2Y0IA

Factor inhibiting hif-1 alpha in complex with tankyrase-2 (tnks2) fragment peptide (21-mer)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
339
structure length
339
Chain Sequence
b'SGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Factor-inhibiting hypoxia-inducible factor (FIH) catalyses the post-translational hydroxylation of histidinyl residues within ankyrin repeat domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 102
structure length 339
sequence length 339
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2y0iA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2y0iA01
3OD4A 1H2MA 4NR1A 2XUMA 2WA3A 4B7EA 3KCXA 5JWPA 3P3PA 4BIOA 1H2KA 2WA4A 2YDEA 2CGNA 4Z2WA 4Z1VA 4AI8A 1H2NA 1YCIA 3P3NA 1MZFA 2Y0IA 4QU2A 2YC0A 2CGOA 4B7KA 1MZEA 3D8CA 2W0XA 3KCYA 1H2LA 1IZ3A 2ILMA 4JAAA
chains in the Genus database with same CATH superfamily
3AMPA 3ASIA 3D4KA 4L0PA 1O4ZA 4S2FA 2R30A 1HQLA 3WEZA 4XPVA 3WY6A 2A0LA 4QPGB 2H94A 5H9CA 1O3TA 3ZXLA 1SHWB 3CF6E 2V73A 4G2KA 5FZGA 4EZ4A 4OULA 4NWVA 3IC7A 4KU7A 3WF0A 2J1SA 5DAPA 3IFXA 2FCTA 1E5RA 2XJTA 2YZ4A 3O1SA 1HWYA 5JUVA 1H4GA 2XB6C 4XJUA 4DR4O 2BE3A 1LHNA 1TAEA 4WFGA 3CRCA 2JWPA 2DFBA 5IK8A 1US2A 2OUJA 1PO23 1OVSA 4FAHA 4X9QA 3O1TA 1KYOF 1OURA 4LE3A 4YNIA 1YUDA 5FIXA 5E1RA 3JD1A 4J7KA 3JB4C 4QPGA 4DUXA 2QZ2A 5T5LA 5FRAA 1N47A 3AMQA 3D3IA 4KMQA 1NE6A 3ALQA 1P8JA 4DRXB 3CMAV 3I4IA 1K34A 2MPFA 3QCWA 5FO9B 4BQ2A 4Q4W2 1CQ9A 1HNWO 4NXNB 1W05A 2R1DA 4LBLA 4K40A 1AI5A 4AL9A 1OSGA 4DO0A 1TVKB 1TG7A 1WA8B 4QD2A 3M3EA 4IV1C 1N1SA 1W59A 4LEJA 4MH0E 4U3FH 1RUF2 2JK5C 5FZCA 3R4UA 4FPCA 2DYRB 1VBA3 2VNGA 1PGL2 3ZRWA 3C3VA 3ZIWA 4BQXA 1QH6A 1JX9A 5EYPB 3GCXA 1W03A 4UB8Z 1Y76B 4LA3A 4HBNA 3ZRXA 4J1XA 4YM3A 3ZX7A 2PXJA 1FV2A 4CDUB 4BM8A 3N9PA 2OS2A 5KXBA 4NIHA 3SYOA 5A3PA 4OI0A 1KQRA 1LNQA 3KM5A 4KG0A 1D0GA 4JZ2A 2R16A 4ARXA 4W8JA 4Y22B 1BL8A 1TVKA 1WA8A 4D6SA 1W9SA 5H9PA 2XH6A 4DV0O 1W99A 2ARCA 1OA2A 2XL7A 3ASNC 3LDKA 1L1FA 3POWA 3DXUA 2JJ1G 1GOGA 3CRRA 3K4ZA 5FZDA 4ASLA 5DABA 4C0BA 3WQBA 4JYAO 2XAGA 1T6BX 1KJRA 2JXAA 5EYPA 2CGNA 1ASJ1 3HKDB 3OGIB 4LH6A 2ZGKA 2OA2A 5DUWA 5CA6A 4CDUA 4AEDC 2R072 1QJY1 4CP0A 1RJ8A 4XDJA 1RPRA 3PIGA 1V6OA 1R092 1GH6A 3U11A 4NN0A 3MGUA 4Y22A 5IHRA 1MQTC 1W6NB 4B4QA 2IM9A 5IJ0B 2LGWA 3H42B 4MHRA 2YPDA 2JENA 1HRV1 2EXKA 4L8JA 5AVPA 1Q5OA 5EIBC 4LQRA 4LIUA 3QH7A 3CYOA 1FXKB 2Z0AA 2MEV2 3A0HZ 3I5DA 2OYZA 3W5NA 4M0HA 3WCSA 3K79A 2CWMA 1SDWA 3D8CA 1IBLB 5BYNA 1COV3 1N36O 1Y3TA 2PAKA 3H3LA 4PDVA 2VQEO 4UF0A 5F5IA 1Q81W 2GTSA 2RMKB 1Q43A 1PMIA 1W6NA 2R061 4LF4B 3LSDA 4DR3O 1JHJA 2IH1C 4I30A 4YY3O 4EROA 3OW2U 5C9AB 1FXKA 4QPJA 4COUA 2EXHA 3B40A 2HLEA 1FPN2 1FNZA 4CCOA 1K7DA 1CXZB 3FUQA 1JHNA 3I55V 1ZSPA 1ZZ8A 3LFIA 3I56V 4C1WA 2CUGA 2VBDA 3S6PA 4UXAA 1XHZA 4FFFA 4NTXA 2WLNA 3OGCC 5BNOB 5FPXA 3E1F1 4LFCB 2AGSA 1W2OA 4R9BA 4DUVA 2VZ1A 1QKQA 4Q4X1 5LW9A 1Q8PA 1DBNA 2JE7A 2XVLA 3B01A 1M93A 1JZ8A 2OZ6A 3IPVA 1ZZ9A 3SJBC 2BOCC 1AVBA 1JN2P 2V09A 3VHOA 1M90W 3QOPA 1RM1C 4ZPIA 2R70A 3ZHQA 2L6LA 3VLBB 1TE1B 4XFAA 2RS32 4J1WA 2RS53 4G9SB 1N1TA 4SLIA 4QPGC 4R9AA 4DUYO 3GZTB 2WSVA 3ZKYA 2PYJA 5SV5A 4XABA 4XUQA 1A6CA 5KXEA 4URAA 1Q82W 3K08A 5B1BB 2QQKA 3AZVA 3CB2A 3K48A 4R8CA 3X29B 3OY8A 3ACFA 4M4RA 2EX3A 3THOA 2VMCA 4ES8A 5JQGA 4R4XA 1MVEA 5DDJ3 4TQDA 3WQ0A 2E53A 2LALA 3K9SA 1SLBA 4NRMA 1G8WA 3PIJA 1AZDA 4LF8B 1WA4A 5L3BA 5GZFA 2NNUA 4IEPA 4MS2A 2VZQA 2YFUA 2F95B 4BE3A 1W2TA 1Z7S2 3J8F3 4HYOA 3IJ4A 3AKQA 1L3JA 1ST8A 3ZFFB 1J3QA 4GALA 1WLEA 1JOYA 5ITZB 2W95A 4W6YA 4XYXA 4DNYA 1DLBA 3SR2C 3FWEA 1Q6UA 1RINA 3PMEA 3OGJA 3UKTA 3A0BZ 3AZXA 3U10A 1OPOA 1C1FA 2K1EA 5C8CB 1PO12 4XIOA 2W08A 3C2UA 2GC1A 2DTWA 4CP9A 4AHZA 4CXWA 4COWA 1ULOA 1D2DA 2DYRC 3CCLV 5JZGB 5FZ1A 2HEWF 2PI4A 2A9HA 3MHHC 4UW3A 2AW9A 4HNAB 2VXJA 1V9U3 4CDUC 4LIVA 1FI2A 4Q2FA 1R3IC 1O9GA 4RGKA 2EIMB 4LBNA 3K5LA 3ZFFA 3B7MA 5ITZA 3EQEA 3AKTA 4JI6B 1AI6A 3IT8A 2UXCB 4GD4A 2P2KA 1VF5B 3MLKA 4CDWB 1KKDA 4W6XA 1LNSA 2KA3A 4XILA 5FYBA 4X6RB 3HVDA 2DUQA 4HVQA 2ZMLA 2AHZA 1FFXB 4GCZA 3VQWA 5JZGA 4N9IA 4RR3A 1GN3A 3OPZA 3CZUA 3JBG2 3PNAA 4KI5M 2IXCA 1PO21 1IS3A 2QQNA 1J3RA 2OIEA 3KB5A 1M1KW 3OMIB 5KR7A 2ZKOA 1US3A 4AYUA 3ON7A 2IXHA 4B3RB 4PDWB 3O1OA 5I93A 3C7GA 4CDWA 1UXZA 4XIKA 2JDZA 1JU4A 3HIFA 4OQ8A 2E5LB 4MOAA 1IQAA 2ZTNA 4YFWA 4MZUA 3S5QA 4X8PA 2VU9A 1FFXA 2YEVA 4C90A 4JF3A 1O5LA 3WZ1A 1RITA 3KLSA 4LKSA 1FXKC 1QQP3 3K2OA 3ABLB 3WNMA 3ZYRA 2FD8A 1VBA1 3AFKA 1CX4A 3HEIA 3F2ZA 2HJDA 2WQZC 3AVSA 1WBFA 4QXHA 1VALA 4PDWA 2FYUH 3AP9A 2P7TC 1NT0A 4BXFA 3OR7C 3RJRA 3NNGA 4FFHA 4YW7A 4DV6O 2YIDA 4OZXA 4CH3A 4LT5A 4XETA 4AQYO 4YYOA 1I94O 2UXBO 4LTAA 1ZZ6A 2UWBA 5C9AC 2RJ2A 3M2MA 3OEHG 4OX9O 3CBNA 4I2OA 2WFF1 3J4UH 3N2KB 4BISA 5I0DA 2Y0IA 4TSVA 2VJXA 4BJ0A 2PUSA 4DYLA 3CEIA 2DDUA 3POSA 1HR0B 4PBPA 4LLOA 2HR3A 1RUH3 2FL4A 2IXKA 2Q8DA 2ZMNA 1JBCA 2PMWB 5G05L 1N1YA 5LGUA 5JI9A 1PP9H 2AEZA 1XE7A 4MTOA 5BNOC 1MEC3 2FCUA 2VQUA 5L3GA 2RDNA 2LO1A 3K3WA 1P49A 1YXWA 2RCVA 4YHHO 1SG3A 3N2KA 4BQ3A 5F3GA 3SH4A 2VMEA 3MHSC 2HHHB 4LO7A 3SKVA 1CAXB 3N4MA 1V0AA 5F7UA 1XNDA 1QJU2 1ASJ2 5KUMA 3SJQC 4O65A 2VOVA 3ZYIB 1KD7A 1OQDA 1SBFA 4RSUA 4TUYB 5C3QA 1COV1 1OA4A 1PNFA 4QX5A 5GLUA 4CDXC 1WKYA 5JCOC 2IW5A 3T30A 1ZRIA 3T4DA 4GX0A 4DY5A 3RZKA 5B1BC 5CNAA 2JIGA 1S3JA 3LNNA 1SCRA 3U37A 3PJSK 3C7OA 1CAXA 3OBTA 2ID4A 3ACHA 1BLZA 2VOKA 2WLMA 3BODA 1Y74B 1FFTB 2PHUA 3ZR6A 1BXHA 4ES9A 3VL9A 4TUYA 4Z07A 3RI9A 2YPJA 2EIKB 1O5UA 2YY1A 4EN8B 4ZI7B 4CC6A 3MEPA 4D6QA 4ZOLB 2J42A 4EWEA 3THDA 1CN1A 2FMYA 2FTKA 1FOD2 3ZYJB 1KDMA 3Q8CA 4F3JA 2VCBA 2BVBA 1NTZH 1S0VA 3APOA 2LFSA 1Y74A 4YGDA 2CU5A 4O7XA 4CCMA 4OPAA 4YARA 1VRBA 4AFAA 3VKOA 1R6KA 1TUEB 5C8CC 2JS3A 2VTXA 1H1IA 4JTNA 5C93A 4PDMA 5LGTA 1LGNA 5ISLA 4ZI7A 1M5IA 4ZOLA 1MS0A 3KV5A 3M4FA 3HN3A 4EWAA 3ZSMA 2EIMC 2PHXA 4LF9O 2YGMA 3WF2A 1VBD1 3L73H 2JIZG 4FPHA 3TN92 4R8HA 1NI8A 2Y6FA 4KH9A 1PM7A 5IVJA 4B3SO 1XOYA 2GN3A 4XJ8A 2ZR2A 3CCUV 4EV0A 4O4HA 5DDJ1 2GZWA 2WABA 4Y3OA 3JD3A 4Z1MG 3STLC 3NJXA 3CQOA 3UM7A 2LFRA 3GF6A 5FOBB 5L7OB 4W4ZA 2ZZJA 5FZ4A 2Y6GA 3LDDA 3ZXGA 2Y64A 4DIQA 1N3QA 4MGQA 3I49A 4A5UB 2XBO2 3J8F1 2WA4A 5LB6A 5FZ0A 4PI2A 4QKFA 3QLQA 5IT9N 2QCSB 4P9LA 4A45A 1JUHA 1KP2A 5KX5B 1LUWA 4LUMA 2ZQMA 1BEV1 3HN1A 4EYUA 2YBKA 3ABLC 3THCA 1YIFA 4MVUA 2P06A 5CFCB 5LHHA 4JI0B 1XI1A 1OH3A 1QJX3 4HN0A 1F51A 2I2SA 1MS4A 1G6UA 3E8HA 1X59A 4X62O 4XZPA 2N7GA 1G9BA 1M57B 5FPZA 4LO4B 1V9U1 2I07B 2XMLA 1O8PA 5GLVA 3THPA 4DR2B 4YW2A 3OT7A 2HG5C 4H33A 1VAVA 1XYOA 5KX5A 2N74A 2VAUA 4Q0VA 1Y9GA 1VJ2A 1YJLA 2UU9O 1K42A 5BMVB 3LKJA 5JSRA 1UWWA 2RS13 5CFCA 2UYBA 3O65A 4Y5TA 3T09A 2JDUA 4Q20A 5BY5A 2BZDA 3K5NA 2F4LA 1TNRA 1X50A 2DVAA 2W0XA 5FP4A 3I3MA 4PV1B 5EFUA 1LB2A 4AQSA 3WG3A 1ZYBA 1LUVA 4U36A 1WPXA 4HG6B 4IUGA 1H30A 3USUB 5KXCA 4XQDA 2OTJV 3T1YO 2ZINA 1VQ4V 2IJJA 1CD3G 5FAXA 3WNPA 3AKPA 1VQKV 5JJEB 2BWCA 5BMVA 3SGIA 2QQLA 4P9PA 1H8VA 4OHYA 3MIHA 4ICGA 5FBZA 1TVGA 2AHYA 3WSOA 3CRAA 3H8XA 3FLPA 2WDBA 5LZ6A 1UXXX 2HH9A 4DV7O 5A7NA 1HDKA 1LJ7A 3WUDA 1MZEA 2P5OA 1QQP1 1D4M3 4XQWA 2DVDA 2JEXA 3MV01 4ISRA 3USUA 2QQVA 3URFA 5LMUB 2LTNA 4HANA 1NA1B 4AOCA 4TZDA 4LKEA 4NHLA 3D36C 2KQXA 4K21A 3VBRB 2BNMA 3WINE 4X65B 3BGAA 5D21A 4BLIA 3ZBHA 2NYYA 4JV5O 3NNJA 5L73A 2AH2A 4JKMA 2ZNJA 1VBB2 4CVUA 2D6NA 4JI8B 5LOVB 3N9NA 4PF5A 5DQ0A 4BH9A 2BEOA 3UL2A 4EZHA 2QM4A 1YI7A 2EIKC 3F7VC 2YMZA 3JAKB 2Z4FA 1ND2B 1NA1A 3A2FA 2Z79A 2GDSA 4WVZA 2A73B 1RUH1 4IE7A 3CP1A 3KCYA 1RUI3 1BT8A 2A6YA 2P3IA 3VDDC 1P4RA 3HR0A 1A8MA 1PMJX 4R50A 5IFTA 1AYM2 3VBRA 4M3CB 4DXTA 4OCTA 1MEC1 1HQNA 2HP8A 4D94A 5LK5A 3TEYA 1AX1A 3OBZA 3KHCA 1H0BA 5GLWA 3FJSA 4Y26A 3CXHF 3G4SV 1N33B 2WFF2 5BR8O 5LOVA 3K06A 5LWBA 3N7KA 2HWC2 3NNLA 5LL6Y 3JAKA 2B45X 1XMQB 1IS4A 3B2EE 1UZZA 4UBGA 2JG8A 5B5EZ 4Q1RA 4AVAA 1P84F 2CAUA 4M3CA 2P34A 3CMGA 4EB6B 1JOJA 2VULA 1CJPA 4FJCC 5FY4A 4QGNA 2JDAA 4IW3A 5LMNO 4E4EA 1AR63 1FJGO 3T08A 2Y0OA 1RUC2 3APBA 1BJQA 2VCAA 1XQ8A 4JRLA 5IYDO 1LU2A 3WP6A 2VGDA 4AHXA 5A6ZA 5JWPA 3OR6C 5F2SA 3ACGA 3PTRB 3FHIB 3PU3A 3NRUA 1CJDA 3RMXA 4FPOB 5L7OC 3AC0A 3OJBA 4EB6A 4JI3O 5CA0B 2D6KA 3WVJA 2QWRB 4U3JB 4YM2A 2A7WA 2WNVB 3EXUA 5CBFA 1XNCA 3I2HA 5L3EA 2DWDC 4BIFA 1ZZCA 3S0MA 4OI1A 3LQCA 4ZHQB 4UFKA 2ZXQA 3CCMV 3CJXA 3X2QB 4BW9A 4NUBA 2LW8A 2B39A 3JQXA 3N9QA 1UPIA 4I0XB 1SKVA 3IIIA 1IVSA 1XUQA 5D8AB 1GN6A 3WP3A 1CX1A 1R64A 4DRVA 1BMV1 2XAFA 5E8AA 3I2OA 4Q4V2 2WO2A 4BK4A 2VCMA 2NZ9A 2WLQA 3BTAA 5CA0A 1YJKA 4H55A 2PF4E 3FAVB 1CEZA 5DZGA 4U3JA 1FPOA 2H6CA 3A0KA 2IJKA 1JJ2U 1FXVA 3SH3A 4UBHA 1WNSA 2GNBA 3M3QA 5J96B 2JD9A 2BTQB 2JE8A 5FWEA 2ZA9A 5A6QA 4IIJB 1HRI3 4AQ2A 4I0XA 1IKPA 1IURA 3WG4A 1MS9A 3H8OA 2EAAA 4DXSA 3IC9A 4H7MA 1D5NA 4WM7C 4CU7A 1AXZA 2WZR1 2EULA 3SPHA 1J5EB 3FAVA 4OI4A 4AXOA 2VE1A 5LA1A 4UAPA 4Z2AA 1GO3F 1KMIZ 4JI4B 3TEXA 3CSXA 5E1AC 1A32A 4RA0A 4GB33 4LULA 1RMU3 2BTQA 3H8UA 2Q6AA 5DZEA 4DPNA 1VBD2 4IIJA 4GKKO 2RMU3 5JAXA 3VBFB 5A32B 3U75A 1QY4A 1ZRRA 1Q6HA 2UY9A 1CAWA 4JI5B 5T52A 2ZHLA 1FT9A 4I01A 4W50A 3FUOA 1W28A 1NYWA 1I5ZA 3WDUA 2FHRA 4QIWF 3M99B 1RPOA 5LA6B 5ABJB 2VC9A 1HW7A 4XXPA 1YJWV 3RNSA 2QQIA 1NH2D 3FD9A 2X10A 3NR7A 1GZ9A 1E1RG 4JGSA 4XTMA 3RYPA 3LOBA 5B2GB 5I8YA 5KWRA 5C5UA 3J81N 2FDGA 3CKHA 1QJX1 4RUEA 2OPWA 4UW4A 4EJRA 5A32A 1S0FA 1FMD2 1NA1C 5LBFA 1H2MA 1XILA 1AI4A 4QE9A 4HK8A 1R3LC 4KQ7A 1CONA 2OPKA 3VBRC 1JVMA 5LA6A 3LEMA 3WG1A 5ABJA 4QHZA 3Q8EA 4XBNA 3WF1A 2VRZA 4MTGA 1BEV2 2JIJA 2KD7A 2RS11 4BIOA 3QF7A 5CVRA 4UVCA 2VD7A 3ETQA 1N0NA 4PJ0Z 2HJFC 3I2DA 4IE0A 5JR2A 1XYPA 1U96A 1H1AA 4RHV3 2B1IA 3JD72 4AI0A 1ND2C 2MHFA 3VBHC 2FDJA 3CX5F 4Q8LA 4EN9B 2MK3A 3CCRV 3E5QA 5I0UA 3BVCA 5J2TB 3K51A 2NMNA 2FZ2A 1NZCA 1WLDA 2VZOA 1NR7A 4IEWA 1B35B 1QNYA 3GCWA 2HWB2 5A80A 5JCTA 2QE7G 4K1YA 2ZX4A 1FNYA 3VZMA 2LQTA 5GTHZ 4QGPA 1G9FA 2ET7A 3K5OA 4AI1A 1GRJA 1LOFC 1RB8G 4QX8A 1AB3A 2VW1A 2XJRA 4UB6Z 2BOBC 1D4M1 4LF7B 1AJOA 2VMIA 4DV2O 1XU2A 4JI7B 1K73W 3N7JA 4X1YB 1Q86W 2BBAA 4XJ9A 3QBQA 4LO5B 1Q3EA 1IX9A 4XVHA 2RG4A 3HNYM 1HNZB 1VRH3 2FCVA 2Q0AA 5H2FZ 5FO7B 1QHTA 5FY8A 4QGLA 3AG4C 5A70A 4Q6GA 3O0WA 5FZMA 3B00A 1XNQB 4J6GA 3WB0A 1YHFA 2YB7A 5LA0A 5CEHA 4I55B 3PVOA 5B4NA 4JI1B 2D6OX 4X1YA 4Y33A 4AVCA 4BZ4A 5FDBA 2WNVC 5DG2A 1RUI1 2HJIA 4NHMA 1F4NA 1GN4A 2GSYA 3OD0A 5FYHA 3X2QC 1HB1A 3PURA 4WV8A 3IM0A 4BIUA 1PX3A 1H2KA 1Q8VA 2A6XA 3OMNB 2JDKA 2ZE5A 5D8AC 4LORA 4IE5A 4AFDA 1DZRA 1H6XA 4RD7A 1UYXA 2ZGUA 3A0NA 4I55A 1G7YA 2O1QA 1CR7A 3NXSA 1VF6C 3PU8A 2ZKLA 1QJEA 3ORJA 2ZGSA 2W92A 4OHZA 3VQYA 2GMMA 3G6BA 3JD0A 1SA0B 4KNCA 4Q8KA 3OTFA 3FB6C 5FYIA 3F5WC 4BK5A 2CAVA 3MAQA 5FPVA 1ULEA 3ZHVA 1AR61 3B93A 2AR6A 2FQPA 3MZHA 2O14A 2YIBD 5BV6A 3B09A 1K97A 2OIIA 4NTYA 2GHYA 4DV4O 1L8DA 3LDCA 2E74B 4QMAA 1HV0A 1MS3A 2RDSA 2Q9LA 1U0AA 1W0KG 3RZMA 2DF7A 4A6SA 1TMF3 2ARBA 4FI9A 3ATGA 2GN7A 4AQTA 2OVUA 3VBBA 5FMDA 1GMMA 1WD3A 4OPHA 5JXIA 2EIEA 3L2YA 4AFMA 1X9TA 1SA0A 4YIPA 4LE4A 1IBMB 4YW6A 5EK0A 4MGZE 3ZLIA 2PI5A 2GC0A 3VBFC 5EJZB 3R05A 1DP0A 4COYA 2WNOA 1V6NA 3OG2A 3P30A 3STZC 4XBLA 1KU9A 2WO7A 4JI2B 4DZGA 3G6JB 4G27B 1YWKA 3JD4A 1WW6A 3AYAA 4QX3A 1RFYA 3MI8A 2EBOA 5ABJC 1IXMA 1V6LA 1DU3D 5BNNA 4D6TH 2RJLA 3RYCB 1AYN2 3FHAA 4EEQA 3VZJA 4RQFA 5F39A 3SQOA 1K3IA 2Y6HA 1UZYA 3KZIZ 2WINB 5CFDB 4Z1VA 3ZFGA 2XASA 3UT5B 4MXWB 1QBZA 2B4KA 2VZPA 4LHNA 3BOWA 4PF1A 4F6RB 1HRI1 2P6JA 4FPGA 4K6BA 2ZHKA 3ME2A 2WA3A 4QXCA 4FFBA 1I7FA 4QX0A 5HI0A 5FLIA 2RJZA 3RWRD 1AL23 2JKBA 1NKGA 1AR93 1UNBA 4ZXEA 2C1FA 2Y33A 5A9GA 5FMBA 4FPJA 5CFDA 3E8FA 5IVCA 3A7QA 4FIPC 3P3NA 3UT5A 2IFRA 4MXWA 4GB31 4CU8A 1RMU1 5B3SB 5DEDA 3MBWA 5J48A 2XOKG 1C8M2 4F6RA 2RMU1 2TUNA 1O7FA 4IGQA 1TME2 1B35C 1AR82 2V7QG 1L0NH 4IGGA 1DLLA 5EJ3A 5FY5A 4RUFA 1O9HA 4LF5O 2E76B 1NH2B 3IMNA 3LIGA 1Z5WA 2YXYA 3WF3A 3J7MA 4N7UA 4DR1O 4LOSA 3MF9A 1H6YA 4GJYA 5JOZA 2WZR2 1KFXL 2DWRA 3GBGA 3NV1A 4HK9A 1GZWA 4W65A 3VD3A 4GLXA 3MO4A 5EZYA 4KGGA 2QBXA 2JICA 1KECA 1ZRDA 3HOBA 5DUXA 5D1IA 4Q4W3 1VLNA 4FLUA 3H01A 3ZHTA 1VQNV 3LSQA 4W4LA 3JXSA 2ARAA 4ATFA 4LFBB 1XJAA 1J84A 4B7KA 1WJZA 1RUF3 1JW6A 4WFHA 4N43C 4ZZ8A 1LRHA 3SEEA 4TYSA 2YU1A 4R7CA 2QR4A 4A7ZA 3IDBB 4C7UA 5H9SA 4IV3B 4RHV1 2UUAB 3JARB 3WDWA 3Q9OA 3ACLA 1OLME 3H1HH 3UYJA 2X5IB 2BGOA 5AVAA 1WCDJ 4JPRA 4GMP3 3GVMA 1CESA 1OCCB 4K0KB 1F5JA 3TK1A 3VHRA 1K12A 4CRQA 3I54A 4LBEC 1LU1A 1LOCA 1B6QA 5JJJB 3LF7A 3VN4A 3R4DB 2RS12 2ZX1A 5K7PA 4XJWA 3K4DA 3AVRA 4FTBA 4KUMA 2R073 4XHXA 3FZ3A 1X36A 4RGAA 1XSQA 1R093 2X5IA 4JC1A 3MPPG 2CTQA 4PA6A 3ZX6A 2DYCA 2UXXA 3GALA 3HKEB 4CUCA 4PQQA 3N2GB 3OOXA 4YM0A 3N7MA 3BTXA 3J80N 1Q90D 1F9KA 1WW4A 4DR4B 1DZQA 4PHZA 2ILMA 4DK0A 2PQQA 4JKLA 3KKYA 5EC1C 5JIUA 3BU0A 1VRH1 2PHRA 2V5DA 3NSTA 4KHPO 1FXZA 1X82A 2BW8A 4QT6A 4MVZA 2ADDA 2JRIA 4DXWA 2MEV3 1W6PA 2JDMA 4HSLA 3E2EA 2ZJCA 4MGIE 1ZRCA 4N53A 4OUMA 1OV9A 4XDOA 1MNGA 1UZWA 3HKEA 4I0WB 3N2GA 3QO5A 3O0VA 4JGZB 2XHNA 1NLQA 2DVBA 1HNWB 2ZEXA 1BK1A 2GP3A 3VDBA 1OUSA 4U7OA 4OUSA 2AC1A 1AR5A 1ALYA 3PMSA 2V4AA 1DYKA 2ZKNA 2XQXA 1OF4A 3TXSA 1S4CA 3A0RA 3E83A 4XC9A 1FPN3 3NO8A 2R042 1SPPA 2AENA 1VBE2 3VHNA 4ZKIA 2BTVC 4JGZA 4ZKTB 1GNHA 3OPTA 3HPNA 5C4WB 3ML0A 3HT2A 3RRDA 1WCUA 4HOOA 3KV4A 1EUUA 2Y60A 3BFRA 1AJPA 5ANNA 3ETDA 2ZAHA 3KVAA 4DV0B 3RN4A 1XHXA 2K9PA 3ZKUA 1GAXA 4SBVA 4OLLA 1AJKA 2ZX3A 1JYCA 2WS92 3KVBA 2ZGQA 4F7ZA 4JYAB 3WT3A 2IC1A 1S5LZ 1C3HA 1Y9QA 1KQSU 1SQGA 1SQ4A 1H8HG 5JH7B 4HXCA 3FYIB 1TMF1 3AJYA 5C4WA 2RS33 2B9UA 4BB3A 2CDOA 4P9GA 3K5MA 3LE0A 5LEJA 3OUFA 2QWQB 3OGRA 2P3YA 1ODNA 3AKSA 4LF4O 2W47A 2XDVA 2W3JA 4GH4A 4GX2A 3KF5A 2W68A 2VQFO 4X8AA 3IAPA 3CJHB 5FY9A 1H9WA 4DUZO 4Q1PA 2J7MA 2AXTZ 3CU7A 5JMCA 3BN6A 4L11A 1D0HA 2O8QA 1DQ5A 1VP7A 2EZOA 5JH7A 4N21A 4JTCB 1YVWA 1N36B 2VQEB 4PA4A 2Z5UA 3EHBB 2PTMA 3UGGA 1JTZX 1S55A 3ABMB 4LOTA 1Z7S3 3BIEA 1PZ9A 4YY3B 2AEYA 5IVBA 3HQRA 4X1IA 3CJHA 1LHWA 3B8MA 2UY8A 1NKDA 4KWUA 4GKJO 3ZJZA 5KHKA 1W6MB 2ZX2A 1PO13 2D6PA 5IY5B 1BS3A 1URFA 3ES4A 4META 2EA7A 2HBUA 3J26N 4DV3O 4QU2A 2GC2A 1AL21 1NR1A 2XR4A 4YVSC 2OQ7A 1AR91 1XEQA 4IV3C 4DQAA 5ACA2 4XF4A 2WLHA 5EP9A 4RAIA 4CUGA 2RQ6A 3PLQA 4I09A 2X5IC 2YBSA 1MZFA 5FWJA 5FXXA 1W6MA 4YZ1A 5EC2C 1U5XA 1OCCC 4L99A 3NVCA 1HRI2 2JS5A 1WMFA 1K9MW 5D5PA 3ZPOA 3JBG3 1Y7BA 3VD9A 3JZVA 5BXZA 2E63A 1LHUA 5HFMA 3ENRA 3VUOA 2BOJA 3QTCA 4CUBA 2X0LA 4FAGA 4NIGA 4DUYB 3RYKA 2R7EB 3VHPA 2HWD1 2YFZA 4UOJA 5I91A 3MYXA 3HNBM 5LBQA 4JYBA 4UCVA 3O14A 3I2IA 5DG1A 4E4ZA 2WO3A 3B9CA 3VOUA 4Q4W1 2VMFA 3LSUA 3KQRA 1BQPA 1K33A 4IEYA 4YZ3A 1DGLA 4ONUA 4E27A 4ZXKA 3RZJA 2H6BA 5FY1A 4COZA 2VW0A 1JYNA 1YJ9V 3IAQA 1RUF1 4D7YA 3NW4A 4U2AA 3DKWA 1DLCA 4B8EA 3ZN0A 1BK0A 1S5HC 1HIXA 1PGL1 4UW6A 5IWFA 2BJSA 2UWAA 3K04A 1OI6A 4CH4A 1LODA 1W6OB 2EILB 1VQOV 1BVP1 2OCCB 2GTAA 2QUOA 1R6NA 3IMMA 4MADA 5D5QA 1O6UA 1VMHA 1RSOB 1KJLA 5K1PA 2ORZA 5F3CA 1U5YA 4GMP1 3WG7B 1HX6A 2X7RB 3ZHRA 2EAKA 4YG0A 1JFFB 1WB8A 2X6CA 1WW5A 3WDTA 1A34A 5FZ3A 5C71A 1GN2A 4QDRA 5LRRA 1DF0A 1SCSA 2DUPA 3THTA 5FQ0B 4A42A 4IEXA 1AJQA 5JMOA 1K4CC 2VM9A 4D3WA 3DPRB 2RN9A 5IYYA 2R071 4KWLA 3S3WA 4RQPA 5C4WC 1F2NA 1OLMA 4P9XA 1DFQA 2VZ3A 1K4DC 2ZACA 1R091 1RSOA 1URXA 2QTSA 2VUCA 2KR2A 5BY1A 2VMGA 3SCFA 2JVDA 5CZKA 1JFFA 4I0AA 3FKSG 4HZFA 1F5FA 3ZOIA 3HB3B 4LP8A 4WFBV 1LOBA 1YI2V 4CE8A 5FQ0A 1QJU3 4LKDA 4LO6B 3VDAA 3ZDVA 1ASJ3 3K0GA 4XJAA 3DPRA 2MEV1 1GQGA 1QH7A 2R9IA 3GHMA 4QX7A 1WP7A 4CCDA 4O2AA 1R1ZA 5HV0A 4O2BB 3FB5C 1VPHA 2GNDA 2ATFA 5FZLA 1RL3A 4WZFA 1EAH2 4R52A 2NLJC 1WBLA 4QB6A 1UPSA 3RMYA 5CU1A 1F31A 4XXAA 3KT1A 3DUIA 2X8KA 4CH6A 3MIFA 1SMVA 1ZX3A 1XNAA 1OC1A 4UFIA 4BYYA 2ARHA 3OBRA 4TTGA 1XRUA 2VZSA 2BOIA 5C8WA 5HCAA 4CA9A 4Z8BA 4JTAB 4FMTA 4O2BA 1FPN1 4MT8A 3GHNA 2ZT9B 2RDCA 1BE3H 3IB3A 2PAEA 2VG9A 1GOHA 1ZLZA 4Q4Y2 4QXKA 3ABMC 4PLMA 2OT5A 4P9OA 4IL7A 1HXS2 1LESA 2JDYA 4DV6B 3LNMB 3ZXEA 1FOD3 4AQYB 4LWSA 3NL1A 1I94B 2UXBB 4LBQD 1UYZA 2Q8VA 3LZZA 4OX9B 5JXJA 2DFCA 2ZDIA 5A3WA 4IV1A 5FR3A 3KGLA 4E4SA 1W2NA 5IY5C 3NJZA 1OPMA 3U1XA 2EIGA 1DHKB 1MABG 2PN5A 1DQ0A 4AVTA 3AP7A 5FK8A 4OMCA 1CAVB 2WN2A 1OLRA 2A75A 1BZWA 4I9WA 3KV9A 4LBMA 1YLLA 4YW3A 1KP3A 2RS31 1IGOA 3ABZA 4P9YA 3PL0A 1IBKO 5FO8B 5A7WB 1DG6A 1N4CA 3UK9A 3BCCH 1N34O 4YHHB 5IJ9A 1MQTB 5LXTB 1BQ0A 2QM7A 4CPBD 3TN93 1HDJA 4TLFA 1GANA 4LLFA 1GP4A 5FZEA 4CUAA 4MYEA 2NMOA 3RQ0A 4E8DA 2R49A 1XNKA 5LRSA 1YTFB 1LR1A 2E75B 1JS9A 1SBEA 5EV7A 2JEUA 2KB1A 5CIRA 5JXGA 4ZHNA 4AEDA 5FYVA 4ASUG 2XLGA 2WWWA 1TMF2 3ZN5A 1YQ5A 1M4WA 1QOOA 4IDZA 5J1XA 5A7WA 1YITV 2KSDA 1H1MA 3SEPA 1W9YA 1DQ1A 1Z7S1 1VQ8V 5LXTA 4FM0A 1MQTA 5AFBA 2XBO3 2QJVA 3WDVA 3SLIA 3LPGA 2EIDA 2YROA 1WCKA 5H9RA 4NMIA 3H7JA 1YI9A 2HFEC 2A70A 2C9AA 5CG8A 4B1LA 3RJ2X 1CZSA 1QR9A 1PO11 4FP3A 1H2GA 4KP4A 3W5MA 1E5IA 3TNQA 4NOTA 4JDOA 2GUZB 2C0ZA 1WA6X 2XAQA 4UCTA 2QKAA 1QNWA 3HKBB 4QNHB 3AFGA 1UIJA 4NJ4A 1BKZA 1V6KA 4DO2A 1S0EA 2NLRA 4ASKA 4XCAA 1PIV1 1R1A3 5L19A 1N3OA 5IVFA 1ZZBA 3C7EA 3PDQA 5FUNA 2EXIA 3VBUC 2QQPA 4IERA 2QGNA 2PHTA 3OGSA 3WG7C 1ENSA 2BNOA 4EN7B 4H7LA 1H2SB 4WFEA 1DGRN 3SNMA 4BW5A 2XTAA 1QXJA 2EF6A 2XT9A 1DDLA 2GALA 5IK7A 2QSAA 3HKBA 5GZGA 4A2UA 3DPRC 3CZJA 3OUIA 5T50A 5FPUA 1NZ6A 1VQ7V 4Y5Z0 3S30A 4LMFA 4LF9B 4RS5B 4XEZA 3ZMSA 1SLCA 2DBIA 4QKDA 3T2QA 1MSWD 2X6BA 2DOSA 2JECA 4X66O 4YSFA 5FCCA 4LO8A 3WDXA 3UV9A 1XE0A 2C5DA 2NR5A 2YHJA 2R9RB 3B4SA 3H1MA 4AVSA 1YQCA 4AVBA 5FLXN 1F4AA 1VB2A 5IWAO 3SYQA 1JZ7A 1YXBA 4JQRA 5EHDA 1U97A 3EO6A 5IE9A 1D4VB 4UCUA 4UUJC 2R72A 4RS5A 4OMDA 3UKMA 4IESA 1OFSA 4BHPA 4COVA 2XKOA 3AP6A 4AI9A 2HWD2 3LA7A 2WYFA 2RM22 2VMHA 3ZEDA 2C2AA 4X64O 2X6AA 1ENXA 4EFEA 2PGGA 4E9KA 5KLVH 5FOJB 1WMEA 3C3TA 1UY1A 2F43G 4HVRA 3UKVA 3UGHA 2ZDIC 5I0SA 2ZE8A 3E35A 2ZGMA 2BUKA 1VBB3 3U0ZA 2JGDB 3DXTA 5FZ8A 2VQAA 4XF3A 1O59A 4X62B 4NIIA 1G1XB 5GKAC 2ZAAA 1LHOA 4DRXA 1GWMA 2GMEA 2WSUA 5FZBA 1ZBA2 2WLIB 4UWDA 3AL6A 1NXD1 3CRMA 2HEYF 1AYM3 2B5HA 4LA2A 5EYXA 3BPZA 3MUY1 5FJHA 3H9AA 3UGFA 2UU9B 4Q27A 1HV1A 2C6SA 1FX5A 2LJ2A 1VMFA 3ZSKA 2OKXA 4Q26A 3N9MA 3M70A 4YFZA 2WFF3 2JGDA 3B3QE 3EBRA 3POYA 2HWC3 2JB8A 5CADA 5FZOB 4F4LA 4FO9A 4GULA 3MICA 2OT7A 2H0VA 3PUSA 1QJU1 3WF4A 3VKNA 4FPPA 4XMAA 4XF0A 1Y76A 4J10A 2DCKA 2XWBB 2R0FA 2WLIA 4BDVB 5L3FA 1NQJA 3T1YB 3TEWA 1GNYA 5LMUO 5DECA 4OFGA 3W7XA 4LH7A 4V2WA 4K3UA 2XLAA 4DV1O 3OFNG 1WN7A 1OQEA 3ABKB 1RUC3 4WF9V 5KC5A 3C7FA 2ZPXA 1RP3B 5FZOA 1V55B 2ETEA 4H14A 2GNMA 4IGOA 4DV7B 4X65O 4XACA 1XYNA 5KMGB 2AZ0A 5H6RA 3LOIA 3JCIA 3HKDA 1VQMV 4FPKA 1QCEA 2BFUS 3IBMA 3C8XA 1CIWA 4X6QB 5IW0A 2ET1A 4XBFA 2AACA 2PELA 2WO1A 1VP6A 2DURA 1SFYA 4N23A 5GW7A 3OUSA 5IJ0A 4XFBA 1C4RA 4HT1T 1W8NA 2NN4A 2WNUB 1FOD1 2WAOA 2XGXA 1T2XA 1AXKA 1J3PA 5CBLA 2Z2SB 4K8RB 4JV5B 4GAZA 3JCZA 5KMGA 4I3GA 5BPXA 1PHMA 4L87A 4K8FA 5FMOL 2H3OA 3ZXFA 3CMEV 4Q4V3 1LR5A 1OBNA 1SQQH 3CCQV 1XMQO 2DBNA 3OB8A 5EWSA 4FLWA 4OZOA 4NPMA 3EXAA 2IFWA 3T1HB 3LEKA 1W39A 3CC2V 3W59A 4DUWA 4I5SA 3K03A 3IAYA 1M56C 3T1MA 2B9VA 1EY2A 3MFCA 5KAFZ 2ZXWB 2W91A 1G9CA 2B9ZA 1ND3B 3HWJA 5C9AA 4JYCA 4KU8A 4KWJA 4CYDA 3B77A 4A3ZA 1WW7A 3TN91 4JYYA 5K8SA 3ZIXA 3VV1A 5H5NA 5CG9A 1DK1A 2WPDG 4NIDA 3B5LB 4CEWC 3SXWA 3T2PA 1IKQA 3OM3B 5LBCA 1YZBA 3CD6V 2YU2A 5F3IA 4QX1A 1XNBA 4CPBA 2VVFA 4I9QA 4JVAA 1AUYA 4NE9A 4E2GA 4RS5C 4IGPA 5BNOA 3ZCCA 1BBT2 5A7QA 4AHCA 4B3MO 1KUQA 1VBD3 4CDXB 5LMNB 1ND3A 4CC5A 4X88A 3TXQA 1U5IA 2BU9A 1FJGB 2X29A 3LA2A 2XBO1 3D5OA 3MIDA 1DYPA 5GONB 4NRQA 1JZ2A 3UETA 1K45A 3LUTB 3ASOB 1VQ9V 1I5PA 1AILA 3INAA 1RUE2 3AZWA 1ZVFA 5IAVA 4YXWG 5LY1A 3NNFA 3GM8A 4V1PA 2VECA 4JI3B 4CDXA 1Z2GA 2JX9A 5JCOA 2E7TA 1F4HA 3BI3A 3VGIA 1FMD3 4P9JA 4IQPA 1CIYA 1TNFA 2LP7A 1R1A1 2XG3A 5GONA 2EIJC 3AG1C 2DYSB 4AI8A 3KHBA 4GWMA 2Q1MA 1V54C 3ES1A 1RVF2 4MXVA 3FYEB 1DZTA 3E86A 1BEV3 4TLGA 3EYPA 1K92A 1POQA 1ONAA 3OEAA 2QDOA 2E9QA 4QX2A 4JX0A 4E2LA 4AR2A 1V6IA 1TA8A 2YGLA 2BSKB 4ARYA 2OWOA 2VQTA 3JD73 1X7NA 3RI8A 1IDSA 1SESA 3DN7A 3NAPB 1JCHA 4DR6O 2DW4A 2PLV2 1Q6IA 1PIV2 1VE0A 5FV3A 2F17A 1XXNA 3RZLA 2J22A 2VZUA 4ATEA 2YSUB 2HWB3 1YJNV 4AEJA 3PUAA 1KS4A 3OSDA 4IEUA 5C8CA 5A3LA 3TGUH 2BSKA 4BIZA 2VUJA 2ZM6B 5FNVB 2VR4A 4MGYE 1PNLA 1EN4A 3H9VA 2VH9A 1PZ7A 4JHTA 3BCWA 5JOWA 3AEIA 4XFFA 4HNAA 1KS5A 4OHVA 3ZRSA 3BB6A 3IDAA 1JODA 1JMKC 2B7YA 5ERLA 1Z78A 1W8FA 1XREA 3RW0A 4LHSA 2JKXA 4A7YA 3BKZA 2OQ6A 3ABKC 2Q5TA 4NHYA 5CB4B 5J09A 1V55C 3MFAA 4K1ZA 1SQFA 2LROA 5FNVA 2WLPA 2W1UA 1RUD2 5FXWA 1ZTEA 5J36A 2XJPA 1DGRA 1HJGA 3POIA 1M06G 3DTUB 4XBQA 2ZEWA 4MVRA 2C4XA 1VBB1 3RDIA 1PM9A 3WG2A 3OE7G 2CH7B 5HCBA 1S0JA 2V5YA 1JYTA 4QQHA 2K0GA 3G80A 3VBSB 1MPXA 4S2DA 2BRTA 2P4KA 3LEGA 1K5QA 1M9NA 2WBKA 1ZM1A 3RVHA 2WNUC 1AYM1 5BNPC 5CB4A 2M6YA 3WP5A 4HSJA 3RYFB 2YI9A 1PGW2 4QQ2A 5C70A 3ZPYA 3ZN4A 3NV4A 4QQLA 2YICA 1LCLA 2BBVA 1GZCA 3NJVA 4DXZA 2RE9A 1PK6C 2HWC1 4Y1ZA 5F8PA 3CCJV 5CKMA 3WW4A 3WNXA 2UXNA 3CS5A 1WCSA 3VBSA 2W94A 5JDBA 4NPRA 4FM2A 4DINB 4S2GA 1YIPA 2UXDO 2VVEA 1QGLA 5L36A 1AHSA 1JMUB 5KHJA 4HFSA 4DXRA 3CO2A 4FZ1A 3RYFA 5IT6A 1S76D 2ZXWC 2V4VA 4M3CE 1ND3C 4QE7A 2D5HA 3I59B 4E2QA 1YCIA 1RUC1 3AZYA 2RNBA 1GFF2 2K46A 4CXXA 1NY72 5EQUA 5EBMC 3V0AB 4QB2A 4D8MA 3TOJA 1LEMA 3PVEA 4JV4A 2L9LA 1E5HA 3E97A 4DV2B 3KZ4C 4CCEA 3FLRA 1W9FA 4NXMO 3CIHA 2G9GA 2XNDG 4GJZA 1T6GC 2GC3A 2BPA2 3DC6A 3FL7A 1F35A 1JQ0A 4CZSA 4MG2A 3PN1A 4DMIA 2SLIA 2J1AA 3RG0A 1I0HA 1E1QG 5SV8A 2DCYA 3H8RA 3V0AA 1G86A 1UPGA 2OIGA 3ASOC 4YGBA 3I8TA 1W90A 1W8HA 1YQ8A 3K58A 1UU5A 2QWOB 3I3EA 1LOEA 4IE4A 1XMOO 5F1RA 1AYN3 1UOJA 4Q4V1 1LEDA 1F15A 1RUG2 2ZR3A 4FQ4A 4AAXA 1MG1A 4UI9L 5A1LA 1HP8A 2Q7HA 2QQUA 1QVFU 3D36A 3FMGA 4FOVA 3VDDB 1IQDC 1GP5A 3ZR5A 2DYSC 4QQPA 5FREA 4LHLA 5IDJA 1S2BA 4L2NA 4AILC 2ES3A 1MOFA 5FLHA 2DE0X 4BQ4A 3F5TA 4J11A 1QLEB 1OCRC 5KHGA 3MHZA 2PHDA 1RUNA 4Q0QA 4A3XA 2A3WA 4XE9A 2F66C 1KD1W 2I45A 4RWUA 1JYXA 1UY0A 4NIAA 3NAPC 2VS0A 2WT0A 2G4IA 3VDDA 1QLNA 1XNRO 1S5JA 2P4VA 5JOYA 4R9DA 1C8M3 1JUIA 4NAMA 1TME3 3LSSA 1ZNPA 1AR83 2QVSB 5AC92 1QDOA 4K35A 2HYXA 4DV4B 1OOPB 1UY4A 5K0UC 1UKGA 4Y1UA 4GMP0 1VR3A 2NM1A 2WZR3 2ENRA 3H1KH 1H2LA 3GJAA 5F32A 3CCEV 2BQPA 1J95A 5GLTA 5GM0A 2O57A 2C26A 3GDBA 2WFPA 3IDEA 3BOPA 1VEWA 2RR12 5A3UA 1FMD1 4X20B 2IXJA 5J3UA 5KA5A 5FZHA 1OOPA 3PJQA 2BP6A 3H0OA 2DVFA 4WBBA 1NS1A 1Y67A 2ZEZA 3GGLA 4B3TO 2YC0A 1Y4WA 2X53S 1RHI2 2EVXA 5FL7G 1S2EA 4JAAA 4U7NA 2P5BA 5CMUA 5L7OA 2HWE2 2O8OA 1H2NA 4QPIB 1CPYA 3JD71 3GZAA 4X20A 4YW1A 3VBSC 1GNZA 4YJ2B 3KQ4B 2QDRA 1X8MA 4CS2A 3HMYA 1R1A2 4O4LB 5LP6B 2DQ3A 1W8ZA 2VQ0A 2ZE6A 4UYBA 3WLUA 3KT7A 1NG0A 4I0BA 3S5AA 2HWB1 1EUTA 2GAUA 3O12A 2BCCH 3TB0A 3UT0A 4MGSA 4HVOA 3IDCB 4MVSA 2DUOA 4WM7B 5A3TA 1CWPA 2HWF2 2FBEA 4P9WA 2ZS6B 2Z5WA 4I4TB 2D98A 5BXXA 3DF0A 4PDLA 3VKLA 4FT8A 2D6LX 3V56A 3BA8A 2GMPA 1NT2B 1I3HA 3PJYA 2A6ZA 3PUIA 4YW4A 5DM6V 2G19A 4O4LA 4M3CF 1R3JC 1KRIA 1PVXA 3HQUA 3P6BA 4X1KB 2XHKA 3WFVA 3BPSA 5GJ6A 4LF5B 3ZXAC 2UURA 3AP5A 3S7EA 1R3KC 4WM7A 3BTYA 4DR1B 4MHUA 2XJSA 2E7AA 2LW1A 4I4TA 4CEYB 2YUAA 1QIQA 4AGGA 1WLTA 3KGZA 2YBPA 5C3OA 1A78A 1AVMA 3CC4V 1W04A 4Y4RA 1W2BU 4FXGB 3QVNA 5F2VO 2F6BA 1YIJV 4L92A 4LITA 2VNOA 4NVPA 3BEHA 4MTFA 3WV6A 5CYYA 3AK2A 3RS6A 3I2FA 5E6HA 4CXYA 4CEYA 4M4PA 2HEVF 1WMDA 2XWJB 2R043 2P6CA 2F23A 1VBE3 3FHQA 3MPBA 2VVDA 3NJYA 4Q5OA 3QD6A 3EFFK 2V4DA 3MIBA 1FV3A 2GU9A 2Q73A 2Q1ZB 3VBHB 2CGPA 1DCSA 4BWOA 3LDBA 1PV0A 1WD4A 4L8QA 1UU4A 3MLLA 3JSNA 1X33A 4Y20B 2I74A 2A3XA 1EPZA 2C9KA 5E79Z 1NU1H 1XSRA 1Y66A 1DF5A 5J2UB 3CWBH 3N36A 2WS93 1IPSA 2Y4TA 2PAMA 3RGBA 4G28B 4M01A 1QLEC 4K8ZA 1W9WA 4X89A 4YIOA 4FPLA 5FUIA 1SZXA 1EM1A 2IXIA 3I2JA 4TV9B 4CP1A 5F5QA 1W0PA 5HXMA 1ND2A 3VBHA 1ZA4A 5IK5A 4R6ZA 5T3NA 3ZRWB 3QO7A 2YC2A 1ZWIC 1OJHA 4JASA 2OXBA 4K7JA 1YO8A 2CSGA 5EZWA 3RWNA 1BMFG 4Y20A 1PX4A 1V00A 1Q8QA 1OFNA 5AFEA 1Q8OA 3QO8A 2IBZH 2J1EA 4B7EA 5J2UA 2HKOA 3WQ1A 3JAMN 2E7QA 2Z3YA 5K1XA 3GXUA 2TEPA 5HV4A 3RFRA 4KHPB 2P6HA 1LOFA 1OOPC 1CP9A 5FZFA 4TV9A 3AG4B 2CAZC 3S7IA 5DUUA 5DAWA 3PUHA 3NKGA 2RHPA 2E6VA 5HPOA 4K9SA 4PIYA 3AYEA 5E16A 1PL0A 1AYN1 4B4RA 3GWKC 5F6KA 4TWTA 3EB7A 2GBOA 2XL9A 3LEIA 4FPFA 2PZSA 2DMXA 3WDYA 2PFWA 3I2KA 2LGQA 2QKSA 3JB8A 3FFQA 1WPBA 3PVNA 3I3DA 4PA9A 4ZU7A 4DR5O 4QHBA 3T0DA 1QQCA 2J1UA 2NPIA 4O9GA 2KG7B 1IPKA 4Y1XA 1J83A 4LR3A 4Q0PA 4PLOA 1ENRA 1S2KA 5C33A 1CZVA 2FB5A 1IS5A 3OPWA 1LAJA 4WCEV 2XJVA 3D3QA 4JZGA 3LIHA 4H2AA 5FFOC 3H50A 1JXNA 4O61A 4PI0A 1DIWA 1MACA 3QACA 4QPIC 5FBJA 3CDZB 5ACA3 4K20A 3BIWE 1TEIA 2WNVA 2HYKA 4OQ9A 4UF0B 4LNUB 3HBZA 1ULFA 4HLTA 2R32A 3GJBA 3ZDSA 2KG7A 4Z92B 2V1DA 4FOQA 5LP6C 5FZIA 3KT4A 4ZHQA 4AHWA 4MV2A 1C8M1 2A7AA 4N7IA 1TME1 3E8BA 1AR81 2ETNA 1Z5VA 3KSCA 1M4UA 4LFAO 1UX6A 5F2WA 5D8AA 1UYYA 4P02B 2X09A 4CCNA 3AG2B 2N05A 4QPYA 5FKBA 3MF6A 4GWNA 4Q0SA 4QPKA 2ZD9A 4FVMA 1VF6A 2VZTA 4PCRA 1RIRA 4YWAA 1CGPA 2CDYA 4LNUA 4IETA 1VBC2 5JVDB 3ZMNA 1COWG 3EMRA 2QQMA 3ZXKA 3C7HA 1GKFA 4XW3A 5FZKA 4H44B 2VQFB 1AR4A 1F4MA 2ZGNA 2TNFA 3WNKA 4CCKA 3UO3A 5HCFA 1JYIA 4DUZB 3ZMUA 2FMLA 2NP0A 4B29A 4JDNA 1YEWA 1RJ7A 3ZM8A 4E8CA 3LFMA 2ZGTA 1JZ5A 5GZCA 1APNA 4CEYC 1WP8A 5DZFA 1YRZA 4JGYC 1FAYA 3IPVB 1IZ3A 1GQHA 2QJ1A 5JVDA 5EJ1B 5BZBA 4XAEA 3VB9A 1R082 2W1QA 2RDQA 5HCHA 4QHOA 4NTWA 2W1WA 5A3MA 3V65A 1PM4A 2WL1A 2QEXV 3VBFA 1OF3A 5C6CA 2QQJA 1PMHX 4GKJB 4DB5A 2WT1A 1AR73 3AYDA 1Q8SA 5IUQA 5LA9A 2AUYA 4OHWA 1HNXO 4GUNA 3OY8B 2Q4SA 3RBZA 1IG3A 2DN9A 2DVGA 4OGQB 3H1WA 3W9AA 2ATKC 2RDRA 4DV3B 1W8UA 5JI7A 5JQGB 3PTYA 4XF9A 4CDQB 4UW5A 2ORXA 4A41A 1JYWA 1NX9A 3POEA 4MUVA 3OTOO 1GYKA 2W39A 3I3BA 4YG6A 2UUBO 4BQ5A 1ZBE2 5B1OA 5KHIA 2PHFA 2CWSA 4DFSA 1W3XA 2UUCO 4BAYA 4GYCB 4LK7A 2W52A 3ZIAG 1RUJ1 1C28A 1V6JA 1GP6A 1J1LA 2E31A 4MVOA 2DJVA 3UESA 4GKYA 1GV9A 1JI6A 1OLQA 4CDQA 3H1JH 2ZABA 1EV12 3A21A 1OQ1A 4PT6A 1P7GA 2ZHMA 3ZYPA 3AZZA 4LF6O 2QTWB 4CP9B 5KBFA 3OF1A 4UVBA 4TV8B 5IK4A 2ZMKA 1Y6XA 2OYQA 3ROUA 2PYLA 4INDA 2VWKA 3RVZA 1SDDB 1XBFA 1EAH3 3L72H 5J2TA 4UFZA 4AEMA 3BU7A 1B35A 5TSWA 4D7SA 2VCCA 2A79B 1SBDA 1MS8A 2OX0A 2AREA 3T2TA 3JALB 2QFEA 2B1GA 2VXRA 4MGKE 1Q8IA 2XJUA 2Q0OC 4DV5B 3NMBA 3DGEA 1C5IA 2WWUA 5FYTA 3K3NA 3AJZA 2WZPP 4TXWA 4TV8A 1MA1A 4N43B 2R041 4FFKA 3PVBB 1OCOB 4QB1A 1VBE1 4G3YC 4RR3B 4MSWC 4Q4Y3 1S0CA 2J1RA 1SF9A 1NQTA 1HXS3 1ZRFA 2A5ZA 4LNVA 4NWWA 2O0OA 3DGTA 1OKOA 2HKXA 3ZMOA 2Q7GA 1DTOA 3JALA 1O4YA 2CHHA 3I2GA 1F8VA 1SLTA 1Z0HA 2FMDA 4XQ4A 2JJ6A 1PL4A 2F4VB 3GNEA 1YF2A 5J9PC 3DXRB 3CLPA 1OD5A 4DK1A 2P90A 1G6NA 4N43A 1FD9A 2XHBA 2WS91 4NAOA 1XC6A 1UY3A 2Q68A 4CH5A 1B3QA 4FTEA 2ZGOA 3KF3A 4NHKA 1Y9MA 2YEVB 1LTEA 1UL9A 1J58A 1GQPA 2QKDA 4O4IB 2W6JG 1DQ4A 3ETEA 3A8TA 1UF2C 1ULDA 4DY3A 4Z2WA 1ZUQA 4CBCA 5G04L 2D7FA 4JQTA 4B08A 4MW3A 2ZCWA 1F23A 1UW8A 4HL0A 4ZU5A 4WVMB 5A6XA 4CSWA 4E4DX 4Z82A 3WU2Z 3O5SA 3FBYA 3DXRA 4FZ0A 3RPQA 1IHMA 1MVQA 4YZ2A 4O4IA 3BUCA 3AG2C 2Z42A 3WX5A 2BGPA 5IAXA 3RYHB 5K4LA 4H3WA 4RFT0 4BMBA 3JD2A 2YC4A 1WGPA 4UT5A 2LM3A 3ZS8C 1POV3 5FPOA 3L71H 4WVMA 2JB4A 4F8AA 2Y8KA 2WN3A 1W8WA 3NQHA 3ZHSA 4ZS3A 5LBEA 4A6OA 3NV2A 3MDPA 1NTKH 4WFAV 3RYHA 1VARA 1SQPH 1H9PA 1UYPA 1MZ5A 1VIBA 2WQ4A 4EKWA 3T2OA 4EN0A 1NXMA 4I02A 2Y69B 2Y34A 4P9IA 3CPWU 1GU3A 3TCUA 1QMJA 3E22B 1GM7A 1W06A 5ACA1 5JSPA 4HPKB 5CA1B 3POBA 1TUBB 3ZMVA 1HW5A 3D0SA 2GDFA 3L74H 1DQ6A 1E79G 1VB4A 1QDCA 2DTYA 2PHLA 4PD4F 3VD4A 1N32O 4MX3A 5FYYA 4Y1VA 3RYCA 1JOBA 4GX1A 3M3OA 2R6QA 4CDQC 1K5MB 5FPAA 1TZOA 3E22A 1SQBH 2YV8A 4P2ZA 1SC5B 1Q7YW 1QJY2 3SPGA 1IBKB 4HPKA 5CA1A 4UCOA 2L35A 1PKXA 3GZUC 3MD0A 1TUBA 1N34B 4XDKA 3E89A 1NBMG 2D3PA 2BFUL 4ET7A 1PVC3 5A1FA 4FBFA 1ULGA 5LYJB 5FZ7A 1HRV2 2HBTA 1SZTA 2YG0A 2VUAA 4YVWB 3NWKA 2RV9A 4XF1A 2FDFA 3L9JT 1DGSA 1TQ5A 1K5MA 2IXLA 2D2CB 4IEQA 4GWJA 3S57A 5FY7A 3AP4A 4NROA 5D2AA 4LKFA 2VMDA 4CU9A 2ERFA 3U4XA 2HWD3 4PQ9A 1GM9A 2EALA 1REDA 2R062 2RM23 5JIAA 3VZLA 4HMZA 2E32A 1KGYA 5B1AB 5A3NA 1YSCA 3RYIB 5LYJA 1VQ5V 1KFUL 2H0BA 2P67A 1D2QA 1SS3A 3DECA 3ZFFC 4YVWA 3QNEA 1SRYA 1OA3A 3SMHA 1H8EG 4J7JA 1W6QB 4DR7O 1FKAO 5KHHA 1AR71 2KM2A 3FB8C 4XFIA 3VZNA 5CISA 3H1YA 4HZ3A 3CC7V 3T4HB 1J1TA 3JATB 2A3QA 3LCPA 4QQOA 5T54A 4GZ9A 1OCOC 2PY5A 5JZGC 4O4HB 4RR3C 4XFGA 4YVSB 2VW2A 3IN9A 3UKNA 1ZBA3 1R6TA 3RYIA 4XDQA 4OUEA 5JPMB 2RS51 3KS7A 3IZOA 1ULPA 5H9QA 3HAGA 2QWPB 1PGSA 1W6QA 2A6WA 4CDWC 1G9DA 4Q4X2 3M3IA 1HB4A 1UU6A 2SBAA 2DU1A 3C90A 3JATA 5I8SA 3UJOA 4OHXA 1NCQB 2VBPA 2CTPA 1SACA 3RSJA 3KV6A 3U4SA 4E2SA 4N90A 4YVSA 3SJAC 4IV3A 2VOXA 5LASA 3L75H 4KGQA 3JARA 2DCTA 1GK9A 3HPLC 1R1BA 1L7LA 2WJSA 3D82A 4PDWC 1EAH1 3O1PA 4IEZA 3I97A 2Z69A 4X66B 3R4SA 3GBFA 3RZZA 1RTVA 1YC61 2IU3A 1BGYH 2ZIOA 1RUJ2 3TJTA 3GZEA 3JSLA 4JZRA 3IGAC 5IWAB 1NCQA 3USSA 4NXNO 2DCZA 3H3ZA 5EIYB 2WT2A 4FK5C 1GSLA 4ASMB 2BTOA 4GKXA 3KG2A 1NLRA 3VKFC 2N04A 2VBBA 4GWIA 1N0JA 5CN0A 1QHDA 2W9XA 1OCZB 2K2SA 5FXZA 4Q4Y1 3KCCA 4X64B 4E4HA 4LUKA 3MUZ1 2H8PC 2VTXJ 1HXS1 1NJIW 2DQ0A 3A22A 4A44A 1HLCA 3ZXJA 4DEQA 2IVJA 4AE2A 3MDSA 4HONA 1XL6A 3H1LH 1W8OA 2P37A 2G38A 3GBWA 3F95A 1I6XA 1UMHA 4DW1A 3ZMZA 2HVKC 4QPWA 1U12A 2Y69C 2Q4PA 1LKNA 3AXEA 2JEMA 2P3KA 3T0AA 2XVGA 1OXCA 3R0RA 4XCBA 1N3PA 4AHYA 1H4HA 4ITCA 4XOGA 4GT1A 3Q8FA 1S0DA 5FYZA 2Y6LA 3EJKA 3T2MA 5LEKA 5FZ6A 4QKBA 5K9YA 1QU7A 3APQA 3WQ7A 1D2SA 4CCLA 1US6A 1S72V 4MTXA 2GSMB 1W0OA 3ZYGA 3VZKA 3HR9A 2Y6KA 1JH5A 3CCVV 4B4PA 4AW7A 3JAWB 1K5MC 1LOGA 1PO22 4TT3G 1MR5A 1ULCA 4PELA 1YFUA 3J7NA 2ZX0A 4ZZ5A 4C91A 4CCJA 4H0LB 4IT5A 2WLLB 4I50B 2W6IG 1NTMH 1IBLO 1BBT3 1WCQA 3WR0A 1POV1 3O1MA 2YIBA 2G1MA 4DV1B 4FLTA 4FLYA 5IYCO 3OGVA 2PYTA 4QU1A 4AF9A 3A4UA 5FUPA 1GTOA 5FLJA 3Q8BA 4YVWC 1K5JA 4CCCA 4FLZA 2FKXA 3JAWA 2J1TA 4ZU4A 1B09A 1KITA 1JZ6A 1RUE3 2F4PA 4YM1A 3MW3A 4NB5A 2B8MA 5EBWC 2OCHA 2WLLA 3K57A 1VAKA 4I50A 1VBA2 4MSVA 5C7GA 3BY6A 1QWRA 5E89A 3FFZA 5T5PA 4WZCA 2ZE7A 4JTDB 5B66Z 4DR3B 2WKKA 5CKNA 1NCRB 5KC6A 2JG8B 2ODMA 3WOGA 5B1AC 3T1HO 3FC0A 4RL7A 5J7MA 3OEBA 1MSDA 1AI7A 2YXLA 4LFCO 1CZTA 2XLFA 2UYAA 1RVF3 2DCJA 5FYCA 1Q56A 5IVEA 3M8AA 3OD4A 4QWNA 2YYOA 2VZVA 2ITDC 2AZ2A 1BYHA 2ITCC 3ZN1A 1GICA 1ODMA 5FZ9A 3N7LA 1NCRA 4FPYA 1PNKA 3ZSLA 4BCUA 2PLV3 1XQNA 4GX5A 1PIV3 1C8NA 2Y4UA 3OCPA 2HEPA 2B5UA 1IG0A 3AMMA 2WLJA 1KXGA 1W0JG 4XUNA 1DGWA 1QXRA 1O3QA 1HB3A 2XVKA 3LSEA 2FDIA 1PVC1 3ILFA 2BWAA 5FYUA 4XMIA 4LBOA 1UN1A 4TN7A 4LK6A 3BAAA 3M7MX 4FOYA 1HQWA 3BALA 4BWAA 1NCQC 3K0DA 4MGTA 2XAHA 3DYPA 1NAEA 4J41A 1S77D 4CS4A 4WFFA 3OGGA 1LGBA 3ACIA 4LF8O 3LWCA 1L0LH 1V70A 4B3MB 1COV2 1E5SA 4KG8A 1LHVA 4KXRA 1XB9A 1EZVH 4YG3A 3SITA 4JKKA 1ZX5A 2Q8OA 2ADEA 3R66A 5J98B 2RM21 1PZ8A 4AK3A 3CXCU 3RWKX 3WB2A 4FSJA 3Q8AA 2BERA 2F1MA 1OUXA 5CKQA 4AVVA 1B04A 1RUD3 3HBKA 3HKCB 2P1BA 5APAA 5CFCC 5C3SA 4PLNA 1UCXA 4DS0A 2EINB 2A1XA 1OCZC 5LHIA 1EPWA 2NQYA 4J9YB 4CTEA 1FS0G 4WBNB 1M57C 1ZBA1 3RZGA 4AWDA 4PA3A 4QJFB 4KBZA 4PJYA 3E5UA 4NKGB 3VBUB 2Y6JA 4JI6O 2XUMA 5JPNB 1FAFA 4HKOA 3HKCA 2UXCO 1AR72 4L97A 1CAWB 4EFBA 1JOPA 3E6CC 4XDLA 2Q8CA 1Y43B 4X8NA 5A33B 4A4AA 4QAWA 5EXOA 3W58A 5JSOA 3K59A 1W6OA 2E3CA 3W7TA 2ZM6O 4DR6B 1I9RA 4WBNA 4QXBA 2ZGLA 5HFLA 1NUKA 4FXKB 2JE9A 1ROPA 2P17A 1UMIA 5T5OA 2RVAA 2RS52 4YLZA 3ZFEB 4AFCA 4ORFA 4BLJA 3SPCA 3VBUA 4YRDA 3H3UA 4RGGA 1MS5A 1AF9A 4B3RO 2DWEC 2XPJA 4AG4A 3CRQA 3WB1A 3CJIB 3I3QA 4UCRA 3BVOA 3TETA 5I8TA 1S0GA 5A33A 2E5LO 5FPBA 4C8DA 2GNTA 1ORQC 2A06H 2YS8A 4CS3A 5DDJ2 4XAAA 4Y24A 4DRRA 3RZHA 3BA9A 1GMGA 3ZFEA 2Q30A 3EVKA 1UAIA 4NRPA 3G71V 4YW5A 4UXNA 5BNQA 1CAUB 2DU0A 1QR8A 3BABA 3ILNA 3C3SA 3FE5A 3SJCC 3M3CA 1L7QA 2VNVA 3CJIA 2Y48A 2YDEA 3J8F2 2XQRA 1MMMA 5GZDA 4XUTA 3ZYHA 1G9AA 3MIGA 3WHUA 2VPVA 1YQ2A 5LATA 1OMIA 2WRAA 5A7PA 1QVGU 4UCSA 2G9ZA 5KUKA 4Q29A 5KA6A 1RUG3 1CAUA 1HN0A 1B06A 3AG3B 2W5FA 1X8EA 1HR0O 3T4ZA 5IATA 1NCRC 2JG8C 1V9U2 1XBLA 1EN6A 2M7WA 5FMOS 3T0BA 1D5AA 3E6DA 3J7LA 3ZN6B 5I0TA 5CAZA 3K75B 1EYBA 2YUEA 4EE2A 2BV4A 3DL3A 2YXSA 5IYBO 2ZOEB 5ANQA 4JAUA 2R1BA 4XTPA 4GA9A 4O4JB 1S0IA 2Y38A 4UV9A 5AG2A 2HHHO 3K4AA 1NLSA 1RYYA 3FN9A 2OW4A 1O8SA 2CK3G 4ZS2A 3KWVA 2UXDB 2V72A 2D5FA 3CL1A 1GZTA 3DYMA 2ZBJA 1BCXA 4G4FA 3ZN6A 3DSQA 2QQWA 1SEFA 1WB7A 1BBT1 3CCSV 4MLOA 5AC93 2QZ3A 1KB9F 2TBVA 3SCGA 4O4JA 4CU6A 3OEEG 1G8MA 3E5XA 2E51A 3VD5A 1W8TA 3E6BA 2ZIMA 1GR3A 5DXDA 4UFLA 3GYDA 1OT5A 1LULA 4K3AA 1CAVA 1RUE1 1QQP2 4PDRA 2X05A 4NXMB 3MW4A 1Y4MA 2BVVA 3O7OA 2RR13 2QQOA 1KDKA 1XPWA 4NYKA 2AGAA 5LGNA 3WNNA 2XJQA 1RGSA 3KCXA 3AB0A 2CTRA 2D93A 1C57A 1RXGA 1EZJA 2IJHA 1GUIA 3TEZA 3KMHA 1RHI3 1RVF1 4BXSV 2E33A 2NN8A 3O0XA 1XMOB 3E8GA 2BNNA 3BTZA 3HJRA 2HWE3 4J9ZB 3VQVA 2EINC 4XUOA 4FFGA 4HETA 4I3PA 5A2QN 1RUH2 3ZMTA 2CTWA 1H38A 2PLV1 3LA3A 3L2HA 2Q69A 3L70H 1M56B 1GWKA 2PA7A 4LXLA 1MEC2 4RFRB 2XONA 3ZYFA 3ICXA 1WWYA 4EN6B 4D7TA 3F7YC 5A1AA 1I08A 2R0HA 2DV9A 3D0JA 1AJNA 2HWF3 4CEWB 1NE4A 1AR1B 2OZJA 3ILRA 2GUZA 1L7RA 4LR4A 2EJ7A 5BNNB 2IVIB 1X4TA 4XUPA 1XNRB 1UZ0A 2D3RA 4QM9A 2P3JA 5C8YB 3KD4A 4LHKA 3VDCA 3ZFEC 2EICA 3WW2A 4J7ZA 2CYFA 4JTOA 4QM8A 1BCCH 5LBBA 1D7PM 1PVC2 5GLZA 3CJIC 2WUHA 4JHZA 3ZFGB 3ZSJA 1KEXA 4B3SB 4CEWA 1VQPV 2JG9B 3U14A 1J59A 4FFIA 1QNMA 1SETA 5FYSA 4LBJA 1RUD1 4FFBB 5FY0A 5DMYA 4MVQA 4B3NA 1N1VA 4AAPA 1UIKA 1SQVH 3W21A 4YZ5A 4XFHA 4K8XA 5C8YA 5B1NA 4J80A 1SQXH 2ZGRA 1V9PA 2B42B 2VTFA 4JI0O 5F9TA 3GWOA 5FZAA 1I5YA 4NO4A 4C0HA 2Y0PA 4RYDA 3N27A 2QTOA 1PNMA 5JXHA 3VKMA 3VZOA 2EIJB 2JG9A 3V64A 3FLTA 3AG1B 4D6RA 1C1LA 2GH8A 4DR2O 4B3TB 3PHMA 4DOUA 4TSFG 1T5EA 1V54B 1PGW1 3H7YA 4AI2A 1GM8A 2HLDG 5F6LB 2Q5ZA 3WW1A 4R4ZA 1BMV2 1RXFA 5FXVA 1HJFA 1SFNA 3V0BB 1SLIA 4IHJB 3WUCA 2W1SA 5JOXA 3OBAA 1GZWB 3AG3C 1O91A 5DPNA 3N35A 1GLHA 3BYWA 5EZYB 1OZ0A 5L9RA 5CB7A 2Q8EA 5CBHA 2IH3C 1X9PA 3BHPA 1JU3A 1JA8A 1RC6A 4RQEA 5T5JA 1ZAUA 4W6WA 1YFYA 2D6MA 4Y1YA 1UOBA 2IZWA 4ZONA 1NY71 1ENQA 3V0BA 1K5SA 4OXSA 1OH4A 3G7DA 4IHJA 3T3YA 3AG7A 2QDNA 2PHWA 5JVVA 2ZEYA 1QOSA 4M0NA 4PA7A 3CHXA 2VZRA 3Q4HB 2P22C 3K3OA 2WNEA 4FCAA 4GIQA 4P00B 5L9BA 4FOWA 3SHRA 3W7SA 3T1LA 3IIAA 4MVMA 2JDIG 3GB7C 5FMCA 3JYCA 2XAJA 1VMGA 3K9AA 5LA2A 2LRPA 1QF3A 5L3DA 4JI8O 1RUG1 1QJX2 4LBQB 3Q4HA 4ABMA 4YJ3B 1BSMA 3JCUZ 5C3RA 4PBOA 1E57A 3ZYBA 4MW8A 2VY0A 1AL0G 3L9DA 4IYHA 1QJFA 4S2HA 5L3CA 3ST7A 5BNPB 1YDXA 4Q0UA 5A7OA 2Y26A 2G9FA 1AP6A 1BZKA 1XOUA 4ZBMA 1VQ6V 1FATA 1UZVA 4BU2A 1N33O 5F5CA 1PK6B 2VL4A 5FJKA 2JDNA 1W6PB 2A3YA 4WM8B 4LBQA 4YJ3A 1REEA 4N53B 3WHTA 3RVYA 4UFJA 2KXLA 5LY2A 3AK0A 3HT1A 2WNUA 1XNTA 5BNPA 2Q7EA 2HVJC 4A7KA 1BQZA 1BHBA 2D44A 5IJRA 3AMHA 3B02A 3SDLA 1NZIA 1BHAA 5AC91 1AXYA 1I1EA 1K8AW 4IEVA 5BR8B 1MS1A 4V2VA 1PK6A 2W2IA 1VMJA 2YIAA 2VWJA 4WM8A 4P5YA 4JRAA 4MVTA 5FK7A 3HNMA 5BNNC 4OI2A 2QWNB 1SPPB 1VBC3 1D4M2 4FM1A 3ZXDA 2D3SA 4P08A 3LPFA 1S0BA 3TRSB 2RR11 2D43A 3ELNA 4FQZA 4JAVA 2UU8A 1C5HA 3N9OA 2Q1FA 2GH2A 2D97A 3POJA 3ZFGC 5EPAA 5DUVA 4J42A 2ZNIA 4AZZA 2JG9C 2WR9A 3P5BA 3ZVXA 4GQ7A 1GKBA 2JGUA 1NQDA 5A6YA 3ETPA 1RHI1 2J1VA 3M8LA 5KAIZ 2BYVE 1ZL8B 2VOTA 2A6VA 1R083 2HWE1 2CTVA 5GTIZ 3ZHUA 2WAAA 4FPEA 3U78A 3O1RA 1G4YB 3SKJE 3FB7C 4DR5B 4BQ1A 3MV11 5CFDC 4NHXA 3LGRA 2WAMA 1RUI2 1JZ3A 4Y5SA 5C5TA 4IEOA 4R9CA 2WZ8A 5JLVA 1CPMA 4GH4B 2CNAA 3NKTA 4JCKA 2ADQB 3POFA 1ZL8A 4AI3A 1OCRB 2HWF1 4CP2A 4PIXA 5IFPA 2AZ5A 5HXVA 5FP9A 4D0QA 4BQWA 1GOFA 1QOTA 1WZXA 1J5EO 1ZBE3 5DAXA 3O1VA 4TOIA 4JI4O 2P4EA 3D6EA 5B3SC 3QG5A 5J37A 3RYRA 2QM8A 5DAVA 5KXDA 4LFAB 3DKQA 4X1IB 2MNGA 3N3HA 5C3PA 3QH6A 3OAAG 4FLXA 1AR62 3AXDA 2VUDA 5DAQA 4JI5O 1EBOA 1W0NA 1XDCA 4L9BA 2FDHA 1EV13 5K0UB 4IYIA 4QDSA 4AGRA 4BR6A 3TNPB 2QA4V 1SFPA 4BQYA 1BHGA 1KBHA 2R9AA 1YTFD 2VO5A 3NAPA 1IS6A 1NOVA 5EIBD 4W4KA 1PNGA 3JQWA 3W7WA 1UQXA 3WW3A 4LC1A 1UKRA 3AYCA 4GKKB 1OHHG 3B8NA 1AX2A 5CA3A 2Q67A 3G6EV 3TYJA 3M7AA 3TWIA 5IYZB 5FP7A 4FTSA 2WYSA 1QJZA 3SPJA 2F93B 1HKDA 1O3SA 5FPRA 1FXHA 4KFMA 5K0UA 1AX0A 3N9LA 3AKRA 3T1CA 1A3KA 4P14A 3DYOA 4B1MA 1QXPA 3AX4A 1UOFA 2VOWA 1UOGA 1PD3A 1THZA 3WNLA 3SISA 5DN6G 4BOWA 2IJIA 5FYMA 5IYZA 2CL2A 3ECQA 4KWKA 1EFRG 4HKLA 4DEVA 1UJWB 5HBAA 1NVPD 1WAZA 1POV0 1K3EA 3DV8A 2PQSA 3AL5A 3RT3C 1IPJA 1HNXB 2XUEA 3HQXA 4BPZA 3VD7A 5TISZ 3W7UA 3ZO0B 1XE8A 1JJOA 3M1HA 1DYOA 5A3OA 1SLAA 2WLKA 5EYYA 3ABUA 2OTLV 3OTOB 1CVNA 2CH7A 3FX3A 2UUBB 4WM8C 2QKCA 4XDPA 2JD4A 5LK7B 3P3PA 4N53C 3WD5A 4LJHA 3VBOB 4D69A 2UUCB 4YZ4A 1H8TB 1WUVA 4GB32 5B4XA 1RMU2 2FZ1A 4LF7O 1KC8W 4JI7O 2RMU2 2MW2B 5M0TA 4PIZA 1YNAA 4AQ6A 4TWKA 1VF7A 3UCSC 4QDQA 3MW2A 3SH5A 4ZY9A 1HNZO 1BVVA 4DV5O 4KL1A 5DN2A 4LF6B 3UO2A 5LCWL 3WCRA 1YFWA 1YFXA 4TQFA 1XNQO 3D3AA 3VBOA 1OD3A 1GWLA 1H8TA 3W20A 1GBGA 4JGZC 2YXHA 2EJRA 3U07A 1IOAA 2WQ8A 4YGCA 1QEXA 4JI1O 4RQPB 2FDKA 2JDHA 4YPJA 2XXZA 2K9ZA 3I59A 2QNKA 2JJ2G 3OYWB 3SYCA 5F37A 5IVVA 2IU0A 3DCQA 2D3OW 3NNMA 2F4VO 5GZEA 1ACCA 4AEKA 2A71A 2EXJA 1QU0A 2LUWA 3IKWA 2CDPA 1W9TA 1VAMA 2AYHA 4GZRB 2EIBA 4OYUA 2WZEA 2JDPA 4XHBA 2CY6A 4RHV2 4O2AB 3TBDA 2D40A 4JDMA 4Y4YA 4BA6A 2ARXA 4EWDA 4QGMA 4M00A 1XL4A 3ITQA 3OYWA 3J7HA 1SERA 2EZPA 1FYJA 2BDRA 2VNRA 1V6MA 2RJKA 4IL6Z 3NV3A 4XZUG 4GH4C 2CV6A 1RUOA 3DC5A 4LCUC 3J9SA 2ADPA 2W87A 4NR1A 4EQVA 4J25A 3LDEA 3AM2A 5FKCA 4ZIBA 2B46X 2IWGB 5BUVA 3SCHA 4UFHA 2W0FC 1QJY3 3T4VA 1HB2A 1EP0A 1ZREA 3FBMA 3MLJA 4URTA 3SC7X 5FP8A 4BMEA 1STMA 4P30A 5JJNB 1VBC1 3PUQA 1XU1A 1ZZ7A 3OUJA 1U5ZA 3BRCA 3WP4A 4XURA 3P32A 3ZSEA 5I0RA 2QE3A 1N8RW 4C1XA 1ENVA 4MO3M 1IBMO 4HKWA 1LENA 1HRV3 3MIEA 1DF4A 3SYPA 1DGWX 4LWSB 3JASB 4I7ZB 5L9VA 2WSSG 4JI2O 1VRH2 4ISQA 4YGEA 3LAGA 3EHKA 4IV1B 3DEMA 2IUWA 1UMZA 5FTTC 4UFMA 4FLVA 1R081 3AK1A 1SZBA 3B69A 3POGA 2R063 3AMNA 1KKCA 4IXLA 1IXBA 4KBBA 4QKNA 3JASA 5JR7B 4F83A 3O1UA 1F7YA 4RO2A 3WXPA 5IJ9B 2GP5A 1REFA 4FVVA 4AFBA 2W46A 1WMXA 1JZ4A 3I7DA 1SLLA 2XOMA 3UNPA 3R65A 3ASNB 4HAMA 1UO9A 1JPXA 2WIIB 1YHQV 1UFIA 3S3XA 2WC2A 2E26A 2WWJA 1P7BA 1W2AX 1S1AA 1JR9A 4AEDB 5LHGA 3AK3A 4LBKA 1LGCA 1ZBE1 1A8DA 3J7AU 4O9EA 4UVAA 3UQ8A 2LS6A 4XFCA 4DW0A 1MZ6A 4N8MA 2C24A 2XKPA 1JYVA 4Q4X3 3VL8A 1AROP 2WWSA 3LDRA 1I5XA 1N32B 4WVWA 3OUHA 1VIWB 4H37A 4FP2A 2ZZQA 2GV9A 1TGOA 1EV11 4UV8A 2KKWA 3O9OA 3VQXA 3P1IA 3JUUA 5F3EA 4QPIA 4H13B 3CNAA 1VQLV 3WNOA 2CE4A 4YJ2A 2CGOA 2UWCA 1LECA 3VBOC 3SPIA 1PPJH 1W2UA 1FYUA 3HD8B 1H8TC 5LP6A 2LW7A 4P5HA 2ZCEA 3K46A 4N9HA 1RUJ3 5T55A 5H6QA 3ABTA 1OKQA 2YI8A 4NPLA 5IVYA 1EN5A 4LFBO 3OMAB 1WLCA 4JGYB 4RN5A 3B9IA 3TAYA 4F6EA 1YQ6A 1W3VA 2BGCA 3LB9A 5E88A 2ZHNA 3K77A 1NVPB 3ZRVA 2EILC 4IE6A 1OVPA 2OCCC 2OUHA 4XJZA 3G67A 3SYAA 4RQPC 3LD8A 2UUAO 1O4TA 1UD1A 4X1KA 5GALA 1DQ2A 1UY2A 1HN1A 5F5AA 1WLWA 1OHFA 3B94A 2ZGPA 4OVEA 1UX7A 1O3RA 4DR7B 3H1IH 4AGVA 3CEWA 1AP5A 1LOAA 3ETGA 5FPLA 4CZZA 4HN1A 3A23A 1ZA7A 5A7SA 1CPNA 4JGYA 4K0KO 3R6SA 5EBLC 4LPLA 1R73A 3CE2A 3FX7A 4GXLA 1AL22 3JBG1 3UJQA 5FP3A 1RM1B 5CBGA 1YYNA 3IWZA 1AR92 4WVVA 3JU9A
chains in the Genus database with same CATH topology
3FC0A 4QMAA 3AMPA 3ASIA 1HV0A 4RL7A 5J7MA 1MS3A 1U0AA 4FFAA 3D4KA 5J09A 2DF7A 1O4ZA 1TMF3 2ARBA 4S2FA 3MFAA 4K1ZA 2R30A 3ATGA 1HQLA 2GN7A 2WLPA 4AQTA 4XPVA 3WY6A 1RUD2 2OVUA 4QPGB 1O3TA 3ZXLA 3CF6E 2V73A 2XJPA 1DGRA 5J36A 1WD3A 2XLFA 1M06G 4XBQA 2UYAA 1RVF3 2DCJA 1Y0ZA 4OULA 1VBB1 4NWVA 1Q56A 4AFMA 3L2YA 4KU7A 3RDIA 4LE4A 3OD4A 3WG2A 2YYOA 2XJTA 4MGZE 2YZ4A 5HCBA 1S0JA 2GC0A 3VBFC 3R05A 2V5YA 4COYA 4QQHA 2K0GA 1BYHA 1H4GA 1V6NA 2XB6C 4XJUA 3VBSB 4XBLA 1LHNA 4S2DA 1GICA 4DZGA 2DFBA 3N7LA 1NCRA 4FPYA 5IK8A 2OUJA 3G6JB 3ZSLA 1PO23 4FAHA 1ZM1A 2PLV3 1YWKA 4BCUA 1XQNA 2WNUC 1AYM1 5BNPC 1PIV3 1C8NA 1WW6A 4LE3A 3OCPA 1YUDA 4YNIA 3AYAA 3WP5A 3AMMA 5E1RA 3MI8A 1KXGA 4HSJA 5ABJC 1GVGA 3JB4C 1DGWA 4QPGA 1V6LA 1DU3D 1QXRA 1PGW2 5BNNA 1O3QA 4QQ2A 2XVKA 3LSEA 2RJLA 3ZPYA 3ZN4A 3NV4A 2QZ2A 4QQLA 5T5LA 5FRAA 1N47A 1AYN2 1LCLA 1PVC1 3AMQA 1GZCA 3ILFA 2BBVA 1NE6A 3ALQA 2BWAA 4DXZA 4CWDA 3VZJA 2RE9A 1PK6C 4XMIA 3I4IA 4LBOA 1UN1A 2HWC1 2MPFA 3QCWA 4Y1ZA 5FO9B 4Q4W2 1CQ9A 4FOYA 1HQWA 3BALA 2R1DA 1OIIA 4LBLA 1NCQC 4K40A 3WW4A 1UZYA 3WNXA 2WINB 1WCSA 3VBSA 5JDBA 1OSGA 4NPRA 5CFDB 4Z1VA 4DINB 4S2GA 1YIPA 3ZFGA 2VVEA 1QGLA 4QD2A 4MXWB 4M27A 3M3EA 4IV1C 1N1SA 4LHNA 3OGGA 5L36A 1AHSA 3BOWA 5KHJA 4LEJA 4MH0E 4HFSA 3CO2A 1LGBA 3LWCA 1RUF2 1V70A 1HRI1 1COV2 4C8RA 4KG8A 4FPGA 4K6BA 2ZHKA 3R4UA 5IT6A 4FPCA 1LHVA 3ME2A 2WA3A 4M3CE 1VBA3 2VNGA 1PGL2 4YG3A 3SITA 1ND3C 1ZX5A 2Q8OA 3C3VA 3ZIWA 5HI0A 2D5HA 3I59B 5J98B 1QH6A 5FLIA 4E2QA 3O2GA 2RM21 1YCIA 1PZ8A 4AK3A 1RUC1 1AL23 4LA3A 2JKBA 3AZYA 4HBNA 1GFF2 4J1XA 4YM3A 3ZX7A 1AR93 1FV2A 4CDUB 4BM8A 2C1FA 1NY72 5KXBA 4FSJA 3V0AB 4AVVA 4OI0A 1KQRA 3KM5A 4KG0A 1D0GA 4FPJA 1LEMA 3TOJA 3PVEA 4JV4A 5CFDA 1RUD3 2R16A 4Y22B 3E97A 2IFRA 3P3NA 4MXWA 4GB31 3KZ4C 5H9PA 1RMU1 3FLRA 2XH6A 1OA2A 4OJ8A 5J48A 2XL7A 1C8M2 5CFCC 2RMU1 2TUNA 1O7FA 3POWA 1TME2 4PLNA 1UCXA 1B35C 2G9GA 1AR82 4DS0A 4ASLA 1DLLA 5EJ3A 1T6GC 2GC3A 4C0BA 2BPA2 1EPWA 2NQYA 1KJRA 2JXAA 3IMNA 2CGNA 4CTEA 1OIJB 1ASJ1 4CZSA 4DMIA 2SLIA 2ZGKA 1ZBA1 2OG6A 2OA2A 3RG0A 4AWDA 5DUWA 4N7UA 5CA6A 4CDUA 3MF9A 4AEDC 2R072 1QJY1 5SV8A 1RJ8A 2DCYA 4CP0A 5JOZA 2WZR2 1KFXL 3V0AA 4PJYA 1G86A 2DWRA 3E5UA 3GBGA 3NV1A 1V6OA 3VBUB 4HK9A 4YGBA 1GZWA 1R092 2XUMA 3U11A 5JPNB 3I8TA 4NN0A 4HKOA 4W65A 3MGUA 3SWTA 4Y22A 1UU5A 1AR72 1DRTA 4L97A 1MQTC 1CAWB 1LOEA 1W6NB