI2V 1B6QA 3SGIA 5JVDA 1PPJH 3PN1A 1J5EB 5EYPA 3FAVA 3JAKB 2YS8A 1H2KA 2P67A 3IAYA 2CGOA 3AK3A 3DGEA 3N2GB 4FFKA 2ZM6O 1S72V 3X2QB 4U7OA 4CC5A 1OV9A 4JV5B 3M7MX 2P6JA 4QPJA 2OIGA 2Y69C 2ZINA 5L3BA 2ZR3A 3BAAA 2GTSA 4MS2A 3ABLC 4B08A 1V54B 3UQ8A 3I55V 4JF3A 4D7TA 4ZOLA 1YJNV 4O2BA 4RQFA 1IBMB 1I5XA 3E8GA 3FKSG 1GN2A 3FB5C 1AJPA 1XQ8A 1N4CA 1MABG 3RFRA 1SETA 4J42A 1IVSA 2P4KA 4JZ2A 4DV2B 3KZIZ 2BSKB 2AZ0A 4H33A 3LNNA 4MTOA 1K4DC 5JQGB 4ZI7A 2PI5A 1RSOB 1EN6A 1VIBA 5KLVH 4FLTA 1BCCH 1ORQC 4UB8Z 2YI8A 3K9SA 1H2SB 5IYCO 2V1DA 3ETEA 2GV9A 1F4MA 2WWWA 3F5WC 4YHHO 1PNLA 5JCOC 4FLWA 3SJCC 2P5OA 4UCVA 3K57A 3DTUB 5CA0A 4DRXB 4XBFA 5KAFZ 2UUAO 2UUBO 1YTFD 2HHHO 3TETA 4NR1A 1JFFA 2LGWA 2H3OA 1Q5OA 1KU9A 3CJHA 5CA1B 4TV9B 3I5DA 2V7QG 3P30A 3K3WA 3K58A 4GT1A 3T1CA 3OE7G 4K8ZA 1H8EG 3ZMUA 1YJ9V 4OXSA 5E79Z 4JI0B 1S76D 1SQFA 4PDRA 4QE7A 5BXZA 4PI0A 1Q90D 4NYKA 2R72A 2UUCB 1U97A 2JEUA 4Z2WA 1AP6A 4EB6A 5BMVA 1M1KW 3K5MA 4UCTA 4JI4B 1S77D 3CRMA 1XMOB 1NQTA 3SPGA 4GKKB 2YEVA 4X1YB 1Q43A 2L6LA 5J2UA 1J5EO 4J41A 3E86A 4EFEA 1U96A 4H0LB 1S3JA 3U0ZA 3L75H 4FVMA 1EN4A 2Z3YA 2Q5ZA 4JZGA 3AG1B 5IT9N 4DV7B 3U10A 2JJ1G 4NXNO 1UPGA 3ZS8C 1VQNV 4JV5O 4KL1A 4YJ3B 3CRQA 2GUZA 2A9HA 3B77A 3B8MA 5JWPA 1OCRC 2A0LA 1FFXA 3D36C 1BZKA 1R6TA 4I50B 2CH7A 2OCCC 4TSFG 3OMIB 5LXTA 5E1AC 4FFBB 3MHHC 5KX5A 1IBMO 1FYJA 3SYAA 5CBGA 4TV8A 5KUMA 2EZPA 1KYOF 2DYSC 1F7YA 5FNVA 3FD9A 4DV4B 3T2MA 4CC6A 1XBLA 1ZL8A 4RO2A 4DV2O 4MVUA 3QO5A 1QLEC 3IC9A 3SPHA 1Q3EA 2AHYA 1D5NA 2ZE6A 3B8NA 1RPOA 4TOIA 4F4LA 1ZLZA 1WLEA 1TGOA 4JI5B 2QKCA 4ZI7B 1TUBB 5AG2A 1YJWV 3OGIB 3CCRV 1VF5B 2P06A 4RAIA 2EIJC 5EZYB 1QU7A 5H9CA 1D2DA 2CTRA 1XHZA 4O4JA 3U11A 1XNQB 1M9NA 3SR2C 5IJ0B 4DR3B 1HW7A 5HFMA 2OWOA 2ATKC 3K5LA 2IJIA 4NTWA 3GWOA 1P49A 4ICGA 2E5LB 5DECA 4PELA 2QTSA 5CA0B 1VQLV 1VF7A 1NR7A 2Y69B 2B1GA 3NR7A 4JI0O 1PKXA 3WB2A 4DW1A 5LGNA 2M7WA 3E22A 1MZEA 3JAMN 4DV3B 2ZE7A 2UUCO 1NVPC 3JYCA 2UU9B 1Y74B 4JYAB 3AG4B 4CBCA 4B3TB 4F6EA 4JI4O 5A9GA 3UT5A 1XMOO 1N8RW 2H94A 4MTXA 4GKKO 5IJ9B 1VQ4V 4X1IA 2QTOA 3UKMA 4AHCA 2OYQA 3LDEA 5IWAB 1S5LZ 3L71H 5LOVB 4DR5B 5L3EA 5IYBO 4DV7O 1N0JA 3CHXA 4AQYB 3CPWU 5KAIZ 1XOUA 4PA9A 2DW4A 4FZ1A 1WJZA 1X4TA 3RVZA 1NH2D 2DWEC 4NTXA 3SJAC 2PY5A 4X20B 3JD3A 1PD3A 5CBHA 2Y0PA 4ZBMA 4LNUA 1K7DA 3A0BZ 1YTFC 5J9PC 1FFXB 1SZXA 4DV4O 2JDIG 4J9ZB 2JGDA 3ABKC 3OFNG 2WLKA 5HFLA 2ZE8A 2CUGA 5LGUA 1DF4A 2YXYA 1SA0B 3JARA 5K1PA 4O4IA 4FPPA 1CP9A 2QSAA 3RYFA 2IJKA 3S3XA 4X66O 1LR1A 2XAQA 1JOYA 4I55A 5CB4B 1BHBA 3HB3B 2IM9A 2B9ZA 1PNKA 1XNQO 3OR6C 1AROP 4DR3O 1YDXA 1M57B 4UVCA 1WB7A 2HEPA 4JI7B 1VQPV 4UXNA 3Q4HA 4WFHA 3CCSV 1RFYA 1IXMA 2E5LO 1RP3B 3A8TA 4CH4A 1Q86W 1WA8A 3LNMB 3HKDB 1W0JG 2P4VA 3ZHRA 1YXBA 3AG7A 3ZRVA 4ASUG 1OCRB 4EFBA 3QG5A 5LGTA 1K73W 2Z0AA 1I08A 2OCHA 1QVFU 1E79G 1QQCA 4WFAV 5LHHA 4DV3O 4J10A 2QWOB 1G4YB 2EINB 1F4NA 2ZIOA 5EBLC 2UU9O 4JYAO
chains in the Genus database with same CATH topology
3K9AA 2QEXV 2Z5UA 2DYSB 3IC7A 3CCUV 4R50A 1M56B 3CP1A 1AI5A 3SYQA 4WF9V 3W7XA 4JPRA 2WLJA 3K08A 1KC8W 1JQ0A 3SPIA 1K5QA 1R6NA 1QLEB 2IJHA 1K3EA 1Q82W 2EILB 3CC2V 2OTLV 5EC2C 4E2LA 3ETDA 1YI2V 2LFRA 3K79A 1B6QA 2UXNA 2X0LA 2X6AA 4P2ZA 3A0RA 1SESA 5KA5A 1Y66A 1PNMA 2WSSG 2DYRC 2WLHA 3OUSA 3LSQA 2XAHA 4P30A 2P67A 1M57C 1Q7YW 3DGEA 3ZRWA 1GTOA 2Q69A 5EBWC 4DXWA 1S72V 3X2QB 4XDLA 4U7NA 1JX9A 4U7OA 1GK9A 5LHGA 1OZ0A 2P6JA 2W6IG 4QPJA 4RUFA 4YXWG 3T4DA 3G6EV 3FYIB 1VQMV 2Y69C 5L3BA 3OGCC 2IW5A 4JTAB 3ML0A 3CCVV 4BIUA 1THZA 2ZR3A 5GW7A 1DLBA 4MS2A 2A79B 3ABLC 1V54B 3ZJZA 3I55V 3CXCU 3ZRWB 3SJQC 4JF3A 1RPRA 2OTJV 4HZ3A 3QNEA 1OCZC 2BOCC 1YJNV 4WFGA 4RQFA 1PL0A 4BIZA 1I5XA 1KP2A 3OM3B 3E8GA 3FKSG 4PA6A 1NH2B 3P32A 1MOFA 3FB5C 3CCLV 1AJPA 2P7TC 1VQ9V 2EINC 1MABG 2FTKA 4JASA 4TT3G 1KKDA 1FS0G 1SETA 2GHYA 1K97A 1KQSU 3CCMV 1R6KA 4WFBV 1M56C 1R3IC 5B1AC 3ZIAG 4H33A 4MTOA 5IDJA 3STLC 1DTOA 1K4DC 2PI5A 5KUKA 2EILC 4JAVA 4J9YB 5EC1C 1SERA 3FYEB 1NVPB 1ORQC 1I5YA 4UVBA 4QE9A 2HJFC 5IYCO 3LSSA 1E1QG 2V1DA 3ETEA 1XL6A 1J95A 1Y4MA 1F4MA 2GSMB 2PI4A 1S0VA 5DN6G 2WWWA 3F5WC 3F7YC 4PDVA 4Z1MG 1PNLA 3LDCA 2IJJA 3KG2A 1EZJA 3MD0A 3IFXA 1SZTA 1GMGA 4GX0A 2EBOA 3HPLC 2HLDG 3DTUB 4LC1A 1ZWIC 2QKSA 5FL7G 4XBFA 4G27B 4PDLA 1V54C 4R6ZA 1YTFD 2ITCC 3TETA 1QCEA 1K5SA 4I5SA 3I56V 1NR1A 4GX5A 4R7CA 4HYOA 1KECA 4QPKA 2QE7G 3F7VC 5L3CA 2V7QG 3P30A 3K3WA 4EKWA 4P9PA 4G2KA 3E89A 1H2GA 4MVSA 1EBOA 1NH2C 4GT1A 3T1CA 3OE7G 3K0DA 4LP8A 5IY5C 1QLNA 2OCCB 4I9WA 1H8EG 1F23A 3ZMUA 4OXSA 1YJ9V 4WFEA 4BAYA 3CMAV 1S76D 2HR3A 1OCOC 4MVZA 4PDRA 4QE7A 3E8HA 1JCHA 1YTFB 1FXVA 1BHAA 2JEUA 2XNDG 2ZXWB 1M1KW 2DQ0A 1OCCB 2QM7A 1AJQA 4DO2A 3W7UA 2LFSA 2UXXA 1DF5A 1OHHG 1S77D 1K34A 2W6JG 1NQTA 2HFEC 3SPGA 2YEVA 3K0GA 1NKDA 2X6CA 1E1RG 3AG3B 1H38A 2JK5C 3E86A 2XAJA 1S3JA 1GM8A 3WFVA 3JD0A 5EBMC 3WG7B 2B5UA 4MT8A 2Z3YA 3AG1B 2EIJB 3OMNB 4UV8A 3OMAB 1AI7A 1V55B 2X6BA 3W7WA 1G8MA 2JJ1G 4GX2A 2YEVB 1ENVA 1JVMA 1VQNV 4LCUC 3VOUA 3ABTA 2QM8A 3ETGA 2DWDC 3STZC 2A9HA 3B77A 3B8MA 3JD4A 1NJIW 1JJ2U 1OCRC 1FXKC 2JJ2G 2A0LA 3ZN1A 2ZQMA 3FB7C 4WCEV 2JEXA 2XASA 2OCCC 2X7RB 3OMIB 4TSFG 5E1AC 3MHHC 3SYAA 5CBGA 4WFFA 4TWKA 1CEZA 2LP7A 5KUMA 5B3SB 2EZPA 3PJSK 2DYSC 2OT5A 1VQKV 3SPCA 3T2MA 1MG1A 2F43G 5CA3A 5EK0A 4UVAA 2ZXWC 4RO2A 4X8AA 1F51A 2EIKB 3FB8C 4MVUA 3QO5A 1QLEC 1R73A 3SPHA 1OCCC 3BEHA 2AHYA 3E8BA 4JTCB 3ZRXA 3B8NA 1RPOA 2ZR2A 3SPJA 2IH3C 1YHQV 3NXSA 4JGSA 4LBEC 3CCQV 1MSWD 2C2AA 4F4LA 1R3JC 1YIJV 3W7SA 4QNHB 1WLEA 3AG2B 4KUMA 1HWYA 3ZMVA 3ABUA 1H8HG 2XOKG 3K06A 1YJWV 4JAUA 4H37A 4UUJC 2XAFA 3WG7C 3CCRV 4P9OA 4FK5C 4MSWC 3ASNB 3X2QC 4RAIA 2EIJC 4PA7A 1V55C 3M99B 1M90W 5H9CA 4GX1A 3OAAG 3E2EA 5B1BB 3SYOA 3CC7V 1VQOV 1W0KG 1M9NA 3QO8A 2K1EA 3ZCCA 5HFMA 2ATKC 4N21A 2IJIA 1KD1W 3R65A 1GM7A 3GWOA 4MVQA 2HG5C 1BL8A 4PELA 3SYPA 3IGAC 4G28B 1VQLV 4XDJA 1NR7A 4PA3A 5H6QA 3RW0A 5B3SC 3G71V 2Y69B 3EFFK 2B1GA 1WPXA 3CD6V 4MTGA 2NNUA 4ZKIA 3GB7C 4MTFA 1RM1B 4X89A 1P4RA 1PKXA 3T4ZA 5LGNA 5L3DA 2M7WA 4FMTA 5BZBA 2EIMB 5IYDO 1AI4A 3RBZA 2MK3A 1OCZB 3TCUA 2IU3A 4X88A 4MVMA 2H8PC 2IH1C 2D3OW 1NVPC 2B1IA 2ZDIA 3CCJV 3JYCA 2WLMA 3ABKB 5H6RA 3AG4B 4QJFB 4CBCA 2QA4V 3EHBB 1AI6A 2CK3G 3AG2C 5L3GA 5DM6V 1N8RW 1K9MW 3E83A 2H94A 4MTXA 3CYOA 3H01A 4JTDB 5B1AB 1VQ4V 2QTOA 3OEEG 1FXHA 4Q20A 2R9IA 3ASNC 4MW8A 2R9RB 3UKMA 2XAGA 3LDEA 5B1BC 4JYBA 1COWG 5IYBO 5L3EA 4L87A 3ZRSA 5L3FA 3ABMB 3SYCA 1K92A 2BOBC 3CPWU 4PA9A 5C93A 2HVKC 4PA4A 1JPXA 2EJRA 2DW4A 4KFMA 4N23A 3RVZA 1NH2D 2DWEC 1AR1B 2IU0A 3UM7A 3MHSC 4RUEA 1GKFA 2DQ3A 3JD3A 2W0FC 1PD3A 1QBZA 3K03A 5CBHA 4ZBMA 4UV9A 1K7DA 1RM1C 2Q68A 3BY6A 1YTFC 5J9PC 5CMUA 3QO7A 4KP4A 2WLIA 4MW3A 2EIMC 4FIPC 3RVYA 3FB6C 1R3KC 1W2BU 1S5HC 2JDIG 1NVPD 4J9ZB 5B1NA 2WPDG 3ABKC 3ASOB 2WLKA 3AG4C 3OFNG 5HFLA 2KB1A 3ZN0A 5IY5B 3CC4V 1R3LC 3OW2U 5LGUA 1DF4A 1NBMG 2WLLA 1K33A 1GO3F 2WAMA 2WLIB 3G4SV 4PDMA 1OCOB 1QR9A 3AG3C 1AJNA 4FPPA 1CP9A 3ZMZA 2ZDIC 2IJKA 2EZOA 2WLNA 5KA6A 4CZZA 2ITDC 1VQ7V 2JIZG 2HKOA 3AG1C 4FJCC 4BW5A 2WLLB 2XAQA 4HAMA 1JOYA 3JD2A 1CPYA 5CN0A 1QR8A 1BHBA 3TK1A 1KP3A 3ABMC 3HB3B 4QIWF 3AEIA 1VQ8V 2ZD9A 1PNKA 5B1OA 1SRYA 3LDDA 2HVJC 1L1FA 5CBFA 3OR6C 1AROP 2NLJC 2DYRB 2Y48A 1EFRG 2Q67A 4GCZA 1M57B 4UVCA 1K8AW 1K4CC 4R8CA 1VQPV 4UXNA 5LBQA 4WFHA 3CCSV 1IXMA 3LUTB 1GM9A 3E8FA 1BMFG 1TUEB 3E35A 2YSUB 3JD1A 1FXKA 3ZMTA 1ROPA 3VBBA 1XL4A 3JCZA 1Q86W 1QVGU 3D36A 3LNMB 4XDKA 1YSCA 1W0JG 3OR7C 3OUFA 1UJWB 3ZMSA 3ABLB 5LHIA 3K04A 1VQ6V 3ZRVA 2EIKC 3D3IA 4ASUG 1OCRB 5LGTA 3OEHG 1FXKB 1YITV 1K73W 1Q81W 4MVOA 2P90A 2Q6AA 1QVFU 4JYCA 1E79G 3ASOC 4WFAV 5LHHA 1LNQA 3CMEV 3CCEV 4MVRA 1G4YB 3W7TA 2EINB 4RQEA 1F4NA 2AHZA 5EBLC 1VQ5V 1FFTB 1P7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC O;  1NVP D;  1NVP C;  5IYD O;  1RM1 C;  1NH2 C;  5IYB O;  1RM1 B;  1NH2 D;  1YTF C;  1YTF D; 
#chains in the Genus database with same CATH topology
 4C7U A;  4B3T O;  2DYS B;  4FM1 A;  1M4U A;  3ZHV A;  1KC8 W;  3K08 A;  1JQ0 A;  5GTH Z;  3DXR B;  1K5Q A;  1QLE B;  2IJH A;  3K59 A;  3L70 H;  4FLV A;  3N2G A;  2LFR A;  3K79 A;  1GAX A;  2X0L A;  5IWA O;  2X6A A;  4P2Z A;  4DR5 O;  1SES A;  4DW0 A;  1Y66 A;  4ZHQ B;  2WSS G;  2D2C B;  3OUS A;  3LSQ A;  3ETQ A;  4P30 A;  4AQY O;  2BE3 A;  4PHZ A;  1Q7Y W;  2BTO A;  2Q69 A;  3B4S A;  4XDL A;  1JX9 A;  1GK9 A;  1PP9 H;  2W6I G;  3G6E V;  2IW5 A;  4JTA B;  1THZ A;  1Q8I A;  5LMU B;  1DLB A;  1N34 B;  1RPR A;  4HBN A;  3QNE A;  1OCZ C;  5IYZ B;  4WFG A;  4BIZ A;  2BSK A;  4Q6G A;  1Y76 B;  3P32 A;  5JQG A;  1RSO A;  2WA4 A;  4DV5 B;  1VQ9 V;  4W4L A;  3JSL A;  1M56 C;  5B1A C;  5JJJ B;  5IDJ A;  2EIL C;  3BAB A;  3BHP A;  3FYE B;  1NVP B;  4UFZ A;  4UVB A;  2E75 B;  5EIB C;  1MMM A;  2HJF C;  1MA1 A;  3LSS A;  1E1Q G;  4ABM A;  4O2A B;  1G6U A;  1XL6 A;  2GSM B;  2PI4 A;  3HR0 A;  4DRX A;  3F7Y C;  5DN6 G;  2ADP A;  4JI3 B;  4Z1M G;  3LDC A;  3IFX A;  1GMG A;  3OTF A;  4JI7 O;  5CA1 A;  4TV9 A;  4LH7 A;  2F93 B;  2HLD G;  4LC1 A;  1IBK B;  2QKS A;  4D7S A;  1ZX3 A;  4G27 B;  4I9Q A;  1QCE A;  1K5S A;  3I56 V;  4GX5 A;  4O4H B;  4R7C A;  4HYO A;  1KEC A;  2ZT9 B;  2QE7 G;  4QPK A;  2FKX A;  5KHK A;  1EBO A;  1NH2 C;  3CRA A;  1EZV H;  2Y0I A;  4PV1 B;  2RCV A;  3CMA V;  1OCO C;  1PL4 A;  1R1B A;  3BA8 A;  1YTF B;  4X1Y A;  2R9A A;  1H2L A;  1OCC B;  2QM7 A;  1OHH G;  2W6J G;  5KHG A;  2HFE C;  2CTP A;  3K0G A;  1NKD A;  1E1R G;  4YJ3 A;  2QKA A;  3G6B A;  1H2M A;  4BR6 A;  1H38 A;  2JK5 C;  1AR4 A;  3OMN B;  4NXN B;  3OMA B;  1AI7 A;  3W7W A;  1G8M A;  3ICX A;  4I50 A;  4LCU C;  3RN4 A;  4FFB A;  2JS3 A;  2QM8 A;  4LF4 B;  3R66 A;  5D5Q A;  5LMU O;  2AW9 A;  4AI8 A;  2QWR B;  1JJ2 U;  1N34 O;  2ZQM A;  3A2F A;  3CWB H;  1GRJ A;  3JSN A;  1CEZ A;  3C3T A;  3J80 N;  5B3S B;  4DV5 O;  2CTW A;  3EXA A;  3A0H Z;  2F43 G;  3L73 H;  4EEQ A;  5F2V O;  5CA3 A;  4UVA A;  2ZXW C;  4BWA A;  3RT3 C;  2ETN A;  1TUB A;  3BFR A;  1XHX A;  2LJ2 A;  2RN9 A;  5EZY A;  3SPJ A;  3TGU H;  3BVO A;  5IE9 A;  2Q0O C;  3W7S A;  1YIJ V;  3VQV A;  4KUM A;  5IJ0 A;  1M93 A;  4JAU A;  3H1H H;  2YIC A;  4H37 A;  3WG7 C;  4HNA A;  4MSW C;  3ASN B;  4JI3 O;  2DJV A;  1V55 C;  3M99 B;  5KHH A;  2L35 A;  3E2E A;  3CC7 V;  1W0K G;  5LP6 C;  5K1X A;  3N2K A;  1IBK O;  3QO8 A;  2K1E A;  2KG7 A;  3ZCC A;  3TXQ A;  4N21 A;  1GM7 A;  1SQG A;  2FL4 A;  4OPA A;  5LA6 B;  3CB2 A;  2HG5 C;  3SYP A;  1P7G A;  3THO A;  3H1K H;  2CGN A;  4MTG A;  1Y74 A;  5A2Q N;  1GN3 A;  4ZKI A;  3GB7 C;  2QWN B;  3CEI A;  1P4R A;  2ODM A;  2FML A;  1XDC A;  2EIM B;  3SDL A;  3RBZ A;  4BW9 A;  2OIE A;  1OCZ B;  4X88 A;  2F66 C;  5IJ9 A;  1JR9 A;  2B1I A;  2ZDI A;  2ILM A;  4DR4 B;  4RWU A;  2YXH A;  3M8A A;  5H6R A;  2QA4 V;  2PGG A;  1VAR A;  1FD9 A;  4B3S B;  4B3R O;  1AI6 A;  5J2T B;  2CK3 G;  3AG2 C;  5LOV A;  5DM6 V;  4DV0 B;  1K9M W;  3E83 A;  5B1A B;  1URF A;  3OEE G;  4LF9 B;  2R9I A;  2CTQ A;  5JCO A;  3TXS A;  5B1B C;  3UCS C;  2A06 H;  4FLZ A;  1COW G;  1DGS A;  3T1Y B;  3ZRS A;  4X20 A;  1K92 A;  2DE0 X;  2BOB C;  4FLU A;  4LF4 O;  5C93 A;  4PA4 A;  1BS3 A;  1Z2G A;  4N23 A;  3CRR A;  1AR1 B;  2IU0 A;  3UM7 A;  1Y6X A;  2VRZ A;  1V9P A;  4B3M B;  2JGU A;  4O4L B;  2CAZ C;  2AXT Z;  2EJ7 A;  1RM1 C;  4FIP C;  1SA0 A;  2QGN A;  5LYJ B;  1R3K C;  2HP8 A;  3ASO B;  1NBM G;  1K33 A;  2KQX A;  2WLI B;  1OCO B;  5CB4 A;  4U3J B;  3AG3 C;  4X66 B;  4NKG B;  5KA6 A;  4CZZ A;  1T5E A;  1VQ7 V;  2JIZ G;  1NTZ H;  2N05 A;  1GN6 A;  4W4K A;  1XEQ A;  4HAM A;  4QGP A;  3K5O A;  5CN0 A;  4CH3 A;  1N32 B;  3TK1 A;  1NU1 H;  3ABM C;  4QIW F;  2RJZ A;  3AEI A;  3F5T A;  3LSU A;  4HNA B;  1SRY A;  1SQV H;  3LDD A;  1L1F A;  3SJB C;  2NLJ C;  2FYU H;  3HKD A;  1EFR G;  1EN5 A;  1XNR B;  1PM9 A;  3LUT B;  1GM9 A;  1TUE B;  3BA9 A;  1NZ6 A;  3N2K B;  3ZMT A;  1ROP A;  1XL4 A;  1QVG U;  3C3S A;  2KG7 B;  2LO1 A;  1HNW B;  3D36 A;  4DYL A;  4X9Q A;  1YSC A;  3OR7 C;  1UJW B;  5FLX N;  3RYC B;  3ABL B;  3UO3 A;  1VQ6 V;  4I4T B;  4UCU A;  2EIK C;  3OEH G;  2E74 B;  4JYC A;  2ZIM A;  3DXR A;  4DUZ O;  3JAS B;  3CCE V;  4MVR A;  3TJT A;  3W7T A;  4RQE A;  1VF6 C;  1WB8 A;  4DR4 O;  1P7B A;  4TQD A;  2QEX V;  3DC5 A;  4B3S O;  2F4V B;  4DV0 O;  3W7X A;  5KHJ A;  4ZHQ A;  1NI8 A;  1K3E A;  2OTL V;  4LF9 O;  1M5I A;  5EC2 C;  4E2L A;  1I0H A;  3S3W A;  2UXN A;  4IYI A;  1KBH A;  4PI2 A;  3A0R A;  2A7W A;  5KA5 A;  3T1Y O;  2DYR C;  2XAH A;  4CH6 A;  1US6 A;  5IYZ A;  5LHG A;  2VQE B;  2MW2 B;  3BRC A;  4YXW G;  4YIP A;  4RUF A;  3T4D A;  1VQM V;  3FYI B;  1Y76 A;  3OGC C;  1N33 B;  3CCV V;  4BIU A;  5GW7 A;  4CS2 A;  4B3M O;  3JAL A;  1L0N H;  3ZJZ A;  3ZRW B;  3ZHQ A;  4IHJ B;  2JRI A;  4FM0 A;  3JAT B;  1PL0 A;  3OM3 B;  2FB5 A;  3T1H B;  4JI8 B;  3JAW B;  2P7T C;  2FTK A;  4OGQ B;  3K5N A;  4B7K A;  3HKB B;  1K97 A;  1KQS U;  4X64 B;  1IXB A;  2IBZ H;  2Q9L A;  3OTO B;  4O2A A;  4DV6 B;  3STL C;  1LUV A;  1SQQ H;  1P84 F;  4JAV A;  5EC1 C;  4TUY B;  1I5Y A;  3B2E E;  2G38 A;  2Q7H A;  4DK1 A;  1SQP H;  3ZHU A;  1N32 O;  2JVD A;  2YIB A;  1JA8 A;  1Y4M A;  3H1L H;  5GON B;  4YIO A;  3AK2 A;  3QF7 A;  3KG2 A;  4O4H A;  1EZJ A;  1IDS A;  3VQX A;  3MD0 A;  1SZT A;  2DMX A;  2EBO A;  1XNR O;  3HPL C;  1ZWI C;  1GN4 A;  5FL7 G;  3DC6 A;  4FLX A;  4PDL A;  1V54 C;  3ZED A;  1HNW O;  2Q4P A;  1O9G A;  4FLY A;  4I5S A;  4J7K A;  2CE4 A;  3CSX A;  2VQF B;  1NS1 A;  5L3C A;  2RNB A;  4P9P A;  3L72 H;  3E89 A;  1XMQ B;  1H2G A;  3KCY A;  4LP8 A;  2E3C A;  2OCC B;  1EM1 A;  4BAY A;  3L74 H;  4MVZ A;  2K9P A;  1HP8 A;  4NB5 A;  1L8D A;  1FXV A;  1BHA A;  2PTM A;  4AIL C;  2F4V O;  4GYC B;  2DQ0 A;  1BE3 H;  1AJQ A;  3W7U A;  2LFS A;  2UXX A;  4YJ2 B;  1N36 O;  1K34 A;  4CS3 A;  1FAF A;  1YEW A;  4B7E A;  3AG3 B;  4DUY B;  1AR5 A;  2XAJ A;  1GM8 A;  4FZ0 A;  5EBM C;  2B5U A;  2VWK A;  4MT8 A;  2EIJ B;  4UV8 A;  2X6B A;  4GX2 A;  3J7A U;  1JVM A;  2VQE O;  4IT5 A;  3CXH F;  4U3F H;  3ETG A;  2DWD C;  4UCS A;  4LFA O;  1N33 O;  3JD4 A;  1HNZ B;  1NJI W;  2BTQ B;  1FXK C;  1XI1 A;  3GWK C;  3ZN1 A;  3FB7 C;  1XUQ A;  2DOS A;  2XAS A;  1YZB A;  1KKC A;  1JJO A;  3T1H O;  3JAL B;  4JI8 O;  4JI2 B;  2LP7 A;  3PJS K;  4X64 O;  2VS0 A;  2PYL A;  1F51 A;  1W59 A;  2EIK B;  3FB8 C;  3OTO O;  4DV6 O;  4BIO A;  4JTC B;  3ZRX A;  4WBN B;  2IH3 C;  3NXS A;  4JGS A;  2QR4 A;  4LBE C;  3CCQ V;  4CS4 A;  2C2A A;  1R3J C;  4QNH B;  5LL6 Y;  1YCI A;  1HWY A;  3ZMV A;  1BT8 A;  4NXM B;  2XOK G;  1ZUQ A;  2XAF A;  2PZS A;  4P9O A;  4FK5 C;  1D5A A;  1M90 W;  5LA6 A;  2LW7 A;  4NTY A;  1QNM A;  3OAA G;  3SYO A;  1VQO V;  4LF5 B;  2V4D A;  1N0N A;  5LMN B;  3R65 A;  4LFC B;  2VQF O;  1BL8 A;  3IGA C;  1WN7 A;  1NTM H;  1XMQ O;  4X65 B;  3HKE B;  1Q6I A;  4DR2 B;  4K8X A;  1PV0 A;  3G71 V;  1WPX A;  2ADQ B;  2NNU A;  2RDC A;  2XUM A;  1B04 A;  4X89 A;  4H44 B;  1KUQ A;  3T4Z A;  5J2T A;  5BZB A;  2ZE5 A;  1AI4 A;  4MVM A;  2H8P C;  2IH1 C;  3CCJ V;  4B3R B;  2E76 B;  2WLM A;  3ABK B;  4QJF B;  3C90 A;  5L3G A;  3CYO A;  3H01 A;  4JTD B;  2XT9 A;  4Q20 A;  2HJD A;  2R9R B;  5KHI A;  4DUY O;  4L8J A;  1Z5W A;  2Q7G A;  4L87 A;  1AVM A;  3OT7 A;  5L3F A;  4X62 B;  4O4L A;  1TAE A;  1JPX A;  1HNZ O;  1VMG A;  4KFM A;  1A32 A;  1SC5 B;  1KMI Z;  5LYJ A;  3G67 A;  1WPB A;  4I0X B;  2AGA A;  3HKC B;  4UV9 A;  2Q68 A;  4JI2 O;  1OJH A;  5C8Y B;  3CRC A;  5CMU A;  3QO7 A;  2WLI A;  2KSD A;  1SQB H;  4Z1V A;  3FB6 C;  2N04 A;  3RYH A;  2LW1 A;  4U3J A;  1NVP D;  2QJ1 A;  5B1N A;  2WPD G;  3AG4 C;  3CC4 V;  3ZN0 A;  4DR1 B;  1XIL A;  2WAM A;  2N74 A;  3G4S V;  2F95 B;  4DV1 B;  4E4E A;  4UCR A;  1AP5 A;  3ZMZ A;  2ZDI C;  2WLN A;  3RYI B;  1JMK C;  4NXM O;  4KXR A;  2HKO A;  2WLL B;  2YIB D;  4GZR B;  3JD2 A;  1Y67 A;  4FM2 A;  5FPO A;  1KP3 A;  2P22 C;  1VQ8 V;  1Q6U A;  1SQX H;  4DK0 A;  4LF5 O;  4LWS A;  3ZHS A;  5B1O A;  2WA3 A;  5CBF A;  2HVJ C;  4UCO A;  5LMN O;  1FKA O;  4KHP B;  5KMG B;  4GCZ A;  3P3N A;  3RYC A;  1K8A W;  4R8C A;  5LBQ A;  1GH6 A;  4I4T A;  3E8F A;  3E35 A;  4LFC O;  3WB0 A;  2ZNJ A;  3WU2 Z;  4X65 O;  4XDK A;  3JAS A;  1XRE A;  4DR2 O;  3ZMS A;  5LHI A;  4LF7 B;  4LFB B;  3D3I A;  1BGY H;  1FXK B;  1Q81 W;  1MSD A;  4DUZ B;  2Q6A A;  5ITZ B;  3CME V;  1O9H A;  1SF9 A;  1HR0 B;  2AHZ A;  1VQ5 V;  1FFT B;  3K9A A;  2Z5U A;  1NT2 B;  1AB3 A;  3CCU V;  4K0K B;  4R50 A;  1M56 B;  2WLJ A;  3SPI A;  1TVK B;  1R6N A;  1Q82 W;  2EIL B;  2GDS A;  3CC2 V;  3L9D A;  3ETD A;  4D6T H;  1BQZ A;  3FFQ A;  2UXC B;  4UB6 Z;  2JS5 A;  1PNM A;  2WLH A;  5LP6 A;  4X62 O;  2GTA A;  1M57 C;  5BR8 B;  3CX5 F;  4X1K B;  3ZRW A;  1GTO A;  5B66 Z;  5EBW C;  4DXW A;  2QDO A;  4IHJ A;  5JVD B;  4U7N A;  5JJN B;  3RGB A;  2UXD B;  1OZ0 A;  3JAT A;  5D5P A;  5EYP B;  4JAA A;  3FAV B;  3JAW A;  3ML0 A;  2ZKO A;  2A79 B;  1FPO A;  3CXC U;  3H1J H;  3SJQ C;  3HKB A;  2OTJ V;  4HZ3 A;  2BOC C;  4JI6 B;  3VQY A;  1ZSP A;  2Y4U A;  4TQF A;  4CH5 A;  1KP2 A;  4PA6 A;  1NH2 B;  1MOF A;  3CCL V;  1B3Q A;  2EIN C;  4JAS A;  4TT3 G;  1KKD A;  4TUY A;  5H5N A;  1FS0 G;  2GHY A;  3CCM V;  1YVW A;  1R6K A;  2CDY A;  3P3P A;  4ZOL B;  4WFB V;  3RYH B;  4O2B B;  4DR1 O;  1R3I C;  4PD4 F;  3OD4 A;  5JH7 A;  2R70 A;  4DV1 O;  3ZIA G;  1DTO A;  5GON A;  5KUK A;  4J9Y B;  1SER A;  4QE9 A;  1QHT A;  3AK1 A;  2QWQ B;  1WNS A;  1L0L H;  1J95 A;  1S0V A;  4ZIB A;  2AZ2 A;  4PDV A;  2IJJ A;  1BSM A;  4KHP O;  2O57 A;  4DR6 B;  4GX0 A;  4LWS B;  1FJG B;  3IJ4 A;  1VP7 A;  4R6Z A;  2ITC C;  2EX3 A;  4LR3 A;  1NR1 A;  1H2N A;  1X59 A;  2F23 A;  3F7V C;  4LF7 O;  4LFB O;  4EKW A;  4G2K A;  2QWP B;  4MVS A;  3K0D A;  5IY5 C;  1QLN A;  5B5E Z;  4I9W A;  1F23 A;  4WFE A;  1JFF B;  2HR3 A;  4JI1 B;  3E8H A;  1HR0 O;  3CJH B;  4YJ2 A;  1JCH A;  4A5U B;  2RMK B;  1I7F A;  2XND G;  2W0X A;  1NTK H;  2ZXW B;  4K0K O;  1WP8 A;  1IZ3 A;  1B06 A;  2ARH A;  1N36 B;  3CS5 A;  4DO2 A;  5EIB D;  1DF5 A;  1IX9 A;  3ZHT A;  2X6C A;  2UXC O;  4JYY A;  4EB6 B;  5BMV B;  3WFV A;  3JD0 A;  3WG7 B;  2BTQ A;  5BR8 O;  1V55 B;  4IYH A;  1MNG A;  2YEV B;  1ENV A;  1Q6H A;  5J2U B;  3VOU A;  2UXD O;  4LFA B;  4J7Z A;  2ZCE A;  3ABT A;  5LP6 B;  3QVN A;  3STZ C;  2BCC H;  4GKJ B;  2JJ2 G;  3KKY A;  3H1I H;  4WCE V;  4JI6 O;  2JEX A;  2X7R B;  5BY1 A;  4K3A A;  2UXB B;  2GUZ B;  4LF8 B;  4WFF A;  4TWK A;  4F6R A;  1SKV A;  2ZNI A;  4WBN A;  2OT5 A;  1VQK V;  1HDJ A;  2M6Y A;  3SPC A;  3BCC H;  3O9O A;  1MG1 A;  1VF6 A;  5EK0 A;  4X8A A;  2CH7 B;  5LXT B;  5KX5 B;  1R73 A;  3J81 N;  1OCC C;  3BEH A;  3E8B A;  4TV8 B;  4YY3 B;  1WAZ A;  2ZR2 A;  3N27 A;  5FNV B;  1YHQ V;  1MSW D;  3H9V A;  1ZL8 B;  2GBO A;  5JH7 B;  4OX9 B;  3AG2 B;  1DK1 A;  3ABU A;  1H8H G;  3K06 A;  4JI5 O;  4UUJ C;  3APO A;  1IUR A;  3X2Q C;  2Q0A A;  4PA7 A;  3VQW A;  4GX1 A;  5DED A;  5B1B B;  4DR6 O;  4IIJ A;  1FJG O;  3HKE A;  4J7J A;  1BQ0 A;  2Q73 A;  1KD1 W;  2Y4T A;  4K35 A;  4MVQ A;  3WB1 A;  3B09 A;  4O4J B;  4GLX A;  4G28 B;  3MAQ A;  2NR5 A;  4GUN A;  5FPR A;  4XDJ A;  1IBL B;  4PA3 A;  5H6Q A;  3RW0 A;  5B3S C;  3EFF K;  3CD6 V;  4MTF A;  1RM1 B;  2YDE A;  2XHB A;  5L3D A;  4JI1 O;  4FMT A;  1G1X B;  2EUL A;  5IYD O;  4NVP A;  2MK3 A;  3TCU A;  2IU3 A;  2D3O W;  4PJ0 Z;  4J11 A;  1I94 B;  3EHB B;  1SS3 A;  4OPH A;  1HNX B;  4IL6 Z;  3E22 B;  3CE2 A;  4LF6 B;  1FXH A;  5GTI Z;  3ASN C;  4MW8 A;  4DR7 B;  1S5J A;  3JAK A;  3APQ A;  2XAG A;  1CXZ B;  3UT5 B;  4JYB A;  3D3Q A;  3GVM A;  1MZF A;  3ABM B;  3SYC A;  4I0X A;  4X1I B;  3MDS A;  3HKC A;  2HVK C;  2ZM6 B;  3D8C A;  3EVK A;  2EJR A;  5C8Y A;  2DN9 A;  1Z5V A;  2YI9 A;  4GKJ O;  2XTA A;  3MHS C;  4RUE A;  1GKF A;  2DQ3 A;  2LQT A;  2YXL A;  2W0F C;  1QBZ A;  3K03 A;  2UXB O;  3FX7 A;  4LF8 O;  2A3Q A;  3BPZ A;  3ZBH A;  3BY6 A;  3G80 A;  4KP4 A;  4MW3 A;  2EIM C;  4LH6 A;  2KKW A;  3RVY A;  3KCX A;  1W2B U;  1S5H C;  2YC0 A;  1ZTE A;  1UFI A;  1TA8 A;  3RYI A;  4F6R B;  5IY5 B;  4LNU B;  2KB1 A;  4YY3 O;  1R3L C;  3OW2 U;  2WLL A;  1GO3 F;  3ZX6 A;  2YIA A;  4PDM A;  1QR9 A;  4OX9 O;  1AJN A;  1AIL A;  2JGD B;  2EZO A;  5TIS Z;  2ITD C;  3B40 A;  2Q8V A;  3AG1 C;  2QM4 A;  3DSQ A;  4FJC C;  5KMG A;  4BW5 A;  2PUS A;  2Q7E A;  3UO2 A;  1YF2 A;  2PF4 E;  3JAR B;  1CPY A;  1QR8 A;  4O4I B;  2LGQ A;  4I7Z B;  3RYF B;  4YHH B;  2RQ6 A;  2NN4 A;  2ZD9 A;  2DYR B;  2Y48 A;  1WP7 A;  2Q67 A;  1VEW A;  1K4C C;  4I55 B;  1BMF G;  2YSU B;  3JD1 A;  1FXK A;  4IIJ B;  3JCU Z;  3VBB A;  2UUA B;  3JCZ A;  2UUB B;  2HHH B;  5ITZ A;  2YID A;  3O65 A;  2VWJ A;  1IBL O;  3OUF A;  1ZAU A;  3K04 A;  3Q4H B;  1YIT V;  2YUA A;  4MVO A;  2P90 A;  1WA8 B;  3ASO C;  1TVK A;  1LNQ A;  2F1M A;  4IGG A;  1I94 O;  3IC7 A;  1LUW A;  1HNX O;  1KB9 F;  3CP1 A;  2PYJ A;  1AI5 A;  3SYQ A;  4WF9 V;  3QTC A;  4JPR A;  4LF6 O;  4J80 A;  4H13 B;  4DR7 O;  4X1K A;  5JJE B;  3RWR D;  5H2F Z;  1YI2 V;  1B6Q A;  3SGI A;  5JVD A;  1PPJ H;  3PN1 A;  1J5E B;  5EYP A;  3FAV A;  3JAK B;  2YS8 A;  1H2K A;  2P67 A;  3IAY A;  2CGO A;  3AK3 A;  3DGE A;  3N2G B;  4FFK A;  2ZM6 O;  1S72 V;  3X2Q B;  4U7O A;  4CC5 A;  1OV9 A;  4JV5 B;  3M7M X;  2P6J A;  4QPJ A;  2OIG A;  2Y69 C;  2ZIN A;  5L3B A;  2ZR3 A;  3BAA A;  2GTS A;  4MS2 A;  3ABL C;  4B08 A;  1V54 B;  3UQ8 A;  3I55 V;  4JF3 A;  4D7T A;  4ZOL A;  1YJN V;  4O2B A;  4RQF A;  1IBM B;  1I5X A;  3E8G A;  3FKS G;  1GN2 A;  3FB5 C;  1AJP A;  1XQ8 A;  1N4C A;  1MAB G;  3RFR A;  1SET A;  4J42 A;  1IVS A;  2P4K A;  4JZ2 A;  4DV2 B;  3KZI Z;  2BSK B;  2AZ0 A;  4H33 A;  3LNN A;  4MTO A;  1K4D C;  5JQG B;  4ZI7 A;  2PI5 A;  1RSO B;  1EN6 A;  1VIB A;  5KLV H;  4FLT A;  1BCC H;  1ORQ C;  4UB8 Z;  2YI8 A;  3K9S A;  1H2S B;  5IYC O;  2V1D A;  3ETE A;  2GV9 A;  1F4M A;  2WWW A;  3F5W C;  4YHH O;  1PNL A;  5JCO C;  4FLW A;  3SJC C;  2P5O A;  4UCV A;  3K57 A;  3DTU B;  5CA0 A;  4DRX B;  4XBF A;  5KAF Z;  2UUA O;  2UUB O;  1YTF D;  2HHH O;  3TET A;  4NR1 A;  1JFF A;  2LGW A;  2H3O A;  1Q5O A;  1KU9 A;  3CJH A;  5CA1 B;  4TV9 B;  3I5D A;  2V7Q G;  3P30 A;  3K3W A;  3K58 A;  4GT1 A;  3T1C A;  3OE7 G;  4K8Z A;  1H8E G;  3ZMU A;  1YJ9 V;  4OXS A;  5E79 Z;  4JI0 B;  1S76 D;  1SQF A;  4PDR A;  4QE7 A;  5BXZ A;  4PI0 A;  1Q90 D;  4NYK A;  2R72 A;  2UUC B;  1U97 A;  2JEU A;  4Z2W A;  1AP6 A;  4EB6 A;  5BMV A;  1M1K W;  3K5M A;  4UCT A;  4JI4 B;  1S77 D;  3CRM A;  1XMO B;  1NQT A;  3SPG A;  4GKK B;  2YEV A;  4X1Y B;  1Q43 A;  2L6L A;  5J2U A;  1J5E O;  4J41 A;  3E86 A;  4EFE A;  1U96 A;  4H0L B;  1S3J A;  3U0Z A;  3L75 H;  4FVM A;  1EN4 A;  2Z3Y A;  2Q5Z A;  4JZG A;  3AG1 B;  5IT9 N;  4DV7 B;  3U10 A;  2JJ1 G;  4NXN O;  1UPG A;  3ZS8 C;  1VQN V;  4JV5 O;  4KL1 A;  4YJ3 B;  3CRQ A;  2GUZ A;  2A9H A;  3B77 A;  3B8M A;  5JWP A;  1OCR C;  2A0L A;  1FFX A;  3D36 C;  1BZK A;  1R6T A;  4I50 B;  2CH7 A;  2OCC C;  4TSF G;  3OMI B;  5LXT A;  5E1A C;  4FFB B;  3MHH C;  5KX5 A;  1IBM O;  1FYJ A;  3SYA A;  5CBG A;  4TV8 A;  5KUM A;  2EZP A;  1KYO F;  2DYS C;  1F7Y A;  5FNV A;  3FD9 A;  4DV4 B;  3T2M A;  4CC6 A;  1XBL A;  1ZL8 A;  4RO2 A;  4DV2 O;  4MVU A;  3QO5 A;  1QLE C;  3IC9 A;  3SPH A;  1Q3E A;  2AHY A;  1D5N A;  2ZE6 A;  3B8N A;  1RPO A;  4TOI A;  4F4L A;  1ZLZ A;  1WLE A;  1TGO A;  4JI5 B;  2QKC A;  4ZI7 B;  1TUB B;  5AG2 A;  1YJW V;  3OGI B;  3CCR V;  1VF5 B;  2P06 A;  4RAI A;  2EIJ C;  5EZY B;  1QU7 A;  5H9C A;  1D2D A;  2CTR A;  1XHZ A;  4O4J A;  3U11 A;  1XNQ B;  1M9N A;  3SR2 C;  5IJ0 B;  4DR3 B;  1HW7 A;  5HFM A;  2OWO A;  2ATK C;  3K5L A;  2IJI A;  4NTW A;  3GWO A;  1P49 A;  4ICG A;  2E5L B;  5DEC A;  4PEL A;  2QTS A;  5CA0 B;  1VQL V;  1VF7 A;  1NR7 A;  2Y69 B;  2B1G A;  3NR7 A;  4JI0 O;  1PKX A;  3WB2 A;  4DW1 A;  5LGN A;  2M7W A;  3E22 A;  1MZE A;  3JAM N;  4DV3 B;  2ZE7 A;  2UUC O;  1NVP C;  3JYC A;  2UU9 B;  1Y74 B;  4JYA B;  3AG4 B;  4CBC A;  4B3T B;  4F6E A;  4JI4 O;  5A9G A;  3UT5 A;  1XMO O;  1N8R W;  2H94 A;  4MTX A;  4GKK O;  5IJ9 B;  1VQ4 V;  4X1I A;  2QTO A;  3UKM A;  4AHC A;  2OYQ A;  3LDE A;  5IWA B;  1S5L Z;  3L71 H;  5LOV B;  4DR5 B;  5L3E A;  5IYB O;  4DV7 O;  1N0J A;  3CHX A;  4AQY B;  3CPW U;  5KAI Z;  1XOU A;  4PA9 A;  2DW4 A;  4FZ1 A;  1WJZ A;  1X4T A;  3RVZ A;  1NH2 D;  2DWE C;  4NTX A;  3SJA C;  2PY5 A;  4X20 B;  3JD3 A;  1PD3 A;  5CBH A;  2Y0P A;  4ZBM A;  4LNU A;  1K7D A;  3A0B Z;  1YTF C;  5J9P C;  1FFX B;  1SZX A;  4DV4 O;  2JDI G;  4J9Z B;  2JGD A;  3ABK C;  3OFN G;  2WLK A;  5HFL A;  2ZE8 A;  2CUG A;  5LGU A;  1DF4 A;  2YXY A;  1SA0 B;  3JAR A;  5K1P A;  4O4I A;  4FPP A;  1CP9 A;  2QSA A;  3RYF A;  2IJK A;  3S3X A;  4X66 O;  1LR1 A;  2XAQ A;  1JOY A;  4I55 A;  5CB4 B;  1BHB A;  3HB3 B;  2IM9 A;  2B9Z A;  1PNK A;  1XNQ O;  3OR6 C;  1ARO P;  4DR3 O;  1YDX A;  1M57 B;  4UVC A;  1WB7 A;  2HEP A;  4JI7 B;  1VQP V;  4UXN A;  3Q4H A;  4WFH A;  3CCS V;  1RFY A;  1IXM A;  2E5L O;  1RP3 B;  3A8T A;  4CH4 A;  1Q86 W;  1WA8 A;  3LNM B;  3HKD B;  1W0J G;  2P4V A;  3ZHR A;  1YXB A;  3AG7 A;  3ZRV A;  4ASU G;  1OCR B;  4EFB A;  3QG5 A;  5LGT A;  1K73 W;  2Z0A A;  1I08 A;  2OCH A;  1QVF U;  1E79 G;  1QQC A;  4WFA V;  5LHH A;  4DV3 O;  4J10 A;  2QWO B;  1G4Y B;  2EIN B;  1F4N A;  2ZIO A;  5EBL C;  2UU9 O;  4JYA O; 
#chains in the Genus database with same CATH homology
 3K9A A;  2QEX V;  2Z5U A;  2DYS B;  3IC7 A;  3CCU V;  4R50 A;  1M56 B;  3CP1 A;  1AI5 A;  3SYQ A;  4WF9 V;  3W7X A;  4JPR A;  2WLJ A;  3K08 A;  1KC8 W;  1JQ0 A;  3SPI A;  1K5Q A;  1R6N A;  1QLE B;  2IJH A;  1K3E A;  1Q82 W;  2EIL B;  3CC2 V;  2OTL V;  5EC2 C;  4E2L A;  3ETD A;  1YI2 V;  2LFR A;  3K79 A;  1B6Q A;  2UXN A;  2X0L A;  2X6A A;  4P2Z A;  3A0R A;  1SES A;  5KA5 A;  1Y66 A;  1PNM A;  2WSS G;  2DYR C;  2WLH A;  3OUS A;  3LSQ A;  2XAH A;  4P30 A;  2P67 A;  1M57 C;  1Q7Y W;  3DGE A;  3ZRW A;  1GTO A;  2Q69 A;  5EBW C;  4DXW A;  1S72 V;  3X2Q B;  4XDL A;  4U7N A;  1JX9 A;  4U7O A;  1GK9 A;  5LHG A;  1OZ0 A;  2P6J A;  2W6I G;  4QPJ A;  4RUF A;  4YXW G;  3T4D A;  3G6E V;  3FYI B;  1VQM V;  2Y69 C;  5L3B A;  3OGC C;  2IW5 A;  4JTA B;  3ML0 A;  3CCV V;  4BIU A;  1THZ A;  2ZR3 A;  5GW7 A;  1DLB A;  4MS2 A;  2A79 B;  3ABL C;  1V54 B;  3ZJZ A;  3I55 V;  3CXC U;  3ZRW B;  3SJQ C;  4JF3 A;  1RPR A;  2OTJ V;  4HZ3 A;  3QNE A;  1OCZ C;  2BOC C;  1YJN V;  4WFG A;  4RQF A;  1PL0 A;  4BIZ A;  1I5X A;  1KP2 A;  3OM3 B;  3E8G A;  3FKS G;  4PA6 A;  1NH2 B;  3P32 A;  1MOF A;  3FB5 C;  3CCL V;  1AJP A;  2P7T C;  1VQ9 V;  2EIN C;  1MAB G;  2FTK A;  4JAS A;  4TT3 G;  1KKD A;  1FS0 G;  1SET A;  2GHY A;  1K97 A;  1KQS U;  3CCM V;  1R6K A;  4WFB V;  1M56 C;  1R3I C;  5B1A C;  3ZIA G;  4H33 A;  4MTO A;  5IDJ A;  3STL C;  1DTO A;  1K4D C;  2PI5 A;  5KUK A;  2EIL C;  4JAV A;  4J9Y B;  5EC1 C;  1SER A;  3FYE B;  1NVP B;  1ORQ C;  1I5Y A;  4UVB A;  4QE9 A;  2HJF C;  5IYC O;  3LSS A;  1E1Q G;  2V1D A;  3ETE A;  1XL6 A;  1J95 A;  1Y4M A;  1F4M A;  2GSM B;  2PI4 A;  1S0V A;  5DN6 G;  2WWW A;  3F5W C;  3F7Y C;  4PDV A;  4Z1M G;  1PNL A;  3LDC A;  2IJJ A;  3KG2 A;  1EZJ A;  3MD0 A;  3IFX A;  1SZT A;  1GMG A;  4GX0 A;  2EBO A;  3HPL C;  2HLD G;  3DTU B;  4LC1 A;  1ZWI C;  2QKS A;  5FL7 G;  4XBF A;  4G27 B;  4PDL A;  1V54 C;  4R6Z A;  1YTF D;  2ITC C;  3TET A;  1QCE A;  1K5S A;  4I5S A;  3I56 V;  1NR1 A;  4GX5 A;  4R7C A;  4HYO A;  1KEC A;  4QPK A;  2QE7 G;  3F7V C;  5L3C A;  2V7Q G;  3P30 A;  3K3W A;  4EKW A;  4P9P A;  4G2K A;  3E89 A;  1H2G A;  4MVS A;  1EBO A;  1NH2 C;  4GT1 A;  3T1C A;  3OE7 G;  3K0D A;  4LP8 A;  5IY5 C;  1QLN A;  2OCC B;  4I9W A;  1H8E G;  1F23 A;  3ZMU A;  4OXS A;  1YJ9 V;  4WFE A;  4BAY A;  3CMA V;  1S76 D;  2HR3 A;  1OCO C;  4MVZ A;  4PDR A;  4QE7 A;  3E8H A;  1JCH A;  1YTF B;  1FXV A;  1BHA A;  2JEU A;  2XND G;  2ZXW B;  1M1K W;  2DQ0 A;  1OCC B;  2QM7 A;  1AJQ A;  4DO2 A;  3W7U A;  2LFS A;  2UXX A;  1DF5 A;  1OHH G;  1S77 D;  1K34 A;  2W6J G;  1NQT A;  2HFE C;  3SPG A;  2YEV A;  3K0G A;  1NKD A;  2X6C A;  1E1R G;  3AG3 B;  1H38 A;  2JK5 C;  3E86 A;  2XAJ A;  1S3J A;  1GM8 A;  3WFV A;  3JD0 A;  5EBM C;  3WG7 B;  2B5U A;  4MT8 A;  2Z3Y A;  3AG1 B;  2EIJ B;  3OMN B;  4UV8 A;  3OMA B;  1AI7 A;  1V55 B;  2X6B A;  3W7W A;  1G8M A;  2JJ1 G;  4GX2 A;  2YEV B;  1ENV A;  1JVM A;  1VQN V;  4LCU C;  3VOU A;  3ABT A;  2QM8 A;  3ETG A;  2DWD C;  3STZ C;  2A9H A;  3B77 A;  3B8M A;  3JD4 A;  1NJI W;  1JJ2 U;  1OCR C;  1FXK C;  2JJ2 G;  2A0L A;  3ZN1 A;  2ZQM A;  3FB7 C;  4WCE V;  2JEX A;  2XAS A;  2OCC C;  2X7R B;  3OMI B;  4TSF G;  5E1A C;  3MHH C;  3SYA A;  5CBG A;  4WFF A;  4TWK A;  1CEZ A;  2LP7 A;  5KUM A;  5B3S B;  2EZP A;  3PJS K;  2DYS C;  2OT5 A;  1VQK V;  3SPC A;  3T2M A;  1MG1 A;  2F43 G;  5CA3 A;  5EK0 A;  4UVA A;  2ZXW C;  4RO2 A;  4X8A A;  1F51 A;  2EIK B;  3FB8 C;  4MVU A;  3QO5 A;  1QLE C;  1R73 A;  3SPH A;  1OCC C;  3BEH A;  2AHY A;  3E8B A;  4JTC B;  3ZRX A;  3B8N A;  1RPO A;  2ZR2 A;  3SPJ A;  2IH3 C;  1YHQ V;  3NXS A;  4JGS A;  4LBE C;  3CCQ V;  1MSW D;  2C2A A;  4F4L A;  1R3J C;  1YIJ V;  3W7S A;  4QNH B;  1WLE A;  3AG2 B;  4KUM A;  1HWY A;  3ZMV A;  3ABU A;  1H8H G;  2XOK G;  3K06 A;  1YJW V;  4JAU A;  4H37 A;  4UUJ C;  2XAF A;  3WG7 C;  3CCR V;  4P9O A;  4FK5 C;  4MSW C;  3ASN B;  3X2Q C;  4RAI A;  2EIJ C;  4PA7 A;  1V55 C;  3M99 B;  1M90 W;  5H9C A;  4GX1 A;  3OAA G;  3E2E A;  5B1B B;  3SYO A;  3CC7 V;  1VQO V;  1W0K G;  1M9N A;  3QO8 A;  2K1E A;  3ZCC A;  5HFM A;  2ATK C;  4N21 A;  2IJI A;  1KD1 W;  3R65 A;  1GM7 A;  3GWO A;  4MVQ A;  2HG5 C;  1BL8 A;  4PEL A;  3SYP A;  3IGA C;  4G28 B;  1VQL V;  4XDJ A;  1NR7 A;  4PA3 A;  5H6Q A;  3RW0 A;  5B3S C;  3G71 V;  2Y69 B;  3EFF K;  2B1G A;  1WPX A;  3CD6 V;  4MTG A;  2NNU A;  4ZKI A;  3GB7 C;  4MTF A;  1RM1 B;  4X89 A;  1P4R A;  1PKX A;  3T4Z A;  5LGN A;  5L3D A;  2M7W A;  4FMT A;  5BZB A;  2EIM B;  5IYD O;  1AI4 A;  3RBZ A;  2MK3 A;  1OCZ B;  3TCU A;  2IU3 A;  4X88 A;  4MVM A;  2H8P C;  2IH1 C;  2D3O W;  1NVP C;  2B1I A;  2ZDI A;  3CCJ V;  3JYC A;  2WLM A;  3ABK B;  5H6R A;  3AG4 B;  4QJF B;  4CBC A;  2QA4 V;  3EHB B;  1AI6 A;  2CK3 G;  3AG2 C;  5L3G A;  5DM6 V;  1N8R W;  1K9M W;  3E83 A;  2H94 A;  4MTX A;  3CYO A;  3H01 A;  4JTD B;  5B1A B;  1VQ4 V;  2QTO A;  3OEE G;  1FXH A;  4Q20 A;  2R9I A;  3ASN C;  4MW8 A;  2R9R B;  3UKM A;  2XAG A;  3LDE A;  5B1B C;  4JYB A;  1COW G;  5IYB O;  5L3E A;  4L87 A;  3ZRS A;  5L3F A;  3ABM B;  3SYC A;  1K92 A;  2BOB C;  3CPW U;  4PA9 A;  5C93 A;  2HVK C;  4PA4 A;  1JPX A;  2EJR A;  2DW4 A;  4KFM A;  4N23 A;  3RVZ A;  1NH2 D;  2DWE C;  1AR1 B;  2IU0 A;  3UM7 A;  3MHS C;  4RUE A;  1GKF A;  2DQ3 A;  3JD3 A;  2W0F C;  1PD3 A;  1QBZ A;  3K03 A;  5CBH A;  4ZBM A;  4UV9 A;  1K7D A;  1RM1 C;  2Q68 A;  3BY6 A;  1YTF C;  5J9P C;  5CMU A;  3QO7 A;  4KP4 A;  2WLI A;  4MW3 A;  2EIM C;  4FIP C;  3RVY A;  3FB6 C;  1R3K C;  1W2B U;  1S5H C;  2JDI G;  1NVP D;  4J9Z B;  5B1N A;  2WPD G;  3ABK C;  3ASO B;  2WLK A;  3AG4 C;  3OFN G;  5HFL A;  2KB1 A;  3ZN0 A;  5IY5 B;  3CC4 V;  1R3L C;  3OW2 U;  5LGU A;  1DF4 A;  1NBM G;  2WLL A;  1K33 A;  1GO3 F;  2WAM A;  2WLI B;  3G4S V;  4PDM A;  1OCO B;  1QR9 A;  3AG3 C;  1AJN A;  4FPP A;  1CP9 A;  3ZMZ A;  2ZDI C;  2IJK A;  2EZO A;  2WLN A;  5KA6 A;  4CZZ A;  2ITD C;  1VQ7 V;  2JIZ G;  2HKO A;  3AG1 C;  4FJC C;  4BW5 A;  2WLL B;  2XAQ A;  4HAM A;  1JOY A;  3JD2 A;  1CPY A;  5CN0 A;  1QR8 A;  1BHB A;  3TK1 A;  1KP3 A;  3ABM C;  3HB3 B;  4QIW F;  3AEI A;  1VQ8 V;  2ZD9 A;  1PNK A;  5B1O A;  1SRY A;  3LDD A;  2HVJ C;  1L1F A;  5CBF A;  3OR6 C;  1ARO P;  2NLJ C;  2DYR B;  2Y48 A;  1EFR G;  2Q67 A;  4GCZ A;  1M57 B;  4UVC A;  1K8A W;  1K4C C;  4R8C A;  1VQP V;  4UXN A;  5LBQ A;  4WFH A;  3CCS V;  1IXM A;  3LUT B;  1GM9 A;  3E8F A;  1BMF G;  1TUE B;  3E35 A;  2YSU B;  3JD1 A;  1FXK A;  3ZMT A;  1ROP A;  3VBB A;  1XL4 A;  3JCZ A;  1Q86 W;  1QVG U;  3D36 A;  3LNM B;  4XDK A;  1YSC A;  1W0J G;  3OR7 C;  3OUF A;  1UJW B;  3ZMS A;  3ABL B;  5LHI A;  3K04 A;  1VQ6 V;  3ZRV A;  2EIK C;  3D3I A;  4ASU G;  1OCR B;  5LGT A;  3OEH G;  1FXK B;  1YIT V;  1K73 W;  1Q81 W;  4MVO A;  2P90 A;  2Q6A A;  1QVF U;  4JYC A;  1E79 G;  3ASO C;  4WFA V;  5LHH A;  1LNQ A;  3CME V;  3CCE V;  4MVR A;  1G4Y B;  3W7T A;  2EIN B;  4RQE A;  1F4N A;  2AHZ A;  5EBL C;  1VQ5 V;  1FFT B;  1P7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...