1EZVH

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
74
structure length
74
Chain Sequence
b'VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 28
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1ezvH00
1SQPH 2BCCH 1PP9H 3L75H 3TGUH 1EZVH 2IBZH 1BGYH 1SQXH 4D6TH 3L70H 3L72H 1SQVH 3L73H 3L71H 2A06H 1NU1H 1BCCH 3CX5F 1NTZH 3L74H 1SQBH 1BE3H 4U3FH 3H1IH 1KYOF 1KB9F 3H1JH 2FYUH 1P84F 3H1KH 3H1HH 5KLVH 4PD4F 1L0LH 3BCCH 1NTKH 1L0NH 3CXHF 1NTMH 1PPJH 1SQQH 3H1LH 3CWBH
chains in the Genus database with same CATH superfamily
5HFLA 1FFTB 4FZ0A 4UVBA 3LSQA 4H37A 2P6JA 4EFEA 1Y76B 1TA8A 4G27B 4H0LB 4I9WA 2FL4A 2YUAA 3C3SA 1KU9A 2YIDA 4JI3O 4ZHQB 3VQVA 3K5NA 2CH7B 2ATKC 3OEHG 4JI5O 2OT5A 1EZVH 4I4TA 3BA9A 3CRCA 1S3JA 3C3TA 2CAZC 2RJZA 4UFZA 1WP8A 5H2FZ 5FL7G 3ZN1A 2OYQA 3E35A 4FMTA 1KB9F 1L0LH 5LBQA 4X89A 3D36A 4HZ3A 4J7ZA 2BCCH 2M7WA 3RYHB 4TQFA 4JI6O 4UV9A 4A5UB 2CTRA 5KAIZ 3RYFA 1QR9A 5B1AC 1MZEA 3WB2A 3N27A 1THZA 2CK3G 5ITZB 2NLJC 4DV5B 2CUGA 5H6QA 4BR6A 2EBOA 4N21A 2QKAA 5LOVA 4X1YA 3HKEA 1N33B 2F66C 4RWUA 2B5UA 1H8HG 1NR1A 5IYDO 2PI5A 3WU2Z 1IVSA 5EBLC 1WAZA 3HKDB 1GN2A 4I50B 4X88A 3RW0A 4DYLA 3T1HB 1K3EA 5KUMA 1NS1A 4DUZO 4NYKA 2QKSA 2JJ1G 5A9GA 4LWSA 4GUNA 5CA3A 1RP3B 1YITV 3FKSG 1XL6A 4FVMA 1V54C 4MTFA 4TOIA 4I5SA 1P84F 4JI2O 5B5EZ 2B1IA 3RYCA 1JR9A 4F6RA 3CXHF 4WFAV 2CTPA 4X66B 1XILA 3K03A 2BTOA 5H6RA 1RSOA 3TGUH 4TV9A 1GH6A 4FLUA 2ETNA 4JI7B 1YZBA 4U3JA 1LR1A 3JAWA 3RYFB 5EIBD 3M7MX 4Z1MG 2YEVA 1JJOA 3J7AU 2ITCC 2QJ1A 4LF8B 2ADPA 2WA4A 5KLVH 4IGGA 4DV0O 2Q5ZA 1ZX3A 2ZR3A 5CB4A 1E1RG 1OCZC 1YIJV 4EKWA 4LF6B 2ZE6A 4LH7A 3TXSA 2Y4UA 2V1DA 1IBLB 3B8NA 4HNAB 1VF7A 4YY3O 4FM1A 4QE7A 3CCMV 4B3MO 1VMGA 1QHTA 2RCVA 3FAVA 4J11A 5CN0A 3X2QC 1FPOA 4PI2A 2Z3YA 3LUTB 1VQKV 4PELA 2G38A 2F95B 3VBBA 1EBOA 3KG2A 4JAAA 2X6CA 1UPGA 4LWSB 3HKCB 5DM6V 1JX9A 4JI3B 3L9DA 1K8AW 3ETDA 4CH6A 1MZFA 4QJFB 2EZPA 2OWOA 1AR4A 1KP2A 3M99B 4O2AA 4WFEA 5B1AB 2L35A 4RAIA 1VQLV 2Y48A 2YIAA 4NXNO 5DEDA 3JD4A 1VF5B 2K9PA 3OEEG 3JAWB 2HJDA 3U0ZA 3SPCA 1R6KA 2YEVB 3CRAA 3CX5F 4RUFA 3FD9A 4IIJA 3IAYA 2XHBA 4JI6B 2AW9A 2AZ0A 2JEXA 4TQDA 3CE2A 4O4LA 1NKDA 5CB4B 1VQ5V 2A79B 2XAHA 3VQYA 3DXRA 4CH3A 1SS3A 4FFKA 4R50A 1FXVA 1X4TA 5L3EA 1IURA 3EVKA 4MVSA 2QGNA 3JARA 3LDDA 2Y4TA 4FLXA 3STLC 4QNHB 3QO8A 1DF5A 2P22C 2ZD9A 2ZNJA 1V54B 1I5XA 1S77D 1SQXH 4D6TH 5KHGA 4BW5A 2Q7GA 4DUZB 1S76D 4P30A 1OCRC 1VQ9V 5L3DA 3T1CA 3AG4C 4G28B 1IZ3A 1I94O 4IT5A 5CA0A 2QM4A 4B7EA 2QEXV 3P3PA 1MMMA 1WB7A 4NTWA 1ZTEA 1HR0O 4O2AB 5IJ0A 2F43G 3MHHC 3CYOA 1QNMA 4JI2B 3CJHA 2P4KA 4GYCB 5BY1A 1SZTA 2A7WA 2XAGA 1DGSA 5LMUO 4ABMA 1Z2GA 5FPRA 4CC5A 1CPYA 4O4LB 3RVZA 4X64B 1BZKA 5B1NA 1YTFB 3DXRB 4JI4O 1PV0A 4HAMA 4DV0B 4J80A 2MW2B 5KMGB 4O4JB 4OPAA 3SYAA 1OJHA 4UCVA 3GVMA 4ZIBA 4OPHA 4DV7O 1TVKB 3SPHA 1XHZA 2GUZA 1NH2B 4NR1A 4XDKA 4JI8O 1LNQA 4NTYA 4LNUA 4TUYB 4RO2A 4YY3B 2VQFO 1Q6UA 2UUBO 2WLMA 4LP8A 4QGPA 1ZSPA 4IYHA 1WNSA 2QM8A 1F4NA 3H1JH 4ASUG 1S5JA 3H1HH 1KKDA 4NVPA 2YSUB 2P5OA 1GM7A 3F7YC 4IHJA 4CS2A 4X65O 4DV6O 5IJ0B 1ZL8B 4K8ZA 2DOSA 5IY5B 4FM0A 1M9NA 4PA6A 5LXTA 3CRQA 1G1XB 2GDSA 5LGNA 4EB6B 5KHIA 4LF9O 3AEIA 4NXNB 3ABKC 4D7SA 2JS3A 3HKBA 5LP6B 2P67A 1GN6A 3A0RA 1COWG 1URFA 3QTCA 4PDMA 3T2MA 1K4DC 4DR6O 2IJJA 3ML0A 1LUWA 1YF2A 5IE9A 4FLVA 2Q68A 1H38A 4GCZA 3TXQA 5AG2A 4DV4O 2GUZB 2NN4A 5KA5A 1S5HC 1FXKB 4LNUB 4WFFA 4X1KB 5IYBO 2BSKA 4JPRA 2V4DA 5E1AC 3L70H 5B66Z 1KECA 2JEUA 4QPJA 2NNUA 2KKWA 3WB1A 3BFRA 2JJ2G 2LO1A 2R70A 3A2FA 2K1EA 5GONB 1I08A 2IU3A 1KC8W 2IM9A 1IBMO 5L3CA 3W7XA 4FPPA 2VWKA 1Q43A 5FNVA 1W0KG 3J80N 1I94B 2VWJA 2JRIA 3P3NA 1QLEB 2KSDA 3S3WA 1HR0B 1TUBA 5LXTB 3OD4A 3JAKA 3ZHQA 1SRYA 3B8MA 2EJ7A 1YCIA 1OZ0A 1Y74A 3HKBB 1WPXA 2UU9O 5GTHZ 4PDRA 2HLDG 4LBEC 1YHQV 1XUQA 3G4SV 5BXZA 1OCOC 5LMUB 1R1BA 3ZMSA 1NZ6A 1GKFA 4LH6A 4F6EA 3BHPA 3B2EE 1Y76A 2XAJA 3GWKC 3CMEV 4KP4A 2QTOA 4JI4B 2L6LA 3E83A 3B09A 4FJCC 1JFFA 4UCOA 3ABLB 3K06A 2BE3A 2H8PC 3ETQA 4DV7B 3N2KB 1AP6A 2BSKB 3NXSA 5E79Z 2LFRA 4JI8B 1U96A 4LFCB 2UUBB 4JI7O 5BZBA 1Y4MA 5KHJA 2W0FC 1GK9A 1SKVA 2CTWA 4PJ0Z 2LJ2A 1NR7A 3RYHA 2NR5A 1NQTA 2LGQA 2IH1C 5K1PA 4I55A 5ITZA 2PYLA 3STZC 1CEZA 1JCHA 3SPJA 4CS3A 1TUBB 4X65B 4DV6B 2UUCO 3SYPA 1AROP 1M5IA 3RWRD 3UCSC 4KHPO 1XBLA 2GTAA 4DK1A 3SYQA 4JI0O 1AI7A 4KL1A 5D5PA 1YSCA 3K59A 1XMOO 4LF9B 4W4LA 4QPKA 3QF7A 1NVPD 4LCUC 3RFRA 4DR4O 4TSFG 3ZHVA 4H44B 1US6A 3HKDA 3CCSV 4I50A 5KHHA 3AK1A 4DR6B 3W7WA 1E79G 3O9OA 3R65A 1PL0A 1Y6XA 4J7JA 4LF7O 4JYBA 3K0DA 4I0XB 3SPGA 1JFFB 3H1LH 1XHXA 3JATB 1KUQA 4DR7O 4DR5O 3QO5A 4DV4B 1PNKA 3P32A 1QBZA 4B3RO 1N4CA 5LYJB 2CTQA 2DN9A 2YXHA 1NBMG 2WAMA 2QWPB 3E8GA 4MTGA 5IJ9B 3SJBC 1UFIA 3FYIB 1F4MA 3R66A 4GKJO 3K3WA 4LF5O 1HNXO 3G67A 1VQ6V 1WA8A 2JGDB 2GHYA 4B7KA 1PP9H 4FZ1A 2MK3A 5C93A 3APOA 3E22A 2QWNB 1K9MW 3T4DA 1XMQO 2PY5A 3UQ8A 4I55B 1JOYA 4JZGA 1IBMB 3THOA 1OCOB 4EEQA 3OMAB 1R3KC 2DWEC 3G6EV 1FFXB 4U7OA 3ZJZA 2AGAA 1PNMA 2Z0AA 1D5AA 4HNAA 4ZBMA 5J2UB 1W59A 1NJIW 3B77A 3IGAC 2ZXWB 4PV1B 5CBGA 1ORQC 3IC7A 2UU9B 3DSQA 2YC0A 3CCLV 5KA6A 1AILA 1R6NA 3CRMA 4F4LA 4Z2WA 4L8JA 3HKCA 2WLKA 4I7ZB 2ZCEA 4Q20A 1RPOA 2UXBO 5JJJB 5D5QA 2QDOA 3B40A 3MAQA 1M1KW 4JAVA 3EXAA 4FLWA 4GLXA 4WBNB 5JQGB 1H2NA 2BTQB 4IL6Z 1WA8B 3QO7A 1VIBA 2F93B 1ZUQA 4DO2A 1VQOV 5CBFA 2RNBA 3E22B 4QIWF 2XOKG 4X64O 2KQXA 5J2TB 3K57A 5F2VO 1VQ7V 2HFEC 5IWAO 1H2SB 3CCJV 3BCCH 4TWKA 2E5LO 1SZXA 1EN6A 1XL4A 4BIOA 2WLHA 2Q69A 2R9RB 3BABA 3RVYA 2ZQMA 2GSMB 2F23A 3OTOO 1N8RW 1L1FA 3B4SA 3BY6A 2UUCB 1GMGA 5GW7A 2EZOA 2DYRB 4KHPB 4Z1VA 2GV9A 4JI0B 1QR8A 1XMOB 2HR3A 3CCQV 2OCHA 1WLEA 1OCCB 4DR4B 1R3LC 1P7GA 3OMNB 1HWYA 4LF7B 1VP7A 1QCEA 4K35A 1CP9A 1GRJA 4P9OA 4DR1O 4GX5A 1LUVA 4DR7B 4DR5B 4PD4F 1VQNV 4K3AA 4B3RB 1AI5A 3TJTA 1GM8A 4E4EA 4BAYA 5K1XA 3FFQA 5JVDA 2Q67A 3FB7C 4WFBV 1S72V 4GKJB 1WB8A 2UXDO 1N34O 1H2KA 1TUEB 4LF5B 3ZHRA 1HNXB 5TISZ 2EIMB 2Y0IA 1K97A 2X6BA 3UKMA 2DWDC 3MDSA 5A2QN 1SC5B 4MTXA 5B1OA 1VQPV 2ZM6O 5IY5C 5CBHA 4B3SO 4YXWG 3ASOB 1XMQB 4L87A 3CSXA 3K5MA 2QM7A 1M56C 1KQSU 3AK3A 5IYZB 4G2KA 4MVZA 4XBFA 3DTUB 5LP6C 3SPIA 4O4JA 5KMGA 2ZIOA 1NU1H 4B3TO 2A9HA 2EINC 1TVKA 4DV2B 2W0XA 1I5YA 3JALB 4TUYA 4XDJA 3W7TA 2FB5A 2WWWA 3OM3B 5EBWC 4XDLA 1RM1B 1KD1W 1AJPA 1HNZO 2JVDA 2ADQB 4NTXA 3UO3A 4H33A 5FPOA 3VQWA 2VQEO 1FXKC 3JCZA 3ZRWA 1NT2B 1Q7YW 4X20A 2PGGA 3OGCC 4PA7A 1WP7A 3APQA 1YVWA 5LHIA 1N36O 2N74A 2V7QG 4IYIA 1UJWB 2UXBB 1ZL8A 3OUSA 5JVDB 1FYJA 3PJSK 1Q6HA 3WB0A 4LF4O 2AZ2A 2ZNIA 3L74H 1QVFU 2Q6AA 5EZYB 3E8BA 2H94A 4HYOA 2DW4A 4PI0A 3OT7A 1IDSA 2LW1A 3K5OA 4EB6A 4NB5A 4D7TA 1Q86W 1SA0B 3OR6C 3BAAA 2QKCA 4GX2A 5LP6A 1B04A 3JD2A 1QLEC 4DRXA 2Y0PA 1PPJH 4KFMA 2JGUA 1ZAUA 4ZOLA 2P06A 3ZRXA 4FIPC 5IWAB 2X6AA 3BPZA 1K4CC 3E86A 2M6YA 2E5LB 5KX5A 1Q5OA 3ASNC 1JA8A 1L0NH 1YEWA 3OTOB 1W2BU 1E1QG 1B06A 2YXYA 3CEIA 1FXKA 1GO3F 3I55V 4LFCO 2DQ0A 4X1KA 3JD3A 1AI4A 1K5SA 1D5NA 3CHXA 3E2EA 3CCRV 1SQVH 3D3QA 4GKKB 3ABLC 3K04A 5DN6G 5LHHA 3ZRWB 3SR2C 1ZLZA 3ZHUA 4X20B 2FYUH 5H9CA 1Z5VA 5KUKA 1PNLA 2KG7A 3AG2B 2UXCO 4JTAB 4R7CA 4PDLA 5GONA 3CB2A 2DQ3A 3AG1C 3JCUZ 4JGSA 2OTJV 5CA1A 2LW7A 1N32O 4DR1B 2IBZH 3CC7V 1GAXA 2VRZA 1WPBA 2P4VA 2QSAA 4UXNA 4PDVA 3ZX6A 1BE3H 1BHAA 4DV3O 1VQ4V 1B6QA 1M56B 1SETA 1X59A 1K33A 1EFRG 2UXDB 1N34B 4DRXB 1EN4A 3ABMB 2EINB 2PF4E 1QLNA 1KP3A 1G6UA 4ZOLB 5LL6Y 5EIBC 1D2DA 1T5EA 5H5NA 3S3XA 2ZM6B 4B3SB 1SQBH 4GZRB 4JTCB 5KX5B 3Q4HA 3N2GB 1QU7A 1W0JG 3FB6C 2EULA 4LFBO 1NVPB 1O9HA 3CWBH 4U7NA 3CC4V 1SQPH 4B3TB 1J95A 2LQTA 4YIOA 2UUAO 3N2KA 4DV1B 2DE0X 2RMKB 3ZBHA 3D8CA 5EBMC 1K73W 3LSUA 4O2BA 1KYOF 3OAAG 3CXCU 1HNZB 2HJFC 1FJGO 3ZHSA 2N05A 2KG7B 1BL8A 3DGEA 4OX9O 2VQEB 4TV8B 2PUSA 3U11A 1EN5A 1DF4A 1XQ8A 5CA1B 2B1GA 2HP8A 2FTKA 1YJNV 3ETEA 2A06H 1N36B 2XASA 4AHCA 2ZDIC 1MA1A 1S0VA 4UVCA 1AR5A 4LF4B 2IU0A 4JYYA 3IFXA 3A0BZ 2ZT9B 3RT3C 4YJ2B 2HHHO 1Q81W 4PHZA 1MOFA 4MS2A 1YI2V 4K0KO 3ASNB 4UB6Z 5BR8O 4O4IA 3UO2A 4GT1A 3UT5B 3WG7C 2YIBD 1QVGU 3Q4HB 1H2GA 3ZHTA 3A0HZ 1AR1B 4I0XA 1K7DA 2ZXWC 3QG5A 1EZJA 3JATA 3F5TA 2BOCC 2XT9A 3WFVA 3M8AA 4X1IB 5LYJA 3AK2A 4OXSA 1KMIZ 5IJ9A 4YJ3B 5JCOC 1ZWIC 1AB3A 3AG1B 4JF3A 1G8MA 3JD0A 2QTSA 4O2BB 2N04A 3DC6A 1PKXA 3CCUV 2W6JG 1BT8A 3ZS8C 2XUMA 5LHGA 2HG5C 2JGDA 1N0JA 2CDYA 3FB8C 5L3GA 2ZDIA 3OMIB 3H01A 2UXCB 3FB5C 3K9AA 1BCCH 2OCCC 1K5QA 4PA9A 1AVMA 2HVKC 3K08A 2QWOB 3T1YO 1TGOA 5JH7A 1N32B 4JYAO 4MTOA 3P30A 5LA6B 1WN7A 1FFXA 3G71V 3HR0A 3LSSA 2XTAA 1RFYA 5J2UA 4DV3B 2AXTZ 3RN4A 3BRCA 3ICXA 3JD1A 4U3FH 1M57B 1K34A 4O4IB 4GX0A 1H8EG 4MW8A 2BOBC 4PA4A 3K0GA 5JCOA 2DYRC 1MABG 3MHSC 2E3CA 4ZI7B 5EK0A 3JSNA 2B9ZA 2ZIMA 2HEPA 1HDJA 1XDCA 1OCCC 2Q7HA 3ZIAG 4LFBB 5JJNB 1ENVA 2UXXA 2YI8A 2UUAB 2VS0A 2OIEA 4WBNA 5JQGA 1Y66A 3JSLA 2BTQA 4TT3G 4WCEV 1NI8A 1Q90D 3SYOA 3W7SA 1GN4A 1FJGB 2H3OA 2EIKC 1R3JC 4OX9B 1XEQA 5J2TA 1GN3A 3H1IH 2YS8A 1P49A 2ITDC 1OHHG 2CE4A 5JH7B 2C2AA 5LMNO 4RQFA 2EIMC 2YXLA 4J9ZB 2R72A 4JTDB 4ICGA 1V9PA 5B1BB 2KB1A 3OFNG 1SQGA 1FKAO 3AG7A 4DV2O 1BQZA 1AP5A 3WG7B 1SESA 3CCVV 3F5WC 5HFMA 3LDEA 1U97A 4WF9V 1JMKC 3ZMZA 1I0HA 1VARA 3ASOC 5EYPB 5LGUA 2E75B 2HHHB 1YXBA 4P9PA 1DK1A 2RN9A 2WLLA 4MW3A 1R3IC 2IW5A 2Q73A 4K0KB 2Q0AA 3KKYA 5BR8B 3LDCA 1EM1A 1GM9A 3K5LA 1XNQO 1VQ8V 4K8XA 1XOUA 2P7TC 2R9IA 4X62O 2GBOA 4E2LA 1AJNA 1Z5WA 3T4ZA 2EIJC 1RM1C 1XI1A 4UUJC 4RUEA 4DR3O 2EILC 1XREA 3E89A 4LFAB 2QE7G 1AJQA 4MVRA 4X9QA 4MVUA 3RYIA 5C8YA 4DR2B 4JV5O 4FLZA 2PYJA 1BHBA 1B3QA 2OCCB 4YHHO 4HBNA 4AI8A 4I4TB 3TETA 3I5DA 2QWRB 3L71H 3F7VC 1AI6A 1FS0G 2DYSB 2CGNA 1TAEA 1DTOA 4N23A 1NTKH 5JWPA 2HKOA 1I7FA 1NTMH 2ZE8A 2X7RB 5DECA 3SDLA 3T1YB 5IYZA 4J7KA 2HVJC 2JIZG 4JYAB 2OTLV 2YDEA 3ZN0A 3CPWU 2ILMA 4BW9A 5FLXN 1JJ2U 1IBKO 2JS5A 4GKKO 3JALA 3JYCA 4NKGB 2WLLB 5IYCO 1RPRA 1VEWA 2Q7EA 5LOVB 4X1YB 4CBCA 3HKEB 2WPDG 4J10A 5J9PC 1JPXA 3VQXA 2YI9A 4RQEA 1J5EO 2WA3A 1HNWO 1YJ9V 4AQYO 5IDJA 3D3IA 2E76B 2R9AA 4KUMA 1GTOA 3ETGA 3KCYA 3CP1A 3RYIB 5C8YB 2EIKB 1F51A 3AG2C 3BA8A 2ZKOA 3L73H 1P4RA 5EZYA 4FLYA 3KCXA 1V55C 4JI5B 1SA0A 2IJKA 4KXRA 3JASA 3RYCB 4F6RB 5CMUA 4JI1O 1KBHA 1A32A 1Q8IA 4W4KA 3U10A 1RSOB 4TV9B 4U3JB 3ZRVA 3W7UA 4FM2A 4B08A 5LMNB 2UXNA 3ABMC 4DV1O 2AHZA 3SYCA 1BSMA 4JAUA 4BIUA 2EIJB 2YIBA 2WLJA 4O4HA 2WSSG 4R6ZA 2EILB 2Q8VA 3MD0A 2IH3C 1NTZH 3I56V 1SF9A 3FAVB 4BIZA 3K9SA 3CMAV 3GB7C 3CD6V 1XNQB 4X62B 1SQQH 3SJCC 3K58A 1FXHA 2A3QA 3BVOA 2JK5C 4P2ZA 5LGTA 4DR3B 4Q6GA 2CGOA 3VOUA 1R73A 5JJEB 2PI4A 4JV5B 2AHYA 1ROPA 4UB8Z 1M90W 4YHHB 2F1MA 5BMVA 4GX1A 1Q3EA 3JASB 3OGIB 3PN1A 3IC9A 3ZCCA 1HW7A 5KHKA 3ZMTA 1JQ0A 3OUFA 4UV8A 1OCZB 1XNRO 1K92A 1MSWD 1WJZA 2LP7A 4IIJB 2Y69C 3N2GA 4YIPA 3UM7A 2IJHA 2WLIA 3CRRA 3AG3C 4I9QA 3OTFA 3K79A 4DUYO 3X2QB 3FX7A 4O4HB 1IX9A 1IBKB 4LR3A 5B3SC 4H13B 2XAQA 1FD9A 2E74B 3RGBA 4WFGA 4FFBA 3JARB 4FK5C 5GTIZ 3LNMB 4TV8A 4B3MB 1J5EB 1P7BA 3DC5A 3CCEV 1SERA 4JASA 4CH5A 3HPLC 2ZR2A 1QQCA 1V55B 1HNWB 4AQYB 1BMFG 4NXMO 2IJIA 4CS4A 3TK1A 4DW1A 1H2LA 2OIGA 3TCUA 3H1KH 1G4YB 4X8AA 2JDIG 5CA0B 4JYCA 3EHBB 5BMVB 1FAFA 3H9VA 2F4VO 4YJ2A 2WLNA 4J42A 1R6TA 2Q4PA 2Q0OC 3CJHB 1PD3A 5KAFZ 1MSDA 4MVOA 4JI1B 3UT5A 2ZE7A 2W6IG 4MSWC 1F23A 2WLIB 4OGQB 2YICA 3KZIZ 3CC2V 1M57C 5IT9N 2RQ6A 4ZKIA 3SGIA 1VQMV 4C7UA 2PTMA 4X1IA 3L72H 4YJ3A 3C90A 2ODMA 1Y67A 1BQ0A 3LNNA 1N0NA 4UCUA 1PM9A 4UCSA 4FFBB 4LC1A 4UCRA 4MT8A 1MG1A 3J81N 1OCRB 4PA3A 1HP8A 3AG4B 3ABTA 1O9GA 3OR7C 2FMLA 1Q82W 2Z5UA 5L3FA 5L3BA 3OE7G 2DMXA 1H2MA 1IXBA 3ZEDA 4BWAA 4EFBA 1S5LZ 3G80A 5LA6A 4J41A 1IXMA 2A0LA 2X0LA 2Q9LA 4DV5O 4IHJB 4MVQA 3QVNA 3L75H 3CS5A 2QA4V 3ABUA 2P90A 2Y69B 3AG3B 3HB3B 1M4UA 4AILC 2ZINA 5B1BC 2EJRA 1YTFD 1N33O 1PL4A 4UVAA 5EC1C 3GWOA 4FLTA 1DLBA 1MNGA 1BS3A 3E8HA 3EFFK 5B3SB 3RBZA 1YJWV 4ZI7A 1XNRB 1NH2D 2XNDG 3T1HO 4LFAO 2QWQB 1VF6C 1Q6IA 3G6BA 4DR2O 3ZMUA 2PZSA 4DXWA 4DUYB 3QNEA 1L8DA 3BEHA 2EX3A 4ZHQA 4JZ2A 2LFSA 2XAFA 2CH7A 3SJQC 5EC2C 1SQFA 3A8TA 4CZZA 4J9YB 1M93A 4MVMA 2D3OW 4X66O 2FKXA 1KKCA 2VQFB 4DK0A 2QR4A 1OV9A 2ARHA 4DW0A 3E8FA 2RDCA 2ZE5A 4UCTA 3SJAC 1CXZB 4NXMB 3OW2U 4WFHA 2DJVA 2DYSC 3ZMVA 4LF8O 1F7YA 4CH4A 3ZRSA 1BGYH 3ABKB 2GTSA 5FNVB 3NR7A 3O65A 4QE9A 5EYPA 3FYEB 4CC6A 3D36C 3IJ4A 2O57A 4LF6O 2F4VB 1IBLO 3JAKB 2D2CB 2LGWA 1VF6A 1Y74B 3JAMN 1JVMA 4R8CA 1YDXA
chains in the Genus database with same CATH topology
1SQPH 2BCCH 1PP9H 3L75H 3TGUH 1EZVH 2IBZH 1BGYH 1SQXH 4D6TH 3L70H 3L72H 1SQVH 3L73H 3L71H 2A06H 1NU1H 1BCCH 3CX5F 1NTZH 3L74H 1SQBH 1BE3H 4U3FH 3H1IH 1KYOF 1KB9F 3H1JH 2FYUH 1P84F 3H1KH 3H1HH 5KLVH 4PD4F 1L0LH 3BCCH 1NTKH 1L0NH 3CXHF 1NTMH 1PPJH 1SQQH 3H1LH 3CWBH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP H;  2BCC H;  1PP9 H;  3L75 H;  3TGU H;  1EZV H;  2IBZ H;  1BGY H;  1SQX H;  4D6T H;  3L70 H;  3L72 H;  1SQV H;  3L73 H;  3L71 H;  2A06 H;  1NU1 H;  1BCC H;  3CX5 F;  1NTZ H;  3L74 H;  1SQB H;  1BE3 H;  4U3F H;  3H1I H;  1KYO F;  1KB9 F;  3H1J H;  2FYU H;  1P84 F;  3H1K H;  3H1H H;  5KLV H;  4PD4 F;  1L0L H;  3BCC H;  1NTK H;  1L0N H;  3CXH F;  1NTM H;  1PPJ H;  1SQQ H;  3H1L H;  3CWB H; 
#chains in the Genus database with same CATH topology
 5HFL A;  1FFT B;  4FZ0 A;  4UVB A;  3LSQ A;  4H37 A;  2P6J A;  4EFE A;  1Y76 B;  1TA8 A;  4G27 B;  4H0L B;  4I9W A;  2FL4 A;  2YUA A;  3C3S A;  1KU9 A;  2YID A;  4JI3 O;  4ZHQ B;  3VQV A;  3K5N A;  2CH7 B;  2ATK C;  3OEH G;  4JI5 O;  2OT5 A;  1EZV H;  4I4T A;  3BA9 A;  3CRC A;  1S3J A;  3C3T A;  2CAZ C;  2RJZ A;  4UFZ A;  1WP8 A;  5H2F Z;  5FL7 G;  3ZN1 A;  2OYQ A;  3E35 A;  4FMT A;  1KB9 F;  1L0L H;  5LBQ A;  4X89 A;  3D36 A;  4HZ3 A;  4J7Z A;  2BCC H;  2M7W A;  3RYH B;  4TQF A;  4JI6 O;  4UV9 A;  4A5U B;  2CTR A;  5KAI Z;  3RYF A;  1QR9 A;  5B1A C;  1MZE A;  3WB2 A;  3N27 A;  1THZ A;  2CK3 G;  5ITZ B;  2NLJ C;  4DV5 B;  2CUG A;  5H6Q A;  4BR6 A;  2EBO A;  4N21 A;  2QKA A;  5LOV A;  4X1Y A;  3HKE A;  1N33 B;  2F66 C;  4RWU A;  2B5U A;  1H8H G;  1NR1 A;  5IYD O;  2PI5 A;  3WU2 Z;  1IVS A;  5EBL C;  1WAZ A;  3HKD B;  1GN2 A;  4I50 B;  4X88 A;  3RW0 A;  4DYL A;  3T1H B;  1K3E A;  5KUM A;  1NS1 A;  4DUZ O;  4NYK A;  2QKS A;  2JJ1 G;  5A9G A;  4LWS A;  4GUN A;  5CA3 A;  1RP3 B;  1YIT V;  3FKS G;  1XL6 A;  4FVM A;  1V54 C;  4MTF A;  4TOI A;  4I5S A;  1P84 F;  4JI2 O;  5B5E Z;  2B1I A;  3RYC A;  1JR9 A;  4F6R A;  3CXH F;  4WFA V;  2CTP A;  4X66 B;  1XIL A;  3K03 A;  2BTO A;  5H6R A;  1RSO A;  3TGU H;  4TV9 A;  1GH6 A;  4FLU A;  2ETN A;  4JI7 B;  1YZB A;  4U3J A;  1LR1 A;  3JAW A;  3RYF B;  5EIB D;  3M7M X;  4Z1M G;  2YEV A;  1JJO A;  3J7A U;  2ITC C;  2QJ1 A;  4LF8 B;  2ADP A;  2WA4 A;  5KLV H;  4IGG A;  4DV0 O;  2Q5Z A;  1ZX3 A;  2ZR3 A;  5CB4 A;  1E1R G;  1OCZ C;  1YIJ V;  4EKW A;  4LF6 B;  2ZE6 A;  4LH7 A;  3TXS A;  2Y4U A;  2V1D A;  1IBL B;  3B8N A;  4HNA B;  1VF7 A;  4YY3 O;  4FM1 A;  4QE7 A;  3CCM V;  4B3M O;  1VMG A;  1QHT A;  2RCV A;  3FAV A;  4J11 A;  5CN0 A;  3X2Q C;  1FPO A;  4PI2 A;  2Z3Y A;  3LUT B;  1VQK V;  4PEL A;  2G38 A;  2F95 B;  3VBB A;  1EBO A;  3KG2 A;  4JAA A;  2X6C A;  1UPG A;  4LWS B;  3HKC B;  5DM6 V;  1JX9 A;  4JI3 B;  3L9D A;  1K8A W;  3ETD A;  4CH6 A;  1MZF A;  4QJF B;  2EZP A;  2OWO A;  1AR4 A;  1KP2 A;  3M99 B;  4O2A A;  4WFE A;  5B1A B;  2L35 A;  4RAI A;  1VQL V;  2Y48 A;  2YIA A;  4NXN O;  5DED A;  3JD4 A;  1VF5 B;  2K9P A;  3OEE G;  3JAW B;  2HJD A;  3U0Z A;  3SPC A;  1R6K A;  2YEV B;  3CRA A;  3CX5 F;  4RUF A;  3FD9 A;  4IIJ A;  3IAY A;  2XHB A;  4JI6 B;  2AW9 A;  2AZ0 A;  2JEX A;  4TQD A;  3CE2 A;  4O4L A;  1NKD A;  5CB4 B;  1VQ5 V;  2A79 B;  2XAH A;  3VQY A;  3DXR A;  4CH3 A;  1SS3 A;  4FFK A;  4R50 A;  1FXV A;  1X4T A;  5L3E A;  1IUR A;  3EVK A;  4MVS A;  2QGN A;  3JAR A;  3LDD A;  2Y4T A;  4FLX A;  3STL C;  4QNH B;  3QO8 A;  1DF5 A;  2P22 C;  2ZD9 A;  2ZNJ A;  1V54 B;  1I5X A;  1S77 D;  1SQX H;  4D6T H;  5KHG A;  4BW5 A;  2Q7G A;  4DUZ B;  1S76 D;  4P30 A;  1OCR C;  1VQ9 V;  5L3D A;  3T1C A;  3AG4 C;  4G28 B;  1IZ3 A;  1I94 O;  4IT5 A;  5CA0 A;  2QM4 A;  4B7E A;  2QEX V;  3P3P A;  1MMM A;  1WB7 A;  4NTW A;  1ZTE A;  1HR0 O;  4O2A B;  5IJ0 A;  2F43 G;  3MHH C;  3CYO A;  1QNM A;  4JI2 B;  3CJH A;  2P4K A;  4GYC B;  5BY1 A;  1SZT A;  2A7W A;  2XAG A;  1DGS A;  5LMU O;  4ABM A;  1Z2G A;  5FPR A;  4CC5 A;  1CPY A;  4O4L B;  3RVZ A;  4X64 B;  1BZK A;  5B1N A;  1YTF B;  3DXR B;  4JI4 O;  1PV0 A;  4HAM A;  4DV0 B;  4J80 A;  2MW2 B;  5KMG B;  4O4J B;  4OPA A;  3SYA A;  1OJH A;  4UCV A;  3GVM A;  4ZIB A;  4OPH A;  4DV7 O;  1TVK B;  3SPH A;  1XHZ A;  2GUZ A;  1NH2 B;  4NR1 A;  4XDK A;  4JI8 O;  1LNQ A;  4NTY A;  4LNU A;  4TUY B;  4RO2 A;  4YY3 B;  2VQF O;  1Q6U A;  2UUB O;  2WLM A;  4LP8 A;  4QGP A;  1ZSP A;  4IYH A;  1WNS A;  2QM8 A;  1F4N A;  3H1J H;  4ASU G;  1S5J A;  3H1H H;  1KKD A;  4NVP A;  2YSU B;  2P5O A;  1GM7 A;  3F7Y C;  4IHJ A;  4CS2 A;  4X65 O;  4DV6 O;  5IJ0 B;  1ZL8 B;  4K8Z A;  2DOS A;  5IY5 B;  4FM0 A;  1M9N A;  4PA6 A;  5LXT A;  3CRQ A;  1G1X B;  2GDS A;  5LGN A;  4EB6 B;  5KHI A;  4LF9 O;  3AEI A;  4NXN B;  3ABK C;  4D7S A;  2JS3 A;  3HKB A;  5LP6 B;  2P67 A;  1GN6 A;  3A0R A;  1COW G;  1URF A;  3QTC A;  4PDM A;  3T2M A;  1K4D C;  4DR6 O;  2IJJ A;  3ML0 A;  1LUW A;  1YF2 A;  5IE9 A;  4FLV A;  2Q68 A;  1H38 A;  4GCZ A;  3TXQ A;  5AG2 A;  4DV4 O;  2GUZ B;  2NN4 A;  5KA5 A;  1S5H C;  1FXK B;  4LNU B;  4WFF A;  4X1K B;  5IYB O;  2BSK A;  4JPR A;  2V4D A;  5E1A C;  3L70 H;  5B66 Z;  1KEC A;  2JEU A;  4QPJ A;  2NNU A;  2KKW A;  3WB1 A;  3BFR A;  2JJ2 G;  2LO1 A;  2R70 A;  3A2F A;  2K1E A;  5GON B;  1I08 A;  2IU3 A;  1KC8 W;  2IM9 A;  1IBM O;  5L3C A;  3W7X A;  4FPP A;  2VWK A;  1Q43 A;  5FNV A;  1W0K G;  3J80 N;  1I94 B;  2VWJ A;  2JRI A;  3P3N A;  1QLE B;  2KSD A;  3S3W A;  1HR0 B;  1TUB A;  5LXT B;  3OD4 A;  3JAK A;  3ZHQ A;  1SRY A;  3B8M A;  2EJ7 A;  1YCI A;  1OZ0 A;  1Y74 A;  3HKB B;  1WPX A;  2UU9 O;  5GTH Z;  4PDR A;  2HLD G;  4LBE C;  1YHQ V;  1XUQ A;  3G4S V;  5BXZ A;  1OCO C;  5LMU B;  1R1B A;  3ZMS A;  1NZ6 A;  1GKF A;  4LH6 A;  4F6E A;  3BHP A;  3B2E E;  1Y76 A;  2XAJ A;  3GWK C;  3CME V;  4KP4 A;  2QTO A;  4JI4 B;  2L6L A;  3E83 A;  3B09 A;  4FJC C;  1JFF A;  4UCO A;  3ABL B;  3K06 A;  2BE3 A;  2H8P C;  3ETQ A;  4DV7 B;  3N2K B;  1AP6 A;  2BSK B;  3NXS A;  5E79 Z;  2LFR A;  4JI8 B;  1U96 A;  4LFC B;  2UUB B;  4JI7 O;  5BZB A;  1Y4M A;  5KHJ A;  2W0F C;  1GK9 A;  1SKV A;  2CTW A;  4PJ0 Z;  2LJ2 A;  1NR7 A;  3RYH A;  2NR5 A;  1NQT A;  2LGQ A;  2IH1 C;  5K1P A;  4I55 A;  5ITZ A;  2PYL A;  3STZ C;  1CEZ A;  1JCH A;  3SPJ A;  4CS3 A;  1TUB B;  4X65 B;  4DV6 B;  2UUC O;  3SYP A;  1ARO P;  1M5I A;  3RWR D;  3UCS C;  4KHP O;  1XBL A;  2GTA A;  4DK1 A;  3SYQ A;  4JI0 O;  1AI7 A;  4KL1 A;  5D5P A;  1YSC A;  3K59 A;  1XMO O;  4LF9 B;  4W4L A;  4QPK A;  3QF7 A;  1NVP D;  4LCU C;  3RFR A;  4DR4 O;  4TSF G;  3ZHV A;  4H44 B;  1US6 A;  3HKD A;  3CCS V;  4I50 A;  5KHH A;  3AK1 A;  4DR6 B;  3W7W A;  1E79 G;  3O9O A;  3R65 A;  1PL0 A;  1Y6X A;  4J7J A;  4LF7 O;  4JYB A;  3K0D A;  4I0X B;  3SPG A;  1JFF B;  3H1L H;  1XHX A;  3JAT B;  1KUQ A;  4DR7 O;  4DR5 O;  3QO5 A;  4DV4 B;  1PNK A;  3P32 A;  1QBZ A;  4B3R O;  1N4C A;  5LYJ B;  2CTQ A;  2DN9 A;  2YXH A;  1NBM G;  2WAM A;  2QWP B;  3E8G A;  4MTG A;  5IJ9 B;  3SJB C;  1UFI A;  3FYI B;  1F4M A;  3R66 A;  4GKJ O;  3K3W A;  4LF5 O;  1HNX O;  3G67 A;  1VQ6 V;  1WA8 A;  2JGD B;  2GHY A;  4B7K A;  1PP9 H;  4FZ1 A;  2MK3 A;  5C93 A;  3APO A;  3E22 A;  2QWN B;  1K9M W;  3T4D A;  1XMQ O;  2PY5 A;  3UQ8 A;  4I55 B;  1JOY A;  4JZG A;  1IBM B;  3THO A;  1OCO B;  4EEQ A;  3OMA B;  1R3K C;  2DWE C;  3G6E V;  1FFX B;  4U7O A;  3ZJZ A;  2AGA A;  1PNM A;  2Z0A A;  1D5A A;  4HNA A;  4ZBM A;  5J2U B;  1W59 A;  1NJI W;  3B77 A;  3IGA C;  2ZXW B;  4PV1 B;  5CBG A;  1ORQ C;  3IC7 A;  2UU9 B;  3DSQ A;  2YC0 A;  3CCL V;  5KA6 A;  1AIL A;  1R6N A;  3CRM A;  4F4L A;  4Z2W A;  4L8J A;  3HKC A;  2WLK A;  4I7Z B;  2ZCE A;  4Q20 A;  1RPO A;  2UXB O;  5JJJ B;  5D5Q A;  2QDO A;  3B40 A;  3MAQ A;  1M1K W;  4JAV A;  3EXA A;  4FLW A;  4GLX A;  4WBN B;  5JQG B;  1H2N A;  2BTQ B;  4IL6 Z;  1WA8 B;  3QO7 A;  1VIB A;  2F93 B;  1ZUQ A;  4DO2 A;  1VQO V;  5CBF A;  2RNB A;  3E22 B;  4QIW F;  2XOK G;  4X64 O;  2KQX A;  5J2T B;  3K57 A;  5F2V O;  1VQ7 V;  2HFE C;  5IWA O;  1H2S B;  3CCJ V;  3BCC H;  4TWK A;  2E5L O;  1SZX A;  1EN6 A;  1XL4 A;  4BIO A;  2WLH A;  2Q69 A;  2R9R B;  3BAB A;  3RVY A;  2ZQM A;  2GSM B;  2F23 A;  3OTO O;  1N8R W;  1L1F A;  3B4S A;  3BY6 A;  2UUC B;  1GMG A;  5GW7 A;  2EZO A;  2DYR B;  4KHP B;  4Z1V A;  2GV9 A;  4JI0 B;  1QR8 A;  1XMO B;  2HR3 A;  3CCQ V;  2OCH A;  1WLE A;  1OCC B;  4DR4 B;  1R3L C;  1P7G A;  3OMN B;  1HWY A;  4LF7 B;  1VP7 A;  1QCE A;  4K35 A;  1CP9 A;  1GRJ A;  4P9O A;  4DR1 O;  4GX5 A;  1LUV A;  4DR7 B;  4DR5 B;  4PD4 F;  1VQN V;  4K3A A;  4B3R B;  1AI5 A;  3TJT A;  1GM8 A;  4E4E A;  4BAY A;  5K1X A;  3FFQ A;  5JVD A;  2Q67 A;  3FB7 C;  4WFB V;  1S72 V;  4GKJ B;  1WB8 A;  2UXD O;  1N34 O;  1H2K A;  1TUE B;  4LF5 B;  3ZHR A;  1HNX B;  5TIS Z;  2EIM B;  2Y0I A;  1K97 A;  2X6B A;  3UKM A;  2DWD C;  3MDS A;  5A2Q N;  1SC5 B;  4MTX A;  5B1O A;  1VQP V;  2ZM6 O;  5IY5 C;  5CBH A;  4B3S O;  4YXW G;  3ASO B;  1XMQ B;  4L87 A;  3CSX A;  3K5M A;  2QM7 A;  1M56 C;  1KQS U;  3AK3 A;  5IYZ B;  4G2K A;  4MVZ A;  4XBF A;  3DTU B;  5LP6 C;  3SPI A;  4O4J A;  5KMG A;  2ZIO A;  1NU1 H;  4B3T O;  2A9H A;  2EIN C;  1TVK A;  4DV2 B;  2W0X A;  1I5Y A;  3JAL B;  4TUY A;  4XDJ A;  3W7T A;  2FB5 A;  2WWW A;  3OM3 B;  5EBW C;  4XDL A;  1RM1 B;  1KD1 W;  1AJP A;  1HNZ O;  2JVD A;  2ADQ B;  4NTX A;  3UO3 A;  4H33 A;  5FPO A;  3VQW A;  2VQE O;  1FXK C;  3JCZ A;  3ZRW A;  1NT2 B;  1Q7Y W;  4X20 A;  2PGG A;  3OGC C;  4PA7 A;  1WP7 A;  3APQ A;  1YVW A;  5LHI A;  1N36 O;  2N74 A;  2V7Q G;  4IYI A;  1UJW B;  2UXB B;  1ZL8 A;  3OUS A;  5JVD B;  1FYJ A;  3PJS K;  1Q6H A;  3WB0 A;  4LF4 O;  2AZ2 A;  2ZNI A;  3L74 H;  1QVF U;  2Q6A A;  5EZY B;  3E8B A;  2H94 A;  4HYO A;  2DW4 A;  4PI0 A;  3OT7 A;  1IDS A;  2LW1 A;  3K5O A;  4EB6 A;  4NB5 A;  4D7T A;  1Q86 W;  1SA0 B;  3OR6 C;  3BAA A;  2QKC A;  4GX2 A;  5LP6 A;  1B04 A;  3JD2 A;  1QLE C;  4DRX A;  2Y0P A;  1PPJ H;  4KFM A;  2JGU A;  1ZAU A;  4ZOL A;  2P06 A;  3ZRX A;  4FIP C;  5IWA B;  2X6A A;  3BPZ A;  1K4C C;  3E86 A;  2M6Y A;  2E5L B;  5KX5 A;  1Q5O A;  3ASN C;  1JA8 A;  1L0N H;  1YEW A;  3OTO B;  1W2B U;  1E1Q G;  1B06 A;  2YXY A;  3CEI A;  1FXK A;  1GO3 F;  3I55 V;  4LFC O;  2DQ0 A;  4X1K A;  3JD3 A;  1AI4 A;  1K5S A;  1D5N A;  3CHX A;  3E2E A;  3CCR V;  1SQV H;  3D3Q A;  4GKK B;  3ABL C;  3K04 A;  5DN6 G;  5LHH A;  3ZRW B;  3SR2 C;  1ZLZ A;  3ZHU A;  4X20 B;  2FYU H;  5H9C A;  1Z5V A;  5KUK A;  1PNL A;  2KG7 A;  3AG2 B;  2UXC O;  4JTA B;  4R7C A;  4PDL A;  5GON A;  3CB2 A;  2DQ3 A;  3AG1 C;  3JCU Z;  4JGS A;  2OTJ V;  5CA1 A;  2LW7 A;  1N32 O;  4DR1 B;  2IBZ H;  3CC7 V;  1GAX A;  2VRZ A;  1WPB A;  2P4V A;  2QSA A;  4UXN A;  4PDV A;  3ZX6 A;  1BE3 H;  1BHA A;  4DV3 O;  1VQ4 V;  1B6Q A;  1M56 B;  1SET A;  1X59 A;  1K33 A;  1EFR G;  2UXD B;  1N34 B;  4DRX B;  1EN4 A;  3ABM B;  2EIN B;  2PF4 E;  1QLN A;  1KP3 A;  1G6U A;  4ZOL B;  5LL6 Y;  5EIB C;  1D2D A;  1T5E A;  5H5N A;  3S3X A;  2ZM6 B;  4B3S B;  1SQB H;  4GZR B;  4JTC B;  5KX5 B;  3Q4H A;  3N2G B;  1QU7 A;  1W0J G;  3FB6 C;  2EUL A;  4LFB O;  1NVP B;  1O9H A;  3CWB H;  4U7N A;  3CC4 V;  1SQP H;  4B3T B;  1J95 A;  2LQT A;  4YIO A;  2UUA O;  3N2K A;  4DV1 B;  2DE0 X;  2RMK B;  3ZBH A;  3D8C A;  5EBM C;  1K73 W;  3LSU A;  4O2B A;  1KYO F;  3OAA G;  3CXC U;  1HNZ B;  2HJF C;  1FJG O;  3ZHS A;  2N05 A;  2KG7 B;  1BL8 A;  3DGE A;  4OX9 O;  2VQE B;  4TV8 B;  2PUS A;  3U11 A;  1EN5 A;  1DF4 A;  1XQ8 A;  5CA1 B;  2B1G A;  2HP8 A;  2FTK A;  1YJN V;  3ETE A;  2A06 H;  1N36 B;  2XAS A;  4AHC A;  2ZDI C;  1MA1 A;  1S0V A;  4UVC A;  1AR5 A;  4LF4 B;  2IU0 A;  4JYY A;  3IFX A;  3A0B Z;  2ZT9 B;  3RT3 C;  4YJ2 B;  2HHH O;  1Q81 W;  4PHZ A;  1MOF A;  4MS2 A;  1YI2 V;  4K0K O;  3ASN B;  4UB6 Z;  5BR8 O;  4O4I A;  3UO2 A;  4GT1 A;  3UT5 B;  3WG7 C;  2YIB D;  1QVG U;  3Q4H B;  1H2G A;  3ZHT A;  3A0H Z;  1AR1 B;  4I0X A;  1K7D A;  2ZXW C;  3QG5 A;  1EZJ A;  3JAT A;  3F5T A;  2BOC C;  2XT9 A;  3WFV A;  3M8A A;  4X1I B;  5LYJ A;  3AK2 A;  4OXS A;  1KMI Z;  5IJ9 A;  4YJ3 B;  5JCO C;  1ZWI C;  1AB3 A;  3AG1 B;  4JF3 A;  1G8M A;  3JD0 A;  2QTS A;  4O2B B;  2N04 A;  3DC6 A;  1PKX A;  3CCU V;  2W6J G;  1BT8 A;  3ZS8 C;  2XUM A;  5LHG A;  2HG5 C;  2JGD A;  1N0J A;  2CDY A;  3FB8 C;  5L3G A;  2ZDI A;  3OMI B;  3H01 A;  2UXC B;  3FB5 C;  3K9A A;  1BCC H;  2OCC C;  1K5Q A;  4PA9 A;  1AVM A;  2HVK C;  3K08 A;  2QWO B;  3T1Y O;  1TGO A;  5JH7 A;  1N32 B;  4JYA O;  4MTO A;  3P30 A;  5LA6 B;  1WN7 A;  1FFX A;  3G71 V;  3HR0 A;  3LSS A;  2XTA A;  1RFY A;  5J2U A;  4DV3 B;  2AXT Z;  3RN4 A;  3BRC A;  3ICX A;  3JD1 A;  4U3F H;  1M57 B;  1K34 A;  4O4I B;  4GX0 A;  1H8E G;  4MW8 A;  2BOB C;  4PA4 A;  3K0G A;  5JCO A;  2DYR C;  1MAB G;  3MHS C;  2E3C A;  4ZI7 B;  5EK0 A;  3JSN A;  2B9Z A;  2ZIM A;  2HEP A;  1HDJ A;  1XDC A;  1OCC C;  2Q7H A;  3ZIA G;  4LFB B;  5JJN B;  1ENV A;  2UXX A;  2YI8 A;  2UUA B;  2VS0 A;  2OIE A;  4WBN A;  5JQG A;  1Y66 A;  3JSL A;  2BTQ A;  4TT3 G;  4WCE V;  1NI8 A;  1Q90 D;  3SYO A;  3W7S A;  1GN4 A;  1FJG B;  2H3O A;  2EIK C;  1R3J C;  4OX9 B;  1XEQ A;  5J2T A;  1GN3 A;  3H1I H;  2YS8 A;  1P49 A;  2ITD C;  1OHH G;  2CE4 A;  5JH7 B;  2C2A A;  5LMN O;  4RQF A;  2EIM C;  2YXL A;  4J9Z B;  2R72 A;  4JTD B;  4ICG A;  1V9P A;  5B1B B;  2KB1 A;  3OFN G;  1SQG A;  1FKA O;  3AG7 A;  4DV2 O;  1BQZ A;  1AP5 A;  3WG7 B;  1SES A;  3CCV V;  3F5W C;  5HFM A;  3LDE A;  1U97 A;  4WF9 V;  1JMK C;  3ZMZ A;  1I0H A;  1VAR A;  3ASO C;  5EYP B;  5LGU A;  2E75 B;  2HHH B;  1YXB A;  4P9P A;  1DK1 A;  2RN9 A;  2WLL A;  4MW3 A;  1R3I C;  2IW5 A;  2Q73 A;  4K0K B;  2Q0A A;  3KKY A;  5BR8 B;  3LDC A;  1EM1 A;  1GM9 A;  3K5L A;  1XNQ O;  1VQ8 V;  4K8X A;  1XOU A;  2P7T C;  2R9I A;  4X62 O;  2GBO A;  4E2L A;  1AJN A;  1Z5W A;  3T4Z A;  2EIJ C;  1RM1 C;  1XI1 A;  4UUJ C;  4RUE A;  4DR3 O;  2EIL C;  1XRE A;  3E89 A;  4LFA B;  2QE7 G;  1AJQ A;  4MVR A;  4X9Q A;  4MVU A;  3RYI A;  5C8Y A;  4DR2 B;  4JV5 O;  4FLZ A;  2PYJ A;  1BHB A;  1B3Q A;  2OCC B;  4YHH O;  4HBN A;  4AI8 A;  4I4T B;  3TET A;  3I5D A;  2QWR B;  3L71 H;  3F7V C;  1AI6 A;  1FS0 G;  2DYS B;  2CGN A;  1TAE A;  1DTO A;  4N23 A;  1NTK H;  5JWP A;  2HKO A;  1I7F A;  1NTM H;  2ZE8 A;  2X7R B;  5DEC A;  3SDL A;  3T1Y B;  5IYZ A;  4J7K A;  2HVJ C;  2JIZ G;  4JYA B;  2OTL V;  2YDE A;  3ZN0 A;  3CPW U;  2ILM A;  4BW9 A;  5FLX N;  1JJ2 U;  1IBK O;  2JS5 A;  4GKK O;  3JAL A;  3JYC A;  4NKG B;  2WLL B;  5IYC O;  1RPR A;  1VEW A;  2Q7E A;  5LOV B;  4X1Y B;  4CBC A;  3HKE B;  2WPD G;  4J10 A;  5J9P C;  1JPX A;  3VQX A;  2YI9 A;  4RQE A;  1J5E O;  2WA3 A;  1HNW O;  1YJ9 V;  4AQY O;  5IDJ A;  3D3I A;  2E76 B;  2R9A A;  4KUM A;  1GTO A;  3ETG A;  3KCY A;  3CP1 A;  3RYI B;  5C8Y B;  2EIK B;  1F51 A;  3AG2 C;  3BA8 A;  2ZKO A;  3L73 H;  1P4R A;  5EZY A;  4FLY A;  3KCX A;  1V55 C;  4JI5 B;  1SA0 A;  2IJK A;  4KXR A;  3JAS A;  3RYC B;  4F6R B;  5CMU A;  4JI1 O;  1KBH A;  1A32 A;  1Q8I A;  4W4K A;  3U10 A;  1RSO B;  4TV9 B;  4U3J B;  3ZRV A;  3W7U A;  4FM2 A;  4B08 A;  5LMN B;  2UXN A;  3ABM C;  4DV1 O;  2AHZ A;  3SYC A;  1BSM A;  4JAU A;  4BIU A;  2EIJ B;  2YIB A;  2WLJ A;  4O4H A;  2WSS G;  4R6Z A;  2EIL B;  2Q8V A;  3MD0 A;  2IH3 C;  1NTZ H;  3I56 V;  1SF9 A;  3FAV B;  4BIZ A;  3K9S A;  3CMA V;  3GB7 C;  3CD6 V;  1XNQ B;  4X62 B;  1SQQ H;  3SJC C;  3K58 A;  1FXH A;  2A3Q A;  3BVO A;  2JK5 C;  4P2Z A;  5LGT A;  4DR3 B;  4Q6G A;  2CGO A;  3VOU A;  1R73 A;  5JJE B;  2PI4 A;  4JV5 B;  2AHY A;  1ROP A;  4UB8 Z;  1M90 W;  4YHH B;  2F1M A;  5BMV A;  4GX1 A;  1Q3E A;  3JAS B;  3OGI B;  3PN1 A;  3IC9 A;  3ZCC A;  1HW7 A;  5KHK A;  3ZMT A;  1JQ0 A;  3OUF A;  4UV8 A;  1OCZ B;  1XNR O;  1K92 A;  1MSW D;  1WJZ A;  2LP7 A;  4IIJ B;  2Y69 C;  3N2G A;  4YIP A;  3UM7 A;  2IJH A;  2WLI A;  3CRR A;  3AG3 C;  4I9Q A;  3OTF A;  3K79 A;  4DUY O;  3X2Q B;  3FX7 A;  4O4H B;  1IX9 A;  1IBK B;  4LR3 A;  5B3S C;  4H13 B;  2XAQ A;  1FD9 A;  2E74 B;  3RGB A;  4WFG A;  4FFB A;  3JAR B;  4FK5 C;  5GTI Z;  3LNM B;  4TV8 A;  4B3M B;  1J5E B;  1P7B A;  3DC5 A;  3CCE V;  1SER A;  4JAS A;  4CH5 A;  3HPL C;  2ZR2 A;  1QQC A;  1V55 B;  1HNW B;  4AQY B;  1BMF G;  4NXM O;  2IJI A;  4CS4 A;  3TK1 A;  4DW1 A;  1H2L A;  2OIG A;  3TCU A;  3H1K H;  1G4Y B;  4X8A A;  2JDI G;  5CA0 B;  4JYC A;  3EHB B;  5BMV B;  1FAF A;  3H9V A;  2F4V O;  4YJ2 A;  2WLN A;  4J42 A;  1R6T A;  2Q4P A;  2Q0O C;  3CJH B;  1PD3 A;  5KAF Z;  1MSD A;  4MVO A;  4JI1 B;  3UT5 A;  2ZE7 A;  2W6I G;  4MSW C;  1F23 A;  2WLI B;  4OGQ B;  2YIC A;  3KZI Z;  3CC2 V;  1M57 C;  5IT9 N;  2RQ6 A;  4ZKI A;  3SGI A;  1VQM V;  4C7U A;  2PTM A;  4X1I A;  3L72 H;  4YJ3 A;  3C90 A;  2ODM A;  1Y67 A;  1BQ0 A;  3LNN A;  1N0N A;  4UCU A;  1PM9 A;  4UCS A;  4FFB B;  4LC1 A;  4UCR A;  4MT8 A;  1MG1 A;  3J81 N;  1OCR B;  4PA3 A;  1HP8 A;  3AG4 B;  3ABT A;  1O9G A;  3OR7 C;  2FML A;  1Q82 W;  2Z5U A;  5L3F A;  5L3B A;  3OE7 G;  2DMX A;  1H2M A;  1IXB A;  3ZED A;  4BWA A;  4EFB A;  1S5L Z;  3G80 A;  5LA6 A;  4J41 A;  1IXM A;  2A0L A;  2X0L A;  2Q9L A;  4DV5 O;  4IHJ B;  4MVQ A;  3QVN A;  3L75 H;  3CS5 A;  2QA4 V;  3ABU A;  2P90 A;  2Y69 B;  3AG3 B;  3HB3 B;  1M4U A;  4AIL C;  2ZIN A;  5B1B C;  2EJR A;  1YTF D;  1N33 O;  1PL4 A;  4UVA A;  5EC1 C;  3GWO A;  4FLT A;  1DLB A;  1MNG A;  1BS3 A;  3E8H A;  3EFF K;  5B3S B;  3RBZ A;  1YJW V;  4ZI7 A;  1XNR B;  1NH2 D;  2XND G;  3T1H O;  4LFA O;  2QWQ B;  1VF6 C;  1Q6I A;  3G6B A;  4DR2 O;  3ZMU A;  2PZS A;  4DXW A;  4DUY B;  3QNE A;  1L8D A;  3BEH A;  2EX3 A;  4ZHQ A;  4JZ2 A;  2LFS A;  2XAF A;  2CH7 A;  3SJQ C;  5EC2 C;  1SQF A;  3A8T A;  4CZZ A;  4J9Y B;  1M93 A;  4MVM A;  2D3O W;  4X66 O;  2FKX A;  1KKC A;  2VQF B;  4DK0 A;  2QR4 A;  1OV9 A;  2ARH A;  4DW0 A;  3E8F A;  2RDC A;  2ZE5 A;  4UCT A;  3SJA C;  1CXZ B;  4NXM B;  3OW2 U;  4WFH A;  2DJV A;  2DYS C;  3ZMV A;  4LF8 O;  1F7Y A;  4CH4 A;  3ZRS A;  1BGY H;  3ABK B;  2GTS A;  5FNV B;  3NR7 A;  3O65 A;  4QE9 A;  5EYP A;  3FYE B;  4CC6 A;  3D36 C;  3IJ4 A;  2O57 A;  4LF6 O;  2F4V B;  1IBL O;  3JAK B;  2D2C B;  2LGW A;  1VF6 A;  1Y74 B;  3JAM N;  1JVM A;  4R8C A;  1YDX A; 
#chains in the Genus database with same CATH homology
 1SQP H;  2BCC H;  1PP9 H;  3L75 H;  3TGU H;  1EZV H;  2IBZ H;  1BGY H;  1SQX H;  4D6T H;  3L70 H;  3L72 H;  1SQV H;  3L73 H;  3L71 H;  2A06 H;  1NU1 H;  1BCC H;  3CX5 F;  1NTZ H;  3L74 H;  1SQB H;  1BE3 H;  4U3F H;  3H1I H;  1KYO F;  1KB9 F;  3H1J H;  2FYU H;  1P84 F;  3H1K H;  3H1H H;  5KLV H;  4PD4 F;  1L0L H;  3BCC H;  1NTK H;  1L0N H;  3CXH F;  1NTM H;  1PPJ H;  1SQQ H;  3H1L H;  3CWB H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...