3RGBA

Crystal structure of particulate methane monooxygenase from methylococcus capsulatus (bath)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
382
structure length
382
Chain Sequence
b'HGEKSQAAFMRMRTIHWYDLSWSKEKVKINETVEIKGKFHVFEGWPETVDEPDVAFLNVGMPGPVFIRKESYIGGQLVPRSVRLEIGKTYDFRVVLKARRPGDWHVHTMMNVQGGGPIIGPGKWITVEGSMSEFRNPVTTLTGQTVDLENYNEGNTYFWHAFWFAIGVAWIGYWSRRPIFIPRLLMVDAGRADELVSATDRKVAMGFLAATILIVVMAMSSANSKYPITIPLQAGTMRGMKPLELPAPTVSVKVEDATYRVPGRAMRMKLTITNHGNSPIRLGEFYTASVRFLDSDVYKDTTGYPEDLLAEDGLSVSDNSPLAPGETRTVDVTASDAAWEVYRLSDIIYDPDSRFAGLLFFFDATGNRQVVQIDAPLIPSFM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methane monooxygenase subunit B2
publication title Crystal Structure and Characterization of Particulate Methane Monooxygenase from Methylocystis species Strain M.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 95
structure length 382
sequence length 382
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3rgbA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 3rgbA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 3rgbA01
3RFRA 1YEWA 3CHXA 4PI0A 4PI2A 4O65A 3RGBA 4PHZA
chains in the Genus database with same CATH superfamily
1JWMA 2QVTA 3BW9A 3PAUA 4L3EB 4BEIA 1YFWA 4K1ZA 2WZR3 1E9OA 4DR3B 4BHUA 3VBOB 1KTRL 2J1WA 2LQTA 3N1FC 4P5KA 4TNVK 1WCUA 1JBJA 5HXMA 4Z7WF 4F7KA 4P00B 1TCMA 4WEEA 5J9PB 5LQBL 2CU5A 3KVDD 4MAUL 3DA0A 3CJHA 2CE6A 3JASB 2YA0A 4CUGA 3VGIA 4S1QL 3UTSD 4Z0BH 1PG7W 2IXLA 2XG3A 1XX9C 4KJWD 5FO8A 1ROWA 4Z78A 5JOFA 1DN2A 4Z95H 2E4FA 2OI9C 4AE0A 2H0BA 4N2AA 2ITDA 3D3VB 3EYOA 4IBTA 2BOBC 1TFHA 5LBSA 3R05A 1FC1A 3BGFC 3QRGH 5F96L 1S3RA 2UUDK 3W7UA 1E4XI 4HDIB 4NM8L 1IAIM 4NOBA 5CGYC 5GGQH 3VXMD 5JO5A 4PJGA 4G7SB 5L9DL 2BIIA 4L9LC 5ACA1 4MMXC 4XXCA 5L7OA 2NY2C 4CDWB 1IM9D 2FB5A 4JI8B 3GUTA 5DA0B 1H2KA 1C5DA 3RHWF 2UX7A 1OCOC 3SKJL 2CZNA 1EV13 1SZNA 4DR7B 3G5WA 4U1LB 4UDUA 4MG2A 3LXAA 4XPGL 3EGDA 3HD8B 5D7JC 4JTNA 4UM9B 3ZDVA 2NTSP 4DAGL 4E42B 1KLFA 2VAUA 2WNVB 1MI5D 1HOCB 4YWGL 4YK4C 1YYML 1AI1H 4ODTH 2QDRA 4X62O 4RGNB 1RL1A 2QDWA 1KIRA 2RMU3 3T3ME 5T3NA 1Q5OA 2P5EB 3RWGA 3D4KA 3CX5J 3QCVH 1UNBA 1YUHA 4Z7QF 3L3GA 4JQRA 5FYLH 5IFAL 1AYN2 1N1TA 3RLSA 4PJ7A 2YI9A 1KGJA 3S37X 4H8WL 4LEXL 3VFPA 4AEIL 1EIBA 4M8QB 2JXMA 3CN3A 2RMKB 2WUHA 2VW1A 2MWCA 3CHSA 4JV4A 4XXAA 3JV4B 2UWEA 4ANXA 3SKUD 4NQCB 5LAXA 4DW2H 1IM9A 2X1OA 4NC1C 4Y1AB 4E2OA 3L3JB 3MRPA 3TP4A 1E27B 3F65A 5C9AA 4QAMB 1RMFH 1FXKC 1ZT7A 3V0WH 1P2CB 4YVSC 3H3LA 2CQVA 3LRLA 4NZRH 5IBTL 5FLHA 2YUZA 4LXFA 2AV7A 3FAWA 4Y1XA 5E9DA 2HLDG 2GTZB 3IMSA 3LEKA 2FSEA 4NHMA 4HWBL 2VZ1A 3T71A 5CP3A 5A6IA 5C3IA 5DRXB 1XGPA 5E6HA 1S7XA 2G2RA 4HOOA 2VL5B 4XP1H 3ML9A 4N86A 4F9LA 4N26A 1WMDA 1HZHH 5CINL 1W0NA 1ZK5A 3GDBA 1G7MA 1BW8A 1U0AA 1YCSA 2XTJD 3V4VL 1V7NL 3KH4A 4IBSA 3BQUD 1OT4A 5C8YA 3V95A 3TJHC 2H8PB 3VSQA 2JIXB 3KAAA 4BIKA 1XYNA 3K2UH 2WSPA 3OKMA 4TUKH 3FUDA 5B1BC 2J8UA 5AVVB 1B0RA 3M70A 1QYGL 1YIJV 2YQGA 3QQ3A 4Q6IB 4YXLH 2F61A 1WP6A 3FQNA 3GXTA 4M6AA 4Y9GA 2YAFA 4YHKH 1BZ8A 3HKCB 2HT2C 5D7KD 4JS7A 3AU1B 1GMGA 1Q0EA 4JHAL 4BFEA 4HK0A 4K8FA 1NGPH 5JOZA 2R2EA 4G59C 1JHLH 4OD2B 5TK4A 1F4WH 1HQ4A 5BO1H 5IHBA 2EXIA 4GP5B 5KS9B 3H56A 3IPEA 1UYZA 3WHXB 4UQ3B 5F44A 3RYIA 5CILL 4XFBA 2JDMA 5LASA 2B16A 1PGL1 1MIEH 1RLBA 1SPPB 3SY0A 5CBFA 3CPLB 2QV4A 1KENH 2XQYG 2WRAA 3RFZC 1L7IL 2WCPA 1NBYB 1H3VA 2P4AB 3KPRE 2X2IA 3BPLB 4AVVA 3BO8A 3U48A 1AS8A 1ACXA 4TPRH 2B9UA 3H3ZA 4YL4A 2EDDA 4QGMA 5FK8A 1PG7H 3PHAA 5I1GL 2Q69A 2AJUL 1ETB1 2JB4A 4UNVA 4PLNC 1TVHB 4Y19B 3BZEB 3VHOA 4P2OD 3BQUA 1J0JA 1E67A 4BRJA 1QFPA 1QR8A 1IKOP 4EIGB 3DJSA 3TOPA 5IESL 1OQOA 3MRBB 2X9ZA 1I1CA 4X1YB 1L9MA 3WD5H 1H6FA 4FTSA 1WWBX 2RTTA 2YD5A 1DDTA 3K6FA 4FFYL 4HD9A 1E28A 1FO0H 2B1HH 5J1AB 4WM8B 5AW0B 1FNEB 2AGAA 3EYQC 3WFDL 3JARB 5IWLA 1NAMB 1KXHA 1WE5A 2AEQH 2W80C 3S2AA 5AD0A 5FYTA 4HVQA 1QVOB 1O5UA 2ZGQA 3TN91 4YGCA 4R0LC 2E7QA 2DVAA 4FLSA 2C7FA 1R5VB 1MOEA 3OLEA 3WF3A 3POEA 2HRPL 2ICEB 5LXTB 3GTTA 4JI3O 4ZUUB 3V2AR 4BQBA 1N5AA 2A74A 4DV6O 4O9EA 1A66A 2GTAA 3OKNB 5A7SA 3VU1A 2YHJA 2ZCEA 4XBFA 3D09A 4CC1A 4ZZ8A 2ARJB 2GC1A 5JH7A 5IB3B 2EVGA 4XCCL 4BFKA 1NCRB 3IAYA 4Q8BA 5EIBD 4AQ8A 4UV4H 5AWNL 3AMNA 4P2OA 3MDJA 3W56A 4HT1H 5DD3H 3VWKB 3FQXA 3HJRA 3BSHA 1IV8A 1MFBH 2DH3A 4Y5Z0 2F74B 1WFOA 3CDGB 3B4SA 4D0DA 2PUQT 1MAKA 4HX1B 4PBPA 5J96B 4B3TB 4NJAL 2HUHA 3L1OL 3E5XA 1DJSA 3ECUA 5KHIA 3IFXA 2APFA 4ZHQB 4M01A 4JV5O 1A6VL 4YVWA 4Y1UA 4Z3JA 4OI7A 1KECA 2F8OA 3RBGA 2Y6JA 3M17A 4M8RA 3C3VA 1GGCL 3AQYA 3CFCL 2R0WL 2KL6A 5BMFL 1Q43A 2CRIA 2VITA 4YHML 4DV1O 3ZE0E 2OVUA 4ALAH 2CCLA 3L3OB 3BEVA 4WSJA 1N1VA 3OPTA 2P1BA 1Q1PA 5CNAA 1P84J 2GK0A 4A42A 3ECWA 1BVLA 3OKYA 3CC5B 3BGMB 1VBC1 3D3VE 1G87A 1BCIA 1G7JB 1IGML 1JGEB 1BD2D 1U30A 5CVRA 4KXRA 3SYQA 2HVJC 4Y9CA 1J1TA 2KHAA 1NAKL 2OBGA 5HDRA 3I2KA 1SLIA 1ZSPA 5IYZB 2DPKA 3FHEA 1E5HA 4Q4W2 4LKDA 5HYQB 4M61A 3MBEC 2ZUTA 3WKPA 4LLOA 4G7RB 1Y43B 5FGBC 4OUUA 4K40A 3BH4A 1A3RL 1VR3A 4K5PA 1JIBA 4TLSA 3H0OA 5B7EA 1TR7A 4LRNL 3V4PA 4K8XA 4K8ZA 3D0SA 4Q1PA 1V8HA 2WQSA 5A2CA 4LPYA 3LQAH 2W9DL 3UTOA 1F51A 1BQPA 3DRQA 1K5MC 2QQKA 4NRMA 3QWNA 1L9QA 3HNBM 2AMUA 2YBRB 2JH2A 4LB8A 3MV11 4YNYB 4DV3B 1L6XA 4AFAA 1MEC3 5K1PA 3ZW3A 3S35H 5D93C 2BOIA 4PD4J 2J22A 3TYGL 4U1IB 4AEDA 2F5BL 4NCC2 3M7MX 2IW5A 3V5HA 3LCPA 5HHOE 2CJ3A 2QGNA 3QS2A 2ZKWA 3EXJA 1XCQA 3P4NB 4B4RA 4OGAC 2IDUA 3I9IA 4Y2OA 4XI5C 5DSCB 3OY8B 2WYHA 2HJKA 3VBFC 2IPKB 1F1AA 5IMMB 1XF2A 3BPCB 3RWFA 3BP6A 2KA3A 1RKRA 2NT0A 1WA4A 1U8HA 1YA5A 3FT2A 3IKCA 1BLNA 1ZPLA 3VD0A 1QSFE 4HC1H 4X6DA 4QLRA 1SFNA 5BOPA 3OKLA 1UD6A 4M3KB 2HYMA 4PJGF 4WI6A 1V9PA 4DV5B 4HCIA 5E8NB 1BQRA 4L18A 2G2PA 2MCPL 2WFF3 5LZ6A 5EUKA 4XMKL 3TWYA 4Z0BL 1P7QD 1TVKB 3BEHA 5JW5A 1XD1A 2OXBA 5CGYD 1I5PA 2VKXA 1LDSA 3Q5OA 1GPOH 3BI9X 4JN2B 4Z95L 2DYCA 1G9AA 3QXVA 1VIWB 1GO3F 5LYJB 3ZYPA 1PP9H 2KLTA 2X9XA 1O0VA 4XAWL 1AI4A 4P9YA 5LHIA 5GGQL 1J0ZA 4O2EA 2HWZL 3DBXB 4X5XA 4R7NB 5D7JD 3LZZA 3OYWA 3TGXA 3MUHL 1HX0A 2AK4E 3QFJD 4LLUA 3FFDB 2VJ8A 4NWWA 4FPJA 1L1FA 1BZEA 1RP8A 1HNZO 3KL5A 3NIGF 5DZVA 3ET9F 3RIAF 4MVQA 1V6JA 2VU9A 3PWPE 1R1ZA 1UU6A 3GBFA 4ISRA 1HSBB 1E7VA 4MLSA 5DU7A 2XLGA 3S30A 1C08B 5J11B 2QTVA 2FJHB 2NX5D 3QO1A 2VT0A 4JDEB 5EN3A 5D8AC 4QXUH 1KEGH 5ICXA 4PJ7F 3K9AA 1I3RA 1AI1L 1MQ8A 4ODTL 5DJ0A 1MVUB 4PW3A 4D7SA 1HSAB 5FCCA 4X7DC 3GSNH 4WK0B 1YEEH 4Z9KB 1XILA 1MVEA 4PF5A 5KS9E 2OJ1A 2UWEF 2VQUA 2BOBA 5B3JE 2N01B 2YD4A 3MR9A 4G82A 4X8CA 1VF6C 3NJIA 4S1DC 1KEMH 1P7QA 2YMXH 4NKMA 3F95A 5FUNA 5F3HB 1UB6B 3T4ZA 5FYLL 3ETSA 4GG6B 5L3FA 3IAPA 3LHAA 4L9LA 5JQGA 4MMXA 4JY4B 1DUYA 5EHFA 1S9KC 4P99A 3GSOB 4MGIE 1JTPA 3B9CA 2CRYA 1E65A 1TENA 1A4JA 2RJMA 2MSPA 4ZUVA 2W1WA 2F58L 3DX6B 1DO6A 3VSVA 3G5VA 2G75A 4TVSa 4JUSA 4OZHE 5D7JA 4HBNA 4AL8C 1KFAH 2QQLH 1HRV3 4DW2L 3MFGB 2NYKA 4Y19E 1S9VB 4FBFA 1W72B 1J05B 3AXEA 4OFPA 5GONA 3IETA 5KOVC 3GXPA 4XQWA 1RMFL 1Q8MA 3GALA 1SZTA 9PCYA 2XKNB 4KXCA 1SF9A 3V0WL 3AYAA 3MJ7A 4LLWB 2IQAA 4FI7A 2ITEA 3PE9A 5EC1B 3SQOA 1NH2D 1IGCH 2JKNA 4W9IC 4Y1YA 1UW8A 3DC5A 1HTYA 3KDPB 4FNRA 3NFSL 4A7ZA 3AY2A 2ENQA 1ZBA2 1T7WA 3V7AG 4AVIA 3UAEA 1EBAA 4A44A 1AR62 4A7GA 3HN3A 3SD2A 5K9QI 2J8UF 2PGGA 4PRPA 2VLMD 32C2A 3TJHD 1G86A 2R9AA 1HZHL 3WKQA 3WSQH 5J12B 1RUC2 4ADIA 2X2HA 3MLUH 3EH2A 3NAAH 4ZFFA 3KF5A 4MXVE 4PUBL 1NPUA 2CO7B 2HUEA 1PNCA 1SZXA 2A2QT 5K5YA 1IS5A 3APFA 2EABA 5A33B 3K2UL 2W91A 3PTRB 1CFVH 1US6A 3P2BA 4V2CB 1DCSA 4TUKL 1E9PA 1HXS3 3QNZB 4IV3C 3L2HA 1A7PH 3I7DA 4YXLL 4ORFA 1TETH 5HXVA 1MCOH 2JK5C 1G7QA 1FXKA 4J6IA 1R5WA 5L2KB 3JWDL 4YVSA 1KBGH 3IF1B 4LT7A 1FV2A 4DR4O 4EE2A 2WZEA 4Q0UA 1OHQA 3EO1A 2JX9A 5I6LA 1JHLL 4Q4Y2 5AOMA 1F4WL 5MEOB 4ELMA 3BTXA 1W3VA 3LF7A 4HS8H 5FWEA 1CGVA 4I0PC 1I08A 3QO8A 4MZ2A 4NKOB 3TJEH 4ZMZA 1MIEL 1A4KB 1FL3A 2GJZB 1UZGA 4UU9B 1QQP3 3FQWB 4L1TA 2Y7QB 1MHPH 1HXYA 1HCVA 2WAAA 3B7RL 5FZAA 1F6AA 2WTRB 3TL5A 2B2XL 2VMDA 5FO7A 5B8CC 4DPBX 4NXSA 3B2VH 2R072 1EZJA 4TPRL 4AEHL 5CU5A 5CKMA 3ZIAG 2V3FA 3WEOA 1PG7L 2YZ1A 5C0IB 5SX4I 5FBJA 3RS6A 4JM2B 2F53D 1A4CA 1JMKC 2A3WA 2O61B 1VENA 3B3IB 4WVMB 2B59B 4LDLB 4YDVB 4PJXE 3ZKSD 5B39G 1HWYA 4FQJH 5K9OA 3OBRA 3EYQD 1O6SB 3BEWA 1L0QA 5IVXA 1KGYE 3PIJA 2P6CA 4Y4HB 2CJSA 1RVFL 2PXYB 4WK4B 1DGRA 1VPHA 2I69A 1FO0L 2B1HL 3LNFA 4GUPB 2X88A 2NTFA 3DMMB 4IOIB 4UI9L 5EXOA 3IMNA 2HJLB 4HLZG 2A06H 1F02I 3LNGA 4MXWH 1UXZA 3CVIH 4GKNB 2AEQL 3QYMA 4X4YB 2YXHA 1KKDA 1A6ZB 1KJVB 1BYNA 1LNSA 1ULEA 3V56A 2TBVA 1FL6A 2Q8DA 5CIPH 1ZANH 5KXDA 3RFZA 2J5LC 4MX3A 1YEFH 3KG2A 3C7EA 1BQSA 4J8RA 3QDJB 4BM7A 1AGDB 1TMF2 3SOTA 4U1KB 2GTWB 1T3FB 2YK1L 4QRBA 2Y2YA 1L3NA 1X8EA 2P3KA 3N40P 2UY7B 2Q0AA 4PCYA 3V4VB 2A77H 3U11A 2P48B 2X9YA 4PLNA 3TXSA 3F12A 4XFCA 4RISH 3MGAA 5AYTA 3W9EA 2Q86A 3CZFB 2DCKA 2F53A 2E56A 1W6MB 1WGOA 1WBZA 4UV4L 4RMWA 3KYMA 2QPDB 1FAIL 4HT1L 4NBZB 2ZOLB 3WNLA 1UX7A 1MFBL 1TEFA 3NKTA 4OULA 4TNGA 3BKYL 4META 3PVEA 1HNYA 5EZPA 4U7NA 2VMJA 2MNUA 4D7TA 2PWHA 3ILDA 3PWNB 3RWCA 3WQ1A 1NGWA 1QLEB 1ID5I 4R0LA 4MZUA 2WQXA 5ITFA 4X4MA 3K80A 4OIIH 4RGOL 5BPXA 5KX5B 1RFDH 1MHCB 3VXNA 1N5YL 3P3YA 1YAZA 2CXKA 3L73H 3MW4A 4Y2LA 2OMYB 4MNQD 1CAXA 1AJNA 3H50A 3HEIB 1CD1B 2VGLM 2F08A 2Y25A 5A3MA 4FI8A 1UM4H 3P9MB 4JFFE 1CGWA 1EAH2 2ORZA 4ALAL 4PVNA 2H47C 4W50A 3EVKA 1SPDA 1AXTH 3KMDA 2IOIA 4Q4EA 3WHE0 2WTOA 3BUPA 2YXFA 3SGDI 3UTZA 4BDVA 3WAKA 4DKAA 5GS0L 4XFGA 2B9ZA 2WUCH 5G5DB 4F8OA 1TME3 5KXCA 4B29A 5GS1C 3F7YB 3KWWB 3MBED 3IT8D 5HGDA 1OVZA 3IDGA 4L37A 2PELA 1DF5A 4NPJA 3VG0L 2R041 5GGTL 1G6NA 1K8DA 2SEBA 4NENB 3B6SA 3K0WA 2YPVL 3JV5A 4J11A 2K9PA 3ARYA 3CQQA 4KVCH 4NI6A 2N4IA 1MRDH 2DQTL 4TUOB 1MS8A 1LGVA 3VQ1C 2UURA 3GSQB 4NT6B 2P24B 2LVEA 4M8VA 3FOMA 1VF5C 3NZSA 5HYEA 4YO0A 3IGKA 4L8BB 2E76B 4QGYA 2CTVA 2RS33 5FZHA 2A1WL 1ED3A 1FQ9C 3OGCC 5FP3A 1UUSA 3KPSD 4Q9QL 1RUF1 3JXSA 4D2NA 1KGXA 1DJGA 1RPOA 1GGTA 4MLOA 3MLKA 1IBGL 1P7KB 1OGAA 2CO1A 4AVJA 4OU3A 1GYVA 3UEQA 5E24E 5FP9A 3HS0B 1K5QA 1YEHH 4HIEA 4JY5L 4HG6B 2XTLA 3OTOO 1J8HB 5C3SA 4OGAD 3DF0A 4RHV1 5FOBA 1AC6A 3M2MA 5FYKE 5GLVA 4DOUA 2GAUA 3U0PA 1GW0A 1FLTX 4X6DF 2HVJA 4YDZA 1TKWB 5ICYA 2YEZB 4LK6A 4JFZL 3T0WA 2EH7L 1HNXB 2KZ1B 1JZ8A 3MBEA 5T1JA 1V6IA 2HWD2 3IT8A 4J5VA 2LTQC 3LNEA 1L9PA 3D2UD 1C9SA 2BIPA 2BSTA 4F7PA 5FGBA 1N4XH 1PNDA 4R4FL 4F7TA 5TDNA 1XF5B 5KBMA 4NS0A 3ZSEA 1DVFB 1C8M3 4FFFA 1NCWL 1LO0H 3QNEA 1ZS8A 2R2CA 4IQHA 4PGBB 2EZPA 2VQTA 2YGVA 5H9PA 1IBKO 1M1KW 1K4CC 1JZHA 1JXKA 4X5RA 1K5MA 1FOD3 4OI0A 2VDQB 2YEVB 2AQPA 5C0GB 3WG1A 1IM3B 3IMUA 2OS2A 2EALA 1XOUA 2BNRE 3KPSA 5M7QA 1VLNA 1J5OL 1G43A 1VRSA 1R3JB 5KHHA 3UBFA 2A9DA 4KUZH 4P2QB 4IKNA 3T2LA 4FFIA 1ACCA 5F6IC 3SQRA 3H1KH 4R9HA 3K2KA 2CRMA 3FFZA 3ZQ9A 1PBYA 2BM3A 3U0TA 3UJJL 4YH6A 1EH9A 1SUHA 3O11B 4OF5A 4NWTH 2PFWA 4PT6A 2ZE0A 2ZUUA 1L7RA 2ROXA 2C2AA 1O7DC 1TQBB 1LO5B 3SPVB 3MRMB 3VBFA 2EIBA 1D4M1 1VB4A 5IVJA 4KQ3H 1TYEB 3B9KD 4HK3N 1DZ0A 1KG0A 5EEZA 3MRDB 2GP3A 1GH6A 4RWYH 3M3CA 3NSFA 3R4RA 4M9PA 4ISQA 4UW6A 3JUYA 5JZ7C 2JGDB 2PTMA 2QA4V 2YRLA 3D2UA 1JDCA 3L9RB 3VFMB 1TJHL 3CC1A 1D2PA 1YFYA 3POYA 4MMYA 5HHQB 1KEGL 1U8MB 3EHBB 1WFIA 4S1DD 2N59A 1FFNA 4FTVD 4XHJD 2G9FA 1NUDA 4FG4A 1HINH 1XH3B 3H8UA 3GSNL 2AFNA 5AC93 4N0UA 2Y0PA 3WY6A 2MEV3 5D7IA 1MAMH 2GJ6E 3LEIA 1KEML 1T0MB 1MHHB 1HXKA 3S34L 4BYHA 4JGSA 1CX1A 4FL4B 1U3NA 1MFCH 2E0PA 1FBIL 2J1EA 3FWEA 1QHDA 1QFWL 2F6AA 1T22A 2RNBA 3NAPC 5JNYA 4JC1A 4U6XA 1MZFA 5FGCB 5FKAA 1KP3A 1Z9PA 2Z31B 4CH3A 2NLJB 3DKHA 4PA3A 3RL1A 5FZBA 4ABQA 4PJBE 1YC61 2QQLL 3KPMA 4RRPG 4A7GF 3ZXLA 2GFBB 3FQRA 2XBO2 2P22C 2XXZA 3QPKA 3DROA 3Q8FA 4OHYA 4NM4L 4UIKH 1FSKB 4H1LH 4PRBA 1LGBA 2WV3A 2MCAA 1ENRA 4GXUN 4OSUL 2NY6C 1EVTC 1U8QB 1A14H 4NQXB 1F18A 4AY0A 5L88H 1C1FA 5BNPB 5DTFA 2C4XA 1I1AD 1LK2A 2H41A 1VF6A 1HJGA 1NKOA 1EDHA 4FTVA 5IJ0B 3WSQL 1OSYA 1QI5A 2G9ZA 3HR5B 5IOPB 2VQFO 4C83B 5F7KC 1HH6A 1OV8A 3QDJE 1O9WA 1KEXA 3C6LC 4GFXA 4PCRA 3ZT7A 2F66C 3DOSA 3VFNB 3GZKA 2X44D 3DGTA 1NZ6A 3THPA 1GR7A 5H37G 1IO4C 2BVEA 4WU5A 5D2NB 1SBSL 1WITA 1T21A 3DV6A 4LOFA 5LA2A 3ZXFA 3B94A 4UCVA 1A7PL 2NRDA 4JR9H 4F8TA 1TETL 1MCOL 3BHBB 3DX7B 1KBGL 3P4MB 1ZRCA 1JYVA 3SE6A 2BFGA 5CZKA 3BUYA 3L3KA 1BXHA 4GQ7A 1UMIA 3A0NA 3OPZH 1J1OL 2BPA2 1THZA 1FORH 4HS8L 3DPDA 1YQVH 2D3RA 12E8L 5E0QA 3GM0A 3TJEL 4NKIH 2KERA 3VCLB 1OXYA 3G5YB 3I74A 2NPIA 4FMKA 4JTOA 4UW4A 4JZJB 1EV12 4RBPK 1OOPB 2Y64A 1WPXA 4LPXA 5IVXF 1PFOA 1W8OA 1RHI3 2VIRB 2DIEA 1NLRA 1Q9LA 3QQDB 4MJIE 4YGVB 1ZZ8A 1A64A 1UCTA 2VN7A 4X99A 4PJYA 5CCKH 4Y22A 1G7IB 2X5IC 2VR6A 1WFJA 2J12B 2W9EH 1YQ8A 2RM21 1RFYA 5EHDA 4OZHF 2NDGA 3V6OC 3H1LH 2BP8B 2I24N 2ICWA 3MCG1 4HJGB 4IV3A 4Q4X1 4FQJL 5IEKA 4FABH 1AMXA 1W0VA 2JK5A 1Y4WA 4YHLH 4UTBH 2GC0A 4N3UA 1C28A 3WS3B 2WR9A 3RZKA 2Z91B 5C09B 2Z35B 2PYFB 2NSQA 3DXAB 5F71A 3UV9A 1G5AA 3E3QC 3OHXB 4XNUL 2PQSA 3CZJA 2ZABA 1KIPA 4I0PA 1SF3A 2R32A 4MXWL 1VCBC 2LGNA 4OLYL 1XRUA 4ZUTB 4AW7A 1D5BA 5C07D 4YC2B 3D0LB 2R0ZL 3LDDA 1WBXB 1ZANL 3L17A 3M1CA 5J06A 1SM3L 2WO7A 4ET7A 1YEFL 1JSYA 1FG9C 5B8CA 2ADFH 4MVRA 2D6MA 3WW1A 4AYSA 4NUJB 1OEZW 5I1LB 2BHFA 3H42B 4BD4A 4W68A 2BRQA 4O02A 1XBDA 3SR2C 3DGCR 4WCYH 1TOXA 2A77L 1PZ9A 2XLAA 4CADB 3B77A 3U9WA 4IGQA 3NCJH 1RP3B 1IVSA 4RISL 2X10A 3EHKA 2EF6A 1GC1L 2APTA 2X4TA 3NFNA 5BR8O 3K6IA 3EO0A 3KPOB 4JFUA 4L9DA 5T3XH 4KNQA 1I94B 2HB0A 3RILA 3OBTA 5A6YA 2LS6A 3VXUE 2NY4C 1VIBA 1G7PB 4K5LA 2WSKA 4N6RB 2MH4A 3WFVA 4HS3B 3W37A 3MHSC 3Q6FA 2DMCA 1ML0A 3VGFA 1KPRB 3DKWA 4FC3E 3HN8A 1JNHB 4XMLH 3X1BA 1GP5A 1G4MA 3VXRE 3KLHC 3D48R 3ETQA 3BAJA 4OIIL 2UXCB 3SEEA 2P8PB 1KYDA 1RFDL 2P5PA 3CU1A 1APNA 1WA8B 2DD8L 2NNRA 4MS8D 3P1VA 5C07A 5T5NF 5DQDH 2BWIA 2X2JA 1LNQA 4WEBL 1MQKH 5EUOA 3Q1SH 3JZYA 1RZQA 4LSRH 3JAWA 4L1SA 2DU0A 4XILA 1CS6A 3L6FA 1H4GA 3VKLA 1QHQA 1DCLA 4HJJL 3TN0B 2XJRA 1ULFA 3V0VB 3HRZC 3U1XA 1XR9B 1EN6A 1AXTL 4LKXB 1KTDA 2K6WA 1ULDA 4CA9A 4TM9A 2WUCL 2AV1B 5ACZB 3WFHB 4PF1A 5JSPA 1NDTA 5K39A 1P5UB 1FO0B 3L9BA 1LGNA 1VMHA 3LNIA 4NRZB 5KJ4A 4KVCL 1N19A 1I1FA 4K15A 3EFDH 4G5AA 2K8QA 3S96A 4BQCA 2ADIA 3CFTA 4N0YL 4PGEB 1DGWA 2HKXA 4YWAA 1XDCA 3VE0A 2ZCLH 1C5IA 3AXLA 4MB3A 2ODHA 4HKWA 3MGOA 3AS0A 3BWAA 5D1QB 3K0YA 2XLLA 4PY8J 2DJSA 3VRIA 3ZXAC 3QULA 4CN6A 3BKZA 5KTEH 2G1MA 5E89A 4LLYB 4HK3J 2NNUA 3NIDE 2QEJA 1K45A 5AKSA 3E0GA 4GEJA 1MNNA 1K42A 1AYOA 3L4XA 4LNRA 1CT8B 1YEHL 2QVKA 3KEHA 5DVNA 5GS1A 4D6QA 1EP0A 1FPOA 1SBFA 1UY4A 2E4TA 3RWNA 3EBGA 2Z1KA 2CDYA 2ED7A 3CFKB 4G9DA 4YSRA 4AZUA 4R52A 3GBMH 2FX7H 1DQ0A 2B1GA 1WT5C 4KI5E 2ETWA 1F35A 2XDVA 5DXWA 2F1EA 3DYPA 3REWB 2VLLA 1ZTXE 4NQSB 4XVUC 1I8MA 4TUJA 4XCNA 4HVBA 1IX2A 2W46A 4MH0E 2VDMH 1AP6A 1HXMA 1N4XL 5FGCE 5JMCA 4JI7B 2VSCA 5IF0B 3D85B 3SBPA 5FQ0B 4YE0A 2EILC 4N4YB 2IFGA 1O4TA 3ASIA 4EAEA 2X70A 2ZCHH 3O4OB 3OGCA 3ZYJA 5LHDA 2FJGA 3CE1A 3SCGA 5A6XA 2R2BB 3NCYS 4HGWA 2F8XC 4NWUH 1HV1A 4BMEA 2XQYA 4NIDA 3C5JB 3VXTB 2AHIA 3T65A 3L3IA 1EO7A 3CWBH 1UZ0A 1FYTD 3VL9A 4JFVA 2AENA 3KWXA 4JRYE 5HVFB 1OARH 3UX9B 2R30A 2Y6LA 1MKFA 2WAOA 1IOAA 4JPRA 1ZV5A 5E9AA 2P49B 4DP0X 1KPUA 3I3MA 1MCWW 4WNSA 5GJSH 1UKQA 3SDCD 2M1KA 4NWTL 3H6JA 3MLRH 5B4XA 5AFEA 1JRHH 3GFUA 4NO0B 5JIDA 4DPNA 1W80A 2IV9A 3TYFA 3NV4A 3WCRA 1SQGA 3QIUC 1JFQL 2IXQA 4F2ME 1P6AB 2YXMA 5JR1H 1S2BA 4V1PA 3BA9A 2PWDA 4KQ3L 1DLLA 5FLJA 4AAPA 3RX9A 3M3IA 1CD8A 3TBVB 4RWYL 3B4NA 2VO8A 3BOWA 1CGSL 1BM3H 4RS5C 3PUQA 3GDCA 4LKCA 4N9GB 1ZZ6A 4UFLA 3WG2A 3D36C 4N8VB 4XN9A 4AVBA 3MRFA 1K4CA 4YXKH 5DD6A 1XE8A 4R96A 2NUTA 4NRPA 1UA6H 3CH1B 4WU7A 1LUWA 5D7LD 1BBT3 3QZPA 1F4HA 2NY1D 5INCA 3ZTCC 5HVHB 4JCMA 4ZXBB 1XF4A 3AZVA 1QSEB 2WW8A 5PAZA 4V2BA 4EIBA 4XN5A 3VUOA 3EXLA 1MAML 3AMHA 1Y74B 2EJ1A 2HJIA 2VR3A 4XCFH 3MMEA 1A8DA 1VBE2 3OAUH 2D7FA 3DTXB 1FYTA 5DD0H 4LA3A 1T2QH 4QTHB 4CBZA 1UIJA 1MFCL 4LSTH 4BE5A 1GV9A 4JM4H 3FUOA 3VDDC 1NKDA 4MWFB 2J1SA 3T4YA 3I3DA 4P14A 2IDSA 3NJLA 3PHQB 3D4ZA 1I5ZA 2YPLD 4OLXH 3NNFA 3AG3C 3VXOA 2J56A 1DQLH 1LO3H 5BRPA 5LNGA 3OTFA 2PW1A 5IVVA 1FGNH 1TQTA 3DGGA 5AKTA 5FO9B 1UCBH 5DJ6B 4YSDA 5C7XH 2RE9A 1QHOA 5F1RA 4UIKL 1D5XB 4MDJA 2E6VA 2W0FC 4F7ZA 2YAOA 3HS8A 4NO5B 1MEC2 2HEWF 3ASOC 1A7QL 5J48A 4W9FC 2FEEI 4D6TH 1JAEA 4PG2C 4FQQB 1XREA 5EB9A 1K12A 3UBXB 1A14L 3RYKA 1OHHG 4QGLA 3L2MA 3K8LA 4I18C 1GK9A 5J6SA 3FRUA 1QDOA 3BUCA 1RUG1 3NV1A 5DC4B 2FK9A 5HP5A 3CVHA 3MACH 1NEZG 1NTKH 3CMOL 4JQXC 4X1IB 1IC7H 2F19H 4KGLA 3NAPA 3FQ1A 4D0BA 1CWVA 3ZHQA 4C0HA 3RYHA 5CBAA 1WLCA 4U3JB 3FAVA 1IIKA 1A2YA 1QWHA 1GS6X 2CGPA 3DX8B 4ZW5A 3LKQA 3CE2A 4RH4A 4XO9A 4AC2A 1XYOA 4JR9L 4ZHNA 2BC4A 3IGUA 4NN5B 2YPLA 4YW7A 3DSQA 3R1GH 1W28A 3P77A 3HKBB 3ZFFC 3SYOA 1JJUA 5FA4B 1M4UA 4LFBB 5J7CC 2XFXB 1M93A 4DV7B 5CD3B 3BP5A 1Q9KA 4X8JB 1YQVL 1DQMH 3VD1A 3UXFA 4AQ2A 2NT1A 4LL4A 5DMKA 4I9WE 1NJ9B 2Q7GA 4JFWA 4ZO9A 5LCVH 2Q8AH 1FPTH 1L6ZA 4P9JA 4BOWA 5F3EA 3D82A 4XP9L 1MSPA 3C6LA 1XNDA 4GRLB 1UM5H 2ARJQ 3ETBF 1US3A 5DHVA 1SGKA 2OJEA 1PK6C 4DB5A 4U6YB 5DYOB 1RUI2 1S9XB 1EK3A 2DBLH 4HUWA 2J8OA 3CPWU 2RS52 4AQZA 1YN6B 3S3WA 1CZVA 4JF3A 1NLBL 3KYAA 4FABL 3K77A 4A2GA 4OLVH 1HHHA 1AD9B 1VSCA 4LVOC 1CQYA 5FWRA 3RBSA 1C1LA 3NQKA 2R4SL 1OAKH 1QJX3 2WO2A 3MV8A 5A1FA 3PG2A 4MD0B 5A7BA 2V72A 1MRFH 4HULB 3JXAA 1AD0B 2C9PA 4X0NA 4BZYA 2GI0A 4LL9A 4F91B 3HNTL 5C08B 1HHKB 5GSRA 2CDOA 1JF1B 1ES0A 1PKQE 2L7QA 3FN9A 4J8QA 2ADFL 5K0UB 5IFHH 1X5JA 3DC0A 3U46A 1RYYA 1QRND 4TSBH 4KWLA 4PQ9A 1ET7A 1M53A 4UOW0 2VMIA 3T1HB 4E9TA 4UOZA 2X5IA 4Q27A 3U14A 1XDTT 1H9PA 2VUYA 4WCYL 2ZKNA 5J3HD 4KQ7A 2NY4D 4OF7A 1LD9B 3V6OA 2APVA 1DLHB 2QKCA 1I9RL 1CXLA 3MJ9A 4BFIB 4MHRA 4N2FA 2OZ4H 5DZOA 3WV0A 4HFWA 2AH2A 3KGSA 1NCBL 1HIMH 1CCZA 3CFIC 1NCNA 1E5ZA 1SQFA 4LLMB 3FT4B 4W6YA 1C12B 3JBG1 5D9SB 4NHYA 2Q30A 2CH8A 2VLJE 3HKDA 1X50A 3QK0A 5EUOF 1L5GB 3P0YH 3CQFA 3DPBB 4XMLL 4BISA 1KWKA 2DH2A 1RINA 4K7JA 3I2OA 2VLRA 1X59A 1NH6A 4ZNEE 4LSVH 1VQPV 5B4NA 4L8DA 5TDPB 2RAMA 5M94B 1R081 1RZKL 4JN1H 4PLKC 1UAIA 1JXDA 1U8KA 5J1XA 1DUZB 1SKVA 1HXS2 1XQNA 1UFIA 4K9EH 3QC5X 3NCWA 5DQDL 3Q4HB 5EYPB 2X4NB 3LD8C 3S5ZA 5I18L 3PAYA 1MQKL 4GW5B 2K1EA 4M62H 2I9TA 1CLVA 4LSRL 5DYFA 1Y6MR 2YR3A 1QRNA 5DVPA 4UW5A 1OAUH 1POV1 2JB6B 3CZGA 1NANI 3OM3B 4BXVA 3BN9D 3V5DA 4O51B 3BP7A 1UT2A 4WUUD 2ZKXA 5C0NC 3S5LB 1QQP2 1MFUA 1ZPUA 3R4DA 4QTIH 2CHXA 3UPRA 3SPIA 2XZAH 4EFBA 2ZEWA 3FPXA 1VESA 4P5YA 4G7YH 4YN3A 4LP5A 1NR7A 3NJVA 4NB7A 1VQ4V 1THCA 2HRHA 4XQ4A 1ADQH 2VABA 2CNYA 1N70A 1XIWB 4PEEA 3RTQC 1LHOA 4LSPH 1ODMA 3KNBB 2C1PA 4RIRA 4JUTA 4JDZB 1PO11 4ODUA 3RL2A 1VGKB 2FATL 4HJIA 2WB7A 3WKMH 5AG8A 4W70A 4I5SA 4J3OF 4NKQB 1ZLUH 3OE7G 1BFOB 3U83A 1Q9OB 3KLAB 3TS8A 4E41E 3N41B 2ZUVA 2RMNA 4YJ3B 2AJZA 5C0DA 3WIHA 5KTEL 1W0YT 2TAAA 4HP5A 1MCRA 4YQXH 4KU1A 3R0RA 3O3BA 4M29A 3MF6A 3HG0A 4QKFA 1OPOA 1LP9B 3HRZA 1U8NB 1FG2A 4FFWC 4YFLI 1KTLA 3WTWA 1LJ7A 3MIBA 3ZU8A 4CCKA 1A5FH 2NNXA 5HDLA 4UDTB 1SVCP 5BYNA 2XHBA 2JB8A 4NXNO 3D2TA 3TT3L 2WDBA 4XVUD 1MDTA 5MERA 3MRKA 1WP8A 2HJFB 3CIQA 3URFA 1H0DB 3A5VA 1ORSB 2FX7L 4PP1C 4WSGA 5H35A 5IFTA 3R0MA 1A4BA 1O5DT 3L1GA 1VBB2 2YS8A 5C0AE 1CFNA 2WOBA 1PMJX 4KNTA 1UY0A 2VDML 3MLTB 2R27A 3IJ8A 4JBSA 2A9NH 1I8IB 5E1QA 3VACA 3S88L 5IW0A 4LWSA 4BK5C 1MHEB 1EFQA 4CVXA 4C7UA 3HPLC 1Q94B 2VLJA 5A7EA 1LEIA 4B4QA 2JNZA 4FHBD 1OD5A 5B1NA 4R8WL 2Y5TB 4COUA 4MD4A 4E0RA 4NWUL 4OZIE 3JD73 4ODHH 3DX9B 3WKYA 5CD5C 3IFLH 1ZHNA 1SJHA 5FGSA 5KC6A 4YIOA 5IT9N 1OARL 1XB8A 2GSIB 3CPUA 2D40A 3H9HA 1PLGH 2OPCA 4M3CE 3CFBA 5GJSL 3K59A 3GSRB 3D4YA 4IK6A 4YHZH 1CPMA 4BYYA 1WT5A 1ZVSA 1ESOA 2B14A 3MLRL 2LE9A 3OZLA 3CC2V 1T0NB 4GIPD 3TPUA 2IEPA 2DYSB 4AYID 4EZKA 2Z42A 4IHOB 2EIGA 4NXMO 4JI0O 2LLNA 5JR1L 2ZZQA 3O3EA 4K71B 3L7FB 1T1WA 1PVC2 4EEQA 2PKDA 1CI5A 1OQXA 1WW5A 3FX3A 5F32A 1XNAA 5IJCC 3UQ8A 1HAUA 2WYZA 3NYKA 5IEHB 5LLIC 3W21A 1XMQB 4YZ1A 1DBMH 4Y4FB 1R19A 2NY7H 3EOAB 3LNDA 1ND3B 4BJ0A 3PHMA 2XCMC 3E6CC 3L4YA 5EDXA 1G7HA 1UA6L 5HI3D 2DLTA 4PDWC 3QUYC 5CJOH 2IAMB 5ETUB 3GB7C 4PYHA 4AQAB 5LG6A 1IQDB 1JZ7A 3O5SA 2YLHA 4IEQA 1YNKH 3EMRA 3K0DA 5C4WB 1KB5B 3MN8A 1DZQA 5HYJB 5JSRA 5HHXH 4YDKL 2XV0A 5DD0L 1T2QL 4HUXB 3JALB 1EAPA 2PNDA 4LSTL 4JM4L 5DZAA 4Y4KC 2JI2A 3LZNA 2L7UA 3OXRA 1MS4A 1V70A 4PWFA 2I45A 1X5GA 1UZ8A 4HSAC 1A6AA 3QIUA 4B95C 3LMJL 2EC8A 4IS6B 4OLXL 4B9ZA 4E4EA 3WF1A 1Z0MA 5SWZB 4D7YA 5D2LB 4FULA 3KF3A 3V55A 1LO3L 4AGLA 4RS5A 3IJ9A 3VGAB 1AR83 1FGNL 4DK0A 3W82A 5KBNC 2V09A 2B9BA 1UCBL 4CVZB 4O2AB 1IAIH 2DQ6A 4W9KC 3D36A 5C7XL 5JHLH 3H7JA 3K03A 2FCTA 3IGLA 2KUTA 4P46D 5K1NA 1H2SB 1RY7B 3O6FC 3A4EA 1NBZA 4QNPE 1RZGB 2OMXB 3C9NA 1M5IA 1KJ3L 4IE5A 2NXZC 3VI4E 2QMJA 4G4FA 4N2BA 4IJTA 2CR3A 3K48A 3OG2A 2YGNA 3C09C 3D39B 1B0GA 1SESA 3MACL 2XKPA 3KHCA 2VUAA 1K8IA 4PY7B 2H94A 4YIQB 1GW6A 3V0EA 1IC7L 4N0RA 4Y5XC 1EHKB 5CYYA 2OXHB 3T6QC 4OZIA 1T5WA 1C8M2 1AI7A 3V7MA 2VAAA 1FNHA 1HL8A 4PJDB 4L0PA 3V8CA 3ZSTA 2FWOA 4Y20A 2GUOB 4LCUC 2YSSB 4WGWB 2W1QA 4CSSA 2OIIA 3BPOB 1FV1A 1QNIA 2QQWA 4WFEA 3IDYB 3ERXA 2W0FA 2W2IA 3R1GL 2WWWA 4N2MA 2EECA 1RUH3 4DRXB 3NA4A 4F57H 4BKTC 4O4HA 4PG2A 3WX5A 5F5IA 5I0YA 2EDTA 1G7LB 1OKQA 4B7IA 3B5LB 3DVGB 2DQCL 4I18A 4X1KB 5LBEA 4ICGA 3PGCA 4PJ5B 2VMHA 1REIA 4X62B 3BAXA 3JUZA 1KJ2A 5FGRA 2ETEA 3ARQA 5EYYA 1FVDA 2ZIMA 4GX0A 4JQXA 1SOSA 1DVXA 5GGUB 5KVGH 1AR1C 4ATEA 2F43G 1OTTC 1Q1JH 1R3LB 4P59H 3NT0A 4MVBC 4Z8BA 3GBWA 1JCVA 4KROC 3D12B 4S10A 1IVTA 2XL9A 3O9WB 4NR1A 4JQVC 1VQLV 5IUCA 2DBLL 1HDJA 3GMMA 3ZHUA 1HDMB 4M5ZH 1AR5A 1B09A 4BK4A 1Y4MA 3AL6A 1CL7I 5AC92 1A9EB 3F5WB 4TQEH 4OLVL 5FZLA 3QC6X 4XBEH 3QUMA 5E16A 3NSTA 1OT5A 4PTTB 2NW3B 1OAKL 3U6XA 4AT6A 4CN1A 2L04A 2DOSA 4BU2A 4IL6Z 5FA3A 5ICZA 1DGSA 1MRFL 1N3NA 2ED8A 4P9IA 4CP9B 3MRNA 1NUFA 2H2PC 4HZ1A 4YXHL 3VD5A 5DAWA 2Y72A 4KH9A 4B60A 4HEMA 1XTLA 2CLZA 1SQ4A 4I0XB 4JY6A 3ABUA 5FUOH 1UB5B 3BFQG 1SFYA 2WBXA 3HG2A 4K7PL 4PJCB 1OSZA 3IJ4A 3MNZB 4TSBL 2BVBA 3VBOC 1YITV 1A7NL 4HBQA 4X6FA 3ARGB 1ZDSA 2F7IA 2QSTA 3FONB 3Q13A 3S0PA 2X42A 1YN7B 2A0LC 2ZX7A 3DIFB 4JZNB 5J9PC 3MV9D 4XE9A 4KZCA 3MZTA 3CVDA 1E2VA 3IB4A 4R3SA 5KAQG 3CCHB 3NJMA 1EPZA 4Y33A 2OZ4L 4YGAB 5GLWA 4U1JB 4MA7L 4AM0A 3H7LA 5BZWB 3EG9B 2AQSA 5C8JB 1WZKA 1I8UA 3BDBA 1ZKAA 2CTWA 3EH4B 1XBFA 1A7RH 3ITQA 3G7TA 2AGSA 2RJ2A 1P69B 2QHRL 4XVHA 5CEXA 5DJDB 3NH7H 1L3JA 4LKFA 4CDWC 1CPUA 4OQ1A 1S0EA 1EJOL 1AR73 2E9WA 4LSVL 4OMCA 1J1LA 2CDEA 5LMUO 4JN1L 5ERLA 2Y3AA 2DOCA 2QQKH 4XX5A 3FN0L 1NICA 3EJTA 4XCEB 2WWUA 3OGJA 4K9EL 1A6CA 4OLUL 1QY4A 2OQ6A 5KVEE 1C8QA 3HC0A 5F9OL 3CCEV 4R90L 4M62L 5CP7B 5C0ND 2GNDA 2WNVC 4HZFA 5LEJA 3CBKB 1ZSDA 4PBDA 1NC4B 3QUGA 5DJ8A 1SA0B 3NFPB 2JCCE 3S3BB 4DFSA 1NDMB 4GQPH 2G4EA 2IADA 2ZAIA 3TBSA 4MJ6A 2Y4UA 3LOWA 2XJSA 4CH5A 4RGNC 1AANA 2LVCA 4YZWA 1WLEA 3MV9A 1BT8A 4J4PC 5I5IA 3RTQD 3FU8A 4QTIL 1UWXK 2WNOA 4JFDB 3ACIA 2VMFA 4WFGD 3AG4B 3KW7A 4G7YL 4RMUA 1RHI2 3K8MA 1KCBA 2Y6FA 1VZHA 2A5UA 1ZLVH 4O5LH 1ADQL 1OSPL 4RRPA 3RVZA 3P40A 4LSPL 4M7KH 1HRI3 1NPNA 3FB6B 1M90W 2WS93 3CCVV 1YMHB 4AKPA 4BCZA 3AXDA 1E8ZA 1DF0A 2E7DA 1LESA 2PAKA 3WKML 3GSUA 3HW7A 2PHTA 3RZHA 1YNTA 2QWPB 2J1RA 4HJ1A 3LD8A 1QUNB 3WE6A 4JDOA 4QKBA 3S5QA 2A6KA 4DNYA 1UH3A 1E43A 1L0PA 5HGHA 4IE4A 3DVIA 1GZ9A 4XO3A 4BXSV 3DRTB 4YQXL 4JI3B 5I24A 2KPNA 2FZ3B 3Q8BA 2R9RB 3ROLB 2R7EA 5A2JH 2HLAA 2WINA 4A37A 1OB0A 2ZICA 1A5FL 1I3GH 5EBWB 3U4KA 5C92A 4L4VD 2DTWA 3T4AB 3FLPA 1PZ7A 1RSOB 4V1DE 4M1DH 4OH2A 1XGUA 4GB31 2IOMA 3ORJA 1T1YA 5MENB 4OZGE 5BUVA 2A6IA 3RTQA 3M1BB 4CDQB 4ASMB 1MFEL 1QW8A 2B1OA 2WA4A 2V7NA 4ASLA 3NJGA 5C9JB 3F04A 2CO6A 1M9WA 2ZX6A 4QHMA 4E9WA 2A9NL 1Q72H 1T03H 1TZGH 4X6EA 2AEZA 2HFTA 4FG0A 3KPNB 2K2SA 1LVEA 2CLVA 4ZYKB 5CD5D 3VZLA 3CFEB 4AMWA 2ZHNA 4EZ4A 3UYOD 3GBEA 4HXCA 3U75A 4XNQB 5I19H 4J28A 4JV5B 1KF9B 4Z7OF 1TEYA 4ODHL 5C2BL 1FJ1B 3WN5B 3IFLL 1TQUA 3MXWH 1GMMA 2DCZA 4OFDA 1YEGH 3MUY1 4P2RD 2QQVA 5CFCC 2ICES 1ID2A 3ZN0A 2WVTA 2HPTA 1UWEH 1PLGL 2Y4SA 3LPWA 2PYTA 4GJTB 2ENPA 1HZKA 3D39E 2JENA 4TQDA 1KGWA 2DS4A 3BPLC 4L4VA 2FNBA 2PUSA 5GIRA 1KXQA 4TQIA 1L0LH 4UQ9A 3S3SA 1WQVT 3E8GA 1XV8A 1JGIA 2YAPA 3APMA 3O41A 3WNOA 1ZBE3 4UT5A 3RB5A 1KCUL 2E9BA 5EYXA 1OP5K 1KIQB 3UETA 1HYSC 4JL2A 3LKRB 5L6YH 4JVPA 4FOWA 3BOVA 5IBUG 1GN4A 4QO1B 4JI6O 3EH5B 2EADA 2H26B 5HD8D 2YHGA 4BK5A 2DQEH 2KG7B 3KB5A 4UQIM 3HPLA 2RD0A 4WM8A 4I2XB 1XGZA 4HZLA 4PW4A 2VH9A 1DBML 3PWVB 2NY7L 5C0JB 2CG9X 3M88A 1J95A 1LILA 4G8EB 3TBWA 2HYXA 1UD8A 3MYJA 3P0VH 3NIFF 5DZNA 5F3GA 4WM8C 5E4AA 3WMSA 1DBJH 2GT9A 2LABA 3P3RA 4KI1A 1A9BB 2WXMA 5EOQH 3ZSSA 2YSTA 4ODWA 5E8PA 2X6BA 3IMTA 1YNKL 3CDCA 4QYOA 5CZRA 5J6GB 3G9VA 4J3BA 1JYNA 3ZHDA 3BP4A 3FFOA 1EEZB 2FJUB 3DX0A 5GRJH 4G43B 3A23A 5HHXL 3WNXA 4FLOA 5CB4B 4P2RA 4FOYA 4F7CB 3D07A 4QHNB 5CN0A 4UVAA 4G8GD 3V0HA 3M1HA 3MBXH 4BCUA 5F2SA 3IJYB 2K70A 4XDLA 1OF3A 2YZ4A 3FHQA 3BYWA 4AVHA 4KGGA 3HBPA 3O6FD 4IEFA 1PZ2A 3P54A 5FZ4A 5G4OA 3E6BA 1WN7A 3LXBA 2MQ0A 5LGUA 1FKAO 3FYEB 3G6DH 5JHLL 4XAKE 1IAIL 2NXZD 1CDBA 1NCRC 1KELL 4AF9A 1CX4A 1TCRB 2VN3A 3VWKC 1U4FA 3QUYA 3H55A 1FN4A 3VFSB 3GB7A 3ELQA 3KPRD 4F93B 4OZIF 3RVUD 1EEYA 1TQ5A 4NPLA 4Y3OA 4JPVL 4A68A 4TYSA 1WIPA 2F54A 4OV6F 3CRRA 5IHLB 4S0SD 4W6XB 3NV2A 1A22B 1PFCA 2R061 2BSEA 3CLPA 1I3UA 4KQ0A 1DVTA 1BVP1 4Y4KA 2EVJA 2LAAA 4WHDA 1M2VA 1P49A 4J6RH 4FFVC 4ACPA 1GBGA 1WA0X 1JZFA 1PF3A 1NCUA 4RWUA 4G8GA 2E26A 2P8LA 1BMV2 5E4EC 1K2DA 3L3OC 5H5NA 1NOFA 5D8AA 3U9UA 2B5HA 2FJFB 5I6XB 3ULUC 2E63A 1I7RA 4U7KA 4OGQB 3O6FA 1JGDB 5EIIA 4F57L 5T52A 4HNAB 2YRPA 3S8WA 2FEDC 5EF3A 2I7OA 1PNLA 2BWQA 1AR1D 1PLBA 5KYYB 3DX1A 5KOMC 5JXIA 1AQKH 1MXDA 2JDNA 4JFED 5J4MA 1CB4A 3WKNA 2VXUH 4LEOA 1BEXA 1NQJA 3DHJA 4JVUA 4M6OH 4XPHH 3RWJB 3HIFA 3TOJA 2XWTB 5KVGL 3W58A 1IUZA 4Y5XA 1Q1JL 4P59L 3EUUA 3O65A 2D7QA 2NY3D 4AKOA 4LDEB 4PJHE 4TOYH 4OMDA 1UY2A 2K9ZA 2BNQB 4H0IA 3S36X 3ZHTA 1NVPB 2MKLC 4H5SB 4UT7L 4YDIH 3I2DA 3IDCB 4LCUA 4M5ZL 4MKTA 1U91A 1E4WH 4A6YB 1BBT2 1BE3H 4K0KO 3F6LA 5FF6A 4ZONA 1HNWB 2ZGTA 1ZK9A 4LFAB 2WLZA 3N43F 4W9ZA 3A2FA 3FK3A 5JOYA 2H2PD 5A7PA 1FZMB 2VOXA 4QB1A 1JH5A 4NHLA 4OJEH 4QPIB 4CXYA 3O12A 2F68X 3D52A 4Q1RA 3Q01A 5KMGB 2FYYA 4JKKA 5ACA3 3T0BA 2EE6A 2ZQMA 4L3ED 5ERWA 1W6OB 2J55A 2QKDA 4YW2A 1II4E 2J57A 3X12B 1AL0G 1OE2A 4KG8A 3DSNB 1OHZA 3PURA 2FLRT 3MRLB 5FUOL 4G1EB 2A0LD 4U1NB 3N3HA 3S3DB 1X9LA 3TCLB 4P57A 2Y8KA 3I49A 2Q67A 2WKGA 3EBAA 4JFEA 2W60B 4K4KA 4HLJA 4NKDA 2BTVC 3S48A 3SZKC 3FQUA 4UUJC 15C8L 3D3VD 4JQVA 4BHPA 1S5IH 4ETQB 3C5SB 3EKCA 2CUGA 2HVKB 2RFXB 1TLKA 5FY0A 4E5XA 5B66Z 2D0FA 4J25A 5FPIA 3ZDZF 1SCRA 1E2ZA 3H3PL 2OS7A 4K5OA 2PW2A 4WFFD 2CAVA 2C3HA 3U4SA 3ZMTA 1S3KH 3SIKA 1U5IA 2ARHA 1X5MA 4M0NA 4OQTA 4P3CH 3HS9A 1A7RL 4OKVB 3IDIB 1CAUB 3M3OA 1CIDA 1AE6H 3IFNH 1SLBA 5DJZA 1SBDA 5F9JB 1JW6A 3NH7L 4UM9D 3IEAA 3BVNB 5IJ9B 1J9TA 4A7KA 1T7ZA 1HB2A 1I4FB 4AJYV 3OKEB 3ACHA 2VXSH 4L3EA 1MEXH 2CSGA 4PHXA 4M48H 2BQPA 2QQKL 1UL9A 3TIEA 2IVJA 2X8KA 3VBOA 3KQRA 2OK0L 2D4FA 4HQQH 1R3HB 2GY7B 2E5EA 4RGND 2A0LA 4DK5A 2PCYA 5J11C 4YW3A 5J9PA 3ML0A 3FO1B 2P5ED 4J4PD 3U4EB 1FMD2 5DGRA 5FY9A 3O7OA 3JASA 3TX4A 3MRHB 4PS8A 4UOQA 1K5SA 3MLPA 2C3VB 5EQUA 2X2UA 1XEDA 2CJUH 1KTBA 4IRZA 1GLHA 5ADPH 1KZYA 4LDCA 4BSWB 1YNTF 1WZLA 1J48A 4HDIA 2V2TA 1QZNA 4NBXB 4FJZA 5AENA 1Q7YW 5IMOB 3TBCA 4Q6GA 3C2UA 4WFFA 1I7ZB 3ZKMD 4XACA 3ZN6B 4NQCD 2HPOA 4O5LL 4CDWA 1QSFD 4M7KL 2VE1A 5FM4A 4OKDA 3VB8A 3VDBA 4Z7NE 1KY7A 5M95B 4U1LA 3UAJC 4H2AA 4QRRB 1QSZA 1OCWH 4MCZB 2YFOA 4UM9A 3S6CA 1EAOA 4Q0XH 2FIKB 4E42A 5KJ7E 2K0GA 3LDKA 2X0VA 3ZDYF 4CS3A 1YYNA 2Z3FA 3SJCC 2BDNL 3AZUA 3QHFH 4UQCA 4WJ5B 4YDJB 1OHFA 1HOCA 2WNVA 1WVZA 5EC1C 2CIKB 3BYTA 4LQ1A 2R0LH 4GKZB 3RN4A 3OUHA 2X4SB 4LCCB 4G6AC 3S35X 2P5EA 4J4PA 4J42A 4M6NH 1E40A 1NIAA 4TLUA 1IS6A 4FCAA 4MBRA 4HIQA 2JIXD 1BQHB 2BP0B 5J12C 4FN0A 4XWOC 1T6GC 1L8DA 3CWGA 2WABA 4WNQB 4M8QA 2GJRA 2H2SC 4LASH 3U4BH 3UJQA 5CEHA 3MLYL 2ESVE 1XCTB 3JV4A 4MOAA 4NQCA 1Q72L 4RGKA 1QNZH 1AR91 4Y1AA 5K9JH 2XNAB 4G27B 3L3JA 1E27A 3LRHA 4ZPTB 4HUKB 4XO4A 4GWMA 3LZFH 3NNGA 1P2CA 5F7UA 1RH8A 4WHYG 3J80N 3O81A 5I19L 4A5UB 2GTZA 2WFPA 5KSAB 2XHKA 1VPOH 5IMLB 5DRXA 4JB9H 3T4HB 3KM1A 3K3OA 1UWEL 3Q9OA 2B8OT 4FXGB 1G6RB 4FNUA 3T77B 3TEUA 2LW1A 5FM5O 4JHTA 1VB9A 2CR0A 4FI6A 3UGFA 4TSAL 1F13A 4MTOA 1QBLH 4TQFA 4Y19D 5EO0B 3TNNB 4P5TC 3EO6A 4HFSA 5E1RA 4XN4A 4F7EA 1QJY1 2LFSA 1MREH 1VAKA 1N7ML 4DXTA 4JM2C 3EYPA 4XHBA 4NOTA 3D0VB 4P9ML 4D8MA 3BZFB 4JDTH 2ATPA 2OR8A 1OCZB 1P4BL 2DQEL 3O1RA 4PS7A 3ZE2B 3JWNE 4BXFA 2ZSVA 3DSFH 3HKCA 2VW4A 3AU1A 4Y4HC 2PXYC 3DX4A 3H3KA 3GJBA 4AQ1B 4B9FA 1JTZX 3KT4A 4RGMB 3P0VL 2Y0SA 3KXFE 4OD2A 3DMMC 1DBJL 3N7MA 1F4XH 4UQ3A 5EOQL 1RJZB 4ZAKB 2WLYA 1OP4A 5CFCA 2XWBB 3ZTJH 1JV2B 2WBJD 1HL5A 1SPPA 4XO5A 2P4EA 3CPLA 1WLDA 3FO2B 1NM9A 3JT0A 3TVMB 1NBYA 1ZGLP 5GRJL 1MW3A 3ZKYA 2R56H 4ODXA 2UY6B 2Q8BH 5IHZB 3OTOB 4B1MA 4PS4L 5FTTC 4WTXA 5ADOH 3QZLA 1HL9A 2ZG2A 4A3ZA 2AXHA 7FABH 2DWRA 3K6SB 5HDBE 1FZKB 1TVHA 3QUXB 3BZEA 2CBQA 1Q90A 5E23A 1XXNA 3OSKA 1QXRA 4J27A 4O4IB 1UJ3B 5BZZA 2ZEZA 2ZYIA 3L4CA 1JI6A 1MPXA 3UTTE 4LBQB 3MRBA 4PMFA 1YHFA 4X1YA 1PMYA 4CVUA 2J6WA 3RA7H 1KJLA 4ADJA 5T33H 1J9RA 3SDDB 1M6UA 4UNTA 4NHUB 5J1AA 4NHXA 2OT5A 3HKZA 3VFGH 2X89A 5DUBA 5C3TA 4ZMXA 2B4CH 2VCBA 3ILFA 2OQ7A 1NAMA 1IBKB 4N8VG 2Q9LA 5EH1A 1QR9A 4WWOA 1GFF2 1QLEC 1QQCA 2CA3A 4BH8B 1F5WA 3BXNB 1FAKT 4QD2E 3SDXE 5IY5C 4OCYH 3F84A 4BZ1H 2XN9E 1FNSH 1R5VA 5I30H 4NQEE 1OB1B 5LXTA 5IQ9A 3SQBB 1ZLWK 2YAHA 3LY6A 3GMNA 4GINA 3F6IA 4J6RL 3WY3A 3ARDB 3HG4A 1ZA6B 2VERN 3HNVH 3OKNA 2WLHA 4ERSH 5LBCA 1OZTG 4I3RH 4YM1A 4ZBJA 4F58L 1MIML 3HC2A 3L75H 2ARJA 3N27A 3N3EA 1JV5B 1OV9A 2FEDD 3CBJB 3M46A 3PP4H 5IB3A 1NCRA 3CSFA 3WB2A 1KULA 5A40E 3I3QA 2DQIH 3BAEH 3VWKA 2ZKLA 3F7YC 1VZIA 4ZTOH 1A3ZA 1PX4A 2CU9A 2F74A 1JMUB 1V6KA 4NZ8A 3CDGA 5L73A 2FZ1A 1LEKB 1AQKL 3FUJA 2BMKB 3K2IA 4HX1A 1UY3A 4IRJC 1CYGA 2VXUL 2E3CA 3AK1A 3MDPA 5IAVA 1DVYA 2P34A 4XPHL 1WD8A 4F83A 5B1JC 43C9B 4AOFA 3MCLH 1JCHA 5C0FB 5A3UA 4ZHQA 1T7YA 2E76C 3CHRA 4L1LA 2IMNA 3NCCB 5CHNB 2AJYH 4QTFA 4O9GA 1W0OA 1NCOA 2P4KA 3LKNB 3PWLB 4LBEB 4YDIL 1JGLH 3L3OA 4P5SA 3Q5YA 4W4ZA 5CN3A 2HWC3 2E7AA 1AHKA 3QUZB 5LG1A 3CC5A 1JWSB 2TSBA 2C9XA 3BGMA 4NZFA 3GCXA 1RZPA 3BVTA 4NHCH 4UI2A 2Q6AA 1G7JA 4RESB 5TK2A 1JGEA 2ENJA 2IG2H 4J3VA 3PL6B 5ABAA 3G6AB 2RMU1 4BUGA 2ZSWB 1HHIB 2NZ9D 4HJTA 3K8KA 3QDMB 3US9A 5IYZA 3DXRB 1URLA 5HYQA 4WVVA 4M93B 2I60H 3GZPA 1SDDB 3UTTA 5GJ6A 1IBHA 3UZQB 4EOWH 3QCTL 1ZZ9A 2PMZA 1TITA 5E1IA 2UXBB 1P4UA 1USZA 1BVKB 1DVFC 5FYJE 3ML8A 4JKWA 4L5FL 2VXRA 3CDYA 2VQFB 1PSKH 4L97A 4B3MB 3IDNB 3AROA 2BBAA 1S5IL 5DECA 2KQMA 1D6EB 2FL4A 2VD7A 3AK0A 2YBRA 2IZWA 2AP2A 3J27A 1SYVA 2I26N 3QXDA 4YNYA 1YNLH 2YB7A 3JAMN 1DJZA 1GOHA 1R3JC 5EO1A 1S3KL 1YJLA 4LL1A 3QW9A 4F8NA 4IV1C 1YUKB 3DYOA 4P3CL 5CSGA 5JMOC 1V9U1 4QKTA 1YDPB 3ZCCA 3KBEA 1PD3A 5CG8A 4QUOA 3AJYA 3ZDXE 3HN5A 3A8TA 2JDUA 3MTXA 1ASOA 4HIJB 3P4NA 3OY8A 4E4SA 3DWTA 1TQBC 5DSCA 2IU0A 1BGYH 2YPKB 3K6OA 3H8OA 2F8IA 2AGJL 4O4JB 2IPKA 2VXSL 1O7SA 2GJPA 2ZKYA 3BPCA 1MEXL 3CHXA 3MRCB 2A9HA 3QZOA 4PW9A 5DEGB 3S97C 3W81A 4PJHF 3BVVA 1F3JA 3VVWA 2C7UA 4YSAA 2ZUYA 1TFPA 2IBBA 4UUJA 5EN2A 3VD2A 3CDFA 3NRQA 1AHSA 2E32A 3NNMA 4YHOH 3EHBC 4H26A 2YSUB 3GS4A 1EUUA 4TNVF 4MCMA 4HL0A 3GF6A 3B8NA 1JYWA 4YHPB 2CJUL 4GXVH 2FH8A 4IU3B 4JN2A 4WM7B 4JO5A 1VIWA 4UXNA 5LYJA 2Q7NA 4M5TA 3FTXA 3RGVB 3VKOA 5JI7A 4KTDH 4YVNA 3SKJE 2ZD9A 4XPBH 3NEXA 3GSWA 2WUBH 3DBXA 3OB8A 4FL4C 2ZE5A 4R7NA 3UAJD 1GWMA 5AZ2H 3POJA 3GRWA 3IFPB 5LGJB 3ULSB 3GXMA 3VFRB 4R4NC 1WRFA 2D7NA 3FFDA 3VG9C 2YIBD 2Z31C 2NLJC 3OMIB 4N7IA 4XVTL 5JDSB 5ALBH 2DI7A 1HSBA 4DR1O 2PR4L 4GP8B 4K3GA 1JTOA 4Q0XL 1QP1A 4DEPC 3WAJA 5BS0E 1C08A 2BNNA 2P7TB 2CBMA 4KDVA 1OPGH 4YHHB 4JDEA 1ZMYA 1FSKC 1F1DA 3AP9A 5GISL 3Q0HA 1AC0A 2HWB1 3B7YA 4KKNA 4CUBA 4IL7A 1MVUA 2R0LL 4U3XA 1CONA 4X20B 3FRPG 4XWOD 5BNPC 2DCJA 5I5RA 5L2JB 2VUCA 5H6QA 4B27A 4LAJH 3T04D 4DO4A 4F20A 4BZ4A 3B69A 1C1EH 3ARSA 1UB6A 3AM8C 5EOTA 2DL2A 3S4SA 3TJPA 3VYNA 4GG6A 2VOWA 5ISLA 3ZL4H 1U33A 4ZOEA 4LF7B 4JY4A 5DK0A 4O58H 3S5LG 1QABA 3GSOA 3UABA 5A43C 2YFUA 2W0KA 3QFGA 4U1GC 2QJVA 4ZOAA 3MRGB 3U4BL 2BY2A 1PVXA 1CXKA 2R15A 5BZXA 2JDPA 2XC8A 5L2KD 3UAJA 2DLIA 2WKKA 3ZFGB 5D2NC 1XPWA 5KAFZ 1QNZL 3BWZA 3NUKA 1A7OH 1S9VA 5K9JL 1W72A 1J05A 3BH9B 2N0MA 3UGUA 1XCWA 1ZHLA 1X4ZA 2EE0A 4G8AC 2Q87A 4EBQH 3QVNA 2XKNA 3LZFL 4BKSC 5IUQA 4Z7UE 4LLWA 4XC1H 5HPMB 5EC1A 1KQSU 5CFDC 2D31B 4C56B 2VQ1B 1PGL2 1BMGA 2DCYA 2GU9A 2F7QA 1ADWA 1VPOL 4DFHA 3CZUB 3RVYA 2WIMA 4XN7A 2BU9A 3FHIB 4YNIA 2X5PA 4JB9L 2JQZA 2BERA 4MDIB 1TJGH 4YSQA 4JZJC 3GGLA 1FFPB 5JHAA 5A1LA 3AT0A 4JM2D 4WI5A 4GKSA 2PWGA 1W8FA 4IOSD 1DSFL 3MC0A 4P49A 1CJPA 1QBLL 3ULVE 1DGRN 1R6KA 3I6GB 2DFBA 4DUYO 3S57A 1MREL 3S3CB 5C71A 2WYFA 4NSKB 1MN4A 5A33A 4F5CA 1UU4A 2PXYD 3SDAB 4R5VA 1QH6A 4EQVA 4CMHB 2ARXA 4JDTL 4K3DH 3CCJV 1AJQA 1AOZA 2W94A 3EJCA 2DV6A 3BUIA 3DMMD 3GHEH 4RGGA 3DSFL 2D03H 3UAFA 5E1GA 3LSEA 1B4TA 2UZXA 1KB9F 2ILMA 4PY8I 3EGXB 4OJYA 5FYZA 3CVHH 2P43B 4AGVA 3UDWC 1GJIA 1HAWA 2VN5A 1F4XL 1P5VA 3OGSA 3KYKH 3QDJD 1SQMA 4NKOA 5FO2A 1FPN2 1GNZA 2GJZA 2R8SL 4UU9A 3KL0A 1TTUA 2X1QA 5KANG 1M2OA 4YC2C 4HHGA 2EUZA 1HRI2 3LV3B 3STBA 3VFWB 3B34A 2WTRA 3IGAB 2R56L 1NGZA 1FNAA 5B21A 1I85C 4G6FB 4P5TA 2ZS6B 2Q8BL 1PJ9A 5TE7H 1Y9MA 4N5EC 1FAFA 1M71A 2OZNA 1A21A 1YPZB 5EU4B 5ADOL 5C0IA 4JM2A 3ARZA 1ERNA 4IOSA 5CLWA 4WVMA 1FGVL 2B59A 4ODVH 3D08A 4DHLA 1LHNA 3GZUC 4WFBV 1PAMA 3OT7A 3JU9A 1OWRM 3W9AA 1P84F 1AMYA 1O6SA 3DVFA 4FGMA 1RXGA 5IYDO 1QFOA 2X38A 4Y4HA 1DDHB 2PXYA 3RA7L 4XIOA 2Z4QA 3PY9A 5IJRA 3KR3L 5A2LH 1RZFH 3SE3C 5B3SC 1I7TB 5T33L 4LHKA 2ITFA 4GUPA 3DMMA 4IOIA 3VFGL 3JWDC 4HIXH 4MJID 2R043 2B4CL 1S9YB 5J09A 4Y89A 4GYBA 1NQDA 1HFUA 2WJ7A 4AYBA 4GKNA 2XYCA 4X4YA 1A6ZA 1KJVA 5ACMA 4HWBA 5DHVH 4I48B 3JTBA 4GRWB 4H8HA 4FI9A 4OCYL 4BZ1L 5ITBH 3B2XA 1NGYB 3GZTB 4G9FA 4YGBA 4U1KA 5ID0B 3EF4A 2GTWA 2R23B 3EO9H 4OGYH 1T3FA 2A9ML 2OR9H 2YD1A 1V6LA 1RUF3 1BJ8A 2UY7A 4ERSL 3V4VA 4MZ3A 3FBQA 1AVBA 1MWAB 1S7TA 1N2RB 5I6NA 4EO5A 5IB2B 1MLBB 4J12A 2CM6A 4KMLB 3ZY7A 4EN3B 2Z8SA 1OLMA 4FJ6A 5CA1A 3CZFA 4JHZA 3TN0C 1OAZH 1BA9A 1W6MA 4XF4A 5K1VA 4W81A 3IDXH 1A6TA 3VNZA 2DQIL 3MROB 3BAEL 4NJ9H 4NWVA 2ZOLA 4ONGL 4PD4F 2ZONA 4LLVA 4ZTOL 2QSAA 3FFCB 4D3CH 1TE1B 3HKEB 1L7QA 1UM6H 1P5UC 1RJYB 2W59A 4LOEA 3PWNA 5A2AA 1ENQA 4K9SA 3L9DA 3PGDB 1QEWB 4HZAA 3D8MA 1JFFB 5BQ7B 5KX5A 1B2WH 1MHCA 3RZWA 3ULUF 5IDJA 5EU5B 1XB6A 5EIYB 5I8YA 3MCLL 1HEZB 5F3CA 5I1JH 1B3IA 2OMYA 4F3FA 4BQXA 5D1QC 1CD1A 2AJYL 1WICA 3GKWL 4A66A 4K8RB 4I1NB 3V4UL 1AY1H 5HDBF 5T1MB 2XPZA 4NNYB 5CN2A 3B8MA 4QX0A 1J8HD 5KUMA 1JGLL 4XVJH 2E8ZA 3HG1E 5CA6A 3GJFH 3KGZA 2XG5B 1OF0A 3FT3B 1RUPL 4TV8A 5E2UL 4XEZA 5TF1H 1MPAH 3M45A 2VZSA 5G5DA 2VDLH 4NHCL 3F7YA 3KWWA 4IJ3C 3WNPA 2IG2L 2WZPP 1A32A 2UXGA 4X88A 4FFYA 4M7LH 4NENA 1NCDL 4IRJA 2XBTA 1UGNA 1DVFD 2I60L 1H38A 4DGIH 4N2KA 3AP7A 4M7JH 4Z07A 5B1JA 2P24A 3SGKC 2ETNA 1QX1A 4L8BA 3WNNA 4IQPA 3Q8AA 2ZPKL 1V05A 3ZE1B 2ZWLT 1IM3D 3O4OC 3MV7E 5L4MA 1NLDH 1PQZB 4BH7B 1PSKL 1PIGA 4XMZA 4TTGA 4P2QD 1Y3TA 3ARWA 4O4YH 1FI2A 2PCPB 1GWKA 1P7KA 2R29H 3GLAA 3UO2A 4BUHA 1ZV2A 1I31A 2WN3A 5IVBA 3BAWA 1HHJB 2QPEB 1EXUB 1DANT 2XQBH 3AUWB 1YNLL 3BQVA 2UXDB 3C8KA 1J8HA 3RWEB 4GOSA 4ALAC 4QRFA 3BRGC 5K9YA 3E6FB 2YUWA 4P9XA 2EDXA 2Z93A 2ZE7A 3RI5K 2LFGA 5GS0C 2UYAA 3HNSH 3QXWA 2B8MA 2XJQA 4QE7A 1FCCA 1WTLA 1TKWA 2YMOA 3LTVA 2YEZA 4PRIB 2H6CA 5D1XB 2YN3A 2Q76A 1RIVL 3MODH 2C26A 3Q9QA 4UOJA 2YPDA 3MIDA 4IIZA 1WLTA 2CBPA 3JWOC 1NGXB 4PJIB 5AUMB 5IVEA 5SWQB 3WIHH 2I5YH 3W0WB 1LHWA 2P5WA 4KQ4L 5DN2A 3USUB 4DP4X 1DVFA 2ZE8A 1I1RA 2A6DB 4WW2B 4DR5O 2QLVB 3LA7A 1O3TA 4PGBA 3OMAB 1ULVA 3J7HA 3QNXB 3W1ZA 3AMPA 4YHOL 4YW5A 4XZ4A 1V6MA 1CXFA 2ZG1A 1A9VA 1FVEB 3CLFH 2YEVA 1T83C 5C0GA 4LPTA 1RUE3 4QWNA 4FAAB 4HHAB 3W9DB 3MICA 4KI5D 5HVHC 4ZXBC 4HALA 4CUCA 4GXVL 3O2DH 4X5QA 1WW4A 1EVUA 1R3JA 2JDHA 4P2QA 2QZ3A 5LATA 2Y3NA 4IV1A 1J18A 4NUQA 3TA3B 1Y7BA 1VACA 4FAGA 5JMOA 5E5MB 2RS11 4MX7B 4XPBL 2Z31D 3T0EE 1POV0 2WUBL 2IPTH 4JRAA 3O11A 4Q74A 1GHFH 5AZ2L 4RR3B 2A4CA 2WP3T 1U8CB 3SPVA 1LO5A 2FBJH 3MRMA 1V3LA 4AIOA 5KBLA 3T8VA 3WJMB 2HRLA 3WFZA 3UZVA 4DGUA 4OZ4B 3K5OA 3MRDA 1NDGB 4RA3A 4R7DB 5I76B 2G5UA 2JGDA 2Q0ZX 4W93A 3L45A 3L9RA 5GS2D 1OPGL 2BY3A 3TESA 4GG6F 1VALA 5IYCO 1IBDA 4OD1L 5FPXA 4BQ9A 2VLKE 1U8MA 4LF5O 2XX0A 1G9CA 2F7PA 3A6BH 5FYLE 1XH3A 5ACA2 2KZWA 3L95B 2UUBO 4HMEA 2DN9A 2CNZA 5H6RA 4DQOL 4F2EA 2ZYRA 4MJJA 1XSRA 2PHRA 3SC7X 2YXLA 1B6DA 2ZD0A 4QRSB 5FYKU 4TNFA 1GNYA 1C1EL 1T0MA 2V73A 1MHHA 5CSZB 2DUPA 1BZWA 1MH5A 1OD7A 1YRKA 3HFMH 5EU6E 4MGYE 1S5HC 4LPWA 4O58L 4GD4A 2XVGA 1BVOA 3WIFB 3OTTA 3D6GA 4GLRI 2DQFB 2QQOA 2RM23 4FFHA 2Z31A 3H1ZA 2NLJA 4HLZH 1YPZE 1R092 1XCXA 1N36O 3GJEB 2G60L 2YICA 1JPGB 3WELA 5KN5B 4Q4X3 4NTYA 2GFBA 3GMOB 1HR0B 1A7OL 2VWKA 3GCWA 2CL2A 2E8YA 2C9RA 1N8RW 1AVMA 1I9IH 2Q5TA 4NN5C 5I0RA 1H1MA 4MNQB 1TG8A 4HMCA 4ELKB 2ZR2A 4MMZB 3LDBB 4XC1L 1GQPA 1PM7A 2MHAA 3SO3B 1J3RA 1BM7A 3VW3H 1U8QA 4GA9A 4NQXA 5BNPA 4X64B 1EPFA 4TQHA 3THCA 3ZPYA 3QORB 4IEWA 4K2UH 3GO1H 5C3LD 3AM8A 3SE8H 3HA0A 5IJ0A 3UG5A 5HPOA 5JCOC 3RI9A 2BHZA 3A24A 5IOPA 1ZRDA 1RP9A 4QQOA 2B77A 2KZKA 1AXSB 4GRLC 2VR4A 5A7WB 3VFNA 4MCYB 3SNMA 4LJHA 4A7VA 4JO1H 5C09D 5D2NA 5JUEH 5CU1A 3UM7A 3DXAD 3J7AU 5GZEA 4K3DL 4Z0XA 2FB4H 5FLUA 2NNAB 1JK9B 2D3NA 3GHEL 4NGHH 1AL21 3BHBA 3QQ4A 4OCMC 3DX7A 4UTAA 1LNUB 3POSA 3P4MA 4PGDA 2L35A 3FZUC 5CFDA 3VRJA 4J6GA 3AFLA 4WV1B 5B7MA 3CVHL 2Y69C 1CLYH 1UKTA 1HLCA 2JDAA 3FFQA 2R2HB 2Z7ZA 1NEPA 4JM2F 4MNHB 4OZXA 1ZEAH 4LUMA 4BM8A 2A6JA 2GW5A 2ARAA 3FFCE 5DC0A 3SCMB 1V7MH 1CQ9A 3G5YA 1TME1 4N5ED 1AZVA 2Y6SD 5L36A 2CHDA 2ZF9A 4JZJA 1UOVA 3QJSB 5L8JB 5KW9L 3LPGA 3WJLC 3QQDA 5CCJA 4YGVA 4AUJA 1A3KA 4U49A 4J3TA 5K0UC 5TE7L 2XIDA 3RRQA 3I6SA 3E5QA 2FECL 4LSQH 4GXUM 3QSKB 4AR2A 2DM7A 4ODVL 4F1SA 5J8OA 2RS31 2EDBA 2BP8A 3F05A 2QKAA 3OMZA 3J8F7 1WA1X 1GGBH 1A7BA 4QXVA 4X9YA 5CNHA 35C8H 3RIFK 1BPLB 1NZCA 3WB1A 3NJXA 3WS3A 4E4ZA 4Z7UF 2Z91A 5C09A 3T6WA 2Z35A 1W2UA 2PYFA 2BRRL 3DXAA 1NCHA 2E31A 3RQ3A 4I9WD 1RZFL 1WIUA 1KJ2H 4HJ0C 5HHNB 2C3WA 1PL4A 1VQ5V 4HT1T 2BP5M 3KGRA 2KZBA 4HUNB 3UDWA 3U4AA 1G9BA 3NG5A 1N6VA 3EYVB 4UAPA 4ZKTB 1DQQB 1M6OB 1TTAA 5L3DA 2PYEB 3OB0K 1DJIA 3QIWB 1HWWA 4NRYB 1KN4H 2PO6C 4ZUTA 1A8JH 5HTSA 4AWJC 5C33A 1IAKB 4WCEV 5TSWA 2GNTA 2LLGA 5ITBL 2OT7A 4PBOA 3OCPA 1I85A 1M05B 3F83A 2XJTA 4NUJA 4YX2H 1DP0A 3D25A 3EO9L 4OGYL 1K34A 2OR9L 3TN0D 4D9QE 3C90A 3ZTEA 3ILNA 2Q0OC 3GLDA 4C59B 1CR7A 1WLWA 2A79B 4CADA 3QUMH 5GS2H 3P6BA 4KXAA 4JG5A 1BLIA 1IJNA 4I13B 5D6CB 4AIEA 1XH0A 3GI8H 4CC5A 3KPOA 4CGTA 5ISZB 1F4YH 4PA9A 3B9KB 2XUEA 4NXMB 5HVWA 1CZ8H 5F7FA 3AFGA 3IDXL 3BB6A 3TN92 1DZRA 3BVCA 1G7PA 1OW0C 1NCIA 4N6RA 1MNUH 4HS3A 3SE3A 1FOD1 4PR5A 4FFZL 1R5IA 1WDAA 3Q6GH 2C9AA 4Z1VA 4ZMAT 5MEQB 1HV0A 4D3CL 1HEJC 1JNHA 4H44B 5C0BA 1X5HA 1B6QA 1XIWC 1KN2H 2Z7UA 5D1QD 1XGYH 1U8JA 5D1XE 2FT7A 4MSWB 5DURB 3H9SB 1DYZA 2P8PA 1B2WL 1W6PB 3OGOE 1WA8A 2OQJB 3ZR5A 1OA2A 2AEPH 4DZGA 5I1JL 2G5BB 4A38A 2F4PA 3ZO0B 3HZMB 4JKMA 3FE5A 4P06A 3K3NA 3AEIA 2AEOA 5I1KH 2O5ZL 4JFOA 4GIAA 2RN9A 3KJ6H 1OE3A 3HVNA 3PUUA 1GZPB 4LVNB 2K3HA 1BP3B 4NQVB 2OW4A 2X53S 4QX3A 1QFHA 3AYDA 1ZRUA 4HFUL 4Z2WA 1B3JA 1QI4A 4C90A 2IWKA 1S55A 5I6PA 3TN0A 1G9EA 3V0VA 2F1BA 1XR9A 3CIHA 2BFVH 3QZMA 4YRDA 1MPAL 4CA4A 2HLEB 1Y9QA 4RMBA 4OHZA 1GC1C 5DUUA 1TUPA 2F8VA 3DHPA 3OF1A 1MZ5A 4XDJA 2HJFC 5JAXA 2X40A 1P5UA 3D85D 2BIMA 4M7LL 2N3JA 2BSKB 1FO0A 1NA1B 2X2YA 4DPCX 4ADGA 2A99A 1OA4A 5D96B 3VI3B 5HJBA 1HB3A 1DLFL 4DV5O 3G3LA 4PGEA 3ZDSA 2ZMKA 1HNGA 2HKFH 2NSXA 4EI6B 4HUVB 5AALA 2DBNA 1EUTA 2QVMA 3QT2A 2Z7YA 5D1QA 1RZ7H 4Z6AT 1JHKH 2AVFA 4K3JH 4H25B 3MIFA 4MZIA 3HI1B 4QOKE 4XR8C 2EIMB 2HG5B 1NLDL 4LLYA 2OMZB 4Y0GA 1VBC2 5C0CE 2BUKA 3MIHA 4O4YL 1QLNA 3ZHLA 2R29L 3O4LE 1W9WA 3LCYA 1O9VA 3BDXA 4RMRA 5EBGA 3CS5A 5GS0D 1RITA 2CY6A 2CUIA 2XQBL 1PZBA 3P2TA 1CZSA 2HVBA 4PJAB 4WO4B 5FAXA 1IHMA 4MFHA 5SWSE 3K4AA 5D7SL 3DURB 4P9PA 4GS7B 3CFKA 1YEKL 3BD3A 4OTXH 4R8HA 2VDNB 4KWJA 5B38B 1DJHA 2DKSA 3MODL 2RV9A 2YROA 3REWA 2BVOB 4NQSA 1UYYA 5LMNO 2DYSC 1IBLO 1CR9L 2JJ6A 1S4CA 3BIKB 1EYBA 3SGKA 4K71C 5IF0A 1UQXA 4BA6A 5FQ0A 1CE6B 2QT6A 4PJ9B 3IB3A 3U1SH 2QDOA 5I74C 2CO3A 4H55A 2JE7A 3PJNA 4QCIB 1DFBH 3GIZH 3PJSK 4ZXBD 3KCCA 4LBKA 1QSED 2YRZA 4Y4FC 4QGNA 1JVOA 2R2BA 2DM4A 3CEIA 3O9OA 1SXBA 3LH9A 5GRUL 3MUUA 1ND3C 2ARCA 1ZX3A 1AI6A 4GIOA 2WXRA 3C5JA 4R6ZA 2DMGA 2IAMC 3VXTA 4K20A 5E8AA 1IQDC 5H37H 1WWAX 3O2DL 4R5TA 3L5XH 1AO7E 1JI1A 3PJLA 4PREA 2JWPA 3OW2U 3ILQC 1J9CT 5C4WC 1U3HB 1WAAE 2B5IB 4ZOLA 4M9OA 4D0CB 3O0XA 5FK9B 3RVTC 1IURA 1R4XA 4L11A 3UTPE 2IJIA 1GHFL 4NO0A 5D8JL 1N4CA 2ICWJ 2OMVB 2FBJL 4U36A 3C60B 4K9JA 1XB9A 1XGTB 3PJSB 5GGTA 1V0AA 2GZWA 4HONA 1MG3C 1RUOA 2YPVA 4I5BB 3ZT6A 4TNWK 4JYBA 4M8UA 2XDHA 2VDOH 3M6DA 1TJXA 3ETBJ 1UKGA 1I0HA 4Z92B 2GBAA 4N9GA 1QFWM 3FTGB 4N8VA 2OKMA 2WM0A 3EYFB 2XAJA 2MQGA 1DDLA 2IV8A 1UOWA 4RETB 1T83A 4N7UA 2P2KA 1IQWH 1NMCC 1AYN1 1EDYA 4WKZB 4ZTPL 1X5ZA 4ZXBA 3RVWD 1QSEA 4XP5H 5APAA 2WWKT 4LF9O 1BZ7B 2AJ3B 4GMSH 3ICXA 3O1PA 1Y74A 4K21A 1W9YA 1XBLA 1SJXA 3DTXA 1OLZA 4KTEH 1IBYA 4QTHA 4O4LB 3HFML 5JJJB 5JA9A 1VF7A 3K9SA 2V4LA 3O4LA 4MWFA 3C75A 1CVNA 5HGBB 3NDYE 3G6BA 3RBZA 3NMEA 2BVYA 2NCMA 5GGRB 4QRPB 5EZJB 4TV3A 3QJUB 5FO9A 4IOFC 4UQDA 1CBJA 5HYIA 3P73A 3BPOC 5DJ6A 2ZACA 4YMPA 1I9IL 3HZKA 5LMUB 5IHUH 1GYUA 3IDYC 5C8CB 1NMBL 2E75B 1E1QG 3D7PA 4NO5A 4ZMQA 4A7YA 1NWOA 3JTTB 4BFNA 1OAQH 1M3JA 3BPNB 4Z7VE 3GXIA 4BQ2A 3VW3L 5FFGA