3RGBA

Crystal structure of particulate methane monooxygenase from methylococcus capsulatus (bath)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
382
structure length
382
Chain Sequence
HGEKSQAAFMRMRTIHWYDLSWSKEKVKINETVEIKGKFHVFEGWPETVDEPDVAFLNVGMPGPVFIRKESYIGGQLVPRSVRLEIGKTYDFRVVLKARRPGDWHVHTMMNVQGGGPIIGPGKWITVEGSMSEFRNPVTTLTGQTVDLENYNEGNTYFWHAFWFAIGVAWIGYWSRRPIFIPRLLMVDAGRADELVSATDRKVAMGFLAATILIVVMAMSSANSKYPITIPLQAGTMRGMKPLELPAPTVSVKVEDATYRVPGRAMRMKLTITNHGNSPIRLGEFYTASVRFLDSDVYKDTTGYPEDLLAEDGLSVSDNSPLAPGETRTVDVTASDAAWEVYRLSDIIYDPDSRFAGLLFFFDATGNRQVVQIDAPLIPSFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase subunit B2
publication title Crystal Structure and Characterization of Particulate Methane Monooxygenase from Methylocystis species Strain M.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 95
structure length 382
sequence length 382
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3rgbA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 3rgbA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 3rgbA01
4PI0A 4O65A 3CHXA 1YEWA 3RFRA 3RGBA 4PI2A 4PHZA
chains in the Genus database with same CATH superfamily
1RMFH 1JMXA 5D1XD 5DHVA 3TM6A 1G87A 3IEAA 3WXWH 3LQZB 4DEPC 4IMLB 4HWEH 1CZTA 3VZJA 1CDIA 2WLNA 4KI5F 4P2QB 4BSVB 3AUWB 3QFDA 5F7EL 5HGHA 4Z1PA 3IJ9A 4FYRA 4EI5A 1WCKA 3E8BA 5J13B 4DY3A 2WWOA 2XZCH 3EG9B 3STLC 2NMSA 2ESVA 3EOTH 3LKSA 3NIFB 4LESA 4NQCB 3TBTB 4Q4V2 3RBGA 3HG4A 5D5MB 1H9WA 3HR6A 3BP4B 4AQ1C 1FAFA 1YEHH 5C0ND 1UZ0A 2BU9A 1GPOH 4P9MH 4PJAA 4IKKA 1SEQH 4C1XA 5JOWA 4RQPA 1BVKA 1MRCL 3PGDB 1S9XA 5A6LA 4CMHC 1R75A 5GKAC 2W9DL 3S96A 3ECQA 1H3UA 4AJWA 1P6AB 3BDYH 5KUMA 2K9UA 5ACZA 4NB7A 4B3TB 3TEXA 3LRMA 2Q6WA 2TSAA 2PTUA 4PCSA 3A4FA 3K2IA 4WFFE 3CFQA 2IXQB 3L3JA 1S2BA 2NY2D 2XA3A 5K8SA 3QR1A 5HYJE 4U1JA 1QQP2 1J1TA 2CNZA 2IG2H 5DMIL 1FNFA 2DIAA 3MV7B 3MGOA 1G9EA 4EBQH 5CKAA 4LEXH 2RCSH 1U5XA 2XJTA 1E9OB 1U8JA 2AJYL 4JV5O 5E79Z 2WKGA 2AXWA 4GYBA 3BFQG 3TFBA 2VTXA 3GTTA 4NN6B 2DIEA 2MNWA 2IALB 1HXS2 2NYYD 5C09A 2YAPA 3Q13A 1NZIA 5SX5H 2OMTA 3UAJC 4CEYA 1DVFC 3SGJA 2GALA 5LY1A 5C4WC 3EYUL 5GGVL 3WDHA 5IHBA 4FQ4A 4TV8A 4MO3M 1R24B 3ZMVA 2CDGB 2NXYC 1F3DJ 2P67A 3TBWB 4JMXA 1E7VA 3RZCB 4JCKA 5JW4Q 1MZEA 1BW8A 3EYVA 4XB7A 1XF2B 5GIRA 2NY1C 2A2QT 2XTSA 3ARPA 3D12B 3QUZA 1B3JA 5AL8A 5I1KH 2ZKNA 1J1OH 2HTKC 1XVSA 4RDBA 1Y6KR 2HKFH 1ND0B 4H1LB 3VM7A 4H55A 2C5DC 1AG0A 4XCEA 1F00I 4DRXA 2A71A 1HS6A 1WC7A 2DI9A 2R042 4UWDA 3BWUF 3VBBA 1INDL 1QLEC 2BNQD 3L1EA 4NTYA 1NLDL 4WLCA 3T0BA 2JQZA 2DMCA 5DLLA 4W50A 1NEZB 4HDIA 2Q7EA 2CAUA 4HUUB 1J83A 2IXLA 1K5QA 4YDKL 4GXUM 3VXMB 7TAAA 4XOAA 4XPGH 4N53A 1AHWA 4YAQA 4O65A 2L7EA 4ARXA 1BBT2 4DN3H 1XGTB 3KLHD 3WF1A 4E9QA 2KHAA 3KHBA 4KK6C 3RTQD 1W0WA 3P0VH 4AEMA 4WV1A 4LNRB 4BQYA 4O4HB 1KB9K 4I3RL 3IDJB 4LLDB 3O1TA 4QAWA 1ZHKB 5E24E 1KDIA 5ANMA 2Z7WA 2VXJA 3BU7A 3FSWA 4Y4HA 2IZWA 3ZDYB 3POJA 4CC0A 1OAUL 4WQOA 5GS2H 2P1YA 5DYOB 1K4CC 1W0JG 3KGZA 1F3JA 4CBPA 1XNRB 3FLPA 5BPXA 2JXMB 4WO4D 1N0JA 2AQ1A 1FBIL 4M7KH 5LBSL 3X1FA 1I8LA 3WUWA 1J8HE 2FIKA 4LXFA 2BY1A 1LP9F 4XVSL 4NO0A 3WIHH 5KVMC 1FZOB 1Z3GL 3S3SA 1KGYA 3K2OA 1I3GL 3FPXA 1AXZA 1EBPA 2Y0SA 1FJ1B 3T0WA 1Y74A 1ZJBA 3MLRL 1MLBB 1E9QB 4K15A 4ZI7B 3D3QA 5DHYB 4DFIA 3TZVC 5C9AB 1HFUA 2B1HH 3IK2A 2BH0A 2NW2A 2J8HA 1ZLWH 1USZA 1AR63 1HB1A 4FHBD 1KBBA 1VAHA 4UBHA 4ZG1A 2P8PA 2W0FB 4YGBA 1A3LL 4U3FH 1VFAB 1T83A 3CC1A 3D9AH 1QHPA 4LB8A 4IU3B 3LIZH 4KZCA 4WENB 3ELNA 3ZLIA 3QI9A 4EOWH 4NRPA 3DJSA 3H8RA 2R56H 3T77A 3VBSB 2NY0B 1UFGA 4ISQA 3GEWB 4LE4A 3L3OA 2JKTM 4UANA 2ICEB 3U4KA 4DR3B 2PO6C 3VXOA 2Z8RA 1GR7A 3KCXA 5AVUB 2F1BA 3UBGA 1H9PA 3W7TA 1FGVH 4MHUA 4S2SA 4PJHE 2DQEH 1EXUB 2VXTH 5F7BA 1VQ4V 2YEZB 2YUZA 5SX4I 5LQBH 4N0UB 5ALCH 4BIOA 2AXGB 2GFBB 5D7IF 2VGLM 2HHHO 1OCOC 1P69B 4NC2B 3H8XA 2AXFA 4UAPA 1VGKB 1L0LH 2RS53 2YA0A 4C56B 1EFQA 4OTXL 2IH1B 5T55A 3OBAA 5IEKA 2CK2A 3SDAC 3V4VA 4DP2X 4DSYA 1YXWA 5KA6A 2OMBA 2P5EB 3G6DH 3PVOA 3IDMB 1M1KW 4OHVA 1ND2A 1RIHH 1DQJA 4G7YH 4FO9A 2B4CH 1DE4A 1BWWA 4OT1H 1KCRL 3B2PA 3AG1C 2VISB 3M3IA 3QDJB 2Y07L 4LARL 5DPNA 3UT5B 2XA8H 1CTMA 4H26B 5DRZB 5I1GL 4DOHE 4GXUN 3QIWB 2XOTA 4AM0A 1BJ8A 4Z8BA 2NMOA 3THCA 3RNQA 4DR6B 5BOJA 2WTRB 4URKA 1E2ZA 2G9FA 1E4KA 3DDGA 4YXHL 1HCFX 1BMWA 4DXRA 5IK4A 3AYCA 1EJ8A 3SGDH 2VABB 4NUBA 1KN2H 1FXKB 3D0VA 2BSSA 5L8JB 1P5UB 3NDZE 3RDTA 5LDUA 3QUXA 4OCLC 3F12A 2VXVL 2CZNA 2NY6C 3HS0C 5HDQH 1O5PA 2EKJA 5HYSB 1X5LA 4LO9A 3HEIA 2DCZA 5D5PA 2OMWB 1YTFB 3PRZA 4XP6H 3HKDB 2R071 2Y06H 3GXDA 1IARB 2WQ8A 4AOFA 1Q6UA 4ASLA 2ATAA 3VW3L 3FO9B 2KLRA 2XVKA 1CI3M 1T5WB 1I3RB 4AIZB 1YEGH 3QFJB 4I0BA 4M7ZC 4J5VA 5JSOA 4UF7C 1F3DH 4OUSA 4EI5C 5BQ7A 1G6UA 1G7YA 4HEMA 2W9LA 3OGIB 3ULVH 2X5IB 1X5JA 1T7WA 1KPRB 2FWOA 2ZOKB 1RUD2 2FD8A 3CRCA 3AB0B 4RZCA 1LO2H 2E8YA 3VWKA 5K1XA 3VD9A 1OVZA 3MX0A 3OR7A 5CB4B 4NZJA 5F71A 2VH9A 4FOQA 1UB5A 4FQQA 1VKXA 2TNFA 3VXRD 1PZCA 1WTLA 4CVXA 2J55A 4GSQA 5E94B 2YQGA 4X98A 4YDNA 5IY5B 3JUYA 2OA9A 3DUSB 3OKKB 1S7XB 1SBBA 5EBWB 3LKNB 4S10A 3VM5A 3G5YA 3H9SD 3VMPA 4JTAB 2X4OA 4PFEA 3GHEL 2LV4A 2AJXL 5L0QB 1G6VK 3BE1H 2EEBA 3P2DA 1U4EA 3D4GA 3DO4A 3V9EA 3GJEA 4L4TB 2XNDG 4NNPL 1P84K 3FH5A 5CR8A 4PRPA 3RGVD 4QLWA 1JMUB 2UY8A 2WZEA 5FYJD 3PV6A 5KBFA 4J3OH 1MVEA 4NEHB 4YK4C 4JCLA 1I1AD 4MAYB 1SQPH 4IU2B 2G2RB 4BWUA 5I5RA 5K9JH 3QULA 4Y33A 5CN2A 4WFBV 1LQBC 5EO1B 1AYM1 4LQFL 1TMF2 4F7KA 1RZFL 3K5SA 5DSCB 2P37A 3IDYB 2D2OA 3ZKYA 1M53A 3LVTA 5IJRA 4LO5B 5BVPH 3H42H 5EZLB 4KOCA 2R9HC 1DLHA 5T3XE 2EULA 4CE8A 4ZQKA 5LGHL 1JYCA 5LNDA 1OTSD 1G4MA 4L8SB 2EVFA 4L3EA 1KFAL 5JXEA 4B7IA 1MEC1 2CU5A 4UNUA 3WEAA 3WXPA 2PXYA 3D09A 5CBLA 1QMUA 2ZX1A 2X4UB 1B2WL 4XACA 5TQ0L 1HTYA 1DZTA 4GI6A 4B3VA 2DQTL 1UGNA 3I8TA 3ZZQA 4G9FA 3NSXA 4R9AA 2RV9A 4I0PD 4MXWA 3PQYA 1AR82 2QPEB 4YSSA 3F05A 2AK4A 1O3QA 5C6TL 4DGIH 2EEXA 3WW2A 2XKOA 4K9JA 3THMH 2GNMA 3W3BA 4LRIA 3VDCA 1F97A 2ETNA 3D34A 3NACH 3C7GA 1SM3L 4GAZA 2GU9A 1U93A 5MHSD 4Z1MG 2D43A 3BMVA 1RZ8A 5KSVB 1NC2D 2VC2H 4OZIA 4GG6B 2GHWB 2BPBA 4Y2DA 4IEZA 3FCBA 1MAJA 1S7TA 2NY3B 4QIRA 3DXRA 4FM1A 4N53C 3RJRA 1AHWC 2XPGB 5EU4B 1R081 5L9DH 1GK9A 4PLOA 3ABKC 5K9KA 3ARGB 1IZJA 2VDNL 2Q8CA 5BMVA 1BD2B 4UNIA 2A9NH 2BE3A 5CP7A 1IQWH 4YWGH 3L1GA 4KTDL 1L6XA 1RPQA 4IV3B 1OKEA 4PJIE 2QE3A 5A40E 2KUTA 5IYCO 3MFFB 4U6YB 4Y4HC 5IVZB 4A38A 5LLIC 1AXKA 1KD7A 3S5QA 2DMBA 3T4HB 3IFLH 2YPLB 1KB3A 5CJQH 3SOTA 2IBZY 3LN4B 3EYFB 4MCNA 1FUNA 3PXLA 2EIMC 3VFUA 3UROR 2VAAB 4N90A 1IFRA 4GLRH 4M8QA 5FO2A 2DQHH 3QDGD 4XPBL 2RN9A 4NQXB 4CCJA 4X4KA 3O1RA 2WZAA 3HKBA 1QYGH 3FT3B 4E42B 1W6MA 4D3WA 1I8LC 2ZYIA 4JRYB 1FL6B 4ONGL 3CN4A 3B02A 2G4EA 2R69H 3G5XA 4Q4EA 1XYNA 2F19L 3AZZA 2HWE1 4E4SA 4AK2A 5CG9A 1FFNA 2N05A 1R4XA 3KNBB 4OCNC 3SY6A 2WD0A 2IU0A 2QLVB 3HHSB 4I18B 5D7SL 3HI1B 5J12C 3VYPA 4PJBA 4YS4A 3TOPA 5B38B 5LGKA 3D0LA 2PA7A 4NQEE 3WDUA 3K5MA 1D5MB 3ULSB 5D6CA 2GH8A 2ZX0A 1ERNA 3HMXA 4IETA 2C26A 1R6KA 1JHKL 1QWNA 4WFHE 2BK8A 3V7AE 1T83C 1F31A 4R3SB 1NQDA 1XQNA 4JM2F 2R2BB 1GA2A 2AANA 4Y16D 1QH7A 3QI9C 3DC6A 2G38A 1UKQA 1YEDA 4G8FA 4LCYB 2BWCA 2VIRA 4HWNA 4ES8A 2ZHMA 3GBDA 4AEEA 3E8UH 1EN5A 4NBXB 1AUYA 1MCNA 4KKBC 1AZZC 1BV8A 2FIRT 1TTCA 4N1HB 4DH2A 1P1VA 1QRNA 3HG1B 4H5SB 2HRHA 1CO1A 5FAXA 1R1ZA 3IPFA 1UPIA 4Y4KA 4PY8I 5FYKD 4RDQG 5EIIG 2JEXA 2BOCA 3RWHA 4FPKA 5SV5A 3RYPA 3QDAA 3RZKA 3DVNA 4R4FH 3TLRA 3MDPA 1RJYA 3H6JA 5HD8D 3LKJA 3VBOB 1ZTEA 3BP6B 4R4ZA 3WG7C 5FYJL 2OK0L 1YO4A 4LR3A 3QO0B 2N0KA 5LMNO 4HZ1A 3QVNA 1FPTH 4V33A 3AAZA 2FMLA 5I1IH 4CC6A 2V33A 3LN5B 5ALBH 1R64A 1ND2C 2CWSA 3TT1L 1ZD6A 3Q43A 5FXWA 1GYCA 1I85A 5I75B 3SH3A 2RDNA 5I66A 2BSRB 1I5XA 3KT7A 3A0RA 1R5WA 1WRFA 4K20A 3EJJX 1HYRC 1GCFA 1IU1A 3QJOA 5AWNL 2AH2A 5HYJA 1ZKAA 5FUCC 1JV5A 3J07A 3QUYA 3BODA 1XGPA 1M9SA 2NY5C 4DXTA 4OQ8A 2VCAA 4PBOA 3Q8BA 2A6WA 3ZE2F 1N26A 2OIEA 2OR9L 2ZTNA 3FU7A 1E4KC 3D33A 3BT2H 1LNUA 2QL1A 3Q2CA 2IPUK 4LLMB 2MNGA 1XYPA 2MOVA 3M8OH 3VGHA 5EBLA 2B3IA 3LS5H 3RDTC 4BV1A 1CQKA 1VBD2 1N64H 3QUXC 4DP7X 3LZZA 2YJQA 5DR5L 1QFWM 2GIMA 4I4WA 4IEYA 4CGTA 2DBNA 5J7CC 2ILLA 2WWWA 4E2QA 3BD4A 2ZM6O 1AI1H 2TRHA 2G5BB 2UVEA 4Z7OB 1UVQB 2DICA 4A39A 4XFFA 1E40A 2GEQA 1POQA 4UINL 5H94B 1PIV2 3DJTA 4XMVA 5EOCJ 4FOWA 4DVBA 1Y9MA 2F5BL 2X9WA 4ZUVB 4A7QA 3KD4A 3BZEB 3P3NA 4F1ZA 3MRRA 4M8VA 2VNRA 1JW6A 4DGYH 5JCOA 1G7LA 5E6RB 3GMMA 2EO1A 2WUHA 2CCVA 2XOKG 1MABG 2QM7A 5A6QA 1D5NA 3I2CL 3VGBA 4PJXA 3VWKC 4ATTA 3O14A 4NLHA 5CZXD 3OR7C 2BVPB 1AD0B 1OCZC 2HFEC 3DX1A 4HD5A 5CEXB 3KVAA 5FPAA 5FYHA 4F93B 1E5SA 1KBVA 4LSSL 2WYHA 2CDYA 3FT2B 2GJJA 2QV4A 5D96C 2YXLA 3SDCA 5HGAA 5LXGH 3I2KA 2HVJB 4NAOA 3GI8H 1OPOA 3B5GA 3CUPA 4F7TA 4M8RA 4D6TH 5IJ9B 4WCYH 5IMMB 3ABMC 1OK0A 2EKSA 1US6A 4JJHA 1WAZA 1QUNB 3ECUA 1LOAA 5KBKA 1HYSD 3MDJA 2P24B 1ET8A 2A4ZA 2EZ0D 5I73C 3EYSL 2RS12 3V4PA 4EDWL 3EDKA 5A6XA 3SDYH 1OP4A 3RI9A 2ATKB 4K3EL 3K91A 4ZD3L 5EHDA 4BQ6A 5FXCH 2MEJB 4YPGB 2KC0A 5JIPA 5F32A 4HS8H 4NJAH 3HD8B 3MRIB 4O2EB 5A2BA 1I7TB 1IG0A 2B1OA 2F74B 2FBOJ 5LCVA 3ZDXE 2BTQB 2GUZA 2VO5A 3S5LB 3LQMA 4PGBA 1O5LA 3MRPA 4A2FA 3FUQA 5EYXA 5I93A 2JB5L 5DS8B 8FABA 4KZEH 1GZQB 3K71B 2O1AA 3B7YA 2CJUL 2QADC 3O4LE 5AW3B 1UKRA 1JSYA 3C6LB 3VXUE 2ARBA 2LTNA 3C3VA 1J8HA 3MREA 5C93A 1CVSC 2DQJL 4B7LA 2PXYC 2MRYA 3DA0A 3P4NA 4NQCE 5B39B 4DXWA 2JDPA 2RS31 1SQBH 2QFEA 3VE0B 1AR71 1HT6A 3UYPA 2D4DA 3C5XA 5HY9A 4HKOA 4UB0L 4NRQA 4AENB 2ZGNA 4IEPA 3U6XA 2NQ3A 5CR1A 4KWLA 2CJTA 5F2FA 4E4EA 5FA4B 1MWAA 1NUNB 4MXQC 5DC9B 3OXSA 4TULL 3S3BB 1QABA 3FO0H 5FYKL 3EJPA 1PK6A 1RERA 3U9UA 3HE6B 4LRIC 1Z0MA 2R51A 4PJGF 5IBLC 1KACB 4DV5O 4Q0SA 4BXSV 5I6PA 3FCTA 1CD8A 5DD3L 1TME3 3G7DA 3MHSC 3DROB 4GSDH 4Y2DC 2ARHA 4UUJB 1TUEB 2B2XL 4KAQH 1MI5D 5F1NA 4F3FB 2VDMB 3OJVC 2E9QA 3BU0A 1SVZA 4HG6B 5GHWL 43CAA 4M00A 3FUDA 1FAYA 2HLAA 4ZUSB 2Z31B 1K6QL 4DETA 5IJVA 2VQFB 5L7OC 1MCSA 3PIJA 3FLTA 3LIGA 4WHYG 1CGPA 3M1CA 3ZRSA 1KCUL 4NUJB 3L2NA 1RP8A 3A5VA 1FSKB 2APXA 2DU0A 5IHRA 5IYBO 1N3NB 2D03L 4XMTA 4K94H 1A3QA 2RMNA 3AL6A 5J6SA 3NUKA 3QPXH 1HB4A 2IMMA 2UUDK 3OUSA 1HKLH 4LIQH 1T6WA 2UYBA 1ROPA 2YIAA 3GO1L 2F43G 3EBIA 2ZSWB 2OKXA 2P5OA 1FL5A 4ZFGH 4JFEA 2KZKA 1UJ3A 4KQ0A 4JPIB 4A7KA 3G71V 2P5WD 3BGFB 1TQUA 3B8YA 5FO8A 1DDHB 2Q20A 4K7PY 2YIDA 4IW4C 3SH4A 4WTXA 2R073 2DD8H 5SWSB 3UBXI 2IQ9H 1MDTA 1QQDB 2XAGA 2I25N 5KHGA 3BVWA 1QBAA 1VQ6V 3CSTA 3L95B 4G59C 4GH7B 4KHTH 4KXDA 4KV5E 4YL9A 3V6BR 3HNTH 2FAUA 4HPKA 2BRRH 4W9KC 4JCWA 4WBNB 4XBGB 5D72H 3KF3A 2ZMKA 5GGSY 3O2WL 5FNVB 5T1LB 4UT9H 1QKZH 4NQSA 3HNYM 1QR8A 1BVOA 2EDDA 4MAUL 2PR9A 4LPCA 3BP5B 1E5RA 4ZZFA 5E08H 2MPAL 1I08A 1SXBA 1WCQA 3OKOA 2E7AA 4EWAA 4GI9A 2BOBA 4XMZA 3OAUL 3MPCA 2DAVA 1UD3A 5IMKB 4IEQA 1JL8A 5IYDO 3HBKA 4QX7A 2HT4D 5T1DH 4FQIH 4RX4D 3PP3H 5IB1B 1B0IA 4GKSB 3FQUB 4KMLB 3WQ7A 5I30H 1U3HD 3DTXB 3C9NB 2BNRD 3HZMA 2DWDA 2XN9B 1WD9A 2J56A 2VNCA 3QG7L 1VQ9V 3ZDYE 2VDOL 3CFKA 4RAUB 3VXSD 4Y4KC 3NAPB 1PCXA 3HKFA 2QVKA 1EZVX 5FYLE 1TTGA 2BOCC 4Q9QH 4ATFA 4HIIA 1QI3A 4QXHA 1FAKT 2HTLD 1DUYB 2HN7B 1UM4H 4JFDB 4H40A 4JREB 2DYRB 4MDJA 5I74B 4ZMPA 3GSWA 3G4SV 3IDNA 2IANB 3AADB 4CC1A 2YRPA 1NVPB 1LE9A 2QR4A 2FB5A 4DR3O 4NO2B 1IE5A 1AYM3 5C7XH 2E32A 5LY2A 2ZOLA 3NIGB 3WFDH 2OYKA 1ND3B 2UWAA 2MTPA 1J58A 5CA3A 1OAYL 2G3NA 5KSUB 3QTCA 4GT0A 1PU0A 5LBVA 1I85C 3FYEB 3L72H 1J5HA 1SBSL 3V4UH 2XDVA 1N7MH 1PV0A 4AI2A 1MEC3 3QUYC 5CMAA 4P9HH 1WK0A 2ZCHL 4P59L 2D6MA 2J1UA 4XFCA 3Q5YA 1T3FB 2WLZA 3UZQB 3WBDA 4P3CH 4J3OF 2DU1A 1E6OH 2CKNA 4BLJA 3L3IB 3RWRD 1YUDA 2AQTA 3V9FA 4LFAO 1HEZA 3H9VA 3GDBA 4IXLA 1CGWA 4ANUA 4NKQB 4NYKA 2BIIA 3CV5A 3HR5A 1NCQC 3ZTJH 2G1MA 3SEPA 3D5OA 4Y4YA 5SV4A 3VHRA 5B3NA 2XWDA 3GVMA 1X7NA 2J4WH 3LQAH 1HEHC 1L9RA 2F58L 4LLYB 3P9MA 3K5NA 2GSIA 1ZXQA 4LSVH 3HNBM 3EJYC 3PXJA 4ZZ5A 1P7QA 1Q9OA 1UU4A 2WWMC 3EGSB 3QZWA 3CJJA 4BZ2L 1KXQE 3FSOA 4BDVA 2YBKA 2VZ1A 1KIUB 2WQVA 3MLSL 1B04A 3KPRE 2WSSG 4WW2A 4XT1C 5AW7B 4C56E 5JCOC 3FHAA 2YGPA 3NAAH 4U6VL 4GI8A 5IK3A 2RMKB 1Z5WA 1RZIA 2P5EE 3JXSA 1UJTA 3U6RA 1UA3A 4N8VB 3V79C 3KCWA 4XCAA 3VBUB 2QVMA 2ZJCA 5DHMC 3C90A 1AR1D 2A75A 4XNDA 4XWOC 1IEBA 2HG0A 5FYJU 4WNSA 5A6IA 2JGDB 1J0ZA 2OMXB 5IMOB 3QDJE 3PNWA 4WAFA 3ZW3A 2H0EA 1T22A 3FBQA 3FU8A 4OFDA 3EJKA 3IT8A 3JBG1 3PUQA 1UZ6E 5DRWA 1GAXA 1FH5H 4W6WB 1MCFA 4A2EA 4NRZB 3U2SB 1LE5B 3B9DA 3N9GL 2IF7A 1ZRCA 3FO1B 3H1IH 2PCFB 3UBXA 5MP6L 2JJTC 2A0LD 8CGTA 4QHOA 4OIIL 1NLQA 1SUHA 3DOSB 1ASPA 3UBHA 1WCSA 5F7KC 3H56A 4J3UA 3SDDA 3TN0C 4JFZH 1T6VN 3D2UD 1AHKA 1DEEA 1URXA 2E3VA 4NO3A 4NGHH 3B5LB 1AO7D 3MRCA 5DJ8A 5FREA 5DG1A 4M93C 1NE6A 4JI8B 4KXBA 4PJIA 4QHNA 2HWE3 5C6CA 3H7JA 3JBG3 4TM9A 4OCYL 4ZUUA 3T2LA 2C2AA 5BRPA 2CDFA 3M1BA 4N4YB 4G8EA 2WYSA 1NCBL 4QRPB 4FLTA 4KROC 4H4NA 4E2SA 3FB7A 2Q8VA 1OAKH 1IGFL 2DURA 1IGJA 4TUKH 4I09A 1T1XB 4O02A 3DKWA 4FPPA 4NZRH 4FTEA 4A04A 5CFCA 1JK9B 1CLZH 1UZWA 2ID4A 3LOBA 3PJYA 3AU1A 1DHKA 4JFQA 2FEEL 3AS2A 2CM5A 1E0OB 3L4VA 4CN1A 4QM9A 1SFPA 1XU1A 2HH0H 3EYOA 3FQXB 1YJDC 2DJUA 4MX7A 4Q6IA 3V5HA 4HIHA 3WFHA 3RSJA 3ACIA 3CS5A 4X7TA 3KVQA 5FCSH 3WGUB 4PEEA 5DZVA 5LCVH 4JLRA 3CZUA 4EB6A 5KTEH 1C16A 3KS7A 4AUUA 2CLZA 3HZVB 1J10A 4XDJA 1MN4A 2QQLH 4JPWL 1PK6C 2XHKA 2H0VA 5HHQB 5KHHA 2QZ5A 4JKNA 4KGJA 4YHKL 4AVJA 1XE7A 4MJ6B 2NTFB 2Q7AA 1OP5H 4F5CA 1XB6A 4WI3A 2D6PA 1AB3A 4IRJD 4M61A 4QKXB 4EUPB 5KYNA 1WGOA 1CD1B 5DJZA 2VE1A 4YW1A 4AVAA 3ZRVA 1G9MC 3RY5A 2QDRA 2YC1A 1D9KB 4NP9A 4DPNA 5IT9N 1E5CA 3H1WA 1OLME 1MWAH 2XQBH 4XPAL 4ZOBA 1L0NH 4IEXA 4C7UA 3GMNB 1J5OL 3POIA 5HCHA 2I69A 4NE9A 1CFSA 4G7SB 4G9DA 4UM9B 3U0WL 5AKSA 3L71H 1ECZA 1NTMH 1AACA 3AP5A 5AC91 1W8EA 1KGCD 3WE6A 3W21A 1A4KB 3E83A 3WTXA 3PWNA 4JFXA 4QR7A 5AYQA 5JVVA 4JYAO 3H55A 4MA8L 1DSYA 2WTPA 3T1CA 2ZS6B 5C3OA 2GTQA 2BOLA 1HNZO 2EYSB 2P44B 1XGQA 2RHEA 4HJGB 4R7NB 3VFRA 4FFBA 3II3A 3VZMA 1TKWA 4JDNA 1ZVNA 1MAMH 3A6CH 4LSUL 3K4AA 4JHWL 3S4SB 3UDWA 3A24A 5AG9A 1KJLA 2WYFA 4BQ2A 5GRWA 2OQJA 4AJ0A 2AK1L 1K4DA 3H0TA 3WNJA 2FL5A 4Y9CA 5LNGA 1QVOA 3S34H 4FJYA 3P3YA 1S3RA 3TVMC 5H2BB 1TTBA 1AFVH 4WW1B 4JFFB 3RPIA 2FRGP 4FADA 2IJKA 2EIDA 4ZI8A 2O8OA 3HPJA 3LY6A 3PF2A 4IL7A 3L2HA 3C87A 4FSJA 1B0RA 4G6JL 1CK0L 3SIKA 2FUTA 5TGBA 1ZBA1 4GG6E 5CINH 1UZGA 5DEGB 2BZCA 3QHTC 1V3LA 5FYKU 2GN3A 2Q6AA 4MS2A 3LNGA 5CYYA 1OSEA 1VERA 4JRFA 5A2LH 1J5EB 1VQMV 3VD7A 4HYTB 5JQIB 1U2CA 2NNAA 2ZPXA 1L9NA 2ZONA 5CN3A 2VXQH 4MDRA 2Z92B 4M56A 2X2YA 2H32H 1PCSA 2ZJSH 1BD2E 4FXKA 4BKSC 3UMNA 1V8HA 4DK0A 1RUML 4HIQA 4IK7A 4QO1B 3N2KA 3VBRA 5AB1A 3COOA 2RACA 1EV11 4O4YH 3DPBB 1OSZA 3LZNA 1INQA 2DWDC 3S3WA 1NC4D 4B7EA 3VG9C 5G05L 4X4ZA 1JGVL 1RK0A 1RUKH 2YPLE 4L3CA 2WMPA 4OCWL 2P5PA 3MYXA 1C1EL 3O9WD 5IB2B 4RFT0 4U36A 4L8BB 2UV3A 4JO2L 2F66C 1HB2A 3FAVA 1N33O 4R2GB 4HOZA 2V5DA 4X6CB 3FMGA 4RBPH 3U4EA 1IVTA 1FMD2 2IWFA 4N6QA 3U0ZA 4J3SA 1DQDH 2CSPA 4RO2A 3DHMA 3G08B 3NPSC 2ISDA 3T2NL 5I1EL 5C3PA 4F7MB 2ZGPA 1S72V 4I89A 1ORSA 4EQ2A 4Z3IA 4X0NA 4U3SA 4WI9A 3CK0L 4I4TB 1KTJA 3UJJL 1Y43B 2MHFA 2QTEA 2WQZC 3PU3A 2ICWB 2P7TA 1B88A 4AX3A 1XHXA 4HCRH 4H7LA 4QX1A 3E6CC 3ALPA 4KUZL 3NJYA 4NIYE 1NGZB 2WVVA 1KBGL 2ZCLH 2WO7A 4LCIH 3LPGA 2PGGA 4YXLH 3JUUA 3N4MA 1NAMA 3SPCA 3RT3C 2HA1A 4NUGL 3OPZL 4TL4A 3BEWB 5L2JA 1ZRIA 4RN5A 5EXOA 3F5WA 2HT2C 3RFZB 1EY2A 2RS33 3QLQA 4QRRB 1J3QA 2V4VA 1YVWA 4ZOEA 1AJQA 4FJCC 5E5UB 4U7OA 1M9WA 4MQXD 4UQBA 1AR73 1KN4H 4NO5B 4ODTH 3HB3B 1A2YB 3VFNB 4F8LA 5IB5A 4K0KB 2JI3A 3BWZA 3GALA 2F7RA 4LPVA 2Y22A 1W0OA 1V7NL 4OLZH 3MA9H 3LS4L 5CGMA 4RUFA 3HG1E 1QFWH 3X11B 4J11A 3ZKMC 1FZJB 1RIUL 3LQZA 2PI5A 4IMLA 2PHWA 3H01A 4P2QA 4BSVA 2NPIA 3L1FA 3Q6GL 2LFGA 5FUPA 4HGMA 2I60L 3EG9A 4WW2C 1E42A 4ZXBB 3TBTA 4NQCA 5KVGE 4POZD 1FCGA 5D5MA 4UFMA 3Q01A 3BP4A 2JKJA 5I1CH 4ESKA 3KBPA 5IVBA 4Q9BA 3GXTA 3SKOB 1BMV1 4J1UB 3VRIB 5C0BE 4NCC1 3PGDA 4TLTA 3B3IB 1WP8A 3SE9H 1O75A 1RYYA 1XEQA 5A3IC 4B08A 4U7MA 5AVSB 1FFTB 5FZDA 1FAIL 1MFBH 4N0YL 3RYRA 3FBKA 4KUCF 5KSAB 1XCQB 5F5CA 3ZJZA 2WTOA 3G6JE 3GSNH 4U2YA 3BQVA 4Q20A 2IC1A 1F56A 1M3IA 5LB6A 5I0RA 2IXQA 2DMXA 5KSBB 5T54A 2Y4SA 5CMUA 1JG9A 4RWYL 5FB8B 3LA3A 1XMOO 1Q90D 4XPHH 5IWFA 3MV7A 1PD1A 3TEZA 2Y1VA 3E8FA 1N1YA 1UOJA 1E9OA 2DLEA 5LAXA 3R7QA 3OF6A 3H3PL 2E6PA 4PIYA 2DF3A 3HC2A 3M2MA 4CDUC 5ILTL 2MQGA 2IALA 1LO3L 3H7BB 3EVKA 2YA2A 2CLRB 1RPOA 1ZLUH 4RHV1 5F9OL 3KPLA 3INAA 1E1RG 4NM4L 3U9PL 4OZIF 5AB2A 3ZCCA 4X5XB 1OCRC 1R24A 1UOKA 4ADJA 4AJVA 4PVMA 4Z7OE 3ARYA 1PNGA 2A3WA 1Z0HA 2YUXA 2CDGA 2A9BA 1W99A 1Z5YD 2I45A 5EJ3A 3TBWA 3RZCA 2PLV2 1B4LA 4RA3A 4NNYB 1XF2A 1A14H 5CFCC 4DO6A 5H4ZA 4EN3B 5T5FH 2WXRA 1ROWA 1HHGB 3UG3A 2LHAA 4DK6A 4MGIE 5FZ7A 1ND0A 1CFVH 3L3DB 3QDMB 4Q6IC 2PI4A 1LO4H 2J1WA 3FN0L 3B7SA 5MEND 1KXHA 3T0DA 3CU1A 1DL7L 5E03A 4D0DB 3DX2A 1OWRM 2F1EA 5GONB 5FK9B 1Z9SB 3HR0A 4UQ9A 4NPMA 2EXJA 1XYOA 1NEZA 4IBZA 2FATL 1AJ7H 2ZWZA 4XHJD 4HUUA 4IIJB 1YMMB 1DSFL 4M7LH 3B8SA 1HILA 1BM3L 2CG9X 3VXMA 3MJGX 3VTAA 2WNEA 5D71H 2YC0A 2WLIB 1PTZA 3F6JA 2ZX5A 3EJRA 2DQ3A 1S7QB 2GJPA 3MLZL 4PRNB 3C75A 1L3NA 1XGTA 2PNDA 4DV0B 2CGRL 2WM0A 1DFQA 4A42A 2WUCH 3EH4B 1NAKH 2E7TA 3NZUA 4KHXL 4AE2A 1AANA 3GNML 4O4HA 2L35A 2FYYB 3IDJA 4LLDA 3ABTA 1ZHKA 1UCTA 5DFTA 3TASA 4ORGB 3OT7A 3R1GL 2E6JA 2J73A 4PJBF 4YUEH 2IXKA 5AOLA 4GUNA 5KBNC 3VSUA 2AQRA 2WFF1 2QVFB 1MOEA 1LJ7A 3ZFEB 2C1PB 5F7FA 2H0BA 3R05A 3KR3H 4JY4A 5DYOA 2VVFA 2PR4H 5EIBD 2YIHA 5KVDE 2DOCA 3TX4A 4OCXH 4HUVB 3D85D 1H5BB 2JXMA 4EPSA 4AG4A 1OGAD 1NA8A 2GITB 2UYLB 1NGWB 3P0YL 1H15B 4QB6A 4C0HA 4L2YA 5I17B 5AVTB 2Y6JA 1ZLZA 2NQDA 3L8QA 4XCBA 2ZQKA 3QJFB 1FZOA 1EHXA 3UDWC 4EXKA 1FJ1A 1HL8A 5J2UB 1HDMB 1MLBA 1K4DC 4ZI7A 4AF9A 4L4VB 2D9QB 3DKHA 4LLWB 5DHYA 3I59B 5C9AA 1LO5B 3CPUA 5J3HD 3CLWA 2P1BA 2HKHL 2BS9A 2AFNA 3VGAC 5IB3B 2W0FA 1WLHA 1VFAA 3S6CA 3SKNB 1MW0A 4K5MA 2HEVF 4IU3A 4OFYD 3V6ZB 1EK3A 3VGDA 3WNPA 1LODA 35C8H 2W92A 2PHXA 3JAWB 5T5OA 3VBSA 1SLTA 2FWLB 2YY1A 1FHNA 3OTOB 5JOYA 2ICEA 2VOWA 2JICA 2LGQA 1LMKA 1DJSA 4FKHA 3ILFA 3TOJA 2KQXA 4FXKC 4YQXH 4YFLI 1RZ7L 4RISL 4XO8A 2N0MA 3VAEA 5JXHA 1A7BA 1EXUA 3VBRC 2LGNA 3C12A 4DV7B 3V10A 2LJ2A 1MCDA 2IOOA 3CCHB 4N0UA 2DN9A 1UH2A 2AXGA 2ZXWC 2GFBA 3UTSD 3MCYA 4GMP1 2ADFH 2IADB 1KXQA 4NXMB 1NY72 1VGKA 3WN5B 2WLMA 2VMHA 2IVFC 4XDQA 1I9RH 5I0TA 3FAXA 3P5BA 3TGUH 5J9PC 2IH1A 4ZOAA 3VGFA 2DM4A 4WIQA 1W15A 4GKZB 5CJ5A 2WQ4A 3FULA 2P5EA 3LV3B 4XN1A 4HPOH 4BK8A 3IDMA 4QJ3B 2WNVB 1PO22 4P2RD 4CPBD 1QW9A 2RJZA 3L5WB 3PPSA 3N1GC 3NGBB 4DS0A 2WYZA 2OX5B 3W5MA 3QDJA 1JZDC 4KVCH 5KW9H 3H54A 3WTYA 4OM1H 4FLOA 2XQYG 2ADPA 3LDDA 1G6RH 3UT5A 4JASA 3HBZA 2P7TC 4H26A 5C08B 4E9WA 3PURA 3QCVL 4M48L 5B3SB 3CYOA 1JVLA 5DRZA 4N24A 5A1AA 1PL4A 2OI9B 2GC2A 1J1LA 4M8UA 5JUVA 3QIWA 4AHZA 1EA9C 2NM1A 5A3LA 4UB6Z 2CO6B 4MD5B 2WTRA 5ABZA 5CJBA 4OLUL 4FQLH 1Y9QA 3MOAH 5FKBA 1MRFH 3AK0A 4PJXF 5EZJB 3F5WC 3G67A 1ZHBB 4DQOH 1HKFA 2EDXA 2JWYA 1HOEA 2VABA 1FXKA 3C5ZB 5T33H 2OYPA 4ZSOE 1P5UA 4QJ5B 4QJ4B 2EALA 2R23B 3R0RA 2Z5UA 1YFYA 5I6KA 2ZA9A 4LUKA 5FY5A 4PWFA 4O9HH 4XC1H 4XTRD 5FPLA 3QJXA 5HYSA 3KEDA 1HOCB 4LBQD 3HKDA 5I15L 3B5HA 4GWIA 1W2KT 1G9BA 2XN9E 5JW4M 1GC1C 1S9KC 1S1AA 4O61A 1EO8L 4MAZA 3FO9A 5GLWA 4IEOA 4FQ2L 5FO9B 1I3RA 4PLNA 4PJ6A 3QFJA 4L5FH 2Q73A 1VBE2 5LBEA 1JRHH 4JFDE 3EHBD 4AKPA 2G4IA 3QORB 1U6AL 5CD5C 1FNAA 2LW8A 4MVUA 1KPRA 2QQNH 2ZOKA 3CN3A 5IVXB 3AB0A 1YJNV 1UZ8B 4I55B 3OEAA 1PGRB 5CB4A 3SCMD 2M2DA 3S98A 4NPLA 1I5ZA 5JZGB 2P46B 5E94A 3PHMA 3ZMUA 4AR2A 1ZRUA 3DUSA 3OKKA 3QUHA 2YHGA 4D9RD 3LNNA 1S7XA 3BKYL 3HCVB 4Z7WB 5HBBA 5EBWA 2V2TB 1DYOA 3LKNA 5AC93 2HPOA 4Z7NB 4Y9BA 5I8KL 1WYJA 4MJID 2CR6A 4YC2B 5HHPB 4D0BB 3ZYHA 2X1OA 4CC4A 1PNFA 4LDLB 1DQLL 1QLFB 1QSFB 4L4TA 4P5TB 4Q9RH 1ZV2A 3PL6C 4RNRB 4ODUB 4K71C 4WK2B 2LM3A 4XNXL 2BP3A 5EK0A 1HH9B 1SXNA 2HWZH 3DYOA 4IU2A 2G2RA 4MAYA 4MB5A 3DIFB 1U8MB 2WBJD 3FUFA 3TYGL 5EO1A 1IO4C 3V4PL 4NN6C 3PAVA 4CVUA 1KBPA 5DSCA 3PMSA 4EWEA 4UVCA 3ETGA 1OW0A 2K0RA 5EZLA 5GLUA 1A6PA 1ZY9A 1DJYA 2V4LA 3ABGA 1T1WB 3OLEA 3VU2A 4AH2B 5JIKA 4JMNA 2WR9A 1ZBA3 3TT3L 1R5VB 1P5VB 4L8SA 5DRNB 5C2UB 1I82A 5GZDA 1TTRA 2Q8BH 3RZCC 5JMRA 4P4KB 1XR9B 4ZONA 3FTZA 4M7LT 4CAGA 3LHAA 2X4UA 1T20B 2B7DT 3NJKA 2F8XC 1NXD1 3JQXA 4X9HA 2K9ZA 3SCHA 2FQFA 4L9DA 2UUCO 5JIIA 1IBGH 1U8LB 1RZJC 3HUJB 1EV13 4LMFA 2CE4A 3QRFM 1JZEA 2EXWD 3DGEA 2B7YA 4N0CD 3KLAB 5F5QA 3Q06A 1GYVA 4GIAA 4H7VA 4U4IA 4GG6A 3LF7A 1O7DE 3QCUL 4LBOA 2HUEA 2JLLA 2XPGA 2VLRB 5EU4A 1CJPA 3H3ZA 5A3MA 4LHUB 5LBSA 2QDOA 2PWDA 5KX5B 1KIPB 3ARGA 3QIUD 3OWRA 1LHVA 1NH6A 1RUG1 1PG7W 4FM0A 1QWHA 1BD2A 1W6OB 3E6BA 1NCTA 3ARBD 3AKPA 2Q2EB 3MRHB 1AMXA 3DSFL 2N7GA 3UEQA 3U6XS 3VG0L 1QJX2 4FNLL 3F7KA 1UZYA 2FNBA 4U6YA 3MFFA 5IVZA 3NSDA 3WFBH 4J1XA 2H45A 4QOKB 1O4ZA 1PNCA 3BT0A 3L4UA 5F96L 4B3RB 3T08A 1FVCB 2YPLA 4Z0XB 4GULA 3LN4A 1TITA 3EYFA 3GRGA 4YM3A 2VWEE 5DURB 5TQ2H 4TQIA 1ONAA 2VAAA 5L2KB 5HHNB 4JHVA 3SPJA 3W9EB 3HPNA 1TIUA 4NQXA 2QPFA 3WD5L 1RUF3 4ZMZA 4E42A 3FT3A 1TETH 1S3JA 1R3KB 1A1MB 2ZKYA 5TE6H 4JRYA 4NLAA 1FL6A 3UIZA 3EGDB 4CSTA 1TVHB 1M4UA 4WI7A 3IN9A 2WFPA 4PWKA 1HH6B 3BAEH 5JQ6H 5JSRA 4X9GA 4N28A 1Z2KA 3KNBA 2Q4PA 3EOBA 1G1OA 3HHSA 4I18A 4YSPA 3HI1A 5JOPD 2XXZA 5B38A 4M5YH 2CA4A 5C9AC 3OUFA 2EYTB 3MRKB 2ZHNA 1OH3A 1D5MA 3ULSA 2QKDA 2W0FC 4Y1YA 4BUGA 4R3SA 1HWGB 2QWNB 1VQ7V 4FQ1L 4C58B 4KU8A 2R2BA 4AQTA 4IKIA 4RWUA 4OD1L 2NY0C 4WWID 4LCYA 1LNSA 1Y67A 1EAH3 1CZ8H 2ICEC 3WFCL 3FD9A 4GMP0 4UTCA 1BL8A 1RC6A 2RIKA 1Q0XL 3ARSA 3PHAA 4F2EA 5E1HB 4QD2E 1JPTL 4H5SA 5D8JL 3HG1A 1FIGL 1V7MH 1HNWO 3KWUA 3ZZ1A 2F93B 1MELA 2BFUL 4YGCA 1WIUA 2AERT 4J6RH 4R8WL 3VMNA 4Y1AB 2BCCH 5H6RA 3ACFA 3VBOA 4FHKA 1HZHH 2D7NA 3BP6A 3LKOB 5IQLA 4Q0XL 2NXZB 4EZJA 3RY4A 4UM8B 2AREA 1V10A 2IH1C 3IC9A 2XZQL 4JGSA 2C3WA 3GLDA 3QO0A 1J5EO 5GGTH 4FK5C 3BUYB 4LVOB 4HK0B 4WWKC 4XMXA 1SQQH 3D5OF 4LT7A 3PREA 2YEVB 4KPHL 2CMRL 2QSQA 4LPYA 2VJXA 1LECA 3LN5A 1JXJA 4GBXD 3M8LA 3NESA 5KZCD 1FDLH 2UUBO 2D0HA 2FB4L 3D4CA 3FS9A 5K0UC 3R4SA 2QELA 3BPLB 3WS6A 2GDSA 2BSRA 2R1XB 2JDHA 1O9ZA 5JWPA 2VN7A 4GAFB 4JFFE 1SNRA 4WW2F 1Z2GA 3ZRWB 3QIWC 4K9EH 4KK9C 5DO2D 2G9KA 1GHFH 2JJVA 3CX5K 4B27A 3ZYJB 3IJHB 4H8PA 3OUIA 2BGOA 4W4OA 3O1PA 1RXLA 3L74H 2Q5BA 4LCWD 4W9GC 3TH4T 2Z42A 1EBOA 3GI9L 3BSGA 4LLMA 5IHUH 4OMCA 5E1RA 2F7PA 4LKSA 2X1WL 1FXKC 3QIBB 1P5UC 4EMZA 4IERA 4MS8D 3PUAA 1DBAH 3ASNB 4PDRA 3MUJA 3ZE1E 4NTWA 5EYYA 2CBOA 5LMUB 1VCBC 5T5PA 2G5BA 2NR6A 2O1QA 1UVQA 1XNQB 2ARCA 1W6LA 2DEYX 5H94A 3ZSTA 1YQ6A 5IAVA 3NIDF 4Z18A 4IBQA 1JOIA 3MD0A 3VX0A 3BZEA 3MLTB 5HVHB 3KXFB 3IGUA 1QU7A 5LHHA 2VZRA 1GS8A 1FNLA 5FPRA 1CE1H 5I1JL 3LPOA 5AZEL 2CPCA 1IC0A 3BP7B 4S1RH 3K57A 5KYYB 1QQCA 2HJIA 2X5IC 3AB0C 3T4ZA 3AMLA 3WLWD 5IFHL 4LO8A 1IC5H 3SPHA 1IZKA 2BVPA 4WVRA 4XBPB 1AD0A 1XH3B 4K0KO 4C54A 5CEXA 1IHMA 3X29B 4GMTH 3RVTC 2AXHA 1BX2B 1B6QA 1JJUA 2WVSA 3R18A 1UTDA 3FT2A 3AP9A 5IY5C 2DRUA 2WFF3 1AX2A 2HVJA 5CBFA 1WAAE 2MOGA 3ELQA 2W95A 5IJ9A 5IMMA 5JOFB 2B46X 2NSXA 4BQBA 5FZCA 4QX3A 3NK4A 1QUNA 1UXMA 4MFHA 4U3HA 4HK3J 4MMZB 3TO4D 5I5MA 5FY1A 3BUCA 4X66O 2P24A 4IGQA 1YY9D 4P06A 5LA9A 1UYWL 2AJYH 4O2BA 4XB3A 3AL5A 3C7FA 4UILL 1XMQB 2YLHA 2MQ0A 3WP4A 4HMZA 3L16A 4XX5A 4AVBA 4JI5O 3REVB 4QRRE 2CRZA 3ZYRA 2ATKA 1IQDB 4KI5D 4XTPA 5E6IB 4MAYC 4ODHH 1F2QA 4H8WC 4OIFA 4PD4J 1I7RB 3TPKA 4J25A 3SQOA 4LF4B 4NP4H 4S1SH 4WI8A 2DWEB 4YPGA 3BVOA 3KWWB 1XC6A 2VSDA 5GGVH 3MRIA 4KK8C 4O2EA 4V1DD 2EH8H 1I7TA 2PPFA 2AI0L 4E68A 2F74A 4N26A 2D8KA 1OW0C 3B2VL 2BTQA 3B2XA 3F85A 4OLWH 3S5LA 2WAHA 1F1DA 3AACA 2B5HA 1MW1A 5DS8A 4EIZC 2XDHA 2HZHA 2XRAH 5G4OA 4R96A 5CCKL 1GZQA 3K71A 5HJ3B 4A6OA 4UT6H 2APTA 5HCAA 4XCFL 4L8SC 3C6LA 2L3BA 2HMID 5B39A 2E9BA 5DDHB 5BO0D 4F7CB 3VE0A 3CIAA 3ZL1A 5B66Z 1UU6A 2WZ0A 4NAJA 4D8PB 5F2SA 1YITV 2OS2A 3AK1A 1JXDA 4AENA 1NLDH 4W9JC 3ZN4A 5FA4A 5C3RA 4GX0A 3FU0A 1C12B 1K5MB 2WWJA 3F6LA 3E6DA 2AW9A 4I0CC 7FABL 4GMP3 3TWYA 1MFDL 1MA1A 2D7OA 3HE6A 1PNKA 3VXNB 4BA0A 4YDKH 5BR8O 5KXEA 5DJXA 3MKGA 4B9KC 5FMBA 5KYWA 2J88L 5EN3A 1P7KB 3CFDB 4FFGA 1RVFL 3DROA 3WENA 5KS9B 3BCCH 3D25B 3SGKA 4UUJA 1P7BA 2NY3C 4F3FA 4LBJA 4GRWB 3M8AA 3TURA 3C7HA 1MCPL 5H9CA 5DJYB 1QJY1 1BQSA 5FP3A 1QD0A 3VI3B 4I3RH 3AMHA 1M1XB 2R0KL 4QDRA 4ZUSA 2VMIA 2Z31A 2F8OA 3APMA 1A7NH 1Q0YL 5BZDA 4X8GA 4A2LA 3LOIA 4PRDB 3HBPA 1GMIA 3CN1A 1OAUH 5CCHE 2WXIA 2NNFA 4NUJA 4PA9A 1URLA 2H3KA 4DP9X 3AQDA 1OB0A 2R4RH 2YEQA 4QRSB 5HHMB 5L19A 2LTQC 1ADQL 1N3NA 1WWAX 5H5NA 2W68A 5BRZD 4BM7A 1FBIH 4WU7B 2H6OA 4F27A 1ZDSA 2XWBB 5CM1A 2CO4A 3CU7A 1VF7A 1QG3A 4XVSH 4ASUG 1N0XL 2EVIA 1I3GH 4MH0E 3HNVH 1K9MW 1MHEB 2QKCA 3QDME 4JPIA 1UEYA 4J3TA 4LNUB 4P49A 2BP8B 1DDHA 2RR3A 2NTSP 2WVUA 4ZOLB 4LF7O 4XPFH 2NYKA 4JYYA 1JZHA 2LAGB 4R97B 5SWSA 1DDTA 3S48A 1QQDA 3L95A 4I18C 4ENEC 1A3LH 4BPZA 4EFBA 1A3ZA 1TJGH 4XBGA 4WBNA 1YMME 4IV1B 4YE4H 4E4HA 2HRLA 3NA9L 3FOMA 5FNVA 5T1LA 4CSWA 3LH2L 3BIEA 4RMBA 3BP5A 1C5CH 3QR2A 3VXTB 1S9VB 4WO0A 4WWNA 3KCCA 3KF5A 1L6ZA 5DQDL 2DDQL 5IMKA 3T2MA 2Z91B 3HAEG 4KKQA 4B3SO 4QWWD 4ZBMA 4JDVB 4NI3A 4RWHA 4ZTEA 5FS5A 3TBYB 4JV4A 2AABH 2ENYA 2X42A 4GKSA 4XP4L 5IB1A 3RIAF 3NFSH 2NZ9D 3DTXA 3C9NA 4B9CA 1ZSPA 3SYAA 5GS0D 1DBNA 2XN9A 5FW7A 4RAUA 4YSCA 5HYFA 3L45A 3NAPA 1LENA 1N8ZB 1SF5A 4JI0O 4IS6B 4RMWA 3S37L 5LG6A 2VM3A 4FT8A 2EAAA 4OTXH 3OAWA 4WVZA 1DUYA 2HN7A 4JFDA 4F24A 4ZXEA 3ARDD 4TNFA 1OTTC 2N04A 1Z9OA 3AP7A 3K06A 1O5UA 1UD5A 3RQ3A 2JRIA 5FCCA 2IANA 5E8OB 1QOOA 3QZWG 3U36B 2IVIB 1FO0H 4KQ3L 5FXVA 3C08L 3OTOO 3F2LA 4NO2A 5HCBA 2P43B 2YUVA 4Y89A 2AGJL 1JGUH 4F15B 1F5JA 1ND3A 2BRTA 3UGUA 3WLBB 3ZE0E 2ZMLA 4MXVA 2H94A 3MRQB 5KSUA 2BWDA 1TGOA 3CHPA 5I1GH 3WS6C 2UWEF 3I6GB 3L3HB 1NGXB 1BYNA 1CF8H 1ZTXL 1LEIB 3KL0A 3NIFF 3QEQD 1DQVA 4M29A 1H2LA 5D5MF 3NRFA 5I0ZA 3DMMB 2IWKA 4RR3A 3VL8A 2VUYA 4TQEH 2BY0A 1T3FA 3UZQA 4OFPA 4CU9A 3EJZC 4GIPD 3L3IA 4W4OC 4KKZA 3UBXG 2BVUA 3E97A 5JUEL 2VXVH 4UBDD 4WHDA 5IK8A 3II1A 1HX6A 1WEJL 3I9GL 3FLRA 2X2UA 3FQ4A 3IAPA 4PBPA 2H26B 3NEXA 3HIFA 4NQTA 1J18A 1A02N 1I75A 1VBA1 4XDKA 4KBZA 4LLYA 1BF8A 1K5WA 4QTIL 2FO1A 2NR6C 2W0XA 1MMMA 4CP9B 2VUOA 3EGSA 4IHJB 5E4IA 1G6NA 2D97A 1HXMB 5LA1A 1UKGA 1WUZA 1KIUA 4J2XA 3L3KB 4JGNA 1CD0A 1ZLSH 2BVBA 2W1WA 3CKHA 4P9XA 2NRDA 1J88A 4NXNO 5AW1B 4KVPA 1GZPB 4G83A 1RUG3 3J7AU 1OLLA 4FXGB 1YZBA 4N8VA 3EMRA 3VBUA 4L23A 2P80A 1JYWA 2PQQA 5HI4D 3JZYA 5TF0A 5IHLB 4L48A 2WQWA 2JSFA 2JGDA 2OMXA 4FNPA 1GYWA 4H88H 4P23D 5IMOA 3V0VB 1QU0A 2VW4A 3ILQC 4XVHA 3MXWL 5K9YA 3L70H 2DQ0A 2AJXH 2HVJC 1W9SA 3U2SA 4W6WA 3U1XA 2OR8A 3NRQA 4NRZA 4OSUL 1LE5A 4N8UA 3FO1A 2PCFA 4Q8LA 1AR4A 4JFOB 2EDWA 4CKVX 4LCCB 3DOSA 3UEZA 4NBZB 4Y7MA 1KJ2L 3QRGL 1FPN2 2A74B 3E22B 2DCKA 3FQYA 4MA3B 3V7AG 3ZBMA 5FUZH 3RUGA 1Z5HA 3RA7L 2K46A 2DB8A 2CH7B 4LQFH 3CXFA 2ATKC 5FDYA 2BFGA 3CXDL 3ZPDA 3K2UH 4U3XA 3TETA 5A2QN 4W4KA 3P69A 3ZKND 1QEWB 1AP5A 5E2WH 1ZANL 3RU8L 4QRPA 3EO0B 1HHHB 4JRLA 4OGXL 3NNFA 5AYUL 1KCVL 1T1XA 4TSAH 3ULUE 3RAJL 1U3NA 1JK9A 1XQ4A 3F7YB 3O6LL 3QPQC 5MEOB 1A7RL 4FD0A 3TTYA 3C6LC 5BPPA 3L9BA 1NCGA 3GWJA 3DN7A 1DBBH 1KEML 3NSJA 4N2MA 5IVXE 1PZSA 4ODBD 1W8UA 1JAEA 2ICWI 1UUNA 1PO13 2XG5B 5SV3A 1VQ8V 2BSKA 2XZAL 4P46B 4NPJA 3ZDYF 4M0HA 4DRVA 3D39D 5GS0L 2Z64C 1JGDB 2VBPA 4QQPA 4KBPA 4LSRH 4WHTB 3HZVA 4N5EC 4ZS6D 2Y23A 4Z7WE 5TDNB 3VYOA 5I0YA 2YI8A 5HHQA 3HE6C 4KJQC 1SS3A 1TZIB 5T52A 1H8LA 2NTFA 2Y1ZA 4MJ6A 4Z7NE 1W3VA 2FWUA 2HVBA 3BOVA 1DZBA 4JM4L 2K78A 3JATB 5D4QA 5DZLA 4AIOA 4L05A 5JPMC 1J8RA 2RS52 1EX0A 3BA8A 3S97C 4EUPA 1S0GA 3EXUA 1CD1A 1RUPL 2WCSA 2FGWL 2VDNH 4FEIA 3SGKC 1NKDA 3VQ1C 2RH0A 4QNPE 3OJDB 4HKJB 4M43L 1D9KA 1TEGA 4KNCA 4KTDH 4WNQB 3BN9C 1NSNL 1URZA 2NSQA 3JCUZ 3DHPA 4LGPB 5BMFH 3PMEA 3KYOB 5C0RL 4HS6B 1BJQA 1AI7A 2VS0A 2Z31C 3OUJA 3GMNA 1A8MA 4XO9A 3WNLA 3FQ2A 1IT9L 5FW8A 1NMBL 3WIFB 3EYQD 2X4SB 4UM9A 2B15A 4JG9A 4IL6Z 1KTDA 4PUBL 3OZLA 2W46A 4BFNA 1JZIA 1FSKC 1U21A 3SJBC 2LFRA 3KPSB 5F88B 4UFIA 1A4KA 1JZ7A 1OGTB 2DVBA 1ZUQA 4XPBH 4KO5A 2OLDA 2XTJB 4U1SA 5C0GA 3RN4A 1F5FA 1HE7A 4LDCA 3BJLA 2L7UA 2EYSA 4ONGH 3ICXA 4HJGA 4R7NA 1UADC 2X5PA 3W9AA 3SC7X 2XASA 3GZOA 3S4SA 4O2CB 1ZOXA 1XGUB 3AZXA 5FZ1A 4HN0A 4B4RA 3BGFC 1XAKA 1YQ5A 3T1HB 5I1HL 1BWMA 5FYVA 1OARL 5H2BA 4A2GA 3L4XA 4WW1A 4UU9B 4BMBA 4JFFA 4E0RB 4BXFA 2C9AA 4HC1A 5I1DB 2CY6A 3UK9A 2TBVA 2FEEI 4WDIB 2BNMA 3KLDA 5DEGA 5T1KD 4XE0A 5E6YA 1BEV1 4HXAL 4Y5Z0 2HEWF 1EUTA 4R6UA 5IROC 2VLRE 5E70A 1ES0B 3T09A 3X1GA 4B9IA 4HXCA 4NAMA 2W3JA 4OJAA 2Z92A 3D06A 4LLOA 5EIVA 4OJYA 2VQUA 2M26A 5LA6B 3BKMH 1Y6XA 4BIUA 3KLQA 4GKKB 4HZAA 3Q1SH 1ZS2A 4QO1A 1BGXL 3BVNB 1XXNA 2PELA 3D6EA 1TA8A 2GK0B 3N1MC 2NY4B 3V65A 5KR7A 3DPBA 1N59B 3I7DA 3Q5OA 5EOTB 4QOKE 4DO2A 1D4VB 4D7BA 2VJ0A 1IGCL 5A2IH 1GYAA 1S0BA 4KQ4L 5F7DB 1PSKH 3KT4A 1MZFA 4L8BA 5FYJH 2OYLA 4Z6AT 2N59A 5DLML 2GBOA 3MIDA 4NIIA 5B1KA 3QACA 2DYRC 5I74C 4X6CA 3IS0X 2DWTA 3P4LA 3DEMA 3G08A 1S8DA 3GHPA 3GGLA 4Z1VA 3VKMA 2ICES 4F7MA 2A9ML 1CDGA 3TT1H 3OB0H 2AVFA 2NPLX 3WNXA 4I4TA 3KAAA 4MCYB 5MI0B 4JM2D 2ETEA 1GYKA 1ND3C 5C07D 2ICWA 4FLQA 4UIMB 2JD4A 1WAAA 2VWKA 5JPNB 3MFGB 4N2DA 2J5LC 1BVNP 1U8QB 1UCBL 3BH9B 3HRPA 1JS9A 1WZAA 3I9AA 2QQUA 1OAZL 4XBMA 1AKPA 3I9IA 4KGLA 1AS6A 3BQUB 3BEWA 3ZZSA 1N1TA 4TZDA 3RFZA 1BQHG 2V2XB 2O14A 4YDLB 3DPRB 3HS9A 4LLFA 4YNYB 4QRRA 3Q44A 4GIOA 5HGDB 5JIAA 1A2YA 2J6WA 4NWUL 3VFNA 1Z32X 2CDPA 4Y3OA 1OMIA 4O9EA 2C9XA 2WSKA 4NUMA 4OUEA 5A3WA 1S5IL 4OI4A 2WWKO 4X80H 4RGNB 4UTAH 1QSED 4JPKL 4OHZA 4MGYE 3E86A 3B94A 2ZOTA 2O30A 3A7QA 3X11A 4FAAB 1O5DT 1FZJA 1BK0A 4XHXA 3W59A 3IJ7A 5DCCA 2V6HA 5HHOB 2PHTA 3MBXL 3POBA 2VH5L 5LGJB 5DC4B 1HJFA 1YNLL 2E0PA 3JWDH 3QWOB 5AALA 4ZXBA 5FZ9A 1KYOK 3VB9A 2K45A 1QJY3 1KJ2B 4HZFA 4OLYH 4DGWC 3BRDA 5FZIA 1JNLL 3SCFA 1Q72L 5DZOA 3SKOA 4J1UA 3VRIA 3LZOA 4LL9A 3ZPYA 3B3IA 4LWSB 5KC5A 4DV2O 2PHUA 1AR2A 3VBUC 4UOJA 4XNYL 3GJFK 3NABH 4BE6A 4A55A 3Q6FB 1KBWA 5KSAA 4WUUB 1XCQA 2WB1A 4H1LG 2Z8WC 3VVWA 1CR7A 1CFMA 5LMUO 4XDPA 4AQ2A 4M6AA 3DYMA 3RWDB 3T2PA 2HWD1 1VEMA 3CCUV 3BLKA 3IFPA 1F5WA 4EKWA 4HKBB 1QBLH 6TAAA 3B7TA 4BCYA 2JK5B 1FWXA 3EYSH 4Q6YA 1NEZG 1O7DC 2MCPL 5FB8A 3JTSB 5D7JB 3H1MA 2R1BA 4FPJA 3ESPA 3GSQB 3AS0A 3O1VA 3VFGH 4K3EH 4ZD3H 4HBNA 3OKEB 1I7FA 1AIZA 1LDPH 2IBZH 3KS0J 4G2AA 1GM7A 5FR3A 3S6PA 4DXSA 1DF5A 2VLMD 1RHHA 5JW5B 1VADB 2ZR3A 2WBKA 4DEUA 3UGEA 5EU3B 2L6LA 3H7BA 4FQXB 5DRXB 3VYNA 5E8AA 1U3HA 2CLRA 3VRLF 5G04L 2BNOA 1SFHA 2Q9LA 5FQ0B 2JS3A 3FU5A 1LCLA 3UAJD 4XNUL 1WF5A 2V3DA 5DECA 4X5XA 1DVFD 3UPAA 3W37A 4GG6F 2EUXA 1IEAB 2VNGA 3P3PA 4XEZA 1A6AB 2WSPA 3C5JB 3PWPD 2XJVA 4OGQB 4UCTA 3ZX7A 1R5IB 4IEVA 5IG7B 1HIMH 3ILPB 5IDJA 4NNYA 1WW5A 1KCKA 2NXYD 5ICUA 4EN3A 1MS5A 2X89D 4BW9A 3BRCA 4GP8B 4QTHB 1HHGA 4LPTA 2NY1D 3L3DA 3QDMA 3T3PE 2EXKA 1CYXA 2YO3A 1AYN2 1I9JL 2HTKD 1SJXA 3GBWA 3U4SA 1J8KA 1CTNA 4TULH 4D0DA 4DVRH 2BLFA 5FYKH 3CE1A 5FK9A 5GONA 2F5AL 1Z9SA 3FPYA 2FSDA 4PJ5B 1SBDA 2MKWA 1CAWB 1UA7A 1ACYL 2E59A 4MA7L 5TE4H 2GC1A 4JTNA 3RVYA 4IIJA 1YMMA 4UT7H 2A79B 1U8PB 1N18A 5EU6B 4NOBA 2WNOA 1N5AB 1DBKH 2B2XH 3IJEB 4GKXA 1AC0A 3CBKB 5I0VA 2Y6LA 5LKNA 2WLIA 3K59A 5J6GB 3SPIA 1S7QA 2H6UA 4IMKA 5B22A 1V3JA 4PRNA 2ADJB 4XBEL 2ZR2A 3O3BB 1BSMA 1KYAA 4KUMA 1RJ8A 5JHLL 1D9KC 3I55V 3T9WA 1IBKO 2FYYA 4B9YA 1AKJB 4KK6D 4Q4Y3 4HLEA 4ORGA 5BRQA 1SCRA 1R6TA 1DLBA 1LD9B 4V11A 5EIIB 2OVUA 2KBGA 3UM7A 4ODSL 3RVZA 2BERA 3EBAA 1GMGA 4JRAA 3ZFEA 2C1PA 4JHBA 2JG8A 5AKRA 3O6KH 5ABDE 3DX6B 3M99B 3BISA 5EIQA 4TN7A 2Q1MA 4IE0A 4DF9A 5M95B 1S4IA 4AL8L 1H5BA 3O4OC 3WTUA 1H2NA 1GVIA 4AYUA 4K5PA 3C60B 2GITA 2UYLA 2YOAA 5F1KC 2TEPA 3SH5A 1H15A 5HGBB 5KXCA 5I17A 2KB1A 1QH6A 3B77A 4NR1A 4LPLA 1XGYL 1JPSH 3QJFA 5D7LB 1S3KH 4AGLA 3B69A 3NN8B 2J1VA 2VITB 5J2UA 1HDMA 1ULEA 3C2AL 2VZSA 4L4VA 2OSLB 4LLWA 3NDYE 1VBA3 2RDQA 1LO5A 5ESVB 5H9RA 2VKWA 5AUMB 1XR8B 3IIIA 3TZVD 3X3GL 4FG6C 5CEZD 3UL2A 4TUJB 3SKNA 4R26L 3K5LA 3FUHA 4MCZB 4MAUH 3SPVB 3V6ZA 1UM5H 3MLKA 4GJTB 2IDSA 1ZDQA 4ELMB 4OJFH 3I74A 2AEYA 1G94A 3JAWA 4LEOB 4TUUA 1ZXKA 3WDWA 2VXSL 4GRWE 1V6JA 1NH2B 5FZLA 4OIAA 5E2JA 3VI3E 1FYHB 2VVEA 1JGLL 3QJUB 2KQNA 3JQOB 3FJTA 1KB9F 1VFBB 1GN4A 2PO6D 4FQJL 4AYMC 3F58L 2K0GA 2WINB 2VDOH 5F2WA 3RZGA 1M7XA 1AF9A 3CCHA 3TBBA 3WKML 2ZACA 2DQUL 4PREA 4DJMA 3NV1A 3TYJA 3ITQA 4HMCA 4ZPVB 4HK8A 2IADA 2FMYA 1YAZA 4K5LA 5HYSG 3UESA 3OQ3B 3AG7A 3WN5A 3KPPB 4ILDA 1I3HA 2Z7ZA 2HX8A 2HJDA 4BB3A 4JANB 1OAXH 3D1MC 1KB5B 4GKZA 2VUCA 4R2GC 4GT1A 3J7HA 3LV3A 2X44D 1CQ9A 1CYGA 3SDAD 2WDBA 2WNVA 3L5WA 2PXJA 4ALAL 1TZGL 3ROOB 1KQRA 1WITA 4A7VA 4Z7OF 1FNGB 2OX5A 1OHFA 4MBOA 5LRRA 4JRXD 1S7SB 2J2ZB 2YD9A 3QJRB 4ETQA 5C08A 1SBSH 1V6IA 3AMNA 1IM3B 2AVGA 2LU7A 5EOQL 4K07A 3QNEA 5EYPB 3BD5A 4ZO7A 4D9QD 4G5ZL 1HKDA 3N85L 2RMU2 3NNGA 3W0WD 1PGL2 2GJ6D 2CO6A 2VDKH 2F23A 4P59H 3HC3L 4JO8A 4MD5A 1KULA 1M71B 5CA0B 5IQ7L 2RR11 2CKBL 4M3KB 5EZJA 3RFZC 3CZNA 4Y9FA 1MCWM 1ZHBA 3EZ8A 4G7VL 3C5ZA 9PCYA 3KS0H 2XJLA 1OURA 3RZLA 2R23A 5SWZD 5GRJH 2VQ1B 3HB3C 1CR9L 4LU5H 1RSFA 3I9PA 4RRPM 5D1ZB 3SZKC 1LM8V 5AVQB 3Q05A 4XW3A 3GK8L 1HOCA 2OZNA 1QLEL 2NY6D 3RB5A 3APBA 1EYBA 4MASA 1Q5OA 4BZ2H 4ZMXA 3ST7A 3F65A 5E5LA 4QHUB 5FO9A 1MW3A 1B4TA 5GPRA 1NG0A 4AVVA 2A5ZA 1TME2 1XF5B 3FSAA 4U6VH 1XB3A 2KT6A 3QORA 1J9QA 1AILA 4ZXBC 1Q38A 2WNUB 5IVXA 4EI5D 5CEYB 1OD3A 4I55A 4F8NA 1POV1 2ESVD 2Q9OA 1H4HA 1WJZA 1T66C 3MV8B 4HMDA 3MNDA 3RX7A 5JZGA 3TAYA 2A6DB 3OKDB 3KWVA 3GPSA 4CILA 4NZDA 4HJ1A 4Z7WA 4A63A 3IYLW 5D1QB 2ZUQB 3HCVA 3RIFK 1XMWA 5J1AB 5KSAC 1JRHI 2ZD0A 4NKMB 2V2TA 3APQA 5LBFA 3N9GH 2WK2A 1KS4A 4PGDB 3AXEA 4E5XB 1WE5A 5KBLA 3OMIB 4OIIH 4E9SA 5HHPA 2HEPA 1UATA 3NJFA 4D0BA 4XOGA 5IFTA 3G7TA 4Z8FH 2ZE6A 3ETTA 3OAYH 3W5NA 1JN2P 1WLCA 4OGYL 2Y6GA 5CNAA 1QLFA 1QSFA 3S57A 2IDTA 4P5TA 5E2VH 4RNRA 5F7MC 2Q7YB 3C3SA 4ODUA 5E9NA 1HH9A 2JIXB 4ZPVA 2YYOA 3DIFA 2HYMA 1JZJA 2CLVB 4GPVA 1AXTL 4OCYH 2ZKLA 3KMHA 4HKWA 5F1NB 4BA8A 4PWJA 1JK8B 1SY6H 1NCBH 1QTPA 2ORBH 2VOVA 3USUB 5A70A 1BA9A 2R072 5C09D 4UF0B 5CEZL 5IVVA 4AH2A 1T1WA 1P4UA 3GQFA 4K7PH 4PS4L 4EI0A 1I94O 1ILUA 1R5VA 4TSFG 1P5VA 2MH4A 1U97A 1T2JA 2R9HD 3O8XB 5DRNA 3ZRFC 1BEV3 4F83A 1LB2A 2ZCKL 1HCVA 4P4KA 1XR9A 2CO7A 3FTYA 4XN2A 4LHQB 4YLZA 1HSAB 1X6LA 2P3YA 4EN3C 1I3VA 1T20A 4JDTH 3BKZA 3P3TA 4NZTL 3FQRB 2P22C 4G8IB 4H25B 4LAQH 2YKLL 3QUZD 5ITBL 4S2DA 3U1SL 4D94A 4HHAB 1U8LA 4DP6X 3DSNB 3HUJA 3LTVA 4R5XA 1PMIA 2ZX6A 3AS1A 2AITA 3SGEI 1C8M2 4KJYB 1O9GA 1H8SA 5J06A 2F7OA 4A2UA 1FS0G 1HQ4B 1N10A 4PI2A 1S4CA 4EN2A 1QFUH 4DR5O 2Q69A 1QJEA 1WPXA 2DI8A 3SO3B 4X65B 2NX5E 2QQWA 4OFGA 4BXVA 3OV6A 5AAPA 1H6FA 4IMKC 1F2XK 4FLRA 4LHUA 1GAFL 4XPTH 2Y7QB 1P84F 5KX5A 1KIPA 4I5BB 4AKOA 1L7IL 4XPAH 2WAQA 5CFDB 3ZR5A 1NCDL 3QEHB 4DR2O 3UJIH 5D2LB 1T0MB 3OTFA 1JFQL 5J36A 4BFRA 5D1XE 3BCWA 4BE5A 3U0WH 1YIPA 3T65B 3I3EA 4KFZC 4N9HA 1B4JH 2X28A 4FFWC 4ONFL 1JPST 5B4MC 3AG2B 4QOKA 4W6XB 1GTFA 3TNMB 2EQDA 2NMNA 1FVCA 1YQCA 3GJFB 4ZNEE 4Y4HD 4Z0XA 5HP5A 2RFXB 1D5RA 1FRGL 1B6UA 2X05A 1N6QH 4AW7A 1ZGLP 4MA8H 4BIFA 2BJSA 1YI9A 2R0ZH 3CCVV 2RTTA 5L2KA 5HHNA 1MEC2 4JPQA 1H5BC 2BJMH 2FVNA 5E2UH 3W9EA 4AHXA 3X17A 2YPKB 4UDUB 3WIAA 4AEJA 2RAMA 2EE9A 4LSUH 2QWRB 1R3KA 5HTSA 4HVBA 3AFLA 3EGDA 1TVHA 1GMMA 2ZP0T 5BY1A 1T0NB 5I6LA 2QBWA 1T5XB 4Y4FC 3KPQB 1QPKA 1MCIA 3F3HA 3MICA 4B4PA 4MD0B 1A4BA 4ZW8A 4G6MH 4KTGA 3TCXA 2OXGB 3MGAA 4NO0D 1IGTB 4P5SA 2H3NB 5CSGA 4X7FC 1OD7A 4IRZH 4G6JH 4KU7A 1HDJA 4D6RA 3MRKA 1NL0H 3TEYA 4GIQA 4ASKA 3AWGA 3SQBB 4CDQC 4Y5VB 2FX9L 4JCMA 2XIIA 4CDUB 3RI5K 4IYHA 2J8UB 4Z7VB 1Q90A 2ENPA 1CX4A 1EJOL 3F62A 3K8LA 1UWGL 5KVFL 2K7PA 2GSMB 1M57B 3IKKA 4PWIA 1EVUA 3NIGF 4XMLH 4TKWA 4MXVF 3QI9D 2ZXGA 4MB4A 1N32B 4UYPA 3UXFA 3V55A 3FFZA 2WYTA 1YXBA 5EPMB 4C1WA 3CHXA 3OJ2C 4XI5C 2FQGA 3LJ3A 1IKFL 2NW3B 3GZUC 1W6NB 4ANVA 4KKBD 3RTLA 4U6TA 1JGVH 1JTOA 2YAHA 3W38A 4DMIA 2V17L 1WZ1L 1EHAA 3HNSL 1UO9A 2HWD3 1MCRA 4JJOA 4Y1AA 3KPSE 3MO1B 1AI4A 4X2UA 4KTYA 5HDWA 3LKOA 4YW5A 4PR5B 3HFML 4M4PA 4UM8A 2WZR3 2XTJE 1E5BA 3CH1B 3T2NH 1K42A 2MIZA 3WKNA 2CKBB 1Y6NR 2BVQB 4BAYA 1U8IA 2MNUA 2VUKA 2LU3A 3BUYA 4F3JA 4HK0A 1G9NL 1GL4B 1OL0A 3JV6B 4HWBL 2W5PA 2YEVA 2CPUA 1ZS8B 2WNVC 5JJJB 2EA7A 2BVYA 4HIXH 5EC1B 4J7RA 2HWE2 1ZHNB 3BUIA 1FV3A 2BY2A 5HJDA 2G9HB 4G8AC 4GXVH 1KBGH 1QLEB 2R1XA 5CS7A 3I2JA 4P9YA 2YDEA 3JVGA 3H9ZA 1YEEH 4CVWA 5EG6C 5B3SC 3ZRWA 2OI9C 4UMGA 5G2NA 4YG0A 3OPZH 2JB8A 2OWOA 4F2ME 3BUQA 3ZYJA 3MBWB 1AHSA 1JNNL 2VQTA 3D8MA 3IJHA 3KLLA 2XBO1 3IGAB 4BRVA 4RS5B 1SZBA 1Y7VA 3H3KA 3HN8A 5E2TL 5IQOA 5A2JH 3TO2B 2PQSA 4W8JA 4OU3A 3C5ZC 3QIBA 3WJLA 1GKOA 4KDTA 1ZX5A 3CFEB 1V7NH 4K35A 3PL0A 3OGVA 4BFEA 4XN8A 3WKYA 4F57L 4ZZKA 3RDTD 1JZ4A 3QUXD 1EPWA 5B1BB 1AQKL 2HVKA 1HR0O 2O5YH 3E1ZA 3OHMB 1SBEA 2VM4A 3UO3A 2ILMA 4DPCX 4M7JH 1SQVH 2VDQL 3ULUC 4BZ4A 3MLYL 1BOGB 3A6BL 1POV0 2J1KA 3CVIL 3MLTA 4KJWC 3RKDC 3V8OA 3KXFA 3RUGF 5DYFA 3S5LG 1EHNA 2W94A 3CFMA 2GBUA 1UOVA 4TV3A 3QORC 2IJIA 12E8H 3LRLA 1AMYA 3BP7A 4YDIH 5AOIA 5KYYA 1L9QA 3QHZH 5FK8A 2GV9A 3TH3T 1AR5A 4K7JA 4XBPA 1FAIH 1XH3A 1W3XA 2WIIB 3VWKD 5B39G 3L5XL 4HZLA 1BX2A 2HFGH 2B3RA 5JZGC 1N5YL 4JN1L 3QNXB 3LEMA 1ET7A 1PLGH 2XIDA 5FY7A 3ES6B 2FDBP 2ZUTA 2CAZC 4RWYH 4B5EA 4G6AC 5JOFA 4NAQA 1SHXA 1XBDA 4X7DC 5LNEA 1KELH 4YC2C 3QE5A 1PNLA 4MMZA 3WIIL 4X9QA 4ZFFB 1Q1JH 3JV4B 3P02A 2QMJA 1MH5A 4JFHD 3H3PH 2HBTA 3MZGB 4P5TC 1NIAA 4X6EB 3H4HA 1KFXL 2XQYK 3IETB 5DQ9B 4F6RB 3N41B 4ZTPL 3REVA 4C59B 1LO3H 1IQDA 1R34A 2KPWA 5E6IA 3WKQA 5EEWA 3E5UA 4AVSA 3ZHNA 4KWUA 1I7RA 4P2AA 4PRPD 4S0HA 5HYQB 3BEVB 2DWEA 1TTUA 3S3CB 4NM4H 2ZMNA 2N4IA 3KWWA 5ANHA 3U9PH 3TIDB 2BW8A 2WC2A 1E90A 4IIQB 4E41B 1WG3A 3UC0L 3N04A 1ICTA 2KLSA 2DE0X 2X70B 5HCFA 3CEIA 3BVUA 1OCOB 3ZT6A 1J7VR 5HHOE 2VN5A 5HJ3A 4K21A 2I74A 3LCYA 1K8DB 4KUCD 2OTWB 4P4KC 1KZYA 2QADD 1H8VA 2XI9A 1R3IH 4OZFB 3FN0H 5DDHA 1D2OA 3WSQH 4F7CA 4L3ED 3M07A 3IDIB 3I3BA 5JXED 3ATGA 4F8AA 5CP3H 4LFBO 2PXYD 3MBEC 3NH7H 5L4IA 3OAZH 1G4RA 4U05A 1AGFB 1QI5A 4Y1SA 1WWYA 4PIZA 1NKRA 2O26U 4JRWA 2X41A 4HLTA 1C12A 3MCLL 4KNUA 1K5MA 1IBMO 1CCZA 1Q9LB 1RHI1 4MZUA 5FP4A 2X2IA 4MXQD 3PQYD 4B9FA 3VXNA 3US0A 5BNOB 3DXTA 4L11A 1TCMA 3VZOA 1CJYA 3U11A 1NCAL 1P7KA 3CFDA 3DYPA 2DZEA 1AGDB 4M02A 3RL2B 5IBLD 5KS9A 3D25A 1XB9A 2R061 5FK7A 2R2CA 1RULL 2EDOA 4AI3A 1ZX3A 4Y2DD 5DJYA 4KHXH 1IBHA 4XFHA 1QOTA 1XI1A 2E5LO 1G1XB 3GNMH 2CA3A 4JX0A 4XMUA 3V4VL 3VI3A 2DVAA 1M1XA 3BN3B 1L0XA 2XV6B 5EWIL 4FPGA 3T6VA 5A3PA 2GSGB 4PRDA 4XP5L 1F6AB 2A3TA 4QPKA 4DFSA 5FJHA 4PJDB 3FWEA 2EF6A 4QRSA 4YGAB 2PPAA 2GMEA 2QQPA 4UV7L 2Y6HA 1L5GB 3HJ0A 4DR1B 1YI2V 3FO2B 4QXKA 4WU7A 2RR13 1BMFG 2VAJA 2WJ7A 2NY5L 1OJHA 2XWBA 3LKRB 4P4RB 2RS32 4JYCA 1PGSA 4PVBA 1OVSA 3CZEA 4N90D 1AR72 1R3KC 1J0HA 1Q94B 1MHEA 1CLOH 1PVHA 3SCMA 1ULDA 1KBKA 4MTOA 4LNUA 4XMIA 2BP8A 4RAVB 3IU3B 3BFOA 3WDVA 4QHMB 4YBQC 4ZOLA 2HKHH 4COYA 5E8DL 2G2NA 4PJ5E 1CD9B 3M7OA 3GLEA 1FYJA 4FFYL 1KMGA 2P3IA 2YPJA 2NUTB 3WF0A 2ZEWA 4R90H 3NNJA 5E99H 4AAPA 4BKTC 2UZIH 3K75B 2RM22 1A1NB 4IV1A 5EU6E 1AXIB 1UXWB 4PJ7B 4X6CF 3RX9A 3UAEA 4E9TA 1H8TB 1LU1A 4IIZA 3RZHA 4Z9KB 4XXAA 5CJ8A 1VRBA 2F53B 1KP2A 4LF9B 1MEXL 4EEEA 4HH8A 3CFIC 3MLUH 1S9VA 3VXTA 1WBYB 3CDFA 5ADPH 5F3HB 4U2ZA 1H6XA 3DGTA 2V09A 1TJIH 3HVNA 2Z91A 4R7LA 1RZ7H 3B9AA 4RISH 3TBYA 3D87B 4JDVA 2HWB3 1PGW2 3L6FB 4X9BA 2Z1KA 3CLFH 4AOCA 2ZOEB 1FC1A 1EIBA 1XUQA 3FE5A 2OXBA 2RDSA 4YHPB 2BTVC 4PV1B 1N8ZA 4P9LA 1QRND 1U12A 2D2CB 1FP5A 2HX9A 4IS6A 4TRPL 2YBSA 1HI6B 3HE7B 4KI5M 1I1YB 2CUIA 1H2KA 4Y4KD 4H2AA 2ENRA 3AY4A 4EI6B 5C33A 1PO11 1AP6A 2NXZC 1YAIA 5F6IB 1NGPL 4FJZA 5F44A 2XETA 4WZCA 3BSZL 5E8OA 2BXYA 2VG9A 3U36A 4ZFQA 1CIWA 1X9LA 3B00A 3D51A 4TTDC 3UJQA 4AYID 2F1AA 5D7LE 3B93A 4I0KA 2VR3A 2YAQA 5T3ZL 5MHSE 3DIVA 4BZYA 3MRQA 3QCVH 3ZFGB 3ZXEA 2B14A 1KQSU 3BPLC 5EA0H 3B4NA 2AW2A 2G75B 3CHOA 3I6GA 2WLYA 3L3HA 5JW3L 3E8VA 3JVGC 1ZIAA 1NGXA 4M6NL 3N5AA 5FA3B 4YIPA 1ZV9A 1LEIA 3KL3A 1NX9A 2BOIA 2VDQB 2Q1FA 2ODMA 3DMMA 4J12A 3S35L 1O3TA 5KAFZ 4JHUA 1AQDB 4WFFD 5AL0A 2F4VB 4AK3A 1KBHA 4FGMA 4ELME 2XFXB 5HYJD 1OTUC 1X7SA 3QUYD 1IBZA 4WEEA 5CLXA 1G7MB 3AKTA 1DGSA 1GGIL 4BHPA 3QIBC 3WJLC 3ZMNA 4KDTC 3MODL 3EYPA 2KDYA 3PJLA 5CZKA 2H26A 3ASNC 3WTSA 1UYPA 2H4EA 4EIUA 3SCGA 1WP7A 4PDMA 5A80A 3L2LA 1OI6A 4KKAC 1IS6A 5KSBF 4META 5CWSB 2AYHA 3W11C 1WMEA 1N36B 1UEMA 2V9RA 2K6WA 2XPZA 3ABZA 1QXJA 1ZLEA 3MIGA 5L3EA 1OQOA 3MXVL 4IHJA 5IVCA 1HXMA 2QHLA 4MV2A 4JAMB 5DZGA 1AGCB 1RUQL 4OQ1A 1U6AH 3EJYD 3L3KA 3ZKQD 3CFJB 2N7BA 2YBRB 4M03A 2WWMD 1EFRG 3R8BB 5HVHC 3IDCB 1Y4MA 4AGGA 1O8SA 4YOKA 4HGKC 5EZIH 3OHXB 2AUYA 1GZPA 2Q7HA 2QFPA 1P49A 5CN0A 3FZUD 4FXGA 1GOHA 2YA1A 4KO6A 4TVPL 2DYCA 1L1FA 3S8GB 4P14A 2PYEB 3BKYH 1ODAA 4NKIH 3GBFA 4XC3H 3V0VA 4ZU4A 5ERLA 4QPGB 3DPRA 5I8KH 1DCSA 2AGAA 4WSJA 5GZOA 2WSVA 4X8NA 3VQ2C 3SDCD 4KH2A 4A6YB 4KGQA 3F64A 4FYTA 4JFOA 1NCWL 1ZWIB 4UQ3B 4LCCA 3B43A 4MMZC 2YAOA 2GP5A 4XNXH 2VJ8A 4JI6B 2WCPA 5IFJB 2A74A 1QBMH 3E22A 1HWYA 2Z4TA 3TYGH 4MA3A 3VVVA 3W2DH 1GGUA 2N7AA 1CLVA 1FNEB 1Z78A 3QCWA 3WINE 3SJCC 2CH7A 4LQRA 3TN0D 1RL1A 1FATA 4EUPG 1IQDC 4XURA 2UXCB 2B16A 5E6IC 4KQ7A 3ML8A 2MEV1 4Y20B 2DWEC 4CL7A 1A64A 1C5DB 1QEWA 3ZDZB 1AVBA 1PKXA 1UD2A 4JI3O 1IFGA 1HHHA 3EO0A 3TT3H 2XJQA 3A4DA 5FZGA 4EV0A 5DHDA 1KRIA 1DANT 5DUML 1Q8SA 5FYTA 4KROD 4PIBA 2AQ3A 3F7YA 5MEOA 1N0NA 5DZAA 1HJBC 1B2YA 3DHJA 1ZV5A 4F20A 1TCRB 2Y36H 2XAJA 4G6KL 1D5IL 1ZCRA 2AJVH 1IAIL 3K81A 3MAWA 4NUQA 2OSWA 1E6JL 2XG5A 2P4EA 3IWVA 5LXTB 1J8HD 2E63A 3RILA 4P46A 3T4AB 5F72S 3MV8E 3S2CA 1JGDA 3L7FA 1GMEA 2VLKB 3C6SB 2CD0A 5ISZB 3ACGA 4WHTA