3RGBA

Crystal structure of particulate methane monooxygenase from methylococcus capsulatus (bath)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
382
structure length
382
Chain Sequence
HGEKSQAAFMRMRTIHWYDLSWSKEKVKINETVEIKGKFHVFEGWPETVDEPDVAFLNVGMPGPVFIRKESYIGGQLVPRSVRLEIGKTYDFRVVLKARRPGDWHVHTMMNVQGGGPIIGPGKWITVEGSMSEFRNPVTTLTGQTVDLENYNEGNTYFWHAFWFAIGVAWIGYWSRRPIFIPRLLMVDAGRADELVSATDRKVAMGFLAATILIVVMAMSSANSKYPITIPLQAGTMRGMKPLELPAPTVSVKVEDATYRVPGRAMRMKLTITNHGNSPIRLGEFYTASVRFLDSDVYKDTTGYPEDLLAEDGLSVSDNSPLAPGETRTVDVTASDAAWEVYRLSDIIYDPDSRFAGLLFFFDATGNRQVVQIDAPLIPSFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Methane monooxygenase subunit B2
publication title Crystal Structure and Characterization of Particulate Methane Monooxygenase from Methylocystis species Strain M.
pubmed doi rcsb
total genus 95
structure length 382
sequence length 382
chains with identical sequence E, I
ec nomenclature ec 1.14.18.3: Methane monooxygenase (particulate).
pdb deposition date 2011-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04744 Monooxygenase_B Monooxygenase subunit B protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.710 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3rgbA02
2.60.40.1580 Mainly Beta Sandwich Immunoglobulin-like Particulate methane monooxygenase, b subunit. Chain: A, domain 3 3rgbA03
2.60.120.570 Mainly Beta Sandwich Jelly Rolls Particulate methane monooxygenase, b subunit. Chain: A, domain 1 3rgbA01
1YEWA 4PI2A 4O65A 3RFRA 3RGBA 4PI0A 3CHXA 4PHZA
chains in the Genus database with same CATH superfamily
2QJDA 2F18A 2B9ZA 5BZZA 3UG4A 2K4AA 2ZE7A 4DGUA 1IE5A 1OD3A 4LVHB 4U6YB 4C56D 3U1QA 3I84A 2UXTA 3AZVA 2IH3B 3QUGA 5FCUH 4BD4A 3C2AH 3LDCA 1WH0A 1OWRM 3RJRA 2VAJA 1ULFA 5SX5K 3BVUA 5TQ0L 5E8NB 4AW7A 15C8L 1M90W 3B5GA 2LROA 2YMZA 2PCPA 3HPLB 1ZWIA 4TLGA 4QIWF 4AYBA 4LBJA 2BC4A 4D9QE 2Q8OA 1FV2A 4MTFA 1S46A 4LIQH 1QLEB 5GGQH 3L6FA 5BZDB 3FAVB 3HI1B 4GMP0 2YC0A 5GRYA 3SJVE 3W11D 1JGLL 4E9QA 1QNZL 1JCKA 1UT1A 1WFOA 5D7SH 3RVUC 4HBCH 1ETZA 1JF6A 1LP9A 4G6KL 5CUSL 3LYRA 4Y4HC 3LSUA 3PGDB 3UTZB 3UT5B 4O51B 1X7TA 4DETA 5TJWK 1AD9B 1CXEA 1IGML 5DS8B 1SM3H 2HSIA 4QWWD 3KXFA 1J87A 4JI3B 4LFBO 4YGVB 3M1CA 4ZFFA 1KFAL 4PJAF 5IBLC 5INCA 5FYTA 1I3RB 1VAKA 4WBBA 3MRDB 1BZ8A 4O58H 2DB8A 4N25A 3VXRE 4ZMNA 4WBNB 2BSKB 1PQZB 1XSIA 2WBJB 4TQIA 2DTML 3CBRA 3F85A 3MLVH 3B2MA 4JFDB 5BPPA 1IQDA 1S0CA 3WCSA 1XZ0A 4JDVA 3CU7A 2KQXA 1CYXA 5I0RA 4F6EA 2RS51 1NQDA 3LEGA 5EUKB 3P3NA 1SQQH 3GNMH 3QHZL 3UBFA 3ZKUA 3X29B 3R65A 2L7EA 3FDWA 3KPMA 4MAUH 1S0JA 1UU6A 4IOIA 2JDNA 4AEDB 1GL4B 1DF4A 5IM7A 3BMWA 5FUNA 1ULEA 4QPGC 2VD7A 3BLBA 1Q94B 3CC2V 3K4DA 4YFLI 1N7ML 2ATKA 2ILMA 4QXTB 1RCYA 5ANNA 3NZUA 4JFQA 1F6FB 2ZGRA 1JMKC 4JLRB 5HI5D 2Y06L 1W6MA 1KPRB 2BNRD 4EI5A 5K7PA 3IT8D 3HNTH 1UZ6E 3AL5A 2FL4A 3JASB 3FSZA 5L2KE 2DUQA 3AKSA 5FZKA 3QNEA 2EIBA 3JATA 3OD0A 4YMPA 1RUMH 4YHIA 2ARCA 4XMLL 4Z1PA 2BP0B 4U1JA 1NAKH 5CU5A 4AIZA 3IBMA 4DS0A 2XAJA 3APCA 3FK3A 3GMOA 3BRCA 3MU3A 1FZJA 4PJFB 3Q4HB 3X14A 5J9PA 3QE5A 1NY71 3WNXA 1R3JB 1IAII 1T83A 2F7OA 3WL9B 3KV5A 4Y26A 1EO5A 1RUC1 1FFTB 5B22A 4JFFD 1EMTL 5K39B 3RUGF 4AIXA 5T33H 1HNFA 4TNEA 4Q4V1 1N8OE 2HWZH 3MBWB 3HRZC 5K9QI 1C8QA 3S5LB 2YICA 2WLJA 4Q2ZA 4RMBA 1R081 3MI8A 5A1FA 3Q8BA 1I9JL 2R51A 4IRSD 4JPIB 1ZTXE 2XTSA 3ZDYE 4D6RA 4AG4L 3VHPA 4YSSA 3BKCL 5IHHA 1R1A3 3U7YL 4PY8I 4IEFA 4NQDD 4QM8A 5FUPA 3ILPB 1QSFD 3VFVB 4NC1E 4HUMB 2LQTA 1OF0A 3KYMB 3ZX7A 4EFEA 5JJNB 2VSKB 4N90E 5EBGA 3VWKB 1KD1W 1EAH2 1XF3B 1GR3A 2W46A 1OHZA 4NPYA 1JUFA 2X2HA 5SWSE 3DJZA 1FCCA 3TJPA 3UKTA 1PD0A 2JTYA 1MH5B 5D93B 4QQPA 2R1YA 3VB8A 3C7OA 3BW9A 4HHAB 2F4LA 3TP4A 3A4DA 3OPWA 1FZMB 3DGTA 4OAWA 5DRNB 4TQFA 2VZSA 3DETC 5L0QC 5DTFA 1MZFA 4UYPA 2NT0A 1HRV2 4ZS6D 2B7YA 2PF6A 4X20B 3IMRA 2F7RA 4MQ7B 1PY4A 2V9UA 2OIEA 2CDGB 5D2LF 5A6IA 1BVOA 2DTWA 1HI6A 2XZCH 2VMIA 2QQNL 5HVWA 3CTTA 2I26N 1D2SA 5AVAA 2MNWA 3B9KB 5CADA 3I6KA 4PG2C 4KVNH 2OJEB 5TH2B 1C5BH 1JNNH 1SJEB 2XT9A 3KWXA 1FSKC 3SDDD 2AMGA 5CJXA 4J3VA 2YUZA 4JYBA 2Y4SA 2CAVA 2WNUB 2BY2A 3ZFEA 2B4CL 3ECBB 4RGMC 2OYQA 3FU8A 5H37H 1H8TC 9CGTA 5LKNA 3CZFA 1JPSH 1G7MA 2B2XL 1W0VA 3S98A 1YEFL 2IWGB 4LP4A 4EOWH 3E2EA 2XKUA 3Q8AA 3NFSL 5LP6C 2L3BA 1WD4A 5ALBL 4ORFA 2YGQA 3BKMH 2GCYA 1DVZA 2FD6L 4PRPA 5K69A 2X42A 4K7JA 1CN4A 1HCYA 3MJWA 4LBKA 5B3JE 1FC2D 3P0YH 1EAPA 5J11C 3K5SA 5F9OH 1DQ5A 3L2HA 4CCJA 1FBIH 3VD5A 1NEPA 1X8MA 5A2CA 1BLNB 1BZDA 1RUH2 4POZC 4NN7C 4P59L 5D71H 2RS53 2Z93A 2M8XA 4LOVA 4MMYA 3PTYA 3CMAV 3CQOA 4IV3A 3L81A 4AGLA 4KU7A 2E27L 2QL1A 4QRFA 4MNGB 1Q90D 4DV6B 2R4SH 4A04A 1YA5A 4OQ8A 4XOEA 3KSCA 3QEHB 5LCVA 1TENA 1TKWA 1K6QL 4FFHA 2WWKT 4RGAA 3UKVA 4PV8A 3AG4C 4Y5YC 5AOKA 2A6WA 3BPOC 2XHNA 5JVDA 4U1HB 1NC2B 5L73A 3HS0B 2G0KA 4B50A 3MLJA 4FQXB 5FK9B 5IVFA 3DBSA 4HIJB 1RZJL 4FPPA 4WNJA 4FPEA 5CBGA 2AQ1A 3IKWA 2W1SA 4U1GB 3V9FA 3ZHLA 2D0GA 5B38G 1OHHG 1F4NA 5I15L 2YGMA 2HWC2 4IOSA 2PHUA 1Y1UA 1I7TA 3M8OL 4PS8A 2VXQA 3Q6GL 3DKQA 1MIMH 2X4TA 3CZUA 1S5LZ 4N8CL 1G7JA 1NANH 1H5BA 4WW2B 1DHKA 2W0FB 1IB5A 1KDMA 1Q8SA 1JPXA 2ZCLH 5I9QB 1RUC3 1W9TA 4OIIL 5AL8A 1AACA 3I85A 4FG6C 1I9RH 3EFOB 2B1IA 5HHOA 3U46A 3IJSA 1WWCA 2RHEA 3RSJA 4Q4V3 3NIGF 1BHBA 3SKOA 3BN3B 4K55A 4QJ4B 4I3SL 2W3JA 4CGTA 4BU2A 3RZJA 1DUZA 2BS71 4PJDF 4Y16D 5IIEA 1PJ9A 3SY0B 4X99B 2IFWA 3JCIA 4WM7B 4FPJA 1X6LA 4RR3C 4J12A 1UWXK 4N24A 4MB5A 1EPZA 4AQ6A 3TV8A 3JARB 3EYFA 4P2OB 1KT2B 2QDWA 2GAZB 2SODB 1S0EA 5GGRB 3AKTA 4DRRA 3X3GL 3UZVB 2G38A 2A74C 3QNYB 1LGBA 5C3QA 3L5WA 1RZJC 4GS7B 2ED6A 3SGJA 1OE2A 4Y0GA 1KS5A 3TXSA 1D5IL 1D7CA 1HEZB 1GIGL 1JV5A 1QZ1A 1TMQA 2WAQA 4XVUD 2FCVA 1S9YB 4NQTA 5JWPA 2HTKC 2CSGA 1V00A 3SPJA 2BSEA 4WO0A 2DWDB 4NQSA 3K79A 2E7MA 2VR7A 4GT1A 3DIFB 4FYSA 1NWPA 3ZXAC 1QOSA 3HG1D 4XXPA 3GRWL 4X1KA 2YSSA 1EAQA 1KTJA 3N2JA 3UJJH 3UMNA 4YL4A 3BZDA 5F7EH 2HX8A 3DLQR 4KBPA 4N2OA 4XDKA 3CZSA 4L9LA 1LKNA 3DX9B 4UB0L 4H7VA 3WCYA 5A1LA 4NNXB 2DQGH 3ETGA 3TH3T 4KX7A 3TTSA 1CGWA 4FZ8L 1DUYB 4Q0UA 1M71A 3WEXA 5DZOA 3RX7A 2C9UA 2EE9A 4L4JA 3EHBC 3SD2A 1OLQA 2BDRA 3ARVA 2EZPA 5F3IA 4X6BB 2NUPA 1JPTH 1R6VA 1AMYA 2YEZA 3IBEA 3NP3A 1WFJA 1I5XA 3B37A 4I5BA 5JIUA 1FYTB 2VQFO 2OPKA 3JSSA 2G0LA 2NNAB 3NV4A 1UA6H 2GSIA 3UYPB 2JXAA 1C5DA 1KGIA 1Y6MR 4P07A 2F5BH 4ISQA 2Y4TA 4LNUB 4PJ7E 4BHUI 3LH9A 2DCZA 1C08B 1KJ2A 2IDUA 4YXHH 1OQOA 3D06A 2A6ZA 4MD4B 2XBO2 1W8TA 2OZ4H 4PDWA 3O1PA 3TT1L 4FQQB 3B2VH 2H6BA 3S36L 1K12A 4JM0A 4QQ2A 2E4FA 2EEBA 3QNZA 5H35A 4YZ5A 1PSKH 1OI6A 5I28A 4HIXL 1DO6A 1AHSA 2DM4A 2V2XB 1H2LA 1N6UA 1BQKA 4CSPA 4ETQB 3ZDSA 1YY8B 3MCLH 4ODXA 2GJJA 4KJQC 1GA2A 4LSQH 1SPPA 3AFGA 4JZRA 2IBBA 4LASL 1J0KA 4B9IA 2EH7L 4A6OA 5FY8A 4FJ6A 1YYLL 3ZN1A 1YEDB 3ARGD 4PS4H 3ZZQA 4MSVA 1G7HA 3AP5A 1CXZB 4KOBA 4NR1A 3T4DA 4YOKA 3DMMB 3UTTD 5CEHA 3PXLA 4E4DX 2A9ML 2KPWA 4UW5A 2XN9B 5KVEL 4L8SA 1RUNA 3SYCA 2P5WE 1CF1A 2XICA 3RWDB 2F4VO 2EJ1A 1TO4A 2X4SA 2K7PA 3UGXA 5DMGC 2K3HA 3RG1C 1BGXL 1UQSA 1F42A 5LQBL 2Y23A 4EN6B 5A6LA 3E3QC 2W5FA 3M4FA 3TXAA 4QTIL 4HKJB 3QRLA 3TLRA 3RGVD 5DGRA 2XNDG 1BQHG 2DU1A 1U42A 2P80A 5IV2B 1RUE2 1UOVA 2IC2A 4AVKA 3FB6B 6TAAA 4O2FB 5IQOA 2ZKHH 3WD5A 4QF1B 2VE1A 4EO5A 4MTGA 5CCGE 1AO7B 1DVFB 1M2VA 4PUBL 4FCHA 2UUDK 4Y5XA 1FFRA 2YD3A 2AGAA 4L4TE 2AQ2A 4AI8A 2ZCHL 2VVDA 2VQ1A 1Y76A 1ZX3A 4L0ZA 3VXOA 2UXCO 4G8GA 4CVZA 1SQ2N 4META 2OYPA 2K8MA 4OCWH 3GSUA 2WD0A 1G1OA 4FAHA 5L3FA 2P7TA 1OW0A 4LH6A 1P4LB 3BXNA 1LR1A 5JH7B 1KXVC 3L2MA 3WY6A 1UKTA 3T0AA 2XQRA 2DVBA 1IKNC 2R9HC 3IB3A 1D5XB 3KDMB 5GGSA 2WNVC 4DOUA 3VRIB 3WUWB 3HI6H 4LEOA 3UZEC 4BHUA 3CCSV 4R2GB 5IT2H 3NJKA 2X5IA 3IJ4A 4LHUD 4KNSA 5E7FA 3FX3A 1WBZB 2WIIB 2QGNA 4O4LA 2HT2D 3FN0L 4HV8B 5AVYB 3C08H 4BFEA 4QT6A 2ZE5A 1INEL 3I75B 4B4QA 2Y34A 1OAYH 2NDGA 3P77A 3EUUA 1IC5L 5J1AB 2J73A 3DBXB 3MJ9L 4FFIA 4LCYB 4FXKC 3G3LA 1K5WA 3D2UB 1NCBH 4I30A 2L0DA 4A6YA 3TESA 5BS0B 5LA6A 1PO11 4YZ3A 1CDUA 3QUML 3A8TA 5KSBA 1OAZH 3EJKA 5JMCA 1KFUL 2K7QA 1DQDL 2VDQH 4KX8A 1ZDQA 4I09A 2QKSA 4TQEH 2BHYA 3WFCL 4QXVA 4JZGA 1RKRA 4ONOA 2BYVE 3MLXL 2VXRA 5AG8A 1YMME 4GG8A 2Q10A 3EGSB 1RJZA 3F7QA 1YFWA 4ZHQB 2EKJA 4BH7A 3WP4A 4FXGC 2QM7A 4HETA 4N9OB 4OZIA 3MFFB 3QJZA 1DBBH 4OKVA 3QDME 1NZ6A 3GSXB 3QUKA 3CJJA 4HT1H 4OZGF 4WFED 2XKOA 1AR1C 1TU2A 1X6NA 1AROP 3IB4A 4UI2A 5JPMA 2HEVF 1OLME 5JXIA 2GABA 2HWD3 1NTKH 5B8CC 4NWTH 3L3IB 1R75A 3FYIB 3EMRA 1BSIA 1JHTB 2CAZC 1PZBA 4GRMB 1YTFB 4JRYE 4U7KA 4V1DD 1WF5A 3ZDZB 1MRDH 4M8QB 3FLTA 3FUNA 4OJEH 2EIMC 1KCUH 3JBG2 3MR9B 1SXAA 2IPKA 4MDIA 4QI3A 5CFHA 3LXBA 4URKA 1OQ1A 4KRMB 2EDHA 3AXEA 2VR5A 4DR3B 1TJGH 1FIGL 4JY5H 1UWEL 5L7OB 3GI9H 2J1UA 5GPRA 4GIQA 4Z76A 1NCCH 2PPAA 4XNBA 5I73B 1NCWL 1HWGB 1WFTA 3UT0A 3BFRA 2R29L 5A1AA 4PCKA 5D7JA 4EMZA 5I1DB 3SBRA 3FFOA 2ARJQ 3R0RA 1BQHB 5EDXA 3OPUA 4YXKH 4LRIC 3B8MA 4RFOH 4QPEA 5I5RA 2DTSA 4Y9GA 1PL0A 1RMFH 3MKGA 2IXQB 4PH8A 1N3OA 3MXWL 5HDQH 1DP0A 2V2TA 5EC2C 3N0PB 4FBFA 3ZDVA 2BX5A 3DV8A 2AGJL 4OCXH 1ENVA 2XQYK 4Q6KA 4TKWA 3V10A 1KFXL 5IHUL 4HANA 4UV4H 4OVEA 4XZ4A 4KXRA 2Q1FA 3O2WL 3PWNB 1JHLH 4FRWA 4MZIA 3AS1A 4X8CA 3IFLL 4Y2DC 4R4BB 4Z2AA 4MXWL 1T4KA 3QR0A 4HJUA 2QLVB 3C6SA 1BF5A 5BNPB 2FJHB 1TTUA 3C7EA 4Z7WF 1QSZA 3KNBB 1PYWA 3K3NA 2J1EA 5EZYA 3VFOA 2MKWA 1N0XL 4UB8Z 4F2MB 2JMRA 5BQ7A 5GM0A 4AVVA 3WTTA 3I49A 3TU6A 2QZ2A 4XPAL 32C2A 2ZHNA 5E6SB 5FWQA 1CJPA 3VXUD 1ACXA 1OBNA 1VFOA 3AGWA 1DFXA 1E65A 5DJ6A 2GN3A 3QQDA 5EFIA 5AFAA 4PJDE 2DQMA 3HMXH 3QUXB 2XG5A 3MAQA 2BJML 3LUTB 4LLYB 5DJXA 2JIGA 1EEZB 3CHRA 4YWGH 2A4EA 4LF9O 3T2MA 5J09A 1NDMA 2A1WL 5DPNA 2ZEZA 5IB4A 1JUIA 1J9RA 3SODB 4IE0A 3P73A 4GRWH 1I8IA 3DV6A 5AW6B 3UROR 5HV4A 1YZBA 1T1ZB 5IVJA 3O81A 2JCCA 5I17B 4BK5A 1E4XH 2O61B 2J8OA 2JI3A 3A4FA 3W56A 3A67L 5A7OA 1HNXB 3HKBA 4D7YA 4DB5A 4DMIA 2PGGA 2ZF8A 4QTFA 5FOJA 4HWUA 3BD3A 1XZWA 4J3XA 5EU4B 3ZE1F 4AAXA 3VQWA 2L7JA 4K94H 4NZUH 3ME0B 3L9YA 1F97A 2XBTA 1KG0A 3N3EA 4CVXA 1GRWA 3NFNB 1GZQB 4NYLB 4WFBV 2XOMA 3D18B 4HMZA 4E41E 3S0PA 2AV1B 4LA2A 2AGSA 4X5PA 5F2SA 3APNA 3V6FA 1FXKC 4OZ4B 2LW1A 1XGTB 1D6EA 3B3BA 3GS7A 4OZFG 2FYYA 4Y2OB 5BRZE 4PJ8C 1RIUL 2EUXA 4XJ8A 1KYUA 2WBJD 3GMPA 4G7YL 4KV5F 4N0RA 3SDXA 3NTCH 3MUY1 4JFDD 5KSUA 1ET5A 4AXWB 3FZ3A 3I2HA 4QXKA 4YLZA 1X59A 1A4CA 4DPAX 2CHWA 4LUKA 3L13A 1QP1A 4JDTL 3I6SA 1KS4A 4DNYA 3BI3A 4B3MB 4ODTH 4XTRC 3PJYA 3PU8A 1RUJ1 4Y4FC 4BQ4A 1CK0H 4OQTA 4BIOA 2ZWSA 5ENWA 3RE0A 1B3IA 1WC7B 4KNCA 2NY6D 1JWSA 3A6CH 2FQFA 3QG6A 2WTRA 3RI8A 5KXEA 1KYAA 5CEYA 2XKSA 2CHZA 4PRIE 1OANA 2R59A 3RKPA 4DP1X 3ZRWB 5L3BA 5FYVA 5CF3A 3VD0A 2DF7A 1EHLH 3CIAA 2ZHMA 5FW7A 3CLFH 5FWRA 4M93C 1VIBA 2A7AA 1KV7A 2QDOA 3QCTL 2B1HH 5EORL 5CAZA 2H2PC 1V6IA 5IJ0B 4PF5A 5INDB 1A6WH 1N1TA 5CFDB 2UZYA 2VXVH 3RX8A 3QFJB 1IKFL 3AREC 5C0RH 5LHDA 3HS9A 1QUNB 1ZRUA 3FOLB 3RWHB 3PJSB 1U21A 1L0NH 1SOXA 5J3UA 1FGVH 1O6VA 2J8HA 5ABZA 1XE0A 3ZYIA 4LF8B 1CCZA 1RJLB 2AZ0A 1HAWA 1TCRB 4JPQA 1AX2A 1YUHA 1DZBA 3MLUL 2P24A 3ZE0F 5LRSA 1AZCA 3MJGX 5F6IB 4JRXE 2J3SA 2KM2A 4OUMA 3FB8A 2N56A 1EJOH 4PDRA 1KJRA 1CD0A 5E8EA 2B5IC 5ICUA 3NQIA 1MWAL 4D0DA 4B53A 4DGWC 3DX0A 3JUYA 3N06B 4LQFH 3D0VB 4OJAA 4DXWA 4LHJB 5LGHH 2PI5A 3WHE1 3L3OC 3MRIA 4M7ZB 1JHKH 5DRXA 1QMJA 1I7ZB 3T0VA 3GBFA 3WKQA 5JZGC 3J7LA 2DD8H 5F0MB 4K3HA 4CMHB 4PJAA 1LOGA 4HLEA 3M1OA 3V6OA 1BF8A 3JVGC 5E7BA 5K59E 4LU5L 3ICXA 3VWKD 1Z7JA 4ZTOH 5BO1L 2FX8L 4IGBB 4BZ2H 4FFWC 1OPGL 2EXYD 1RM1B 4Q58C 3IN0A 5JPNC 5E5MB 1I7FA 1YEEL 3T1CA 3P3TA 4IOFC 3L9BA 3ZRSA 2OMXB 4N2AA 4GW5B 3VJ6B 1R9FA 3M7AA 4Q4Y2 1MOEA 2OPWA 4TUYB 4HWBL 1K2DB 3DUUA 2V1DA 5GSRA 4BW5A 4X9GA 3JCZA 1FPN1 3CHPA 5HXVA 2FO4B 1Q38A 5IGXH 3PVBB 3QSKB 4UV8A 3HKDB 1RP8A 2O6DA 2QPFA 2YN3A 1JFFA 3HZVA 3JQXA 4CN6A 3LSDA 3B3IA 1TG8A 1G7LA 4M6OH 4P9LA 3WDTA 1VQMV 1R5WA 3B9KD 1G9CA 2NY2C 5FKCA 4P5SA 4ZX6A 1SBFA 3TC9A 3IIAA 1H6EA 1CQYA 5BCAA 2KS0A 1MHPL 4G7RB 4PJEF 2XJTA 3K5NA 4JPRA 4XNMA 4NC0B 1EEYA 2W0XA 1R73A 1MI5B 2DQJH 2HLAA 3UPRB 1E5HA 3D30A 2FGZA 3PWPA 4W9KC 4F91B 3U7WH 3WYRA 1AC6A 2O5YL 4O61A 3VFSA 3GRGA 1IHMA 5CGMA 2UYLA 2IANB 5LB1A 1RHFA 4Z7IA 3GZAA 5D1XD 4RMRA 4O9GA 5FNVB 5DJ2A 4GUOA 4Q4W1 3OZKA 3O45A 5LHIA 2HEPA 2AQRA 3CSPA 3VFGL 2WL1A 3RL2B 1WNSA 4U7NA 1HVXA 1BDYA 2WMPB 4C4BA 4F92B 5IVEA 2H47C 1ZSDA 4TPRH 4K7PH 3UYRL 1TFHA 4O00A 2R071 2H26A 1PZSA 1DJZA 4AUYA 5G05L 1N6QH 3P3RA 2PXYA 4J23A 1RUJ3 3UH8A 4PEEA 4QTHB 5AQ0A 5IT9N 4KUMA 5JQIB 4CEWA 1KYOJ 1H3XA 3KCCA 4OZGE 4H20L 4XBNA 5A6XA 3NSJA 2M26A 5D5MB 1DE4B 4LF6O 1NCUA 4LB8A 1BOYA 1WPCA 4GO8A 4YXLH 4XP5H 3U07A 1DQ1A 1NC2D 3OHMB 4DKFH 2R9AA 4IMKA 3KGTA 5HHVH 1RPRA 4KGGA 1UM5L 3HA0A 5T3XH 5BUVA 2EIZA 2YAFA 4FQXD 4Z7QF 4Z0BL 3X3FH 2ID5A 4PJGA 2EAAA 1XFPA 1IQDC 1X33A 4QX3A 4ISRA 2C1OA 1RUH1 1NL0H 5DD3H 4X5XA 5D7LA 1EBOA 4R50A 3TTYA 2VLMD 3BVNA 1RFYA 1UZ8A 4M4RB 4AFCA 2JICA 2K46A 5C0IB 2VDRH 5D8AC 3BP6B 3BPCB 5FAXA 4ZUVB 3FQRA 2PYTA 4Z0XA 1KOAA 5D2LA 5HVFB 2VY0A 4IRJA 2ILLA 2PO6A 3CMEV 2ATKC 5FZ7A 3CBKB 2HJKB 4Q9BA 4NYKA 1S2BA 4HPKA 5IB1B 2YLHA 5T5NG 1T1XA 3G5VA 4PP1D 4HJJH 4XCEA 2O1AA 5FUCC 4K73A 4TUUA 1BKZA 4AHYA 3HCVA 3KR3L 2NX5B 3Q13A 1ZCRA 3POCA 3QZWA 1P5UB 4ISVA 4I3PA 4F7MA 3TASA 4FFFA 4UQCA 2XGXA 2BK8A 5AZ2H 2A6KA 2F8IA 1N1YA 1ZREA 3O4LB 2WZPD 1STMA 3EIFA 5B5EZ 3RZWA 2A6XA 3M2MA 1JRHH 4AHCA 3H1HH 3LZOA 4FTVB 3D33A 4NERA 5IVZB 1OVSA 2AUYA 1QR9A 3SO5A 1ODAA 2XBZA 2JK5B 3CFJA 3ULSB 5J9PC 4FOYA 3J8F1 1JXJA 2DKUA 1O7FA 2D31A 4P2OD 4LLVB 2EKSB 4J3OH 1K8DB 3G6JF 3MACL 4WUUB 2FUQA 4F6RA 5BXXA 1UNBA 2BWCA 1PU0A 2RS12 3VI3F 1N34O 1KIRA 1RZ7L 2E76C 3VD1A 4J5VA 4G3YH 2OI9C 3QHFH 1SN2A 4A7VA 1ACYH 2BSSA 5DMYA 3DX7A 3P4LA 2AXWA 4RYDA 4FADA 1CX4A 4GSXA 3RWEB 1CN1A 4GRWB 1A02N 3F7YB 4CC4A 5ISZA 4H1LG 4QGTA 5A2IH 4XBQA 2VPVA 3K71A 4AZUA 4ZMAT 1VRH3 3TBVA 4G9FA 2VMJA 4UTBA 5IFJB 1JPGA 2KKQA 3DECA 1UVQB 2HB0A 4YW2A 3DURB 3WNPA 1Q9OA 4DN3H 1PIV2 4OY9A 2YMOA 4ABUA 2Y3NA 1HH6B 3NAAH 3JAKA 4X0KB 3MMEB 3RPQA 4ZNCD 1W72L 2CA3A 5F37A 4BEIA 4CZZA 2CHNA 1YPZE 2ZXWB 2YOAA 3KJ4B 4NAQA 3FPXA 1PZ7A 4BISA 4K7PX 5DVOA 3I9PA 3IDNB 3MD0A 4ADGA 3RRDA 4CA9A 3OLIA 4NX0A 4MZRA 1UPIA 4Q4W3 1RPKA 4MMZC 3CCUV 1J7VR 1UZ0A 2ZPKH 5CD5D 2NY4C 1BXHA 3CXFA 1GANA 3IKCA 1FYTD 3P4OB 1JIBA 3AROA 3WN6A 2QSTA 5F88B 3RKDC 3G6BA 1EN5A 3IVKA 1A4JB 2GHZA 3LF7A 4NJ4A 1BVKB 4R7NA 2VT0A 4ABQA 4X66O 4N8VB 1DANT 4H8PA 4QWWC 3QBTB 3HAEG 3S3CB 2R073 3ASNC 1MFAL 4F7TB 1Q81W 5LA2A 2Q86A 5JLZA 5LVEA 5CJXC 1W8ZA 3ZFEC 2ITDC 4LLQB 1N3NA 3S3WA 1VEOA 3TEXA 1N18A 2N0MA 3RVXD 2E32A 1CVSC 1Y6NR 5BUGA 5T1DH 1R091 1DDLA 3QFGA 3M7FB 3R0NA 5FY5A 5T1MB 4NRXB 4XMTA 1DLHA 2GN7A 1K8IB 1X7QA 3QC6X 3KHQA 2GT9A 5I16B 5ICYA 2HWD1 5FQ0A 1AIFA 5GGUB 4QYAA 1FE8L 1WBYB 1O3QA 4LVOB 4U6HB 3T0WA 1W0JG 1GS6X 1T6VN 3G5YA 4P4RA 1ZA7A 2Z31C 5FPOA 2CXKA 2G30A 3VZNA 3DMMD 4IIJA 4HJSA 2VNRA 5I19H 2XN9D 3KZ4C 1ITCA 5C07A 2P67A 5BNNC 1NAMH 1TVHA 3EDFA 5DUPL 2XAHA 4GG6E 5LEKA 2H1PH 1R1A2 4OI4A 2JE8A 3QO1A 4MLIA 3LRSA 2WS92 1ULOA 2OQ6A 4HZFA 1CS6A 4QX2A 3KH3A 3LQAH 4X6CE 3WN5B 3WW3A 1C5CL 3JWNG 3Q44A 3BVVA 4GQQA 3OTFA 3KMHA 4Q4X1 4OFYD 2WZAA 1MFEH 5FF6A 1Y18B 3WP6A 4AFAA 4CEYB 1W2KT 4XP9L 5FUOH 1HV1A 1AO7D 1DVFD 3MRRA 3J7MA 1FO0H 5KZCD 4D2NA 1XOYA 4AVBA 2J6EL 3F58L 3UL2A 2N7BA 3VFWA 3VYOA 1NCRB 3OYWA 5FP7A 2J20A 3WTXA 5AZEH 5JOYA 5A16B 2FIRT 4AQ1B 3ZE0E 4TL5A 4H2AA 3FMGA 2WO2A 2P45B 2OCJA 1E3ZA 1KXTB 4JZNB 1QI5A 4Y22B 2YD5A 3ZYFA 4B29A 5FYJU 1EH9A 3MTXA 3MDPA 1PDKA 3ZFFC 3NXSA 2DBLH 1GICA 2E86A 5LDUA 1MS8A 3DI2B 5F3EA 1YF2A 1MFMA 3B5HA 1U41A 4NAOA 3IDXH 2GZWA 5IQLA 2WZEA 4O65A 2EDKA 2XWXA 4KGQA 3WKMH 1U3HA 4MX7A 4X6DA 2YGVA 3VXME 1CGPA 2HJLB 4R2GD 4YW4A 1MCRA 4LPCA 5GRUL 1UMIA 3MREA 2VN3A 1DN2A 4LNRA 1TAEA 4Z3IA 4FULA 2AZ2A 2O72A 3OTOB 1XH1A 2CUIA 2DAVA 3VGHA 3F05A 3T1HB 3QCUL 2P1BA 2VDMH 4AGVA 3QACA 3L9EA 1FZOA 1GZWA 3JV4B 3T1MA 3D2UD 4JFYA 4BUQA 4FLYA 4KAQL 4XHBA 1U33A 1N36O 2NY1B 5D2NB 5BS0D 2Q9OA 2WT1A 1UB5A 5EC1B 1D4M3 3H0TB 4YIPA 3FONA 5LXGL 2QCSB 4DR2B 2KYIA 2W0PA 2RS52 3MLLA 5C6WH 4AYDC 5JHLH 4UINH 3SGJC 4D3CL 2YPVL 1S0DA 5GZNC 1PK6A 4WM8A 4IS6B 1N5AA 2ZGPA 3EJCA 4FI7A 4NUGL 3VKLA 4PJEE 2CK0L 5D1QB 2ISDA 1W03A 4DY5A 1J59A 2XXZA 2OQJA 4GAJL 4WI5A 1RJYA 4PJCB 1S9XB 3N9NA 4WSGA 1KDJA 1G9AA 3DPRB 1NLSA 2IXKA 3BJLA 3KBHE 4RA0C 1XCTA 2XSKA 1A64A 1ET8A 5DN6G 2IAMA 3LN9A 2A77L 4L9LC 5H2BA 4GIPD 3UAJD 4YHNB 3GI8L 4XVSH 4HWZB 2HYXA 2IJKA 1CFVL 3B7SA 5MHSD 1YTFD 5E2WL 2VISB 1R093 4H8QA 1P6FA 2CKBA 2ENSA 4P5MB 3CD4A 2DQEH 4FNPA 4OBRA 2VZTA 5IMKB 4CMMA 1NY72 3WFDL 2JDUA 1A0QH 4DEWA 4U3CA 3JV0A 1UIKA 2IC1A 1V55B 3HBPA 3MO1B 4ZUWB 4BFIB 1MJ7H 1LO0L 1NH6A 2W60A 3L7EB 2CGRL 3LVEA 1OOAA 4DFHA 3T2NL 3K6OA 1H3PL 5KVGH 3ZKMD 4BA6A 4Y4KB 3WENA 1EHAA 1CDGA 1BJMA 3WKYA 1PG7W 1Z32X 1MJJA 4WWOA 4NFDA 4L5FH 1E1RG 3AMMA 3M3CA 1A3LL 3CG8A 4ICGA 4UYBA 2W95A 3V4VA 4UT9H 3P4NB 3D4YA 4ZNEA 5JXJA 1ZE3C 4M0NA 4I1NB 4U1LB 3N35A 5HGDB 4M7KL 2QLYA 2I07B 2QADB 2ZAHA 3VI4B 3ASWA 3KCXA 2Q7YB 2JJ2G 5K1NA 5FYZA 1EANA 4MT8A 2QELA 4AYFB 5L4JA 3M3OA 4Q4X3 5C0BE 2A70A 3GB7A 1SHWB 2AK4B 1XSOA 1FL3B 2E7DA 2FECL 2ZIMA 3RWGB 3U9WA 2YY1A 1GHFH 5ABJB 5F3CA 5H6RA 1VBE3 5IJRA 4NQXA 4NP4L 4AGMA 4ITCA 2NLJB 3GSNL 4MHUA 1UPSA 2WHVA 4MQSB 4MX3A 2YGLA 3GZEA 4PGDB 4EDWL 1S7UB 1AI5A 4I4TB 1GSMA 3FTGB 3NIDB 4K7FA 4WEMB 4ZXBD 1BM7A 2FHFA 3RT3C 3AZZA 5EH1A 3JSNA 5FA3A 2QQOA 5E9DE 2LS6A 4M61A 5BVJB 4NENA 2X4UB 4URTA 4DVRL 5AAMA 1OCZB 3CDGB 4BSJA 3MCYA 1H9PA 1QHDA 2Z8WC 2BQPA 3KL5A 3GKZA 2FDGA 1W3XA 3QUXD 4ZO8A 4FZEH 1LHNA 5C0JA 3KPTA 4TUOA 5C0EB 1YMHA 2WV3A 1WFMA 3T2PA 1E5ZA 4Y1XA 1J84A 3FRPA 1EEQA 2YPLE 2PPEA 1X9RA 3K2OA 4P23B 2WQWA 1QO3A 1EO7A 2X0WA 4L3EA 1MVYA 4ZW7A 4HYTB 4JZOB 5IOPB 2IBGA 1AYM3 2FEEL 4LLUB 4LSSH 3WUZA 3CFEB 5IAXA 1JYWA 5JUEL 3MLSH 2J25A 3NABH 3Q05A 5IYCO 4P0DA 2Y8KA 5FL7G 5GRVK 5EP9A 2V0AA 2P7TC 3U37A 1OW0C 1QQP3 2ZJCA 5TFSH 3NK4A 4JFXB 2DCTA 5JNYB 1EXHA 4FXTA 2CO1A 1ND0B 1WITA 2WJ7A 5MENA 5I1IL 2IOIA 1VZGA 2O5XH 4P2AA 1YDPA 2W1UA 4OJCA 4C91A 1AR5A 1KCLA 4MD5B 3FQWB 2X5IC 1UZZA 1JZIA 2QPDB 4GAFB 5CINH 1KLGB 2NXYC 4CC0A 1FYJA 1XJAA 3WQ7A 3KGSA 4XAEA 5LMNB 3OQRA 3ETQA 1CU4L 1HNWB 2WKOF 3ETDA 1WTGT 2RV9A 4JO2H 1RULL 4L1HA 5C09B 3ZHKA 1B6UA 3CBNA 4JI4O 2A6JA 3UG3A 1K5MB 4U1NA 2E74B 1K92A 1CC3A 1PAMA 4UIKL 3ULUC 5FUCE 5AWNH 3WV0A 3AQXA 4XUNA 3S7IA 1MAJA 4ZYKA 1EGJL 4A7SA 2CO7A 2XQBH 5EOQH 5SX4H 1KDKA 1LHWA 5L9DL 4BH8B 5DG2A 2UZXA 5HHNA 3O1UA 4M7LL 3PHAA 5DMKB 4Z7WA 1ENSA 3FC0A 4B3NA 5KMGB 4GX0A 5F3BB 3PL0A 2K70A 4QT5B 3T0EB 5GIRB 5TTRA 4PG9A 5D7IB 2NZ9A 2HXAA 2ZT9B 3DEMA 4N43C 3MV7B 3ZIYA 2A6DB 1ZVNA 5T5FA 4FTDA 2WT0A 1UY2A 2G2PA 1YCSA 1NFDF 2F54B 4P4KB 3V0AA 2K3TA 3CXDL 4J80A 4N9GB 1GS7A 3GINA 1LNUB 3BAWA 5SWZE 1QJU1 4LSRL 4PIBA 3UO1H 1JOPA 1M5IA 3QFJD 2MMXA 2GJ6A 1B04A 1HOCA 1I7UA 3ZXDA 4YW5A 2D7FA 1AGCB 2R0KH 4NQQA 3TBTB 3CFQA 5T8IA 4DQOL 3MJ9A 5LWYH 3ARGC 2DJVA 1LRHA 5F89A 4EJRA 1DR9A 1ULVA 1N10A 1YITV 3VQLA 2XL7A 4NIKB 1VR3A 5HYJD 3CSFA 2ZX0A 3EO0A 3ESUF 1JDAA 5CU9A 5LY2A 3N44B 4F80A 4HPYL 3G4SV 4NO3A 4D9LL 2FO1A 4ODUA 2Q76B 4LT5A 1QF3A 3WG2A 1Q0XH 1WCBA 4Y1AA 5D7KD 2ED7A 4XP6L 3D0JA 5FZLA 2ZOKB 2JB6A 4Q9QH 3PJSK 5D7JC 1Q43A 4XOCA 1BIHA 3FTSA 3QIWC 1QBMH 3WO4C 2DWEC 5HHXL 3MLRL 4NOTA 2YXFA 4CYDA 4I50B 3LQZA 2VO5A 3Q8EA 4JQIA 2VSDA 4ZQKA 4HK8A 2ENRA 2MHAB 3O6KH 2V33A 3IMTA 2EP6A 3UPAA 2E3VA 4JYYA 5DD1H 2E7TA 2J44A 1FNSH 4I0CC 5EUOF 4AFMA 1WBXA 4IGBD 3KW8A 1G9ML 1R5VB 4W70A 2VQUA 5F1SA 2VCCA 4B9KC 4GH4A 1WA6X 4ENEC 1H8EG 4U6XA 4LNVA 3KPRA 3GEFA 3GMQA 3S37H 2X4OA 3SDAA 3W38A 2ZIDA 1KBGH 3JV6A 3K4AA 5I1CL 3RNQA 3BEHA 4YFZA 1VLNA 1CD1A 3H42B 4WFHA 3TF7C 5A7WB 3UJIH 3QIUA 2JEXA 4N8UA 3RTQA 3X1NA 1VZIA 3PWVB 3MLPA 4UQ3B 5E8PB 3HVDA 5AAWC 3LZLA 1HDKA 2BOBB 1UU4A 1E7VA 4KWLA 1OGTA 2VDMB 3QUZC 1PX4A 2Y6GA 4BR6A 4MNQE 4U0RC 4R8CA 1VQNV 1RU9L 2DQFA 2VC9A 2BSRB 3MHHC 3GMNB 1TJXA 4QQLA 4N20A 4RWUA 3BQUB 3CHXA 1TETL 4Q74A 4ZS7L 2XJLA 2H8PA 2Z69A 3NKGA 4PJIE 2GP3A 1MI5D 1KTCA 1U2CA 3O2DL 1ASQA 2VNCA 3LDKA 1QA9B 1DL7L 2OXGA 1WFNA 1BVNT 3FQYA 3A0KA 4Q2FA 5C3SA 2AJVL 3P3PA 5CFCA 2YRZA 3QDJE 4YG6A 2IAND 1BZ7A 4U1SA 4KITB 4TV3A 3F62A 2AJZA 4C90A 3TEUA 1F5JA 1L0XA 2LHAA 4M5ZH 5GGTH 4BE5A 4Y4RA 2WAOA 4H5SA 3X11A 1QPPA 2JQZA 5ICZA 1DYPA 2BNRE 2WO1A 3WNNA 1QR1A 3BUIA 4FOQA 2D93A 1ODNA 5FZ4A 3MLZH 1XV8A 1X5LA 4UVAA 4F7EB 3DC6A 5JW3H 2V5RA 4NJAL 1A2YA 3GSRA 1EXGA 2VAAB 5D70L 1V7ML 2IZWA 5E1QA 5C93A 4OULA 4GIAA 4NFCA 3WR0A 2HRPL 4GKZB 4PV1C 4LF7O 1AHWB 1SLUA 5G5DA 4JRAA 4ODHH 4V2VA 4JFFE 3CCRV 1CL7L 1E2ZA 2AACA 2APXA 2X2JA 3NAPA 4JI5O 4GOSA 1NX9A 2OMUA 3CDYA 3OKYA 3QEGL 5ECGA 2A9BA 2EF6A 4M03A 1HXS1 1QHOA 2Q0AA 2YC1A 3PP4H 1SKVA 1A21A 2VQAA 1CZVA 1XX9C 2WQ4A 3N7JA 3BWUF 3PVOA 4MRCA 4O2CA 4ZPTB 1UOFA 4NQDE 3HKFA 1HV0A 1MCQA 1QJU3 2E6VA 2PY5A 1GPOL 1QSFE 4GAGH 2WNKA 2HEYF 1QI4A 3MA9L 5DS2A 3RBGA 4RL7A 4S2FA 4CUBA 3WLUA 4RAUB 2HKHL 4CPBA 4FCAA 3SXWA 3ABLB 5I1HH 1JH5A 3VUOA 1E27A 2D3RA 4QPIA 5E1IA 3L3JB 3GHEL 2QPUA 3VD3A 3GS4A 4EE2A 4JR9L 4JM4H 3FTUA 3IFPA 3WY2A 2Q6WB 2QV4A 3DUSA 2EH8H 1HC1A 2NX5D 4G5ZL 4N1EA 4X5WB 2JTDA 1GJUA 3GSWA 3ZTCC 1X82A 3IPVB 3HC0A 5C9AB 3J4UH 2F19H 3M1HA 2BTQA 2HFEB 2HP4A 4W9FC 5EWSA 4GXUN 5A6QA 1PD6A 3AYCA 1SY6H 1XQ4A 3O4LD 4AV5A 1N26A 2EDEA 3ZDXB 5L8KB 3EJJX 2BSCA 4FL4B 5D6CA 4HVOA 5DD0H 2C3VA 1QRNE 2ED9A 4ADJA 3BWAB 3TO2A 4K9EC 2P5EA 1OD9A 2WANA 3SQBA 3VYPA 4NJ9L 2YXLA 1R47A 2VDPH 1GP6A 1DVUA 1FFOA 5ITBL 4WUUD 1N3QA 1Y07A 4BJ0A 3WXPA 3QYMA 1SACA 4C58B 4YE0A 2JKTM 4LHSA 2EEAA 1JERA 4HUWB 2B1AH 3LKPB 4X5LA 2XI9A 2VOWA 3POIA 1SF9A 4F83A 4PD4K 5T5LA 4LO6B 1XGQA 2YAPA 2ZP9A 1LTEA 3OJVC 4ELMB 2ORBH 1W6QB 4DGYL 3OJ2C 4N5ED 1HRI1 4PJ0Z 3G6AB 1ODMA 3KYNB 4P9XA 2P22C 4OZFA 5IROC 4MXVF 4R9AA 4C47A 3U1SL 2JJSC 4JQXC 4LCUC 3THMH 4LESA 3AG2B 3ATDA 2ZOEB 2ADDA 4APXB 3U2SB 1OTUD 2CO6B 3S9DB 3VHOA 4R90L 4HKXB 5E08H 1W6NB 3RYCA 3WIIH 1TNFA 4P5KB 1VBA1 5B7FA 4YUEH 1UJ3C 1KPUA 1LCLA 4LWSA 4TXVB 1G9FA 4JX0A 5EA0L 3LEKA 3CKHA 2H32A 4Z7VE 3HQRA 2V37A 4C8XA 1IZ3A 3L1EA 4RMUA 3OL2A 4WFFA 3ZMVA 3ETBF 1KB5B 1LNQA 1GS8A 3OUHA 5CP3A 3VBSA 1LEMA 4WF9V 1A32A 3P4MB 3ECUA 2PYEB 5FYJL 5KYWB 4MJHA 4NNYA 3E8BA 1ZXQA 5I6XC 3HAGA 4UW6A 4AEMA 1AOZA 2QQVA 2CIIA 4Z7AA 3HR0A 4WSJA 1DBNA 4KC3B 1PIFA 3AUVA 4YAQA 4FQ1H 4HUXB 1Z0NA 1ILSA 5C6CA 4FQHB 3GBNH 2VM9A 1KQSU 4AENA 3II1A 3CZLA 2YK1H 1NTZH 1H8SA 1MCJA 3ES6B 3LKRA 1T1WB 4O2EA 5CLXA 3UBHA 1BLIA 1RHI1 4KQ3L 1NGYB 2P49B 3O41B 4HFWA 4BDVB 1J05A 3T77A 3UADA 4OLZH 1OZ0A 1W8NA 5GGRY 3MKKA 3TVMA 3UZQB 4XBLA 1E3FA 3N2KB 3RN4A 4CH3A 4MS8C 1R5IA 1SFPA 4JHUA 2AJSH 2BP8A 4R4NC 1GFF2 3TNMA 2NY6C 3KPSA 3G6JA 1OAUH 1I5PA 4TZDA 1XH2A 4KHXL 2XZQH 3GK8H 4LGSB 4LULA 1XPWA 4M7JH 4OJFL 1EA9C 2BZDA 3D0AA 5I0UA 5JIQA 2GK0B 2AYHA 2PXYC 3B1TA 5CKNA 3SBQA 3BSZA 4Y24A 5CBAB 1V6OA 2ZAGA 3OXSB 4E9RA 3NAPB 4EUPG 5TDPA 1Z7S3 2X09A 3U14A 1W9XA 4CEWC 2XJVA 3SCGA 2PETA 1IS5A 1EZSA 1NFDE 5IB5B 1KGCD 4TTGA 4BIFA 1RJ8A 3MV8B 3EDKA 2VQFB 4DV2B 3STZB 3QG7L 1BQLL 1YECH 1RERA 1O91A 4IMKC 3LB6D 5DAQA 4QRSA 4RX4D 4YNYA 5FMOS 1OA3A 5DYOA 1SRDA 1HEHC 3QK0A 2DJMA 2XA8L 4LLDA 2E7QA 5DEGB 1WLEA 4Y88A 2YI9A 3DA0A 2EXSA 4MUVA 3RJDA 2AJXH 2IQ9H 1JZ5A 3DYPA 1IPJA 5T1KB 4I77L 1YFXA 4RSYA 4ZW3A 1HJFA 4R6ZA 4YN3A 4JFZH 1R3IC 2WQZC 4G7VH 1WJZA 1KTDA 2K9UA 1EYBA 4HIPA 3OY8B 5IESL 1WT5A 4YHKH 1SEQH 4IRJC 1GSLA 3GMRA 3U0PB 5CNAA 3F00A 4YG3A 5F5IA 1T1YB 1PKQA 5LO7A 1G9DA 4OCYH 1HAUA 2WPGA 3DPBB 1ZVSA 2R7EA 1NPJA 4GMP3 2FX9H 3ULUE 4M6NH 1DQQB 3TOPA 2X2UA 4L8DB 1BW8A 5F3GA 4I4WB 5KSBE 2F4VB 5F39A 2PCFA 2CIKA 5LUMA 4IU3A 4NQCA 5EUOE 1RZFH 4FFVC 3MXVL 1S5HA 5ANME 2BVYA 2DMKA 4XFHA 3MHSC 1EAJA 2D7MA 2JXMB 1OCCB 1AD0B 2XPYA 5DUBA 5DJAB 3STLC 5EBWA 2YUWA 3VXNA 1HHIB 4HFSA 4HUVA 2JKRM 1K85A 5E16A 3BAYA 1A6VH 4R7DB 3E6HB 3O0LA 4ZMZA 4RFT0 4XFGA 2F58H 3ZO0B 3QG5A 2NY1D 3IAPA 4IRZL 1S7WA 1S8DA 3N5AA 4KVCL 4ZOCA 5AL0A 1OP5H 1NCQC 1UWFA 4C56A 5BVPH 1GGUA 3LA2A 2ZGSA 1FV1B 4PA3A 4GFXA 2RJ2A 2UURA 3TZVA 2PP8A 3MA7B 4NRZA 4B6ZA 3DC5A 5C0DA 4G6ML 1AGEA 2UXCB 5A7PA 3UYJA 2WINB 4PLNA 4PJFF 3QR2A 4CC4C 3H1JH 4NKOA 1UUSA 3AXLA 2CBMA 2NNCA 3MV11 5D1QD 4XB7A 4DEPC 2Y36L 2OXHB 2XG4B 4NP9A 4A63A 1FJ1B 5I8CA 1IC4L 3VBFB 25C8H 1I1YA 3BO8B 1YAIA 4GP5B 4ARYA 3LPGA 4BQWA 1N33O 3BSHA 3UBXI 1NXD1 2Y6JA 5D1XC 4WCEV 1Y0LB 4G8EA 4QKTA 1AVAA 4C4UA 1JU3A 4DR4O 4YM3A 3G5XA 1BCIA 5DA4A 1GSKA 5DC9B 4QYOA 3KYKL 4JUTA 5I30L 3WU1A 2ZGMA 1CFBA 1KN2H 2VITA 2ZKMX 2IALB 4B9GA 1BEV1 2EZ0C 2OMBA 4OIFA 2WYIA 2Y6KA 5KSAB 1RHI3 4ICWA 4M62H 1TZGH 3A2FA 2B3IA 5EU3B 3WUCA 2CBQA 1S4CA 3E6FB 4N23A 5GRZA 2D6LX 2WYSA 4FLUA 1NCHA 4NXNO 2V5YA 2Z4QA 1I5YA 3FO0L 5T3XD 5JO5A 2D0HA 3IDJB 3RIFK 1ULDA 4QU2A 3AB0B 2K9FB 5ID0B 4A2GA 4TVUA 4Y4KD 3TFKD 1JR9A 1XGYL 3ARBA 3KWWA 3NP4A 4BCUA 2V2WB 5D1ZI 2Q1ZB 2QDNA 3CHOA 1X5MA 3MIGA 2ZQMA 3G08B 3IDGB 1LK3H 5JMRA 5CN0A 1NEZG 1FWXA 1HH9A 1XBLA 1VFAA 1YNLL 4QAWA 1XNDA 1M56B 4BLIA 2LQRA 4RMSA 2CBTA 1TNNA 2X6MA 1ZA6B 1YNTB 2PPCA 3TA3C 3MRMA 4RDBA 1K9MW 3LH2H 3RWJB 5EBMA 3FU7B 1JGUL 1FH5L 1QPXA 2BSDA 2JFCA 1AGFB 3HZKB 3I6GA 3NUKA 3H9HA 2YXSA 3DX4A 3SOBL 3LPFA 4M1DH 2ZEXA 1E5YA 1NT2B 2X9ZA 2AK4D 4DK5A 3VBHA 5E8OB 3ZYPA 1N4XL 3O6FC 2MNGA 1KPVB 1DYOA 2IH1A 3VW3L 3QB7C 5FZ0A 5EO9A 4P5RA 3APOA 2WQVA 1WA8A 2M6YA 5TE6H 3HJRA 4LBLA 2G4GA 3L1OL 3EAKA 4KROB 3CFUA 5ALCL 1U91B 1QVOB 1WAAF 2FKXA 1JZDC 3PUHA 2V9QA 1NGWB 5EZLA 1MELA 4P30A 3SGKA 1VRH2 2Y2WA 1FN4B 2BSTB 2NOYA 5IHZB 2ZAIA 1MZYA 4BUGA 3NV3A 4LXLA 4CDQC 3CC7V 5L7XL 4EV0A 3HZMA 3EFFK 3IJYA 3CSXA 3OB8A 3K6IA 1L9TA 1W2NA 2BOIA 1EY2A 5FZ6A 3OJBA 3UBXA 3RS6A 4PR5A 3GBMH 5LDSA 2XV3A 4HZ1A 1U8JB 2MFNA 4TULH 4N5UA 4QRUA 5DHVA 2SLIA 1GVIA 2J1WA 5CWSA 4YVSB 1UOLA 3SZ6A 4ATWA 1TUBB 4XH2B 5C5TA 4KKBD 2VZ1A 2VL4A 2XV2A 3BIKB 4R5VA 4NOFA 3ACIA 2C1PA 3TIDB 4HGWB 5L6YL 4LBQA 3CN4A 4A45A 2DW4A 2DI7A 2WZ6A 4HEMA 4A6YH 4EZJA 1X44A 1CICA 3CFBA 3RW0A 3TN0C 4V1DE 1L6XA 3GIZL 5I24A 5F2VO 1Y66A 1JD7A 1C5IA 1D0HA 2R072 3WW1A 4WFGA 5K0UB 3LEYH 1F1AA 4EIBA 1C8PA 5I74C 4G6AD 5JXEC 5T3ZD 4CU9A 1HCFX 3ZQWA 4GYCB 3REVA 4N2FA 1NJIW 5D1ZA 4M9PA 4KI1A 5H9CA 1ZTXH 3NCCB 4OF0A 2ZHKA 5LBFA 5CBHA 1G87A 3DROB 5EIBD 1S9WA 3ISWA 4M5YH 4FFBB 4XODA 2WT2A 4EYUA 4WW2F 3REWA 2X6BA 1ILUA 4PFEA 4PJHE 5C09D 3LJ3A 2F4PA 5F32A 3ZTJH 2Q7EA 2Z65C 2HT3C 4W9HC 4DUXA 4PMEA 3MRGA 3VGEA 2TRHA 4JGZB 1G6RH 3EBAA 1VKXA 2EJRA 2SBAA 4QPJA 3SDDA 4MGZE 3SGDH 2LJ2A 1PGW1 4YX2L 3VKOA 2EVJA 2VB5A 4JDZA 4A2HA 1ZTMA 4I3RL 3QQ4A 2HEWF 4LF9B 1C57A 1Y9MA 3NZ8B 5FZMA 1BEV3 4GP8B 1EFQA 1GC1L 3BAEH 4I2XA 3SE8H 3GQFA 3L9RA 4B60A 3D25B 5IVXB 3W9DA 3H1YA 5H9PA 2GFBB 5LW9A 2D9CA 3T0ED 1PK6C 2DWSA 4FYRA 4XJAA 1A5FL 2I24N 3DJSA 3IDMB 2E6PA 4QGMA 3MV7D 5EIYB 3LOWA 3SCMC 1BCXA 3OKLB 1GGBH 4HQQH 3IMNA 5FO7A 3GSOA 4JZJB 4HCRL 2JG8B 2LUWA 3K0YA 2F54D 5AG9A 4NKIH 2KC0A 2A3YA 3B43A 3JQOB 4P4KD 4LQ1A 3QXUA 4TNVK 2XB6C 3MPBA 3DRQB 3G5WA 4QU1A 3K80A 3OR7A 5AOLA 4IBUA 1RSOA 1G9NL 4I0PB 1UQXA 1W91A 1WLWA 1MNNA 1R6KA 3ZXFA 2K6WA 4OLXL 1OHQA 4EPSA 3U82B 3X12A 1BQRA 1J5DA 1FAIL 1PVXA 3PP3K 5DQ9B 4OI1A 2DTYA 4IKIA 4TUJA 2J1SA 1XL6A 1Q90A 3JZ7A 3ALXA 4HJTA 4RGOL 1I8MA 3P3YA 3N9PA 1HSAA 3LWCA 4MW8A 5J37A 2YMXL 5EEXA 4PMFA 3CJIA 1KLFA 2B08A 2AEOA 3A23A 4UTAA 3IXTA 3I6LD 1D4M1 4FE9A 2W9XA 3K3QA 4NUBA 3AAZB 2DM3A 1RK0A 4YBLB 4J39A 3O3BA 1EBPA 1J8KA 1DEDA 4XVTL 3IEAA 4FFZL 1CAWB 1FIEA 1UH3A 3OUIA 2E59A 2JQMA 2YBSA 2OL3A 3BT0A 3L5XL 3AQZA 4GMSL 2ENYA 5HGBA 2AHIA 3VG9B 3AYAA 2L04A 5DJ8A 5CHNA 2CRIA 3OMNB 1QFWI 3AFLA 4MAYA 1OAXL 4WTZA 3I2KA 1OOPB 1J1PH 4OX9O 1A7OH 4D0QA 2AABL 3MRCA 4GUPA 3R1GH 1Z9NA 2WKOA 2DYRB 3QDGE 4NNPL 3V5KB 5DAPA 4QKNA 1E9PA 5A9GA 4XHJD 3BZ5A 4QE7A 3ZX6A 3DGGA 2AS5M 1CLZL 4L2NA 1S9KC 3CSGA 43CAB 1DO5A 4EN3A 3GB7C 5I71C 4GA9A 2ZSWB 2IGTA 3PG2A 4X88A 4XWGL 2ZUTA 4BUHA 1R1ZA 2DVDA 1N68A 5JR2A 2A3QA 4PELA 2LVCA 5F72S 3T08A 3GFUA 4WO4A 3CFMA 3VKFC 4UQEA 1L8DA 1NUDA 1U95A 3POFA 3VKMA 3O9WB 3A0OA 1BEYL 5L9RA 2G5BA 4WNSA 5B1JA 1E5SA 3OZ9L 2BBAA 2WDBA 5I0TA 1MHHA 1VB9A 3JV5A 3US9A 1M57C 2NR5A 2EC9T 6FABL 1J3PA 1QLRA 1XSQA 3GZUC 2BBVA 4L48A 2X4PB 2AITA 4RZKA 2QQIA 3JU9A 1I1FA 5FO8A 1MQ8A 2BVVA 3BQUD 3BZ4A 4Q6IB 4ASLA 4TNGA 4NTXA 4IKKA 5AAMC 1A7RL 2FJGA 5K4LA 4D3WA 3VQYA 3GHBH 3VE0A 1FFPA 2KQNA 2ID4A 1CQ9A 4QXUH 2EXKA 3SIKA 1HQWA 2PWEA 3OCPA 1BG1A 4Y5TA 4KI5C 5AKSA 1WWBX 2JENA 1ZVFA 2ZOLB 4I9XA 2VDKB 4AWJC 4K9SA 4HS3A 2JELL 1OO2A 4OSUH 3K6SB 4LT7A 1R092 5HHMB 4H26A 4XP4L 3BUPA 3BT2H 3U79A 1RXGA 5KYNA 1QKZH 2A9CA 1OB1B 1A7PH 1UM4H 3DHJA 3GBEA 3SKNB 2M2DA 4AL8H 1YEHH 4MCZB 3K3OA 3WFHA 1HEJC 5FYJE 3HUJB 2WJSA 1E4KC 4KO5A 1ESOA 3IDIA 3OM3B 4PREB 2VLLB 5CSBA 5E56A 4NO5B 2OQ7A 1KIPA 1ADQH 1OJHA 4A2MA 4CP1A 3AY2A 5JW4N 4IYHA 1M7XA 4S0TD 3RJQB 1U8LA 3PXHA 3ISYA 1T5WB 2N1KA 3TBDA 3USUA 4PCYA 1J3RA 3B69A 3C75A 4O02B 1QBBA 1I1EA 3G6DL 1LLAA 2VECA 5F9TA 1RZIB 4XI5C 1VQ8V 4S1SH 1MCKA 2VOKA 3II2A 3LZFL 5LBSL 3LDBA 5EJZB 2Y69B 1A6AB 2AP2A 3VH8G 1OD5A 3NSTA 2Q69A 3SJVB 5AAPA 1OM3L 3LIZH 2WWWA 2Q5ZA 1VBE2 5GRVL 1AE6L 4UV7H 3IJEB 1JOJA 4ZOBA 2IBZY 2A75A 1UXZA 1ZZBA 2BIOA 1CT8B 3IF1A 5LXTB 1VGEL 4BFBD 2NZ9C 3DSFL 3EYVA 3HI5L 1AI1L 5KLVH 1SVZA 4GYBA 3KLSA 4NZFA 4CDXA 4LDOB 4CP9A 1M9SA 3BAKA 1C12A 3AK0A 5FGCB 4JKPL 3NJVA 3V0AC 2Q73A 1BHAA 3WB2A 4JAMA 3VXRB 4LP8A 1SBSL 1XGRB 1BZEA 4OTXL 2FB5A 4MKMA 5BNOA 5IYZB 4KXZI 5B1BB 1HQNA 4BZ1H 3PHQB 1SLWA 3WFVA 1N4CA 1IEAB 3IFOB 4KKLD 1KB9J 4JO4H 3LNMB 1J1XH 2JNZA 4OF6A 5DU7A 3QXDA 3VG0L 1YIJV 1PZAA 1EWHA 1QFOA 4LF6B 1SOKA 3FUKA 1P7GA 5A33B 2GHWB 3RZCB 4XCNA 3LSSA 3VQXA 4KNQA 2YD4A 1AYM2 1YC61 4FMTA 4I55B 3M7MX 5A6ZA 1XHZA 1U8HA 1JJUA 1V3JA 3QISA 4FQJL 4CDHA 4L1DA 3FS9A 4Z3JA 4YR6A 3U1XA 1M7DA 5C08B 3M3IA 4CCKA 5E00A 3WP3A 2GALA 1QQP2 3D0SA 5D1XE 3MZGB 4J1UA 3D39D 4XZUA 4MMXA 3HFML 4ZXBC 1HXMA 4PJ9B 2WUCH 4ZDHA 1RXFA 2J5LC 2UY7A 4UT6H 4I0BA 1A4KB 3BP4A 3ZDZF 4LBOA 5FHAL 3GYRA 1YI9A 4ZOEA 2WNOA 1OV8A 2BW8A 3P5BA 1MCPH 2QTOA 1E6OL 1IGFL 2O6CA 5JHDE 2H0VA 2ZEYA 3E6BA 5E2VL 1JV2A 1WA4A 2FBJL 1Q8MA 5HXMA 2NUTB 3EZJB 3LV3B 4F33A 5I1LB 4GH4C 4CJ1A 2IFFH 3R18A 2DW5A 1BZKA 4B3TO 3MDJA 4WDIA 2PYJA 5DCCA 4WJ5A 2F2HA 1XNAA 4Y3OA 5IF0A 1UENA 3FAXA 5J1TC 1A1NB 5J13B 2D9QB 4I0KA 4DGVL 3O6LH 1RD6A 3ILFA 4PGCA 1UB6A 2R062 3BD4A 3QIUC 4E0RB 4X4ME 4LHUA 2BZ7A 3RTQC 3ZDYB 1ASJ3 4H33A 4DV0O 3D4CA 3JTBA 4P5TB 2AMUA 1D5ZB 3VGDA 2GTZA 3KGZA 2PYED 2KKWA 4ETYA 2X53A 2R69L 3WJJC 1R3HB 2DQTL 4GKJO 4N2LA 3SDCB 1UHVA 1T7VA 1AI6A 2VLME 5FYKD 4XUQA 3O2VH 4FMFA 5L8JB 3ROUA 4BQ1A 1G6RB 3T0XA 1N34B 4ZU4A 2H8PC 3PAZA 1T2XA 4HNAB 2QKIB 4UDTA 1VF7A 1NMCB 2K6YA 1JS9A 3OAZK 1U6AL 3ZSEA 5CFCC 1AGBA 1EBAA 3L4CA 3GSVA 4K23H 3LOBA 1QCEA 4TV9B 3BHBB 4TVPD 4JI8B 4AEIL 1QXRA 1ZM1A 3CC5B 2K9ZA 1AAJA 3QEQB 2D6KA 1CFNB 1UEYA 3HC4L 2WKKA 5JI7A 5E88A 4CDUA 2BGCA 4KK9C 1AQMA 4XRCA 1YQVL 2B9AA 3SO3C 5TQ0H 4WFEA 1FNLA 1CPMA 5F2WA 4NM8L 1TQSA 1CGSL 3LRMA 4ATEA 3H9ZA 15C8H 1E9OB 4LK4A 5DO2C 3NPSC 1LULA 2XWBA 3DYMA 4R96A 5KANG 1SLIA 2F43G 3WIFA 4PYHA 2X1OA 3QI9A 3EBHA 3ZYRA 4Q1PA 3LHPL 1QYGL 5KXDA 3P6BA 2UXGA 2WLLB 1OT2A 1XMQO 3NJMA 4YM1A 1CR9L 1OCRC 1JGLH 3RU8L 1QNZH 3B2PA 3SBWA 3MV8D 1FC1A 3VFRA 5CB4B 4G6KH 5CUSH 4I0XA 2VRQA 2NY3B 2IM9A 3QJQB 3P54A 3Q6FB 4X66B 3KPOA 5IB3A 3NFPB 3TGUH 1GYCA 2KDGA 4E42A 3ESOA 5BZXA 1IGMH 2QQKA 2J2ZA 4IMLB 4GI8A 4JN2B 1ROWA 2JWYA 2QHRL 2W94A 4X83A 3QIBB 1JGDB 1KFAH 5IMOA 3TBYB 5L19A 5KBFA 5BY5A 3EXUA 4HC1L 5T1KD 5KTEL 3FHAA 4QMEA 4JJHA 4B9PA 3E8UL 4JFPB 1B2WL 1W2AX 2XETA 3HE6C 1UTDA 1WCSA 2DTMH 1T0MA 1JOBA 1L6ZA 5E2JA 3VD2A 2JGUA 3TBSB 1M1SA 1AY1L 5A3IC 2GI0A 4XCCL 5A40E 4GFTB 3QHZH 5J12B 1DYKA 4ASKA 4RDQG 4K71C 1X9TA 3ZYHA 5IW3A 1ZRRA 4Q1RA 3A6OA 1DBAL 1DEEB 2E7AA 2C9VA 4EI6B 2ZUQC 1D9KB 4PRHA 4Z95L 1IS3A 1WP6A 5CBLA 3NQHA 2A73B 4FEIA 1N7MH 1DQJB 1UKQA 3OC8A 5BMVB 3A6BL 1GGCL 5AYTA 3OGCA 3JVFC 4TLKA 2E75C 5CA0A 5C2UB 2Y06H 4N0UA 2OK0L 3MUZ1 5GS1C 3I50L 1HL5A 2NTFB 3PGCA 2HH9A 3EBRA 3ABMB 3OEBA 3ZSJA 5EFUA 1RGSA 2F68X 5A3OA 1G0XA 4ZO7A 1LL1A 1TMF3 3VXUA 1I3GL 4AYFA 3TS8A 3CCVV 1NE6A 4XAAA 4XMLH 2GAUA 5LBCA 3FQNA 1NCTA 1IKOP 4U6YA 4X1IB 4E4SA 3G7TA 5E99L 5A7EA 1EV13 2IH3A 2WXGA 1JPST 4QGYA 1JOYA 3WG4A 5E2TL 3OG6B 4FTEA 3D3IA 1CAXB 1KJMA 1EMTH 1SJHB 3HC3L 4V11A 5HCBA 2P8PA 4DQAA 3GRBA 4OFVA 5C7XL 4OW6A 4S0SD 4C0BA 5EOCL 1PZ8A 1P7KB 4H13C 1I9JH 5TK2A 3KWUA 4OT1L 2FH6A 5GJTL 3ZL4L 2XN9E 4AG4H 4AGQA 5D55A 1LEDA 2E7BA 3BKCH 3KPPA 1I8AA 3L5JA 3IXAB 2XIDA 3U7YH 2Y1VA 4L8BB 2CGNA 2H94A 2CLZB 3FCTB 1N47A 2QM8A 2OYLA 4Z77B 4HOMA 3PGDA 5J1SC 3UT5A 4O51A 2BNQA 5KSAD 1AD9A 1LDPL 2L8AA 3VD7A 4K3GA 2PHWA 2XRAL 4JGYC 4YGVA 5DGQA 2Y6FA 1NZRA 5HDBE 2P28B 4UUJC 1SERA 1J0ZA 4U3JB 1I3RA 4IV1B 1LHZA 4NWUL 3VBSC 7FABL 4OV5B 3L3GB 3QO0B 4K3DL 4WBNA 1S7QA 3LS4L 4DKEL 2BSKA 3CCQV 1PQZA 2FNWA 2WBJA 3EH5B 1CF8L 4JFDA 1N36B 2P3IA 4UCTA 4WZCA 3V4PA 1ZGLM 2UY6B 4RIRB 5EUKA 2QQNH 3MUJA 2HWF3 1PIGA 5CAYB 2OMYB 5KYXA 3RVVD 3RZGA 5LMUO 3NCFB 1L0YA 2GSGB 4M3CA 1BQ0A 1JZFA 4AEDA 4JTAB 1KYOK 3Q8FA 2W08A 4L37A 5KX5B 1Q94A 3P1VA 1PV0A 1XEUA 2WXPA 5H4YA 4Z18A 3V4UL 2BFUS 2J7MA 4QXTA 1KB3A 2B4CH 1KBHA 2OS2A 3BTYA 4WGVB 5HYQA 2Y72A 2FDIA 1M42A 2J12B 3HB3C 4WIQA 1DLFL 1Y4MA 4JLRA 1VE0A 3T2TA 4XGZA 4RHV3 2GJPA 3N1FC 1C1FA 5TDOA 1O8PA 5HI0A 3PAVA 2L4OA 1YEFH 4HF5L 3D4KA 1PLGL 3JASA 1H2NA 2CKNA 3ARDB 3NFSH 3QC5X 4YH6A 4F15C 4PJ7B 5ALBH 1VAMA 4Y9EA 4XCBA 1DQIA 4KROD 4CKVX 3IK2A 4QGPA 2FD6H 4PB9L 1AR93 2AAVA 2BP0A 3FZUD 4K21A 4GSDL 4K7PY 4KI5E 4OKDA 2YA1A 3P30A 5AALA 3FB7B 4KRPC 3G67A 4PJFA 5C8YB 2MSPA 2XYCA 5FZHA 1R3JA 2BOLA 3D7PA 4GQ9L 3WL9A 4L9DA 1J5CA 1OMIA 4P59H 2FB4L 5I1EL 4LO9A 1UXXX 2Z2SB 4N53C 2Q4SA 4DESA 3UQ8A 3DTXA 3T4YA 3F7VB 4GI6A 5JIKA 2PR4L 2DN7A 3FT2B 4DT2A 4IBSA 2BOCC 3LZNA 2DMGA 2E27H 3SOTA 5A7SA 3MBWA 4I7ZB 1A7BA 1F4WL 2I60L 3V65A 3S5LA 3BN9D 4HH9B 3O8XB 5E6IA 5KBLA 1K6QH 4BE3A 2WAAA 2IJ0C 3JD71 3DGCR 2FR4B 1XC6A 1OGAE 3UOAB 3MUHL 1BVZA 1NKGA 2MOGA 3QQXA 4DCQB 3IDEA 4HN1A 5FY9A 2VJ0A 3CN1A 1AQ8A 3ETEA 3ILPA 4U1IA 2P5WB 3VFVA 5D5MF 1I0HA 5CP7B 1RZJH 3TCUA 4RMQA 3KYMA 3D3AA 1GMMA 4OI9A 4M4PA 4UOQA 5KA5A 4N9IA 1XF3A 3GJFH 4D0BB 5CKAA 5I15H 3QRGL 3F7PC 3MFCA 2YIAA 4QCIB 5BRQA 3ZSTA 3M8OH 5MHSE 1ZUQA 3Q6GH 1HZLA 1YO8A 3U4EB 2I9LA 1MEXL 1XB3A 1HILB 4UM8B 4HHAA 3RYMA 3DXUA 4N8CH 4XUPA 3PABB 2GIMA 1R24B 3L75H 2HX9A 12E8H 1QSEA 5GRWA 5JIPA 1MFCL 5F9WC 4OIIH 1V3LA 2BHZA 4DRVA 4X20A 3V52L 1S5HC 2QSQA 4JYCA 1UN1A 4Y4HB 1F45A 1HINL 3PLQA 5EBWC 1B4JL 3CRCA 1M7IA 4HD9A 4YQXL 2J1YA 3B9KA 4I3SH 4PS7A 2OJEA 1NICA 2Y2TA 5TH2A 1SJEA 2AXJA 5F2FA 4PI2A 4HLZG 4FPKA 4CE8A 4A6SA 1LO4L 3DO3A 2O30A 2HMIC 4CS2A 5L4FA 2WNUA 3BVOA 5T54A 2W8CA 4PWJA 5FW8A 4PWEA 1WS7A 1I4FB 2J6WA 3PWUB 4XF9A 1N5YL 3KLAB 1O9GA 4WWKA 5EHDA 2GITB 3AQDA 4CDWA 4PRAB 3VZMA 4PD4F 4W93A 1WAAA 5B4XA 2EXWD 2Z8SA 1JYXA 2IWGA 3RYIB 5BR8O 2X1PA 5I2IB 1Z7S2 2CH8A 3S34L 3X3GH 1RVF1 3WS6C 1LO3L 4Q20A 2Y33A 1QHQA 3G04B 5F1NB 4OZHE 4KKCD 5DUJA 4CSTA 5KEZA 4QPGB 4DP5X 1RVFL 2FTAA 2IGFL 4FKKA 4LVEA 2VW0A 1D5IH 1GIGH 3F6LA 3V9EA 1VAVA 5FK7A 3WF0A 3C5SA 4P3DB 2YWZA 5FYKU 4GBXC 2GY7B 4IBQA 1P53A 5KOMC 2V4VA 1GO3F 1W2BU 2DVAA 1CLOH 3GRWH 4MNGA 2PPDA 3EYOA 4GRWF 5ES4B 1QJX3 1WN7A 2MQCA 4LK7A 3VFUA 4PY7B 5JYLA 4PIXA 1FQ9C 4UB0H 3CH1B 4U1HA 4IEPA 4PY8J 1ZZ8A 4JI4B 1Q9KA 5H9RA 5E4OA 4HG4J 2HFGL 3LN4B 3LTVA 4FZ8H 1EERB 3HR5B 2AKRB 3E9UA 2OR9L 3CVDA 3QDMB 4FI8A 4FQXA 5FK9A 3C9NB 4B9ZA 4ODVL 1NU1H 4ZKIA 9PCYA 3ARBC 3E5XA 2VLJA 4H8VA 5I8EA 4U7MA 3SKJE 3NSFA 3ZBMA 2R16A 5FYLD 5LGJB 2H41A 3V0IA 3HRZB 1BXVA 2AW9A 4LFAO 2LU4A 3PV7A 1LNSA 1BVLB 3BEVB 4U3SB 3B00A 1OAQL 3MROA 2NQ3A 1K5NA 3FF7A 2JRIA 4G2AA 4JRYB 1NIFA 4F7CA 4WW2A 2FTKA 1R3LC 4XETA 1IGTB 1TG7A 5EBMC 4PW9A 2LV4A 3KWTA 3EFOA 3TT1H 2GG1A 5HPOA 3S36H 2QGDA 4Z3TA 4HJEA 1MFUA 1NE4A 3NEEA 3L3KA 3EHKA 4HKBB 2HVKC 3MFGB 1T0NB 4I9WD 3F83A 1EN6A 2V3EA 1ZVYA 3PRZA 4HIXH 2LW8A 4IGOA 2X87A 2IH1C 1ZDSA 1VMGA 3JD73 2OLDA 2X10A 4JG5A 3FX7A 3SPGA 1HN1A 2WZPA 4B7KA 3O9WD 1VEMA 4X99A 3SY0A 4LASH 2GVYA 3N42B 4DV1O 1I7RA 1BBDL 2EH7H 4M43L 2WP3O 1P0SE 5JQHC 4F4LA 5DZEA 5FA4B 1YYLH 3FT0A 3WS3B 3UTPD 4LMQE 2CY6A 2A1XA 3GCXA 1N6VA 5L0QB 3NJNA 4MGSA 3V0VB 2YG0A 3JARA 2A9MH 4HAKA 2AREA 1KT2A 5JDSB 1NFIA 3VNYA 5KVEH 5KW9H 1SZTA 4QHOA 1AXTL 1LVEA 2GAZA 2YOCA 1YJLA 4YGDA 1AKPA 1NA8A 3UZVA 3N4MA 1BGXH 1HHKA 5LQBH 2WJ5A 2GUZB 3K1KC 4QTIH 5DEJA 8PAZA 4FM2A 5TK4A 3V5DB 1FSKB 2RR11 5JSOA 5B39B 4JGSA 1HEZA 5LBBA 2O5ZL 5E6ZA 4RGMB 3B56A 4HT1T 2VG9A 2WRAA 5HHMD 4PCTA 5G4OA 3MHZA 1H8TB 3LRLA 3WY1A 4PUBH 2C4FT 4J3OG 3U4XA 4L97A 3FAWA 5F9AC 2ETEA 4OFDA 5LP6B 4COWA 2ZCHH 1CICC 3CVIL 3Q2NA 4XTMA 3E2HC 4TOYL 5DZJA 3ZT7A 1UD2A 5DZVA 2ZSVB 3DX9A 4X4XB 3F2LA 2DM7A 2MH4A 1Z9SA 3FTWA 5J11B 2C9PA 1XMOO 1RUG1 3U9UB 1W6OB 1X4TA 1NEZA 2AV7B 4YSDA 3SY6A 5HYJE 3DSQA 2HG5A 1INQA 2BNMA 1M6OB 4MVBC 3TEWA 4NN7B 5D1ZC 2ZWYA 5F44A 2BZCA 5JW5B 2ZOUA 2CQVA 3KWVA 3H4HA 1FYTA 5DQDL 5JIHA 4M8VA 3CFNA 3EYQD 1NLBL 2HVJA 2NNAA 1QX1A 4N0FB 3AMLA 4D9QD 4F5CE 4YFDB 1SQMA 4IW4C 3U4BL 4BQXA 2B59B 3VMNA 5KC5A 1YJDL 3OZLA 1GWKA 3AG4B 4Y5YB 2QSCL 3WTVA 4KQ7A 3FN0H 4UMGA 3BPOB 3SJVD 5FMOL 3OGVA 1INEH 3CCJV 1LEIB 3O3DB 4JDNA 2WLMA 1RPQA 1NEUA 5J7CC 4FQQA 2LM3A 1IC5H 1SETA 3MJ9H 2VW2A 4FZ1A 4KK6C 1KXQE 1GAXA 1BQZA 4U49A 4YVUA 4W1TA 4PBOA 4YDLC 3TFKC 5GLVA 3QUMH 5IW1B 3HEIA 4DP9X 1CBJA 1DQDH 2NW2B 4Y1AE 4E41B 4EVNA 1W3VA 5KAQF 4TV8B 3PWLA 3WFCH 1F9KA 3L5IA 4H14A 3MLXH 5KWYC 3CJHB 1JNHB 3GTVA 2BRTA 2UUAO 1YEDA 5IUSA 5EO1B 3R7RA 3OR7C 1OAJA 4ZO9A 4QHNA 1PZDA 1YNKL 3DMMA 3VXPB 4IEUA 5HBAA 4LF7B 3SE4C 3TWCL 2UUCO 5J48A 3RWDA 2HLEB 3L4VA 4ES9A 3VDDA 3S36X 1WMDA 1DVYA 2EIEA 2WXQA 1IILE 2G9FA 3WSQL 4JI5B 3CWBH 2VC2B 3BH9B 2UWAA 2FT7A 3AG3C 3WF2A 3RZCD 4ANXA 1K4DC 3BX7C 4KJPD 5B4MD 5T3ZL 2EUWA 3ZYBA 2X0UA 5IV2A 4RR3B 3R4RA 4PJCF 4PRIB 5C6TL 5C08D 4FO9A 4O2FA 1G43A 4WZFA 1B09A 1AYN2 1AO7A 4PJ9D 1YJDC 3F12A 1JFQL 5DZNA 2UWEE 5IG7B 4ZFOB 3FT3A 3SN6N 2C1FA 4XT1C 3Q0HA 1KUMA 1OKEA 3OHXC 2XQ0A 3IS1X 3AXIA 3M07A 5E2UL 8FABB 4JI3O 1JZ7A 4XQWA 1FIGH 5SV8A 1UWEH 2A74B 3URFA 5C5UA 1EFXA 3PJNA 2YGNA 4MAYC 4HCRA 4FFYL 1IGYB 1J48A 3VQ2C 5FGBC 2BGPA 1NCWH 2R29H 2IU0A 4OMDA 2X70A 3QH3A 4KTGA 1BOGA 3GJFB 5IOKA 1P4LA 3FH7A 3GBDA 3LNIA 3QDHA 2VTFA 3NEXA 1JWUB 5CIPH 4HX1B 5JH7A 1VP7A 4AK1A 2G75B 2WQ8A 1D5XA 3MXWH 3ZLIA 4CS3A 2IWFA 3WUWA 4X8JB 4LEJA 5CM1A 3D6GA 1I8LA 2EO7A 2AGJH 4WO4C 1SG3A 3CGTA 2KZ1B 4RGNC 3A4AA 1BEV2 5IHUH 4OHVA 1URZA 3C8DA 3CX5J 1D2DA 3O2WH 5EF3A 2EEXA 3CB2A 4J9YB 4P5TD 4Z7UE 3I75A 1DJSA 2TAAA 3IFLH 5AW5B 3CRRA 3ARYA 1HXYB 3VI4F 2RMU1 3VFPB 1S7SB 1MS1A 4MXWH 5J1AA 4P02B 1AXIB 3C7GA 4LARL 3EHBB 4DINB 2G9HB 3D2UA 2BFGA 2BWIA 4GO6B 3MIDA 3HMWL 4N90D 5BS0A 5LOVA 1HS6A 5DRWB 1N0XH 3BGFC 4LLAA 5CR8A 2J1VA 5M7QA 1E2WA 3IJHA 4YVWC 5H37A 1LJMA 4XPAH 1MG3C 4Y9CA 1KIQA 4NAMA 3WTWA 1RUG3 3K72B 2VE6B 3AL6A 1EHKB 3EGSA 2HAZA 3FQXB 2HWE1 2QE3A 4A42A 5ACMA 1TJMA 2E0PA 3NIDF 3FH5A 3MFFA 3QEQD 1U8MA 2Z3YA 6PCYA 3B01A 4NDMB 3W5MA 4WEUD 5KS9E 1E79G 2BJMH 4L4VA 4MAZA 1YN7B 1BEXA 2Y22A 3ROOB 3KLHC 2N74A 3ILQC 1WGPA 3AMNA 4MJJA 1X7SA 4J25A 3O4LE 3F04A 5MP6L 3PN1A 5CVRA 4R4FL 5KHIA 4XXCA 4COYA 1Y6KR 2NT1A 3TX4A 3UAJA 3VSUA 3L3IA 4P9IA 3FSOA 1FPOA 4FC3E 4AVHA 4GRMA 1NC4B 3A67H 3W57A 3ZRCC 3H42L 5F93C 3MNMA 4G59C 3FSAA 1XYNA 4XB3A 1AANA 3ZMOA 1F4XL 2KUTA 4ANWA 1MFBL 3IRCA 5A32B 1ZHNA 3D07A 3V0HA 2D44A 2NY3D 3FSVA 1UFGA 2EAKA 5L7OA 2YPKB 3RGBA 4X80L 1KIUA 2ZGQA 3TOJA 3WNKA 5AOZA 4D7BA 3QIBD 3OF1A 4AEKA 4DR7O 3T1YO 1NCJA 3Q1SL 4PYGA 2D7OA 1SBBA 5I1DA 3WEZA 4MTOA 1DJYA 3MNVB 4ZUUB 4XPBL 2Y1YA 1RIUH 1D0GA 2RMKB 4G7YH 1LEGB 2TSBA 1JK8B 4V33A 4XO3A 1RSYA 4E5XB 5FMCA 1NA1C 2IXQA 2HPOA 4NQCE 1ES0B 2BNOA 2CWSA 4B4RA 2WZ5A 1BMV1 2V7HB 3DIVA 4JDTH 5ITFB 5H94B 3ZJAA 4R8HA 2J1KA 3UETA 1FFNB 3AVEA 3ZYJB 4HUUB 4UW4A 4GWNA 4OGYL 1W99A 2UZIL 5GKAC 2CLVA 1I9RA 1DN0B 1BJQA 2ADEA 1EJ8A 3PWNA 1C16B 2EYSB 4MSWC 3JWOL 1D9KD 4R4BA 3RMYA 5CEXB 1CG9B 3QORC 2QFPA 3BCWA 5BNOC 1PMYA 1JVMA 2FLBT 3AS3A 1NIDA 3EO1B 4PJ5A 3GYDA 4UFJA 5BNPA 3JD3A 4QKDA 4YJ2A 4UAOC 1WUNT 3KNBA 3UKNA 3APBA 2O4EA 3RVHA 2ZMNA 5KVDE 4XYXA 1U8CB 2WNVB 2X0LA 1HB3A 4F2MA 3K08A 5D7IF 3QCTH 4XHXA 4JY4B 5EORH 5HJDA 2CTQA 2G19A 4GKYA 1MJUL 1EO8L 1KELL 3R4SA 1IKFH 3QAZC 3CFKA 1BM3L 1U8NA 3I74A 1TLMA 3QWQB 3KPQB 4UU9B 3CK0L 2CWMA 5I0WA 3QUXA 4GIOA 2HN7B 1UIJA 5FOBB 4FXKB 1EEZA 1PGW2 2J72A 3W11C 3MLUH 2ZNJA 4HK0B 4W6XB 1KCKA 2R1WB 2F15A 3EADA 4NO0B 4CH4A 3WLWC 1O5UA 1JN6B 5L3DA 2F5AL 3CN0A 3K0WA 1MWAH 1T1ZA 4DO5A 4F8PA 3TA4D 2C0ZA 2X8KA 5DT1L 2V5MA 5TPWL 5I17A 2NYYA 2DS4A 3OAAG 1TT6A 1UWGL 5EU6A 2XASA 1Z5LB 1T22A 1JL8A 3N44F 3OF6A 4FXGB 4IBTA 5LAPA 5C0AE 3AGVA 3MIBA 4NHCL 4OLVL 5MERB 2BIQA 3L2NA 1XCWA 1Z5HA 5CR1A 5EU4A 2WXIA 1RI8A 1NMAL 2A71A 4R8WL 2CCLA 5LG1A 1F0LA 4WHYG 3TBBA 2J1AA 1GKOA 1UGNA 3N9LA 4WVMB 3QWOA 1KGCE 3N55A 2HR3A 3N9GL 4LU5H 5ESVB 5BO1H 1GZQA 1BCCH 2FX8H 2EA7A 1XF4B 1WZAA 3NRUA 1NR1A 4ZO6A 1OPGH 2WO3A 3V7AG 3ENRA 2F53E 5B8CB 1D5BA 1FNGB 3GUTB 1UASA 1YEEH 4KBBA 4GUNA 4OZ4A 5GISL 2OYZA 2UX6A 4QXHA 4U1KA 5B21A 4ZMXA 2NYKA 1TQ5A 1JZGA 4Q6YA 1ET7A 1AG6A 3HHRB 4HWBH 2EIMB 4AXWA 4DXSA 5FPZA 1ZT1A 2FGWL 4P48A 1X5ZA 5AW1B 1B4TA 4P8QA 4DOHE 4ZQTA 4FVVA 3ZKYA 2F1BA 1AI4A 3K7UA 3ZUNC 1QNWA 2CE6A 2OZ4A 1TTFA 2ZOOA 1YPZB 2YS4A 3R8QA 4MFHA 2NQYA 4GY4A 3WG1A 4HOXA 4L3CB 1MCLA 4WCYL 1MHPH 5DD5L 1K5JA 1P84J 2OV0A 1CPYA 3QUMB 4JVUA 2OM5A 1DLBA 1SFDA 2ZUVA 5GZOC 4MGTA 1SDAB 1TYEB 1N33B 1MREL 2O5YH 1QQDB 2QHLA 3OAYK 3PVNA 1XB6A 5HI4C 5FY7A 3CCLV 4DR4B 5EC2B 1IL1B 2EYRB 3FSWA 4DGIL 2ADQB 5IJKC 3H9SA 5IJ0A 4H0LC 5INDA 3ARDD 1ZXKA 1U8QA 2CDFB 1CGYA 1XVSA 4QAMB 3QFJA 5EOTA 3VFGH 2ZZQA 3U75A 2HP8A 1HJGA 1QUNA 3ZHQA 3FOLA 3RWHA 1F5WA 4Y2DB 5HJBA 4N2EA 1GZPB 3UYRH 4DR6O 3OX8B 4QLWA 5K1PA 1RJLA 3UYOD 1TCRA 1BREA 1WIOA 2VW4A 1X50A 4WEBL 5D2NE 3SBWC 3CYOA 1ORQC 5FECB 2VOXA 4AFDA 2ZR3A 4NXNB 1A7QL 1JF1B 2J1ZA 3UCQA 5IEHA 2W2IA 3LKJA 2F66C 3B8SA 1KB5L