1EZVH

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 28
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1ezvH00
4U3FH 1EZVH 3L74H 3L72H 1KYOF 1SQQH 3L75H 1L0LH 1KB9F 2A06H 3CWBH 3TGUH 3H1JH 5KLVH 2IBZH 1SQVH 1SQBH 3H1HH 1BE3H 3CXHF 1BGYH 3H1IH 1BCCH 1SQXH 2FYUH 3L70H 1NU1H 1L0NH 2BCCH 1PPJH 3H1KH 3CX5F 4D6TH 3L73H 1NTZH 1P84F 4PD4F 3BCCH 1NTMH 3H1LH 1NTKH 1PP9H 3L71H 1SQPH
chains in the Genus database with same CATH superfamily
2R9AA 1XQ8A 1KBHA 1XNQO 3CC2V 3SPCA 2OTLV 1VQ4V 2JGDB 1QQCA 1ZTEA 3I55V 2IW5A 4X8AA 4CBCA 1JMKC 1R6TA 2EZPA 1AILA 2EIKB 1N33B 3P3NA 1WP7A 2QJ1A 3L73H 2EIKC 5C93A 2YICA 1DK1A 2PTMA 2ZNIA 3RN4A 4LFCO 1Q3EA 1XI1A 4YJ2A 4QJFB 3ZRXA 1GN6A 3E89A 4PELA 3ZBHA 5E1AC 1WB8A 5FL7G 1F23A 1QLEC 4QE9A 1WNSA 4QPKA 1NVPD 1EM1A 1H2SB 1K9MW 2YIAA 4DO2A 4TT3G 4MVSA 4LCUC 2LFSA 4GKJB 4Z1VA 3K08A 1OCCB 2E76B 3CMEV 3ZN1A 2YSUB 3ZMVA 1OCCC 5FPRA 1G4YB 2O57A 1Z5WA 4JYBA 4B7KA 2A79B 3KZIZ 3RGBA 3TK1A 1BQZA 2IJKA 1P84F 4YHHO 1FAFA 3OTOB 3OMNB 1CEZA 4B3SB 2X0LA 4WCEV 3JAKB 4CH5A 1SQGA 1MMMA 4PHZA 1XUQA 3EXAA 1I5XA 3JD4A 4LF7O 2UXDO 1IX9A 4AQYB 3H1HH 4FLVA 4DV7O 4X20A 5J9PC 4X9QA 2JS3A 2FL4A 2ZE7A 3ZX6A 1T5EA 2F95B 2M6YA 1RSOB 5GTHZ 3F7YC 3H1LH 1Y76B 1M90W 1MSDA 2LW7A 2VQFB 2ZNJA 2UXBB 3TXQA 5EK0A 1I94O 1NJIW 2CTPA 1Q5OA 1WA8A 1B6QA 4H33A 4LR3A 3K58A 4UCSA 1JOYA 2LGWA 4J7KA 2KKWA 3CP1A 2P6JA 2IH1C 2YEVA 2H8PC 4YJ2B 1YI2V 5KHJA 1BCCH 3EFFK 3NR7A 1IBKB 5H6RA 2ARHA 2ZCEA 4QE7A 2E5LB 1AI6A 2Y4UA 4ASUG 4JF3A 3JD1A 2PY5A 4X1IA 4F4LA 1UJWB 1AR1B 1Z5VA 2XAHA 4O4JA 1XNQB 2NLJC 1XBLA 5H6QA 5KA5A 2YC0A 2Q73A 1IDSA 3ABKB 2CK3G 4ZOLA 2IH3C 3ABKC 4R50A 3J7AU 3KCXA 4DW0A 4LFCB 3D36A 4B08A 2P4VA 5CMUA 5L3FA 5FLXN 4GX1A 2X6BA 3H01A 4Z1MG 4X20B 1Q82W 2DYSB 3DSQA 4LBEC 2FTKA 3G80A 5DN6G 2UXNA 3A0HZ 2DYSC 1NKDA 1YEWA 2XT9A 3UKMA 2QR4A 1KP3A 3K06A 4OPAA 1N0NA 4PDMA 2P90A 1JA8A 3BA8A 3QNEA 2RQ6A 3CJHA 5BY1A 4CH3A 2JS5A 5KA6A 1WA8B 5LA6A 2YI9A 1D5AA 1PL0A 1OCRB 4YHHB 1OCRC 1P4RA 4F6RA 3UT5A 3DGEA 1SA0A 4CC6A 2YEVB 4LF7B 1QHTA 2UXDB 4DV7B 1CXZB 5GONA 2OWOA 1V54B 4LFBO 3BRCA 1K7DA 2QEXV 4RUEA 1YHQV 3RWRD 2W6JG 1V54C 4UCVA 2OCCC 2Q0OC 3B2EE 1VQNV 1JCHA 1LNQA 1IBMO 4X1IB 4U7OA 1ZUQA 1VQ8V 3QO8A 2BSKA 3FB5C 3CCEV 3OD4A 4O4JB 2BCCH 3FYEB 2R9IA 4BW9A 4DV2O 1I94B 5TISZ 3ZRVA 4ZOLB 4FLWA 5EBWC 5KHGA 3CC7V 2GUZA 3ABUA 5LMNO 4JI6B 2XASA 2IM9A 4LF5O 1SQXH 1GM7A 1GK9A 4DYLA 5CA3A 1DGSA 5LXTA 3K57A 3AG2C 2E75B 1Q6UA 1JVMA 1K8AW 5C8YA 2H94A 3W7SA 2RCVA 3PJSK 4U3JA 3EHBB 1WPBA 2XAQA 3ZJZA 2ZIMA 2A7WA 1UFIA 4NYKA 2P5OA 2WLNA 1IBLB 4B3RO 3WB2A 2EJ7A 4LFAO 4DUZO 1YVWA 4J10A 2M7WA 4J11A 3OGIB 3CJHB 4IYIA 1S5JA 1EZVH 5LA6B 3P30A 3OUSA 3VOUA 1VQMV 4K8ZA 2UU9O 4DR6O 3H9VA 1ZWIC 4F6RB 3W7XA 1V55C 2KQXA 4GYCB 1QR8A 1Q90D 4Q20A 3UT5B 2BE3A 1SA0B 3OEEG 5EZYA 5GONB 1SRYA 1AROP 2PGGA 4FFKA 4MVRA 1KYOF 3DC5A 4GCZA 1AR4A 1THZA 2PYJA 4UCRA 4I50A 1HP8A 4K35A 3D8CA 1K4DC 1PL4A 3I5DA 3A8TA 1BE3H 5KHIA 3CSXA 3BHPA 3JAMN 1DLBA 2BSKB 1OZ0A 1PNKA 5IY5B 2CTQA 4UCUA 1JX9A 3ZMUA 3F5TA 5IY5C 3W7WA 5FNVA 3E35A 1NT2B 4J42A 2XNDG 4PI0A 3OAAG 4MVZA 2GUZB 4ZBMA 1XMQO 1KD1W 3B4SA 3W7TA 1NI8A 1DF4A 4N21A 2YDEA 3N2KA 4RQEA 1TUBA 4YY3B 1R3JC 3RYHA 1VQKV 1I0HA 4LH6A 3ZN0A 4LFBB 2RMKB 5LXTB 1EN5A 5IJ9A 1XILA 4PA9A 1N34O 4X65O 3AG4C 1HNXO 1BQ0A 5C8YB 3CCRV 4U3JB 4KHPO 3CCUV 3GWOA 4JI0O 1IBMB 3QF7A 4JTDB 4J9ZB 1YCIA 4UB8Z 3FKSG 5B1OA 1YF2A 1VP7A 2P06A 1BT8A 4DV2B 2MW2B 2QWRB 5B1AB 3FD9A 3JALA 2ZXWB 2VWKA 1NQTA 1GH6A 2YXLA 5B1AC 2ADQB 4BW5A 5B66Z 3IGAC 1PKXA 3OR6C 5LMNB 4HYOA 5LGUA 5LMUO 1R1BA 1RP3B 3WG7B 3K9AA 3P32A 1AR5A 3O9OA 4FMTA 5H9CA 1LUVA 3JYCA 3CE2A 3K5NA 4OGQB 1GRJA 5EZYB 1JJOA 4CZZA 2BTQA 3M7MX 2AHYA 4I5SA 2RJZA 2ZE6A 1ENVA 4RUFA 4GX5A 4X1KA 4I7ZB 1R6NA 4QIWF 4I50B 5EC1C 2BTOA 2ZM6O 3L9DA 1U97A 2Q69A 3ZMSA 1H38A 2DOSA 4MTXA 5LL6Y 4DR2O 3B8MA 4B3RB 4LFAB 4MVMA 4DUZB 3R66A 1MOFA 2VWJA 3L74H 4RO2A 2Q7HA 2H3OA 2XAFA 1D2DA 5JQGA 2F4VO 4EB6A 2XAGA 5FNVB 2EINB 3O65A 3THOA 3ML0A 4CC5A 3K04A 2UU9B 3JD2A 4DR6B 3CMAV 4FM0A 3ABTA 3AG1B 2HEPA 3N2KB 3RW0A 2WAMA 1TUBB 5EBLC 3PN1A 4FLXA 4ABMA 3RYHB 3FYIB 2YIDA 3QO7A 3B09A 5IJ9B 3LDEA 2Q6AA 4UFZA 2WLKA 1ZX3A 3MHHC 4H13B 2JEUA 4IYHA 4BIZA 2WA3A 4JTAB 3SPHA 4TSFG 2QWOB 3BFRA 4CS4A 1Q86W 2A0LA 2AGAA 3B77A 2OYQA 4NR1A 2ADPA 2ZIOA 4KL1A 2JRIA 1P7GA 4EEQA 1D5NA 1MZEA 1XMQB 5BMVA 2Q4PA 1O9HA 2GTAA 2Q68A 4WF9V 1G6UA 1X59A 4JZGA 3CHXA 1N34B 4X65B 3CRMA 1QLEB 4JASA 2MK3A 4DUYB 4X1KB 1SC5B 3CYOA 3ETDA 4I55A 4JI0B 1R3KC 1I5YA 3JCZA 4YIPA 2LJ2A 4X66O 4K0KO 3FAVA 3MAQA 2ZQMA 3SJQC 1PM9A 2HJDA 2GV9A 4LF9O 4F6EA 4OX9O 2XUMA 1ZSPA 4BIOA 4EKWA 4L87A 1QR9A 3E22A 5E79Z 2ODMA 5JQGB 4EB6B 3T1HB 4O4LA 3ASOB 3IFXA 3OE7G 2WLIA 4C7UA 3U0ZA 1YJNV 5LMUB 5L3EA 3ASOC 3M99B 4AHCA 4MS2A 1QLNA 4TOIA 1M4UA 1AI4A 3F7VC 1ORQC 3CS5A 1NBMG 1YTFD 5IYDO 3CXHF 1AJNA 1BZKA 2DQ0A 5BZBA 1NR1A 4JI8O 3HKDA 5B3SC 1Y6XA 4DR2B 4IIJA 2EJRA 3I56V 3RVZA 1EFRG 3B40A 2IJIA 3CB2A 4HZ3A 2HJFC 3F5WC 3B8NA 4JI1O 2F4VB 2R70A 4I9QA 1SESA 3UQ8A 1N32O 1I7FA 4KFMA 3OW2U 1FXKA 1VARA 3TJTA 5JH7A 3T4ZA 2WSSG 5LOVA 5BMVB 4UB6Z 4LF6O 1GN2A 4FJCC 4WFEA 1YIJV 4FZ1A 3JAWA 1XREA 1GM9A 3GB7C 2EIMC 3A0RA 2HVKC 3W7UA 3ICXA 3SYQA 4I55B 3G6BA 4PDLA 4NB5A 2DWDC 3FAVB 1Q7YW 4PA3A 5D5QA 2UUCO 1TAEA 2LFRA 1GN4A 3ZHRA 1AP5A 3E22B 2QDOA 1B3QA 4D6TH 4YXWG 5CA0A 1IURA 4K3AA 4O4LB 5F2VO 2VQEO 3JASA 2WLIB 2IJJA 3CXCU 2N05A 4NTWA 1BSMA 3ZHUA 2DYRC 1RPOA 3OTFA 1KB9F 2WPDG 2LW1A 3OMAB 1PV0A 1WN7A 5EC2C 2FKXA 2QM8A 5B5EZ 2X6AA 5DM6V 4WBNA 4U7NA 3FB6C 4LF8O 5HFLA 1F51A 3HKDB 4UCOA 3SYOA 4X66B 4K0KB 4J7JA 4DV6O 3OEHG 5CBFA 1X4TA 1XNRO 4IIJB 4LF9B 4DV0O 4OX9B 2ZR3A 3DTUB 3E2EA 1KQSU 3J81N 5A9GA 2N04A 3UO2A 4PD4F 3QG5A 2CAZC 2F93B 5CN0A 1FXKB 5JH7B 4JI3O 3C3TA 3CCMV 1GO3F 2F23A 2Q67A 4FLYA 4JYAO 4HBNA 3R65A 3UM7A 1FXKC 1SKVA 4R8CA 5LOVB 1ZAUA 3WB0A 1URFA 3E86A 3JARA 1VQ6V 3CRRA 3AG3B 3RYFA 3JAWB 4E4EA 1NS1A 3AG3C 2QE7G 2OCCB 2P22C 1JPXA 5LHHA 1H2NA 3NXSA 4JAUA 3SJCC 3SPJA 2A06H 3BA9A 1W0KG 3G67A 1H2LA 2IJHA 5KUKA 4XDLA 3WB1A 1H8EG 1XL6A 3ZCCA 4N23A 4H0LB 4JI1B 1OCZC 5KAIZ 3L71H 5CA0B 1N32B 4WFAV 3JASB 4E2LA 1H2KA 4PA7A 5GTIZ 5EIBC 5IE9A 4LF6B 4WFFA 4IHJA 2IU3A 3SGIA 1Y67A 1YXBA 3OGCC 5J2TA 3AG2B 1XMOO 4BR6A 4WBNB 4NKGB 2YI8A 3BVOA 1K33A 4MTFA 4OPHA 1FFTB 2WLMA 1TGOA 4FLZA 2Q8VA 3CCVV 2AZ0A 1V9PA 2BOBC 2GDSA 3S3WA 4GKKO 2Q0AA 1ZLZA 1SQFA 1NR7A 2PZSA 3E8BA 4J80A 4RWUA 2JK5C 5K1XA 2HHHO 3OM3B 1SF9A 1FPOA 4TV9A 1NTMH 4J41A 3BY6A 1RPRA 2VQEB 3ETEA 4DV4O 1V55B 4B3TO 2FYUH 2WWWA 3TXSA 3RVYA 5JWPA 3RBZA 1OHHG 4LF4O 3JARB 1IVSA 4MW8A 1R3LC 3RYFB 3U11A 1YITV 1NTKH 2JEXA 1Q81W 2Z5UA 4PA6A 2DMXA 3ZS8C 4LF8B 2YXYA 2ILMA 4DV6B 1VQ9V 2B5UA 3TCUA 4P9PA 3ZEDA 3CCLV 4JI5O 2CTRA 2HP8A 1XNRB 3HKEA 4UVCA 3WU2Z 3T1YO 5EYPA 3BCCH 4X64O 2WA4A 4DV1O 3OMIB 5LP6A 1SQPH 3L72H 2HLDG 5JJJB 1TUEB 2CUGA 3ZHQA 3BABA 1KC8W 3SPGA 4JI3B 2E3CA 1Q43A 2AW9A 1SQVH 1GTOA 3J80N 4BIUA 4JYAB 4QGPA 2CE4A 1BHBA 1WJZA 4FLTA 1JQ0A 4I0XA 1K3EA 4IHJB 4O4HA 2KG7A 1HWYA 4TQDA 5DEDA 1S3JA 5J2TB 1Y4MA 1XEQA 4R7CA 1U96A 3AG4B 4MTOA 2YS8A 4LC1A 2R72A 1VF6C 1J95A 4ICGA 3AG7A 4YIOA 1US6A 1CPYA 3ABMC 3FB7C 1WB7A 4UUJC 3SYPA 4O4IA 1QNMA 3LSQA 2E74B 5IT9N 4I9WA 3RYCA 1AB3A 3DXRA 5LYJA 1H2GA 4TV9B 5D5PA 3L75H 1FKAO 3LUTB 2LP7A 1MG1A 1S5HC 1AI5A 2DW4A 3K5LA 4BWAA 1YJWV 4HNAA 4LF5B 1KP2A 3VQXA 2XTAA 1XMOB 4FM1A 4U3FH 4MTGA 3STLC 4DR4O 5JCOC 3IC9A 4JAAA 3SPIA 1M93A 4UXNA 3AEIA 5KUMA 3ZMZA 3OFNG 1B06A 1K4CC 3H1IH 5JVDA 4TQFA 1NU1H 4GKKB 1B04A 2WLLA 2CH7A 3HKEB 1P7BA 1O9GA 4MW3A 3CCSV 4FM2A 1RM1C 3CD6V 2HHHB 4XDJA 2QWQB 5EYPB 3STZC 4DR3O 2ETNA 1IXBA 5LP6B 1MABG 4ZI7A 3AK2A 2XAJA 3JSNA 1M5IA 5LP6C 2XOKG 4GT1A 5B1NA 4DV4B 2DN9A 2DWEC 1R73A 5KHHA 4UV9A 4NXNO 4I0XB 4X88A 1ZL8A 4O4HB 3HKBA 4LF4B 2KG7B 4UVAA 2UXCO 5LGNA 4DR1O 4UV8A 2QM7A 4JPRA 4NTXA 3C3SA 4JYYA 1SS3A 2W6IG 3E8HA 2NN4A 2V4DA 2X7RB 1VQ7V 3T2MA 1ROPA 4JI5B 3OUFA 2GBOA 3MD0A 1LR1A 3IC7A 3P3PA 2YIBA 4MVUA 3A2FA 4DV5O 4O4IB 3T1YB 4RAIA 4X64B 4DV1B 1IZ3A 1XL4A 3RYCB 3JALB 3DXRB 5LYJB 4PDRA 2CDYA 2OIGA 1W2BU 2JDIG 4GX2A 1RSOA 1R3IC 3X2QB 2NNUA 1VQPV 1BMFG 3LSUA 2QGNA 1I08A 1SZTA 3JSLA 4AI8A 1L1FA 5BXZA 3X2QC 1EN4A 1Q6IA 4HNAB 3FFQA 3BEHA 1XOUA 2BTQB 3K0GA 1HNXB 1KECA 4WFGA 4KHPB 5JVDB 5JJEB 1RFYA 3IAYA 2WLLB 1AVMA 1FYJA 2CH7B 4TUYA 4D7SA 2LQTA 3CC4V 1J5EO 4YJ3A 3HKCA 1VF5B 4DXWA 2B1GA 2L6LA 5J2UA 1Q6HA 2EBOA 4BAYA 4ZI7B 1Y74A 5BR8O 2EX3A 1SERA 4I4TA 4DK0A 2XHBA 3UCSC 2K9PA 1QU7A 3ETQA 3CCQV 5HFMA 5CBGA 2ZKOA 2K1EA 1ZL8B 3HKBB 4P9OA 4DR4B 1FJGO 4FPPA 1H8HG 2C2AA 2ZE8A 5LHGA 5B3SB 4D7TA 2ZM6B 2DQ3A 1K34A 1R6KA 1BL8A 4JI7O 3ZRWA 2RN9A 4NXMO 3U10A 4J9YB 1NH2B 1JFFA 1S77D 1N4CA 4DR3B 4WFHA 2JVDA 1MSWD 5ITZA 4PI2A 1YJ9V 5A2QN 4LP8A 2PYLA 3UO3A 3MHSC 2DE0X 4WFBV 1M1KW 2ZDIC 4MVQA 2RDCA 2F43G 4NXNB 2EILB 3E8GA 2HKOA 2UXCB 4TV8A 4GX0A 5H5NA 1AJPA 5IYCO 4DR1B 4X1YA 2EILC 1M56B 5H2FZ 1TA8A 2EIMB 4GZRB 1M56C 2Q7GA 3OR7C 2WLHA 3JATA 3G6EV 4PA4A 2F1MA 2Y0PA 2W0FC 3D3QA 4KP4A 3N2GA 4JI6O 1VEWA 1YZBA 1WLEA 2Q9LA 2YUAA 4TUYB 4JV5O 4DV5B 5L3GA 5EIBD 2QTSA 5GW7A 1KUQA 4YJ3B 1VF7A 3HKCB 1Q8IA 2QWPB 2KB1A 5J2UB 4DV3O 1PPJH 5CBHA 1Y74B 5LHIA 3JD3A 2A9HA 3K9SA 2LGQA 2DYRB 3HPLC 4I4TB 2CGNA 2HVJC 2PF4E 3A0BZ 2ZD9A 4NTYA 1N36O 2VS0A 3C90A 1VQ5V 2Z3YA 1IBLO 1K5SA 1M57B 2IBZH 2HR3A 3ZHSA 4DW1A 4GUNA 1GKFA 1NVPB 4G2KA 3K3WA 2BOCC 1M57C 3CRCA 3ETGA 3IJ4A 3EVKA 2EULA 1QBZA 4MVOA 1XHZA 4X62O 5L3DA 1KMIZ 5L3CA 4FIPC 5K1PA 4OXSA 1W0JG 3KG2A 1S5LZ 2N74A 4JI2O 4W4KA 4J7ZA 2Y48A 3H1JH 3ZRWB 2GHYA 1AI7A 1F7YA 2JGUA 1J5EB 1JFFB 3M8AA 2R9RB 3K5MA 1HR0O 1JR9A 5ITZB 3E8FA 3N27A 5BR8B 3T1CA 2QTOA 3ZHVA 4R6ZA 1YTFB 4A5UB 3G71V 4ZKIA 4G27B 4DK1A 1S72V 3SYAA 2NR5A 4LNUA 2ZT9B 4EFEA 4LWSA 4TV8B 1FS0G 4X1YB 4PDVA 2UUBO 1FJGB 3Q4HA 4XDKA 5KAFZ 3K79A 1HNZO 4CH6A 1S0VA 4FZ0A 1SETA 4HAMA 3CCJV 1F4MA 4TWKA 3ASNB 1FFXA 3SDLA 4JZ2A 2PUSA 3JATB 4JI8B 2QKAA 4XBFA 1JJ2U 2D2CB 1MZFA 3ASNC 2JIZG 1BHAA 3N2GB 4KXRA 4O2AA 4JI7B 4NXMB 4DR5O 4YY3O 4IL6Z 1EBOA 2CGOA 3VBBA 1OCZB 1Y66A 1N8RW 3LNMB 4DRXA 1VQOV 1FXHA 2PI5A 2P7TC 1EN6A 3AK1A 4FVMA 4CH4A 3D3IA 1K73W 4UVBA 1S76D 1H2MA 5IWAO 3L70H 2ZE5A 2Z0AA 5FPOA 5LGTA 3ZIAG 5CB4A 2QSAA 4G28B 2Y0IA 4JI4O 3MDSA 1HNWO 4JAVA 1M9NA 4JYCA 4RQFA 2GSMB 2YXHA 5DECA 1VF6A 1W59A 2OT5A 1L0LH 2DJVA 2KSDA 5IYZA 5AG2A 1K97A 1PNLA 4FLUA 4JV5B 2UUCB 2QKCA 2B1IA 5KX5A 3D36C 1L8DA 2JJ2G 4DV3B 1FXVA 3KKYA 5IYBO 1K5QA 1DF5A 4DR7O 4FFBA 4QPJA 4FK5C 1YDXA 3LDCA 1LUWA 4CS2A 1VMGA 3E83A 1OCOB 4B7EA 1N36B 4K8XA 3DC6A 1E1RG 1OCOC 3LDDA 4H37A 3SR2C 4L8JA 3HR0A 1MA1A 2RNBA 2UUAO 4LNUB 4LWSB 2Q5ZA 5JCOA 3HB3B 1COWG 5B1BB 3Q4HB 3APOA 4B3MO 4X62B 1HDJA 2B9ZA 4LH7A 5B1BC 4MSWC 1GMGA 1FFXB 1MNGA 1A32A 3TGUH 2ATKC 1SQBH 3RYIA 4JI2B 4ZHQA 4O2AB 2AZ2A 1CP9A 2WLJA 1NZ6A 3ZMTA 1OV9A 3RFRA 2L35A 1KKCA 4DV0B 4JTCB 1OJHA 2ZINA 1HR0B 2EIJB 1PP9H 4AILC 4DRXB 4X89A 2EIJC 2PI4A 5LBQA 1IXMA 3G4SV 3VQWA 3QO5A 3AK3A 3JD0A 4PV1B 2VRZA 5EBMC 2LO1A 3S3XA 3CRAA 3K03A 2QA4V 2UUBB 4KUMA 1TVKA 5CB4B 5IDJA 5KMGA 1HNZB 2CTWA 2X6CA 3KCYA 1GN3A 5JJNB 3QTCA 2JJ1G 1N33O 4GLXA 4P2ZA 3SYCA 4IGGA 1F4NA 2F66C 5IYZB 2ITDC 4O2BA 3ABMB 2QKSA 4DR5B 3APQA 1WPXA 2QWNB 3SJBC 5KX5B 1WAZA 1FD9A 1E79G 1PD3A 3FB8C 1Z2GA 3GWKC 4DUYO 4FFBB 2FMLA 3K59A 4QNHB 1AP6A 1QCEA 2P4KA 1KU9A 2ITCC 5CA1A 5IJ0A 2OTJV 3ABLB 2V7QG 3CX5F 5IWAB 4GKJO 3ABLC 3BAAA 3CEIA 1N0JA 4JI4B 3TETA 1HNWB 1P49A 2JGDA 1WP8A 4MT8A 2ZXWC 1SQQH 1QVGU 1G1XB 2HFEC 2UXXA 3T1HO 2A3QA 5KLVH 3CRQA 5L3BA 1BGYH 1XDCA 3FX7A 3ZRSA 4H44B 1YSCA 3OTOO 3RYIB 3VQYA 5KHKA 4CS3A 4B3SO 3WFVA 4ZHQB 4Q6GA 3WG7C 1RM1B 2D3OW 1BS3A 1K92A 4W4LA 4UCTA 3SJAC 4AQYO 3JCUZ 4JGSA 4DR7B 2GTSA 4PJ0Z 2P67A 3K5OA 2G38A 4Z2WA 3K0DA 1VQLV 4IT5A 3LSSA 2Q7EA 1GM8A 3H1KH 1NTZH 1SZXA 4B3TB 3GVMA 1DTOA 2VQFO 2UUAB 1KKDA 2HG5C 2UXBO 2QM4A 1VIBA 1TVKB 2V1DA 4B3MB 5KMGB 2YIBD 3CWBH 1G8MA 1NH2D 4EFBA 3OT7A 1E1QG 3T4DA 4ZIBA 2EINC 2OCHA 2ZR2A 1EZJA 2OIEA 1UPGA 4O2BB 3JAKA 2EZOA 1PNMA 3LNNA 3AG1C 2FB5A 4P30A 3BPZA 3ZHTA 1HW7A 1GAXA 1XHXA 2Y69B 2IU0A 1IBKO 3VQVA 1QVFU 2AXTZ 2Y69C 2E5LO 2AHZA 3RT3C 1L0NH 2ZDIA 4NVPA 2W0XA 2Y4TA 3CPWU 5CA1B 5IJ0B 1Y76A 3QVNA 1AJQA
chains in the Genus database with same CATH topology
4U3FH 1EZVH 3L74H 3L72H 1KYOF 1SQQH 3L75H 1L0LH 1KB9F 2A06H 3CWBH 3TGUH 3H1JH 5KLVH 2IBZH 1SQVH 1SQBH 3H1HH 1BE3H 3CXHF 1BGYH 3H1IH 1BCCH 1SQXH 2FYUH 3L70H 1NU1H 1L0NH 2BCCH 1PPJH 3H1KH 3CX5F 4D6TH 3L73H 1NTZH 1P84F 4PD4F 3BCCH 1NTMH 3H1LH 1NTKH 1PP9H 3L71H 1SQPH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U3F H;  1EZV H;  3L74 H;  3L72 H;  1KYO F;  1SQQ H;  3L75 H;  1L0L H;  1KB9 F;  2A06 H;  3CWB H;  3TGU H;  3H1J H;  5KLV H;  2IBZ H;  1SQV H;  1SQB H;  3H1H H;  1BE3 H;  3CXH F;  1BGY H;  3H1I H;  1BCC H;  1SQX H;  2FYU H;  3L70 H;  1NU1 H;  1L0N H;  2BCC H;  1PPJ H;  3H1K H;  3CX5 F;  4D6T H;  3L73 H;  1NTZ H;  1P84 F;  4PD4 F;  3BCC H;  1NTM H;  3H1L H;  1NTK H;  1PP9 H;  3L71 H;  1SQP H; 
#chains in the Genus database with same CATH topology
 2R9A A;  1XQ8 A;  1KBH A;  1XNQ O;  3CC2 V;  3SPC A;  2OTL V;  1VQ4 V;  2JGD B;  1QQC A;  1ZTE A;  3I55 V;  2IW5 A;  4X8A A;  4CBC A;  1JMK C;  1R6T A;  2EZP A;  1AIL A;  2EIK B;  1N33 B;  3P3N A;  1WP7 A;  2QJ1 A;  3L73 H;  2EIK C;  5C93 A;  2YIC A;  1DK1 A;  2PTM A;  2ZNI A;  3RN4 A;  4LFC O;  1Q3E A;  1XI1 A;  4YJ2 A;  4QJF B;  3ZRX A;  1GN6 A;  3E89 A;  4PEL A;  3ZBH A;  5E1A C;  1WB8 A;  5FL7 G;  1F23 A;  1QLE C;  4QE9 A;  1WNS A;  4QPK A;  1NVP D;  1EM1 A;  1H2S B;  1K9M W;  2YIA A;  4DO2 A;  4TT3 G;  4MVS A;  4LCU C;  2LFS A;  4GKJ B;  4Z1V A;  3K08 A;  1OCC B;  2E76 B;  3CME V;  3ZN1 A;  2YSU B;  3ZMV A;  1OCC C;  5FPR A;  1G4Y B;  2O57 A;  1Z5W A;  4JYB A;  4B7K A;  2A79 B;  3KZI Z;  3RGB A;  3TK1 A;  1BQZ A;  2IJK A;  1P84 F;  4YHH O;  1FAF A;  3OTO B;  3OMN B;  1CEZ A;  4B3S B;  2X0L A;  4WCE V;  3JAK B;  4CH5 A;  1SQG A;  1MMM A;  4PHZ A;  1XUQ A;  3EXA A;  1I5X A;  3JD4 A;  4LF7 O;  2UXD O;  1IX9 A;  4AQY B;  3H1H H;  4FLV A;  4DV7 O;  4X20 A;  5J9P C;  4X9Q A;  2JS3 A;  2FL4 A;  2ZE7 A;  3ZX6 A;  1T5E A;  2F95 B;  2M6Y A;  1RSO B;  5GTH Z;  3F7Y C;  3H1L H;  1Y76 B;  1M90 W;  1MSD A;  2LW7 A;  2VQF B;  2ZNJ A;  2UXB B;  3TXQ A;  5EK0 A;  1I94 O;  1NJI W;  2CTP A;  1Q5O A;  1WA8 A;  1B6Q A;  4H33 A;  4LR3 A;  3K58 A;  4UCS A;  1JOY A;  2LGW A;  4J7K A;  2KKW A;  3CP1 A;  2P6J A;  2IH1 C;  2YEV A;  2H8P C;  4YJ2 B;  1YI2 V;  5KHJ A;  1BCC H;  3EFF K;  3NR7 A;  1IBK B;  5H6R A;  2ARH A;  2ZCE A;  4QE7 A;  2E5L B;  1AI6 A;  2Y4U A;  4ASU G;  4JF3 A;  3JD1 A;  2PY5 A;  4X1I A;  4F4L A;  1UJW B;  1AR1 B;  1Z5V A;  2XAH A;  4O4J A;  1XNQ B;  2NLJ C;  1XBL A;  5H6Q A;  5KA5 A;  2YC0 A;  2Q73 A;  1IDS A;  3ABK B;  2CK3 G;  4ZOL A;  2IH3 C;  3ABK C;  4R50 A;  3J7A U;  3KCX A;  4DW0 A;  4LFC B;  3D36 A;  4B08 A;  2P4V A;  5CMU A;  5L3F A;  5FLX N;  4GX1 A;  2X6B A;  3H01 A;  4Z1M G;  4X20 B;  1Q82 W;  2DYS B;  3DSQ A;  4LBE C;  2FTK A;  3G80 A;  5DN6 G;  2UXN A;  3A0H Z;  2DYS C;  1NKD A;  1YEW A;  2XT9 A;  3UKM A;  2QR4 A;  1KP3 A;  3K06 A;  4OPA A;  1N0N A;  4PDM A;  2P90 A;  1JA8 A;  3BA8 A;  3QNE A;  2RQ6 A;  3CJH A;  5BY1 A;  4CH3 A;  2JS5 A;  5KA6 A;  1WA8 B;  5LA6 A;  2YI9 A;  1D5A A;  1PL0 A;  1OCR B;  4YHH B;  1OCR C;  1P4R A;  4F6R A;  3UT5 A;  3DGE A;  1SA0 A;  4CC6 A;  2YEV B;  4LF7 B;  1QHT A;  2UXD B;  4DV7 B;  1CXZ B;  5GON A;  2OWO A;  1V54 B;  4LFB O;  3BRC A;  1K7D A;  2QEX V;  4RUE A;  1YHQ V;  3RWR D;  2W6J G;  1V54 C;  4UCV A;  2OCC C;  2Q0O C;  3B2E E;  1VQN V;  1JCH A;  1LNQ A;  1IBM O;  4X1I B;  4U7O A;  1ZUQ A;  1VQ8 V;  3QO8 A;  2BSK A;  3FB5 C;  3CCE V;  3OD4 A;  4O4J B;  2BCC H;  3FYE B;  2R9I A;  4BW9 A;  4DV2 O;  1I94 B;  5TIS Z;  3ZRV A;  4ZOL B;  4FLW A;  5EBW C;  5KHG A;  3CC7 V;  2GUZ A;  3ABU A;  5LMN O;  4JI6 B;  2XAS A;  2IM9 A;  4LF5 O;  1SQX H;  1GM7 A;  1GK9 A;  4DYL A;  5CA3 A;  1DGS A;  5LXT A;  3K57 A;  3AG2 C;  2E75 B;  1Q6U A;  1JVM A;  1K8A W;  5C8Y A;  2H94 A;  3W7S A;  2RCV A;  3PJS K;  4U3J A;  3EHB B;  1WPB A;  2XAQ A;  3ZJZ A;  2ZIM A;  2A7W A;  1UFI A;  4NYK A;  2P5O A;  2WLN A;  1IBL B;  4B3R O;  3WB2 A;  2EJ7 A;  4LFA O;  4DUZ O;  1YVW A;  4J10 A;  2M7W A;  4J11 A;  3OGI B;  3CJH B;  4IYI A;  1S5J A;  1EZV H;  5LA6 B;  3P30 A;  3OUS A;  3VOU A;  1VQM V;  4K8Z A;  2UU9 O;  4DR6 O;  3H9V A;  1ZWI C;  4F6R B;  3W7X A;  1V55 C;  2KQX A;  4GYC B;  1QR8 A;  1Q90 D;  4Q20 A;  3UT5 B;  2BE3 A;  1SA0 B;  3OEE G;  5EZY A;  5GON B;  1SRY A;  1ARO P;  2PGG A;  4FFK A;  4MVR A;  1KYO F;  3DC5 A;  4GCZ A;  1AR4 A;  1THZ A;  2PYJ A;  4UCR A;  4I50 A;  1HP8 A;  4K35 A;  3D8C A;  1K4D C;  1PL4 A;  3I5D A;  3A8T A;  1BE3 H;  5KHI A;  3CSX A;  3BHP A;  3JAM N;  1DLB A;  2BSK B;  1OZ0 A;  1PNK A;  5IY5 B;  2CTQ A;  4UCU A;  1JX9 A;  3ZMU A;  3F5T A;  5IY5 C;  3W7W A;  5FNV A;  3E35 A;  1NT2 B;  4J42 A;  2XND G;  4PI0 A;  3OAA G;  4MVZ A;  2GUZ B;  4ZBM A;  1XMQ O;  1KD1 W;  3B4S A;  3W7T A;  1NI8 A;  1DF4 A;  4N21 A;  2YDE A;  3N2K A;  4RQE A;  1TUB A;  4YY3 B;  1R3J C;  3RYH A;  1VQK V;  1I0H A;  4LH6 A;  3ZN0 A;  4LFB B;  2RMK B;  5LXT B;  1EN5 A;  5IJ9 A;  1XIL A;  4PA9 A;  1N34 O;  4X65 O;  3AG4 C;  1HNX O;  1BQ0 A;  5C8Y B;  3CCR V;  4U3J B;  4KHP O;  3CCU V;  3GWO A;  4JI0 O;  1IBM B;  3QF7 A;  4JTD B;  4J9Z B;  1YCI A;  4UB8 Z;  3FKS G;  5B1O A;  1YF2 A;  1VP7 A;  2P06 A;  1BT8 A;  4DV2 B;  2MW2 B;  2QWR B;  5B1A B;  3FD9 A;  3JAL A;  2ZXW B;  2VWK A;  1NQT A;  1GH6 A;  2YXL A;  5B1A C;  2ADQ B;  4BW5 A;  5B66 Z;  3IGA C;  1PKX A;  3OR6 C;  5LMN B;  4HYO A;  5LGU A;  5LMU O;  1R1B A;  1RP3 B;  3WG7 B;  3K9A A;  3P32 A;  1AR5 A;  3O9O A;  4FMT A;  5H9C A;  1LUV A;  3JYC A;  3CE2 A;  3K5N A;  4OGQ B;  1GRJ A;  5EZY B;  1JJO A;  4CZZ A;  2BTQ A;  3M7M X;  2AHY A;  4I5S A;  2RJZ A;  2ZE6 A;  1ENV A;  4RUF A;  4GX5 A;  4X1K A;  4I7Z B;  1R6N A;  4QIW F;  4I50 B;  5EC1 C;  2BTO A;  2ZM6 O;  3L9D A;  1U97 A;  2Q69 A;  3ZMS A;  1H38 A;  2DOS A;  4MTX A;  5LL6 Y;  4DR2 O;  3B8M A;  4B3R B;  4LFA B;  4MVM A;  4DUZ B;  3R66 A;  1MOF A;  2VWJ A;  3L74 H;  4RO2 A;  2Q7H A;  2H3O A;  2XAF A;  1D2D A;  5JQG A;  2F4V O;  4EB6 A;  2XAG A;  5FNV B;  2EIN B;  3O65 A;  3THO A;  3ML0 A;  4CC5 A;  3K04 A;  2UU9 B;  3JD2 A;  4DR6 B;  3CMA V;  4FM0 A;  3ABT A;  3AG1 B;  2HEP A;  3N2K B;  3RW0 A;  2WAM A;  1TUB B;  5EBL C;  3PN1 A;  4FLX A;  4ABM A;  3RYH B;  3FYI B;  2YID A;  3QO7 A;  3B09 A;  5IJ9 B;  3LDE A;  2Q6A A;  4UFZ A;  2WLK A;  1ZX3 A;  3MHH C;  4H13 B;  2JEU A;  4IYH A;  4BIZ A;  2WA3 A;  4JTA B;  3SPH A;  4TSF G;  2QWO B;  3BFR A;  4CS4 A;  1Q86 W;  2A0L A;  2AGA A;  3B77 A;  2OYQ A;  4NR1 A;  2ADP A;  2ZIO A;  4KL1 A;  2JRI A;  1P7G A;  4EEQ A;  1D5N A;  1MZE A;  1XMQ B;  5BMV A;  2Q4P A;  1O9H A;  2GTA A;  2Q68 A;  4WF9 V;  1G6U A;  1X59 A;  4JZG A;  3CHX A;  1N34 B;  4X65 B;  3CRM A;  1QLE B;  4JAS A;  2MK3 A;  4DUY B;  4X1K B;  1SC5 B;  3CYO A;  3ETD A;  4I55 A;  4JI0 B;  1R3K C;  1I5Y A;  3JCZ A;  4YIP A;  2LJ2 A;  4X66 O;  4K0K O;  3FAV A;  3MAQ A;  2ZQM A;  3SJQ C;  1PM9 A;  2HJD A;  2GV9 A;  4LF9 O;  4F6E A;  4OX9 O;  2XUM A;  1ZSP A;  4BIO A;  4EKW A;  4L87 A;  1QR9 A;  3E22 A;  5E79 Z;  2ODM A;  5JQG B;  4EB6 B;  3T1H B;  4O4L A;  3ASO B;  3IFX A;  3OE7 G;  2WLI A;  4C7U A;  3U0Z A;  1YJN V;  5LMU B;  5L3E A;  3ASO C;  3M99 B;  4AHC A;  4MS2 A;  1QLN A;  4TOI A;  1M4U A;  1AI4 A;  3F7V C;  1ORQ C;  3CS5 A;  1NBM G;  1YTF D;  5IYD O;  3CXH F;  1AJN A;  1BZK A;  2DQ0 A;  5BZB A;  1NR1 A;  4JI8 O;  3HKD A;  5B3S C;  1Y6X A;  4DR2 B;  4IIJ A;  2EJR A;  3I56 V;  3RVZ A;  1EFR G;  3B40 A;  2IJI A;  3CB2 A;  4HZ3 A;  2HJF C;  3F5W C;  3B8N A;  4JI1 O;  2F4V B;  2R70 A;  4I9Q A;  1SES A;  3UQ8 A;  1N32 O;  1I7F A;  4KFM A;  3OW2 U;  1FXK A;  1VAR A;  3TJT A;  5JH7 A;  3T4Z A;  2WSS G;  5LOV A;  5BMV B;  4UB6 Z;  4LF6 O;  1GN2 A;  4FJC C;  4WFE A;  1YIJ V;  4FZ1 A;  3JAW A;  1XRE A;  1GM9 A;  3GB7 C;  2EIM C;  3A0R A;  2HVK C;  3W7U A;  3ICX A;  3SYQ A;  4I55 B;  3G6B A;  4PDL A;  4NB5 A;  2DWD C;  3FAV B;  1Q7Y W;  4PA3 A;  5D5Q A;  2UUC O;  1TAE A;  2LFR A;  1GN4 A;  3ZHR A;  1AP5 A;  3E22 B;  2QDO A;  1B3Q A;  4D6T H;  4YXW G;  5CA0 A;  1IUR A;  4K3A A;  4O4L B;  5F2V O;  2VQE O;  3JAS A;  2WLI B;  2IJJ A;  3CXC U;  2N05 A;  4NTW A;  1BSM A;  3ZHU A;  2DYR C;  1RPO A;  3OTF A;  1KB9 F;  2WPD G;  2LW1 A;  3OMA B;  1PV0 A;  1WN7 A;  5EC2 C;  2FKX A;  2QM8 A;  5B5E Z;  2X6A A;  5DM6 V;  4WBN A;  4U7N A;  3FB6 C;  4LF8 O;  5HFL A;  1F51 A;  3HKD B;  4UCO A;  3SYO A;  4X66 B;  4K0K B;  4J7J A;  4DV6 O;  3OEH G;  5CBF A;  1X4T A;  1XNR O;  4IIJ B;  4LF9 B;  4DV0 O;  4OX9 B;  2ZR3 A;  3DTU B;  3E2E A;  1KQS U;  3J81 N;  5A9G A;  2N04 A;  3UO2 A;  4PD4 F;  3QG5 A;  2CAZ C;  2F93 B;  5CN0 A;  1FXK B;  5JH7 B;  4JI3 O;  3C3T A;  3CCM V;  1GO3 F;  2F23 A;  2Q67 A;  4FLY A;  4JYA O;  4HBN A;  3R65 A;  3UM7 A;  1FXK C;  1SKV A;  4R8C A;  5LOV B;  1ZAU A;  3WB0 A;  1URF A;  3E86 A;  3JAR A;  1VQ6 V;  3CRR A;  3AG3 B;  3RYF A;  3JAW B;  4E4E A;  1NS1 A;  3AG3 C;  2QE7 G;  2OCC B;  2P22 C;  1JPX A;  5LHH A;  1H2N A;  3NXS A;  4JAU A;  3SJC C;  3SPJ A;  2A06 H;  3BA9 A;  1W0K G;  3G67 A;  1H2L A;  2IJH A;  5KUK A;  4XDL A;  3WB1 A;  1H8E G;  1XL6 A;  3ZCC A;  4N23 A;  4H0L B;  4JI1 B;  1OCZ C;  5KAI Z;  3L71 H;  5CA0 B;  1N32 B;  4WFA V;  3JAS B;  4E2L A;  1H2K A;  4PA7 A;  5GTI Z;  5EIB C;  5IE9 A;  4LF6 B;  4WFF A;  4IHJ A;  2IU3 A;  3SGI A;  1Y67 A;  1YXB A;  3OGC C;  5J2T A;  3AG2 B;  1XMO O;  4BR6 A;  4WBN B;  4NKG B;  2YI8 A;  3BVO A;  1K33 A;  4MTF A;  4OPH A;  1FFT B;  2WLM A;  1TGO A;  4FLZ A;  2Q8V A;  3CCV V;  2AZ0 A;  1V9P A;  2BOB C;  2GDS A;  3S3W A;  4GKK O;  2Q0A A;  1ZLZ A;  1SQF A;  1NR7 A;  2PZS A;  3E8B A;  4J80 A;  4RWU A;  2JK5 C;  5K1X A;  2HHH O;  3OM3 B;  1SF9 A;  1FPO A;  4TV9 A;  1NTM H;  4J41 A;  3BY6 A;  1RPR A;  2VQE B;  3ETE A;  4DV4 O;  1V55 B;  4B3T O;  2FYU H;  2WWW A;  3TXS A;  3RVY A;  5JWP A;  3RBZ A;  1OHH G;  4LF4 O;  3JAR B;  1IVS A;  4MW8 A;  1R3L C;  3RYF B;  3U11 A;  1YIT V;  1NTK H;  2JEX A;  1Q81 W;  2Z5U A;  4PA6 A;  2DMX A;  3ZS8 C;  4LF8 B;  2YXY A;  2ILM A;  4DV6 B;  1VQ9 V;  2B5U A;  3TCU A;  4P9P A;  3ZED A;  3CCL V;  4JI5 O;  2CTR A;  2HP8 A;  1XNR B;  3HKE A;  4UVC A;  3WU2 Z;  3T1Y O;  5EYP A;  3BCC H;  4X64 O;  2WA4 A;  4DV1 O;  3OMI B;  5LP6 A;  1SQP H;  3L72 H;  2HLD G;  5JJJ B;  1TUE B;  2CUG A;  3ZHQ A;  3BAB A;  1KC8 W;  3SPG A;  4JI3 B;  2E3C A;  1Q43 A;  2AW9 A;  1SQV H;  1GTO A;  3J80 N;  4BIU A;  4JYA B;  4QGP A;  2CE4 A;  1BHB A;  1WJZ A;  4FLT A;  1JQ0 A;  4I0X A;  1K3E A;  4IHJ B;  4O4H A;  2KG7 A;  1HWY A;  4TQD A;  5DED A;  1S3J A;  5J2T B;  1Y4M A;  1XEQ A;  4R7C A;  1U96 A;  3AG4 B;  4MTO A;  2YS8 A;  4LC1 A;  2R72 A;  1VF6 C;  1J95 A;  4ICG A;  3AG7 A;  4YIO A;  1US6 A;  1CPY A;  3ABM C;  3FB7 C;  1WB7 A;  4UUJ C;  3SYP A;  4O4I A;  1QNM A;  3LSQ A;  2E74 B;  5IT9 N;  4I9W A;  3RYC A;  1AB3 A;  3DXR A;  5LYJ A;  1H2G A;  4TV9 B;  5D5P A;  3L75 H;  1FKA O;  3LUT B;  2LP7 A;  1MG1 A;  1S5H C;  1AI5 A;  2DW4 A;  3K5L A;  4BWA A;  1YJW V;  4HNA A;  4LF5 B;  1KP2 A;  3VQX A;  2XTA A;  1XMO B;  4FM1 A;  4U3F H;  4MTG A;  3STL C;  4DR4 O;  5JCO C;  3IC9 A;  4JAA A;  3SPI A;  1M93 A;  4UXN A;  3AEI A;  5KUM A;  3ZMZ A;  3OFN G;  1B06 A;  1K4C C;  3H1I H;  5JVD A;  4TQF A;  1NU1 H;  4GKK B;  1B04 A;  2WLL A;  2CH7 A;  3HKE B;  1P7B A;  1O9G A;  4MW3 A;  3CCS V;  4FM2 A;  1RM1 C;  3CD6 V;  2HHH B;  4XDJ A;  2QWQ B;  5EYP B;  3STZ C;  4DR3 O;  2ETN A;  1IXB A;  5LP6 B;  1MAB G;  4ZI7 A;  3AK2 A;  2XAJ A;  3JSN A;  1M5I A;  5LP6 C;  2XOK G;  4GT1 A;  5B1N A;  4DV4 B;  2DN9 A;  2DWE C;  1R73 A;  5KHH A;  4UV9 A;  4NXN O;  4I0X B;  4X88 A;  1ZL8 A;  4O4H B;  3HKB A;  4LF4 B;  2KG7 B;  4UVA A;  2UXC O;  5LGN A;  4DR1 O;  4UV8 A;  2QM7 A;  4JPR A;  4NTX A;  3C3S A;  4JYY A;  1SS3 A;  2W6I G;  3E8H A;  2NN4 A;  2V4D A;  2X7R B;  1VQ7 V;  3T2M A;  1ROP A;  4JI5 B;  3OUF A;  2GBO A;  3MD0 A;  1LR1 A;  3IC7 A;  3P3P A;  2YIB A;  4MVU A;  3A2F A;  4DV5 O;  4O4I B;  3T1Y B;  4RAI A;  4X64 B;  4DV1 B;  1IZ3 A;  1XL4 A;  3RYC B;  3JAL B;  3DXR B;  5LYJ B;  4PDR A;  2CDY A;  2OIG A;  1W2B U;  2JDI G;  4GX2 A;  1RSO A;  1R3I C;  3X2Q B;  2NNU A;  1VQP V;  1BMF G;  3LSU A;  2QGN A;  1I08 A;  1SZT A;  3JSL A;  4AI8 A;  1L1F A;  5BXZ A;  3X2Q C;  1EN4 A;  1Q6I A;  4HNA B;  3FFQ A;  3BEH A;  1XOU A;  2BTQ B;  3K0G A;  1HNX B;  1KEC A;  4WFG A;  4KHP B;  5JVD B;  5JJE B;  1RFY A;  3IAY A;  2WLL B;  1AVM A;  1FYJ A;  2CH7 B;  4TUY A;  4D7S A;  2LQT A;  3CC4 V;  1J5E O;  4YJ3 A;  3HKC A;  1VF5 B;  4DXW A;  2B1G A;  2L6L A;  5J2U A;  1Q6H A;  2EBO A;  4BAY A;  4ZI7 B;  1Y74 A;  5BR8 O;  2EX3 A;  1SER A;  4I4T A;  4DK0 A;  2XHB A;  3UCS C;  2K9P A;  1QU7 A;  3ETQ A;  3CCQ V;  5HFM A;  5CBG A;  2ZKO A;  2K1E A;  1ZL8 B;  3HKB B;  4P9O A;  4DR4 B;  1FJG O;  4FPP A;  1H8H G;  2C2A A;  2ZE8 A;  5LHG A;  5B3S B;  4D7T A;  2ZM6 B;  2DQ3 A;  1K34 A;  1R6K A;  1BL8 A;  4JI7 O;  3ZRW A;  2RN9 A;  4NXM O;  3U10 A;  4J9Y B;  1NH2 B;  1JFF A;  1S77 D;  1N4C A;  4DR3 B;  4WFH A;  2JVD A;  1MSW D;  5ITZ A;  4PI2 A;  1YJ9 V;  5A2Q N;  4LP8 A;  2PYL A;  3UO3 A;  3MHS C;  2DE0 X;  4WFB V;  1M1K W;  2ZDI C;  4MVQ A;  2RDC A;  2F43 G;  4NXN B;  2EIL B;  3E8G A;  2HKO A;  2UXC B;  4TV8 A;  4GX0 A;  5H5N A;  1AJP A;  5IYC O;  4DR1 B;  4X1Y A;  2EIL C;  1M56 B;  5H2F Z;  1TA8 A;  2EIM B;  4GZR B;  1M56 C;  2Q7G A;  3OR7 C;  2WLH A;  3JAT A;  3G6E V;  4PA4 A;  2F1M A;  2Y0P A;  2W0F C;  3D3Q A;  4KP4 A;  3N2G A;  4JI6 O;  1VEW A;  1YZB A;  1WLE A;  2Q9L A;  2YUA A;  4TUY B;  4JV5 O;  4DV5 B;  5L3G A;  5EIB D;  2QTS A;  5GW7 A;  1KUQ A;  4YJ3 B;  1VF7 A;  3HKC B;  1Q8I A;  2QWP B;  2KB1 A;  5J2U B;  4DV3 O;  1PPJ H;  5CBH A;  1Y74 B;  5LHI A;  3JD3 A;  2A9H A;  3K9S A;  2LGQ A;  2DYR B;  3HPL C;  4I4T B;  2CGN A;  2HVJ C;  2PF4 E;  3A0B Z;  2ZD9 A;  4NTY A;  1N36 O;  2VS0 A;  3C90 A;  1VQ5 V;  2Z3Y A;  1IBL O;  1K5S A;  1M57 B;  2IBZ H;  2HR3 A;  3ZHS A;  4DW1 A;  4GUN A;  1GKF A;  1NVP B;  4G2K A;  3K3W A;  2BOC C;  1M57 C;  3CRC A;  3ETG A;  3IJ4 A;  3EVK A;  2EUL A;  1QBZ A;  4MVO A;  1XHZ A;  4X62 O;  5L3D A;  1KMI Z;  5L3C A;  4FIP C;  5K1P A;  4OXS A;  1W0J G;  3KG2 A;  1S5L Z;  2N74 A;  4JI2 O;  4W4K A;  4J7Z A;  2Y48 A;  3H1J H;  3ZRW B;  2GHY A;  1AI7 A;  1F7Y A;  2JGU A;  1J5E B;  1JFF B;  3M8A A;  2R9R B;  3K5M A;  1HR0 O;  1JR9 A;  5ITZ B;  3E8F A;  3N27 A;  5BR8 B;  3T1C A;  2QTO A;  3ZHV A;  4R6Z A;  1YTF B;  4A5U B;  3G71 V;  4ZKI A;  4G27 B;  4DK1 A;  1S72 V;  3SYA A;  2NR5 A;  4LNU A;  2ZT9 B;  4EFE A;  4LWS A;  4TV8 B;  1FS0 G;  4X1Y B;  4PDV A;  2UUB O;  1FJG B;  3Q4H A;  4XDK A;  5KAF Z;  3K79 A;  1HNZ O;  4CH6 A;  1S0V A;  4FZ0 A;  1SET A;  4HAM A;  3CCJ V;  1F4M A;  4TWK A;  3ASN B;  1FFX A;  3SDL A;  4JZ2 A;  2PUS A;  3JAT B;  4JI8 B;  2QKA A;  4XBF A;  1JJ2 U;  2D2C B;  1MZF A;  3ASN C;  2JIZ G;  1BHA A;  3N2G B;  4KXR A;  4O2A A;  4JI7 B;  4NXM B;  4DR5 O;  4YY3 O;  4IL6 Z;  1EBO A;  2CGO A;  3VBB A;  1OCZ B;  1Y66 A;  1N8R W;  3LNM B;  4DRX A;  1VQO V;  1FXH A;  2PI5 A;  2P7T C;  1EN6 A;  3AK1 A;  4FVM A;  4CH4 A;  3D3I A;  1K73 W;  4UVB A;  1S76 D;  1H2M A;  5IWA O;  3L70 H;  2ZE5 A;  2Z0A A;  5FPO A;  5LGT A;  3ZIA G;  5CB4 A;  2QSA A;  4G28 B;  2Y0I A;  4JI4 O;  3MDS A;  1HNW O;  4JAV A;  1M9N A;  4JYC A;  4RQF A;  2GSM B;  2YXH A;  5DEC A;  1VF6 A;  1W59 A;  2OT5 A;  1L0L H;  2DJV A;  2KSD A;  5IYZ A;  5AG2 A;  1K97 A;  1PNL A;  4FLU A;  4JV5 B;  2UUC B;  2QKC A;  2B1I A;  5KX5 A;  3D36 C;  1L8D A;  2JJ2 G;  4DV3 B;  1FXV A;  3KKY A;  5IYB O;  1K5Q A;  1DF5 A;  4DR7 O;  4FFB A;  4QPJ A;  4FK5 C;  1YDX A;  3LDC A;  1LUW A;  4CS2 A;  1VMG A;  3E83 A;  1OCO B;  4B7E A;  1N36 B;  4K8X A;  3DC6 A;  1E1R G;  1OCO C;  3LDD A;  4H37 A;  3SR2 C;  4L8J A;  3HR0 A;  1MA1 A;  2RNB A;  2UUA O;  4LNU B;  4LWS B;  2Q5Z A;  5JCO A;  3HB3 B;  1COW G;  5B1B B;  3Q4H B;  3APO A;  4B3M O;  4X62 B;  1HDJ A;  2B9Z A;  4LH7 A;  5B1B C;  4MSW C;  1GMG A;  1FFX B;  1MNG A;  1A32 A;  3TGU H;  2ATK C;  1SQB H;  3RYI A;  4JI2 B;  4ZHQ A;  4O2A B;  2AZ2 A;  1CP9 A;  2WLJ A;  1NZ6 A;  3ZMT A;  1OV9 A;  3RFR A;  2L35 A;  1KKC A;  4DV0 B;  4JTC B;  1OJH A;  2ZIN A;  1HR0 B;  2EIJ B;  1PP9 H;  4AIL C;  4DRX B;  4X89 A;  2EIJ C;  2PI4 A;  5LBQ A;  1IXM A;  3G4S V;  3VQW A;  3QO5 A;  3AK3 A;  3JD0 A;  4PV1 B;  2VRZ A;  5EBM C;  2LO1 A;  3S3X A;  3CRA A;  3K03 A;  2QA4 V;  2UUB B;  4KUM A;  1TVK A;  5CB4 B;  5IDJ A;  5KMG A;  1HNZ B;  2CTW A;  2X6C A;  3KCY A;  1GN3 A;  5JJN B;  3QTC A;  2JJ1 G;  1N33 O;  4GLX A;  4P2Z A;  3SYC A;  4IGG A;  1F4N A;  2F66 C;  5IYZ B;  2ITD C;  4O2B A;  3ABM B;  2QKS A;  4DR5 B;  3APQ A;  1WPX A;  2QWN B;  3SJB C;  5KX5 B;  1WAZ A;  1FD9 A;  1E79 G;  1PD3 A;  3FB8 C;  1Z2G A;  3GWK C;  4DUY O;  4FFB B;  2FML A;  3K59 A;  4QNH B;  1AP6 A;  1QCE A;  2P4K A;  1KU9 A;  2ITC C;  5CA1 A;  5IJ0 A;  2OTJ V;  3ABL B;  2V7Q G;  3CX5 F;  5IWA B;  4GKJ O;  3ABL C;  3BAA A;  3CEI A;  1N0J A;  4JI4 B;  3TET A;  1HNW B;  1P49 A;  2JGD A;  1WP8 A;  4MT8 A;  2ZXW C;  1SQQ H;  1QVG U;  1G1X B;  2HFE C;  2UXX A;  3T1H O;  2A3Q A;  5KLV H;  3CRQ A;  5L3B A;  1BGY H;  1XDC A;  3FX7 A;  3ZRS A;  4H44 B;  1YSC A;  3OTO O;  3RYI B;  3VQY A;  5KHK A;  4CS3 A;  4B3S O;  3WFV A;  4ZHQ B;  4Q6G A;  3WG7 C;  1RM1 B;  2D3O W;  1BS3 A;  1K92 A;  4W4L A;  4UCT A;  3SJA C;  4AQY O;  3JCU Z;  4JGS A;  4DR7 B;  2GTS A;  4PJ0 Z;  2P67 A;  3K5O A;  2G38 A;  4Z2W A;  3K0D A;  1VQL V;  4IT5 A;  3LSS A;  2Q7E A;  1GM8 A;  3H1K H;  1NTZ H;  1SZX A;  4B3T B;  3GVM A;  1DTO A;  2VQF O;  2UUA B;  1KKD A;  2HG5 C;  2UXB O;  2QM4 A;  1VIB A;  1TVK B;  2V1D A;  4B3M B;  5KMG B;  2YIB D;  3CWB H;  1G8M A;  1NH2 D;  4EFB A;  3OT7 A;  1E1Q G;  3T4D A;  4ZIB A;  2EIN C;  2OCH A;  2ZR2 A;  1EZJ A;  2OIE A;  1UPG A;  4O2B B;  3JAK A;  2EZO A;  1PNM A;  3LNN A;  3AG1 C;  2FB5 A;  4P30 A;  3BPZ A;  3ZHT A;  1HW7 A;  1GAX A;  1XHX A;  2Y69 B;  2IU0 A;  1IBK O;  3VQV A;  1QVF U;  2AXT Z;  2Y69 C;  2E5L O;  2AHZ A;  3RT3 C;  1L0N H;  2ZDI A;  4NVP A;  2W0X A;  2Y4T A;  3CPW U;  5CA1 B;  5IJ0 B;  1Y76 A;  3QVN A;  1AJQ A; 
#chains in the Genus database with same CATH homology
 4U3F H;  1EZV H;  3L74 H;  3L72 H;  1KYO F;  1SQQ H;  3L75 H;  1L0L H;  1KB9 F;  2A06 H;  3CWB H;  3TGU H;  3H1J H;  5KLV H;  2IBZ H;  1SQV H;  1SQB H;  3H1H H;  1BE3 H;  3CXH F;  1BGY H;  3H1I H;  1BCC H;  1SQX H;  2FYU H;  3L70 H;  1NU1 H;  1L0N H;  2BCC H;  1PPJ H;  3H1K H;  3CX5 F;  4D6T H;  3L73 H;  1NTZ H;  1P84 F;  4PD4 F;  3BCC H;  1NTM H;  3H1L H;  1NTK H;  1PP9 H;  3L71 H;  1SQP H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...