5IYCO

Human core-pic in the initial transcribing state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
O PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5iycO01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 5iycO02
5IYCO 1NH2C 1NVPC 1YTFC 5IYBO 1RM1B 1YTFD 1NH2D 1NVPD 5IYDO 1RM1C
chains in the Genus database with same CATH superfamily
3OTOO 4F6RA 3CRRA 4FLXA 1WN7A 3CXHF 2QWNB 2CH7A 2AHYA 3AK1A 4FLWA 4DK1A 2R9IA 3T2MA 2WAMA 4I4TA 3ZRSA 1O9HA 5IJ9B 1H2NA 5F2VO 3CC2V 2Q68A 4BIUA 3HKBA 2A7WA 4LBEC 2E75B 2ZXWB 1I5YA 4I9QA 5LHIA 2YEVB 1JVMA 3APOA 2YC0A 4PDRA 2QM7A 2V1DA 3OGCC 4QE7A 4FFBA 1AR1B 3C90A 3FAVA 1TVKA 3IFXA 3AG3C 3JD3A 5EZYA 2BOCC 3K5OA 1K9MW 3UO3A 4RO2A 5L3CA 2H8PC 3P3NA 1D5NA 2W0FC 2JS3A 3JYCA 3SPHA 3OMNB 1L8DA 4W4LA 1W0JG 3ZHVA 1NKDA 1NR1A 1YITV 3MHHC 3CP1A 5H6RA 2UUBB 3DC6A 4IHJA 1KC8W 1FAFA 1US6A 2JGUA 5EK0A 2CK3G 3K06A 1G4YB 1FPOA 1I08A 3EXAA 3JSNA 2DQ0A 2DYRC 2B1GA 1H8HG 3CX5F 2Y48A 2ZM6B 4NTYA 2VQFO 5B3SB 4J42A 3E8HA 5BXZA 4B3SO 1TA8A 1MNGA 3OE7G 2QTSA 3B8MA 3FYEB 3FKSG 4G27B 1BHAA 2XASA 2Q7GA 4X1YB 1K8AW 5IJ0B 2HKOA 2E74B 3D36C 2HP8A 4LF6B 4I50A 1H8EG 4PD4F 4X64B 2ZXWC 2CUGA 4JI8O 1OJHA 3HKEB 2R70A 2ZIOA 2Z0AA 1ZL8B 2OCCC 1Q6HA 3E89A 3CS5A 1JFFB 2N74A 2OIEA 2OWOA 5JJJB 2QSAA 4GKJB 1K33A 3RN4A 3L73H 1WA8A 2CTWA 4O4JA 3JCZA 3LSUA 5LA6B 5LHHA 1XNRO 1URFA 1FJGB 5LYJB 4CS2A 3AG4B 4JYAB 2DJVA 1MZEA 1W59A 3DXRB 4JI0B 5HFMA 2R9RB 4WBNA 3UT5B 3W7UA 1RPRA 4DK0A 3BVOA 3E83A 4R50A 4FLZA 2ZE5A 4U3JA 1N32O 4UB6Z 2NNUA 2P67A 3ZN0A 1Q5OA 2LFRA 1R6TA 4O2AB 2E76B 3VBBA 4B3RO 4B3TO 4X8AA 4P9PA 5D5PA 1HNZO 1ORQC 1ZUQA 2YXLA 1XL4A 3T4ZA 2GV9A 4CH4A 4JV5O 1TAEA 2Q5ZA 2LJ2A 3CYOA 3ZRXA 5EC1C 3H9VA 2RN9A 2HJFC 5B1BC 2RDCA 2AXTZ 4PA7A 3H1LH 3OTOB 4X20A 2Q0OC 4LCUC 3CE2A 2Y69B 4RAIA 3CPWU 4UVBA 2UUAO 2PUSA 2FKXA 1AVMA 4I0XB 4TUYB 4L8JA 2X6BA 3ZMTA 2GTSA 5C8YA 2JRIA 1F51A 3WG7B 2CGNA 2XAFA 2YDEA 4OPAA 2N04A 1NS1A 3T4DA 3G6BA 5LXTA 3ABTA 1KP3A 2JS5A 2IH3C 4GX0A 4IYIA 3N2KB 1FXVA 2X6CA 5KHJA 4TV8A 1Y6XA 3CCEV 5LOVB 3SPIA 4YIOA 2QEXV 4DR3O 1IZ3A 1QQCA 1YJNV 3VQXA 1XOUA 4JI2O 3CRCA 1BQ0A 5DM6V 2HLDG 2QR4A 1J5EO 1P84F 3W7WA 3RW0A 4LF7O 2R72A 2EILB 3SDLA 1WLEA 2QWRB 2ZDIC 5CA0B 1LNQA 4FLUA 1SERA 1K4DC 5J2TA 1M90W 1KU9A 1B6QA 1F7YA 4IGGA 2AGAA 3ZMZA 3RYIB 4DUZO 1NZ6A 1QLNA 4BW5A 3RT3C 4JAVA 5JVDB 4I9WA 4ASUG 2G38A 2V4DA 3F5WC 2VQFB 1Q86W 1R6KA 4DW0A 4B3SB 2XHBA 1FYJA 3CEIA 2D2CB 4UCVA 2Y69C 3OMAB 2X7RB 3OAAG 1P49A 4Z2WA 3LSSA 1PNLA 2WLIB 2YS8A 4JYBA 5KHHA 1IURA 4ICGA 3THOA 3STZC 4MVQA 5L3DA 3RGBA 4J9YB 4FVMA 1MABG 4LC1A 2VS0A 3WG7C 4TWKA 5KA6A 4K8ZA 4JI8B 2BCCH 1PV0A 4YIPA 1YSCA 3N27A 1JJ2U 2WA3A 2UXDO 4ZI7A 3CCRV 3RYCA 4GX5A 1BL8A 1ZTEA 2P6JA 4LWSA 4MVOA 2Y0IA 1BHBA 1NH2C 2QGNA 4X88A 4K3AA 2WPDG 4GCZA 3QO7A 1XNRB 1ZWIC 1CXZB 1GAXA 2EILC 5EYPA 3K5LA 3E2EA 1NTMH 2ARHA 1THZA 4KUMA 2Q7EA 1AP5A 1N32B 2QTOA 2ILMA 4HNAB 2CTPA 2CE4A 4B3RB 4B3TB 2Q8VA 3IC9A 1HNZB 1FFTB 1X4TA 5IYDO 4JI4O 1SQGA 5LHGA 5IE9A 2YIDA 2XTAA 1A32A 2QKSA 4RUEA 4LF5O 2BSKB 5JH7B 1EN6A 5H6QA 4MVUA 3QF7A 3OM3B 1N8RW 3J80N 3K58A 3D3IA 5FNVB 2F43G 3JASA 3CCJV 1RM1B 1NVPB 2UUAB 1VF7A 3H1KH 2VQEO 1HWYA 2YIAA 4MVZA 2WLMA 3WB2A 3ABLB 5IDJA 3CCVV 2FTKA 3AG7A 3DGEA 2F66C 3T1CA 3H1IH 3E22B 4MVMA 2ZT9B 3ZCCA 2F4VO 4Q20A 1U96A 5JQGB 1SQPH 3JD2A 2ZQMA 3SYQA 3CMAV 3P32A 2LO1A 2OCHA 5IY5B 4CS4A 1MSWD 3QNEA 1EM1A 1NI8A 4I7ZB 4X62O 5J2UB 4DR3B 4JPRA 4X1IB 1IBMO 2EBOA 1F23A 4XDJA 4JI2B 3VQYA 3CCSV 5IJ9A 1J5EB 4TV9B 1SF9A 2AZ2A 2UXBO 3ZRWB 1K92A 4MW8A 4DUYO 1Y74B 4LF7B 2WSSG 5L3FA 4O4IA 4AHCA 5KMGB 4LP8A 2KQXA 2YEVA 3B4SA 2P4KA 3VQWA 4UXNA 1Q8IA 4DUZB 1JJOA 2K1EA 4OX9O 2JGDB 1IX9A 1T5EA 2E3CA 2WA4A 5B5EZ 4C7UA 4NXMB 3LDEA 3JALA 3FFQA 4O2BB 3W7TA 4J80A 2ZKOA 4WCEV 2NLJC 4GUNA 2Y4TA 4PDMA 5J9PC 1GRJA 5E1AC 5LGTA 5CB4B 2KB1A 1Y4MA 1RPOA 2A06H 3CCLV 1SETA 4GLXA 2UUCO 2KG7B 1M56B 1AI7A 2DN9A 2QE7G 3CSXA 2IU0A 2ITCC 1FD9A 1JMKC 4UCOA 1P7BA 4HAMA 2F23A 3ABLC 5FL7G 4DV2O 1WPXA 4PHZA 2DYRB 1NQTA 4FFKA 3OFNG 3OT7A 2ZE8A 3JSLA 3E86A 5FPRA 3TK1A 3W7SA 2VWJA 1QVFU 4CBCA 5LP6B 3Q4HA 4MTFA 4X66O 1DK1A 2YI9A 3HKCB 4ZBMA 1FXKB 1NJIW 5JCOC 3A0RA 2W0XA 3A0HZ 1Q43A 3TXSA 5GTIZ 5IY5C 2ZIMA 1VP7A 2IW5A 2XAJA 1S5HC 1OHHG 2FMLA 1BGYH 3K9AA 4XDKA 4FM1A 4PJ0Z 5IJ0A 3D8CA 1L1FA 1IXMA 2PY5A 1NR7A 4OPHA 1B04A 4WFEA 1IBLB 2OCCB 4X65O 3HKEA 5KX5B 4UCRA 3HKDB 3B40A 4JI5O 5BY1A 1SA0B 3K0DA 3ZMUA 1UJWB 1MOFA 1RFYA 1JOYA 1YCIA 3SJQC 3B77A 1JFFA 1AJQA 3ASOB 5D5QA 3HB3B 4JI4B 1ENVA 2HG5C 5LA6A 2EINB 5LYJA 2N05A 4PA6A 1K73W 3TJTA 2ZCEA 1M56C 3UT5A 3LDCA 5GONB 1Z5VA 3CCMV 2NN4A 1Z5WA 2IM9A 2FL4A 2XAHA 2VQEB 4OXSA 3R66A 2JVDA 4O2AA 2LFSA 4KP4A 3ZMVA 3TCUA 2PI5A 5B1BB 3EVKA 3K3WA 1CPYA 5LP6C 5L3BA 3L74H 1PL4A 1YTFB 1FXKC 3JARB 1M9NA 4D7TA 2F4VB 4JI6O 4QGPA 1VIBA 1OCRB 3BA9A 4YY3B 3OTFA 4UCTA 2P90A 4PI0A 2ZR3A 1AP6A 2GSMB 4X62B 2CH7B 3CB2A 4HBNA 4LNUB 4UFZA 1VQ9V 1IBMB 1ZX3A 4JTCB 4YJ3B 4I0XA 2Q0AA 4TUYA 5CA1B 4YHHO 3CJHA 1K7DA 4G28B 4FZ1A 3ZEDA 2UXBB 4DUYB 1CEZA 1N0NA 2B5UA 2YSUB 1YEWA 1YF2A 1Y76B 1OCCB 2AZ0A 1WP8A 1YHQV 2C2AA 3VQVA 3SJCC 3SJBC 3O9OA 2EZPA 3ABMC 2HVJC 3ASOC 3N2KA 1PL0A 3S3WA 4OX9B 4DR6O 4LF8O 4JYCA 5LOVA 4GX1A 2EIJB 4Z1MG 1S0VA 1XNQO 4IIJB 1EN4A 2EINC 4R8CA 1XMQO 2MK3A 4PA3A 3BEHA 2FYUH 1MA1A 1XUQA 2P7TC 4GKKO 2ZNIA 3ZRVA 5TISZ 5KUKA 4YJ2A 4X1KB 1VF6A 1F4NA 2UUCB 5CA0A 3WU2Z 1Q3EA 1M4UA 2QWOB 1J95A 4JI7O 4AQYO 3CXCU 4CC5A 4DV2B 3RYIA 3MDSA 5CBHA 2ZNJA 1KKCA 3EFFK 4UB8Z 5DN6G 4JZ2A 2Q69A 4X66B 1YTFC 2JIZG 1GK9A 2LGQA 3ZS8C 1AI6A 1VQOV 3OEEG 5BMVA 1SQQH 1QLEC 2GUZA 4XDLA 1XI1A 1OCRC 1R3IC 3K08A 2IJHA 1JR9A 3DC5A 5B1AC 3IGAC 2UXCO 4DV6O 4DV7O 3K03A 3LSQA 2ZD9A 5LMNO 4WF9V 2YIBA 1Y67A 1VQ5V 5CBFA 3ZHUA 3RFRA 3K9SA 1XEQA 2LW1A 3LDDA 3OR7C 1HNWO 1N4CA 4X65B 2M6YA 5EC2C 1OCCC 2WLNA 3NR7A 2VRZA 5GW7A 3FB7C 4JF3A 1NH2B 3FB8C 3BA8A 1QNMA 5CA3A 1OCZB 4LFAO 4CH6A 4ZHQB 3CWBH 4I55B 2EIJC 4DR5O 5LL6Y 2OTLV 1YZBA 3X2QC 3G4SV 2LW7A 4IL6Z 5KA5A 4XBFA 5JJNB 1AR5A 3JD1A 5IT9N 2HFEC 4DV1O 3BPZA 3OUFA 4CH3A 2ITDC 3OR6C 3U10A 2HEPA 1GO3F 1HNXO 1TUEB 2Q67A 3CD6V 1KQSU 3B2EE 1SQXH 2GHYA 5H9CA 1Q82W 4JI6B 3NXSA 2BSKA 1Q6IA 5LMUO 3LUTB 1KECA 4J11A 3R65A 5JH7A 5K1PA 3KCYA 4K35A 1Q90D 1VQ4V 3OD4A 3LNMB 2WLKA 1K97A 2B1IA 3FYIB 2O57A 3C3TA 5FNVA 2WLJA 4PDVA 3ICXA 5EBWC 4JAAA 3I56V 3ETQA 1Y66A 3QG5A 1G6UA 1TUBB 2F95B 3TXQA 1N33O 5L3EA 3E35A 3E22A 2YXYA 5BZBA 1I5XA 2L35A 2UU9O 1KBHA 5JQGA 5KAIZ 4DR1O 1NTKH 4TOIA 1H2KA 5JCOA 3VOUA 1OCZC 1AROP 5A9GA 4DR6B 4TV8B 4AILC 4LF8B 5LGUA 3WB0A 4B08A 5J2UA 4MVRA 4DV4O 3MHSC 4X1IA 1KUQA 1XNQB 3SGIA 4H0LB 4DXWA 1UFIA 2RJZA 4P2ZA 2EIMC 1AR4A 4UV9A 4TV9A 4IT5A 1BS3A 4GKKB 3ZRWA 1Y74A 1H38A 1SKVA 3I55V 3ABUA 1L0LH 1D5AA 3KG2A 2KKWA 4NTWA 1AB3A 1VQMV 1V9PA 4JI7B 4JI1O 2Z5UA 2RNBA 5EIBD 4AQYB 4JV5B 1FFXB 1L0NH 4RWUA 1G8MA 2JGDA 4JASA 4BR6A 4DRXB 1XQ8A 1EZJA 1DTOA 4O2BA 5IYCO 1QCEA 4ZOLA 4FPPA 2MW2B 4KFMA 4NYKA 4P9OA 1JQ0A 4TQDA 4QNHB 3E8BA 2IJKA 5CB4A 3GB7C 4UCSA 3RWRD 4DV6B 4DV7B 4RUFA 1U97A 3CMEV 5LMNB 2JK5C 4JGSA 3LNNA 1IDSA 1FS0G 4RQEA 1BSMA 3FX7A 2H3OA 1M5IA 3EHBB 4W4KA 4R7CA 4U7NA 2P06A 1GMGA 1JX9A 3WFVA 3S3XA 1OV9A 4QJFB 3QO5A 4JI3O 3N2GB 2PF4E 3ETDA 3ASNB 3CC7V 4J9ZB 3HKCA 1S5LZ 1FXKA 1IBKO 1JPXA 3ETEA 1M1KW 3RVYA 1PNMA 3PN1A 2OIGA 1HDJA 4LFAB 3D36A 4D6TH 1H2LA 1BZKA 1K34A 3ZBHA 1UPGA 2F1MA 1M57B 4DR5B 4PA9A 4QPKA 3ZIAG 3TETA 1P4RA 4O4LB 2ZE6A 4LF9O 3UM7A 4GYCB 5EYPB 5KUMA 5B66Z 1R3LC 2P5OA 1I94O 4DV1B 5KX5A 1N34O 4FIPC 3F5TA 3HKDA 4FJCC 2XT9A 4Z1VA 1SA0A 4PELA 3C3SA 5FPOA 1H2SB 1HNXB 1DLBA 4X9QA 3KZIZ 4D7SA 3F7VC 5B1NA 4H13B 1Z2GA 2HHHO 3BRCA 1SESA 4FMTA 2UXNA 1B3QA 2QKCA 2A0LA 4PDLA 5A2QN 3P30A 4LH7A 5LMUB 1WPBA 2YIBD 2BTQB 4DYLA 3L71H 2X6AA 2ADQB 4KL1A 3QVNA 4U7OA 3STLC 3SR2C 5KHGA 4EB6B 5GONA 2JEUA 1XMOO 4WFBV 5IYZB 1TGOA 4CZZA 3UCSC 1SQVH 1VQ8V 3L75H 2ZINA 3RBZA 2E5LO 1N33B 4U3FH 4ZKIA 4WFHA 2UXDB 4KXRA 3ASNC 5KAFZ 1BMFG 2UU9B 5DEDA 3JARA 4DR1B 4DR2O 4DR4O 4NXNO 4CS3A 4B3MO 4X1YA 3P3PA 5EBMC 2GTAA 1SS3A 2DMXA 3M8AA 3IJ4A 4LNUA 4DV4B 1M57C 4PA4A 3CCUV 4YJ3A 5CA1A 2K9PA 3CRQA 2A79B 1E79G 4B7KA 1W2BU 4O4HB 1ZL8A 1RSOB 4O4IB 3SYPA 3JAKB 1Y76A 3ABMB 1R1BA 3ZN1A 4N23A 4JI1B 4BIOA 1KB9F 4F4LA 4H44B 4F6EA 1S76D 1BE3H 4FM2A 5ITZB 3K79A 2LQTA 1KMIZ 3HR0A 5H2FZ 4UV8A 4LF5B 4UVCA 3RYFB 3AG2B 3O65A 3JALB 2WLLB 2Y0PA 3B09A 3L70H 1GN6A 3RYHB 1G1XB 1SQBH 3FB5C 4BW9A 4IIJA 3DXRA 4DV0O 1SZXA 2ZDIA 2GDSA 3L9DA 4CH5A 4WFFA 3UO2A 1V54B 1NVPD 4X1KA 2QM4A 4IYHA 1PD3A 3M99B 1QR9A 4KHPO 2DE0X 2Z3YA 4UVAA 2XAQA 2IH1C 2RCVA 2D3OW 2B9ZA 3JATB 1COWG 4A5UB 1ZAUA 4QIWF 3KCXA 1HW7A 2HVKC 3A0BZ 3Q4HB 1QLEB 3JAWB 4FZ0A 3E8FA 4JI3B 4FLVA 4MS2A 2IBZH 1V55B 5JJEB 5B1AB 1XL6A 4F6RB 1IBKB 2H94A 3JD4A 5KLVH 1QU7A 3APQA 5FLXN 2R9AA 4G2KA 1N0JA 1SRYA 2W6JG 1ROPA 4I4TB 4UUJC 1QHTA 3QTCA 2BTOA 2XAGA 4JYYA 3HKBB 2YICA 4YXWG 1EZVH 2JDIG 4EFBA 3A8TA 4LF9B 1GM7A 1WAZA 4MTOA 1XHXA 4FFBB 2W6IG 2LGWA 1HP8A 1I94B 1LUWA 3U0ZA 1N34B 3FAVB 1TVKB 1YIJV 3PJSK 5EZYB 2L6LA 3AK2A 4NR1A 2DWEC 3BAAA 3I5DA 5DECA 3M7MX 4ZHQA 3AG2C 3X2QB 1YDXA 4I55A 2HHHB 3GWOA 1QBZA 3K59A 1AI5A 4MTXA 1QVGU 3G80A 4R6ZA 3ETGA 1GTOA 4HZ3A 1MZFA 1VQLV 4IHJB 4K8XA 4J7KA 2PGGA 1V54C 2QDOA 1S72V 1XMOB 2JJ2G 4FLYA 2LP7A 5IWAO 4WFAV 2E5LB 4GT1A 1VEWA 5JVDA 5KHKA 2RMKB 2AHZA 4DW1A 1N36O 1R6NA 1V55C 4DR7O 2Q9LA 1GH6A 5LGNA 2V7QG 1H2GA 2DYSB 2CGOA 1RP3B 4EEQA 4DR2B 1KD1W 4NXNB 4DR4B 5B3SC 3CCQV 4AI8A 3ABKB 4B3MB 2WLIA 2EIKB 1S3JA 2Q6AA 1FXHA 4I50B 4BWAA 2OYQA 1XREA 2QKAA 2PZSA 2DQ3A 3MD0A 5CN0A 4QPJA 2A3QA 3AK3A 2WLHA 3ZHRA 3J81N 2FB5A 3CJHB 1PNKA 4J7ZA 1TUBA 1KKDA 4JI5B 3U11A 3HPLC 4PI2A 4X89A 4LF4O 3ML0A 4NVPA 3ZHTA 1BCCH 4DV5O 5AG2A 3CC4V 1JA8A 1WA8B 2P22C 4O4JB 1PPJH 4H37A 1AI4A 4JZGA 4LFBO 1VQ7V 2EIMB 3G6EV 1R3KC 3CHXA 1MSDA 2CTRA 1DF5A 4EFEA 1IXBA 4E4EA 2VWKA 2JJ1G 5BR8O 4DV0B 1HR0O 4WBNB 2F93B 4BAYA 1NBMG 3AG4C 1VF5B 3OMIB 3JCUZ 5CMUA 4H33A 4U3JB 3TGUH 1QR8A 2PYLA 1OZ0A 1ZLZA 4HNAA 4YJ2B 3GWKC 4JTDB 3DSQA 2YUAA 2NR5A 1VQPV 4K0KO 4KHPB 3GVMA 1F4MA 2KSDA 4RQFA 1FFXA 1YTFD 1NTZH 2QWQB 4DRXA 4NXMO 5EIBC 4JTAB 1KP2A 1PM9A 2ETNA 3J7AU 3UKMA 1SQFA 5HFLA 4X20B 3ZJZA 3G71V 4ABMA 5BMVB 1PP9H 2M7WA 4JAUA 3SPCA 2DYSC 2GUZB 3F7YC 4MSWC 3ABKC 2EIKC 4N21A 4DV3O 2ZE7A 3T1HO 5B1OA 4YHHB 1CP9A 1NU1H 2JEXA 2DW4A 3H1JH 3T1YO 1XILA 5C8YB 4MW3A 1ZSPA 3SJAC 1MG1A 2DWDC 1JCHA 2ADPA 1GN4A 3ZX6A 4LFCO 5LXTB 5IYBO 4FM0A 1Q6UA 2Q73A 3N2GA 3QO8A 1WNSA 1BT8A 3OUSA 1GN3A 5L3GA 4BIZA 3K04A 1AJNA 1XMQB 1XDCA 5E79Z 3DTUB 1MMMA 5EBLC 3RVZA 3ZHSA 1WJZA 1YJ9V 1E1QG 1W0KG 4I5SA 4FLTA 1DF4A 1PKXA 5CBGA 4FK5C 1YJWV 5KMGA 4O4LA 4J41A 2A9HA 5J2TB 1IBLO 1VF6C 4NTXA 3IAYA 4DO2A 1K5QA 3K0GA 2X0LA 4LR3A 2BE3A 4WFGA 3KKYA 3IC7A 1S5JA 1Q7YW 3K5NA 3H01A 5IWAB 3K5MA 3BCCH 2CTQA 2GBOA 4UCUA 1N36B 1H2MA 4DR7B 1WP7A 3WB1A 2UXCB 1LR1A 2KG7A 3AG1B 1VQKV 1R73A 2P4VA 2UUBO 2OTJV 1B06A 2BTQA 3D3QA 4NKGB 3BFRA 1WB7A 2BOBC 1OCOB 3OGIB 4EB6A 5JWPA 4Q6GA 2OT5A 5IYZA 2EJ7A 3FB6C 1HNWB 1FKAO 2QA4V 2PI4A 5LP6A 1BQZA 1AJPA 2EJRA 4MTGA 1E1RG 3BY6A 2Q7HA 3L72H 1EBOA 3SYAA 2ZM6O 2EX3A 2QJ1A 4ZI7B 4LF4B 2RQ6A 1NH2D 4GZRB 3RYCB 4DV5B 2ATKC 2CAZC 4CC6A 1K3EA 3UQ8A 2PYJA 4LWSB 3G67A 4J10A 4YY3O 1SZTA 2ZR2A 2EZOA 1VQ6V 1GM8A 4LF6O 2QWPB 2XNDG 5C93A 4LFBB 4X64O 1YVWA 1K5SA 1EFRG 1R3JC 4MT8A 1M93A 4L87A 4J7JA 4TSFG 3SPJA 2Y4UA 3A2FA 5BR8B 1HR0B 2XOKG 1P7GA 3SYCA 1S77D 2HR3A 2UXXA 4O4HA 1YXBA 1SC5B 5LBQA 1RSOA 2HJDA 4B7EA 1K4CC 2QM8A 3SYOA 3SPGA 3JAKA 4K0KB 4GKJO 2YXHA 1XHZA 2CDYA 4GX2A 3AG3B 4QE9A 3FD9A 1AILA 5ITZA 1Q81W 3BABA 3BHPA 1VQNV 3E8GA 1GM9A 2EULA 4E2LA 4MVSA 1FJGO 2IJIA 1LUVA 4P30A 3ZMSA 2IU3A 3RYFA 4JYAO 2WLLA 3JD0A 3AEIA 3RYHA 1I0HA 4ZOLB 3JAMN 1O9GA 4HYOA 2AW9A 2PTMA 4JI0O 1GN2A 2WWWA 3AG1C 1YI2V 1DGSA 2Q4PA 4NB5A 2YI8A 3JASB 3OEHG 4TT3G 5GTHZ 3MAQA 3ZHQA 1I7FA 4DV3B 3CRAA 3T1HB 1VARA 5K1XA 1GKFA 1OCOC 3T1YB 3W7XA 1NT2B 5KHIA 1RM1C 1WB8A 1NVPC 1EN5A 2DOSA 2IJJA 1XBLA 3OW2U 4EKWA 1IVSA 2ODMA 2XUMA 1X59A 3JATA 4OGQB 1D2DA 1VMGA 4LH6A 3CRMA 4LFCB 1KYOF 3K57A 3B8NA 4TQFA 4PV1B 5H5NA 3H1HH 3JAWA 4ZIBA
chains in the Genus database with same CATH topology
3OM3B 3OUFA 1N8RW 1YIJV 3PJSK 3D3IA 2ITDC 2F43G 3OR6C 3CCJV 1RM1B 2AHYA 1NVPB 2R9IA 2DWEC 3T2MA 1GO3F 1HWYA 2WAMA 3ZRSA 4MVZA 2WLMA 3ABLB 5IDJA 1TUEB 2Q67A 3CD6V 3CCVV 1KQSU 2FTKA 3CC2V 3AG2C 3DGEA 3X2QB 2Q68A 4BIUA 3GWOA 1QBZA 4LBEC 2GHYA 2ZXWB 3T1CA 1I5YA 1AI5A 5H9CA 4MVMA 4MTXA 1Q82W 3ZCCA 5LHIA 2YEVB 4Q20A 1JVMA 1QVGU 3NXSA 4R6ZA 3ETGA 3JD2A 3SYQA 2ZQMA 1GTOA 3LUTB 4HZ3A 4PDRA 1KECA 1VQLV 3CMAV 3P32A 2QM7A 3R65A 2V1DA 1V54C 3OGCC 4QE7A 1S72V 1VQ4V 1AR1B 3LNMB 2WLKA 5IY5B 1K97A 1MSWD 3QNEA 2B1IA 3FYIB 3IFXA 3AG3C 3JD3A 2BOCC 2JJ2G 2WLJA 4PDVA 5EBWC 4JPRA 1K9MW 2LP7A 2EBOA 3I56V 1F23A 4RO2A 1Y66A 4XDJA 5L3CA 2H8PC 4WFAV 4GT1A 3CCSV 2W0FC 3JYCA 3SPHA 2AHZA 3ZRWB 1K92A 4MW8A 3OMNB 5L3EA 2WSSG 5L3FA 1W0JG 1R6NA 3E35A 1V55C 1NKDA 1NR1A 5BZBA 1I5XA 4LP8A 1YITV 3MHHC 5LGNA 2V7QG 2YEVA 3CP1A 5H6RA 1H2GA 2DYSB 1KD1W 5B3SC 3CCQV 1KC8W 3ABKB 2WLIA 2EIKB 4UXNA 3VOUA 1OCZC 1AROP 1S3JA 1FXHA 2CK3G 2Q6AA 3K06A 5EK0A 2K1EA 1G4YB 5LGUA 2DQ3A 3MD0A 5CN0A 4QPJA 3LDEA 4MVRA 2WLHA 3MHSC 4DXWA 3W7TA 2DQ0A 2DYRC 1PNKA 4P2ZA 2EIMC 2B1GA 1H8HG 4WCEV 1KKDA 2NLJC 4UV9A 3HPLC 4PDMA 5J9PC 2Y48A 5E1AC 3ZRWA 4X89A 5LGTA 2KB1A 1Y4MA 5B3SB 1H38A 3E8HA 1RPOA 3ML0A 3I55V 3CCLV 3ABUA 1SETA 3KG2A 3OE7G 3CC4V 1M56B 1AI7A 3B8MA 2QE7G 3FYEB 3FKSG 4G27B 1BHAA 2XASA 1VQMV 2IU0A 4H37A 2ITCC 1K8AW 2Z5UA 2HKOA 1P7BA 1AI4A 4HAMA 5FL7G 3ABLC 1WPXA 2DYRB 1NQTA 3OFNG 1G8MA 4JASA 1H8EG 2EIMB 3G6EV 1VQ7V 1R3KC 3E86A 3TK1A 3W7SA 2ZXWC 1EZJA 1DF5A 1QVFU 4CBCA 1DTOA 4MTFA 5IYCO 1QCEA 2JJ1G 4ZBMA 4FPPA 1FXKB 4BAYA 1NBMG 3AG4C 3OMIB 4KFMA 5CMUA 4H33A 1JQ0A 4P9OA 4QNHB 2OCCC 1QR8A 3E8BA 1NJIW 2IJKA 3E89A 3A0RA 3GB7C 1OZ0A 4JTDB 5IY5C 2XAJA 2IW5A 1S5HC 1K33A 4RUFA 1VQPV 1OHHG 3CMEV 2JK5C 4JGSA 3K9AA 4XDKA 1FS0G 1F4MA 4RQEA 3JCZA 1L1FA 4RQFA 1IXMA 1NR7A 3EHBB 5LHHA 1YTFD 4R7CA 4U7NA 1GMGA 1JX9A 3AG4B 4JTAB 1KP2A 4WFEA 3WFVA 2OCCB 3UKMA 4QJFB 3QO5A 3ETDA 3ASNB 5HFLA 3CC7V 4J9ZB 5HFMA 3ZJZA 3G71V 2R9RB 3W7UA 1FXKA 1JPXA 2M7WA 1RPRA 3ETEA 2DYSC 4JAUA 3SPCA 1M1KW 3E83A 3F7YC 4R50A 3RVYA 3K0DA 3ZMUA 1PNMA 1MOFA 4MSWC 2NNUA 2P67A 3ABKC 1UJWB 3ZN0A 2EIKC 1JOYA 2LFRA 3SJQC 4N21A 3B77A 1AJQA 3VBBA 3ASOB 5B1OA 4X8AA 3D36A 4P9PA 1CP9A 2JEXA 3HB3B 2DW4A 1ORQC 1K34A 4MW3A 1XL4A 1ENVA 1M57B 2HG5C 3T4ZA 1MG1A 4PA9A 4QPKA 3CYOA 2EINB 3ZIAG 5EC1C 3ZRXA 2DWDC 1JCHA 2HJFC 5B1BC 3TETA 1P4RA 3UM7A 5IYBO 4PA7A 4PA6A 5KUMA 1K73W 1R3LC 3QO8A 3OUSA 1M56C 4FIPC 4LCUC 4FJCC 2Y69B 3LDCA 4RAIA 5L3GA 3CPWU 4BIZA 4PELA 3CCMV 4UVBA 2XAHA 3K04A 4OXSA 1DLBA 1AJNA 2LFSA 3DTUB 3F7VC 2X6BA 5B1NA 4KP4A 3ZMVA 5EBLC 3TCUA 3ZMTA 2PI5A 5B1BB 3K3WA 1CPYA 1SESA 4FMTA 1F51A 2UXNA 3RVZA 1YJ9V 3WG7B 5L3BA 1E1QG 1W0KG 2A0LA 4I5SA 1DF4A 1PKXA 4PDLA 1YTFB 1FXKC 2XAFA 3P30A 5CBGA 4FK5C 1YJWV 1M9NA 3T4DA 2A9HA 3ABTA 1KP3A 1OCRB 2IH3C 4GX0A 2X6AA 2P90A 1FXVA 4DO2A 1K5QA 2X6CA 4U7OA 2ZR3A 3STLC 3K0GA 2X0LA 2GSMB 3CCEV 2JEUA 4WFGA 3SPIA 4WFBV 2QEXV 3IC7A 1Q7YW 1VQ9V 4CZZA 1YJNV 1VQ8V 3H01A 4JTCB 3RBZA 5DM6V 1K7DA 2HLDG 4G28B 3W7WA 1CEZA 2B5UA 3RW0A 4ZKIA 2YSUB 4WFHA 3ASNC 2EILB 1WLEA 2ZDIC 1BMFG 1LNQA 1OCCB 1SERA 1YHQV 2C2AA 3AG1B 1K4DC 1R73A 1VQKV 1M90W 1B6QA 2OTJV 2EZPA 3ZMZA 5EBMC 3ABMC 2HVJC 3ASOC 2BOBC 1PL0A 1OCOB 1QLNA 4BW5A 4JYCA 2OT5A 4GX1A 3FB6C 1M57C 2PI4A 2QA4V 2EIJB 4PA4A 4Z1MG 3CCUV 1S0VA 2EINC 4R8CA 1AJPA 2MK3A 4JAVA 4PA3A 2A79B 2EJRA 3BEHA 4I9WA 1E1RG 4MTGA 3BY6A 4ASUG 1E79G 1W2BU 2P7TC 3F5WC 1EBOA 3SYAA 3ZRVA 1Q86W 1R6KA 5KUKA 1NH2D 3SYPA 1F4NA 3ABMB 2ATKC 3ZN1A 1K3EA 2Y69C 3OMAB 2X7RB 4N23A 3OAAG 1J95A 3LSSA 1PNLA 2WLIB 4JYBA 4F4LA 1SZTA 2ZR2A 1S76D 2EZOA 3K79A 3STZC 3CXCU 1VQ6V 1GM8A 5CBHA 2XNDG 5C93A 4MVQA 4UV8A 5L3DA 4UVCA 4J9YB 3EFFK 1MABG 1K5SA 2WLLB 1EFRG 1R3JC 3AG2B 4LC1A 4MT8A 4TWKA 3WG7C 5DN6G 2Q69A 4L87A 5KA6A 4TSFG 3FB5C 3SPJA 1YTFC 2JIZG 1GK9A 2XOKG 2ZDIA 1AI6A 3SYCA 1VQOV 3OEEG 1S77D 1YSCA 2HR3A 1QLEC 2UXXA 4XDLA 1OCRC 1R3IC 1JJ2U 3K08A 2IJHA 4WFFA 5LBQA 3CCRV 1K4CC 1V54B 2QM8A 5B1AC 3SYOA 3SPGA 1NVPD 4GX5A 3IGAC 1BL8A 3K03A 3LSQA 1PD3A 2P6JA 3M99B 1QR9A 2ZD9A 4MVOA 2Z3YA 1BHBA 4WF9V 4GX2A 1NH2C 3AG3B 4UVAA 4QE9A 4X88A 1VQ5V 2XAQA 5CBFA 2IH1C 2WPDG 4GCZA 1Q81W 2D3OW 3QO7A 1VQNV 3E8GA 1COWG 1GM9A 4E2LA 4MVSA 1ZWIC 4QIWF 2IJIA 3LDDA 4P30A 3ZMSA 3OR7C 2IU3A 2WLLA 2HVKC 3JD0A 3AEIA 1QLEB 3E8FA 2EILC 4MS2A 3E2EA 5EC2C 1V55B 4HYOA 1OCCC 2WLNA 5B1AB 1XL6A 2WWWA 2H94A 1THZA 3JD4A 3AG1C 4KUMA 5GW7A 1YI2V 3FB7C 4JF3A 3OEHG 2QTOA 4G2KA 1NH2B 4TT3G 3FB8C 1SRYA 5CA3A 2W6JG 1ROPA 4UUJC 1OCZB 1GKFA 1OCOC 3W7XA 1FFTB 2XAGA 5IYDO 1RM1C 1NVPC 2IJJA 4YXWG 2EIJC 3OW2U 4EKWA 5LHGA 2JDIG 2QKSA 4RUEA 2OTLV 3X2QC 3G4SV 3B8NA 5KA5A 4XBFA 1GM7A 4MTOA 3JD1A 2HFEC 5H6QA 2W6IG 4MVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC O;  1NH2 C;  1NVP C;  1YTF C;  5IYB O;  1RM1 B;  1YTF D;  1NH2 D;  1NVP D;  5IYD O;  1RM1 C; 
#chains in the Genus database with same CATH topology
 3OTO O;  4F6R A;  3CRR A;  4FLX A;  1WN7 A;  3CXH F;  2QWN B;  2CH7 A;  2AHY A;  3AK1 A;  4FLW A;  4DK1 A;  2R9I A;  3T2M A;  2WAM A;  4I4T A;  3ZRS A;  1O9H A;  5IJ9 B;  1H2N A;  5F2V O;  3CC2 V;  2Q68 A;  4BIU A;  3HKB A;  2A7W A;  4LBE C;  2E75 B;  2ZXW B;  1I5Y A;  4I9Q A;  5LHI A;  2YEV B;  1JVM A;  3APO A;  2YC0 A;  4PDR A;  2QM7 A;  2V1D A;  3OGC C;  4QE7 A;  4FFB A;  1AR1 B;  3C90 A;  3FAV A;  1TVK A;  3IFX A;  3AG3 C;  3JD3 A;  5EZY A;  2BOC C;  3K5O A;  1K9M W;  3UO3 A;  4RO2 A;  5L3C A;  2H8P C;  3P3N A;  1D5N A;  2W0F C;  2JS3 A;  3JYC A;  3SPH A;  3OMN B;  1L8D A;  4W4L A;  1W0J G;  3ZHV A;  1NKD A;  1NR1 A;  1YIT V;  3MHH C;  3CP1 A;  5H6R A;  2UUB B;  3DC6 A;  4IHJ A;  1KC8 W;  1FAF A;  1US6 A;  2JGU A;  5EK0 A;  2CK3 G;  3K06 A;  1G4Y B;  1FPO A;  1I08 A;  3EXA A;  3JSN A;  2DQ0 A;  2DYR C;  2B1G A;  1H8H G;  3CX5 F;  2Y48 A;  2ZM6 B;  4NTY A;  2VQF O;  5B3S B;  4J42 A;  3E8H A;  5BXZ A;  4B3S O;  1TA8 A;  1MNG A;  3OE7 G;  2QTS A;  3B8M A;  3FYE B;  3FKS G;  4G27 B;  1BHA A;  2XAS A;  2Q7G A;  4X1Y B;  1K8A W;  5IJ0 B;  2HKO A;  2E74 B;  3D36 C;  2HP8 A;  4LF6 B;  4I50 A;  1H8E G;  4PD4 F;  4X64 B;  2ZXW C;  2CUG A;  4JI8 O;  1OJH A;  3HKE B;  2R70 A;  2ZIO A;  2Z0A A;  1ZL8 B;  2OCC C;  1Q6H A;  3E89 A;  3CS5 A;  1JFF B;  2N74 A;  2OIE A;  2OWO A;  5JJJ B;  2QSA A;  4GKJ B;  1K33 A;  3RN4 A;  3L73 H;  1WA8 A;  2CTW A;  4O4J A;  3JCZ A;  3LSU A;  5LA6 B;  5LHH A;  1XNR O;  1URF A;  1FJG B;  5LYJ B;  4CS2 A;  3AG4 B;  4JYA B;  2DJV A;  1MZE A;  1W59 A;  3DXR B;  4JI0 B;  5HFM A;  2R9R B;  4WBN A;  3UT5 B;  3W7U A;  1RPR A;  4DK0 A;  3BVO A;  3E83 A;  4R50 A;  4FLZ A;  2ZE5 A;  4U3J A;  1N32 O;  4UB6 Z;  2NNU A;  2P67 A;  3ZN0 A;  1Q5O A;  2LFR A;  1R6T A;  4O2A B;  2E76 B;  3VBB A;  4B3R O;  4B3T O;  4X8A A;  4P9P A;  5D5P A;  1HNZ O;  1ORQ C;  1ZUQ A;  2YXL A;  1XL4 A;  3T4Z A;  2GV9 A;  4CH4 A;  4JV5 O;  1TAE A;  2Q5Z A;  2LJ2 A;  3CYO A;  3ZRX A;  5EC1 C;  3H9V A;  2RN9 A;  2HJF C;  5B1B C;  2RDC A;  2AXT Z;  4PA7 A;  3H1L H;  3OTO B;  4X20 A;  2Q0O C;  4LCU C;  3CE2 A;  2Y69 B;  4RAI A;  3CPW U;  4UVB A;  2UUA O;  2PUS A;  2FKX A;  1AVM A;  4I0X B;  4TUY B;  4L8J A;  2X6B A;  3ZMT A;  2GTS A;  5C8Y A;  2JRI A;  1F51 A;  3WG7 B;  2CGN A;  2XAF A;  2YDE A;  4OPA A;  2N04 A;  1NS1 A;  3T4D A;  3G6B A;  5LXT A;  3ABT A;  1KP3 A;  2JS5 A;  2IH3 C;  4GX0 A;  4IYI A;  3N2K B;  1FXV A;  2X6C A;  5KHJ A;  4TV8 A;  1Y6X A;  3CCE V;  5LOV B;  3SPI A;  4YIO A;  2QEX V;  4DR3 O;  1IZ3 A;  1QQC A;  1YJN V;  3VQX A;  1XOU A;  4JI2 O;  3CRC A;  1BQ0 A;  5DM6 V;  2HLD G;  2QR4 A;  1J5E O;  1P84 F;  3W7W A;  3RW0 A;  4LF7 O;  2R72 A;  2EIL B;  3SDL A;  1WLE A;  2QWR B;  2ZDI C;  5CA0 B;  1LNQ A;  4FLU A;  1SER A;  1K4D C;  5J2T A;  1M90 W;  1KU9 A;  1B6Q A;  1F7Y A;  4IGG A;  2AGA A;  3ZMZ A;  3RYI B;  4DUZ O;  1NZ6 A;  1QLN A;  4BW5 A;  3RT3 C;  4JAV A;  5JVD B;  4I9W A;  4ASU G;  2G38 A;  2V4D A;  3F5W C;  2VQF B;  1Q86 W;  1R6K A;  4DW0 A;  4B3S B;  2XHB A;  1FYJ A;  3CEI A;  2D2C B;  4UCV A;  2Y69 C;  3OMA B;  2X7R B;  3OAA G;  1P49 A;  4Z2W A;  3LSS A;  1PNL A;  2WLI B;  2YS8 A;  4JYB A;  5KHH A;  1IUR A;  4ICG A;  3THO A;  3STZ C;  4MVQ A;  5L3D A;  3RGB A;  4J9Y B;  4FVM A;  1MAB G;  4LC1 A;  2VS0 A;  3WG7 C;  4TWK A;  5KA6 A;  4K8Z A;  4JI8 B;  2BCC H;  1PV0 A;  4YIP A;  1YSC A;  3N27 A;  1JJ2 U;  2WA3 A;  2UXD O;  4ZI7 A;  3CCR V;  3RYC A;  4GX5 A;  1BL8 A;  1ZTE A;  2P6J A;  4LWS A;  4MVO A;  2Y0I A;  1BHB A;  1NH2 C;  2QGN A;  4X88 A;  4K3A A;  2WPD G;  4GCZ A;  3QO7 A;  1XNR B;  1ZWI C;  1CXZ B;  1GAX A;  2EIL C;  5EYP A;  3K5L A;  3E2E A;  1NTM H;  2ARH A;  1THZ A;  4KUM A;  2Q7E A;  1AP5 A;  1N32 B;  2QTO A;  2ILM A;  4HNA B;  2CTP A;  2CE4 A;  4B3R B;  4B3T B;  2Q8V A;  3IC9 A;  1HNZ B;  1FFT B;  1X4T A;  5IYD O;  4JI4 O;  1SQG A;  5LHG A;  5IE9 A;  2YID A;  2XTA A;  1A32 A;  2QKS A;  4RUE A;  4LF5 O;  2BSK B;  5JH7 B;  1EN6 A;  5H6Q A;  4MVU A;  3QF7 A;  3OM3 B;  1N8R W;  3J80 N;  3K58 A;  3D3I A;  5FNV B;  2F43 G;  3JAS A;  3CCJ V;  1RM1 B;  1NVP B;  2UUA B;  1VF7 A;  3H1K H;  2VQE O;  1HWY A;  2YIA A;  4MVZ A;  2WLM A;  3WB2 A;  3ABL B;  5IDJ A;  3CCV V;  2FTK A;  3AG7 A;  3DGE A;  2F66 C;  3T1C A;  3H1I H;  3E22 B;  4MVM A;  2ZT9 B;  3ZCC A;  2F4V O;  4Q20 A;  1U96 A;  5JQG B;  1SQP H;  3JD2 A;  2ZQM A;  3SYQ A;  3CMA V;  3P32 A;  2LO1 A;  2OCH A;  5IY5 B;  4CS4 A;  1MSW D;  3QNE A;  1EM1 A;  1NI8 A;  4I7Z B;  4X62 O;  5J2U B;  4DR3 B;  4JPR A;  4X1I B;  1IBM O;  2EBO A;  1F23 A;  4XDJ A;  4JI2 B;  3VQY A;  3CCS V;  5IJ9 A;  1J5E B;  4TV9 B;  1SF9 A;  2AZ2 A;  2UXB O;  3ZRW B;  1K92 A;  4MW8 A;  4DUY O;  1Y74 B;  4LF7 B;  2WSS G;  5L3F A;  4O4I A;  4AHC A;  5KMG B;  4LP8 A;  2KQX A;  2YEV A;  3B4S A;  2P4K A;  3VQW A;  4UXN A;  1Q8I A;  4DUZ B;  1JJO A;  2K1E A;  4OX9 O;  2JGD B;  1IX9 A;  1T5E A;  2E3C A;  2WA4 A;  5B5E Z;  4C7U A;  4NXM B;  3LDE A;  3JAL A;  3FFQ A;  4O2B B;  3W7T A;  4J80 A;  2ZKO A;  4WCE V;  2NLJ C;  4GUN A;  2Y4T A;  4PDM A;  5J9P C;  1GRJ A;  5E1A C;  5LGT A;  5CB4 B;  2KB1 A;  1Y4M A;  1RPO A;  2A06 H;  3CCL V;  1SET A;  4GLX A;  2UUC O;  2KG7 B;  1M56 B;  1AI7 A;  2DN9 A;  2QE7 G;  3CSX A;  2IU0 A;  2ITC C;  1FD9 A;  1JMK C;  4UCO A;  1P7B A;  4HAM A;  2F23 A;  3ABL C;  5FL7 G;  4DV2 O;  1WPX A;  4PHZ A;  2DYR B;  1NQT A;  4FFK A;  3OFN G;  3OT7 A;  2ZE8 A;  3JSL A;  3E86 A;  5FPR A;  3TK1 A;  3W7S A;  2VWJ A;  1QVF U;  4CBC A;  5LP6 B;  3Q4H A;  4MTF A;  4X66 O;  1DK1 A;  2YI9 A;  3HKC B;  4ZBM A;  1FXK B;  1NJI W;  5JCO C;  3A0R A;  2W0X A;  3A0H Z;  1Q43 A;  3TXS A;  5GTI Z;  5IY5 C;  2ZIM A;  1VP7 A;  2IW5 A;  2XAJ A;  1S5H C;  1OHH G;  2FML A;  1BGY H;  3K9A A;  4XDK A;  4FM1 A;  4PJ0 Z;  5IJ0 A;  3D8C A;  1L1F A;  1IXM A;  2PY5 A;  1NR7 A;  4OPH A;  1B04 A;  4WFE A;  1IBL B;  2OCC B;  4X65 O;  3HKE A;  5KX5 B;  4UCR A;  3HKD B;  3B40 A;  4JI5 O;  5BY1 A;  1SA0 B;  3K0D A;  3ZMU A;  1UJW B;  1MOF A;  1RFY A;  1JOY A;  1YCI A;  3SJQ C;  3B77 A;  1JFF A;  1AJQ A;  3ASO B;  5D5Q A;  3HB3 B;  4JI4 B;  1ENV A;  2HG5 C;  5LA6 A;  2EIN B;  5LYJ A;  2N05 A;  4PA6 A;  1K73 W;  3TJT A;  2ZCE A;  1M56 C;  3UT5 A;  3LDC A;  5GON B;  1Z5V A;  3CCM V;  2NN4 A;  1Z5W A;  2IM9 A;  2FL4 A;  2XAH A;  2VQE B;  4OXS A;  3R66 A;  2JVD A;  4O2A A;  2LFS A;  4KP4 A;  3ZMV A;  3TCU A;  2PI5 A;  5B1B B;  3EVK A;  3K3W A;  1CPY A;  5LP6 C;  5L3B A;  3L74 H;  1PL4 A;  1YTF B;  1FXK C;  3JAR B;  1M9N A;  4D7T A;  2F4V B;  4JI6 O;  4QGP A;  1VIB A;  1OCR B;  3BA9 A;  4YY3 B;  3OTF A;  4UCT A;  2P90 A;  4PI0 A;  2ZR3 A;  1AP6 A;  2GSM B;  4X62 B;  2CH7 B;  3CB2 A;  4HBN A;  4LNU B;  4UFZ A;  1VQ9 V;  1IBM B;  1ZX3 A;  4JTC B;  4YJ3 B;  4I0X A;  2Q0A A;  4TUY A;  5CA1 B;  4YHH O;  3CJH A;  1K7D A;  4G28 B;  4FZ1 A;  3ZED A;  2UXB B;  4DUY B;  1CEZ A;  1N0N A;  2B5U A;  2YSU B;  1YEW A;  1YF2 A;  1Y76 B;  1OCC B;  2AZ0 A;  1WP8 A;  1YHQ V;  2C2A A;  3VQV A;  3SJC C;  3SJB C;  3O9O A;  2EZP A;  3ABM C;  2HVJ C;  3ASO C;  3N2K A;  1PL0 A;  3S3W A;  4OX9 B;  4DR6 O;  4LF8 O;  4JYC A;  5LOV A;  4GX1 A;  2EIJ B;  4Z1M G;  1S0V A;  1XNQ O;  4IIJ B;  1EN4 A;  2EIN C;  4R8C A;  1XMQ O;  2MK3 A;  4PA3 A;  3BEH A;  2FYU H;  1MA1 A;  1XUQ A;  2P7T C;  4GKK O;  2ZNI A;  3ZRV A;  5TIS Z;  5KUK A;  4YJ2 A;  4X1K B;  1VF6 A;  1F4N A;  2UUC B;  5CA0 A;  3WU2 Z;  1Q3E A;  1M4U A;  2QWO B;  1J95 A;  4JI7 O;  4AQY O;  3CXC U;  4CC5 A;  4DV2 B;  3RYI A;  3MDS A;  5CBH A;  2ZNJ A;  1KKC A;  3EFF K;  4UB8 Z;  5DN6 G;  4JZ2 A;  2Q69 A;  4X66 B;  1YTF C;  2JIZ G;  1GK9 A;  2LGQ A;  3ZS8 C;  1AI6 A;  1VQO V;  3OEE G;  5BMV A;  1SQQ H;  1QLE C;  2GUZ A;  4XDL A;  1XI1 A;  1OCR C;  1R3I C;  3K08 A;  2IJH A;  1JR9 A;  3DC5 A;  5B1A C;  3IGA C;  2UXC O;  4DV6 O;  4DV7 O;  3K03 A;  3LSQ A;  2ZD9 A;  5LMN O;  4WF9 V;  2YIB A;  1Y67 A;  1VQ5 V;  5CBF A;  3ZHU A;  3RFR A;  3K9S A;  1XEQ A;  2LW1 A;  3LDD A;  3OR7 C;  1HNW O;  1N4C A;  4X65 B;  2M6Y A;  5EC2 C;  1OCC C;  2WLN A;  3NR7 A;  2VRZ A;  5GW7 A;  3FB7 C;  4JF3 A;  1NH2 B;  3FB8 C;  3BA8 A;  1QNM A;  5CA3 A;  1OCZ B;  4LFA O;  4CH6 A;  4ZHQ B;  3CWB H;  4I55 B;  2EIJ C;  4DR5 O;  5LL6 Y;  2OTL V;  1YZB A;  3X2Q C;  3G4S V;  2LW7 A;  4IL6 Z;  5KA5 A;  4XBF A;  5JJN B;  1AR5 A;  3JD1 A;  5IT9 N;  2HFE C;  4DV1 O;  3BPZ A;  3OUF A;  4CH3 A;  2ITD C;  3OR6 C;  3U10 A;  2HEP A;  1GO3 F;  1HNX O;  1TUE B;  2Q67 A;  3CD6 V;  1KQS U;  3B2E E;  1SQX H;  2GHY A;  5H9C A;  1Q82 W;  4JI6 B;  3NXS A;  2BSK A;  1Q6I A;  5LMU O;  3LUT B;  1KEC A;  4J11 A;  3R65 A;  5JH7 A;  5K1P A;  3KCY A;  4K35 A;  1Q90 D;  1VQ4 V;  3OD4 A;  3LNM B;  2WLK A;  1K97 A;  2B1I A;  3FYI B;  2O57 A;  3C3T A;  5FNV A;  2WLJ A;  4PDV A;  3ICX A;  5EBW C;  4JAA A;  3I56 V;  3ETQ A;  1Y66 A;  3QG5 A;  1G6U A;  1TUB B;  2F95 B;  3TXQ A;  1N33 O;  5L3E A;  3E35 A;  3E22 A;  2YXY A;  5BZB A;  1I5X A;  2L35 A;  2UU9 O;  1KBH A;  5JQG A;  5KAI Z;  4DR1 O;  1NTK H;  4TOI A;  1H2K A;  5JCO A;  3VOU A;  1OCZ C;  1ARO P;  5A9G A;  4DR6 B;  4TV8 B;  4AIL C;  4LF8 B;  5LGU A;  3WB0 A;  4B08 A;  5J2U A;  4MVR A;  4DV4 O;  3MHS C;  4X1I A;  1KUQ A;  1XNQ B;  3SGI A;  4H0L B;  4DXW A;  1UFI A;  2RJZ A;  4P2Z A;  2EIM C;  1AR4 A;  4UV9 A;  4TV9 A;  4IT5 A;  1BS3 A;  4GKK B;  3ZRW A;  1Y74 A;  1H38 A;  1SKV A;  3I55 V;  3ABU A;  1L0L H;  1D5A A;  3KG2 A;  2KKW A;  4NTW A;  1AB3 A;  1VQM V;  1V9P A;  4JI7 B;  4JI1 O;  2Z5U A;  2RNB A;  5EIB D;  4AQY B;  4JV5 B;  1FFX B;  1L0N H;  4RWU A;  1G8M A;  2JGD A;  4JAS A;  4BR6 A;  4DRX B;  1XQ8 A;  1EZJ A;  1DTO A;  4O2B A;  5IYC O;  1QCE A;  4ZOL A;  4FPP A;  2MW2 B;  4KFM A;  4NYK A;  4P9O A;  1JQ0 A;  4TQD A;  4QNH B;  3E8B A;  2IJK A;  5CB4 A;  3GB7 C;  4UCS A;  3RWR D;  4DV6 B;  4DV7 B;  4RUF A;  1U97 A;  3CME V;  5LMN B;  2JK5 C;  4JGS A;  3LNN A;  1IDS A;  1FS0 G;  4RQE A;  1BSM A;  3FX7 A;  2H3O A;  1M5I A;  3EHB B;  4W4K A;  4R7C A;  4U7N A;  2P06 A;  1GMG A;  1JX9 A;  3WFV A;  3S3X A;  1OV9 A;  4QJF B;  3QO5 A;  4JI3 O;  3N2G B;  2PF4 E;  3ETD A;  3ASN B;  3CC7 V;  4J9Z B;  3HKC A;  1S5L Z;  1FXK A;  1IBK O;  1JPX A;  3ETE A;  1M1K W;  3RVY A;  1PNM A;  3PN1 A;  2OIG A;  1HDJ A;  4LFA B;  3D36 A;  4D6T H;  1H2L A;  1BZK A;  1K34 A;  3ZBH A;  1UPG A;  2F1M A;  1M57 B;  4DR5 B;  4PA9 A;  4QPK A;  3ZIA G;  3TET A;  1P4R A;  4O4L B;  2ZE6 A;  4LF9 O;  3UM7 A;  4GYC B;  5EYP B;  5KUM A;  5B66 Z;  1R3L C;  2P5O A;  1I94 O;  4DV1 B;  5KX5 A;  1N34 O;  4FIP C;  3F5T A;  3HKD A;  4FJC C;  2XT9 A;  4Z1V A;  1SA0 A;  4PEL A;  3C3S A;  5FPO A;  1H2S B;  1HNX B;  1DLB A;  4X9Q A;  3KZI Z;  4D7S A;  3F7V C;  5B1N A;  4H13 B;  1Z2G A;  2HHH O;  3BRC A;  1SES A;  4FMT A;  2UXN A;  1B3Q A;  2QKC A;  2A0L A;  4PDL A;  5A2Q N;  3P30 A;  4LH7 A;  5LMU B;  1WPB A;  2YIB D;  2BTQ B;  4DYL A;  3L71 H;  2X6A A;  2ADQ B;  4KL1 A;  3QVN A;  4U7O A;  3STL C;  3SR2 C;  5KHG A;  4EB6 B;  5GON A;  2JEU A;  1XMO O;  4WFB V;  5IYZ B;  1TGO A;  4CZZ A;  3UCS C;  1SQV H;  1VQ8 V;  3L75 H;  2ZIN A;  3RBZ A;  2E5L O;  1N33 B;  4U3F H;  4ZKI A;  4WFH A;  2UXD B;  4KXR A;  3ASN C;  5KAF Z;  1BMF G;  2UU9 B;  5DED A;  3JAR A;  4DR1 B;  4DR2 O;  4DR4 O;  4NXN O;  4CS3 A;  4B3M O;  4X1Y A;  3P3P A;  5EBM C;  2GTA A;  1SS3 A;  2DMX A;  3M8A A;  3IJ4 A;  4LNU A;  4DV4 B;  1M57 C;  4PA4 A;  3CCU V;  4YJ3 A;  5CA1 A;  2K9P A;  3CRQ A;  2A79 B;  1E79 G;  4B7K A;  1W2B U;  4O4H B;  1ZL8 A;  1RSO B;  4O4I B;  3SYP A;  3JAK B;  1Y76 A;  3ABM B;  1R1B A;  3ZN1 A;  4N23 A;  4JI1 B;  4BIO A;  1KB9 F;  4F4L A;  4H44 B;  4F6E A;  1S76 D;  1BE3 H;  4FM2 A;  5ITZ B;  3K79 A;  2LQT A;  1KMI Z;  3HR0 A;  5H2F Z;  4UV8 A;  4LF5 B;  4UVC A;  3RYF B;  3AG2 B;  3O65 A;  3JAL B;  2WLL B;  2Y0P A;  3B09 A;  3L70 H;  1GN6 A;  3RYH B;  1G1X B;  1SQB H;  3FB5 C;  4BW9 A;  4IIJ A;  3DXR A;  4DV0 O;  1SZX A;  2ZDI A;  2GDS A;  3L9D A;  4CH5 A;  4WFF A;  3UO2 A;  1V54 B;  1NVP D;  4X1K A;  2QM4 A;  4IYH A;  1PD3 A;  3M99 B;  1QR9 A;  4KHP O;  2DE0 X;  2Z3Y A;  4UVA A;  2XAQ A;  2IH1 C;  2RCV A;  2D3O W;  2B9Z A;  3JAT B;  1COW G;  4A5U B;  1ZAU A;  4QIW F;  3KCX A;  1HW7 A;  2HVK C;  3A0B Z;  3Q4H B;  1QLE B;  3JAW B;  4FZ0 A;  3E8F A;  4JI3 B;  4FLV A;  4MS2 A;  2IBZ H;  1V55 B;  5JJE B;  5B1A B;  1XL6 A;  4F6R B;  1IBK B;  2H94 A;  3JD4 A;  5KLV H;  1QU7 A;  3APQ A;  5FLX N;  2R9A A;  4G2K A;  1N0J A;  1SRY A;  2W6J G;  1ROP A;  4I4T B;  4UUJ C;  1QHT A;  3QTC A;  2BTO A;  2XAG A;  4JYY A;  3HKB B;  2YIC A;  4YXW G;  1EZV H;  2JDI G;  4EFB A;  3A8T A;  4LF9 B;  1GM7 A;  1WAZ A;  4MTO A;  1XHX A;  4FFB B;  2W6I G;  2LGW A;  1HP8 A;  1I94 B;  1LUW A;  3U0Z A;  1N34 B;  3FAV B;  1TVK B;  1YIJ V;  3PJS K;  5EZY B;  2L6L A;  3AK2 A;  4NR1 A;  2DWE C;  3BAA A;  3I5D A;  5DEC A;  3M7M X;  4ZHQ A;  3AG2 C;  3X2Q B;  1YDX A;  4I55 A;  2HHH B;  3GWO A;  1QBZ A;  3K59 A;  1AI5 A;  4MTX A;  1QVG U;  3G80 A;  4R6Z A;  3ETG A;  1GTO A;  4HZ3 A;  1MZF A;  1VQL V;  4IHJ B;  4K8X A;  4J7K A;  2PGG A;  1V54 C;  2QDO A;  1S72 V;  1XMO B;  2JJ2 G;  4FLY A;  2LP7 A;  5IWA O;  4WFA V;  2E5L B;  4GT1 A;  1VEW A;  5JVD A;  5KHK A;  2RMK B;  2AHZ A;  4DW1 A;  1N36 O;  1R6N A;  1V55 C;  4DR7 O;  2Q9L A;  1GH6 A;  5LGN A;  2V7Q G;  1H2G A;  2DYS B;  2CGO A;  1RP3 B;  4EEQ A;  4DR2 B;  1KD1 W;  4NXN B;  4DR4 B;  5B3S C;  3CCQ V;  4AI8 A;  3ABK B;  4B3M B;  2WLI A;  2EIK B;  1S3J A;  2Q6A A;  1FXH A;  4I50 B;  4BWA A;  2OYQ A;  1XRE A;  2QKA A;  2PZS A;  2DQ3 A;  3MD0 A;  5CN0 A;  4QPJ A;  2A3Q A;  3AK3 A;  2WLH A;  3ZHR A;  3J81 N;  2FB5 A;  3CJH B;  1PNK A;  4J7Z A;  1TUB A;  1KKD A;  4JI5 B;  3U11 A;  3HPL C;  4PI2 A;  4X89 A;  4LF4 O;  3ML0 A;  4NVP A;  3ZHT A;  1BCC H;  4DV5 O;  5AG2 A;  3CC4 V;  1JA8 A;  1WA8 B;  2P22 C;  4O4J B;  1PPJ H;  4H37 A;  1AI4 A;  4JZG A;  4LFB O;  1VQ7 V;  2EIM B;  3G6E V;  1R3K C;  3CHX A;  1MSD A;  2CTR A;  1DF5 A;  4EFE A;  1IXB A;  4E4E A;  2VWK A;  2JJ1 G;  5BR8 O;  4DV0 B;  1HR0 O;  4WBN B;  2F93 B;  4BAY A;  1NBM G;  3AG4 C;  1VF5 B;  3OMI B;  3JCU Z;  5CMU A;  4H33 A;  4U3J B;  3TGU H;  1QR8 A;  2PYL A;  1OZ0 A;  1ZLZ A;  4HNA A;  4YJ2 B;  3GWK C;  4JTD B;  3DSQ A;  2YUA A;  2NR5 A;  1VQP V;  4K0K O;  4KHP B;  3GVM A;  1F4M A;  2KSD A;  4RQF A;  1FFX A;  1YTF D;  1NTZ H;  2QWQ B;  4DRX A;  4NXM O;  5EIB C;  4JTA B;  1KP2 A;  1PM9 A;  2ETN A;  3J7A U;  3UKM A;  1SQF A;  5HFL A;  4X20 B;  3ZJZ A;  3G71 V;  4ABM A;  5BMV B;  1PP9 H;  2M7W A;  4JAU A;  3SPC A;  2DYS C;  2GUZ B;  3F7Y C;  4MSW C;  3ABK C;  2EIK C;  4N21 A;  4DV3 O;  2ZE7 A;  3T1H O;  5B1O A;  4YHH B;  1CP9 A;  1NU1 H;  2JEX A;  2DW4 A;  3H1J H;  3T1Y O;  1XIL A;  5C8Y B;  4MW3 A;  1ZSP A;  3SJA C;  1MG1 A;  2DWD C;  1JCH A;  2ADP A;  1GN4 A;  3ZX6 A;  4LFC O;  5LXT B;  5IYB O;  4FM0 A;  1Q6U A;  2Q73 A;  3N2G A;  3QO8 A;  1WNS A;  1BT8 A;  3OUS A;  1GN3 A;  5L3G A;  4BIZ A;  3K04 A;  1AJN A;  1XMQ B;  1XDC A;  5E79 Z;  3DTU B;  1MMM A;  5EBL C;  3RVZ A;  3ZHS A;  1WJZ A;  1YJ9 V;  1E1Q G;  1W0K G;  4I5S A;  4FLT A;  1DF4 A;  1PKX A;  5CBG A;  4FK5 C;  1YJW V;  5KMG A;  4O4L A;  4J41 A;  2A9H A;  5J2T B;  1IBL O;  1VF6 C;  4NTX A;  3IAY A;  4DO2 A;  1K5Q A;  3K0G A;  2X0L A;  4LR3 A;  2BE3 A;  4WFG A;  3KKY A;  3IC7 A;  1S5J A;  1Q7Y W;  3K5N A;  3H01 A;  5IWA B;  3K5M A;  3BCC H;  2CTQ A;  2GBO A;  4UCU A;  1N36 B;  1H2M A;  4DR7 B;  1WP7 A;  3WB1 A;  2UXC B;  1LR1 A;  2KG7 A;  3AG1 B;  1VQK V;  1R73 A;  2P4V A;  2UUB O;  2OTJ V;  1B06 A;  2BTQ A;  3D3Q A;  4NKG B;  3BFR A;  1WB7 A;  2BOB C;  1OCO B;  3OGI B;  4EB6 A;  5JWP A;  4Q6G A;  2OT5 A;  5IYZ A;  2EJ7 A;  3FB6 C;  1HNW B;  1FKA O;  2QA4 V;  2PI4 A;  5LP6 A;  1BQZ A;  1AJP A;  2EJR A;  4MTG A;  1E1R G;  3BY6 A;  2Q7H A;  3L72 H;  1EBO A;  3SYA A;  2ZM6 O;  2EX3 A;  2QJ1 A;  4ZI7 B;  4LF4 B;  2RQ6 A;  1NH2 D;  4GZR B;  3RYC B;  4DV5 B;  2ATK C;  2CAZ C;  4CC6 A;  1K3E A;  3UQ8 A;  2PYJ A;  4LWS B;  3G67 A;  4J10 A;  4YY3 O;  1SZT A;  2ZR2 A;  2EZO A;  1VQ6 V;  1GM8 A;  4LF6 O;  2QWP B;  2XND G;  5C93 A;  4LFB B;  4X64 O;  1YVW A;  1K5S A;  1EFR G;  1R3J C;  4MT8 A;  1M93 A;  4L87 A;  4J7J A;  4TSF G;  3SPJ A;  2Y4U A;  3A2F A;  5BR8 B;  1HR0 B;  2XOK G;  1P7G A;  3SYC A;  1S77 D;  2HR3 A;  2UXX A;  4O4H A;  1YXB A;  1SC5 B;  5LBQ A;  1RSO A;  2HJD A;  4B7E A;  1K4C C;  2QM8 A;  3SYO A;  3SPG A;  3JAK A;  4K0K B;  4GKJ O;  2YXH A;  1XHZ A;  2CDY A;  4GX2 A;  3AG3 B;  4QE9 A;  3FD9 A;  1AIL A;  5ITZ A;  1Q81 W;  3BAB A;  3BHP A;  1VQN V;  3E8G A;  1GM9 A;  2EUL A;  4E2L A;  4MVS A;  1FJG O;  2IJI A;  1LUV A;  4P30 A;  3ZMS A;  2IU3 A;  3RYF A;  4JYA O;  2WLL A;  3JD0 A;  3AEI A;  3RYH A;  1I0H A;  4ZOL B;  3JAM N;  1O9G A;  4HYO A;  2AW9 A;  2PTM A;  4JI0 O;  1GN2 A;  2WWW A;  3AG1 C;  1YI2 V;  1DGS A;  2Q4P A;  4NB5 A;  2YI8 A;  3JAS B;  3OEH G;  4TT3 G;  5GTH Z;  3MAQ A;  3ZHQ A;  1I7F A;  4DV3 B;  3CRA A;  3T1H B;  1VAR A;  5K1X A;  1GKF A;  1OCO C;  3T1Y B;  3W7X A;  1NT2 B;  5KHI A;  1RM1 C;  1WB8 A;  1NVP C;  1EN5 A;  2DOS A;  2IJJ A;  1XBL A;  3OW2 U;  4EKW A;  1IVS A;  2ODM A;  2XUM A;  1X59 A;  3JAT A;  4OGQ B;  1D2D A;  1VMG A;  4LH6 A;  3CRM A;  4LFC B;  1KYO F;  3K57 A;  3B8N A;  4TQF A;  4PV1 B;  5H5N A;  3H1H H;  3JAW A;  4ZIB A; 
#chains in the Genus database with same CATH homology
 3OM3 B;  3OUF A;  1N8R W;  1YIJ V;  3PJS K;  3D3I A;  2ITD C;  2F43 G;  3OR6 C;  3CCJ V;  1RM1 B;  2AHY A;  1NVP B;  2R9I A;  2DWE C;  3T2M A;  1GO3 F;  1HWY A;  2WAM A;  3ZRS A;  4MVZ A;  2WLM A;  3ABL B;  5IDJ A;  1TUE B;  2Q67 A;  3CD6 V;  3CCV V;  1KQS U;  2FTK A;  3CC2 V;  3AG2 C;  3DGE A;  3X2Q B;  2Q68 A;  4BIU A;  3GWO A;  1QBZ A;  4LBE C;  2GHY A;  2ZXW B;  3T1C A;  1I5Y A;  1AI5 A;  5H9C A;  4MVM A;  4MTX A;  1Q82 W;  3ZCC A;  5LHI A;  2YEV B;  4Q20 A;  1JVM A;  1QVG U;  3NXS A;  4R6Z A;  3ETG A;  3JD2 A;  3SYQ A;  2ZQM A;  1GTO A;  3LUT B;  4HZ3 A;  4PDR A;  1KEC A;  1VQL V;  3CMA V;  3P32 A;  2QM7 A;  3R65 A;  2V1D A;  1V54 C;  3OGC C;  4QE7 A;  1S72 V;  1VQ4 V;  1AR1 B;  3LNM B;  2WLK A;  5IY5 B;  1K97 A;  1MSW D;  3QNE A;  2B1I A;  3FYI B;  3IFX A;  3AG3 C;  3JD3 A;  2BOC C;  2JJ2 G;  2WLJ A;  4PDV A;  5EBW C;  4JPR A;  1K9M W;  2LP7 A;  2EBO A;  3I56 V;  1F23 A;  4RO2 A;  1Y66 A;  4XDJ A;  5L3C A;  2H8P C;  4WFA V;  4GT1 A;  3CCS V;  2W0F C;  3JYC A;  3SPH A;  2AHZ A;  3ZRW B;  1K92 A;  4MW8 A;  3OMN B;  5L3E A;  2WSS G;  5L3F A;  1W0J G;  1R6N A;  3E35 A;  1V55 C;  1NKD A;  1NR1 A;  5BZB A;  1I5X A;  4LP8 A;  1YIT V;  3MHH C;  5LGN A;  2V7Q G;  2YEV A;  3CP1 A;  5H6R A;  1H2G A;  2DYS B;  1KD1 W;  5B3S C;  3CCQ V;  1KC8 W;  3ABK B;  2WLI A;  2EIK B;  4UXN A;  3VOU A;  1OCZ C;  1ARO P;  1S3J A;  1FXH A;  2CK3 G;  2Q6A A;  3K06 A;  5EK0 A;  2K1E A;  1G4Y B;  5LGU A;  2DQ3 A;  3MD0 A;  5CN0 A;  4QPJ A;  3LDE A;  4MVR A;  2WLH A;  3MHS C;  4DXW A;  3W7T A;  2DQ0 A;  2DYR C;  1PNK A;  4P2Z A;  2EIM C;  2B1G A;  1H8H G;  4WCE V;  1KKD A;  2NLJ C;  4UV9 A;  3HPL C;  4PDM A;  5J9P C;  2Y48 A;  5E1A C;  3ZRW A;  4X89 A;  5LGT A;  2KB1 A;  1Y4M A;  5B3S B;  1H38 A;  3E8H A;  1RPO A;  3ML0 A;  3I55 V;  3CCL V;  3ABU A;  1SET A;  3KG2 A;  3OE7 G;  3CC4 V;  1M56 B;  1AI7 A;  3B8M A;  2QE7 G;  3FYE B;  3FKS G;  4G27 B;  1BHA A;  2XAS A;  1VQM V;  2IU0 A;  4H37 A;  2ITC C;  1K8A W;  2Z5U A;  2HKO A;  1P7B A;  1AI4 A;  4HAM A;  5FL7 G;  3ABL C;  1WPX A;  2DYR B;  1NQT A;  3OFN G;  1G8M A;  4JAS A;  1H8E G;  2EIM B;  3G6E V;  1VQ7 V;  1R3K C;  3E86 A;  3TK1 A;  3W7S A;  2ZXW C;  1EZJ A;  1DF5 A;  1QVF U;  4CBC A;  1DTO A;  4MTF A;  5IYC O;  1QCE A;  2JJ1 G;  4ZBM A;  4FPP A;  1FXK B;  4BAY A;  1NBM G;  3AG4 C;  3OMI B;  4KFM A;  5CMU A;  4H33 A;  1JQ0 A;  4P9O A;  4QNH B;  2OCC C;  1QR8 A;  3E8B A;  1NJI W;  2IJK A;  3E89 A;  3A0R A;  3GB7 C;  1OZ0 A;  4JTD B;  5IY5 C;  2XAJ A;  2IW5 A;  1S5H C;  1K33 A;  4RUF A;  1VQP V;  1OHH G;  3CME V;  2JK5 C;  4JGS A;  3K9A A;  4XDK A;  1FS0 G;  1F4M A;  4RQE A;  3JCZ A;  1L1F A;  4RQF A;  1IXM A;  1NR7 A;  3EHB B;  5LHH A;  1YTF D;  4R7C A;  4U7N A;  1GMG A;  1JX9 A;  3AG4 B;  4JTA B;  1KP2 A;  4WFE A;  3WFV A;  2OCC B;  3UKM A;  4QJF B;  3QO5 A;  3ETD A;  3ASN B;  5HFL A;  3CC7 V;  4J9Z B;  5HFM A;  3ZJZ A;  3G71 V;  2R9R B;  3W7U A;  1FXK A;  1JPX A;  2M7W A;  1RPR A;  3ETE A;  2DYS C;  4JAU A;  3SPC A;  1M1K W;  3E83 A;  3F7Y C;  4R50 A;  3RVY A;  3K0D A;  3ZMU A;  1PNM A;  1MOF A;  4MSW C;  2NNU A;  2P67 A;  3ABK C;  1UJW B;  3ZN0 A;  2EIK C;  1JOY A;  2LFR A;  3SJQ C;  4N21 A;  3B77 A;  1AJQ A;  3VBB A;  3ASO B;  5B1O A;  4X8A A;  3D36 A;  4P9P A;  1CP9 A;  2JEX A;  3HB3 B;  2DW4 A;  1ORQ C;  1K34 A;  4MW3 A;  1XL4 A;  1ENV A;  1M57 B;  2HG5 C;  3T4Z A;  1MG1 A;  4PA9 A;  4QPK A;  3CYO A;  2EIN B;  3ZIA G;  5EC1 C;  3ZRX A;  2DWD C;  1JCH A;  2HJF C;  5B1B C;  3TET A;  1P4R A;  3UM7 A;  5IYB O;  4PA7 A;  4PA6 A;  5KUM A;  1K73 W;  1R3L C;  3QO8 A;  3OUS A;  1M56 C;  4FIP C;  4LCU C;  4FJC C;  2Y69 B;  3LDC A;  4RAI A;  5L3G A;  3CPW U;  4BIZ A;  4PEL A;  3CCM V;  4UVB A;  2XAH A;  3K04 A;  4OXS A;  1DLB A;  1AJN A;  2LFS A;  3DTU B;  3F7V C;  2X6B A;  5B1N A;  4KP4 A;  3ZMV A;  5EBL C;  3TCU A;  3ZMT A;  2PI5 A;  5B1B B;  3K3W A;  1CPY A;  1SES A;  4FMT A;  1F51 A;  2UXN A;  3RVZ A;  1YJ9 V;  3WG7 B;  5L3B A;  1E1Q G;  1W0K G;  2A0L A;  4I5S A;  1DF4 A;  1PKX A;  4PDL A;  1YTF B;  1FXK C;  2XAF A;  3P30 A;  5CBG A;  4FK5 C;  1YJW V;  1M9N A;  3T4D A;  2A9H A;  3ABT A;  1KP3 A;  1OCR B;  2IH3 C;  4GX0 A;  2X6A A;  2P90 A;  1FXV A;  4DO2 A;  1K5Q A;  2X6C A;  4U7O A;  2ZR3 A;  3STL C;  3K0G A;  2X0L A;  2GSM B;  3CCE V;  2JEU A;  4WFG A;  3SPI A;  4WFB V;  2QEX V;  3IC7 A;  1Q7Y W;  1VQ9 V;  4CZZ A;  1YJN V;  1VQ8 V;  3H01 A;  4JTC B;  3RBZ A;  5DM6 V;  1K7D A;  2HLD G;  4G28 B;  3W7W A;  1CEZ A;  2B5U A;  3RW0 A;  4ZKI A;  2YSU B;  4WFH A;  3ASN C;  2EIL B;  1WLE A;  2ZDI C;  1BMF G;  1LNQ A;  1OCC B;  1SER A;  1YHQ V;  2C2A A;  3AG1 B;  1K4D C;  1R73 A;  1VQK V;  1M90 W;  1B6Q A;  2OTJ V;  2EZP A;  3ZMZ A;  5EBM C;  3ABM C;  2HVJ C;  3ASO C;  2BOB C;  1PL0 A;  1OCO B;  1QLN A;  4BW5 A;  4JYC A;  2OT5 A;  4GX1 A;  3FB6 C;  1M57 C;  2PI4 A;  2QA4 V;  2EIJ B;  4PA4 A;  4Z1M G;  3CCU V;  1S0V A;  2EIN C;  4R8C A;  1AJP A;  2MK3 A;  4JAV A;  4PA3 A;  2A79 B;  2EJR A;  3BEH A;  4I9W A;  1E1R G;  4MTG A;  3BY6 A;  4ASU G;  1E79 G;  1W2B U;  2P7T C;  3F5W C;  1EBO A;  3SYA A;  3ZRV A;  1Q86 W;  1R6K A;  5KUK A;  1NH2 D;  3SYP A;  1F4N A;  3ABM B;  2ATK C;  3ZN1 A;  1K3E A;  2Y69 C;  3OMA B;  2X7R B;  4N23 A;  3OAA G;  1J95 A;  3LSS A;  1PNL A;  2WLI B;  4JYB A;  4F4L A;  1SZT A;  2ZR2 A;  1S76 D;  2EZO A;  3K79 A;  3STZ C;  3CXC U;  1VQ6 V;  1GM8 A;  5CBH A;  2XND G;  5C93 A;  4MVQ A;  4UV8 A;  5L3D A;  4UVC A;  4J9Y B;  3EFF K;  1MAB G;  1K5S A;  2WLL B;  1EFR G;  1R3J C;  3AG2 B;  4LC1 A;  4MT8 A;  4TWK A;  3WG7 C;  5DN6 G;  2Q69 A;  4L87 A;  5KA6 A;  4TSF G;  3FB5 C;  3SPJ A;  1YTF C;  2JIZ G;  1GK9 A;  2XOK G;  2ZDI A;  1AI6 A;  3SYC A;  1VQO V;  3OEE G;  1S77 D;  1YSC A;  2HR3 A;  1QLE C;  2UXX A;  4XDL A;  1OCR C;  1R3I C;  1JJ2 U;  3K08 A;  2IJH A;  4WFF A;  5LBQ A;  3CCR V;  1K4C C;  1V54 B;  2QM8 A;  5B1A C;  3SYO A;  3SPG A;  1NVP D;  4GX5 A;  3IGA C;  1BL8 A;  3K03 A;  3LSQ A;  1PD3 A;  2P6J A;  3M99 B;  1QR9 A;  2ZD9 A;  4MVO A;  2Z3Y A;  1BHB A;  4WF9 V;  4GX2 A;  1NH2 C;  3AG3 B;  4UVA A;  4QE9 A;  4X88 A;  1VQ5 V;  2XAQ A;  5CBF A;  2IH1 C;  2WPD G;  4GCZ A;  1Q81 W;  2D3O W;  3QO7 A;  1VQN V;  3E8G A;  1COW G;  1GM9 A;  4E2L A;  4MVS A;  1ZWI C;  4QIW F;  2IJI A;  3LDD A;  4P30 A;  3ZMS A;  3OR7 C;  2IU3 A;  2WLL A;  2HVK C;  3JD0 A;  3AEI A;  1QLE B;  3E8F A;  2EIL C;  4MS2 A;  3E2E A;  5EC2 C;  1V55 B;  4HYO A;  1OCC C;  2WLN A;  5B1A B;  1XL6 A;  2WWW A;  2H94 A;  1THZ A;  3JD4 A;  3AG1 C;  4KUM A;  5GW7 A;  1YI2 V;  3FB7 C;  4JF3 A;  3OEH G;  2QTO A;  4G2K A;  1NH2 B;  4TT3 G;  3FB8 C;  1SRY A;  5CA3 A;  2W6J G;  1ROP A;  4UUJ C;  1OCZ B;  1GKF A;  1OCO C;  3W7X A;  1FFT B;  2XAG A;  5IYD O;  1RM1 C;  1NVP C;  2IJJ A;  4YXW G;  2EIJ C;  3OW2 U;  4EKW A;  5LHG A;  2JDI G;  2QKS A;  4RUE A;  2OTL V;  3X2Q C;  3G4S V;  3B8N A;  5KA5 A;  4XBF A;  1GM7 A;  4MTO A;  3JD1 A;  2HFE C;  5H6Q A;  2W6I G;  4MVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...