2Y0IA

Factor inhibiting hif-1 alpha in complex with tankyrase-2 (tnks2) fragment peptide (21-mer)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
339
structure length
339
Chain Sequence
SGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/peptide
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Factor-inhibiting hypoxia-inducible factor (FIH) catalyses the post-translational hydroxylation of histidinyl residues within ankyrin repeat domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 339
sequence length 339
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2y0iA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2y0iA01
2XUMA 2CGOA 4BIOA 3OD4A 1YCIA 1MZFA 2WA4A 4Z2WA 5JWPA 1MZEA 4NR1A 3KCXA 4B7KA 2Y0IA 1H2KA 1H2LA 2YDEA 4QU2A 2CGNA 4B7EA 1H2MA 2ILMA 4Z1VA 2W0XA 4AI8A 3P3NA 3KCYA 3D8CA 2YC0A 1H2NA 3P3PA 1IZ3A 2WA3A 4JAAA
chains in the Genus database with same CATH superfamily
3ETDA 3AXDA 2HBUA 1ZZCA 1FYUA 3CF6E 1UU6A 3P3NA 4YW5A 2ET7A 4HANA 2OUJA 5FZBA 4Y1XA 3S5AA 2P34A 3SH5A 5CG8A 5B1BC 4EN9B 4WBNB 1AI5A 2IFWA 4MGYE 1HNZB 4I02A 4LNVA 4IL7A 5APAA 4AQ6A 5FP3A 1ZBA2 1OOPC 2HWE1 2HVJC 2EXHA 4HBNA 3MZHA 3ZXKA 4LA3A 4P9GA 5ABJA 2EIGA 2HKXA 1BE3H 1R73A 1U0AA 4CDUB 1DGWX 4DEQA 1GH6A 3VBHA 3VL9A 2QM7A 4IDZA 4Q4V2 1ZM1A 3RZJA 3E89A 3K5OA 3MF6A 1KBHA 1VLNA 4IE0A 4ZOLA 1C4RA 1PMHX 2DUPA 2HJDA 1EZVH 1XPWA 1W05A 2A71A 1TA8A 1S4CA 5HXMA 4CBCA 3WG3A 4AQTA 5A6ZA 1D0HA 1D4VB 1WLDA 1VE0A 3OUIA 4XJUA 3LDRA 1URXA 4LP8A 4ABMA 4IYHA 4JI1B 4FLWA 3ACGA 3G6JB 5FY5A 4G27B 1RUD1 4META 4QX5A 1CZTA 3U14A 2D6MA 4MH0E 4JGZC 4KI5M 1ZRFA 4K6BA 1E5IA 4J80A 4A5UB 2VU9A 1OCOC 1CAUA 3I2DA 4XZPA 1NH2B 2V72A 2P3KA 2D44A 1TUBB 1IDSA 3FB8C 4JHTA 4HZ3A 1MVEA 5FTTC 3K48A 2GH2A 5FJHA 3H1HH 2ZHKA 2AZ2A 3OGVA 3FHQA 3ZS8C 2DVGA 4HLTA 5IVCA 1AILA 3NR7A 5AG2A 2CWMA 1RHI3 1K33A 1NCQA 1A3KA 1I5XA 2VCCA 4Q6GA 2QKDA 1MG1A 2Q0AA 1Z7S3 5FBJA 3X29B 2E33A 4I50A 1YF2A 5FMCA 5EV7A 2A0LA 1LU2A 2EX3A 5FZOB 1AXYA 3L70H 1F51A 5FY7A 3Q8FA 1ENVA 4I55B 2J42A 4A7ZA 5KC6A 4LH7A 5I93A 2X5IB 3J7MA 4DRXB 3HJRA 3WHUA 2Q67A 3F5TA 3IDAA 5HV0A 3WF3A 4LNUB 4QPKA 5FUIA 2F66C 1IS6A 4LA2A 1OPMA 3N9LA 4AFBA 3CC7V 1ORQC 3M7AA 3I54A 4YHHO 2J1RA 5IUQA 3VDAA 2WO7A 3TN91 4CUGA 3E2EA 4O4LA 1DQ2A 4DK0A 1IURA 3J80N 3ACFA 4DR7O 3WF0A 1EN6A 1B3QA 1DGWA 2QTOA 2ZXQA 4N43B 5JQGB 1AHSA 1DQ5A 2W1UA 2WWSA 1QU7A 2D3RA 1TEIA 1C8M3 1IBLO 4DW0A 5LHHA 2OQ7A 3G80A 3DGEA 1MS8A 2GV9A 2QA4V 2D40A 2XOMA 4XXPA 2WJSA 4QM8A 4LFBO 1EPWA 3U1XA 4RQPB 4C0HA 4F83A 4FLZA 2ZX1A 3ES4A 1NI8A 3I59A 2EIJB 1US3A 1XNRO 3CJIA 1UPSA 4UFLA 2VOWA 2O57A 4KL1A 2BNNA 3JXSA 1CAXB 4NHKA 2PA7A 2ZXWB 1U5IA 3KGZA 1DF4A 1UFIA 4NRMA 3FUQA 4DUYO 1QCEA 1AL23 4ZKIA 1POQA 3JASA 2W95A 1KKCA 1OCCB 1WCQA 1S72V 1NCRB 1K5SA 3TEXA 5J2TB 4QX0A 1LRHA 1GN6A 1B09A 1OQEA 4AI2A 4LHLA 3N35A 3VZOA 5FPXA 4PHZA 2I45A 1AR72 1DFQA 1XI1A 1GP6A 4UCVA 2JB4A 3CB2A 1S1AA 1REFA 5T52A 1S0EA 4YM2A 2PQQA 5KHIA 5FYMA 5LA1A 3VBOA 1BGYH 2WNEA 3N9MA 1LUVA 5H6QA 4LF4O 4XMIA 1UPGA 5C8YA 3C7EA 1CX4A 2PI5A 3CZUA 2QBXA 4EWDA 4IEUA 1CVNA 5A3OA 4CCOA 1IZ3A 2HYXA 1W2TA 3J7HA 3KV6A 1O3TA 4CUBA 1COV2 1MZFA 2EIKB 3RZGA 4NXNO 5ABJC 1CEZA 3K5NA 4K7JA 3VHOA 5E6HA 4JQRA 4FIPC 4W4KA 1SESA 2A3WA 1H38A 4FAHA 3VBHC 2V09A 1NYWA 3D6EA 4DXZA 1RXFA 1QU0A 1NZCA 4FPYA 3E83A 2K0GA 2R32A 3ZYGA 4LFAB 4IV1A 1S5JA 1ULCA 1EN4A 3WDXA 4X8AA 3JARA 1FNYA 4ARYA 4TV9A 3JD71 5AC92 2F4VO 4Q4X2 2IJIA 4EQVA 1GZWA 4N21A 2ARCA 1RMU3 1CXZB 1ST8A 2W1WA 1K97A 4DV1O 4J25A 4JI0B 1JFFA 2W6JG 3WX5A 2AACA 4AE2A 4K8XA 2LP7A 2VZSA 5FPVA 4FI9A 5KUKA 4QQLA 1X8MA 4Q4W2 2UXXA 4D6RA 3SITA 1QMJA 5BNPB 3VN4A 4ZS3A 3JUUA 1Q43A 2F1MA 3EXUA 2ADPA 1QH6A 2VWJA 4YZ1A 5EBLC 3GM8A 2XPJA 2MNGA 1NJIW 3K3WA 2QDRA 5GTHZ 1HJFA 1C5IA 1NT0A 3OTOB 2YXSA 1XMOO 1NCQC 1HNWB 1C57A 1CZVA 1S77D 3ZRWA 2XUEA 3ZPOA 5GLUA 3PVEA 4GMP1 1W39A 2E26A 1PP9H 5IE9A 1X9PA 4W65A 1RUE1 3KT1A 5A7PA 3DSQA 2XAFA 4LF9O 4FPEA 4IEYA 4FO9A 2ZGOA 1HXS2 2IJJA 1OD3A 4QXCA 2JDIG 1O6UA 1AP5A 3AJYA 1VAVA 3HR9A 3UKTA 3HNMA 4GX0A 3BABA 3P3PA 2XMLA 1MEC1 4B08A 3GHMA 1KS5A 4XC9A 4UWDA 4AEMA 5JR2A 2LO1A 5IJ9A 2W52A 2OT7A 2ZS6B 5ACA1 2YXLA 1WA6X 4YJ2B 3PUQA 3NXSA 1W3XA 1HW7A 1K7DA 4I5SA 5IVBA 4NUBA 3N2GA 3I3DA 2XLGA 4HN1A 1UYYA 2PHUA 1PNGA 3BPSA 2DCJA 3Q9OA 2DCKA 3IDBB 1D7PM 2J1AA 4RS5A 1G6UA 4H55A 1G9CA 1J59A 3ACHA 1BCCH 5E1AC 3O1VA 2HHHB 2UUCO 2XXZA 5J2UA 3GYDA 3RPQA 3BOWA 1RL3A 5JIUA 4E4ZA 1A6CA 1LJ7A 2JWPA 4YJ3B 4NRPA 2W1QA 1DK1A 1F4NA 2C9KA 2VRZA 4D7TA 3VBRA 4CH6A 4UCSA 1YI9A 4M4PA 1QJEA 2WQ4A 4XFHA 2XT9A 4FMTA 4OX9B 4BH9A 3VHRA 3WG7C 4R7CA 4PA4A 3LSDA 1V70A 3JAMN 1H6XA 1WMXA 4JTOA 4O9GA 3JCZA 5F1RA 4WFAV 3HOBA 3ZYJB 1OKOA 4DV4O 4E4DX 3H3UA 2DCTA 3FFZA 5FNVA 4XHBA 3LPFA 2WNUC 4X1YB 3VBOC 3INAA 1M56C 4CDWB 1XB9A 3H7YA 3J8F3 1BBT3 2ZGRA 4Z1VA 1AF9A 4RUEA 1UX7A 5A33A 3GB7C 4FLTA 4NPRA 1F9KA 3OMIB 3BY6A 1WMFA 2UYAA 4ZHQB 1Z78A 1R1A1 2OT5A 3USSA 5J48A 4LLFA 1PGW2 2ZR3A 5L3CA 2ZINA 2GSMB 1JQ0A 3N7JA 3OGIB 3NQHA 4QQHA 1PK6B 1I3HA 4BCUA 1W0JG 2VECA 2VAUA 3VZMA 4XUTA 2E5LB 1WNSA 4L9BA 3E6BA 3VQWA 5FZ0A 3NNGA 4IV1C 2ENRA 1K5QA 1FMD2 3VHPA 3I2GA 3V0BA 4DRVA 4XJAA 1RUG3 4XBQA 4FBFA 2JX9A 4FVVA 1AX2A 5IFTA 4KG8A 2QQUA 2KSDA 2B9UA 4CCMA 2M6YA 1XNAA 2J7MA 3VD4A 5F3CA 3ASOB 5GTIZ 1COWG 1BXHA 4J7JA 3LA7A 5LXTB 1RITA 2QQPA 3RBZA 2XH6A 4CH3A 2DQ0A 1TME2 3ETQA 4MV2A 3WY6A 1PMJX 2HYKA 2D6OX 4OQ9A 4XAAA 3QO5A 1JYVA 1QOSA 1J3PA 4O7XA 2VNOA 1HJGA 1XL4A 2EZPA 3HEIA 1WBLA 1OQDA 3RS6A 3OR6C 2CGPA 4O4IB 3DYOA 2BGOA 4L92A 3ZMUA 1DIWA 1E1RG 1X36A 5CBLA 2RM22 4WM8A 5HFLA 5DQ0A 4PQ9A 2P6JA 1UXXX 5B1AB 3CDZB 3PU8A 2ORXA 1JZ5A 1BQZA 2BWCA 3OUFA 2Y69C 3GZAA 4JTAB 1OVSA 1LHOA 1K5MA 1ZVFA 4MGSA 3JAWA 2BE3A 3B8NA 5I0DA 4NAOA 1QF3A 4MGTA 5BR8B 3P1IA 4HPKB 4MTXA 2TEPA 1M57B 2ZGNA 2VTXA 4YIOA 1IBMB 5JH7A 2C9AA 1XREA 4KMQA 1BQPA 3KWVA 5FAXA 1XSQA 3UT5A 3R65A 5I8YA 4LF6B 2X53S 4A45A 2R042 2KQXA 4OPHA 1VRBA 5F6KA 4XMAA 1Y43B 4CS4A 4LFCO 3CMEV 4UBHA 5LWBA 2HWB3 3TNQA 5DAVA 2VOXA 4L87A 4JGSA 1QLEB 4TUYA 5DDJ2 3N7KA 2UWBA 3I3BA 3VD3A 1PVC3 5KXBA 5CA3A 4JDMA 2GN3A 2ZE8A 2BGCA 1CAWB 1R093 4ZI7B 3UV9A 1YTFD 4S2HA 1S2BA 4RS5C 1XEQA 3CEIA 3ACIA 2WZR2 4JDOA 1QHTA 5FYBA 1THZA 4MHUA 4QPIA 2BP6A 1SDDB 1ZX5A 3W21A 1YO8A 2NN8A 4K20A 1M4WA 4M0NA 3VKLA 4FP3A 5CFCB 3JAKB 1DGLA 2ZQMA 3WZ1A 2JIGA 2Z4FA 1F5FA 4BMBA 3WB1A 2HWF1 3H9AA 2KG7A 4LBJA 2XBO2 4JI2O 2VCBA 1FPN2 1WLEA 3VBRC 1VAKA 1VBE2 4YG0A 1I94B 4K3AA 4WFGA 2V7QG 3SKJE 3BUCA 1Q6UA 3LIGA 3IIIA 1MSDA 1OV9A 5D8AA 3AYCA 3BA9A 3LDCA 1TQ5A 5CAZA 2CL2A 1Z5WA 4UAPA 1QXJA 4UVAA 4MYEA 2EILB 4G9SB 5CU1A 4DW1A 5FZ4A 3MDSA 1BS3A 5JI9A 5IYCO 5IWFA 2K9PA 5DMYA 4Z1MG 1QH7A 2XAHA 4QHZA 4LULA 2JE8A 3SEPA 2X7RB 1ZBE3 1S0DA 1AYN1 3AL6A 1W8UA 4OMCA 4QGLA 1JYTA 4H13B 2DCZA 1PNKA 4KHPB 2QKAA 4XILA 1BL8A 4WM7B 3WCSA 4OQ8A 4XHXA 3N2KA 5FYHA 1O4YA 4FCAA 1CONA 1UWWA 3RQ0A 4EFEA 5DAPA 1V54C 2A3YA 1HNXB 1S76D 3WF1A 4PELA 1PD3A 2WL1A 1AB3A 4NE9A 2WQZC 3R4UA 3C3TA 4DR4O 3SJBC 2CH7B 4XDOA 2QWNB 1H8TA 2JJ1G 1QJU3 4KWLA 1VMGA 1GAXA 2WA4A 1W6NB 2UU9O 2RS51 2D6KA 3MIGA 1CP9A 3HKBB 2VQFB 3HKDA 1EY2A 3IPVB 2E76B 2JE9A 3FB7C 1PGL1 5FPBA 2VC9A 5L19A 4AILC 3FL7A 4BISA 1MZ5A 3AM2A 3IMNA 3VD5A 4A3XA 1IHMA 4IUGA 2DF7A 1JXNA 5F5AA 4CCNA 4QKFA 2Y6HA 2R063 1H4GA 5BPXA 5DAQA 3VBUB 1YIFA 2DWDC 1YJWV 3KQ4B 1HN1A 1ZNPA 5A3TA 2Y0OA 3M1HA 1C28A 1GNHA 1V6KA 5FUNA 4YSFA 5A70A 1SBEA 5DXDA 3PVOA 1N3OA 1UZWA 5F2SA 3EO6A 2K1EA 3AMNA 3GDBA 3VUOA 1K92A 1F8VA 4W50A 3MEPA 3ZVXA 4GWJA 1VQ5V 1AR82 1VQMV 3KZIZ 5FPAA 4WFFA 1RUH3 4LF5B 5IK5A 3AP5A 1ULPA 4WM8C 4I0XA 1AYM3 4A7KA 2HBTA 4YG6A 3FX7A 1K5JA 1KUQA 1O4TA 1XL6A 4MXVA 2PZSA 1V6LA 4UFZA 1K5MC 3CKHA 3MPBA 5HXVA 4COZA 3RYPA 5IYZA 4DK1A 4IE5A 2WFF3 1GM9A 2DVFA 3GJAA 1RUJ2 2L6LA 1XYOA 3NVCA 4QQOA 2LM3A 1N1SA 3U4XA 3WDTA 4D8MA 5CFDA 1QIQA 3M3IA 5F5IA 3ZHVA 3E8BA 5CB4B 4P9OA 1S2KA 4N23A 4XCBA 4AGVA 1ROPA 3G6EV 5TISZ 5CZKA 3FWEA 5BMVB 3M2MA 1KJRA 3VZJA 1XE8A 5SV5A 1VB2A 3I5DA 4F3JA 3LE0A 3SMHA 5CYYA 1ONAA 3K9SA 5FQ0B 1RUOA 4P9YA 2OVUA 4AG4A 2VQEB 3ZFEA 2IW5A 4NO4A 4YW3A 4BIOA 3H1MA 3KMHA 3B3QE 3H1JH 4YLZA 1LESA 4TSFG 3MYXA 4YARA 4UFKA 1AROP 4H0LB 4AI3A 2GHYA 3OYWB 4G2KA 4HSLA 5LZ6A 3LEKA 2XGXA 4GMP3 1DZRA 1GWKA 2DFBA 2JDMA 1U97A 4C1XA 4FLXA 4DZGA 2FCVA 1ND3B 3VKFC 1DYOA 2JDNA 3OFNG 3ABLC 4OLLA 1OCZC 2D43A 1RFYA 5I0RA 3POIA 2OPKA 1LOFA 3QD6A 5FXWA 4HFSA 3RYHB 1EBOA 2VZQA 5L7OA 1MEC3 1W6QB 3I7DA 1WGPA 5D8AC 4GYCB 1YFXA 5L36A 1NBMG 4OULA 2DCYA 4FZ0A 1J84A 4JI3O 2BFUL 3RJRA 1WD4A 3WNXA 3L72H 2A1XA 4NR1A 2AC1A 2ZCWA 1WA8B 3S6PA 1XNKA 1FV2A 1Z0HA 5JOZA 3D3QA 4PLMA 5BNOA 1OHFA 4K1YA 5FXZA 2GC0A 4NHXA 3V65A 1WLCA 2EIMC 1LHUA 3POSA 4RHV3 1XJAA 1JYIA 1GKFA 4EN0A 4JYAB 4Z92B 4Y33A 1TUEB 5JXGA 4D6TH 5FLJA 3T0AA 4LF7O 1BMV2 1QR8A 1XNCA 5JOWA 2Z3YA 3PUAA 4OUSA 2JG9B 5A7QA 5DUXA 3T0BA 1H8TC 2NLRA 2YBKA 5FO9B 1CWPA 4EKWA 4EYUA 3RYFA 2ZDIA 3WW1A 5LHGA 2C4XA 3E22B 1JS9A 4N9HA 1WN7A 2IJHA 5CKMA 5LBFA 3ZYPA 3BGAA 2ET1A 3KCXA 3W7TA 2L9LA 4XURA 3GGLA 3ZN4A 4KNCA 4I4TB 3H1YA 5M0TA 2PAMA 3LOIA 5FZ7A 2FDHA 1RUI1 2JDAA 4FJCC 2FMDA 3CJHA 3WW3A 1GRJA 2GC3A 1BK0A 3BIWE 1AJNA 4JI4O 5DAXA 2X05A 1ZZ8A 3ABMC 5FXVA 5FOJB 1TVKA 1S0BA 4WVVA 1V9U3 1VBA3 4D6SA 3CCEV 2WAOA 1X50A 2QQNA 1ZLZA 1JZ2A 4K0KO 2ZBJA 2PHTA 2EF6A 1NR1A 1W6OB 3ZHTA 1ZREA 2QZ2A 3BFRA 1K45A 5A7NA 2VMIA 3SH3A 3JATB 5FZLA 2P5OA 5F3GA 2QR4A 2RS11 1PL0A 4I3PA 4C91A 2CGNA 3ZXFA 1BEV1 4JAUA 5CMUA 3UL2A 5FPOA 4Q27A 2B45X 4JI5O 4ARXA 3K03A 4IIJA 1C1LA 2WC2A 4I7ZB 3Q8AA 3VHNA 4N7IA 3TCUA 4D94A 5HV4A 2XJTA 1GANA 4WVZA 1QEXA 2I74A 4DR5B 4Q8KA 3JBG1 2RR11 5CFDC 1QJY3 3ZSEA 4GKYA 4AVCA 2CAVA 5IY5B 1V9PA 2WLLA 3FB6C 5EYPB 5DPNA 3VBBA 1MQTA 5LBQA 2W47A 1OZ0A 3HT2A 3CD6V 2TBVA 2Q8VA 3KF3A 3NJZA 4IGPA 3FAVB 2DW4A 1ALYA 5T5PA 3UCSC 4FPCA 5EQUA 4QPGB 1D4M1 2CHHA 2PQSA 2XVLA 1K4CC 2QWPB 2VZPA 4A7YA 3NNMA 4M3CE 3ZFEC 1Q8OA 1WUVA 3K2OA 5HBAA 1NG0A 3V0AA 4B3SO 1J1LA 3N9OA 5B3SB 3WF4A 5FZ9A 4TV8A 1RUC1 4DUZB 1ZA7A 3HQRA 4IL6Z 2YI9A 2VMDA 5CA0B 1BHGA 1XNQO 4AI9A 3ZYFA 3QTCA 4R4ZA 4AWDA 1LR5A 2OW4A 1L3JA 3LOBA 1ZBA3 2WAAA 4HOOA 3MHSC 4JGYA 1SPPB 4CU8A 3AVSA 3SPCA 1LOFC 4LPLA 1JCHA 1A32A 4LBOA 4BJ0A 1H2KA 5L7OC 2R9RB 1JU4A 3NNJA 4LBQA 3O1MA 4OI0A 1S0GA 3RNSA 5T3NA 3AK2A 4ZIBA 4KH9A 3KD4A 1V6JA 3FUOA 4LJHA 3OBRA 2HWD1 4Q4Y2 4ES9A 3ZEDA 4WFBV 2GC1A 1X8EA 4DV0B 4KWUA 4Q4V3 1NUKA 4P00B 1NZIA 1LOBA 2HH9A 1AR4A 4A2UA 4P08A 4DUXA 2Y8KA 3IB3A 2RDCA 4N53A 1JMUB 3T4VA 5BNOC 5C7GA 1KKDA 4KXRA 5F32A 3CRMA 3LQCA 5GZFA 1OVPA 4AGGA 4B7EA 4UW6A 5JLVA 2Q8OA 2R72A 4RUFA 1NTKH 4RR3B 4U36A 5B1NA 1F35A 2WO2A 4JI7B 1KFXL 5DDJ1 1JZ6A 2ES3A 1XYPA 4K1ZA 2CV6A 5FLIA 2B42B 4BQXA 2QGNA 2EBOA 2JIZG 4FAGA 2LQTA 2ZDIC 2NNUA 2VH9A 2YIAA 2RMU1 2BDRA 2YEVB 5D21A 1VQKV 1UY4A 2H3OA 2YC2A 2JE7A 4FFHA 3PLQA 3WW2A 3W7XA 4BW5A 3OEBA 2DOSA 3QVNA 1GTOA 5KMGA 5L3GA 2LRPA 1F2NA 4I9WA 3CSXA 4UCOA 5J98B 1SA0B 1U12A 4DV7B 5LY1A 1AUYA 2CAUA 1AYN3 1X82A 3S5QA 4IQPA 2VO5A 2XL9A 5LYJA 2B1IA 3SDLA 4X62O 5KC5A 2UUBO 1VRH2 4AAXA 4BU2A 1YXWA 1NKGA 3DGTA 2GZWA 5JSRA 4X8PA 2PLV2 4F8AA 3ILFA 5IAVA 1UO9A 2I07B 3VBFB 3WP3A 4CDUA 5HCBA 1Q3EA 4FLYA 1I08A 4AVAA 1C3HA 1WLWA 1YCIA 4I9QA 2K46A 1N4CA 4UF0B 1VBD1 1EV11 5BZBA 2RS53 3K5LA 4FQZA 1EAH1 3R05A 5JVDB 2GUZB 1QJX1 2QQKA 3KSCA 2YI8A 3TYJA 4PI2A 1GOFA 4FPOB 3HPLC 2GNTA 5K8SA 4TZDA 5E88A 2W2IA 3VZKA 4YW2A 3B02A 2PGGA 2X09A 5IJ0B 1O9GA 3IMMA 2YYOA 1TNRA 4XF1A 3PTYA 2G38A 3J9SA 4UFHA 3PVBB 3RYRA 3IN9A 3ZYRA 1TUBA 4XFFA 1MQTC 1O3SA 1WW5A 3ZLIA 4RAIA 1SLCA 4HN0A 3VKNA 1SQGA 4JI6B 3LDDA 4YIPA 1VR3A 1BCXA 1ZUQA 1POV0 4XBLA 4QDRA 2QE3A 2AGSA 1PNMA 1QBZA 4YW1A 4LBKA 1UMIA 4IV3B 1OCRC 1U96A 2RJLA 1AR73 2XLAA 3OAAG 2HJFC 4UXAA 1NAEA 4AQYB 3KV5A 1GICA 3C7FA 2AYHA 1SQFA 5C9AB 1NS1A 2FYUH 4AAPA 5C5TA 1AR92 2ZA9A 4Q1RA 5J9PC 4DEVA 3E35A 2DBNA 4I55A 2ZZJA 4BWOA 3ZN1A 2Z69A 5CBGA 3AKTA 4AL9A 4H7LA 1FFXA 2X5IA 2Q9LA 2C26A 3AYAA 2BTQB 2YG0A 3OOXA 2A6ZA 3QOPA 3ECQA 5A1LA 4LNUA 3EHKA 2DQ3A 1HNZO 4FVMA 5EPAA 1COV3 4JGYC 3MIDA 3AL5A 3ZSJA 4JV5B 1RVF2 2VXJA 3H7JA 4GZRB 3OEHG 1OH4A 4Z07A 4E4SA 4JX0A 3O1PA 3CS5A 5H5NA 3JD0A 2IZWA 3GNEA 3OUSA 4V2VA 1UNBA 4H37A 2Q7GA 5FREA 5EZWA 1UXZA 3X2QB 3PUHA 1OF3A 2FZ1A 5LMNB 4N43A 1G6NA 4AYUA 2RCVA 3T1HB 1O8SA 1ZZ9A 3Q4HB 3EMRA 2N04A 1IQAA 5AC93 4Q4X3 1OOPB 4GJZA 4N53C 4DS0A 4XJ9A 1RGSA 4UVBA 4LKEA 2DN9A 4JI1O 4WZFA 4CC6A 5JIAA 3ZHQA 2D2CB 4UCRA 1YQ2A 4BQWA 2A3QA 4CEYB 1OXCA 4RQPA 1DQ0A 3ZYBA 1NE6A 2VOKA 4A6SA 1CAXA 1SQXH 5C33A 2NN4A 4KWKA 4PDLA 3D0JA 4QGPA 3NL1A 5FPZA 1NLSA 2BBAA 3TJTA 2BYVE 4DV6B 3HT1A 1OA3A 2BOCC 3WCRA 2V4AA 1NCRA 4CEWB 4DO0A 4TLFA 5J2TA 4EV0A 3NO8A 1NA1B 3NV1A 1OA2A 3WF2A 1WCDJ 2GN7A 4JGZB 3ZOIA 4ASKA 4DMIA 1SQQH 4Y1ZA 1NX9A 4Y4RA 1TMF1 3VBSB 1YZBA 3AKRA 3BALA 1HXS3 3GBWA 3D3IA 2BFUS 1IBKB 4YM0A 1JX9A 3HMYA 1IPJA 3B4SA 2ZKOA 2G1MA 3CCVV 1NTMH 3I2KA 2QKCA 1ZZ7A 1OJHA 1Q5OA 3CE2A 1AI6A 1FXZA 3NAPC 4JASA 4LIUA 1LULA 2PTMA 1FAYA 3JU9A 2D98A 5FP8A 4NHYA 1S2EA 5C6CA 2NQYA 1QDOA 3MIHA 5FV3A 1XNDA 3K75B 4PJ0Z 2D93A 1B06A 3WW4A 5A6XA 4GKKB 3ZSKA 2HWE2 2ZE6A 4XFGA 4UOJA 2HEVF 4CDUC 3T2PA 5LGUA 3T4ZA 1W8ZA 3OPTA 2B7YA 4AI8A 2R1DA 1WJZA 4LBQD 5A6YA 2DBIA 2B39A 4AHCA 3TGUH 2IVIB 5JAXA 3POFA 3DN7A 2Q68A 2ZX2A 4YGDA 4DXSA 2KD7A 3U37A 4RFRB 1KP3A 4K21A 4M01A 4ZKTB 2OUHA 1HIXA 2MPFA 2P6CA 3SEEA 4G3YC 1F31A 2CDPA 3TAYA 1BMV1 3B94A 5EC1C 1RUD2 2C5DA 1E57A 5FP9A 3UJQA 1ZRCA 3HQUA 2BPA2 1V6MA 4DPNA 1XE0A 4DYLA 1M1KW 1CESA 1ACCA 4GB31 5BNPA 2CY6A 3T2QA 3IGAC 4BQ4A 2CK3G 3ZXAC 2R0FA 5A1AA 1YUDA 1UCXA 4HETA 1QNMA 4CP2A 3ZRSA 2H6BA 1O59A 5I8SA 5C4WB 2J1UA 1DLBA 4FPPA 3ROUA 3I3MA 2ZD9A 2XNDG 1R64A 1N8RW 1LOCA 4XUPA 3T2OA 3ZDSA 5FJKA 4NXMB 2Y4TA 1QQP1 5JMOA 4CZSA 1SQBH 1XMQB 4IESA 5KBFA 4LMFA 4EB6B 2W68A 4Z8BA 5DG1A 3W20A 5EP9A 1OFSA 1JYWA 4MGKE 2X5IC 4LCUC 1FPOA 1SKVA 2PHDA 1EFRG 2E6VA 2Y64A 5LGTA 2MEV1 5HCAA 3CMGA 4Y20A 3T09A 5FPLA 4NWWA 4HVQA 4YZ4A 2VVFA 2H0BA 3ASNB 2RR13 3LDBA 3K58A 4YJ2A 1I5ZA 2UUAB 3Q8CA 2OCCB 1S5LZ 4YG3A 2OYQA 3GJBA 5C3RA 3QBQA 3AC0A 3TN92 4DR3B 3BRCA 2BOBC 5EJ1B 1YJ9V 3T1YB 3KGLA 4N43C 2HJIA 3NRUA 3VDBA 3WQ0A 1FMD3 4LFAO 4YZ5A 3D4KA 4O2AB 1FNZA 2P1BA 4UI9L 5K4LA 1I6XA 3ACLA 2FTKA 2X6AA 3ASIA 3D36A 2UWAA 3L73H 5FZ1A 1GU3A 2W94A 2RHPA 5FZGA 1W59A 2DYSB 1W0KG 3GBFA 3NNLA 4JI0O 3I3EA 3OPWA 1TME3 2QJVA 4COYA 5H9SA 4RQPC 3VBHB 1JI6A 2EIJC 4AVSA 2SBAA 4YJ3A 5GLVA 3DEMA 4E2GA 2ZXWC 3JD2A 4FK5C 1BZKA 2MHFA 3USUB 5FWEA 1R3KC 4JTDB 1YDXA 3BA8A 1D5NA 3IDEA 1OCCC 5GZEA 2E7TA 4WF9V 3OTOO 1G8MA 2NLJC 1VQ7V 1NCRC 2RM23 4LHSA 5FYTA 4TWTA 1PZ9A 1N0NA 4Q1PA 4NJ4A 3RT3C 2R071 3U0ZA 1PNFA 5K0UA 1G4YB 4X1YA 4IERA 3FKSG 4CDWA 4PA6A 5IAXA 5H9RA 4HKOA 4DV2B 2P67A 1UU5A 4K8RB 1Q7YW 3C7OA 4GQ7A 3L9DA 1JOPA 2R043 4LBMA 1G8WA 3CNAA 3W5MA 2XHNA 1LAJA 1NU1H 2EIKC 1AR1B 2QQOA 4MS2A 4CXXA 3MLLA 5T5JA 5SV8A 1X4TA 1WZXA 2WWJA 3WQ7A 3KHCA 3RYIB 1PK6A 5DDJ3 4NOTA 2LTNA 2R0HA 3BTXA 3SPJA 2XTAA 3OCPA 5JMCA 1Q8IA 4LTAA 4ES8A 3MW4A 3LFMA 4IW3A 4OZXA 2JEXA 2P4KA 5BY5A 1R6TA 1H1MA 1HX6A 3CBNA 5I91A 4Y1YA 5KXEA 4LBNA 2WZR3 1H2GA 3ZXJA 3ZHRA 4DUWA 2HHHO 3JD72 3BVOA 2NMNA 4LE3A 4SLIA 4ZZ5A 2W46A 3GVMA 1SQVH 1RUF1 4MXWB 5LXTA 4OHWA 3ABZA 2XBO3 3U4SA 2XHKA 4PDWC 1CQ9A 4Y5Z0 4D0QA 2H6CA 1FPN3 3KT7A 4JYCA 1H8EG 4U3FH 1VBE3 1IS5A 2NYYA 2Z0AA 4BR6A 5BNPC 4LO5B 3MLKA 1H0BA 4GKJB 2YMZA 1Y9QA 1F15A 2FDJA 4OX9O 2ORZA 2YGMA 2XVKA 5LBEA 3PU3A 3T4HB 1Y76A 3LB9A 5A3WA 4YXWG 4GLXA 2XVGA 3WR0A 3H8XA 3VB9A 2D3OW 2QWOB 1IKQA 4QU2A 4WV8A 4JDNA 5GLWA 2YIDA 1CJDA 4Q0PA 4NN0A 2W92A 2HWC1 1DQ1A 2GDFA 5H6RA 2OTLV 1RUE2 3HR0A 1EAH3 3G67A 3C3SA 1H1AA 2QSAA 5FZFA 1RC6A 5CN0A 2UXDB 3OEAA 3LDEA 3JASB 1J58A 3STZC 1REDA 5J3UA 2GNDA 5JUVA 4HPKA 2CTVA 3RYKA 2FCUA 3MO4A 5C3OA 5H2FZ 2PUSA 1HRI1 5FR3A 5KWRA 1MEC2 2GU9A 4YVWC 4MG2A 5C3PA 2GTSA 4PF5A 4QE9A 4CCLA 5ACA2 2DFCA 3WB2A 1AR61 2WNUB 3WQBA 4PA3A 1M56B 4FLVA 2E5LO 4XJWA 3DYMA 4FPJA 1DTOA 1WW4A 2F4PA 1FXHA 5B66Z 1MS4A 2UURA 1CAWA 1FXKB 4ZI7A 4LR4A 1UF2C 2YZ4A 4I2OA 3D36C 4ZU5A 3KQRA 3N27A 4UYBA 5DZEA 2W0FC 4Q0SA 2GBOA 1REEA 1UY2A 2TNFA 2VZ1A 5F8PA 2IXHA 5LBBA 3BYWA 2QM4A 4B7KA 1UX6A 5A3LA 2D3PA 2YDEA 5CFCA 1OLQA 4LE4A 5A6QA 1Q82W 5EXOA 3POJA 3HQXA 2BRTA 4CVUA 1SLIA 3RI9A 2ZEXA 1M5IA 3FJSA 1OPOA 3GZTB 2QJ1A 3VKOA 4NB5A 2F4LA 1VBB1 3AMPA 4IV1B 3DCQA 1VMJA 5K1XA 4N7UA 2ZAAA 2ZR2A 3FBYA 5KAIZ 1AR83 2BWAA 2RE9A 1UYXA 4LXLA 5GM0A 4KBBA 2CUGA 1GBGA 3RFRA 4OGQB 3JQXA 3H8RA 3TETA 4B3MB 3WNNA 2E3CA 2VTFA 3IM0A 3OG2A 3M3CA 3LGRA 1Y9GA 1EP0A 1UY3A 1HQWA 4ATEA 5K0UC 4RYDA 5JZGB 4CDWC 1XRUA 1K12A 1RUJ3 5L3FA 1DHKB 4QIWF 3G4SV 5BR8O 4Y4YA 2G9ZA 3BPZA 2JEUA 1PZ8A 5DUVA 3VZNA 2W39A 3W7SA 5LRSA 2VPVA 4QQPA 5C8CA 1IBMO 5GLTA 1QJZA 2WS91 1HQLA 5KHHA 4LF6O 5J96B 1R1A2 5F6LB 3VL8A 2CH7A 5EHDA 1WMDA 2Y69B 1PK6C 1W6NA 3FN9A 4H14A 4BK4A 2XWJB 1UQXA 5LL6Y 3SHRA 1R3IC 3ZR6A 3PURA 4AEDB 4NRQA 3IAQA 3I49A 2XJSA 1FS0G 2OCHA 4Y26A 5FLXN 4JZRA 3ILRA 2F93B 3ZJZA 3I2OA 1JYXA 4JTNA 2R6QA 5FP4A 4FPGA 3OBTA 3LNMB 3EBRA 1UY1A 3ASOC 5F3EA 3SQOA 3BVCA 3BOPA 2ZCEA 3ON7A 5HI0A 3N2GB 2JS3A 1ASJ1 2VOTA 2WR9A 2A70A 1YQCA 2DYRB 2YB7A 2AXTZ 2BCCH 1I94O 1MS1A 4GWIA 2VZVA 2PHWA 3NJXA 1MS5A 2W0XA 2FB5A 1BYHA 1N3QA 2JECA 3PUIA 4P9XA 3C7HA 1F23A 5DZGA 3P5BA 4WFEA 2RS31 5IK4A 4FM0A 4H44B 3WD5A 5A3MA 3HAGA 3LSQA 2O14A 3T08A 2E7AA 1FKAO 3UM7A 2ADDA 5C8WA 4MLOA 2PN5A 1HDJA 1K3EA 1OLME 3D3AA 3U75A 1LOAA 4MVTA 3NMBA 3O14A 3J7AU 4O4JB 1ZRDA 1HNXO 4FT8A 5CB4A 2ZIMA 4AFAA 3RZKA 4UBGA 1VQ9V 3F95A 5KA6A 3FFQA 1MR5A 5KXDA 3JALB 1SCRA 3NV3A 5FNVB 3AG3B 3EJKA 4GB33 4DR6B 3R0RA 2Y48A 1QXRA 1W9YA 2VQFO 3P32A 3A0HZ 1OKQA 4LUKA 4J42A 5BYNA 3AKSA 3LA2A 3OPZA 3RDIA 1SC5B 1V6NA 3POGA 3BB6A 4UV9A 3OYWA 2XUMA 1W3VA 3RYCB 3ZO0B 5IK8A 1GN4A 4LF8B 2Z42A 3AP6A 4NYKA 4XF3A 1ND3A 3AMMA 2LFRA 5DUWA 5CFCC 3ELNA 1IG3A 5CBFA 4OCTA 5IVYA 1DF5A 2LROA 3NKGA 5EC2C 2HLDG 4XFAA 3ZN5A 1CGPA 1GQGA 4MVQA 2HWF2 2IXIA 4WVMB 1QR9A 3RYHA 3V0BB 5LBCA 1VALA 3JB8A 2MEV3 1AI7A 1W6QA 5I0SA 1R3JC 5FPUA 3T1LA 1N34B 5JPNB 3PJYA 1XNBA 3AB0A 3CRCA 2PYTA 1L1FA 1FJGB 1KMIZ 4JI8B 5CA6A 4LF5O 4W4LA 1QVGU 1I7FA 2EILC 3AJZA 4IHJB 4KWJA 4YGCA 2QE7G 5H9PA 5IDJA 1VQLV 2WUHA 1WA8A 1JVMA 5LGNA 1UN1A 1ZA4A 2OWOA 3I56V 3K46A 4M3CF 1ULGA 1YFYA 5JWPA 1XQNA 4Q0QA 1AYN2 1LGNA 2IVJA 3MD0A 2Q73A 3MFAA 4NTWA 4AK3A 5CKQA 1R081 3VZLA 5FBZA 1XXNA 1RPOA 2Q7HA 4I0WB 5C8CC 3T2MA 3JD3A 1PO21 3BI3A 2EULA 3SYCA 3HBZA 5JVVA 2PFWA 2H94A 2WZ8A 3N3HA 3POYA 3PTRB 1JMKC 1DQ4A 4EWAA 5KUMA 1NQDA 3MFCA 1ZL8B 4XQWA 3PJSK 1LR1A 3LSSA 3E22A 2WYSA 4CYDA 4IE6A 4WFHA 2RS52 4PQQA 2VQEO 2EIEA 1N36B 1YQ6A 2P22C 1OFNA 1J3QA 3B2EE 1PGL2 5T54A 4I4TA 2WT1A 1S0IA 4GMP0 1WPBA 4LLOA 3WNOA 4FFBB 2NPIA 3ZMOA 4DOUA 4TUYB 4F6RB 3H3ZA 1HN0A 2P4VA 3M70A 3TBDA 1HR0B 1SHWB 1VIWB 4FXGB 4M4RA 1DYKA 2ZAHA 5K1PA 1RM1C 2BSKB 2DU1A 2D6LX 3PN1A 3CCRV 3U10A 4BIUA 2BERA 4TYSA 2ZACA 4Q4Y3 3DPRC 4LOTA 3I2HA 4RGGA 2R9AA 4NHLA 2JIJA 3NKTA 4YRDA 1PX4A 3JATA 4HVOA 2ZX3A 1JYCA 4PIYA 1QOTA 1IGOA 2IU3A 3UGFA 4JKLA 3JD4A 2ZGMA 1BHBA 2KG7B 1JU3A 3SYAA 3F5WC 2A7AA 5FPRA 2WSUA 2JKBA 3WNPA 1HW5A 1P84F 2VQUA 1X9TA 1POV1 3C7GA 5KXCA 1DQ6A 1URFA 2QQJA 1MABG 3TEYA 1N32B 1AJKA 1HWYA 1Q8PA 2B9VA 4FPHA 3AG1B 3KF5A 4JRAA 4JYAO 5FP7A 3AVRA 3HNYM 2ZOEB 4GIQA 1OD5A 3WNKA 3ILNA 1LUWA 5EYPA 2C2AA 3ZMNA 1W2UA 3H0OA 3ZFGA 3ABUA 5F3IA 2VZ3A 1NXD1 4LBLA 4ZONA 2RMKB 3AG4B 1S0VA 2JICA 4IGQA 4DUVA 4TSVA 1AZDA 4R52A 3LEGA 3CXHF 1XNTA 4QPGA 3MIBA 3F7YC 4XUOA 1Y67A 1UZZA 5FZIA 2WSVA 4RA0A 5E8AA 4ASMB 5FO7B 4X6QB 5CIRA 4BAYA 2Y6JA 4CCCA 1CX1A 4M3CB 3DF0A 4CZZA 5CA0A 1DGRA 1WWYA 4BLIA 3OF1A 4PT6A 3QG5A 4DQAA 3JCIA 1H8TB 1G86A 2BV4A 3AZXA 4BLJA 1ND3C 3ETGA 1H2NA 2GALA 1YQ5A 1VRH3 1S3JA 5L3DA 1HRV1 4QKDA 4DY5A 5A80A 1SPPA 3SCGA 3BTZA 2BEOA 2PLV3 1XQ8A 4I30A 3T1MA 4X65B 2Y33A 5H9QA 4KGGA 1WP8A 2BNMA 1M4UA 4QX1A 3FC0A 3M3OA 2RDQA 3L2HA 2NP0A 2RNBA 2JS5A 1B35B 4O2BB 1KQRA 2RV9A 4IGOA 3M99B 5JI7A 1H9PA 1GN2A 3RSJA 4YY3B 1G7YA 2WNVB 3CCSV 1IQDC 1RHI1 2RJKA 4HZFA 2ZX4A 4U2AA 3WG1A 2Q69A 5FL7G 1Z7S1 4NHMA 4ASUG 5EIBD 3TK1A 2R16A 4RR3A 1Q6HA 2GNBA 2ID4A 4AQSA 4OI1A 3ML0A 5DECA 1T5EA 3TXQA 3N9PA 1M9NA 1RP3B 3ZHUA 3MBWA 4QB1A 3V56A 1Y74B 1UPIA 4BQYA 4AHYA 1WKYA 4JVAA 2UY9A 1VBB3 3ZRXA 4ZBMA 1H2LA 4NPLA 5FMDA 4CCEA 4QGMA 2YIBA 2IU0A 2JDPA 2V1DA 3TWIA 2WA3A 4D7SA 1GWMA 3CJXA 1AR93 1RINA 4DUZO 3SCHA 3NJVA 4PA7A 2DDUA 1V6IA 3ZX7A 4ICGA 4XFCA 1SA0A 1PO11 1DP0A 5KLVH 3O0XA 4FM2A 1RUI2 3CJIC 1M06G 1J5EB 2W6IG 1OUSA 1DLLA 1C8M1 3B8MA 1RVF3 1JH5A 1SRYA 3ZFEB 4BE3A 3RVZA 1UYPA 4IYIA 2VE1A 4W6WA 3MPPG 5CISA 4E27A 5JSOA 3K51A 5LA9A 3U07A 5H9CA 4AW7A 2D3SA 2A73B 4OFGA 5HPOA 2CTWA 4LC1A 3QO8A 5JJJB 4BQ2A 4DV0O 1FV3A 4UF0A 3VQXA 2BJSA 1JYNA 4HNAB 2LJ2A 3Q8BA 2TUNA 2PELA 4YFZA 3GXUA 2ADQB 3S30A 1AL21 3THDA 2RS12 4GCZA 4FOVA 4GH4B 5DN2A 1RXGA 3SPIA 5J1XA 3I2JA 1BEV2 2VBBA 5FFOC 5EJZB 4R8CA 5IJ0A 5JR7B 1K8AW 1WPXA 4HMZA 2DJVA 2Y4UA 5L3EA 5ANQA 4YGBA 1AJPA 5D1IA 1WAZA 1YEWA 4JHZA 2Y6FA 4LH6A 2JB8A 3JBG2 1JOJA 4H3WA 5IY5C 2PF4E 2RR12 3FE5A 2F23A 3GWKC 2VGDA 4JI7O 5F39A 2ZGKA 3ZFGC 4BYYA 5FMBA 2YXHA 2FDKA 2UXCB 1MACA 3H1WA 3PMSA 4QPGC 3RZLA 1VF5B 1VEWA 4LORA 3QNEA 5CA1B 4LWSB 4OYUA 2YROA 1K34A 1RSOB 1SCSA 4IV3A 1D4M2 3WP5A 1BSMA 3CHXA 3IAYA 4I0AA 2E9QA 5D2AA 2PHFA 5B3SC 4P9JA 5C9AA 1FFTB 1YIJV 3F2ZA 4OHXA 2RS33 3CRAA 3SH4A 3M8AA 4EE2A 1RUC2 4QDSA 1VMHA 3K4DA 1Q8QA 4DV7O 3KKYA 2UXBB 3OD0A 3APQA 2XASA 3HD8B 4DFSA 2Q8DA 3VD9A 2LALA 3ZXGA 4KBZA 3KCYA 4YYOA 2QQLA 1E5SA 2LW8A 1V55B 2HWE3 3E6DA 1LHNA 4X1IA 2ZT9B 1RMU1 1KD1W 1PPJH 1GK9A 2W5FA 2Y0IA 2LW1A 1BHAA 1H9WA 3HKCA 1VF7A 3AMQA 3CJHB 3WNLA 1XOUA 1L7RA 2ZGPA 1XSRA 2GSYA 1MS0A 2YSUB 2HWD2 3MV11 3OBAA 1CPYA 4QHBA 4P9WA 4EN7B 4ORFA 3WQ1A 1MZEA 1NLRA 1AVMA 1NR7A 1YJLA 4HT1T 4O9EA 1PL4A 2PHRA 1JN2P 1UY0A 4EN8B 4QJFB 2WO1A 5I0TA 1W8FA 4QXHA 3CEWA 2X6CA 3CC4V 1DCSA 2WLMA 1RUD3 3AFKA 1E79G 3ICXA 1Y66A 3ZXLA 1N1VA 1DU3D 2ZIOA 4CEYA 4QU1A 4RR3C 1LHVA 4XAEA 2B46X 2RVAA 4XACA 3ENRA 3J4UH 2A6XA 2UU8A 4CPBD 4LUMA 3SPGA 4JKKA 4QPWA 3WB0A 1W2AX 4XTMA 3ZN6A 4P02B 4FZ1A 4P30A 1PM4A 2A6VA 2WT0A 4INDA 3RWRD 5FZHA 1TVGA 4CEWA 2YC0A 4MX3A 1NA1A 3H42B 4HK8A 2RMU2 1LODA 1EUTA 4AQYO 5F37A 3WINE 1NY72 3VBSA 2WLLB 5B2GB 2AENA 4LO6B 5GZGA 3N7LA 3MIEA 1PIV1 4NROA 4O65A 1L7QA 1OT5A 3E6CC 4CCDA 5EBWC 4CUAA 1EZJA 4AFDA 2FDGA 3HVDA 1OCRB 1W0PA 4XIKA 2Q4SA 1W6PB 4QMAA 4XJZA 4A41A 5IT6A 2DV9A 3HIFA 1W2NA 3RW0A 1GM8A 4NIIA 2DE0X 4TV8B 4AZZA 2K2SA 4GWNA 3DKQA 3LKJA 3WEZA 3TN93 4PD4F 1JBCA 1RJ8A 2C6SA 1ND2B 1BK1A 2I2SA 1XU1A 1P7GA 2GH8A 1YFUA 3E1F1 2VUJA 2YHJA 5LMNO 4DXTA 1HDKA 4GULA 3WUCA 2P7TC 1WB7A 3IDCB 1US2A 1GO3F 2DU0A 1VBD2 2DUQA 1EV12 3T1HO 4E8CA 1DGRN 1I5PA 1EAH2 5FO8B 1QJX2 3IC9A 1D5AA 3I8TA 3RVHA 5F2WA 3THCA 2WZEA 5HCHA 3K59A 1GNZA 2ZE5A 4FQ4A 2J1TA 5L73A 3WUDA 2CGOA 4Y24A 3I55V 4FXKB 2JG8B 3VDDB 3BTYA 1BBT1 4WZCA 1JZ3A 4LR3A 1KP2A 4N53B 3W58A 4DV6O 4JF3A 2HFEC 4XDKA 3GCXA 5C4WA 5CVRA 3ZFFB 5GONA 3FBMA 4IV3C 5A1FA 1W9FA 4XDJA 3AX4A 4N90A 4UUJC 3WDVA 5C9AC 2AW9A 1KYOF 3EVKA 1JW6A 2E63A 1WCUA 2YIBD 4R4XA 2D6PA 1QKQA 1IBKO 4E2LA 5FY0A 2GNMA 4QM9A 4EB6A 3T30A 3MF9A 3AG2B 1ZSPA 3SPHA 4FOYA 1SFNA 5G05L 4MVSA 3M4FA 3D82A 4NPMA 5LP6B 4B3RB 2RDSA 4ITCA 4XBFA 5JXHA 2AREA 4URTA 1RUG1 1BJQA 5FY9A 2G9FA 3FLRA 4N8MA 5IWAB 3MLJA 3O1UA 1QNYA 4GKKO 3ZCCA 1MVQA 5ITZB 3SJQC 5KMGB 4B4RA 3R6SA 3JCUZ 4IE7A 2PAKA 4XJ8A 5DABA 1DYPA 3X2QC 4CH4A 3O5SA 4ATFA 2C0ZA 3NAPB 5LYJB 1W8NA 4O2AA 3E8GA 2ITDC 1UKRA 4W4ZA 1S55A 5FMOL 1SLAA 4RL7A 1ENSA 2LGQA 3JD73 4X66O 4Z2AA 3EHBB 4I3GA 4U3JB 1Y4MA 5A7WA 2W87A 5FCCA 1MZ6A 3UGHA 4X64B 4X20B 4CEYC 4NIAA 3FYIB 1W8HA 2ZGLA 1YHFA 4CDQB 4QQ2A 1LKNA 1Y7BA 1F4AA 4J6GA 4J10A 3IC7A 3AZVA 1HRV3 3USUA 2DTWA 1NE4A 3CRRA 1W04A 2DYCA 1PNLA 4QKBA 3UKVA 5A3PA 3CC2V 2N7GA 3OW2U 4CEWC 5E89A 1W8WA 1GV9A 2ZNJA 1D2SA 3JD1A 1NA1C 1Q56A 4LQRA 3M3EA 3AYDA 3VBSC 4NXMO 4QPIC 4BPZA 3ABKC 2KB1A 4YPJA 3JB4C 1RUE3 1K42A 2HLEA 4AOCA 1XBFA 1TMF2 1XMQO 2HWB1 1QNWA 4IETA 4DV5B 2FMLA 1M90W 3GALA 3ORJA 3PHMA 2ZGQA 1PVXA 2Z5WA 2VUAA 4RQFA 3B9IA 2ARXA 1PVC1 2NR5A 1NZ6A 4R50A 4QGNA 2XAJA 3CWBH 1R091 1FI2A 3SR2C 1AXZA 1QQCA 1EUUA 2W3JA 2CSGA 3M3QA 4AFMA 4UB8Z 1ENXA 5ACA3 3ZR5A 3UK9A 3ZRVA 2UUAO 5K7PA 4XETA 3RYIA 1LECA 5G04L 4PV1B 5FYSA 1XOYA 3K5MA 2MW2B 2B5HA 4DR3O 1FFXB 3LDKA 3A8TA 3LA3A 3T1YO 2WFPA 4BXFA 1IXBA 5T50A 2ODMA 5J37A 1VB4A 1IS3A 2FCTA 2AZ0A 2XAGA 4C8DA 3OEEG 3FX3A 3E86A 3JYCA 2A6YA 4PLNA 2FKXA 4MT8A 4AQ2A 2F17A 2VUCA 1SBFA 4X89A 4MXWA 3MGUA 2XWBB 4ASLA 5KX5A 4P5HA 2A79B 5A32B 1PO13 4CDXB 4AVBA 2R7EB 3B40A 1ZBE1 4CRQA 4NTYA 2BW8A 5IJRA 1K4DC 2ZX0A 4JV4A 1YNAA 2YPDA 4IEOA 3HPNA 4GB32 1VJ2A 3AP7A 1G1XB 1YIPA 4DINB 3G71V 5C4WC 1GMMA 2WLIB 2OZ6A 3TB0A 1N1TA 1MPXA 4DIQA 2YICA 5KAFZ 4JQTA 4MVZA 1AXKA 1UW8A 3K4ZA 2IWGB 1OBNA 1QJU1 2QVSB 3O1RA 2XG3A 4CSWA 3TXSA 1QQP2 3A2FA 5LMUB 4BMEA 3VLBB 4DV2O 4X6RB 3HNBM 3DECA 1CIWA 2Y6LA 4QX2A 1W6MB 1GP4A 5IHRA 1FYJA 3AKPA 1R1ZA 4S2FA 3UO3A 1R1A3 1V6OA 2FDIA 4LOSA 3TNPB 3ASNC 2MEV2 2VOVA 2RG4A 5FRAA 2R061 2OCCC 5LW9A 3RVYA 5EYXA 2WNUA 3ZX6A 3JSNA 3SKVA 1H2SB 1M93A 5KR7A 2FMYA 2VUDA 3ZDVA 2IBZH 2ZGTA 4UFMA 4MW3A 4CUCA 4Y22A 1FXKA 1TNFA 3BU7A 4AXOA 4I0BA 4J1XA 4XF4A 1XBLA 1PMIA 3WDWA 4XOGA 1W28A 3E5QA 2N74A 4BIZA 1VQ4V 1QDCA 1GQPA 1RUH1 3U11A 2DYSC 3LAGA 2SLIA 1AYM1 1UOFA 4TQFA 1CZSA 2VTXJ 1SETA 2WZPP 2PXJA 1ENRA 4CS2A 2OS2A 4PDMA 4CP9A 5BY1A 3P30A 2QFEA 5F2VO 4XEZA 3SCFA 1PV0A 3OUJA 3W5NA 3A0BZ 1KITA 3OB8A 1JJ2U 3N9QA 3PMEA 2UYBA 5FWJA 2WFF1 1KDKA 1VP7A 4GKJO 1JUIA 4ZY9A 3CMAV 4ONUA 1AL0G 1GKBA 3H3LA 3LPGA 3N36A 3KT4A 3GZUC 1GN3A 3PVNA 4D69A 3IAPA 3GBGA 1GWLA 2QTSA 2JJ6A 1C5HA 4QXKA 4PDWB 1K9MW 4MVMA 1ZRIA 2QWRB 3SLIA 2XJRA 4NWVA 5JZGA 3NNFA 1V0AA 3PIGA 1ODNA 2R072 3DXUA 4HSJA 2NM1A 3V64A 2UXDO 4MZUA 4Y5TA 4NKGB 1W0NA 4OVEA 2J1VA 2F6BA 2ARBA 2BNOA 1WMEA 1FT9A 4I01A 2VZRA 4FSJA 4CXYA 2YS8A 4UV8A 3GCWA 2VZOA 3E97A 4OHVA 2AHYA 4KG0A 3DXRA 4QXBA 3QH7A 3IFXA 3O0WA 5B4NA 4GJYA 2B4KA 5BNNB 1BVP1 1O4ZA 1PGSA 3ZMTA 2Y60A 4QNHB 1UMZA 3K3NA 2FQPA 2A06H 1FOD1 4HK9A 3CYOA 1DGSA 2VXRA 1SF9A 1OHHG 4UXNA 4UB6Z 4AEDA 2VVDA 4Q0UA 1MS9A 3LSUA 4IGGA 4ZZ8A 2UXNA 2YUEA 3AFGA 5IVJA 5L9RA 3MW3A 5C3SA 3ZN0A 4Y20B 1AX0A 2PHLA 2YFUA 2R30A 2XL7A 4IT5A 4YVWB 1VP6A 3CU7A 1PHMA 4V2WA 1FD9A 2OX0A 1CR7A 4B1MA 1SBDA 3IJ4A 3OGJA 4YVSB 2LGWA 1PIV3 3T0DA 3B7MA 1RUF2 4Q29A 4OUMA 2HWF3 4PBPA 3HKEB 1LGCA 5L3BA 3J26N 3H8UA 3W7UA 4RHV1 1LCLA 1NY71 3KG2A 4TWKA 2VR4A 4HYOA 4RQEA 1TE1B 1X33A 2GP3A 4MUVA 1N33B 4B3MO 2ZM6B 5A7SA 3K77A 3CX5F 2R9IA 1GP5A 4GKXA 4F7ZA 4CCJA 3AMHA 4N9IA 2JGDB 4DR2B 3UQ8A 1H8HG 3ZMVA 5B4XA 5JJNB 1E5RA 2HWC2 4WBNA 1WW6A 2BVVA 2ZMNA 2GAUA 2Y26A 2Z2SB 1GZTA 1XHZA 1BT8A 2Q0OC 5BXZA 1ZYBA 4O4JA 2ZGSA 4B4PA 4X1KB 3KM5A 1DLCA 2CNAA 1IX9A 4C1WA 5JDBA 2VNGA 2VQAA 4J9ZB 5HFMA 1HRI2 4FFGA 3JALA 4QPYA 5K0UB 3DC6A 3WG2A 4BK5A 3PNAA 2ZE7A 4NIDA 3WNMA 4DR1B 1NVPD 1AR62 1V9U1 1VBA1 1SZBA 4BQ5A 3THPA 5A3UA 1PKXA 1XE7A 5DAWA 1FXKC 1A78A 1UKGA 1DF0A 5C71A 1GFF2 3ZSMA 3OGRA 1D2DA 4P2ZA 4FM1A 5EZYB 1J1TA 2ETEA 4UCUA 1R3LC 3OMNB 3RYCA 4EN6B 2WLKA 1SQPH 2CTRA 1XU2A 2VNVA 3WHTA 1NLQA 3C2UA 2PHXA 1KDMA 3E8HA 1NOVA 3OR7C 1LTEA 2BUKA 4WVMA 2PI4A 5J7MA 4BHPA 4FFIA 1J83A 1VBB2 1VF6A 1MOFA 4MHRA 4MVOA 4B3TB 1QJY1 1Y6XA 3RMYA 4L99A 1O8PA 3B5LB 4IHJA 4GALA 3CL1A 4X9QA 5FZOA 5BNQA 3ETPA 2WN3A 5KHJA 1W90A 5FK7A 4DV3B 1VBC2 1UOGA 3K9AA 1GM7A 2IXCA 2EZOA 3APBA 1Q81W 2IM9A 2ZNIA 4DRXA 2EIDA 2EINB 2MK3A 4YNIA 5JZGC 1IS4A 3OY8B 4PDVA 2HEWF 4Z2WA 3BN6A 5FMOS 5LOVB 1U5YA 4XDLA 3CPWU 4UT5A 2JKXA 3GF6A 5FY4A 1Y76B 5JOXA 5FY1A 3ZXDA 3AK3A 1C8NA 3RI8A 3IKWA 2NZ9A 2WS92 5F9TA 2YU1A 4UVCA 1O91A 2P37A 4Q20A 3AP9A 1SACA 2Q8EA 1RIRA 3WT3A 1ZL8A 4QD2A 5JQGA 5B1BB 5F5QA 4XFIA 1ZBA1 3UYJA 2WT2A 4DR6O 4Q8LA 3CCLV 1BZWA 2JDYA 4AEDC 1CAVB 3R4SA 2Y6KA 1Z5VA 4YGEA 3I2FA 4XQ4A 4XQDA 4MGZE 5DUUA 2KR2A 2CDYA 3T4DA 1SLTA 2X8KA 1OQ1A 4TXWA 1F5JA 3O1SA 4XDPA 2V4VA 2QEXV 3ZIWA 4CE8A 4EWEA 4Q4V1 3FZ3A 2ARAA 4LF8O 5FZ8A 4B1LA 4TOIA 1Z2GA 4FFBA 3QCWA 4BXSV 5LA6B 1GZ9A 2XJVA 3SJAC 4F6RA 2WRAA 3R66A 3SISA 4RFT0 2Q6AA 2WLPA 3ZHSA 1TZOA 5LK5A 1J95A 1Q86W 4IXLA 2DYRC 2DURA 2C1FA 2BSKA 1ASJ2 3OD4A 5JCOA 3CZJA 3WP4A 4UFJA 3ZSLA 3ZBHA 2KXLA 4O4HB 4C90A 2WAMA 2L35A 1N34O 3PUSA 2O8QA 2OZJA 4G4FA 5JXJA 1FJGO 3MW2A 4JI8O 3BCWA 3E8FA 5IVFA 1OCOB 4YZ2A 4JC1A 4Y1UA 3VKMA 2K9ZA 4HAMA 2QQMA 1S5HC 2RS32 1T2XA 2R70A 4ZHNA 3O1OA 3U78A 2Q1MA 4BW9A 1OMIA 3PL0A 3NW4A 3D0SA 4R6ZA 3N4MA 1EYBA 3NJYA 2QKSA 3URFA 2E51A 4QE7A 2A9HA 1V00A 1BVVA 1UZ0A 3SNMA 4ISRA 2VBDA 4COVA 1YITV 4V1PA 4KGQA 1UYZA 1ZX3A 3QLQA 1TAEA 3AG3C 4OHZA 1QOOA 3RJ2X 2J1SA 2Y0PA 2GMMA 1STMA 4JYYA 1YI7A 1X7NA 3GHNA 4XPVA 4QHOA 1N36O 1CJPA 2QZ3A 5C8CB 4QKNA 1N1YA 3C8XA 3R4DB 4H7MA 4GD4A 4CS3A 3H50A 4M3CA 3UJOA 1A8MA 4CP1A 2X0LA 4IEWA 2X29A 4RSUA 2FD8A 2JJ2G 1RUI3 5EJ3A 3LEIA 4IEXA 4PLOA 4J1WA 4QDQA 2CU5A 1HB2A 2YBPA 3PIJA 5E16A 1HR0O 3C90A 3RZZA 2PMWB 1JA8A 4D6QA 4HL0A 1GMGA 3CQOA 1VF6C 4MTOA 4ZXKA 1HV0A 3L2YA 1IPSA 1OI6A 1I1EA 1RYYA 2D5FA 3ZPYA 4JCKA 4OHYA 1E1QG 1B35A 4O2BA 1SG3A 4UW3A 2RS13 4XDQA 2PAEA 2YPJA 2BTOA 4GX1A 2EXJA 1BEV3 4RN5A 3IBMA 1ENQA 3OT7A 1UOJA 2WNVA 3VD7A 3D8CA 1RM1B 2XB6C 1HLCA 3SGIA 1H4HA 3HN3A 1GZCA 1WA4A 1N32O 3DPRB 4KP4A 1AR71 3BHPA 3M8LA 1WCSA 3WXPA 1YRZA 4RGKA 3JBG3 4JTCB 1GQHA 1XDCA 1IVSA 1R082 4GWMA 3AP4A 2ZKLA 3ST7A 4FPFA 2JVDA 1PO22 1VIBA 2O0OA 1KEXA 4ZXEA 1Y74A 1K73W 5E1RA 2G9GA 1AP6A 4LT5A 4P9IA 4R9DA 4LBEC 4R9AA 3VOUA 1MNGA 1D4M3 4XABA 4B8EA 1JZ8A 2DVBA 3VQVA 1COV1 3AXEA 4LEJA 1VMFA 4HKLA 1VAMA 5A7OA 4PA9A 4CA9A 2P5BA 4YHHB 5ABJB 3OTFA 2EJRA 4QWNA 1B6QA 3VGIA 1RUC3 5DEDA 1GYKA 2EAAA 1R1BA 1UZVA 4YW4A 5GZCA 2Y38A 3BKZA 2HVKC 3MUZ1 4MVRA 4DR7B 2RN9A 4GX2A 1H30A 2O8OA 3ABTA 2YBSA 1SZXA 1U5XA 2QWQB 4ZOLB 3A0RA 4KU8A 1HKDA 4BWAA 1SLBA 3AZZA 5AC91 4Q4X1 1IBLB 3IZOA 1UL9A 3H1KH 1W8TA 1GSLA 5JCOC 4QX3A 1YYNA 4X65O 2QNKA 1HNWO 4FOWA 2IUWA 3POBA 5FZAA 4LFBB 4Q4W1 2HWD3 3A7QA 2VM9A 2VL4A 3AZWA 1CAUB 3SJCC 1XNRB 5J09A 2VZUA 2XKPA 2DWEC 4HNAA 4CU6A 1NQJA 3K3OA 1FOD3 2GP5A 4DB5A 2BU9A 4YM3A 1QY4A 3M7MX 4DUYB 1UAIA 4YY3O 1FXVA 4COUA 4GH4A 1N3PA 2WLHA 1K3IA 1KC8W 3LNNA 2WLJA 1S0FA 5BV6A 4XYXA 1O9HA 4FLUA 4B4QA 4E9KA 3DUIA 4RGAA 1NCQB 1YSCA 1T6GC 4GX5A 1SFPA 4ZHQA 1JJOA 3AG1C 2WKKA 3LFIA 5LRRA 3RZHA 1WBFA 1J3RA 1NVPB 3BU0A 1HXS1 5GJ6A 4I50B 3BTAA 4XF0A 4S2DA 4LK7A 4AVTA 4W8JA 3AG4C 1KB9F 4Q2FA 5KA5A 4LF4B 4J9YB 2E32A 1LHWA 2ZGUA 1CN1A 5CA1A 5L9BA 4LWSA 2XONA 2E7QA 1RSOA 1WB8A 1VQNV 3O9OA 2AEYA 2RMU3 4YWAA 1T6BX 1Y4WA 3UESA 2A7WA 4NMIA 1PM7A 2RDRA 4NXNB 3GWOA 2KKWA 1SERA 2JD4A 3CLPA 1H1IA 4URAA 1W2OA 5B5EZ 2GTAA 1S0JA 2Q30A 2CTPA 4O4LB 1R6KA 4MADA 2DUOA 4M0HA 2F95B 1I0HA 1C1FA 2OPWA 4NVPA 4UW5A 3W7WA 1J5EO 1GR3A 2ZZQA 3TRSB 3W9AA 1RB8G 3ZMSA 2LW7A 4H33A 1NQTA 3STLC 3FLTA 1HRV2 3ZMZA 3LUTB 4O4IA 2G4IA 4AEKA 2F4VB 2WNOA 2W91A 1QJFA 4DV1B 5FDBA 5FZEA 4X8NA 4EROA 3WLUA 1UOBA 4XIOA 4IEPA 3I59B 1O5LA 3CJIB 4EJRA 1B35C 3WG4A 1VBD3 5FZ6A 1EV13 1BQ0A 5LCWL 2Q4PA 1QJX3 2Q8CA 2ADEA 2WNVC 1TGOA 3E5XA 3SXWA 2PYLA 1JPXA 2BBVA 4XTPA 3WG7B 5A9GA 1XMOB 3FYEB 1RHI2 4FFKA 2OIEA 1P7BA 3H1LH 4WCEV 4OZOA 5IYDO 4XUNA 1Z7S2 1MA1A 3O12A 4LF9B 4P5YA 4BDVB 1F4MA 1YWKA 4COWA 3B9CA 3VBOB 5C70A 2ZHMA 2UXCO 2VVEA 4EZ4A 1KJLA 3UETA 5C8YB 1WP7A 2OA2A 2ZEWA 4RWUA 1PGW1 5C5UA 3WSOA 5LK7B 2RJ2A 5FYIA 2Q7EA 1VARA 1CD3G 1I5YA 1N0JA 2DVAA 4YZ3A 2JDHA 2CE4A 4M00A 2B9ZA 4PBOA 4F4LA 3H9VA 2E31A 3ZFGB 5LATA 4YFWA 3JAKA 1YTFB 3EXAA 3HBKA 2UXBO 3C3VA 2GDSA 2ATFA 1FMD1 3VV1A 1PO12 2ZEZA 1CIYA 5GW7A 3OMAB 3JARB 1AJOA 3G7DA 1GUIA 3EQEA 1W6PA 4CTEA 1JZ4A 4TV9B 1C8M2 2Z79A 3ZXEA 1W9WA 2Q1FA 3N9NA 1OUXA 2Y6GA 3EYPA 1GZWB 2HEYF 2UUCB 3H8OA 4FPKA 1MSWD 1YHQV 2ARHA 3S57A 1JFFB 2VW0A 1TME1 2VWKA 5LY2A 2C24A 4UW4A 3ZIAG 1ND2A 3Q8EA 4E2QA 1VBC1 5JXIA 4A4AA 3S3WA 2VS0A 4FPLA 3APOA 4H2AA 2Q1ZB 5KHKA 2BZDA 2JGUA 1XILA 3OE7G 3MDPA 4LHKA 1OH3A 3VQYA 3ZYIB 4GH4C 4WM7A 1AX1A 2NMOA 1AL22 1WD3A 3QH6A 2RM21 4XCAA 5GALA 1FX5A 3ZRWB 2XOKG 1LENA 4E4EA 3RWKX 1WLTA 4DV4B 1O7FA 2D5HA 3B93A 5LEJA 2QUOA 1ULEA 2JG8A 3VDDA 1KQSU 5CKNA 5DN6G 3K0DA 2YUAA 2JRIA 3HKBA 1IOAA 3A4UA 5FZ3A 3IPVA 3OJBA 4OI4A 4MTGA 2OIIA 2A3XA 3ZFFA 1KS4A 2R041 1WW7A 5FYUA 3DKWA 4PIXA 1G9DA 2V5DA 1W0OA 3OGGA 5IJ9B 4WVWA 2WSSG 1TMF3 2XQXA 2V4DA 3KV9A 1FAFA 3THOA 4LO4B 3OBZA 1ZRRA 4NIHA 3VBUA 4CU9A 3WFVA 3AKQA 3WU2Z 1P4RA 4ET7A 4IEVA 3K08A 2WPDG 2IJKA 5LP6A 1ZAUA 4Y1VA 5LASA 2WZR1 5IFPA 4RS5B 1W03A 2ZMKA 5LEKA 5LHIA 1V55C 5ANNA 5AFBA 4DY3A 4UFIA 5ITZA 3K0GA 2CWSA 5J2UB 3QO7A 1RMU2 3AEIA 4HVRA 2W08A 4IE4A 4XXAA 2XBO1 2HKOA 2DMXA 3B77A 5B1AC 4WBBA 1FPN1 2ZHLA 1VBE1 1VPHA 2EAKA 4KFMA 5B1OA 5TSWA 1Y9MA 2Q5TA 2JK5C 3FHAA 3NAPA 3I2IA 5FXXA 3IWZA 2VMFA 4YW6A 4BOWA 3VBRB 5JOYA 3FB5C 3T3YA 3S3XA 4Y3OA 4TT3G 4KHPO 3FD9A 2WINB 3I3QA 4R9BA 3P6BA 4X88A 3ITQA 1QVFU 3NWKA 4U3JA 5JCTA 1WCKA 2YXYA 1M57C 4K8FA 4NAMA 1OC1A 2RJZA 3RG0A 4X20A 4MOAA 5A2QN 2EALA 3W59A 5BMVA 4CDQA 5CEHA 4JAVA 2AHZA 4ISQA 3CCQV 2E53A 4AEJA 3LF7A 1QLEC 4LO7A 2JD9A 1AR5A 3AK1A 5FQ0A 4FTEA 1US6A 2H0VA 5IATA 2VG9A 4DXWA 2H8PC 4LK6A 5A33B 4GUNA 1UD1A 1V54B 5A3NA 2GMPA 4BM8A 3AZYA 1X59A 4MGIE 4B3NA 4RO2A 1KRIA 1NXMA 2WWUA 4XE9A 4LFCB 1QQP3 3A0KA 4PIZA 1NT2B 2WLQA 4C7UA 5CB7A 3K79A 1YI2V 3UT0A 1Q8VA 4LIVA 2YGLA 3KS7A 3MI8A 1PIV2 2G19A 1LU1A 1LNQA 4AI1A 4B3RO 5FKCA 4EZHA 4PDRA 2AZ5A 2OTJV 2WQ8A 1KGYA 2W1SA 2FBEA 2ZEYA 4E2SA 4L0PA 1LEDA 4XW3A 5IWAO 1OLRA 4JKMA 3ZKYA 4LKDA 1IG0A 2FL4A 3O0VA 5T55A 2WN2A 1ND2C 3S7EA 4FP2A 1HB4A 3MAQA 4JI2B 3J7LA 1A8DA 1B04A 5ISLA 1VQ8V 1Q6IA 4J41A 2O1QA 2LFSA 5IT9N 1PX3A 2B5UA 1OURA 1AR81 3FLPA 3CIHA 4G28B 4WM7C 1W06A 3BODA 1GOGA 5GLZA 3OUHA 4X1IB 2UY8A 5T5OA 3HKCB 4WM8B 5AFEA 4X64O 2X10A 5FZDA 5BUVA 2BTVC 2JG9A 1ULFA 5A32A 5DM6V 4CDXA 2VCAA 3NV2A 2M7WA 4PJYA 1IKPA 1K5MB 2JG8C 3VDDC 2QM8A 1RUJ1 4JAAA 3POEA 3JAWB 3K04A 3QACA 3KVAA 2E74B 2EJ7A 1KFUL 1BBT2 3J8F2 3J7NA 3IT8A 3SYOA 1JOBA 5IVEA 2BOIA 1JUHA 2B8MA 2WLIA 1KECA 2BVBA 3ZFFC 5JH7B 2VQ0A 3RZMA 3UT5B 4Q4W3 4DR4B 2OYZA 1ZZBA 4JYBA 1JODA 2DWRA 5FY8A 2A75A 2WBKA 4D7YA 2R073 5AVAA 3VBUC 5I8TA 1VQ6V 2UU9B 1YXBA 4DV5O 1LGBA 3DV8A 3AG2C 3ZN6B 4MGQA 2YFZA 1MS3A 1Y3TA 5LP6C 3OM3B 1FATA 4UCTA 1W6MA 2IXLA 3RGBA 3HN1A 3PDQA 1NTZH 2IC1A 5LB6A 1W6OA 5LA0A 4ZU7A 4TQDA 1SZTA 1HV1A 1SQ4A 1RUG2 4QPIB 3ABKB 2F43G 2A6WA 4GZ9A 4O61A 2CAZC 3OSDA 3ABLB 4MVUA 4AF9A 3B00A 1Q90D 4F6EA 1OCZB 4KQ7A 1S0CA 3FMGA 1AI4A 2BQPA 2LUWA 4FFFA 5EIBC 2XLFA 4BB3A 4J7ZA 2R49A 3UGGA 3ZM8A 1DDLA 5ERLA 5D8AB 4CPBA 2IH1C 5IVVA 4PF1A 1LOEA 3F7VC 5DG2A 3ES1A 3JQWA 1BKZA 2EICA 1TG7A 4LKFA 3BIEA 1RUF3 2XR4A 1H2MA 3AK0A 2WWWA 1W8OA 4TTGA 3MUY1 4CDQC 3D5OA 3FAVA 2LS6A 4K9SA 1SMVA 4AGRA 1CPMA 2D7FA 2EIMB 4A6OA 2R1BA 3N2KB 2CTQA 3OGCC 2IH3C 3L74H 2ZABA 2ZKNA 4Q26A 4X66B 4OPAA 4YW7A 2RDNA 3WP6A 2EIBA 2KA3A 2WDBA 2Q5ZA 4PDWA 2YY1A 1OA4A 1OSGA 5C3QA 1SLLA 1DZTA 3MHZA 3DXTA 1D2QA 1UU4A 2HWC3 4XBNA 2VULA 2YV8A 5KHGA 1W99A 1U5ZA 5LMUO 2ZPXA 2P90A 4QT6A 2HWB2 3AG7A 4HKWA 3HKDB 2QDOA 3HB3B 2XHBA 1AJQA 3ME2A 5GONB 1PVC2 2XQRA 2CDOA 2XJUA 5CNAA 4AR2A 1R092 2ZJCA 3KZ4C 1ULDA 5DZFA 4K3UA 1HRI3 1YJNV 5BNNA 5C93A 4JRLA 4XF9A 1P49A 3WDUA 4IEZA 1W9SA 4YM1A 4C0BA 1AR63 4MW8A 4K35A 3DTUB 2AUYA 3WV6A 5IW0A 3ABMB 2WLNA 4QX7A 2GMEA 1O5UA 4TN7A 1O3RA 5CBHA 4AHWA 5CG9A 5HCFA 1ODMA 3H01A 2HEPA 4A44A 3EFFK 4NIGA 3K4AA 3KHBA 1YC61 3ATGA 4GXLA 3OGSA 1ZTEA 5IK7A 3VDCA 3LSEA 3LIHA 1ULOA 5FLHA 1L8DA 3E5UA 1W2BU 4YVWA 4DR5O 1Q8SA 1H8VA 4Q0VA 5K9YA 4JI3B 4L11A 2N05A 1RPRA 4W6XA 3KV4A 4XZUG 4I0XB 4YVSA 3BAAA 1DBNA 1KXGA 3UNPA 1XC6A 4BA6A 1JTZX 4CU7A 2JG9C 4CDXC 2B1GA 2Y34A 2VMGA 3DYPA 3SC7X 3HKEA 1ZBE2 4E8DA 4K40A 3S7IA 5IYZB 1LNSA 2V73A 3RMXA 2YEVA 1LEMA 3GZEA 5CFDB 5A7WB 1JOYA 4TLGA 4MTFA 3CCJV 5GKAC 4EEQA 5CADA 4DXRA 4LF7B 1VBC3 4L97A 1XYNA 1QHDA 1HP8A 2VW1A 4Z82A 4ZU4A 1NKDA 4Q5OA 1ZWIC 2P4EA 5GZDA 2JGDA 5FYYA 4DO2A 2PYJA 1UIJA 1QJU2 3DL3A 3J81N 2EXKA 1SS3A 1YJKA 3T1CA 4EFBA 1NH2D 3G6BA 3CO2A 4LKSA 3HWJA 2D6NA 3WVJA 4X1KA 2E75B 2P2KA 2OQ6A 1DG6A 1OLMA 4CXWA 5J36A 3EB7A 3VBFA 2WS93 4QPJA 2J1EA 3O7OA 1QXPA 3RWNA 5FZKA 2IXJA 2WIIB 3TEWA 3MICA 1SFYA 1JZ7A 3I97A 4JPRA 4P9LA 5FIXA 4L8JA 4JI4B 4HXCA 2P3JA 2R062 4GA9A 1JHNA 3POWA 2WABA 5JJEB 5LA2A 5JVDA 3B01A 2GUZA 4KUMA 2JDUA 3KLSA 4GAZA 2EA7A 3CRQA 1RJ7A 4K0KB 4HG6B 4OI2A 2IFRA 5L7OB 5FOBB 4Q4Y1 5EZYA 2PY5A 3K57A 3O65A 1LOGA 4L2NA 2AH2A 1QLNA 2Z5UA 3DC5A 1UJWB 2FZ2A 1N47A 1P8JA 2J22A 3LWCA 4QX8A 1RUNA 1RUH2 3CCUV 1CPNA 2QDNA 4U7OA 1AYM2 3H1IH 5D5QA 2VMHA 1L7LA 3QF7A 3L9JT 5EK0A 1ASJ3 4JI5B 1HQNA 3PJQA 4L8QA 5BNOB 1APNA 2P3IA 3T2TA 3A23A 3BEHA 1MMMA 2XKOA 5D5PA 2JDKA 4MO3M 5FK8A 3L75H 1QGLA 4QB6A 2WFF2 4AVVA 2OXBA 2FHRA 3A22A 2AGAA 4CCKA 2W9XA 3UKMA 3WDYA 2VQTA 1N33O 2ZM6O 4LO8A 3A21A 5KX5B 1XHXA 3SYPA 4D3WA 4JZ2A 1VQPV 2QQVA 4FTSA 4NTXA 2HP8A 2P6HA 3LZZA 4DR2O 3RYFB 3THTA 2XJPA 2BTQA 5L9VA 1YVWA 4DRRA 4HONA 3RN4A 2KM2A 2DVDA 3OY8A 2BGPA 1RTVA 1HB1A 5BXXA 4E4HA 2ITCC 3AYEA 2ZTNA 1H6YA 4XUQA 1KD7A 4ZS2A 1DZQA 5LOVA 1OF4A 3NSTA 2HR3A 4B3SB 2XDVA 1G9FA 2QQWA 2VMEA 5FYCA 1QWRA 2EXIA 2VJXA 2OKXA 2ETNA 4OUEA 2X6BA 5BNNC 4IEQA 2VNRA 2VCMA 1XNQB 4U7NA 3LCPA 1SDWA 1W9TA 1VRH1 4FTBA 1GOHA 3CXCU 3B09A 1TVKB 4OXSA 4DR1O 2ZMLA 1EN5A 1FOD2 1CAVA 2PLV1 3Q4HA 5EBMC 3SYQA 1OOPA 1SEFA 5FZMA 4PCRA 3TOJA 3JSLA 1F4HA 1R6NA 3N7MA 4A42A 2XAQA 3FHIB 2JEMA 4MSWC 2XJQA 2CYFA 1GNYA 5AVPA 4LITA 2ERFA 1E5HA 4A3ZA 3CCMV 1VQOV 5LA6A 1KU9A 4YVSC 2P3YA 1IXMA 2JENA 3MHHC 5FYZA 3ZYHA 4BQ1A 3S0MA 4JI6O 5EWSA 2QTWB 1L0NH 2WO3A 4IIJB 4Y22B 1G9BA 5EFUA 4SBVA 4O4HA 2WYFA 4KU7A 3RRDA 2QCSB 4JGZA 4B3TO 3MV01 4W6YA 4RHV2 4AI0A 4B29A 3TEZA 1PZ7A 2AEZA 2VBPA 1MQTB 1G9AA 4CP9B 5IYYA 4DV3O 2D97A 3K06A 1ZZ6A 4XFBA 5F7UA 3IIAA 4I09A 2ZHNA 3MIFA 1IPKA 3KCCA 5I0UA 2JXAA 3ZKUA 1D0GA 1YLLA 1AVBA 4JV5O 1R083 2OIGA 3V0AB 3LD8A 4P14A 1YFWA 1AR91 2VD7A 4JZGA 1EPZA 1PO23 1LB2A 3VBFC 5JSPA 5JPMB 1A34A 4BIFA 4FOQA 4CH5A 2ILMA 3UKNA 3O1TA 1UIKA 4BZ4A 3ETEA 2GC2A 5T5LA 4R9CA 1F7YA 4S2GA 1BLZA 3JZVA 4CP0A 2P06A 3NV4A 4X62B 2QQIA 1RVF1 3LEMA 2UUBB 5FYVA 3BCCH 2V5YA 4JGYB 4QAWA 2BOJA 5EIYB 1V9U2 1EM1A 1VBA2 1YQ8A 2AR6A 2ATKC 3WOGA 4LBQB 3DXRB 5IYBO 3UO2A 4P9PA 4RD7A 2YU2A 4BQ3A 1XUQA 1I9RA 2P17A 3CP1A 2VZTA 4XVHA 3L71H 1GLHA 4DNYA 1BMFG 1JR9A 4AHZA 4CC5A 5EYYA 4AFCA 3J8F1 2YC4A 4AHXA 3B69A 4ZPIA 2VW2A 4J11A 4GT1A 1UMHA 4LHNA 4J7KA 3ZIXA 2A5ZA 2UWCA 4QB2A 5FUPA 2HG5C 4MSVA 2VMCA 2JDZA 5FKBA 2RQ6A 4OMDA 4PI0A 1QJY2 5FZCA 1HB3A 5F5CA 2EVXA 3KB5A 2VY0A 2DTYA 2FDFA 4Y5SA 1O3QA 2EINC 3I4IA 3A0NA 1UZYA 1POV3 4K8ZA 3KVBA 1JHJA 3DPRA 2IXKA 5E79Z 4R8HA 1PM9A 3ALQA 1L0LH
chains in the Genus database with same CATH topology
1UPIA 4GWMA 3AP4A 2RMU1 4AHYA 2ZKLA 3ST7A 4FPFA 2UY9A 1PO22 4JVAA 1VBB3 3AXDA 2O0OA 1H2LA 1ZZCA 5E1RA 2G9GA 2JE7A 3PLQA 3WW2A 4LT5A 1FYUA 4P9IA 4QGMA 2OG6A 3CF6E 4R9DA 3O2GA 1UU6A 3P3NA 4YW5A 3TWIA 4R9AA 2ET7A 4HANA 2OUJA 1D4M3 4B8EA 2WA3A 4Y1XA 2DVBA 4D7SA 1F2NA 1COV1 3AXEA 2P34A 4LEJA 3CJXA 3SH5A 4HKLA 1AR93 1VAMA 5CG8A 1RINA 4EN9B 5J98B 2IFWA 1U12A 3SCHA 1AUYA 4MGYE 4LNVA 4I02A 1OIHA 4IL7A 2CAUA 1AYN3 4AQ6A 1X82A 5ABJB 4IQPA 3OTFA 1V6IA 3ZX7A 1ZBA2 4XFCA 1OOPC 3VGIA 2HWE1 1RUC3 2XL9A 1GYKA 2EXHA 2EAAA 4HBNA 5KC5A 3MZHA 1PO11 3O0XA 3ZXKA 1VRH2 1RUI2 4LA3A 4P9GA 3CJIC 1M06G 5ABJA 4YW4A 2EIGA 2Y38A 5GZCA 1YXWA 2HKXA 3DGTA 2GZWA 1U0AA 1DLLA 4CDUB 1H30A 1DGWX 1C8M1 4X8PA 5JSRA 1RVF3 2PLV2 4NE0A 2O8OA 1JH5A 4F8AA 1VZ4A 3ZFEB 1U5XA 3ILFA 4BE3A 3VBHA 3VL9A 2I07B 3VBFB 3WP3A 4KU8A 4CDUA 5HCBA 1HKDA 1SLBA 3AZZA 4W6WA 4Q4V2 1Q3EA 1ZM1A 3MPPG 5AC91 4Q4X1 4AVAA 1UL9A 1C3HA 1VLNA 3MF6A 4E27A 1C4RA 1WLWA 2DUPA 1YCIA 3K51A 5JSOA 3U07A 4AW7A 1GSLA 2A71A 2D3SA 2A73B 4OFGA 1VBD1 1EV11 2OG7A 3WG3A 4AQTA 1YYNA 1D0HA 1D4VB 2QNKA 1WLDA 2RS53 4FOWA 4FQZA 4XJUA 1FV3A 1EAH1 3R05A 1QJX1 1URXA 3KSCA 3TYJA 4Q4W1 4FPOB 3G6JB 2GNTA 5K8SA 2HWD3 1RUD1 4META 5E88A 4TZDA 2TUNA 4QX5A 2PELA 3AZWA 3VZKA 4YFZA 1CAUB 3S30A 4YW2A 5J09A 1AL21 3B02A 2XKPA 2D6MA 4MH0E 4JGZC 2RS12 1NQJA 4FOVA 4GH4B 1ZRFA 4K6BA 1FOD3 4DB5A 4YM3A 2VU9A 2YYOA 1BEV2 1CAUA 1TNRA 1QY4A 4XF1A 3I2DA 4XZPA 3PTYA 3J9SA 1UAIA 5FFOC 2P3KA 3PVBB 4COUA 2D44A 3SWTA 4GH4A 1N3PA 5JR7B 3RYRA 4HMZA 1MVEA 1S0FA 3IN9A 5BV6A 3K48A 4YGBA 2GH2A 5FTTC 3ZYRA 4XYXA 2ZHKA 5D1IA 4XFFA 4B4QA 4E9KA 3DUIA 4RGAA 1MQTC 1NCQB 1T6GC 1O3SA 1WW5A 1SLCA 2DVGA 4HLTA 3JBG2 4HN0A 1JOJA 4H3WA 3VKNA 2CWMA 2RR12 3FE5A 1RHI3 2WKKA 5LRRA 1NCQA 1A3KA 1VR3A 2VGDA 2ZGKA 1WBFA 3ZFGC 1J3RA 4BYYA 2QKDA 1BCXA 1HXS1 1POV0 5GJ6A 3BTAA 1Z7S3 2Q0AA 4XBLA 2QE3A 4J5IA 2AGSA 4XF0A 4YW1A 1MACA 3H1WA 4LBKA 4S2DA 3X29B 4IV3B 4AVTA 3PMSA 4QPGC 2RJLA 1AR73 2XLAA 5EV7A 4UXAA 2YROA 1LU2A 4Q2FA 1AXYA 1SCSA 1GICA 2AYHA 4IV3A 5C9AB 1D4M2 1LHWA 3WP5A 2ZGUA 4A7ZA 1CN1A 2E7QA 4I0AA 5KC6A 5I93A 1AR92 2E9QA 2X5IB 2RMU3 2ZA9A 2PHFA 4P9JA 4Q1RA 5C9AA 3WHUA 2ZZJA 4BWOA 4OHXA 2Z69A 3AKTA 4H7LA 2RS33 2X5IA 1PM7A 3AYAA 3SH4A 1RUC2 1GY9A 1IS6A 2JD4A 3CLPA 2A6ZA 3QOPA 1H1IA 3ECQA 1Q8QA 1S0JA 2Q30A 4LA2A 3EHKA 1OPMA 4AFBA 3M7AA 3I54A 3OD0A 1COV3