2Y0IA

Factor inhibiting hif-1 alpha in complex with tankyrase-2 (tnks2) fragment peptide (21-mer)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
339
structure length
339
Chain Sequence
SGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Factor-inhibiting hypoxia-inducible factor (FIH) catalyses the post-translational hydroxylation of histidinyl residues within ankyrin repeat domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 102
structure length 339
sequence length 339
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2y0iA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2y0iA01
3OD4A 3KCYA 4Z2WA 1H2KA 4B7EA 3P3NA 4JAAA 3D8CA 2WA4A 3P3PA 1MZFA 1IZ3A 2W0XA 2CGNA 2YC0A 3KCXA 2ILMA 1H2MA 4B7KA 1H2NA 1YCIA 2YDEA 1MZEA 4AI8A 4QU2A 2XUMA 2CGOA 2Y0IA 1H2LA 2WA3A 4Z1VA 4NR1A 4BIOA 5JWPA
chains in the Genus database with same CATH superfamily
3WU2Z 4WBNA 4QAWA 2Q7GA 1AR82 4RSUA 5LYJA 2VPVA 4QB6A 2AREA 4JV5B 3WR0A 2W6IG 2LW1A 2ZGLA 2OIEA 1CJPA 2E26A 5JH7A 4NHMA 5FKBA 4WFBV 4JV4A 4XJWA 1JOYA 3WDUA 5GONA 1W9TA 2HEWF 2QKSA 5AC93 4OI4A 4GZ9A 3LF7A 3ZX6A 4MOAA 3H1WA 2JG9A 4S2FA 2CY6A 2R043 2HEPA 4XFAA 3WXPA 4Q29A 4OMDA 3SCGA 5CA1A 5EQUA 4WCEV 4GH4A 1NS1A 2GSYA 1JZ3A 3NV2A 2BV4A 4BU2A 2D5HA 3LGRA 3AB0A 2FYUH 1O3TA 4DV2B 2XL9A 3K03A 2A7AA 3JU9A 1APNA 2G9ZA 4CEWB 4TSVA 2FDHA 2D6OX 3LPGA 4FOVA 2QQUA 1VBC2 3POJA 3ZYRA 1UF2C 3ZHSA 3SISA 1CAUA 4CCDA 1NA1B 4X8PA 3DXRA 4X65O 2YU1A 4MS2A 3IAYA 3BTYA 2XWJB 3FAVB 3CZUA 2WNVA 4XFFA 3HWJA 5FY9A 3TEYA 2EZPA 2ZGUA 1AI7A 5IWFA 1YYNA 3ETQA 1N3QA 4AVSA 4MLOA 2ZINA 5LRRA 4EN8B 5FPVA 5CU1A 2WZPP 5TSWA 3M3QA 4XHXA 1WMFA 3MDPA 1WCSA 4WM8C 4AEDA 1LU2A 5D2AA 4XUTA 1LEMA 4J25A 3KT7A 3GCXA 1GKFA 2JG8B 4ZS2A 4D7SA 2A6WA 3VBHA 1V9U1 5BYNA 4NN0A 4CU9A 4PLNA 3VBRC 4QHZA 1RSOB 2VZVA 2EIJB 3KV4A 2ZDIA 5FUNA 4DOUA 3QBQA 1S0BA 1KB9F 2Q0AA 1Q8PA 1OC1A 4AF9A 1LOAA 1WA6X 4Q1RA 5H9CA 4AEDB 2ZXWB 3CQOA 4P5YA 2I2SA 5LK7B 3S5QA 5CADA 2LGWA 1CAXB 5I0SA 5LW9A 5JJJB 1NH2B 5D8AC 2X09A 1F9KA 4LKDA 2WNVB 1PGSA 1O3QA 3BA9A 3UYJA 4AXOA 4R8HA 1NA1A 4XF1A 5F3IA 3DYMA 3Q9OA 1CXZB 1Z7S2 1UYYA 1KRIA 2IXHA 4MGZE 4P02B 1BMV1 1KUQA 2ITDC 3E35A 3D36C 1R73A 3ZSLA 4IIJA 2ZAHA 1VF7A 5FMDA 2HWC2 1S0CA 4LF5O 2KG7B 3ZMSA 4PLMA 1TMF2 4CH5A 2MEV1 4J11A 4YJ2A 1COWG 2UYAA 1HW7A 1RITA 2BVVA 3DCQA 4TTGA 3AKSA 4JKLA 1I6XA 1PV0A 3CLPA 2AEZA 3N35A 3FMGA 3ZN4A 1W8UA 2RS13 4ICGA 1I7FA 4LO7A 3TN93 4EWAA 1V6MA 4XDQA 4N9HA 5IK7A 4JTDB 1VBC3 1WA4A 1RUI2 4HLTA 1S3JA 1RYYA 2HKXA 2YYOA 3THOA 4RGGA 3RZKA 3I8TA 3U4SA 3LA2A 4JI4O 1F5JA 4CCMA 3AL5A 3QO5A 1WAZA 5FYIA 1VMGA 1DF4A 4CS2A 4WZFA 2OVUA 4QHOA 3TEWA 2XAQA 4L92A 4LF7O 2WIIB 1VQ4V 1IPKA 2VQ0A 4IV3C 2OUHA 2D7FA 4WBNB 1I5ZA 2VZOA 3K0GA 4B3SB 3UKMA 2Y48A 1H6YA 3K2OA 3ZMZA 2GAUA 2JJ1G 3B5LB 1D2QA 3LSQA 3H42B 1H8TA 2HLDG 3RZJA 2QSAA 4GQ7A 3CRRA 3U37A 3WB0A 1DHKB 4BH9A 1G6NA 2ETEA 1AYN3 4Y1VA 5FZFA 2GP5A 4DS0A 5LATA 3JD72 3OT7A 3AP7A 3VKMA 4LJHA 3FUOA 1ND2B 1FFTB 4TXWA 2L6LA 3ZM8A 3C7OA 5I0RA 1PO23 4FAGA 5LP6B 4HN1A 2WZR2 1EM1A 2AZ0A 2D3RA 2OQ6A 4EQVA 3T2TA 5LA0A 5CBGA 1NT0A 4A6SA 5F9TA 2FQPA 1GU3A 4Y4YA 3RDIA 3OGGA 5E79Z 2HKOA 4MG2A 4LUMA 4JTAB 1K8AW 2GDSA 1L0NH 4QJFB 4AEMA 3POGA 3MLJA 3WQ1A 1W99A 3WF0A 2BCCH 2QWOB 2D44A 3I3MA 3A2FA 1WLDA 3VZKA 1KITA 3BEHA 4W4ZA 3GGLA 1XL4A 4RR3B 2WLIA 3FB5C 1X4TA 5A3PA 4DUYB 2RMU3 1O8SA 1QMJA 3J8F1 1A32A 5F32A 1OCCC 5FZ9A 1UJWB 2PHFA 4CUGA 4QPIA 4LH6A 2BERA 1UXXX 3ACIA 2WPDG 1PPJH 2EILB 4Z82A 4Y20B 1MS0A 1M9NA 5B5EZ 2VTFA 2EINC 1Z5WA 2CL2A 5C4WB 2DQ0A 1X36A 4A42A 1XNRB 2VECA 5LOVB 5FZ6A 4WF9V 5M0TA 1SHWB 5DUWA 2O57A 5IE9A 1HRV3 4WFEA 4ZKTB 5A3NA 3CZJA 3TB0A 5EZWA 1KMIZ 3OD4A 3LEGA 2TUNA 4K8RB 5ACA1 4Y1ZA 2VGDA 3FLTA 1G9AA 4NTWA 1P49A 3HPLC 1RUG2 3WF3A 3OGRA 5C7GA 1H9PA 4XCAA 3L2YA 3W7TA 3LNMB 1IS5A 3E8HA 1P7GA 1H0BA 3WDXA 3FFQA 3FYIB 4DEQA 4QPGA 5F3EA 4OYUA 5EZYB 1VB2A 4ZXEA 1E57A 1O4TA 4V2VA 4LXLA 1JZ8A 2OS2A 5LCWL 3PIGA 5LL6Y 3WNPA 4XDPA 1JYVA 2WL1A 3FBYA 4KU8A 3CMEV 1GP6A 2Q4PA 4UFLA 4OZOA 5D1IA 4GXLA 1MVEA 2QEXV 4JI2O 3JBG2 3ABMB 3L70H 3W58A 4KHPB 3J8F2 4FOWA 4UT5A 5CN0A 1S0GA 2CU5A 1PZ7A 5FZAA 3VD7A 1WW4A 3LZZA 5F5IA 4X88A 2VL4A 2ATFA 5ABJA 2BP6A 1RUJ3 4AQYO 2ZXQA 2X5IB 1HLCA 4JAUA 3AYAA 1P8JA 2YXLA 1R083 3HB3B 3IGAC 4DXRA 4PIYA 2JG9C 2XJRA 2ZTNA 1W0JG 3PUQA 3A0NA 1JCHA 4OZXA 4PT6A 1M5IA 1KXGA 3OEEG 5F5CA 1XBLA 1V6NA 5DQ0A 3WNMA 3M70A 4HZ3A 1SLLA 4ITCA 1XB9A 1K73W 2JWPA 1W28A 4YWAA 3NVCA 4H2AA 5FJKA 5B1AB 1FV3A 4Y22B 5A7NA 3K5NA 4LP8A 1VAMA 3CJIB 3EB7A 3WNOA 3E5UA 2DWDC 2DWRA 4LC1A 3ZXFA 3OPTA 3CJHA 1YI2V 4F6EA 3VHOA 1VIBA 3FYEB 2X6BA 1TME1 1IPJA 3OBRA 3OY8B 1Q56A 4LFCB 3TJTA 4D6QA 3NXSA 4YGDA 3Q8EA 5IWAB 1SQ4A 2DVDA 1FXKC 4AFCA 1YIPA 1W8HA 5AG2A 3O0WA 3AMNA 3JARB 3OOXA 5IJ0A 2BGPA 5CA0B 3KZ4C 3VBFC 2W1SA 2Y6HA 3S5AA 4LF8O 4B3SO 1CAWA 4RO2A 2ZOEB 4NIDA 2XPJA 1S0IA 4GB32 5FPBA 1TNRA 1YLLA 1OOPC 5F8PA 4O4IB 1IS6A 4GWIA 2E33A 4Q4W2 3DKWA 3OG2A 2DWEC 4I09A 4YGBA 1FPN1 5KBFA 2O14A 1WPXA 4JI8O 1PNGA 2M7WA 5BXZA 1UXZA 1E5SA 1O5UA 5L73A 3WFVA 2R30A 3WDWA 5DZFA 2UXCO 2HJIA 1FJGB 1HB1A 1K5MC 2YC0A 3UO2A 5DUXA 3CC7V 3VUOA 2G38A 3FUQA 3AXDA 3M1HA 3LEMA 4MHRA 1ODNA 4XAAA 4DV5O 1CN1A 3LEIA 2JJ6A 4A45A 4FFHA 2CYFA 4QPIC 1RUD1 5FZLA 3WW3A 5F2VO 4ES9A 2RDNA 5FYZA 4ZU5A 1HQLA 2P3IA 2YROA 2CTQA 4LF8B 3UM7A 1SBDA 1WLTA 3OGCC 4Q8KA 4J80A 5GW7A 3RT3C 2BW8A 1ENQA 1HB3A 2PHXA 3U78A 3DYPA 2OPKA 1Y67A 5FZHA 1HNZO 4N7IA 4UW4A 1RMU2 1UQXA 4JCKA 2AENA 1RJ8A 4IETA 4CRQA 3X2QB 3HNYM 4XZUG 1XC6A 1GYKA 5EJ1B 1LENA 1KFUL 4X1KA 5LA6B 1I1EA 1VAVA 3VBSC 4PDWB 2CE4A 2F95B 3NAPB 1Y66A 1RUH2 5EYPB 5FP4A 2XAJA 3ZSKA 1PO11 4BQXA 1L0LH 1BMFG 4LHSA 4WVMB 4B4PA 3M99B 2QWPB 3D3IA 1KECA 1P7BA 4XDJA 5FZKA 3ABKC 4YIOA 1N36O 2FL4A 3Q4HB 4XUPA 3CCLV 1CX4A 4YG3A 2OIGA 1BHGA 1RHI1 1NY72 2PYLA 3K3NA 4BE3A 2Q5ZA 4JHZA 3BU0A 1H1IA 1FFXA 2RS33 5GZDA 3KF5A 1CESA 2X5IC 1RUD2 3RZGA 2FZ1A 3LCPA 1OPMA 1AYN2 1FD9A 4K7JA 4PI2A 4NIAA 1TME3 1N3OA 1ZZ8A 2K46A 5EYPA 2WFF2 3I3DA 3DTUB 4NXMB 1MS8A 4F6RB 1YWKA 3PHMA 5LP6A 1WUVA 3OCPA 1AXKA 2Y69B 4JGZC 4Q4V3 1K45A 3MIGA 2VBDA 5H2FZ 1ZYBA 3PMSA 2QZ3A 1UOJA 2DYCA 1B6QA 2VVDA 1LGBA 1AJOA 1QWRA 1RPRA 5FY7A 4EKWA 4FTSA 2XUMA 3ZN6B 1LULA 2XXZA 2FDFA 4XXPA 1IBMB 5F5AA 1JFFA 3NJYA 4D7TA 1VBB2 3VGIA 1FJGO 2JE8A 4ZXKA 4DR4O 2ZQMA 3FE5A 2Q73A 1FOD1 1YTFD 4QX1A 1NVPD 2GALA 3SMHA 1LB2A 1AR73 3I49A 4WFFA 5KHKA 1OA3A 5F6LB 1E1RG 3A0RA 3ZDVA 5FZMA 5KR7A 3LIGA 3WNLA 2RR13 1X7NA 1W0PA 4X1IB 4OQ9A 4N8MA 1MOFA 4AVTA 4FLYA 3TBDA 3PJQA 3N27A 3WW1A 3AZZA 1R1A3 1HNZB 1BBT3 4JVAA 3ZPOA 4RS5A 1VBD3 1MS4A 5FUPA 4CP2A 3OTOB 3H0OA 4ATFA 1ZZCA 2Q9LA 2C0ZA 4MGYE 5J2TA 3OYWB 1F8VA 1JMUB 1ULDA 4O4IA 5IT9N 2GH8A 2PHUA 3P32A 4P9OA 1UY2A 2VOVA 2G4IA 3GNEA 2PMWB 3H3UA 3R05A 1OD3A 2R9IA 2YICA 2J1RA 2WZR1 3I3QA 3ZFFA 1Q6IA 5FO8B 3ABLC 1ND3C 5CIRA 1X50A 1J3QA 2HYKA 1PP9H 3JAWB 3EHBB 3ZMUA 2W52A 2FHRA 2KB1A 4N7UA 4DR1O 3E8BA 3ZRVA 1W8NA 2UU9O 1CVNA 1GOFA 4MVTA 4XE9A 2E9QA 1XBFA 3VKOA 5KC6A 4LHKA 4MW3A 3BAAA 2UXBB 5FPZA 1PVC2 4R4XA 1YJWV 5FZDA 4D7YA 3JBG3 3CJIA 1LHOA 3EXAA 3O12A 5DABA 3K77A 4XBLA 2ZIOA 4U3FH 1JUHA 1J95A 2YSUB 3WG7C 3M3CA 2JENA 4JC1A 3SH4A 3RMYA 3FN9A 4LKFA 5B1NA 2TBVA 4GJZA 4HK8A 1H1MA 1RUJ2 1BQ0A 3K3OA 1WMEA 4EFEA 3VZLA 2VOTA 3VBHB 1JOJA 2JG8A 4FIPC 2P3JA 1H8EG 1JOPA 3SYQA 2PHRA 3J7HA 2Q8VA 1VMFA 4LF6B 1WW6A 2BBAA 4AQTA 1OCRB 3RYKA 4FAHA 3O1RA 1VBB3 3AP4A 1PIV1 4DV4B 4NWVA 2EILC 3CS5A 1F4NA 2EIMC 5JOZA 4DRXB 1WD3A 5FLJA 2E31A 3L72H 1RXFA 2AHYA 4KXRA 2OQ7A 1WGPA 1TUBA 1IBMO 4Q1PA 3VD3A 1UYXA 2FBEA 2BTOA 4RR3C 4ASMB 4IV3B 5B3SC 3VBRB 4YNIA 5FUIA 3ILFA 4I0AA 2OPWA 1JYWA 2Z79A 4YLZA 2H0BA 2D97A 3VZOA 4IT5A 3T1CA 1R1A2 2VNOA 1DYOA 4XW3A 5DMYA 1AR4A 3HKEA 3WNXA 2WT1A 3O14A 5EC1C 5LZ6A 2XASA 2VZ3A 2LGQA 3K58A 3ROUA 5IVEA 5FY0A 3M7MX 3UJQA 4GUNA 2HFEC 3OF1A 1AF9A 2I07B 4BWAA 4MXWA 4DW0A 1W2TA 3ZHQA 4JI5O 2P3YA 2CAVA 4NIIA 2ZGTA 1NZCA 4R7CA 3BY6A 3QOPA 2WLKA 3PJSK 2RQ6A 1SPPB 4S2DA 3O1OA 5A3WA 3CRMA 2LTNA 5T5OA 1PD3A 4HSJA 3VL9A 2ZACA 2RHPA 3LUTB 3GZTB 2RJKA 2E53A 3ZN1A 1QNYA 4CZSA 4JI0O 5GONB 2XHNA 1S1AA 5CB4B 2X7RB 1CAVB 4L87A 4HVQA 4N53A 4AGVA 2DVFA 2GP3A 4AR2A 5A7WB 1DDLA 1V9U2 3IPVA 1R1BA 3I2GA 5GTIZ 2G1MA 2JDPA 4LO5B 4GKJB 2QM4A 1W8WA 5FPOA 3GM8A 4AGGA 2DBIA 1NR1A 1EYBA 4AI9A 4X66O 4Z1MG 1GRJA 3VZMA 3I3EA 1YXWA 4FPYA 1NKGA 4LKSA 2HWB1 5B1BC 3UKNA 4DYLA 4GZRB 3SJQC 2YIDA 1KDKA 5T5PA 1LHVA 2FDIA 3H8RA 4AHCA 1NCQB 4FCAA 3T1YO 4YW2A 2JDNA 5LWBA 3J7NA 1UFIA 1JTZX 4PIZA 4EV0A 1X33A 1QIQA 5GALA 1GR3A 2YG0A 4RR3A 2YPDA 5JQGB 1NQTA 1HJGA 1WJZA 3MIDA 4DR4B 3ZRWA 4JDMA 4LK6A 5KAIZ 3LNNA 2UYBA 4LA2A 2ITCC 4YW5A 3P3NA 4TN7A 1D2SA 4J6GA 1RMU3 2R6QA 5IYBO 5IAXA 2ILMA 3D3AA 2XKOA 4AEKA 3RW0A 3RBZA 5FZCA 5L19A 5HCHA 1KYOF 5DG1A 3ZKUA 5DAPA 4B7EA 2WO7A 4EE2A 5EYYA 4Z2AA 4FSJA 3B3QE 3WUCA 1R6TA 5J48A 2EIJC 3AZXA 3VDAA 3L75H 5ERLA 2X29A 1ENVA 3IN9A 2P06A 1PO21 2GUZB 2NQYA 3WDTA 4E4HA 4ASKA 1VRH1 1KP3A 2UXCB 1WZXA 3WSOA 1Q8SA 2AGSA 4U2AA 2DQ3A 4JKMA 4CCOA 1EN4A 2W3JA 2BOBC 3QO7A 1AR61 1Q90D 4DV5B 2JDYA 4LCUC 4CEYB 1AL21 1K5QA 1W0KG 2BOJA 4LBLA 2CTPA 2VQAA 4OFGA 3K4AA 3SKVA 4TV8A 2EIDA 1QXPA 4LO8A 5FMBA 1K33A 4B3NA 4AG4A 3GHNA 2KD7A 3WNKA 4YW4A 5KA5A 2VQEO 2VVFA 3JSNA 3IAPA 4ASUG 3B9CA 5DM6V 3G7DA 4Y5SA 2D3SA 1L7LA 3SQOA 5KHHA 3KGLA 1ODMA 1TME2 2TEPA 1OI6A 4IE4A 3GJAA 3LDEA 5DN2A 2NN4A 4NTXA 3ABUA 4LF4O 4YPJA 4IGGA 1AHSA 5BNPA 2Q8DA 4DXWA 3ABKB 1ONAA 3VQVA 1IBKO 4JI3O 2ZM6O 4NROA 2B39A 3TAYA 3FL7A 1W6MB 3WVJA 1G8WA 4O61A 3T3YA 5HCAA 2DE0X 4UUJC 1QLEB 2NPIA 1A3KA 2WWJA 4XZPA 2Y0PA 4XFHA 5CKMA 1HXS2 3CRQA 4META 3H3LA 2R70A 4FM0A 2GHYA 1FX5A 4NWWA 1DQ0A 5C6CA 1POV0 4D6TH 3SITA 4QDQA 4FFBA 1LEDA 4BB3A 2RNBA 3O1VA 4XOGA 1UIKA 3DECA 4Q4X3 4YM0A 3C7EA 2BZDA 3ABMC 3HNBM 3U14A 3ETGA 5I8TA 4P9IA 3A21A 5JSRA 2ZT9B 4GKKO 2VU9A 4RHV1 3ZXGA 2A73B 4YZ5A 2XLGA 1C28A 1VB4A 1LOFC 5J96B 2R041 4ZY9A 1W04A 4M00A 2K9PA 2SBAA 2VZUA 2ZMKA 5E1AC 1AVBA 2PI4A 1NTKH 5IY5B 2PF4E 1BBT2 1XL6A 3K5MA 3KCXA 3VBOB 4O2BB 4TLFA 2P4VA 5LBBA 3MAQA 3GDBA 2QFEA 4WZCA 3LDKA 5LP6C 4R9AA 2F1MA 3O1MA 3BU7A 1NYWA 2BNMA 2EZOA 2ADDA 1IS3A 2HWC3 1SQPH 4L8JA 1KGYA 2HWF3 1W6PA 2QM7A 1OOPB 1OCZB 5H9QA 4XVHA 5BNNA 3ZVXA 3LDCA 1JZ7A 2F23A 3OMNB 3D36A 4UBHA 3KMHA 4PA9A 3E6BA 3O1TA 3B09A 3G67A 1QH6A 4QGPA 4YM2A 3TXSA 4ZOLA 1VQ6V 3ZRSA 2VRZA 3DXRB 4JDNA 4QX5A 4AVAA 3LDBA 5LY2A 1R3KC 4BR6A 4FOQA 3A8TA 1EV13 4QB2A 4KNCA 2WWUA 1NLRA 4DV2O 4LLOA 3NNLA 4X8NA 4YJ3B 2XMLA 1OLQA 2GNMA 4O2AB 4I3PA 3BIEA 2IFWA 1H2KA 1YSCA 4YRDA 1ZRFA 1J83A 2CH7B 4XTMA 3N4MA 1OBNA 1W6QA 2MNGA 4E4ZA 2HWD1 3M2MA 4IYHA 1F4HA 4EN9B 2H3OA 4KHPO 4LF4B 4JTOA 4WVWA 3WZ1A 4COUA 3CMGA 5CA6A 1SCSA 5F37A 1S5LZ 2YUAA 2NMNA 4J7JA 3ZIAG 4HAMA 3KT4A 4Q0QA 4CDQB 2R7EB 1YFUA 2QQOA 1B04A 4P00B 4LO4B 3QLQA 4ZU7A 3JCUZ 4AAPA 4PHZA 4RUFA 2Q5TA 2W91A 1JN2P 1W8TA 1W90A 1VEWA 3WP5A 1H2NA 3CU7A 2Y6LA 2Y4UA 1RC6A 5HFLA 1QJY1 3CNAA 3AYCA 5CEHA 2PTMA 1W06A 4LH7A 1HRV1 2VZPA 4PBPA 4MSWC 1ZZ9A 5JPMB 2CDPA 5IJ9B 3GZAA 2NM1A 2JEUA 3OPWA 4XMAA 3DC6A 3IAQA 1MZEA 3FB8C 4TUYB 3RYCA 4EJRA 1CR7A 2JDHA 3BI3A 1Y74A 3OFNG 3OUHA 2GC1A 3DV8A 4BQ5A 5LMUO 1S0JA 1RINA 3T0BA 4LBEC 1OUSA 5A1FA 1E1QG 2K1EA 4CDQA 3NWKA 2HWD2 4QQOA 1VBE3 1WBFA 2R071 4F7ZA 4DV7B 1O9HA 2VMDA 3B00A 1GICA 2GDFA 3NV3A 1KJLA 1VBD2 1UU6A 3ILRA 1GN4A 3MUY1 4NXNO 3E1F1 4AI2A 2BJSA 2XNDG 1W6QB 5FXZA 4AI8A 2DCYA 2VS0A 4FTBA 1UY1A 4EFBA 4XQDA 2EJRA 1ACCA 4SBVA 3TWIA 1RVF3 4EROA 3POFA 3B40A 3AVRA 1NLSA 4W4KA 2YBSA 3KVAA 4UAPA 4AEJA 1NE6A 2Z42A 1CZVA 1PL0A 1RMU1 3VDBA 5JZGA 2NYYA 5FLIA 1GH6A 4V2WA 1THZA 1V54C 5LGTA 5JI7A 4XABA 2OW4A 2QKDA 2MHFA 2WR9A 2R16A 2ZZQA 4UF0A 3SJCC 5FBJA 4IEVA 4DQAA 2Y0OA 5FYSA 1A8MA 1FKAO 4CYDA 2D6KA 5CMUA 4L11A 3THDA 4E2SA 4IW3A 5IYZA 4XACA 4ZU4A 3SNMA 1NR7A 1MS1A 1G4YB 3SJBC 4WM8A 2ZGNA 1HV1A 4AL9A 1VBE1 4KQ7A 4P9LA 5CG8A 5CFCA 3PU8A 2PLV3 1FXVA 2VMEA 5F2WA 5F1RA 1YXBA 3H1YA 4RWUA 1PMIA 4LULA 1RUNA 5FYUA 1IGOA 1REDA 2IH3C 3POEA 3V0AB 2VTXA 3AC0A 1URFA 3HQRA 1KC8W 2D93A 3CP1A 2YPJA 3I2JA 3UT5A 2HBTA 3AZWA 4X20A 1M93A 2A1XA 4JZGA 3OM3B 1CX1A 1YQ8A 1VQ7V 3WG3A 4HN0A 4FQ4A 4MVSA 1U5ZA 3K3WA 4YVSA 4MO3M 4P9GA 4KBZA 4UWDA 1F4AA 3OMIB 2BGCA 3MI8A 3EMRA 4UFMA 1UIJA 2Q67A 4BK4A 4CVUA 3E89A 5EBMC 3WG4A 3IC9A 4GT1A 4P30A 4PJYA 5KLVH 1PK6A 1GK9A 4CC6A 1HX6A 1QR9A 1WW5A 4CDXA 4B3MB 4HXCA 3DXTA 2BQPA 4UB6Z 2UUAB 1AL0G 3LOIA 1NJIW 2FB5A 1EUUA 1HDJA 4IESA 3JUUA 3WX5A 3IMMA 4AVVA 3WD5A 4Y1YA 4A4AA 3TK1A 3VHPA 3HKBA 2EAKA 5C8CC 1FNZA 3ZR5A 1U5IA 2C6SA 2K9ZA 1NKDA 4I4TA 4HANA 3BCWA 3ZFGB 1JX9A 3PUHA 2P3KA 4CDXC 5E16A 2XQXA 3QF7A 2A06H 1D2DA 4MVUA 3BVOA 4FOYA 4QDSA 3UT5B 5JXGA 4QPGC 1LOCA 1G6UA 4NE9A 4H7MA 4FXKB 2IXKA 1UZVA 1RXGA 4MV2A 4XBNA 5ACA3 5CKNA 4ARYA 3EYPA 4PDRA 2QVSB 2Y6FA 3USUA 4NHXA 1QEXA 5K1PA 2LFSA 2IZWA 1H9WA 3T2PA 1V9U3 3F2ZA 4I5SA 5CFCB 4LR4A 5DDJ3 2QGNA 4NXMO 1DF0A 4AGRA 2QWNB 3E8GA 2Y26A 2W39A 3I59B 1HXS3 4KWKA 1K9MW 2VWKA 3G6JB 4FPKA 1EZJA 5KC5A 3EFFK 3WW4A 4LBMA 2QKAA 5JJEB 2A75A 4RUEA 2KM2A 4Q4W3 1AX1A 4X9QA 2NNUA 3STLC 2GUZA 3F7YC 3V64A 3D0JA 3S30A 4FLZA 3MHSC 1GQHA 2W1WA 1MZFA 3AG3C 4IEYA 3VKFC 1JA8A 4LBNA 3AKRA 2QCSB 2VMCA 1GSLA 4QQLA 1YHQV 4N23A 3T4HB 4I2OA 4ATEA 5EC2C 4PELA 4QWNA 4A7YA 1SQXH 3URFA 3WDYA 3CL1A 1MPXA 1UY3A 1JYNA 2Q4SA 2AYHA 2RDQA 1C4RA 2YEVA 4JI4B 5BNPC 2Q1MA 4JZ2A 3RG0A 3ZRWB 1QHDA 1AI4A 2DVAA 3ACHA 2VNGA 4MADA 3T2QA 3POWA 2ORXA 4U36A 1R1A1 3NNGA 2YIBA 2W0XA 3E2EA 3B94A 4DEVA 5LK5A 3I2OA 3PMEA 2ZS6B 1Y9GA 3H8OA 1YI7A 3VZJA 4EN7B 3PDQA 1QDOA 5IAVA 2CTVA 4A7KA 2A6XA 1GZWA 2RMU2 3I2KA 3APBA 3DSQA 5IJ9A 1OMIA 3ML0A 1UL9A 4OHWA 1XSQA 1OXCA 1XYNA 1Z78A 5JCTA 2A71A 3V0BB 3I55V 4N9IA 1YHFA 3KHBA 3MHHC 1ZAUA 4P9YA 2Q8OA 2VQFB 1QJY3 4NHYA 2P5BA 4XAEA 1VLNA 1D0GA 1MS9A 4OPHA 1E79G 3JALB 3W5NA 2ZEZA 2DV9A 4UYBA 4MVRA 1UKGA 1M4WA 1V6LA 3BTAA 1QH7A 1YO8A 2YB7A 4IHJB 1TA8A 2GH2A 3JD71 2ZHLA 4FQZA 3BOWA 5KMGA 3OD0A 4S2GA 1YQ6A 4LFCO 1D4M2 2EXJA 2WDBA 4MSVA 1V55B 1HW5A 5IWAO 5B1AC 4COWA 3UGGA 3HBZA 2XBO1 2VD7A 5L3EA 1H4GA 1TMF1 4K0KB 3RYHB 4M0HA 4ABMA 2QA4V 1L8DA 1A6CA 3WQ0A 5K1XA 1DBNA 4IYIA 2WLQA 1Q8IA 1AVMA 2Y6KA 3OTOO 4L99A 5BV6A 2NN8A 4MVMA 4EZHA 4IDZA 1C5IA 3A7QA 4TZDA 4B7KA 2AHZA 2P6JA 4OUEA 4XURA 1JYCA 4IV3A 1OVSA 1BLZA 4B08A 1ZZBA 2QZ2A 2JDZA 3ZYFA 1G9CA 1ZBE3 2ZIMA 1GO3F 2QM8A 1FPN3 3MLLA 1B3QA 2RMU1 1N34O 1OCOC 1ULGA 2ADEA 1FMD2 3CC2V 2EX3A 1OOPA 1W6PB 2VZSA 1JW6A 2WLLB 1UKRA 2GN7A 2QQKA 3UNPA 3EBRA 2QTOA 5H9PA 3POYA 3UCSC 2BSKA 2CTWA 4R8CA 4I0WB 1PNMA 1GOHA 1FATA 1NH2D 5A70A 3VBOA 2LM3A 4O65A 2GC2A 1ZRDA 1VRH2 1TAEA 2LW8A 5IVBA 2AEYA 1GV9A 2QE3A 1GWMA 1AR83 5CAZA 2Y0IA 4BIOA 3PVEA 2DURA 4P2ZA 3ZFEB 2QQNA 3RJRA 5L9RA 1UWWA 1UPSA 5FXVA 3CCMV 2RS52 2A79B 1N4CA 3NJXA 4AK3A 3W5MA 4DUWA 3SHRA 2VCCA 2WNUA 3L2HA 1UU4A 4LHNA 2WWSA 5J1XA 4Y1XA 1M56C 2YI9A 1FXZA 3HQUA 2DUOA 4YGEA 1XHZA 1WMXA 5FZ3A 5FDBA 4E4DX 5FFOC 2W2IA 4AYUA 2M6YA 3VV1A 1S55A 3JAWA 5B4XA 1LUWA 3THPA 2QJ1A 3ZMTA 4GB33 4XIKA 1VQ8V 3OEBA 2PAEA 3ZFFB 4QQPA 4YZ1A 1HJFA 1JODA 2H94A 4LEJA 3IJ4A 4PA7A 2XGXA 2P4KA 3OR6C 3JAMN 4FLUA 3UKVA 4UW6A 1W6MA 3APOA 5J2TB 4MGQA 1AX2A 4K9SA 4L2NA 2PI5A 4E4SA 3JAKB 4YHHO 2UUCO 1I3HA 4BMBA 4QM8A 5BMVB 5BNPB 1PNLA 2WWWA 2BTQA 2ARXA 2YGLA 3VQXA 1V6KA 1G86A 2D3PA 5L9BA 1RFYA 3ZMNA 2J1TA 2XLFA 2WBKA 1XYPA 1D7PM 1FOD3 2RM21 4W6XA 5FK8A 1ZTEA 5DECA 5DDJ2 1UPIA 3ZSEA 1XNDA 2XJVA 1C1FA 1LR5A 2YIAA 4TV8B 4DB5A 2CDOA 1VBA2 4MTOA 4Q5OA 1ZREA 4CEYA 2RE9A 4YM1A 2XB6C 3A0KA 4FM2A 2DUPA 4M3CF 5IUQA 2PFWA 2JDMA 3P5BA 3M8LA 3C3TA 4YXWG 5DAQA 3UETA 1W8FA 3AG7A 5DEDA 2P1BA 3HBKA 5JOXA 1S4CA 4DUVA 5K0UC 4QXCA 4UW5A 1X8EA 1J59A 1XDCA 1J84A 4A3XA 2VOXA 1OLMA 1QJX2 2ADPA 5C3QA 4DXZA 2ZGRA 3QNEA 3F5TA 2GV9A 4GX2A 2W1UA 2A6YA 4JGYA 4EN6B 1VRH3 5FY5A 3KV5A 4XTPA 2P4EA 5ABJC 5FZOB 4MZUA 5J09A 4F6RA 3FB7C 4PA4A 5C33A 2Z69A 3E8FA 5FY1A 4PA6A 4HONA 3NQHA 5J36A 1W2OA 3ES1A 1I5YA 2UXDB 3LSEA 4CP0A 2DYSB 4HPKB 5L7OC 4PA3A 4DY5A 1DQ1A 2RJLA 2ZE6A 1PK6C 1K3EA 2Y69C 4I0XA 1JZ4A 4LFBB 4BLJA 3DPRA 5BXXA 2AUYA 2IVIB 4ZPIA 2NLRA 1MQTB 1OQDA 4YVSC 4OVEA 1FFXB 3OUFA 1XNQO 3SEPA 1ST8A 4CZZA 5CFDA 1JMKC 1G9BA 5IVFA 3N9OA 4R9DA 1DQ5A 1Q5OA 2A3XA 1ULEA 2LFRA 3HKDA 2HJFC 3PTYA 3ASNB 1QXRA 3B7MA 1DU3D 1KQRA 3AP5A 4Z2WA 3BKZA 5GLZA 1XUQA 1XSRA 2BE3A 1BXHA 4U3JA 2XG3A 4B3TB 4PDLA 4W6YA 1M90W 3GCWA 4PDVA 1C5HA 4UFHA 3N7JA 3AJYA 2DUQA 5AVAA 1OT5A 4GX5A 4AAXA 5J2UA 1JHJA 4QXHA 2ZX2A 2YU2A 1MSWD 2RS32 4NAOA 1M56B 4GH4C 4E9KA 3MD0A 5I93A 5A7PA 1NVPB 4XUOA 4XJUA 1VF6C 3D6EA 4GB31 3IPVB 4FPOB 5ANNA 4NRPA 4CP1A 3JD0A 1N1SA 3N9LA 1CAVA 5CB4A 3WV6A 1U12A 3JALA 3H1JH 4PJ0Z 2DBNA 4C90A 2I45A 5JVDA 1ORQC 4K6BA 5BR8B 5KXEA 3O5SA 3LD8A 1UD1A 4CC5A 1K4DC 2CUGA 4MXWB 5T55A 4K35A 2HEVF 1XEQA 4IEWA 1V6JA 5FZ8A 2FTKA 4RQPA 4EB6B 3I97A 2O8QA 2R072 1NXMA 1WW7A 1WLWA 2RV9A 2X53S 2Q7EA 1DQ6A 1YJLA 4H7LA 1GZ9A 3VDDC 4G27B 5KXBA 4Q4Y3 3ZFGC 4XXAA 5FZEA 1IQAA 2WABA 4TWKA 2JK5C 3RYRA 3HKDB 2EALA 1RTVA 2E7QA 2E5LB 3VDCA 1H30A 1K34A 5CFDB 3D4KA 2F4VB 3IT8A 3VD5A 1IURA 3HT2A 1MABG 2EBOA 3D3QA 1MEC3 4CP9A 4BA6A 4H33A 4UOJA 5LA1A 3M8AA 1ULOA 1D5AA 3CCVV 1QOTA 1QJY2 4HNAA 4QXBA 1B06A 5FV3A 4A44A 4C1WA 4V1PA 2MK3A 5A6YA 2IFRA 2P2KA 4P9XA 1JZ2A 1QBZA 4IGOA 4IEQA 2UWBA 2A6ZA 2PQSA 4DO0A 4ZI7B 1GN6A 4DO2A 1V00A 4AQ6A 4G9SB 4FLXA 3S3XA 1SLAA 2F93B 5JVVA 4IV1C 1UZZA 4J10A 2PGGA 4DR1B 4GMP0 3MV11 1AR92 3CRCA 4JGYB 2ZGPA 1RUC3 1LNQA 2E7AA 1FT9A 1FYUA 4BAYA 2AC1A 2JD9A 3RNSA 3POIA 3JCIA 5D8AA 4UCVA 3BALA 3AEIA 2E51A 3VD9A 3RS6A 1VARA 4J9ZB 2RS51 4OHVA 4OUMA 5FLHA 4AZZA 2PAMA 4XJ9A 4OI2A 3N9PA 1GP5A 2PHWA 5E1RA 4YFWA 5E8AA 1N1TA 2JIJA 1QQP1 5JI9A 5APAA 5H5NA 1COV1 3FHAA 4DR3O 3IB3A 2B42B 2VAUA 3J7AU 2WNEA 4OI0A 4JF3A 3AVSA 4RFRB 4X65B 1OQ1A 4UFIA 4JRLA 4G28B 4FVVA 1NTZH 1CPYA 1W2NA 1QOOA 4LK7A 1S72V 3U11A 3ZKYA 4QE9A 4JKKA 1UN1A 3KF3A 4ASLA 1Q81W 2BTQB 4Q20A 1DGWX 3LE0A 4X62O 5IYDO 3HT1A 5FQ0A 5JJNB 3AMPA 4W8JA 4XQWA 5LB6A 5FNVB 4WVVA 1A34A 3I54A 3MIBA 2CNAA 5ABJB 5BUVA 4X6RB 4H3WA 1R64A 2AW9A 3HKBB 1JU4A 1GUIA 2CSGA 3JATB 1OUXA 3ON7A 1AILA 1JOBA 1NOVA 3W20A 2WT0A 5CA3A 4UW3A 4CDXB 1JYXA 4BXFA 2HVJC 3JASB 4FK5C 2UURA 2R1BA 1DLCA 2CAZC 2Z4FA 3BFRA 3ZJZA 3PUIA 4UVAA 2XHKA 5DG2A 5KHJA 1XHXA 5E6HA 2VG9A 3KT1A 4JYAO 3TNQA 2ETNA 2VQUA 4B4RA 1EPWA 2IJKA 5IK5A 1I94B 5EZYA 1OH4A 5FMCA 2F17A 3JYCA 4IL6Z 3ZFEA 4O9GA 1AR71 4L0PA 3ZN6A 5KHGA 2XVGA 2Y33A 5LMNO 1JH5A 3D82A 5L36A 1W39A 4FFGA 2A3WA 3WB2A 3T4ZA 3J7MA 4LF5B 1H38A 3UGHA 5C3PA 2F4PA 5A32B 5H6QA 3B93A 3B8NA 2IJJA 5JR2A 1W6OA 5F7UA 1N3PA 2XH6A 3F5WC 4IEXA 1EV12 4NHLA 4COVA 1CPMA 2AXTZ 2JDAA 3LFMA 4NMIA 4YW6A 1O5LA 1SG3A 5I0UA 5EPAA 1VAKA 1LCLA 2DFCA 1FYJA 1Y6XA 3D0SA 4UV9A 1LOFA 4Q0UA 4JHTA 4ZS3A 1LOGA 4CEYC 2VCAA 3ZFFC 3KD4A 3R4SA 2J1SA 3L9DA 3WINE 2DTWA 1RUG3 1JJOA 2VMIA 4D69A 1WMDA 5T50A 2PHTA 3SPHA 2WS91 5HXMA 1G8MA 1BZWA 3CMAV 1IZ3A 3FB6C 1AJQA 1OHHG 1XNKA 4XEZA 3T08A 4DMIA 3FD9A 1J1TA 1ZBE2 1O8PA 4ZZ5A 3JCZA 5GZEA 1HR0O 1BK0A 1E5IA 5A3TA 5C8YB 1EN5A 4DV0B 4LLFA 4C7UA 5JSPA 5JZGC 4P9JA 5FYCA 1OHFA 2V4DA 4FPEA 4R50A 3OTFA 3VBUC 1VBA1 4LBOA 4I50A 3R4UA 2WSUA 1PNKA 4JI7B 1R6NA 2OYQA 4OLLA 1TQ5A 3ZCCA 3AM2A 4ZZ8A 5IATA 2HWF2 3BA8A 1GMMA 3GHMA 5HXVA 3AK0A 4GWNA 3ZLIA 4E8DA 4INDA 2J42A 3VQYA 4MGKE 3AMMA 1POV1 3K51A 4MUVA 1Y4MA 3RWRD 4EYUA 1ASJ1 4XBQA 2GN3A 4TYSA 1HN0A 1OA4A 5LGNA 4YM3A 3G80A 4JX0A 1ZZ7A 3AKTA 1RUC1 4R4ZA 4TUYA 3Q8CA 2FDKA 3WHTA 2QDRA 1N36B 2D6MA 1M57C 2C1FA 2WO2A 3T1YB 4F83A 3CIHA 4UI9L 2Q7HA 5C9AB 1UX6A 2R49A 2ZBJA 4DPNA 3OJBA 1ZUQA 1AR81 1M06G 2IWGB 3NNMA 4JZRA 4KH9A 4DFSA 3ILNA 1BGYH 4TT3G 4HKLA 2GC3A 3R6SA 2ARAA 2VY0A 2KXLA 3FHIB 3WF4A 1WNSA 3CCEV 3RQ0A 3GVMA 2KQXA 1XI1A 4PIXA 4RHV3 1YIJV 3PJYA 3B02A 5HV4A 3GBFA 4JI7O 4HZFA 2WNUC 3JATA 2ZX1A 4BCUA 2QBXA 3HAGA 5FXWA 2R063 3TN92 4Q8LA 2V72A 1SKVA 3BVCA 1CEZA 4EWDA 4CCJA 3UKTA 3H01A 3X29B 5EK0A 3MO4A 5SV8A 4DRRA 1OCZC 1V9PA 2B9ZA 2KG7A 3QCWA 4LOSA 2ZD9A 2VXJA 5FL7G 3PL0A 4CS3A 4AHYA 4IIJB 5A3UA 1QJU3 2CGOA 4CXXA 2EF6A 3NJVA 3J4UH 1JJ2U 2WS93 3GF6A 2N05A 1AL23 1LUVA 1GNYA 4H13B 1KD7A 1QF3A 1TG7A 4QB1A 3JZVA 3MFAA 4GWMA 3KVBA 2UXBO 2VJXA 1OCOB 4PDWC 3I2FA 1F7YA 4ZOLB 4FLWA 1Q82W 1R082 2W68A 1ZA7A 3CEIA 3U4XA 3OUSA 2UUBB 2D6PA 4NHKA 3UO3A 3S57A 4OPAA 4PCRA 3ZXAC 2ZHKA 5F5QA 4R9CA 5E89A 3AX4A 1GWKA 1CAXA 3H1MA 2ARHA 5LBCA 3GWOA 4A7ZA 5FXXA 1JR9A 2OTJV 2D3OW 5JCOA 4JI2B 4CCCA 5EXOA 1QJZA 2WSVA 1DZTA 2HHHO 4I3GA 1WLCA 3LIHA 5D8AB 1ZLZA 1W59A 4O2BA 1OSGA 4ORFA 2WC2A 2ADQB 1BHAA 3SKJE 2CWMA 1DLLA 4FPCA 5AVPA 4FXGB 2J22A 5EWSA 5LHHA 4NVPA 4NUBA 1KKCA 2C5DA 1NZIA 5JIUA 1RUE2 2ZAAA 1Z5VA 4GAZA 4QU1A 5H6RA 2BOCC 1U0AA 3HPNA 1BKZA 2DU0A 4J1XA 5LRSA 3K75B 1V0AA 5JIAA 4N90A 1RUC2 2UY8A 1R081 1AJNA 3AG1B 2IU3A 1GNZA 4CP9B 1OZ0A 5A9GA 1S2BA 2VUDA 1SETA 2XDVA 4D6RA 4Q0SA 1VRBA 3BHPA 3KQRA 1QNWA 1Q3EA 5J9PC 2HJDA 4ARXA 3ZIWA 2ZEWA 5FJHA 2LS6A 1OH3A 2OA2A 5IHRA 2HWE1 4GMP1 1AR5A 5LBQA 3CYOA 2YI8A 4K0KO 3ETDA 4CEWA 5IFPA 5GLWA 3O65A 1UOFA 4YVSB 2HVKC 3N9NA 1IOAA 3PVBB 2UWCA 1Y76A 5K9YA 1HQNA 5I8YA 3MHZA 1JYIA 2XBO2 1L7QA 2VMGA 2JJ2G 3ZO0B 4HMZA 1HN1A 3LWCA 4BQ3A 4XDKA 1V55C 3H1LH 3KZIZ 5C5UA 1SA0B 1DIWA 1VQ5V 5CKQA 3RI8A 3V0AA 2N7GA 4AHXA 3C3VA 1MQTC 4R6ZA 1AL22 3W9AA 1Z7S1 4QGLA 5CZKA 2DTYA 3OBTA 5FLXN 1BEV2 4DV0O 3TNPB 3RYIA 2W92A 4JTNA 1VF5B 2O8OA 5IYCO 4UBGA 2C26A 4XC9A 1SQVH 4YZ2A 1US2A 5IYZB 2D40A 4TLGA 3MBWA 5C9AC 2V73A 1ULFA 2PA7A 4FP2A 1GOGA 4YW3A 1BK1A 4TSFG 2OZJA 5C4WA 1NX9A 2EXHA 2ZGQA 4BDVB 1OKQA 5C8YA 4COYA 1T2XA 4QPIB 5JLVA 4HFSA 2QE7G 3JSLA 3CHXA 5LXTA 4QKBA 3AG2B 4MTFA 1REFA 3O0XA 2HWD3 5GLTA 4NJ4A 1P84F 3MDSA 4XFGA 2QTSA 2D43A 4FP3A 3UK9A 1QXJA 3TOJA 4KMQA 3MF9A 2Q69A 3AFKA 1TGOA 3IFXA 5FPXA 1GWLA 4JYYA 5DAVA 2R9AA 1N33B 2TNFA 3AK2A 1HIXA 4QGMA 3PVOA 4DRVA 4OUSA 4QD2A 2Q1FA 3DUIA 4JTCB 4GX0A 4J1WA 4TV9A 1LU1A 1VBE2 3BABA 1XMOB 2XAGA 1O59A 1UZWA 1NQDA 3J81N 4O4JA 1AR72 4B1MA 2XOKG 1KS4A 5LEKA 4E2GA 2N74A 1C8M3 4E2QA 4Q0PA 1AI6A 5ANQA 1HNWB 2ZX4A 3JXSA 4DV3B 3KCCA 4BQ2A 5L3FA 1XJAA 4UFJA 5FZOA 1AYM1 1AJKA 1GKBA 1N1VA 4IV1A 1ROPA 5A32A 1YFXA 1IHMA 3T1MA 2RS12 2NZ9A 4AW7A 4N21A 3RYCB 1VQLV 2B5HA 5FYBA 4M3CA 3MF6A 4Y5TA 2L35A 4AQSA 1K92A 2XBO3 4ZHQA 1JQ0A 3WP4A 4CDWB 4LBJA 3SPIA 1LR1A 3RZMA 1H8TC 4IXLA 4RQFA 4SLIA 3RGBA 5KHIA 5FYMA 1IG0A 3QTCA 2ID4A 3T4DA 3CF6E 4I02A 3JBG1 3RPQA 5HCBA 1BCCH 4N53B 4HVOA 2XLAA 4RYDA 3SPGA 3AP6A 2EIGA 2ZKLA 5FPAA 2CV6A 4MYEA 4AFBA 2VWJA 1MACA 2ZE7A 4DV3O 2JKXA 4JI3B 2ZM6B 3ABZA 1OJHA 2P7TC 4AQ2A 4M4RA 2XR4A 2W94A 3B4SA 1AR62 1PZ9A 2Y60A 1VBC1 3O7OA 4BMEA 2DMXA 1L3JA 1DZRA 2RS11 1YEWA 2WQZC 4D94A 1I5PA 2RR12 4O2AA 3E5XA 4YJ2B 1N0JA 1RJ7A 4BISA 1DCSA 3N2GA 3HKEB 5JPNB 5EIBD 4FZ1A 5EFUA 2WS92 5GKAC 1NI8A 4IE7A 2LRPA 2MEV3 2ZJCA 2R9RB 3I7DA 4JQRA 4LF9O 1EN6A 2ET7A 4W65A 1K5JA 2JGDB 4KWLA 1FPN2 1AR1B 1LTEA 2NR5A 2JG8C 4Z92B 1R6KA 3J7LA 3JD3A 4NRQA 4FMTA 4GLXA 4XF0A 3STZC 4LBKA 1WB8A 4PDMA 4E8CA 2GBOA 3ITQA 4FPPA 5BNNB 4MGSA 4OGQB 1S0FA 1C57A 1KFXL 2QTWB 2B1GA 3ELNA 2VCMA 3NRUA 4K1YA 3VHRA 4DR5O 1XMOO 4ONUA 1YDXA 4JI6B 4CDQC 1DLBA 3B69A 3WF1A 2HWC1 2MPFA 5T52A 1OV9A 4DUZB 5EHDA 3USSA 5K8SA 3KSCA 2EVXA 1ZRIA 2NMOA 3T1HO 4YVWB 2WAMA 3J26N 4XIOA 3EQEA 1S76D 4IEOA 5IVJA 4ZI7A 2G19A 3I56V 2WLLA 2ZA9A 5C3RA 1SBFA 3VBHC 4P9WA 1XILA 1RVF1 3GYDA 4UCOA 2B9UA 4MGTA 3WQ7A 1RM1B 3T1LA 4H44B 4H14A 4LF7B 1Z2GA 3OMAB 2PY5A 1RHI3 5C4WC 3WG7B 1UZ0A 1MS5A 4XUQA 4K8ZA 1NE4A 1BT8A 4URTA 3HEIA 3I2HA 5A6ZA 4I7ZB 2GC0A 1KD1W 2AZ5A 4RGKA 2GMPA 2JGDA 2W6JG 4JASA 1H8HG 3SCFA 4LFBO 1HWYA 2WNOA 5I8SA 3WF2A 4FLVA 4C91A 4CE8A 4JI5B 3WQBA 4QM9A 3CXCU 2AR6A 1R3LC 1YCIA 4DV1B 1YJNV 3ZBHA 4G3YC 2VNRA 4B1LA 5IW0A 4R9BA 5E88A 2HH9A 3VBSB 2ZGKA 2AGAA 5FP8A 4Q26A 3VDDA 3OB8A 5CA1B 2BEOA 1E5RA 4DV6B 2YDEA 2VW2A 3U0ZA 5DZEA 2HEYF 1GMGA 4RQPC 4XQ4A 1BJQA 5KMGB 5T5JA 4COZA 5C8WA 4UCSA 4IHJA 3KV9A 2C9AA 3MIHA 4JPRA 1X9PA 3VKNA 5JVDB 3VBUB 3OW2U 4OHYA 1Z0HA 3KKYA 4N43C 4QX2A 1YRZA 2BBVA 3M4FA 2J1EA 2WYSA 1CD3G 1FAFA 4JAAA 4WM7C 1UAIA 1EP0A 1G7YA 5LYJB 4IEPA 4U7NA 3MPPG 2ZMLA 5BZBA 4LNVA 2BPA2 2DYRC 3AG4C 5FKCA 1U5XA 1QJX3 1POQA 2KA3A 3ZYHA 2LO1A 4DW1A 4PF5A 1SFYA 4NRMA 1U5YA 4YZ4A 2FCUA 4QGNA 5J2UB 1SFNA 3FWEA 1GN3A 1VALA 2IM9A 1FXKA 4M3CB 3VB9A 4MVZA 2WUHA 3SYAA 3CCSV 4U3JB 1X82A 1ZX3A 1XNRO 2DCZA 1Y43B 2XHBA 1TZOA 3HKCA 3H9AA 5DZGA 4BIFA 1SQBH 1EV11 5I0TA 4NO4A 2RDRA 1ND3A 4WFHA 1QLEC 4XCBA 1VMHA 3O9OA 1VP7A 3H7YA 3ME2A 3ETEA 4K8FA 4GCZA 4CH6A 1WN7A 2VZQA 4RD7A 2RVAA 3LQCA 4I0XB 5FOBB 4Q6GA 2D98A 1W9YA 3M3EA 2XWBB 3NV1A 4YG0A 2H0VA 3BCCH 3MW4A 1UYZA 1ZBE1 4BQ1A 4MGIE 3FLPA 1MMMA 3BRCA 1BEV3 5FMOS 1PIV3 2LQTA 1N32O 3ZXEA 4AHWA 2Q8CA 1W8ZA 2WLMA 3SCHA 3BPZA 4FO9A 2HWB3 2Z3YA 1ND3B 3EO6A 1J58A 4FTEA 2Z5WA 1PO13 2DVBA 3W7XA 2OXBA 4QMAA 2JIZG 5LA9A 3ACLA 2WQ8A 5L3GA 3MICA 4CUCA 4DXSA 3IMNA 1VQPV 3S6PA 3G6BA 5IK8A 5LXTB 3AFGA 4WVMA 4JGYC 3OSDA 1FXKB 3LKJA 1DGRN 3SPCA 4KG8A 3R4DB 1OVPA 2JB8A 1K97A 1YJ9V 1PHMA 2VUCA 3RFRA 1QJX1 3KHCA 2FMLA 4RGAA 5AC91 1UCXA 5LA6A 2V09A 1NTMH 1ULCA 1ENRA 3SLIA 4ZONA 3ZEDA 3IDBB 2IVJA 1UPGA 2EULA 1ZL8A 1BVVA 3USUB 3VBUA 1PGL2 1IBKB 1ZBA1 5LBEA 1AP5A 4DY3A 3HIFA 1US6A 4LQRA 3DC5A 4K40A 2ZNIA 1QU0A 1SA0A 4JAVA 1XMQO 1SRYA 4KBBA 1NCQC 4G4FA 2QQMA 4IEUA 1UMZA 1G1XB 1W2UA 5DUUA 3OUIA 2XONA 2DVGA 3CCQV 3I2DA 3VDDB 3H8XA 1VF6A 4B3MO 5IJRA 2DYRB 1CGPA 3JQXA 2X05A 3VBSA 4JI6O 1Y76B 1Q86W 4LBQA 1F2NA 3NKTA 4I4TB 1J5EO 1D4M1 1XNAA 1XU2A 2WLJA 1PM7A 3MPBA 2PUSA 5HCFA 1AXYA 1SC5B 2WQ4A 2EINB 4BOWA 3WY6A 2MW2B 3UL2A 2PYJA 1O3SA 2JE9A 1YFYA 3Q8AA 1B35A 4Z8BA 3B77A 2B1IA 5DXDA 3P3PA 1OCCB 1UY0A 3VLBB 1HRI3 1YQ5A 3KS7A 3H9VA 4NPLA 1O4YA 2DF7A 3R65A 3CXHF 3WP6A 4YZ3A 3DKQA 4GA9A 2P17A 5BNOB 4QIWF 4QX7A 3SYCA 4XF3A 2X10A 2WNUB 2RJ2A 1FXHA 2BNNA 1MNGA 2VQEB 3NKGA 3UESA 2HG5C 1CAWB 1VE0A 4AQYB 2XJTA 5FZBA 4TQDA 2K2SA 3NSTA 1LOEA 3ZRXA 2FD8A 5L3CA 3TETA 2YV8A 1RHI2 1L7RA 4NIGA 2XVKA 2Z2SB 1VBB1 1F31A 4Q4X2 1QY4A 4F8AA 2H8PC 3LEKA 4FFKA 5JMOA 1ND2C 2DCTA 5A6QA 1SEFA 5FWJA 3OY8A 4Q4W1 1H2MA 4D8MA 5LHIA 1R091 3LB9A 3AG4B 2ZE5A 3E22B 1YC61 4D3WA 2MEV2 1CIWA 2BRTA 3MW3A 4HKWA 4MW8A 4B29A 2RG4A 2YBPA 4IUGA 3HNMA 2D2CB 1W0NA 2YS8A 5FAXA 4MVQA 4HOOA 5DDJ1 4C1XA 3IDCB 4BLIA 2QQJA 2RN9A 4Z1VA 4HK9A 5F3CA 1W03A 4K3UA 3JB8A 3FHQA 2ERFA 3Q8FA 4MT8A 1K4CC 2JEXA 2UY9A 2A3YA 4JGZB 1PZ8A 1AYM3 1Y7BA 4J42A 4FFIA 5FZ0A 3EVKA 3CE2A 1RUJ1 2WO1A 2VZRA 2E6VA 3K06A 5J98B 3N2GB 1O9GA 3KB5A 2EIMB 5IFTA 1D0HA 3EHKA 4LFAB 1JU3A 4PQ9A 2YIBD 3UT0A 4FI9A 3IDEA 4LIUA 4FM1A 5CB7A 5IYYA 4OQ8A 5BNNC 2R061 3SGIA 1BZKA 2R073 1JHNA 1C8M2 4L97A 1X8MA 2YBKA 2I74A 3GJBA 4KU7A 1H6XA 1SS3A 4AVBA 5BY5A 4XDOA 4KWUA 3CSXA 3AG3B 2JIGA 3BGAA 4AE2A 1AX0A 4DR2B 4X1IA 4MVOA 4ZKIA 2VQTA 4BQWA 3W7UA 4C0BA 4ZHNA 3B01A 3M3OA 2LUWA 3ZSJA 2HBUA 3ASOB 1LGCA 4OCTA 2VO5A 2B45X 3AXEA 2YFUA 2JECA 2CWSA 2IJHA 5C5TA 1ZVFA 5LEJA 5FP3A 1F4MA 3LSUA 4BW9A 3R66A 4CXYA 3PN1A 3V0BA 3EXUA 5B1BB 3VHNA 1NXD1 2ZCEA 3D8CA 5KUKA 1HQWA 5LMUB 4PBOA 1FS0G 5C9AA 4AVCA 4CDWA 4ZHQB 3JB4C 3K08A 2KR2A 1NBMG 1CPNA 2V4AA 3ABTA 3THTA 4DV7O 3SR2C 5B3SB 4YARA 1BVP1 1DQ2A 1Q6UA 1YNAA 1RUF2 2W95A 4NTYA 5C8CB 3CJIC 4BHPA 4AI1A 3M3IA 1PIV2 4LTAA 3RN4A 3LAGA 1KDMA 3HD8B 2YC4A 4IV1B 3WHUA 4NB5A 2IU0A 3CC4V 2HWE3 1EAH1 2FMYA 1AI5A 4N53C 4NKGB 3U10A 5FMOL 1KQSU 2A9HA 1QKQA 5FK7A 5C3SA 3ORJA 1N8RW 1GNHA 4DK0A 2XJSA 3U75A 4HG6B 2ODMA 1XPWA 1UZYA 3MW2A 1DFQA 3WOGA 3J8F3 4CDWC 1EAH2 3WT3A 3C3SA 4K20A 3DN7A 4TV9B 2WINB 4H37A 4X1YB 4Y20A 3G6EV 3FLRA 4FPGA 4FFFA 1ALYA 2OCCB 3CCRV 2Q8EA 1QCEA 1BMV2 3DGTA 2SLIA 3QD6A 1Y3TA 3ZFEC 4K8XA 1XE7A 1HV0A 2LJ2A 2JDKA 2WLIB 4GKJO 4GULA 2C2AA 4Q4Y2 1BEV1 4OXSA 3JD1A 3BTZA 2FCVA 2LALA 2RM22 1PKXA 1RL3A 2LROA 1AZDA 1F23A 2JGUA 1Q7YW 4XF9A 2JD4A 1TVKA 5K0UA 3ZMOA 1YTFB 4ES8A 1ZRRA 3ZXKA 5FBZA 1RUH3 2ES3A 2EIKB 2W9XA 3I59A 2F66C 4PDWA 5CBFA 4O4HB 2CAUA 3OPZA 3MFCA 3I2IA 3HR9A 5BY1A 3K9SA 3RYIB 4I30A 1ZWIC 3LA3A 4DIQA 1JVMA 1W6OB 5KUMA 2W1QA 4FT8A 1OF3A 4KFMA 4DNYA 2QQWA 1PGL1 1SZXA 2C24A 4A6OA 4AWDA 3JD4A 3T2MA 1JS9A 1MA1A 5A7OA 1LESA 1H8TB 2X6CA 4ZBMA 4LITA 4AI3A 2X8KA 2GTAA 3L71H 2ZX3A 2VM9A 1XQ8A 3WUDA 2J1AA 4TWTA 2OT7A 1S2KA 2A6VA 3ZN5A 1PO12 3TEZA 1DK1A 4EWEA 1OKOA 2ZPXA 3RVHA 2E74B 1VMJA 1GBGA 3EJKA 5CYYA 4FPLA 2A7WA 2IW5A 4I01A 4FPJA 5L9VA 4FFBB 5EJ3A 4LHLA 2W0FC 4A2UA 2QDNA 5DUVA 4UXAA 1QLNA 4P5HA 2AH2A 4YHHB 4JDOA 1XOYA 3C90A 1LOBA 4UB8Z 5GJ6A 5DAWA 2FDGA 1E5HA 4BXSV 4Q27A 4KL1A 4QHBA 1BE3H 5IVVA 3WB1A 2WLNA 1WB7A 1WBLA 1Q43A 3W59A 5FNVA 4HYOA 1R3IC 1OLRA 3AYDA 1QDCA 1C8M1 3WW2A 4BJ0A 2XAHA 1PGW1 1O3RA 1GM7A 3RMXA 1DYKA 1QGLA 4C0HA 4JI1O 3RI9A 1HR0B 4LORA 5IJ0B 3RYPA 3AG2C 4NPRA 2WLHA 1T6GC 4BM8A 3SDLA 1TVGA 3NMBA 1VP6A 2Y4TA 4JYAB 4AOCA 2W47A 1DG6A 4XF4A 4LUKA 2FMDA 1KP2A 4JV5O 4TQFA 2CGPA 4IERA 2PLV1 1FMD1 1GLHA 5HV0A 1EBOA 2ARBA 1UU5A 3GXUA 1MS3A 2WO3A 1CIYA 5T54A 4XFBA 3CJHB 1W0OA 5ACA2 4QNHB 2XJQA 1W9FA 4QQHA 4YIPA 1VQNV 1MSDA 2UUAO 1LHWA 4Y22A 5FR3A 1ZA4A 3T4VA 1SACA 2JXAA 3LDDA 2WA4A 5LHGA 5KXDA 2UXNA 4X62B 1AYM2 1Y4WA 1TUEB 1JPXA 1PL4A 1NA1C 1K5SA 2QWQB 2XTAA 1TEIA 2CTRA 3T30A 2RS53 5I0DA 2ENRA 4CDUA 3UGFA 1UX7A 3N7KA 4QX3A 5F6KA 3A0HZ 4XILA 1XU1A 3VD4A 4Q4X1 5JOYA 4LIVA 1SZTA 3M7AA 4CA9A 3OEAA 3QACA 1W3XA 3INAA 3LSDA 1J3RA 3NR7A 1RUH1 3KCYA 3ZYPA 3CCUV 3KQ4B 5FPLA 4CXWA 1SBEA 1UOBA 3BOPA 2CGNA 2BVBA 3ZYJB 2ZHMA 4HNAB 1O6UA 2VR4A 1J3PA 1KU9A 3IKWA 4UVCA 1NCRB 3QO8A 1CONA 5F39A 1HNXO 1XMQB 4CSWA 4GKXA 3WG2A 1UY4A 2ZNJA 3SJAC 2OZ6A 5F2SA 2GNTA 5EIYB 5JQGA 2DN9A 1CAUB 1YJKA 2E7TA 2WN3A 5CG9A 4B3TO 4Y26A 5A33B 4DINB 5IVCA 3TN91 3GZEA 3H1IH 4CH3A 2OCHA 1YITV 4KG0A 1B35C 4X8AA 1Q8OA 2Q68A 3ST7A 2A3QA 3LA7A 5FREA 4GMP3 1N1YA 1P4RA 5G04L 5DPNA 2ZABA 4BWOA 1DP0A 5EV7A 5JUVA 1K3IA 5ITZA 2RMKB 5FPUA 3A0BZ 5TISZ 4EB6A 5JWPA 1T6BX 1H2SB 5K7PA 3JD73 3LFIA 4FVMA 4QPGB 2E3CA 2VMHA 4G2KA 2E63A 1F51A 2Q6AA 2IH1C 3OGJA 3UQ8A 1LODA 1SF9A 2J1UA 1EUTA 1RUF1 5FP7A 4YGCA 3K46A 5A7WA 1W9SA 2FKXA 4QX0A 2ZXWC 4BQYA 3AL6A 1Y9MA 5SV5A 4AI0A 5FY4A 2EJ7A 1HNXB 2VXRA 4J7ZA 3SXWA 1I0HA 4S2HA 2PELA 5IDJA 5FWEA 4Y3OA 1O91A 2D6NA 1PMHX 1ZZ6A 5CVRA 3IIAA 4H0LB 2YGMA 2P5OA 3N7LA 3OE7G 3CCJV 5GZGA 4I50B 3CWBH 3K5OA 4DR7O 1LHUA 2WAOA 4DR5B 2WZR3 4MTGA 4IE5A 2HP8A 4LA3A 1ZX5A 4WV8A 3S7EA 2K0GA 5B66Z 3GBWA 1I9RA 4QKNA 3NV4A 2F6BA 3VOUA 3BB6A 3VZNA 5T5LA 1BQPA 4JQTA 1V54B 1GQGA 2PXJA 1SLTA 1YI9A 2VULA 3C7GA 5A33A 3GZUC 2OTLV 4QPJA 4O4LA 2GZWA 3CBNA 3VBRA 4GD4A 2ZGMA 3ZDSA 3MEPA 4FZ0A 1WKYA 1RUG1 4I0BA 4BW5A 4IEZA 1WCKA 3AZYA 4LF9B 3HVDA 4BIUA 3T0AA 5EBWC 3NW4A 5LBFA 2WZEA 4I9QA 1TUBB 3H1KH 4QQ2A 5IK4A 1S0VA 4LNUB 1NT2B 2WFF1 2RDCA 3ZYGA 1BYHA 1UMHA 3I4IA 1QJU2 2B7YA 4J9YB 1V6IA 3BUCA 1AYN1 3A23A 3THCA 5JMCA 1NLQA 2HWE2 1JXNA 5EJZB 3PVNA 2L9LA 2Y38A 3CPWU 3FKSG 3SYPA 1VQ9V 2R0FA 2HLEA 4CDUB 5FYYA 2B5UA 5GZCA 5HBAA 2HR3A 1IBLB 5JXJA 5A1AA 4BIZA 4CCKA 3SH3A 3ZR6A 3D5OA 2QNKA 2H6CA 2YFZA 3IWZA 4DV6O 3CDZB 1LECA 1G9FA 3VL8A 2F43G 4DR3B 1QU7A 2G9FA 2WJSA 5JR7B 3VN4A 3P30A 3TXQA 4M3CE 1GN2A 3BTXA 1S77D 3H3ZA 3KWVA 3P1IA 4HETA 1NY71 1DF5A 1URXA 1FV2A 2IXLA 1QJEA 4YSFA 1K7DA 5FYTA 2VCBA 2VNVA 1QQCA 2W87A 2BGOA 5HFMA 2RM23 2XJUA 3JASA 3HQXA 3AYEA 1DTOA 2JDUA 2XKPA 4IL7A 3QH7A 1W6NB 3CJXA 3RSJA 2W5FA 4PLOA 4OMCA 3MYXA 1N34B 2R32A 1WCQA 3Q8BA 4NOTA 2YHJA 4NAMA 1N47A 2YXSA 4KWJA 2FZ2A 2Q0OC 2GSMB 3H7JA 1BQZA 5C3OA 5KX5A 1SQQH 1JUIA 3A22A 4HL0A 1XNCA 2PAKA 5BMVA 5A2QN 3JAKA 3K4DA 3O1UA 1OLME 1AP6A 1QOSA 5JDBA 4M4PA 2ZZJA 4PD4F 2ZCWA 5FQ0B 4CU7A 2WT2A 1UYPA 4ISRA 2Y6JA 1OCRC 1T5EA 4GJYA 4WVZA 4J7KA 4AFDA 2QKCA 2VE1A 1OQEA 1V6OA 2X6AA 3TEXA 4RA0A 1CJDA 3E6CC 4W4LA 2E32A 2VH9A 3TRSB 1W6NA 4CUBA 4HSLA 4ET7A 2BTVC 4B8EA 2BFUL 3K57A 2HWF1 2VZTA 3KG2A 4QPYA 4CUAA 3MGUA 5GM0A 3E97A 3S0MA 3POSA 1LJ7A 1JYTA 2DCJA 1DYPA 4YG6A 3OGVA 3DGEA 4GKYA 1HNWO 3LOBA 3DF0A 2JEMA 2E75B 5LMNB 1YQ2A 4J41A 4YY3B 2OIIA 3B8MA 3ACGA 2O1QA 4PI0A 3ZHTA 3W7SA 2R72A 3AMQA 1COV2 3WDVA 1IQDC 1XQNA 5GTHZ 4Q4V1 1JFFB 3ZPYA 4GIQA 1WCDJ 1NU1H 5EBLC 4RAIA 4CCEA 2IBZH 3ETPA 1AR63 1VQKV 1RSOA 1O7FA 5EYXA 1QVFU 3F7VC 2JICA 1WP7A 2QDOA 3KLSA 2J1VA 1BS3A 2XT9A 3ASOC 2GTSA 4FJCC 2BSKB 2VOKA 1SCRA 1GM9A 4O4HA 4FPFA 1LKNA 3RZLA 1RM1C 1GTOA 1O4ZA 5FYVA 1HP8A 4K1ZA 1XNQB 1EFRG 5CNAA 4IGPA 3RVYA 3BIWE 1JZ5A 1TVKB 5K0UB 2HYXA 3ASNC 2JX9A 1D4VB 1NG0A 4OHZA 5LA2A 3FAVA 3ENRA 4M01A 1UW8A 1Y9QA 4XFCA 3DXUA 4F4LA 4CBCA 1Q8QA 4QKFA 1W9WA 1C1LA 4QX8A 2EIKC 1DGLA 3AKPA 3ZHRA 4CTEA 3RYFB 1DZQA 2VOWA 4XJZA 2WNVC 1CWPA 4HBNA 1K5MA 3H1HH 1NCQA 4X66B 4N43B 2DFBA 2E76B 1F5FA 1PVXA 5A7SA 2D5FA 1IKPA 3ZXJA 1NZ6A 3PNAA 1BBT1 2AZ2A 3K9AA 4FBFA 2QR4A 1WCUA 3O1PA 1IS4A 3C2UA 5EIBC 2VZ1A 1OPOA 4RQPB 3RYHA 2B4KA 4XPVA 2ZHNA 2RR11 5AFEA 2IXCA 3NAPA 4Q4Y1 5L3BA 3JQWA 2WZ8A 1V70A 5BR8O 2P6CA 2JG9B 4GALA 2YC2A 3RJ2X 1RUE1 1DGWA 1US3A 5A3MA 2VBBA 4CPBD 4EEQA 4X1KB 4PF1A 4YW7A 1HRV2 1ASJ3 3BYWA 1ZM1A 2Y34A 3VBFB 4YFZA 5JH7B 3ALQA 5C8CA 1SLIA 2DU1A 3RZZA 3ECQA 4MX3A 4NIHA 3I3BA 4U7OA 3S3WA 2PHDA 2A70A 4B4QA 3NO8A 2DCKA 3ICXA 2VUAA 2Y8KA 1SPPA 1OA2A 1SMVA 4JI0B 2GMEA 4ZIBA 2YXYA 1NUKA 4LWSB 2P37A 1SZBA 2E5LO 4XFIA 1PM4A 5ITZB 1COV3 2LP7A 1TNFA 2A5ZA 4CH4A 3ASIA 3CRAA 3RWKX 1GZWB 2VMFA 4QT6A 5DN6G 4OHXA 1GM8A 1XRUA 1RUI1 5GLUA 5L7OB 2JRIA 3QG5A 2V7QG 3ES4A 5B2GB 4W50A 1H2GA 5D5PA 3NL1A 3KV6A 4WM7A 3TCUA 4JI8B 1MQTA 4BQ4A 2IXJA 1SLCA 2BNOA 1H8VA 2JE7A 4LO6B 3N2KB 2WFF3 4AEDC 3DPRB 1NCRA 1RPOA 3OR7C 3HOBA 5FZ7A 2YEVB 4X64O 2GNBA 2VQFO 3O1SA 1H1AA 3DEMA 4HPKA 4DRXA 1U96A 1SDDB 2WN2A 2JKBA 3ZYIB 1ZBA3 2RJZA 3MUZ1 5CFDC 4AFAA 4OULA 5H9SA 3GBGA 2UUBO 4LMFA 2VW1A 4DV1O 5CBHA 1H4HA 3I5DA 1MEC2 4JGZA 3BPSA 5A7QA 2V1DA 3JD2A 1QQP3 1M57B 5CA0A 1W8OA 1X9TA 3K5LA 4LKEA 1IPSA 3W7WA 1K12A 4O7XA 2B46X 3RVZA 1M4UA 1ENXA 3V56A 5HPOA 3OUJA 3CEWA 1UMIA 3CKHA 3AKQA 1NAEA 1Q8VA 2OUJA 3VBBA 2FDJA 3PIJA 2G9GA 1PX4A 1Q6HA 1SLBA 3OAAG 2HHHB 4PQQA 2V5YA 2XL7A 1SDWA 2X0LA 3H50A 5GLVA 2D6LX 3MLKA 3OGSA 1VQOV 3VKLA 4Q2FA 1SESA 4TOIA 3HR0A 3ATGA 4WBBA 3N36A 1EY2A 4UVBA 3ZX7A 4X64B 1LHNA 1RVF2 1JI6A 2V4VA 4CEWC 1QJU1 4NYKA 4JRAA 1ASJ2 1WA8A 4UCRA 4KGGA 2CHHA 3DYOA 1WWYA 1HXS1 4D6SA 3AZVA 3SYOA 4BZ4A 5GZFA 1S0DA 4R52A 3UJOA 1AR93 4P14A 4A5UB 5JXIA 4P9PA 1QJFA 4JYCA 1KKDA 1XE8A 2WFPA 3LSSA 5EP9A 5J3UA 2ZEYA 3BN6A 4DUYO 1MEC1 2HWB2 5FO9B 4CU6A 4MHUA 5FZGA 4Y33A 4HT1T 3OYWA 2JDIG 2P67A 3PU3A 2QJVA 1K42A 5LGUA 3ZFGA 4I55A 5BNOA 1YIFA 5DAXA 2X5IA 2EA7A 2OYZA 5CFCC 4RS5B 4LFAO 2Q1ZB 3V65A 1PMJX 1VR3A 4E4EA 5FO7B 3KM5A 2DW4A 2IXIA 2PLV2 4DV4O 3ZS8C 2P90A 5KAFZ 2QWRB 3G4SV 1NQJA 1F35A 1MR5A 4XJAA 4L8QA 1GZCA 2JVDA 1OFSA 5F3GA 1PK6B 3ZMVA 2WYFA 3ZXDA 3B9IA 1WP8A 3WNNA 4LE3A 4I55B 1AR91 3G71V 1DQ4A 4UXNA 4CU8A 3IIIA 5FZIA 1CQ9A 1PNFA 4K21A 1JBCA 1ZBA2 2ZDIC 4GX1A 5LY1A 2UXXA 2WLPA 3AP9A 2Y64A 1R093 1STMA 1HB4A 5FRAA 3FBMA 3P6BA 4GKKB 1RUD3 1S5HC 1OF4A 4Y5Z0 3NJZA 2UU9B 4QPWA 2B8MA 3PUSA 1WA8B 5IY5C 1UO9A 1I08A 2BDRA 2BWCA 1XREA 5KA6A 2ZMNA 5A3OA 4A41A 4RL7A 1DGSA 1YZBA 1GQPA 4EZ4A 4IQPA 4HKOA 1GANA 2JS3A 2ET1A 1MG1A 3U1XA 4P08A 4L9BA 4CCLA 1QNMA 4GWJA 4LF6O 2GNDA 4YYOA 3DPRC 2JB4A 3ZYBA 3RWNA 2FCTA 3MV01 1MVQA 5BNQA 3S7IA 1GP4A 5C70A 3OEHG 3N9MA 1KBHA 1B09A 3ZXLA 1ZRCA 2Y6GA 1FI2A 3ABLB 4Y4RA 2PYTA 3VQWA 5BNOC 1M1KW 1ZSPA 2BUKA 4KI5M 3CO2A 4QDRA 5JZGB 1AROP 2KSDA 1IDSA 3Q4HA 2J7MA 1SFPA 2WKKA 4IE6A 3SEEA 3FFZA 5FIXA 3L74H 1J5EB 2RS31 2N04A 3RRDA 3ZHUA 3K04A 1S2EA 4H55A 4X1YA 3OBAA 4XHBA 1NCRC 3OBZA 5AC92 3AJZA 3ZSMA 3C7FA 2H6BA 3TYJA 2EXKA 1AXZA 5FOJB 1QR8A 2VTXJ 2WSSG 2VUJA 2YUEA 1EZVH 2ZEXA 4RFT0 1VPHA 3N2KA 4LOTA 3E6DA 3POBA 3PUAA 1BL8A 2XJPA 4ISQA 3E86A 4DUXA 2V5DA 2A0LA 2YXHA 5HI0A 1RUI3 5L7OA 4WFAV 5FPRA 4YVWC 5I91A 5B1OA 4URAA 2UXDO 4LT5A 2ZKOA 1D4M3 5FCCA 4QPKA 3K0DA 5G05L 1RUOA 1UOGA 5FTTC 4Q4V2 3R0RA 1CZTA 3IZOA 2R0HA 1XYOA 4DK1A 1MZ6A 3APQA 4HVRA 2F4VO 2QQPA 1FOD2 4LWSA 2EIBA 3SH5A 1IX9A 5A6XA 3AG1C 5FZ4A 1CP9A 4XMIA 2RCVA 4OI1A 4JYBA 2XOMA 2UWAA 1G9DA 1AUYA 1KEXA 4YY3O 1IVSA 2VBPA 3AMHA 3C7HA 3ZOIA 4I9WA 3UV9A 2OX0A 3VBFA 2XQRA 5IVYA 3T09A 4YW1A 2RDSA 4AHZA 1WD4A 3WLUA 3K79A 3DL3A 1HDKA 3OGIB 3FJSA 1XE0A 1XXNA 4UCUA 4NPMA 1RP3B 2OWOA 1XNBA 2NLJC 5A80A 4FLTA 3N9QA 4X6QB 1WLEA 5CBLA 3ZHVA 2YY1A 4CS4A 1QVGU 4DR6B 4E2LA 4KP4A 2VW0A 2CH7A 2OCCC 2B9VA 1ZNPA 2UU8A 3IDAA 4NXNB 5K4LA 1A8DA 3L9JT 4XDLA 1LRHA 4YJ3A 2C9KA 3FZ3A 3CX5F 2PN5A 4N43A 4AILC 1K5MB 2DOSA 2P22C 1N0NA 3RYFA 1HRI2 3CB2A 2ORZA 3WEZA 3U07A 4OX9B 3JARA 3F95A 1OURA 2LW7A 4X89A 4CPBA 1BSMA 3MZHA 3FX3A 1BCXA 1RGSA 2GU9A 3FX7A 5JCOC 2BU9A 3WCSA 5T3NA 2IC1A 4RHV2 4QKDA 2QQLA 2BYVE 4NR1A 1J1LA 4RS5C 3GB7C 3WP3A 2ARCA 1IXMA 3BODA 4WFGA 5JAXA 2CK3G 1VQMV 5J37A 5A1LA 3HN1A 1YFWA 2EIEA 1TE1B 1KJRA 2AACA 2R062 2XAFA 3E22A 3IC7A 4K3AA 1RB8G 5FP9A 2WRAA 2ZR3A 3SPJA 1POV3 3QH6A 4UCTA 4DUZO 2IUWA 3K4ZA 5KWRA 5D5QA 1JZ6A 4MH0E 4W6WA 3J80N 4YVWA 3ACFA 3T1HB 1PVC3 1FAYA 5J7MA 4E27A 1SERA 3NAPC 5B4NA 5C71A 5H9RA 2JS5A 4XYXA 4IE0A 5A3LA 4D0QA 4F3JA 4XETA 2QQVA 5LASA 5JOWA 2DDUA 1GZTA 1IXBA 4XBFA 1XNTA 4OX9O 1FPOA 2ZR2A 1S0EA 2ZGSA 2Z5UA 2EAAA 1OD5A 3WCRA 1HRI1 4LE4A 2ATKC 3B2EE 1UNBA 4UV8A 1PGW2 5CISA 2BOIA 3J9SA 4JGSA 1VJ2A 2IJIA 1QQP2 2QQIA 1FMD3 4DXTA 4FPHA 5IT6A 1H2LA 3W21A 1BHBA 1YQCA 2F4LA 4UFZA 3IM0A 3CD6V 2W46A 5BPXA 1I5XA 2O0OA 5C93A 4GYCB 1I94O 3HMYA 3N7MA 3VBOC 3GWKC 1RUE3 1R092 2WAAA 3O0VA 1LNSA 1B35B 1ULPA 1XOUA 4Y1UA 3K59A 5ISLA 1IG3A 3AK3A 4DR2O 2YMZA 3KGZA 2OT5A 3GALA 1IKQA 4LBQB 4LR3A 1EPZA 2R1DA 3LDRA 2P6HA 4A3ZA 2XUEA 4BK5A 1R3JC 1TMF3 2C4XA 4PV1B 4M0NA 4RQEA 3HN3A 1DGRA 1W2AX 1WPBA 1KS5A 5KX5B 4GH4B 1PO22 1EAH3 1SQFA 5JSOA 4X20B 1ENSA 2Q30A 3MIFA 5D21A 1AJPA 1R1ZA 4MXVA 1GFF2 3E83A 1Z7S3 1CZSA 1YF2A 4QXKA 2KKWA 3X2QC 3T2OA 5FZ1A 1D5NA 1F15A 3LPFA 2PQQA 4DR6O 1ZL8B 3PURA 1W2BU 2UUCB 1SQGA 1PX3A 3QVNA 2CDYA 2OKXA 1OFNA 1AB3A 4C8DA 4CDUC 4QU2A 2PZSA 3AK1A 4B3RO 3FC0A 1S5JA 4DZGA 4IGQA 4EN0A 3PTRB 4WM8B 3T0DA 2R042 5L3DA 1PVC1 5LOVA 3C8XA 3E5QA 2YZ4A 1IBLO 2DYSC 1RUF3 1W05A 3WG1A 1MZ5A 4DR7B 4UF0B 2P34A 1N33O 1U97A 1PM9A 3MIEA 4LPLA 1YVWA 4Y24A 3TGUH 1W3VA 4QE7A 4BPZA 4RN5A 4XUNA 5JXHA 1VIWB 1C8NA 1A78A 1LGNA 2PHLA 3L73H 5FY8A 1VBA3 4KUMA 4LBQD 1N32B 1L1FA 2XVLA 2WA3A 1GAXA 4O4JB 1FNYA 3A4UA 4BYYA 4LNUA 4B3RB 3NNFA 4UFKA 3N3HA 3HJRA 4MTXA 2W08A 2ZGOA 4KGQA 1YUDA 2NP0A 2ZKNA 2VC9A 5AFBA 3SC7X 1HKDA 4WM7B 2EICA 4Q0VA 4O4LB 1VBD1 4O9EA 1ND2A 3RZHA 2BFUS 2ZX0A 3HKCB 3ZIXA 1C3HA 1RIRA 2GMMA 1HB2A 2Z0AA 2QUOA 5KXCA 1Y74B 3NNJA 4XJ8A 5FYHA 2BWAA 3PLQA 4CCNA 2VVEA 4Z07A 1QHTA 3K48A 3H8UA 4JI1B 4AFMA 1X59A 1LAJA 3IBMA 2ZE8A 2DJVA 1REEA 3ZN0A 2EXIA
chains in the Genus database with same CATH topology
1FMD1 1GLHA 4MGKE 3AMMA 1POV1 3K51A 4MUVA 1BBT2 1ASJ1 4XBQA 2GN3A 2ARBA 4TYSA 1AR82 1UU5A 4RSUA 1OA4A 2VPVA 1MS3A 4YM3A 1ZZ7A 5T54A 4XFBA 3AKTA 3KCXA 1RUC1 3VBOB 2AREA 1W0OA 4R4ZA 5ACA2 2XJQA 4TLFA 4QQHA 3WHTA 2QDRA 3WR0A 2QFEA 2ZGLA 2D6MA 4WZCA 2C1FA 1CJPA 1OTJA 4R9AA 1LHWA 4M2FA 4Y22A 4NHMA 1ZA4A 4JV4A 3BU7A 4XJWA 3WDUA 4F83A 1SACA 2JXAA 2WA4A 1NYWA 2BNMA 5C9AB 5KXDA 2HEWF 1UX6A 2R49A 2ZBJA 4DPNA 3OJBA 1AR81 5AC93 1M06G 2IWGB 4OI4A 1IS3A 2HWC3 4KH9A 2HWF3 1W6PA 4DFSA 1AYM2 1OOPB 1NX8A 5H9QA 3H1WA 3ILNA 2JG9A 1NA1C 1TEIA 5BNNA 3ZVXA 4S2FA 2RS53 4HKLA 2CY6A 2ENRA 2GC3A 2R043 4CDUA 3R6SA 2VY0A 2KXLA 3FHIB 4XFAA 3RQ0A 3N7KA 5F6KA 4UBHA 3WXPA 4Q29A 3KMHA 4XILA 4PIXA 1XU1A 3E6BA 3SCGA 4Q4X1 4RHV3 5JOYA 1QH6A 4GH4A 3PJYA 4YM2A 3M7AA 2GSYA 3B02A 3GBFA 3NV2A 4HZFA 3QACA 3INAA 3LSDA 1J3RA 2D5HA 4JDNA 2WNUC 3LGRA 4QX5A 3AB0A 1O3TA 4BCUA 2ZX1A 1RUH1 2XL9A 4AVAA 3KCYA 2A7AA 3HAGA 3ZYPA 3JU9A 1APNA 2R063 1SBEA 3BOPA 2CGNA 3TN92 2BVBA 3ZYJB 2ZHMA 4FOQA 4Q8LA 4CEWB 1EV13 4KNCA 4TSVA 1J3PA 2D6OX 3IKWA 1NCRB 1CONA 1NLRA 4FOVA 1VBC2 4EWDA 4GKXA 3WG2A 4LLOA 3ZYRA 3UKTA 1UF2C 3X29B 2OZ6A 4X8NA 3SISA 1CAUA 1OLQA 2GNMA 4I3PA 5SV8A 2IFWA 2GNTA 1H2KA 4DRRA 1NA1B 4X8PA 4YRDA 1ZRFA 1YJKA 1CAUB 2E7TA 5CG9A 4XTMA 3QCWA 4Y26A 5A33B 2XWJB 3N4MA 4DINB 2WNVA 4XFFA 3HWJA 3TN91 4AHYA 1QJU3 1W6QA 2MNGA 4KG0A 4E4ZA 2HWD1 3M2MA 2CGOA 1B35C 2ZGUA 1Q8OA 2EF6A 3ST7A 4EN9B 3J4UH 1YYNA 3ETQA 4JTOA 3LA7A 5FREA 4GMP3 2WS93 1N3QA 1N1YA 3GF6A 4WVWA 4AVSA 5J92A 1AL23 4MLOA 3WZ1A 4COUA 1KD7A 1QF3A 5LRRA 5CA6A 1SCSA 4EN8B 3JZVA 3MFAA 4GWMA 4BWOA 2ZABA 2NMNA 5CU1A 5EV7A 2WZPP 5TSWA 3M3QA 4XHXA 4PDWC 3KT4A 1WMFA 4Q0QA 4CDQB 1R082 3MDPA 1YFUA 2W68A 1WCSA 4WM8C 4AEDA 1NX4A 3U4XA 1JR7A 1LU2A 2D6PA 4LO4B 3QLQA 4NHKA 4ZU7A 4PCRA 5JWPA 3R1JA 1LEMA 5K7PA 3KT7A 3JD73 2Q5TA 2ZHKA 3ZXAC 1JN2P 5F5QA 4QPGB 4R9CA 2JG8B 2VMHA 5E89A 3AX4A 2E63A 4D7SA 1CAXA 2A6WA 3VBHA 1V9U1 3H1MA 5BYNA 4NN0A 4PLNA 3VBRC 3OGJA 4A7ZA 3WP5A 1LODA 1H2NA 3CU7A 1RUF1 1RC6A 1QJY1 4YGCA 3CNAA 3AYCA 2PTMA 4DOUA 1HRV1 4PBPA 3QBQA 1ZZ9A 5SV5A 1S0BA 4AI0A 2Q0AA 5JPMB 5EXOA 1Q8PA 1QJZA 2WSVA 1DZTA 4AF9A 2VXRA 3GZAA 4I3GA 3SXWA 1LOAA 1WLCA 4Q1RA 4S2HA 2NM1A 2PELA 5D8AB 4AEDB 4XMAA 3V17A 1O91A 2D6NA 2I2SA 1OIKA 5LK7B 1MZEA 1OSGA 1ZZ6A 4ORFA 3IIAA 5CVRA 5CADA 4EJRA 2WC2A 2YGMA 2CWMA 3N7LA 1CAXB 1CR7A