3RGBA

Crystal structure of particulate methane monooxygenase from methylococcus capsulatus (bath)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
382
structure length
382
Chain Sequence
HGEKSQAAFMRMRTIHWYDLSWSKEKVKINETVEIKGKFHVFEGWPETVDEPDVAFLNVGMPGPVFIRKESYIGGQLVPRSVRLEIGKTYDFRVVLKARRPGDWHVHTMMNVQGGGPIIGPGKWITVEGSMSEFRNPVTTLTGQTVDLENYNEGNTYFWHAFWFAIGVAWIGYWSRRPIFIPRLLMVDAGRADELVSATDRKVAMGFLAATILIVVMAMSSANSKYPITIPLQAGTMRGMKPLELPAPTVSVKVEDATYRVPGRAMRMKLTITNHGNSPIRLGEFYTASVRFLDSDVYKDTTGYPEDLLAEDGLSVSDNSPLAPGETRTVDVTASDAAWEVYRLSDIIYDPDSRFAGLLFFFDATGNRQVVQIDAPLIPSFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Characterization of Particulate Methane Monooxygenase from Methylocystis species Strain M.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Methane monooxygenase subunit B2
total genus 95
structure length 382
sequence length 382
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3rgbA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 3rgbA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 3rgbA01
3RGBA 4PI2A 1YEWA 4PHZA 3RFRA 3CHXA 4PI0A 4O65A
chains in the Genus database with same CATH superfamily
4UDUA 1VQ7V 4X5XB 2P5EA 3PDOA 1QUNA 1HNWO 3DSQA 3WBDA 5FFLA 2IPUK 2O57A 1BYOA 3BPCA 1ZWIA 5FECB 3ETPA 4AEHH 5AB1A 4EKXA 1B0GB 3TH4T 3NJVA 2Q76B 3I84A 2WKLA 5B1JA 1CDUA 3WXWH 3D36C 1QSZA 4B3NA 1MUJA 5JSPA 2NY4B 1GM9A 2J8UE 1Q81W 4AVJA 5AQ0A 4BFFA 2ZACA 2MCPL 3WP4A 2QR0A 4PV1B 1JZIA 2VABB 3CU1A 4ETQA 1VRH3 3URFA 2WW8A 2CDEA 4KI5E 2WXIA 4DINB 5CZVL 4E4EA 4YHOH 5SWQA 3LOBA 1SM3L 3Q9QA 5IF0A 1LO5B 1RZJC 3N50A 3U1SL 3ZX1A 3KQ4B 3Q48A 4PLOB 4GB32 3RT3C 1ZPUA 3MACL 2XH6A 4G9SB 2K3TA 4CMHC 4GT0A 2BCCH 1IBKB 4U3SA 1GN3A 4MAYC 1H38A 4IBZA 5EU7E 3LH2H 5EEVA 4YDIH 5KX5B 3MAWA 4GP5B 5DEJA 1ND2C 2R0FA 1Q1JL 1WA0X 3BUBA 5DDJ3 5J4MA 1VJSA 4HK8A 5SV8A 3RYCA 4Y16B 5GALA 4FOYA 3UL4A 3FBKA 5EPAA 2J1TA 3GT6A 4UQBA 1TMF2 1X9RA 1UD8A 2XA8H 3MODH 2UYLB 4MNQE 4XVUC 3Q6FB 2MFNA 3B40A 4CE8A 1WG3A 1PO13 1XNAA 5H35B 3D4KA 4QWWD 1U92B 2OTWB 2F17A 3EOYG 3UAJA 1W9FA 3GMOA 4OIFA 3DXRA 1E4HA 4DKDC 2I60H 5E8DH 1NTMH 4AQYB 3S5ZA 1A6VH 5GXBB 4C56B 2RMU2 2IH3C 4EOWL 5CJQH 3IU4L 2DCTA 4XYXA 3DGDA 3THMH 1IGTA 3LRLA 1L7IL 4TF4A 3T4HB 5DR5H 3JD72 3HAEB 1URLA 1T2XA 3B9KB 3WN5C 1QJEA 3HE6D 5FXZA 2ICWA 1WO2A 3C6SB 4O00A 5LMNO 5DUBB 1IQDB 4AITA 2GNBA 3P3SA 4XBNA 3X2QC 5ABJB 2GMEA 3Q2NA 2EH8H 4WLCA 4IE0A 1MCKA 2XX1A 1DJYA 1GXEA 2JI2A 3O4LB 5F7BA 3BP5A 4LLFA 4XPFH 1TFHA 2CH7A 2BZDA 1T6VN 3W82A 4D8PB 1UWEL 1CZ8L 1X5ZA 1OQ1A 1QPXA 1OF2A 4QX7A 3O6FA 2F53D 3CCLV 1OAYL 3RYIB 2VYRE 5ICXB 4F57L 4RQPA 2C3GA 4KGJA 1AIFB 1AYRA 2D73A 2EAEA 3X3GL 5C0BD 1OA4A 2EXYC 1U3YA 1D5BA 1U21A 4O4IB 4W4OC 5HVWA 1J05B 1H6EA 2YC1B 3O3AA 5L3DA 1SXAA 4XI5D 5ANMA 4J4PC 2PWDA 4RAUA 4XPTL 5F7HA 4O9HL 1XE0A 3OBTA 4KHPO 2YS8A 1NWOA 2C5DA 5CCKH 4ZSOA 2XVBA 4UV9A 4BZ2H 5LQBH 2CDOA 3AFKA 3ABMC 2E75C 3ATFA 4TLFA 4YGDA 5TSWA 3AS2A 4AHYA 5T5NF 2EINB 5FP8A 3IXTB 3TCLB 1RPRA 3MV8A 3NZHL 4EXKA 4Z3EA 4TQEH 4UZUA 3LN5B 3P4MA 5B38B 5I0YA 4FGMA 4NUQA 4PJEA 4RFEB 7PCYA 1I1EA 3AP6A 2IEPA 5FKCA 2F4VO 2H6BA 2RCSL 4OCXL 4WJ5A 4BZ1A 2FJGB 2F54D 4Y2DA 3APBA 4LOEA 1GZQA 3BXNB 2BBVA 1SUHA 4LL4A 3ZE1F 3JWOH 2VNRA 2GTWA 2LW1A 1X7QA 5LCVH 3MRDA 5CBEB 1DBAL 3ZE0B 3DTUB 3P0VL 4FFZH 2ZE5A 4G9FA 3DX9B 2WLIB 5DD0L 2HG5A 2D7FA 3OV6A 3V52H 3ZFEA 2XKOA 4S1QL 2ZWKA 1YF2A 3GMQB 4WI2A 2QPDB 3QO1B 5E2WH 2EVJA 1MAJA 4TNGA 4W81A 1P84J 2A2QT 5A6XA 5JMRA 1UH4A 2G0LA 2RS53 1KTLA 2GSIB 5DWPA 4WVMB 4OF8A 5K4LA 5BNQA 1OP5H 3LRSB 3HMWL 1BFOA 2EC9U 4MG2A 1NFIA 1I7UB 4ZOBA 5H9PA 4CP9A 1EO8L 4IOIB 3CRAA 4Y5XC 3D8CA 4LPYA 4WGVB 1WIUA 3TP4A 2VQFB 3CKHA 4QKFA 3VXMA 5HJBA 4U0RB 3AW5A 1HAUA 1IZJA 1A3QA 3DX2A 4RGAA 1T3FA 2BP0A 3OMNB 4D0CB 1MHHB 1GIGL 5D9SB 1ADWA 2F66C 5AW6B 4CADB 3BKYL 2MK3A 4LBNA 1OGAD 2W6IG 4XO3A 1TLKA 2R043 1KTDA 1HWWA 2EKSB 2HX9A 3SDDB 1MOFA 4IKJA 5I16B 2VNOA 3E0GA 1GTOA 1OP9A 3J7HA 4WWKB 4BRJA 2VOVA 2FDHA 2GV9A 1MG1A 1LO5A 2P8MA 3GVMA 1YQVH 4BXVA 4E9TA 2HWD3 3RTQB 3PP4H 3JD2A 1OOAA 1PEWA 4JRYD 2VH9A 4LBQD 2VDLB 2QLYA 4Z5RA 5T1DH 2IZWA 1XGZA 3FB6A 3IWZA 4Y2OB 5FMBA 4N0UE 3SGKA 3DROB 4IRZL 2Q1EA 2DWTA 4XVSL 3NCFB 4PJHB 3NA9H 1A6ZA 1A6UL 1BD2D 1XQ8A 1GYVA 2MEJB 1KBPA 1GFF2 4JPQA 5EYPA 5AAMC 3PHMA 4MLOA 3Q6FA 1F00I 1AOZA 1NIBA 3VXUB 3U75A 4WFHA 2HH0L 4DJMA 5D1XA 5I18L 1H4GA 2DQHH 5AVAA 4QXKA 2OI9B 5FO8B 5IQ7H 3T77B 1A1OA 1RUJ2 1BGYH 5CD3B 5FZ6A 3VBHB 4BD4A 1EO7A 4GKKB 3GBMH 3GRWA 2VM4A 1JYVA 1HXS3 3KVAA 5HXVA 2F8IA 3EAKA 3GI9L 5JLZA 1XTMA 1RVF2 4NXMO 1NCIA 3R7RA 4JI4O 3HE7A 3SJVE 2QWOB 3L6FA 3B00A 5F3GA 4ERSH 3D82A 3AZVA 1KYOK 1R083 1NBZA 3U1PA 3SDAD 1FOD3 2VISA 3WS6A 1BQLH 3ETQA 4TQPA 5E8OA 4JG9A 4ZMXA 3VRJA 1I31A 1FL6A 1XV8A 2BPBA 3FQWB 5AB9A 3EJZD 4GSXA 1CD9B 1GM8A 2CE4A 5KSAB 1EO8H 3L3HB 1CT8B 2C4FT 2NQDA 3C6LB 3M07A 2Q8AL 5I1KH 1FZJB 5ALBL 3BQVA 4NWVA 4LPVA 1AGFB 2VM3A 5ECJE 1FJ1A 3KLHD 1VB9A 5FY4A 1JI2A 4PJ5D 2G3NA 1ZLZA 1FXKB 2PHWA 2W9DL 3FTWA 2J12B 4M48L 3W7UA 1DUYA 1DYKA 1HQNA 1A4KA 5F7NC 4JYCA 4AZ8A 4EUPG 2ZGTA 4FQIL 1GS8A 3WT3A 3MLXL 2A3XA 2G1MA 4H8PA 3MRHB 1JNLH 1TCRA 4HU8A 2H2PC 3QFGA 4NM4H 3RY6C 3ALPA 1H6YA 1DLCA 2F6AA 3RVXC 3H50A 3II2A 1B3QA 2ITCB 5A7WB 3QIUD 1DO6A 1I3GH 4FLSA 2MPVA 5JTWA 4GZRB 2Y7LA 1A66A 1YDPB 2NW2A 1J7VR 4YDVA 1H1AA 2GAZA 5FZFA 4RDQF 1O6SA 2WQVA 2HKFL 3STZB 4AQEA 5JHLH 4J3SA 5CO1A 3I75A 1EJOH 4X80H 2ZAHA 3LV3B 3G08B 2P5WE 4OFVA 4X1IA 4U6HB 3CGTA 3S36X 3V6OE 2HKOA 3BEWB 4P4RB 2LJ2A 3ARBB 3UTQB 2I07A 4P5KA 4RL7A 1A4JA 4P46B 4XQWA 1Z0HA 3RWCA 1TME2 2HWZH 4Q9BA 2HAZA 4O4LA 1FFXB 1CGYA 1QFHA 2XC8A 3ETDA 4M6NL 1YNTF 3EBIA 1JCHA 4HJJL 5KHKA 4OM0L 2QFEA 1F8TL 1U93B 2DQJH 3PP4L 2B3RA 3VKFC 5FB8A 2VUKA 3U0WH 1LOFA 4MSWA 3KYMB 5I8YA 2ZSWA 3MUHL 2J1YA 2C3HA 5TE7H 3BWUC 3QNXA 1X5FA 3HNSL 1KCRL 5EUKA 3ZIWA 3H4FA 2AK4B 4Y9GA 1DQQB 4IQPA 1P7QA 2F1AA 5AOMA 3CPLA 1GNZA 3UYOD 4AH2A 1Q8MA 3C7OA 3S2CA 3HOBA 2F7RA 1OHQA 4XPHH 1RM1B 5I6OA 1ZRCA 2W1SA 5DC0A 4JQXA 2DQUL 1FXVA 2QM8A 2XLLA 3W0WB 2ARBA 2ZEWA 1FL5A 3Q1SH 4GSRA 1VFBB 1S7VB 2OFQA 4LFCO 2JI3A 4DN3H 1MCPH 4JLRB 3TWCL 4JPKH 4Y16D 4HUWA 4UNIA 1GJWA 4EN2A 3N7LA 1A6VL 3BVDB 1J12A 3ATGA 3H9AA 1B0IA 4X8JB 3OEHG 5DEZA 5FK9B 3V5KB 9PCYA 3HNMA 4L29A 1N26A 3VWKB 2GH8A 4OD3L 2WN3A 2AQRA 2X38A 1TSRA 3AP5A 4BK4A 3NRUA 4A7UA 1BZ9B 3O6LH 3JCIA 3T0WA 1UXLA 5INDB 5F1SA 2PAEA 1VEOA 3FRPA 5EU6A 5TH2A 4QXUL 3NMEA 3S34L 1EAH3 2H8PC 2JIXB 4J80A 2XWEA 1I7RB 3PWJB 2FJFB 3PREA 4OQ1A 1VBC1 4XUQA 4OCMC 3F65A 3HNTL 2JKLA 4JFOA 1T5XA 3ME0A 3MDJA 1PZ8A 1QLRA 1AI7A 4Y3OA 1IC5L 3TFBA 3L4VA 4W9HC 5HDBE 5HI4C 3KLSA 2IFGA 5L73A 5LGNA 1S7TA 2XHNA 4Q4W1 2Z4TA 3JUZA 4A2MA 5B1BC 4MZUA 2CO7A 4ODXA 4OLWL 4XOBA 4KVCL 2IOOA 3QNZA 4GO9A 5JOZA 4JQVC 3RL1A 4UBDD 3AREC 4EWAA 3VX1A 5FQ0B 4OLUH 4EFEA 4DXRA 3UJQA 1S0CA 1NGPL 1UFUA 4YHKL 4HMCA 2RS11 1CLOH 3QUZC 5MENE 3IDYC 3CDFA 3PAVA 2XG5B 4XQDA 3FU5A 4GY4A 3K2OA 2QT6A 1BAFH 1KXVC 5IJDC 5KAFZ 4JRYE 3T77A 2GEEA 5D2AA 1E3XA 3M1CA 2VXVL 3LXUX 5FWRA 5KYWB 3QH3B 3W39B 3VFRA 4ZMQA 2E7LC 4LHLA 4N90A 4YDKH 4U0QB 2UWEF 4GAJL 5FZOB 4FOWA 3UPRB 3TT1L 1I5PA 1KJMB 1DK1A 1DLHA 1JOJA 5FW8A 4RZKA 1NUDA 4FLUA 4OULA 3ZR5A 3ABMB 2IALA 2JGDB 2VXQL 4PJDA 3I50H 4AVBA 2HP8A 2YAHA 2Y5EA 4M5ZH 5HYJB 1NKDA 4JPVL 1XYOA 3K1DA 3GZUC 1N10A 2DEYX 3O2WH 3EGSA 2OQ7A 4P5YA 2G30A 2RBLA 1AMXA 5DUBA 1CDJA 3S36H 1NAMH 1NCDL 4WFED 5JW4M 5EJ1B 2WUBL 5L3EA 1A6AA 3CLWA 4WV8A 2AJYL 1UASA 1SETA 1SA0A 3DJZA 4NENB 2LABA 1HDKA 3SYOA 2EC9T 1EUTA 3ZRWA 4WFGE 4QXTB 4I0CC 1YRZA 2BZCA 4H4NA 2G60H 1LHWA 1N32B 2AABL 5B1OA 4GIOA 4M7JH 3W59A 1G9MH 2BFUS 1B0RA 4YJ3B 2RDCA 5D71H 5DLML 4ZS3A 3LSQA 2VO5A 1ETB1 1JHTB 2N0MA 4ZD3L 4E9RA 4DSYA 5FS5A 1R73A 4P23A 5KXCA 1VZIA 4F3FB 4NI6A 2WO3A 3QJRB 2WBKA 1NKRA 3ROLA 2JDKA 1TEGA 2EDOA 3LKQB 1JZ4A 4HEMA 5GLUA 4G8IB 4KUCF 4YXHL 4FPJA 3QJUB 1J10A 1J48A 2BVTA 3DX6B 4JPKL 4A7SA 1UN1A 1PYWB 2VUYA 4NC1E 3CCHA 1HNYA 3IN0A 3KVQA 5D1QE 3UERA 2XPGB 3KBFA 2X29A 1S7XB 5JDSA 1ZBE1 4XBQA 1SXCA 5I6MA 1B2WH 1R5VB 4YHPA 2IXQB 2EDWA 1RKRA 4OGAC 2CK2A 2DQMA 4D6QA 4PJ8C 2OTWA 4OM1H 3WKMH 2UXXA 3M3CA 5DZEA 2WZR1 1KACB 2WMPA 1FVCA 3MKKA 3S0MA 5FZ0A 1R3KA 2DWEA 4PLNA 3I5DA 1UD5A 1TDQA 5FLVA 5BNOA 3DDFA 5KSUB 3ZFEB 1UJTA 2FZ2A 5BRZE 1BBJB 1YNTA 4D6TH 4G6AD 4PI0A 1UA7A 4XIKA 4YVUA 1UD3A 4R7XA 4YOKA 4JZOB 3UGUA 1RUI2 3JD4A 1BFTA 5JXEC 2PW2A 1CR9H 3BSZH 5A2CA 3IFOB 4ZFFA 5F5QA 4MDIB 1A3RL 1AOHA 4LSSH 2XZZA 1V9U2 3SO3C 1DUZB 4XNZC 3MRMA 5KOMC 1WZ1H 3NXSA 1ZMYA 2CTVA 1CXFA 4QHLA 3QRLA 4HJGB 4FEMA 4KO7A 3E8VA 2PTMA 5B3JE 1DGRN 2EVGA 5JXAH 4TUOA 3VXMB 4K1ZA 1SLXA 1DQ0A 1CONA 3SKVA 4EJRA 4JRXE 1PAZA 5SWQB 2XOKG 3G6JF 1MQTA 4WV1A 4I7ZB 2A5UA 1IL1B 4META 5FYIA 3S5LG 4QAWA 1LO4H 2P5WB 2E86A 3VFSA 1EHLL 3BOPA 3RWIB 1OKOA 4QKTA 3KVPA 1K85A 2CTWA 4EZ4A 2GBVA 5DZOA 4OCSH 1PTZA 2PF4E 1MCNA 4PP2A 3ZHNA 1COV3 2BSBA 3CSFA 4WWKA 1SQQH 1FC1A 1UT9A 4QD2E 5EU7C 3HG1E 4AYBA 4QNPF 3ZVVA 5EHFA 3FQXA 5CBHA 3FT4B 3BVUA 1IJNA 3K8MA 4LPCA 4S1SL 3NQHA 2HLDG 3VDDB 4WTXA 4ZZKA 4JG0H 2QADC 3WFEL 5DS8A 2FDFA 1VGEL 3IDCB 1TUBA 3NZ8A 2BP8B 4BCXA 2JDZA 1J5CA 1IFHH 1EHXA 1RUOA 3RYHA 3I2FA 2Q87A 3Q8AA 3IIAA 2J8UB 3F7VA 5DD1H 4E5XB 2B9VA 1RSFA 1U58B 1H2NA 2PTUA 1JVLA 4LL9A 1QR1B 1AYN2 3VXRE 2WSSG 2M26A 2VR8A 2NUPA 4DKEH 1QNZH 1U4EA 3O6ML 4GMP3 2UZXA 5D2LE 1DF4A 1NFAA 1PSKH 1NFKA 1JF1A 3A5VA 3MX0A 4PWIA 4PM1A 2A71A 4KRPD 2Y24A 1XZ0A 4AVKA 5CKMA 2R1WB 3CDGA 3WIFA 2YAMA 4AM0B 4AW4A 4NUGH 1QWUA 1T1XB 4DK1A 1ZLEA 4YSOA 2E4TA 3MDPA 1YJDH 3ZDZE 1FX5A 5HYSG 5B1NA 1QDCA 1BK0A 4NHUB 1NA1C 4HG6B 4UYBA 4G59C 4EFBA 1KN4H 3FN3A 1CDIA 3V10A 3ACGA 4R8HA 3FAVA 2NY5H 4KY2A 2OMYB 5GSRB 4UQ3B 3UO3A 5IMOA 4HVQA 3ZPOA 2IDCA 3D3QA 3WFHA 3OZLA 3NABL 5GJSH 2XCMC 4QAMB 3GSUA 3P2BA 4PS3A 1LGCA 2ID4A 4L92A 4OF5A 2ZE6A 1PZ2A 3HG1D 4XNMA 4BOWA 2JF1A 1UWXK 3MRRA 4KQ4H 3GB7A 4NWUL 2XN2A 2UWEE 5AVQB 5HJ3B 3O1TA 3VFTA 1H5BC 1LP9A 5FKAA 2ZKOA 2WZR3 2BW5A 4AIZA 4N26A 3STZC 3BAIA 3ZN6A 1JP5A 3QUXD 5D1QB 4P2RA 1HDJA 1G1OA 2H3NB 1B04A 1XMEB 3M17A 4QYAA 4DK0A 3INOA 1E5CA 3FN0H 4PWHA 2LE9A 2Y48A 5GS0H 1QOKA 4YVNA 5L9DH 2BJMH 2G5BB 3GMMB 4YHIA 2G75A 1AR61 4FNTA 5I1LB 3EJCA 1OH4A 3H42B 1AR82 3THOA 2B1AH 4XAKD 4QRQB 5AYUH 3MGUA 4XUPA 4JDTH 3UC2A 4EDXB 2DFBA 4XF9A 2HYMA 2NZIA 4KRMB 3GMOB 3RVXD 3W9EA 2H2PD 1SVCP 4XMVA 4MMXB 3QFJE 5FYJU 1W0OA 4B7EA 2CJUL 4QNPE 2QQOA 5LA2A 4I4WB 4I9WE 1RMU2 4A4AA 4BUHA 3CIHA 1KFXL 4AOCA 3VXNB 1IGOA 4RGMB 4X4ME 3GDBA 3F62A 3GJEA 4U6XB 2D7OA 3ZKUA 3JARA 1LO3L 1BQHB 1IE5A 5E99L 3ARED 2G4EA 1C1LA 2JS5A 4NR1A 1CFNA 3OB0K 4YSRA 5BNXD 2WAOA 3I2GA 2QPUA 1IILE 1IQDA 2VGLM 4MHHG 5FCUH 3U7YL 3NNGA 1DN0B 2ITDA 2EDYA 3ALQA 3PUIA 3KHQA 3OGCC 4XOEA 3G08A 1W8ZA 4YJ2B 2JECA 2ZJCA 4IV3A 2FQEA 2VC2L 5E2TL 3PN1A 4FSJA 3D3VD 5DUMH 1TCMA 3HJ0A 1CYWA 2X3CA 5K93A 4JZJC 5JHDE 4FFVD 3TM6A 4U1HA 2VOXA 2VJ8A 2DTML 1W9WA 4FZ8H 1HLCA 1F1DA 1PSKL 2X10A 1UGNA 5A3WA 5SWSA 5AC92 2DH2A 4WM7C 5EIIG 1QR9A 5SWZD 4HOMA 2VWEC 1S78D 4KKZA 4OI0A 2R063 1COBA 1JZ6A 1XF4B 4Z77A 2O61A 1AGCB 5DFTA 4IIQA 3V6ZA 3M88A 5K39B 1M4WA 2OYZA 2XAHA 2UXNA 3LKNB 1RV6X 3U4AA 1MFAL 3MGTB 5M94B 1WBYB 2HRPL 5EBMC 1XWVA 1MUJB 2DCYA 1S3KH 2JB8A 3B2UD 4H55A 3SKNA 2N7BA 4J28A 3CSBA 1AXSB 4LGRB 2QVMA 3S0PA 3QK0A 1J9QA 1UACL 3OXSA 5HJDA 3KLHC 1PIV1 2JICA 1PVC2 2VXRA 1TJXA 3GSQB 4K3JL 4K9EL 1ZANH 2VDNH 1JPGB 4RVBA 1D2QA 2DB8A 1C08B 2DMHA 2GC3A 3RWRD 1QI3A 4WI9A 3V0JA 3O14A 1QSFA 4DVRL 1SEBA 3VXPA 4DW0A 1JG9A 1R46A 3BD5A 3LRGA 2CBPA 5FYLL 3CJIB 4YXLL 4Y8AA 1BVZA 3GNMH 1TEYA 4PLOA 2FTKA 3EOAA 4I0PD 1AI6A 4BK8A 3M8AA 3GRBA 3M1BA 4LESA 3GYDA 1J0HA 1F97A 4JDEB 3WFCH 4DO0A 3CC5B 4CU9A 4FKHA 2WSVA 2WYSA 3TRSB 2EILC 1KLUB 5D8AB 4FULA 2WXFA 3P0GB 2YD2A 1I8IA 4PELA 1SJHA 1RHI1 2HLAB 4CH4A 4R7NA 1RURH 3PAYA 2VDLH 4Z7VF 3T1FB 4GALA 1V6MA 4XUTA 1DBJH 1E7UA 1Y6XA 3FYIB 2XIBA 3BRFA 3V4VL 2IAMB 4UW5A 3MO4A 1D4VB 3TYJA 2PMZA 2GTQA 4MXWA 2F61A 3ORJA 2A4EA 2ZGSA 4K8XA 2VDKL 1XQNA 2FX8H 1VMHA 1MAMH 4QHKI 4ZFOL 2AEYA 2WP3T 2W0LA 5AUMB 4K73A 4FTVE 2DIJA 1YUHA 2O5XL 1XEQA 5TDPB 4ZFGL 1SQVH 5JIQA 1IZ3A 1ZSPA 4JFYB 4P3DB 4AE0A 3FBYA 2FH6A 3EGDB 2JELL 1UMHA 5F6LB 1DYZA 2Y2TA 3OGRA 1OTSC 1XIWC 4KK5C 2WWKO 5FM8A 4DK5A 1U8PA 3KEDA 4LCCB 1T6BX 3ZLQC 2C4FU 5LA9A 1NL0H 1NANH 2RHEA 1ZLWH 4GX5A 1VGEH 2ZAGA 4YNYA 1W39A 5FYUA 5HHOE 1FFPA 2R9HD 1S5IH 3D39E 5IF0B 4Z9KB 3RFZB 5I15H 2DI8A 2GTZA 3L9YA 4XB3A 1T04B 2VNCA 3DSFL 2QBWA 1EJ6A 5F9OH 5CGMA 1D6VL 1RUD1 3WV6A 4E4HA 1BFVH 12E8L 1OSPL 3FT3B 2DMCA 4K8ZA 5C6TH 4WM8A 3SE4C 3VBSB 3MNMA 3EGXA 3FO1A 2UVFA 5LCVL 5A3IC 4J3OD 1OOPC 3AG7A 3H85A 3V8CA 3EJJX 1AO7E 4XNBA 4JGMA 3ZO0A 2YD7A 1WCDJ 3O0XA 3MFFA 2ZOTA 5L6YL 5DJXB 4DP9X 4S10A 5FDYA 3QDMB 1ZJBA 3L3DA 1OP5K 2DMKA 4PRPD 4Z7NB 2FD6H 3F2LA 5C8YB 5KHGA 1K6QL 4HK3N 2AZ5A 1H8TA 4AI1A 3CZEA 5IKCA 1U97A 4HAKA 5I1IH 2GFBB 3VDBA 4IGBC 1B0RB 2CR0A 2XJPA 4MJIB 1L7TL 1S78C 3ULUD 1NC2B 2VCMA 3ZOAA 4M1DL 4ZU5A 5E6IB 1UWFA 1O4TA 1Y18B 1SJEB 3O4OB 3L3OB 2B77A 3ROLB 1ZT7B 4AW7A 1YEKL 3N43B 4BMBA 5GLVA 3HN1A 3N9PA 3NCYP 2EA7A 3ERXA 2Z79A 4EN3B 1FFXA 5GLZA 3SD2A 3E80A 4FQLL 3QQDB 4FNUA 5J09A 1XDCA 1GGIL 3DUIA 2BNQA 3KJ4B 5T1LA 3L3HA 1C1EL 5SX5H 43C9A 3AMQA 1NSNL 4JUTA 4R0LA 1AGEB 3GMQA 3OG6B 4I3GA 5ID0A 2WN2A 4BFGA 1UZ0A 1EIBA 2IXQA 1NZ6A 1GC1H 3RSJA 3WW3A 2VJXA 4WGWB 2JQMA 2AC1A 4FLVA 2CWMA 3ZKQD 4X4XA 5CF3A 3FNKA 3T4AC 1LEDA 4CSWA 4ONFL 5DD6B 1EEUA 2ZPKL 3I6SA 1SYSB 4TNWF 4DV5B 3E38A 4B97A 1UHVA 5D55A 1KJMA 1R3LA 1PO12 2Z2SB 3WXPA 1YEJH 1YHPA 4JFQB 3ACHA 2W95A 1WD8A 1KBVA 4LBEA 3TBBA 2IALB 3WV0A 1L9TA 3LKNA 3O3AB 2OJ1A 5CN0A 4JO1H 4AIXA 3IPFA 3KV4A 5JMOA 2R49A 5IVNA 3NR7A 3LD8C 2B9ZA 2J21A 4GBXB 1AR93 1HV0A 1VE0A 3G04B 4GMSL 4MD0B 4HWEL 5DGQA 4XNYH 3E6HB 2AV1B 5JSRA 3IXTA 2EIMB 4K9JA 2BCKB 2XTJB 4DKAA 2EXIA 2DLHA 3I6GB 4LF6O 2GG1A 2EDEA 4ISVB 5F0PB 2BM3A 3Q0HA 3H53A 2AKRA 4IUGA 1T5XB 3ME0B 4OZFG 3T3PB 2PCYA 3II1A 3TBVB 4S1DC 3GI8L 4PCYA 3GFUA 1NICA 4ZOAA 2WFPA 3J81N 1M42A 4YDJB 3U82B 5FUNA 2JE8A 1KIPA 2YZ4A 3NIDE 4E2SA 5I8TA 3CP1A 3MLVH 3NK3A 2EXKA 3VD7A 1U5XA 2EXSA 3RWEB 4XCYA 2V7NA 1E4WL 3POGA 3SODB 2VQAA 4LO8A 4D9LH 4YDNA 2I69A 2QHRL 4B7IA 1T03H 2YA0A 3BVCA 5FK7A 3L4YA 3VI4B 3ME2A 2XL9A 3J07A 1REEA 4FM0A 5MHSD 4GH4B 4QX8A 43CAB 2JXMA 4FJYA 4XFBA 1EPFA 1NFIB 3GS0A 2BU9A 3VI3A 1JYXA 1PS3A 4KBBA 3M1HA 4XCCH 1MQKL 1X5AA 4UOJA 1DYOA 2VXTL 4KJYA 1P4IL 2DQGH 1N1SA 1WW6A 1WZKA 4QGLA 1NCRB 4NDMB 4ZOEA 3RYIA 3KKYA 4K5OA 3ZDSA 3IJYA 4KO9A 4KKPA 5D5QA 4G70B 1LEKA 1A2YB 1XZ0B 3VW3L 4JPVH 3KPOB 1PIV2 3BUDA 3O3BA 3TO4D 4BZ1H 1DGLA 2EBOA 2ALAA 4PTUB 1FGVH 3SPJA 3SYPA 1F51A 1CGXA 3DOSB 2W5PA 2EXYD 5E1GA 3WNIA 1LNSA 4NN6C 3G6JB 1V54C 1KTRL 2ADJA 5JLVA 5FYZA 1T0MB 1PL3A 2E8ZA 2J4WH 2Y1ZA 2ZKMX 4JFZL 3TXSA 5LATA 3KF5A 2EIJC 3KL5A 1CFBA 2MKLC 3S3XA 4K7PL 2YUWA 4RSYA 4G5AA 3VBSA 4U1GC 4P2QB 1G9MC 4BIKA 5FO9A 1WFUA 4EQVA 2B9BA 2IBZY 4RNRA 2VIRA 5IAVA 4ZI7A 1QHOA 3EYUL 5DGRA 3UZVA 4PRHD 4WJ5B 4LOUD 1KCBA 4AEFA 5DDJ1 3C2SA 3NZSA 2BNUB 5GRJH 1WK0A 1CZSA 2WFF1 2WFF3 4BUGA 4PGJA 1FA4A 3LSOB 5FJKA 1O6TA 4V2CB 3B2EE 3FW6A 5D4HA 4QOKE 5CGTA 4JFVA 5E8PA 5LBCA 3QDGD 2FQPA 2FATH 4MQXC 5EU4B 3EBAA 1GY1A 5ISZD 3RILA 2CAVA 1DTUA 4HKXA 2A0LA 3KLQA 4HLZG 3WIHA 1BLNA 1T1ZB 5IB2A 1W6MB 1FNSL 2P6HA 1OD7A 3KS7A 2CSPA 2N74A 1U6AL 3ZX6A 3ZMEA 1EXUB 5IHBA 2QFPA 4QD2A 4ICGA 4LKXA 5ISLA 2XA3A 2E7QA 4YW4A 2EZPA 1SJEA 4G7YL 1QKZH 1NUGA 3BHBB 1FIGL 4X9IA 1MCBA 3ABTA 2P4AB 1IC0A 5CBFA 2NX5A 3EH1A 5DK0A 3NWKA 4CCKA 3DX4A 5K0UB 4ZFQA 3FT0A 3OJDB 5L88L 3FTYA 1I8KA 4WI0B 2VSDA 4U1NB 3HPLA 4XH2A 1WGOA 4DP6X 1A32A 2QPFA 4KUCD 4MD5B 1WA8B 3SPVB 4ZMPA 5IREA 1NCNA 5E4AA 5EO9A 1AR71 5ENWA 4XX1G 2P8LA 3V6OA 4FLQA 2OCCB 3MDSA 2YGOA 1U8OB 3V0GA 1BX2B 3GXNA 4NQCD 5AKTA 3ASNB 1HINH 3PCYA 4PR5B 2ITDB 4AFMA 4U6VH 5KVFH 4K5NA 3ZHQA 2WP3O 1BCCH 5KSAA 5JQGB 1OAUH 4BW9A 1EFXB 2EDDA 4AV5A 1UQXA 2Q8CA 2DM4A 1F1AA 1U41A 3DYOA 3NIGF 4GI8A 4PRHE 5GHWH 3RPBA 1QTSA 4KKLD 5I82A 4URTA 4J10A 1XXFC 2NSQA 1ZGLP 3UH8A 3L9DA 4IOFC 2J1SA 1E5ZA 2VWEE 3GMLB 1UCBH 5BCAA 4L9LC 1BVKA 1KV3A 2CNAA 3BP7A 3MRBA 1QSEA 3TEZA 2YIBD 3CQOA 4P2RD 4MGIE 4M7LT 2HWD1 2CCWA 4A45A 3MOAH 5J8OA 2IOIA 4TTDC 4JYAO 3GQFA 4JO4L 2OSWA 1XCQA 4NRZB 4QRPB 4Y0GA 3RY6A 4FXGA 1P6AB 1T22A 4ZFGH 4HUVA 4PJ7F 2DTYA 3VYPA 1CTOA 1S0EA 1AJ7H 3ZIAG 3QBTB 4L37B 4AX3A 2H1XA 5D96C 5HSFA 4R4FH 4KI5M 5GONA 1BP3B 2R1XB 3VYNA 4B53A 4KWKA 3GWJA 4Z0BH 4U36A 3NPSC 5DVMA 3CFBA 4BIUA 1KYUA 2E9JA 2WNKA 3FRUB 1MCJA 3VFOB 5EXOA 4MVBD 3QZBA 5FYKE 1YG9A 4Z3TA 1EFRG 5DJYA 5DVOA 4LLVA 2FR4B 2O5YL 2I74A 1A22B 3G6EV 1F4HA 5J37A 3LV3A 5DMGC 4EVNB 4G27B 2UXCB 3HPJA 3VMPA 1UW8A 2FL4A 2O1AA 3LS5L 5IJ0A 5I19H 1ZVSB 1IG0A 3BMWA 4GP8B 3SBPA 3ULSB 3MLPA 2DCJA 1I94O 2DL9A 1KIPB 2CO6A 2O6DA 3E2HB 3FT1A 4JDEA 3HZVB 3SJVA 1J5IA 3RTQC 1Q0YH 2AQTA 5I0WA 3M4FA 4JYBA 1F3DJ 1IC1A 5DC9B 1OSGA 4R9DA 3HRZC 1TGOA 3CZJA 1L0XA 5F89A 4HCGA 1GS7A 5DRNB 4ERSL 3GXIA 1WFMA 4DXWA 5TGBA 4XP5L 4CDQB 1WJ3A 3WG1A 2NY6C 1AJNA 4HYTB 3SY0B 5BXFB 1WLCA 4DEQA 4ZX4A 2IO5A 1G1CA 3M1OA 3LXBA 1AGBA 4IBWA 3ZXAC 2KH2B 3REWB 3O5SA 5FUZL 5SX5K 1U42A 2IBBA 4BQ4A 3T65B 5LGUA 3APOA 4PJIA 3O8XD 4YZ2A 1QEWB 3S34H 4D8OA 4ZPIA 3BP6B 3RGVC 3WP5A 2IXCA 2GJZA 4LVHB 2DBJA 1X9UA 3B2VL 4TXWA 1VQ4V 1IAIM 3DPBB 1XI1A 5E23A 1OQEA 3K75B 1EZVH 3ABLC 1L0QA 1LO0H 3BDYH 1T21B 3TNMB 4JNXA 2XZCH 3PL6D 4BYYA 5C0IA 3FU3A 3WAJA 1NVPB 1AFVH 1M05B 4MMZC 3ZXJA 4KK9D 1OCRC 2ZIMA 1F4XH 3FQUA 1I82A 2CCLA 5EIQA 4Q4V1 2AACA 3H0TB 3CX5F 1LO0L 4RCAA 4ZMOA 3GXFA 4HK9A 5DQ0A 3C3TA 1L6PA 4XRCA 2XJVA 3NIDB 4NP4L 4OJAA 4PRHA 4OD2B 1FFPB 1MIEL 4LVOC 5DHEA 2WXHA 3VTMA 5IZ7A 2R0LL 4NHCH 2H32H 5KSBF 1UWGH 3M99B 4XCEB 1EAH1 4MVBC 1GKEA 4NO2B 1QLRB 1V05A 3IPEA 1PJ9A 5L4MA 1MMMA 1SLUA 1QSED 4YBQC 4JN1H 4Q4X2 3VXPB 5DZJA 4OGXH 5J12C 3C9NB 1N8RW 3IJHB 3EYVB 4GAAA 5L9VA 1GZWB 4DXSA 4LF9B 2YPLE 2C26A 4LZKA 4FPFA 5IYYA 1NM9A 3TVMA 1UWXH 4G6JL 4Q8BA 3VGEA 3X13B 1EK3A 4WO4D 3DXRB 5IYBO 1IBHA 3AY4A 3KGRA 1AACA 4GXVH 1WP6A 3CDGB 5D2NA 4WO4C 2WSUA 4NQCA 2PLV3 2VS0A 2XOMA 1W8HA 4B4RA 4Q6IB 2FE0A 1M93A 3LNNA 2KI6A 5JOFA 1J83A 1E5HA 4GQZA 4KOCA 3RDTD 1DVQA 2BRQA 3K6IA 3VE0B 3RZGA 3SDCC 4ESKA 1CAXA 1NQTA 5FZ1A 2ZM6B 1XSIA 4QQLA 1DZBA 2LP7A 1AZRA 1NGXA 3ILPA 2QHLA 2WWJA 1HESA 4WU5A 4NQUA 1RZJL 3FCUB 1GOHA 4U1HB 3ROOB 3T3ME 2IXHA 4M4RB 3WNNA 2VDRB 3T6XA 5IVCA 2BDRA 2Q10A 3GB7B 4H33A 3L08A 5HJ3A 2XZQL 4NRYB 5IVVA 5HCHA 3QWRD 2LAGB 2I9LB 2V17L 5DJ2A 3DMMC 3ZSLA 1K7DA 4P4KA 1H0DB 1I9JL 4G3YL 3UMTA 3ZE2E 1C8PA 1LB2A 4IU3A 4K3AA 2K3HA 2OMWA 4QRUA 4L8BB 5C09D 1GNHA 1OPGL 4XOAA 3VGDA 2IVIB 3A47A 1FZKA 5DRZA 3CXHF 2EJRA 1MZEA 3MV7B 4JE4B 4PJ9D 2FJHA 3BC9A 2R4SH 5KS9E 1OOPB 4KJWC 3PABB 1R64A 3NO8A 4LCIL 4N0UA 5JUVA 1BIIB 4N0FB 3GIVA 1BG9A 4X6CB 2HLFC 4JO2L 1UT1A 4F7CA 5CFCA 3QUZD 3GGWA 4MNQA 3Q3GA 2HPTA 5IP4A 2Z4QB 3IN9A 4I0AA 5ACA1 2BOCB 1N2RA 3AGVA 1IAKB 4GSQA 5CJOL 5B38A 3AROA 2UXFA 3Q1EA 3O8XC 1A3LL 3MUGA 5AW8B 4FFHA 4ORGB 4PWJA 5CJXC 5FZMA 1AROP 4YL4A 4CH5A 3ZIMA 2DLTA 1AKPA 2CO7B 2JJUA 1CD3G 2H26A 2GN3A 4RHV1 5BXZA 2P80D 2C3VA 2BOBB 1GHFL 3EDFA 4MXVF 3ZDYE 4OIAA 1RVF1 3WDHA 2HWE3 1SZNA 4JPWL 2DCKA 4GW5A 3V0BB 2ZIOA 4RMUA 4UINH 4WNQB 4IGPA 4LQRA 2GTWB 3KV5A 4XILA 4ODSH 3L7FA 2JJSA 2MSPA 2NNRA 2WQ8A 3AS3A 3F58H 3Q5YA 5EOTA 1R093 2X7LA 3BH9B 5PAZA 2ZBJA 3KV6A 1R1A3 2VR4A 2CDPA 2C9AA 5EUOA 1ZWIC 4R7NB 3AMNA 4UILH 1K4DB 3E7JA 3EJYD 4GFTB 3ULSA 1UOBA 3T2MA 5C0FB 4GKSB 3Q8CA 5CA0B 5GRVK 5DUVA 2VAUA 5D93C 3O0LA 3C8HA 2LT9A 1LL1A 3OLEA 2ARJB 5EC1A 3SDXA 2K0RA 3KBHE 4BZ1L 4J3OG 1GZHC 5T1LD 3MO1A 3QXWA 1C8M1 4QNHB 4Y5YC 4DV1B 3TF7C 3PMEA 5D7IF 1GGIH 3BAXA 2A7BA 1EHLH 1PM9A 5TDNB 1X5GA 3LMJH 4P57A 1NKOA 2PQQA 5FYKD 4PHZA 2PCFA 2IADB 3GBLA 1U3HC 3GEFA 2HRHA 2A9NL 3KLAB 4HUUA 3MJ9L 2D7TH 3ULVH 5A3NA 4J3BA 3B09A 5JHMA 2W0KA 3WTSA 2HX8A 5EIIA 4RSVA 1OZUA 1NKGA 4LCCA 2R23A 5GGRB 3UACA 1NY72 5DRWA 3R18A 4KVNH 2EO1A 1PL4A 2SEBB 1N0JA 5BR8B 1OM3H 3G5VB 4DFHA 3CUPB 5HY9B 3WG3A 1RUPL 3LN4B 4JAAA 3IXAA 2ZA9A 3ULVL 1TQUA 2FCUA 1QFWM 4JI6B 3AJZA 1FL3A 4HX1A 4P2CG 3IBOA 4PRPA 2C9KA 4LHKA 4CNIA 3INUL 1YWKA 5TE6L 3CWBH 3SJQC 4QCIB 1LENA 5C97A 1L7IH 3ULUH 3FWEA 3O1VA 3VDCA 2WBJC 3GHNA 2IJKA 4HWBA 2E8YA 3C60B 3C5JB 1IBLO 4LFHG 5D5MF 4NMIA 5ITZA 4OLVL 2ATAA 1JPEA 4KJQC 2NY6D 3ZN6B 25C8L 4RBPH 2BYVE 1ONQB 2BY0A 1M7XA 4N1HB 1PVXA 4LOUC 1NBQA 5IESL 4M01A 3NUKA 4NIHA 3JBG3 4LPTA 2MNGA 5FZ9A 3AUVA 3FUFA 1YI2V 2WLJA 1RZKL 3QIUC 4OFKA 3ZZ1A 5DO8A 1RUKL 1RZGA 2L7EA 4G2KA 1JTPA 4LF5O 1NIDA 2GIXA 4IMLA 3HIFA 4G3YC 1XVSA 1K73W 5IESH 1HXYB 4W93A 5D7LE 4NOTA 4UAPA 3CPWU 4KAQH 3BESR 4AI7A 1SEFA 2J3SA 2KMWA 3LNGA 1HR0O 4JGYB 1BBT3 1ZT7A 3B7SA 4PRIB 4ODHL 3SE3A 3LX9A 4ENZA 4NQCB 3E5QA 1BLNB 1W6MA 3CN4A 2EADA 5JJJB 3WDWA 3I74A 2NQ3A 3DA0A 3N27A 1EBOA 4GSUA 5CIPB 3WVJA 2V7NB 2YGLA 4XFFA 3QJOA 3N5AA 2ZCEA 4ZFFB 5FR3A 4BGLA 2EULA 1E40A 5BPPA 1CDBA 2RDSA 4I02A 4O2FA 3CMOL 3MNDA 4X6CE 4IKIA 4CN1A 2BW4A 5HPOA 4A68A 4ONHB 4JFHE 3PY9A 3N44F 1AB3A 3EJZC 2X3AA 3RPIB 4J6IA 2YPLD 1I9EA 4JASA 1EYBA 1KMGA 3OGCB 4TN7A 4Z95H 3C3SA 4YGVA 5B3SB 3FCTB 4N2LA 4Y1UA 2Z5WA 3AUWB 2UY6B 2VN6A 3QI9A 1AGFA 4HWNA 2RJ2A 4L2LA 3ZHLA 2R1YA 4CRQA 4WZ9A 1R092 2D31B 3ZU8A 2A9NH 2VSKB 1J95A 5FY7A 3L9RB 3HC4L 4HHAA 2GC1A 4NXKA 43C9B 4WHCA 4AVAA 1F3JB 2KYIA 3S37H 4OUSA 2K6ZA 3NJNA 5FF6A 1FVDA 3TJHD 5ACZB 5MERA 3DARA 2OJEA 1FJGB 4D0BB 3J8F1 3DSNA 1S3JA 3E8GA 4LEOA 1DF0A 1KIRB 4QQPA 1BW8A 1W8EA 4RZCB 1YQCA 1T2QL 5EIYB 1UZ8B 2V4LA 3MRJB 2DYPB 1NWPA 3OY8B 4L8QA 3ECVA 2EDTA 3D50A 1EGJL 1HL5A 3W81A 4Z7WE 1T22B 4WW2C 4HUVB 1NPJA 5F7UA 1S5LZ 2HT4C 4JCMA 4L37A 1XF2B 2P8PA 2RR11 3CB2A 2JJTA 5DYOA 3MRLA 4PJGA 2AI0H 2BXZA 1Q9WA 2D6LX 2HVBA 3WG4A 5E8PB 1F56A 4FQQA 2YMOA 5EA0H 4P05A 4YGCA 2IPKA 4HQQH 3P40A 5KYYA 2F1EA 2MNJB 5T1LB 1D4M3 4MLSA 3BKJL 4DUZB 1Z6JT 3VRLF 4YHHO 3P77A 3U2SA 1DQVA 4QHMB 2BHZA 4HFUL 1U93A 3SKOA 4KFMA 3CD6V 4HU2A 5D4JA 3S5LA 1XNQO 4W65A 4AFCA 5LBBA 3B8NA 4WFHD 4XE0A 4YHZH 3T4AB 2BP6A 2W60B 1KB5B 1BXXA 3GSRA 3UROR 1FNLA 3O1PA 5TF1L 4V2WA 2ZXWB 1SHWA 4FQCH 4HIEB 4MJ5A 1ENQA 1CB4A 3QDJD 5ACMA 1RZ8A 3GLDA 4LCWA 4OB5L 5DFVC 1U8CA 1CG9A 4JJ5A 3WIHH 5FZEA 3CO2A 5C4WB 2ICWI 3JV4A 4Y5SA 2ZMNA 3ZBHA 3TV3H 4D3CH 5HYIA 4NQTA 4RMTA 2B2XL 1JZ8A 2M2DA 1YEHL 1EZVY 1QABA 4DR3B 4HEPA 3HMXA 5C33A 2F68X 2EX3A 2MQGA 1FVEB 4CCOA 4U31A 3BGAA 2XRAL 3QARA 2WPGA 1P7BA 4LH7A 2G75B 4G8GB 4BFNA 4Q27A 4S11A 1D2DA 4DR1B 1K8DB 5LO7A 3AFGA 4I1NB 1QSEB 3VX0A 3ZDZF 2WIIB 4QQ2A 4RA0A 3L5HA 3LS4H 4F33B 4NPKA 5EBLB 2ZGPA 3WXWL 4O2CA 5B2GB 3P3NA 1MZFA 2Q9OA 3O9WC 3HR9A 1FNEA 3HG1B 5BZZA 5L2KB 3H7JA 2V5TA 4XCYB 1RC6A 4H5SA 4HKBA 4RISH 2DBLL 2R2BB 3FQNA 2N7AA 3MLRL 2VLRB 2ZPXA 1MS1A 1FO0B 1SY6L 3G5XA 4F1SA 1Q86W 3D9AL 2BNRA 3ETEA 4U7OA 1QBMH 2IPTL 3ZSKA 4LIQL 2VXJA 4HLTA 4NXNO 4GZ9A 1UEMA 5F7EL 1U92A 2HFEA 3TAYA 4LMFA 5IQ9B 4R9AA 2CRYA 3ZX7A 3QHZH 3UYRH 1FZMB 1U95A 5EWIH 1UXSB 2CR3A 3DXAE 3J8F3 1RAMA 4MVTA 1Y4WA 3BHBA 2R8SH 3NV2A 3V8OA 1BHAA 4C0HA 3NCWA 1FYTE 1OTUC 2B39A 4AEMA 2VLJA 1XIWA 3IDMB 4YVSB 1R1ZA 5DI8A 1QWRA 3BN6A 1NEZA 2JTDA 3CFNA 1RTVA 2GIYA 2IFFH 2C4XA 1OUSA 4HSCX 5A32A 5J6HB 2ATFA 4JI1B 1YECH 2QKIC 3BN9C 3C6EA 3OBRA 3MROA 4KQ3L 4L3FA 1GQHA 1WBZB 2GHWB 1ULEA 1FAIL 1FE8L 1KDIA 2Z3FA 3ZKXB 1KCWA 2WXJA 1BZWA 3MCYA 2L9LA 5CJ8A 3GZEA 5CA3A 1EAPB 4MS8D 4PVNA 5H94B 3OF1A 1FMD3 5I75B 1QOOA 1Y66A 1ZLVH 2E5LO 3IFLH 5HHMB 3TC9A 3L75H 1A21A 2DQEH 5I71C 3GHMA 2VDPL 5FZBA 4K9EC 3ATBA 5A7BA 2V09A 4Q52A 2A77L 5JXHA 1QSFB 1CIUA 5FL7G 3QPKA 5EFIA 1N6QL 1F4XL 2ZNXA 3FUJA 1F18A 1JE6A 1CFSB 1KT2B 4KHTH 2RMU3 3FF8A 3HI5H 3C09C 4AR2A 3CZUB 3U2JA 5IMLB 1AGDB 4B9PA 3ABUA 1WA1X 4KP4A 2BOJA 3VAEA 2OTUA 3PUAA 3BRCA 2IV8A 1F45A 5E9DE 3TIDA 3H0TA 4C59B 4LBOA 3BB6A 3DXAD 4A2UA 2WKOF 2IWGB 1C8M2 1R6TA 4PS7A 1UZ8A 1GOGA 1SMOA 1MHEA 1YMHB 3MRJA 4XTRD 5I18H 3KAAA 5DMIL 3AK3A 5C0BE 4Z3HA 2CO3A 4L9BA 1CZTA 3LFMA 5H5NA 3OB8A 3WD5A 5FGCB 4D6SA 4A7KA 5JMCA 2HPOA 1MA1A 2NX5B 5GS0L 5C09E 1INDL 2Y7SA 3DLQR 3PXLA 3BKML 4N90E 5I1EL 2ARAA 2B1GA 3MRLB 5ADPL 1CFMA 2F54E 5E1RA 1QXRA 3H7YA 4JY6B 3GMNB 1YQ6A 3VQMA 2AEPL 2NY4D 1FSKC 1M2VA 4O9HH 3EYVA 3TETA 3DC5A 2O72A 3E3QC 1L6XA 1MJ7L 3FSAA 4GS7C 3IS1X 3IK2A 3OKKA 1G0DA 4MCNA 3WSQH 4P3DA 1HXS1 1W2AX 2XKPA 2ICEC 4FLYA 2LU5A 2X4OA 4TM9A 4NHLA 5CSGA 4M5YH 2Y7QA 5F3FA 5DRNA 2UU8A 5CFHA 1TZAA 4LLYA 3T4AA 3E5XA 4Z1VA 1EBAA 4LO9A 4PMFA 3I6KA 4WY7H 4PJDF 1XGPA 3ZDXF 1JI6A 2QMKA 3VXOB 2B1AL 2GTSA 3MRIA 4YNYB 3PURA 5JR1L 2X0UA 3VRLE 4KRLB 4GMP0 3FFZA 3RFZA 4IRSA 1QAWA 4P2AA 1AHWA 1MDAA 2N59A 4FPYA 3IF1B 1PU0A 3MBED 4NP4H 3ZIYA 3PGFH 3EYSH 3IM0A 4B9JA 3V0AC 4GAYA 1EV12 3ROOA 3QUYD 1H3PL 3FBQA 4D0CA 1ONAA 1T20B 1JWSB 3DPBA 2Q76A 1CCZA 1W04A 3DHJA 4X83A 4FLTA 2ETWA 3P11H 1A6PA 4IETA 4ZMAT 4UDTA 4BFEA 3PJYA 5C0ND 1QDOA 4YW2A 3FQTA 4AXWB 4NNYA 4GEIA 3N41B 3HMYA 2F8OA 3FF7A 5T1KD 1TQBB 1JSYA 5JQ6L 4RHV3 5FLJA 2PW1A 2HJFA 3I2CL 2J1ZA 4A7YA 5I6KA 4YHNB 4BA6A 5BMVA 2R071 5I1HL 3MRNB 4LP5A 5HV4A 2X2YA 2XV3A 1Q94B 4GRMB 3TZVC 2E3CA 4FI6A 5LCVA 1CX1A 1ZREA 1X6NA 4DV7B 4PRNB 1GPOH 5F71A 2J88L 3IJ7A 3NFNB 4QUOA 1UUNA 4TLUA 3U48A 2D7QA 1PO23 3T0ED 3ATDA 3W7SA 1HV1A 4UOW1 4Y4FA 2CIIB 3WUCA 4EZLA 4KKQA 5LWBA 2B4KA 4ZODA 1VBB1 5K33A 1OGTB 1FFTB 1RIHH 2IDFA 1QNMA 5SWSE 4MQTB 5H4ZA 3QRGH 1JZ3A 1J1PL 4CCEA 4HG4K 5AAMA 5BO1L 3VKMA 4GIQA 4LLQA 1MI5B 4ABMA 1SVBA 3NAAH 1KFUL 5DHMC 3ARGA 2FEJA 1Q90A 4KVNL 3C2AH 4WUUB 4DW2L 4IV1B 3WOGA 2BVUA 4IEFA 4LMQI 5E1HB 5EJZB 4P49A 1FCGA 2FDBP 4UCTA 4XPTH 4EQ2A 3SYAA 3B3IA 5LEJA 4DXTA 2XX0A 2ADFH 5K0UA 1RUE1 3QFDA 5BMFL 4XHBA 3D30A 4HKZB 2BHYA 2XKNB 2DJ4A 3PNWA 4FL4B 4H20H 4QLRA 2X0LA 1W2KT 4UV4L 3PUSA 2UY7B 1D2PA 2IJ0C 4QWWC 2EUXA 3BISA 4DV5O 3O1RA 2C9QA 1JGLL 5CILL 2MEV1 4K21A 4IGQA 2Y06L 1CAWA 5F7YC 2ZGLA 5C9KA 4PWKA 4K2UH 4BH7A 2R042 1RJYB 2W3JA 4PCTA 2KBGA 3OR7A 1RJZB 4FXKB 1EFXA 5DZLA 4KJPD 4OZXA 4JI6O 1DBKL 3VZNA 5E94A 4DY5A 5I91A 2F5BH 1I08A 1SPDA 3CX5K 3FCTA 1RUJ3 1F8VA 2D44A 4IEPA 4ZQTA 4LIUA 4NWTL 3GBEA 5FO9B 5DHXB 4OSUL 3V5DA 4KV5E 3C9NA 4P2OA 1WAAF 4PJGF 4UFHA 3QJHB 5DHDA 3BTAA 5HDBB 2VAAB 3BVNB 1MFEL 5CU9A 4FPGA 4CNIB 1VHPA 3BZ4B 1ZUQA 3VXQA 3BTZA 1TTUA 1DTOA 2IG2L 2B5IC 3BCCH 4Z3FA 2P28B 1G7YA 3ECQA 4PJ5E 4WFEA 2WWMC 2BOBA 3TIEA 2WKOA 3HBZA 5IB2B 1SN2A 1TZIA 2ZCZA 4MJIE 5T5NG 4N8VB 4LF5B 4QRFA 4LXLA 4P9YA 3ZYBA 2GMPA 1FIGH 1CESA 1KWKA 3S9DB 2DURA 4V1DE 3CSXA 2ZXQA 2BNNA 2A6WA 1F23A 1LMIA 1IT9L 4HKWA 1CLZH 1AR4A 1J9SA 1KUMA 2WNUB 4JRAA 5JR1H 5FWJA 3JV6A 3JVGA 3OL2A 4UZSA 4ZG1A 4Y1YA 4JPRA 2ERJC 3GUFA 2QTWB 1ET5A 3MRDB 2I9LA 3MXWL 4JHAL 4ELMA 4FTVD 1YFXA 1CVRA 1A47A 1J8HE 3O2WL 1VQ6V 2DLGA 4XWOC 5GS0C 4JV4A 3NACH 4GXFA 4GG6A 2LAAA 2X0WA 1CFTA 1DP0A 3GEWB 3VQWA 3CVHA 3ARBD 5AVXB 2AS5M 2P48B 2DWRA 4WV1C 4GNKB 4YFEA 2ZP8A 2FJUB 2VLMD 4MSWC 3KCWA 1MRFH 3MNVB 3LA2A 4ANVA 4S0TD 2AEPH 5E51A 2F15A 2ARJQ 4H40A 3X17A 4FCHA 4MCMA 3L1EA 5BW7C 5ADPH 3RGBA 4KI1A 1PO22 5BXXA 1OAJA 1GAXA 4M8UA 4YG6A 4M3CB 4DQAA 1F4AA 4D2NA 1ZHBB 3QNFA 4I48B 1Q43A 4DR2O 1DBNA 3IGFA 4Q9RH 3H8RA 4Q4Y2 3S36L 2CWSA 4TRPL 3JXSA 1YFWA 3MTXA 2C24A 4U1SA 4GMP1 3R06A 3RX5A 4MW3A 4OXSA 3H8OA 5T1KA 4AQ1A 2XBDA 3SD5A 2NLRA 4XMIA 4YR6B 1IGCH 1M71B 2FK9A 4H88L 4WFFD 1XR9B 4RHV2 3R1GH 1POV1 1MY7A 3CFBB 3PJNA 4RH4A 4ONOA 2VZOA 1NJ9A 3S3PA 4OCYL 2CNZA 1AP2B 1IAOA 1ODUA 4N28A 2JKBA 3STLB 4Y16A 5DVKA 3BUCA 5CA0A 3SE9L 4FA6A 1IPSA 5FBJA 1P49A 2Q1MA 1GLHA 3GNEA 2KUTA 2YWZA 4AEDA 4KKAC 2XN9E 3KSCA 3D33A 4IRSD 4YFDB 4D9LL 2BWAA 4HUCA 3KCXA 4Z7WA 1A8ZA 2H1PL 1KC5H 1ODNA 4DUZO 1MELA 2BS8A 4LSDA 4S2HA 1BT8A 2QQNA 2XYCA 4B4QA 5FDBA 4XJ8A 1GZWA 3SDAA 1DL7H 1SACA 1G6RB 3HZYA 1Y9GA 2ICWB 1KJ2B 4QXGL 4F7TA 3NFPB 4PW4A 4J8RB 3RJDA 3SCMB 5DEGA 1QMUA 1RUAH 2ICES 3MJ8A 3OWRA 2XACC 3A4AA 5JQGA 5IGXL 3AVSA 5DAVA 4U2YA 5A3MA 2AW2A 4QHMA 5CYYA 5DD5H 1XCWA 1EAQA 3C3VA 1LK2B 3N04A 1S9XB 4JX0A 4L2NA 2VDQB 3OT7A 3U46A 1PY4A 5CSZB 4RDBA 3GTTA 4P30A 2EDKA 1CBVH 2PTTB 5I0TA 3GLAA 3ULVF 4YM1A 4AT6B 1VACA 4O4IA 4DNYA 1CU4H 2FVNA 4HS8H 4KNTA 5ES4B 1I8LA 5HP5A 1BFSA 1X6LA 5CU1A 2TSBA 3EFFA 5AOIA 1X9TA 4BWUA 5LZ6A 4NZJA 3GDCA 4CA4A 3HPNA 3JZ7A 4J7JA 2JCCA 4F6EA 1D5RA 3DOHA 3J80N 2CRMA 1A6AB 2QTEA 3CVIH 1L0NH 3MOBH 1MVUA 2YZ8A 4XO5A 1ASJ2 1H0DA 1HRV1 1YC61 5HGGS 2RMKB 4JYAB 2CKBA 1M56B 3POWA 5EQUA 2ZGMA 1TTCA 5MERB 4NKMB 2ENSA 5DJXA 3ULUF 4Q9QL 1M3JA 1BF8A 5FFOA 2ITCC 1KCUH 3GZOA 4V2BA 4U2AA 3OTOO 5FAXA 2Z1KA 3JVFC 2O5YH 3CN0A 4ZS6C 4XWOD 1MH5A 1CFSA 2CH8A 4XAWH 1IURA 5C0EA 3K06A 5CP3H 4TV9A 4K1YA 4R52A 4EI6A 3DIVA 1G6UA 2BSKB 3LEYH 4NKIH 4ODWA 3RYMA 3DJRA 1N3PA 1V6NA 1BQKA 3CVHH 3KCCA 1NC2A 3FTZA 2Z7YA 3OKDB 5IUSA 4MV2A 1R6VA 2JDNA 3ZXGA 4EXPX 1RUE3 3T2LA 3X29B 5D5MA 5EF2A 2VGDA 4AG4A 4YN3A 4ZFZA 3BRGC 1S0GA 1CGUA 3CVHL 2LU3A 3VBOC 4GKOA 4DS0A 4OUUA 4MB3A 4HNAB 3MBEB 2WUCL 3IMRA 5JDJA 5L2JB 1I7UA 1RUH2 3WLBA 4Z7WF 3G5YA 5A16B 5FA3B 2HWB3 2OKXA 1ZT1B 2OXGA 2X4PB 3TL5A 3CU7A 4KC3B 2XL7A 5LP6B 3DHUA 2AERT 3K71A 5LYJB 1TJGL 2VDPH 4XDLA 3GMNA 2AJZB 3SPCA 1S4IA 2I07B 4P5KB 2ZJSH 2WVTA 4XNQA 3ST7A 3JWDC 5HPMA 4C0BA 4XC3H 4QPYA 1MEC2 2ZF9A 5LASA 2FLMA 4ATEA 1BQLL 5CBAB 1HJGA 1P84F 4U1KB 3WENA 2CLZB 4KQ3H 4D69A 1BVNT 4I3SL 5F37A 3SJVD 2Y4TA 3FQ4A 5BNOC 3CMGA 4NQDD 1YZBA 4PF1A 1NUNB 2VQUA 4TVPE 3K1KC 4LPLA 4IHJA 4MMYB 3L2YA 1C7TA 2KR2A 4JDZB 1U8NB 2HFFB 1PNCA 3VKOA 1K3ZA 1OSZB 4DZ8B 3STBA 1IX9A 1L3WA 2NMNA 3AYAA 1I8MA 5DF0A 1G7QB 5AAWA 3ZFGC 1FHNA 1KGXA 5I1GL 2B16A 1YIPA 3K03A 4LA3A 1N67A 1GTFA 1QBML 4YO0A 4MXQC 5CCGE 5KTEH 4JQRA 1F42A 2NT1A 1OKEA 4LSQH 4JANB 3N2GA 4JB9H 4OFYD 4HPKB 2MEV3 2RA1A 5K1NA 3FTUA 2A6IB 2YGQA 3BGFC 5LOVA 3FB8B 3E8HA 1VESA 2ORBH 1KGIA 4O5LL 2R30A 2AZ0A 3UCSC 2H7WA 2HVKA 4YHYB 3FO2A 1IE4A 3QD6A 1E4KC 5JXAL 1ZE3C 5D70H 2PLV1 4LFBB 2YD3A 4GAGL 3IRCA 2H6PB 3OC5A 5KHHA 2XQYG 4GRWB 2F9BT 4H25A 3X1NA 3O1UA 1JHKL 4LCWD 2WCGA 4B6ZA 4K23H 3AKPA 4MJ6A 5TK2A 1OKQA 3D0AA 5C0AE 4GKSA 5JLZB 4J12A 4Z7QE 1LGBA 1RURL 3AK0A 4F7MB 2WLLB 3NJXA 2RDRA 5A7OA 2BJSA 5BOPA 1QNYA 1FZMA 1U95B 3LZRA 2E33A 2B5UA 1HHKA 3AL6A 2DD8L 3D69A 4WO4B 4AC4A 1IGCL 4N6RA 1DHKB 4O2AB 5LRSA 2ZM6O 3T2PA 2MPAH 4NDMA 3FN9A 2OYPA 4M6ML 4AEJA 5GZGA 2R27A 5GRXG 1YJNV 4BFOA 3LB9A 1JMKC 2Y7QB 3I59A 4WM8C 1CXEA 3IMUA 1H8NA 3V4LA 1EZJA 4NM8H 3UG4A 5I6XC 1X8MA 2CQVA 2F19L 2ZZJA 1YAIA 1M56C 2A3WA 4K3JH 4QF1A 4QHUA 4X5RA 2WNXA 2OMYA 5GSRA 3UCQA 2UU9O 5HY9A 1ND3C 3MI8A 4MFHA 4C56E 1WLWA 1JD9A 3Q3GB 3QO8A 3JV5A 1MG2C 1VIBA 4ALAH 1S8DA 1JBCA 1H8HG 5L8JB 1Y1UA 1LOEA 5EIBC 3PLQA 1HZHL 1MQ8A 2YBRB 3FB5A 2ZYIA 5FJHA 4JFFD 5I24A 1T03L 4L5FE 3BPLC 1SCSA 4AQ6A 4GAYB 3PJLA 1BVLA 3LSEA 4MTOA 4CMMA 4XF1A 4QRBA 3OKNA 4YUEL 1E6OL 4U3SB 3BQUB 3PL6B 4ZI7B 3UZVB 1UB6A 2ZHLA 1G0XA 2R2BA 5MEPB 3UO2A 3ON7A 5A6QA 2A83A 5ILTH 3ZYJA 2R073 4D7TA 3KS0J 5DMKB 3BALA 4E41B 2WBXA 3FB7B 1BK1A 1E67A 3S35X 4LSVH 3HUJF 4LWSA 4DV7O 3CZKA 4KO5A 4Z76A 3QNYB 4JFXA 2PHXA 3ARBA 4MNGE 4P9HH 4UQ2A 5F0LB 3NJYA 2AJYH 1NCAL 1YI9A 3IEAA 4NP9A 4MZRA 2JKIS 3BVWA 1FFRA 3SE3C 2VTXJ 2BNQD 5LXTA 3MCLH 3PPSA 4R0LC 3DI3B 1AJKA 2VMFA 5FFGA 3HHSA 1MFVA 4PJFE 4KPHH 4JREC 3OUHA 4FVVA 5H8DA 3VBHC 3FSWA 4JY6A 2P1YA 5FHBH 2D3PA 2JB4A 5IE9A 3TA3A 1K5MB 2A4CA 1KC8W 4YVWA 3OJMB 1SMAA 4UT7H 4F1ZA 1IQWH 2EEDA 3X3GH 1NGWA 2VE6A 3BJLA 4X9HA 4BHUA 4GWJA 2VZPA 3U14A 4F5CE 1P2CA 4QDGA 5T3XE 4R9BA 5DUXA 2X4OB 3BZFA 4Y1SA 1ECYA 2NMSA 1G94A 1KB9J 4FXKC 2WLIA 4AI9A 3CL1A 1SXSA 1XSQA 4HGWA 3HWJA 5G04L 3AG2C 1SXZA 3JD71 2XWJB 3VSTA 4AXOA 4FNLH 1MEC3 5KUMA 1JPFB 4NN7B 1DBKH 2SEBA 4Q4Y3 2OWOA 3N85L 3GSNB 4UOW0 3V2AR 1HH6A 4Y5XA 5C08A 1O6UA 1KB5A 3FU0A 3ZFGB 1BG1A 2CE6A 3GF8A 1YLLA 1B4JH 2KHAA 4Y4YA 1B35B 1ZSDA 1FNGB 4NOBA 5KOVC 1JPST 2R0ZL 1NIFA 4DEWA 4P2OD 2PPCA 3WGVB 4Q8KA 3EJQA 2X4NA 1X5HA 3NTCH 4HMEA 1LHNA 4KWJA 1RIUH 2XDHA 3FU6A 4QOKA 5C0GA 4LLWB 1U8QA 1CDCA 1QQP2 4UFKA 4JI5O 3T0EB 2VQEB 3JCUZ 2PPEA 3BIWE 4HDIA 4DP8X 4GJZA 4GLXA 2NY1B 5EBMA 1NCOA 5DJCB 2D3JA 3HG0A 2QSCH 2ZSVA 2L8AA 4QXUH 3SGJA 4KG0A 4AGNA 3MODL 5C08D 4ASKA 2Q73A 1YYCA 4JHZA 4QYOB 5IBUG 4KZCA 4Y4HC 1FLRH 2JKJA 4L8DA 3LB6C 4MD4A 1QOSA 4YSPA 3JWNE 2NY3B 2ZD0A 2CU9A 4FKKA 2A79B 2GI0A 4S0HA 2HYKA 1HYSC 1G84A 2WKGA 3FHQA 4TVPD 2FSEB 5H6RA 5FY0A 1ZLUK 4WUKH 4HCIA 1ZA6B 1W06A 4A6YL 1VR3A 3OEBA 2NXYD 2O0OA 2ARCA 2JIZG 1G4YB 4W4LA 2AXWA 1TIUA 3KPLA 4HP5A 2FQFA 4XBGB 3RX8A 3WHXA 4NUBA 1UJ3A 2HTKD 3N4MA 1KV7A 4JO5A 2A5ZA 1HR0B 5DABA 1OGTA 3HCVB 1S9YA 5D1XC 1NMCC 4W9ZA 4K40A 2VOWA 4YLQT 1ZDQA 2VXQA 5C6CA 1X36A 4BR6A 2GT9B 2X05A 3LRSA 3OUJA 1PZDA 4W6WA 1RFDH 5L4FA 3JZVA 4G5ZL 1JAEA 4FNSA 1WA6X 2IGFH 2VUCA 1OBNA 1TJIH 3HE7C 3UOAB 1DQ4A 4CDXC 1J1XH 1MFMA 5D72H 4Z82A 1XB6A 2VO8A 2BRRH 3HE6C 3P3YA 4ZO6A 3RUGF 3WDVA 4LE8A 1MW0A 4X6DE 1NCCL 5GRUH 3TA3D 2HWZL 4JAUA 1SEQL 3VBSC 1A4BA 4UNUA 3OB0H 4JGZB 3S57A 5BPXA 1PL0A 4E0RB 4PDWA 3RUGE 5EC2A 3OCPA 1AY1L 4LRIC 3DSNB 5F9WB 2GC2A 3VKNA 1ZV5A 2WSDA 5FLIA 2IH1C 3DUUB 3O4LD 4X88A 4DR2B 1OUXA 1LM8V 3JYBA 2VDPB 2GJ6B 2DBNA 2DUQA 3BPSA 3G9AB 4N43A 1SXNA 3LN9A 3ZYGA 2GMMA 1NSNH 1YEIL 2FHCA 3I6LE 1BD2B 1TNMA 4CVUA 5L0QB 4O02A 1CIWA 4UFZA 4M7LL 4XQ4A 2CXGA 4CC5A 3VBRA 2H94A 3K5RA 4OM0H 2OYKA 2I45A 4GQ7A 1FNAA 4I55B 4JGJA 5AW4B 4YWGL 5CGBA 5I1JL 2W9XA 1D2OA 4E5XG 1HW7A 3JAKB 2YD1A 2QGDA 3BZ4A 3SCMC 4FPKA 3RJRA 4AVVA 5FPXA 5I17A 5LP6C 3QXAA 4G9FB 3UDWC 4XJAA 1FAFA 1YYMH 3OKMA 4Z7NF 3WDYA 3BU0A 5JDSB 1FH5H 1RQ5A 4GKXA 1C57A 4P5TB 4U3JA 1W59A 4ODUA 1QZ1A 4LDCA 3RZMA 5D5PA 5LXGL 1BM3L 3L3JB 2VVEA 1U36A 3EJRA 3WIAA 1UYPA 3IFLL 3DBXB 2XQ0A 3P2DA 3LD8A 4OZFB 1A1OB 2QR4A 1JUFA 3PGDA 3NNFA 4N7IA 4OLXL 3FULA 1T0NB 1MWAL 1ZTXH 4IKNA 5TDOB 4ZXBA 2XXMB 1BYHA 1WPBA 4PF5A 4BQ2A 3JV6B 5CD5D 1MS3A 5HHVH 1GZ9A 2VR9A 1SCRA 5KXDA 3B9VA 4W9LC 5H9RA 4XDQA 1CGPA 5IIEA 3LPPA 1S0DA 5H9QA 1H8LA 4H13C 3CMEV 4XBPA 1R3JA 2OMUA 5DJ0A 4AYID 3KYAA 2PCXA 4FNQA 1PGL2 3GJFH 2ZCLL 3U9UA 4ZONA 3LEGA 3RZKA 3S4SG 3GZAA 1N5YL 5EORL 4PJXE 2MTPA 3I54A 3EHBB 2ZSWB 3TVMD 1G8WA 4GAZA 5FUPA 2NLJC 4APXA 1BEYH 3BPOB 4R7LA 1ITCA 4Y9EA 5C07D 2OIIA 4CS3A 4XT1C 5I5RA 4BQ3A 3QA3A 1PNLA 5AFBA 3I3BA 1DSFL 4Y4KC 5H9SA 3CPLB 3KWTA 4X64O 4PVMA 3VL9A 2R0KL 4NRXB 3U83A 1LJ7A 2R56H 1GCFA 5F9JB 3OX8A 3K6OA 4F7CB 3CE2A 1QRNB 2PI5A 3RNKB 2CCVA 3SJBC 3MXVH 3W9AA 3U0ZA 4JM2D 4I0PA 2NY3C 3WSOA 4JZNA 3FQ2A 1DGRA 4ZPTA 4IHJB 4MMYA 4UT6L 3MCKA 4BDVA 4N85A 3PGFL 4JFPA 5KBPA 3NNMA 1QSFD 4PBWD 1LP9E 3BIEA 2Z7WA 4ZX5A 4DV0B 1JWMA 1QBBA 1RK0B 5FK9A 5SWZA 4FLWA 3V5KA 5HDOA 1HRV3 2ZOKB 5KC5A 1IC7H 1TO5A 2H8PA 3QZWA 1LEIA 2XG4B 4JFUA 4NKMA 3BAYA 4ZAKC 5KXBA 3THDA 4PBVC 5L4JA 2A6JB 4DN4H 2YMXL 4LNUB 1BPVA 2WYTA 5FO8A 5HCBA 3L5XH 3LDEA 3KPRE 4FQXB 4KMTL 3B8MA 1KNOB 2LFEA 3KLLA 1T4WA 5DFWH 3RB7A 1RP3B 2ESVE 1Z32X 3HS0A 4GD4A 4XGZA 4M0NA 1JF1B 5KHIA 2G19A 1BGXH 5E5MA 3ZXEA 5BNPC 2F0CA 1J9RA 3AREA 1KP3A 4YLZA 5FMDA 1V7NH 3OGIB 4GIAA 4PG2A 4PJCA 4UV8A 2XWBA 4WK2B 4G9DA 4X62O 5FB8B 2PO6D 4UUJB 5F7KC 1ORSA 1MFBH 3JWNH 1RIRA 4HH9B 3TTYA 3FOMA 2YOAA 2ILMA 1HCFX 1NC2D 4QXWA 3I49A 3RY4A 1DCLA 1RP8A 1TITA 4JEGB 1UZWA 2W80C 5IMOB 4EUPB 1WISA 2W88A 2JG9C 1KN4L 3D0SA 1KY7A 4NO3B 2Y07H 3DV6A 1KEXA 4LKFA 3VA2C 4XMTA 1VFBA 2CKBL 4OCLC 6PAZA 1CE6A 1VEMA 4LCYB 4N9HA 5FKAB 1XH1A 2KKWA 3TCTA 1NAMA 2WVSA 3VFSB 4N2KA 4RO2A 3LHPH 3WEZA 3AKQA 1PNKA 1G9AA 2VMGA 2OW4A 4QPGC 1NR7A 2PELA 2OXHA 4NIIA 5J2UA 2WNOA 4HBCL 4FP8L 1IBGL 1AQMA 2BS71 2YD8A 4OLXH 4AXWA 3EZ8A 2BVEA 3MRHA 3GZTB 3MLWH 4BHPA 5C2BL 1D5AA 3ZLIA 3FQYA 3LHPL 1UO9A 2Y6HA 2YXSA 3B9DA 3ZT6A 1QO3B 3PAUA 4PJGE 3LSDA 2JEUA 2HJFB 2IMNA 2CK0H 1BPLB 2NCEA 3AACA 5ABDE 4NO0B 1EERB 2RS52 3BGFB 3MYXA 4QPJA 4AAXA 2JGUA 5IWLC 5D2NC 2XWTA 4Q2FA 3NCXA 4YZ4A 2YIBA 2Z92B 3V0WL 5ITFB 1IVLA 1F3DH 1JK9B 5EU5B 1A4JB 4P46A 3O0VA 1JVKA 4WI5A 3MFFB 4N2BA 1DBML 1SS3A 1XL4A 3JZYA 3OKDA 5AYQA 1CAVA 4B3SB 4CVWA 4OZGE 2OM5A 3T6VA 1KTCA 4ODUB 2DQCL 3NFPA 2GI7A 4KXZH 4ABWA 2DQ6A 4N86A 4E41A 4W4ZA 5BOJA 4RWYH 1VRH1 1IVTA 3B2PA 3D4CA 1UXZA 2F4PA 3NJMA 1EGJH 2YK1H 5FP4A 1O7VA 3PUHA 1I5YA 3H9HA 4V33A 1OLLA 1S7SA 3L5XL 3PHOA 2Y0OA 5CIPA 3T0DA 5HI3D 4JR9H 3H1WA 3O12A 4HEME 2UY8A 4UXAA 4KRPC 2BY2A 1WB7A 4QRAA 1FZOA 4WO0A 3QW9A 5JIKA 2HWD2 4HCRL 5ISZE 3E1F1 1BQ5A 4NBYB 1NBYA 1XGTB 4IRZA 2NX5D 5HGDB 4UTAH 4LOTA 5GTIZ 5C8CB 1IC7L 1VSCA 2G9HA 2Y34A 3TBWB 2QV2A 3NG5A 1AZBA 4NS0A 1VA9A 3PNWB 1MRDL 4Q58C 1AF9A 1ND3B 3SCFA 4DOUA 2IH3B 4F8NA 3DJ9A 4LPWA 1L4IA 2ERJB 3KPTA 4WSGA 4BKLB 3ROUA 5AENA 3AU0A 2OK0H 4AIZB 3JV0A 4PP1C 2W5FA 1Z9PA 1SQXH 2A0LD 3GJFB 5D7SH 3VM7A 3HZKB 1JNJA 2WZPP 3UTOA 3G6AB 5CJXA 4JTCB 3UGXA 3DETC 2VR3A 3BSZA 4PD4F 2VLME 1OV8A 2JDPA 4E9LA 3KZIZ 4WBNB 4L4TB 1JGVL 3BP7B 4DO5A 3UBXA 3WX5A 2FUQA 3MRMB 4Q0SA 2JDYA 1CLCA 1JDAA 2QZ2A 2XI9A 2W9EL 3M7MX 3POIA 3RNQB 4X20B 4MMXC 1PZBA 1N59A 1CICA 3FB7C 1DZ0A 4J9YB 1HRI1 1MS5A 2OMZB 4BSVB 3UZEA 3QI9D 4PJ7B 4L97A 4U6VL 5KVFL 1BZ7B 1DL7L 1NMBH 1T5KA 2WO3B 5FYLE 3S8FB 1HRV2 5D8JH 2WLZA 4K7FB 2Y6TE 2YBKA 4XUNA 2KQXA 1H8OA 5TF1H 3SBWC 1E1RG 3TWYA 3V6FA 1LU2A 4NZDA 1SFYA 3PFUA 4M56A 3QDJE 3TO4A 1TETH 2FGWL 1GGUA 1AX0A 4A7VA 1OAZH 1PYWA 2ATPA 5DMKA 3MUJA 1KP2A 1G6RL 1QVOA 4EV0A 4ZFOA 3FZ3A 4LPUA 4KK9C 4OCNC 2DDUA 4HJTA 1VAHA 2Z6FA 2KB1A 1AANA 3QZMA 2BVVA 2NCMA 4M61A 1K72A 3P3UA 5FA4A 3IMVA 1J3QA 5DDHB 3KWVA 5T50A 1WCBB 2BX5A 2XKUA 3TBSB 1DZRA 5BNOB 3TZVB 5DEDA 4L5FL 3WJLC 1CFQB 1FOD1 5F9WC 2O61B 1EHAA 4B08A 3WOVA 4DV4B 4UV4H 2JKXA 1KIUB 3HRZA 2DOSA 3BA9A 2ROYA 4KROD 4U1LB 2YGPA 1YIJV 2WINA 4ZHQA 4DV6O 1KD1W 2WSPA 2I24N 2WXGA 1O3RA 3P30A 1ZY9A 3QZPA 4R5VA 4YHLL 3I59B 4UB8Z 2QADD 3HKZA 4NO3A 2A73B 4AFAA 5F7DA 1Q8QA 1JGEB 3DETD 4Q4V2 4X6EB 1U91A 2EE9A 5C7GA 4PRAB 4TLKA 5DJDB 5IWAO 5A2IH 5KVMC 2Y7MA 2WR9A 1VQOV 2VRKA 3CJIC 3HS9A 1UXWA 4X5QA 5KBFA 1NAKL 4L4VB 4CKQA 4LEJA 2VVDA 1PLBA 2IF7A 2FBRA 2R9RB 4R96B 5HGBB 5IVZB 3NKTA 2VQEO 5C4WC 4P23B 3FB8C 5DR5L 1MCFA 1HS6A 1KCVL 4Y1VA 2Y6SD 5EBLA 3B7MA 4N2NA 5EJ3A 5AB0A 2ZOLA 1Q8SA 4GYCB 5F3IA 6PCYA 4FP3A 1L9RA 3BABA 5E5RB 3VTAA 3QEUA 2AC0A 1LEMA 4QMAA 5K9JL 4NQSB 2WNEA 4Z3IA 4YEFA 4IXLA 1WZLA 5CS7A 1YVWA 2WT0A 2R0WL 1EX0A 1REIA 3QIWA 4UILL 4OFGA 1RULL 1ADQL 4LSVL 4Z7UB 3K9SA 5AALA 5B8CC 3EXJA 1HZHH 1RK7A 3AABA 35C8L 4K5PA 4R6UA 3Q6GL 4JJOA 4RNRB 4W9CC 4N90D 4KKBC 4WHYH 4HC1A 5A7EA 2V7HA 5LDUA 1PCXA 5HHQB 3F7YB 5LAXB 4UINL 3KHCA 3ASOB 2M1KA 3RBGA 3PXJA 5CM1A 1E4WH 1SQ4A 1LDPH 4ELME 1IS6A 1MJJA 4LF8B 3JQOB 5C8CC 4YY3B 4KU7A 3LZZA 4G1MA 4O9EA 2ZHKA 2DYSB 1W6LA 5JCOC 2W07A 4JDVB 4U3JB 3IU3A 4Q9CA 3ES4A 2MQ3A 5I6XB 1ZAUA 5IV2B 3Q01A 3VXNA 4K6BA 1S7SB 3Q8BA 1GU3A 2DY2A 1KPUA 1SJVA 3D12B 3D5OA 1YEFH 1NCRC 4QPIC 4NEHB 3LEXB 2XLAA 1GO3F 3KPMA 2RCVA 1FS0G 3HCVA 4B60A 2ROXA 2VISB 3AZUA 4GUOA 1FGNH 4E8CA 3CXHK 5FV3A 3QIWD 2VCOA 4U7KA 5I8OL 4JGZC 1EAPA 2ICCA 3VH8B 2OIEA 3QUKA 2ZUTA 5L0QC 3NMBA 3FUIA 5AW2B 1DBJL 2BBAA 4AT6A 4FHBD 2R062 3WZ1A 3KCYA 2AJZA 3ZYIA 4E9SA 3NPZB 2X2UA 4RWYL 2D98A 3VJ6A 2H6CA 2WA4A 3P9MA 5C3RA 3LQZB 1G43A 1UA6L 2VZ3A 2OA2A 3RG0A 2BNOA 1JK8B 1Y1DA 1X4YA 4JO1L 1YMME 2BEOA 5E2UH 3CDCA 1A4KB 1KPRA 2ZYRA 2GUYA 3N9QA 3L3DB 1MCQA 2H3NA 4U1MB 2YFUA 1PM7A 1IS4A 3J8F2 1X5YA 5EC2B 4QHZA 1NC4A 3EJSA 4ONFH 3B8SA 4HDIB 1U8NA 2HFFA 2MHAA 1CLVA 3BCFA 4P06A 3D2UD 5EU6D 5ICYB 1MS4A 1CICB 3N1PC 4HZFA 4J1WA 3VZMA 2JB5L 3VDDA 3MJ9H 2VDML 5A7WA 1XCTA 3LA7A 3AAZB 2R29A 2NR6D 2ZWNA 4JREB 3E89A 5E6YA 3FBMA 4N53A 1YDPA 3N0PB 4Q4X3 1FV3A 4RGNB 3L54A 2W0FA 2XXZA 4KY1H 5B3NA 4A42A 2VKWA 4XZUB 4JPIA 4AGMA 4JAMA 3C7HA 4GO6B 4N23A 3CJJA 3JTSA 1C5IA 3DKHA 4R4ZA 5KBMA 1BVP1 1S5JA 2I27N 3MBEA 4OJEH 1AYM3 5HGHA 3OKKB 1MW3A 1WJZA 3HUJA 5MEND 2FR4A 4M48H 2XWJA 2FHRA 2Y07L 4QXVA 2H6OA 1H9WA 3P3RA 3M7FB 2CG9X 4HD5A 2ZQMA 1ND2A 1O3SA 2PYFA 2ZWZA 3EW3B 5T55A 2DYCA 3ZN5A 1VQMV 4KXRA 4TULH 3EOBB 5FYYA 3VG0H 4Q20A 3MNZA 1JPSH 2J6EH 3BSHA 2XJKA 1HW5A 2JJVA 4OY9A 3EYPA 4P57B 3U10A 3AS1A 3BPOC 4S1RH 1MREL 2MH4A 5IMKA 1HRI2 5EEZA 5FYMA 4L1BA 5J7MA 1GZHA 2H9GB 4ZHQB 3OC8A 2VSMB 4IRJB 4LK4A 4LLMB 5GGUB 1N1YA 3I3EA 3OAUL 4WFBV 4JHWH 2OYQA 3T0EA 5AAWC 1JZ2A 4NPRA 3H9SE 3NSFA 3JATB 4LCUC 3GPSA 5FV1L 4M5TA 5EOCL 2R9IA 3F85A 2CGZA 4KU1A 2VD7A 1EVTC 5JOPD 4K71B 1FV1A 5BZWB 1PAMA 1E2ZA 2JJWA 3GBNH 4HIXL 2DI9A 5IW6A 3E6BA 4LJHA 2BSRA 4NJ9L 3BUPA 3RPKA 2W52A 5AYUL 4IBQA 2AKRB 5C86A 2RE9A 3TNMA 5KJRH 1AZZC 1H5BB 1PD3A 1BA9A 2XBZA 2J2ZB 3SH5A 2HVKC 5EIVA 3Q05A 4O02B 3VBRB 3TB0A 4WAFA 3OD0A 4E4SA 3OTOB 2FWLB 3I9GH 4YEEA 1YAZA 3D3VE 1CK0H 5BVJA 3VFWA 2XWRA 5T1DL 4AENB 3D85B 4WHTB 1DQKA 1E3FA 4X89A 1Y0LA 2FX7H 5EZJA 4BKTC 1B2YA 4WCYH 3VB9A 2ISDA 3P0YL 1RUI3 2BTVC 2E59A 3QUYA 3VI4A 1XF3B 2VLJD 1RGSA 1RUE2 2M83A 2AEOA 4IGBA 2F53E 3UAFA 1T80A 3SPGA 1OANA 4LBAA 1AR1B 2D3SA 1W72B 3W9DA 5T5LA 2UWCA 3LDCA 1Z5YD 3IS0X 5F39A 4YZFE 1JS9A 3UO1L 3OPZL 2VMCA 2MQCA 4PLJC 2VCAA 3SNMA 2R9HC 4XE5B 4M0HA 2IQAA 1F0LA 1INQB 5JW4N 4TV8A 2XVGA 3IN2A 5JI7A 1PLGH 4C91A 3AEIA 4E41D 4ZMVA 1YJDL 3IAPA 1CX4A 1HQWA 3JASA 1T0NA 2BNRD 4ZXBB 5TDOA 1TTGA 1SLTA 4I8DA 2YPKA 3JWOC 4RFNC 4FYSA 3B2DC 4KGQA 3AREB 3AG1C 2YAQA 1Z0MA 1RI8A 1WMDA 4AL9A 5K5YA 4I3SH 1FPN1 1QNZL 4RRPM 3MRKB 2NY2D 4U49A 1XNTA 5FC9A 3ISWA 4KDTA 5FKPB 4K94L 4AL8H 1WUVA 1H9VA 3S3JA 1WLDA 2CGYA 4KBZA 4TQDA 1U9KA 3MV8D 3D09A 4W70A 5ANME 5I1KL 1XF5B 4FLOA 1US2A 3MLYL 2CHHA 1OW0C 2P67A 2D2OA 4K94H 2B59B 4AL8L 4QWNA 4BJLA 3NN8A 1HL8A 2BTQA 1FH5L 3PWNA 1F86A 2N7SA 4FQPA 1IBGH 2LOEA 2H0EA 2VT0A 3WEMA 1PO11 1HINL 4MYWB 4G4FA 2DL2A 2FHFA 3UQ8A 2YZ1A 4JFEB 4AV4A