2A3QA

X-ray structure of protein from mus musculus mm.29898
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
113
structure length
113
Chain Sequence
PFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHVDLPQAVISKMDTNRQRYPVHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
publication title X-Ray Structure of Protein from Mus Musculus MM.29898
rcsb
source organism Mus musculus
total genus 33
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2005-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12643 MazG-like MazG-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2a3qA00
2A7WA 2Q9LA 1YXBA 2Q4PA 2A3QA 3C90A 3CRCA 2OIGA 2YXHA 3CRAA 2Q5ZA 1YVWA 4QGPA 1Y6XA 2GTAA 1VMGA 5IE9A 2P06A 2OIEA 2Q73A
chains in the Genus database with same CATH superfamily
1FFTB 3RYIA 3JALB 4WFFA 3HKBA 2QWOB 3UQ8A 4WCEV 3OMAB 4LF6B 1XMQB 5EBWC 2R9IA 3BCCH 3PJSK 3O9OA 1KU9A 4GKJB 3HKCA 5JJEB 1N33B 1GMGA 3H9VA 3F7YC 1FKAO 4DV3B 1EM1A 2X6CA 3CEIA 3GWKC 4L8JA 5LYJB 5GONB 2LFSA 4KFMA 3ZS8C 1BCCH 3U11A 1AR5A 5KHIA 3CHXA 3WG7B 1URFA 1V55B 3K9AA 2Z0AA 1Q6HA 3CS5A 4DR7B 3QTCA 1NR1A 1KB9F 3I55V 4LP8A 4GT1A 2UUCB 4FMTA 3J81N 5KX5A 2Y0PA 5IT9N 5IY5C 2IW5A 4MVOA 4E4EA 3N2KA 4LWSB 1S5JA 4R8CA 1QVGU 3E22B 2QWRB 2ZR2A 2LO1A 4MTXA 1XNQO 4LFAB 2F93B 4TV9A 2ZNJA 5LMUO 3W7TA 2QKSA 3CCRV 4CBCA 3K03A 1RM1C 4X65O 1RSOA 3K3WA 1KP3A 5JCOA 1Z5WA 4XDJA 5JH7A 3CRRA 1XI1A 1JX9A 1UJWB 1JQ0A 1YEWA 1NKDA 5FPOA 2P7TC 4PDRA 4EFBA 1OCCB 2PF4E 1IDSA 1D5AA 1TA8A 5B3SC 3EVKA 5DEDA 2F95B 4DR4B 5IYZA 4I9QA 2HVKC 4JI0O 4BAYA 2DN9A 1XEQA 1QR8A 2RDCA 1L0NH 1BMFG 1KMIZ 1TVKA 1AJQA 4IYHA 4DV0O 1AILA 3M7MX 2Z5UA 2L35A 5D5QA 1H8HG 5LP6C 2K9PA 3CD6V 3OMNB 4JI6O 4D7TA 3W7XA 2W6IG 3SJCC 3QNEA 2Q8VA 4IT5A 4R7CA 1GN6A 2BSKB 3K59A 4RUEA 1H2LA 3VBBA 5BR8O 1F7YA 3QG5A 4TQFA 2DQ3A 3WB2A 5IY5B 1VQLV 1RPOA 5JVDB 1TUBA 3CJHA 4HNAB 3GWOA 3UCSC 5K1XA 2QM8A 3VQVA 1VQ9V 3BFRA 1FXKC 5LHIA 3ZRSA 1US6A 1QLEC 2DE0X 5FLXN 1VQ6V 1YIJV 5CBFA 4UCSA 1RM1B 3B8MA 4DV2O 5IE9A 4P9OA 3OE7G 3HPLC 2IU3A 1S72V 2WLLA 2ZDIA 4BIUA 5IWAO 4MTOA 5LBQA 2VQEO 2YEVA 5GTIZ 2R72A 1FD9A 4MTFA 1I94B 1T5EA 5L3CA 4GX1A 4JI4B 5B3SB 4LNUA 5AG2A 4O4JB 3K0GA 2QWQB 3E83A 3QO7A 3FX7A 3CXHF 2LGQA 1XDCA 3DC5A 1P84F 4MSWC 2OCHA 3EXAA 2P22C 2EX3A 1IBLB 3ZMSA 1SESA 1AJNA 1F23A 1YHQV 2RN9A 2IJJA 3CB2A 1VARA 2PGGA 1N0JA 4MT8A 2EZPA 4JYCA 1Y4MA 4G28B 4RUFA 4LFCB 1IBMO 4J7ZA 2YUAA 5LP6B 3OUSA 2QTOA 3QVNA 4IHJA 3CCVV 3RYCB 3UT5A 2Y69B 4JASA 4JF3A 2A79B 4FVMA 3IFXA 1O9HA 5HFLA 2BTQA 1WPXA 1N34O 3SPCA 1Y74A 2JK5C 2YSUB 4TV8B 4DRXB 4H37A 5IYBO 3OT7A 2BE3A 1PKXA 3C3TA 4JI7O 5GTHZ 3OTOO 5BZBA 5JCOC 1FXKB 2E76B 4DR3O 2ZE7A 3RYIB 1QLEB 3HKBB 4FLVA 4GX2A 5H9CA 1HDJA 1QVFU 3ZHQA 2OIGA 3K0DA 1R6TA 2WLIB 1R1BA 3JCUZ 2WLMA 4I4TA 4NTWA 2VWKA 3BA9A 3HKCB 3K5MA 4FIPC 1TAEA 4AI8A 1VF6A 2VWJA 1SKVA 4WF9V 1R6NA 2BOCC 1CXZB 3HKEA 2EINC 2UU9O 1VEWA 3A0BZ 4GLXA 1SERA 1G8MA 2WLHA 5FNVA 1XNQB 1B04A 1SQFA 5LMUB 2GTSA 3KCYA 4X65B 3STZC 2ADQB 3SR2C 1MOFA 2YIBA 1R3IC 4O2BA 2FMLA 1HNWO 1K8AW 3JARA 3AG3C 4J41A 4OPAA 2YI9A 1SQPH 2AXTZ 2CTRA 1Q81W 2ETNA 5K1PA 1KECA 5JQGA 2HJFC 4JI0B 5CB4B 1BS3A 2NLJC 3ZJZA 3DXRA 4DW1A 2OT5A 2ZDIC 4BWAA 2DOSA 4DV0B 4Q20A 5IYDO 2H94A 2AHZA 2Q7GA 1QBZA 3FB5C 2NNUA 1Y66A 1WPBA 4CC5A 2XTAA 2HEPA 4GX0A 4JI6B 3OFNG 1O9GA 3W7SA 1I08A 4YJ3A 1CEZA 5IYZB 1XL6A 4PV1B 4B3MO 2YDEA 3L72H 3HB3B 2EINB 2XNDG 1BL8A 1JFFB 5BR8B 1I7FA 2P6JA 5B1BC 3CCUV 2ZXWC 1I5YA 2A7WA 1Q8IA 1BHBA 3ZHUA 3TK1A 4K35A 4DUYO 3OUFA 1NVPD 1JOYA 4RAIA 1YDXA 4FLTA 2DMXA 4LH6A 1ZUQA 4FFBA 2QWNB 4AQYO 5EIBC 4YJ2A 4GKKO 1VMGA 1WB8A 4RO2A 2ZE5A 1JCHA 3JD1A 2EJ7A 3F7VC 3JASA 5A2QN 5LHGA 1I5XA 2E5LB 4UUJC 5IWAB 2HVJC 2Q0AA 3CJHB 2VQEB 2ZM6O 3AG3B 3JCZA 3DC6A 3QF7A 2PYJA 1EBOA 4GX5A 2OWOA 2OCCC 4PDVA 1NZ6A 5KMGB 3HKDB 1ZTEA 2RMKB 2IJKA 2RNBA 3ABMC 2XUMA 2D3OW 1M4UA 2EILC 3KZIZ 3SYOA 4DR2O 2YEVB 1AP6A 3CCLV 5EZYB 2UXCO 1H2SB 2G38A 4X62B 1IBMB 1P7BA 3ETQA 4QIWF 2JRIA 3U0ZA 5LGTA 1PNLA 2KKWA 5IJ9B 1OV9A 4LNUB 1ROPA 1ZX3A 4J7KA 4TWKA 4X1KB 2Q4PA 3K58A 2WSSG 4Q6GA 3RFRA 4GZRB 1N34B 2OYQA 2EIMB 2CGNA 1Y67A 2EZOA 2B5UA 1YTFB 2UXNA 2ZXWB 3OR7C 3AG2C 2EBOA 4QJFB 2DQ0A 5TISZ 2RCVA 1YZBA 1NTKH 3ASNC 4JI7B 3OTOB 1AR1B 4ZIBA 3CX5F 3IJ4A 4DR3B 4P9PA 2MK3A 4JI3O 3BHPA 5FL7G 4O4IA 1BE3H 1Q6UA 3O65A 3B8NA 2BTQB 2YXHA 5IJ0A 4O4HA 2XAGA 4LH7A 1B6QA 4OPHA 4PA3A 1KKCA 2ZINA 5ITZA 4H13B 2JS3A 1VQOV 2ZE6A 1HNZO 1XNRO 1HNXO 2OCCB 2WLJA 4JZGA 1AB3A 2N04A 3JAWA 3S3WA 1YJ9V 3SYAA 1NH2B 3CRAA 1XHXA 2XHBA 3ABMB 2R9AA 4FLWA 1QCEA 1OCRC 4I4TB 1JJOA 3ZMUA 2DYSC 4DK0A 2BOBC 3ZRWB 3BRCA 4O4LB 2CUGA 2QA4V 2GBOA 3HKEB 3BAAA 3DGEA 4GYCB 1IXMA 4FPPA 1HNWB 1SQBH 1W59A 4ICGA 2P67A 4I55B 5LL6Y 3ZN0A 1ZL8A 3HR0A 3EHBB 3M99B 2IH3C 2KG7B 4Z2WA 4JTCB 5KUKA 3IC9A 4ZHQA 2QM4A 2V4DA 3AG2B 1W0KG 3TETA 3AG1C 2ZIOA 1XMOO 2WPDG 5L3BA 3W7UA 3M8AA 1NT2B 4I0XA 5L3EA 2UXDB 3OM3B 5LOVA 5H2FZ 2LW1A 1KBHA 2Q0OC 4EFEA 3K57A 5EYPA 3RGBA 3JARB 4JI1O 5EBLC 3TXQA 3FB8C 2H8PC 2Q73A 1H2KA 5KAFZ 3OTFA 4K8ZA 4DUZO 4KHPO 5JQGB 2JGDA 1UPGA 1HP8A 1YJWV 1WNSA 3TJTA 4B3MB 2WWWA 1N32O 2HR3A 4FM0A 3FAVA 1FJGO 4JZ2A 3MDSA 4I50A 1LUVA 2AW9A 4DUYB 3JSNA 5KA6A 5KUMA 3ABKC 2QWPB 5J2UA 1WB7A 3R66A 4DV7B 4K0KO 2F1MA 4YJ3B 4DV4O 2Q5ZA 4J7JA 4UB8Z 4GKKB 2WLNA 4X8AA 1MABG 2OTLV 4ABMA 3AG4C 1GN4A 4MVQA 5BY1A 4LF9B 2ADPA 1IXBA 3G71V 1PP9H 5L3DA 1H2NA 4K8XA 4RWUA 1XL4A 2X7RB 3N27A 4PELA 4WFHA 2ZM6B 1IBKO 5BXZA 3E86A 3KCXA 2V1DA 4F6RA 4FFBB 5C8YA 2W6JG 4YJ2B 3K04A 2Q6AA 3LSUA 1Q82W 1N36B 3AG1B 2A9HA 3MHSC 1WA8B 2YXYA 3K5LA 3RYFA 1VQPV 1SA0A 4NYKA 3AK3A 3FYIB 1Q90D 3JASB 3T2MA 2W0FC 1FFXA 2AZ0A 1QLNA 4PI2A 4UFZA 2UXCB 2KB1A 3CSXA 1YI2V 2YXLA 1Q7YW 3JATA 1NTMH 1M56C 2AHYA 5CA1A 4X89A 4NXNO 1KKDA 5HFMA 1HW7A 5B1AC 1I0HA 2JIZG 1PM9A 1H38A 2DWEC 4ZBMA 2QTSA 2XAHA 5E1AC 3B40A 5J9PC 1M5IA 3L75H 1PD3A 4JI3B 3WB0A 4JYYA 2D2CB 2RQ6A 1Q5OA 5BMVB 3CC2V 1RPRA 2XT9A 2WAMA 4FLZA 4WBNA 3SGIA 5CBHA 1PNMA 4HZ3A 5D5PA 3AEIA 4BIOA 2PTMA 1B06A 1P4RA 1VF5B 2QEXV 4DO2A 1GAXA 1HNZB 1XNRB 5A9GA 1HNXB 4CZZA 4XDKA 3L73H 1WLEA 1D5NA 1DLBA 4ZI7A 2MW2B 3WB1A 2Q68A 1VQ7V 3B4SA 2UUAO 4I9WA 4O4HB 3C3SA 4FK5C 1S3JA 2ARHA 2P06A 5LMNO 1SF9A 3P3NA 1F4NA 4JI5O 3E8FA 3ZCCA 5KHGA 5H6QA 2IBZH 4R50A 1K5SA 4QPJA 4JGSA 3SJBC 2JJ1G 3CRMA 2VQFO 3JAWB 1H2GA 2LJ2A 5CA0A 4CS3A 4UXNA 3D3IA 1IZ3A 4X1YA 4HYOA 4FM1A 4QE9A 5JJNB 2GUZA 4G27B 1MA1A 4NKGB 1JJ2U 1FAFA 5B1AB 3B09A 3ZN1A 3H1HH 3LUTB 3JAKA 5FPRA 2EJRA 2F23A 2F43G 1XMOB 4B08A 2B1IA 3OGCC 4ZOLA 3BY6A 3UO3A 3AK2A 1ORQC 2O57A 5LXTA 4LF5O 1NTZH 2ZD9A 4LF7O 2ODMA 4QPKA 4X1IA 4G2KA 5KHKA 4JI1B 4MVSA 1J95A 1KP2A 1ZL8B 1S5HC 1M9NA 4H33A 2FTKA 3Q4HA 1OJHA 2QM7A 3CRQA 1YTFD 5CBGA 2QKCA 1M90W 3RYHA 4WFBV 3CCMV 4DUZB 2HHHO 4KHPB 1QR9A 1KD1W 5KA5A 1WP7A 2QE7G 1N32B 3LNMB 3JALA 1FJGB 1P49A 1X59A 1D2DA 5LGUA 3ICXA 3PN1A 2QDOA 2FYUH 4LC1A 1MNGA 4JAUA 5J2TA 4UCUA 1OCOC 3G6BA 5KX5B 3F5WC 3VQXA 4DYLA 4K0KB 3VOUA 4J10A 4DV4B 2JGDB 3N2GA 3N2KB 1S77D 3OEHG 4LF4O 3ABLC 2EIKC 4J9YB 4JPRA 3UO2A 5LYJA 1NBMG 1GRJA 2QGNA 4JTDB 3FAVB 4KXRA 4TV9B 3SYCA 2YIDA 4UVAA 5H6RA 4PHZA 2HJDA 4BW9A 2NN4A 4PA6A 1K7DA 3IC7A 1RSOB 1NJIW 5F2VO 1OZ0A 2UXXA 1BZKA 1IBKB 1ZWIC 5J2UB 2WA3A 2Y4TA 5JH7B 2EULA 1S76D 4DV3O 1WJZA 2Q9LA 1BT8A 2CGOA 1W2BU 1W0JG 2E75B 1YF2A 1Y76A 3E22A 2NR5A 2BCCH 3A0RA 3TCUA 4C7UA 1VQNV 1ZSPA 4N23A 1TVKB 2UUCO 3ABTA 3X2QC 5JWPA 1DF5A 1SZXA 2ATKC 2R9RB 1K4CC 3CWBH 1HWYA 5LHHA 4X88A 2DWDC 4NXNB 3OD4A 4FLUA 4PA4A 2JDIG 1JMKC 2A06H 4JI2O 1FYJA 3ZX6A 3I56V 2GHYA 3BVOA 3A2FA 4DV2B 4DV1O 1KYOF 3KKYA 1L8DA 4IIJA 1SQQH 4TOIA 3JATB 4FFKA 3P3PA 3CMEV 1TUBB 3ABLB 3L9DA 3U10A 1K92A 1VQ4V 2P4KA 2ITCC 4D7SA 1A32A 3AK1A 4W4LA 2OTJV 1N0NA 2GTAA 3ZRVA 4AILC 1YITV 2ZIMA 4EKWA 3ZMVA 1KUQA 2VS0A 2PZSA 2JJ2G 1AI6A 1FPOA 2WLLB 3FYEB 3WU2Z 2ZT9B 3RW0A 3ZHVA 1VF6C 4FLYA 2LW7A 3K5OA 2H3OA 4H44B 2UUAB 4O2AA 3JD4A 2B9ZA 1M93A 2CTQA 4CH5A 4LBEC 4U7OA 5E79Z 4BIZA 1DGSA 5LMNB 3CC4V 3LSQA 1K3EA 4JI5B 2WA4A 2LGWA 1NQTA 1M1KW 1S5LZ 3BPZA 3OEEG 2R70A 1JA8A 1LUWA 4I7ZB 2VQFB 2X6AA 1YJNV 5B1BB 2C2AA 1N8RW 1Q3EA 3D8CA 3X2QB 5JJJB 1AI7A 1F51A 4B7EA 2OIEA 2B1GA 2HFEC 3B77A 4WFEA 3G6EV 3S3XA 4IHJB 1GN3A 3UT5B 3EFFK 2Q7EA 3VQYA 3C90A 3D3QA 1THZA 2E3CA 3TGUH 4PDLA 4EB6A 4U3JA 2X6BA 3SPJA 5DN6G 1AJPA 1Y74B 3E8HA 4DR6O 1LNQA 4LF5B 1RP3B 3SPIA 1V55C 4U3FH 1MG1A 4KL1A 4Z1MG 1V54C 3G4SV 4X1YB 4Z1VA 3JD0A 2GUZB 2HKOA 4N21A 3ZMTA 2A3QA 2UU9B 2XAJA 3JAKB 5DECA 2HHHB 3SYQA 1G4YB 1FXHA 4J42A 4PJ0Z 2ZCEA 4ZOLB 4LFBO 5EC2C 1MMMA 1MZFA 5LXTB 2EIJC 4TSFG 1TUEB 3MD0A 2EILB 1RFYA 4P2ZA 3E2EA 3CCSV 1SETA 1Q6IA 3APQA 3Q4HB 3CXCU 1JPXA 3OAAG 1F4MA 3RYHB 4MW3A 4UB6Z 1XUQA 1E1QG 1EFRG 3T1CA 4GUNA 4LF4B 1FXKA 2QSAA 5FNVB 3LDEA 4D6TH 1H2MA 1ZAUA 4PA7A 1OCZC 3DSQA 5B5EZ 3SDLA 3CE2A 1S0VA 4CH6A 2WLIA 1OCCC 5J2TB 2YS8A 3ASNB 4DW0A 1NI8A 3LDCA 1XREA 4O2BB 3ZHRA 4MVZA 3N2GB 1Q43A 1VP7A 2XAFA 4OXSA 3GVMA 3J7AU 2M7WA 3G67A 3OGIB 1WN7A 1GK9A 1SZTA 1PNKA 3K06A 1QU7A 3UKMA 1BSMA 4BW5A 1V54B 4KP4A 3ABUA 3KG2A 1NVPB 3A8TA 3DXRB 3QO5A 2RJZA 4PD4F 2BTOA 1JVMA 3E8GA 4XBFA 3K5NA 1YXBA 3MAQA 3RVYA 4TUYA 5B66Z 2ITDC 2CAZC 2P90A 1BGYH 1XQ8A 1XILA 3CYOA 1OCRB 2FB5A 4UV8A 2EIJB 1Y76B 5LA6A 2DYSB 2Y48A 4JI2B 3FD9A 2Y0IA 4PDMA 4AQYB 5LGNA 4DV1B 4WFGA 4XDLA 4CH3A 4YHHO 3RT3C 3RVZA 5CB4A 1U96A 3ETEA 3OR6C 1ENVA 4CC6A 2YC0A 2ZQMA 1TGOA 4DV5O 1AVMA 2F4VO 5L3GA 5DM6V 3T4ZA 1OCZB 1XHZA 5CA3A 1AI5A 4FZ1A 3RWRD 2YIAA 4MS2A 4UVBA 1GH6A 2HG5C 2YICA 4IIJB 2Q67A 4NTXA 1LR1A 3T1HO 4OX9O 2ZE8A 3SJAC 4DR2B 1JFFA 4CS2A 1Z2GA 3L70H 1EN5A 2JEUA 1UFIA 2KQXA 4B7KA 3ZIAG 1K97A 2ZNIA 1G6UA 2N74A 3JAMN 1K4DC 4B3SO 4A5UB 1AR4A 3CPWU 4R6ZA 2Y69C 4UCOA 2UUBO 1YVWA 4X64O 2JVDA 4O2AB 2GSMB 4QE7A 1YCIA 3ZRXA 2L6LA 3ABKB 2CH7A 3T1YO 4B3TO 4RQEA 4FJCC 1EZVH 2W0XA 1QHTA 3ASOC 3BABA 3AG4B 2PY5A 5KMGA 3HKDA 1VQMV 3H01A 4DR6B 2FKXA 4TT3G 1HR0O 4YXWG 3NR7A 2IM9A 3TXSA 2PUSA 2PI4A 3RN4A 2JEXA 2WLKA 2ZR3A 2E5LO 1K33A 1WP8A 3FFQA 3OW2U 4O4IB 4YY3O 4L87A 5EZYA 4MW8A 4IYIA 3SJQC 4EB6B 2V7QG 4U3JB 4LFBB 2CDYA 5IJ0B 5IJ9A 4X20A 5C93A 1SS3A 4JYBA 4X1KA 1L0LH 3THOA 4EEQA 3H1LH 5ITZB 1PL0A 4JTAB 1R3LC 1GM7A 4JAVA 1IURA 3E35A 4X62O 4LF8O 1Y6XA 4DR1O 1DK1A 4UV9A 1M56B 2PI5A 4UVCA 3WFVA 1COWG 2CTPA 2HLDG 3APOA 1DF4A 3B2EE 4JYAO 1X4TA 4W4KA 5H5NA 1R3JC 1GTOA 4J9ZB 2HP8A 2ZKOA 3H1KH 2IJIA 3ZHTA 1PV0A 4JV5O 3CCQV 3ASOB 3UM7A 3CP1A 4DXWA 4X66O 3P32A 1J5EO 4UCRA 4ZHQB 3F5TA 2AZ2A 1EN6A 4CS4A 4HAMA 3SPHA 1SC5B 3IAYA 4I0XB 2N05A 4ASUG 4ZKIA 1KC8W 5LOVB 1ZLZA 2DJVA 1MSWD 3ZRWA 5KHJA 2UXBO 4O4LA 3BEHA 5EYPB 3D36A 5EIBD 4JI8O 2ILMA 5KHHA 4WFAV 1BQZA 1K9MW 3R65A 1U97A 3STLC 4NXMO 4P30A 3DTUB 4I55A 4B3RO 2Q7HA 4DV6O 1IX9A 2KG7A 4DR5O 1WAZA 3NXSA 2QKAA 5GONA 1CPYA 4HBNA 1NS1A 1NH2D 4I50B 4YHHB 3T4DA 1K34A 1XBLA 1M57C 3LNNA 4LF6O 4TUYB 1XMQO 4DV5B 3CC7V 4F6EA 2YI8A 2F4VB 3I5DA 4GKJO 1FXVA 4TQDA 5LA6B 1N33O 3W7WA 2VRZA 1XOUA 4MVUA 2Y4UA 1KQSU 2X0LA 3FB7C 5EBMC 4U7NA 3T1HB 4LWSA 3ML0A 1VQKV 4YIPA 4OX9B 1JR9A 3JSLA 2UXDO 2IJHA 4MVMA 1VQ5V 4DR7O 3LSSA 2E74B 5KAIZ 1MZEA 4QGPA 2P4VA 1GKFA 1P7GA 1SQXH 3E89A 2CTWA 1Q86W 1CP9A 3ZBHA 4F6RB 5B1NA 4NTYA 5C8YB 4FM2A 1EN4A 2GDSA 2YIBD 1QNMA 3MHHC 3RYFB 1SA0B 3ZHSA 1GM9A 4B3SB 3L71H 1Z5VA 2JGUA 3FB6C 4CH4A 2UUBB 4LCUC 3VQWA 2LP7A 1FFXB 4X64B 2EIMC 2XOKG 5IDJA 4LFAO 3BA8A 2DYRC 2F66C 4BR6A 1OCOB 3T1YB 4B3TB 2A0LA 3K9SA 1AP5A 1NU1H 2P5OA 1MSDA 1OHHG 2CE4A 2EIKB 4DV7O 5CA1B 2LQTA 4IGGA 4NVPA 4I5SA 1GN2A 1SRYA 1SQGA 2DW4A 1HR0B 3J80N 1M57B 1WA8A 4LF9O 3JYCA 2JS5A 1DTOA 2LFRA 4F4LA 2CK3G 2CH7B 2IU0A 3JD3A 4H0LB 1YSCA 1R6KA 1GO3F 4DR4O 4YY3B 1BQ0A 5L3FA 4FLXA 2BSKA 2QR4A 3A0HZ 1N36O 4WBNB 3ETGA 1VF7A 1E79G 5JVDA 1EZJA 3RBZA 4HNAA 3CCEV 2K1EA 1E1RG 3ETDA 1R73A 4E2LA 1K5QA 4UCVA 4MVRA 5CN0A 4AHCA 2Q69A 1SQVH 3D36C 5KLVH 3AG7A 1PPJH 1R3KC 1AI4A 3K79A 4LR3A 3QO8A 3ZMZA 2QJ1A 4ZI7B 4LF8B 4DR1B 4J80A 3G80A 4X20B 1K73W 4QNHB 3P30A 1H8EG 3H1IH 4PI0A 3IGAC 5BMVA 1AROP 1VIBA 1N4CA 4JYAB 4KUMA 1V9PA 2DYRB 3SYPA 2Z3YA 3LDDA 1VQ8V 4JAAA 4O4JA 5CA0B 3WG7C 4GCZA 3CMAV 4LF7B 2IH1C 3CCJV 4NB5A 4JV5B 3OMIB 4MTGA 4K3AA 4FZ0A 4UCTA 1G1XB 4X66B 2PYLA 1J5EB 3JD2A 3H1JH 3GB7C 4X9QA 2M6YA 4DK1A 3L74H 2FL4A 3FKSG 1FS0G 1NR7A 1I94O 4OGQB 1QQCA 1BHAA 1B3QA 4JI4O 5LP6A 3E8BA 5EK0A 2UXBB 3RYCA 4YIOA 4NR1A 3K08A 4X1IB 4PA9A 2XASA 4JI8B 3ZEDA 2KSDA 4J11A 5EC1C 2AGAA 5IYCO 1PL4A 1IBLO 4IL6Z 4RQFA 4TV8A 3CRCA 5B1OA 5CMUA 4DRXA 4NXMB 2XAQA 5GW7A 4B3RB 1GM8A 4DV6B 1IVSA 3SPGA 4DR5B 1L1FA 4LFCO 2GV9A
chains in the Genus database with same CATH topology
2A7WA 2Q9LA 1YXBA 2Q4PA 2A3QA 3C90A 3CRCA 2OIGA 2YXHA 3CRAA 2Q5ZA 1YVWA 4QGPA 1Y6XA 2GTAA 1VMGA 5IE9A 2P06A 2OIEA 2Q73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A7W A;  2Q9L A;  1YXB A;  2Q4P A;  2A3Q A;  3C90 A;  3CRC A;  2OIG A;  2YXH A;  3CRA A;  2Q5Z A;  1YVW A;  4QGP A;  1Y6X A;  2GTA A;  1VMG A;  5IE9 A;  2P06 A;  2OIE A;  2Q73 A; 
#chains in the Genus database with same CATH topology
 1FFT B;  3RYI A;  3JAL B;  4WFF A;  3HKB A;  2QWO B;  3UQ8 A;  4WCE V;  3OMA B;  4LF6 B;  1XMQ B;  5EBW C;  2R9I A;  3BCC H;  3PJS K;  3O9O A;  1KU9 A;  4GKJ B;  3HKC A;  5JJE B;  1N33 B;  1GMG A;  3H9V A;  3F7Y C;  1FKA O;  4DV3 B;  1EM1 A;  2X6C A;  3CEI A;  3GWK C;  4L8J A;  5LYJ B;  5GON B;  2LFS A;  4KFM A;  3ZS8 C;  1BCC H;  3U11 A;  1AR5 A;  5KHI A;  3CHX A;  3WG7 B;  1URF A;  1V55 B;  3K9A A;  2Z0A A;  1Q6H A;  3CS5 A;  4DR7 B;  3QTC A;  1NR1 A;  1KB9 F;  3I55 V;  4LP8 A;  4GT1 A;  2UUC B;  4FMT A;  3J81 N;  5KX5 A;  2Y0P A;  5IT9 N;  5IY5 C;  2IW5 A;  4MVO A;  4E4E A;  3N2K A;  4LWS B;  1S5J A;  4R8C A;  1QVG U;  3E22 B;  2QWR B;  2ZR2 A;  2LO1 A;  4MTX A;  1XNQ O;  4LFA B;  2F93 B;  4TV9 A;  2ZNJ A;  5LMU O;  3W7T A;  2QKS A;  3CCR V;  4CBC A;  3K03 A;  1RM1 C;  4X65 O;  1RSO A;  3K3W A;  1KP3 A;  5JCO A;  1Z5W A;  4XDJ A;  5JH7 A;  3CRR A;  1XI1 A;  1JX9 A;  1UJW B;  1JQ0 A;  1YEW A;  1NKD A;  5FPO A;  2P7T C;  4PDR A;  4EFB A;  1OCC B;  2PF4 E;  1IDS A;  1D5A A;  1TA8 A;  5B3S C;  3EVK A;  5DED A;  2F95 B;  4DR4 B;  5IYZ A;  4I9Q A;  2HVK C;  4JI0 O;  4BAY A;  2DN9 A;  1XEQ A;  1QR8 A;  2RDC A;  1L0N H;  1BMF G;  1KMI Z;  1TVK A;  1AJQ A;  4IYH A;  4DV0 O;  1AIL A;  3M7M X;  2Z5U A;  2L35 A;  5D5Q A;  1H8H G;  5LP6 C;  2K9P A;  3CD6 V;  3OMN B;  4JI6 O;  4D7T A;  3W7X A;  2W6I G;  3SJC C;  3QNE A;  2Q8V A;  4IT5 A;  4R7C A;  1GN6 A;  2BSK B;  3K59 A;  4RUE A;  1H2L A;  3VBB A;  5BR8 O;  1F7Y A;  3QG5 A;  4TQF A;  2DQ3 A;  3WB2 A;  5IY5 B;  1VQL V;  1RPO A;  5JVD B;  1TUB A;  3CJH A;  4HNA B;  3GWO A;  3UCS C;  5K1X A;  2QM8 A;  3VQV A;  1VQ9 V;  3BFR A;  1FXK C;  5LHI A;  3ZRS A;  1US6 A;  1QLE C;  2DE0 X;  5FLX N;  1VQ6 V;  1YIJ V;  5CBF A;  4UCS A;  1RM1 B;  3B8M A;  4DV2 O;  5IE9 A;  4P9O A;  3OE7 G;  3HPL C;  2IU3 A;  1S72 V;  2WLL A;  2ZDI A;  4BIU A;  5IWA O;  4MTO A;  5LBQ A;  2VQE O;  2YEV A;  5GTI Z;  2R72 A;  1FD9 A;  4MTF A;  1I94 B;  1T5E A;  5L3C A;  4GX1 A;  4JI4 B;  5B3S B;  4LNU A;  5AG2 A;  4O4J B;  3K0G A;  2QWQ B;  3E83 A;  3QO7 A;  3FX7 A;  3CXH F;  2LGQ A;  1XDC A;  3DC5 A;  1P84 F;  4MSW C;  2OCH A;  3EXA A;  2P22 C;  2EX3 A;  1IBL B;  3ZMS A;  1SES A;  1AJN A;  1F23 A;  1YHQ V;  2RN9 A;  2IJJ A;  3CB2 A;  1VAR A;  2PGG A;  1N0J A;  4MT8 A;  2EZP A;  4JYC A;  1Y4M A;  4G28 B;  4RUF A;  4LFC B;  1IBM O;  4J7Z A;  2YUA A;  5LP6 B;  3OUS A;  2QTO A;  3QVN A;  4IHJ A;  3CCV V;  3RYC B;  3UT5 A;  2Y69 B;  4JAS A;  4JF3 A;  2A79 B;  4FVM A;  3IFX A;  1O9H A;  5HFL A;  2BTQ A;  1WPX A;  1N34 O;  3SPC A;  1Y74 A;  2JK5 C;  2YSU B;  4TV8 B;  4DRX B;  4H37 A;  5IYB O;  3OT7 A;  2BE3 A;  1PKX A;  3C3T A;  4JI7 O;  5GTH Z;  3OTO O;  5BZB A;  5JCO C;  1FXK B;  2E76 B;  4DR3 O;  2ZE7 A;  3RYI B;  1QLE B;  3HKB B;  4FLV A;  4GX2 A;  5H9C A;  1HDJ A;  1QVF U;  3ZHQ A;  2OIG A;  3K0D A;  1R6T A;  2WLI B;  1R1B A;  3JCU Z;  2WLM A;  4I4T A;  4NTW A;  2VWK A;  3BA9 A;  3HKC B;  3K5M A;  4FIP C;  1TAE A;  4AI8 A;  1VF6 A;  2VWJ A;  1SKV A;  4WF9 V;  1R6N A;  2BOC C;  1CXZ B;  3HKE A;  2EIN C;  2UU9 O;  1VEW A;  3A0B Z;  4GLX A;  1SER A;  1G8M A;  2WLH A;  5FNV A;  1XNQ B;  1B04 A;  1SQF A;  5LMU B;  2GTS A;  3KCY A;  4X65 B;  3STZ C;  2ADQ B;  3SR2 C;  1MOF A;  2YIB A;  1R3I C;  4O2B A;  2FML A;  1HNW O;  1K8A W;  3JAR A;  3AG3 C;  4J41 A;  4OPA A;  2YI9 A;  1SQP H;  2AXT Z;  2CTR A;  1Q81 W;  2ETN A;  5K1P A;  1KEC A;  5JQG A;  2HJF C;  4JI0 B;  5CB4 B;  1BS3 A;  2NLJ C;  3ZJZ A;  3DXR A;  4DW1 A;  2OT5 A;  2ZDI C;  4BWA A;  2DOS A;  4DV0 B;  4Q20 A;  5IYD O;  2H94 A;  2AHZ A;  2Q7G A;  1QBZ A;  3FB5 C;  2NNU A;  1Y66 A;  1WPB A;  4CC5 A;  2XTA A;  2HEP A;  4GX0 A;  4JI6 B;  3OFN G;  1O9G A;  3W7S A;  1I08 A;  4YJ3 A;  1CEZ A;  5IYZ B;  1XL6 A;  4PV1 B;  4B3M O;  2YDE A;  3L72 H;  3HB3 B;  2EIN B;  2XND G;  1BL8 A;  1JFF B;  5BR8 B;  1I7F A;  2P6J A;  5B1B C;  3CCU V;  2ZXW C;  1I5Y A;  2A7W A;  1Q8I A;  1BHB A;  3ZHU A;  3TK1 A;  4K35 A;  4DUY O;  3OUF A;  1NVP D;  1JOY A;  4RAI A;  1YDX A;  4FLT A;  2DMX A;  4LH6 A;  1ZUQ A;  4FFB A;  2QWN B;  4AQY O;  5EIB C;  4YJ2 A;  4GKK O;  1VMG A;  1WB8 A;  4RO2 A;  2ZE5 A;  1JCH A;  3JD1 A;  2EJ7 A;  3F7V C;  3JAS A;  5A2Q N;  5LHG A;  1I5X A;  2E5L B;  4UUJ C;  5IWA B;  2HVJ C;  2Q0A A;  3CJH B;  2VQE B;  2ZM6 O;  3AG3 B;  3JCZ A;  3DC6 A;  3QF7 A;  2PYJ A;  1EBO A;  4GX5 A;  2OWO A;  2OCC C;  4PDV A;  1NZ6 A;  5KMG B;  3HKD B;  1ZTE A;  2RMK B;  2IJK A;  2RNB A;  3ABM C;  2XUM A;  2D3O W;  1M4U A;  2EIL C;  3KZI Z;  3SYO A;  4DR2 O;  2YEV B;  1AP6 A;  3CCL V;  5EZY B;  2UXC O;  1H2S B;  2G38 A;  4X62 B;  1IBM B;  1P7B A;  3ETQ A;  4QIW F;  2JRI A;  3U0Z A;  5LGT A;  1PNL A;  2KKW A;  5IJ9 B;  1OV9 A;  4LNU B;  1ROP A;  1ZX3 A;  4J7K A;  4TWK A;  4X1K B;  2Q4P A;  3K58 A;  2WSS G;  4Q6G A;  3RFR A;  4GZR B;  1N34 B;  2OYQ A;  2EIM B;  2CGN A;  1Y67 A;  2EZO A;  2B5U A;  1YTF B;  2UXN A;  2ZXW B;  3OR7 C;  3AG2 C;  2EBO A;  4QJF B;  2DQ0 A;  5TIS Z;  2RCV A;  1YZB A;  1NTK H;  3ASN C;  4JI7 B;  3OTO B;  1AR1 B;  4ZIB A;  3CX5 F;  3IJ4 A;  4DR3 B;  4P9P A;  2MK3 A;  4JI3 O;  3BHP A;  5FL7 G;  4O4I A;  1BE3 H;  1Q6U A;  3O65 A;  3B8N A;  2BTQ B;  2YXH A;  5IJ0 A;  4O4H A;  2XAG A;  4LH7 A;  1B6Q A;  4OPH A;  4PA3 A;  1KKC A;  2ZIN A;  5ITZ A;  4H13 B;  2JS3 A;  1VQO V;  2ZE6 A;  1HNZ O;  1XNR O;  1HNX O;  2OCC B;  2WLJ A;  4JZG A;  1AB3 A;  2N04 A;  3JAW A;  3S3W A;  1YJ9 V;  3SYA A;  1NH2 B;  3CRA A;  1XHX A;  2XHB A;  3ABM B;  2R9A A;  4FLW A;  1QCE A;  1OCR C;  4I4T B;  1JJO A;  3ZMU A;  2DYS C;  4DK0 A;  2BOB C;  3ZRW B;  3BRC A;  4O4L B;  2CUG A;  2QA4 V;  2GBO A;  3HKE B;  3BAA A;  3DGE A;  4GYC B;  1IXM A;  4FPP A;  1HNW B;  1SQB H;  1W59 A;  4ICG A;  2P67 A;  4I55 B;  5LL6 Y;  3ZN0 A;  1ZL8 A;  3HR0 A;  3EHB B;  3M99 B;  2IH3 C;  2KG7 B;  4Z2W A;  4JTC B;  5KUK A;  3IC9 A;  4ZHQ A;  2QM4 A;  2V4D A;  3AG2 B;  1W0K G;  3TET A;  3AG1 C;  2ZIO A;  1XMO O;  2WPD G;  5L3B A;  3W7U A;  3M8A A;  1NT2 B;  4I0X A;  5L3E A;  2UXD B;  3OM3 B;  5LOV A;  5H2F Z;  2LW1 A;  1KBH A;  2Q0O C;  4EFE A;  3K57 A;  5EYP A;  3RGB A;  3JAR B;  4JI1 O;  5EBL C;  3TXQ A;  3FB8 C;  2H8P C;  2Q73 A;  1H2K A;  5KAF Z;  3OTF A;  4K8Z A;  4DUZ O;  4KHP O;  5JQG B;  2JGD A;  1UPG A;  1HP8 A;  1YJW V;  1WNS A;  3TJT A;  4B3M B;  2WWW A;  1N32 O;  2HR3 A;  4FM0 A;  3FAV A;  1FJG O;  4JZ2 A;  3MDS A;  4I50 A;  1LUV A;  2AW9 A;  4DUY B;  3JSN A;  5KA6 A;  5KUM A;  3ABK C;  2QWP B;  5J2U A;  1WB7 A;  3R66 A;  4DV7 B;  4K0K O;  2F1M A;  4YJ3 B;  4DV4 O;  2Q5Z A;  4J7J A;  4UB8 Z;  4GKK B;  2WLN A;  4X8A A;  1MAB G;  2OTL V;  4ABM A;  3AG4 C;  1GN4 A;  4MVQ A;  5BY1 A;  4LF9 B;  2ADP A;  1IXB A;  3G71 V;  1PP9 H;  5L3D A;  1H2N A;  4K8X A;  4RWU A;  1XL4 A;  2X7R B;  3N27 A;  4PEL A;  4WFH A;  2ZM6 B;  1IBK O;  5BXZ A;  3E86 A;  3KCX A;  2V1D A;  4F6R A;  4FFB B;  5C8Y A;  2W6J G;  4YJ2 B;  3K04 A;  2Q6A A;  3LSU A;  1Q82 W;  1N36 B;  3AG1 B;  2A9H A;  3MHS C;  1WA8 B;  2YXY A;  3K5L A;  3RYF A;  1VQP V;  1SA0 A;  4NYK A;  3AK3 A;  3FYI B;  1Q90 D;  3JAS B;  3T2M A;  2W0F C;  1FFX A;  2AZ0 A;  1QLN A;  4PI2 A;  4UFZ A;  2UXC B;  2KB1 A;  3CSX A;  1YI2 V;  2YXL A;  1Q7Y W;  3JAT A;  1NTM H;  1M56 C;  2AHY A;  5CA1 A;  4X89 A;  4NXN O;  1KKD A;  5HFM A;  1HW7 A;  5B1A C;  1I0H A;  2JIZ G;  1PM9 A;  1H38 A;  2DWE C;  4ZBM A;  2QTS A;  2XAH A;  5E1A C;  3B40 A;  5J9P C;  1M5I A;  3L75 H;  1PD3 A;  4JI3 B;  3WB0 A;  4JYY A;  2D2C B;  2RQ6 A;  1Q5O A;  5BMV B;  3CC2 V;  1RPR A;  2XT9 A;  2WAM A;  4FLZ A;  4WBN A;  3SGI A;  5CBH A;  1PNM A;  4HZ3 A;  5D5P A;  3AEI A;  4BIO A;  2PTM A;  1B06 A;  1P4R A;  1VF5 B;  2QEX V;  4DO2 A;  1GAX A;  1HNZ B;  1XNR B;  5A9G A;  1HNX B;  4CZZ A;  4XDK A;  3L73 H;  1WLE A;  1D5N A;  1DLB A;  4ZI7 A;  2MW2 B;  3WB1 A;  2Q68 A;  1VQ7 V;  3B4S A;  2UUA O;  4I9W A;  4O4H B;  3C3S A;  4FK5 C;  1S3J A;  2ARH A;  2P06 A;  5LMN O;  1SF9 A;  3P3N A;  1F4N A;  4JI5 O;  3E8F A;  3ZCC A;  5KHG A;  5H6Q A;  2IBZ H;  4R50 A;  1K5S A;  4QPJ A;  4JGS A;  3SJB C;  2JJ1 G;  3CRM A;  2VQF O;  3JAW B;  1H2G A;  2LJ2 A;  5CA0 A;  4CS3 A;  4UXN A;  3D3I A;  1IZ3 A;  4X1Y A;  4HYO A;  4FM1 A;  4QE9 A;  5JJN B;  2GUZ A;  4G27 B;  1MA1 A;  4NKG B;  1JJ2 U;  1FAF A;  5B1A B;  3B09 A;  3ZN1 A;  3H1H H;  3LUT B;  3JAK A;  5FPR A;  2EJR A;  2F23 A;  2F43 G;  1XMO B;  4B08 A;  2B1I A;  3OGC C;  4ZOL A;  3BY6 A;  3UO3 A;  3AK2 A;  1ORQ C;  2O57 A;  5LXT A;  4LF5 O;  1NTZ H;  2ZD9 A;  4LF7 O;  2ODM A;  4QPK A;  4X1I A;  4G2K A;  5KHK A;  4JI1 B;  4MVS A;  1J95 A;  1KP2 A;  1ZL8 B;  1S5H C;  1M9N A;  4H33 A;  2FTK A;  3Q4H A;  1OJH A;  2QM7 A;  3CRQ A;  1YTF D;  5CBG A;  2QKC A;  1M90 W;  3RYH A;  4WFB V;  3CCM V;  4DUZ B;  2HHH O;  4KHP B;  1QR9 A;  1KD1 W;  5KA5 A;  1WP7 A;  2QE7 G;  1N32 B;  3LNM B;  3JAL A;  1FJG B;  1P49 A;  1X59 A;  1D2D A;  5LGU A;  3ICX A;  3PN1 A;  2QDO A;  2FYU H;  4LC1 A;  1MNG A;  4JAU A;  5J2T A;  4UCU A;  1OCO C;  3G6B A;  5KX5 B;  3F5W C;  3VQX A;  4DYL A;  4K0K B;  3VOU A;  4J10 A;  4DV4 B;  2JGD B;  3N2G A;  3N2K B;  1S77 D;  3OEH G;  4LF4 O;  3ABL C;  2EIK C;  4J9Y B;  4JPR A;  3UO2 A;  5LYJ A;  1NBM G;  1GRJ A;  2QGN A;  4JTD B;  3FAV B;  4KXR A;  4TV9 B;  3SYC A;  2YID A;  4UVA A;  5H6R A;  4PHZ A;  2HJD A;  4BW9 A;  2NN4 A;  4PA6 A;  1K7D A;  3IC7 A;  1RSO B;  1NJI W;  5F2V O;  1OZ0 A;  2UXX A;  1BZK A;  1IBK B;  1ZWI C;  5J2U B;  2WA3 A;  2Y4T A;  5JH7 B;  2EUL A;  1S76 D;  4DV3 O;  1WJZ A;  2Q9L A;  1BT8 A;  2CGO A;  1W2B U;  1W0J G;  2E75 B;  1YF2 A;  1Y76 A;  3E22 A;  2NR5 A;  2BCC H;  3A0R A;  3TCU A;  4C7U A;  1VQN V;  1ZSP A;  4N23 A;  1TVK B;  2UUC O;  3ABT A;  3X2Q C;  5JWP A;  1DF5 A;  1SZX A;  2ATK C;  2R9R B;  1K4C C;  3CWB H;  1HWY A;  5LHH A;  4X88 A;  2DWD C;  4NXN B;  3OD4 A;  4FLU A;  4PA4 A;  2JDI G;  1JMK C;  2A06 H;  4JI2 O;  1FYJ A;  3ZX6 A;  3I56 V;  2GHY A;  3BVO A;  3A2F A;  4DV2 B;  4DV1 O;  1KYO F;  3KKY A;  1L8D A;  4IIJ A;  1SQQ H;  4TOI A;  3JAT B;  4FFK A;  3P3P A;  3CME V;  1TUB B;  3ABL B;  3L9D A;  3U10 A;  1K92 A;  1VQ4 V;  2P4K A;  2ITC C;  4D7S A;  1A32 A;  3AK1 A;  4W4L A;  2OTJ V;  1N0N A;  2GTA A;  3ZRV A;  4AIL C;  1YIT V;  2ZIM A;  4EKW A;  3ZMV A;  1KUQ A;  2VS0 A;  2PZS A;  2JJ2 G;  1AI6 A;  1FPO A;  2WLL B;  3FYE B;  3WU2 Z;  2ZT9 B;  3RW0 A;  3ZHV A;  1VF6 C;  4FLY A;  2LW7 A;  3K5O A;  2H3O A;  4H44 B;  2UUA B;  4O2A A;  3JD4 A;  2B9Z A;  1M93 A;  2CTQ A;  4CH5 A;  4LBE C;  4U7O A;  5E79 Z;  4BIZ A;  1DGS A;  5LMN B;  3CC4 V;  3LSQ A;  1K3E A;  4JI5 B;  2WA4 A;  2LGW A;  1NQT A;  1M1K W;  1S5L Z;  3BPZ A;  3OEE G;  2R70 A;  1JA8 A;  1LUW A;  4I7Z B;  2VQF B;  2X6A A;  1YJN V;  5B1B B;  2C2A A;  1N8R W;  1Q3E A;  3D8C A;  3X2Q B;  5JJJ B;  1AI7 A;  1F51 A;  4B7E A;  2OIE A;  2B1G A;  2HFE C;  3B77 A;  4WFE A;  3G6E V;  3S3X A;  4IHJ B;  1GN3 A;  3UT5 B;  3EFF K;  2Q7E A;  3VQY A;  3C90 A;  3D3Q A;  1THZ A;  2E3C A;  3TGU H;  4PDL A;  4EB6 A;  4U3J A;  2X6B A;  3SPJ A;  5DN6 G;  1AJP A;  1Y74 B;  3E8H A;  4DR6 O;  1LNQ A;  4LF5 B;  1RP3 B;  3SPI A;  1V55 C;  4U3F H;  1MG1 A;  4KL1 A;  4Z1M G;  1V54 C;  3G4S V;  4X1Y B;  4Z1V A;  3JD0 A;  2GUZ B;  2HKO A;  4N21 A;  3ZMT A;  2A3Q A;  2UU9 B;  2XAJ A;  3JAK B;  5DEC A;  2HHH B;  3SYQ A;  1G4Y B;  1FXH A;  4J42 A;  4PJ0 Z;  2ZCE A;  4ZOL B;  4LFB O;  5EC2 C;  1MMM A;  1MZF A;  5LXT B;  2EIJ C;  4TSF G;  1TUE B;  3MD0 A;  2EIL B;  1RFY A;  4P2Z A;  3E2E A;  3CCS V;  1SET A;  1Q6I A;  3APQ A;  3Q4H B;  3CXC U;  1JPX A;  3OAA G;  1F4M A;  3RYH B;  4MW3 A;  4UB6 Z;  1XUQ A;  1E1Q G;  1EFR G;  3T1C A;  4GUN A;  4LF4 B;  1FXK A;  2QSA A;  5FNV B;  3LDE A;  4D6T H;  1H2M A;  1ZAU A;  4PA7 A;  1OCZ C;  3DSQ A;  5B5E Z;  3SDL A;  3CE2 A;  1S0V A;  4CH6 A;  2WLI A;  1OCC C;  5J2T B;  2YS8 A;  3ASN B;  4DW0 A;  1NI8 A;  3LDC A;  1XRE A;  4O2B B;  3ZHR A;  4MVZ A;  3N2G B;  1Q43 A;  1VP7 A;  2XAF A;  4OXS A;  3GVM A;  3J7A U;  2M7W A;  3G67 A;  3OGI B;  1WN7 A;  1GK9 A;  1SZT A;  1PNK A;  3K06 A;  1QU7 A;  3UKM A;  1BSM A;  4BW5 A;  1V54 B;  4KP4 A;  3ABU A;  3KG2 A;  1NVP B;  3A8T A;  3DXR B;  3QO5 A;  2RJZ A;  4PD4 F;  2BTO A;  1JVM A;  3E8G A;  4XBF A;  3K5N A;  1YXB A;  3MAQ A;  3RVY A;  4TUY A;  5B66 Z;  2ITD C;  2CAZ C;  2P90 A;  1BGY H;  1XQ8 A;  1XIL A;  3CYO A;  1OCR B;  2FB5 A;  4UV8 A;  2EIJ B;  1Y76 B;  5LA6 A;  2DYS B;  2Y48 A;  4JI2 B;  3FD9 A;  2Y0I A;  4PDM A;  4AQY B;  5LGN A;  4DV1 B;  4WFG A;  4XDL A;  4CH3 A;  4YHH O;  3RT3 C;  3RVZ A;  5CB4 A;  1U96 A;  3ETE A;  3OR6 C;  1ENV A;  4CC6 A;  2YC0 A;  2ZQM A;  1TGO A;  4DV5 O;  1AVM A;  2F4V O;  5L3G A;  5DM6 V;  3T4Z A;  1OCZ B;  1XHZ A;  5CA3 A;  1AI5 A;  4FZ1 A;  3RWR D;  2YIA A;  4MS2 A;  4UVB A;  1GH6 A;  2HG5 C;  2YIC A;  4IIJ B;  2Q67 A;  4NTX A;  1LR1 A;  3T1H O;  4OX9 O;  2ZE8 A;  3SJA C;  4DR2 B;  1JFF A;  4CS2 A;  1Z2G A;  3L70 H;  1EN5 A;  2JEU A;  1UFI A;  2KQX A;  4B7K A;  3ZIA G;  1K97 A;  2ZNI A;  1G6U A;  2N74 A;  3JAM N;  1K4D C;  4B3S O;  4A5U B;  1AR4 A;  3CPW U;  4R6Z A;  2Y69 C;  4UCO A;  2UUB O;  1YVW A;  4X64 O;  2JVD A;  4O2A B;  2GSM B;  4QE7 A;  1YCI A;  3ZRX A;  2L6L A;  3ABK B;  2CH7 A;  3T1Y O;  4B3T O;  4RQE A;  4FJC C;  1EZV H;  2W0X A;  1QHT A;  3ASO C;  3BAB A;  3AG4 B;  2PY5 A;  5KMG A;  3HKD A;  1VQM V;  3H01 A;  4DR6 B;  2FKX A;  4TT3 G;  1HR0 O;  4YXW G;  3NR7 A;  2IM9 A;  3TXS A;  2PUS A;  2PI4 A;  3RN4 A;  2JEX A;  2WLK A;  2ZR3 A;  2E5L O;  1K33 A;  1WP8 A;  3FFQ A;  3OW2 U;  4O4I B;  4YY3 O;  4L87 A;  5EZY A;  4MW8 A;  4IYI A;  3SJQ C;  4EB6 B;  2V7Q G;  4U3J B;  4LFB B;  2CDY A;  5IJ0 B;  5IJ9 A;  4X20 A;  5C93 A;  1SS3 A;  4JYB A;  4X1K A;  1L0L H;  3THO A;  4EEQ A;  3H1L H;  5ITZ B;  1PL0 A;  4JTA B;  1R3L C;  1GM7 A;  4JAV A;  1IUR A;  3E35 A;  4X62 O;  4LF8 O;  1Y6X A;  4DR1 O;  1DK1 A;  4UV9 A;  1M56 B;  2PI5 A;  4UVC A;  3WFV A;  1COW G;  2CTP A;  2HLD G;  3APO A;  1DF4 A;  3B2E E;  4JYA O;  1X4T A;  4W4K A;  5H5N A;  1R3J C;  1GTO A;  4J9Z B;  2HP8 A;  2ZKO A;  3H1K H;  2IJI A;  3ZHT A;  1PV0 A;  4JV5 O;  3CCQ V;  3ASO B;  3UM7 A;  3CP1 A;  4DXW A;  4X66 O;  3P32 A;  1J5E O;  4UCR A;  4ZHQ B;  3F5T A;  2AZ2 A;  1EN6 A;  4CS4 A;  4HAM A;  3SPH A;  1SC5 B;  3IAY A;  4I0X B;  2N05 A;  4ASU G;  4ZKI A;  1KC8 W;  5LOV B;  1ZLZ A;  2DJV A;  1MSW D;  3ZRW A;  5KHJ A;  2UXB O;  4O4L A;  3BEH A;  5EYP B;  3D36 A;  5EIB D;  4JI8 O;  2ILM A;  5KHH A;  4WFA V;  1BQZ A;  1K9M W;  3R65 A;  1U97 A;  3STL C;  4NXM O;  4P30 A;  3DTU B;  4I55 A;  4B3R O;  2Q7H A;  4DV6 O;  1IX9 A;  2KG7 A;  4DR5 O;  1WAZ A;  3NXS A;  2QKA A;  5GON A;  1CPY A;  4HBN A;  1NS1 A;  1NH2 D;  4I50 B;  4YHH B;  3T4D A;  1K34 A;  1XBL A;  1M57 C;  3LNN A;  4LF6 O;  4TUY B;  1XMQ O;  4DV5 B;  3CC7 V;  4F6E A;  2YI8 A;  2F4V B;  3I5D A;  4GKJ O;  1FXV A;  4TQD A;  5LA6 B;  1N33 O;  3W7W A;  2VRZ A;  1XOU A;  4MVU A;  2Y4U A;  1KQS U;  2X0L A;  3FB7 C;  5EBM C;  4U7N A;  3T1H B;  4LWS A;  3ML0 A;  1VQK V;  4YIP A;  4OX9 B;  1JR9 A;  3JSL A;  2UXD O;  2IJH A;  4MVM A;  1VQ5 V;  4DR7 O;  3LSS A;  2E74 B;  5KAI Z;  1MZE A;  4QGP A;  2P4V A;  1GKF A;  1P7G A;  1SQX H;  3E89 A;  2CTW A;  1Q86 W;  1CP9 A;  3ZBH A;  4F6R B;  5B1N A;  4NTY A;  5C8Y B;  4FM2 A;  1EN4 A;  2GDS A;  2YIB D;  1QNM A;  3MHH C;  3RYF B;  1SA0 B;  3ZHS A;  1GM9 A;  4B3S B;  3L71 H;  1Z5V A;  2JGU A;  3FB6 C;  4CH4 A;  2UUB B;  4LCU C;  3VQW A;  2LP7 A;  1FFX B;  4X64 B;  2EIM C;  2XOK G;  5IDJ A;  4LFA O;  3BA8 A;  2DYR C;  2F66 C;  4BR6 A;  1OCO B;  3T1Y B;  4B3T B;  2A0L A;  3K9S A;  1AP5 A;  1NU1 H;  2P5O A;  1MSD A;  1OHH G;  2CE4 A;  2EIK B;  4DV7 O;  5CA1 B;  2LQT A;  4IGG A;  4NVP A;  4I5S A;  1GN2 A;  1SRY A;  1SQG A;  2DW4 A;  1HR0 B;  3J80 N;  1M57 B;  1WA8 A;  4LF9 O;  3JYC A;  2JS5 A;  1DTO A;  2LFR A;  4F4L A;  2CK3 G;  2CH7 B;  2IU0 A;  3JD3 A;  4H0L B;  1YSC A;  1R6K A;  1GO3 F;  4DR4 O;  4YY3 B;  1BQ0 A;  5L3F A;  4FLX A;  2BSK A;  2QR4 A;  3A0H Z;  1N36 O;  4WBN B;  3ETG A;  1VF7 A;  1E79 G;  5JVD A;  1EZJ A;  3RBZ A;  4HNA A;  3CCE V;  2K1E A;  1E1R G;  3ETD A;  1R73 A;  4E2L A;  1K5Q A;  4UCV A;  4MVR A;  5CN0 A;  4AHC A;  2Q69 A;  1SQV H;  3D36 C;  5KLV H;  3AG7 A;  1PPJ H;  1R3K C;  1AI4 A;  3K79 A;  4LR3 A;  3QO8 A;  3ZMZ A;  2QJ1 A;  4ZI7 B;  4LF8 B;  4DR1 B;  4J80 A;  3G80 A;  4X20 B;  1K73 W;  4QNH B;  3P30 A;  1H8E G;  3H1I H;  4PI0 A;  3IGA C;  5BMV A;  1ARO P;  1VIB A;  1N4C A;  4JYA B;  4KUM A;  1V9P A;  2DYR B;  3SYP A;  2Z3Y A;  3LDD A;  1VQ8 V;  4JAA A;  4O4J A;  5CA0 B;  3WG7 C;  4GCZ A;  3CMA V;  4LF7 B;  2IH1 C;  3CCJ V;  4NB5 A;  4JV5 B;  3OMI B;  4MTG A;  4K3A A;  4FZ0 A;  4UCT A;  1G1X B;  4X66 B;  2PYL A;  1J5E B;  3JD2 A;  3H1J H;  3GB7 C;  4X9Q A;  2M6Y A;  4DK1 A;  3L74 H;  2FL4 A;  3FKS G;  1FS0 G;  1NR7 A;  1I94 O;  4OGQ B;  1QQC A;  1BHA A;  1B3Q A;  4JI4 O;  5LP6 A;  3E8B A;  5EK0 A;  2UXB B;  3RYC A;  4YIO A;  4NR1 A;  3K08 A;  4X1I B;  4PA9 A;  2XAS A;  4JI8 B;  3ZED A;  2KSD A;  4J11 A;  5EC1 C;  2AGA A;  5IYC O;  1PL4 A;  1IBL O;  4IL6 Z;  4RQF A;  4TV8 A;  3CRC A;  5B1O A;  5CMU A;  4DRX A;  4NXM B;  2XAQ A;  5GW7 A;  4B3R B;  1GM8 A;  4DV6 B;  1IVS A;  3SPG A;  4DR5 B;  1L1F A;  4LFC O;  2GV9 A; 
#chains in the Genus database with same CATH homology
 2A7W A;  2Q9L A;  1YXB A;  2Q4P A;  2A3Q A;  3C90 A;  3CRC A;  2OIG A;  2YXH A;  3CRA A;  2Q5Z A;  1YVW A;  4QGP A;  1Y6X A;  2GTA A;  1VMG A;  5IE9 A;  2P06 A;  2OIE A;  2Q73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...