1NTMH

Crystal structure of mitochondrial cytochrome bc1 complex at 2.4 angstrom
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
ELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1ntmH00
4U3FH 2IBZH 1L0LH 1P84F 1SQVH 4PD4F 3L74H 3TGUH 3L71H 3H1IH 1BGYH 1NTKH 1NU1H 1SQQH 1KB9F 2A06H 3CX5F 3CXHF 2FYUH 3H1JH 1EZVH 1SQXH 1PP9H 3L75H 1NTMH 3BCCH 3H1KH 1BCCH 1PPJH 3H1HH 4D6TH 1BE3H 3H1LH 3CWBH 3L72H 1NTZH 1SQPH 5KLVH 1KYOF 3L73H 1L0NH 2BCCH 3L70H 1SQBH
chains in the Genus database with same CATH superfamily
4I50B 5DN6G 1W0KG 3ZHTA 4LF5O 2N74A 2BTQB 4O4LA 4EKWA 3L71H 1IVSA 1JQ0A 5L3EA 2JEXA 5JVDA 1VQLV 4NXNB 4DUZO 1K97A 5EK0A 1QBZA 1T5EA 3BEHA 4X1KB 2P4VA 1NVPD 3HPLC 3WB2A 3APQA 1S77D 3B8NA 1PV0A 4LP8A 3T1HO 1JX9A 1IBLO 1SZTA 1BL8A 4FLYA 4NXMO 2ILMA 4I4TA 2XHBA 1MSDA 2X6BA 3ZHRA 5JQGA 1BSMA 2EIMC 2Q68A 3ZCCA 1E1RG 4GKJB 2O57A 4K0KO 3VQVA 2Q7GA 2B1GA 4YHHO 2E3CA 1VMGA 1QU7A 4JTDB 4D7SA 4UCSA 4J7JA 3JASB 2AZ2A 1EZJA 1PNLA 2F93B 3HKEB 3X2QC 4NKGB 2HP8A 4R50A 1AI5A 3AG3C 4Q20A 1K8AW 4G28B 3WU2Z 1KYOF 1GM9A 1F4MA 1K7DA 5IJ9B 3A8TA 4TQDA 3S3WA 3FYIB 1Q82W 1RSOA 2IU3A 5JH7B 4HAMA 4GLXA 3C90A 2JS3A 1FFXB 4UB8Z 5LHGA 3K9SA 1IURA 4UCVA 3CCRV 3W7TA 2KKWA 1L0LH 2JGDA 3K5LA 2ZT9B 2NN4A 3OW2U 4O4HB 2P7TC 3AG2B 4DUYO 2RJZA 1ENVA 1KU9A 3E86A 2XAGA 1KBHA 2CAZC 1OCCC 3ZJZA 4F6RB 1QR8A 1MABG 1Q81W 2BOBC 4LWSA 2EZOA 4CS3A 2GDSA 5B1AB 1VQ6V 1DK1A 3ZN0A 1FYJA 2JEUA 3JAKB 2DMXA 1YZBA 2BTOA 2NNUA 1I7FA 5CMUA 4TQFA 5JCOA 5LP6B 3CCJV 3CE2A 4FLTA 1RM1B 3ZMSA 3CYOA 5LOVA 1XBLA 4CS2A 2R72A 4QIWF 1GKFA 2Q8VA 3G80A 4GX0A 3E83A 1G8MA 5LGUA 4H33A 5KUMA 2WLLA 5D5PA 5LXTB 4DR2O 4DV1O 3SPCA 1YDXA 2EIKC 1OV9A 1M57C 5EIBD 1NH2D 2Q7HA 2QDOA 2A0LA 1IBMO 4JAUA 4U7NA 2CH7B 2LP7A 5IY5C 2DYRC 2Q7EA 1LUWA 4CH4A 2ZE5A 3W7SA 1GN6A 1E1QG 1VQKV 4E2LA 4PA7A 4L8JA 3RYCB 1XNQO 4B7EA 4UFZA 2QKSA 3HKCA 1FFTB 4DR5B 4LC1A 2ZM6B 4JAAA 4L87A 2OIEA 4AQYO 2UU9O 4JASA 3BAAA 3SJBC 1NJIW 1TGOA 1P49A 4UXNA 2VS0A 3CP1A 3CD6V 4JI4O 1VF5B 1RFYA 4J10A 3E89A 2PUSA 4GZRB 1SETA 2ITCC 4PDLA 3M7MX 4UCOA 4FPPA 3JALB 3CPWU 5C8YB 4NYKA 1VQNV 5CA3A 2EILB 3MHSC 4X1IB 1L1FA 5D5QA 1W59A 2LJ2A 3G4SV 4KXRA 3K03A 4DV0B 4X62B 3ABKC 4Z1MG 3BHPA 1BT8A 4MVUA 2GV9A 3ABMC 4HBNA 2L35A 4K8XA 2A06H 4RQFA 4X20A 1Y67A 4JYAO 1XMQB 2DWDC 1SF9A 4LBEC 2GTSA 3OUSA 4O2AB 1N36O 1RPOA 1FPOA 4ZHQA 1PNKA 4NTWA 2YXYA 4U3FH 2IJIA 4X66B 2KG7A 3D3QA 1M4UA 2QKAA 4WFEA 1SKVA 3E35A 4X65B 3P32A 1QNMA 2B9ZA 3SPHA 3CJHB 4PDMA 1N0NA 1XDCA 5DECA 2E5LB 4LFCB 1WB8A 1V9PA 1UFIA 1HR0O 2HFEC 5H9CA 4Z2WA 4JI6B 1Q5OA 2RN9A 4OXSA 2YI9A 1CXZB 4LFBB 3RGBA 4O2BB 1GH6A 2PI5A 1A32A 3CHXA 4UVCA 4GUNA 1PKXA 2ZNIA 2D3OW 3BABA 1YVWA 3FB6C 1K5SA 1LR1A 2Y4TA 2ZXWC 1OJHA 3E2EA 4KFMA 1WPBA 3E22A 4R6ZA 3B40A 2DYSC 1D5NA 1V54B 4FLWA 4I55B 2CTRA 3D36C 1QHTA 3KCYA 4EEQA 4O4IA 4B3TO 3RYIA 4WCEV 4CH3A 4OPHA 2CE4A 3QTCA 4MTFA 5CBFA 4JTAB 4JV5B 2ZE8A 3KZIZ 4H44B 2P4KA 3AG4B 4GT1A 4BIOA 4ZKIA 5DM6V 2VWKA 3OFNG 1ZTEA 1AJQA 1PNMA 2UUBB 5L3FA 1SQPH 3T4DA 4U3JB 2ZDIA 4CZZA 2H8PC 3OGCC 4LF7B 1Q3EA 1VQPV 3DC5A 4JF3A 3Q4HA 2ZD9A 2JJ2G 1PD3A 1AJPA 2QWRB 3IFXA 1Z5WA 2IJKA 5CBHA 3ZMZA 1B06A 2GTAA 3AG1C 2ITDC 1BZKA 5EBLC 4FZ1A 3K0DA 4E4EA 1OCZB 2QE7G 4XBFA 4FM1A 3QVNA 3K06A 3LUTB 1NI8A 1YEWA 3EHBB 4MVQA 1EFRG 5BR8O 2CGNA 4WBNA 3SDLA 2F66C 3TCUA 1AR4A 3FAVA 1JA8A 1VIBA 3A0BZ 3B8MA 3ASNC 3NXSA 1K33A 4N23A 3BA8A 4ABMA 2YI8A 5ITZB 1S72V 2ARHA 3I5DA 2A79B 4FK5C 1XL4A 1L8DA 3LSQA 1JR9A 4FFBA 2HJFC 2DWEC 2QTSA 4F6EA 2C2AA 3G6EV 1ZL8A 2Y69B 2UXNA 3OR6C 4UV9A 4B3MO 2W0XA 3JARA 4TUYB 4JI8O 5J2TA 5B3SC 4FM2A 3FKSG 3JSLA 2QM7A 3STZC 5EC1C 1GN4A 4JI1O 4LF6B 5EYPB 2WLIA 2KQXA 5IWAB 3CCUV 1V55C 3CRRA 3E22B 2EINB 1B3QA 2YDEA 2OYQA 3MHHC 2XAJA 4P9PA 1KUQA 2IJHA 2QSAA 1BQ0A 4MS2A 1H2SB 2Q73A 3JATB 2PI4A 3N2GB 2X6AA 4EFEA 3NR7A 1I5YA 3E8GA 5BY1A 2G38A 1WA8B 2QWOB 2Q9LA 3CX5F 1OCOC 2GUZB 5CB4B 4ZOLB 1OHHG 4OGQB 3FYEB 1U96A 1NBMG 2XOKG 4TV8A 3TXQA 2UXDB 2F23A 2W6IG 3CCMV 2UXCB 1MA1A 5F2VO 4J80A 5KA6A 1D2DA 2KB1A 2F95B 2H94A 3CEIA 5KAFZ 2CTPA 4X88A 2E74B 1PPJH 4YIOA 2DW4A 2NLJC 2WPDG 4PA9A 3K5NA 5LA6A 1K3EA 4DV3O 2BSKB 3ZX6A 2Q6AA 3BRCA 3RFRA 2QTOA 3CCVV 5IDJA 2WAMA 1WNSA 4JI5B 3EVKA 3G71V 1SESA 5LMUO 4O4JB 1WP7A 4IYIA 3K59A 3RYFA 2F4VB 2RNBA 4NXNO 4G2KA 3CWBH 1PM9A 2IM9A 1QLEB 1HWYA 4DR7B 3CXHF 3IAYA 3UT5A 2JS5A 2ZR3A 1SA0B 1S5HC 4PD4F 2JJ1G 1ZUQA 1KP3A 1Y76B 3RYHA 4OX9B 2EBOA 1R6NA 1H38A 3QO8A 5KX5A 5IYZB 1IXMA 4JAVA 4DR6B 4EB6A 2HVJC 2VQFB 3FB7C 1S76D 3OMNB 3BY6A 4GCZA 1VF6C 4HYOA 4GX1A 4DV4B 3HKBA 1XILA 1AVMA 1YITV 4PHZA 5K1XA 5E1AC 1JVMA 4LH6A 3U11A 3G6BA 5H2FZ 4CS4A 4YHHB 3VQWA 5AG2A 4ZIBA 4FVMA 2R9AA 3K3WA 3K5MA 3LDEA 4TV8B 3RVZA 2IH1C 3OMAB 4JZ2A 3AG2C 1YTFD 2WLJA 5GONB 1ZX3A 3H1IH 1H2NA 3STLC 4K8ZA 3JAWB 2E75B 3ZHQA 1KKCA 1E79G 3CRAA 5B5EZ 3M8AA 3QG5A 3RN4A 2RDCA 1YXBA 3IJ4A 3BA9A 1FXKB 3CXCU 3FB8C 2RMKB 1QQCA 1XI1A 1I94B 3K9AA 4GKKB 4P2ZA 3RT3C 1AR1B 3CMAV 3ZHUA 5B1AC 1SQVH 2P5OA 1SQFA 3ETDA 3OE7G 5B1BB 4AILC 4YIPA 1JMKC 1W0JG 1JJOA 2CGOA 1W2BU 4DR4B 2BOCC 1EM1A 3ETEA 2D2CB 4O4LB 3ZRWA 3K5OA 5L3GA 3APOA 5LP6C 5JVDB 3VOUA 1O9HA 1NZ6A 1RM1C 4DUYB 1HNZB 1MSWD 1P4RA 3TGUH 4C7UA 3LSUA 4AHCA 3L9DA 4UVBA 3ZRXA 3UT5B 3CS5A 5IJ0A 3TK1A 2GHYA 3ABUA 5CA0A 1DF4A 4I4TB 2R9RB 1IDSA 5JQGB 3J80N 3P3NA 3OTFA 3RWRD 4ZI7A 4EFBA 4LFAO 3UQ8A 5KX5B 3MDSA 2ODMA 4WFAV 2Q69A 3ML0A 2EJ7A 3ZHVA 3ICXA 4KUMA 2CDYA 1B6QA 2ADQB 3ZMTA 1NKDA 3ETQA 4B3SB 1K92A 3AK3A 2P90A 2QJ1A 3WG7B 3ABLB 2R9IA 1TVKA 1QR9A 4RO2A 4PA3A 4JZGA 3OEHG 2V1DA 4FMTA 4QE7A 1NVPB 1KECA 2IH3C 3LNMB 2XTAA 1NT2B 3H1HH 3JD2A 2DQ3A 4DR1B 4YJ3A 3G67A 2LGWA 1AI6A 3SYCA 4FZ0A 1RSOB 4BWAA 2N05A 2B1IA 2WLNA 1OCRB 1MNGA 1UJWB 4DO2A 2K1EA 2QM8A 3AG7A 3R66A 4R7CA 2XT9A 3B2EE 2JGDB 5LMNB 2EILC 1BHBA 2Q5ZA 3LDDA 2ZM6O 4PDRA 1P7GA 2JDIG 3HKDA 2DQ0A 2IJJA 4LF9B 2W6JG 1GN2A 4CC6A 1SS3A 2ZE6A 2HR3A 1AJNA 4WF9V 1Y74A 3CCSV 1FAFA 1R3LC 1S5LZ 4UV8A 4CH5A 2UU9B 4JI7B 4LWSB 4J9ZB 4QGPA 4UCTA 4CH6A 4IIJA 1XEQA 4WFBV 1I5XA 1K4DC 3AK1A 4J7ZA 1P84F 3LDCA 4TOIA 4DRXA 4DV0O 5CA0B 4X62O 1R3KC 1KB9F 1MZEA 4KHPB 2HLDG 4J11A 4I9QA 4AI8A 2MW2B 3BCCH 3H1KH 2X0LA 3OT7A 2PZSA 2EZPA 2HKOA 4ZI7B 1DGSA 1MMMA 2JGUA 4TV9A 3MD0A 1GTOA 5LOVB 5J2UA 1BQZA 1TUBA 4PI0A 3DXRA 3DGEA 2QGNA 3F7YC 2ZKOA 4X66O 2UUAB 4YJ2A 1M5IA 4MW3A 2WLLB 3D36A 4X65O 5B1OA 1TVKB 3ETGA 5A9GA 2RCVA 4I0XA 2JVDA 4X89A 4FM0A 3H1LH 4DW1A 3I55V 3SR2C 1WPXA 3WB1A 1Q6HA 3B77A 5FPOA 4JI0B 5LYJA 4LFCO 1HW7A 5C93A 5FNVA 1ORQC 2OTLV 3E8FA 4DV2B 4RUFA 4ASUG 4LFBO 1V54C 4NVPA 5FLXN 2A9HA 1GK9A 3JD0A 4MTXA 1KP2A 1XMOB 1VQ5V 2QWNB 3LSSA 1JFFA 3AK2A 2X6CA 3TETA 4JI3B 3HKCB 2Y0IA 3K0GA 1YJWV 4TWKA 3QF7A 3AG4C 4IT5A 2CK3G 1CPYA 1Q7YW 2Z0AA 4F4LA 2OTJV 4QPJA 3SYQA 5IYDO 5LHIA 4FJCC 3GB7C 5CN0A 2ETNA 1M56B 4BW5A 2PYJA 1NTZH 2ZQMA 3BVOA 4RAIA 3THOA 1NH2B 5CA1A 1QCEA 1XNRB 4FLZA 2Q67A 1S0VA 1X4TA 1YJNV 4CC5A 1HNXB 1N4CA 1VQMV 4JV5O 3JYCA 1EZVH 1SQXH 4MTOA 1IBKB 1JJ2U 4J42A 3ZRSA 4RQEA 4U7OA 3ZMVA 4B3TB 1K5QA 1OCZC 2E76B 2YIBD 3SYAA 1M90W 3F7VC 4MVOA 2UUBO 4X20B 3O9OA 4X64B 1GAXA 1MZFA 3JSNA 4DV7B 1VP7A 3CRQA 1Q6UA 4IHJA 4LH7A 4LF7O 5J2UB 5KMGA 1N33O 1TUBB 3BFRA 4ZHQB 4WFFA 2QEXV 5KUKA 4HNAA 2HEPA 2KG7B 5BMVA 2LGQA 3A0RA 1J5EB 3B4SA 3F5TA 4RUEA 1FXVA 1AILA 4DR3B 4X1YA 1HNWB 4IL6Z 2Y69C 2YEVA 1D5AA 1H2MA 1SQGA 2P06A 2HHHB 2VRZA 4P30A 4DV6B 1MOFA 2YIBA 4W4LA 2WA4A 2FTKA 1GM7A 2EINC 4K35A 5KHGA 2VQEB 5KHKA 1NR7A 2WLKA 3OTOB 1GO3F 4LNUA 2QWPB 4PJ0Z 2F43G 4K3AA 1IXBA 3UO3A 2ZCEA 4I50A 4H37A 3L75H 4ICGA 2YS8A 2BTQA 4JI2B 4I5SA 2LW1A 3ZBHA 3ASOB 2H3OA 1Y6XA 4X9QA 5LL6Y 1N34B 2ZE7A 1P7BA 1L0NH 2YSUB 4LF6O 4FLXA 5IWAO 2HVKC 4J9YB 1Q86W 4X1KA 2AXTZ 1FJGB 4O4IB 3RYIB 1PP9H 3OR7C 1G1XB 4NB5A 3OEEG 1N32B 3UO2A 5JJNB 2OCHA 4GX5A 4NTYA 5KHJA 2AZ0A 1XOUA 4FLUA 1H8HG 5EBMC 3T1YB 5FL7G 3JASA 1AP6A 2DOSA 4YXWG 1I0HA 1F23A 2Y4UA 3Q4HB 2QM4A 3L73H 2UXDO 3HKEA 2EIJB 5IT9N 1K34A 2UXCO 4JTCB 1EBOA 4BIZA 2X7RB 2QWQB 1N8RW 1BGYH 2P22C 5JWPA 3OUFA 4DV5B 3CRMA 1VARA 5IJ9A 1U97A 2UUCB 1FKAO 1QLEC 3CC2V 4YY3B 2UXBB 1OZ0A 1ZLZA 1AI7A 4W4KA 1J95A 4UUJC 4Z1VA 5JH7A 2VWJA 1KC8W 3EFFK 4WBNB 1B04A 4H0LB 5B66Z 4JYBA 1FFXA 2EULA 3FAVB 2ATKC 4Q6GA 4JI5O 5BZBA 4LF4B 4J7KA 4LR3A 3UKMA 3DSQA 4LF8B 1FD9A 2F4VO 4B3RB 4O4HA 4A5UB 2OT5A 4FFBB 2YIDA 4LF5B 3JD4A 3SPJA 4DXWA 3A2FA 1VQ7V 2OCCB 4DR7O 1ZL8B 2NR5A 5LMUB 3JARB 2P6JA 4BR6A 3L74H 5J2TB 2PF4E 1NTKH 4F6RA 4DUZB 2WWWA 1RPRA 2WLIB 5LGTA 1EN4A 1Q43A 3IGAC 1JCHA 5GTHZ 4XDJA 1TA8A 1XHZA 5L3BA 4OX9O 2XUMA 1Q8IA 3JAKA 3T1HB 1IBLB 4DR6O 4NXMB 2VQFO 4GKJO 1LNQA 1XL6A 4DV4O 4QNHB 4P9OA 1FXKC 5H6RA 2ZINA 5LP6A 3K57A 1GM8A 4K0KB 1DLBA 3PN1A 3QO7A 1R73A 3JCZA 4JYCA 1GRJA 2XASA 1IZ3A 4I9WA 3ZRVA 5B1BC 5EZYA 1BMFG 3UM7A 1ZSPA 4JPRA 5LXTA 4BIUA 1NS1A 3T4ZA 1VQ9V 5HFMA 1WAZA 3O65A 2EIMB 2LQTA 3L72H 2DE0X 3LNNA 3IC7A 1I94O 4MT8A 2FMLA 1FS0G 4GKKO 2CH7A 5K1PA 2F1MA 3W7WA 5LA6B 3H1JH 1KKDA 4UCRA 2ZNJA 4IGGA 4GX2A 1S5JA 1WJZA 1Y4MA 1PL0A 2K9PA 3D8CA 3RYCA 1R6KA 3SJCC 3X2QB 4DR4O 3AG3B 2R70A 3RYFB 4ZBMA 1GN3A 2XAQA 3VBBA 1HNZO 1NR1A 4MTGA 4HZ3A 2AHYA 3TJTA 3WG7C 3ABLC 1US6A 4JGSA 3JALA 5JJJB 3N2KA 3RYHB 3T2MA 1ROPA 1X59A 5E79Z 5C8YA 1XHXA 3C3SA 1AR5A 2QKCA 4R8CA 3K58A 4KP4A 3UCSC 4X1IA 1I08A 2FYUH 4EB6B 4UCUA 3FFQA 3CC7V 2Q0AA 3MAQA 1YIJV 1LUVA 3HKBB 4LCUC 1RP3B 2ZR2A 3CSXA 4LFAB 2LW7A 1OCCB 4B3SO 1OCRC 1VEWA 1DTOA 4O2AA 5KHIA 4B7KA 5J9PC 3CB2A 1H2LA 2PTMA 3RBZA 4OPAA 4N21A 2EJRA 4QJFB 5EZYB 2ZIOA 5KHHA 2BE3A 2Y48A 3OD4A 4DR2B 1JOYA 4DV1B 1WB7A 2W0FC 3JD1A 3CJHA 4DR1O 3AEIA 1SQBH 4IYHA 4BAYA 2JK5C 1ZAUA 1NQTA 4MW8A 2IW5A 1N0JA 3F5WC 1R3IC 1PL4A 1IBMB 1S3JA 1NTMH 4D6TH 5HFLA 5IE9A 5FPRA 1Z2GA 2KSDA 2Q4PA 4DR5O 1VF7A 3VQXA 4O2BA 3SYPA 5LMNO 3CC4V 3EXAA 1Q6IA 1AROP 3BPZA 5KA5A 1XNQB 1H2KA 1CP9A 3K79A 3WB0A 5GTIZ 1K73W 4LF9O 2AW9A 1R3JC 4MSWC 3T1CA 1MG1A 2EIKB 5IYCO 3ZRWB 5JCOC 2DJVA 1M57B 4AQYB 1YTFB 1R1BA 4JI7O 3ZIAG 3B09A 2OIGA 2QR4A 4UB6Z 2PYLA 2RQ6A 5IY5B 4JI4B 2DYRB 3OAAG 4PA4A 2QA4V 1GMGA 5IJ0B 2IU0A 4I55A 3GWOA 2Y0PA 2N04A 2PGGA 5LHHA 1VQOV 3N2KB 2DN9A 1SZXA 3W7UA 4KHPO 2P67A 3H9VA 2A7WA 2MK3A 1XMQO 3JCUZ 4MVRA 2XAFA 2WLHA 4PI2A 1G6UA 4FLVA 1XUQA 1DF5A 2Z3YA 1O9GA 3FB5C 4JYAB 1YSCA 4U3JA 3ZS8C 5IYBO 5EBWC 3GWKC 3DC6A 2UUAO 3CCLV 1N36B 1BHAA 3IC9A 3C3TA 4DK1A 3R65A 3L70H 2E5LO 1WLEA 2LO1A 3SPGA 4JI0O 1H8EG 3RVYA 3HR0A 3ABKB 4YJ3B 1ZWIC 4XDLA 4JI6O 1AP5A 3ABMB 3SGIA 1M56C 4DV2O 3OM3B 2YXHA 1JPXA 4RWUA 1QVGU 5EIBC 1HR0B 1XMOO 4G27B 5A2QN 1F51A 1KD1W 3M99B 2V7QG 5LGNA 4JI3O 2YICA 2Z5UA 5ITZA 3HKDB 1VQ4V 4H13B 5EC2C 2FL4A 1THZA 1AB3A 3J81N 1K9MW 2AHZA 3VQYA 5LBQA 1Y74B 1M1KW 3QO5A 4TUYA 2CTQA 3E8HA 1YJ9V 1XNRO 1KQSU 5JJEB 5EYPA 1NU1H 4IIJB 5KAIZ 1HNXO 5B1NA 4DK0A 3KG2A 1QVFU 1IBKO 3ZMUA 4PV1B 3E8BA 3OGIB 4DRXB 3HB3B 1YCIA 4PELA 5L3DA 2A3QA 3PJSK 2GSMB 2FKXA 2YUAA 3JATA 3N2GA 4BW9A 4X64O 1M9NA 4TV9B 4XDKA 1SQQH 2ZXWB 2JRIA 3JAMN 4DV7O 3KCXA 1SERA 3DXRB 1BE3H 1WA8A 2M6YA 2GUZA 4DYLA 2DYSB 3SJAC 1COWG 2YC0A 5CB4A 4MVZA 4YJ2B 4ZOLA 5TISZ 3ZN1A 5KLVH 1J5EO 1HP8A 3CCQV 1XREA 2HJDA 1YHQV 2IBZH 4TT3G 4I0XB 2Q0OC 1VQ8V 4MVSA 1N33B 4PA6A 4PDVA 4DR3O 5CBGA 1HNWO 1Y66A 1URFA 5LYJB 1IX9A 4FIPC 3ASOC 4NTXA 3P30A 5FNVB 2CUGA 3H01A 4DW0A 5L3CA 3QNEA 3U10A 2HHHO 3K08A 1Q90D 3KKYA 4DV6O 2BCCH 3ABTA 1H2GA 4WFGA 3FX7A 5BR8B 2WSSG 1F7YA 2VQEO 3OTOO 1UPGA 2ZIMA 1JFFB 4FFKA 2BSKA 1FXHA 3GVMA 3S3XA 2WLMA 4NR1A 1TAEA 2EX3A 2CTWA 1WN7A 1BS3A 2UXXA 3AG1B 5DEDA 2ADPA 1R6TA 3SJQC 3FD9A 3ZEDA 1SC5B 4O4JA 4JI2O 4QPKA 2OWOA 3TXSA 4MVMA 1N34O 1XQ8A 3I56V 3A0HZ 1CEZA 2LFRA 4I7ZB 3K04A 2ZDIC 2LFSA 1QLNA 4B3MB 1HDJA 2GBOA 4JI8B 1FJGO 5CA1B 1SA0A 1BCCH 1K4CC 5GW7A 4JI1B 1KMIZ 2AGAA 1EN5A 1Y76A 2EIJC 3ASNB 4JYYA 1EN6A 2WA3A 1N32O 1YF2A 3SYOA 5IYZA 3U0ZA 4KL1A 4X8AA 1YI2V 4D7TA 3CMEV 3D3IA 3ZHSA 3JD3A 3N27A 3W7XA 4B08A 3T1YO 1SRYA 5BXZA 2PY5A 5B3SB 4IHJB 5KMGB 3CCEV 2L6LA 4J41A 2YXLA 1V55B 2V4DA 2YIAA 1F4NA 4HNAB 1G4YB 5BMVB 1AI4A 2M7WA 4QE9A 3RW0A 4DV5O 1WP8A 3J7AU 1VF6A 4X1YB 5GONA 2UUCO 5H5NA 1M93A 3JAWA 5H6QA 4YY3O 4GYCB 2OCCC 2YEVB 2UXBO 3CRCA 3DTUB 3P3PA 1FXKA 1TUEB 1Z5VA 3WFVA 4UVAA 2B5UA 2HG5C 2XAHA 1OCOB 4LF4O 2JIZG 3OMIB 4LNUB 4WFHA 4DV3B 4CBCA 2XNDG 4LF8O 4TSFG 4B3RO 3SPIA 2FB5A
chains in the Genus database with same CATH topology
4U3FH 2IBZH 1L0LH 1P84F 1SQVH 4PD4F 3L74H 3TGUH 3L71H 3H1IH 1BGYH 1NTKH 1NU1H 1SQQH 1KB9F 2A06H 3CX5F 3CXHF 2FYUH 3H1JH 1EZVH 1SQXH 1PP9H 3L75H 1NTMH 3BCCH 3H1KH 1BCCH 1PPJH 3H1HH 4D6TH 1BE3H 3H1LH 3CWBH 3L72H 1NTZH 1SQPH 5KLVH 1KYOF 3L73H 1L0NH 2BCCH 3L70H 1SQBH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U3F H;  2IBZ H;  1L0L H;  1P84 F;  1SQV H;  4PD4 F;  3L74 H;  3TGU H;  3L71 H;  3H1I H;  1BGY H;  1NTK H;  1NU1 H;  1SQQ H;  1KB9 F;  2A06 H;  3CX5 F;  3CXH F;  2FYU H;  3H1J H;  1EZV H;  1SQX H;  1PP9 H;  3L75 H;  1NTM H;  3BCC H;  3H1K H;  1BCC H;  1PPJ H;  3H1H H;  4D6T H;  1BE3 H;  3H1L H;  3CWB H;  3L72 H;  1NTZ H;  1SQP H;  5KLV H;  1KYO F;  3L73 H;  1L0N H;  2BCC H;  3L70 H;  1SQB H; 
#chains in the Genus database with same CATH topology
 4I50 B;  5DN6 G;  1W0K G;  3ZHT A;  4LF5 O;  2N74 A;  2BTQ B;  4O4L A;  4EKW A;  3L71 H;  1IVS A;  1JQ0 A;  5L3E A;  2JEX A;  5JVD A;  1VQL V;  4NXN B;  4DUZ O;  1K97 A;  5EK0 A;  1QBZ A;  1T5E A;  3BEH A;  4X1K B;  2P4V A;  1NVP D;  3HPL C;  3WB2 A;  3APQ A;  1S77 D;  3B8N A;  1PV0 A;  4LP8 A;  3T1H O;  1JX9 A;  1IBL O;  1SZT A;  1BL8 A;  4FLY A;  4NXM O;  2ILM A;  4I4T A;  2XHB A;  1MSD A;  2X6B A;  3ZHR A;  5JQG A;  1BSM A;  2EIM C;  2Q68 A;  3ZCC A;  1E1R G;  4GKJ B;  2O57 A;  4K0K O;  3VQV A;  2Q7G A;  2B1G A;  4YHH O;  2E3C A;  1VMG A;  1QU7 A;  4JTD B;  4D7S A;  4UCS A;  4J7J A;  3JAS B;  2AZ2 A;  1EZJ A;  1PNL A;  2F93 B;  3HKE B;  3X2Q C;  4NKG B;  2HP8 A;  4R50 A;  1AI5 A;  3AG3 C;  4Q20 A;  1K8A W;  4G28 B;  3WU2 Z;  1KYO F;  1GM9 A;  1F4M A;  1K7D A;  5IJ9 B;  3A8T A;  4TQD A;  3S3W A;  3FYI B;  1Q82 W;  1RSO A;  2IU3 A;  5JH7 B;  4HAM A;  4GLX A;  3C90 A;  2JS3 A;  1FFX B;  4UB8 Z;  5LHG A;  3K9S A;  1IUR A;  4UCV A;  3CCR V;  3W7T A;  2KKW A;  1L0L H;  2JGD A;  3K5L A;  2ZT9 B;  2NN4 A;  3OW2 U;  4O4H B;  2P7T C;  3AG2 B;  4DUY O;  2RJZ A;  1ENV A;  1KU9 A;  3E86 A;  2XAG A;  1KBH A;  2CAZ C;  1OCC C;  3ZJZ A;  4F6R B;  1QR8 A;  1MAB G;  1Q81 W;  2BOB C;  4LWS A;  2EZO A;  4CS3 A;  2GDS A;  5B1A B;  1VQ6 V;  1DK1 A;  3ZN0 A;  1FYJ A;  2JEU A;  3JAK B;  2DMX A;  1YZB A;  2BTO A;  2NNU A;  1I7F A;  5CMU A;  4TQF A;  5JCO A;  5LP6 B;  3CCJ V;  3CE2 A;  4FLT A;  1RM1 B;  3ZMS A;  3CYO A;  5LOV A;  1XBL A;  4CS2 A;  2R72 A;  4QIW F;  1GKF A;  2Q8V A;  3G80 A;  4GX0 A;  3E83 A;  1G8M A;  5LGU A;  4H33 A;  5KUM A;  2WLL A;  5D5P A;  5LXT B;  4DR2 O;  4DV1 O;  3SPC A;  1YDX A;  2EIK C;  1OV9 A;  1M57 C;  5EIB D;  1NH2 D;  2Q7H A;  2QDO A;  2A0L A;  1IBM O;  4JAU A;  4U7N A;  2CH7 B;  2LP7 A;  5IY5 C;  2DYR C;  2Q7E A;  1LUW A;  4CH4 A;  2ZE5 A;  3W7S A;  1GN6 A;  1E1Q G;  1VQK V;  4E2L A;  4PA7 A;  4L8J A;  3RYC B;  1XNQ O;  4B7E A;  4UFZ A;  2QKS A;  3HKC A;  1FFT B;  4DR5 B;  4LC1 A;  2ZM6 B;  4JAA A;  4L87 A;  2OIE A;  4AQY O;  2UU9 O;  4JAS A;  3BAA A;  3SJB C;  1NJI W;  1TGO A;  1P49 A;  4UXN A;  2VS0 A;  3CP1 A;  3CD6 V;  4JI4 O;  1VF5 B;  1RFY A;  4J10 A;  3E89 A;  2PUS A;  4GZR B;  1SET A;  2ITC C;  4PDL A;  3M7M X;  4UCO A;  4FPP A;  3JAL B;  3CPW U;  5C8Y B;  4NYK A;  1VQN V;  5CA3 A;  2EIL B;  3MHS C;  4X1I B;  1L1F A;  5D5Q A;  1W59 A;  2LJ2 A;  3G4S V;  4KXR A;  3K03 A;  4DV0 B;  4X62 B;  3ABK C;  4Z1M G;  3BHP A;  1BT8 A;  4MVU A;  2GV9 A;  3ABM C;  4HBN A;  2L35 A;  4K8X A;  2A06 H;  4RQF A;  4X20 A;  1Y67 A;  4JYA O;  1XMQ B;  2DWD C;  1SF9 A;  4LBE C;  2GTS A;  3OUS A;  4O2A B;  1N36 O;  1RPO A;  1FPO A;  4ZHQ A;  1PNK A;  4NTW A;  2YXY A;  4U3F H;  2IJI A;  4X66 B;  2KG7 A;  3D3Q A;  1M4U A;  2QKA A;  4WFE A;  1SKV A;  3E35 A;  4X65 B;  3P32 A;  1QNM A;  2B9Z A;  3SPH A;  3CJH B;  4PDM A;  1N0N A;  1XDC A;  5DEC A;  2E5L B;  4LFC B;  1WB8 A;  1V9P A;  1UFI A;  1HR0 O;  2HFE C;  5H9C A;  4Z2W A;  4JI6 B;  1Q5O A;  2RN9 A;  4OXS A;  2YI9 A;  1CXZ B;  4LFB B;  3RGB A;  4O2B B;  1GH6 A;  2PI5 A;  1A32 A;  3CHX A;  4UVC A;  4GUN A;  1PKX A;  2ZNI A;  2D3O W;  3BAB A;  1YVW A;  3FB6 C;  1K5S A;  1LR1 A;  2Y4T A;  2ZXW C;  1OJH A;  3E2E A;  4KFM A;  1WPB A;  3E22 A;  4R6Z A;  3B40 A;  2DYS C;  1D5N A;  1V54 B;  4FLW A;  4I55 B;  2CTR A;  3D36 C;  1QHT A;  3KCY A;  4EEQ A;  4O4I A;  4B3T O;  3RYI A;  4WCE V;  4CH3 A;  4OPH A;  2CE4 A;  3QTC A;  4MTF A;  5CBF A;  4JTA B;  4JV5 B;  2ZE8 A;  3KZI Z;  4H44 B;  2P4K A;  3AG4 B;  4GT1 A;  4BIO A;  4ZKI A;  5DM6 V;  2VWK A;  3OFN G;  1ZTE A;  1AJQ A;  1PNM A;  2UUB B;  5L3F A;  1SQP H;  3T4D A;  4U3J B;  2ZDI A;  4CZZ A;  2H8P C;  3OGC C;  4LF7 B;  1Q3E A;  1VQP V;  3DC5 A;  4JF3 A;  3Q4H A;  2ZD9 A;  2JJ2 G;  1PD3 A;  1AJP A;  2QWR B;  3IFX A;  1Z5W A;  2IJK A;  5CBH A;  3ZMZ A;  1B06 A;  2GTA A;  3AG1 C;  2ITD C;  1BZK A;  5EBL C;  4FZ1 A;  3K0D A;  4E4E A;  1OCZ B;  2QE7 G;  4XBF A;  4FM1 A;  3QVN A;  3K06 A;  3LUT B;  1NI8 A;  1YEW A;  3EHB B;  4MVQ A;  1EFR G;  5BR8 O;  2CGN A;  4WBN A;  3SDL A;  2F66 C;  3TCU A;  1AR4 A;  3FAV A;  1JA8 A;  1VIB A;  3A0B Z;  3B8M A;  3ASN C;  3NXS A;  1K33 A;  4N23 A;  3BA8 A;  4ABM A;  2YI8 A;  5ITZ B;  1S72 V;  2ARH A;  3I5D A;  2A79 B;  4FK5 C;  1XL4 A;  1L8D A;  3LSQ A;  1JR9 A;  4FFB A;  2HJF C;  2DWE C;  2QTS A;  4F6E A;  2C2A A;  3G6E V;  1ZL8 A;  2Y69 B;  2UXN A;  3OR6 C;  4UV9 A;  4B3M O;  2W0X A;  3JAR A;  4TUY B;  4JI8 O;  5J2T A;  5B3S C;  4FM2 A;  3FKS G;  3JSL A;  2QM7 A;  3STZ C;  5EC1 C;  1GN4 A;  4JI1 O;  4LF6 B;  5EYP B;  2WLI A;  2KQX A;  5IWA B;  3CCU V;  1V55 C;  3CRR A;  3E22 B;  2EIN B;  1B3Q A;  2YDE A;  2OYQ A;  3MHH C;  2XAJ A;  4P9P A;  1KUQ A;  2IJH A;  2QSA A;  1BQ0 A;  4MS2 A;  1H2S B;  2Q73 A;  3JAT B;  2PI4 A;  3N2G B;  2X6A A;  4EFE A;  3NR7 A;  1I5Y A;  3E8G A;  5BY1 A;  2G38 A;  1WA8 B;  2QWO B;  2Q9L A;  3CX5 F;  1OCO C;  2GUZ B;  5CB4 B;  4ZOL B;  1OHH G;  4OGQ B;  3FYE B;  1U96 A;  1NBM G;  2XOK G;  4TV8 A;  3TXQ A;  2UXD B;  2F23 A;  2W6I G;  3CCM V;  2UXC B;  1MA1 A;  5F2V O;  4J80 A;  5KA6 A;  1D2D A;  2KB1 A;  2F95 B;  2H94 A;  3CEI A;  5KAF Z;  2CTP A;  4X88 A;  2E74 B;  1PPJ H;  4YIO A;  2DW4 A;  2NLJ C;  2WPD G;  4PA9 A;  3K5N A;  5LA6 A;  1K3E A;  4DV3 O;  2BSK B;  3ZX6 A;  2Q6A A;  3BRC A;  3RFR A;  2QTO A;  3CCV V;  5IDJ A;  2WAM A;  1WNS A;  4JI5 B;  3EVK A;  3G71 V;  1SES A;  5LMU O;  4O4J B;  1WP7 A;  4IYI A;  3K59 A;  3RYF A;  2F4V B;  2RNB A;  4NXN O;  4G2K A;  3CWB H;  1PM9 A;  2IM9 A;  1QLE B;  1HWY A;  4DR7 B;  3CXH F;  3IAY A;  3UT5 A;  2JS5 A;  2ZR3 A;  1SA0 B;  1S5H C;  4PD4 F;  2JJ1 G;  1ZUQ A;  1KP3 A;  1Y76 B;  3RYH A;  4OX9 B;  2EBO A;  1R6N A;  1H38 A;  3QO8 A;  5KX5 A;  5IYZ B;  1IXM A;  4JAV A;  4DR6 B;  4EB6 A;  2HVJ C;  2VQF B;  3FB7 C;  1S76 D;  3OMN B;  3BY6 A;  4GCZ A;  1VF6 C;  4HYO A;  4GX1 A;  4DV4 B;  3HKB A;  1XIL A;  1AVM A;  1YIT V;  4PHZ A;  5K1X A;  5E1A C;  1JVM A;  4LH6 A;  3U11 A;  3G6B A;  5H2F Z;  4CS4 A;  4YHH B;  3VQW A;  5AG2 A;  4ZIB A;  4FVM A;  2R9A A;  3K3W A;  3K5M A;  3LDE A;  4TV8 B;  3RVZ A;  2IH1 C;  3OMA B;  4JZ2 A;  3AG2 C;  1YTF D;  2WLJ A;  5GON B;  1ZX3 A;  3H1I H;  1H2N A;  3STL C;  4K8Z A;  3JAW B;  2E75 B;  3ZHQ A;  1KKC A;  1E79 G;  3CRA A;  5B5E Z;  3M8A A;  3QG5 A;  3RN4 A;  2RDC A;  1YXB A;  3IJ4 A;  3BA9 A;  1FXK B;  3CXC U;  3FB8 C;  2RMK B;  1QQC A;  1XI1 A;  1I94 B;  3K9A A;  4GKK B;  4P2Z A;  3RT3 C;  1AR1 B;  3CMA V;  3ZHU A;  5B1A C;  1SQV H;  2P5O A;  1SQF A;  3ETD A;  3OE7 G;  5B1B B;  4AIL C;  4YIP A;  1JMK C;  1W0J G;  1JJO A;  2CGO A;  1W2B U;  4DR4 B;  2BOC C;  1EM1 A;  3ETE A;  2D2C B;  4O4L B;  3ZRW A;  3K5O A;  5L3G A;  3APO A;  5LP6 C;  5JVD B;  3VOU A;  1O9H A;  1NZ6 A;  1RM1 C;  4DUY B;  1HNZ B;  1MSW D;  1P4R A;  3TGU H;  4C7U A;  3LSU A;  4AHC A;  3L9D A;  4UVB A;  3ZRX A;  3UT5 B;  3CS5 A;  5IJ0 A;  3TK1 A;  2GHY A;  3ABU A;  5CA0 A;  1DF4 A;  4I4T B;  2R9R B;  1IDS A;  5JQG B;  3J80 N;  3P3N A;  3OTF A;  3RWR D;  4ZI7 A;  4EFB A;  4LFA O;  3UQ8 A;  5KX5 B;  3MDS A;  2ODM A;  4WFA V;  2Q69 A;  3ML0 A;  2EJ7 A;  3ZHV A;  3ICX A;  4KUM A;  2CDY A;  1B6Q A;  2ADQ B;  3ZMT A;  1NKD A;  3ETQ A;  4B3S B;  1K92 A;  3AK3 A;  2P90 A;  2QJ1 A;  3WG7 B;  3ABL B;  2R9I A;  1TVK A;  1QR9 A;  4RO2 A;  4PA3 A;  4JZG A;  3OEH G;  2V1D A;  4FMT A;  4QE7 A;  1NVP B;  1KEC A;  2IH3 C;  3LNM B;  2XTA A;  1NT2 B;  3H1H H;  3JD2 A;  2DQ3 A;  4DR1 B;  4YJ3 A;  3G67 A;  2LGW A;  1AI6 A;  3SYC A;  4FZ0 A;  1RSO B;  4BWA A;  2N05 A;  2B1I A;  2WLN A;  1OCR B;  1MNG A;  1UJW B;  4DO2 A;  2K1E A;  2QM8 A;  3AG7 A;  3R66 A;  4R7C A;  2XT9 A;  3B2E E;  2JGD B;  5LMN B;  2EIL C;  1BHB A;  2Q5Z A;  3LDD A;  2ZM6 O;  4PDR A;  1P7G A;  2JDI G;  3HKD A;  2DQ0 A;  2IJJ A;  4LF9 B;  2W6J G;  1GN2 A;  4CC6 A;  1SS3 A;  2ZE6 A;  2HR3 A;  1AJN A;  4WF9 V;  1Y74 A;  3CCS V;  1FAF A;  1R3L C;  1S5L Z;  4UV8 A;  4CH5 A;  2UU9 B;  4JI7 B;  4LWS B;  4J9Z B;  4QGP A;  4UCT A;  4CH6 A;  4IIJ A;  1XEQ A;  4WFB V;  1I5X A;  1K4D C;  3AK1 A;  4J7Z A;  1P84 F;  3LDC A;  4TOI A;  4DRX A;  4DV0 O;  5CA0 B;  4X62 O;  1R3K C;  1KB9 F;  1MZE A;  4KHP B;  2HLD G;  4J11 A;  4I9Q A;  4AI8 A;  2MW2 B;  3BCC H;  3H1K H;  2X0L A;  3OT7 A;  2PZS A;  2EZP A;  2HKO A;  4ZI7 B;  1DGS A;  1MMM A;  2JGU A;  4TV9 A;  3MD0 A;  1GTO A;  5LOV B;  5J2U A;  1BQZ A;  1TUB A;  4PI0 A;  3DXR A;  3DGE A;  2QGN A;  3F7Y C;  2ZKO A;  4X66 O;  2UUA B;  4YJ2 A;  1M5I A;  4MW3 A;  2WLL B;  3D36 A;  4X65 O;  5B1O A;  1TVK B;  3ETG A;  5A9G A;  2RCV A;  4I0X A;  2JVD A;  4X89 A;  4FM0 A;  3H1L H;  4DW1 A;  3I55 V;  3SR2 C;  1WPX A;  3WB1 A;  1Q6H A;  3B77 A;  5FPO A;  4JI0 B;  5LYJ A;  4LFC O;  1HW7 A;  5C93 A;  5FNV A;  1ORQ C;  2OTL V;  3E8F A;  4DV2 B;  4RUF A;  4ASU G;  4LFB O;  1V54 C;  4NVP A;  5FLX N;  2A9H A;  1GK9 A;  3JD0 A;  4MTX A;  1KP2 A;  1XMO B;  1VQ5 V;  2QWN B;  3LSS A;  1JFF A;  3AK2 A;  2X6C A;  3TET A;  4JI3 B;  3HKC B;  2Y0I A;  3K0G A;  1YJW V;  4TWK A;  3QF7 A;  3AG4 C;  4IT5 A;  2CK3 G;  1CPY A;  1Q7Y W;  2Z0A A;  4F4L A;  2OTJ V;  4QPJ A;  3SYQ A;  5IYD O;  5LHI A;  4FJC C;  3GB7 C;  5CN0 A;  2ETN A;  1M56 B;  4BW5 A;  2PYJ A;  1NTZ H;  2ZQM A;  3BVO A;  4RAI A;  3THO A;  1NH2 B;  5CA1 A;  1QCE A;  1XNR B;  4FLZ A;  2Q67 A;  1S0V A;  1X4T A;  1YJN V;  4CC5 A;  1HNX B;  1N4C A;  1VQM V;  4JV5 O;  3JYC A;  1EZV H;  1SQX H;  4MTO A;  1IBK B;  1JJ2 U;  4J42 A;  3ZRS A;  4RQE A;  4U7O A;  3ZMV A;  4B3T B;  1K5Q A;  1OCZ C;  2E76 B;  2YIB D;  3SYA A;  1M90 W;  3F7V C;  4MVO A;  2UUB O;  4X20 B;  3O9O A;  4X64 B;  1GAX A;  1MZF A;  3JSN A;  4DV7 B;  1VP7 A;  3CRQ A;  1Q6U A;  4IHJ A;  4LH7 A;  4LF7 O;  5J2U B;  5KMG A;  1N33 O;  1TUB B;  3BFR A;  4ZHQ B;  4WFF A;  2QEX V;  5KUK A;  4HNA A;  2HEP A;  2KG7 B;  5BMV A;  2LGQ A;  3A0R A;  1J5E B;  3B4S A;  3F5T A;  4RUE A;  1FXV A;  1AIL A;  4DR3 B;  4X1Y A;  1HNW B;  4IL6 Z;  2Y69 C;  2YEV A;  1D5A A;  1H2M A;  1SQG A;  2P06 A;  2HHH B;  2VRZ A;  4P30 A;  4DV6 B;  1MOF A;  2YIB A;  4W4L A;  2WA4 A;  2FTK A;  1GM7 A;  2EIN C;  4K35 A;  5KHG A;  2VQE B;  5KHK A;  1NR7 A;  2WLK A;  3OTO B;  1GO3 F;  4LNU A;  2QWP B;  4PJ0 Z;  2F43 G;  4K3A A;  1IXB A;  3UO3 A;  2ZCE A;  4I50 A;  4H37 A;  3L75 H;  4ICG A;  2YS8 A;  2BTQ A;  4JI2 B;  4I5S A;  2LW1 A;  3ZBH A;  3ASO B;  2H3O A;  1Y6X A;  4X9Q A;  5LL6 Y;  1N34 B;  2ZE7 A;  1P7B A;  1L0N H;  2YSU B;  4LF6 O;  4FLX A;  5IWA O;  2HVK C;  4J9Y B;  1Q86 W;  4X1K A;  2AXT Z;  1FJG B;  4O4I B;  3RYI B;  1PP9 H;  3OR7 C;  1G1X B;  4NB5 A;  3OEE G;  1N32 B;  3UO2 A;  5JJN B;  2OCH A;  4GX5 A;  4NTY A;  5KHJ A;  2AZ0 A;  1XOU A;  4FLU A;  1H8H G;  5EBM C;  3T1Y B;  5FL7 G;  3JAS A;  1AP6 A;  2DOS A;  4YXW G;  1I0H A;  1F23 A;  2Y4U A;  3Q4H B;  2QM4 A;  3L73 H;  2UXD O;  3HKE A;  2EIJ B;  5IT9 N;  1K34 A;  2UXC O;  4JTC B;  1EBO A;  4BIZ A;  2X7R B;  2QWQ B;  1N8R W;  1BGY H;  2P22 C;  5JWP A;  3OUF A;  4DV5 B;  3CRM A;  1VAR A;  5IJ9 A;  1U97 A;  2UUC B;  1FKA O;  1QLE C;  3CC2 V;  4YY3 B;  2UXB B;  1OZ0 A;  1ZLZ A;  1AI7 A;  4W4K A;  1J95 A;  4UUJ C;  4Z1V A;  5JH7 A;  2VWJ A;  1KC8 W;  3EFF K;  4WBN B;  1B04 A;  4H0L B;  5B66 Z;  4JYB A;  1FFX A;  2EUL A;  3FAV B;  2ATK C;  4Q6G A;  4JI5 O;  5BZB A;  4LF4 B;  4J7K A;  4LR3 A;  3UKM A;  3DSQ A;  4LF8 B;  1FD9 A;  2F4V O;  4B3R B;  4O4H A;  4A5U B;  2OT5 A;  4FFB B;  2YID A;  4LF5 B;  3JD4 A;  3SPJ A;  4DXW A;  3A2F A;  1VQ7 V;  2OCC B;  4DR7 O;  1ZL8 B;  2NR5 A;  5LMU B;  3JAR B;  2P6J A;  4BR6 A;  3L74 H;  5J2T B;  2PF4 E;  1NTK H;  4F6R A;  4DUZ B;  2WWW A;  1RPR A;  2WLI B;  5LGT A;  1EN4 A;  1Q43 A;  3IGA C;  1JCH A;  5GTH Z;  4XDJ A;  1TA8 A;  1XHZ A;  5L3B A;  4OX9 O;  2XUM A;  1Q8I A;  3JAK A;  3T1H B;  1IBL B;  4DR6 O;  4NXM B;  2VQF O;  4GKJ O;  1LNQ A;  1XL6 A;  4DV4 O;  4QNH B;  4P9O A;  1FXK C;  5H6R A;  2ZIN A;  5LP6 A;  3K57 A;  1GM8 A;  4K0K B;  1DLB A;  3PN1 A;  3QO7 A;  1R73 A;  3JCZ A;  4JYC A;  1GRJ A;  2XAS A;  1IZ3 A;  4I9W A;  3ZRV A;  5B1B C;  5EZY A;  1BMF G;  3UM7 A;  1ZSP A;  4JPR A;  5LXT A;  4BIU A;  1NS1 A;  3T4Z A;  1VQ9 V;  5HFM A;  1WAZ A;  3O65 A;  2EIM B;  2LQT A;  3L72 H;  2DE0 X;  3LNN A;  3IC7 A;  1I94 O;  4MT8 A;  2FML A;  1FS0 G;  4GKK O;  2CH7 A;  5K1P A;  2F1M A;  3W7W A;  5LA6 B;  3H1J H;  1KKD A;  4UCR A;  2ZNJ A;  4IGG A;  4GX2 A;  1S5J A;  1WJZ A;  1Y4M A;  1PL0 A;  2K9P A;  3D8C A;  3RYC A;  1R6K A;  3SJC C;  3X2Q B;  4DR4 O;  3AG3 B;  2R70 A;  3RYF B;  4ZBM A;  1GN3 A;  2XAQ A;  3VBB A;  1HNZ O;  1NR1 A;  4MTG A;  4HZ3 A;  2AHY A;  3TJT A;  3WG7 C;  3ABL C;  1US6 A;  4JGS A;  3JAL A;  5JJJ B;  3N2K A;  3RYH B;  3T2M A;  1ROP A;  1X59 A;  5E79 Z;  5C8Y A;  1XHX A;  3C3S A;  1AR5 A;  2QKC A;  4R8C A;  3K58 A;  4KP4 A;  3UCS C;  4X1I A;  1I08 A;  2FYU H;  4EB6 B;  4UCU A;  3FFQ A;  3CC7 V;  2Q0A A;  3MAQ A;  1YIJ V;  1LUV A;  3HKB B;  4LCU C;  1RP3 B;  2ZR2 A;  3CSX A;  4LFA B;  2LW7 A;  1OCC B;  4B3S O;  1OCR C;  1VEW A;  1DTO A;  4O2A A;  5KHI A;  4B7K A;  5J9P C;  3CB2 A;  1H2L A;  2PTM A;  3RBZ A;  4OPA A;  4N21 A;  2EJR A;  4QJF B;  5EZY B;  2ZIO A;  5KHH A;  2BE3 A;  2Y48 A;  3OD4 A;  4DR2 B;  1JOY A;  4DV1 B;  1WB7 A;  2W0F C;  3JD1 A;  3CJH A;  4DR1 O;  3AEI A;  1SQB H;  4IYH A;  4BAY A;  2JK5 C;  1ZAU A;  1NQT A;  4MW8 A;  2IW5 A;  1N0J A;  3F5W C;  1R3I C;  1PL4 A;  1IBM B;  1S3J A;  1NTM H;  4D6T H;  5HFL A;  5IE9 A;  5FPR A;  1Z2G A;  2KSD A;  2Q4P A;  4DR5 O;  1VF7 A;  3VQX A;  4O2B A;  3SYP A;  5LMN O;  3CC4 V;  3EXA A;  1Q6I A;  1ARO P;  3BPZ A;  5KA5 A;  1XNQ B;  1H2K A;  1CP9 A;  3K79 A;  3WB0 A;  5GTI Z;  1K73 W;  4LF9 O;  2AW9 A;  1R3J C;  4MSW C;  3T1C A;  1MG1 A;  2EIK B;  5IYC O;  3ZRW B;  5JCO C;  2DJV A;  1M57 B;  4AQY B;  1YTF B;  1R1B A;  4JI7 O;  3ZIA G;  3B09 A;  2OIG A;  2QR4 A;  4UB6 Z;  2PYL A;  2RQ6 A;  5IY5 B;  4JI4 B;  2DYR B;  3OAA G;  4PA4 A;  2QA4 V;  1GMG A;  5IJ0 B;  2IU0 A;  4I55 A;  3GWO A;  2Y0P A;  2N04 A;  2PGG A;  5LHH A;  1VQO V;  3N2K B;  2DN9 A;  1SZX A;  3W7U A;  4KHP O;  2P67 A;  3H9V A;  2A7W A;  2MK3 A;  1XMQ O;  3JCU Z;  4MVR A;  2XAF A;  2WLH A;  4PI2 A;  1G6U A;  4FLV A;  1XUQ A;  1DF5 A;  2Z3Y A;  1O9G A;  3FB5 C;  4JYA B;  1YSC A;  4U3J A;  3ZS8 C;  5IYB O;  5EBW C;  3GWK C;  3DC6 A;  2UUA O;  3CCL V;  1N36 B;  1BHA A;  3IC9 A;  3C3T A;  4DK1 A;  3R65 A;  3L70 H;  2E5L O;  1WLE A;  2LO1 A;  3SPG A;  4JI0 O;  1H8E G;  3RVY A;  3HR0 A;  3ABK B;  4YJ3 B;  1ZWI C;  4XDL A;  4JI6 O;  1AP5 A;  3ABM B;  3SGI A;  1M56 C;  4DV2 O;  3OM3 B;  2YXH A;  1JPX A;  4RWU A;  1QVG U;  5EIB C;  1HR0 B;  1XMO O;  4G27 B;  5A2Q N;  1F51 A;  1KD1 W;  3M99 B;  2V7Q G;  5LGN A;  4JI3 O;  2YIC A;  2Z5U A;  5ITZ A;  3HKD B;  1VQ4 V;  4H13 B;  5EC2 C;  2FL4 A;  1THZ A;  1AB3 A;  3J81 N;  1K9M W;  2AHZ A;  3VQY A;  5LBQ A;  1Y74 B;  1M1K W;  3QO5 A;  4TUY A;  2CTQ A;  3E8H A;  1YJ9 V;  1XNR O;  1KQS U;  5JJE B;  5EYP A;  1NU1 H;  4IIJ B;  5KAI Z;  1HNX O;  5B1N A;  4DK0 A;  3KG2 A;  1QVF U;  1IBK O;  3ZMU A;  4PV1 B;  3E8B A;  3OGI B;  4DRX B;  3HB3 B;  1YCI A;  4PEL A;  5L3D A;  2A3Q A;  3PJS K;  2GSM B;  2FKX A;  2YUA A;  3JAT A;  3N2G A;  4BW9 A;  4X64 O;  1M9N A;  4TV9 B;  4XDK A;  1SQQ H;  2ZXW B;  2JRI A;  3JAM N;  4DV7 O;  3KCX A;  1SER A;  3DXR B;  1BE3 H;  1WA8 A;  2M6Y A;  2GUZ A;  4DYL A;  2DYS B;  3SJA C;  1COW G;  2YC0 A;  5CB4 A;  4MVZ A;  4YJ2 B;  4ZOL A;  5TIS Z;  3ZN1 A;  5KLV H;  1J5E O;  1HP8 A;  3CCQ V;  1XRE A;  2HJD A;  1YHQ V;  2IBZ H;  4TT3 G;  4I0X B;  2Q0O C;  1VQ8 V;  4MVS A;  1N33 B;  4PA6 A;  4PDV A;  4DR3 O;  5CBG A;  1HNW O;  1Y66 A;  1URF A;  5LYJ B;  1IX9 A;  4FIP C;  3ASO C;  4NTX A;  3P30 A;  5FNV B;  2CUG A;  3H01 A;  4DW0 A;  5L3C A;  3QNE A;  3U10 A;  2HHH O;  3K08 A;  1Q90 D;  3KKY A;  4DV6 O;  2BCC H;  3ABT A;  1H2G A;  4WFG A;  3FX7 A;  5BR8 B;  2WSS G;  1F7Y A;  2VQE O;  3OTO O;  1UPG A;  2ZIM A;  1JFF B;  4FFK A;  2BSK A;  1FXH A;  3GVM A;  3S3X A;  2WLM A;  4NR1 A;  1TAE A;  2EX3 A;  2CTW A;  1WN7 A;  1BS3 A;  2UXX A;  3AG1 B;  5DED A;  2ADP A;  1R6T A;  3SJQ C;  3FD9 A;  3ZED A;  1SC5 B;  4O4J A;  4JI2 O;  4QPK A;  2OWO A;  3TXS A;  4MVM A;  1N34 O;  1XQ8 A;  3I56 V;  3A0H Z;  1CEZ A;  2LFR A;  4I7Z B;  3K04 A;  2ZDI C;  2LFS A;  1QLN A;  4B3M B;  1HDJ A;  2GBO A;  4JI8 B;  1FJG O;  5CA1 B;  1SA0 A;  1BCC H;  1K4C C;  5GW7 A;  4JI1 B;  1KMI Z;  2AGA A;  1EN5 A;  1Y76 A;  2EIJ C;  3ASN B;  4JYY A;  1EN6 A;  2WA3 A;  1N32 O;  1YF2 A;  3SYO A;  5IYZ A;  3U0Z A;  4KL1 A;  4X8A A;  1YI2 V;  4D7T A;  3CME V;  3D3I A;  3ZHS A;  3JD3 A;  3N27 A;  3W7X A;  4B08 A;  3T1Y O;  1SRY A;  5BXZ A;  2PY5 A;  5B3S B;  4IHJ B;  5KMG B;  3CCE V;  2L6L A;  4J41 A;  2YXL A;  1V55 B;  2V4D A;  2YIA A;  1F4N A;  4HNA B;  1G4Y B;  5BMV B;  1AI4 A;  2M7W A;  4QE9 A;  3RW0 A;  4DV5 O;  1WP8 A;  3J7A U;  1VF6 A;  4X1Y B;  5GON A;  2UUC O;  5H5N A;  1M93 A;  3JAW A;  5H6Q A;  4YY3 O;  4GYC B;  2OCC C;  2YEV B;  2UXB O;  3CRC A;  3DTU B;  3P3P A;  1FXK A;  1TUE B;  1Z5V A;  3WFV A;  4UVA A;  2B5U A;  2HG5 C;  2XAH A;  1OCO B;  4LF4 O;  2JIZ G;  3OMI B;  4LNU B;  4WFH A;  4DV3 B;  4CBC A;  2XND G;  4LF8 O;  4TSF G;  4B3R O;  3SPI A;  2FB5 A; 
#chains in the Genus database with same CATH homology
 4U3F H;  2IBZ H;  1L0L H;  1P84 F;  1SQV H;  4PD4 F;  3L74 H;  3TGU H;  3L71 H;  3H1I H;  1BGY H;  1NTK H;  1NU1 H;  1SQQ H;  1KB9 F;  2A06 H;  3CX5 F;  3CXH F;  2FYU H;  3H1J H;  1EZV H;  1SQX H;  1PP9 H;  3L75 H;  1NTM H;  3BCC H;  3H1K H;  1BCC H;  1PPJ H;  3H1H H;  4D6T H;  1BE3 H;  3H1L H;  3CWB H;  3L72 H;  1NTZ H;  1SQP H;  5KLV H;  1KYO F;  3L73 H;  1L0N H;  2BCC H;  3L70 H;  1SQB H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...