2A3QA

X-ray structure of protein from mus musculus mm.29898
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
113
structure length
113
Chain Sequence
PFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHVDLPQAVISKMDTNRQRYPVHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structure of Protein from Mus Musculus MM.29898
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
total genus 33
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2005-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12643 MazG-like MazG-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1080 Mainly Alpha Orthogonal Bundle Helix Hairpins MazG-like 2a3qA00
4QGPA 2Q5ZA 2GTAA 2Q4PA 2A7WA 2OIEA 1VMGA 3C90A 2A3QA 3CRCA 2OIGA 1Y6XA 3CRAA 2P06A 1YVWA 2Q9LA 1YXBA 2Q73A 5IE9A 2YXHA
chains in the Genus database with same CATH superfamily
2CH7B 1O9HA 2VRZA 3PN1A 3Q4HA 1KYOF 3OW2U 5CA1B 3CC4V 2P67A 1WLEA 5KMGB 4DR6O 3DC5A 4AQYB 5IWAB 3EHBB 2GUZB 2DE0X 2BCCH 2PYJA 1HR0O 3H1JH 4NYKA 4L8JA 1M57B 3CJHA 1HNWO 1M56B 4HAMA 5KHHA 4H44B 4UB6Z 3DSQA 4J42A 2Q6AA 4YIOA 4JI5B 1BT8A 2CE4A 4U7OA 1VQOV 1UFIA 5LYJA 1NR1A 2R70A 4DV0O 4A5UB 4UFZA 3FB6C 3E35A 3E8HA 4LF9B 1JA8A 3QO5A 3CRCA 3LDEA 4H33A 4ZHQB 5CB4B 5FLXN 3ETDA 4MVMA 5GW7A 3T4DA 1Q81W 2P22C 1S76D 2HJFC 1Y67A 3MAQA 5DN6G 4AI8A 4YY3O 2Q7HA 4X1YA 2ZT9B 3FAVA 4TV8B 2Q9LA 3C3TA 1DF4A 2EX3A 3WU2Z 2UXBO 1Y66A 2F4VO 3T2MA 2IH3C 2CDYA 4R8CA 3D36A 5CA1A 1IBMB 2Z3YA 1KECA 4RWUA 2R9RB 4O4IA 4DR2B 2YIBA 3OD4A 3QO7A 2YXHA 4J9ZB 4WF9V 4WBNB 2CUGA 4TT3G 4QE7A 3JAWB 1HP8A 5LMNO 2BOCC 4I0XA 2XUMA 3D3QA 4IHJA 5JH7B 4RUFA 3CCSV 2UXNA 2O57A 1OZ0A 3EVKA 1NVPD 3ZRWB 2YI9A 4TQFA 3M8AA 4IL6Z 3E8GA 2X7RB 2DQ3A 1MZEA 5LA6A 3OGIB 3W7WA 4L87A 5KUMA 3CE2A 3ZHQA 1OCCB 3SJBC 5EYPA 1U97A 4EFBA 4JI7O 3FX7A 4LR3A 2ZIOA 5CBHA 2UXBB 1NBMG 1GH6A 1LUVA 2ZKOA 5CA0B 4E2LA 2QE7G 4UCRA 4JV5B 3O65A 3UO3A 1R73A 1XNRB 2FB5A 3LDDA 2M6YA 1JVMA 4O4JB 1IBLO 1MMMA 4B3MO 1XNQO 2OTLV 4BW9A 2GSMB 4DR3B 3L72H 1F4NA 1DLBA 2QWPB 5A2QN 3E22A 3ABLB 3IC9A 3KCYA 1I94B 2OWOA 3G4SV 3OT7A 5L3DA 1PNLA 3VOUA 4DV0B 3SYOA 2R9AA 2NNUA 3CCQV 2UUAO 3OMIB 3P32A 1HNXO 2UXCB 1VP7A 4QPKA 3AG3C 1FXVA 4YJ3A 1PV0A 1R6KA 3ZHUA 1XILA 3K5MA 1BCCH 2JS3A 4MS2A 4PV1B 5JJJB 2HFEC 5K1PA 3ZRVA 4DV1O 1R3LC 2XAJA 3PJSK 1RSOA 4FZ1A 4IGGA 2IJKA 4D7TA 1TVKA 2XHBA 5BR8B 4X20A 4WFAV 1FAFA 1PNKA 4PDMA 1PKXA 2YC0A 2IJHA 2V1DA 5B1AC 1FFXA 5KLVH 5EC2C 3ICXA 4F6RA 3CC2V 1H8HG 2ADQB 2LJ2A 4B7KA 1R6TA 3ZN1A 3T1YB 2YIDA 2H94A 5LHIA 2YI8A 3ABTA 4TWKA 1IVSA 1SS3A 3UT5B 3OUFA 4JYYA 1GMGA 2CTPA 3K03A 5KHGA 4X1IB 4LFBB 2Q73A 4FLWA 3AG4B 1SRYA 1AI4A 4K8XA 3RYCA 4RQEA 5IE9A 4JI0B 2A3QA 5JCOC 1AR4A 4DYLA 1NQTA 4GKJO 1TGOA 4IYHA 2DMXA 2B1GA 1QLEB 3QO8A 3AG2C 2CK3G 3SGIA 1B3QA 3E8BA 4JI3B 4JZ2A 3I55V 3K58A 3K08A 3WB1A 1EM1A 1SESA 2KG7A 1YVWA 3I5DA 5DM6V 1PL4A 4PA7A 4EKWA 3BFRA 3CRAA 3CRRA 3RYIA 1ORQC 4PD4F 1NT2B 2BTQA 4J7ZA 3OR6C 5JCOA 1IZ3A 2XTAA 4J7JA 2Q67A 1SC5B 1VMGA 1SF9A 1YSCA 4LNUA 1IBLB 3JATA 4X1IA 1IXMA 2LP7A 4YHHB 4JZGA 3THOA 2Q69A 3KCXA 4MTFA 3SPHA 2W6JG 1THZA 2PZSA 4EB6B 2UUBO 4NXNO 4IYIA 3VBBA 2XT9A 2ZQMA 5LMUO 2HVJC 4O4JA 1SKVA 2HG5C 2CAZC 4X64O 1N0NA 4CS3A 1WB8A 2RMKB 2HHHO 3M99B 3JAWA 4J10A 2LGWA 2F1MA 2OTJV 2GTAA 1P7BA 5AG2A 2A0LA 4JI2B 2ADPA 4RUEA 1VEWA 4ASUG 5J9PC 4JI4O 1KU9A 1SQXH 3ZRWA 4MVZA 4QJFB 1AB3A 5IYCO 3RYHA 4QNHB 4K0KO 4YIPA 3E2EA 1CXZB 4X89A 2OCCC 5LA6B 3CS5A 2F95B 3CWBH 4B3SO 1SA0B 5KAIZ 4DW1A 4MTXA 4JI6B 1JCHA 4X64B 1VF5B 4B3MB 2OYQA 1XNQB 2Q7GA 2YXYA 2Q0AA 5E1AC 2Y69B 4LF4B 5DECA 2JEUA 4KP4A 4UV9A 1YZBA 1G8MA 4PA6A 3WG7C 5J2UB 3CXHF 4ZI7B 3LNNA 2BTQB 2GV9A 1H8EG 4IIJA 5IJ0A 3GWOA 2PUSA 3B09A 5BZBA 5KX5B 5LYJB 2HR3A 4JI7B 1Y76B 1BE3H 2A79B 3M7MX 3SPJA 3P3NA 1O9GA 3JALA 5KHIA 1VQLV 4KHPB 5EIBD 3RYFA 3L70H 1KC8W 4GLXA 4GZRB 3FB5C 1WAZA 2YIAA 4JI3O 1U96A 3VQXA 3BCCH 2UUCB 1AJPA 1JR9A 3ZMUA 5K1XA 1AJNA 1HNXB 5EIBC 1GO3F 1NI8A 1G4YB 5KA6A 2Y4UA 1Q6HA 2XNDG 4NTWA 1FXKA 1NH2B 1VQ4V 2YSUB 2ZE7A 4DO2A 4X8AA 4JAAA 2ZE6A 2HEPA 1S5JA 3GB7C 1GM8A 3OM3B 4KFMA 4LH7A 4HNAB 1NJIW 3RWRD 4DV7O 5BY1A 4P9PA 3ML0A 1MOFA 2YEVA 4CH5A 1XNRO 1SZTA 2UU9O 1NTZH 4DV4B 1K34A 1BQ0A 5BXZA 2YIBD 3K3WA 4JI6O 2QTOA 4NKGB 5FPRA 4X66O 3JD4A 1PM9A 2NN4A 3L74H 4J41A 2MK3A 1OCRB 4QIWF 1H2LA 2VQEO 4WFBV 1BMFG 2LW1A 3K0DA 1G6UA 2NLJC 4FJCC 4MVUA 1QR9A 3FYEB 4KL1A 4BAYA 4JI4B 1Q6IA 2W6IG 1QVGU 3B2EE 1XHZA 4TUYB 4EB6A 4FIPC 5F2VO 1UPGA 2WLIB 1RSOB 4JF3A 3UT5A 1IBKB 4Q20A 4N23A 2X0LA 4DXWA 3VQYA 5JVDB 4DK1A 3JSNA 1YDXA 1N8RW 1IBMO 3H1IH 4P30A 3HKEA 5JWPA 2YEVB 4MW3A 3ZN0A 1R3IC 5B3SB 3S3WA 1FD9A 2ETNA 4R50A 3VQVA 2H3OA 3AK2A 3RFRA 2DYSC 2P90A 3FB7C 1Y6XA 2N04A 2RN9A 2CGOA 3ASNC 2EIKB 2WLKA 1S3JA 4H37A 2IW5A 3K06A 1RM1C 4U3JB 3N2KA 3AG3B 3RYIB 4ZOLB 1RM1B 3FD9A 1GN4A 1SQFA 2B1IA 2EIJC 4NR1A 1Y74B 4XDKA 3IAYA 2EIMB 2E3CA 5EBWC 1B04A 3E8FA 1UJWB 1OCOC 4KHPO 3SDLA 4B3RO 4FM0A 2VS0A 3LSUA 3R66A 4GUNA 4PDLA 4UCTA 2XAQA 1I5XA 3CCRV 4B3TO 1GN3A 3ZRSA 4UVAA 2DYRC 2NR5A 1TAEA 3BPZA 3C90A 1WP8A 4DV5O 4XDLA 1V54B 3T1YO 3DGEA 4I9QA 4PI0A 3JASA 5HFLA 2JGDB 2X6BA 3OFNG 1R1BA 1WP7A 2ZDIA 3IFXA 3HR0A 1QR8A 4UCOA 3U11A 1LUWA 1H2KA 3RYHB 5J2TA 5LL6Y 5CB4A 3BY6A 2ZIMA 1LR1A 2CTRA 4W4LA 5CA3A 4B3SB 3LNMB 1RFYA 2HP8A 3CCEV 3APQA 1QHTA 2F43G 3IC7A 1HW7A 2LO1A 1RPOA 1F51A 3F7VC 1G1XB 2LFSA 2UUAB 3RBZA 1HNWB 1M1KW 3IJ4A 3UKMA 2L35A 3A0BZ 1W0JG 3K0GA 2VWKA 4FLTA 4XDJA 3S3XA 3CXCU 2HHHB 4O4IB 1Q7YW 3ZRXA 2Q68A 1OCZC 2CTWA 2HLDG 1IBKO 3CCVV 1AR1B 3JARB 1XREA 3B8MA 3GVMA 3ZMVA 4QE9A 2UUBB 3L9DA 1Y76A 4U7NA 2EULA 3RT3C 2EILB 1SZXA 3ZHTA 4YHHO 3CCJV 4J7KA 2JEXA 4WFFA 3QVNA 1WNSA 3ZS8C 2PTMA 1HDJA 2OT5A 3F7YC 2WLLB 2Q7EA 4F6EA 1SQPH 3CRQA 1NZ6A 1BQZA 1PP9H 4DV6O 3D8CA 4FM2A 4AILC 2V7QG 3MD0A 5GTIZ 3TCUA 3TXQA 2XOKG 4I4TA 3SR2C 1K7DA 4ZBMA 4ZIBA 3STZC 2E74B 4B7EA 1K4DC 4DUZB 4TOIA 2F23A 3B4SA 2GDSA 5LHHA 5B1OA 4X1KB 1BHAA 1ZAUA 4QPJA 1X59A 4CBCA 3W7TA 2QA4V 3GWKC 1KP3A 4CZZA 4FFBA 4Q6GA 1OCOB 1VQMV 3BA9A 4NXMB 4I50A 1W59A 3E89A 5EZYB 4PHZA 4ABMA 1DF5A 1ENVA 5B3SC 2RJZA 3CP1A 5E79Z 1SETA 4LF8O 2ZM6O 1HWYA 4F4LA 3ABMB 3IGAC 2P4KA 4Z1MG 4BW5A 1Q86W 1R6NA 4CS2A 5L3EA 1J95A 2FTKA 2R9IA 4LCUC 5BMVA 4DR1O 2GUZA 5KUKA 3W7XA 3K9SA 1QQCA 3OEEG 1M4UA 1ZLZA 2FKXA 1S77D 3H01A 1IDSA 4CS4A 1A32A 3UQ8A 1AI6A 5D5PA 3Q4HB 3K79A 3ABUA 5IDJA 2FMLA 5IYBO 1SA0A 4W4KA 5IJ9B 5LHGA 4NTXA 4FLYA 1N34B 1FJGB 2E75B 4X88A 1TUBB 1AP5A 1N33B 5LOVB 5IYZB 4NTYA 2Z5UA 4B08A 2Q8VA 3HKCA 1K9MW 5B1BB 3TXSA 5FPOA 1HNZB 4J11A 5IY5B 1M56C 4UVCA 1I94O 2IH1C 1E1QG 2ITCC 1Q82W 4N21A 2WLIA 2VQFB 1QVFU 1F4MA 4C7UA 5IYDO 4O2BB 1VARA 5IWAO 4CC5A 2YICA 4CH6A 3K5NA 3J7AU 4J9YB 1VQ7V 3JARA 4O4HB 4YXWG 2EINC 4LFCB 2XAHA 4MVSA 2Y69C 1JX9A 1I08A 2IU0A 3OMNB 1SQVH 3W7UA 1JPXA 4ZOLA 5EZYA 5LGUA 4TV9A 4FFKA 4Z1VA 2WWWA 1H2NA 2E76B 1YXBA 3R65A 3NXSA 1FXHA 1AP6A 4LP8A 4G28B 1YTFD 2DQ0A 3ZEDA 5HFMA 3F5TA 3HKDA 1GM7A 1EZVH 1M90W 5IT9N 2IU3A 1L8DA 5BMVB 2X6AA 2UXDO 1XEQA 4OX9O 4GCZA 1K73W 1KB9F 2ZNIA 2CTQA 2DYSB 2RCVA 2GTSA 2JVDA 2PY5A 1TA8A 2X6CA 3AG7A 1K92A 3D3IA 3SYCA 1X4TA 4DV5B 3OAAG 2EIMC 5FL7G 2LQTA 4WBNA 3CJHB 2VQFO 1H38A 4OGQB 1L0NH 2LW7A 2JGDA 1P49A 4HYOA 4CH4A 1CP9A 3MHHC 4LWSB 4B3RB 4DV3B 4LBEC 1WN7A 3B77A 4UV8A 3ZMZA 2F4VB 1AVMA 4BIUA 3A8TA 1WA8A 4JTCB 4AHCA 1US6A 1J5EO 2PF4E 1JFFA 3CMEV 4ZKIA 4JYAO 4FLVA 4RO2A 3UO2A 3LDCA 4ZHQA 1ZSPA 2KB1A 4PA3A 1NTKH 4X65B 4LF6O 4DK0A 1I5YA 4YJ2B 2G38A 3H1KH 3NR7A 3JAKA 1PNMA 2QWOB 3CEIA 2P4VA 3JD3A 2RDCA 4JI0O 3ASNB 4LF9O 1JJOA 4LF6B 3A0RA 3OE7G 1JJ2U 2AW9A 3C3SA 2QKCA 2W0XA 3SPGA 4OXSA 1VQ9V 4MVOA 4LF8B 3LSSA 3KZIZ 3CHXA 1ZTEA 3L71H 4BIOA 1YJNV 4X1KA 5H6QA 1BGYH 4DR5O 5KHKA 4PELA 5B1NA 1KKDA 3ETGA 2EJ7A 3BABA 3BAAA 3ZMTA 1BHBA 4WFHA 1V55C 3U0ZA 3CMAV 4WFEA 3TETA 1K4CC 4O4LB 3RYFB 4TSFG 2BTOA 4PA9A 2EZPA 4O2AB 2QM8A 4LF5O 1YJ9V 4JASA 4DUZO 4DR7B 5H2FZ 1KUQA 2Y0IA 2DOSA 2QWNB 3STLC 3RVZA 2QDOA 1VF7A 1YEWA 3AK1A 5ITZB 1QLNA 2FL4A 1VQ5V 4LH6A 3JCZA 2R72A 1S5LZ 1R3JC 1GTOA 2DWDC 1WJZA 1AI7A 3CSXA 3I56V 3QF7A 2K1EA 1XL4A 2ZR3A 1N32O 2ZD9A 4MVQA 4PI2A 1Y4MA 5JJEB 3RN4A 2BSKB 3WB2A 2UU9B 3E22B 4FFBB 4I55B 4GT1A 1VQKV 1XMOO 4EFEA 1EFRG 3SPCA 2ARHA 3LSQA 2JRIA 3SYAA 3OTOB 2M7WA 3J81N 2ODMA 4R6ZA 1IXBA 1J5EB 5IJ9A 1MG1A 3G80A 4DRXA 1GKFA 1OCRC 4LF7O 1DTOA 1YITV 4RAIA 1I0HA 2OCCB 4HNAA 3RGBA 5CBFA 4NXMO 3B8NA 1QCEA 2DN9A 3DXRB 4JTAB 4LF7B 4G2KA 2JDIG 1FYJA 4HBNA 5JJNB 3ETEA 3P3PA 2EJRA 3F5WC 1JFFB 1VF6C 1OV9A 5J2TB 3OMAB 1FPOA 4BR6A 5L3FA 1E1RG 4GX5A 4O2BA 1W2BU 3MHSC 4X66B 3HPLC 3E83A 1XDCA 2C2AA 5C8YB 5KA5A 1F23A 1OCCC 2Y48A 2Q4PA 4O4HA 4LNUB 3AG1C 1BL8A 1EN4A 1V54C 2KKWA 1N32B 3E86A 2YUAA 4JGSA 2ZCEA 1M9NA 1W0KG 2EIJB 3K5LA 4NB5A 2OCHA 2WLJA 1L0LH 3X2QC 2HJDA 2AHZA 3TJTA 4JYCA 3G6BA 1VQ6V 3SJCC 4G27B 4B3TB 1NR7A 4CH3A 2QKSA 3BA8A 3UM7A 4DV3O 3ABLC 2KQXA 1XOUA 3SPIA 4BWAA 3CRMA 1Q8IA 4DR7O 1N4CA 4I55A 2L6LA 1AJQA 1YCIA 3BRCA 2K9PA 2RNBA 4I9WA 5IY5C 5BR8O 3ASOC 5C93A 2E5LO 2QTSA 3HKBA 4NVPA 1OHHG 1SQQH 3CYOA 4DV1B 3HKDB 2QSAA 3ZJZA 4F6RB 4DW0A 4CC6A 1GRJA 4FZ0A 5KX5A 3LUTB 1XUQA 4DR5B 3CD6V 5C8YA 3ZHVA 1OCZB 4DV2O 4OX9B 5EYPB 1BS3A 1JQ0A 1K97A 4K35A 1SQBH 1FXKC 3K57A 4D7SA 3H9VA 1XBLA 4JAUA 3WG7B 3BVOA 3JATB 1ZL8A 2LFRA 4UXNA 3U10A 1P4RA 3JAMN 3K5OA 2DWEC 3K9AA 1JMKC 2JS5A 4AQYO 3N27A 5LMUB 4IIJB 5IJ0B 2N74A 1Z2GA 1NKDA 1FFTB 3CCLV 4E4EA 4DV7B 4JPRA 5A9GA 1XMQB 2P6JA 5IYZA 3T1HB 4K8ZA 3H1HH 2ZM6B 5FNVB 2QWQB 3OUSA 4YJ2A 2WLNA 4DR4B 4JI1B 4K3AA 3G71V 3ABKB 1FKAO 2P5OA 4PJ0Z 1S5HC 1N33O 2EBOA 4UB8Z 5LGNA 3HKBB 3JD1A 2W0FC 2VQEB 4X20B 1WB7A 4D6TH 1IURA 4UCVA 5LMNB 1PL0A 3A2FA 4HZ3A 3APOA 1DK1A 4I5SA 1NTMH 5GONA 4ZI7A 2AZ0A 5EBMC 5D5QA 1P84F 3ZIAG 1YJWV 2B5UA 3O9OA 3JYCA 3ZX6A 4DV6B 2UXDB 3CX5F 2ZINA 1ZX3A 3FFQA 5B5EZ 5L3GA 3L73H 1KD1W 1ZL8B 4LWSA 2F93B 3OGCC 5TISZ 4LFBO 2A06H 5JQGA 1H2MA 4GX2A 4FLXA 3AG4C 4TV9B 3WB0A 3P30A 5FNVA 4TUYA 4YY3B 4QGPA 1YIJV 1JOYA 1AROP 3K04A 2P06A 1QNMA 5LXTA 5KMGA 1N36B 3DXRA 5LP6B 4JI1O 1D2DA 2ILMA 1KP2A 1DGSA 4Z2WA 3SJQC 3ZMSA 2PI5A 3ZBHA 1MABG 3K59A 2KG7B 3JALB 4UCUA 3B40A 3W7SA 3J80N 2KSDA 2F66C 4EEQA 3DTUB 2AHYA 2V4DA 2WLLA 3CPWU 1XI1A 1S0VA 4GX1A 4GKJB 3JD2A 4JTDB 2UXCO 1EZJA 2YXLA 1RPRA 3AG1B 2XAFA 2XAGA 4FM1A 1FS0G 3FB8C 4TV8A 2YDEA 3HKEB 2Q0OC 4U3JA 2CGNA 5CMUA 4LFAO 1CPYA 1HR0B 1SERA 1K5QA 2D3OW 3N2GA 3T4ZA 4DUYO 4WFGA 3D36C 3SYQA 1IX9A 4DR6B 1Y74A 3BHPA 5L3BA 5CN0A 2CH7A 2ZE8A 4DV2B 1MNGA 4DR1B 2WA3A 2ZDIC 3RVYA 4P2ZA 1B6QA 1Q3EA 1YI2V 1Z5WA 1K33A 4LF5B 2GBOA 3RW0A 1V55B 1GK9A 5CA0A 3RYCB 2E5LB 1MSDA 2ITDC 4LC1A 2PYLA 1M93A 1Q5OA 5LBQA 2N05A 4GKKO 2EIKC 4PDVA 4O4LA 2XASA 3ASOB 1YHQV 1HNZO 3JSLA 2MW2B 1K5SA 4X62B 3QTCA 4UUJC 1N36O 1EN6A 4MW8A 2Y4TA 1EN5A 1COWG 1QBZA 4MTOA 3JCUZ 1QLEC 2Q5ZA 3SYPA 3UCSC 4IHJB 5JH7A 2IJJA 1D5AA 5LOVA 2UUCO 5JVDA 1PPJH 4MSWC 4OPAA 2WSSG 2QJ1A 1MZFA 1I7FA 1D5NA 4GX0A 1AR5A 5ITZA 4FMTA 1PD3A 3G67A 1EBOA 2JK5C 2EINB 1Q90D 1VQPV 2BOBC 2DYRB 1GM9A 5KAFZ 2A7WA 4JYBA 1GN6A 4JV5O 1VIBA 1MA1A 2HVKC 1GN2A 4MTGA 2ATKC 1VF6A 3QG5A 2DJVA 2ZXWC 3N2KB 1TUEB 2IJIA 4R7CA 3CCUV 1F7YA 2HKOA 2PI4A 1FFXB 1RP3B 1XL6A 3X2QB 1KMIZ 4KUMA 2P7TC 1AILA 4LFCO 1BZKA 5L3CA 4H13B 3FAVB 4U3FH 3AG2B 2GHYA 3FKSG 3T1HO 4RQFA 2QM4A 1XMQO 3OTOO 1QU7A 2OIGA 1R3KC 3KKYA 1KQSU 1XMOB 1L1FA 3SJAC 1Z5VA 2VWJA 1K8AW 4FPPA 1P7GA 1CEZA 4UVBA 4TQDA 1N34O 1FJGO 3G6EV 3ZCCA 2JJ1G 3OEHG 3AEIA 2WLHA 1N0JA 3AK3A 1SQGA 5GTHZ 5LXTB 4FLZA 2ZE5A 1KKCA 2RQ6A 3FYIB 3ZHSA 1Q6UA 4UCSA 5EC1C 1LNQA 2WLMA 2QEXV 5KHJA 2ZXWB 2AGAA 1VQNV 5B1AB 4ICGA 2B9ZA 4X1YB 5LP6A 3EFFK 3VQWA 3H1LH 2ZR2A 3L75H 2DW4A 4I0XB 3JAKB 2AXTZ 4FK5C 1NVPB 4DUYB 5B1BC 4PA4A 4OPHA 1M57C 2AZ2A 2UXXA 1S72V 4LFAB 5JQGB 2WPDG 1M5IA 5H5NA 4WCEV 1URFA 4JI5O 1KBHA 2JJ2G 3ABKC 2JIZG 1T5EA 1TUBA 1BSMA 2QGNA 3A0HZ 2QKAA 2H8PC 3JASB 4I50B 1FXKB 4IT5A 5H9CA 2LGQA 4KXRA 3CC7V 4FLUA 3WFVA 3OTFA 2Z0AA 1WPXA 1ROPA 4DV4O 2WA4A 4JAVA 1H2SB 2FYUH 4NXNB 1XQ8A 1E79G 1B06A 2JGUA 3ABMC 2ZNJA 2WAMA 4X65O 3TK1A 1NU1H 2QM7A 3HB3B 2BE3A 5EK0A 4BIZA 4MVRA 1GAXA 4JYAB 3DC6A 3ZHRA 1MSWD 4I7ZB 4JI8O 3CCMV 3ETQA 3EXAA 3N2GB 4YJ3B 1ZWIC 4O2AA 1V9PA 4J80A 1K3EA 2QWRB 5B66Z 1XHXA 5LP6C 3BEHA 3KG2A 4H0LB 1H2GA 4LF4O 2QR4A 4DRXB 1TVKB 2BSKA 5DEDA 4FVMA 4MT8A 1NH2D 5J2UA 2PGGA 2A9HA 3HKCB 3TGUH 1NS1A 5H6RA 4PDRA 5CBGA 4K0KB 2YS8A 3QNEA 1WPBA 4X9QA 4DR2O 1VQ8V 5GONB 2EZOA 2IM9A 1OJHA 3CB2A 4GYCB 3OR7C 5LGTA 1Q43A 1ZUQA 1YTFB 1AI5A 2OIEA 4X62O 4JI2O 1YF2A 4DR4O 3JD0A 4P9OA 4JI8B 4XBFA 1WA8B 4DR3O 2Y0PA 4GKKB 2EILC 3MDSA 2D2CB 5EBLC 4I4TB 2IBZH 3T1CA
chains in the Genus database with same CATH topology
4QGPA 2Q5ZA 2GTAA 2Q4PA 2A7WA 2OIEA 1VMGA 3C90A 2A3QA 3CRCA 2OIGA 1Y6XA 3CRAA 2P06A 1YVWA 2Q9LA 1YXBA 2Q73A 5IE9A 2YXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QGP A;  2Q5Z A;  2GTA A;  2Q4P A;  2A7W A;  2OIE A;  1VMG A;  3C90 A;  2A3Q A;  3CRC A;  2OIG A;  1Y6X A;  3CRA A;  2P06 A;  1YVW A;  2Q9L A;  1YXB A;  2Q73 A;  5IE9 A;  2YXH A; 
#chains in the Genus database with same CATH topology
 2CH7 B;  1O9H A;  2VRZ A;  3PN1 A;  3Q4H A;  1KYO F;  3OW2 U;  5CA1 B;  3CC4 V;  2P67 A;  1WLE A;  5KMG B;  4DR6 O;  3DC5 A;  4AQY B;  5IWA B;  3EHB B;  2GUZ B;  2DE0 X;  2BCC H;  2PYJ A;  1HR0 O;  3H1J H;  4NYK A;  4L8J A;  1M57 B;  3CJH A;  1HNW O;  1M56 B;  4HAM A;  5KHH A;  4H44 B;  4UB6 Z;  3DSQ A;  4J42 A;  2Q6A A;  4YIO A;  4JI5 B;  1BT8 A;  2CE4 A;  4U7O A;  1VQO V;  1UFI A;  5LYJ A;  1NR1 A;  2R70 A;  4DV0 O;  4A5U B;  4UFZ A;  3FB6 C;  3E35 A;  3E8H A;  4LF9 B;  1JA8 A;  3QO5 A;  3CRC A;  3LDE A;  4H33 A;  4ZHQ B;  5CB4 B;  5FLX N;  3ETD A;  4MVM A;  5GW7 A;  3T4D A;  1Q81 W;  2P22 C;  1S76 D;  2HJF C;  1Y67 A;  3MAQ A;  5DN6 G;  4AI8 A;  4YY3 O;  2Q7H A;  4X1Y A;  2ZT9 B;  3FAV A;  4TV8 B;  2Q9L A;  3C3T A;  1DF4 A;  2EX3 A;  3WU2 Z;  2UXB O;  1Y66 A;  2F4V O;  3T2M A;  2IH3 C;  2CDY A;  4R8C A;  3D36 A;  5CA1 A;  1IBM B;  2Z3Y A;  1KEC A;  4RWU A;  2R9R B;  4O4I A;  4DR2 B;  2YIB A;  3OD4 A;  3QO7 A;  2YXH A;  4J9Z B;  4WF9 V;  4WBN B;  2CUG A;  4TT3 G;  4QE7 A;  3JAW B;  1HP8 A;  5LMN O;  2BOC C;  4I0X A;  2XUM A;  3D3Q A;  4IHJ A;  5JH7 B;  4RUF A;  3CCS V;  2UXN A;  2O57 A;  1OZ0 A;  3EVK A;  1NVP D;  3ZRW B;  2YI9 A;  4TQF A;  3M8A A;  4IL6 Z;  3E8G A;  2X7R B;  2DQ3 A;  1MZE A;  5LA6 A;  3OGI B;  3W7W A;  4L87 A;  5KUM A;  3CE2 A;  3ZHQ A;  1OCC B;  3SJB C;  5EYP A;  1U97 A;  4EFB A;  4JI7 O;  3FX7 A;  4LR3 A;  2ZIO A;  5CBH A;  2UXB B;  1NBM G;  1GH6 A;  1LUV A;  2ZKO A;  5CA0 B;  4E2L A;  2QE7 G;  4UCR A;  4JV5 B;  3O65 A;  3UO3 A;  1R73 A;  1XNR B;  2FB5 A;  3LDD A;  2M6Y A;  1JVM A;  4O4J B;  1IBL O;  1MMM A;  4B3M O;  1XNQ O;  2OTL V;  4BW9 A;  2GSM B;  4DR3 B;  3L72 H;  1F4N A;  1DLB A;  2QWP B;  5A2Q N;  3E22 A;  3ABL B;  3IC9 A;  3KCY A;  1I94 B;  2OWO A;  3G4S V;  3OT7 A;  5L3D A;  1PNL A;  3VOU A;  4DV0 B;  3SYO A;  2R9A A;  2NNU A;  3CCQ V;  2UUA O;  3OMI B;  3P32 A;  1HNX O;  2UXC B;  1VP7 A;  4QPK A;  3AG3 C;  1FXV A;  4YJ3 A;  1PV0 A;  1R6K A;  3ZHU A;  1XIL A;  3K5M A;  1BCC H;  2JS3 A;  4MS2 A;  4PV1 B;  5JJJ B;  2HFE C;  5K1P A;  3ZRV A;  4DV1 O;  1R3L C;  2XAJ A;  3PJS K;  1RSO A;  4FZ1 A;  4IGG A;  2IJK A;  4D7T A;  1TVK A;  2XHB A;  5BR8 B;  4X20 A;  4WFA V;  1FAF A;  1PNK A;  4PDM A;  1PKX A;  2YC0 A;  2IJH A;  2V1D A;  5B1A C;  1FFX A;  5KLV H;  5EC2 C;  3ICX A;  4F6R A;  3CC2 V;  1H8H G;  2ADQ B;  2LJ2 A;  4B7K A;  1R6T A;  3ZN1 A;  3T1Y B;  2YID A;  2H94 A;  5LHI A;  2YI8 A;  3ABT A;  4TWK A;  1IVS A;  1SS3 A;  3UT5 B;  3OUF A;  4JYY A;  1GMG A;  2CTP A;  3K03 A;  5KHG A;  4X1I B;  4LFB B;  2Q73 A;  4FLW A;  3AG4 B;  1SRY A;  1AI4 A;  4K8X A;  3RYC A;  4RQE A;  5IE9 A;  4JI0 B;  2A3Q A;  5JCO C;  1AR4 A;  4DYL A;  1NQT A;  4GKJ O;  1TGO A;  4IYH A;  2DMX A;  2B1G A;  1QLE B;  3QO8 A;  3AG2 C;  2CK3 G;  3SGI A;  1B3Q A;  3E8B A;  4JI3 B;  4JZ2 A;  3I55 V;  3K58 A;  3K08 A;  3WB1 A;  1EM1 A;  1SES A;  2KG7 A;  1YVW A;  3I5D A;  5DM6 V;  1PL4 A;  4PA7 A;  4EKW A;  3BFR A;  3CRA A;  3CRR A;  3RYI A;  1ORQ C;  4PD4 F;  1NT2 B;  2BTQ A;  4J7Z A;  3OR6 C;  5JCO A;  1IZ3 A;  2XTA A;  4J7J A;  2Q67 A;  1SC5 B;  1VMG A;  1SF9 A;  1YSC A;  4LNU A;  1IBL B;  3JAT A;  4X1I A;  1IXM A;  2LP7 A;  4YHH B;  4JZG A;  3THO A;  2Q69 A;  3KCX A;  4MTF A;  3SPH A;  2W6J G;  1THZ A;  2PZS A;  4EB6 B;  2UUB O;  4NXN O;  4IYI A;  3VBB A;  2XT9 A;  2ZQM A;  5LMU O;  2HVJ C;  4O4J A;  1SKV A;  2HG5 C;  2CAZ C;  4X64 O;  1N0N A;  4CS3 A;  1WB8 A;  2RMK B;  2HHH O;  3M99 B;  3JAW A;  4J10 A;  2LGW A;  2F1M A;  2OTJ V;  2GTA A;  1P7B A;  5AG2 A;  2A0L A;  4JI2 B;  2ADP A;  4RUE A;  1VEW A;  4ASU G;  5J9P C;  4JI4 O;  1KU9 A;  1SQX H;  3ZRW A;  4MVZ A;  4QJF B;  1AB3 A;  5IYC O;  3RYH A;  4QNH B;  4K0K O;  4YIP A;  3E2E A;  1CXZ B;  4X89 A;  2OCC C;  5LA6 B;  3CS5 A;  2F95 B;  3CWB H;  4B3S O;  1SA0 B;  5KAI Z;  4DW1 A;  4MTX A;  4JI6 B;  1JCH A;  4X64 B;  1VF5 B;  4B3M B;  2OYQ A;  1XNQ B;  2Q7G A;  2YXY A;  2Q0A A;  5E1A C;  2Y69 B;  4LF4 B;  5DEC A;  2JEU A;  4KP4 A;  4UV9 A;  1YZB A;  1G8M A;  4PA6 A;  3WG7 C;  5J2U B;  3CXH F;  4ZI7 B;  3LNN A;  2BTQ B;  2GV9 A;  1H8E G;  4IIJ A;  5IJ0 A;  3GWO A;  2PUS A;  3B09 A;  5BZB A;  5KX5 B;  5LYJ B;  2HR3 A;  4JI7 B;  1Y76 B;  1BE3 H;  2A79 B;  3M7M X;  3SPJ A;  3P3N A;  1O9G A;  3JAL A;  5KHI A;  1VQL V;  4KHP B;  5EIB D;  3RYF A;  3L70 H;  1KC8 W;  4GLX A;  4GZR B;  3FB5 C;  1WAZ A;  2YIA A;  4JI3 O;  1U96 A;  3VQX A;  3BCC H;  2UUC B;  1AJP A;  1JR9 A;  3ZMU A;  5K1X A;  1AJN A;  1HNX B;  5EIB C;  1GO3 F;  1NI8 A;  1G4Y B;  5KA6 A;  2Y4U A;  1Q6H A;  2XND G;  4NTW A;  1FXK A;  1NH2 B;  1VQ4 V;  2YSU B;  2ZE7 A;  4DO2 A;  4X8A A;  4JAA A;  2ZE6 A;  2HEP A;  1S5J A;  3GB7 C;  1GM8 A;  3OM3 B;  4KFM A;  4LH7 A;  4HNA B;  1NJI W;  3RWR D;  4DV7 O;  5BY1 A;  4P9P A;  3ML0 A;  1MOF A;  2YEV A;  4CH5 A;  1XNR O;  1SZT A;  2UU9 O;  1NTZ H;  4DV4 B;  1K34 A;  1BQ0 A;  5BXZ A;  2YIB D;  3K3W A;  4JI6 O;  2QTO A;  4NKG B;  5FPR A;  4X66 O;  3JD4 A;  1PM9 A;  2NN4 A;  3L74 H;  4J41 A;  2MK3 A;  1OCR B;  4QIW F;  1H2L A;  2VQE O;  4WFB V;  1BMF G;  2LW1 A;  3K0D A;  1G6U A;  2NLJ C;  4FJC C;  4MVU A;  1QR9 A;  3FYE B;  4KL1 A;  4BAY A;  4JI4 B;  1Q6I A;  2W6I G;  1QVG U;  3B2E E;  1XHZ A;  4TUY B;  4EB6 A;  4FIP C;  5F2V O;  1UPG A;  2WLI B;  1RSO B;  4JF3 A;  3UT5 A;  1IBK B;  4Q20 A;  4N23 A;  2X0L A;  4DXW A;  3VQY A;  5JVD B;  4DK1 A;  3JSN A;  1YDX A;  1N8R W;  1IBM O;  3H1I H;  4P30 A;  3HKE A;  5JWP A;  2YEV B;  4MW3 A;  3ZN0 A;  1R3I C;  5B3S B;  3S3W A;  1FD9 A;  2ETN A;  4R50 A;  3VQV A;  2H3O A;  3AK2 A;  3RFR A;  2DYS C;  2P90 A;  3FB7 C;  1Y6X A;  2N04 A;  2RN9 A;  2CGO A;  3ASN C;  2EIK B;  2WLK A;  1S3J A;  4H37 A;  2IW5 A;  3K06 A;  1RM1 C;  4U3J B;  3N2K A;  3AG3 B;  3RYI B;  4ZOL B;  1RM1 B;  3FD9 A;  1GN4 A;  1SQF A;  2B1I A;  2EIJ C;  4NR1 A;  1Y74 B;  4XDK A;  3IAY A;  2EIM B;  2E3C A;  5EBW C;  1B04 A;  3E8F A;  1UJW B;  1OCO C;  4KHP O;  3SDL A;  4B3R O;  4FM0 A;  2VS0 A;  3LSU A;  3R66 A;  4GUN A;  4PDL A;  4UCT A;  2XAQ A;  1I5X A;  3CCR V;  4B3T O;  1GN3 A;  3ZRS A;  4UVA A;  2DYR C;  2NR5 A;  1TAE A;  3BPZ A;  3C90 A;  1WP8 A;  4DV5 O;  4XDL A;  1V54 B;  3T1Y O;  3DGE A;  4I9Q A;  4PI0 A;  3JAS A;  5HFL A;  2JGD B;  2X6B A;  3OFN G;  1R1B A;  1WP7 A;  2ZDI A;  3IFX A;  3HR0 A;  1QR8 A;  4UCO A;  3U11 A;  1LUW A;  1H2K A;  3RYH B;  5J2T A;  5LL6 Y;  5CB4 A;  3BY6 A;  2ZIM A;  1LR1 A;  2CTR A;  4W4L A;  5CA3 A;  4B3S B;  3LNM B;  1RFY A;  2HP8 A;  3CCE V;  3APQ A;  1QHT A;  2F43 G;  3IC7 A;  1HW7 A;  2LO1 A;  1RPO A;  1F51 A;  3F7V C;  1G1X B;  2LFS A;  2UUA B;  3RBZ A;  1HNW B;  1M1K W;  3IJ4 A;  3UKM A;  2L35 A;  3A0B Z;  1W0J G;  3K0G A;  2VWK A;  4FLT A;  4XDJ A;  3S3X A;  3CXC U;  2HHH B;  4O4I B;  1Q7Y W;  3ZRX A;  2Q68 A;  1OCZ C;  2CTW A;  2HLD G;  1IBK O;  3CCV V;  1AR1 B;  3JAR B;  1XRE A;  3B8M A;  3GVM A;  3ZMV A;  4QE9 A;  2UUB B;  3L9D A;  1Y76 A;  4U7N A;  2EUL A;  3RT3 C;  2EIL B;  1SZX A;  3ZHT A;  4YHH O;  3CCJ V;  4J7K A;  2JEX A;  4WFF A;  3QVN A;  1WNS A;  3ZS8 C;  2PTM A;  1HDJ A;  2OT5 A;  3F7Y C;  2WLL B;  2Q7E A;  4F6E A;  1SQP H;  3CRQ A;  1NZ6 A;  1BQZ A;  1PP9 H;  4DV6 O;  3D8C A;  4FM2 A;  4AIL C;  2V7Q G;  3MD0 A;  5GTI Z;  3TCU A;  3TXQ A;  2XOK G;  4I4T A;  3SR2 C;  1K7D A;  4ZBM A;  4ZIB A;  3STZ C;  2E74 B;  4B7E A;  1K4D C;  4DUZ B;  4TOI A;  2F23 A;  3B4S A;  2GDS A;  5LHH A;  5B1O A;  4X1K B;  1BHA A;  1ZAU A;  4QPJ A;  1X59 A;  4CBC A;  3W7T A;  2QA4 V;  3GWK C;  1KP3 A;  4CZZ A;  4FFB A;  4Q6G A;  1OCO B;  1VQM V;  3BA9 A;  4NXM B;  4I50 A;  1W59 A;  3E89 A;  5EZY B;  4PHZ A;  4ABM A;  1DF5 A;  1ENV A;  5B3S C;  2RJZ A;  3CP1 A;  5E79 Z;  1SET A;  4LF8 O;  2ZM6 O;  1HWY A;  4F4L A;  3ABM B;  3IGA C;  2P4K A;  4Z1M G;  4BW5 A;  1Q86 W;  1R6N A;  4CS2 A;  5L3E A;  1J95 A;  2FTK A;  2R9I A;  4LCU C;  5BMV A;  4DR1 O;  2GUZ A;  5KUK A;  3W7X A;  3K9S A;  1QQC A;  3OEE G;  1M4U A;  1ZLZ A;  2FKX A;  1S77 D;  3H01 A;  1IDS A;  4CS4 A;  1A32 A;  3UQ8 A;  1AI6 A;  5D5P A;  3Q4H B;  3K79 A;  3ABU A;  5IDJ A;  2FML A;  5IYB O;  1SA0 A;  4W4K A;  5IJ9 B;  5LHG A;  4NTX A;  4FLY A;  1N34 B;  1FJG B;  2E75 B;  4X88 A;  1TUB B;  1AP5 A;  1N33 B;  5LOV B;  5IYZ B;  4NTY A;  2Z5U A;  4B08 A;  2Q8V A;  3HKC A;  1K9M W;  5B1B B;  3TXS A;  5FPO A;  1HNZ B;  4J11 A;  5IY5 B;  1M56 C;  4UVC A;  1I94 O;  2IH1 C;  1E1Q G;  2ITC C;  1Q82 W;  4N21 A;  2WLI A;  2VQF B;  1QVF U;  1F4M A;  4C7U A;  5IYD O;  4O2B B;  1VAR A;  5IWA O;  4CC5 A;  2YIC A;  4CH6 A;  3K5N A;  3J7A U;  4J9Y B;  1VQ7 V;  3JAR A;  4O4H B;  4YXW G;  2EIN C;  4LFC B;  2XAH A;  4MVS A;  2Y69 C;  1JX9 A;  1I08 A;  2IU0 A;  3OMN B;  1SQV H;  3W7U A;  1JPX A;  4ZOL A;  5EZY A;  5LGU A;  4TV9 A;  4FFK A;  4Z1V A;  2WWW A;  1H2N A;  2E76 B;  1YXB A;  3R65 A;  3NXS A;  1FXH A;  1AP6 A;  4LP8 A;  4G28 B;  1YTF D;  2DQ0 A;  3ZED A;  5HFM A;  3F5T A;  3HKD A;  1GM7 A;  1EZV H;  1M90 W;  5IT9 N;  2IU3 A;  1L8D A;  5BMV B;  2X6A A;  2UXD O;  1XEQ A;  4OX9 O;  4GCZ A;  1K73 W;  1KB9 F;  2ZNI A;  2CTQ A;  2DYS B;  2RCV A;  2GTS A;  2JVD A;  2PY5 A;  1TA8 A;  2X6C A;  3AG7 A;  1K92 A;  3D3I A;  3SYC A;  1X4T A;  4DV5 B;  3OAA G;  2EIM C;  5FL7 G;  2LQT A;  4WBN A;  3CJH B;  2VQF O;  1H38 A;  4OGQ B;  1L0N H;  2LW7 A;  2JGD A;  1P49 A;  4HYO A;  4CH4 A;  1CP9 A;  3MHH C;  4LWS B;  4B3R B;  4DV3 B;  4LBE C;  1WN7 A;  3B77 A;  4UV8 A;  3ZMZ A;  2F4V B;  1AVM A;  4BIU A;  3A8T A;  1WA8 A;  4JTC B;  4AHC A;  1US6 A;  1J5E O;  2PF4 E;  1JFF A;  3CME V;  4ZKI A;  4JYA O;  4FLV A;  4RO2 A;  3UO2 A;  3LDC A;  4ZHQ A;  1ZSP A;  2KB1 A;  4PA3 A;  1NTK H;  4X65 B;  4LF6 O;  4DK0 A;  1I5Y A;  4YJ2 B;  2G38 A;  3H1K H;  3NR7 A;  3JAK A;  1PNM A;  2QWO B;  3CEI A;  2P4V A;  3JD3 A;  2RDC A;  4JI0 O;  3ASN B;  4LF9 O;  1JJO A;  4LF6 B;  3A0R A;  3OE7 G;  1JJ2 U;  2AW9 A;  3C3S A;  2QKC A;  2W0X A;  3SPG A;  4OXS A;  1VQ9 V;  4MVO A;  4LF8 B;  3LSS A;  3KZI Z;  3CHX A;  1ZTE A;  3L71 H;  4BIO A;  1YJN V;  4X1K A;  5H6Q A;  1BGY H;  4DR5 O;  5KHK A;  4PEL A;  5B1N A;  1KKD A;  3ETG A;  2EJ7 A;  3BAB A;  3BAA A;  3ZMT A;  1BHB A;  4WFH A;  1V55 C;  3U0Z A;  3CMA V;  4WFE A;  3TET A;  1K4C C;  4O4L B;  3RYF B;  4TSF G;  2BTO A;  4PA9 A;  2EZP A;  4O2A B;  2QM8 A;  4LF5 O;  1YJ9 V;  4JAS A;  4DUZ O;  4DR7 B;  5H2F Z;  1KUQ A;  2Y0I A;  2DOS A;  2QWN B;  3STL C;  3RVZ A;  2QDO A;  1VF7 A;  1YEW A;  3AK1 A;  5ITZ B;  1QLN A;  2FL4 A;  1VQ5 V;  4LH6 A;  3JCZ A;  2R72 A;  1S5L Z;  1R3J C;  1GTO A;  2DWD C;  1WJZ A;  1AI7 A;  3CSX A;  3I56 V;  3QF7 A;  2K1E A;  1XL4 A;  2ZR3 A;  1N32 O;  2ZD9 A;  4MVQ A;  4PI2 A;  1Y4M A;  5JJE B;  3RN4 A;  2BSK B;  3WB2 A;  2UU9 B;  3E22 B;  4FFB B;  4I55 B;  4GT1 A;  1VQK V;  1XMO O;  4EFE A;  1EFR G;  3SPC A;  2ARH A;  3LSQ A;  2JRI A;  3SYA A;  3OTO B;  2M7W A;  3J81 N;  2ODM A;  4R6Z A;  1IXB A;  1J5E B;  5IJ9 A;  1MG1 A;  3G80 A;  4DRX A;  1GKF A;  1OCR C;  4LF7 O;  1DTO A;  1YIT V;  4RAI A;  1I0H A;  2OCC B;  4HNA A;  3RGB A;  5CBF A;  4NXM O;  3B8N A;  1QCE A;  2DN9 A;  3DXR B;  4JTA B;  4LF7 B;  4G2K A;  2JDI G;  1FYJ A;  4HBN A;  5JJN B;  3ETE A;  3P3P A;  2EJR A;  3F5W C;  1JFF B;  1VF6 C;  1OV9 A;  5J2T B;  3OMA B;  1FPO A;  4BR6 A;  5L3F A;  1E1R G;  4GX5 A;  4O2B A;  1W2B U;  3MHS C;  4X66 B;  3HPL C;  3E83 A;  1XDC A;  2C2A A;  5C8Y B;  5KA5 A;  1F23 A;  1OCC C;  2Y48 A;  2Q4P A;  4O4H A;  4LNU B;  3AG1 C;  1BL8 A;  1EN4 A;  1V54 C;  2KKW A;  1N32 B;  3E86 A;  2YUA A;  4JGS A;  2ZCE A;  1M9N A;  1W0K G;  2EIJ B;  3K5L A;  4NB5 A;  2OCH A;  2WLJ A;  1L0L H;  3X2Q C;  2HJD A;  2AHZ A;  3TJT A;  4JYC A;  3G6B A;  1VQ6 V;  3SJC C;  4G27 B;  4B3T B;  1NR7 A;  4CH3 A;  2QKS A;  3BA8 A;  3UM7 A;  4DV3 O;  3ABL C;  2KQX A;  1XOU A;  3SPI A;  4BWA A;  3CRM A;  1Q8I A;  4DR7 O;  1N4C A;  4I55 A;  2L6L A;  1AJQ A;  1YCI A;  3BRC A;  2K9P A;  2RNB A;  4I9W A;  5IY5 C;  5BR8 O;  3ASO C;  5C93 A;  2E5L O;  2QTS A;  3HKB A;  4NVP A;  1OHH G;  1SQQ H;  3CYO A;  4DV1 B;  3HKD B;  2QSA A;  3ZJZ A;  4F6R B;  4DW0 A;  4CC6 A;  1GRJ A;  4FZ0 A;  5KX5 A;  3LUT B;  1XUQ A;  4DR5 B;  3CD6 V;  5C8Y A;  3ZHV A;  1OCZ B;  4DV2 O;  4OX9 B;  5EYP B;  1BS3 A;  1JQ0 A;  1K97 A;  4K35 A;  1SQB H;  1FXK C;  3K57 A;  4D7S A;  3H9V A;  1XBL A;  4JAU A;  3WG7 B;  3BVO A;  3JAT B;  1ZL8 A;  2LFR A;  4UXN A;  3U10 A;  1P4R A;  3JAM N;  3K5O A;  2DWE C;  3K9A A;  1JMK C;  2JS5 A;  4AQY O;  3N27 A;  5LMU B;  4IIJ B;  5IJ0 B;  2N74 A;  1Z2G A;  1NKD A;  1FFT B;  3CCL V;  4E4E A;  4DV7 B;  4JPR A;  5A9G A;  1XMQ B;  2P6J A;  5IYZ A;  3T1H B;  4K8Z A;  3H1H H;  2ZM6 B;  5FNV B;  2QWQ B;  3OUS A;  4YJ2 A;  2WLN A;  4DR4 B;  4JI1 B;  4K3A A;  3G71 V;  3ABK B;  1FKA O;  2P5O A;  4PJ0 Z;  1S5H C;  1N33 O;  2EBO A;  4UB8 Z;  5LGN A;  3HKB B;  3JD1 A;  2W0F C;  2VQE B;  4X20 B;  1WB7 A;  4D6T H;  1IUR A;  4UCV A;  5LMN B;  1PL0 A;  3A2F A;  4HZ3 A;  3APO A;  1DK1 A;  4I5S A;  1NTM H;  5GON A;  4ZI7 A;  2AZ0 A;  5EBM C;  5D5Q A;  1P84 F;  3ZIA G;  1YJW V;  2B5U A;  3O9O A;  3JYC A;  3ZX6 A;  4DV6 B;  2UXD B;  3CX5 F;  2ZIN A;  1ZX3 A;  3FFQ A;  5B5E Z;  5L3G A;  3L73 H;  1KD1 W;  1ZL8 B;  4LWS A;  2F93 B;  3OGC C;  5TIS Z;  4LFB O;  2A06 H;  5JQG A;  1H2M A;  4GX2 A;  4FLX A;  3AG4 C;  4TV9 B;  3WB0 A;  3P30 A;  5FNV A;  4TUY A;  4YY3 B;  4QGP A;  1YIJ V;  1JOY A;  1ARO P;  3K04 A;  2P06 A;  1QNM A;  5LXT A;  5KMG A;  1N36 B;  3DXR A;  5LP6 B;  4JI1 O;  1D2D A;  2ILM A;  1KP2 A;  1DGS A;  4Z2W A;  3SJQ C;  3ZMS A;  2PI5 A;  3ZBH A;  1MAB G;  3K59 A;  2KG7 B;  3JAL B;  4UCU A;  3B40 A;  3W7S A;  3J80 N;  2KSD A;  2F66 C;  4EEQ A;  3DTU B;  2AHY A;  2V4D A;  2WLL A;  3CPW U;  1XI1 A;  1S0V A;  4GX1 A;  4GKJ B;  3JD2 A;  4JTD B;  2UXC O;  1EZJ A;  2YXL A;  1RPR A;  3AG1 B;  2XAF A;  2XAG A;  4FM1 A;  1FS0 G;  3FB8 C;  4TV8 A;  2YDE A;  3HKE B;  2Q0O C;  4U3J A;  2CGN A;  5CMU A;  4LFA O;  1CPY A;  1HR0 B;  1SER A;  1K5Q A;  2D3O W;  3N2G A;  3T4Z A;  4DUY O;  4WFG A;  3D36 C;  3SYQ A;  1IX9 A;  4DR6 B;  1Y74 A;  3BHP A;  5L3B A;  5CN0 A;  2CH7 A;  2ZE8 A;  4DV2 B;  1MNG A;  4DR1 B;  2WA3 A;  2ZDI C;  3RVY A;  4P2Z A;  1B6Q A;  1Q3E A;  1YI2 V;  1Z5W A;  1K33 A;  4LF5 B;  2GBO A;  3RW0 A;  1V55 B;  1GK9 A;  5CA0 A;  3RYC B;  2E5L B;  1MSD A;  2ITD C;  4LC1 A;  2PYL A;  1M93 A;  1Q5O A;  5LBQ A;  2N05 A;  4GKK O;  2EIK C;  4PDV A;  4O4L A;  2XAS A;  3ASO B;  1YHQ V;  1HNZ O;  3JSL A;  2MW2 B;  1K5S A;  4X62 B;  3QTC A;  4UUJ C;  1N36 O;  1EN6 A;  4MW8 A;  2Y4T A;  1EN5 A;  1COW G;  1QBZ A;  4MTO A;  3JCU Z;  1QLE C;  2Q5Z A;  3SYP A;  3UCS C;  4IHJ B;  5JH7 A;  2IJJ A;  1D5A A;  5LOV A;  2UUC O;  5JVD A;  1PPJ H;  4MSW C;  4OPA A;  2WSS G;  2QJ1 A;  1MZF A;  1I7F A;  1D5N A;  4GX0 A;  1AR5 A;  5ITZ A;  4FMT A;  1PD3 A;  3G67 A;  1EBO A;  2JK5 C;  2EIN B;  1Q90 D;  1VQP V;  2BOB C;  2DYR B;  1GM9 A;  5KAF Z;  2A7W A;  4JYB A;  1GN6 A;  4JV5 O;  1VIB A;  1MA1 A;  2HVK C;  1GN2 A;  4MTG A;  2ATK C;  1VF6 A;  3QG5 A;  2DJV A;  2ZXW C;  3N2K B;  1TUE B;  2IJI A;  4R7C A;  3CCU V;  1F7Y A;  2HKO A;  2PI4 A;  1FFX B;  1RP3 B;  1XL6 A;  3X2Q B;  1KMI Z;  4KUM A;  2P7T C;  1AIL A;  4LFC O;  1BZK A;  5L3C A;  4H13 B;  3FAV B;  4U3F H;  3AG2 B;  2GHY A;  3FKS G;  3T1H O;  4RQF A;  2QM4 A;  1XMQ O;  3OTO O;  1QU7 A;  2OIG A;  1R3K C;  3KKY A;  1KQS U;  1XMO B;  1L1F A;  3SJA C;  1Z5V A;  2VWJ A;  1K8A W;  4FPP A;  1P7G A;  1CEZ A;  4UVB A;  4TQD A;  1N34 O;  1FJG O;  3G6E V;  3ZCC A;  2JJ1 G;  3OEH G;  3AEI A;  2WLH A;  1N0J A;  3AK3 A;  1SQG A;  5GTH Z;  5LXT B;  4FLZ A;  2ZE5 A;  1KKC A;  2RQ6 A;  3FYI B;  3ZHS A;  1Q6U A;  4UCS A;  5EC1 C;  1LNQ A;  2WLM A;  2QEX V;  5KHJ A;  2ZXW B;  2AGA A;  1VQN V;  5B1A B;  4ICG A;  2B9Z A;  4X1Y B;  5LP6 A;  3EFF K;  3VQW A;  3H1L H;  2ZR2 A;  3L75 H;  2DW4 A;  4I0X B;  3JAK B;  2AXT Z;  4FK5 C;  1NVP B;  4DUY B;  5B1B C;  4PA4 A;  4OPH A;  1M57 C;  2AZ2 A;  2UXX A;  1S72 V;  4LFA B;  5JQG B;  2WPD G;  1M5I A;  5H5N A;  4WCE V;  1URF A;  4JI5 O;  1KBH A;  2JJ2 G;  3ABK C;  2JIZ G;  1T5E A;  1TUB A;  1BSM A;  2QGN A;  3A0H Z;  2QKA A;  2H8P C;  3JAS B;  4I50 B;  1FXK B;  4IT5 A;  5H9C A;  2LGQ A;  4KXR A;  3CC7 V;  4FLU A;  3WFV A;  3OTF A;  2Z0A A;  1WPX A;  1ROP A;  4DV4 O;  2WA4 A;  4JAV A;  1H2S B;  2FYU H;  4NXN B;  1XQ8 A;  1E79 G;  1B06 A;  2JGU A;  3ABM C;  2ZNJ A;  2WAM A;  4X65 O;  3TK1 A;  1NU1 H;  2QM7 A;  3HB3 B;  2BE3 A;  5EK0 A;  4BIZ A;  4MVR A;  1GAX A;  4JYA B;  3DC6 A;  3ZHR A;  1MSW D;  4I7Z B;  4JI8 O;  3CCM V;  3ETQ A;  3EXA A;  3N2G B;  4YJ3 B;  1ZWI C;  4O2A A;  1V9P A;  4J80 A;  1K3E A;  2QWR B;  5B66 Z;  1XHX A;  5LP6 C;  3BEH A;  3KG2 A;  4H0L B;  1H2G A;  4LF4 O;  2QR4 A;  4DRX B;  1TVK B;  2BSK A;  5DED A;  4FVM A;  4MT8 A;  1NH2 D;  5J2U A;  2PGG A;  2A9H A;  3HKC B;  3TGU H;  1NS1 A;  5H6R A;  4PDR A;  5CBG A;  4K0K B;  2YS8 A;  3QNE A;  1WPB A;  4X9Q A;  4DR2 O;  1VQ8 V;  5GON B;  2EZO A;  2IM9 A;  1OJH A;  3CB2 A;  4GYC B;  3OR7 C;  5LGT A;  1Q43 A;  1ZUQ A;  1YTF B;  1AI5 A;  2OIE A;  4X62 O;  4JI2 O;  1YF2 A;  4DR4 O;  3JD0 A;  4P9O A;  4JI8 B;  4XBF A;  1WA8 B;  4DR3 O;  2Y0P A;  4GKK B;  2EIL C;  3MDS A;  2D2C B;  5EBL C;  4I4T B;  2IBZ H;  3T1C A; 
#chains in the Genus database with same CATH homology
 4QGP A;  2Q5Z A;  2GTA A;  2Q4P A;  2A7W A;  2OIE A;  1VMG A;  3C90 A;  2A3Q A;  3CRC A;  2OIG A;  1Y6X A;  3CRA A;  2P06 A;  1YVW A;  2Q9L A;  1YXB A;  2Q73 A;  5IE9 A;  2YXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...