2Y0IA

Factor inhibiting hif-1 alpha in complex with tankyrase-2 (tnks2) fragment peptide (21-mer)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
339
structure length
339
Chain Sequence
SGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Factor-inhibiting hypoxia-inducible factor (FIH) catalyses the post-translational hydroxylation of histidinyl residues within ankyrin repeat domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
total genus 102
structure length 339
sequence length 339
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2y0iA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2y0iA01
1H2NA 2WA4A 3P3NA 3D8CA 1MZFA 2CGOA 2W0XA 3OD4A 3KCXA 4NR1A 4Z2WA 4B7KA 1YCIA 4JAAA 4AI8A 2Y0IA 3KCYA 1IZ3A 1H2KA 2XUMA 4Z1VA 2ILMA 4B7EA 2CGNA 1H2MA 2YC0A 3P3PA 2YDEA 1MZEA 1H2LA 4QU2A 5JWPA 4BIOA 2WA3A
chains in the Genus database with same CATH superfamily
5F6KA 3FZ3A 1Y76B 1RVF2 5KHIA 5IT6A 4RAIA 5FV3A 1RUH2 2N7GA 5FMOL 4N90A 2NP0A 3SLIA 5DAXA 1AR61 1YFYA 3E97A 4O61A 1HNZO 2BNNA 3J9SA 5LY1A 5JUVA 2ZGNA 3AL5A 4HG6B 3CZJA 1A8DA 3OPWA 1NYWA 2DFBA 1DIWA 3DC6A 5A80A 2F17A 1FKAO 1CAUA 4L97A 4XF3A 4GX2A 3K58A 1LENA 1UU5A 2WT2A 4I3PA 3KGLA 2Q8DA 1G8MA 3EBRA 1JZ8A 4FOWA 5JVVA 2WYSA 4JTOA 3T1CA 1S0CA 3JD71 4GULA 4Q0UA 4FXGB 1OVPA 1LB2A 2XR4A 1VB4A 2RR11 4FVMA 2Y6FA 3VKOA 4YW6A 2YDEA 3KWVA 4BA6A 1H2LA 1TG7A 4B3SO 3UKTA 4LF6B 3M7AA 5E6HA 1C8NA 1KQRA 2MEV1 3AKQA 4QKDA 4RA0A 1S4CA 1K92A 2OYQA 1RC6A 4AZZA 2WLLA 2W1SA 4GWMA 5FZEA 2BTQB 4LF9B 1UIKA 4AEMA 4XF9A 4Q6GA 2O57A 3PHMA 5BR8O 1VF6A 3T1HB 1R083 1OCZC 1QNWA 3GVMA 1M93A 2EBOA 2WZ8A 5FY0A 3KQRA 4PDMA 1AL22 2ZE6A 2RJKA 4J80A 4PT6A 3MF9A 2HH9A 5BY5A 1GZTA 3ZJZA 1ZVFA 3LDEA 2V73A 4F6RB 2Y64A 3CJIB 1DYPA 2Z0AA 2JG9A 4IIJB 2CTVA 1UU6A 1AB3A 1KRIA 4YRDA 2RDRA 1DQ4A 3R6SA 4YZ3A 4J7KA 1C28A 1F4AA 2K9ZA 4O9EA 4O7XA 1FJGB 1QF3A 5AVAA 1N34O 5DG2A 2WLPA 1OCZB 3CJHB 1QH7A 3K0GA 4GH4C 3UO3A 3DC5A 1VBE3 3WP3A 4XCAA 4TQFA 5B1AC 3JASB 1F23A 3LDBA 3IM0A 1U12A 4NXNB 4RFRB 5FZ7A 1ENVA 4ES8A 4GB32 3CB2A 3VDBA 3LEMA 4HSJA 2YROA 1NVPB 3KZIZ 2X6BA 3NAPA 1N0NA 2P3YA 5A3MA 5K8SA 1SLIA 3EFFK 2YBPA 4H37A 4GX0A 4LH6A 4ZHNA 2EX3A 3HBKA 5E1RA 4BISA 3AFGA 5LGTA 1VMFA 1JODA 1C3HA 3VQVA 3P30A 1HRI2 3E35A 2Q69A 4FO9A 4LO6B 4WBNA 2VW2A 4CUAA 3S3WA 2GSMB 3ZXFA 5IVYA 1Y66A 3T2MA 3RJ2X 3ELNA 5C7GA 3JARA 2ZHLA 5F32A 1F8VA 4X65B 4D8MA 1JFFA 4DXRA 1ND2C 2CTWA 1IBKB 4PBOA 2WFF3 1Y9QA 1OXCA 1ND3C 2UY8A 1O8PA 2XJQA 4H2AA 1V9PA 1VBC1 5FXXA 3A0HZ 1XJAA 4GYCB 2YEVB 3RYIB 4CPBD 1YHFA 4EFEA 2C1FA 4MVTA 1QQCA 4K8XA 4QHOA 4X1KA 1R092 3U78A 1MS5A 1QQP3 5C3QA 4LF8O 4O2BA 3B40A 1WA8A 4IL6Z 4AWDA 1ZBE1 1DLBA 1GICA 1BEV2 4EYUA 3ROUA 4JV5O 5LA6A 4FMTA 4JGZC 3CPWU 5GKAC 1NLSA 1JZ4A 3DUIA 1Q86W 1X4TA 5GLWA 2QZ3A 1VRH3 1FOD3 1CJDA 5FYTA 2BZDA 3M1HA 1OCOC 1PGSA 3PUSA 5FYBA 4KU7A 1FXHA 2R0HA 3M3EA 3SPHA 3FB8C 1LU1A 4Q4X1 1LU2A 3STLC 4M01A 3NJVA 4BZ4A 4FLVA 5D8AC 2CDOA 4QNHB 1YC61 3NNGA 1MZEA 2RMU1 3AKRA 2Y6JA 5J2TA 2ARBA 5B1BC 4MVUA 1HV0A 1WBFA 4YZ2A 1NQTA 1W9SA 3N9OA 5FP4A 1NQDA 2JK5C 4Z8BA 2CL2A 1V6LA 4AQTA 3B94A 1J3RA 4IV3C 4NJ4A 4TOIA 3PVEA 3U4SA 5KR7A 2DCJA 1MR5A 3O0XA 4FQ4A 5K0UB 3D3QA 2NLRA 3WDUA 4DZGA 4X88A 1ORQC 2WLHA 5BR8B 2VZVA 2WWJA 5B66Z 1W2UA 3K4DA 1BQZA 2ZBJA 3CJXA 1K8AW 4BH9A 4JYCA 4FJCC 1A78A 3BPZA 5ACA1 1DZTA 4B3MO 1ST8A 4DUVA 3ETDA 4P2ZA 3ACLA 3I3EA 2WSVA 2VW0A 5IVVA 4K20A 4DUXA 2QFEA 3K59A 2BBVA 4X1KB 4E4SA 4FTSA 1WD4A 5FTTC 1GM7A 1KJRA 5FYUA 3T2PA 3VBOA 4NAOA 2YPDA 4U7NA 3USUB 3FBYA 1E79G 2RJZA 2XVLA 2UUCO 4LFCO 3PMEA 4Q0PA 4CDXB 1VRBA 3NJYA 5L73A 5L3EA 4CCOA 5H5NA 2WNUA 3N36A 3MUY1 2ZEYA 1EUUA 4OULA 2I74A 2ZGRA 5CNAA 3E6CC 2YG0A 4CCLA 2ZMNA 1UOJA 5EQUA 3GJAA 1EY2A 4HPKA 3HOBA 3DYPA 3UO2A 3ES1A 4Q4V1 2Q7EA 3A8TA 3WNMA 4BK5A 4ISQA 4PDLA 1UOBA 3NXSA 4N43C 1UYYA 5LMNO 4IE7A 2PA7A 1RVF1 4LE4A 4Q5OA 3RZHA 5J7MA 1H2NA 2ZQMA 4AQYB 4TWTA 4DRXB 1GQHA 3WG4A 2JWPA 1Q8IA 2LALA 3THCA 5EHDA 2EIJB 1ROPA 1VIBA 2IXJA 2OPKA 4EZ4A 4E2GA 4DR6B 1EV13 2ZXWB 5C4WB 4F83A 3OT7A 3TAYA 2X0LA 4CC6A 2ET7A 1XMQO 1LJ7A 1C57A 1XNQO 3WB1A 3VBUB 4MGIE 2EXKA 4DUWA 5J2UA 2ORXA 4PA6A 4GD4A 4TYSA 3FKSG 1AYN3 2CTRA 5F2SA 3VBSC 4LIUA 4OCTA 4QQHA 1G9AA 3JALA 2J42A 4MHUA 3J8F3 1WW6A 3B09A 4CEWB 1OFNA 4C7UA 1YDXA 3ZVXA 2VH9A 1OJHA 5C71A 5T5OA 3GB7C 4Y5SA 4R8CA 1R3IC 1C1LA 5FZKA 1K4DC 3A4UA 4W65A 3IZOA 1ZRFA 1JZ7A 3DYOA 2QCSB 3CO2A 2R042 2P1BA 3BAAA 4XOGA 5ACA3 4Z1VA 3OGRA 4AI3A 4K1ZA 5C3OA 1PIV2 5DAVA 4CEYC 4MXWA 1YSCA 1RUE1 4AW7A 2O1QA 4W50A 1BL8A 5ABJA 1PO12 1GQGA 2ZGUA 4QGMA 4DS0A 2VD7A 1RTVA 5H9QA 4AEDB 3AFKA 3DKWA 5LA2A 4NTXA 2BOIA 1HR0O 5APAA 4LUMA 4GX5A 3RVHA 1JVMA 3I4IA 2EIBA 5FDBA 4CCNA 1M57C 1KS4A 2OVUA 3SYCA 1YQ2A 1OKQA 2XT9A 3HD8B 3AK1A 5JR2A 2VJXA 3UGGA 1RHI2 3KD4A 5FZ4A 4MVSA 1SESA 4Q4W1 1OA4A 1RUJ2 5FZGA 1FAFA 2GU9A 3VZLA 4D69A 1AR93 4HAMA 4KMQA 1QXPA 2WN3A 1HXS3 1LRHA 1QOTA 3ACHA 3K9SA 1ZTEA 2CWMA 4TTGA 3JYCA 4AEDA 3M8AA 4FPPA 1AF9A 4C1XA 4MS2A 1RGSA 1W9YA 2RDSA 3I2FA 1UYPA 4Y24A 4GKJO 1BT8A 3ASOB 3AG3B 4AHYA 1M57B 1W2NA 2QUOA 2ARCA 2OPWA 1IOAA 2BFUS 2R071 3ZYHA 2WQ4A 4CDQC 2P6HA 1G7YA 4JGZA 1UU4A 2WQ8A 4BYYA 3WF3A 2J1SA 1SBFA 3EYPA 4BQ2A 3MI8A 3TK1A 3AL6A 5H9RA 3S6PA 3BA9A 4CCKA 1OF4A 4YW3A 1HV1A 3W7WA 4DOUA 2BTOA 4YJ2A 1WCKA 5SV5A 1ACCA 4NTWA 3HNBM 3B7MA 4E4DX 4K9SA 1U5ZA 1GOGA 5IWFA 4X8AA 4MVQA 1SACA 1SQPH 5JOZA 4BDVB 1JMKC 3WQ0A 1W6QB 4QGNA 2P3KA 4LH7A 4MXVA 3OTOO 4I50B 2LS6A 3M2MA 3K03A 5CB4B 2C0ZA 3BVCA 4R7CA 3AVRA 5JAXA 2LW1A 4YIPA 4HPKB 4LBMA 3MICA 2R9AA 3CWBH 1JJ2U 5JXHA 5BZBA 3NNLA 2ZINA 2WS92 1YO8A 3QBQA 3EXUA 3KS7A 1SCSA 4MV2A 2BNMA 1VR3A 2KG7A 2DYRC 5J3UA 3L2HA 1WA8B 4JKMA 3CCQV 2LGQA 5A1LA 4MX3A 2ZHKA 1W9FA 4WFBV 5IE9A 2JJ2G 1PVC2 1LHVA 4OI4A 5AVPA 2QWNB 4LHNA 5DDJ3 3L73H 4OXSA 4HZFA 2M6YA 1W0OA 2WKKA 1W05A 5TISZ 4CH3A 1UOFA 4YJ3A 3BABA 5FUNA 4DR1B 4BW5A 5G04L 1LHOA 2CE4A 1H1IA 1DF5A 3RYCB 5LYJB 4WVWA 4I4TA 2C9AA 4X1IA 3I2JA 4NYKA 1Z0HA 1JPXA 2A0LA 2W94A 3HKBA 1HQNA 1EUTA 3QOPA 2VMCA 1NI8A 1T2XA 4QDSA 2VNOA 1N34B 4LF6O 1PGW1 3H8OA 3ZIAG 2E63A 1O4YA 2OUHA 3OG2A 2LJ2A 3RZKA 5FUIA 3WUDA 1JHNA 4XACA 4YG6A 4K0KO 3W7UA 1UAIA 3HNYM 3M99B 5IDJA 1CZSA 4JTNA 1S55A 2BW8A 2WLNA 1FI2A 1JYWA 2ADDA 2MNGA 3ZMVA 2WLKA 4CDWA 5A3NA 5AFBA 2ITDC 3MV11 4CVUA 5DXDA 4FVVA 2D6PA 2OA2A 5CN0A 5FZ8A 1LGNA 1MS9A 4ZIBA 1JU3A 5BYNA 4IXLA 2Y4UA 2WQZC 1H30A 4Q1PA 3AG2C 4FTEA 4FPKA 5L9VA 2YIDA 1VLNA 2Z5UA 3ORJA 2DDUA 1ZRIA 1K5MC 4MHRA 1NZCA 1XOYA 2VPVA 4XW3A 2VCAA 1CPYA 4M3CB 1YUDA 1XBLA 2ZEWA 3NO8A 1RUG2 4FP3A 1ZBA3 1J95A 1NLRA 2WNEA 2XAHA 1K3IA 4D7TA 4TQDA 1ODMA 2R32A 3RGBA 3C7HA 1PX3A 1F9KA 1V9U1 4PLNA 4DW1A 4OLLA 5CKNA 5IJ9A 1TMF3 2HHHB 1VAMA 5LMUO 5IVJA 1RSOB 1WCSA 4LITA 3UYJA 2HWF2 3H3ZA 5FZBA 4CEYA 2GALA 3OF1A 3P3NA 3BUCA 1K5MB 3WG2A 3AKSA 3H01A 4BB3A 2MEV2 5FP3A 1D4M2 3H42B 1VBB3 5FLXN 4GKXA 3OPZA 1ENQA 1G1XB 3G6JB 1I5ZA 2X6CA 5C70A 1SQGA 4HYOA 3OSDA 5F5IA 4N53C 3SPGA 4DR7B 2GDFA 1E57A 2PN5A 3HMYA 1CAVB 5CA0A 4IEXA 1DYOA 2XG3A 2QQIA 1S5JA 3ZN6B 1FYUA 3JATB 4FM0A 2AHZA 4NMIA 1J5EB 3K77A 4DR5O 1WPXA 3IGAC 3UGFA 3BVOA 4XUTA 1UF2C 5AC93 3ZSEA 4FIPC 4JQTA 1OSGA 2CAVA 2WDBA 4AQYO 1EYBA 1ZZBA 3SQOA 4N53B 3SCFA 3UNPA 3TEXA 5DG1A 1C5HA 4K8FA 3AP4A 4ZXEA 4CS2A 1ZBE2 3AK0A 4KU8A 1C8M3 3M70A 3CMGA 2XNDG 5FPVA 1V54C 4QDQA 1PM7A 2G9GA 2VCMA 4JZ2A 5FUPA 5DM6V 5FY8A 4HN1A 4CYDA 1SFNA 3PJYA 3ICXA 3ZRWB 3AG2B 2VUJA 3CCJV 4GKYA 2ZGMA 3QH7A 3JAWB 1RUF1 2XKPA 4B3RO 2B39A 3U37A 2OXBA 3T1YB 4DK1A 3LFMA 5CFCB 2PUSA 2LTNA 1BBT1 4JDOA 4MYEA 2A79B 1MG1A 3DGTA 3H1MA 4LF7B 2FKXA 4PDWA 2QQJA 3ZLIA 4GXLA 1NTZH 2FDFA 1PNFA 3FWEA 2QQNA 3S5QA 4LWSA 4IEWA 2VUDA 2IXIA 1Q6HA 2VQEO 1PKXA 2P67A 4MVMA 2W92A 3WP4A 3AG1B 2Q0OC 3RYHB 3RDIA 4BHPA 1H2MA 2J1AA 2CH7A 1GFF2 1W8UA 3C90A 4SBVA 2D93A 2YBKA 3CCVV 4F7ZA 3OR6C 1PNKA 4UW4A 4TN7A 4AVBA 3AMHA 2FCUA 4JYBA 4RO2A 2UXCO 4QIWF 3C7FA 4XJWA 3ACIA 3GWKC 4META 4DV4O 1Q8QA 4LPLA 3I97A 4RQPC 3FUQA 1WAZA 1BMV2 2UYBA 5F7UA 3RN4A 1AYM1 1S2BA 1PZ7A 4LK7A 1E5IA 1KU9A 3ZYRA 1TNRA 2B1GA 3NJXA 1XYPA 3R4UA 4HKOA 2GDSA 2J22A 3A7QA 5A3TA 4XFAA 1RB8G 4KP4A 1VALA 1DLCA 2HYKA 3CF6E 1WB8A 1AP5A 4IYIA 4HLTA 3AP5A 4OHWA 4C1WA 3LE0A 2VAUA 5J96B 5FMCA 4O2AA 3MFAA 4I55B 1S76D 4GALA 4OI0A 1V55B 2Y4TA 3Q8BA 1AL21 1LODA 1Y76A 1TME2 2BYVE 2XASA 2VU9A 1N3OA 1R6NA 1QLEB 1XB9A 2WO7A 1UX6A 4P30A 3N2GA 3RW0A 1TQ5A 3OBZA 1KB9F 2W95A 4NTYA 5K7PA 4MXWB 2BGPA 3M3IA 4NWWA 4CSWA 3O65A 3AC0A 2BSKB 3AXEA 2Q6AA 3WFVA 4R50A 3JAKB 1AYM3 2QGNA 1JZ6A 1UZ0A 3K5NA 3AYEA 2PHWA 5C4WA 2EIGA 2VY0A 1UY4A 5D2AA 4ASMB 4LF9O 3ME2A 3KV5A 1F4MA 1BK0A 1Y7BA 4A7ZA 2QQUA 4CP2A 2ODMA 1ZZ9A 2W0FC 1OLME 5K0UA 3E89A 1PO22 2EIKB 3JD0A 1QJY1 5A7SA 3I7DA 4R9DA 3AG1C 2VGDA 3BCWA 4DRXA 5LXTB 1F15A 3FYIB 3AMQA 4DV2O 3ZRSA 4K8ZA 2D6MA 5FKCA 1WLCA 4DV5B 3H1KH 4EN6B 1BYHA 1FOD2 3T2TA 4K8RB 1KYOF 3E5XA 1OCCB 1UXZA 5CFDB 1IGOA 5FZLA 3LDRA 3I3MA 3USSA 2EAAA 5EPAA 4CEWC 1PGL1 3ZHTA 2IBZH 2WLMA 5C8WA 3E8GA 4M3CF 3TETA 2YIBD 2YFUA 4RGKA 4X8NA 2DN9A 4JZGA 4UWDA 1H8HG 2E26A 4IV3B 1CPNA 1JCHA 4AFCA 1H0BA 2P4VA 1RUE2 4OI1A 5KXDA 1Q6UA 2N74A 4JI7O 2VNGA 4ZBMA 2TNFA 1RFYA 3UKNA 4N7IA 4L8JA 4WZFA 1Y3TA 2RS52 2XLFA 3ASNB 5L19A 1K34A 3VUOA 3TOJA 3H3LA 2R073 1UKGA 3WG7C 1G86A 1GP5A 3AG4B 4Z92B 3CRAA 2FZ1A 2CDYA 2LW7A 3CD6V 3Q4HB 3JB4C 4GWNA 1OLMA 5LMNB 1XUQA 2QTSA 1VBA2 5HFMA 3WP6A 1POV1 3PL0A 4NKGB 4LO8A 2CSGA 1X7NA 5EBLC 2PI4A 1N1VA 4RUFA 5HBAA 4XF4A 3ZX7A 4JHTA 4YGCA 3VLBB 5LY2A 3D5OA 4NWVA 2CUGA 3IFXA 1BQ0A 1LR1A 1QNYA 4K40A 4CEWA 4XQDA 5F9TA 2AYHA 1I5XA 4O4HB 3DTUB 4ZPIA 2I2SA 4IV1A 4JKKA 2M7WA 4U7OA 3WDYA 2HWF1 5A7PA 1HNWO 3DCQA 2JG9C 4IL7A 2NR5A 2DOSA 1CX4A 4QAWA 4F4LA 1XNAA 3D0JA 3A2FA 4QPJA 1MZ5A 4RR3C 4JI6O 5I8TA 3ABLC 1CONA 5F8PA 2WFF2 2ZIMA 4P5HA 3OUHA 4UXNA 4S2DA 3VZKA 3RWKX 2JVDA 1Q8SA 4YM2A 1FV3A 2ATFA 4K1YA 1Y4WA 1AR72 1OVSA 5CIRA 1NCRA 1VQ8V 3ZSMA 2A9HA 4IEOA 2KXLA 1HX6A 5C4WC 4U3JA 1R082 4DUZO 4QPGA 1UNBA 2PF4E 3OTFA 4LBKA 4JV4A 1TEIA 3F7VC 4BIUA 4YM1A 2E32A 1NH2D 2VVDA 3LZZA 1GZCA 3JD73 1TVKA 1QLNA 2JE7A 1GZ9A 4FBFA 4O9GA 1EP0A 4HVQA 5CA1B 4JGYB 4JI0B 1Q6IA 2DFCA 3BB6A 1YI9A 3C7GA 5I91A 1W6OB 2ZEXA 4FM2A 2AEZA 2D3PA 2DF7A 4Y1ZA 4Z2WA 4MSVA 2KB1A 3IMNA 1K97A 1LUVA 1XE7A 1YEWA 2O0OA 1XILA 1GANA 4XFIA 1CAVA 5F3EA 1G9BA 2W52A 3N3HA 1HNXB 1QGLA 1LNQA 3VL9A 1W3XA 3B69A 2KG7B 1NY71 3UGHA 4JGYC 2HJIA 5A9GA 5FWEA 2VOKA 4H14A 2VQFB 3PUHA 2JIJA 4JI2O 3E8FA 4J1WA 5IVCA 3RYHA 3FHIB 3IIAA 1IURA 5DEDA 3T1HO 1VBB1 1DG6A 3ZSLA 2D98A 2PGGA 3ACGA 2V4AA 2ZMKA 1XNTA 3ST7A 4RQPA 5KXEA 2QWQB 2XWJB 2FDGA 5DABA 1TVKB 1VBE2 2RHPA 2VZTA 1SLBA 5F39A 2HFEC 3JASA 4IT5A 2QA4V 2YYOA 1ZYBA 4RR3B 4AVAA 1OQ1A 3CJHA 3RJRA 3NQHA 2BWAA 1VP7A 4GX1A 2JDUA 4UW3A 1MS0A 5BPXA 2P7TC 3ZXLA 1V9U2 2F4PA 1EAH3 2VCBA 2Y0IA 1RUI2 4IEZA 3VBSB 4LQRA 4R52A 1Q8VA 4YVWA 4XFBA 5CKMA 1BK1A 1WA4A 4EFBA 2BPA2 4DUYB 2NZ9A 3NAPB 3UETA 5FMOS 1SCRA 4WM8B 2CAUA 3UV9A 4LF7O 1NQJA 3E5QA 1QDCA 1S0EA 4Q4X3 5CISA 2WAOA 4O4HA 2GUZA 2RS11 1K5SA 1X8MA 4CH4A 3NKGA 4Y20B 2EZOA 4F6EA 5AG2A 3UKVA 3N9LA 3I2KA 3O1VA 2ZHNA 1LEMA 3CZUA 5GLVA 1E5RA 1XNCA 5B4XA 2AH2A 4GKKO 2FL4A 4YVWC 4BMBA 1AR1B 4XJUA 1UX7A 2QQWA 1POQA 4PA3A 2RDNA 5A6ZA 1URFA 1HB2A 3IN9A 4X66O 3C2UA 3MHZA 4YY3B 2JICA 2HHHO 4OMCA 5LHGA 3GWOA 3E2EA 3MIFA 2QM4A 3ZKUA 5DUUA 2BWCA 1R3KC 3N9PA 4XJ8A 1Q82W 2AREA 4M4RA 1NY72 4BJ0A 5C3PA 4FLZA 5CA3A 2ARHA 4AFBA 2ZX4A 1PMHX 1FNYA 3IAQA 5GLUA 1MMMA 1NE4A 3B5LB 3BIWE 1Z5VA 5KLVH 3WNNA 3QACA 3RYPA 3QTCA 5FYHA 3SCHA 1MEC3 3RVYA 3CSXA 2OW4A 3W20A 4JRLA 1BJQA 2X09A 3ZN5A 3THPA 2RJLA 2QTOA 3F7YC 3WX5A 5JOXA 2GP5A 3IDCB 4S2GA 4CRQA 4ICGA 5H6QA 3KT7A 1W28A 3HR9A 4BK4A 3AK2A 4M3CA 5BNNC 1ULDA 4AI1A 2W68A 1AXKA 4A44A 3VQYA 4LBEC 4OHVA 4YSFA 4DR3O 1PO11 5HFLA 4FPEA 4LHKA 1W2OA 5ITZB 1QJX3 4XBQA 2DCKA 3MAQA 4R9AA 5C8CA 1SLAA 2EVXA 1SF9A 3T4ZA 2LGWA 3J26N 1US6A 1XE8A 1GM9A 4ZU5A 5JCOA 1ODNA 3AXDA 1PO21 2PHUA 3NNJA 4X1YB 3HT2A 2UYAA 1JS9A 2OCHA 3SR2C 1OUXA 3OUSA 1UQXA 5FY5A 3RZGA 1AR92 3H7YA 5JDBA 4Y26A 3VBBA 1RM1C 1EPWA 3VN4A 1YJWV 2GMPA 4I9QA 1JTZX 1YWKA 2XXZA 5TSWA 4HETA 1UD1A 5BMVB 1DHKB 3G6BA 5LYJA 1ENXA 3P6BA 1N1TA 3CLPA 3TB0A 4LTAA 3H8XA 2ZE5A 3K57A 4FPCA 5F5CA 4AGVA 4JI1B 4ZHQA 1SFYA 4NRPA 2R072 2A70A 2J7MA 2WC2A 3VHRA 2WNUC 2GZWA 3HWJA 3UT5B 1OA2A 3CC7V 1VQKV 2ADQB 1N3QA 4LO7A 2VZRA 1QR9A 3KT1A 3ZMSA 3K4AA 4QDRA 1U5IA 4DR7O 4LO5B 2DW4A 1WCDJ 1GYKA 1OLQA 3OY8B 1W3VA 1SHWB 2Y26A 4QU1A 1KITA 4XVHA 1B35A 2MEV3 2CK3G 2HJFC 4A45A 4UVAA 5FIXA 2A1XA 1JU4A 3PVBB 1QQP2 4UCRA 4PELA 4QPGB 5J1XA 1S0VA 4H33A 3POEA 1PM4A 1N1SA 2G4IA 2WNUB 1OD3A 1V70A 2E3CA 1RIRA 3B2EE 3W5MA 1Q81W 4UVBA 1QJY2 5FY4A 4DR4B 5BNNB 2XJSA 2ZM6O 1D2DA 5FPOA 4FPOB 5C93A 1W8NA 4AI8A 3PTYA 2A3WA 4MGTA 1ENRA 1WD3A 4FLUA 1H8TC 4EN9B 3RNSA 1Z5WA 3NR7A 3E1F1 4YIOA 1ZZ8A 1AYN1 2Y69B 2FMYA 1LAJA 4D6TH 2D44A 2JS3A 1GMMA 3J8F2 1WMXA 4UFKA 1AR63 2BGOA 1OMIA 5IAXA 3CEIA 3W9AA 4JF3A 1RUG1 3ZFFA 2RS51 1YQ6A 3TEYA 4QT6A 2XTAA 2UXXA 2Y38A 3KF5A 4QKNA 1PK6B 1R1A2 3V0BB 3NJZA 1CP9A 2KR2A 4CP0A 2B5UA 2Z69A 3DPRB 3O1SA 5D5QA 3JZVA 3VBHA 4NXMB 1FX5A 5CG9A 4COUA 1B04A 4CS4A 3ZXEA 1SQFA 2VO5A 1UCXA 5JZGC 1OCRC 2XDVA 3LKJA 3JBG3 3OM3B 4XTMA 3THTA 1VPHA 3D82A 5LBFA 1SA0B 1YLLA 4OPAA 3BALA 5BXZA 2VWJA 4XBFA 5C9AA 2BERA 1W8WA 3WEZA 3VD3A 4M3CE 2P3IA 4XCBA 4ASKA 2D43A 3IPVB 2ADPA 5EJZB 2ZKOA 1O3TA 1DFQA 2ZMLA 3VDDC 1FXZA 1LHNA 4HNAB 4ZI7B 4XHBA 4PCRA 4UCVA 2EIKC 2JGDB 4P9YA 3POBA 5GJ6A 4I0AA 1W8TA 3U75A 5A32B 1B3QA 4X66B 4XBLA 1RPRA 3CCLV 4EKWA 4DV3B 3BY6A 4NHLA 3WG1A 2NLJC 1FFTB 4FQZA 2E7QA 4P9JA 5F6LB 4IW3A 1JXNA 1S5HC 5JOWA 1MQTA 1DQ5A 5C6CA 4RGGA 1GV9A 1PHMA 3KZ4C 2VMDA 1CVNA 5EV7A 5DQ0A 3ZSKA 3TWIA 1CESA 3OGCC 4URTA 4ZU7A 4UUJC 3OB8A 4PA7A 3N9MA 1GN3A 1AJQA 3J7LA 1VAKA 2D5FA 4AI2A 3O1PA 5FY1A 4CU8A 3ABTA 4OGQB 3DF0A 5K4LA 5EIBD 3LCPA 1W9TA 2YHJA 2UXNA 4XF1A 1UN1A 1V9U3 2ZA9A 4NXMO 1QU0A 1GP6A 3PURA 4JI2B 1UXXX 3H8UA 4CH6A 4BWAA 2YUEA 2A3YA 5IY5C 4IQPA 3WNXA 2ZZJA 5K1PA 2ZNIA 1HR0B 1DGSA 4XE9A 4I0XB 1B35C 4B8EA 4X62O 5FCCA 3ZM8A 5LXTA 4KWJA 3DPRC 2CTPA 3O1TA 4XETA 4FFIA 5A70A 4FFKA 3LDCA 1VQPV 1H38A 5LGUA 4V2WA 5FBZA 2X29A 4BW9A 4Q4Y3 4Q4V3 3ILFA 2EJ7A 1WPBA 4DRVA 1VEWA 3SPJA 2QM8A 4BIOA 3LAGA 5D21A 1D4M3 1H6YA 1VRH1 4L11A 3FX7A 4I9WA 1JZ2A 1Y74B 4XZPA 2DQ3A 3BCCH 3VZMA 3P3PA 2Y0OA 1Q7YW 3ZIXA 4AI0A 1N32B 4DUZB 1ZZCA 3S57A 3X2QB 1BZKA 2QWRB 3JATA 1KEXA 1PL0A 5KHGA 4Z07A 2IJHA 2W91A 3PU8A 2H0BA 4LBQB 3KLSA 1IG0A 4CXYA 3VBUC 1GN2A 4YFWA 4XYXA 2ZX1A 2VZSA 4FFFA 1CD3G 2WNVC 4S2FA 2ZAHA 5FZ0A 4AG4A 2JDAA 4W4ZA 3OUFA 3PUIA 2QEXV 5LZ6A 2ZM6B 1VMGA 5FK8A 3DXRA 1O3SA 3NWKA 1YNAA 4RHV3 2R72A 1WLDA 1XMOB 2R70A 2JD9A 2JJ6A 2BV4A 4QU2A 2QZ2A 3PVNA 4CU6A 4MTOA 3IJ4A 4FLYA 1MPXA 1MEC2 1N47A 5FFOC 2Y34A 1R1BA 1AXYA 4HKLA 1NR7A 4E27A 4B3MB 1R3JC 2HWD1 1X50A 5KAIZ 5IJ9B 1DU3D 4I02A 3OGVA 3ZBHA 3LFIA 5IFTA 4YGDA 4N9HA 2R9IA 2OS2A 3CNAA 3HQRA 2B45X 2GC3A 4CZZA 3ES4A 5DZGA 2VL4A 2ETNA 3WINE 4TZDA 3MHHC 1NCQB 2DU1A 4FOVA 1O9GA 3HQUA 5IY5B 2JDZA 4DQAA 2E31A 4QQPA 4PIZA 3SNMA 2WWUA 4PD4F 3K5OA 4UOJA 3ZRXA 1CIYA 2VUAA 5IJ0A 5LRRA 4Q26A 4NAMA 3I2DA 1DP0A 4XAAA 3OPTA 3GGLA 2VTFA 1CEZA 2XJUA 2VBDA 1QLEC 2DVFA 2UXBO 4NIAA 1RXFA 4QHZA 1K33A 2RS12 4CXWA 1SERA 3NSTA 1X8EA 3WVJA 4PF5A 1NUKA 3CL1A 4R6ZA 4I0BA 3L75H 5FMDA 2W39A 5K1XA 2OWOA 2XHBA 3M3OA 1J58A 1Q56A 3ASNC 2HWE1 1XE0A 4XIOA 4ZY9A 4BLIA 1R093 3N27A 3NKTA 2DYCA 5H9PA 4EB6A 3WG7B 4TV8B 5GZDA 2JDKA 4PHZA 3DSQA 5FZ1A 3KSCA 2DTYA 3I49A 3X2QC 1EV12 1JYVA 5IHRA 1UZZA 1ZBA2 2ES3A 3E22A 4CCMA 4OZXA 1FNZA 1WMEA 3DL3A 1VP6A 4CDUA 5JXIA 1RMU1 4AFMA 3IDAA 5LW9A 4WBBA 5C8YB 3FJSA 2WNVB 2HKOA 2JECA 2YC0A 2IH1C 2IVIB 4KGGA 3ZN6A 1GZWA 4YJ3B 1K12A 3ZHSA 4QE9A 3RMYA 4RUEA 2JG8B 1OCCC 3A0BZ 4Y3OA 5CFDC 4QGLA 5D8AA 1OD5A 2JE9A 5DZEA 3LEIA 1L3JA 2WLIB 3MLJA 1W0NA 2ZXWC 4ATEA 2QJ1A 2W3JA 3K79A 1BQPA 1XNKA 1MQTC 2DTWA 3ZDVA 1Q8PA 1PVXA 5CKQA 4KGQA 1KJLA 3TEWA 4FFGA 1AVMA 2F6BA 1COV1 4LF4O 4P9LA 5C5UA 1SLCA 5EFUA 2EXJA 3AZYA 4DV0O 4O65A 5HCFA 2P6CA 2Q1FA 1CAWB 1RUC2 4JI4B 1XEQA 4P14A 1H2SB 4K3UA 3E8HA 2K0GA 2NNUA 4JAVA 2J1VA 4BXSV 1DBNA 2DYSB 3SH4A 1QHTA 1QJU3 4HL0A 4ISRA 4KXRA 1FMD2 3ZHUA 2RM21 4Q2FA 1AI6A 3PJSK 2XQXA 3I54A 2E5LB 2JB8A 5JCOC 4JHZA 3CE2A 1K7DA 4Y20A 1F31A 2ZOEB 4MTXA 1O91A 5ANNA 3CMEV 4U3JB 2ZGPA 4K3AA 4BQ3A 2AZ0A 1YTFD 5JSRA 4ARXA 1VBA1 1J1LA 3HT1A 5L9RA 1V6OA 3VHPA 3ZFGB 4H44B 2XVGA 1YJKA 4OHXA 4CUGA 2E75B 3DEMA 2GH2A 2AXTZ 2Y6HA 3WW1A 1YI7A 1R081 5FYVA 5IYBO 3RS6A 2OUJA 2WUHA 2GMEA 4X1YA 2CNAA 3VDCA 3WHUA 2XKOA 2HWB2 4FPYA 2W6JG 2W6IG 4J41A 1NZIA 2PHLA 4O4JA 3FB5C 4FLXA 3MGUA 1MS3A 5A3LA 2OX0A 1NXD1 2JRIA 1POV3 1P84F 5BXXA 4UFIA 3VKNA 4LF5O 4FP2A 2Q67A 1KS5A 4AK3A 1RJ7A 1PZ8A 2P4KA 1G9CA 2HWE3 3F95A 4LKEA 1GOFA 4GLXA 1YFXA 3UT0A 3U4XA 2A71A 5IW0A 2ZACA 4HN0A 1G4YB 4LBJA 4LA3A 4BXFA 2P06A 4KHPB 5LK7B 3HKCA 3P32A 2QQVA 2VQEB 1CJPA 2QJVA 1XYNA 2PLV1 1R6TA 1HW5A 4IGPA 1KFXL 3ZYJB 1S5LZ 1ENSA 1W59A 3WDTA 4YHHO 3UJQA 1XQNA 1H4HA 1SG3A 3T1MA 1YQ5A 5IJ0B 3W58A 3ZFFB 2XONA 3N2KB 5F37A 3ABMB 4IE5A 3D8CA 4JC1A 1OC1A 3K3WA 4B3RB 3UK9A 2ZZQA 2E76B 1CWPA 1J3PA 2JD4A 1SQBH 2HYXA 2UWBA 2V5YA 2QVSB 2PAEA 1ZWIC 3ZN4A 2D6NA 4CDQA 2YV8A 3POJA 3OBRA 3JXSA 4IV1C 4X65O 4NN0A 4QXCA 1DK1A 1HJFA 3OOXA 2IJJA 1XDCA 4DV7B 3HKDA 3EHKA 1W0JG 3WNPA 1GWLA 1HNXO 2GTAA 2IFRA 3KV9A 1NBMG 5L3FA 4LHSA 1WLEA 4GJZA 4BIFA 3PIJA 4JDMA 3DXTA 2DBNA 4I09A 1F4NA 1H2GA 2QWOB 4GB31 4LA2A 2A6WA 2GC2A 1J5EO 3DXRB 4IUGA 2NQYA 5A1FA 5HCHA 4BCUA 4CU9A 2XVKA 2ETEA 1L1FA 1SBDA 2XHKA 2D3RA 4GB33 2JE8A 2ZX0A 4QXBA 3RYFB 2JJ1G 3VBRB 1TVGA 3VQWA 2H8PC 1NH2B 1SBEA 4G28B 5IATA 2BRTA 2WA3A 4QPYA 4LNVA 1CAWA 3GZEA 3ABUA 4UCOA 4QQLA 3H9VA 5H6RA 1O6UA 4DFSA 1W6OA 2GNBA 2DBIA 1G6NA 4NXNO 3ALQA 2XJVA 1TUBB 4DIQA 5CMUA 2VTXJ 2XLGA 1EPZA 4BR6A 3VBFA 5LMUB 3BIEA 3KG2A 4LR4A 1KQSU 2G9ZA 3E22B 1J3QA 2OIEA 2Y0PA 5FP7A 3J7MA 4AEJA 3WV6A 1PPJH 2R0FA 1QOOA 2XOKG 1GWMA 3WB0A 1DF4A 3VKLA 3U14A 1DZRA 1YJLA 2CV6A 4FPGA 2RVAA 3T0DA 5JPNB 4Q4W2 4FCAA 1YRZA 1VBA3 5C8YA 5FZ6A 3K5LA 3H1WA 3D4KA 3WG3A 1RUH1 4ZS2A 4O4LA 4YVWB 3MD0A 2RNBA 2GNMA 1P7BA 2RDQA 2YPJA 4KBBA 3ABKB 1REDA 2ZKNA 1IX9A 3POFA 5HV4A 1N4CA 2R041 5JQGA 2B9UA 2RS53 2B8MA 2ZABA 4JI8O 2IXCA 2GNDA 2VZ3A 5LL6Y 2HEVF 3GDBA 2RM23 5DUXA 3BU7A 3T4VA 1W9WA 1PVC1 4B3TO 4QB2A 2L6LA 4JASA 2F93B 4X1IB 4XFGA 2X05A 3PDQA 3WP5A 5JJJB 4H7MA 2ZR2A 3WW2A 4AVCA 5FL7G 4C91A 5FZOB 4OVEA 4RD7A 3MF6A 1R6KA 4JI1O 4ARYA 1LUWA 4BAYA 3OUJA 4LFBO 5LGNA 3CRCA 2ZGQA 1IKQA 3LSQA 2WIIB 2EILC 1HNWB 3LA2A 4DV2B 2HWF3 2DVBA 1XL6A 3I8TA 1AXZA 3S3XA 3GBGA 5IVFA 1JFFB 4D6RA 3VDDA 2JKBA 3AMMA 4QB6A 4U3FH 3MPPG 1VMHA 2EXIA 4J25A 5KHJA 1QJEA 1YVWA 1LOEA 5C9AC 2RM22 1N33O 1HNZB 1UMIA 1R1ZA 4XDQA 3CHXA 5JJNB 5JH7A 1HW7A 4XHXA 4CUCA 5FPBA 1ZUQA 4AL9A 4Y4YA 5KA6A 4H13B 2VWKA 3LDKA 2RV9A 4NIHA 4X20B 3ETQA 4QPWA 2E53A 4IDZA 3BKZA 1VQOV 3AZVA 4XDKA 2K2SA 1S0JA 1ZAUA 1JUHA 4QX3A 3C8XA 1PIV3 2ZD9A 3JD4A 1AJOA 3PMSA 1Z78A 1QJX1 2VM9A 3L74H 1YYNA 5CA1A 2HEWF 1ZA7A 5C9AB 1TAEA 1PO13 1Z2GA 4CP9B 4WVZA 4L87A 3T1LA 3KHBA 3NV1A 5EBWC 1APNA 2QE3A 2A3XA 3UM7A 4MO3M 5E1AC 4JCKA 3RT3C 4FAHA 3LDDA 5CFCA 5J48A 2DQ0A 5FPXA 2ZDIC 1VQ6V 4YW1A 4JDNA 2B5HA 2JIZG 5LBQA 4AR2A 1W03A 5LHHA 5DN2A 1S2EA 1WKYA 4O2BB 1PK6A 1A6CA 1MS1A 1W0KG 1RINA 1WJZA 3ABKC 4XABA 1T6BX 2VVFA 2ET1A 2J1EA 3MZHA 2L35A 2H6CA 2F43G 5A3PA 1Q43A 1M90W 3I3DA 1OT5A 2X10A 5B2GB 2ARXA 1YF2A 4IEYA 2BBAA 2LO1A 4H3WA 5KUMA 2Q30A 4UFZA 4LMFA 2PYJA 3BEHA 4QX1A 2H6BA 1W2BU 5F2WA 4ZS3A 2UUAO 3BOWA 3H3UA 1DLLA 5BY1A 2YI8A 2CHHA 2Z2SB 4Y5Z0 3L72H 4LULA 3RFRA 4MADA 3U10A 4FFBB 2VXRA 1IXMA 4Y5TA 1OQDA 5B4NA 1H4GA 1DYKA 1ULGA 3RZLA 3T09A 1LOBA 4XFFA 3IAYA 3JBG2 1ULPA 3ZN1A 1IPSA 3TBDA 4QPGC 1VF7A 3HBZA 3OBAA 3W7SA 2PAMA 4UBHA 2Z79A 1ALYA 3IWZA 1QWRA 5CBLA 3VDDB 1LOAA 3TEZA 2AZ5A 1YXBA 3TXQA 2WT1A 5BV6A 5LBEA 4J9ZB 5FPAA 3CRRA 3AMPA 4JAUA 1RL3A 3AP9A 1RUD3 2YMZA 1RMU2 3FLPA 3R4DB 4LEJA 3GALA 5JIAA 4G2KA 3I3BA 3OW2U 2Q7HA 3MEPA 2HWE2 5CAZA 1V00A 1HB1A 4JTDB 3QD6A 3O0WA 5FMBA 5GONA 3A23A 4AXOA 2P4EA 1COWG 2GC0A 5ANQA 2HWC3 5IFPA 1DQ1A 1LOCA 5D5PA 4XDJA 5LBCA 3VBOC 1P7GA 2DWRA 4MGYE 3PTRB 2Y33A 2XMLA 2JDMA 5FZCA 3CYOA 2EIMB 3FD9A 3ZXJA 3SC7X 5IVBA 2IUWA 4YZ1A 3H1HH 2VMHA 2W9XA 4DV6O 1ULFA 1ZZ6A 2JEMA 3CC2V 5EZYB 3H9AA 1UPSA 2Z3YA 4CZSA 1UYXA 3ECQA 1QHDA 1NX9A 1XRUA 4J1XA 5JZGB 3OMNB 2X53S 2KQXA 2XBO2 5A2QN 2OCCB 3VZOA 4YJ2B 2CU5A 2D6OX 3WF0A 2DJVA 2W87A 1M56B 3SJQC 4ET7A 3UL2A 3AYCA 4GZ9A 2QKCA 1U5YA 2ZDIA 3MIGA 5CBGA 1GN4A 2P22C 4JGZB 5CG8A 1V6MA 2HWB1 5A3OA 1XU2A 2RE9A 4A41A 5EIBC 1G6UA 4UCUA 4LFBB 5GONB 1THZA 2D40A 4YNIA 5GLZA 3JARB 1PP9H 3M3QA 1IS3A 3I2HA 1QOSA 2YGLA 3AK3A 2YGMA 3WW3A 5JMOA 1CAXA 3SCGA 3ZR6A 4HBNA 4FAGA 3URFA 2LRPA 5GTIZ 3K2OA 5KXCA 3BHPA 1DTOA 1VBD3 2ZEZA 1COV2 1I5PA 2BOCC 1I6XA 2XAGA 1ZNPA 4P9XA 2HG5C 1IVSA 1REFA 2VQ0A 3BODA 3B3QE 5GW7A 1WMDA 5A32A 3TN93 5CADA 2LFSA 3RZMA 3OY8A 2ZT9B 4MSWC 4TT3G 1HXS2 5CA0B 2CGPA 4PV1B 1L0NH 2W46A 2XH6A 2IXHA 5BMVA 1U96A 5L3GA 3ASIA 3D0SA 4UBGA 2FB5A 2Q8CA 1FPN1 2Z4FA 4BOWA 5ISLA 1Z7S1 3KHCA 3APOA 5JQGB 5FPLA 2DU0A 3ZYFA 1WN7A 4R9CA 1D7PM 4EE2A 1L8DA 4OMDA 5EYYA 3KCYA 2QBXA 2FMDA 2C26A 2WPDG 2VQUA 5IVEA 2XAQA 5C3SA 1TME1 1NCQC 5JR7B 1WLWA 3E6BA 2HR3A 4B08A 1UY1A 1OF3A 2CAZC 4LFAB 3K5MA 3OR7C 3AEIA 5JPMB 3EXAA 2VOWA 1M56C 1JHJA 1U97A 4LORA 1AR4A 3ON7A 2RS32 1M1KW 4DR1O 3S0MA 1AI5A 1RYYA 2ZX3A 2VZOA 4L8QA 2R063 2R30A 1YQCA 3VD7A 3U0ZA 3O12A 1KD1W 3SYOA 1R73A 1HQWA 1JMUB 4DYLA 1HB4A 4QM9A 4W6YA 1IBLO 4N53A 1W6PA 4QMAA 3CCSV 5E16A 1HWYA 2JX9A 4OUEA 3S7IA 1JOYA 3IC9A 4LCUC 4OI2A 4XC9A 2A7WA 2WZR2 5LP6C 5I0DA 1TE1B 5JCTA 3TYJA 4XIKA 5FZAA 3S5AA 3AP7A 4QE7A 2VZQA 2V4VA 1PGW2 3M3CA 1RXGA 2JG9B 3AKPA 2ZIOA 1O59A 4UF0A 4AYUA 2ITCC 3N7LA 1TME3 2Q5ZA 1XYOA 2HBTA 5FPZA 3VKFC 2K1EA 1O7FA 3APQA 4B7EA 5FQ0B 1SLTA 3JD72 4NPRA 1QJZA 1BEV3 1SDWA 2SBAA 1Q90D 3FN9A 1QKQA 1NCQA 4FZ0A 3CKHA 1FYJA 3CRMA 4OX9B 5T5PA 3RRDA 1H9PA 1I3HA 2ZCWA 2H3OA 1BMV1 3LEGA 5I0RA 2WO3A 2ILMA 2BTQA 3IIIA 1D2SA 1AVBA 3AZZA 3ZFEA 3MDPA 1YI2V 1AYM2 1CPMA 4IESA 4UV8A 1H6XA 4EZHA 3QLQA 4JI7B 2UURA 2UWCA 4PJYA 2IFWA 3ITQA 4LBQD 2GH8A 5LCWL 5B1AB 4QKBA 2LUWA 4QPIC 2PLV2 1VF5B 1HRV3 4JYYA 5E89A 3T2OA 3THDA 1L7RA 2VQAA 1K45A 3SISA 3CCMV 3SEEA 1GRJA 5JWPA 1GOHA 4YLZA 1AHSA 4L92A 3QH6A 4MGQA 3AJYA 1W8ZA 2TUNA 1J83A 4WVMA 4NB5A 5A7WA 1PNLA 5T52A 4TV9B 3RSJA 1ULOA 1R3LC 3OTOB 1AP6A 1US3A 1VQ4V 1S2KA 4YGEA 2IWGB 1KDMA 4PI2A 4CXXA 2RR13 1TGOA 2JDNA 1RUH3 4QPIB 5FP8A 2FCTA 4DV5O 4NHYA 5KXBA 2ID4A 1QJU2 1Y43B 2HWD2 4Q0QA 3LA3A 1KGYA 2W2IA 3ZRWA 5KUKA 3JAKA 4A2UA 4JI6B 5E8AA 4RWUA 4UCTA 1GKBA 2FTKA 1GBGA 3POIA 1YIFA 3K3NA 2BSKA 4Q1RA 4UAPA 2J1RA 3RPQA 2XAJA 4IGQA 3LSSA 3SPIA 3LSUA 1C1FA 3MIEA 5IUQA 3W59A 1GP4A 5F5QA 2Q1ZB 5LEKA 1UL9A 5J2UB 1LOFA 2OZJA 1S77D 4YVSC 3RG0A 1VB2A 4HK8A 5BUVA 3R65A 2ZGLA 5EP9A 1RUF2 2Y6KA 1TUBA 3ZYIB 5L3CA 4CP1A 3AG3C 1R64A 2K9PA 3WQ1A 4JI5O 3B4SA 1Z7S2 3Q8CA 2HWD3 3ZFEB 1TMF2 4MVOA 3OGSA 3WT3A 3J8F1 4MH0E 2VBPA 3AZWA 2J1TA 2ZNJA 5F3IA 4BMEA 5I8YA 2VECA 4L9BA 3WNKA 1YCIA 3K3OA 3MO4A 5KC6A 4TV9A 2FDIA 1SETA 4TUYA 3JSNA 1AL23 4ZONA 2YEVA 3RYIA 3GHMA 2WLJA 5LOVA 1YIJV 2JS5A 1K5MA 4YVSA 1CQ9A 2OTJV 1LOFC 1YFWA 1JI6A 4P9WA 3RI9A 3LWCA 3WF2A 1NZ6A 3Q8FA 5FBJA 2WA4A 2F4VB 3ZMNA 3ZR5A 3ABMC 4KH9A 1W99A 2ARAA 2YZ4A 3B00A 5HV0A 4GWJA 4B1MA 4YW5A 3WUCA 3KKYA 2VBBA 1C5IA 2RMU3 4QJFB 4C0BA 4N43A 1G9DA 2W08A 4CCJA 4GCZA 1PX4A 3B8NA 3ZYPA 1M06G 4RL7A 2BQPA 1BVP1 3OJBA 2TEPA 1HLCA 5K0UC 1SEFA 4XJ9A 2F23A 2D3OW 1W2TA 2A6YA 3QF7A 2ZE7A 2FD8A 2EZPA 3WR0A 3H50A 2VUCA 3VOUA 4YZ4A 5AFEA 4OX9O 5IYCO 4BQYA 2ZXQA 5H2FZ 4PJ0Z 1D5AA 1X59A 3JQWA 1RHI3 1WCQA 1WUVA 3E8BA 3BRCA 1X9PA 3BTYA 2YU1A 2PQQA 1Y9MA 3OGJA 4L2NA 1CZVA 4BQ1A 5J98B 4WVVA 3J81N 2Y6LA 1OOPB 2RMU2 2DCTA 3K51A 5G05L 5FY7A 4LC1A 1REEA 4G9SB 1ZREA 2Q7GA 2HEPA 1BCXA 1L0LH 5JH7B 1WW4A 2MPFA 3ZO0B 1GWKA 3BTXA 4I0XA 5BNPA 3CX5F 1YJ9V 5CA6A 4UFLA 1EM1A 2BNOA 4ZZ8A 4A6OA 1B09A 1PK6C 4KFMA 3HNMA 1POV0 1DQ2A 5IJRA 2BP6A 4Q27A 1BE3H 4UFMA 1W6NB 3TN92 3QO7A 3U11A 5CEHA 5FYYA 5L7OA 2WWWA 1LGCA 1I0HA 5EZWA 4NO4A 5L3BA 4G27B 2VC9A 2FHRA 2YS8A 4AEKA 1K9MW 5FR3A 5DN6G 4A3XA 2D5HA 1SZBA 3CDZB 3WNLA 1O3RA 4Q20A 3ZMUA 3RYKA 4XF0A 3HR0A 4UV9A 5GALA 1IHMA 2BTVC 3POYA 3BTAA 2CTQA 5AC91 4PDVA 4OQ8A 2YXSA 3HN1A 2FYUH 3BOPA 2XGXA 3GNEA 4BQ5A 2HEYF 4FT8A 1UFIA 4KG0A 4J11A 2XWBB 3PIGA 3OGGA 4JQRA 5F3CA 4DV0B 2WFPA 1IS6A 2XL9A 2ENRA 2FCVA 5F2VO 1QIQA 4LF4B 4QWNA 2D97A 4KUMA 2PYTA 3SKVA 3VBRC 5CB4A 4AHZA 3IC7A 4LBOA 5FPRA 1H8EG 2IXKA 2GAUA 3TJTA 5IYZA 3OUIA 3MIHA 3SH5A 2VZ1A 4NR1A 4HONA 2QQPA 5IK5A 5CB7A 2B42B 1ND3A 2PHTA 5FZDA 1RUNA 4S2HA 3LB9A 4AHCA 4F8AA 1S0GA 4JVAA 5FWJA 4AOCA 4Z1MG 1HDJA 3ZMZA 3IB3A 3T0BA 2D3SA 4IE4A 4XQWA 2PMWB 2IW5A 3AYDA 4M0NA 2KSDA 2UXDO 1QJFA 3R05A 2VMEA 1RPOA 4FOYA 2OTLV 2QKSA 4QM8A 3W7XA 2YIAA 2YU2A 2PAKA 4OHZA 4AFDA 1IQDC 1GM8A 3F5TA 3VBUA 1ZRCA 3SITA 1H2KA 2RDCA 1IXBA 3H1IH 3PUQA 1XOUA 4MOAA 5FY9A 3LSEA 1CR7A 4YY3O 4AHWA 1AX0A 4COWA 2UU9O 4H7LA 4CH5A 4LT5A 3KF3A 1H8TB 4DO0A 4GZRB 3Q4HA 3JD2A 4NROA 1ZA4A 3D36C 1T5EA 4IHJA 5JLVA 3IT8A 5LA1A 3ETPA 2B7YA 2UXBB 4I0WB 2CY6A 3UESA 5FYSA 5CBFA 2PQSA 2R7EB 3SH3A 4WM7C 3LF7A 3L71H 1V54B 3O1OA 2HWB3 1VQ5V 4IERA 3VGIA 2ZGKA 3GZAA 2PXJA 1IG3A 4MGZE 1WP8A 3CEWA 2RG4A 4G4FA 1AR82 4QHBA 1KBHA 3V56A 2EJRA 2V72A 3FYEB 1VBE1 4EJRA 1RUE3 4RS5B 2WINB 3G7DA 4WFAV 4D0QA 3N7JA 1VQ7V 1Q3EA 3SKJE 1OCRB 2VOXA 5L7OC 4P9OA 4JI5B 1CAUB 4PLMA 3OGIB 4DR2B 1F4HA 3JUUA 3HAGA 1XNRO 4WFEA 4BWOA 4FLWA 2VQFO 5FKBA 3P5BA 4XQ4A 4QKFA 5FOJB 4V1PA 3BFRA 2XAFA 2EAKA 1FPN2 4LKDA 2A7AA 1VF6C 2E7AA 4MG2A 3TRSB 1WP7A 1EN6A 5T54A 5FZOA 4LF5B 1NLQA 4H55A 3KT4A 4XBNA 1AI7A 2DE0X 3TN91 4BQWA 4Q8LA 1RUD2 3EQEA 1BCCH 4YZ5A 5FPUA 1HIXA 2XOMA 1AX2A 2PFWA 3LPFA 1B6QA 4UF0B 1AUYA 4PQQA 3SYPA 4E4HA 2YC4A 1W39A 2AENA 1VBD1 2QTWB 1VBC3 4UXAA 3L2YA 3O1RA 5KHKA 4OHYA 4F3JA 4RSUA 1OV9A 1E1QG 3LGRA 2O8QA 4Q29A 1OA3A 2XUMA 1M4WA 4RGAA 4IHJB 2WNVA 2DYRB 1S0FA 3C7EA 4NHKA 2YFZA 1Y74A 3VBRA 2AC1A 1V6NA 1AR73 4TXWA 3PU3A 3V65A 3K0DA 3UKMA 4YM0A 2LFRA 4AVTA 3MHSC 1BXHA 2WSSG 1GSLA 2P90A 5EIYB 1WA6X 2IU0A 2OIIA 4Q4Y1 3RWNA 5JZGA 1NS1A 1F2NA 3G6EV 4L99A 2F66C 1QQP1 1VBB2 1YIPA 4YGBA 2VG9A 1SQQH 4K7JA 2EIMC 4WM7B 4E8CA 2VW1A 3PVOA 3HKEB 2R6QA 3I59A 1HKDA 4Y4RA 2XJPA 1YQ8A 2QDOA 2PI5A 3Q8EA 4Y1VA 4XXPA 2Y6GA 4AVVA 3CIHA 4YM3A 1R091 1ZM1A 1HRI1 2V1DA 3MFCA 1OQEA 2YB7A 1UY2A 2LM3A 4AAXA 1SQVH 2C5DA 2ZS6B 2BVVA 3WF4A 1X9TA 1MVEA 4A4AA 1KMIZ 3GZTB 1MEC1 1YXWA 2EICA 1RITA 1QVGU 2E6VA 5EC1C 4ZHQB 3FFZA 1VJ2A 1EN5A 5JIUA 3CU7A 4I30A 4LO4B 1DF0A 3K9AA 4RHV1 4Y1UA 3I3QA 1FXKA 1O9HA 4WFHA 2PYLA 5FYCA 4ZOLA 5LB6A 1N1YA 4PLOA 1O4TA 4R4ZA 1NT2B 3OYWA 3IAPA 4BQ4A 4Q4W3 4IGOA 3H1LH 4KWKA 2D2CB 2C2AA 3RZZA 3HIFA 3IMMA 1JYTA 1SPPB 1W06A 1AL0G 4GH4A 4HVOA 2GN3A 4CDXA 1YTFB 1MABG 2QDRA 2WO2A 1WMFA 4DPNA 4BIZA 1NVPD 3VBOB 4DXTA 3RYRA 3T4HB 5LRSA 1CIWA 3KMHA 4UB6Z 3BA8A 1VMJA 4TUYB 4E4EA 2Y8KA 3N7KA 4PQ9A 2W1UA 4I50A 3X29B 1BBT3 5FK7A 2B1IA 4NVPA 3ETGA 1MS4A 4LBLA 3WCSA 3GBWA 2VS0A 4FOQA 1W8FA 1UZWA 3KVBA 4O4JB 4QXHA 3FUOA 5K9YA 5J2TB 3IBMA 2EINC 3A0KA 3K08A 4JPRA 2QM7A 3R66A 1WBLA 3JBG1 3CCRV 3WXPA 3T3YA 1XNBA 3ZHRA 3WDWA 2YIBA 4CDUB 1NA1B 4XZUG 3V0AA 4A3ZA 5HCBA 1HRV1 3RMXA 3I2IA 2R16A 3C3TA 2DVDA 2KKWA 1RUJ1 2P17A 2WR9A 1F5JA 4QPIA 2WWSA 3ZXGA 2G9FA 4HZ3A 4XUNA 4F6RA 4GMP1 2WBKA 4C8DA 5T50A 3H0OA 2DVAA 3RYCA 2ZGSA 1PVC3 4YFZA 1DGWA 1RUI3 1IBMO 4LUKA 1HXS1 1SZXA 4CDUC 3AKTA 4COZA 1IDSA 5EBMC 3MW3A 3POWA 4JV5B 5KHHA 1JZ3A 3OYWB 1BHGA 4MUVA 2DWEC 2ADEA 3VZJA 5BNNA 1IPJA 5FO7B 4KL1A 1I94B 2NMNA 3N35A 5T5JA 1HDKA 2GBOA 1K42A 1IKPA 2JDPA 2WS93 3SJAC 3ABLB 2BFUL 2ERFA 3PNAA 4J9YB 4J42A 1JOBA 3CXHF 4IGGA 1AYN2 1GLHA 1LHUA 3H8RA 3F2ZA 4Y33A 5ABJB 2PELA 3L9DA 4DY5A 3EB7A 4XUOA 1J84A 2WJSA 3O0VA 4DV1B 3D6EA 4E9KA 1OHFA 1W6MA 2ZKLA 5I93A 4LP8A 3NVCA 1ZL8B 5FZ3A 2WZR3 2E9QA 1JR9A 1TUEB 5FQ0A 1JJOA 1MQTB 5HCAA 3VBFC 3KVAA 4IEPA 1GNZA 2CYFA 4LXLA 2DCYA 1WWYA 3FB6C 5FZHA 1UY0A 3INAA 3DECA 2QR4A 1SRYA 1YZBA 2IU3A 1Y4MA 4X8PA 4AAPA 1N32O 1EBOA 3NRUA 2OZ6A 1IS4A 4RQFA 2DV9A 1XSRA 1WZXA 2WZPP 3WU2Z 1OHHG 1GZWB 2WABA 3VV1A 2IJKA 2R1DA 2DYSC 2VRZA 5EXOA 1RUC1 5CBHA 1FD9A 1WGPA 2I45A 4OFGA 3R0RA 3K06A 4RQPB 3GZUC 4GMP3 3FX3A 5CU1A 2AR6A 1HRV2 2AUYA 2D6KA 4Y1XA 5B5EZ 3IKWA 4I01A 2CDPA 1RUJ3 1LKNA 2ZJCA 4UW6A 3GCWA 2UXDB 1US2A 3GHNA 4LLOA 4TV8A 1Y6XA 4JI4O 1J59A 1N3PA 4WVMB 3ZX6A 4JKLA 3FFQA 3ZXAC 1RMU3 3BI3A 4DY3A 3ZFGC 2P2KA 2VMFA 3D3IA 1XHZA 4D6QA 4DK0A 1HRI3 3MPBA 1RHI1 3MBWA 3FC0A 1F5FA 3J4UH 3MIBA 1OKOA 3FB7C 2A6VA 5J09A 5DMYA 2VXJA 3T2QA 1RVF3 4QQOA 3R4SA 1H9WA 1TA8A 5L36A 1Y9GA 1RUG3 5IT9N 4MGSA 4DV3O 2BVBA 4N7UA 1AZDA 1SKVA 4ORFA 5EYXA 5ABJC 5I0TA 4LF8B 4W6XA 2G38A 1CGPA 4AQ2A 2PHFA 4PA9A 3JCIA 5FYZA 3HKDB 3SYAA 4HXCA 1KP3A 1HP8A 5LA0A 1ASJ2 1ONAA 3T1YO 3NMBA 3SDLA 4M4PA 2XPJA 1MZFA 3HQXA 4URAA 3CMAV 2VOVA 5EK0A 2VZUA 2JENA 4DV6B 4NOTA 3OEBA 4H0LB 1VBC2 2BUKA 1PL4A 3CXCU 2A6XA 4XJAA 1SMVA 3O5SA 1S72V 1MA1A 2NM1A 4YARA 1K5QA 2RN9A 4KHPO 3N2KA 5JOYA 5LHIA 2PZSA 5B1BB 4KWUA 5LK5A 3B77A 1W04A 4JGYA 3BU0A 2WL1A 2VNVA 4IV3A 1W6PB 4A7KA 3MW2A 5EWSA 3HKEA 4HSLA 1K73W 3TNQA 3OEAA 2MK3A 5JVDB 4QB1A 1DCSA 1KKDA 2V7QG 2QE7G 4XPVA 5GZFA 3T4DA 2A5ZA 4U36A 1I5YA 1BHBA 3ATGA 4D7YA 1XMQB 1OBNA 1XC6A 4EWDA 1NJIW 3KGZA 2B4KA 1R1A3 2V4DA 4LNUB 4HFSA 2N05A 4QX8A 1DQ0A 3LEKA 4FFHA 3N7MA 5EYPA 2QQKA 5C5TA 4M0HA 1LULA 3E6DA 1FFXB 2FDHA 2WNOA 3HPNA 3D3AA 4NE9A 1NA1A 1XPWA 2W5FA 3HVDA 4ZKTB 4RQEA 2R49A 3J7NA 4E2SA 3U1XA 4Z82A 1LOGA 3N9QA 2YXLA 3QCWA 4UI9L 1A34A 1PNMA 1BZWA 3VHOA 5E88A 3W7TA 2VNRA 3T08A 5IK8A 4MVRA 1YJNV 2BOBC 3BYWA 2LQTA 1VBD2 3CCEV 1ND2B 1G8WA 1COV3 4RR3A 3MLLA 5GLTA 1KKCA 3VD9A 4P02B 4O4IB 2ZGOA 5DUVA 3HKBB 1EAH2 5L3DA 4AI9A 2W1WA 3VBHC 1ND3B 4ZXKA 2Q8VA 4TLGA 2OT7A 5B1NA 4FPFA 5KWRA 2A3QA 4DR3B 2OYZA 3PUAA 1MOFA 4D3WA 4N21A 5LATA 2PTMA 5IYYA 5DUWA 3LOBA 1BS3A 3JD3A 3VKMA 1ULCA 3AG7A 4XEZA 1ASJ1 5CFDA 1ZRDA 2XBO1 1I94O 4D6SA 4JI3B 1W8OA 1B06A 3FAVB 3NV3A 1GN6A 1A8MA 1GNYA 2DMXA 4Q4V2 3JQXA 3N9NA 4CCCA 3MLKA 1VIWB 4QD2A 4RS5C 1JOPA 2GV9A 5F3GA 3IDBB 3AM2A 2Q5TA 3L70H 1XMOO 3I5DA 2WLIA 5H9CA 1V6IA 4WBNB 2IZWA 1KECA 4HVRA 3ZOIA 2LROA 1WW5A 2RS33 4P00B 3ZPYA 4UT5A 1PV0A 5KMGB 2Q8OA 4GIQA 1PIV1 4JX0A 3I59B 2JEUA 3FHAA 1AR81 4W4LA 1KP2A 5FNVB 3GCXA 2JB4A 4P9GA 3OMAB 2ZAAA 4N8MA 2E74B 3GYDA 4O4IA 1SA0A 5LWBA 1OLRA 1OOPC 4EN0A 2DCZA 5A3UA 2V09A 3DYMA 5IWAB 2EIDA 4JYAO 1F7YA 1QXRA 1MS8A 1N36B 5DDJ2 4CDWB 5I8SA 4Y22B 2JDHA 3K75B 4MW3A 2WN2A 2QQLA 3G71V 4YPJA 2DUQA 1GKFA 4GUNA 1BSMA 1XU1A 2YSUB 4IIJA 4NIIA 1STMA 1PO23 4J10A 4CS3A 1DGLA 1ZX5A 2GP3A 3VBHB 3FE5A 2YC2A 5KC5A 4LLFA 3MDSA 3LSDA 3WQBA 3DKQA 1DDLA 1S0IA 5T5LA 4Q4Y2 2RMKB 4DV7O 1UMHA 5LA6B 3PLQA 2FZ2A 2Y69C 4EEQA 5F5AA 5E79Z 3CC4V 1QNMA 3ETEA 3AVSA 3SMHA 2L9LA 1KC8W 2TBVA 2VR4A 4YW4A 3O1MA 3QVNA 1D2QA 4ASLA 3LUTB 4R4XA 3WNOA 3SJBC 5IYDO 1DGRN 2PY5A 4AE2A 1NT0A 3I2OA 4PA4A 1CZTA 2WRAA 1EV11 5FJKA 2YBSA 3MIDA 4ITCA 2OQ6A 2P6JA 2BEOA 5JXGA 1YHQV 1AJKA 4P08A 2JGDA 5FZFA 1UJWB 3GM8A 3K4ZA 3DN7A 5IWAO 5FP9A 4X62B 1XI1A 1ZSPA 3MYXA 4DB5A 1QY4A 2NPIA 1GUIA 3RVZA 3NAPC 5DAQA 4PDWB 4WZCA 1SZTA 4DEQA 2B9ZA 4OYUA 3SEPA 5EC2C 4XDPA 1NXMA 4Y1YA 2WSUA 1FPN3 1CXZB 1N33B 3OAAG 1JW6A 1PNGA 2HLDG 2P37A 3K46A 1I7FA 4GKJB 2WO1A 4PDRA 3THOA 1VQ9V 4FFBA 2KA3A 5FLIA 5L7OB 1QU7A 1UIJA 2E7TA 4YHHB 5I0UA 1S0BA 2P3JA 1MSDA 4EROA 1D0HA 1TZOA 1AJNA 1O8SA 4OZOA 3WSOA 2GN7A 2F1MA 3RQ0A 1V0AA 3UJOA 2D6LX 3A22A 3ZEDA 1D4VB 2R062 3BGAA 3D36A 1XNRB 5D1IA 1FAYA 4LHLA 4JI3O 3KV4A 3LD8A 3A0RA 4QQ2A 4B29A 4X20A 4EWAA 2BE3A 4CP9A 1FOD1 2XQRA 3HJRA 2FDKA 3PN1A 3N2GB 3AX4A 5CVRA 4I3GA 3ZFGA 4KNCA 4X64O 2EULA 4GMP0 1OH3A 4B4RA 4RYDA 1OPOA 1M4UA 5A3WA 2AEYA 2WAMA 5LEJA 1IPKA 1UZVA 5LA9A 4RN5A 4FTBA 1W6MB 1E5HA 3LOIA 1NA1C 4I55A 3WD5A 3CRQA 4XMAA 4X6RB 2VQTA 4AF9A 3RYFA 2NYYA 1K4CC 4HANA 1FPOA 4IEUA 3ZMOA 1N36O 1C8M2 5DZFA 2RCVA 3LNNA 1IBLB 5A6XA 4XUPA 1HJGA 5FREA 1A32A 2UU9B 1QJY3 4LJHA 3ML0A 5JSOA 4COYA 2X7RB 3C7OA 1LEDA 1U5XA 4FZ1A 2HLEA 2VE1A 4LR3A 4CC5A 2NMOA 1GMGA 4E4ZA 2OCCC 3LIHA 2YUAA 1H1AA 1O5UA 1QDOA 1G9FA 4FPHA 2BJSA 1VARA 1NR1A 2FBEA 3ZYBA 1AR62 1FMD1 1NU1H 2GNTA 3ZXKA 5H9SA 4IETA 2WZEA 1PZ9A 3QG5A 1IBMB 1ZBE3 4XDLA 2EA7A 2HP8A 4GA9A 1M5IA 3ZIWA 3ZKYA 5LP6A 4HT1T 5B3SC 4DV4B 1L7LA 2C24A 5BNOB 3NL1A 2UXCB 4XUQA 1VQNV 3M7MX 1RM1B 2Q9LA 3NNMA 2BGCA 4NHMA 3O1UA 2QSAA 1W0PA 5LASA 2AACA 5FXVA 4CE8A 1Q8OA 3V0AB 1UOGA 3ILNA 5A1AA 1YITV 4I7ZB 3C3SA 1BMFG 1LR5A 4BU2A 5GZGA 4E2LA 3VL8A 5FJHA 4DR5B 3AZXA 3H7JA 4HOOA 4R9BA 4LFAO 3S7EA 4KWLA 3L9JT 1VQLV 3P1IA 4CA9A 3VQXA 1WW7A 1UW8A 1SFPA 4B3TB 3SPCA 1QXJA 2Q1MA 3Q9OA 4YYOA 3ZPOA 2GUZB 4BE3A 1RUF3 3CJIA 4GH4B 4FXKB 4QPKA 5A33B 1ZRRA 3VHNA 5T3NA 4M00A 4CCEA 2BOJA 5IK4A 4Y22A 3LA7A 1HN1A 1OPMA 2W1QA 2AW9A 2F4VO 4MVZA 4UVCA 1NKDA 2J1UA 4DXSA 2H94A 4FSJA 4N9IA 3ZRVA 3OEHG 3J7HA 3E86A 4Q0VA 4ZZ5A 2D7FA 2OKXA 5ITZA 2GMMA 4JRAA 4NIGA 1BBT2 2VVEA 2EINB 4PIYA 3WHTA 1PGL2 1EZJA 1BVVA 2ZE8A 4CPBA 3JCZA 3GJBA 3POSA 5GZEA 1EZVH 3WY6A 4K6BA 3VB9A 2EIEA 3OD0A 4OQ9A 2DWDC 1LNSA 1HQLA 2IVJA 2PHRA 4FPJA 2VMGA 1LESA 4YVSB 3ZMTA 2A06H 2VMIA 1LTEA 2DUOA 3U07A 3GF6A 3NV2A 2P5BA 4RFT0 5B3SB 1I9RA 2AHYA 1N0JA 1DGRA 2FQPA 2E33A 5BNOC 1EFRG 4DUYO 4DXZA 5B1OA 4WFGA 1QBZA 4GJYA 3ZN0A 4MGKE 5GZCA 4PI0A 5FO9B 1IBKO 5FOBB 1UY3A 5JI7A 3JCUZ 3I55V 5LP6B 5FRAA 5BNQA 2KD7A 4ABMA 2C6SA 1EAH1 3IDEA 1XNDA 3OBTA 3HN3A 4GAZA 4K0KB 3SJCC 2A6ZA 3A0NA 2Y60A 1ULEA 1PMJX 4XMIA 2XHNA 4LK6A 1IQAA 1W90A 2VTXA 2ZTNA 3H1YA 4P9IA 2WZR1 4UFHA 5FYIA 3RWRD 4B3NA 5HPOA 4EWEA 1P8JA 1GTOA 1MACA 2XB6C 3KCXA 2R043 3VD5A 4MTGA 1AR5A 1WB7A 1MSWD 1NAEA 2UWAA 4MW8A 3AB0A 3I2GA 5ACA2 4IE6A 4JI8B 3EHBB 5A6YA 1AR83 1PM9A 3ENRA 4COVA 4HNAA 1NCRB 3AP6A 5A7NA 4LWSB 1RP3B 3OEEG 4QXKA 1W6QA 2BDRA 4DINB 5KX5A 4LNUA 3BN6A 2NN8A 4IEVA 1SQ4A 1VAVA 2JKXA 5EZYA 4RHV2 1JYXA 2ZCEA 5ERLA 1S3JA 3VBFB 5M0TA 3S30A 1QJX2 4QX7A 3EVKA 3Q8AA 1IS5A 4JTAB 4YW7A 3B9CA 4EB6B 1RUI1 5FYMA 4WM8A 2IM9A 1FFXA 3WDXA 2IC1A 1XL4A 4MLOA 5J36A 1H8VA 2MHFA 3EO6A 1NCRC 4IEQA 2Q4PA 2EF6A 3CP1A 5FXWA 4CU7A 3EJKA 2H0VA 5FNVA 3ZXDA 3SHRA 5JMCA 3JD1A 5KMGA 1U0AA 3JSLA 1HB3A 1D5NA 1I08A 3WQ7A 1XREA 4NHXA 4EN7B 3CBNA 1W2AX 2XJTA 3OE7G 1B35B 4TSVA 5JSPA 4OUSA 1XXNA 3FMGA 3CCUV 4BQXA 1O3QA 5DAWA 4DO2A 2RS13 3WCRA 1IZ3A 2O8OA 1DGWX 4CCDA 5J9PC 1WNSA 1F35A 4BM8A 3QO5A 1PMIA 3ILRA 2R061 1FXKB 4JGSA 4UB8Z 2FDJA 1RUOA 1D0GA 2E5LO 4DRRA 2A73B 4CDXC 3RZJA 1GNHA 2EXHA 1OCOB 2VULA 3WZ1A 5F1RA 4NRMA 2I07B 3CJIC 1GU3A 4IE0A 2HWC1 2UUBB 5HXVA 3ZFEC 4B3SB 1OFSA 2OQ7A 4CTEA 5D8AB 1XSQA 3ZYGA 5IAVA 1VE0A 3STZC 4AGRA 1O5LA 1X82A 2N04A 5FXZA 2X5IA 3TGUH 4RS5A 4QX2A 2IJIA 4EV0A 4E2QA 1DQ6A 1FXKC 4X6QB 4SLIA 3K48A 2BCCH 4NRQA 4N23A 1RUD1 5CFCC 1UPIA 3O7OA 2GTSA 1FATA 2UY9A 4KG8A 2Z42A 1SDDB 3SGIA 5FAXA 4HMZA 2PHXA 1X33A 3PJQA 3HEIA 1AX1A 2O14A 4KQ7A 3E5UA 3FL7A 1UMZA 2ZX2A 3DPRA 5IK7A 2B9VA 1QH6A 3ABZA 3WW4A 1WCUA 2PLV3 3APBA 2QKAA 1KFUL 2HVJC 4OPHA 2VCCA 4DR4O 2AZ2A 4UFJA 4WM7A 4TWKA 2E51A 3T30A 2EALA 4HKWA 2HKXA 3NW4A 1UZYA 3CS5A 4B4PA 2JG8A 5DECA 1FV2A 1F51A 2W0XA 3WDVA 4MTFA 5A6QA 4A42A 5SV8A 4B1LA 5JVDA 3F5WC 3TXSA 4WCEV 3OFNG 1JX9A 1H1MA 2W47A 3B02A 4DNYA 4GT1A 3VBSA 4AFAA 4EN8B 1BGYH 2DUPA 1K5JA 3FBMA 2MW2B 3CQOA 1NKGA 4DMIA 1Y67A 1FMD3 3ZCCA 4FPLA 3OCPA 2XL7A 1BKZA 5JI9A 3DGEA 1GK9A 1C8M1 4JAAA 1V6JA 2G1MA 1LCLA 4L0PA 4ONUA 1A3KA 3MW4A 4A5UB 3E83A 1CX1A 2Y48A 4ASUG 4LOSA 1FXVA 4DR6O 1J1TA 3DXUA 4CEYB 1SPPA 2JEXA 5DPNA 1S1AA 1AR91 1RSOA 3POGA 1V55C 2JDYA 4ZU4A 5A7QA 3K04A 3LPGA 4AEDC 4G3YC 1CAXB 5C3RA 4IYHA 1W8HA 3VZNA 2ZR3A 1S0DA 1WLTA 4AHXA 3AMNA 2YI9A 4DEVA 3HB3B 3G67A 2C9KA 2B46X 4I2OA 2YXHA 4ZKIA 2OT5A 4W8JA 4ATFA 2WLQA 2WAAA 3WLUA 4TSFG 1KDKA 3BTZA 3QNEA 2JG8C 3H1JH 4BPZA 1NTMH 1UPGA 1AROP 3M8LA 5I0SA 1JZ5A 3OMIB 4LE3A 1SC5B 3VDAA 1AJPA 4C90A 2V5DA 4CUBA 5GM0A 4Q4X2 2ZPXA 1QMJA 4YG3A 1AI4A 1TMF1 4Z2AA 3NNFA 5CYYA 4JZRA 2AGAA 1MZ6A 5GTHZ 1JYIA 4OUMA 2X6AA 1JA8A 2QKDA 3RBZA 5FO8B 1SLLA 4DXWA 2EILB 1ZBA1 5AC92 1ASJ3 1JYNA 5FLJA 4Q0SA 2CWSA 3JAWA 3QO8A 4W6WA 5EJ1B 2P5OA 4U2AA 1LECA 1MVQA 1QEXA 4LKSA 4XURA 1KUQA 4LBQA 4INDA 2X5IC 4J7ZA 2HWC2 1JUIA 1NG0A 3FLRA 1BEV1 4XILA 3KM5A 4UYBA 1P49A 1GO3F 2YXYA 4WFFA 1BHAA 3HPLC 4I5SA 3GBFA 3UQ8A 3SYQA 2X8KA 5FLHA 3N4MA 1ZX3A 1LGBA 4XFHA 1JH5A 1OZ0A 3FAVA 2F4LA 4TLFA 3JU9A 3ZHVA 3J80N 4Q8KA 4CDWC 3AYAA 4AILC 2YICA 1UWWA 3KV6A 3KB5A 2XBO3 1XHXA 1XQ8A 2X5IB 5JXJA 2BU9A 1JBCA 2YY1A 4X89A 2PHDA 1URXA 4NPMA 1NE6A 4GKKB 4AVSA 5JJEB 2RR12 3AG4C 5KA5A 3ZSJA 5J37A 4GQ7A 4AQ6A 1QVFU 3ZHQA 2UUAB 2DVGA 4HK9A 1JYCA 4N43B 1BLZA 3KQ4B 2Q73A 5FZIA 1ZL8A 4UW5A 1W6NA 2QDNA 3V64A 1JOJA 4XJZA 2HBUA 4V2VA 3B93A 1KD7A 3EMRA 2QNKA 2A75A 2UUBO 3WF1A 2Q4SA 1FS0G 4ZI7A 3WOGA 1DZQA 2EIJC 1E1RG 1UYZA 1O4ZA 2NN4A 3UT5A 5DDJ1 3B8MA 4B4QA 3USUA 1QR8A 2XUEA 3B9IA 1FT9A 4YW2A 4WM8C 2IH3C 3ZDSA 3M4FA 4FK5C 3T0AA 3AJZA 3O9OA 2AGSA 4J7JA 2QQOA 1OOPA 1Z7S3 5EJ3A 4DR2O 1GQPA 2ZGTA 1SS3A 2WT0A 3HKCB 3IPVA 4AQSA 4JTCB 1LHWA 1JN2P 3ZFFC 4LOTA 1FJGO 1OI6A 5C33A 1GH6A 4QGPA 2R1BA 4W4KA 3ZS8C 5C8CB 4XXAA 3V0BA 3C3VA 4ES9A 5L9BA 1P4RA 1NOVA 1M9NA 1OURA 4X9QA 3FHQA 4R8HA 3FLTA 1H8TA 4XAEA 1C4RA 1UO9A 4X64B 2ZHMA 3JB8A 4NIDA 4FLTA 3LQCA 5FZ9A 2WS91 1V6KA 2IXLA 1XNQB 3WB2A 2HJDA 4IV1B 2FMLA 5FZMA 4MZUA 4NPLA 4YG0A 2UU8A 2P34A 4WV8A 5BNPC 1YFUA 1ZZ7A 1CN1A 2VOTA 2KM2A 3VD4A 2ORZA 3MUZ1 1OUSA 4XDOA 2DURA 4E8DA 2LW8A 1RJ8A 1VRH2 3O14A 3DV8A 2LP7A 3G80A 4K35A 5T55A 2SLIA 1GR3A 1JQ0A 1MNGA 4YXWG 1AILA 2WYFA 2QQMA 1ZLZA 1T6GC 4O2AB 1GAXA 5EYPB 2RJ2A 4D94A 5LOVB 3B01A 5A7WB 1QCEA 5BNOA 4XTPA 2JDIG 2Q68A 3RI8A 1TNFA 3A21A 3UCSC 4JYAB 3GXUA 4B7KA 2Z5WA 1K3EA 4J6GA 3BPSA 1I1EA 4A6SA 2CGNA 2GSYA 2GHYA 1D4M1 2WLLB 1VQMV 3ACFA 1RUC3 4AGGA 3OD4A 1UKRA 2R9RB 4PDWC 4ZOLB 4LKFA 3ASOC 2WFF1 4FI9A 3LNMB 2K46A 4A7YA 2JIGA 5KAFZ 4XFCA 4PBPA 5LBBA 4C0HA 2CGOA 5A7OA 1AR71 4CDQB 2CH7B 3JAMN 4LIVA 3KCCA 3W5NA 4WF9V 4O4LB 4KI5M 5HXMA 4CBCA 1ND2A 1KXGA 5C8CC 4MT8A 3MV01 3LIGA 3G4SV 4JI0O 4BLJA 1Q5OA 4NUBA 3I56V 4LFCB 2UUCB 4D7SA 1N8RW 2G19A 5DAPA 2OIGA 4DV1O 5A33A 4LBNA 1PD3A 2Q8EA 2RQ6A 4PF1A 1X36A 4UCSA 5HI0A 3NV4A 2XJRA 2QWPB 1SQXH 1R1A1 4KBZA 3J7AU 4PIXA 1HN0A 1QJU1 2VZPA 4P5YA 5KBFA 4FM1A 2ATKC 5CZKA 1OH4A 4EQVA 5BNPB 3TNPB 2HVKC 4P9PA 1NTKH 2XLAA 3JALB 4GWIA 3SXWA 1XBFA 2Q0AA 4QX0A 2JGUA 1EN4A 3TCUA 2F95B 2RS31 4DW0A 4QX5A 1E5SA 4YWAA 4I4TB 5KX5B 2JXAA 2C4XA 3W21A 1L7QA 5IYZB 2GC1A 4K21A
chains in the Genus database with same CATH topology
2D3PA 5F6KA 3FZ3A 2DF7A 1RVF2 3AMPA 3KGZA 4Y1ZA 1RL3A 3AP9A 5KHIA 4Z2WA 1RUD3 4MSVA 2YMZA 1RMU2 3FLPA 5IT6A 1RUH2 1R1A3 2N7GA 5FMOL 4N90A 2NP0A 3IMNA 3R4DB 4LEJA 3SLIA 4HFSA 1XE7A 3GALA 1DQ0A 1AR61 2O0OA 5JIAA 1YFYA 3N7MA 1GANA 4M0HA 3E97A 4XFIA 1CAVA 1G9BA 3O2GA 1LULA 2BNNA 2W52A 3N3HA 3J9SA 3MEPA 3E6DA 2HWE2 5CAZA 1V00A 2ZGNA 1QGLA 3VL9A 1A8DA 1NYWA 3B69A 3QD6A 3O0WA 1NA1A 2DFBA 1NY71 4JGYC 4AXOA 2GC0A 2HJIA 4ZKTB 2R49A 2HWC3 4E2SA 1DQ1A 1DIWA 2VOKA 4H14A 4Z82A 1LOGA 1LOCA 3QCWA 3VBOC 2DWRA 4MGYE 3V15A 1CAUA 4L97A 4XF3A 1LENA 1UU5A 4I3PA 2WT2A 4J1WA 3ZXJA 1BZWA 3KGLA 3VHOA 5E88A 4YZ1A 3EBRA 4FOWA 3FHIB 2VNRA 5JVVA 4JTOA 5IK8A 1S0CA 3IIAA 3JD71 4GULA 1VBB1 4Q0UA 4FXGB 2VMHA 1DG6A 3ZSLA 2D98A 1LB2A 1ULFA 1ZZ6A 1VB4A 2JEMA 2RR11 1VBD2 2ZMKA 3H9AA 3VKOA 2YDEA 1G8WA 1ND2B 1UPSA 4BA6A 1H2LA 1COV3 4RR3A 3MLLA 3ST7A 4RQPA 5GLTA 5KXEA 4CZSA 3ECQA 1QHDA 1XRUA 2ZGOA 3UKTA 5DUVA 2XWJB 4J1XA 1GVGA 3M7AA 1C8NA 1EAH2 1KQRA 1VBE2 5JZGB 2RHPA 2X53S 1SLBA 3VBHC 1ND3B 2XBO2 2MEV1 4ZXKA 3AKQA 4RA0A 3VZOA 4FPFA 5KWRA 2OYZA 1RC6A 2D6OX 2YYOA 1ZYBA 4RR3B 4AVAA 4D3WA 1OQ1A 3RJRA 4GWMA 2BWAA 4M2EA 2PTMA 3UL2A 1UIKA 3AYCA 4BHFA 5DUWA 4AEMA 4UW3A 1MS0A 4XF9A 5BPXA 3LOBA 3ZXLA 3PHMA 1U5YA 1V9U2 2F4PA 3MIGA 1EAH3 4M2GA 3VKMA 2Y0IA 1ULCA 1RUI2 4IEZA 4XEZA 3VBSB 1ASJ1 1R083 1QNWA 4R52A 1Q8VA 5CFDA 4YVWA 4XFBA 4JGZB 5CG8A 1V6MA 1ZRDA 2HWB1 3KQRA 2XBO1 1AL22 2RJKA 1BK1A 1WA4A 3MF9A 1XU2A 2RE9A 2BPA2 5BY5A 3NV3A 1ZVFA 1A8MA 2NZ9A 2V73A 3NAPB 2D40A 5FMOS 1SCRA 3CJIB 1DYPA 2JG9A 4YNIA 4WM8B 2CAUA 5GLZA 3UV9A 2CTVA 3M3QA 1IS3A 1UU6A 1NQJA 1KRIA 4Q4V2 3JQXA 3E5QA 1QOSA 1QDCA 1S0EA 2YGLA 4Q4X3 4YRDA 3MLKA 2YGMA 3WW3A 1VIWB 4QD2A 4RS5C 1DQ4A 3R6SA 1CAXA 2RS11 3SCGA 1X8MA 4HBNA 4FAGA 3IDBB 3AM2A 4YZ3A 3NKGA 1C28A 3URFA 4Y20B 2Q5TA 2K9ZA 4O9EA 3UKVA 5KXCA 1VBD3 1QF3A 5AVAA 1V6IA 5DG2A 1COV2 2WLPA 2IZWA 1QH7A 4HVRA 2ZHNA 4GH4C 1LEMA 1VBE3 1I6XA 1ZNPA 4P9XA 5GLVA 1REFA 1XNCA 3WP3A 2VQ0A 3BODA 3B3QE 1WW5A 2AH2A 2RS33 4YVWC 1WMDA 3ZPYA 4BMBA 4XJUA 5A32A 3TN93 5CADA 3IM0A 1U12A 2Q8OA 3OY8A 4GIQA 1PIV1 4ES8A 3I59B 4GB32 1AR81 1HXS2 4HSJA 2CGPA 4P9GA 3IN9A 2ZAAA 2YROA 3GYDA 3C2UA 2JICA 1OLRA 3NAPA 3MIFA 1OOPC 5A3MA 2XH6A 5DUUA 5K8SA 1SLIA 2BWCA 2DCZA 4EN0A 2V09A 2IXHA 3ASIA 3D0SA 4UBGA 1QXRA 1MS8A 5DDJ2 4CDWB 4XJ8A 5I8SA 4Y22B 2AREA 1FPN1 5E1RA 4BOWA