1NTMH

Crystal structure of mitochondrial cytochrome bc1 complex at 2.4 angstrom
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
ELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 20
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1ntmH00
3CWBH 1SQXH 1EZVH 1P84F 1SQQH 3L74H 1SQVH 1SQPH 1KYOF 3L73H 1NU1H 1BCCH 4D6TH 4U3FH 1NTKH 3L72H 5KLVH 3TGUH 3CXHF 3L71H 1KB9F 2IBZH 3H1KH 3L75H 3BCCH 3CX5F 1SQBH 3H1LH 3H1JH 1NTMH 3L70H 2FYUH 1L0NH 1NTZH 1L0LH 1PPJH 1BGYH 1PP9H 2BCCH 2A06H 1BE3H 3H1IH 4PD4F 3H1HH
chains in the Genus database with same CATH superfamily
4LNUB 1P84F 1OCRC 2JGDB 3P32A 3RVYA 1E1RG 3OTOB 2AHYA 1BS3A 3VQXA 2YSUB 2Z3YA 4X9QA 2ZDIA 4QGPA 1VF6C 1QCEA 3E8HA 3J7AU 1R3IC 3JAWA 1DF4A 1NH2D 3AG3C 4QE7A 2Q68A 2QDOA 1BE3H 1K7DA 4LCUC 1N32O 4ZI7A 3H1HH 5IJ9A 3OGIB 1OV9A 4GKJB 5IYDO 4CS2A 2OT5A 4FFKA 5EYPA 4BWAA 2R9RB 1AI5A 1L8DA 3OMIB 4X62O 3A0RA 4LBEC 1YTFD 2WWWA 4JTDB 3RYHA 4FPPA 3OUSA 1JVMA 1XQ8A 2XAQA 4BAYA 5H6QA 4CC5A 2WLLB 5B1AC 1VQ8V 2P22C 4X1KA 2WLIA 1B06A 1JQ0A 2JIZG 4CBCA 3ZRWB 4DV5B 1AI4A 5KMGB 2F93B 1R6TA 4LF9B 5IT9N 2GBOA 1OZ0A 2WPDG 4BR6A 2UXBO 1NZ6A 1QR9A 5J2UA 3CWBH 4UCVA 1SRYA 3ASOB 1XMOO 2XTAA 1H2SB 2ZCEA 3K9AA 4LF7O 4TV9A 4DV6B 2BOBC 1MABG 2WLNA 4ASUG 5IJ0A 3ABKB 1ZLZA 2HHHO 2E5LB 3G80A 1G6UA 1QVFU 1SC5B 1PM9A 1WP8A 1Y76A 4O4IB 3HKEB 3SYOA 4DV0B 4D7SA 4NXMB 1FXKB 3CD6V 4X88A 4FZ0A 2ATKC 3JAKA 1H8EG 4CS4A 3BRCA 5AG2A 3MHHC 4WFGA 3P3PA 1IBLO 3P3NA 4AHCA 4DR4O 4W4LA 1ZUQA 4JYBA 3JAWB 4PJ0Z 2M6YA 2YI8A 4LC1A 4K0KO 1J5EO 1NTKH 3ZHUA 1M56C 5IJ9B 4XDLA 2IBZH 4MVMA 4H37A 1DLBA 2PYJA 3H01A 3AG1B 1X59A 3U0ZA 2DYRC 5LXTA 2A0LA 3B4SA 2HJDA 3RYHB 5EC1C 1AR4A 2E75B 3OMAB 3JSLA 4R6ZA 1WPBA 3RVZA 2B1IA 4LF6O 2ZM6O 3M8AA 1VP7A 2YEVB 1QU7A 2EIMB 4PA6A 4X1KB 1DGSA 1Q82W 4LP8A 5LP6C 5KHKA 2GHYA 3D8CA 3IAYA 4X20A 2K1EA 4QE9A 4XDKA 1AP5A 1V9PA 2NR5A 3TETA 2YS8A 4J80A 4Z2WA 3CRAA 1KBHA 3HKCA 1GK9A 1SZTA 3L75H 2R72A 1WB8A 1QLEB 2LQTA 2ZXWC 3E35A 4J7KA 1FFXA 2P4VA 2CDYA 5IWAO 2QA4V 1FJGO 3CS5A 3ZHVA 4FLTA 3B40A 2D3OW 4TV9B 1AR1B 3SYCA 5DEDA 1KYOF 5IJ0B 1BT8A 4F6RA 2A79B 2QTSA 2X6AA 2E76B 5ITZA 1ZL8A 3OGCC 4KHPB 1HNXO 4WF9V 3JD3A 2UU9O 1K4DC 1Y76B 2OIEA 3QG5A 1IZ3A 3OT7A 4CH3A 1N32B 3CMEV 3K57A 5LOVA 1VQ9V 1D2DA 2LO1A 4TOIA 1WLEA 2YC0A 4L87A 4R50A 3K58A 5E79Z 3ZIAG 4X62B 2CTQA 3E83A 1UPGA 5L3FA 4AQYO 2ZT9B 1M57C 4TT3G 2QM7A 3HR0A 3BAAA 3LDDA 4I9WA 1Q86W 1FPOA 3ABUA 2FMLA 1S76D 1R3LC 4JF3A 2GSMB 1KMIZ 4UCSA 3ABMC 4JI5B 1YSCA 3CCEV 4JZ2A 5LXTB 2YI9A 3JD2A 1I7FA 1SZXA 4N23A 4QJFB 2UXBB 3CEIA 5IY5B 2H3OA 5E1AC 3SPHA 4YIOA 1PP9H 3WB0A 2EBOA 1Q7YW 5LMNO 2W6JG 1SQGA 5KHIA 1XMOB 5GTHZ 3CCLV 4UCRA 3ML0A 5BMVA 1F51A 1R73A 4X20B 4C7UA 5CBFA 1V55B 3SYAA 1VIBA 1HW7A 1N34B 4LFAO 4DV1O 1ZWIC 3HKCB 1E1QG 1K5SA 1RM1C 1IBKO 1PNLA 3CPWU 2OWOA 2IW5A 3E2EA 1SETA 2YIDA 4QNHB 5JH7A 1FFXB 5GTIZ 1O9GA 2ZE6A 4FLZA 3FAVA 4YY3O 5B5EZ 1IBLB 3UCSC 2EULA 4DR4B 4I5SA 4F6RB 1XUQA 4OX9O 2EJ7A 3AK1A 4K0KB 1J5EB 4F6EA 3HKBA 2HR3A 1IXBA 5EIBC 4Q20A 2ARHA 1OCOB 2JJ2G 1WNSA 1EN5A 3CCSV 1WP7A 1TUBA 1SA0B 4LF8O 4JASA 1D5AA 3RFRA 4JGSA 2YIAA 3ZJZA 4FM1A 4MT8A 1LUWA 3ABLC 2ZM6B 1DF5A 5A2QN 1L1FA 2LGWA 3D36C 4FMTA 4GUNA 1OCCB 3GWOA 5CBGA 5LGTA 1MZEA 3U11A 5J9PC 2XHBA 4KFMA 3GVMA 4LFCB 1PL4A 3ZHSA 5JCOC 2Y4TA 4X89A 1HNWO 1JPXA 3T4ZA 1HP8A 3T1HO 1NT2B 1SQQH 2QTOA 3L74H 1VQ5V 1AROP 1NH2B 2EJRA 3JATB 4UCTA 5LL6Y 3N2GA 3L72H 1K8AW 3E8FA 1YITV 3MD0A 4J9ZB 1SQBH 2DE0X 3C3SA 1K33A 2P4KA 2EINB 1FJGB 2AW9A 2WLMA 5BMVB 4YHHO 4B3SO 4X66B 1PPJH 3DC5A 2JGUA 3D3QA 5JQGA 1HNXB 1KD1W 3W7XA 2UU9B 4GT1A 3ZBHA 1P7GA 4DR1O 3OFNG 4B3MB 5JH7B 3HB3B 4GX1A 4LNUA 2EIKC 1AJNA 3CCQV 2VS0A 2VQEO 1JOYA 4J11A 3FAVB 3RWRD 2WLKA 2Y0PA 3MDSA 1YJNV 4DUZO 4QPJA 3LSQA 3AG2C 2IJKA 4AQYB 2L6LA 2Q0AA 3DC6A 2JDIG 1F7YA 2Y48A 1SF9A 4PA9A 2JVDA 3L9DA 4LWSA 4UV9A 3CCMV 3JD0A 5B66Z 2RDCA 3DGEA 1NTMH 3HKBB 4I9QA 1OCRB 3UQ8A 4JAAA 3AG7A 4OPHA 3K06A 3OR7C 5IE9A 4LH6A 3LSUA 1M1KW 4G2KA 1TUBB 5IYBO 2DWDC 1S3JA 5KHGA 3FX7A 3SPGA 4GLXA 5K1PA 2DMXA 1R3KC 2WLLA 4LF5B 2GTSA 2RQ6A 5H9CA 5LMNB 4O2AA 2DN9A 3NXSA 4GX5A 4BIUA 2DYSC 2A7WA 4KL1A 3E89A 5DECA 2WLHA 3RYFA 2Q9LA 1LNQA 4NYKA 3IJ4A 4LH7A 1GN4A 3CCUV 2HG5C 3KKYA 1P7BA 5L3EA 1JJ2U 4TSFG 3F7VC 4LFAB 3CJHB 1IX9A 1FYJA 1AVMA 2JJ1G 5F2VO 2CTPA 2FYUH 3N2GB 5K1XA 1YVWA 1K9MW 1BGYH 4MW3A 2OCCC 1NI8A 3SGIA 3APOA 4GZRB 3R65A 5TISZ 1EN4A 1H2LA 3B8MA 2F1MA 2QM8A 5L3BA 5LMUB 4JI2O 4O4JB 1OCZC 5JQGB 2ODMA 1GM7A 1H2NA 2XUMA 3WU2Z 2Q0OC 4O4IA 1XMQO 4WFBV 4TQFA 3LNNA 3FYEB 2XOKG 2HJFC 1NR1A 4JI8B 1RSOB 1JA8A 2QKCA 3PJSK 1G8MA 4UVAA 4EFEA 3MAQA 3LSSA 4MW8A 4LR3A 3P30A 1Q6HA 1YI2V 1A32A 4R8CA 4A5UB 4JYAO 4B3TO 1GH6A 3Q4HA 2DWEC 3RGBA 4LWSB 4PA3A 2GV9A 1QLNA 2HKOA 3M7MX 1ENVA 5EBLC 1SQVH 2HFEC 3RN4A 3JALA 3LDEA 5CA0A 4ZBMA 2DW4A 5BXZA 5KLVH 1H2GA 3JARA 1KB9F 4U3JA 1RPRA 3VQVA 5GW7A 2KKWA 1Y74B 5EZYA 3ZHQA 3T1HB 1R6NA 1I0HA 1TGOA 3CC4V 3JAMN 5FPOA 4DR7B 2UUCO 1GN3A 1W59A 1WPXA 2YEVA 2ZD9A 4O2AB 4BW9A 4UB8Z 3W7SA 1FXVA 1B04A 2OTLV 3BY6A 3L71H 2VRZA 3H1KH 3RYFB 2W0FC 2IH3C 3T2MA 4IHJA 1H2KA 2UXCO 2Q69A 4UVCA 4IL6Z 2CK3G 2AGAA 1EZVH 5KAIZ 4QPKA 2WA4A 5LP6B 4DR1B 4JI7O 1BHBA 3C90A 2NN4A 2L35A 1XILA 4RUFA 2VQEB 1US6A 1YIJV 1I5XA 4BW5A 2YDEA 2ZKOA 2X0LA 5B3SB 4X1IB 3CB2A 4DRXA 4FM2A 3SR2C 1XL6A 4DUZB 3SJQC 4NXNO 1YF2A 2HVKC 5H6RA 2P6JA 4Z1MG 4CH4A 1SESA 1SERA 1XBLA 4MTOA 4DV7O 1NJIW 5CN0A 1Y66A 3OW2U 1XDCA 1ORQC 2QWPB 3BA8A 3D3IA 3NR7A 4K35A 1N4CA 1XNQO 3WB2A 3EVKA 4JV5B 3K04A 1M5IA 3Q4HB 2XAFA 3S3WA 2QWQB 2GDSA 4UV8A 1K92A 1CP9A 4DO2A 2O57A 2CTWA 1IVSA 1EFRG 3BCCH 2LFRA 4WFFA 3JALB 5IDJA 4DR6O 1ZSPA 1I5YA 5CA0B 1VQPV 2IU0A 3K5OA 2CAZC 3ZMVA 2HVJC 3JARB 2Q4PA 4U3JB 5BR8B 3DSQA 5CA3A 2XASA 5EZYB 1WJZA 1SQPH 1VQ7V 2UXDB 4I50A 3F5TA 1Y67A 3CC2V 2Y4UA 3N2KB 4GX0A 4WBNA 1I94O 3K03A 3E22A 2RMKB 3H1IH 3ABMB 4AILC 1WB7A 2ZE5A 3AEIA 3G4SV 2Z5UA 4IHJB 4FLXA 4FJCC 1K4CC 2GTAA 4JI2B 3E8GA 3FB7C 1KUQA 4JI0O 1RPOA 1GN6A 1XMQB 3ASOC 3BEHA 1JFFB 3OUFA 4GKKB 1PV0A 2E3CA 2QKAA 3SYQA 1S5JA 1F4MA 2KB1A 5CB4A 4U7OA 3AG4B 3OD4A 4NVPA 2EX3A 3ABKC 3H9VA 4DRXB 5LA6A 3FB6C 1IDSA 3U10A 1OJHA 4RAIA 4B3TB 1EZJA 1M93A 3SYPA 1FXKC 2JS3A 4JI1O 4JZGA 5KA5A 4ZOLA 4CC6A 1BSMA 1G1XB 2EZOA 3SJAC 2ZDIC 4DR2O 1SA0A 2Q5ZA 5DN6G 2LW7A 2JEXA 4FLWA 1S72V 3JYCA 1JCHA 2LGQA 2A06H 2PI5A 5KHHA 5D5PA 2IJHA 4PA4A 3LNMB 3AG1C 4BIZA 1AR5A 5IYZA 1YDXA 4UFZA 3M99B 1QR8A 2VQFO 3ETGA 1T5EA 3TK1A 3K5LA 2R9IA 4I50B 2CE4A 3ABLB 2EILB 3SPCA 3JATA 2EIMC 4WBNB 3E22B 1WN7A 4P9OA 4RQEA 5EK0A 1MSDA 3ZCCA 4JI6O 1VARA 4LF7B 4NTXA 5FLXN 1H38A 5JVDA 1QHTA 1KU9A 4PI0A 2Y0IA 2HHHB 3CC7V 4JYCA 1QLEC 1VF7A 1RP3B 1SQXH 1IBMO 2KSDA 4DV7B 2RCVA 5B1BB 3ZN1A 4O2BA 2DQ3A 4J10A 5CB4B 5EBMC 4DR5O 1J95A 1XNQB 2Q7HA 5LA6B 1PKXA 3CE2A 4JPRA 4DV3O 4UCUA 3MHSC 1PD3A 4JTCB 1MNGA 3K3WA 2UUAO 4IGGA 2XAHA 4K3AA 4H13B 4DXWA 4NKGB 4DR6B 4PDVA 2Q6AA 4ZOLB 1I08A 3CX5F 4FVMA 3JD4A 1GMGA 1QVGU 1EN6A 1VF6A 2UUBO 4L8JA 1FS0G 2LFSA 2ILMA 2V4DA 1N0JA 3T1YO 5KUKA 2ZR3A 4MVSA 1R6KA 2Z0AA 4LF6B 2ADPA 2CH7A 4PV1B 4EEQA 2PYLA 3X2QB 3TGUH 3CP1A 1GM8A 4TV8A 1I94B 3STLC 2F43G 3VBBA 1L0NH 1V54B 5IYZB 1GN2A 3QO8A 4FLVA 3E8BA 3OM3B 3E86A 2XAGA 5IY5C 1DK1A 3I5DA 2LP7A 1KKCA 1HWYA 4LF4O 4DUYO 4JI0B 2YUAA 4Z1VA 1COWG 3CJHA 1KKDA 2X7RB 4PELA 3BA9A 2IU3A 1KP2A 2P67A 3EHBB 5KA6A 1UJWB 4EB6A 1GAXA 4MVRA 5IWAB 1RFYA 2N04A 2QSAA 5JVDB 3UT5B 1V55C 3GB7C 2EIJB 2Q67A 1HNZO 1N0NA 4O4JA 5EIBD 2AXTZ 4MTFA 4GYCB 3ZS8C 2QJ1A 4DV5O 3K08A 3SJBC 3WG7B 1QBZA 1UFIA 4O2BB 1NQTA 3VOUA 4LF9O 5HFLA 4J42A 1G4YB 4JAVA 1RSOA 3CCRV 4MTGA 1THZA 2IH1C 2Q7EA 3ETDA 2WSSG 5D5QA 4PA7A 1MSWD 2B9ZA 4I4TB 5C8YA 1S0VA 1NTZH 4DV6O 3IGAC 1OCOC 1M90W 2P06A 4MVQA 2ETNA 4PDLA 2E5LO 1Z5WA 4YIPA 1NVPB 3W7UA 2CGOA 3SDLA 2JK5C 2Q73A 3QVNA 1Y74A 4MS2A 4NR1A 3AG3B 3STZC 4FLUA 3BVOA 4DK0A 3ZMZA 2Q7GA 2CH7B 2ZINA 4N21A 3CHXA 1U97A 1OCCC 1X4TA 3THOA 1VEWA 4TV8B 3OTFA 3VQYA 4FLYA 4RWUA 3ZHTA 3WFVA 4JI6B 1BMFG 3SPIA 1B6QA 4PHZA 5H5NA 3FB8C 1JMKC 3OMNB 1GRJA 1Z5VA 4Q6GA 4I0XB 5B1AB 3F7YC 3H1JH 2R70A 3UO2A 4DV1B 3JASA 3L70H 1YHQV 2ZIMA 1IBKB 1L0LH 3A0BZ 5LP6A 4RQFA 4MTXA 1WA8A 1FD9A 4JI3O 5B1NA 3QF7A 4P9PA 4EB6B 3BPZA 5HFMA 4TWKA 2RNBA 1GO3F 1NU1H 2NLJC 4XBFA 3CSXA 4DR5B 4YY3B 4X1IA 4EKWA 3T4DA 2QR4A 2FB5A 4DV3B 1S5HC 1CXZB 1Q6IA 3C3TA 4OX9B 2LJ2A 1U96A 1YCIA 2B5UA 1Q8IA 4B08A 1VQ6V 1KP3A 3CRMA 5BY1A 2N74A 1K34A 4UUJC 3J81N 4R7CA 4JYYA 5FNVB 1MZFA 4E4EA 4KXRA 2Q8VA 2H8PC 1MMMA 4ZHQB 4X1YA 3SJCC 4LF8B 3H1LH 1D5NA 1H2MA 3T1YB 2OCHA 4X64O 2G38A 3KCXA 4B7EA 5FL7G 3ABTA 2W6IG 5C8YB 2UXXA 2ZNIA 3HKDA 1KECA 4OXSA 4LFBO 3K9SA 3FB5C 1FKAO 4KHPO 1JJOA 2FL4A 5L3CA 1GTOA 1DTOA 3QO5A 1HNWB 2ZR2A 4B7KA 4XDJA 4PD4F 4LF4B 4DUYB 2IJIA 1Q3EA 2QWOB 1M56B 1JR9A 3N2KA 1FFTB 3ZMSA 2AZ2A 3LUTB 3TCUA 2QE7G 2FTKA 5IYCO 4YHHB 4I55A 1VQNV 4B3SB 4RUEA 1XNRO 2DYRB 1QQCA 2PY5A 2CUGA 5GONA 3FKSG 3PN1A 1HNZB 2E74B 1WAZA 2Y69C 2CTRA 2VWKA 4WCEV 3IC9A 3FYIB 4G27B 2QWRB 1Z2GA 3JASB 1NS1A 1YZBA 1E79G 1VQKV 3ASNC 1JFFA 1WA8B 4EFBA 2M7WA 4CZZA 2YIBD 1URFA 1Y6XA 4IIJA 2R9AA 4JI5O 4CS3A 4HBNA 1NVPD 2W0XA 3RW0A 1P4RA 4OGQB 4DV2O 1TUEB 1YXBA 4CH6A 2V7QG 1BQ0A 5JWPA 2WLJA 5CA1A 1S77D 1Y4MA 1AI7A 4D6TH 2ZXWB 3T1CA 2K9PA 2JRIA 3G6BA 5JJJB 3JSNA 2DJVA 2PUSA 1AB3A 1IXMA 3W7WA 2FKXA 1IURA 4TUYA 4X1YB 4ICGA 1SKVA 1N34O 3B2EE 2BE3A 4UB6Z 3G6EV 3UM7A 2PF4E 3F5WC 1S5LZ 3O9OA 1TVKB 2AZ0A 1W0JG 2BTOA 3AK2A 1K73W 3ZX6A 1XHXA 4DR3O 1GKFA 4F4LA 4BIOA 2XAJA 4DK1A 3K79A 4DW0A 4PI2A 3CMAV 3HKDB 4JI4O 4U7NA 3TXQA 1VF5B 1VQMV 4FZ1A 1M57B 3A8TA 1VQ4V 2A3QA 3L73H 1BL8A 1NKDA 4PDRA 2QWNB 4U3FH 4YJ2A 4ZI7B 2F23A 2HLDG 3J80N 4FK5C 3QNEA 4CH5A 3D36A 4JI3B 3CXCU 2PTMA 5EYPB 1N36O 5FPRA 2RJZA 4I55B 4H44B 1HR0O 2MW2B 2EZPA 4H33A 5JCOA 5GONB 2F66C 5LGNA 3RYCA 3K5MA 1PNMA 1AI6A 4E2LA 2WLIB 4HAMA 4O4HA 5KUMA 3UO3A 1NR7A 1N33O 4KP4A 3ETQA 4IIJB 3N27A 4LFCO 1K97A 1B3QA 5B3SC 1JX9A 4IT5A 4O4LA 3RBZA 5J2UB 4UXNA 3B77A 4JYAB 5CA1B 1RM1B 1K3EA 4KUMA 2F4VO 1CEZA 4X64B 5LHGA 2XT9A 5CMUA 1Q6UA 3BFRA 1VQLV 4X66O 4FM0A 3G71V 4GX2A 2C2AA 4LFBB 3ZRVA 2WAMA 1AJQA 2PI4A 1QNMA 2BTQA 5CBHA 3I56V 1BQZA 3G67A 4TUYB 1XOUA 4NTYA 2BSKA 3IFXA 4X8AA 1M9NA 4X65O 4B3MO 2ZNJA 2UUCB 3JAKB 2N05A 4OPAA 2YXLA 3DXRA 2P90A 5KHJA 5H2FZ 1XNRB 2GUZA 3EXAA 2DQ0A 2P5OA 2UXCB 2JEUA 1ROPA 3FD9A 1EM1A 1F4NA 1PNKA 4YJ2B 2YXHA 4DV4O 3WB1A 1MOFA 2HEPA 5L3DA 1H8HG 4RO2A 4JI7B 4J7ZA 2QEXV 4W4KA 4MVZA 4MSWC 3K0GA 3ZHRA 5DM6V 3UT5A 3ZRSA 5L3GA 1P49A 3RYCB 4K8XA 4DV2B 2ITDC 4LF5O 2QM4A 2CGNA 2VWJA 3JCUZ 4NXNB 4MVUA 1XHZA 4O4HB 3RYIA 2XNDG 3RT3C 5KAFZ 1R3JC 4HNAA 1F23A 3GWKC 3AG4C 4HZ3A 3ETEA 2YXYA 4O4LB 1YJWV 3CCJV 4B3RO 4IYIA 3OEEG 2BCCH 1SQFA 3ZRXA 4I4TA 1NBMG 1TA8A 3EFFK 4DR3B 3ZN0A 1BCCH 2KG7A 2OTJV 5KX5A 3R66A 1W0KG 2EIKB 1MA1A 2HP8A 2MK3A 1TAEA 4QIWF 3I55V 4P30A 2YIBA 1FAFA 4JI4B 3JCZA 4UCOA 2PZSA 4DYLA 2ZE7A 2BTQB 3CRRA 5LMUO 2RN9A 2AHZA 3FFQA 5ITZB 1ZL8B 3K5NA 3IC7A 2BSKB 1XL4A 3AG2B 2ZQMA 4TQDA 5A9GA 3B8NA 5LOVB 3K59A 1ZX3A 5LBQA 2V1DA 1KC8W 4JI8O 2X6BA 3OAAG 2D2CB 4YJ3A 3AK3A 4DW1A 3OTOO 4HYOA 3DXRB 1N36B 3TXSA 3SPJA 2KQXA 3VQWA 1HR0B 1YEWA 3S3XA 2GUZB 3OE7G 3DTUB 4MVOA 3A0HZ 3KCYA 1W2BU 1BZKA 3ZMUA 4I0XA 2EILC 2PGGA 4K8ZA 1FXHA 5LYJA 5LHHA 4GKJO 2B1GA 2DYSB 1N33B 3ZMTA 4NB5A 1VMGA 2F95B 1GM9A 4H0LB 5J2TA 2JS5A 2A9HA 3UKMA 1AILA 1XI1A 2P7TC 4FFBA 4GCZA 4DR7O 1K5QA 4AI8A 2F4VB 1O9HA 3KZIZ 4ZIBA 3RYIB 2UXNA 5B1BC 4HNAB 2QGNA 4JI1B 1N8RW 2OCCB 4D7TA 5EC2C 5FNVA 3OEHG 5EBWC 5B1OA 1YTFB 5JJNB 4ZHQA 4DR2B 4ZKIA 1OCZB 4WFEA 1R1BA 4X65B 4ABMA 1YJ9V 4WFHA 3CRCA 1MG1A 4IYHA 2JGDA 2KG7B 3CYOA 5KX5B 1VQOV 3W7TA 1BHAA 1PL0A 4P2ZA 4JTAB 3K0DA 3QO7A 3A2FA 2VQFB 5LGUA 4JAUA 4DV0O 3JD1A 5LHIA 1AP6A 2X6CA 4DV4B 4NXMO 5BZBA 1EBOA 2WA3A 3ICXA 3X2QC 1XEQA 2BOCC 4YJ3B 1KQSU 2NNUA 4UVBA 2ITCC 4JV5O 1V54C 1CPYA 2YICA 2ADQB 3KG2A 3OR6C 1AJPA 1Q81W 4J7JA 4FIPC 2QKSA 4J41A 2OYQA 3O65A 5C93A 5LYJB 3ZRWA 1HDJA 3BHPA 1IBMB 5KMGA 1OHHG 1XREA 2EINC 3APQA 5BR8O 2IJJA 3CRQA 5J2TB 4G28B 2EIJC 2UXDO 3CXHF 2ZIOA 1LR1A 4YXWG 4B3RB 1Q5OA 2Y69B 3QTCA 4FFBB 4I7ZB 1ZTEA 1ZAUA 3BABA 3B09A 3ASNB 4WFAV 2ZE8A 2UUAB 3WG7C 4NTWA 1M4UA 3CCVV 2IM9A 4J9YB 1LUVA 3ZEDA 2H94A 2UUBB 1Q90D 2DOSA 2LW1A 1Q43A 3HKEA 4PDMA 1SS3A 5JJEB 2OIGA 3TJTA 1TVKA 1FXKA 3HPLC 4GKKO 3LDCA
chains in the Genus database with same CATH topology
3CWBH 1SQXH 1EZVH 1P84F 1SQQH 3L74H 1SQVH 1SQPH 1KYOF 3L73H 1NU1H 1BCCH 4D6TH 4U3FH 1NTKH 3L72H 5KLVH 3TGUH 3CXHF 3L71H 1KB9F 2IBZH 3H1KH 3L75H 3BCCH 3CX5F 1SQBH 3H1LH 3H1JH 1NTMH 3L70H 2FYUH 1L0NH 1NTZH 1L0LH 1PPJH 1BGYH 1PP9H 2BCCH 2A06H 1BE3H 3H1IH 4PD4F 3H1HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWB H;  1SQX H;  1EZV H;  1P84 F;  1SQQ H;  3L74 H;  1SQV H;  1SQP H;  1KYO F;  3L73 H;  1NU1 H;  1BCC H;  4D6T H;  4U3F H;  1NTK H;  3L72 H;  5KLV H;  3TGU H;  3CXH F;  3L71 H;  1KB9 F;  2IBZ H;  3H1K H;  3L75 H;  3BCC H;  3CX5 F;  1SQB H;  3H1L H;  3H1J H;  1NTM H;  3L70 H;  2FYU H;  1L0N H;  1NTZ H;  1L0L H;  1PPJ H;  1BGY H;  1PP9 H;  2BCC H;  2A06 H;  1BE3 H;  3H1I H;  4PD4 F;  3H1H H; 
#chains in the Genus database with same CATH topology
 4LNU B;  1P84 F;  1OCR C;  2JGD B;  3P32 A;  3RVY A;  1E1R G;  3OTO B;  2AHY A;  1BS3 A;  3VQX A;  2YSU B;  2Z3Y A;  4X9Q A;  2ZDI A;  4QGP A;  1VF6 C;  1QCE A;  3E8H A;  3J7A U;  1R3I C;  3JAW A;  1DF4 A;  1NH2 D;  3AG3 C;  4QE7 A;  2Q68 A;  2QDO A;  1BE3 H;  1K7D A;  4LCU C;  1N32 O;  4ZI7 A;  3H1H H;  5IJ9 A;  3OGI B;  1OV9 A;  4GKJ B;  5IYD O;  4CS2 A;  2OT5 A;  4FFK A;  5EYP A;  4BWA A;  2R9R B;  1AI5 A;  1L8D A;  3OMI B;  4X62 O;  3A0R A;  4LBE C;  1YTF D;  2WWW A;  4JTD B;  3RYH A;  4FPP A;  3OUS A;  1JVM A;  1XQ8 A;  2XAQ A;  4BAY A;  5H6Q A;  4CC5 A;  2WLL B;  5B1A C;  1VQ8 V;  2P22 C;  4X1K A;  2WLI A;  1B06 A;  1JQ0 A;  2JIZ G;  4CBC A;  3ZRW B;  4DV5 B;  1AI4 A;  5KMG B;  2F93 B;  1R6T A;  4LF9 B;  5IT9 N;  2GBO A;  1OZ0 A;  2WPD G;  4BR6 A;  2UXB O;  1NZ6 A;  1QR9 A;  5J2U A;  3CWB H;  4UCV A;  1SRY A;  3ASO B;  1XMO O;  2XTA A;  1H2S B;  2ZCE A;  3K9A A;  4LF7 O;  4TV9 A;  4DV6 B;  2BOB C;  1MAB G;  2WLN A;  4ASU G;  5IJ0 A;  3ABK B;  1ZLZ A;  2HHH O;  2E5L B;  3G80 A;  1G6U A;  1QVF U;  1SC5 B;  1PM9 A;  1WP8 A;  1Y76 A;  4O4I B;  3HKE B;  3SYO A;  4DV0 B;  4D7S A;  4NXM B;  1FXK B;  3CD6 V;  4X88 A;  4FZ0 A;  2ATK C;  3JAK A;  1H8E G;  4CS4 A;  3BRC A;  5AG2 A;  3MHH C;  4WFG A;  3P3P A;  1IBL O;  3P3N A;  4AHC A;  4DR4 O;  4W4L A;  1ZUQ A;  4JYB A;  3JAW B;  4PJ0 Z;  2M6Y A;  2YI8 A;  4LC1 A;  4K0K O;  1J5E O;  1NTK H;  3ZHU A;  1M56 C;  5IJ9 B;  4XDL A;  2IBZ H;  4MVM A;  4H37 A;  1DLB A;  2PYJ A;  3H01 A;  3AG1 B;  1X59 A;  3U0Z A;  2DYR C;  5LXT A;  2A0L A;  3B4S A;  2HJD A;  3RYH B;  5EC1 C;  1AR4 A;  2E75 B;  3OMA B;  3JSL A;  4R6Z A;  1WPB A;  3RVZ A;  2B1I A;  4LF6 O;  2ZM6 O;  3M8A A;  1VP7 A;  2YEV B;  1QU7 A;  2EIM B;  4PA6 A;  4X1K B;  1DGS A;  1Q82 W;  4LP8 A;  5LP6 C;  5KHK A;  2GHY A;  3D8C A;  3IAY A;  4X20 A;  2K1E A;  4QE9 A;  4XDK A;  1AP5 A;  1V9P A;  2NR5 A;  3TET A;  2YS8 A;  4J80 A;  4Z2W A;  3CRA A;  1KBH A;  3HKC A;  1GK9 A;  1SZT A;  3L75 H;  2R72 A;  1WB8 A;  1QLE B;  2LQT A;  2ZXW C;  3E35 A;  4J7K A;  1FFX A;  2P4V A;  2CDY A;  5IWA O;  2QA4 V;  1FJG O;  3CS5 A;  3ZHV A;  4FLT A;  3B40 A;  2D3O W;  4TV9 B;  1AR1 B;  3SYC A;  5DED A;  1KYO F;  5IJ0 B;  1BT8 A;  4F6R A;  2A79 B;  2QTS A;  2X6A A;  2E76 B;  5ITZ A;  1ZL8 A;  3OGC C;  4KHP B;  1HNX O;  4WF9 V;  3JD3 A;  2UU9 O;  1K4D C;  1Y76 B;  2OIE A;  3QG5 A;  1IZ3 A;  3OT7 A;  4CH3 A;  1N32 B;  3CME V;  3K57 A;  5LOV A;  1VQ9 V;  1D2D A;  2LO1 A;  4TOI A;  1WLE A;  2YC0 A;  4L87 A;  4R50 A;  3K58 A;  5E79 Z;  3ZIA G;  4X62 B;  2CTQ A;  3E83 A;  1UPG A;  5L3F A;  4AQY O;  2ZT9 B;  1M57 C;  4TT3 G;  2QM7 A;  3HR0 A;  3BAA A;  3LDD A;  4I9W A;  1Q86 W;  1FPO A;  3ABU A;  2FML A;  1S76 D;  1R3L C;  4JF3 A;  2GSM B;  1KMI Z;  4UCS A;  3ABM C;  4JI5 B;  1YSC A;  3CCE V;  4JZ2 A;  5LXT B;  2YI9 A;  3JD2 A;  1I7F A;  1SZX A;  4N23 A;  4QJF B;  2UXB B;  3CEI A;  5IY5 B;  2H3O A;  5E1A C;  3SPH A;  4YIO A;  1PP9 H;  3WB0 A;  2EBO A;  1Q7Y W;  5LMN O;  2W6J G;  1SQG A;  5KHI A;  1XMO B;  5GTH Z;  3CCL V;  4UCR A;  3ML0 A;  5BMV A;  1F51 A;  1R73 A;  4X20 B;  4C7U A;  5CBF A;  1V55 B;  3SYA A;  1VIB A;  1HW7 A;  1N34 B;  4LFA O;  4DV1 O;  1ZWI C;  3HKC B;  1E1Q G;  1K5S A;  1RM1 C;  1IBK O;  1PNL A;  3CPW U;  2OWO A;  2IW5 A;  3E2E A;  1SET A;  2YID A;  4QNH B;  5JH7 A;  1FFX B;  5GTI Z;  1O9G A;  2ZE6 A;  4FLZ A;  3FAV A;  4YY3 O;  5B5E Z;  1IBL B;  3UCS C;  2EUL A;  4DR4 B;  4I5S A;  4F6R B;  1XUQ A;  4OX9 O;  2EJ7 A;  3AK1 A;  4K0K B;  1J5E B;  4F6E A;  3HKB A;  2HR3 A;  1IXB A;  5EIB C;  4Q20 A;  2ARH A;  1OCO B;  2JJ2 G;  1WNS A;  1EN5 A;  3CCS V;  1WP7 A;  1TUB A;  1SA0 B;  4LF8 O;  4JAS A;  1D5A A;  3RFR A;  4JGS A;  2YIA A;  3ZJZ A;  4FM1 A;  4MT8 A;  1LUW A;  3ABL C;  2ZM6 B;  1DF5 A;  5A2Q N;  1L1F A;  2LGW A;  3D36 C;  4FMT A;  4GUN A;  1OCC B;  3GWO A;  5CBG A;  5LGT A;  1MZE A;  3U11 A;  5J9P C;  2XHB A;  4KFM A;  3GVM A;  4LFC B;  1PL4 A;  3ZHS A;  5JCO C;  2Y4T A;  4X89 A;  1HNW O;  1JPX A;  3T4Z A;  1HP8 A;  3T1H O;  1NT2 B;  1SQQ H;  2QTO A;  3L74 H;  1VQ5 V;  1ARO P;  1NH2 B;  2EJR A;  3JAT B;  4UCT A;  5LL6 Y;  3N2G A;  3L72 H;  1K8A W;  3E8F A;  1YIT V;  3MD0 A;  4J9Z B;  1SQB H;  2DE0 X;  3C3S A;  1K33 A;  2P4K A;  2EIN B;  1FJG B;  2AW9 A;  2WLM A;  5BMV B;  4YHH O;  4B3S O;  4X66 B;  1PPJ H;  3DC5 A;  2JGU A;  3D3Q A;  5JQG A;  1HNX B;  1KD1 W;  3W7X A;  2UU9 B;  4GT1 A;  3ZBH A;  1P7G A;  4DR1 O;  3OFN G;  4B3M B;  5JH7 B;  3HB3 B;  4GX1 A;  4LNU A;  2EIK C;  1AJN A;  3CCQ V;  2VS0 A;  2VQE O;  1JOY A;  4J11 A;  3FAV B;  3RWR D;  2WLK A;  2Y0P A;  3MDS A;  1YJN V;  4DUZ O;  4QPJ A;  3LSQ A;  3AG2 C;  2IJK A;  4AQY B;  2L6L A;  2Q0A A;  3DC6 A;  2JDI G;  1F7Y A;  2Y48 A;  1SF9 A;  4PA9 A;  2JVD A;  3L9D A;  4LWS A;  4UV9 A;  3CCM V;  3JD0 A;  5B66 Z;  2RDC A;  3DGE A;  1NTM H;  3HKB B;  4I9Q A;  1OCR B;  3UQ8 A;  4JAA A;  3AG7 A;  4OPH A;  3K06 A;  3OR7 C;  5IE9 A;  4LH6 A;  3LSU A;  1M1K W;  4G2K A;  1TUB B;  5IYB O;  2DWD C;  1S3J A;  5KHG A;  3FX7 A;  3SPG A;  4GLX A;  5K1P A;  2DMX A;  1R3K C;  2WLL A;  4LF5 B;  2GTS A;  2RQ6 A;  5H9C A;  5LMN B;  4O2A A;  2DN9 A;  3NXS A;  4GX5 A;  4BIU A;  2DYS C;  2A7W A;  4KL1 A;  3E89 A;  5DEC A;  2WLH A;  3RYF A;  2Q9L A;  1LNQ A;  4NYK A;  3IJ4 A;  4LH7 A;  1GN4 A;  3CCU V;  2HG5 C;  3KKY A;  1P7B A;  5L3E A;  1JJ2 U;  4TSF G;  3F7V C;  4LFA B;  3CJH B;  1IX9 A;  1FYJ A;  1AVM A;  2JJ1 G;  5F2V O;  2CTP A;  2FYU H;  3N2G B;  5K1X A;  1YVW A;  1K9M W;  1BGY H;  4MW3 A;  2OCC C;  1NI8 A;  3SGI A;  3APO A;  4GZR B;  3R65 A;  5TIS Z;  1EN4 A;  1H2L A;  3B8M A;  2F1M A;  2QM8 A;  5L3B A;  5LMU B;  4JI2 O;  4O4J B;  1OCZ C;  5JQG B;  2ODM A;  1GM7 A;  1H2N A;  2XUM A;  3WU2 Z;  2Q0O C;  4O4I A;  1XMQ O;  4WFB V;  4TQF A;  3LNN A;  3FYE B;  2XOK G;  2HJF C;  1NR1 A;  4JI8 B;  1RSO B;  1JA8 A;  2QKC A;  3PJS K;  1G8M A;  4UVA A;  4EFE A;  3MAQ A;  3LSS A;  4MW8 A;  4LR3 A;  3P30 A;  1Q6H A;  1YI2 V;  1A32 A;  4R8C A;  4A5U B;  4JYA O;  4B3T O;  1GH6 A;  3Q4H A;  2DWE C;  3RGB A;  4LWS B;  4PA3 A;  2GV9 A;  1QLN A;  2HKO A;  3M7M X;  1ENV A;  5EBL C;  1SQV H;  2HFE C;  3RN4 A;  3JAL A;  3LDE A;  5CA0 A;  4ZBM A;  2DW4 A;  5BXZ A;  5KLV H;  1H2G A;  3JAR A;  1KB9 F;  4U3J A;  1RPR A;  3VQV A;  5GW7 A;  2KKW A;  1Y74 B;  5EZY A;  3ZHQ A;  3T1H B;  1R6N A;  1I0H A;  1TGO A;  3CC4 V;  3JAM N;  5FPO A;  4DR7 B;  2UUC O;  1GN3 A;  1W59 A;  1WPX A;  2YEV A;  2ZD9 A;  4O2A B;  4BW9 A;  4UB8 Z;  3W7S A;  1FXV A;  1B04 A;  2OTL V;  3BY6 A;  3L71 H;  2VRZ A;  3H1K H;  3RYF B;  2W0F C;  2IH3 C;  3T2M A;  4IHJ A;  1H2K A;  2UXC O;  2Q69 A;  4UVC A;  4IL6 Z;  2CK3 G;  2AGA A;  1EZV H;  5KAI Z;  4QPK A;  2WA4 A;  5LP6 B;  4DR1 B;  4JI7 O;  1BHB A;  3C90 A;  2NN4 A;  2L35 A;  1XIL A;  4RUF A;  2VQE B;  1US6 A;  1YIJ V;  1I5X A;  4BW5 A;  2YDE A;  2ZKO A;  2X0L A;  5B3S B;  4X1I B;  3CB2 A;  4DRX A;  4FM2 A;  3SR2 C;  1XL6 A;  4DUZ B;  3SJQ C;  4NXN O;  1YF2 A;  2HVK C;  5H6R A;  2P6J A;  4Z1M G;  4CH4 A;  1SES A;  1SER A;  1XBL A;  4MTO A;  4DV7 O;  1NJI W;  5CN0 A;  1Y66 A;  3OW2 U;  1XDC A;  1ORQ C;  2QWP B;  3BA8 A;  3D3I A;  3NR7 A;  4K35 A;  1N4C A;  1XNQ O;  3WB2 A;  3EVK A;  4JV5 B;  3K04 A;  1M5I A;  3Q4H B;  2XAF A;  3S3W A;  2QWQ B;  2GDS A;  4UV8 A;  1K92 A;  1CP9 A;  4DO2 A;  2O57 A;  2CTW A;  1IVS A;  1EFR G;  3BCC H;  2LFR A;  4WFF A;  3JAL B;  5IDJ A;  4DR6 O;  1ZSP A;  1I5Y A;  5CA0 B;  1VQP V;  2IU0 A;  3K5O A;  2CAZ C;  3ZMV A;  2HVJ C;  3JAR B;  2Q4P A;  4U3J B;  5BR8 B;  3DSQ A;  5CA3 A;  2XAS A;  5EZY B;  1WJZ A;  1SQP H;  1VQ7 V;  2UXD B;  4I50 A;  3F5T A;  1Y67 A;  3CC2 V;  2Y4U A;  3N2K B;  4GX0 A;  4WBN A;  1I94 O;  3K03 A;  3E22 A;  2RMK B;  3H1I H;  3ABM B;  4AIL C;  1WB7 A;  2ZE5 A;  3AEI A;  3G4S V;  2Z5U A;  4IHJ B;  4FLX A;  4FJC C;  1K4C C;  2GTA A;  4JI2 B;  3E8G A;  3FB7 C;  1KUQ A;  4JI0 O;  1RPO A;  1GN6 A;  1XMQ B;  3ASO C;  3BEH A;  1JFF B;  3OUF A;  4GKK B;  1PV0 A;  2E3C A;  2QKA A;  3SYQ A;  1S5J A;  1F4M A;  2KB1 A;  5CB4 A;  4U7O A;  3AG4 B;  3OD4 A;  4NVP A;  2EX3 A;  3ABK C;  3H9V A;  4DRX B;  5LA6 A;  3FB6 C;  1IDS A;  3U10 A;  1OJH A;  4RAI A;  4B3T B;  1EZJ A;  1M93 A;  3SYP A;  1FXK C;  2JS3 A;  4JI1 O;  4JZG A;  5KA5 A;  4ZOL A;  4CC6 A;  1BSM A;  1G1X B;  2EZO A;  3SJA C;  2ZDI C;  4DR2 O;  1SA0 A;  2Q5Z A;  5DN6 G;  2LW7 A;  2JEX A;  4FLW A;  1S72 V;  3JYC A;  1JCH A;  2LGQ A;  2A06 H;  2PI5 A;  5KHH A;  5D5P A;  2IJH A;  4PA4 A;  3LNM B;  3AG1 C;  4BIZ A;  1AR5 A;  5IYZ A;  1YDX A;  4UFZ A;  3M99 B;  1QR8 A;  2VQF O;  3ETG A;  1T5E A;  3TK1 A;  3K5L A;  2R9I A;  4I50 B;  2CE4 A;  3ABL B;  2EIL B;  3SPC A;  3JAT A;  2EIM C;  4WBN B;  3E22 B;  1WN7 A;  4P9O A;  4RQE A;  5EK0 A;  1MSD A;  3ZCC A;  4JI6 O;  1VAR A;  4LF7 B;  4NTX A;  5FLX N;  1H38 A;  5JVD A;  1QHT A;  1KU9 A;  4PI0 A;  2Y0I A;  2HHH B;  3CC7 V;  4JYC A;  1QLE C;  1VF7 A;  1RP3 B;  1SQX H;  1IBM O;  2KSD A;  4DV7 B;  2RCV A;  5B1B B;  3ZN1 A;  4O2B A;  2DQ3 A;  4J10 A;  5CB4 B;  5EBM C;  4DR5 O;  1J95 A;  1XNQ B;  2Q7H A;  5LA6 B;  1PKX A;  3CE2 A;  4JPR A;  4DV3 O;  4UCU A;  3MHS C;  1PD3 A;  4JTC B;  1MNG A;  3K3W A;  2UUA O;  4IGG A;  2XAH A;  4K3A A;  4H13 B;  4DXW A;  4NKG B;  4DR6 B;  4PDV A;  2Q6A A;  4ZOL B;  1I08 A;  3CX5 F;  4FVM A;  3JD4 A;  1GMG A;  1QVG U;  1EN6 A;  1VF6 A;  2UUB O;  4L8J A;  1FS0 G;  2LFS A;  2ILM A;  2V4D A;  1N0J A;  3T1Y O;  5KUK A;  2ZR3 A;  4MVS A;  1R6K A;  2Z0A A;  4LF6 B;  2ADP A;  2CH7 A;  4PV1 B;  4EEQ A;  2PYL A;  3X2Q B;  3TGU H;  3CP1 A;  1GM8 A;  4TV8 A;  1I94 B;  3STL C;  2F43 G;  3VBB A;  1L0N H;  1V54 B;  5IYZ B;  1GN2 A;  3QO8 A;  4FLV A;  3E8B A;  3OM3 B;  3E86 A;  2XAG A;  5IY5 C;  1DK1 A;  3I5D A;  2LP7 A;  1KKC A;  1HWY A;  4LF4 O;  4DUY O;  4JI0 B;  2YUA A;  4Z1V A;  1COW G;  3CJH A;  1KKD A;  2X7R B;  4PEL A;  3BA9 A;  2IU3 A;  1KP2 A;  2P67 A;  3EHB B;  5KA6 A;  1UJW B;  4EB6 A;  1GAX A;  4MVR A;  5IWA B;  1RFY A;  2N04 A;  2QSA A;  5JVD B;  3UT5 B;  1V55 C;  3GB7 C;  2EIJ B;  2Q67 A;  1HNZ O;  1N0N A;  4O4J A;  5EIB D;  2AXT Z;  4MTF A;  4GYC B;  3ZS8 C;  2QJ1 A;  4DV5 O;  3K08 A;  3SJB C;  3WG7 B;  1QBZ A;  1UFI A;  4O2B B;  1NQT A;  3VOU A;  4LF9 O;  5HFL A;  4J42 A;  1G4Y B;  4JAV A;  1RSO A;  3CCR V;  4MTG A;  1THZ A;  2IH1 C;  2Q7E A;  3ETD A;  2WSS G;  5D5Q A;  4PA7 A;  1MSW D;  2B9Z A;  4I4T B;  5C8Y A;  1S0V A;  1NTZ H;  4DV6 O;  3IGA C;  1OCO C;  1M90 W;  2P06 A;  4MVQ A;  2ETN A;  4PDL A;  2E5L O;  1Z5W A;  4YIP A;  1NVP B;  3W7U A;  2CGO A;  3SDL A;  2JK5 C;  2Q73 A;  3QVN A;  1Y74 A;  4MS2 A;  4NR1 A;  3AG3 B;  3STZ C;  4FLU A;  3BVO A;  4DK0 A;  3ZMZ A;  2Q7G A;  2CH7 B;  2ZIN A;  4N21 A;  3CHX A;  1U97 A;  1OCC C;  1X4T A;  3THO A;  1VEW A;  4TV8 B;  3OTF A;  3VQY A;  4FLY A;  4RWU A;  3ZHT A;  3WFV A;  4JI6 B;  1BMF G;  3SPI A;  1B6Q A;  4PHZ A;  5H5N A;  3FB8 C;  1JMK C;  3OMN B;  1GRJ A;  1Z5V A;  4Q6G A;  4I0X B;  5B1A B;  3F7Y C;  3H1J H;  2R70 A;  3UO2 A;  4DV1 B;  3JAS A;  3L70 H;  1YHQ V;  2ZIM A;  1IBK B;  1L0L H;  3A0B Z;  5LP6 A;  4RQF A;  4MTX A;  1WA8 A;  1FD9 A;  4JI3 O;  5B1N A;  3QF7 A;  4P9P A;  4EB6 B;  3BPZ A;  5HFM A;  4TWK A;  2RNB A;  1GO3 F;  1NU1 H;  2NLJ C;  4XBF A;  3CSX A;  4DR5 B;  4YY3 B;  4X1I A;  4EKW A;  3T4D A;  2QR4 A;  2FB5 A;  4DV3 B;  1S5H C;  1CXZ B;  1Q6I A;  3C3T A;  4OX9 B;  2LJ2 A;  1U96 A;  1YCI A;  2B5U A;  1Q8I A;  4B08 A;  1VQ6 V;  1KP3 A;  3CRM A;  5BY1 A;  2N74 A;  1K34 A;  4UUJ C;  3J81 N;  4R7C A;  4JYY A;  5FNV B;  1MZF A;  4E4E A;  4KXR A;  2Q8V A;  2H8P C;  1MMM A;  4ZHQ B;  4X1Y A;  3SJC C;  4LF8 B;  3H1L H;  1D5N A;  1H2M A;  3T1Y B;  2OCH A;  4X64 O;  2G38 A;  3KCX A;  4B7E A;  5FL7 G;  3ABT A;  2W6I G;  5C8Y B;  2UXX A;  2ZNI A;  3HKD A;  1KEC A;  4OXS A;  4LFB O;  3K9S A;  3FB5 C;  1FKA O;  4KHP O;  1JJO A;  2FL4 A;  5L3C A;  1GTO A;  1DTO A;  3QO5 A;  1HNW B;  2ZR2 A;  4B7K A;  4XDJ A;  4PD4 F;  4LF4 B;  4DUY B;  2IJI A;  1Q3E A;  2QWO B;  1M56 B;  1JR9 A;  3N2K A;  1FFT B;  3ZMS A;  2AZ2 A;  3LUT B;  3TCU A;  2QE7 G;  2FTK A;  5IYC O;  4YHH B;  4I55 A;  1VQN V;  4B3S B;  4RUE A;  1XNR O;  2DYR B;  1QQC A;  2PY5 A;  2CUG A;  5GON A;  3FKS G;  3PN1 A;  1HNZ B;  2E74 B;  1WAZ A;  2Y69 C;  2CTR A;  2VWK A;  4WCE V;  3IC9 A;  3FYI B;  4G27 B;  2QWR B;  1Z2G A;  3JAS B;  1NS1 A;  1YZB A;  1E79 G;  1VQK V;  3ASN C;  1JFF A;  1WA8 B;  4EFB A;  2M7W A;  4CZZ A;  2YIB D;  1URF A;  1Y6X A;  4IIJ A;  2R9A A;  4JI5 O;  4CS3 A;  4HBN A;  1NVP D;  2W0X A;  3RW0 A;  1P4R A;  4OGQ B;  4DV2 O;  1TUE B;  1YXB A;  4CH6 A;  2V7Q G;  1BQ0 A;  5JWP A;  2WLJ A;  5CA1 A;  1S77 D;  1Y4M A;  1AI7 A;  4D6T H;  2ZXW B;  3T1C A;  2K9P A;  2JRI A;  3G6B A;  5JJJ B;  3JSN A;  2DJV A;  2PUS A;  1AB3 A;  1IXM A;  3W7W A;  2FKX A;  1IUR A;  4TUY A;  4X1Y B;  4ICG A;  1SKV A;  1N34 O;  3B2E E;  2BE3 A;  4UB6 Z;  3G6E V;  3UM7 A;  2PF4 E;  3F5W C;  1S5L Z;  3O9O A;  1TVK B;  2AZ0 A;  1W0J G;  2BTO A;  3AK2 A;  1K73 W;  3ZX6 A;  1XHX A;  4DR3 O;  1GKF A;  4F4L A;  4BIO A;  2XAJ A;  4DK1 A;  3K79 A;  4DW0 A;  4PI2 A;  3CMA V;  3HKD B;  4JI4 O;  4U7N A;  3TXQ A;  1VF5 B;  1VQM V;  4FZ1 A;  1M57 B;  3A8T A;  1VQ4 V;  2A3Q A;  3L73 H;  1BL8 A;  1NKD A;  4PDR A;  2QWN B;  4U3F H;  4YJ2 A;  4ZI7 B;  2F23 A;  2HLD G;  3J80 N;  4FK5 C;  3QNE A;  4CH5 A;  3D36 A;  4JI3 B;  3CXC U;  2PTM A;  5EYP B;  1N36 O;  5FPR A;  2RJZ A;  4I55 B;  4H44 B;  1HR0 O;  2MW2 B;  2EZP A;  4H33 A;  5JCO A;  5GON B;  2F66 C;  5LGN A;  3RYC A;  3K5M A;  1PNM A;  1AI6 A;  4E2L A;  2WLI B;  4HAM A;  4O4H A;  5KUM A;  3UO3 A;  1NR7 A;  1N33 O;  4KP4 A;  3ETQ A;  4IIJ B;  3N27 A;  4LFC O;  1K97 A;  1B3Q A;  5B3S C;  1JX9 A;  4IT5 A;  4O4L A;  3RBZ A;  5J2U B;  4UXN A;  3B77 A;  4JYA B;  5CA1 B;  1RM1 B;  1K3E A;  4KUM A;  2F4V O;  1CEZ A;  4X64 B;  5LHG A;  2XT9 A;  5CMU A;  1Q6U A;  3BFR A;  1VQL V;  4X66 O;  4FM0 A;  3G71 V;  4GX2 A;  2C2A A;  4LFB B;  3ZRV A;  2WAM A;  1AJQ A;  2PI4 A;  1QNM A;  2BTQ A;  5CBH A;  3I56 V;  1BQZ A;  3G67 A;  4TUY B;  1XOU A;  4NTY A;  2BSK A;  3IFX A;  4X8A A;  1M9N A;  4X65 O;  4B3M O;  2ZNJ A;  2UUC B;  3JAK B;  2N05 A;  4OPA A;  2YXL A;  3DXR A;  2P90 A;  5KHJ A;  5H2F Z;  1XNR B;  2GUZ A;  3EXA A;  2DQ0 A;  2P5O A;  2UXC B;  2JEU A;  1ROP A;  3FD9 A;  1EM1 A;  1F4N A;  1PNK A;  4YJ2 B;  2YXH A;  4DV4 O;  3WB1 A;  1MOF A;  2HEP A;  5L3D A;  1H8H G;  4RO2 A;  4JI7 B;  4J7Z A;  2QEX V;  4W4K A;  4MVZ A;  4MSW C;  3K0G A;  3ZHR A;  5DM6 V;  3UT5 A;  3ZRS A;  5L3G A;  1P49 A;  3RYC B;  4K8X A;  4DV2 B;  2ITD C;  4LF5 O;  2QM4 A;  2CGN A;  2VWJ A;  3JCU Z;  4NXN B;  4MVU A;  1XHZ A;  4O4H B;  3RYI A;  2XND G;  3RT3 C;  5KAF Z;  1R3J C;  4HNA A;  1F23 A;  3GWK C;  3AG4 C;  4HZ3 A;  3ETE A;  2YXY A;  4O4L B;  1YJW V;  3CCJ V;  4B3R O;  4IYI A;  3OEE G;  2BCC H;  1SQF A;  3ZRX A;  4I4T A;  1NBM G;  1TA8 A;  3EFF K;  4DR3 B;  3ZN0 A;  1BCC H;  2KG7 A;  2OTJ V;  5KX5 A;  3R66 A;  1W0K G;  2EIK B;  1MA1 A;  2HP8 A;  2MK3 A;  1TAE A;  4QIW F;  3I55 V;  4P30 A;  2YIB A;  1FAF A;  4JI4 B;  3JCZ A;  4UCO A;  2PZS A;  4DYL A;  2ZE7 A;  2BTQ B;  3CRR A;  5LMU O;  2RN9 A;  2AHZ A;  3FFQ A;  5ITZ B;  1ZL8 B;  3K5N A;  3IC7 A;  2BSK B;  1XL4 A;  3AG2 B;  2ZQM A;  4TQD A;  5A9G A;  3B8N A;  5LOV B;  3K59 A;  1ZX3 A;  5LBQ A;  2V1D A;  1KC8 W;  4JI8 O;  2X6B A;  3OAA G;  2D2C B;  4YJ3 A;  3AK3 A;  4DW1 A;  3OTO O;  4HYO A;  3DXR B;  1N36 B;  3TXS A;  3SPJ A;  2KQX A;  3VQW A;  1HR0 B;  1YEW A;  3S3X A;  2GUZ B;  3OE7 G;  3DTU B;  4MVO A;  3A0H Z;  3KCY A;  1W2B U;  1BZK A;  3ZMU A;  4I0X A;  2EIL C;  2PGG A;  4K8Z A;  1FXH A;  5LYJ A;  5LHH A;  4GKJ O;  2B1G A;  2DYS B;  1N33 B;  3ZMT A;  4NB5 A;  1VMG A;  2F95 B;  1GM9 A;  4H0L B;  5J2T A;  2JS5 A;  2A9H A;  3UKM A;  1AIL A;  1XI1 A;  2P7T C;  4FFB A;  4GCZ A;  4DR7 O;  1K5Q A;  4AI8 A;  2F4V B;  1O9H A;  3KZI Z;  4ZIB A;  3RYI B;  2UXN A;  5B1B C;  4HNA B;  2QGN A;  4JI1 B;  1N8R W;  2OCC B;  4D7T A;  5EC2 C;  5FNV A;  3OEH G;  5EBW C;  5B1O A;  1YTF B;  5JJN B;  4ZHQ A;  4DR2 B;  4ZKI A;  1OCZ B;  4WFE A;  1R1B A;  4X65 B;  4ABM A;  1YJ9 V;  4WFH A;  3CRC A;  1MG1 A;  4IYH A;  2JGD A;  2KG7 B;  3CYO A;  5KX5 B;  1VQO V;  3W7T A;  1BHA A;  1PL0 A;  4P2Z A;  4JTA B;  3K0D A;  3QO7 A;  3A2F A;  2VQF B;  5LGU A;  4JAU A;  4DV0 O;  3JD1 A;  5LHI A;  1AP6 A;  2X6C A;  4DV4 B;  4NXM O;  5BZB A;  1EBO A;  2WA3 A;  3ICX A;  3X2Q C;  1XEQ A;  2BOC C;  4YJ3 B;  1KQS U;  2NNU A;  4UVB A;  2ITC C;  4JV5 O;  1V54 C;  1CPY A;  2YIC A;  2ADQ B;  3KG2 A;  3OR6 C;  1AJP A;  1Q81 W;  4J7J A;  4FIP C;  2QKS A;  4J41 A;  2OYQ A;  3O65 A;  5C93 A;  5LYJ B;  3ZRW A;  1HDJ A;  3BHP A;  1IBM B;  5KMG A;  1OHH G;  1XRE A;  2EIN C;  3APQ A;  5BR8 O;  2IJJ A;  3CRQ A;  5J2T B;  4G28 B;  2EIJ C;  2UXD O;  3CXH F;  2ZIO A;  1LR1 A;  4YXW G;  4B3R B;  1Q5O A;  2Y69 B;  3QTC A;  4FFB B;  4I7Z B;  1ZTE A;  1ZAU A;  3BAB A;  3B09 A;  3ASN B;  4WFA V;  2ZE8 A;  2UUA B;  3WG7 C;  4NTW A;  1M4U A;  3CCV V;  2IM9 A;  4J9Y B;  1LUV A;  3ZED A;  2H94 A;  2UUB B;  1Q90 D;  2DOS A;  2LW1 A;  1Q43 A;  3HKE A;  4PDM A;  1SS3 A;  5JJE B;  2OIG A;  3TJT A;  1TVK A;  1FXK A;  3HPL C;  4GKK O;  3LDC A; 
#chains in the Genus database with same CATH homology
 3CWB H;  1SQX H;  1EZV H;  1P84 F;  1SQQ H;  3L74 H;  1SQV H;  1SQP H;  1KYO F;  3L73 H;  1NU1 H;  1BCC H;  4D6T H;  4U3F H;  1NTK H;  3L72 H;  5KLV H;  3TGU H;  3CXH F;  3L71 H;  1KB9 F;  2IBZ H;  3H1K H;  3L75 H;  3BCC H;  3CX5 F;  1SQB H;  3H1L H;  3H1J H;  1NTM H;  3L70 H;  2FYU H;  1L0N H;  1NTZ H;  1L0L H;  1PPJ H;  1BGY H;  1PP9 H;  2BCC H;  2A06 H;  1BE3 H;  3H1I H;  4PD4 F;  3H1H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...