5IYCO

Human core-pic in the initial transcribing state
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
b'MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription, transferase/dna
source organism Homo sapiens
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
O PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5iycO01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 5iycO02
5IYDO 1NVPC 1NH2D 1YTFC 1NVPD 1YTFD 1RM1B 1NH2C 5IYBO 1RM1C 5IYCO
chains in the Genus database with same CATH superfamily
1NT2B 5IY5C 2X6BA 1PD3A 1V9PA 2E76B 4LWSA 1NH2D 4NXNO 3ABKB 4DR4O 3JARB 1N36B 1WPXA 5FPOA 4H0LB 2YXYA 5BXZA 1XNRB 1S0VA 4JASA 2P4VA 1J95A 1PNLA 2D2CB 4J11A 5B1NA 4EEQA 1AJNA 1NZ6A 1EN4A 2ETNA 1V55C 1M56B 1KB9F 1B06A 2WSSG 3BAAA 1NVPB 1VQ5V 5KAFZ 2FMLA 2EIKB 4AHCA 1P4RA 5FL7G 5L3FA 1XHZA 4Z2WA 1TAEA 1FXKA 1H2NA 3ZJZA 3Q4HA 1WA8A 2CK3G 1BHBA 2MW2B 4JYBA 3FYEB 4TOIA 4DUZO 2Y0PA 5EBMC 1YHQV 1DK1A 1AR1B 5GTHZ 2QWPB 1AJPA 3VQVA 2KSDA 1VQ7V 4LWSB 4LC1A 4FMTA 5B1OA 1YJ9V 4MVMA 2AZ2A 3WB1A 1S77D 1VQ8V 1BQZA 5EIBC 1TGOA 3D3IA 2Y69C 4ABMA 3F7YC 1IX9A 1M9NA 2JS5A 4X1KA 5HFLA 1SRYA 4P30A 4DW1A 4JI3B 2KG7A 3AG2B 1ZAUA 4IIJB 3FAVB 4UCVA 1N4CA 3B8MA 3CMEV 4DR6B 2RMKB 2XT9A 4DR3B 4PDRA 1AB3A 3TK1A 1NR1A 4XDKA 4GKJB 1GK9A 1WA8B 1QU7A 1JR9A 1AJQA 5GW7A 1Y74A 4QE9A 1FFTB 4TV8B 4KHPO 4LF6B 2L35A 2P4KA 5LMNO 4JI3O 5BZBA 5BY1A 4D7TA 4X1YA 2VRZA 3CCSV 2DQ0A 1VQNV 3GVMA 4DXWA 1RFYA 4GKKB 2E5LB 1JJOA 3CCUV 3OAAG 2JIZG 1HP8A 4JYAO 1SC5B 4JV5O 1K9MW 5EYPB 3ZHSA 3L74H 4CC5A 4RUFA 3A0HZ 3SPJA 3KCYA 4JV5B 2ZIOA 5IY5B 4ICGA 2P6JA 3IFXA 3RN4A 1IZ3A 1S5JA 3HKEA 1YTFC 4X20A 5LGUA 3U0ZA 3K5OA 4H13B 1OCZB 3H9VA 2GUZB 2XASA 2QWOB 2YI8A 4X88A 2UUCB 4ZHQB 1XHXA 5LMUB 4IGGA 5LMNB 4CH5A 3B40A 4LF6O 4KHPB 4DV4O 4O4LB 1OZ0A 4RUEA 4U7NA 5EZYA 3CEIA 1F7YA 4DV7O 4LNUB 1N34O 2HHHB 3CC2V 1OV9A 1MZEA 2UU9O 1THZA 3W7SA 4FFBA 3CSXA 4ZBMA 4ZOLB 2XAHA 2Z5UA 2AHZA 4PDLA 1QBZA 5H6QA 1JJ2U 5GONB 1FPOA 4WFAV 3JCUZ 4P2ZA 5TISZ 2QE7G 3K9SA 4MVQA 4B3SB 3K5MA 2PUSA 1F51A 3UO2A 2XAFA 1Q7YW 3BVOA 3OUFA 3UQ8A 1G6UA 1AI5A 3SJBC 3CRQA 2A7WA 2IJHA 1D5AA 5LA6A 1V54C 1K97A 4WCEV 1GN4A 2DOSA 5LGNA 2RJZA 4KL1A 3ZHUA 4TT3G 1JOYA 4LF8B 4O4IB 2CGNA 2IU3A 3CXCU 4FLYA 5LHGA 1ZTEA 4LF7B 3ABLB 3OMIB 4JI0B 5CA1A 2YIDA 5K1PA 3STLC 4EKWA 3ABMB 2VQFO 2ZE6A 5B66Z 4RO2A 4LNUA 2JK5C 4GX0A 4UCUA 3JAWB 1H2LA 4OGQB 2WLKA 3DTUB 3WU2Z 5IJ0B 4ZOLA 4DRXB 5L3CA 4DV2B 2QTOA 3JAKA 5FLXN 4I50A 3G80A 5KUKA 1VQMV 3IAYA 1HNWB 2CAZC 5JCOC 2QEXV 2AXTZ 4Q6GA 1I7FA 5JVDB 3K9AA 2LGQA 3OEHG 4MVUA 2V4DA 2OCHA 2EZPA 4N23A 3T4DA 2IJJA 1GMGA 4Z1VA 2FTKA 1M4UA 3CCVV 4LR3A 4X1KB 5KAIZ 1N36O 4QPJA 1I5XA 3G6EV 1G8MA 2N04A 1EBOA 3ABTA 2VQEB 3N2GA 2OYQA 1O9HA 2G38A 1YVWA 1N8RW 3TGUH 3A2FA 3CRCA 1N33B 3CCLV 3FAVA 2CTQA 2PI5A 1ZSPA 1R1BA 2LJ2A 1ZL8A 3E83A 3BFRA 1BE3H 3I56V 1YZBA 4FFKA 4X8AA 2DYRC 1QR8A 1R3JC 4TWKA 2OT5A 4QGPA 3SYOA 1K33A 4UCTA 3E8HA 1I94B 5BR8B 1S3JA 3IGAC 1Y74B 2YXHA 4PI2A 3CRRA 1M1KW 2XTAA 4JI1B 2ZDIC 4TV8A 4LFCB 2DW4A 4LFCO 5H5NA 4UXNA 4FLWA 3ZMSA 1K4DC 3DXRA 4EB6B 2KQXA 3FFQA 5EYPA 2EIJC 1QHTA 5EZYB 4FM1A 2EZOA 1N0NA 4GKJO 3OT7A 4HBNA 3OGCC 2XAQA 3APQA 2WAMA 5KHIA 2WLNA 1CP9A 3EXAA 2NNUA 3SGIA 3VQWA 1VF6C 2R9IA 4PHZA 4G27B 3ASNC 1CXZB 4LBEC 4YIOA 2CTWA 2YSUB 2UUBO 1J5EO 2IBZH 2FKXA 4LP8A 3X2QC 1KECA 3ZHVA 1XDCA 2VS0A 1XNQO 3ETQA 1RSOA 1AP6A 2GSMB 3ZN0A 4JGSA 3TJTA 4IIJA 1WB8A 1OCOB 1A32A 1VQOV 2WPDG 2LFRA 3ZMZA 2DYSC 3K08A 1SQBH 4DR1B 1Q43A 1BCCH 4K0KO 3DSQA 2ZXWB 2Q4PA 3SPHA 4WFEA 1S5HC 3K0DA 1FJGB 3G67A 3SJCC 4C7UA 5CBFA 3AG3C 2UXBB 3AK2A 3OW2U 4LF8O 2BE3A 4MTOA 3ZN1A 2M6YA 4X62B 4K8XA 1OCCB 4HAMA 1XNRO 2R9AA 2YEVA 3LNNA 4PI0A 3J80N 4WFGA 1Q81W 4TV9B 2ADQB 4W4LA 3W7WA 3RYHA 4PA4A 4PA9A 2RCVA 1KD1W 4OX9O 2OIGA 2AW9A 1H8HG 1SF9A 3KKYA 2DYSB 2FB5A 1NVPD 4NXMO 3AK3A 4RQEA 1VQ9V 2UU9B 4RWUA 3MHHC 1VF7A 4O2AA 1SQQH 2V1DA 3HB3B 2UXCB 3BA9A 1W59A 3M8AA 3B8NA 3JAKB 2ZE8A 4I0XB 3P3PA 3X2QB 4DR5B 1RM1C 1G4YB 3K06A 4JTDB 5KX5B 4DV1B 3ZHQA 4LFBB 4WFBV 3N2GB 1JX9A 1SETA 2AGAA 4X64O 1QVGU 4JTAB 4B3TB 1SQPH 2BCCH 2JJ2G 1MA1A 3ML0A 1H2SB 2RN9A 4NTXA 2YEVB 2LW1A 4E2LA 4MW8A 1JQ0A 1MZFA 2LP7A 3AG7A 1EZVH 4YY3B 2IW5A 4BAYA 3NR7A 2BOBC 1DLBA 3L70H 4KXRA 5JCOA 5J2TA 1WJZA 3T2MA 3BRCA 1SA0B 3OUSA 1YJWV 4X66O 3S3XA 1R6NA 1BSMA 3LNMB 1YDXA 5L3EA 4CS2A 4GKKO 4MVSA 1AI4A 2DJVA 3AG4B 4QIWF 4BIZA 1NH2B 1Z5VA 4QNHB 2EIKC 2HLDG 4K35A 3ZIAG 3OTOO 1P7GA 3RFRA 4W4KA 3FB8C 3DGEA 3QF7A 4LH6A 4DV2O 3S3WA 3SDLA 4YHHB 2UXDO 4PV1B 1SESA 2A0LA 3RYCA 2R70A 2P90A 3JAMN 3ABUA 1PNMA 2BOCC 4ZKIA 3RVYA 4LF4O 1ENVA 1K73W 2NN4A 4XDJA 4I9QA 5LA6B 1GO3F 5IJ0A 3T1HO 2WLHA 3B77A 4DR6O 4WF9V 2E74B 5D5PA 2FL4A 1AR5A 1QCEA 3ABKC 5CA0B 1UJWB 3UT5A 4U3FH 1PM9A 1RSOB 1SQVH 2ZT9B 2UUAB 1GN3A 1Q5OA 1IXMA 4DW0A 4PD4F 1L0LH 1X4TA 1IBMB 2ZE7A 4GT1A 1U96A 1WLEA 3OGIB 4WBNA 4DO2A 3JALA 1WB7A 1FYJA 3W7XA 4B3SO 3QG5A 3B09A 4LCUC 4TQDA 4E4EA 2H94A 1SZXA 1VF6A 3L73H 2XHBA 3ETGA 2F1MA 4HYOA 3E8BA 1QLEB 1MSDA 2ZM6B 3K79A 2L6LA 3ZMUA 4I0XA 4MVRA 2QWNB 4JI6B 3OM3B 3ZMTA 3K59A 3OTFA 3UT5B 2EJ7A 2FYUH 1I08A 5KX5A 3E22A 1OCCC 1Q6IA 2WWWA 2Q0AA 3JD3A 4LFAO 2KG7B 2Y0IA 3CRAA 4PDMA 1QR9A 4DV0B 2BSKA 5B1AB 3OR6C 5EC2C 3EHBB 4FM0A 4HZ3A 1ZUQA 1FXVA 3RT3C 5EBWC 5LHHA 3JCZA 1T5EA 4JI2O 3UCSC 5LOVA 4JI7O 2W6IG 2WLLB 2KB1A 2EIMB 1YXBA 3P3NA 1P49A 3C3SA 3IC7A 1BHAA 3ASNB 2XAJA 1DTOA 1W0JG 2UXXA 3RVZA 3CP1A 3DC6A 2WLJA 2ZKOA 5C8YA 4IHJA 1L0NH 2CH7A 2ZNJA 1KU9A 1SERA 1AP5A 2Q7EA 3CCEV 3HKDB 3CC4V 3HKBA 4MTGA 3N2KB 4O2BA 4MS2A 1OHHG 4L8JA 5B5EZ 4KUMA 1WAZA 2LGWA 1QLEC 5JJJB 3QVNA 4UB8Z 5J9PC 2IM9A 4KP4A 1H2MA 1LUWA 3SPCA 5A2QN 1GM8A 3CJHA 5LP6C 5LBQA 5CB4A 2GBOA 1JPXA 1M93A 5IDJA 1Q6UA 5FPRA 3U10A 4IYIA 4OPHA 1VQKV 2BTQA 1V55B 4DR3O 3W7TA 1IBMO 1SQGA 4F6RB 1SQXH 3F5WC 4I9WA 5J2UA 3RYFA 4ZHQA 3BPZA 1VMGA 3APOA 4EFEA 4OXSA 1JMKC 3W7UA 2PI4A 2K1EA 1IXBA 1MG1A 3UM7A 3AG1C 2JRIA 2WLMA 3L71H 1VQ6V 4O4LA 4FLVA 3LSSA 1M90W 2IJIA 4I55A 2PYLA 3P30A 1XI1A 1Y4MA 1Y67A 2PYJA 3JALB 4YJ2B 2ATKC 4LF9O 2UXNA 4DK1A 1BL8A 3WG7B 1W0KG 3G4SV 3A0RA 2QR4A 3LSQA 1PNKA 4X65B 3AG2C 3ICXA 3OFNG 3ZRWB 4JI8B 2B1GA 1I5YA 1P84F 4DV5B 1PPJH 2IU0A 4JI4O 2Q5ZA 4PA3A 2W0FC 3UKMA 4B3RO 3JD1A 2VWKA 1DF5A 2Q68A 1R3IC 1EN5A 3E22B 5L3GA 4UB6Z 1MABG 3ABLC 4YXWG 1GTOA 3ZRSA 3A8TA 1CPYA 5KUMA 2PZSA 5CBHA 1N32O 3CCMV 4UVBA 4I7ZB 2BSKB 4U7OA 2QWQB 1YCIA 2OTJV 5LL6Y 1H2GA 4U3JB 2DQ3A 1VQ4V 4GUNA 4B3TO 4B3MO 2HFEC 2YDEA 2ZIMA 3AG1B 3T4ZA 4LF5B 2ZCEA 3MAQA 3TCUA 3H1JH 5LOVB 1HNXO 1V54B 4NYKA 3JAWA 1K3EA 2ZINA 2QA4V 5E1AC 1XMQO 4DRXA 1JCHA 4GCZA 3ASOB 4UV8A 4WFFA 5IE9A 1H2KA 3H1HH 2YC0A 4JI5B 1TVKB 1FFXB 2GTAA 1EM1A 2CH7B 3WG7C 4O4JA 5FNVA 1VARA 5B3SB 5JJNB 1H8EG 2YI9A 1BMFG 1L1FA 1L8DA 2DN9A 2X7RB 1LR1A 4R50A 3RYCB 5KHKA 1IBKO 2W6JG 1NR7A 1HNXB 1XMOB 3G71V 4UVCA 4LF5O 1WP7A 4DV6O 4B3MB 1PL4A 1WN7A 5CB4B 1M57B 2ARHA 2F4VB 1ZX3A 1K92A 2ADPA 2PF4E 1Y66A 2VWJA 3JSNA 4JAVA 2CE4A 2LO1A 4TQFA 4MVZA 2GUZA 1XREA 1COWG 4K3AA 3O9OA 4CBCA 1UFIA 4PA7A 4FVMA 1AVMA 2DYRB 3VQYA 4B3RB 3HR0A 4P9PA 3N27A 3T1HB 2HJFC 2P06A 3OE7G 1TVKA 4I5SA 3QO7A 1N0JA 1XILA 5KMGA 4DV5O 4DR7O 3B4SA 4BR6A 4O4JB 1S72V 5ITZA 3HKDA 3ZMVA 1YITV 4X65O 5KHGA 4JZ2A 3N2KA 1Q82W 3VOUA 1QLNA 3R66A 5IWAB 3OTOB 4FLXA 3ETDA 5IWAO 4X9QA 1AI7A 3CS5A 4CC6A 3J81N 4I4TB 3PN1A 1B6QA 1GM9A 3CJHB 1P7BA 3QNEA 3JD4A 2Z0AA 1XOUA 3FB7C 1UPGA 4UFZA 3U11A 4UCOA 4YJ3A 1MNGA 3WFVA 4I55B 1M56C 2AHYA 4CZZA 2JJ1G 4Q20A 1NBMG 4O4IA 4YY3O 1FXKB 5IYDO 2CTRA 3GWKC 2C2AA 4JZGA 3SJAC 2ILMA 1PKXA 1URFA 1R6TA 2HVJC 5LP6A 5CMUA 2P22C 4FZ1A 3SPGA 2HG5C 2ZDIA 3H1LH 3D36A 2EJRA 4UUJC 4WFHA 4H33A 1KC8W 4EFBA 3CRMA 4NR1A 3CC7V 3ZS8C 3D8CA 2RDCA 2WA4A 4DR5O 2EILB 1IBLO 1VEWA 1FAFA 1FFXA 3SYPA 2R72A 3UO3A 5E79Z 3ZRWA 2PY5A 4J41A 1KQSU 4IHJB 4N21A 2XNDG 2LFSA 1BQ0A 4IT5A 5EK0A 2HEPA 2YIBA 1GRJA 4O2BB 2WLIA 1AR4A 5IYCO 1E79G 2XAGA 4PJ0Z 4G28B 5B3SC 1GN2A 2VQEO 5H6RA 2Y69B 4AI8A 2JVDA 1K8AW 1US6A 3JD0A 3MD0A 3PJSK 5KHHA 4B08A 4J10A 4DR7B 1EN6A 1ZLZA 4UVAA 1Q86W 1Y76B 2QWRB 1R6KA 2HKOA 4DV0O 4MVOA 5IYZB 4O2AB 2N05A 1OCRB 5J2UB 3SJQC 1GM7A 2YUAA 2NR5A 1HNWO 3CYOA 1M5IA 4JI6O 1FJGO 3MHSC 2ZE5A 2A9HA 1E1RG 1VP7A 2F4VO 2JGUA 4JI4B 3LSUA 4DR1O 2H8PC 3E86A 4UV9A 4DV6B 4JI8O 2X0LA 1NVPC 3EFFK 2DWEC 1XL6A 1YF2A 2VQFB 2Q9LA 1JA8A 5JH7B 2BTQB 2B1IA 4LF7O 2AZ0A 3K5NA 4R6ZA 2YXLA 3JSLA 4F6RA 4CS3A 1G1XB 5LGTA 5F2VO 5B1AC 4FIPC 4X1IB 3GWOA 5J2TB 4FLUA 1I0HA 1GN6A 3MDSA 4IL6Z 4RAIA 2UUBB 2NLJC 3AG3B 3L72H 2E75B 3CHXA 2JGDA 2JEUA 3FX7A 2LQTA 2UUAO 3VQXA 4DUYB 3IJ4A 5H2FZ 4J9ZB 5AG2A 5KLVH 1HNZO 1QNMA 4MT8A 2Y4TA 5H9CA 1D5NA 4FK5C 3ZX6A 1AROP 3ZRXA 2Q69A 4MTXA 1N34B 2HHHO 2ZD9A 4DV3B 5JWPA 5DEDA 3OR7C 2F95B 3ZCCA 5K1XA 1EZJA 4GYCB 4YJ3B 2ZR3A 1F4NA 4XDLA 3SR2C 4I4TA 1S76D 3ZHRA 4H37A 4LH7A 3RGBA 2EBOA 2XOKG 4HNAB 4NKGB 5FNVB 5BMVB 4JYYA 4U3JA 1WPBA 3LUTB 4LF9B 1LNQA 4CH6A 1BZKA 5CA3A 3CPWU 3CXHF 2W0XA 4DV3O 2DWDC 1KP3A 2V7QG 3BHPA 1FKAO 4CH4A 2Q6AA 5DN6G 4X64B 3FB5C 5IYZA 4LFAB 2QSAA 1AI6A 1HNZB 1HR0O 3A0BZ 1TUBB 4DUYO 2YIAA 1K7DA 4L87A 1TA8A 1Y6XA 2JEXA 2QKSA 1JVMA 3WB2A 1NQTA 4ZI7A 3K57A 3CCQV 3HKCA 3C3TA 3CWBH 4JF3A 4FLTA 1Q3EA 3K58A 2ZM6O 1S5LZ 1BS3A 2UXCO 5B1BB 1OCOC 1D2DA 1O9GA 3VBBA 4O4HA 4J7ZA 5LHIA 3O65A 4KFMA 1F4MA 2EULA 3H1KH 2QM4A 1YEWA 1OCZC 4CH3A 2ZXWC 4BW5A 4NTYA 2WLLA 2PGGA 1K5QA 4BIUA 5GTIZ 4FLZA 1PL0A 3I55V 1IVSA 4UCSA 3JASA 4X89A 4AILC 2Q67A 1SZTA 1SA0A 2D3OW 3AK1A 4JI5O 1BGYH 5B1BC 2JGDB 5LXTB 5C8YB 1KMIZ 3DXRB 4EB6A 3M99B 4G2KA 5LYJA 2UXBO 2HR3A 3KG2A 2EINC 3HKBB 1HR0B 3KCXA 3BY6A 4JI7B 4ZI7B 1KKCA 2GDSA 3SYAA 3CMAV 4XBFA 3QO5A 4J7JA 2OTLV 3SYCA 2YS8A 1N32B 2IH1C 1Q6HA 5D5QA 3ZHTA 3P32A 2ODMA 5EBLC 4QJFB 4YHHO 2UXDB 4DV4B 1GH6A 1NTZH 2X6AA 1HWYA 3RYIB 1FD9A 1FXKC 3ASOC 4B7EA 5IJ9B 1XNQB 3RYFB 2Q7HA 2UUCO 1SS3A 2F66C 1F23A 4DYLA 1NTKH 3F7VC 4UCRA 3JYCA 3JASB 2QKAA 3CD6V 1AILA 4Z1MG 3K5LA 1HDJA 1CEZA 3WB0A 2QM8A 4X66B 4BW9A 2OCCB 5LXTA 2F43G 5LP6B 1KBHA 4IYHA 4DR4B 4WBNB 2A3QA 4NXNB 1VQLV 4D6TH 2EX3A 1R3LC 1YSCA 1JFFA 2Z3YA 4J42A 1YJNV 4JYAB 3H01A 4ZIBA 3D36C 1GKFA 2E5LO 1M57C 2CUGA 4AQYO 1Y76A 1QQCA 1GAXA 4B7KA 4NVPA 1WP8A 2IJKA 2A06H 5BMVA 4DV1O 3I5DA 2P5OA 2WLIB 1NJIW 4GX1A 2Q0OC 1E1QG 1IDSA 2GHYA 1Z2GA 2IH3C 4LF4B 1NKDA 4QPKA 4HNAA 4TV9A 1YI2V 4TUYA 3SPIA 2OCCC 4PELA 4MTFA 4D7SA 5KA6A 4QE7A 1RPOA 2H3OA 3K3WA 3L75H 2YIBD 1FXHA 2XUMA 1N33O 2Y4UA 1ZL8B 1NS1A 1B04A 3SYQA 3TXQA 2CTPA 2HP8A 4BIOA 2LW7A 4FZ0A 2EIJB 1R3KC 3DC5A 3R65A 4JYCA 4X62O 3JATA 2Q73A 2R9RB 1K5SA 3BABA 2HVKC 5JQGA 3NXSA 1NTMH 2CGOA 1DGSA 4CS4A 2F23A 3H1IH 4GLXA 5LYJB 1TUBA 3K03A 3ZRVA 4O4HB 5C93A 5JH7A 4JI2B 5EC1C 4DUZB 3E8GA 3K0GA 2E3CA 1YTFD 3BEHA 3FD9A 4FJCC 4X1IA 1HW7A 1XMOO 3ABMC 5L3BA 1IBKB 3OMNB 3IC9A 4LFBO 1PP9H 4A5UB 4JI0O 2Q7GA 1MSWD 2RNBA 1MOFA 2M7WA 3ZEDA 4J80A 3THOA 2A79B 4R7CA 3ETEA 2GTSA 4OPAA 3J7AU 4K8ZA 2B9ZA 1H38A 3G6BA 5EIBD 1J5EB 4J7KA 5DM6V 1Q8IA 4MSWC 1IBLB 1OCRC 2EINB 4NB5A 1WNSA 2P7TC 3E35A 3L9DA 5KMGB 3QO8A 5CBGA 4P9OA 1Q90D 1IURA 5L3DA 1KUQA 3LDDA 3TXSA 2MK3A 4OX9B 5ITZB 2QKCA 1XMQB 3FYIB 2KKWA 4YJ2A 4F6EA 3E2EA 2JS3A 4TSFG 2ITCC 2EIMC 5IT9N 3HKEB 3LDEA 4X20B 2QJ1A 2HJDA 5DECA 4JPRA 3CCRV 3C90A 3E8FA 3ZBHA 1R73A 3BCCH 5CA0A 2WA3A 2CDYA 4DV7B 4BWAA 1RP3B 4J9YB 1NI8A 2QGNA 2Q8VA 3CB2A 3CX5F 2PTMA 3T1YO 2QDOA 4DR2O 2ZNIA 1B3QA 3D3QA 1X59A 1U97A 5HFMA 2BTOA 5LMUO 2RQ6A 1VF5B 3AEIA 4PDVA 4K0KB 4FM2A 5BR8O 5KHJA 1QVFU 1JFFB 1YTFB 3RYHB 4TUYB 3RBZA 4H44B 2N74A 3QTCA 2ZQMA 1PV0A 5CN0A 3K04A 4YIPA 5KA5A 3EVKA 2DE0X 1VIBA 5GONA 1LUVA 3F5TA 1VQPV 1XQ8A 2OIEA 2P67A 1RM1B 2Y48A 2B5UA 4GX5A 3LDCA 4ASUG 3HKCB 1XEQA 1KKDA 1SQFA 1EFRG 1KYOF 2QTSA 3RW0A 3KZIZ 3JD2A 2GV9A 4JAUA 3T1CA 1NU1H 3B2EE 4R8CA 4X1YB 2EILC 3OD4A 5IYBO 2JDIG 4GX2A 3JARA 3CCJV 5CA1B 1TUEB 1MMMA 1SKVA 2OWOA 5A9GA 3FKSG 2O57A 3CE2A 3OEEG 1XL4A 1OJHA 4F4LA 1XUQA 2F93B 2ZR2A 3E89A 2QM7A 1K4CC 3TETA 1W2BU 4I50B 3JATB 3GB7C 3FB6C 4FPPA 3BA8A 4GZRB 4DR2B 3RYIA 4JI1O 1XBLA 3T1YB 1FS0G 2X6CA 3OMAB 5JVDA 2K9PA 4RQFA 1YIJV 4PA6A 5IJ9A 1BT8A 2ITDC 1I94O 2DMXA 1KP2A 4NTWA 1K34A 4MW3A 3Q4HB 3M7MX 4AQYB 1ORQC 3RWRD 1ZWIC 1Z5WA 5JJEB 3STZC 3HPLC 1DF4A 1NH2C 3AG4C 4JAAA 4JTCB 4NXMB 4FFBB 1RPRA 5JQGB 2YICA 4DK0A 1ROPA
chains in the Genus database with same CATH topology
1CPYA 5KUMA 1OCOC 3ZN0A 4JGSA 5CBHA 5IY5C 2X6BA 1OCOB 1PD3A 3VBBA 3CCMV 4UVBA 4U7OA 1VQOV 2WPDG 5LHIA 2OTJV 2LFRA 4KFMA 1NH2D 3ZMZA 2DYSC 3K08A 1F4MA 1H2GA 2DQ3A 1VQ4V 3ABKB 2HFEC 3AG1B 3T4ZA 1OCZC 1WPXA 3TCUA 2ZXWC 1V54B 4BW5A 1S0VA 4JASA 2WLLA 2ZXWB 1K5QA 1K3EA 1J95A 3SPHA 2QA4V 4BIUA 5E1AC 1PNLA 5B1NA 1PL0A 1S5HC 4WFEA 3I55V 1JCHA 3K0DA 1AJNA 4GCZA 3ASOB 4UV8A 4WFFA 4X89A 1V55C 1M56B 5CBFA 3AG3C 2Q67A 1SZTA 2D3OW 3OW2U 5B1BC 2WSSG 1NVPB 1VQ5V 3WG7C 3M99B 4G2KA 2EIKB 2HR3A 4MTOA 3KG2A 3ZN1A 2EINC 1P4RA 5FL7G 5B3SB 5L3FA 1OCCB 4HAMA 3BY6A 1H8EG 2YEVA 1BMFG 1FXKA 4WFGA 3ZJZA 1Q81W 2CK3G 3W7WA 3SYAA 1BHBA 1L1FA 3CMAV 4JYBA 4XBFA 2X7RB 3FYEB 4PA4A 3QO5A 2OTLV 4R50A 3SYCA 2W6JG 4PA9A 1NR7A 1KD1W 2IH1C 5EBMC 3G71V 4UVCA 1H8HG 1YHQV 2DYSB 1AR1B 3P32A 1NVPD 1AJPA 1M57B 5EBLC 4RQEA 1VQ7V 1K92A 4QJFB 4LC1A 1VQ9V 4FMTA 5B1OA 1GTOA 1YJ9V 3MHHC 1Y66A 4MVMA 2X6AA 1HWYA 4JAVA 1S77D 2V1DA 3HB3B 1VQ8V 4MVZA 1FXKC 3D3IA 1COWG 2Y69C 3ASOC 3F7YC 3B8NA 4CBCA 1M9NA 3X2QB 1F23A 3F7VC 1RM1C 3JYCA 1G4YB 4PA7A 2DYRB 5HFLA 3CD6V 3K06A 4JTDB 4P9PA 4Z1MG 1SRYA 4P30A 2HJFC 4I5SA 3OE7G 1CEZA 2QM8A 3QO7A 4WFBV 1JX9A 2OCCB 2F43G 1SETA 3AG2B 1QVGU 1S72V 3B8MA 4JTAB 3CMEV 2JJ2G 3ZMVA 1YITV 4PDRA 1VQLV 3ML0A 3TK1A 1Q82W 1NR1A 3VOUA 1R3LC 4XDKA 1YSCA 2YEVB 1QLNA 1GK9A 2Z3YA 3ETDA 4E2LA 1YJNV 4MW8A 1AI7A 1JQ0A 2LP7A 1AJQA 5GW7A 3H01A 2IW5A 4BAYA 1GKFA 1M57C 2BOBC 1B6QA 1DLBA 1GM9A 1P7BA 3QNEA 4QE9A 1FFTB 3T2MA 3JD4A 3FB7C 2IJKA 3OUSA 1YJWV 5BZBA 1R6NA 3LNMB 5L3EA 4MVSA 3WFVA 3CCSV 1M56C 2DQ0A 2WLIB 1VQNV 1AI4A 4QIWF 3AG4B 1NJIW 4GX1A 2AHYA 4BIZA 4CZZA 4DXWA 1NH2B 1E1QG 2JJ1G 4Q20A 1NBMG 3CCUV 3OAAG 2JIZG 2GHYA 2IH3C 4QNHB 2EIKC 1NKDA 4QPKA 1FXKB 2HLDG 3ZIAG 5IYDO 1YI2V 3SPIA 3FB8C 3DGEA 2C2AA 1K9MW 2OCCC 4PELA 4MTFA 1PKXA 1SESA 2A0LA 5KA6A 2P90A 4QE7A 1RPOA 2HVJC 3K3WA 4RUFA 3SPJA 5CMUA 3ABUA 1PNMA 3SPGA 2BOCC 5IY5B 1FXHA 2HG5C 2ZDIA 2P6JA 4ZKIA 3RVYA 1ENVA 3IFXA 1K73W 3D36A 2EJRA 4UUJC 4WFHA 4H33A 1KC8W 4XDJA 1GO3F 1YTFC 2WLHA 3B77A 3SYQA 5LGUA 3CC7V 4WF9V 1OCZB 2XASA 1QCEA 3ABKC 4X88A 1UJWB 2EILB 2EIJB 1R3KC 3R65A 4JYCA 2R9RB 3SYPA 1K5SA 3ZRWA 1IXMA 2HVKC 1KQSU 4N21A 3NXSA 2XNDG 2LFSA 1OZ0A 4RUEA 3K03A 3ZRVA 4U7NA 5EK0A 4GT1A 5C93A 2WLIA 5IYCO 1WLEA 3CC2V 1E79G 4DO2A 5EC1C 2XAGA 4G28B 5B3SC 3E8GA 3W7XA 1THZA 3W7SA 3K0GA 2Y69B 5H6RA 4ZBMA 1YTFD 3BEHA 2XAHA 1K8AW 2Z5UA 4FJCC 2AHZA 4LCUC 4PDLA 3JD0A 3MD0A 3PJSK 1QBZA 2H94A 5H6QA 1JJ2U 3ABMC 3ETGA 4WFAV 5L3BA 3OMNB 4P2ZA 2QE7G 4UVAA 4MVQA 1Q86W 1F51A 1R6KA 2HKOA 2XAFA 1Q7YW 1MSWD 4HYOA 3OUFA 4MVOA 3E8BA 1AI5A 1MOFA 2M7WA 1OCRB 2IJHA 1QLEB 3SJQC 1GM7A 2A79B 3K79A 4R7CA 3ETEA 1V54C 1K97A 3ZMUA 4WCEV 4MVRA 1H38A 3CYOA 3OM3B 5LGNA 3ZMTA 3MHSC 4TT3G 1JOYA 5DM6V 2A9HA 1E1RG 2IU3A 1OCCC 2WWWA 4MSWC 1OCRC 2EINB 3JD3A 3CXCU 2P7TC 3E35A 2H8PC 3E86A 3QO8A 4UV9A 5LHGA 5CBGA 4P9OA 2X0LA 4PDMA 1NVPC 5L3DA 3EFFK 2DWEC 3ABLB 1QR9A 2MK3A 3LDDA 1XL6A 3OMIB 3OR6C 5B1AB 5EC2C 3EHBB 3STLC 3FYIB 4HZ3A 3ABMB 4EKWA 1FXVA 5EBWC 5LHHA 2B1IA 4RO2A 2JK5C 3JCZA 3E2EA 4GX0A 4TSFG 2W6IG 2WLLB 2ITCC 2EIMC 2KB1A 4R6ZA 2EIMB 2WLKA 3DTUB 3LDEA 5LGTA 5L3CA 2QTOA 3IC7A 4JPRA 4FIPC 5B1AC 5KUKA 3CCRV 1VQMV 3GWOA 3E8FA 2QEXV 1R73A 1BHAA 3ASNB 2XAJA 1DTOA 1W0JG 4RAIA 2UXXA 3RVZA 2NLJC 3AG3B 3CP1A 4J9YB 2JEUA 2WLJA 3K9AA 3OEHG 4MVUA 2EZPA 4N23A 1SERA 3CCEV 3T4DA 2IJJA 5HFMA 1GMGA 3CC4V 4J9ZB 4MTGA 2FTKA 3CCVV 3AEIA 4PDVA 4MS2A 1OHHG 1QVFU 4KUMA 4QPJA 1I5XA 3G6EV 1YTFB 1G8MA 4MT8A 1QLEC 1EBOA 3RBZA 3ABTA 5H9CA 2ZQMA 4FK5C 5J9PC 5CN0A 1AROP 3ZRXA 3K04A 4KP4A 1N8RW 3SPCA 2Q69A 4MTXA 1GM8A 5KA5A 3CCLV 2ZD9A 5LBQA 2PI5A 3OR7C 3ZCCA 1JPXA 5IDJA 1EZJA 1VQPV 1VQKV 3E83A 3I56V 1V55B 4X8AA 2DYRC 2P67A 2ZR3A 1QR8A 1R3JC 4TWKA 3W7TA 2Y48A 1RM1B 2OT5A 1F4NA 3SYOA 2B5UA 4GX5A 1K33A 4XDLA 3E8HA 3LDCA 4ASUG 1S3JA 3F5WC 4I9WA 1KKDA 3IGAC 1S76D 1EFRG 4H37A 4OXSA 3W7UA 1M1KW 2ZDIC 2EBOA 2K1EA 2XOKG 2PI4A 2DW4A 3RW0A 1MG1A 3UM7A 3AG1C 3JD2A 2WLMA 4UXNA 1VQ6V 3T1CA 4JAUA 3ZMSA 1K4DC 4R8CA 3LSSA 1M90W 2IJIA 2EILC 2EIJC 3P30A 2EZOA 5IYBO 2JDIG 3LUTB 4GX2A 1Y4MA 3CCJV 1TUEB 1LNQA 5CA3A 3OGCC 2XAQA 3FKSG 3OEEG 3CPWU 2ATKC 2WAMA 2UXNA 1XL4A 2WLNA 1CP9A 4F4LA 1BL8A 2ZR2A 3E89A 3WG7B 2NNUA 2V7QG 1W0KG 1KP3A 2DWDC 2QM7A 1K4CC 3G4SV 3A0RA 2R9IA 3LSQA 3TETA 1PNKA 1W2BU 2Q6AA 4G27B 3ASNC 3AG2C 5DN6G 3GB7C 3FB6C 3OFNG 4FPPA 4LBEC 3ZRWB 3FB5C 2B1GA 1I5YA 1AI6A 2IU0A 4PA3A 1FS0G 2X6CA 2W0FC 3OMAB 2YSUB 3UKMA 4RQFA 1YIJV 4PA6A 2ITDC 1KP2A 1K7DA 3JD1A 2QKSA 2JEXA 1DF5A 4L87A 1JVMA 1K34A 4MW3A 4LP8A 3X2QC 1NQTA 1KECA 2Q68A 3CCQV 1ORQC 4JF3A 1R3IC 1ZWIC 3STZC 3HPLC 1DF4A 1NH2C 5L3GA 3AG4C 4JTCB 1MABG 3ABLC 1RPRA 5B1BB 4YXWG 2GSMB 3ZRSA 1ROPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYD O;  1NVP C;  1NH2 D;  1YTF C;  1NVP D;  1YTF D;  1RM1 B;  1NH2 C;  5IYB O;  1RM1 C;  5IYC O; 
#chains in the Genus database with same CATH topology
 1NT2 B;  5IY5 C;  2X6B A;  1PD3 A;  1V9P A;  2E76 B;  4LWS A;  1NH2 D;  4NXN O;  3ABK B;  4DR4 O;  3JAR B;  1N36 B;  1WPX A;  5FPO A;  4H0L B;  2YXY A;  5BXZ A;  1XNR B;  1S0V A;  4JAS A;  2P4V A;  1J95 A;  1PNL A;  2D2C B;  4J11 A;  5B1N A;  4EEQ A;  1AJN A;  1NZ6 A;  1EN4 A;  2ETN A;  1V55 C;  1M56 B;  1KB9 F;  1B06 A;  2WSS G;  3BAA A;  1NVP B;  1VQ5 V;  5KAF Z;  2FML A;  2EIK B;  4AHC A;  1P4R A;  5FL7 G;  5L3F A;  1XHZ A;  4Z2W A;  1TAE A;  1FXK A;  1H2N A;  3ZJZ A;  3Q4H A;  1WA8 A;  2CK3 G;  1BHB A;  2MW2 B;  4JYB A;  3FYE B;  4TOI A;  4DUZ O;  2Y0P A;  5EBM C;  1YHQ V;  1DK1 A;  1AR1 B;  5GTH Z;  2QWP B;  1AJP A;  3VQV A;  2KSD A;  1VQ7 V;  4LWS B;  4LC1 A;  4FMT A;  5B1O A;  1YJ9 V;  4MVM A;  2AZ2 A;  3WB1 A;  1S77 D;  1VQ8 V;  1BQZ A;  5EIB C;  1TGO A;  3D3I A;  2Y69 C;  4ABM A;  3F7Y C;  1IX9 A;  1M9N A;  2JS5 A;  4X1K A;  5HFL A;  1SRY A;  4P30 A;  4DW1 A;  4JI3 B;  2KG7 A;  3AG2 B;  1ZAU A;  4IIJ B;  3FAV B;  4UCV A;  1N4C A;  3B8M A;  3CME V;  4DR6 B;  2RMK B;  2XT9 A;  4DR3 B;  4PDR A;  1AB3 A;  3TK1 A;  1NR1 A;  4XDK A;  4GKJ B;  1GK9 A;  1WA8 B;  1QU7 A;  1JR9 A;  1AJQ A;  5GW7 A;  1Y74 A;  4QE9 A;  1FFT B;  4TV8 B;  4KHP O;  4LF6 B;  2L35 A;  2P4K A;  5LMN O;  4JI3 O;  5BZB A;  5BY1 A;  4D7T A;  4X1Y A;  2VRZ A;  3CCS V;  2DQ0 A;  1VQN V;  3GVM A;  4DXW A;  1RFY A;  4GKK B;  2E5L B;  1JJO A;  3CCU V;  3OAA G;  2JIZ G;  1HP8 A;  4JYA O;  1SC5 B;  4JV5 O;  1K9M W;  5EYP B;  3ZHS A;  3L74 H;  4CC5 A;  4RUF A;  3A0H Z;  3SPJ A;  3KCY A;  4JV5 B;  2ZIO A;  5IY5 B;  4ICG A;  2P6J A;  3IFX A;  3RN4 A;  1IZ3 A;  1S5J A;  3HKE A;  1YTF C;  4X20 A;  5LGU A;  3U0Z A;  3K5O A;  4H13 B;  1OCZ B;  3H9V A;  2GUZ B;  2XAS A;  2QWO B;  2YI8 A;  4X88 A;  2UUC B;  4ZHQ B;  1XHX A;  5LMU B;  4IGG A;  5LMN B;  4CH5 A;  3B40 A;  4LF6 O;  4KHP B;  4DV4 O;  4O4L B;  1OZ0 A;  4RUE A;  4U7N A;  5EZY A;  3CEI A;  1F7Y A;  4DV7 O;  4LNU B;  1N34 O;  2HHH B;  3CC2 V;  1OV9 A;  1MZE A;  2UU9 O;  1THZ A;  3W7S A;  4FFB A;  3CSX A;  4ZBM A;  4ZOL B;  2XAH A;  2Z5U A;  2AHZ A;  4PDL A;  1QBZ A;  5H6Q A;  1JJ2 U;  5GON B;  1FPO A;  4WFA V;  3JCU Z;  4P2Z A;  5TIS Z;  2QE7 G;  3K9S A;  4MVQ A;  4B3S B;  3K5M A;  2PUS A;  1F51 A;  3UO2 A;  2XAF A;  1Q7Y W;  3BVO A;  3OUF A;  3UQ8 A;  1G6U A;  1AI5 A;  3SJB C;  3CRQ A;  2A7W A;  2IJH A;  1D5A A;  5LA6 A;  1V54 C;  1K97 A;  4WCE V;  1GN4 A;  2DOS A;  5LGN A;  2RJZ A;  4KL1 A;  3ZHU A;  4TT3 G;  1JOY A;  4LF8 B;  4O4I B;  2CGN A;  2IU3 A;  3CXC U;  4FLY A;  5LHG A;  1ZTE A;  4LF7 B;  3ABL B;  3OMI B;  4JI0 B;  5CA1 A;  2YID A;  5K1P A;  3STL C;  4EKW A;  3ABM B;  2VQF O;  2ZE6 A;  5B66 Z;  4RO2 A;  4LNU A;  2JK5 C;  4GX0 A;  4UCU A;  3JAW B;  1H2L A;  4OGQ B;  2WLK A;  3DTU B;  3WU2 Z;  5IJ0 B;  4ZOL A;  4DRX B;  5L3C A;  4DV2 B;  2QTO A;  3JAK A;  5FLX N;  4I50 A;  3G80 A;  5KUK A;  1VQM V;  3IAY A;  1HNW B;  2CAZ C;  5JCO C;  2QEX V;  2AXT Z;  4Q6G A;  1I7F A;  5JVD B;  3K9A A;  2LGQ A;  3OEH G;  4MVU A;  2V4D A;  2OCH A;  2EZP A;  4N23 A;  3T4D A;  2IJJ A;  1GMG A;  4Z1V A;  2FTK A;  1M4U A;  3CCV V;  4LR3 A;  4X1K B;  5KAI Z;  1N36 O;  4QPJ A;  1I5X A;  3G6E V;  1G8M A;  2N04 A;  1EBO A;  3ABT A;  2VQE B;  3N2G A;  2OYQ A;  1O9H A;  2G38 A;  1YVW A;  1N8R W;  3TGU H;  3A2F A;  3CRC A;  1N33 B;  3CCL V;  3FAV A;  2CTQ A;  2PI5 A;  1ZSP A;  1R1B A;  2LJ2 A;  1ZL8 A;  3E83 A;  3BFR A;  1BE3 H;  3I56 V;  1YZB A;  4FFK A;  4X8A A;  2DYR C;  1QR8 A;  1R3J C;  4TWK A;  2OT5 A;  4QGP A;  3SYO A;  1K33 A;  4UCT A;  3E8H A;  1I94 B;  5BR8 B;  1S3J A;  3IGA C;  1Y74 B;  2YXH A;  4PI2 A;  3CRR A;  1M1K W;  2XTA A;  4JI1 B;  2ZDI C;  4TV8 A;  4LFC B;  2DW4 A;  4LFC O;  5H5N A;  4UXN A;  4FLW A;  3ZMS A;  1K4D C;  3DXR A;  4EB6 B;  2KQX A;  3FFQ A;  5EYP A;  2EIJ C;  1QHT A;  5EZY B;  4FM1 A;  2EZO A;  1N0N A;  4GKJ O;  3OT7 A;  4HBN A;  3OGC C;  2XAQ A;  3APQ A;  2WAM A;  5KHI A;  2WLN A;  1CP9 A;  3EXA A;  2NNU A;  3SGI A;  3VQW A;  1VF6 C;  2R9I A;  4PHZ A;  4G27 B;  3ASN C;  1CXZ B;  4LBE C;  4YIO A;  2CTW A;  2YSU B;  2UUB O;  1J5E O;  2IBZ H;  2FKX A;  4LP8 A;  3X2Q C;  1KEC A;  3ZHV A;  1XDC A;  2VS0 A;  1XNQ O;  3ETQ A;  1RSO A;  1AP6 A;  2GSM B;  3ZN0 A;  4JGS A;  3TJT A;  4IIJ A;  1WB8 A;  1OCO B;  1A32 A;  1VQO V;  2WPD G;  2LFR A;  3ZMZ A;  2DYS C;  3K08 A;  1SQB H;  4DR1 B;  1Q43 A;  1BCC H;  4K0K O;  3DSQ A;  2ZXW B;  2Q4P A;  3SPH A;  4WFE A;  1S5H C;  3K0D A;  1FJG B;  3G67 A;  3SJC C;  4C7U A;  5CBF A;  3AG3 C;  2UXB B;  3AK2 A;  3OW2 U;  4LF8 O;  2BE3 A;  4MTO A;  3ZN1 A;  2M6Y A;  4X62 B;  4K8X A;  1OCC B;  4HAM A;  1XNR O;  2R9A A;  2YEV A;  3LNN A;  4PI0 A;  3J80 N;  4WFG A;  1Q81 W;  4TV9 B;  2ADQ B;  4W4L A;  3W7W A;  3RYH A;  4PA4 A;  4PA9 A;  2RCV A;  1KD1 W;  4OX9 O;  2OIG A;  2AW9 A;  1H8H G;  1SF9 A;  3KKY A;  2DYS B;  2FB5 A;  1NVP D;  4NXM O;  3AK3 A;  4RQE A;  1VQ9 V;  2UU9 B;  4RWU A;  3MHH C;  1VF7 A;  4O2A A;  1SQQ H;  2V1D A;  3HB3 B;  2UXC B;  3BA9 A;  1W59 A;  3M8A A;  3B8N A;  3JAK B;  2ZE8 A;  4I0X B;  3P3P A;  3X2Q B;  4DR5 B;  1RM1 C;  1G4Y B;  3K06 A;  4JTD B;  5KX5 B;  4DV1 B;  3ZHQ A;  4LFB B;  4WFB V;  3N2G B;  1JX9 A;  1SET A;  2AGA A;  4X64 O;  1QVG U;  4JTA B;  4B3T B;  1SQP H;  2BCC H;  2JJ2 G;  1MA1 A;  3ML0 A;  1H2S B;  2RN9 A;  4NTX A;  2YEV B;  2LW1 A;  4E2L A;  4MW8 A;  1JQ0 A;  1MZF A;  2LP7 A;  3AG7 A;  1EZV H;  4YY3 B;  2IW5 A;  4BAY A;  3NR7 A;  2BOB C;  1DLB A;  3L70 H;  4KXR A;  5JCO A;  5J2T A;  1WJZ A;  3T2M A;  3BRC A;  1SA0 B;  3OUS A;  1YJW V;  4X66 O;  3S3X A;  1R6N A;  1BSM A;  3LNM B;  1YDX A;  5L3E A;  4CS2 A;  4GKK O;  4MVS A;  1AI4 A;  2DJV A;  3AG4 B;  4QIW F;  4BIZ A;  1NH2 B;  1Z5V A;  4QNH B;  2EIK C;  2HLD G;  4K35 A;  3ZIA G;  3OTO O;  1P7G A;  3RFR A;  4W4K A;  3FB8 C;  3DGE A;  3QF7 A;  4LH6 A;  4DV2 O;  3S3W A;  3SDL A;  4YHH B;  2UXD O;  4PV1 B;  1SES A;  2A0L A;  3RYC A;  2R70 A;  2P90 A;  3JAM N;  3ABU A;  1PNM A;  2BOC C;  4ZKI A;  3RVY A;  4LF4 O;  1ENV A;  1K73 W;  2NN4 A;  4XDJ A;  4I9Q A;  5LA6 B;  1GO3 F;  5IJ0 A;  3T1H O;  2WLH A;  3B77 A;  4DR6 O;  4WF9 V;  2E74 B;  5D5P A;  2FL4 A;  1AR5 A;  1QCE A;  3ABK C;  5CA0 B;  1UJW B;  3UT5 A;  4U3F H;  1PM9 A;  1RSO B;  1SQV H;  2ZT9 B;  2UUA B;  1GN3 A;  1Q5O A;  1IXM A;  4DW0 A;  4PD4 F;  1L0L H;  1X4T A;  1IBM B;  2ZE7 A;  4GT1 A;  1U96 A;  1WLE A;  3OGI B;  4WBN A;  4DO2 A;  3JAL A;  1WB7 A;  1FYJ A;  3W7X A;  4B3S O;  3QG5 A;  3B09 A;  4LCU C;  4TQD A;  4E4E A;  2H94 A;  1SZX A;  1VF6 A;  3L73 H;  2XHB A;  3ETG A;  2F1M A;  4HYO A;  3E8B A;  1QLE B;  1MSD A;  2ZM6 B;  3K79 A;  2L6L A;  3ZMU A;  4I0X A;  4MVR A;  2QWN B;  4JI6 B;  3OM3 B;  3ZMT A;  3K59 A;  3OTF A;  3UT5 B;  2EJ7 A;  2FYU H;  1I08 A;  5KX5 A;  3E22 A;  1OCC C;  1Q6I A;  2WWW A;  2Q0A A;  3JD3 A;  4LFA O;  2KG7 B;  2Y0I A;  3CRA A;  4PDM A;  1QR9 A;  4DV0 B;  2BSK A;  5B1A B;  3OR6 C;  5EC2 C;  3EHB B;  4FM0 A;  4HZ3 A;  1ZUQ A;  1FXV A;  3RT3 C;  5EBW C;  5LHH A;  3JCZ A;  1T5E A;  4JI2 O;  3UCS C;  5LOV A;  4JI7 O;  2W6I G;  2WLL B;  2KB1 A;  2EIM B;  1YXB A;  3P3N A;  1P49 A;  3C3S A;  3IC7 A;  1BHA A;  3ASN B;  2XAJ A;  1DTO A;  1W0J G;  2UXX A;  3RVZ A;  3CP1 A;  3DC6 A;  2WLJ A;  2ZKO A;  5C8Y A;  4IHJ A;  1L0N H;  2CH7 A;  2ZNJ A;  1KU9 A;  1SER A;  1AP5 A;  2Q7E A;  3CCE V;  3HKD B;  3CC4 V;  3HKB A;  4MTG A;  3N2K B;  4O2B A;  4MS2 A;  1OHH G;  4L8J A;  5B5E Z;  4KUM A;  1WAZ A;  2LGW A;  1QLE C;  5JJJ B;  3QVN A;  4UB8 Z;  5J9P C;  2IM9 A;  4KP4 A;  1H2M A;  1LUW A;  3SPC A;  5A2Q N;  1GM8 A;  3CJH A;  5LP6 C;  5LBQ A;  5CB4 A;  2GBO A;  1JPX A;  1M93 A;  5IDJ A;  1Q6U A;  5FPR A;  3U10 A;  4IYI A;  4OPH A;  1VQK V;  2BTQ A;  1V55 B;  4DR3 O;  3W7T A;  1IBM O;  1SQG A;  4F6R B;  1SQX H;  3F5W C;  4I9W A;  5J2U A;  3RYF A;  4ZHQ A;  3BPZ A;  1VMG A;  3APO A;  4EFE A;  4OXS A;  1JMK C;  3W7U A;  2PI4 A;  2K1E A;  1IXB A;  1MG1 A;  3UM7 A;  3AG1 C;  2JRI A;  2WLM A;  3L71 H;  1VQ6 V;  4O4L A;  4FLV A;  3LSS A;  1M90 W;  2IJI A;  4I55 A;  2PYL A;  3P30 A;  1XI1 A;  1Y4M A;  1Y67 A;  2PYJ A;  3JAL B;  4YJ2 B;  2ATK C;  4LF9 O;  2UXN A;  4DK1 A;  1BL8 A;  3WG7 B;  1W0K G;  3G4S V;  3A0R A;  2QR4 A;  3LSQ A;  1PNK A;  4X65 B;  3AG2 C;  3ICX A;  3OFN G;  3ZRW B;  4JI8 B;  2B1G A;  1I5Y A;  1P84 F;  4DV5 B;  1PPJ H;  2IU0 A;  4JI4 O;  2Q5Z A;  4PA3 A;  2W0F C;  3UKM A;  4B3R O;  3JD1 A;  2VWK A;  1DF5 A;  2Q68 A;  1R3I C;  1EN5 A;  3E22 B;  5L3G A;  4UB6 Z;  1MAB G;  3ABL C;  4YXW G;  1GTO A;  3ZRS A;  3A8T A;  1CPY A;  5KUM A;  2PZS A;  5CBH A;  1N32 O;  3CCM V;  4UVB A;  4I7Z B;  2BSK B;  4U7O A;  2QWQ B;  1YCI A;  2OTJ V;  5LL6 Y;  1H2G A;  4U3J B;  2DQ3 A;  1VQ4 V;  4GUN A;  4B3T O;  4B3M O;  2HFE C;  2YDE A;  2ZIM A;  3AG1 B;  3T4Z A;  4LF5 B;  2ZCE A;  3MAQ A;  3TCU A;  3H1J H;  5LOV B;  1HNX O;  1V54 B;  4NYK A;  3JAW A;  1K3E A;  2ZIN A;  2QA4 V;  5E1A C;  1XMQ O;  4DRX A;  1JCH A;  4GCZ A;  3ASO B;  4UV8 A;  4WFF A;  5IE9 A;  1H2K A;  3H1H H;  2YC0 A;  4JI5 B;  1TVK B;  1FFX B;  2GTA A;  1EM1 A;  2CH7 B;  3WG7 C;  4O4J A;  5FNV A;  1VAR A;  5B3S B;  5JJN B;  1H8E G;  2YI9 A;  1BMF G;  1L1F A;  1L8D A;  2DN9 A;  2X7R B;  1LR1 A;  4R50 A;  3RYC B;  5KHK A;  1IBK O;  2W6J G;  1NR7 A;  1HNX B;  1XMO B;  3G71 V;  4UVC A;  4LF5 O;  1WP7 A;  4DV6 O;  4B3M B;  1PL4 A;  1WN7 A;  5CB4 B;  1M57 B;  2ARH A;  2F4V B;  1ZX3 A;  1K92 A;  2ADP A;  2PF4 E;  1Y66 A;  2VWJ A;  3JSN A;  4JAV A;  2CE4 A;  2LO1 A;  4TQF A;  4MVZ A;  2GUZ A;  1XRE A;  1COW G;  4K3A A;  3O9O A;  4CBC A;  1UFI A;  4PA7 A;  4FVM A;  1AVM A;  2DYR B;  3VQY A;  4B3R B;  3HR0 A;  4P9P A;  3N27 A;  3T1H B;  2HJF C;  2P06 A;  3OE7 G;  1TVK A;  4I5S A;  3QO7 A;  1N0J A;  1XIL A;  5KMG A;  4DV5 O;  4DR7 O;  3B4S A;  4BR6 A;  4O4J B;  1S72 V;  5ITZ A;  3HKD A;  3ZMV A;  1YIT V;  4X65 O;  5KHG A;  4JZ2 A;  3N2K A;  1Q82 W;  3VOU A;  1QLN A;  3R66 A;  5IWA B;  3OTO B;  4FLX A;  3ETD A;  5IWA O;  4X9Q A;  1AI7 A;  3CS5 A;  4CC6 A;  3J81 N;  4I4T B;  3PN1 A;  1B6Q A;  1GM9 A;  3CJH B;  1P7B A;  3QNE A;  3JD4 A;  2Z0A A;  1XOU A;  3FB7 C;  1UPG A;  4UFZ A;  3U11 A;  4UCO A;  4YJ3 A;  1MNG A;  3WFV A;  4I55 B;  1M56 C;  2AHY A;  4CZZ A;  2JJ1 G;  4Q20 A;  1NBM G;  4O4I A;  4YY3 O;  1FXK B;  5IYD O;  2CTR A;  3GWK C;  2C2A A;  4JZG A;  3SJA C;  2ILM A;  1PKX A;  1URF A;  1R6T A;  2HVJ C;  5LP6 A;  5CMU A;  2P22 C;  4FZ1 A;  3SPG A;  2HG5 C;  2ZDI A;  3H1L H;  3D36 A;  2EJR A;  4UUJ C;  4WFH A;  4H33 A;  1KC8 W;  4EFB A;  3CRM A;  4NR1 A;  3CC7 V;  3ZS8 C;  3D8C A;  2RDC A;  2WA4 A;  4DR5 O;  2EIL B;  1IBL O;  1VEW A;  1FAF A;  1FFX A;  3SYP A;  2R72 A;  3UO3 A;  5E79 Z;  3ZRW A;  2PY5 A;  4J41 A;  1KQS U;  4IHJ B;  4N21 A;  2XND G;  2LFS A;  1BQ0 A;  4IT5 A;  5EK0 A;  2HEP A;  2YIB A;  1GRJ A;  4O2B B;  2WLI A;  1AR4 A;  5IYC O;  1E79 G;  2XAG A;  4PJ0 Z;  4G28 B;  5B3S C;  1GN2 A;  2VQE O;  5H6R A;  2Y69 B;  4AI8 A;  2JVD A;  1K8A W;  1US6 A;  3JD0 A;  3MD0 A;  3PJS K;  5KHH A;  4B08 A;  4J10 A;  4DR7 B;  1EN6 A;  1ZLZ A;  4UVA A;  1Q86 W;  1Y76 B;  2QWR B;  1R6K A;  2HKO A;  4DV0 O;  4MVO A;  5IYZ B;  4O2A B;  2N05 A;  1OCR B;  5J2U B;  3SJQ C;  1GM7 A;  2YUA A;  2NR5 A;  1HNW O;  3CYO A;  1M5I A;  4JI6 O;  1FJG O;  3MHS C;  2ZE5 A;  2A9H A;  1E1R G;  1VP7 A;  2F4V O;  2JGU A;  4JI4 B;  3LSU A;  4DR1 O;  2H8P C;  3E86 A;  4UV9 A;  4DV6 B;  4JI8 O;  2X0L A;  1NVP C;  3EFF K;  2DWE C;  1XL6 A;  1YF2 A;  2VQF B;  2Q9L A;  1JA8 A;  5JH7 B;  2BTQ B;  2B1I A;  4LF7 O;  2AZ0 A;  3K5N A;  4R6Z A;  2YXL A;  3JSL A;  4F6R A;  4CS3 A;  1G1X B;  5LGT A;  5F2V O;  5B1A C;  4FIP C;  4X1I B;  3GWO A;  5J2T B;  4FLU A;  1I0H A;  1GN6 A;  3MDS A;  4IL6 Z;  4RAI A;  2UUB B;  2NLJ C;  3AG3 B;  3L72 H;  2E75 B;  3CHX A;  2JGD A;  2JEU A;  3FX7 A;  2LQT A;  2UUA O;  3VQX A;  4DUY B;  3IJ4 A;  5H2F Z;  4J9Z B;  5AG2 A;  5KLV H;  1HNZ O;  1QNM A;  4MT8 A;  2Y4T A;  5H9C A;  1D5N A;  4FK5 C;  3ZX6 A;  1ARO P;  3ZRX A;  2Q69 A;  4MTX A;  1N34 B;  2HHH O;  2ZD9 A;  4DV3 B;  5JWP A;  5DED A;  3OR7 C;  2F95 B;  3ZCC A;  5K1X A;  1EZJ A;  4GYC B;  4YJ3 B;  2ZR3 A;  1F4N A;  4XDL A;  3SR2 C;  4I4T A;  1S76 D;  3ZHR A;  4H37 A;  4LH7 A;  3RGB A;  2EBO A;  2XOK G;  4HNA B;  4NKG B;  5FNV B;  5BMV B;  4JYY A;  4U3J A;  1WPB A;  3LUT B;  4LF9 B;  1LNQ A;  4CH6 A;  1BZK A;  5CA3 A;  3CPW U;  3CXH F;  2W0X A;  4DV3 O;  2DWD C;  1KP3 A;  2V7Q G;  3BHP A;  1FKA O;  4CH4 A;  2Q6A A;  5DN6 G;  4X64 B;  3FB5 C;  5IYZ A;  4LFA B;  2QSA A;  1AI6 A;  1HNZ B;  1HR0 O;  3A0B Z;  1TUB B;  4DUY O;  2YIA A;  1K7D A;  4L87 A;  1TA8 A;  1Y6X A;  2JEX A;  2QKS A;  1JVM A;  3WB2 A;  1NQT A;  4ZI7 A;  3K57 A;  3CCQ V;  3HKC A;  3C3T A;  3CWB H;  4JF3 A;  4FLT A;  1Q3E A;  3K58 A;  2ZM6 O;  1S5L Z;  1BS3 A;  2UXC O;  5B1B B;  1OCO C;  1D2D A;  1O9G A;  3VBB A;  4O4H A;  4J7Z A;  5LHI A;  3O65 A;  4KFM A;  1F4M A;  2EUL A;  3H1K H;  2QM4 A;  1YEW A;  1OCZ C;  4CH3 A;  2ZXW C;  4BW5 A;  4NTY A;  2WLL A;  2PGG A;  1K5Q A;  4BIU A;  5GTI Z;  4FLZ A;  1PL0 A;  3I55 V;  1IVS A;  4UCS A;  3JAS A;  4X89 A;  4AIL C;  2Q67 A;  1SZT A;  1SA0 A;  2D3O W;  3AK1 A;  4JI5 O;  1BGY H;  5B1B C;  2JGD B;  5LXT B;  5C8Y B;  1KMI Z;  3DXR B;  4EB6 A;  3M99 B;  4G2K A;  5LYJ A;  2UXB O;  2HR3 A;  3KG2 A;  2EIN C;  3HKB B;  1HR0 B;  3KCX A;  3BY6 A;  4JI7 B;  4ZI7 B;  1KKC A;  2GDS A;  3SYA A;  3CMA V;  4XBF A;  3QO5 A;  4J7J A;  2OTL V;  3SYC A;  2YS8 A;  1N32 B;  2IH1 C;  1Q6H A;  5D5Q A;  3ZHT A;  3P32 A;  2ODM A;  5EBL C;  4QJF B;  4YHH O;  2UXD B;  4DV4 B;  1GH6 A;  1NTZ H;  2X6A A;  1HWY A;  3RYI B;  1FD9 A;  1FXK C;  3ASO C;  4B7E A;  5IJ9 B;  1XNQ B;  3RYF B;  2Q7H A;  2UUC O;  1SS3 A;  2F66 C;  1F23 A;  4DYL A;  1NTK H;  3F7V C;  4UCR A;  3JYC A;  3JAS B;  2QKA A;  3CD6 V;  1AIL A;  4Z1M G;  3K5L A;  1HDJ A;  1CEZ A;  3WB0 A;  2QM8 A;  4X66 B;  4BW9 A;  2OCC B;  5LXT A;  2F43 G;  5LP6 B;  1KBH A;  4IYH A;  4DR4 B;  4WBN B;  2A3Q A;  4NXN B;  1VQL V;  4D6T H;  2EX3 A;  1R3L C;  1YSC A;  1JFF A;  2Z3Y A;  4J42 A;  1YJN V;  4JYA B;  3H01 A;  4ZIB A;  3D36 C;  1GKF A;  2E5L O;  1M57 C;  2CUG A;  4AQY O;  1Y76 A;  1QQC A;  1GAX A;  4B7K A;  4NVP A;  1WP8 A;  2IJK A;  2A06 H;  5BMV A;  4DV1 O;  3I5D A;  2P5O A;  2WLI B;  1NJI W;  4GX1 A;  2Q0O C;  1E1Q G;  1IDS A;  2GHY A;  1Z2G A;  2IH3 C;  4LF4 B;  1NKD A;  4QPK A;  4HNA A;  4TV9 A;  1YI2 V;  4TUY A;  3SPI A;  2OCC C;  4PEL A;  4MTF A;  4D7S A;  5KA6 A;  4QE7 A;  1RPO A;  2H3O A;  3K3W A;  3L75 H;  2YIB D;  1FXH A;  2XUM A;  1N33 O;  2Y4U A;  1ZL8 B;  1NS1 A;  1B04 A;  3SYQ A;  3TXQ A;  2CTP A;  2HP8 A;  4BIO A;  2LW7 A;  4FZ0 A;  2EIJ B;  1R3K C;  3DC5 A;  3R65 A;  4JYC A;  4X62 O;  3JAT A;  2Q73 A;  2R9R B;  1K5S A;  3BAB A;  2HVK C;  5JQG A;  3NXS A;  1NTM H;  2CGO A;  1DGS A;  4CS4 A;  2F23 A;  3H1I H;  4GLX A;  5LYJ B;  1TUB A;  3K03 A;  3ZRV A;  4O4H B;  5C93 A;  5JH7 A;  4JI2 B;  5EC1 C;  4DUZ B;  3E8G A;  3K0G A;  2E3C A;  1YTF D;  3BEH A;  3FD9 A;  4FJC C;  4X1I A;  1HW7 A;  1XMO O;  3ABM C;  5L3B A;  1IBK B;  3OMN B;  3IC9 A;  4LFB O;  1PP9 H;  4A5U B;  4JI0 O;  2Q7G A;  1MSW D;  2RNB A;  1MOF A;  2M7W A;  3ZED A;  4J80 A;  3THO A;  2A79 B;  4R7C A;  3ETE A;  2GTS A;  4OPA A;  3J7A U;  4K8Z A;  2B9Z A;  1H38 A;  3G6B A;  5EIB D;  1J5E B;  4J7K A;  5DM6 V;  1Q8I A;  4MSW C;  1IBL B;  1OCR C;  2EIN B;  4NB5 A;  1WNS A;  2P7T C;  3E35 A;  3L9D A;  5KMG B;  3QO8 A;  5CBG A;  4P9O A;  1Q90 D;  1IUR A;  5L3D A;  1KUQ A;  3LDD A;  3TXS A;  2MK3 A;  4OX9 B;  5ITZ B;  2QKC A;  1XMQ B;  3FYI B;  2KKW A;  4YJ2 A;  4F6E A;  3E2E A;  2JS3 A;  4TSF G;  2ITC C;  2EIM C;  5IT9 N;  3HKE B;  3LDE A;  4X20 B;  2QJ1 A;  2HJD A;  5DEC A;  4JPR A;  3CCR V;  3C90 A;  3E8F A;  3ZBH A;  1R73 A;  3BCC H;  5CA0 A;  2WA3 A;  2CDY A;  4DV7 B;  4BWA A;  1RP3 B;  4J9Y B;  1NI8 A;  2QGN A;  2Q8V A;  3CB2 A;  3CX5 F;  2PTM A;  3T1Y O;  2QDO A;  4DR2 O;  2ZNI A;  1B3Q A;  3D3Q A;  1X59 A;  1U97 A;  5HFM A;  2BTO A;  5LMU O;  2RQ6 A;  1VF5 B;  3AEI A;  4PDV A;  4K0K B;  4FM2 A;  5BR8 O;  5KHJ A;  1QVF U;  1JFF B;  1YTF B;  3RYH B;  4TUY B;  3RBZ A;  4H44 B;  2N74 A;  3QTC A;  2ZQM A;  1PV0 A;  5CN0 A;  3K04 A;  4YIP A;  5KA5 A;  3EVK A;  2DE0 X;  1VIB A;  5GON A;  1LUV A;  3F5T A;  1VQP V;  1XQ8 A;  2OIE A;  2P67 A;  1RM1 B;  2Y48 A;  2B5U A;  4GX5 A;  3LDC A;  4ASU G;  3HKC B;  1XEQ A;  1KKD A;  1SQF A;  1EFR G;  1KYO F;  2QTS A;  3RW0 A;  3KZI Z;  3JD2 A;  2GV9 A;  4JAU A;  3T1C A;  1NU1 H;  3B2E E;  4R8C A;  4X1Y B;  2EIL C;  3OD4 A;  5IYB O;  2JDI G;  4GX2 A;  3JAR A;  3CCJ V;  5CA1 B;  1TUE B;  1MMM A;  1SKV A;  2OWO A;  5A9G A;  3FKS G;  2O57 A;  3CE2 A;  3OEE G;  1XL4 A;  1OJH A;  4F4L A;  1XUQ A;  2F93 B;  2ZR2 A;  3E89 A;  2QM7 A;  1K4C C;  3TET A;  1W2B U;  4I50 B;  3JAT B;  3GB7 C;  3FB6 C;  4FPP A;  3BA8 A;  4GZR B;  4DR2 B;  3RYI A;  4JI1 O;  1XBL A;  3T1Y B;  1FS0 G;  2X6C A;  3OMA B;  5JVD A;  2K9P A;  4RQF A;  1YIJ V;  4PA6 A;  5IJ9 A;  1BT8 A;  2ITD C;  1I94 O;  2DMX A;  1KP2 A;  4NTW A;  1K34 A;  4MW3 A;  3Q4H B;  3M7M X;  4AQY B;  1ORQ C;  3RWR D;  1ZWI C;  1Z5W A;  5JJE B;  3STZ C;  3HPL C;  1DF4 A;  1NH2 C;  3AG4 C;  4JAA A;  4JTC B;  4NXM B;  4FFB B;  1RPR A;  5JQG B;  2YIC A;  4DK0 A;  1ROP A; 
#chains in the Genus database with same CATH homology
 1CPY A;  5KUM A;  1OCO C;  3ZN0 A;  4JGS A;  5CBH A;  5IY5 C;  2X6B A;  1OCO B;  1PD3 A;  3VBB A;  3CCM V;  4UVB A;  4U7O A;  1VQO V;  2WPD G;  5LHI A;  2OTJ V;  2LFR A;  4KFM A;  1NH2 D;  3ZMZ A;  2DYS C;  3K08 A;  1F4M A;  1H2G A;  2DQ3 A;  1VQ4 V;  3ABK B;  2HFE C;  3AG1 B;  3T4Z A;  1OCZ C;  1WPX A;  3TCU A;  2ZXW C;  1V54 B;  4BW5 A;  1S0V A;  4JAS A;  2WLL A;  2ZXW B;  1K5Q A;  1K3E A;  1J95 A;  3SPH A;  2QA4 V;  4BIU A;  5E1A C;  1PNL A;  5B1N A;  1PL0 A;  1S5H C;  4WFE A;  3I55 V;  1JCH A;  3K0D A;  1AJN A;  4GCZ A;  3ASO B;  4UV8 A;  4WFF A;  4X89 A;  1V55 C;  1M56 B;  5CBF A;  3AG3 C;  2Q67 A;  1SZT A;  2D3O W;  3OW2 U;  5B1B C;  2WSS G;  1NVP B;  1VQ5 V;  3WG7 C;  3M99 B;  4G2K A;  2EIK B;  2HR3 A;  4MTO A;  3KG2 A;  3ZN1 A;  2EIN C;  1P4R A;  5FL7 G;  5B3S B;  5L3F A;  1OCC B;  4HAM A;  3BY6 A;  1H8E G;  2YEV A;  1BMF G;  1FXK A;  4WFG A;  3ZJZ A;  1Q81 W;  2CK3 G;  3W7W A;  3SYA A;  1BHB A;  1L1F A;  3CMA V;  4JYB A;  4XBF A;  2X7R B;  3FYE B;  4PA4 A;  3QO5 A;  2OTL V;  4R50 A;  3SYC A;  2W6J G;  4PA9 A;  1NR7 A;  1KD1 W;  2IH1 C;  5EBM C;  3G71 V;  4UVC A;  1H8H G;  1YHQ V;  2DYS B;  1AR1 B;  3P32 A;  1NVP D;  1AJP A;  1M57 B;  5EBL C;  4RQE A;  1VQ7 V;  1K92 A;  4QJF B;  4LC1 A;  1VQ9 V;  4FMT A;  5B1O A;  1GTO A;  1YJ9 V;  3MHH C;  1Y66 A;  4MVM A;  2X6A A;  1HWY A;  4JAV A;  1S77 D;  2V1D A;  3HB3 B;  1VQ8 V;  4MVZ A;  1FXK C;  3D3I A;  1COW G;  2Y69 C;  3ASO C;  3F7Y C;  3B8N A;  4CBC A;  1M9N A;  3X2Q B;  1F23 A;  3F7V C;  1RM1 C;  3JYC A;  1G4Y B;  4PA7 A;  2DYR B;  5HFL A;  3CD6 V;  3K06 A;  4JTD B;  4P9P A;  4Z1M G;  1SRY A;  4P30 A;  2HJF C;  4I5S A;  3OE7 G;  1CEZ A;  2QM8 A;  3QO7 A;  4WFB V;  1JX9 A;  2OCC B;  2F43 G;  1SET A;  3AG2 B;  1QVG U;  1S72 V;  3B8M A;  4JTA B;  3CME V;  2JJ2 G;  3ZMV A;  1YIT V;  4PDR A;  1VQL V;  3ML0 A;  3TK1 A;  1Q82 W;  1NR1 A;  3VOU A;  1R3L C;  4XDK A;  1YSC A;  2YEV B;  1QLN A;  1GK9 A;  2Z3Y A;  3ETD A;  4E2L A;  1YJN V;  4MW8 A;  1AI7 A;  1JQ0 A;  2LP7 A;  1AJQ A;  5GW7 A;  3H01 A;  2IW5 A;  4BAY A;  1GKF A;  1M57 C;  2BOB C;  1B6Q A;  1DLB A;  1GM9 A;  1P7B A;  3QNE A;  4QE9 A;  1FFT B;  3T2M A;  3JD4 A;  3FB7 C;  2IJK A;  3OUS A;  1YJW V;  5BZB A;  1R6N A;  3LNM B;  5L3E A;  4MVS A;  3WFV A;  3CCS V;  1M56 C;  2DQ0 A;  2WLI B;  1VQN V;  1AI4 A;  4QIW F;  3AG4 B;  1NJI W;  4GX1 A;  2AHY A;  4BIZ A;  4CZZ A;  4DXW A;  1NH2 B;  1E1Q G;  2JJ1 G;  4Q20 A;  1NBM G;  3CCU V;  3OAA G;  2JIZ G;  2GHY A;  2IH3 C;  4QNH B;  2EIK C;  1NKD A;  4QPK A;  1FXK B;  2HLD G;  3ZIA G;  5IYD O;  1YI2 V;  3SPI A;  3FB8 C;  3DGE A;  2C2A A;  1K9M W;  2OCC C;  4PEL A;  4MTF A;  1PKX A;  1SES A;  2A0L A;  5KA6 A;  2P90 A;  4QE7 A;  1RPO A;  2HVJ C;  3K3W A;  4RUF A;  3SPJ A;  5CMU A;  3ABU A;  1PNM A;  3SPG A;  2BOC C;  5IY5 B;  1FXH A;  2HG5 C;  2ZDI A;  2P6J A;  4ZKI A;  3RVY A;  1ENV A;  3IFX A;  1K73 W;  3D36 A;  2EJR A;  4UUJ C;  4WFH A;  4H33 A;  1KC8 W;  4XDJ A;  1GO3 F;  1YTF C;  2WLH A;  3B77 A;  3SYQ A;  5LGU A;  3CC7 V;  4WF9 V;  1OCZ B;  2XAS A;  1QCE A;  3ABK C;  4X88 A;  1UJW B;  2EIL B;  2EIJ B;  1R3K C;  3R65 A;  4JYC A;  2R9R B;  3SYP A;  1K5S A;  3ZRW A;  1IXM A;  2HVK C;  1KQS U;  4N21 A;  3NXS A;  2XND G;  2LFS A;  1OZ0 A;  4RUE A;  3K03 A;  3ZRV A;  4U7N A;  5EK0 A;  4GT1 A;  5C93 A;  2WLI A;  5IYC O;  1WLE A;  3CC2 V;  1E79 G;  4DO2 A;  5EC1 C;  2XAG A;  4G28 B;  5B3S C;  3E8G A;  3W7X A;  1THZ A;  3W7S A;  3K0G A;  2Y69 B;  5H6R A;  4ZBM A;  1YTF D;  3BEH A;  2XAH A;  1K8A W;  2Z5U A;  4FJC C;  2AHZ A;  4LCU C;  4PDL A;  3JD0 A;  3MD0 A;  3PJS K;  1QBZ A;  2H94 A;  5H6Q A;  1JJ2 U;  3ABM C;  3ETG A;  4WFA V;  5L3B A;  3OMN B;  4P2Z A;  2QE7 G;  4UVA A;  4MVQ A;  1Q86 W;  1F51 A;  1R6K A;  2HKO A;  2XAF A;  1Q7Y W;  1MSW D;  4HYO A;  3OUF A;  4MVO A;  3E8B A;  1AI5 A;  1MOF A;  2M7W A;  1OCR B;  2IJH A;  1QLE B;  3SJQ C;  1GM7 A;  2A79 B;  3K79 A;  4R7C A;  3ETE A;  1V54 C;  1K97 A;  3ZMU A;  4WCE V;  4MVR A;  1H38 A;  3CYO A;  3OM3 B;  5LGN A;  3ZMT A;  3MHS C;  4TT3 G;  1JOY A;  5DM6 V;  2A9H A;  1E1R G;  2IU3 A;  1OCC C;  2WWW A;  4MSW C;  1OCR C;  2EIN B;  3JD3 A;  3CXC U;  2P7T C;  3E35 A;  2H8P C;  3E86 A;  3QO8 A;  4UV9 A;  5LHG A;  5CBG A;  4P9O A;  2X0L A;  4PDM A;  1NVP C;  5L3D A;  3EFF K;  2DWE C;  3ABL B;  1QR9 A;  2MK3 A;  3LDD A;  1XL6 A;  3OMI B;  3OR6 C;  5B1A B;  5EC2 C;  3EHB B;  3STL C;  3FYI B;  4HZ3 A;  3ABM B;  4EKW A;  1FXV A;  5EBW C;  5LHH A;  2B1I A;  4RO2 A;  2JK5 C;  3JCZ A;  3E2E A;  4GX0 A;  4TSF G;  2W6I G;  2WLL B;  2ITC C;  2EIM C;  2KB1 A;  4R6Z A;  2EIM B;  2WLK A;  3DTU B;  3LDE A;  5LGT A;  5L3C A;  2QTO A;  3IC7 A;  4JPR A;  4FIP C;  5B1A C;  5KUK A;  3CCR V;  1VQM V;  3GWO A;  3E8F A;  2QEX V;  1R73 A;  1BHA A;  3ASN B;  2XAJ A;  1DTO A;  1W0J G;  4RAI A;  2UXX A;  3RVZ A;  2NLJ C;  3AG3 B;  3CP1 A;  4J9Y B;  2JEU A;  2WLJ A;  3K9A A;  3OEH G;  4MVU A;  2EZP A;  4N23 A;  1SER A;  3CCE V;  3T4D A;  2IJJ A;  5HFM A;  1GMG A;  3CC4 V;  4J9Z B;  4MTG A;  2FTK A;  3CCV V;  3AEI A;  4PDV A;  4MS2 A;  1OHH G;  1QVF U;  4KUM A;  4QPJ A;  1I5X A;  3G6E V;  1YTF B;  1G8M A;  4MT8 A;  1QLE C;  1EBO A;  3RBZ A;  3ABT A;  5H9C A;  2ZQM A;  4FK5 C;  5J9P C;  5CN0 A;  1ARO P;  3ZRX A;  3K04 A;  4KP4 A;  1N8R W;  3SPC A;  2Q69 A;  4MTX A;  1GM8 A;  5KA5 A;  3CCL V;  2ZD9 A;  5LBQ A;  2PI5 A;  3OR7 C;  3ZCC A;  1JPX A;  5IDJ A;  1EZJ A;  1VQP V;  1VQK V;  3E83 A;  3I56 V;  1V55 B;  4X8A A;  2DYR C;  2P67 A;  2ZR3 A;  1QR8 A;  1R3J C;  4TWK A;  3W7T A;  2Y48 A;  1RM1 B;  2OT5 A;  1F4N A;  3SYO A;  2B5U A;  4GX5 A;  1K33 A;  4XDL A;  3E8H A;  3LDC A;  4ASU G;  1S3J A;  3F5W C;  4I9W A;  1KKD A;  3IGA C;  1S76 D;  1EFR G;  4H37 A;  4OXS A;  3W7U A;  1M1K W;  2ZDI C;  2EBO A;  2K1E A;  2XOK G;  2PI4 A;  2DW4 A;  3RW0 A;  1MG1 A;  3UM7 A;  3AG1 C;  3JD2 A;  2WLM A;  4UXN A;  1VQ6 V;  3T1C A;  4JAU A;  3ZMS A;  1K4D C;  4R8C A;  3LSS A;  1M90 W;  2IJI A;  2EIL C;  2EIJ C;  3P30 A;  2EZO A;  5IYB O;  2JDI G;  3LUT B;  4GX2 A;  1Y4M A;  3CCJ V;  1TUE B;  1LNQ A;  5CA3 A;  3OGC C;  2XAQ A;  3FKS G;  3OEE G;  3CPW U;  2ATK C;  2WAM A;  2UXN A;  1XL4 A;  2WLN A;  1CP9 A;  4F4L A;  1BL8 A;  2ZR2 A;  3E89 A;  3WG7 B;  2NNU A;  2V7Q G;  1W0K G;  1KP3 A;  2DWD C;  2QM7 A;  1K4C C;  3G4S V;  3A0R A;  2R9I A;  3LSQ A;  3TET A;  1PNK A;  1W2B U;  2Q6A A;  4G27 B;  3ASN C;  3AG2 C;  5DN6 G;  3GB7 C;  3FB6 C;  3OFN G;  4FPP A;  4LBE C;  3ZRW B;  3FB5 C;  2B1G A;  1I5Y A;  1AI6 A;  2IU0 A;  4PA3 A;  1FS0 G;  2X6C A;  2W0F C;  3OMA B;  2YSU B;  3UKM A;  4RQF A;  1YIJ V;  4PA6 A;  2ITD C;  1KP2 A;  1K7D A;  3JD1 A;  2QKS A;  2JEX A;  1DF5 A;  4L87 A;  1JVM A;  1K34 A;  4MW3 A;  4LP8 A;  3X2Q C;  1NQT A;  1KEC A;  2Q68 A;  3CCQ V;  1ORQ C;  4JF3 A;  1R3I C;  1ZWI C;  3STZ C;  3HPL C;  1DF4 A;  1NH2 C;  5L3G A;  3AG4 C;  4JTC B;  1MAB G;  3ABL C;  1RPR A;  5B1B B;  4YXW G;  2GSM B;  3ZRS A;  1ROP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...