2Y0IA

Factor inhibiting hif-1 alpha in complex with tankyrase-2 (tnks2) fragment peptide (21-mer)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
339
structure length
339
Chain Sequence
SGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1-ALPHA INHIBITOR
publication title Factor-inhibiting hypoxia-inducible factor (FIH) catalyses the post-translational hydroxylation of histidinyl residues within ankyrin repeat domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/peptide
total genus 102
structure length 339
sequence length 339
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2y0iA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2y0iA01
3KCXA 2WA4A 1YCIA 3P3PA 2W0XA 3D8CA 3OD4A 5JWPA 4Z1VA 1MZEA 2CGOA 3KCYA 1IZ3A 2WA3A 1MZFA 2YC0A 4NR1A 2Y0IA 4JAAA 4B7KA 1H2KA 4QU2A 2YDEA 2ILMA 1H2NA 2CGNA 2XUMA 4AI8A 1H2LA 4B7EA 4Z2WA 3P3NA 1H2MA 4BIOA
chains in the Genus database with same CATH superfamily
3CMEV 4GKXA 3E5QA 1VIBA 4X62B 4KMQA 4AVBA 3D82A 1WD3A 1SQGA 1HNXO 4CU6A 1SPPA 4M3CF 5FZGA 5LA2A 3FMGA 5EBMC 4E2QA 3JASB 1UU5A 3K3WA 1PMJX 2AZ5A 4XEZA 3RZMA 1WPXA 1VBB1 2CV6A 5CB4A 5IWAO 3VHOA 1PHMA 5IYCO 1W2TA 1VBE2 3QF7A 1IOAA 2ZA9A 3T1LA 4ARXA 1HJGA 4A42A 1WBLA 5LL6Y 1L7LA 2IXJA 4XFAA 3B40A 1AL0G 2HWF2 1BSMA 5FIXA 4I7ZB 2EULA 4AXOA 2UXCB 1NT0A 2KQXA 5IHRA 5CKMA 3AMHA 5FYVA 3GYDA 2JE9A 5KX5B 2PHTA 4LO4B 1S5LZ 2JDYA 1AI4A 4HVQA 3MV01 1RMU1 3NNJA 5A7WA 1NCQB 5JXHA 5E88A 5C6CA 2GP3A 3B69A 3OGVA 5GTIZ 2ARAA 3N9MA 5AG2A 1RL3A 2DCYA 5FXXA 5IE9A 4LO5B 2YB7A 4FAGA 5T5JA 2AUYA 3VZKA 4XXAA 4RO2A 4XF4A 3JB8A 3P3PA 2H94A 5JSRA 4EZHA 3CLPA 1OC1A 1ZA4A 1PKXA 1DQ2A 2MK3A 4FTBA 3KVBA 4O9GA 2RDCA 3S3XA 2XJUA 5FY9A 5FRAA 5F32A 1T2XA 1SHWB 4GH4C 4XPVA 4CCEA 5EC2C 5DZFA 1ENRA 4NJ4A 2D7FA 1OCOB 1PVC3 5BR8B 2BNNA 2FB5A 2A3WA 1KQSU 1Y76A 4RHV2 3AZXA 3MYXA 4FPPA 4GJZA 5GLVA 5CBHA 2FHRA 4AQSA 2VWKA 4DXZA 2ZD9A 4NE9A 1Q8OA 1CGPA 3H3ZA 1W9WA 4JPRA 1GICA 5LHGA 3CXHF 1BYHA 3WU2Z 2YXLA 1JFFB 1LOFA 5FPXA 2SLIA 3K04A 2BNOA 5CADA 1JW6A 2ZNJA 1IGOA 2EIEA 3MDPA 2XJPA 3M70A 3NJZA 4B4RA 4UW4A 3N7MA 2VECA 5FZ0A 1AUYA 3ZHQA 1W0OA 4AILC 5LOVB 1VBB2 3UNPA 2WABA 2P90A 2X7RB 4HYOA 5KXDA 3OGSA 3LF7A 4O2BB 4Q4Y1 2X5IC 5D8AA 5KXCA 3OD4A 1WNSA 1S2EA 1UN1A 2G9GA 1T6BX 3IDEA 4DPNA 3CJIB 1N32B 3N9PA 3KF5A 5B3SC 3RYRA 5A32B 1HRV3 4HPKA 1UY0A 4AGGA 3DYPA 2XMLA 3SGIA 2QGNA 4KWUA 2UXDO 3AG4C 1ULEA 4X8AA 4DEVA 3WR0A 4BCUA 4EWDA 2MNGA 2UWBA 1V6LA 3B7MA 1RIRA 5IW0A 1FXZA 1RMU2 2R1BA 1R73A 2LW1A 1G8WA 5C8CA 4URAA 3HKCB 1U0AA 4F83A 2UUCO 1BK0A 4G4FA 3SJQC 3GBFA 3M8LA 1PX3A 3ICXA 4QHZA 4BIZA 2VMEA 4L92A 4RR3A 4JDNA 4S2DA 2P3IA 4BQ5A 5T3NA 1LJ7A 2DTWA 1HNZB 2ZR3A 4MGYE 1RJ7A 2VAUA 3CNAA 1V6JA 4OXSA 3PUIA 3JAMN 1FV3A 4BQ3A 1LRHA 1WMFA 3MEPA 4JTOA 2Y69B 5JCTA 5JI7A 1MEC3 5FLXN 4H33A 4O4HB 4WVVA 1N33B 5HCAA 2QJ1A 3HQUA 1EM1A 4AHCA 4Q20A 4KWLA 3C3SA 2WLLB 5IY5B 1GOFA 3H50A 3IC9A 4XETA 3LSEA 2XR4A 3V64A 1NVPD 1PNLA 4PDLA 1F5JA 2RS33 4NRMA 3AP9A 4FFHA 4QX1A 1V00A 1DCSA 2Y6LA 4LJHA 4KGQA 2E74B 1IQDC 4QM9A 5SV5A 4AHXA 3SYPA 1VB4A 3IPVB 5B1BB 4LKSA 4G28B 3LA7A 4UFKA 5IYYA 3CKHA 4EROA 1N36O 5EV7A 1CAVA 4WBNB 1AL21 3ABLB 4X1KA 3AK1A 5FZ6A 4C0BA 4XMIA 5FK7A 5C5TA 1MSDA 3EXUA 3BVCA 4IEPA 3URFA 4NWWA 5HBAA 1K5JA 3IT8A 5ANQA 2EIJB 5DN2A 5A3WA 1ZTEA 2A6ZA 3HPNA 4KBZA 3OUIA 4BQ1A 1K3EA 1D5NA 2MPFA 2E6VA 1AR61 4IEUA 1NTMH 4KL1A 2OYQA 4ZOLA 2R30A 3VQXA 1TNRA 2DMXA 2OIEA 5B66Z 4CC5A 4Q4Y2 4MSVA 1IPKA 4CRQA 4LEJA 4IUGA 1CJPA 3LPGA 4LOSA 1PO11 5LP6C 2GSYA 5CBGA 4L99A 3FUQA 5FBZA 1YJKA 5L19A 1XBFA 4LF7B 4WFHA 2YROA 4BU2A 3DPRA 3VDBA 5KUKA 1LESA 4P30A 1VB2A 1H0BA 5FZOB 5CFDC 4JRLA 3VBRB 4JGZC 3RJRA 3IDBB 3EBRA 3OEAA 4JI3B 2W95A 3K4ZA 4FPOB 4W50A 4CEYA 5F1RA 3WP5A 4LBQB 4CPBA 3J8F1 3D0SA 3LFIA 4XAEA 1IURA 4MVQA 3NMBA 3GBWA 4FOQA 1VQLV 4HXCA 2EILB 4LITA 4ICGA 5FYUA 1F9KA 1UX7A 1H1AA 2XL9A 3X29B 5JI9A 2ZZQA 5F5QA 1LHOA 1MS0A 4PIZA 1AYN1 1YQCA 4E9KA 1V6IA 2ZGMA 3PUQA 3ZEDA 4UCSA 3VBFB 1O3SA 4LP8A 2Q1ZB 2JEMA 3KZ4C 3G67A 5GJ6A 3HIFA 2Y38A 1XNTA 1FS0G 1W39A 2RS53 2IUWA 2JG8B 3SJCC 4XUPA 1NUKA 3K2OA 3OB8A 2WFF1 3RGBA 1DF0A 1W8HA 2YFUA 1DTOA 4MVMA 3VOUA 2CE4A 4YYOA 3SITA 2WNVB 3GCWA 2BTVC 3WHTA 3AM2A 3JAWB 3H7YA 1GBGA 1AL22 3SH5A 2XL7A 3DYMA 4PELA 3LD8A 1S77D 1UL9A 3JARA 2DUOA 4H7MA 5DAWA 4AI1A 2AENA 4WM8C 3OMIB 3CMGA 3NL1A 1NS1A 2BVBA 2WFPA 3BYWA 2KG7B 4QPGA 2ZEYA 4I3PA 3ZFEC 1N1TA 3IGAC 1PVXA 4Q2FA 2P4KA 3RZZA 1COV1 3K48A 2M6YA 1QQCA 4JX0A 1WUVA 2RDNA 1AR73 1AR62 4H44B 4CP9B 2ZX2A 5FZ1A 1DQ6A 3D3IA 2H6BA 1QJZA 4BLIA 4OHVA 2PAKA 2ZS6B 4PDVA 3SC7X 3CJHB 1PO12 1OF4A 5FZDA 2EJRA 4YY3O 3PTRB 3FHQA 3KG2A 5I0TA 4C8DA 3RZGA 3N7LA 3K06A 3RYPA 4NB5A 4K35A 2WNEA 3LSUA 5BV6A 4FPFA 4RUFA 4PA3A 4A4AA 5LBFA 1J3PA 3BRCA 4DXSA 1AI6A 2GZWA 4FLXA 2E76B 3J8F2 1UF2C 3Q4HB 3POYA 2WL1A 3LDCA 4XUQA 4LFAB 1Q6UA 4QQHA 5LGNA 4OQ8A 4QU2A 1WW4A 1H8TB 5FKCA 1VQKV 2XJSA 2CAZC 3NRUA 3FAVB 3VBHB 4TWTA 1O9GA 1I08A 2QCSB 4FFGA 4A45A 1AYN2 3JD3A 4J1WA 2R70A 4YJ3A 1CPNA 5LMUO 1UU4A 1HDKA 2VZOA 4DRVA 3HN3A 2P6CA 3ABMB 3NNGA 3OD0A 4IV1B 4PDMA 1M56C 3DKQA 5FLHA 2YG0A 3N2KA 4WM7B 4CP2A 4YZ1A 3GHMA 1KP2A 4QX3A 4CEWB 3WNKA 3WW3A 4UVCA 3D6EA 3OTOB 2B1GA 3VQYA 3E8GA 4QHBA 2JENA 4PBPA 2J7MA 3MIEA 3LDKA 1XMOB 2O8OA 4R52A 2E33A 4QGPA 5LXTA 2V4VA 4O4IA 1A34A 2XVLA 5BNPC 2RM21 4FOVA 2GMMA 3FHIB 1VQOV 3WZ1A 5CKQA 3D5OA 5CBLA 3VBSB 3IFXA 1W9TA 3N36A 5EWSA 3K5NA 1IG3A 3ZIXA 4XJUA 3ZN6B 1UYPA 1CPYA 4DRXA 1NZIA 2KD7A 1BVP1 4AFBA 5EBLC 3AKRA 2Q1FA 1K34A 3IAPA 1XYNA 4Y33A 1DGRA 4NN0A 2A6XA 1VLNA 3CZUA 1HRI3 1NVPB 2YIBD 2UXBO 3RMXA 3BA8A 1TUEB 2EVXA 3O1UA 4OGQB 2W1UA 1UOBA 2NN8A 3UYJA 4KQ7A 1NTKH 2FZ2A 2DQ0A 4GA9A 5BPXA 1GR3A 1PM7A 1S0EA 3W9AA 2WZR3 1QF3A 4HSLA 4C0HA 1MQTC 2P4VA 3UGHA 3JCUZ 4XCAA 1FOD3 2EICA 1HW7A 4PIYA 1K7DA 4BQ2A 1XMQO 4E4SA 3M7AA 4I9QA 3E6CC 2LGQA 4L8JA 3ZBHA 3USUA 3WNMA 1R1A1 3THTA 1UPGA 2B46X 1S3JA 2JRIA 3H1HH 4FLTA 4OI0A 1HXS2 4AI2A 1YTFD 3SH4A 1SFYA 1YQ5A 4K7JA 5BNOC 1BK1A 2A5ZA 3E22B 4U3JB 2IXLA 4O7XA 1TG7A 5FUIA 3KV4A 3AK3A 2ZGNA 2JDNA 1J1TA 4X64B 3FB7C 4LIVA 3PLQA 1XL6A 4KU7A 1L7RA 3OM3B 1FPN2 1M06G 4BW5A 2WWSA 3A0NA 4JKKA 5FZ8A 3APBA 5EP9A 2RMU3 5FY0A 3J26N 4J1XA 2ZKOA 3P1IA 4UFHA 5I8TA 4WV8A 2VG9A 2XQXA 3AVSA 1RM1B 1X8MA 2WLJA 2D5HA 3AK2A 1RUI3 4XZUG 1SLBA 2OPKA 4WZCA 4W6YA 2GNTA 2CTWA 3T4HB 1ZRRA 3AG3C 4ZZ8A 4LOTA 2RM22 1P7BA 5CVRA 1MVEA 3MIFA 1NE6A 4NIIA 4F6EA 3RI8A 3HN1A 2E26A 2CGNA 1DDLA 3L9JT 2VTXA 1XNQO 4I55B 3OBTA 2RR11 1MR5A 2A6WA 3TAYA 5IK7A 4TN7A 3JQXA 4RA0A 4B3SO 2LUWA 4J25A 2VCAA 4L8QA 5LWBA 1I5PA 4NXMO 4LIUA 1L7QA 5A6YA 3OMNB 1QJU3 2EXHA 1O4TA 1UOFA 4YW6A 4Q4V1 4E4ZA 1C4RA 3B93A 5A32A 5FYTA 1OCCC 3ETDA 2AGAA 2PY5A 4JYYA 3WX5A 5A7SA 1NX9A 4QX8A 5KBFA 4LBLA 4COZA 3PNAA 2OZJA 2JIGA 2A6VA 3T2TA 1KRIA 5CG8A 3OGIB 4EFEA 3E5XA 1AJPA 3H9AA 1R1A2 5J3UA 3BA9A 3I55V 3JQWA 1F4AA 4WFEA 5F2VO 3MICA 4YPJA 1G9FA 2AC1A 3IIIA 4WF9V 3B3QE 4QHOA 3UQ8A 4BMEA 3O14A 4PF1A 4MHUA 3APQA 4P5HA 2B39A 2K9ZA 2Y4TA 2BCCH 2HWB3 3BUCA 2WWUA 2H0BA 3E8FA 2UU9O 4N7IA 3WY6A 1YXWA 3ROUA 2CDYA 1YI2V 2W94A 2EJ7A 4XURA 3WLUA 4XXPA 2B45X 5K0UB 3I97A 3WDYA 4Z2WA 3SKJE 2D6NA 1OH4A 1COWG 4LWSA 5D5QA 5A7NA 1J58A 3ZSJA 2E75B 4UB8Z 3OJBA 4CZSA 2ERFA 4OI2A 2UY8A 3MLJA 2JX9A 4K8ZA 4X1IA 1JR9A 1PGW1 4ASMB 1JYIA 1GN4A 2DW4A 2KXLA 1SRYA 2VE1A 5H9CA 1LEDA 3CHXA 1VIWB 5T5LA 2W6JG 3JAKA 5JZGC 1OCZC 2VBBA 4JI5B 4CDWA 4F6RA 4MT8A 1ND2C 4HOOA 2D40A 1XILA 4KFMA 4XF9A 2EIMB 1WZXA 4AGVA 2RR12 3K4DA 3MIBA 1VQ7V 2E7TA 1Q7YW 3OGCC 2HLDG 5FP3A 2CHHA 5KHKA 3HR9A 2QA4V 3CCUV 4FPHA 4FT8A 3KM5A 5EYYA 3LNMB 3ILRA 1AP6A 1DQ4A 1XQNA 2HWE1 2GP5A 4Q4V2 1OPMA 2HWD3 1JU4A 2IU0A 2JJ6A 1PK6B 3FBYA 3D3QA 3T3YA 5DUVA 4N90A 5C4WA 1PZ8A 1YI7A 4L87A 5BMVB 2EIKC 5FZHA 4XDPA 4PDWA 1RSOA 3WNNA 1LU1A 4K8XA 1O7FA 4BIUA 4CSWA 2R041 1J3RA 2YGLA 1BT8A 2ZABA 5LYJB 4LBQA 5FV3A 2X53S 1NYWA 4MTFA 4HKLA 3IKWA 1EFRG 1WBFA 2N04A 2YU2A 4IYHA 5FK8A 2QQPA 1F35A 3MW4A 4PA4A 4RS5C 2C1FA 1Y6XA 3ABUA 3S30A 1FJGO 5JCOC 5EZYB 2HJFC 3WHUA 4LR3A 3KT1A 2XAFA 3VD5A 2ZX0A 1PP9H 5FZAA 1ZBA2 1UMZA 3NAPA 4MLOA 4UCOA 4R9BA 4NOTA 4CE8A 1J84A 1GN3A 2RS12 2ET1A 2DVBA 4UW6A 3S5AA 2CUGA 5H9QA 4A7ZA 2WINB 3RZJA 4DV2B 1JBCA 3CWBH 5H6QA 1R093 5F3GA 1XNBA 2EIBA 3ZYBA 5GALA 2XLFA 3APOA 2BW8A 1PGW2 1H30A 2BOBC 4AR2A 2WYSA 2R49A 2XLGA 3K58A 4E27A 2HJIA 4QXCA 2BGPA 4LHSA 1OMIA 1MZ6A 4HNAA 3CO2A 4HG6B 3ZFGB 4I0XB 3O5SA 1KQRA 4A44A 5FPZA 5ERLA 2EAAA 3H1KH 4MX3A 2W3JA 1LOGA 5E8AA 5T54A 3LOBA 4META 1BQPA 4XFIA 1FAFA 1MZ5A 3BTXA 1KYOF 2YEVA 2Q30A 5C70A 2QTWB 3NKGA 2GC3A 3AL6A 4QQLA 4RQFA 1Q56A 1JMKC 4DXTA 3LEGA 4GWNA 2VNOA 5DUWA 1S55A 4QPIB 2F4VB 3STZC 1JZ6A 4KI5M 4BK4A 3NR7A 2HWE2 2XAQA 3PVOA 2XDVA 5FY5A 1G7YA 3ACGA 4FLUA 4DR3O 5IJ0A 3L9DA 3K57A 4CH3A 1NH2B 3H1IH 3LQCA 5LA0A 3ASNB 1AR71 4UAPA 3F95A 1Y9GA 4FQZA 3ZX7A 2R042 4OHXA 2W1SA 4U36A 2NQYA 4PA9A 2BV4A 4AEMA 4R8HA 3OSDA 3WEZA 1EP0A 5AVAA 4NWVA 5IK8A 4N9IA 1THZA 4XOGA 4XYXA 4YVSC 3WG2A 1GM9A 4K3AA 2Z4FA 2P67A 2CGOA 1H8TA 3ZMTA 5A3UA 4I5SA 2DJVA 3W5NA 3MFCA 3WG1A 1QJY3 3EMRA 3LZZA 3U14A 1WLEA 1IQAA 2NNUA 2IBZH 2VOKA 2BE3A 3ZMZA 1I5ZA 3M3IA 4JYAB 3MHSC 4FFIA 1DK1A 4FTSA 1RXGA 4U2AA 2R7EB 4OX9O 1WPBA 3JD2A 4HKWA 1UKRA 2HKXA 2NN4A 1E57A 1GN6A 3PL0A 1I1EA 4DUZB 4I3GA 1W6MA 1Y9QA 1W0PA 1CAXA 5SV8A 2VY0A 2DCZA 3H01A 4TUYA 3F7YC 2R073 4O4JB 1O8SA 4YM1A 2VD7A 3I56V 1LECA 3SMHA 4Q4X3 4IHJB 2WO3A 1IXBA 3Q8BA 1SFNA 1PM9A 3ZN5A 3VKNA 3ZN6A 5LBEA 3LPFA 5I8YA 1QJX3 3ETGA 3CEIA 2RDQA 4QQOA 3H3LA 4FBFA 2XVGA 3ML0A 1QCEA 4CCKA 2Q5ZA 4M00A 2X8KA 2Q7HA 5G04L 1QVGU 4JGYB 3DXRB 3VDDB 3SDLA 2Y8KA 3RZLA 2EINC 4DV6B 2GNDA 3O1TA 4FPCA 2Q4SA 3A2FA 1W0KG 2ZX4A 2DURA 5AC91 4YHHO 5FY7A 4AF9A 3RT3C 3OEHG 3T1YB 3JU9A 1W2OA 2E7AA 2YPJA 4AQ2A 1OD3A 3OE7G 5BY5A 4PHZA 1ND3A 1SQQH 1V54B 3NJXA 4AQYB 1EYBA 1N1VA 3R66A 3UGGA 3X2QB 4K1ZA 3SPGA 4AAPA 3D8CA 1HRI1 1DZTA 2EF6A 5JJEB 3H9VA 2UXNA 4M4RA 1W59A 3WF3A 2TNFA 1OLME 5IVFA 1Q86W 1YC61 1A3KA 3OR7C 1KITA 1VQ6V 1H2KA 2XHBA 3CIHA 5J2UB 4JI6O 1AZDA 3RW0A 5B1AC 3LEIA 2NM1A 3V56A 3WDXA 3CCJV 4AFDA 1BE3H 3ZDVA 5I0UA 4QQPA 4X8PA 3CC2V 3E22A 4U3JA 5A3OA 2JIJA 2ZE6A 3JB4C 3WOGA 3AKPA 5GONA 4XDQA 5L3BA 3WUCA 1D5AA 2JG9B 3JATA 5A3NA 1OOPB 1DGWX 3J7HA 5D8AC 4JI1O 1UYZA 1Z2GA 3T0AA 4CDQA 5LBBA 3WB1A 4YLZA 1JI6A 5E89A 1UOGA 4BDVB 4GKJB 3GZAA 2R9AA 1ZVFA 4HBNA 2OCHA 3E6DA 4LT5A 1K5MC 1SQVH 5KAFZ 1LENA 3T2QA 3UGFA 5CBFA 3ZSMA 3JCIA 5FWJA 1BJQA 4E2SA 2CTRA 1HNXB 1XREA 3V65A 5EYPB 1ZWIC 3OPTA 4WZFA 4H7LA 2VJXA 5JOXA 4JV4A 1NTZH 2CTVA 4AE2A 4I55A 4TWKA 4YGCA 2JD9A 4IL6Z 2R6QA 4XHXA 5IWAB 2RN9A 1MS1A 4JDMA 1FPOA 1WN7A 5C3RA 2JS3A 2VUAA 5T50A 5K4LA 4Q5OA 5J37A 1I0HA 5AC92 1N34B 3NJVA 2YUAA 3UKNA 1GZWB 1S0FA 1GQPA 5BNNC 4CCDA 4BXSV 2JDUA 4GALA 3UO2A 1M57C 4O9EA 4LF5B 2PYJA 2P34A 2WBKA 4BE3A 5F6LB 1MG1A 3F5TA 2HFEC 3DXUA 5GKAC 1AXZA 4GX1A 4ES9A 2VZVA 4AVCA 1Q8SA 2OVUA 4YW1A 1GV9A 4PLNA 4N53B 4Q0VA 2WA3A 4FPEA 4NIHA 5FZ3A 2R9IA 1O3RA 2UU8A 4YW3A 1QOSA 2JS5A 5FDBA 4RQPA 4UT5A 5H9RA 5EBWC 1TVKB 4JI0B 1ZNPA 1OUXA 4KG8A 3K9AA 2WUHA 1ZUQA 3CC7V 1K73W 2VNRA 1H2SB 1N3OA 1MNGA 3PVBB 2W5FA 2LFRA 4YGDA 5FQ0A 5GLUA 1WLCA 3NV4A 1AR81 2ZXWB 4BXFA 2G4IA 4PA6A 2PLV1 2VM9A 5CYYA 5IUQA 3EO6A 5FWEA 2PTMA 1REEA 2JDPA 2BERA 1GNYA 1RUF3 1KBHA 2BBVA 4FZ0A 4DR6O 3GALA 1Y3TA 4GAZA 5LCWL 3EB7A 1ROPA 3OW2U 4TSVA 1NR1A 4O4LB 2WNOA 3MUZ1 4FFBB 2W1QA 4XILA 2BGCA 2ZIOA 5B1NA 3T0DA 2QTOA 3WVJA 2VXJA 5GLWA 1B35A 4UI9L 3LSSA 1NA1B 4CH6A 2GMEA 2VBPA 1DHKB 5A7PA 4OZOA 5FYYA 2IH1C 5FUPA 5IJ9B 4K8RB 2ZINA 1X4TA 4IEZA 2FD8A 3WG3A 3LDDA 3KHCA 1JOYA 1AYM1 2B9VA 2VPVA 4PI2A 1QMJA 3STLC 4IL7A 3OTFA 1OQ1A 2Z42A 2DTYA 4XTPA 3W7XA 3ZXLA 5AVPA 2P3JA 1GP6A 3IZOA 5IJRA 4DUWA 1IS4A 2E7QA 2YV8A 2CNAA 1PK6A 2XKOA 4H2AA 3Q8AA 4X66O 1DGSA 2ZDIC 2UXDB 4CCJA 1SLTA 3KF3A 4QWNA 3M99B 4D6RA 3JALA 1QWRA 3DUIA 5KLVH 2BSKB 2OZ6A 5HV4A 3TWIA 1MZFA 3AMPA 5JSOA 2VUJA 1REFA 5L3DA 3PIGA 2UUCB 4YM0A 2J1EA 1GYKA 2DCKA 1QDCA 1ENXA 1H1MA 1M4WA 1VQ8V 2WO1A 4GMP3 4OI4A 1Y7BA 3FKSG 2ZGRA 2D6LX 3J9SA 5F2WA 1BKZA 4E2LA 1BCXA 2QWRB 1UO9A 4DV1O 2ZGQA 2WC2A 1YJWV 3OY8A 1I6XA 3H8XA 2YXSA 1ZRDA 4MGQA 4X20A 2IU3A 1KFUL 2J1UA 4JYBA 2WO2A 1A6CA 5FY1A 1SG3A 2JE8A 5IT9N 1AR82 4GKKB 3E35A 3DKWA 4DUYB 2Z0AA 1R6NA 1GP5A 2NMNA 2PLV2 2W9XA 3VD9A 1P49A 4LO6B 3N2GA 4PT6A 4IIJB 2QUOA 1QVFU 2YGMA 3FJSA 2I07B 2XKPA 3IMMA 4P9WA 2YI8A 4RFRB 3OBZA 2X09A 1N36B 5D2AA 1C3HA 4OUMA 4MS2A 3R65A 4OPAA 2XBO1 2Y6FA 4TLGA 2AGSA 4CA9A 2F93B 5DN6G 3VBUC 2ZHLA 4YVWB 5BZBA 4I0XA 2RCVA 2Z69A 3CCMV 1C1LA 1QR9A 5C9AB 4HL0A 2DE0X 1QH7A 2VZRA 2ZXQA 3WQ1A 3M7MX 3SISA 1SZXA 1SQFA 1DQ1A 1AF9A 2EAKA 2W2IA 4Q1PA 4XMAA 3KV5A 4QX7A 5JQGB 4FOWA 3VBOA 4DZGA 1R091 3I5DA 2IXKA 1W06A 2OA2A 3RYKA 1AR4A 1AYM2 2HVKC 3POIA 3RYFB 3EXAA 2BOCC 3CCEV 1AJNA 2ODMA 4NPRA 4MVTA 1QQP1 3W7SA 4URTA 4BQWA 1AVMA 4EE2A 1MVQA 2J1SA 3L70H 5FZ4A 1KGYA 4U3FH 1DP0A 3B00A 3B9IA 4FQ4A 3UKMA 2A70A 4IGGA 1ENVA 2FDJA 1SPPB 4I09A 2VQAA 3WB0A 4UFJA 1HV1A 5CG9A 1RUC1 4CCCA 2QTSA 4DS0A 3QACA 1JH5A 4RN5A 1XOUA 4AYUA 1F8VA 1C8M2 5CB4B 3KQRA 2OXBA 1H1IA 1FNYA 3HKDA 5I8SA 1RFYA 1BEV3 3ST7A 5LEJA 4AVAA 2DF7A 2QWPB 1BZWA 4XJWA 5GW7A 4IEOA 5BXZA 3ME2A 1R083 2VQFB 4CH5A 4OMCA 4ZXEA 1JU3A 3RN4A 3ZRVA 2ID4A 2GAUA 3JYCA 3K46A 5C33A 5LY1A 1ZAUA 2AEYA 2WS93 2TBVA 2RJLA 1NCQC 3WF1A 5KXEA 4K40A 1FV2A 2Q6AA 1ZA7A 4O4JA 3T1MA 4DV4O 2D3PA 2I74A 1YITV 3DYOA 2XBO2 1UOJA 1Q5OA 1GMMA 4I9WA 4IHJA 1NOVA 1VRH2 4QDQA 1K42A 4AEDC 4GWIA 1JOJA 1YCIA 1YRZA 4RYDA 2VU9A 2ARHA 4M0HA 1MZEA 4K20A 2QDRA 5A70A 1SQPH 3FZ3A 3ITQA 1OHHG 3BEHA 4NHKA 1LHNA 3CS5A 4ZHQA 4LO8A 1XYPA 1UZVA 2YHJA 4CCLA 1PGSA 1OF3A 2AREA 4LULA 1JJ2U 4TT3G 5JWPA 5J7MA 4PQQA 5ABJA 3DN7A 2R071 5CN0A 1IKPA 3B8MA 2CDOA 2KKWA 4FTEA 4NHXA 4K1YA 1QQP2 3CSXA 4YY3B 1OCOC 4N43B 1W0JG 4ZY9A 5F5IA 1UQXA 2E51A 4M3CB 5CFDB 1IXMA 2QQNA 2ZGKA 1FXKA 1H2LA 4YIPA 4MV2A 1LGBA 2MEV3 4DR7O 1RUC2 1XNAA 2RVAA 2LP7A 1G6NA 1JA8A 4LK6A 4ATFA 3G4SV 4LF8O 3JBG3 5KR7A 1Q43A 4KWJA 2RJ2A 3JD71 4BQXA 1M90W 5LA9A 2D6OX 2WQ4A 4AHZA 4J10A 1LOBA 5L3FA 3TNQA 2E63A 4AVTA 4YFZA 4LUKA 2AHYA 2GV9A 1ASJ3 2Z3YA 2BP6A 3TXQA 1S4CA 4DV5O 3CJIC 5LMUB 5EQUA 2A7WA 4HPKB 2YXYA 3ZYIB 5T5PA 2JDHA 3OPZA 3HQXA 1VMJA 1S2KA 1XU1A 4Z1MG 2ZMKA 4LC1A 4QGNA 5FOBB 3ZKUA 3I2FA 3S3WA 2D3SA 4NXNO 3ZMSA 2VVDA 3MLKA 1LULA 1JYVA 1G6UA 3OPWA 5LK7B 1GSLA 2PN5A 4QPWA 1WW5A 1E1QG 2WJSA 2XB6C 1CWPA 2JKXA 4RR3B 1Z7S2 5EJ3A 4WM8B 1F23A 2GALA 4XDOA 2C26A 3T1HO 5DDJ2 4ISRA 3ZR6A 2WSSG 1W8OA 1HJFA 4IV3A 4F3JA 1VARA 2HWC1 1IPSA 1PIV3 1GK9A 1RHI3 2J1TA 3L75H 4FSJA 1Q8QA 2CSGA 2Y4UA 3WQ0A 4JHZA 2Y69C 5IFTA 4XACA 3V0AB 4MH0E 4LR4A 1HR0O 3U07A 1ONAA 4MGIE 2YI9A 2DQ3A 1UJWB 1GZWA 1EV11 5LBCA 3GWKC 4FLWA 4QNHB 1LOAA 4CS4A 1YIPA 4H13B 3OCPA 4NAOA 2EA7A 5DUXA 1RUG1 4LQRA 4MZUA 5B1BC 1CAVB 1OLMA 5FAXA 3ETEA 1W6NA 2XH6A 3ZN0A 2NPIA 1H6YA 4X1KB 1XMQB 3FX3A 4IE0A 1PO21 2QQOA 3ABLC 3BPSA 4N53A 5I0DA 4RGGA 3J7AU 3KLSA 3LNNA 1BS3A 2QQVA 4XBLA 1UD1A 1G9BA 1FD9A 1Z5VA 3ZHVA 3ZR5A 4IEXA 1OPOA 2EIJC 2ZKNA 1JOPA 4QE9A 5FPBA 3FYEB 2E5LO 3JD72 5T55A 1TVKA 4ZKTB 4HVRA 1F15A 5KMGA 4ZOLB 1LR1A 3NNFA 3W5MA 3I2HA 2TEPA 2QVSB 4O61A 4LBEC 4ZIBA 1D4M3 5CAZA 4TXWA 3BB6A 5L7OA 2RJKA 3ACFA 4IT5A 3ZJZA 3D36C 4LF4B 5LMNO 3DPRB 2JD4A 2XHKA 4DR4O 1JYWA 2WSVA 3ZMUA 1AR91 3LSDA 4PLOA 1GN2A 4XQDA 4LBOA 4IXLA 3VBRC 4QX2A 1DQ0A 1K92A 4CEYB 1MS8A 2P5OA 1OVSA 4DQAA 2GBOA 4JGSA 2Q0OC 1PNGA 1US6A 5CZKA 1RUE3 4LH7A 3MHHC 1XOYA 4UB6Z 1UZWA 3WQBA 4MTGA 2EILC 1OURA 1Y43B 1VQ4V 5JPMB 3FFZA 4AEJA 2ZQMA 4YM2A 3KHBA 4QXBA 2XJQA 1N3QA 2PI4A 1XNQB 1CJDA 1VQ9V 1RUH3 2HWC2 2DDUA 1MA1A 3DECA 3A0HZ 2JJ1G 4NTYA 1LU2A 3AP5A 3VBFC 4B3SB 5EYXA 1L1FA 4NXMB 3IBMA 2YYOA 4BISA 1UPSA 2XJRA 4BJ0A 3PMEA 2VZPA 1EV12 2QWNB 2VMFA 4JYCA 4Y1UA 2JG8C 3SXWA 5C3PA 4Y24A 3CRMA 4DK0A 2GSMB 3CC4V 1RUG2 2WNVC 2QEXV 5FZIA 3WNXA 1EY2A 1BBT2 4KU8A 3N9NA 2GH2A 3JARB 2EXIA 2D43A 1FMD2 1QIQA 3MHZA 5JR2A 2HHHB 1PO22 4HK9A 3I49A 5LATA 1QR8A 4CZZA 1EN4A 4JI8O 2YIDA 4QT6A 1DLCA 2ZE7A 1VBA3 5GZEA 4QPGB 4AAXA 2CDPA 1LOEA 2VC9A 1AR5A 5FMDA 1TME1 5I0SA 1ZBE3 1AX2A 1K5QA 5EXOA 1RVF2 3FB8C 3H8RA 5A80A 5BNOB 1BQ0A 4EYUA 3OUHA 3MIGA 1HDJA 1TEIA 3N7KA 3VZNA 4AFCA 3ZHRA 2UU9B 4OUEA 2W08A 4QXKA 5F5AA 1CEZA 5IVJA 2VZQA 4YJ2A 2W91A 3GZEA 3BGAA 3EYPA 1QY4A 1L0LH 2VZ1A 2C2AA 3R4DB 2WLMA 3WDVA 4GH4A 2G1MA 3CF6E 1AR92 3J7MA 3C7GA 4ITCA 5ACA3 1RP3B 4IIJA 2BZDA 1FNZA 3SYCA 1JQ0A 4HMZA 1VF6C 1IBLO 2FCUA 5JLVA 4CUBA 1GM8A 2DCJA 5C7GA 3TN93 4XFCA 3K3NA 4FLZA 2HYXA 5C3SA 4AHWA 1AHSA 2ZT9B 4YW2A 4FP3A 4UW5A 1ZREA 3O1MA 3S0MA 3L2HA 4LHKA 3BFRA 4OI1A 1YFUA 3A22A 4P02B 2VS0A 5FMOL 4YZ4A 1FXHA 4UYBA 1I5YA 4X9QA 4ZHNA 5JQGA 2XGXA 3VBHC 3WF0A 4YJ3B 3KT7A 5EJZB 2JDKA 5FLIA 1AXKA 1IVSA 4MADA 2Y48A 4FLVA 4K0KO 2FCVA 2X5IA 3GZUC 2EALA 5FMOS 3M8AA 4IV1C 3N2KB 4R50A 4W4KA 4WM7C 4LFBO 3HNMA 4CEWC 5ANNA 5CA0A 5FZCA 1FATA 2WA4A 2ZGTA 3ZXDA 5JJNB 2X6BA 4CYDA 1VEWA 5LXTB 4O4IB 2VMDA 2LJ2A 3M2MA 2NMOA 1EAH3 2Q67A 2PHDA 4K3UA 5GM0A 4ET7A 4LKDA 3VBSC 1SETA 3N27A 2VZSA 3USSA 4DRXB 1C5HA 4B1LA 4NMIA 3BTZA 2FQPA 1TME2 1YJ9V 3LB9A 4I50A 3PHMA 4LBQD 1KS5A 3R6SA 3OBAA 3ABTA 3WNOA 5JMCA 4XUTA 1K33A 2OCCB 1RUJ1 3CZJA 4D94A 3LAGA 2VZ3A 5BYNA 1YVWA 3LDRA 3PU8A 2AH2A 5DMYA 2FDIA 3HKEB 1BXHA 1VR3A 5E1AC 2DUQA 2CL2A 4XF1A 4NPMA 4Q0SA 1EPZA 3WW1A 4WFBV 4XHBA 3ZPYA 1VBC1 5IT6A 4YZ2A 1VF7A 2O1QA 3ZLIA 1WAZA 1F51A 4KG0A 1NXD1 3KSCA 1VALA 5EZWA 2WWWA 1S0JA 5AFBA 2BU9A 1C1FA 3EHBB 3USUB 4XFBA 2WIIB 5G05L 2H3OA 3TJTA 2ORZA 4MGKE 4Y22B 1JXNA 5A9GA 2WQZC 3PJYA 1D2SA 2GDFA 4EN9B 4J80A 2IZWA 2RMKB 2ES3A 4MXWB 1AI7A 3I3BA 4SBVA 1QH6A 2VNVA 5BXXA 1QKQA 1VAKA 5L9VA 5F39A 5LB6A 3H1MA 3FHAA 2Q7EA 3K5LA 2VZTA 1UIKA 4AFMA 1P84F 1YNAA 3N35A 4XF3A 1RUD1 5T52A 3KKYA 3ZHSA 5LP6A 3IWZA 3SH3A 3AMNA 4N43A 5J2TA 2HR3A 1LEMA 4DR3B 2JECA 3I3QA 5H2FZ 5BNQA 4M3CA 5CFDA 4MOAA 4UCRA 4B1MA 4JGZA 1VBE3 1RM1C 4GX0A 1SDDB 1JX9A 1TZOA 2W68A 2Q5TA 2D6PA 5F9TA 3I4IA 1GZTA 1YO8A 4HFSA 1GZCA 5CEHA 2VCBA 3UO3A 4OCTA 2HWF3 2QWQB 5CA1A 1VPHA 2KB1A 2QM7A 2J42A 4HZ3A 2NLJC 1HB4A 2W92A 1VBD1 4BIOA 5L3CA 1RUJ2 2P6HA 3SR2C 4IW3A 4G9SB 3TETA 4Q8LA 2LTNA 4GWJA 1YJLA 1K45A 2Y6KA 4QX5A 2BQPA 1CXZB 3NO8A 1K4DC 1HN1A 2JDMA 3HMYA 3I2DA 1WCDJ 5FZLA 3FFQA 1VBC2 3PUSA 2QR4A 3HKBA 4OX9B 4DR2O 4I4TA 2JB8A 3HEIA 3I2GA 3DGTA 2YY1A 2BOJA 5FXVA 5H9SA 2W39A 2P1BA 2VMIA 3I3EA 4QU1A 4DMIA 2IM9A 5FPVA 1HV0A 3OOXA 3M3EA 4FPGA 3ZKYA 2FTKA 3T4VA 1IBMB 1ASJ1 3EFFK 2JGUA 1ZLZA 1JN2P 3FN9A 2VMCA 4Y1XA 4Y3OA 5IK5A 5JDBA 2CGPA 3PIJA 2A7AA 4IE5A 4WM8A 4D0QA 2X10A 4QIWF 2UUBO 5CFCB 2B9ZA 3LUTB 3ZFEA 2YBPA 3RG0A 5KUMA 5HPOA 3C7FA 4EN8B 5TISZ 4RHV3 3TOJA 2XWJB 3F2ZA 2RG4A 1W05A 3ZMOA 1H2NA 1RXFA 4NIAA 3V0AA 1U97A 4XFGA 2ZE8A 3CE2A 3K0GA 1LHVA 5BUVA 4MVUA 2ZCWA 2HJDA 1H4HA 4AK3A 2CU5A 3AKSA 5K0UC 4LBNA 1SDWA 4YHHB 1RUD2 3LIHA 4PCRA 2HKOA 5FPUA 3RJ2X 2J1VA 4DINB 1QJEA 4LWSB 1EUTA 3MW3A 3MAQA 2R061 2FKXA 1WGPA 1G4YB 1UX6A 4J6GA 1W6OA 4DXRA 3OFNG 5A1FA 1NXMA 4UFIA 4X1IB 1UZZA 1V6MA 4LF6B 3SPCA 4UF0A 4P9LA 1FFTB 1GWMA 1AX1A 4PLMA 1BHBA 2WAAA 3G6EV 2D3OW 1C28A 4BAYA 2WR9A 4X89A 2XAGA 3JAKB 1WA8A 3TEZA 1DLLA 4RQEA 5A6QA 4CDWB 1IBKO 4F6RB 1Z78A 4I0WB 4R9CA 4GULA 1IKQA 4TTGA 2P37A 4EQVA 1ULOA 3LA2A 3CBNA 2EIMC 3FLPA 3POFA 2HBTA 2JJ2G 1VBD2 3NKTA 3C90A 2DN9A 5KHHA 3IJ4A 3T2MA 4LUMA 3WD5A 1RMU3 4XC9A 5JVDA 1X8EA 4PJYA 1VMFA 2EXKA 4PQ9A 3U37A 1YUDA 3CXCU 2D6MA 1A78A 4JI1B 1IX9A 4TV8A 5DAQA 3AG7A 3UT5A 5CU1A 4GZRB 5C4WB 1PK6C 4QGLA 1YHQV 1U5IA 4K21A 4MYEA 1LHUA 1YFWA 4PDWB 1S76D 1RSOB 3O0XA 2C9KA 2ZEWA 2FDKA 2Y6JA 2ZGOA 4CDXC 3WDUA 1B06A 1H8HG 3RVHA 4JAVA 3BU0A 4DR5O 3KMHA 2A1XA 2VOTA 2C6SA 4GB31 2F4LA 3M1HA 5FZ7A 4N9HA 3B09A 4ATEA 5BNPA 1QXJA 5J1XA 2QM8A 2ORXA 1SLLA 4N23A 3OYWA 3K59A 4WVZA 2F66C 5DABA 1CPMA 5CNAA 3U4SA 4KXRA 2VTXJ 2WT2A 2BGOA 1K97A 2ADDA 3IAQA 3O12A 1UXXX 3AYAA 2ATKC 1N47A 1HW5A 1X7NA 3NAPB 4DR1O 3I2IA 2LS6A 1WCKA 2WKKA 1R1BA 2WAMA 1LB2A 4MTXA 1FYJA 2V5YA 3ZXAC 2JDAA 4X1YA 5C3OA 2Z5UA 4Q0UA 1FT9A 3T1CA 3ZMVA 1SCSA 5AFEA 1I9RA 4R4XA 2HH9A 1PNFA 1XI1A 4CXXA 1W6PA 2R062 3HBZA 3N9QA 1OKOA 1MQTA 3ES1A 1NJIW 5FP8A 1GOGA 2ZNIA 2V5DA 5FUNA 2N7GA 2FCTA 5E1RA 3VLBB 3EVKA 3A0BZ 4YXWG 3MFAA 4Q4Y3 3MI8A 3D3AA 2PFWA 1S0IA 4HNAB 1Q3EA 3A21A 3FLRA 2V7QG 2FMYA 1POV0 5LHIA 1OA4A 5KC6A 2UUAO 3RWRD 2WNUC 3GNEA 1JZ3A 3ZFGC 2AXTZ 5JOYA 4OULA 3WG4A 1EUUA 1G9CA 1TNFA 4JI7B 4ORFA 4GCZA 4BQYA 2YEVB 3ORJA 1RINA 3IN9A 2LW7A 2O57A 5BNOA 3W7TA 1UZ0A 4HK8A 1K4CC 3AJZA 2CH7B 2BUKA 5FP4A 3BCWA 3KCCA 2YBSA 4IE7A 4FMTA 4YG6A 2ZHNA 3ZFFB 1PGL1 2OTLV 4QPIC 5IYZA 2ZACA 3VDAA 3CL1A 1SKVA 3B9CA 5APAA 4NIGA 4MW3A 5IJ0B 5DPNA 2BVVA 1XNRB 1ZBE1 1V9U3 1A8DA 1RJ8A 1OKQA 5F37A 4NHLA 2VVFA 3WB2A 3JZVA 2ZE5A 3ASNC 3RZHA 1AILA 1RUNA 4P00B 4JTAB 2K2SA 3POSA 1KMIZ 3RVZA 3WG7B 2Y0PA 4GB32 3RSJA 3HBKA 3ZXKA 1PNMA 3H3UA 1JYNA 1OA2A 4OHYA 3GJAA 4EWAA 4Y20A 2Q7GA 2Q0AA 2AEZA 2CAVA 4IEQA 5GZCA 1UYXA 1LGNA 4B7EA 2WLPA 4H0LB 4DUXA 1W04A 2HEWF 2AR6A 3K79A 5ACA1 2YFZA 1NCRB 4DV0B 3UETA 4Y1VA 4Z07A 3H1JH 4UW3A 3RYCB 1AL23 1M5IA 2VCMA 4QB2A 1Z0HA 1CZVA 5ITZA 1PX4A 1AP5A 3MZHA 3E2EA 3FUOA 4XCBA 3PU3A 5EPAA 4QE7A 4QPJA 4KHPO 2WFF2 4XJ8A 4YZ3A 1W6MB 4P5YA 3AP7A 1CAXB 5FLJA 4ES8A 1XJAA 4XDKA 4CU9A 1NBMG 1AR63 4TUYB 2XAJA 4GX5A 2GN7A 2QKSA 1VQ5V 1TMF1 4FK5C 4HLTA 4D8MA 4AI8A 3WP6A 3DCQA 1QNYA 4CVUA 3WDTA 1PO13 1HKDA 1GAXA 1POV1 2PAEA 2DBNA 1VMGA 1COV2 2QKAA 1E5HA 1QHDA 4DNYA 2A9HA 1D0HA 4YW5A 1RGSA 1FKAO 4B08A 5FO8B 1HQWA 4BM8A 1LOCA 1OHFA 2BDRA 2VQEB 4JGYC 3VDDC 4YM3A 1PMIA 3HKEA 4OPHA 1C8NA 5EK0A 1PGL2 3G7DA 4HN0A 2ITCC 2LQTA 3V0BA 2PHXA 3J8F3 2DFBA 4OUSA 1ND3B 2DYRB 2VQ0A 4COVA 3ILFA 4CXWA 3RFRA 5EIBD 3NWKA 3X2QC 2WSUA 1N0JA 5I93A 1MS4A 4XVHA 2WRAA 4NIDA 1AYN3 1SERA 3CQOA 4Y22A 5FREA 5IVYA 4LCUC 3K5MA 4JZRA 5LZ6A 3SJAC 1CAUA 4BLJA 4Z1VA 3RMYA 3K08A 4JV5O 2HG5C 2P3YA 4MTOA 1CIYA 5JZGA 3MIHA 4Y5TA 4Y4YA 3M3CA 4MXWA 4UOJA 1F5FA 4YG3A 1PPJH 5GONB 2L6LA 3N7JA 2QQUA 3JATB 1JYTA 4CCOA 1UXZA 3ZYGA 2JG9C 2IW5A 3ZRXA 1W2BU 3EHKA 1OOPC 4CDQB 1R1ZA 1XE0A 3HR0A 4AGRA 2ARCA 4LBMA 4JASA 2GUZB 3O1OA 1H9WA 4LBKA 2CWSA 1MS3A 1DGWA 4Q29A 4COYA 4DUZO 1F4NA 1YDXA 3CP1A 4NRQA 4U7NA 4W6WA 5F5CA 5GZGA 1L8DA 1W8NA 3HVDA 1JUIA 1TMF2 4R8CA 4ZZ5A 1XL4A 2O0OA 2Y64A 3NVCA 2DV9A 4JF3A 1NH2D 3MV11 3A4UA 1U96A 3G80A 4L97A 4FP2A 1PVC1 1QLEB 3HNBM 2PHWA 1TQ5A 2QQIA 4YRDA 4GD4A 1ZZ8A 4B7KA 2WZPP 5C5UA 4RS5A 1PV0A 3R05A 4Y1ZA 3U0ZA 3AB0A 5JCOA 2QZ2A 3RWNA 5JIUA 4V1PA 2IC1A 3VZJA 4LH6A 1ZRFA 1S0VA 5JOWA 1V9PA 3CCSV 4QGMA 4NHYA 3T4ZA 4BH9A 3O0WA 1U5XA 2QQKA 3ZYFA 1HXS3 2AZ0A 3AMQA 3JSLA 5C8YA 3QLQA 1D2QA 1B6QA 4XIOA 3BN6A 5EHDA 2OT5A 2N05A 1D4VB 1GZ9A 1HB3A 1TA8A 5CA3A 1F7YA 2V09A 2V73A 3MIDA 4MGZE 1JHJA 2PYLA 3ZN1A 2DU0A 1ACCA 3I7DA 1FPN3 3C7HA 4N53C 1CX4A 4GIQA 1WCQA 4LF9B 4JQTA 1BCCH 1DLBA 1HRV1 3TEWA 3JUUA 2ZCEA 3GF6A 4RQPB 5CFCA 2Z2SB 2QDNA 2D97A 3CX5F 3FL7A 3FWEA 1ULPA 4IQPA 1OFNA 3MBWA 1XE8A 4Y5SA 1Q82W 4W8JA 3WQ7A 3B02A 5LASA 3OEEG 5LRRA 5FQ0B 4UXAA 1NE4A 5K9YA 5K1XA 1ZL8B 1KD1W 2RM23 4BK5A 1TAEA 3B8NA 1XBLA 1X33A 3CDZB 4LFCB 4RD7A 5E16A 5GLTA 1S2BA 4NUBA 5A1LA 4JKLA 5L9RA 1M9NA 2B8MA 1NLQA 3GDBA 4AFAA 3LGRA 4O2AB 1KU9A 2W52A 5D5PA 1AJOA 1DZQA 4IGPA 3GCXA 3QOPA 3RYIB 1MEC1 2B9UA 2F95B 2A73B 5LBQA 5HV0A 2UXXA 4DV7O 3AMMA 1XE7A 1B35B 3HQRA 4EB6A 2IJIA 4DR7B 1E1RG 1NA1C 2RS31 1PVC2 2XUEA 4LF8B 3QH7A 4YVSA 4ZKIA 3AG2B 5EFUA 3OAAG 1Y67A 2JXAA 1S0BA 2EXJA 5A2QN 2FMLA 2EX3A 3VKFC 4F7ZA 5HFLA 4NVPA 3LFMA 4FJCC 3E8HA 4FIPC 4B8EA 1R1A3 2X05A 4DV5B 2XONA 2OUJA 1N34O 3TYJA 3QO7A 1W8FA 2OKXA 3UJQA 1S5HC 1W03A 3ZSLA 1FFXB 2ZM6O 4K8FA 3JALB 4LF5O 2BFUL 4D7TA 2LALA 2R16A 1MMMA 4RL7A 2CTPA 4RGKA 4NXNB 1FX5A 4KGGA 4GX2A 5FZFA 1S1AA 3H7JA 3CPWU 3HT1A 2BFUS 4ABMA 3T2PA 1SS3A 1XB9A 2Q9LA 1HRV2 1OQDA 1HB2A 4AEDB 1ZRIA 4N7UA 1SZTA 2BRTA 3POBA 5FFOC 4RSUA 2QQWA 4AI0A 2JGDA 3T1HB 4CDUC 1XNCA 1W9FA 1VE0A 3ZRWA 4JI0O 3MD0A 1O8PA 3OY8B 1U5YA 4Q0PA 2IFRA 3DC6A 4A2UA 5JIAA 4MUVA 1DZRA 1RITA 1P7GA 4YIOA 3K03A 4X20B 5IFPA 3D0JA 2Y6GA 3LA3A 4E8CA 3DC5A 3PJQA 1HR0B 2YC2A 5A7OA 1QDOA 1YYNA 1DFQA 2QKDA 2VQUA 3N2GB 1Y9MA 2C9AA 4JTDB 5JOZA 1UMIA 2DWEC 4LE3A 2RR13 4TV9A 5LA6A 1Y4WA 4FVVA 5H5NA 3POGA 2WT1A 1XSRA 1MEC2 1QXPA 1VAVA 2Q4PA 1OBNA 1QU0A 3OT7A 3I59A 5HCFA 3AZYA 2VQTA 1H9PA 4YVWC 2RS51 3DF0A 4Q4V3 4YNIA 1JZ7A 3S6PA 3DL3A 5C9AC 4C90A 3CCVV 2RS32 3U75A 1TUBA 2G9FA 2RQ6A 1UW8A 4LHNA 3E83A 2EBOA 2OW4A 3VBOB 4X65O 2E5LB 5IWFA 2CH7A 1M93A 1V55B 3SEPA 3I54A 1OCRC 1NQDA 5A33A 3VZOA 3RBZA 3ZFFA 4LO7A 4PBOA 2OPWA 1UAIA 4IEWA 5FO9B 2DUPA 3GGLA 4UFMA 1OFSA 5FO7B 1JMUB 4E4HA 5LMNB 5IVEA 1GNHA 4DR4B 1XXNA 3GJBA 3WW2A 4Q1RA 5IAXA 5LA1A 5D21A 3ZRSA 3UCSC 5FZ9A 2LFSA 1K5MA 2XLAA 3SPIA 1V6NA 5K8SA 2QQLA 4ASLA 3AZZA 1D7PM 1ZBA3 3E1F1 3FE5A 3H8OA 4UWDA 1TE1B 3VDCA 3SYAA 1YFYA 5F8PA 2RS13 2Y0IA 1DIWA 2PYTA 3RYHA 3HKDB 1BVVA 3K3OA 4YFWA 1V9U1 1NCRA 1ZX5A 3ABZA 4OVEA 1R3IC 1U5ZA 1UFIA 2PGGA 3L73H 3RYCA 3FD9A 4LA3A 2F17A 3UKVA 4QKNA 1H6XA 5FYZA 2Q1MA 1LCLA 3AKTA 5JMOA 4GKKO 2W47A 4E2GA 2ZGSA 4A5UB 4DUYO 3PUAA 5BNNA 5FR3A 4XFFA 3QO8A 1CR7A 2OWOA 4AVSA 3R4UA 3UM7A 2XTAA 4XDJA 2ARBA 3VZLA 3CD6V 3WV6A 1L3JA 4UVAA 1YIFA 4ZI7B 1BLZA 4XDLA 3GZTB 4JI8B 3LOIA 2HWE3 3GB7C 4R7CA 5FP7A 2RS52 3AG1B 1E5SA 4ZHQB 4EZ4A 1QNWA 1KEXA 1GMGA 3OF1A 2AW9A 3J4UH 5F3IA 2VUDA 1W3XA 5B5EZ 2VO5A 3D4KA 4UXNA 5ABJB 3S57A 2R043 1SLAA 2PQSA 3BCCH 2CY6A 4X8NA 3TCUA 1KXGA 3ZYHA 1JUHA 1CN1A 4G27B 4FO9A 4IE6A 3IB3A 3WF2A 4N43C 4EN0A 2Y34A 1AR72 4KBBA 5I0RA 3O1PA 1FXKB 2A06H 1JS9A 4D7SA 3OGJA 5JAXA 4E4EA 3AZVA 1IBLB 1OXCA 2QBXA 1G9DA 3THPA 1LOFC 5FZEA 1GQHA 2BTQA 2LW8A 1CAWB 1W8WA 4P9GA 2XG3A 2WZR1 1X59A 2E3CA 3EQEA 5DECA 3WSOA 2SBAA 1SZBA 1FOD1 1W2NA 2D3RA 1V9U2 4XABA 1H8VA 1AX0A 3I3DA 2FYUH 4PI0A 1OJHA 1QHTA 5CKNA 1X9PA 4CUCA 1H4GA 1ODMA 2YPDA 4AG4A 5KC5A 4K0KB 4QD2A 1JZ2A 2GUZA 4LNUB 2VQFO 1C5IA 3NNLA 4JRAA 2OYZA 3NSTA 3WCRA 3CMAV 1BZKA 5C71A 4LFBB 1GU3A 4NRPA 2IVIB 2HEVF 2D2CB 3RDIA 3VV1A 3CCLV 4JTCB 2ZDIA 1UYYA 2WPDG 2B42B 1NI8A 1NU1H 3POWA 5EC1C 4ZS2A 5C8CC 1URFA 5A6ZA 2IWGB 3WW4A 1ULCA 3AFKA 4QKFA 2P17A 1IS3A 4RR3C 3B4SA 2RMU1 4EWEA 4HONA 3T4DA 2XPJA 4KNCA 4IV3B 3MPPG 1H2MA 1VQMV 3ASOC 2DVGA 1YI9A 2DWRA 5E79Z 4OYUA 2Y0OA 1RUI1 2E32A 4DFSA 2RDRA 3K77A 3S7IA 4WFAV 4IEYA 1O3QA 4JI2O 4FZ1A 3PVNA 2LRPA 4EV0A 5HCHA 5FZBA 5B4XA 4HVOA 4RGAA 1X9TA 1E79G 2JVDA 4PA7A 2P4EA 1MABG 1W6NB 1KJRA 3KWVA 1HRI2 5JH7B 3K9SA 2KM2A 2QFEA 3UESA 2ET7A 4DK1A 1QJU1 5B4NA 1H38A 5J48A 3PN1A 2IFWA 1OD5A 1SLIA 4IGQA 2PHFA 4CU7A 3T0BA 4NAMA 3VBUA 4J7ZA 3ACIA 2WZR2 5I91A 5KMGB 1HXS1 1QGLA 3HB3B 4XBQA 2IVJA 3E6BA 1FOD2 1VAMA 1DGRN 2V4DA 5L9BA 4GUNA 1UPIA 4MGTA 3CRRA 2FDHA 2P3KA 1ODNA 3U78A 5L7OB 2QDOA 1LHWA 1SLCA 1ZL8A 3BI3A 1FPN1 5FY4A 2MHFA 2VUCA 3WFVA 1RTVA 1WB7A 1US2A 1N3PA 4BWAA 2JWPA 1YQ8A 3DPRC 1K5SA 4L11A 4FCAA 4W4ZA 1FI2A 3ZXJA 1WP7A 4XZPA 1OVPA 5FOJB 3BABA 2RNBA 3ZYRA 4MGSA 2NLRA 4O2AA 1GKFA 3WDWA 3R4SA 3T30A 4GLXA 2HWB1 3B5LB 3ZXEA 4CEYC 2PI5A 1VF5B 3RYIA 4TSFG 2VOWA 4KUMA 2ZEZA 4ZU5A 4YWAA 3ZOIA 2UYAA 3O7OA 4JQRA 4BA6A 3I8TA 2QZ3A 3MF6A 5AC93 3QO5A 4QAWA 3JASA 4ARYA 1CZTA 4BW9A 2RMU2 3T2OA 4BYYA 2GU9A 1LNQA 1T5EA 5FKBA 1I3HA 2RV9A 4COUA 3IDCB 4OMDA 4GYCB 2OIIA 3ZMNA 1IS5A 2C4XA 3MW2A 3BAAA 1RUI2 5FPAA 3ZCCA 4BB3A 4Z92B 5FYMA 3VHRA 4DV3O 5FMCA 3SEEA 2DVDA 3MGUA 3RZKA 4S2FA 5FP9A 4XIKA 4J11A 2BOIA 4OQ9A 3S5QA 2ZIMA 3TEXA 1HN0A 3E5UA 1SBEA 1S0CA 1OQEA 1I5XA 1LODA 1W2AX 1FFXA 1XC6A 1J5EO 4DR2B 5A1AA 3W21A 5KX5A 3FBMA 4JI4O 3Q9OA 4QKDA 3N9OA 4FPJA 1SMVA 1NCQA 3ZYJB 4C1WA 4WVWA 4M0NA 3ABKC 1AXYA 1QJU2 2JK5C 3BHPA 2DYSC 3POEA 2HWD1 4QPGC 2PAMA 4LTAA 2QSAA 4AEDA 2VGDA 2TUNA 2D6KA 2UWCA 4AVVA 2UUBB 4FAHA 1PD3A 5JUVA 3O0VA 3SCGA 5JJJB 3BIWE 2PUSA 1OA3A 1SACA 1WP8A 1WMXA 5DAXA 3MF9A 3VKLA 4YJ2B 1YZBA 3L71H 4V2WA 1Q8VA 3RQ0A 4GH4B 3U10A 1I94O 4LF4O 4XQ4A 4DEQA 2ADEA 1Z5WA 4ZPIA 4B3RO 1ULDA 4DO2A 1O4ZA 5HXVA 2Q8EA 1M1KW 5HCBA 2AZ2A 4DB5A 2Q8CA 4MVSA 2HWB2 2V4AA 1KS4A 5FYSA 3INAA 2M7WA 1EN5A 1DF5A 2WDBA 3OGGA 2H8PC 2XNDG 3FX7A 2W0XA 2YZ4A 4XFHA 2DU1A 1JFFA 3SKVA 1KP3A 1ZSPA 3KZIZ 1GKBA 1IBKB 3F5WC 2ETEA 4DY3A 1REDA 2CWMA 3KQ4B 5FL7G 1XNDA 1ZM1A 4OHWA 3QG5A 2XOKG 1YQ2A 5LOVA 4UVBA 4LLFA 2VOVA 3CCRV 1LKNA 4AWDA 2X5IB 4JKMA 1APNA 4C1XA 4JTNA 1N1SA 4L0PA 4E4DX 4O2BA 3AX4A 3ZIAG 1B04A 5B3SB 3AJYA 3QTCA 4B3TO 3CJIA 1F2NA 4XJAA 2GH8A 4N8MA 5CA0B 3AG4B 2GNBA 1X36A 4DO0A 2XJVA 2Q73A 4IEVA 4NYKA 3HAGA 2IXCA 4ISQA 3ZM8A 2YS8A 3HD8B 3GBGA 4DR5B 3B94A 5FYIA 3MO4A 5H9PA 2HHHO 1YEWA 5FMBA 3BU7A 3SCHA 4NROA 2F23A 1GQGA 1YFXA 3HKCA 3OGRA 2J1AA 4GZ9A 3HPLC 3LWCA 2ZAHA 2HWD2 2L9LA 1XDCA 2YMZA 1AR83 1W99A 1ENSA 5LK5A 2D44A 4I50B 1JYCA 4TOIA 4CPBD 2HEYF 3P5BA 2PLV3 2R72A 2Q69A 2XAHA 2A6YA 2GC0A 4ZU4A 2LROA 4UV9A 2Z79A 4Z2AA 1X50A 2OCCC 1HNWO 2IXHA 1A32A 1EBOA 3WP4A 4PF5A 1XQ8A 1JPXA 1HX6A 3TXSA 4DR1B 1ZBA1 1PM4A 5GLZA 4O4HA 4KWKA 2PF4E 3SCFA 4EN7B 1KUQA 2WLLA 4DXWA 2HEPA 2RS11 1GWLA 4Q6GA 2P6JA 4CUAA 4HANA 2A75A 1QJY1 3I2OA 1KC8W 2BWCA 4A7YA 1BMFG 2H6CA 4N21A 3IPVA 3WT3A 1AYM3 1EZVH 2ITDC 4R6ZA 3VZMA 3POJA 2WYFA 1TVGA 1GP4A 4JCKA 4WBNA 4ZI7A 1IHMA 2IH3C 5KA6A 3C3TA 4P9YA 2J1RA 3HWJA 2UUAB 3NV3A 4H14A 3L2YA 1JHNA 4RFT0 3FLTA 3KGZA 1R092 1O6UA 1ULGA 3ZN4A 4B3MO 3ALQA 2UYBA 2KSDA 4HT1T 5E6HA 4CP0A 2VW0A 2CAUA 2OT7A 3UV9A 4FVMA 3OR6C 4Q4X1 3MPBA 1VQNV 4EJRA 1SEFA 5LP6B 1MPXA 1QJX1 5J2TB 1W3VA 3D36A 2HVJC 1TGOA 3H1YA 4WBBA 1C8M3 3VUOA 1UZYA 5JXGA 5IVBA 4CCNA 4MW8A 4JGZB 2ZKLA 4SLIA 5FZOA 3VBRA 4X62O 1US3A 4CDXB 1J1LA 1YQ6A 5ISLA 3J7NA 5F7UA 4UCVA 1F31A 2QKCA 4AHYA 3OUSA 2BYVE 1CAWA 2A79B 5CA1B 1POQA 3W7WA 5IYBO 2W46A 4CS3A 1PMHX 3BODA 1D2DA 1BGYH 2B5UA 2QM4A 1KD7A 1P8JA 2VMHA 1LAJA 4BQ4A 4I30A 4FM1A 2HLEA 3VBFA 2VR4A 3VD4A 2KA3A 2XBO3 4XF0A 3BTYA 1VRH3 3W58A 3OG2A 1F4HA 2UXCO 4LNUA 3HKBB 4I4TB 3E8BA 1ZZCA 2OTJV 1DQ5A 3NV2A 5HFMA 1NLSA 4UBHA 2V1DA 2Z5WA 3K0DA 4KHPB 4NTXA 2JG8A 1RB8G 2VXRA 1ZZ7A 1V70A 3VBBA 5DEDA 2A3YA 1QJY2 4BOWA 5C3QA 1NQTA 1K12A 2FMDA 1YTFB 2WNVA 4XBFA 4DW0A 3LEKA 3H8UA 2X6AA 3JAWA 4FFKA 2F6BA 3ZIWA 2UY9A 3KCXA 2BWAA 3HOBA 1MSWD 1KDMA 1QU7A 1OLQA 4OLLA 1B3QA 3H0OA 1QQP3 3ZFEB 5CFCC 2WNUB 2KG7A 2FL4A 1GH6A 1CONA 3WP3A 1CQ9A 4BWOA 4B4PA 3C2UA 2V72A 2DWDC 3ZHUA 3VN4A 2JEUA 5A6XA 2UXBB 2WN3A 4KP4A 1Q8PA 2VMGA 2NR5A 1QNMA 2R072 4CP9A 3O1SA 1IS6A 4P9OA 5IY5C 4Q26A 4Q4X2 3NW4A 5DQ0A 2Q8VA 1RUC3 4Q4W3 5CMUA 3B01A 5HI0A 3CJHA 3VGIA 1XU2A 3WF4A 1QJX2 2OQ7A 3TNPB 1JZ5A 5BR8O 1W6OB 4CP1A 4JC1A 3WXPA 2FDFA 3AC0A 1QJFA 1G8MA 4JAAA 4I02A 5IATA 2WLIB 4JZGA 5JH7A 1LTEA 5F2SA 2ILMA 4Y26A 2ENRA 4UF0B 1W28A 1MS5A 3RWKX 1VF6A 2N74A 1WW7A 3BOPA 2DVAA 4TQDA 1WA8B 2Q8OA 3RI9A 2GTAA 4UCUA 4I01A 1GNZA 3BPZA 2A3XA 3JCZA 1N0NA 4CDWC 3Q4HA 1BHGA 4JV5B 1OV9A 5BY1A 5LHHA 2JIZG 4F8AA 5A3MA 5JVDB 1J59A 2B4KA 1PNKA 3A0RA 3FAVA 3VBHA 3BALA 1W0NA 2QNKA 3VD7A 4XJZA 4GMP0 1VJ2A 4TV8B 1N32O 1L0NH 2F43G 3I2JA 2ETNA 1W6QB 1YXBA 3UT5B 4WVMB 1M56B 1JZ8A 3SYOA 4IV1A 4YG0A 1Z7S3 5C4WC 4P9JA 1URXA 3T09A 4PDWC 3S7EA 5DDJ3 4WM7A 2ZAAA 2ZX3A 3RPQA 4CEWA 1QLNA 4J9ZB 1SA0B 1B09A 1LUVA 2C24A 3WNPA 2WLNA 1XUQA 2JB4A 3BY6A 2VH9A 1RPRA 2MW2B 1CZSA 3G6JB 5BNPB 4D69A 2P7TC 1O5LA 1IBMO 3AVRA 3OYWB 2IJJA 3DSQA 2I45A 3C8XA 1OT5A 1SBFA 3VBSA 4TQFA 1HNZO 2O14A 1W2UA 5JR7B 1WLTA 4AW7A 4MSWC 2P2KA 1RUF1 4LNVA 4S2GA 4TZDA 4E8DA 4D7YA 2VTFA 3CYOA 1YF2A 1WMEA 4XTMA 4Y5Z0 4QB6A 3NAPC 1J3QA 1N33O 1YHFA 4X1YB 1DGLA 1NKDA 3SPJA 1GUIA 3AK0A 3IM0A 2VNGA 1HP8A 4YW4A 3W20A 1NT2B 1CESA 2A71A 4B4QA 1W6PB 1MQTB 1NZCA 4GJYA 2VOXA 4P08A 3JD73 3DTUB 4NO4A 3ZXGA 4FPYA 2B1IA 2ZMNA 4LF6O 2ZGPA 1X82A 4IERA 3C3VA 4IETA 4LORA 3CEWA 5KHIA 4TYSA 1N1YA 4F4LA 2C0ZA 2ZOEB 2NP0A 4H37A 4ZXKA 5JXIA 3E86A 5T5OA 3DV8A 2XT9A 1STMA 2E53A 2VULA 4J9YB 1LNSA 2JKBA 1CD3G 1UY3A 1NAEA 3LDBA 4H55A 3MUY1 3G71V 1XYOA 3CRQA 3N4MA 5L3GA 5IYZB 3RNSA 3ZFFC 3AP6A 2ZJCA 1GWKA 3J80N 5FJHA 4LF7O 3C7OA 4MO3M 4IYIA 5J09A 4GMP1 2NZ9A 1WCSA 2I2SA 2W87A 2HBUA 5KAIZ 4AQ6A 5C93A 1ZZ6A 3PURA 3VL8A 2ZX1A 3VB9A 4NHMA 3P3NA 5CISA 4JI3O 5FYBA 4XQWA 4YZ5A 1BQZA 2HWC3 1RUOA 4OFGA 1AR1B 3WG7C 3AG3B 2GN3A 1RPOA 4NPLA 3ZSKA 3SYQA 2PHLA 4Y20B 2ZGUA 2BPA2 3W59A 4BZ4A 4DV7B 1G9AA 5TSWA 5GZFA 2A3QA 4CC6A 1H8TC 1KKCA 1EV13 3LCPA 2XWBB 4YSFA 1R6KA 2IJHA 1MOFA 3ENRA 2C5DA 1NCRC 1RUF2 3RVYA 4EN6B 1RUG3 4MG2A 1BBT3 4AI3A 4RWUA 1SQ4A 4D6SA 1CVNA 3ABMC 1FMD3 4QM8A 3THCA 1PO23 5ITZB 2GNMA 2K9PA 3ACLA 1XEQA 2BJSA 4L9BA 4XUOA 1OCCB 1UWWA 4DOUA 1O9HA 3ETPA 2WLHA 4HETA 1Q6HA 1RVF3 3MLLA 2QQJA 2ZM6B 1NY71 3ZSEA 2X6CA 3CRCA 1AVBA 3N9LA 4FXGB 4DY5A 3VHNA 1JTZX 3SHRA 2D98A 2YBKA 4Y4RA 3LIGA 3O1VA 4LKFA 2ARXA 1FAYA 3A0KA 5L36A 3IMNA 2ATFA 2WN2A 1VP6A 4LKEA 1WKYA 4UFLA 4JI7O 5F6KA 4M4PA 1AR93 2W0FC 3UK9A 4W65A 3QVNA 1FJGB 2PMWB 2XXZA 3ON7A 2BBAA 1UY1A 1HLCA 4BHPA 2FDGA 2Q68A 4R9AA 3K4AA 2FZ1A 4I0AA 3V0BB 3LSQA 5DZGA 1IPJA 1CIWA 1O91A 2Q8DA 4JVAA 2ZGLA 4LMFA 5K0UA 2K1EA 5F3CA 1ND3C 5LW9A 1EN6A 2DYRC 3LE0A 4INDA 1UCXA 1E5RA 5IDJA 1XNRO 1GM7A 3U4XA 5FPRA 3DXTA 1BEV1 4FM0A 1D0GA 3O65A 3G6BA 1ALYA 2OS2A 2Y33A 1EPWA 1CAUB 1Q90D 5CA6A 1R081 4MVZA 2ZHMA 1Y4MA 3PJSK 1XPWA 2JEXA 2G9ZA 3E89A 1Q81W 4LA2A 2CTQA 5H6RA 4LFAO 5JZGB 1OCZB 4V2VA 3SQOA 1ND2B 2WS91 4FPLA 2B5HA 1E5IA 4A3XA 2PELA 2YUEA 4X65B 4DV0O 5IVVA 3O9OA 3EJKA 1V6OA 5FXWA 4YGBA 3SJBC 5EJ1B 2A0LA 3TK1A 1QEXA 1GRJA 4CDQC 5FNVB 4BR6A 2EIDA 1HIXA 1RC6A 3HT2A 1CX1A 3L74H 3OTOO 4HSJA 2ZR2A 1TME3 1O59A 5KWRA 2EIKB 1YWKA 3AKQA 5CB7A 1ULFA 4M01A 1XMOO 5BMVA 4CDXA 1NY72 4EKWA 4WCEV 1A8MA 4QDRA 4RAIA 5GZDA 4L2NA 4QX0A 2HYKA 2PQQA 5LYJA 4GQ7A 1XSQA 5B2GB 1U12A 2WLKA 4GWMA 4XAAA 5IAVA 1ORQC 1NG0A 1R3LC 2YIBA 1V6KA 2QWOB 3A23A 1G86A 4Q0QA 1QLEC 2OX0A 4ZS3A 5FJKA 1ZRCA 5L73A 1C8M1 4RS5B 2VL4A 3GM8A 4EFBA 2PHRA 2QE7G 4CDUB 3KS7A 4FXKB 1Y66A 5EZYA 4Q8KA 4AZZA 2VQEO 3MDSA 4Y1YA 2LGWA 4ASUG 2MEV1 1QOTA 1DYOA 3JBG1 1R64A 2ZHKA 2G38A 3QH6A 1JYXA 5C8YB 2OIGA 1MACA 5FYHA 2CYFA 5JPNB 5DAVA 2XOMA 5LGUA 1WLDA 1BEV2 1S5JA 2W6IG 3AEIA 4FLYA 4LPLA 1JCHA 1F4MA 3BTAA 2ZEXA 1R082 3KV6A 3RS6A 4HKOA 4D3WA 2DOSA 2VCCA 3F7VC 1VRH1 3FB6C 1KKDA 3CRAA 1OLRA 5K7PA 4RQPC 5DZEA 2WNUA 2R32A 3ZFGA 2VBDA 2CK3G 1M4UA 5FCCA 1NKGA 3SPHA 1K8AW 2WS92 4X64O 5FYCA 2GTSA 1J83A 1NQJA 3Q8EA 4BIFA 1S0GA 4MVOA 4DRRA 1Y74B 2QJVA 1OCRB 1H8EG 1K3IA 4QPIA 4UFZA 2R9RB 4FI9A 1YSCA 2GDSA 3JD0A 1NR7A 3IAYA 3VKOA 1PL4A 3ACHA 4X6RB 1ST8A 1VBB3 1R3KC 4A41A 1T6GC 1PIV1 1RHI1 2WLIA 2F4PA 3PMSA 3OBRA 1RUJ3 4I2OA 1WB8A 4A3ZA 1SQBH 2JICA 1UY4A 5DUUA 1HB1A 3THOA 4IDZA 1WMDA 4Q27A 4M3CE 1UKGA 4CU8A 1JJOA 3J7LA 2EZPA 1PZ7A 4EB6B 3ECQA 5GTHZ 4JI6B 1B35C 4K9SA 4X88A 4Q4W1 4YVSB 1VBC3 5DAPA 3CB2A 5J96B 1DG6A 4BPZA 1C57A 4A6OA 3AG2C 1CP9A 3AZWA 1ZZ9A 3U11A 1W9YA 2YXHA 2OQ6A 3H42B 3Q8CA 3KB5A 4XE9A 1W8UA 2D93A 3SLIA 3CU7A 1DBNA 1W6QA 2MEV2 2WWJA 2X29A 4WVMA 2PXJA 3NJYA 4CS2A 5EIYB 3VHPA 4K6BA 4P9XA 3JBG2 5A3PA 3I3MA 3WCSA 3PVEA 4A7KA 5LGTA 4AL9A 2VWJA 3LDEA 1SA0A 2GC2A 3AYCA 4UV8A 4ZBMA 2IXIA 5A7WB 1AI5A 1AJKA 1ASJ2 1D4M1 3KVAA 4Z8BA 1LUWA 5KA5A 1SBDA 5K1PA 4LF9O 4JAUA 1AROP 2RJZA 2R0HA 3LEMA 1RUD3 4UBGA 1S72V 3QD6A 4OZXA 1Z7S1 2YSUB 3BKZA 2JGDB 3OUFA 5B1OA 1Q8IA 3ZRWB 3W7UA 5DDJ1 4QDSA 3PTYA 5J9PC 1VRBA 3JD1A 3NNMA 2PZSA 4AEKA 2EINB 2DVFA 5EIBC 3DXRA 4JGYA 3VDDA 1RUE1 2BTOA 2QQMA 2XHNA 2XQRA 3K75B 4OHZA 3H1WA 4JI2B 3ILNA 2JDIG 4FM2A 5M0TA 2G19A 2PA7A 3GWOA 3B77A 4LFCO 2K46A 2PHUA 4PD4F 5A3TA 3J81N 1YJNV 4RUEA 3WINE 4UUJC 1WD4A 5FBJA 3HNYM 1RUH1 1PIV2 1RHI2 4TV9B 5LA6B 1Y76B 3ELNA 1VBD3 5FXZA 4CH4A 1SQXH 1QOOA 3KD4A 4HN1A 5A3LA 4QQ2A 4COWA 2WT0A 4CBCA 1W9SA 3I59B 4PDRA 3M3OA 2VZUA 4QJFB 1DF4A 3RRDA 2B7YA 4AI9A 5B1AB 4JI5O 3P6BA 1TUBB 1IZ3A 5J2UA 1DYKA 4Q4W2 5KXBA 2P5BA 3N3HA 4LBJA 4LXLA 2YIAA 3FC0A 2WQ8A 1RYYA 1ZZBA 3VBOC 1JVMA 1UIJA 3IDAA 1KECA 5A33B 1V55C 5FY8A 4C91A 4GKYA 4J7KA 3K5OA 5DG2A 4LK7A 1YIJV 1QXRA 5D8AB 1SC5B 2JG9A 1JZ4A 1OOPA 4HZFA 1VBA1 2RHPA 1HWYA 3CCQV 2WZ8A 3QBQA 2OUHA 3UKTA 4GXLA 3TBDA 3AL5A 4BMBA 4CXYA 5JXJA 2LM3A 3VL9A 2YC0A 4JZ2A 3TRSB 1K5MB 1KB9F 1V0AA 3NXSA 2XASA 3VQVA 5JSPA 2GHYA 4DR6B 1O5UA 3NV1A 1XRUA 4NKGB 5D1IA 1D4M2 5C8CB 1VQPV 3BIEA 4ZONA 3H1LH 4NR1A 1PZ9A 5FZKA 4O65A 4A6SA 5EYPA 1LR5A 1UY2A 3RYHB 1GFF2 3O1RA 5A7QA 4KH9A 4R9DA 4MVRA 1WA4A 1FYUA 3OEBA 1WJZA 1O3TA 2R063 3ASOB 4FFFA 1SCRA 4EEQA 5DXDA 3ZDSA 5IVCA 1AB3A 2JE7A 3GXUA 3Q8FA 1ZX3A 3TN91 1XHZA 1GANA 2P22C 4ASKA 1RUE2 4DV3B 3AXDA 1W8TA 1SFPA 3A7QA 1XHXA 4LLOA 5BNNB 3ATGA 5FPLA 4DV2O 4X66B 3KT4A 1M57B 2J22A 1JOBA 2ZBJA 3P32A 3JXSA 1J5EB 1RUH2 3DEMA 1KDKA 4B3NA 1H2GA 3IIAA 4S2HA 4XJ9A 3BVOA 4JI4B 1BBT1 5LRSA 5JVVA 5LEKA 2ADQB 1OZ0A 1FMD1 2E9QA 3UT0A 1SESA 3M3QA 1UMHA 2DCTA 5DM6V 4J7JA 4W4LA 4G2KA 3AG1C 3AFGA 5FPOA 2WZEA 4XW3A 3M4FA 2AACA 4I0BA 1FXVA 4UCTA 2VW2A 1RVF1 2QE3A 4DV1B 2IJKA 3OMAB 1UNBA 1JODA 3FB5C 3B2EE 4YW7A 4YARA 5ABJC 4WFFA 1DYPA 1EAH1 2F4VO 2HP8A 4GB33 2R1DA 5IK4A 1HQLA 1BMV1 2ADPA 4G3YC 4QMAA 1VBA2 3K51A 3CJXA 3ZXFA 1OUSA 4CTEA 1LGCA 1ZBE2 1I94B 1V54C 4AQTA 1WCUA 2DFCA 4B3RB 3L72H 1FXKC 5L3EA 2D5FA 1KJLA 4TLFA 1YLLA 2Y60A 1GTOA 2RE9A 3BOWA 4X6QB 4WFGA 2BTQB 4AOCA 4GT1A 2EZOA 1MS9A 3TGUH 2JDZA 4O4LA 4FFBA 1NLRA 1SF9A 3ZPOA 2L35A 4QB1A 3ZX6A 3JD4A 2XUMA 3DGEA 2F1MA 3R0RA 3QNEA 3QCWA 1ND2A 4QPKA 3KV9A 1GLHA 1WLWA 2WFF3 1NA1A 4HAMA 5ACA2 2FBEA 4W6XA 4DW1A 2BEOA 5IJ9A 2X0LA 3KCYA 4D6TH 1KFXL 3C7EA 1WWYA 4ONUA 4XBNA 3ZVXA 3OUJA 2YDEA 1QBZA 4CUGA 1BHAA 1W90A 4LE4A 3TN92 3VQWA 5FNVA 3KGLA 4JYAO 4R4ZA 3WUDA 2AHZA 1OI6A 2GMPA 3I2KA 4MHRA 4P14A 4B3TB 3UJOA 5J98B 5LY2A 1W8ZA 1COV3 1UU6A 4PIXA 3E97A 1EZJA 2WO7A 1OSGA 5DG1A 4IESA 1HQNA 2XJTA 1WA6X 1IG0A 4J42A 3A8TA 3AP4A 2Y26A 3HJRA 1N4CA 2BSKA 3VKMA 1NZ6A 3ABKB 2DYSB 2ZTNA 2NYYA 3IC7A 4XUNA 2EIGA 4QKBA 1VP7A 5KHGA 4IV3C 5J36A 1VMHA 2AYHA 3ZHTA 2YICA 1AJQA 1P4RA 2ZMLA 4CDUA 1VBE1 2VVEA 4P9IA 4IE4A 2YC4A 3FYIB 4PJ0Z 3JSNA 4DV6O 1HNWB 1EAH2 2R0FA 2H0VA 3AYDA 1N8RW 2VRZA 3ZS8C 5HXMA 2XVKA 1BMV2 3PUHA 3U1XA 3T1YO 2HWF1 2VW1A 1R6TA 4DUVA 4DIQA 5FTTC 4P9PA 2UURA 4AQYO 1O4YA 5FZMA 1R3JC 4U7OA 2O8QA 3UL2A 2DBIA 3GVMA 3TB0A 4DV4B 3T08A 1BL8A 2YU1A 5C8WA 4P2ZA 1S0DA 4FOYA 2KR2A 5F3EA 1I7FA 4H3WA 3WNLA 5CIRA 3VBUB 3GHNA 2WAOA 2ZPXA 4YVWA 4C7UA 4ZU7A 3NQHA 1IDSA 5C9AA 3AYEA 1WW6A 2Y6HA 2K0GA 3ASIA 2WLQA 3LKJA 4DYLA 2W1WA 4PV1B 4J41A 1K9MW 4NTWA 1OH3A 3PDQA 3SNMA 4QXHA 1J95A 1Q6IA 2GC1A 4B3MB 2UWAA 1ENQA 2DYCA 1PL0A 3THDA 4MXVA 2P06A 1XNKA 5IYDO 5L7OC 1Y74A 1TMF3 3AXEA 4B29A 3ZO0B 2ZXWC 3TEYA 4QPYA 1GO3F 5KHJA 2RDSA 4IGOA 3VD3A 4GKJO 3RYFA 4FPKA 4JHTA 4Z82A 2BNMA 1GOHA 3ZYPA 3ETQA 3P30A 4D6QA 2E31A 3ES4A 2LO1A 4CCMA 1ZYBA 1POV3 4JDOA 1DU3D 2ZZJA 1G1XB 4YGEA 4RHV1 4LHLA
chains in the Genus database with same CATH topology
3ZN4A 3ALQA 4GKXA 2UYBA 2N7GA 3E5QA 4HT1T 4CP0A 1MS1A 5E1RA 4AVBA 3D82A 4JDMA 1WD3A 2VW0A 3VLBB 4M2EA 2CAUA 3MFAA 2VUAA 4Q4Y3 5T50A 4M3CF 3UV9A 3MI8A 5J37A 2PFWA 1S0IA 1Q3EA 3FLRA 4Q4X1 3MPBA 3FMGA 2FMYA 4E2QA 1POV0 1SEFA 4EJRA 5AC92 1OA4A 5KC6A 3UKNA 2WNUC 1UU5A 3GNEA 1GZWB 1S0FA 3ZFGC 2AZ5A 5JOYA 4OULA 1QJX1 4XEZA 3WG4A 1G9CA 5BNNC 1TNFA 3H1YA 4WBBA 1C8M3 4GALA 3VUOA 1UZYA 4ORFA 4O9EA 1VBB1 2CV6A 1RINA 3IN9A 2P34A 4BE3A 3VHOA 4JGZB 5F6LB 1PHMA 5BNOA 2ZKLA 5GKAC 4SLIA 4HK8A 3VBRA 1AXZA 1VBE2 3AJZA 4CDXB 1J1LA 4ES9A 1IOAA 2BUKA 3BCWA 2ZA9A 4AVCA 3KCCA 3T1LA 1Q8SA 2OVUA 4YW1A 4YG6A 1GV9A 1WBLA 2ZHNA 3ZFFB 1DS1A 4PLNA 1PGL1 4N53B 4Q0VA 4QPIC 2WA3A 4FPEA 1F31A 2ZACA 3CL1A 3B9CA 2IXJA 4XFAA 4AHYA 2BYVE 1AL0G 1CAWA 2HWF2 1O3RA 2UU8A 4YW3A 4AXOA 2BVVA 1QOSA 3AMHA 3BODA 3GYDA 2JE9A 5FDBA 2PHTA 4RQPA 1ZBE1 4LO4B 1V9U3 5H9RA 1A8DA 1RJ8A 1OKQA 1ZNPA 4HVQA 4NHLA 2VVFA 3JZVA 1KD7A 1RMU1 2VMHA 4KG8A 4M27A 1NCQB 1RUNA 5E88A 5C6CA 2K2SA 3POSA 2VNRA 4I30A 3B69A 4GB32 1N3OA 3RSJA 3ZXKA 3PVBB 4YGDA 3VBFA 3H3UA 2KA3A 5FQ0A 1RL3A 2XBO3 4XF0A 2DCYA 1OA2A 1VRH3 5GLUA 1WLCA 3NV4A 3W58A 4OHYA 4EWAA 1AR81 4Y20A 2Q0AA 4LO5B 1ZZCA 2G4IA 4FAGA 1DQ5A 3NV2A 4UBHA 1NLSA 2AUYA 5T5JA 2CAVA 4IEQA 3VZKA 2PLV1 2Z5WA 5GZCA 4XXAA 1LGNA 5IUQA 3EO6A 4B7EA 4XF4A 3JB8A 2PTMA 2WLPA 2JG8A 1REEA 3P3PA 1RB8G 2HEWF 2VXRA 1ZZ7A 1V70A 2AR6A 5JSRA 5ACA1 2A3YA 1NCRB 1QJY2 4BOWA 4Y1VA 1RUF3 3CLPA 2FMDA 2BBVA 4Z07A 2WNVA 3GALA 1ZA4A 4UW3A 1DQ2A 3H8UA 1Y3TA 4FTBA 4TSVA 1AL23 4O9GA 2F6BA 3ZIWA 2XJUA 4C8RA 2UY9A 5FRAA 3KCXA 2BWAA 1Z0HA 1KDMA 4XILA 2BGCA 3MZHA 1OLQA 4OLLA 3FUOA 3WVJA 4GH4C 4XPVA 5GLWA 1B35A 5DZFA 3H0OA 1NA1B 1ENRA 2GMEA 1QQP3 3ZFEB 3MS5A 5CFCC 2WNUB 1DHKB 2D7FA 2WFF2 4XJ8A 4YZ3A 1PVC3 4CWDA 1CONA 1W6MB 3WP3A 1CQ9A 3AP7A 1CAXB 2BNNA 5FLJA 2A3WA 4ES8A 4BWOA 4B4PA 4IEZA 4OJ8A 3C2UA 4RHV2 3WG3A 3AZXA 3MYXA 3VN4A 5GLVA 2FHRA 1AR63 4AQSA 1AYM1 2VPVA 4DXZA 1QMJA 1Q8PA 1Q8OA 2VMGA 4IL7A 2GN7A 3OTFA 1OQ1A 3H3ZA 1CGPA 1TMF1 2R072 1GICA 2Z42A 1BYHA 2DTYA 4XTPA 3ZXLA 4HLTA 5AVPA 1IS6A 2P3JA 1LOFA 4Q26A 5FPXA 4AI8A 4Q4X2 3WP6A 2SLIA 3NW4A 1QNYA 1RUC3 2BNOA 3WDTA 5CADA 4Q4W3 1PO13 1IS4A 2E7QA 2YV8A 3B01A 2CNAA 1PK6A 1JW6A 3VGIA 5HI0A 1XU2A 2XKOA 4BHIA 1IGOA 1VZ5A 3MDPA 1HKDA 1QJX2 2XJPA 1Y0ZA 3M70A 3NJZA 3TNPB 4B4RA 1POV1 4UW4A 3N7MA 1W6OB 4CP1A 2PAEA 2VECA