2A3QA

X-ray structure of protein from mus musculus mm.29898
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
113
structure length
113
Chain Sequence
PFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHVDLPQAVISKMDTNRQRYPVHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title X-Ray Structure of Protein from Mus Musculus MM.29898
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 33
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2005-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12643 MazG-like MazG-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2a3qA00
1Y6XA 3CRCA 2Q4PA 1YVWA 2P06A 2GTAA 1YXBA 2OIGA 2Q5ZA 3C90A 5IE9A 4QGPA 2A3QA 2Q9LA 2YXHA 2Q73A 2OIEA 2A7WA 1VMGA 3CRAA
chains in the Genus database with same CATH superfamily
1GO3F 4CC6A 2GV9A 1ZL8B 1H8HG 3T1HB 2QM8A 3K03A 4MSWC 5B1AB 1AVMA 3S3XA 3CXHF 4GLXA 5DECA 2ADQB 4GX5A 4X1IA 3TGUH 4N23A 1SQVH 4EB6A 4X1YB 4YIPA 4KL1A 2QM7A 4JI5O 2LGQA 2OT5A 2VQFB 2YUAA 2XAFA 3K04A 3OD4A 4O4LB 4GKKB 5CN0A 2ITCC 1MA1A 3UO2A 3IFXA 2VRZA 5B3SC 1S5JA 1UJWB 4EEQA 4DV4B 4PHZA 1VQNV 1EN6A 4RUEA 3B8NA 5EIBD 4DR1O 3AK1A 1YCIA 3O9OA 5LHGA 3CC4V 4LF4O 2QWRB 3FB6C 4DR7O 1AR5A 1QLEC 4A5UB 1QNMA 3S3WA 5B3SB 4CS4A 2XUMA 2EILB 1PD3A 4I50A 4KP4A 1GKFA 2JGDA 3SJQC 1K33A 4UVBA 4DR6B 3E8FA 2IJKA 3UO3A 2Q8VA 4NYKA 3DXRB 1JFFA 4DK0A 1XUQA 3VQXA 2OTLV 1Y74B 1LUWA 4R8CA 1WN7A 5KA5A 3VQWA 2QKSA 3SJBC 4HNAB 4K35A 4X8AA 3ZHQA 1OV9A 4MTXA 1NT2B 1BQZA 1Z5VA 1ZX3A 3ZMZA 2UXCB 1RSOA 2HHHO 4DV6B 3APOA 4CH3A 1K4DC 4X9QA 3RYFB 1P7GA 2HP8A 3CCEV 1NU1H 2EBOA 2QWOB 4FK5C 2NR5A 2BTQB 2EINC 5DM6V 4CH6A 1OCOC 1R6NA 4UXNA 4B3TB 2QWNB 3JATB 1NVPB 4N21A 1SZXA 5EBWC 5L3EA 4JTDB 2IU0A 1MOFA 1AB3A 1KP2A 2ZKOA 4ZHQA 4FZ0A 1E79G 1K3EA 1M57C 4OPHA 2QGNA 4JTAB 1IX9A 1KECA 1DF5A 3AK3A 5CBFA 1NZ6A 4FM1A 2JK5C 1T5EA 1Q8IA 1KKDA 3WG7C 2L6LA 4BAYA 3X2QC 4DV0B 1F7YA 1IVSA 1KD1W 5IYBO 3CCJV 2UXXA 1M57B 3CE2A 1Q43A 3E89A 3THOA 1DGSA 3SYQA 1FFXB 3X2QB 1NTMH 2DWDC 4NTWA 4I4TB 2CH7A 2DW4A 4CH4A 2HR3A 1RFYA 3I56V 5B5EZ 1GN3A 3H1KH 3OE7G 4BW9A 1PNMA 1QVGU 1HNZB 1KQSU 5E79Z 2Q4PA 3K08A 3FD9A 3ZMUA 3BAAA 3QG5A 4IYHA 4PELA 1BT8A 3C90A 2LW1A 3U10A 2DWEC 4QGPA 1NTZH 2Q73A 2P6JA 1R3LC 2WWWA 3RFRA 1I5XA 3JAKA 3L75H 4B08A 4H33A 4X20B 2QKAA 2ZNIA 4TUYA 1VF6C 2MK3A 1D2DA 5LYJB 3RWRD 4JI4O 2RJZA 4RQEA 4JI6B 4JASA 4XDKA 5CBGA 2UXDO 3RYHB 1XBLA 5EC2C 1SQQH 3ASNB 4HYOA 1YDXA 2PYLA 1CXZB 3OMNB 2UXBO 2H8PC 4GZRB 4GKJB 2CTWA 3OTOO 1NR7A 1FXKA 2GDSA 3SPIA 1H2GA 4MVMA 4OPAA 3SGIA 1XHZA 2QTSA 2RN9A 3OR6C 3ZN1A 1AJNA 1O9GA 1H2MA 3I55V 3SPCA 1BS3A 2GUZB 3HKBA 4YIOA 1Y67A 4JV5B 3H1HH 4IHJA 1K9MW 1PV0A 5JJNB 4DV6O 2DE0X 3HKCA 4R6ZA 5EC1C 1AI7A 2YEVA 3G4SV 4MVUA 1FXHA 1GK9A 3LUTB 5KMGA 1IBMO 1SZTA 4B7EA 5LGTA 4B3TO 2ARHA 4F6RB 3RW0A 5H2FZ 4JF3A 4DV2B 1NKDA 4UCVA 3B4SA 2JS5A 1COWG 2FMLA 2MW2B 3KCXA 4TQFA 4IT5A 3U0ZA 3ZRWA 1H38A 5KHGA 4LFAB 4JYAB 4UV8A 4TV9B 2F4VO 5EZYA 5ITZA 5B1NA 4FPPA 3H1LH 1R3IC 4DRXB 2CK3G 1S5LZ 3OUFA 3K5MA 2XTAA 5DN6G 4IIJA 2CAZC 4ZIBA 2A79B 1Q6IA 4X88A 2AW9A 1SKVA 4GX1A 5LA6B 4DV7O 2V1DA 5J2TB 4J41A 2ZE8A 2YI8A 1LNQA 3LDDA 1HNZO 1XNRB 4J9YB 1AR4A 3GB7C 3FX7A 1MSDA 1FD9A 3FAVB 2H94A 1CPYA 1XI1A 3JAWB 3KCYA 5EBLC 1Z2GA 2HLDG 3F7VC 3ABLB 3K0DA 3CEIA 4BW5A 5IYZA 3CRCA 4IL6Z 2PGGA 3DSQA 2ZINA 1M56C 3IJ4A 5KAIZ 2QA4V 1WB8A 1VQ6V 1E1RG 4TV8B 3A2FA 5IWAB 5IE9A 4FZ1A 1AI4A 1D5AA 1R3KC 4J7KA 3DC5A 2ZR3A 4Z1MG 1V9PA 1M56B 4LF6O 3N2GA 2ZIMA 1IBKO 3JCUZ 1B6QA 3E8HA 2P90A 4JI8B 4HAMA 1I94O 5KA6A 4UV9A 2W0XA 3JALA 2UUAB 3AG2C 5IJ9A 4CC5A 2NNUA 1U96A 4DUZB 5JCOC 2OCCC 5LXTB 1YI2V 3BHPA 4WCEV 2AGAA 3AG2B 1K97A 2F93B 4K8XA 4PI2A 4DO2A 3I5DA 1MSWD 2EULA 2OCCB 1KB9F 3J7AU 1K34A 2ZIOA 2KG7A 4B3RO 3EXAA 3WFVA 3CCUV 3CP1A 2OYQA 4F4LA 3GVMA 2FTKA 2BSKA 5KHHA 4DR5B 4WFFA 3M7MX 3C3TA 3BFRA 2WAMA 3OEHG 5EIBC 2Q67A 5C8YA 1K7DA 1V55B 3BCCH 1O9HA 3CJHB 4B3MB 1NI8A 3CX5F 2WSSG 1P7BA 4BIUA 1EM1A 2WLIA 4LF9O 2LJ2A 5FLXN 4DV5O 4OX9O 2VWJA 3N2KB 4TSFG 2C2AA 1BHAA 4JYAO 2WLLA 1XREA 1N34O 1TUBA 4GT1A 1WP8A 5L3DA 1N4CA 3JASA 1W59A 4ZI7A 2QEXV 4O2AB 3SYAA 4UCSA 3B40A 5JVDB 2IJJA 2B1IA 1KBHA 5A9GA 1XILA 1N36B 3JCZA 3JYCA 3AG1C 3MDSA 1ZAUA 1FPOA 1DTOA 2YICA 1Q82W 1XNRO 4X65B 1YZBA 1PP9H 2ZE6A 3OAAG 2E3CA 2UUCB 1ZL8A 3ZRVA 2N04A 2ZXWB 5LMNO 5LMUB 4O2BA 3AG1B 2HKOA 3QNEA 5FPOA 5AG2A 4B3SO 3UM7A 3BA8A 1HNWB 4LNUB 3VQYA 4DR3B 4X1YA 5JQGA 4YJ2A 2CGOA 2RMKB 5BMVB 3E22B 4NR1A 4HZ3A 4NXNO 2EIMB 3AG7A 4MT8A 2DMXA 1VF5B 4DV3B 1VP7A 4DW0A 1GTOA 4O4JA 4MVOA 4O4LA 1HP8A 2P06A 3L74H 2LGWA 1H2KA 1JX9A 1NTKH 1NQTA 1AP6A 1E1QG 3D36C 4DXWA 5CB4A 4PA9A 2DQ3A 2WA3A 3BEHA 3T4ZA 1B04A 1YVWA 3SJCC 5LHHA 3TJTA 1XDCA 4K8ZA 1SA0B 1QLNA 1VIBA 5KAFZ 1JR9A 1Q6HA 3UT5B 3OEEG 2E74B 1HR0B 5H6QA 4DUYO 3L71H 1HNXO 4TOIA 2XHBA 3N27A 3JD1A 4DW1A 4W4KA 2XAHA 3BABA 2CTQA 1KKCA 2L35A 4FFBA 4JI3O 2HG5C 3OFNG 2ZT9B 1J5EB 3DXRA 2EILC 1RPOA 1YJWV 4GYCB 3ZRSA 3CCRV 2OWOA 4UVAA 3W7UA 4R7CA 3MHSC 4FFKA 2R72A 1P49A 4HNAA 3JSLA 4X1IB 1XHXA 2FL4A 2B5UA 1G4YB 4DV1O 1VQLV 4FM2A 4EB6B 4RQFA 3RYFA 2JIZG 4P2ZA 4LH6A 3SYPA 2K1EA 3ASOB 2Q6AA 2UUBB 1OCCC 5IJ0B 5CMUA 3P3PA 4KHPO 4K0KO 5HFMA 5E1AC 4X62B 3ZMVA 1LR1A 3IAYA 2Y4TA 4YHHB 4JI7B 3GWKC 4D7TA 1X59A 1OCCB 5B1OA 1SF9A 3L72H 1US6A 2QJ1A 4WFHA 2Y69C 3QO5A 3DGEA 5IDJA 5LP6C 2A0LA 4WFEA 2QE7G 2LFSA 1N36O 4O4HA 4FLZA 1PKXA 3G80A 4YXWG 1ZSPA 2W0FC 2XAGA 3TETA 2RQ6A 3CXCU 2Y69B 3B2EE 5LP6B 1VMGA 1I5YA 4I50B 1MZEA 1R73A 1FFXA 3ZMTA 1JCHA 1ROPA 1HNWO 4L8JA 5LGNA 3FFQA 3J81N 4I55A 1JFFB 1TGOA 2E5LB 4PA3A 3K9AA 3RN4A 1B3QA 4X64B 2XOKG 3CRAA 5JJJB 2UU9O 3HKEA 2P7TC 1K5SA 2IW5A 1AI6A 3T1YB 5GONB 1VQ5V 1RSOB 2ETNA 1URFA 3K79A 3T1HO 2AZ2A 1QR8A 3C3SA 3OT7A 3CRMA 3CB2A 4NTYA 5DEDA 1IURA 1THZA 4ABMA 4X20A 1JOYA 2DYSC 3RYCA 4X66B 4K3AA 1GRJA 4J11A 1BSMA 3Q4HA 4QJFB 1MZFA 4X89A 3A0HZ 3G6BA 3CC7V 4G27B 2JEUA 1Y4MA 1MG1A 3RYHA 2Q0AA 2VQFO 1OCRC 2DYSB 4FLYA 1XQ8A 5H6RA 1VQ9V 1VF6A 2DN9A 4LF7B 4GKKO 3ZCCA 3JARB 5A2QN 3OMAB 4DV4O 3SPHA 3VBBA 3ASNC 1OCRB 1YXBA 4MVSA 3QTCA 4E4EA 5CBHA 1R6TA 2ZDIC 2A3QA 2YXHA 1N32B 1AR1B 2GUZA 3CS5A 3TXSA 2CH7B 2AXTZ 1JQ0A 4MW3A 5J9PC 1PL4A 4IYIA 5GW7A 4FLTA 5FL7G 4U3FH 2HFEC 4FJCC 1NR1A 4UCOA 3ZIAG 2XAJA 4DR6O 1EZJA 1NH2D 4OXSA 1XOUA 3U11A 2ZM6B 2PY5A 1AP5A 1F4NA 1UPGA 4X62O 4MTOA 3ICXA 1K4CC 2Q0OC 5FPRA 5BR8B 1R6KA 2PI4A 2NLJC 3RT3C 1EFRG 1M93A 3ZBHA 1FXVA 1L0NH 3ZRXA 1WA8B 2R9IA 3K3WA 4NTXA 1YIJV 4TT3G 4Q20A 2UXCO 4LFBB 4GUNA 4QIWF 3ZHTA 2EIKB 2EZOA 2EJ7A 3ZEDA 1NVPD 4XBFA 4LFCB 1EN5A 4LCUC 2ZQMA 3NR7A 1A32A 2GTSA 4UUJC 4FLWA 4DRXA 2XNDG 4CZZA 3K0GA 5LHIA 1QU7A 2A9HA 4MVZA 3VOUA 4CS3A 5KHIA 5TISZ 5J2UA 4JI1B 2Y0PA 2PF4E 2HVKC 3KG2A 3JAMN 1FXKB 2VS0A 4KFMA 1SC5B 3M99B 4U3JB 4BIZA 5CA1A 5FNVA 1Q3EA 2X6BA 4DV0O 2Y0IA 1GN6A 3FYEB 2N05A 3FAVA 1OHHG 2WLKA 2HVJC 3JAWA 4JAAA 5B1BB 4IHJB 1IXMA 3CC2V 4C7UA 2DOSA 1XMQB 2F66C 4H0LB 4J9ZB 1UFIA 3CSXA 3ZHSA 4P9PA 4WFAV 5KMGB 4JAUA 3SR2C 1SS3A 3ABLC 3ZN0A 1YJ9V 1NS1A 3QVNA 3LSSA 1GN4A 4D7SA 3EVKA 3LSQA 2DQ0A 2BCCH 1PNLA 4G2KA 2F43G 1GMGA 2A7WA 4DR2B 1NBMG 3JD0A 1KUQA 4I0XB 3HKDB 2WLNA 3P30A 3WB2A 3ZRWB 2FB5A 3AEIA 1W2BU 2ZE7A 4DYLA 2VQEB 2H3OA 3NXSA 4WFGA 2YC0A 3H01A 1JMKC 4LF5B 3E2EA 3SYOA 3H9VA 1FJGB 4IGGA 4YJ3B 5EK0A 3ZHUA 1XMOB 4JI6O 3IC9A 4ZOLB 2Q7GA 4CBCA 1JPXA 3T2MA 1FYJA 4JAVA 3L9DA 1ORQC 5JCOA 2CE4A 2QWQB 1DF4A 4MW8A 5LOVA 4GKJO 3JSNA 1GM9A 3D3IA 5KX5A 4NXMB 3AG4C 4XDLA 4XDJA 1MABG 3ETGA 1YTFB 1S0VA 1Q7YW 2AHZA 2WLJA 4H13B 1YJNV 5IYZB 5CA0A 3LDCA 3RYIB 3CJHA 4JYBA 1D5NA 4JV5O 2E76B 3GWOA 4X1KA 3ETDA 3LNMB 2EX3A 4PDRA 2ZR2A 3AG4B 3F5TA 2P22C 4JI5B 1V55C 3UQ8A 3N2KA 1TVKA 1ZUQA 4LFCO 2NN4A 2Z0AA 3OM3B 3N2GB 2GSMB 1XL4A 4O2AA 4O4IA 3L73H 4WBNB 1N0JA 2IBZH 4BWAA 4DV2O 1HWYA 3G6EV 3CCSV 3H1JH 1AJQA 1OCZB 1VQ4V 4EFBA 2BTOA 1M1KW 2M7WA 2KKWA 5L3GA 4LF4B 1Y76B 3UKMA 4DR7B 4Z1VA 2F23A 3W7TA 4LWSB 1X4TA 1VQPV 4LFAO 4UCTA 1OZ0A 3SYCA 4PA7A 2W6IG 2BOBC 4FVMA 1QBZA 3E8GA 3CCVV 1ZTEA 5IY5C 4DR4B 4LNUA 4UB6Z 4I9WA 2KG7B 4PJ0Z 4RAIA 2ZXWC 1VQKV 4H44B 4PD4F 3ZHVA 2Y48A 5EYPB 2V4DA 1V54B 1S3JA 3DTUB 3OGCC 4J10A 2PYJA 1TUEB 5IY5B 1G1XB 1W0KG 1XNQB 1SQGA 5C93A 5JH7B 3K9SA 4WFBV 2YSUB 3OTFA 1S77D 2EIMC 2W6JG 2KSDA 4BR6A 2WLIB 5HFLA 2P4VA 1ZWIC 1JJOA 3QO7A 3BVOA 3ABTA 2CTRA 4B7KA 3E8BA 4KXRA 3P32A 1G6UA 2WLLB 1YF2A 5KLVH 3STLC 3CCLV 2OIEA 5IWAO 2IM9A 3JASB 2F1MA 3ML0A 1BQ0A 4QPKA 4GX0A 3EHBB 1VF7A 1S72V 1SA0A 2M6YA 3TCUA 1RPRA 4OGQB 1L1FA 1XMOO 3D36A 1FFTB 3E83A 3WU2Z 2GTAA 2XT9A 4QE9A 1SQXH 1MMMA 2FYUH 4JI8O 4PDMA 4KUMA 3SDLA 3MAQA 2UUAO 3D3QA 1YSCA 3R66A 2ATKC 2IJHA 4NXMO 4I7ZB 4O2BB 1R1BA 2YIDA 4DUZO 1BMFG 1IDSA 1L8DA 3CRQA 3E86A 4AQYB 4PDLA 2LQTA 5CA3A 2G38A 3A8TA 1WPBA 1MNGA 5JQGB 4YJ2B 5IJ0A 4ASUG 3QF7A 1VQMV 4PA6A 3RGBA 2QM4A 5GTIZ 4UCUA 2HJFC 3B77A 4FLXA 2JJ2G 3KZIZ 1Y66A 3ASOC 1Y74A 4O4JB 4DR5O 3SPJA 3FB7C 1NJIW 1CP9A 1K8AW 4LH7A 1GAXA 4P9OA 3JD3A 3W7WA 1VQ7V 4AHCA 2K9PA 3UCSC 4B3MO 3AK2A 1XEQA 3TK1A 3AG3C 5CB4B 1KU9A 4E2LA 5LBQA 3K59A 4H37A 2AHYA 1CEZA 4JI4B 4AI8A 1JVMA 2BTQA 2LP7A 5D5QA 4FIPC 3OW2U 2UXDB 1N0NA 3OR7C 1H2LA 3HR0A 2YIBA 2JDIG 3JATA 5LP6A 3HB3B 5BY1A 4BIOA 1PPJH 3AG3B 2UXBB 3L70H 2GHYA 1QLEB 2HEPA 4FFBB 3OTOB 5L3BA 4DR4O 4AILC 1WP7A 5IYDO 4ZBMA 3K57A 1NH2B 1S76D 1G8MA 4CH5A 1RM1C 5L3FA 4X65O 3DC6A 2VWKA 2JS3A 2Z5UA 5GONA 4F6EA 1XNQO 1FAFA 2UUCO 1GN2A 5LMUO 2JGDB 3BRCA 3RBZA 2PZSA 1F23A 4I4TA 1KC8W 1N8RW 1RM1B 2DYRC 4FM0A 4DR3O 2KQXA 2QR4A 3FKSG 1IBMB 2RCVA 1YEWA 1LUVA 1B06A 4L87A 4JI0B 1M90W 1M9NA 2OCHA 1QQCA 3VQVA 1PNKA 2B1GA 2DYRB 4LBEC 1ENVA 5JWPA 4DV3O 3BA9A 3P3NA 1GM7A 1GH6A 2EINB 1OCOB 4EKWA 2Q69A 3CCQV 2HJDA 2O57A 4O4HB 4Q6GA 3JARA 4JYYA 3EFFK 3FB8C 2F4VB 4NB5A 4EFEA 3W7SA 1EN4A 2N74A 4JYCA 3ZMSA 4YY3B 1IBLB 5LYJA 2BOCC 3MD0A 3K5NA 1JA8A 3FB5C 3WG7B 1SETA 2P67A 4ZHQB 5BZBA 1SQPH 4AQYO 4DV7B 2QKCA 4R50A 2PUSA 2Q68A 1H2SB 1QHTA 1HR0O 3JD2A 1YITV 4I55B 4P30A 2EIJC 1Y6XA 3LSUA 2ZDIA 2ITDC 4JZ2A 3HKEB 1J5EO 1AILA 1WPXA 4TWKA 1OJHA 2OIGA 3O65A 2CGNA 4LF8B 2Q5ZA 2EIJB 3IC7A 1KMIZ 3OGIB 1WA8A 2YDEA 1DLBA 4UB8Z 3PN1A 2ILMA 1Q81W 1PM9A 2QDOA 1VARA 3RYCB 2YI9A 2UUBO 3K5OA 1TAEA 2JVDA 3Q4HB 1M4UA 4LF6B 1IBKB 2FKXA 2IJIA 3ETEA 4YHHO 4J7JA 2EIKC 3APQA 2QTOA 4I5SA 4F6RA 4JI7O 1H8EG 2IU3A 1I94B 1F4MA 1BL8A 2CTPA 3JAKB 3F7YC 1P4RA 4U3JA 1Q6UA 4TUYB 2YXYA 3K58A 5D5PA 2YIBD 2X0LA 4PA4A 1DK1A 5KUKA 4TV9A 4RO2A 1FKAO 1FXKC 1J95A 3T4DA 4ICGA 1IZ3A 2Y4UA 3HPLC 1VEWA 2ZNJA 2OTJV 1HDJA 1R3JC 2CDYA 2ADPA 3SPGA 3CRRA 1SRYA 2JRIA 2X7RB 1BHBA 4NVPA 2R9RB 5LA6A 4B3RB 2YXLA 5J2TA 5B1BC 2UXNA 1BE3H 1RP3B 1S5HC 3CPWU 2E5LO 2BE3A 3PJSK 2F95B 1KYOF 3TXQA 1WB7A 4X64O 4JI0O 3CHXA 4J7ZA 2Z3YA 2YS8A 4LC1A 4PDVA 3T1YO 3HKBB 4QPJA 2X6CA 4FLUA 2D3OW 2V7QG 3HKCB 4LF9B 4I0XA 3HKDA 4DV5B 4OX9B 4G28B 3B09A 3OMIB 1XL6A 2YEVB 1L0LH 3OUSA 1N34B 2Q7EA 1H2NA 4PV1B 4TV8A 3T1CA 4X66O 1VQOV 4YY3O 1IBLO 3D8CA 4YJ3A 3J80N 3G71V 2Q9LA 4ZOLA 3MHHC 4RUFA 5J2UB 3CMAV 4I9QA 1N33B 3WB0A 2IH1C 1ZLZA 5H9CA 1I0HA 4LF7O 5CA1B 5FNVB 1Q5OA 1SQBH 4JI2B 3M8AA 2LW7A 4W4LA 4J80A 5EZYB 5ITZB 5LMNB 4WF9V 3KKYA 1TA8A 3SJAC 4LF8O 1HW7A 3RVZA 4MVQA 5LXTA 4B3SB 4JGSA 4IIJB 1N32O 3R65A 3RYIA 2R70A 1I08A 1WLEA 2WPDG 4NXNB 2KB1A 3QO8A 3BPZA 1K5QA 2ZM6O 2RNBA 4TQDA 2ZE5A 5BR8O 1SERA 2RDCA 2IH3C 1M5IA 1Q90D 4WBNA 1BGYH 4ZKIA 2LO1A 4MTGA 2YIAA 2EZPA 2R9AA 5LGUA 3F5WC 4FMTA 3ZHRA 1W0JG 5K1XA 1SQFA 4DK1A 4LFBO 1Y76A 4MVRA 3ETQA 2P5OA 3LNNA 5KUMA 2ZCEA 1U97A 2AZ0A 5BXZA 4LWSA 1K73W 1OCZC 1P84F 1Z5WA 2XASA 4GCZA 4DUYB 1HNXB 4PI0A 1I7FA 2QWPB 5F2VO 2Q7HA 4MS2A 2JJ1G 1EZVH 5JVDA 2LFRA 4RWUA 4JI3B 2B9ZA 1BCCH 3CCMV 3JALB 3STZC 3CYOA 5LOVB 4DR1B 4D6TH 4JI1O 3ZX6A 2JEXA 3ABUA 4LP8A 1K92A 1F51A 5KX5B 5IJ9B 3CWBH 5LL6Y 2WLMA 5EYPA 1BZKA 1PL0A 1SESA 3CMEV 5IT9N 2PTMA 3FYIB 4U7NA 4DV1B 4J42A 5CA0B 5JH7A 1FS0G 4CS2A 4JZGA 5KHKA 1AJPA 2WLHA 1QVFU 4X1KB 1YHQV 1V54C 2D2CB 4JTCB 5L3CA 4KHPB 1XMQO 4K0KB 1GM8A 5GTHZ 3W7XA 3H1IH 2XAQA 5K1PA 1WAZA 3WB1A 1JJ2U 2E75B 4QNHB 3ZS8C 3K5LA 1TVKB 2P4KA 5BMVA 5KHJA 3ABMC 3E22A 3B8MA 2ZD9A 2BSKB 4MTFA 5B66Z 4QE7A 2CUGA 1QCEA 1AROP 1EBOA 1IXBA 4U7OA 2PI5A 4O4IB 1QR9A 5C8YB 2HHHB 1AI5A 1WJZA 4HBNA 3BY6A 3ABKC 3ABMB 4Z2WA 3RVYA 2X6AA 2DJVA 4JPRA 4UCRA 3A0RA 1WNSA 4LR3A 1N33O 4DR2O 3IGAC 5IYCO 1Q86W 4NKGB 4JI2O 2QSAA 2WA4A 2VQEO 3K06A 3ABKB 1TUBB 2GBOA 4LF5O 4ZI7B 2ODMA 1FJGO 1KP3A 3UT5A 3A0BZ 5H5NA 4UVCA 3JD4A 3ZJZA 3E35A 4UFZA 3CD6V 5B1AC 4GX2A 2EJRA 5EBMC 3G67A 4FLVA 2UU9B 1VQ8V 3LDEA 5JJEB 1YTFD 2JGUA 2A06H
chains in the Genus database with same CATH topology
1Y6XA 3CRCA 2Q4PA 1YVWA 2P06A 2GTAA 1YXBA 2OIGA 2Q5ZA 3C90A 5IE9A 4QGPA 2A3QA 2Q9LA 2YXHA 2Q73A 2OIEA 2A7WA 1VMGA 3CRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y6X A;  3CRC A;  2Q4P A;  1YVW A;  2P06 A;  2GTA A;  1YXB A;  2OIG A;  2Q5Z A;  3C90 A;  5IE9 A;  4QGP A;  2A3Q A;  2Q9L A;  2YXH A;  2Q73 A;  2OIE A;  2A7W A;  1VMG A;  3CRA A; 
#chains in the Genus database with same CATH topology
 1GO3 F;  4CC6 A;  2GV9 A;  1ZL8 B;  1H8H G;  3T1H B;  2QM8 A;  3K03 A;  4MSW C;  5B1A B;  1AVM A;  3S3X A;  3CXH F;  4GLX A;  5DEC A;  2ADQ B;  4GX5 A;  4X1I A;  3TGU H;  4N23 A;  1SQV H;  4EB6 A;  4X1Y B;  4YIP A;  4KL1 A;  2QM7 A;  4JI5 O;  2LGQ A;  2OT5 A;  2VQF B;  2YUA A;  2XAF A;  3K04 A;  3OD4 A;  4O4L B;  4GKK B;  5CN0 A;  2ITC C;  1MA1 A;  3UO2 A;  3IFX A;  2VRZ A;  5B3S C;  1S5J A;  1UJW B;  4EEQ A;  4DV4 B;  4PHZ A;  1VQN V;  1EN6 A;  4RUE A;  3B8N A;  5EIB D;  4DR1 O;  3AK1 A;  1YCI A;  3O9O A;  5LHG A;  3CC4 V;  4LF4 O;  2QWR B;  3FB6 C;  4DR7 O;  1AR5 A;  1QLE C;  4A5U B;  1QNM A;  3S3W A;  5B3S B;  4CS4 A;  2XUM A;  2EIL B;  1PD3 A;  4I50 A;  4KP4 A;  1GKF A;  2JGD A;  3SJQ C;  1K33 A;  4UVB A;  4DR6 B;  3E8F A;  2IJK A;  3UO3 A;  2Q8V A;  4NYK A;  3DXR B;  1JFF A;  4DK0 A;  1XUQ A;  3VQX A;  2OTL V;  1Y74 B;  1LUW A;  4R8C A;  1WN7 A;  5KA5 A;  3VQW A;  2QKS A;  3SJB C;  4HNA B;  4K35 A;  4X8A A;  3ZHQ A;  1OV9 A;  4MTX A;  1NT2 B;  1BQZ A;  1Z5V A;  1ZX3 A;  3ZMZ A;  2UXC B;  1RSO A;  2HHH O;  4DV6 B;  3APO A;  4CH3 A;  1K4D C;  4X9Q A;  3RYF B;  1P7G A;  2HP8 A;  3CCE V;  1NU1 H;  2EBO A;  2QWO B;  4FK5 C;  2NR5 A;  2BTQ B;  2EIN C;  5DM6 V;  4CH6 A;  1OCO C;  1R6N A;  4UXN A;  4B3T B;  2QWN B;  3JAT B;  1NVP B;  4N21 A;  1SZX A;  5EBW C;  5L3E A;  4JTD B;  2IU0 A;  1MOF A;  1AB3 A;  1KP2 A;  2ZKO A;  4ZHQ A;  4FZ0 A;  1E79 G;  1K3E A;  1M57 C;  4OPH A;  2QGN A;  4JTA B;  1IX9 A;  1KEC A;  1DF5 A;  3AK3 A;  5CBF A;  1NZ6 A;  4FM1 A;  2JK5 C;  1T5E A;  1Q8I A;  1KKD A;  3WG7 C;  2L6L A;  4BAY A;  3X2Q C;  4DV0 B;  1F7Y A;  1IVS A;  1KD1 W;  5IYB O;  3CCJ V;  2UXX A;  1M57 B;  3CE2 A;  1Q43 A;  3E89 A;  3THO A;  1DGS A;  3SYQ A;  1FFX B;  3X2Q B;  1NTM H;  2DWD C;  4NTW A;  4I4T B;  2CH7 A;  2DW4 A;  4CH4 A;  2HR3 A;  1RFY A;  3I56 V;  5B5E Z;  1GN3 A;  3H1K H;  3OE7 G;  4BW9 A;  1PNM A;  1QVG U;  1HNZ B;  1KQS U;  5E79 Z;  2Q4P A;  3K08 A;  3FD9 A;  3ZMU A;  3BAA A;  3QG5 A;  4IYH A;  4PEL A;  1BT8 A;  3C90 A;  2LW1 A;  3U10 A;  2DWE C;  4QGP A;  1NTZ H;  2Q73 A;  2P6J A;  1R3L C;  2WWW A;  3RFR A;  1I5X A;  3JAK A;  3L75 H;  4B08 A;  4H33 A;  4X20 B;  2QKA A;  2ZNI A;  4TUY A;  1VF6 C;  2MK3 A;  1D2D A;  5LYJ B;  3RWR D;  4JI4 O;  2RJZ A;  4RQE A;  4JI6 B;  4JAS A;  4XDK A;  5CBG A;  2UXD O;  3RYH B;  1XBL A;  5EC2 C;  1SQQ H;  3ASN B;  4HYO A;  1YDX A;  2PYL A;  1CXZ B;  3OMN B;  2UXB O;  2H8P C;  4GZR B;  4GKJ B;  2CTW A;  3OTO O;  1NR7 A;  1FXK A;  2GDS A;  3SPI A;  1H2G A;  4MVM A;  4OPA A;  3SGI A;  1XHZ A;  2QTS A;  2RN9 A;  3OR6 C;  3ZN1 A;  1AJN A;  1O9G A;  1H2M A;  3I55 V;  3SPC A;  1BS3 A;  2GUZ B;  3HKB A;  4YIO A;  1Y67 A;  4JV5 B;  3H1H H;  4IHJ A;  1K9M W;  1PV0 A;  5JJN B;  4DV6 O;  2DE0 X;  3HKC A;  4R6Z A;  5EC1 C;  1AI7 A;  2YEV A;  3G4S V;  4MVU A;  1FXH A;  1GK9 A;  3LUT B;  5KMG A;  1IBM O;  1SZT A;  4B7E A;  5LGT A;  4B3T O;  2ARH A;  4F6R B;  3RW0 A;  5H2F Z;  4JF3 A;  4DV2 B;  1NKD A;  4UCV A;  3B4S A;  2JS5 A;  1COW G;  2FML A;  2MW2 B;  3KCX A;  4TQF A;  4IT5 A;  3U0Z A;  3ZRW A;  1H38 A;  5KHG A;  4LFA B;  4JYA B;  4UV8 A;  4TV9 B;  2F4V O;  5EZY A;  5ITZ A;  5B1N A;  4FPP A;  3H1L H;  1R3I C;  4DRX B;  2CK3 G;  1S5L Z;  3OUF A;  3K5M A;  2XTA A;  5DN6 G;  4IIJ A;  2CAZ C;  4ZIB A;  2A79 B;  1Q6I A;  4X88 A;  2AW9 A;  1SKV A;  4GX1 A;  5LA6 B;  4DV7 O;  2V1D A;  5J2T B;  4J41 A;  2ZE8 A;  2YI8 A;  1LNQ A;  3LDD A;  1HNZ O;  1XNR B;  4J9Y B;  1AR4 A;  3GB7 C;  3FX7 A;  1MSD A;  1FD9 A;  3FAV B;  2H94 A;  1CPY A;  1XI1 A;  3JAW B;  3KCY A;  5EBL C;  1Z2G A;  2HLD G;  3F7V C;  3ABL B;  3K0D A;  3CEI A;  4BW5 A;  5IYZ A;  3CRC A;  4IL6 Z;  2PGG A;  3DSQ A;  2ZIN A;  1M56 C;  3IJ4 A;  5KAI Z;  2QA4 V;  1WB8 A;  1VQ6 V;  1E1R G;  4TV8 B;  3A2F A;  5IWA B;  5IE9 A;  4FZ1 A;  1AI4 A;  1D5A A;  1R3K C;  4J7K A;  3DC5 A;  2ZR3 A;  4Z1M G;  1V9P A;  1M56 B;  4LF6 O;  3N2G A;  2ZIM A;  1IBK O;  3JCU Z;  1B6Q A;  3E8H A;  2P90 A;  4JI8 B;  4HAM A;  1I94 O;  5KA6 A;  4UV9 A;  2W0X A;  3JAL A;  2UUA B;  3AG2 C;  5IJ9 A;  4CC5 A;  2NNU A;  1U96 A;  4DUZ B;  5JCO C;  2OCC C;  5LXT B;  1YI2 V;  3BHP A;  4WCE V;  2AGA A;  3AG2 B;  1K97 A;  2F93 B;  4K8X A;  4PI2 A;  4DO2 A;  3I5D A;  1MSW D;  2EUL A;  2OCC B;  1KB9 F;  3J7A U;  1K34 A;  2ZIO A;  2KG7 A;  4B3R O;  3EXA A;  3WFV A;  3CCU V;  3CP1 A;  2OYQ A;  4F4L A;  3GVM A;  2FTK A;  2BSK A;  5KHH A;  4DR5 B;  4WFF A;  3M7M X;  3C3T A;  3BFR A;  2WAM A;  3OEH G;  5EIB C;  2Q67 A;  5C8Y A;  1K7D A;  1V55 B;  3BCC H;  1O9H A;  3CJH B;  4B3M B;  1NI8 A;  3CX5 F;  2WSS G;  1P7B A;  4BIU A;  1EM1 A;  2WLI A;  4LF9 O;  2LJ2 A;  5FLX N;  4DV5 O;  4OX9 O;  2VWJ A;  3N2K B;  4TSF G;  2C2A A;  1BHA A;  4JYA O;  2WLL A;  1XRE A;  1N34 O;  1TUB A;  4GT1 A;  1WP8 A;  5L3D A;  1N4C A;  3JAS A;  1W59 A;  4ZI7 A;  2QEX V;  4O2A B;  3SYA A;  4UCS A;  3B40 A;  5JVD B;  2IJJ A;  2B1I A;  1KBH A;  5A9G A;  1XIL A;  1N36 B;  3JCZ A;  3JYC A;  3AG1 C;  3MDS A;  1ZAU A;  1FPO A;  1DTO A;  2YIC A;  1Q82 W;  1XNR O;  4X65 B;  1YZB A;  1PP9 H;  2ZE6 A;  3OAA G;  2E3C A;  2UUC B;  1ZL8 A;  3ZRV A;  2N04 A;  2ZXW B;  5LMN O;  5LMU B;  4O2B A;  3AG1 B;  2HKO A;  3QNE A;  5FPO A;  5AG2 A;  4B3S O;  3UM7 A;  3BA8 A;  1HNW B;  4LNU B;  3VQY A;  4DR3 B;  4X1Y A;  5JQG A;  4YJ2 A;  2CGO A;  2RMK B;  5BMV B;  3E22 B;  4NR1 A;  4HZ3 A;  4NXN O;  2EIM B;  3AG7 A;  4MT8 A;  2DMX A;  1VF5 B;  4DV3 B;  1VP7 A;  4DW0 A;  1GTO A;  4O4J A;  4MVO A;  4O4L A;  1HP8 A;  2P06 A;  3L74 H;  2LGW A;  1H2K A;  1JX9 A;  1NTK H;  1NQT A;  1AP6 A;  1E1Q G;  3D36 C;  4DXW A;  5CB4 A;  4PA9 A;  2DQ3 A;  2WA3 A;  3BEH A;  3T4Z A;  1B04 A;  1YVW A;  3SJC C;  5LHH A;  3TJT A;  1XDC A;  4K8Z A;  1SA0 B;  1QLN A;  1VIB A;  5KAF Z;  1JR9 A;  1Q6H A;  3UT5 B;  3OEE G;  2E74 B;  1HR0 B;  5H6Q A;  4DUY O;  3L71 H;  1HNX O;  4TOI A;  2XHB A;  3N27 A;  3JD1 A;  4DW1 A;  4W4K A;  2XAH A;  3BAB A;  2CTQ A;  1KKC A;  2L35 A;  4FFB A;  4JI3 O;  2HG5 C;  3OFN G;  2ZT9 B;  1J5E B;  3DXR A;  2EIL C;  1RPO A;  1YJW V;  4GYC B;  3ZRS A;  3CCR V;  2OWO A;  4UVA A;  3W7U A;  4R7C A;  3MHS C;  4FFK A;  2R72 A;  1P49 A;  4HNA A;  3JSL A;  4X1I B;  1XHX A;  2FL4 A;  2B5U A;  1G4Y B;  4DV1 O;  1VQL V;  4FM2 A;  4EB6 B;  4RQF A;  3RYF A;  2JIZ G;  4P2Z A;  4LH6 A;  3SYP A;  2K1E A;  3ASO B;  2Q6A A;  2UUB B;  1OCC C;  5IJ0 B;  5CMU A;  3P3P A;  4KHP O;  4K0K O;  5HFM A;  5E1A C;  4X62 B;  3ZMV A;  1LR1 A;  3IAY A;  2Y4T A;  4YHH B;  4JI7 B;  3GWK C;  4D7T A;  1X59 A;  1OCC B;  5B1O A;  1SF9 A;  3L72 H;  1US6 A;  2QJ1 A;  4WFH A;  2Y69 C;  3QO5 A;  3DGE A;  5IDJ A;  5LP6 C;  2A0L A;  4WFE A;  2QE7 G;  2LFS A;  1N36 O;  4O4H A;  4FLZ A;  1PKX A;  3G80 A;  4YXW G;  1ZSP A;  2W0F C;  2XAG A;  3TET A;  2RQ6 A;  3CXC U;  2Y69 B;  3B2E E;  5LP6 B;  1VMG A;  1I5Y A;  4I50 B;  1MZE A;  1R73 A;  1FFX A;  3ZMT A;  1JCH A;  1ROP A;  1HNW O;  4L8J A;  5LGN A;  3FFQ A;  3J81 N;  4I55 A;  1JFF B;  1TGO A;  2E5L B;  4PA3 A;  3K9A A;  3RN4 A;  1B3Q A;  4X64 B;  2XOK G;  3CRA A;  5JJJ B;  2UU9 O;  3HKE A;  2P7T C;  1K5S A;  2IW5 A;  1AI6 A;  3T1Y B;  5GON B;  1VQ5 V;  1RSO B;  2ETN A;  1URF A;  3K79 A;  3T1H O;  2AZ2 A;  1QR8 A;  3C3S A;  3OT7 A;  3CRM A;  3CB2 A;  4NTY A;  5DED A;  1IUR A;  1THZ A;  4ABM A;  4X20 A;  1JOY A;  2DYS C;  3RYC A;  4X66 B;  4K3A A;  1GRJ A;  4J11 A;  1BSM A;  3Q4H A;  4QJF B;  1MZF A;  4X89 A;  3A0H Z;  3G6B A;  3CC7 V;  4G27 B;  2JEU A;  1Y4M A;  1MG1 A;  3RYH A;  2Q0A A;  2VQF O;  1OCR C;  2DYS B;  4FLY A;  1XQ8 A;  5H6R A;  1VQ9 V;  1VF6 A;  2DN9 A;  4LF7 B;  4GKK O;  3ZCC A;  3JAR B;  5A2Q N;  3OMA B;  4DV4 O;  3SPH A;  3VBB A;  3ASN C;  1OCR B;  1YXB A;  4MVS A;  3QTC A;  4E4E A;  5CBH A;  1R6T A;  2ZDI C;  2A3Q A;  2YXH A;  1N32 B;  1AR1 B;  2GUZ A;  3CS5 A;  3TXS A;  2CH7 B;  2AXT Z;  1JQ0 A;  4MW3 A;  5J9P C;  1PL4 A;  4IYI A;  5GW7 A;  4FLT A;  5FL7 G;  4U3F H;  2HFE C;  4FJC C;  1NR1 A;  4UCO A;  3ZIA G;  2XAJ A;  4DR6 O;  1EZJ A;  1NH2 D;  4OXS A;  1XOU A;  3U11 A;  2ZM6 B;  2PY5 A;  1AP5 A;  1F4N A;  1UPG A;  4X62 O;  4MTO A;  3ICX A;  1K4C C;  2Q0O C;  5FPR A;  5BR8 B;  1R6K A;  2PI4 A;  2NLJ C;  3RT3 C;  1EFR G;  1M93 A;  3ZBH A;  1FXV A;  1L0N H;  3ZRX A;  1WA8 B;  2R9I A;  3K3W A;  4NTX A;  1YIJ V;  4TT3 G;  4Q20 A;  2UXC O;  4LFB B;  4GUN A;  4QIW F;  3ZHT A;  2EIK B;  2EZO A;  2EJ7 A;  3ZED A;  1NVP D;  4XBF A;  4LFC B;  1EN5 A;  4LCU C;  2ZQM A;  3NR7 A;  1A32 A;  2GTS A;  4UUJ C;  4FLW A;  4DRX A;  2XND G;  4CZZ A;  3K0G A;  5LHI A;  1QU7 A;  2A9H A;  4MVZ A;  3VOU A;  4CS3 A;  5KHI A;  5TIS Z;  5J2U A;  4JI1 B;  2Y0P A;  2PF4 E;  2HVK C;  3KG2 A;  3JAM N;  1FXK B;  2VS0 A;  4KFM A;  1SC5 B;  3M99 B;  4U3J B;  4BIZ A;  5CA1 A;  5FNV A;  1Q3E A;  2X6B A;  4DV0 O;  2Y0I A;  1GN6 A;  3FYE B;  2N05 A;  3FAV A;  1OHH G;  2WLK A;  2HVJ C;  3JAW A;  4JAA A;  5B1B B;  4IHJ B;  1IXM A;  3CC2 V;  4C7U A;  2DOS A;  1XMQ B;  2F66 C;  4H0L B;  4J9Z B;  1UFI A;  3CSX A;  3ZHS A;  4P9P A;  4WFA V;  5KMG B;  4JAU A;  3SR2 C;  1SS3 A;  3ABL C;  3ZN0 A;  1YJ9 V;  1NS1 A;  3QVN A;  3LSS A;  1GN4 A;  4D7S A;  3EVK A;  3LSQ A;  2DQ0 A;  2BCC H;  1PNL A;  4G2K A;  2F43 G;  1GMG A;  2A7W A;  4DR2 B;  1NBM G;  3JD0 A;  1KUQ A;  4I0X B;  3HKD B;  2WLN A;  3P30 A;  3WB2 A;  3ZRW B;  2FB5 A;  3AEI A;  1W2B U;  2ZE7 A;  4DYL A;  2VQE B;  2H3O A;  3NXS A;  4WFG A;  2YC0 A;  3H01 A;  1JMK C;  4LF5 B;  3E2E A;  3SYO A;  3H9V A;  1FJG B;  4IGG A;  4YJ3 B;  5EK0 A;  3ZHU A;  1XMO B;  4JI6 O;  3IC9 A;  4ZOL B;  2Q7G A;  4CBC A;  1JPX A;  3T2M A;  1FYJ A;  4JAV A;  3L9D A;  1ORQ C;  5JCO A;  2CE4 A;  2QWQ B;  1DF4 A;  4MW8 A;  5LOV A;  4GKJ O;  3JSN A;  1GM9 A;  3D3I A;  5KX5 A;  4NXM B;  3AG4 C;  4XDL A;  4XDJ A;  1MAB G;  3ETG A;  1YTF B;  1S0V A;  1Q7Y W;  2AHZ A;  2WLJ A;  4H13 B;  1YJN V;  5IYZ B;  5CA0 A;  3LDC A;  3RYI B;  3CJH A;  4JYB A;  1D5N A;  4JV5 O;  2E76 B;  3GWO A;  4X1K A;  3ETD A;  3LNM B;  2EX3 A;  4PDR A;  2ZR2 A;  3AG4 B;  3F5T A;  2P22 C;  4JI5 B;  1V55 C;  3UQ8 A;  3N2K A;  1TVK A;  1ZUQ A;  4LFC O;  2NN4 A;  2Z0A A;  3OM3 B;  3N2G B;  2GSM B;  1XL4 A;  4O2A A;  4O4I A;  3L73 H;  4WBN B;  1N0J A;  2IBZ H;  4BWA A;  4DV2 O;  1HWY A;  3G6E V;  3CCS V;  3H1J H;  1AJQ A;  1OCZ B;  1VQ4 V;  4EFB A;  2BTO A;  1M1K W;  2M7W A;  2KKW A;  5L3G A;  4LF4 B;  1Y76 B;  3UKM A;  4DR7 B;  4Z1V A;  2F23 A;  3W7T A;  4LWS B;  1X4T A;  1VQP V;  4LFA O;  4UCT A;  1OZ0 A;  3SYC A;  4PA7 A;  2W6I G;  2BOB C;  4FVM A;  1QBZ A;  3E8G A;  3CCV V;  1ZTE A;  5IY5 C;  4DR4 B;  4LNU A;  4UB6 Z;  4I9W A;  2KG7 B;  4PJ0 Z;  4RAI A;  2ZXW C;  1VQK V;  4H44 B;  4PD4 F;  3ZHV A;  2Y48 A;  5EYP B;  2V4D A;  1V54 B;  1S3J A;  3DTU B;  3OGC C;  4J10 A;  2PYJ A;  1TUE B;  5IY5 B;  1G1X B;  1W0K G;  1XNQ B;  1SQG A;  5C93 A;  5JH7 B;  3K9S A;  4WFB V;  2YSU B;  3OTF A;  1S77 D;  2EIM C;  2W6J G;  2KSD A;  4BR6 A;  2WLI B;  5HFL A;  2P4V A;  1ZWI C;  1JJO A;  3QO7 A;  3BVO A;  3ABT A;  2CTR A;  4B7K A;  3E8B A;  4KXR A;  3P32 A;  1G6U A;  2WLL B;  1YF2 A;  5KLV H;  3STL C;  3CCL V;  2OIE A;  5IWA O;  2IM9 A;  3JAS B;  2F1M A;  3ML0 A;  1BQ0 A;  4QPK A;  4GX0 A;  3EHB B;  1VF7 A;  1S72 V;  1SA0 A;  2M6Y A;  3TCU A;  1RPR A;  4OGQ B;  1L1F A;  1XMO O;  3D36 A;  1FFT B;  3E83 A;  3WU2 Z;  2GTA A;  2XT9 A;  4QE9 A;  1SQX H;  1MMM A;  2FYU H;  4JI8 O;  4PDM A;  4KUM A;  3SDL A;  3MAQ A;  2UUA O;  3D3Q A;  1YSC A;  3R66 A;  2ATK C;  2IJH A;  4NXM O;  4I7Z B;  4O2B B;  1R1B A;  2YID A;  4DUZ O;  1BMF G;  1IDS A;  1L8D A;  3CRQ A;  3E86 A;  4AQY B;  4PDL A;  2LQT A;  5CA3 A;  2G38 A;  3A8T A;  1WPB A;  1MNG A;  5JQG B;  4YJ2 B;  5IJ0 A;  4ASU G;  3QF7 A;  1VQM V;  4PA6 A;  3RGB A;  2QM4 A;  5GTI Z;  4UCU A;  2HJF C;  3B77 A;  4FLX A;  2JJ2 G;  3KZI Z;  1Y66 A;  3ASO C;  1Y74 A;  4O4J B;  4DR5 O;  3SPJ A;  3FB7 C;  1NJI W;  1CP9 A;  1K8A W;  4LH7 A;  1GAX A;  4P9O A;  3JD3 A;  3W7W A;  1VQ7 V;  4AHC A;  2K9P A;  3UCS C;  4B3M O;  3AK2 A;  1XEQ A;  3TK1 A;  3AG3 C;  5CB4 B;  1KU9 A;  4E2L A;  5LBQ A;  3K59 A;  4H37 A;  2AHY A;  1CEZ A;  4JI4 B;  4AI8 A;  1JVM A;  2BTQ A;  2LP7 A;  5D5Q A;  4FIP C;  3OW2 U;  2UXD B;  1N0N A;  3OR7 C;  1H2L A;  3HR0 A;  2YIB A;  2JDI G;  3JAT A;  5LP6 A;  3HB3 B;  5BY1 A;  4BIO A;  1PPJ H;  3AG3 B;  2UXB B;  3L70 H;  2GHY A;  1QLE B;  2HEP A;  4FFB B;  3OTO B;  5L3B A;  4DR4 O;  4AIL C;  1WP7 A;  5IYD O;  4ZBM A;  3K57 A;  1NH2 B;  1S76 D;  1G8M A;  4CH5 A;  1RM1 C;  5L3F A;  4X65 O;  3DC6 A;  2VWK A;  2JS3 A;  2Z5U A;  5GON A;  4F6E A;  1XNQ O;  1FAF A;  2UUC O;  1GN2 A;  5LMU O;  2JGD B;  3BRC A;  3RBZ A;  2PZS A;  1F23 A;  4I4T A;  1KC8 W;  1N8R W;  1RM1 B;  2DYR C;  4FM0 A;  4DR3 O;  2KQX A;  2QR4 A;  3FKS G;  1IBM B;  2RCV A;  1YEW A;  1LUV A;  1B06 A;  4L87 A;  4JI0 B;  1M90 W;  1M9N A;  2OCH A;  1QQC A;  3VQV A;  1PNK A;  2B1G A;  2DYR B;  4LBE C;  1ENV A;  5JWP A;  4DV3 O;  3BA9 A;  3P3N A;  1GM7 A;  1GH6 A;  2EIN B;  1OCO B;  4EKW A;  2Q69 A;  3CCQ V;  2HJD A;  2O57 A;  4O4H B;  4Q6G A;  3JAR A;  4JYY A;  3EFF K;  3FB8 C;  2F4V B;  4NB5 A;  4EFE A;  3W7S A;  1EN4 A;  2N74 A;  4JYC A;  3ZMS A;  4YY3 B;  1IBL B;  5LYJ A;  2BOC C;  3MD0 A;  3K5N A;  1JA8 A;  3FB5 C;  3WG7 B;  1SET A;  2P67 A;  4ZHQ B;  5BZB A;  1SQP H;  4AQY O;  4DV7 B;  2QKC A;  4R50 A;  2PUS A;  2Q68 A;  1H2S B;  1QHT A;  1HR0 O;  3JD2 A;  1YIT V;  4I55 B;  4P30 A;  2EIJ C;  1Y6X A;  3LSU A;  2ZDI A;  2ITD C;  4JZ2 A;  3HKE B;  1J5E O;  1AIL A;  1WPX A;  4TWK A;  1OJH A;  2OIG A;  3O65 A;  2CGN A;  4LF8 B;  2Q5Z A;  2EIJ B;  3IC7 A;  1KMI Z;  3OGI B;  1WA8 A;  2YDE A;  1DLB A;  4UB8 Z;  3PN1 A;  2ILM A;  1Q81 W;  1PM9 A;  2QDO A;  1VAR A;  3RYC B;  2YI9 A;  2UUB O;  3K5O A;  1TAE A;  2JVD A;  3Q4H B;  1M4U A;  4LF6 B;  1IBK B;  2FKX A;  2IJI A;  3ETE A;  4YHH O;  4J7J A;  2EIK C;  3APQ A;  2QTO A;  4I5S A;  4F6R A;  4JI7 O;  1H8E G;  2IU3 A;  1I94 B;  1F4M A;  1BL8 A;  2CTP A;  3JAK B;  3F7Y C;  1P4R A;  4U3J A;  1Q6U A;  4TUY B;  2YXY A;  3K58 A;  5D5P A;  2YIB D;  2X0L A;  4PA4 A;  1DK1 A;  5KUK A;  4TV9 A;  4RO2 A;  1FKA O;  1FXK C;  1J95 A;  3T4D A;  4ICG A;  1IZ3 A;  2Y4U A;  3HPL C;  1VEW A;  2ZNJ A;  2OTJ V;  1HDJ A;  1R3J C;  2CDY A;  2ADP A;  3SPG A;  3CRR A;  1SRY A;  2JRI A;  2X7R B;  1BHB A;  4NVP A;  2R9R B;  5LA6 A;  4B3R B;  2YXL A;  5J2T A;  5B1B C;  2UXN A;  1BE3 H;  1RP3 B;  1S5H C;  3CPW U;  2E5L O;  2BE3 A;  3PJS K;  2F95 B;  1KYO F;  3TXQ A;  1WB7 A;  4X64 O;  4JI0 O;  3CHX A;  4J7Z A;  2Z3Y A;  2YS8 A;  4LC1 A;  4PDV A;  3T1Y O;  3HKB B;  4QPJ A;  2X6C A;  4FLU A;  2D3O W;  2V7Q G;  3HKC B;  4LF9 B;  4I0X A;  3HKD A;  4DV5 B;  4OX9 B;  4G28 B;  3B09 A;  3OMI B;  1XL6 A;  2YEV B;  1L0L H;  3OUS A;  1N34 B;  2Q7E A;  1H2N A;  4PV1 B;  4TV8 A;  3T1C A;  4X66 O;  1VQO V;  4YY3 O;  1IBL O;  3D8C A;  4YJ3 A;  3J80 N;  3G71 V;  2Q9L A;  4ZOL A;  3MHH C;  4RUF A;  5J2U B;  3CMA V;  4I9Q A;  1N33 B;  3WB0 A;  2IH1 C;  1ZLZ A;  5H9C A;  1I0H A;  4LF7 O;  5CA1 B;  5FNV B;  1Q5O A;  1SQB H;  4JI2 B;  3M8A A;  2LW7 A;  4W4L A;  4J80 A;  5EZY B;  5ITZ B;  5LMN B;  4WF9 V;  3KKY A;  1TA8 A;  3SJA C;  4LF8 O;  1HW7 A;  3RVZ A;  4MVQ A;  5LXT A;  4B3S B;  4JGS A;  4IIJ B;  1N32 O;  3R65 A;  3RYI A;  2R70 A;  1I08 A;  1WLE A;  2WPD G;  4NXN B;  2KB1 A;  3QO8 A;  3BPZ A;  1K5Q A;  2ZM6 O;  2RNB A;  4TQD A;  2ZE5 A;  5BR8 O;  1SER A;  2RDC A;  2IH3 C;  1M5I A;  1Q90 D;  4WBN A;  1BGY H;  4ZKI A;  2LO1 A;  4MTG A;  2YIA A;  2EZP A;  2R9A A;  5LGU A;  3F5W C;  4FMT A;  3ZHR A;  1W0J G;  5K1X A;  1SQF A;  4DK1 A;  4LFB O;  1Y76 A;  4MVR A;  3ETQ A;  2P5O A;  3LNN A;  5KUM A;  2ZCE A;  1U97 A;  2AZ0 A;  5BXZ A;  4LWS A;  1K73 W;  1OCZ C;  1P84 F;  1Z5W A;  2XAS A;  4GCZ A;  4DUY B;  1HNX B;  4PI0 A;  1I7F A;  2QWP B;  5F2V O;  2Q7H A;  4MS2 A;  2JJ1 G;  1EZV H;  5JVD A;  2LFR A;  4RWU A;  4JI3 B;  2B9Z A;  1BCC H;  3CCM V;  3JAL B;  3STZ C;  3CYO A;  5LOV B;  4DR1 B;  4D6T H;  4JI1 O;  3ZX6 A;  2JEX A;  3ABU A;  4LP8 A;  1K92 A;  1F51 A;  5KX5 B;  5IJ9 B;  3CWB H;  5LL6 Y;  2WLM A;  5EYP A;  1BZK A;  1PL0 A;  1SES A;  3CME V;  5IT9 N;  2PTM A;  3FYI B;  4U7N A;  4DV1 B;  4J42 A;  5CA0 B;  5JH7 A;  1FS0 G;  4CS2 A;  4JZG A;  5KHK A;  1AJP A;  2WLH A;  1QVF U;  4X1K B;  1YHQ V;  1V54 C;  2D2C B;  4JTC B;  5L3C A;  4KHP B;  1XMQ O;  4K0K B;  1GM8 A;  5GTH Z;  3W7X A;  3H1I H;  2XAQ A;  5K1P A;  1WAZ A;  3WB1 A;  1JJ2 U;  2E75 B;  4QNH B;  3ZS8 C;  3K5L A;  1TVK B;  2P4K A;  5BMV A;  5KHJ A;  3ABM C;  3E22 A;  3B8M A;  2ZD9 A;  2BSK B;  4MTF A;  5B66 Z;  4QE7 A;  2CUG A;  1QCE A;  1ARO P;  1EBO A;  1IXB A;  4U7O A;  2PI5 A;  4O4I B;  1QR9 A;  5C8Y B;  2HHH B;  1AI5 A;  1WJZ A;  4HBN A;  3BY6 A;  3ABK C;  3ABM B;  4Z2W A;  3RVY A;  2X6A A;  2DJV A;  4JPR A;  4UCR A;  3A0R A;  1WNS A;  4LR3 A;  1N33 O;  4DR2 O;  3IGA C;  5IYC O;  1Q86 W;  4NKG B;  4JI2 O;  2QSA A;  2WA4 A;  2VQE O;  3K06 A;  3ABK B;  1TUB B;  2GBO A;  4LF5 O;  4ZI7 B;  2ODM A;  1FJG O;  1KP3 A;  3UT5 A;  3A0B Z;  5H5N A;  4UVC A;  3JD4 A;  3ZJZ A;  3E35 A;  4UFZ A;  3CD6 V;  5B1A C;  4GX2 A;  2EJR A;  5EBM C;  3G67 A;  4FLV A;  2UU9 B;  1VQ8 V;  3LDE A;  5JJE B;  1YTF D;  2JGU A;  2A06 H; 
#chains in the Genus database with same CATH homology
 1Y6X A;  3CRC A;  2Q4P A;  1YVW A;  2P06 A;  2GTA A;  1YXB A;  2OIG A;  2Q5Z A;  3C90 A;  5IE9 A;  4QGP A;  2A3Q A;  2Q9L A;  2YXH A;  2Q73 A;  2OIE A;  2A7W A;  1VMG A;  3CRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...