1EZVH

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 28
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1ezvH00
1KB9F 1L0LH 1SQPH 1NTKH 4U3FH 1BE3H 3CWBH 3H1LH 4PD4F 3H1KH 1NTMH 3CXHF 1BCCH 3H1HH 1EZVH 3L71H 1SQXH 3H1IH 1SQQH 2BCCH 1NU1H 4D6TH 3L72H 3L73H 2FYUH 1SQBH 2A06H 5KLVH 2IBZH 1BGYH 3BCCH 3H1JH 1SQVH 1L0NH 3TGUH 3L74H 3CX5F 1PP9H 1NTZH 1PPJH 3L75H 1KYOF 1P84F 3L70H
chains in the Genus database with same CATH superfamily
3TCUA 1N36O 3OW2U 3AG2C 3TJTA 4C7UA 3CJHB 1O9GA 3OUFA 4DV7O 1N34O 2UXNA 3C3SA 5JQGB 1VQ5V 1YXBA 3ZN1A 3CCEV 5IYZB 4HBNA 1US6A 4E4EA 3Q4HA 2BTQB 3ASNB 1QLNA 3LDCA 3JASB 5IYZA 1FJGB 4OX9B 2L35A 4JI5B 5JQGA 5K1XA 4LC1A 3QG5A 3CB2A 5BZBA 3U11A 4DV7B 1Z2GA 2E3CA 1T5EA 3S3WA 1CPYA 5EBWC 1FXKA 2ZXWC 4GX2A 3BEHA 3AK3A 1WN7A 5LXTB 2HFEC 5IJ0A 1Q6HA 2BTOA 3JCZA 4JI8B 5IYCO 4B3MB 1I0HA 3G6BA 2PF4E 3N2KA 5BXZA 4JTCB 2XUMA 4O4IB 1GN4A 4JAUA 3I55V 1UPGA 3CSXA 3L73H 2K1EA 4FM1A 5H2FZ 2LP7A 4AQYO 2NR5A 4X89A 4X62B 3FYIB 4WF9V 1IDSA 4EEQA 2O57A 5IJ9A 1SQPH 5CN0A 2IW5A 1NTKH 4Z1VA 2EIMC 3CCMV 1DF4A 1H2MA 4GYCB 5L3EA 1F23A 2ODMA 1QR9A 3F5WC 3MDSA 4DR5B 3ASNC 1OCCC 3BCCH 3FAVA 4LWSB 5BMVA 3VQWA 1WP7A 4MT8A 3CMAV 2JGDA 2ZE6A 1DGSA 2ZCEA 4TV9A 1VIBA 3MHSC 5BY1A 5LMNB 1XQ8A 1IZ3A 5J2TB 4JI0B 4R7CA 3SJCC 1NVPD 2ZXWB 3AG4B 2LGWA 3ZHQA 5LMUO 1YEWA 4JYBA 3TXSA 1OJHA 3WU2Z 4RO2A 4UCTA 2ZE5A 2ZM6O 2Q5ZA 2H3OA 1M4UA 2UXBB 4JYAB 5E1AC 2DQ3A 3ZMTA 4LF5B 3AG1C 1BSMA 1MSDA 5CB4A 2A3QA 4DR1O 3RYIB 4O2AA 4LFCB 3DSQA 2WPDG 3K0GA 3ZS8C 1M56C 4MW3A 2X6BA 4MTGA 4P9PA 4I5SA 5BMVB 4RWUA 2Y4UA 2YXLA 3G6EV 4FM0A 4LH7A 3K59A 3E22A 4FLVA 4MVMA 5KAFZ 3JD2A 2BCCH 2HJDA 1FD9A 1RPRA 1H2LA 2WWWA 3E89A 1YF2A 1VQMV 2FKXA 3CMEV 1Y4MA 2ZINA 3L74H 3GWKC 1NVPB 4JTDB 2QM7A 4K3AA 4DR6B 2ZKOA 1N8RW 3KCYA 2N05A 2M7WA 4IHJA 2EX3A 4K35A 3B8MA 3UM7A 2HHHB 4J9ZB 1AP6A 1YTFB 3NR7A 2RMKB 2CE4A 5IYDO 5EZYB 3OMIB 4JZGA 2QE7G 4BW9A 3AG1B 1ROPA 1GAXA 3AG3C 3HKCB 2X6CA 2VQEO 4YIOA 3JAKA 1M57C 3FYEB 4WBNB 4LF7O 4LF4B 4JI6O 1HNXO 5IJ9B 3K5MA 4JPRA 2WA4A 1CXZB 2N74A 3I5DA 2YI9A 1XEQA 1Q6IA 4W4KA 2XAHA 5LP6C 3HKEA 1J5EB 2OIEA 2EZPA 4NXNO 2UXDO 4DV4B 2RCVA 1W59A 3LSUA 3UT5B 3SGIA 2HG5C 2YUAA 2Y69C 4EFEA 4F4LA 1JCHA 5KUKA 5FNVB 3B77A 3ZMZA 3JAMN 3QO5A 2UUAO 2QWRB 3ASOC 2W6JG 3CC7V 4F6EA 2R9IA 2EILB 3OM3B 4FFBB 3HKEB 3AG3B 4G2KA 4E2LA 2GDSA 4NXMO 2F4VO 4JAAA 2FYUH 5CBHA 1TGOA 2QA4V 3C3TA 3TGUH 3SJBC 1KYOF 1MA1A 1OCOB 2DMXA 3ETEA 5IYBO 4DRXB 1SA0B 4FFBA 1QBZA 2YS8A 1VQ7V 4J10A 4MTXA 1KQSU 3K5OA 1P49A 1IXMA 2ZT9B 1FFXB 1S5HC 1X4TA 2ZDIA 2NN4A 4H33A 1DF5A 5LXTA 3ETQA 2CH7B 2Y69B 1SZXA 4JI2O 3AG7A 4OPAA 1WPBA 3F5TA 3ZHVA 1B6QA 3A0HZ 3WG7B 5ITZB 4MVOA 1Q81W 1H2KA 2BSKA 3ASOB 4N21A 3CCLV 4EB6B 2JDIG 3G67A 2W0FC 3RVYA 1W0JG 4RQFA 2QWNB 1MMMA 3ZHTA 3SPHA 1R73A 2UU9O 4EB6A 3WB1A 1AI6A 1GM7A 2EULA 3JAWA 2HVJC 1ZL8A 4WBNA 4DR2O 4JZ2A 3SYAA 4JI2B 4FLYA 3ABUA 1PNKA 1TAEA 3CC2V 1VQNV 3ETGA 1PNLA 4PHZA 2GV9A 5HFMA 1ZTEA 4BIZA 3MD0A 5EC1C 5EZYA 4X1YA 4O4JB 3MAQA 2X6AA 1MZEA 1VF5B 4DK1A 1S5LZ 3BA9A 2UUCB 5CA1A 3ABMC 4YJ2B 1AJNA 2KG7A 1VARA 3A0RA 1LNQA 4X1KA 2ETNA 4MVZA 3SPCA 2E74B 5J2TA 3WG7C 1PV0A 1LUVA 1BMFG 1GTOA 4UCOA 3ZRXA 2DYSC 2IM9A 4HZ3A 2JEXA 3JD4A 4DW0A 3RYFA 3BA8A 2OCCB 2JS5A 2P67A 4CH6A 4FLWA 4TQDA 1S77D 1W0KG 1KP2A 1S72V 1OCZC 2ZE7A 1VF7A 3T2MA 1RM1C 1WP8A 4W4LA 3T1YB 5AG2A 3IGAC 3LNMB 4JI4B 4BR6A 4CZZA 4IYHA 4DV6B 2VQFO 2LGQA 3R66A 2PYJA 2QDOA 3T1HO 4LR3A 2HKOA 3ABMB 4PA9A 4X65O 4U7OA 4WFBV 4FFKA 4DV6O 2WLHA 1QR8A 4IGGA 1FXKB 3K57A 5KHIA 4QGPA 4LF7B 3LUTB 3T1YO 1ZLZA 2JGDB 4TV9B 4ZOLB 4I0XA 4EFBA 4MW8A 4WFAV 3L75H 3ZIAG 3ZMVA 2OIGA 2W6IG 2A7WA 3N2GA 2BTQA 2C2AA 4PDVA 5TISZ 4UCRA 5EIBD 4PDMA 1QVGU 2D2CB 2B9ZA 2CTQA 2DWEC 3LSQA 3OAAG 4CH4A 3T1CA 5IDJA 5JVDA 3CCSV 3ML0A 2EILC 2CAZC 4I7ZB 5KMGA 4PI2A 2KG7B 3UQ8A 1AI5A 4CH5A 4RUEA 2Z5UA 3ICXA 4MVQA 4GUNA 3WB2A 2BOCC 4NB5A 2VRZA 2YIDA 3GB7C 4AI8A 4FLTA 4YY3O 2Q68A 1GKFA 2ZD9A 4JI3O 2P06A 4O4HA 4U3JB 2YXHA 4DV0O 1JQ0A 1WNSA 1QVFU 3IC7A 2WSSG 2ZNJA 3KG2A 4UVCA 2YSUB 4DV3B 3KKYA 4L87A 1B3QA 4PA4A 1NI8A 4UCSA 2F23A 2IBZH 2P7TC 1HDJA 2DYRB 1VEWA 1WB8A 4MVRA 2QKSA 1KC8W 4JAVA 4DW1A 1VQLV 1IBKO 1OCRC 1MSWD 4GZRB 1V54B 1UJWB 4KL1A 3EXAA 1G8MA 1JVMA 1VF6C 4DV0B 3X2QB 3CJHA 4CC6A 4UV8A 3WB0A 1BT8A 2EIKC 3RN4A 4QIWF 4JI3B 5D5QA 5GONA 1AR1B 1J95A 2MK3A 3O65A 3P30A 4I0XB 2GUZB 3K06A 2K9PA 2PGGA 5DN6G 3DC5A 4JYCA 1XREA 1JJ2U 2QJ1A 2Q9LA 2ZM6B 1K33A 2VWJA 4J80A 3OGCC 2P22C 1Q6UA 3L9DA 3RFRA 2ADPA 2Q73A 2JIZG 2UXDB 4O4LA 3ZHRA 4JI0O 1BQ0A 3ZEDA 2WAMA 1AI7A 1YJWV 1LR1A 2ADQB 1TUEB 5EYPA 4P2ZA 2P4VA 3JATA 2EINB 4J9YB 3OE7G 1YZBA 2N04A 3OT7A 4LF6O 2ZQMA 4H0LB 2ITDC 3ZRSA 4YHHB 1VQPV 1YSCA 1V9PA 1XL6A 5CA3A 4GX1A 2Q69A 2YEVA 4NXNB 2PUSA 2GUZA 3X2QC 4FLUA 2DYSB 3UT5A 4DV2O 2OCCC 2M6YA 5CBGA 3DTUB 2ARHA 3VQVA 3CCRV 2YXYA 2KKWA 1OCZB 1H38A 1KKCA 1KKDA 4JV5O 1BS3A 1YJ9V 4DV4O 1KBHA 1EN4A 1HNWO 2PTMA 3JARB 2XT9A 2DE0X 3OMAB 4Q6GA 2OT5A 4NTYA 3CD6V 3H01A 5B1NA 1IBMO 2EIJB 4YY3B 5JH7A 5LHHA 3JSLA 1IBKB 1Q3EA 1R1BA 2R70A 4P30A 4X20B 3HR0A 2OYQA 4G27B 4NTXA 3M7MX 4JI8O 3HKCA 3FB7C 2EINC 1K4CC 3A0BZ 4PDRA 2QM8A 4HNAA 3M8AA 3OGIB 1ZL8B 5FPRA 5LHGA 3C90A 4AHCA 2WLJA 3H9VA 3HKBA 3E86A 2EJ7A 3J81N 4KFMA 2UXCO 3JYCA 5L3GA 4FMTA 3EFFK 2VQFB 2KB1A 3CEIA 2F4VB 4DR7B 3CWBH 2RDCA 3FAVB 3KCXA 3RVZA 2EIJC 1JX9A 4PV1B 2ZDIC 3TXQA 1D5NA 3FB5C 4FM2A 2QKAA 3SYCA 1VQ6V 4ZOLA 1B06A 5KHHA 1N32B 4GCZA 4DR5O 1AI4A 3AEIA 3H1KH 4DR1B 1NTMH 3ZHSA 3HKDB 4DXWA 1GO3F 4K0KB 5LGUA 1U97A 1VQOV 1PL0A 5KHJA 4D7TA 4GKJB 4O2BB 4KHPB 4JI4O 5B5EZ 1WA8B 4PA7A 4I4TA 3GVMA 3FKSG 5LBQA 3WFVA 2P4KA 1AVMA 2Q8VA 3K9SA 4DUYO 4KHPO 2H8PC 1NU1H 3BAAA 4UCVA 1PM9A 5L3CA 1OZ0A 1SQBH 1F7YA 2UUAB 4WFFA 4HYOA 4JYYA 5KA5A 1FXHA 2H94A 2G38A 2EIKB 3QTCA 2MW2B 4ICGA 1XHXA 1OCCB 2IJHA 2A0LA 1HR0O 3SYPA 2Z3YA 1VMGA 2UXCB 2UU9B 3CCJV 2Q6AA 5DECA 4F6RA 1GMGA 3CRQA 1VQ8V 2GTSA 2PI4A 5EYPB 2HR3A 1H2SB 5F2VO 4GX0A 4EKWA 3LDEA 1G1XB 1Y76B 2XAFA 2ZR2A 3U0ZA 4B3SO 3RWRD 4X1IA 1SERA 4K8XA 2Q7HA 4IIJA 2Y0IA 4XDKA 3ZRWA 5LA6A 4O4HB 4DK0A 4HAMA 2XOKG 2UUCO 4ZIBA 1SETA 4YJ3B 1HNXB 2GSMB 4ABMA 4DV3O 5IE9A 3CCUV 1IXBA 1I7FA 4IIJB 1K73W 4LFCO 1BZKA 5IY5B 1YCIA 3JAWB 4PD4F 2LJ2A 2V4DA 3FFQA 3OTOO 2OCHA 2W0XA 5GW7A 1M1KW 1V55C 4BW5A 4J7KA 4YIPA 2A79B 3Q4HB 1RSOA 4DR7O 1BGYH 3QO8A 4CH3A 4XDJA 1QQCA 3K03A 1E79G 1N0JA 1Q5OA 2Q67A 2JEUA 1AILA 1L1FA 1SQFA 1YDXA 1RFYA 2ATKC 2BOBC 4Z1MG 2WLMA 4TUYA 4MSWC 3PJSK 1KECA 5JJJB 2D3OW 4I55B 1SZTA 5JWPA 1ORQC 3LDDA 1X59A 5KHKA 3CX5F 1PP9H 4FZ0A 2QGNA 2XNDG 1S5JA 4DV1B 4LFAO 1CP9A 3JD0A 2ILMA 1KD1W 2XTAA 2X7RB 5LL6Y 3LNNA 5LP6A 1I08A 3H1HH 3L71H 3CRRA 4GLXA 1AR5A 4RQEA 5LMUB 3KZIZ 3CCQV 4LF9B 1K97A 4IT5A 1K3EA 3K04A 5FPOA 4FVMA 3EHBB 1BL8A 3F7YC 3SPJA 2EJRA 3RW0A 5LYJB 4OPHA 1QCEA 4U3FH 2QR4A 2YEVB 3CPWU 2AW9A 4TWKA 3ZX6A 2LQTA 1EN5A 4CBCA 3M99B 2FB5A 4AILC 2ZIMA 1Q90D 3CRMA 2GTAA 2CTPA 4JGSA 3E8GA 3J80N 3ABTA 1Q82W 1VQKV 5CMUA 3RYFB 3TETA 4AQYB 1XHZA 4B3RB 1SS3A 5B1BB 2HLDG 4FPPA 3B2EE 4LNUB 4ASUG 4MVSA 2UXBO 3T1HB 1ENVA 3K9AA 1TUBB 2JVDA 1H2NA 4JI6B 1EM1A 4B7KA 1I5XA 3AG4C 5FLXN 3R65A 4TV8B 4JI7B 4B7EA 5EBMC 5KX5B 4TT3G 2EZOA 2B1GA 3E8BA 5EK0A 4X62O 4I9QA 2HVKC 3BVOA 4ZI7B 3AG2B 1F4MA 2WLKA 2P6JA 3HKDA 1Q43A 1FJGO 1DTOA 2WA3A 3G80A 2Z0AA 5GTHZ 2QM4A 1GN2A 3IC9A 4MTOA 1M56B 2JS3A 3JCUZ 1XI1A 2KQXA 2F95B 2JK5C 1JOYA 3QO7A 1R3LC 1SESA 4Q20A 1AJQA 2LFRA 4LH6A 3JARA 4B08A 1N36B 1K9MW 3BFRA 1D5AA 4ZKIA 3OEEG 2DQ0A 2RQ6A 5J2UB 4OGQB 4UCUA 3H1IH 3UKMA 1NR1A 4XDLA 3CYOA 1I94B 2PI5A 2XAGA 3SJAC 3E2EA 1H8EG 3MHHC 4TQFA 1ZX3A 3O9OA 4J42A 4QNHB 2CGNA 4DO2A 4YHHO 3A2FA 4HNAB 4LF6B 1NJIW 4DV5O 2PYLA 1SC5B 2VWKA 5L3BA 5LYJA 1BQZA 1ZAUA 3SPIA 1M57B 2EIMB 2CDYA 2UUBB 1I5YA 1K8AW 4D7SA 3LSSA 1HR0B 1V55B 1RSOB 4LFBO 1P4RA 3THOA 4R6ZA 3OFNG 5A9GA 1HNWB 2RJZA 1XILA 5LP6B 4MTFA 3ZN0A 2PY5A 4X88A 3IFXA 1Y67A 1KP3A 3DXRA 5FNVA 4B3MO 4GT1A 4LNUA 2XASA 5JCOC 1K4DC 4CS2A 4DV2B 5LGNA 3ZMSA 5E79Z 4KUMA 4GKKB 2AZ2A 3IAYA 4IYIA 2L6LA 3W7UA 1VQ9V 1IURA 3GWOA 1JR9A 1OCOC 2QKCA 4JYAO 4OX9O 1RM1B 4XBFA 1K34A 1COWG 1TVKA 1E1QG 2DW4A 4LF8O 4X65B 4I9WA 1M93A 3T4DA 1DLBA 1S0VA 1WB7A 1L0LH 1H8HG 2ZE8A 4LFAB 5H6RA 4O4LB 3D36C 4ZHQA 3U10A 1N33B 3STLC 1QLEB 4JF3A 5K1PA 3CRCA 1XDCA 3FB6C 2A9HA 1XNRO 2QWOB 1AP5A 1SQVH 1YJNV 1VF6A 4GX5A 5IWAO 1M5IA 1BHAA 4NVPA 3L70H 5JCOA 5B3SB 4DUZO 1PD3A 1JA8A 3S3XA 3JALA 1GK9A 2VQEB 2F93B 1P7GA 2E75B 3SDLA 3JASA 1IBLO 3OR7C 3HKBB 2CTWA 2CTRA 4LBEC 4LCUC 3DC6A 5B1BC 2OWOA 4F6RB 1URFA 1N0NA 3K58A 3ZRVA 4WFGA 1AJPA 4WCEV 4X1YB 4JASA 4MS2A 3G4SV 4X9QA 3RYCB 1XBLA 4JI1B 1SKVA 2JJ1G 2Q0OC 3IJ4A 2CUGA 2E5LB 4NKGB 1HNZB 1Q86W 1K92A 1SF9A 3B8NA 1Q8IA 1JFFA 3F7VC 4O2AB 5H5NA 1MABG 1FPOA 3G71V 1DK1A 5EBLC 3SJQC 2HHHO 4PELA 4YJ3A 3SR2C 3B09A 2R9RB 3JD1A 1I94O 3D3IA 4I50B 4LF8B 3D3QA 2JGUA 1WA8A 5LHIA 2BSKB 4WFHA 4BAYA 1ZUQA 4X1IB 3UO3A 2XAQA 4IHJB 5C93A 2NLJC 3HPLC 1MG1A 3ABKC 2XHBA 1N34B 1THZA 5LOVA 3CHXA 2Q4PA 2QEXV 5C8YB 1KU9A 3OTFA 3TK1A 1TVKB 1OCRB 5DM6V 1OV9A 2AHZA 1V54C 1EBOA 1GM8A 4LWSA 4MVUA 5A2QN 1XMQB 1YITV 3AK2A 3K0DA 3N2GB 5BR8B 3CRAA 1XNRB 1D2DA 1K5SA 1ZWIC 2AXTZ 1HW7A 2ITCC 1BCCH 1R3IC 1SQXH 3DXRB 4DR4O 2IJKA 2OTLV 1RP3B 3BRCA 4UXNA 5KX5A 4JTAB 3VQYA 3CXCU 1AROP 2FL4A 4I50A 1R6TA 1S3JA 1M9NA 1U96A 2YIAA 1PPJH 1FXKC 3P3PA 4DR3B 4DYLA 4O4IA 3BHPA 1XUQA 2QSAA 1ZSPA 1E1RG 1HP8A 4NXMB 1RPOA 4O4JA 5GTIZ 1SQGA 1JMKC 3VBBA 5BR8O 4TUYB 1L8DA 3PN1A 3RT3C 4DR2B 3CP1A 3K5LA 1KB9F 2F43G 1NZ6A 2RNBA 2YIBA 4NYKA 1VP7A 3STZC 1G4YB 2Y48A 1Z5WA 3NXSA 3E8FA 1WJZA 4DR6O 2GBOA 5L3FA 1WPXA 1J5EO 5J2UA 2HJFC 3N27A 2RN9A 4LFBB 1JPXA 1TA8A 4FZ1A 1NKDA 3OTOB 3UCSC 5ITZA 1NH2B 3E35A 3ETDA 2F1MA 3SYQA 4PI0A 4X1KB 3ZHUA 1Z5VA 4B3TO 2WLLA 3T4ZA 2LW1A 1EZVH 4RUFA 2Q0AA 2XAJA 2X0LA 1MZFA 4DUZB 1NBMG 2A06H 1B04A 1SRYA 5L3DA 1IVSA 4DV1O 1R6KA 3AK1A 3W7SA 1CEZA 1QLEC 3QVNA 1AB3A 2AHYA 5GONB 5EC2C 2DJVA 2E76B 3EVKA 1Y6XA 5B1OA 2WLLB 5KHGA 2E5LO 2LFSA 4DRXA 2DYRC 2Q7EA 3RYCA 2YI8A 4BIOA 1N4CA 3CE2A 4B3TB 1YIJV 1YI2V 5JVDB 5B3SC 2ZIOA 2PZSA 3FX7A 3HB3B 4JV5B 3OMNB 2YC0A 3D8CA 1GH6A 5IT9N 4TV8A 4J11A 3I56V 3UO2A 1GRJA 1QU7A 4U3JA 4GKKO 1XL4A 2QWPB 2CH7A 1F51A 5D5PA 4DUYB 3CS5A 5B66Z 5LA6B 2DOSA 4JI7O 2HEPA 4UUJC 5LGTA 2QWQB 1R6NA 3W7XA 1K5QA 1NQTA 1Y74A 5JJEB 1BHBA 4O2BA 5H9CA 4X64B 2AZ0A 2IJIA 1S76D 5B1AB 2GHYA 1IX9A 4B3RO 1SA0A 4FLXA 4FIPC 4QJFB 5KAIZ 1NTZH 1NH2D 4BIUA 4LP8A 2WLNA 3RYHA 4J7JA 3ABLC 3FB8C 4L8JA 2IU3A 1BE3H 4UVAA 5EIBC 4CS4A 1R3KC 4PJ0Z 1Y74B 4PA3A 4UB6Z 4OXSA 4TOIA 2F66C 3JAKB 1SQQH 4U7NA 3ABKB 3J7AU 3APQA 2QTOA 4G28B 5JJNB 4DV5B 4QPKA 1NS1A 3QNEA 1PKXA 5LMNO 1Y66A 3ZJZA 4PA6A 1UFIA 4WFEA 2B1IA 3JD3A 5CBFA 1WAZA 1M90W 4J41A 5CA0B 1NT2B 3DGEA 2V1DA 5C8YA 4FJCC 2OTJV 4P9OA 3APOA 2AGAA 5LOVB 3ZMUA 1H2GA 4YXWG 4I4TB 1WLEA 2LW7A 4FK5C 1L0NH 2Y0PA 4X66B 3K3WA 4JI5O 4UV9A 2VS0A 4DR4B 1EZJA 1GN3A 2V7QG 3B40A 3SYOA 4H13B 1MOFA 3VOUA 3CC4V 3QF7A 1OHHG 2KSDA 4RAIA 1EFRG 3OR6C 4J7ZA 3E22B 1K7DA 1KUQA 2IJJA 3ABLB 4QPJA 1JFFB 1FYJA 2JJ2G 2UXXA 2QTSA 1FAFA 5JH7B 5CB4B 4KP4A 3ZRWB 1W2BU 3E8HA 4NR1A 1XMOB 1TUBA 1XNQO 3BY6A 2Q7GA 4X66O 2NNUA 3BABA 1FS0G 1NR7A 1Q7YW 5IY5C 5KA6A 2WLIB 2FMLA 2CGOA 2YDEA 1XMOO 5H6QA 1KMIZ 2ZR3A 4YJ2A 5KMGB 5CA1B 3K08A 2WLIA 3JALB 3CXHF 2R72A 4B3SB 4FLZA 2BE3A 1A32A 4H37A 3P3NA 1YVWA 4KXRA 4N23A 4JI1O 4ZI7A 4ZHQB 3A8TA 3VQXA 3H1LH 1HWYA 2Y4TA 3D36A 4X20A 4UVBA 2CK3G 2IH1C 1QNMA 3RYHB 5J9PC 3RYIA 2HP8A 3ZCCA 2EBOA 3RBZA 2LO1A 1IBMB 1G6UA 4LF5O 3H1JH 4ZBMA 1N33O 2YICA 4K0KO 1FFTB 1IBLB 3W7WA 1GN6A 4GKJO 3N2KB 3W7TA 1QHTA 4DR3O 5FL7G 1LUWA 1XOUA 2DWDC 5IJ0B 1PL4A 1YTFD 4I55A 5IWAB 3JSNA 1YHQV 2B5UA 4UFZA 4X64O 1JJOA 3SPGA 5CA0A 2P5OA 4X8AA 1P7BA 1HNZO 5DEDA 4LF9O 2JRIA 1MNGA 4NTWA 3OEHG 2YIBD 4Z2WA 1EN6A 3JATB 1R3JC 3OD4A 3L72H 5KUMA 3BPZA 3K5NA 4R50A 1GM9A 2IU0A 4CC5A 4UB8Z 2ZNIA 1XNQB 1P84F 2DN9A 4PDLA 1O9HA 4IL6Z 3OUSA 2P90A 3B4SA 5B1AC 1VQ4V 1FXVA 2R9AA 3K79A 4R8CA 4TSFG 4QE7A 3CCVV 3RGBA 1F4NA 4CS3A 1XMQO 3P32A 4D6TH 2UUBO 4A5UB 1AR4A 2FTKA 2IH3C 4H44B 4K8ZA 5KLVH 4LF4O 1N32O 3E83A 4QE9A 5HFLA 1FFXA 3FD9A 1PNMA 3ZBHA 4BWAA 1Y76A 1FKAO
chains in the Genus database with same CATH topology
1KB9F 1L0LH 1SQPH 1NTKH 4U3FH 1BE3H 3CWBH 3H1LH 4PD4F 3H1KH 1NTMH 3CXHF 1BCCH 3H1HH 1EZVH 3L71H 1SQXH 3H1IH 1SQQH 2BCCH 1NU1H 4D6TH 3L72H 3L73H 2FYUH 1SQBH 2A06H 5KLVH 2IBZH 1BGYH 3BCCH 3H1JH 1SQVH 1L0NH 3TGUH 3L74H 3CX5F 1PP9H 1NTZH 1PPJH 3L75H 1KYOF 1P84F 3L70H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KB9 F;  1L0L H;  1SQP H;  1NTK H;  4U3F H;  1BE3 H;  3CWB H;  3H1L H;  4PD4 F;  3H1K H;  1NTM H;  3CXH F;  1BCC H;  3H1H H;  1EZV H;  3L71 H;  1SQX H;  3H1I H;  1SQQ H;  2BCC H;  1NU1 H;  4D6T H;  3L72 H;  3L73 H;  2FYU H;  1SQB H;  2A06 H;  5KLV H;  2IBZ H;  1BGY H;  3BCC H;  3H1J H;  1SQV H;  1L0N H;  3TGU H;  3L74 H;  3CX5 F;  1PP9 H;  1NTZ H;  1PPJ H;  3L75 H;  1KYO F;  1P84 F;  3L70 H; 
#chains in the Genus database with same CATH topology
 3TCU A;  1N36 O;  3OW2 U;  3AG2 C;  3TJT A;  4C7U A;  3CJH B;  1O9G A;  3OUF A;  4DV7 O;  1N34 O;  2UXN A;  3C3S A;  5JQG B;  1VQ5 V;  1YXB A;  3ZN1 A;  3CCE V;  5IYZ B;  4HBN A;  1US6 A;  4E4E A;  3Q4H A;  2BTQ B;  3ASN B;  1QLN A;  3LDC A;  3JAS B;  5IYZ A;  1FJG B;  4OX9 B;  2L35 A;  4JI5 B;  5JQG A;  5K1X A;  4LC1 A;  3QG5 A;  3CB2 A;  5BZB A;  3U11 A;  4DV7 B;  1Z2G A;  2E3C A;  1T5E A;  3S3W A;  1CPY A;  5EBW C;  1FXK A;  2ZXW C;  4GX2 A;  3BEH A;  3AK3 A;  1WN7 A;  5LXT B;  2HFE C;  5IJ0 A;  1Q6H A;  2BTO A;  3JCZ A;  4JI8 B;  5IYC O;  4B3M B;  1I0H A;  3G6B A;  2PF4 E;  3N2K A;  5BXZ A;  4JTC B;  2XUM A;  4O4I B;  1GN4 A;  4JAU A;  3I55 V;  1UPG A;  3CSX A;  3L73 H;  2K1E A;  4FM1 A;  5H2F Z;  2LP7 A;  4AQY O;  2NR5 A;  4X89 A;  4X62 B;  3FYI B;  4WF9 V;  1IDS A;  4EEQ A;  2O57 A;  5IJ9 A;  1SQP H;  5CN0 A;  2IW5 A;  1NTK H;  4Z1V A;  2EIM C;  3CCM V;  1DF4 A;  1H2M A;  4GYC B;  5L3E A;  1F23 A;  2ODM A;  1QR9 A;  3F5W C;  3MDS A;  4DR5 B;  3ASN C;  1OCC C;  3BCC H;  3FAV A;  4LWS B;  5BMV A;  3VQW A;  1WP7 A;  4MT8 A;  3CMA V;  2JGD A;  2ZE6 A;  1DGS A;  2ZCE A;  4TV9 A;  1VIB A;  3MHS C;  5BY1 A;  5LMN B;  1XQ8 A;  1IZ3 A;  5J2T B;  4JI0 B;  4R7C A;  3SJC C;  1NVP D;  2ZXW B;  3AG4 B;  2LGW A;  3ZHQ A;  5LMU O;  1YEW A;  4JYB A;  3TXS A;  1OJH A;  3WU2 Z;  4RO2 A;  4UCT A;  2ZE5 A;  2ZM6 O;  2Q5Z A;  2H3O A;  1M4U A;  2UXB B;  4JYA B;  5E1A C;  2DQ3 A;  3ZMT A;  4LF5 B;  3AG1 C;  1BSM A;  1MSD A;  5CB4 A;  2A3Q A;  4DR1 O;  3RYI B;  4O2A A;  4LFC B;  3DSQ A;  2WPD G;  3K0G A;  3ZS8 C;  1M56 C;  4MW3 A;  2X6B A;  4MTG A;  4P9P A;  4I5S A;  5BMV B;  4RWU A;  2Y4U A;  2YXL A;  3G6E V;  4FM0 A;  4LH7 A;  3K59 A;  3E22 A;  4FLV A;  4MVM A;  5KAF Z;  3JD2 A;  2BCC H;  2HJD A;  1FD9 A;  1RPR A;  1H2L A;  2WWW A;  3E89 A;  1YF2 A;  1VQM V;  2FKX A;  3CME V;  1Y4M A;  2ZIN A;  3L74 H;  3GWK C;  1NVP B;  4JTD B;  2QM7 A;  4K3A A;  4DR6 B;  2ZKO A;  1N8R W;  3KCY A;  2N05 A;  2M7W A;  4IHJ A;  2EX3 A;  4K35 A;  3B8M A;  3UM7 A;  2HHH B;  4J9Z B;  1AP6 A;  1YTF B;  3NR7 A;  2RMK B;  2CE4 A;  5IYD O;  5EZY B;  3OMI B;  4JZG A;  2QE7 G;  4BW9 A;  3AG1 B;  1ROP A;  1GAX A;  3AG3 C;  3HKC B;  2X6C A;  2VQE O;  4YIO A;  3JAK A;  1M57 C;  3FYE B;  4WBN B;  4LF7 O;  4LF4 B;  4JI6 O;  1HNX O;  5IJ9 B;  3K5M A;  4JPR A;  2WA4 A;  1CXZ B;  2N74 A;  3I5D A;  2YI9 A;  1XEQ A;  1Q6I A;  4W4K A;  2XAH A;  5LP6 C;  3HKE A;  1J5E B;  2OIE A;  2EZP A;  4NXN O;  2UXD O;  4DV4 B;  2RCV A;  1W59 A;  3LSU A;  3UT5 B;  3SGI A;  2HG5 C;  2YUA A;  2Y69 C;  4EFE A;  4F4L A;  1JCH A;  5KUK A;  5FNV B;  3B77 A;  3ZMZ A;  3JAM N;  3QO5 A;  2UUA O;  2QWR B;  3ASO C;  2W6J G;  3CC7 V;  4F6E A;  2R9I A;  2EIL B;  3OM3 B;  4FFB B;  3HKE B;  3AG3 B;  4G2K A;  4E2L A;  2GDS A;  4NXM O;  2F4V O;  4JAA A;  2FYU H;  5CBH A;  1TGO A;  2QA4 V;  3C3T A;  3TGU H;  3SJB C;  1KYO F;  1MA1 A;  1OCO B;  2DMX A;  3ETE A;  5IYB O;  4DRX B;  1SA0 B;  4FFB A;  1QBZ A;  2YS8 A;  1VQ7 V;  4J10 A;  4MTX A;  1KQS U;  3K5O A;  1P49 A;  1IXM A;  2ZT9 B;  1FFX B;  1S5H C;  1X4T A;  2ZDI A;  2NN4 A;  4H33 A;  1DF5 A;  5LXT A;  3ETQ A;  2CH7 B;  2Y69 B;  1SZX A;  4JI2 O;  3AG7 A;  4OPA A;  1WPB A;  3F5T A;  3ZHV A;  1B6Q A;  3A0H Z;  3WG7 B;  5ITZ B;  4MVO A;  1Q81 W;  1H2K A;  2BSK A;  3ASO B;  4N21 A;  3CCL V;  4EB6 B;  2JDI G;  3G67 A;  2W0F C;  3RVY A;  1W0J G;  4RQF A;  2QWN B;  1MMM A;  3ZHT A;  3SPH A;  1R73 A;  2UU9 O;  4EB6 A;  3WB1 A;  1AI6 A;  1GM7 A;  2EUL A;  3JAW A;  2HVJ C;  1ZL8 A;  4WBN A;  4DR2 O;  4JZ2 A;  3SYA A;  4JI2 B;  4FLY A;  3ABU A;  1PNK A;  1TAE A;  3CC2 V;  1VQN V;  3ETG A;  1PNL A;  4PHZ A;  2GV9 A;  5HFM A;  1ZTE A;  4BIZ A;  3MD0 A;  5EC1 C;  5EZY A;  4X1Y A;  4O4J B;  3MAQ A;  2X6A A;  1MZE A;  1VF5 B;  4DK1 A;  1S5L Z;  3BA9 A;  2UUC B;  5CA1 A;  3ABM C;  4YJ2 B;  1AJN A;  2KG7 A;  1VAR A;  3A0R A;  1LNQ A;  4X1K A;  2ETN A;  4MVZ A;  3SPC A;  2E74 B;  5J2T A;  3WG7 C;  1PV0 A;  1LUV A;  1BMF G;  1GTO A;  4UCO A;  3ZRX A;  2DYS C;  2IM9 A;  4HZ3 A;  2JEX A;  3JD4 A;  4DW0 A;  3RYF A;  3BA8 A;  2OCC B;  2JS5 A;  2P67 A;  4CH6 A;  4FLW A;  4TQD A;  1S77 D;  1W0K G;  1KP2 A;  1S72 V;  1OCZ C;  2ZE7 A;  1VF7 A;  3T2M A;  1RM1 C;  1WP8 A;  4W4L A;  3T1Y B;  5AG2 A;  3IGA C;  3LNM B;  4JI4 B;  4BR6 A;  4CZZ A;  4IYH A;  4DV6 B;  2VQF O;  2LGQ A;  3R66 A;  2PYJ A;  2QDO A;  3T1H O;  4LR3 A;  2HKO A;  3ABM B;  4PA9 A;  4X65 O;  4U7O A;  4WFB V;  4FFK A;  4DV6 O;  2WLH A;  1QR8 A;  4IGG A;  1FXK B;  3K57 A;  5KHI A;  4QGP A;  4LF7 B;  3LUT B;  3T1Y O;  1ZLZ A;  2JGD B;  4TV9 B;  4ZOL B;  4I0X A;  4EFB A;  4MW8 A;  4WFA V;  3L75 H;  3ZIA G;  3ZMV A;  2OIG A;  2W6I G;  2A7W A;  3N2G A;  2BTQ A;  2C2A A;  4PDV A;  5TIS Z;  4UCR A;  5EIB D;  4PDM A;  1QVG U;  2D2C B;  2B9Z A;  2CTQ A;  2DWE C;  3LSQ A;  3OAA G;  4CH4 A;  3T1C A;  5IDJ A;  5JVD A;  3CCS V;  3ML0 A;  2EIL C;  2CAZ C;  4I7Z B;  5KMG A;  4PI2 A;  2KG7 B;  3UQ8 A;  1AI5 A;  4CH5 A;  4RUE A;  2Z5U A;  3ICX A;  4MVQ A;  4GUN A;  3WB2 A;  2BOC C;  4NB5 A;  2VRZ A;  2YID A;  3GB7 C;  4AI8 A;  4FLT A;  4YY3 O;  2Q68 A;  1GKF A;  2ZD9 A;  4JI3 O;  2P06 A;  4O4H A;  4U3J B;  2YXH A;  4DV0 O;  1JQ0 A;  1WNS A;  1QVF U;  3IC7 A;  2WSS G;  2ZNJ A;  3KG2 A;  4UVC A;  2YSU B;  4DV3 B;  3KKY A;  4L87 A;  1B3Q A;  4PA4 A;  1NI8 A;  4UCS A;  2F23 A;  2IBZ H;  2P7T C;  1HDJ A;  2DYR B;  1VEW A;  1WB8 A;  4MVR A;  2QKS A;  1KC8 W;  4JAV A;  4DW1 A;  1VQL V;  1IBK O;  1OCR C;  1MSW D;  4GZR B;  1V54 B;  1UJW B;  4KL1 A;  3EXA A;  1G8M A;  1JVM A;  1VF6 C;  4DV0 B;  3X2Q B;  3CJH A;  4CC6 A;  4UV8 A;  3WB0 A;  1BT8 A;  2EIK C;  3RN4 A;  4QIW F;  4JI3 B;  5D5Q A;  5GON A;  1AR1 B;  1J95 A;  2MK3 A;  3O65 A;  3P30 A;  4I0X B;  2GUZ B;  3K06 A;  2K9P A;  2PGG A;  5DN6 G;  3DC5 A;  4JYC A;  1XRE A;  1JJ2 U;  2QJ1 A;  2Q9L A;  2ZM6 B;  1K33 A;  2VWJ A;  4J80 A;  3OGC C;  2P22 C;  1Q6U A;  3L9D A;  3RFR A;  2ADP A;  2Q73 A;  2JIZ G;  2UXD B;  4O4L A;  3ZHR A;  4JI0 O;  1BQ0 A;  3ZED A;  2WAM A;  1AI7 A;  1YJW V;  1LR1 A;  2ADQ B;  1TUE B;  5EYP A;  4P2Z A;  2P4V A;  3JAT A;  2EIN B;  4J9Y B;  3OE7 G;  1YZB A;  2N04 A;  3OT7 A;  4LF6 O;  2ZQM A;  4H0L B;  2ITD C;  3ZRS A;  4YHH B;  1VQP V;  1YSC A;  1V9P A;  1XL6 A;  5CA3 A;  4GX1 A;  2Q69 A;  2YEV A;  4NXN B;  2PUS A;  2GUZ A;  3X2Q C;  4FLU A;  2DYS B;  3UT5 A;  4DV2 O;  2OCC C;  2M6Y A;  5CBG A;  3DTU B;  2ARH A;  3VQV A;  3CCR V;  2YXY A;  2KKW A;  1OCZ B;  1H38 A;  1KKC A;  1KKD A;  4JV5 O;  1BS3 A;  1YJ9 V;  4DV4 O;  1KBH A;  1EN4 A;  1HNW O;  2PTM A;  3JAR B;  2XT9 A;  2DE0 X;  3OMA B;  4Q6G A;  2OT5 A;  4NTY A;  3CD6 V;  3H01 A;  5B1N A;  1IBM O;  2EIJ B;  4YY3 B;  5JH7 A;  5LHH A;  3JSL A;  1IBK B;  1Q3E A;  1R1B A;  2R70 A;  4P30 A;  4X20 B;  3HR0 A;  2OYQ A;  4G27 B;  4NTX A;  3M7M X;  4JI8 O;  3HKC A;  3FB7 C;  2EIN C;  1K4C C;  3A0B Z;  4PDR A;  2QM8 A;  4HNA A;  3M8A A;  3OGI B;  1ZL8 B;  5FPR A;  5LHG A;  3C90 A;  4AHC A;  2WLJ A;  3H9V A;  3HKB A;  3E86 A;  2EJ7 A;  3J81 N;  4KFM A;  2UXC O;  3JYC A;  5L3G A;  4FMT A;  3EFF K;  2VQF B;  2KB1 A;  3CEI A;  2F4V B;  4DR7 B;  3CWB H;  2RDC A;  3FAV B;  3KCX A;  3RVZ A;  2EIJ C;  1JX9 A;  4PV1 B;  2ZDI C;  3TXQ A;  1D5N A;  3FB5 C;  4FM2 A;  2QKA A;  3SYC A;  1VQ6 V;  4ZOL A;  1B06 A;  5KHH A;  1N32 B;  4GCZ A;  4DR5 O;  1AI4 A;  3AEI A;  3H1K H;  4DR1 B;  1NTM H;  3ZHS A;  3HKD B;  4DXW A;  1GO3 F;  4K0K B;  5LGU A;  1U97 A;  1VQO V;  1PL0 A;  5KHJ A;  4D7T A;  4GKJ B;  4O2B B;  4KHP B;  4JI4 O;  5B5E Z;  1WA8 B;  4PA7 A;  4I4T A;  3GVM A;  3FKS G;  5LBQ A;  3WFV A;  2P4K A;  1AVM A;  2Q8V A;  3K9S A;  4DUY O;  4KHP O;  2H8P C;  1NU1 H;  3BAA A;  4UCV A;  1PM9 A;  5L3C A;  1OZ0 A;  1SQB H;  1F7Y A;  2UUA B;  4WFF A;  4HYO A;  4JYY A;  5KA5 A;  1FXH A;  2H94 A;  2G38 A;  2EIK B;  3QTC A;  2MW2 B;  4ICG A;  1XHX A;  1OCC B;  2IJH A;  2A0L A;  1HR0 O;  3SYP A;  2Z3Y A;  1VMG A;  2UXC B;  2UU9 B;  3CCJ V;  2Q6A A;  5DEC A;  4F6R A;  1GMG A;  3CRQ A;  1VQ8 V;  2GTS A;  2PI4 A;  5EYP B;  2HR3 A;  1H2S B;  5F2V O;  4GX0 A;  4EKW A;  3LDE A;  1G1X B;  1Y76 B;  2XAF A;  2ZR2 A;  3U0Z A;  4B3S O;  3RWR D;  4X1I A;  1SER A;  4K8X A;  2Q7H A;  4IIJ A;  2Y0I A;  4XDK A;  3ZRW A;  5LA6 A;  4O4H B;  4DK0 A;  4HAM A;  2XOK G;  2UUC O;  4ZIB A;  1SET A;  4YJ3 B;  1HNX B;  2GSM B;  4ABM A;  4DV3 O;  5IE9 A;  3CCU V;  1IXB A;  1I7F A;  4IIJ B;  1K73 W;  4LFC O;  1BZK A;  5IY5 B;  1YCI A;  3JAW B;  4PD4 F;  2LJ2 A;  2V4D A;  3FFQ A;  3OTO O;  2OCH A;  2W0X A;  5GW7 A;  1M1K W;  1V55 C;  4BW5 A;  4J7K A;  4YIP A;  2A79 B;  3Q4H B;  1RSO A;  4DR7 O;  1BGY H;  3QO8 A;  4CH3 A;  4XDJ A;  1QQC A;  3K03 A;  1E79 G;  1N0J A;  1Q5O A;  2Q67 A;  2JEU A;  1AIL A;  1L1F A;  1SQF A;  1YDX A;  1RFY A;  2ATK C;  2BOB C;  4Z1M G;  2WLM A;  4TUY A;  4MSW C;  3PJS K;  1KEC A;  5JJJ B;  2D3O W;  4I55 B;  1SZT A;  5JWP A;  1ORQ C;  3LDD A;  1X59 A;  5KHK A;  3CX5 F;  1PP9 H;  4FZ0 A;  2QGN A;  2XND G;  1S5J A;  4DV1 B;  4LFA O;  1CP9 A;  3JD0 A;  2ILM A;  1KD1 W;  2XTA A;  2X7R B;  5LL6 Y;  3LNN A;  5LP6 A;  1I08 A;  3H1H H;  3L71 H;  3CRR A;  4GLX A;  1AR5 A;  4RQE A;  5LMU B;  3KZI Z;  3CCQ V;  4LF9 B;  1K97 A;  4IT5 A;  1K3E A;  3K04 A;  5FPO A;  4FVM A;  3EHB B;  1BL8 A;  3F7Y C;  3SPJ A;  2EJR A;  3RW0 A;  5LYJ B;  4OPH A;  1QCE A;  4U3F H;  2QR4 A;  2YEV B;  3CPW U;  2AW9 A;  4TWK A;  3ZX6 A;  2LQT A;  1EN5 A;  4CBC A;  3M99 B;  2FB5 A;  4AIL C;  2ZIM A;  1Q90 D;  3CRM A;  2GTA A;  2CTP A;  4JGS A;  3E8G A;  3J80 N;  3ABT A;  1Q82 W;  1VQK V;  5CMU A;  3RYF B;  3TET A;  4AQY B;  1XHZ A;  4B3R B;  1SS3 A;  5B1B B;  2HLD G;  4FPP A;  3B2E E;  4LNU B;  4ASU G;  4MVS A;  2UXB O;  3T1H B;  1ENV A;  3K9A A;  1TUB B;  2JVD A;  1H2N A;  4JI6 B;  1EM1 A;  4B7K A;  1I5X A;  3AG4 C;  5FLX N;  3R65 A;  4TV8 B;  4JI7 B;  4B7E A;  5EBM C;  5KX5 B;  4TT3 G;  2EZO A;  2B1G A;  3E8B A;  5EK0 A;  4X62 O;  4I9Q A;  2HVK C;  3BVO A;  4ZI7 B;  3AG2 B;  1F4M A;  2WLK A;  2P6J A;  3HKD A;  1Q43 A;  1FJG O;  1DTO A;  2WA3 A;  3G80 A;  2Z0A A;  5GTH Z;  2QM4 A;  1GN2 A;  3IC9 A;  4MTO A;  1M56 B;  2JS3 A;  3JCU Z;  1XI1 A;  2KQX A;  2F95 B;  2JK5 C;  1JOY A;  3QO7 A;  1R3L C;  1SES A;  4Q20 A;  1AJQ A;  2LFR A;  4LH6 A;  3JAR A;  4B08 A;  1N36 B;  1K9M W;  3BFR A;  1D5A A;  4ZKI A;  3OEE G;  2DQ0 A;  2RQ6 A;  5J2U B;  4OGQ B;  4UCU A;  3H1I H;  3UKM A;  1NR1 A;  4XDL A;  3CYO A;  1I94 B;  2PI5 A;  2XAG A;  3SJA C;  3E2E A;  1H8E G;  3MHH C;  4TQF A;  1ZX3 A;  3O9O A;  4J42 A;  4QNH B;  2CGN A;  4DO2 A;  4YHH O;  3A2F A;  4HNA B;  4LF6 B;  1NJI W;  4DV5 O;  2PYL A;  1SC5 B;  2VWK A;  5L3B A;  5LYJ A;  1BQZ A;  1ZAU A;  3SPI A;  1M57 B;  2EIM B;  2CDY A;  2UUB B;  1I5Y A;  1K8A W;  4D7S A;  3LSS A;  1HR0 B;  1V55 B;  1RSO B;  4LFB O;  1P4R A;  3THO A;  4R6Z A;  3OFN G;  5A9G A;  1HNW B;  2RJZ A;  1XIL A;  5LP6 B;  4MTF A;  3ZN0 A;  2PY5 A;  4X88 A;  3IFX A;  1Y67 A;  1KP3 A;  3DXR A;  5FNV A;  4B3M O;  4GT1 A;  4LNU A;  2XAS A;  5JCO C;  1K4D C;  4CS2 A;  4DV2 B;  5LGN A;  3ZMS A;  5E79 Z;  4KUM A;  4GKK B;  2AZ2 A;  3IAY A;  4IYI A;  2L6L A;  3W7U A;  1VQ9 V;  1IUR A;  3GWO A;  1JR9 A;  1OCO C;  2QKC A;  4JYA O;  4OX9 O;  1RM1 B;  4XBF A;  1K34 A;  1COW G;  1TVK A;  1E1Q G;  2DW4 A;  4LF8 O;  4X65 B;  4I9W A;  1M93 A;  3T4D A;  1DLB A;  1S0V A;  1WB7 A;  1L0L H;  1H8H G;  2ZE8 A;  4LFA B;  5H6R A;  4O4L B;  3D36 C;  4ZHQ A;  3U10 A;  1N33 B;  3STL C;  1QLE B;  4JF3 A;  5K1P A;  3CRC A;  1XDC A;  3FB6 C;  2A9H A;  1XNR O;  2QWO B;  1AP5 A;  1SQV H;  1YJN V;  1VF6 A;  4GX5 A;  5IWA O;  1M5I A;  1BHA A;  4NVP A;  3L70 H;  5JCO A;  5B3S B;  4DUZ O;  1PD3 A;  1JA8 A;  3S3X A;  3JAL A;  1GK9 A;  2VQE B;  2F93 B;  1P7G A;  2E75 B;  3SDL A;  3JAS A;  1IBL O;  3OR7 C;  3HKB B;  2CTW A;  2CTR A;  4LBE C;  4LCU C;  3DC6 A;  5B1B C;  2OWO A;  4F6R B;  1URF A;  1N0N A;  3K58 A;  3ZRV A;  4WFG A;  1AJP A;  4WCE V;  4X1Y B;  4JAS A;  4MS2 A;  3G4S V;  4X9Q A;  3RYC B;  1XBL A;  4JI1 B;  1SKV A;  2JJ1 G;  2Q0O C;  3IJ4 A;  2CUG A;  2E5L B;  4NKG B;  1HNZ B;  1Q86 W;  1K92 A;  1SF9 A;  3B8N A;  1Q8I A;  1JFF A;  3F7V C;  4O2A B;  5H5N A;  1MAB G;  1FPO A;  3G71 V;  1DK1 A;  5EBL C;  3SJQ C;  2HHH O;  4PEL A;  4YJ3 A;  3SR2 C;  3B09 A;  2R9R B;  3JD1 A;  1I94 O;  3D3I A;  4I50 B;  4LF8 B;  3D3Q A;  2JGU A;  1WA8 A;  5LHI A;  2BSK B;  4WFH A;  4BAY A;  1ZUQ A;  4X1I B;  3UO3 A;  2XAQ A;  4IHJ B;  5C93 A;  2NLJ C;  3HPL C;  1MG1 A;  3ABK C;  2XHB A;  1N34 B;  1THZ A;  5LOV A;  3CHX A;  2Q4P A;  2QEX V;  5C8Y B;  1KU9 A;  3OTF A;  3TK1 A;  1TVK B;  1OCR B;  5DM6 V;  1OV9 A;  2AHZ A;  1V54 C;  1EBO A;  1GM8 A;  4LWS A;  4MVU A;  5A2Q N;  1XMQ B;  1YIT V;  3AK2 A;  3K0D A;  3N2G B;  5BR8 B;  3CRA A;  1XNR B;  1D2D A;  1K5S A;  1ZWI C;  2AXT Z;  1HW7 A;  2ITC C;  1BCC H;  1R3I C;  1SQX H;  3DXR B;  4DR4 O;  2IJK A;  2OTL V;  1RP3 B;  3BRC A;  4UXN A;  5KX5 A;  4JTA B;  3VQY A;  3CXC U;  1ARO P;  2FL4 A;  4I50 A;  1R6T A;  1S3J A;  1M9N A;  1U96 A;  2YIA A;  1PPJ H;  1FXK C;  3P3P A;  4DR3 B;  4DYL A;  4O4I A;  3BHP A;  1XUQ A;  2QSA A;  1ZSP A;  1E1R G;  1HP8 A;  4NXM B;  1RPO A;  4O4J A;  5GTI Z;  1SQG A;  1JMK C;  3VBB A;  5BR8 O;  4TUY B;  1L8D A;  3PN1 A;  3RT3 C;  4DR2 B;  3CP1 A;  3K5L A;  1KB9 F;  2F43 G;  1NZ6 A;  2RNB A;  2YIB A;  4NYK A;  1VP7 A;  3STZ C;  1G4Y B;  2Y48 A;  1Z5W A;  3NXS A;  3E8F A;  1WJZ A;  4DR6 O;  2GBO A;  5L3F A;  1WPX A;  1J5E O;  5J2U A;  2HJF C;  3N27 A;  2RN9 A;  4LFB B;  1JPX A;  1TA8 A;  4FZ1 A;  1NKD A;  3OTO B;  3UCS C;  5ITZ A;  1NH2 B;  3E35 A;  3ETD A;  2F1M A;  3SYQ A;  4PI0 A;  4X1K B;  3ZHU A;  1Z5V A;  4B3T O;  2WLL A;  3T4Z A;  2LW1 A;  1EZV H;  4RUF A;  2Q0A A;  2XAJ A;  2X0L A;  1MZF A;  4DUZ B;  1NBM G;  2A06 H;  1B04 A;  1SRY A;  5L3D A;  1IVS A;  4DV1 O;  1R6K A;  3AK1 A;  3W7S A;  1CEZ A;  1QLE C;  3QVN A;  1AB3 A;  2AHY A;  5GON B;  5EC2 C;  2DJV A;  2E76 B;  3EVK A;  1Y6X A;  5B1O A;  2WLL B;  5KHG A;  2E5L O;  2LFS A;  4DRX A;  2DYR C;  2Q7E A;  3RYC A;  2YI8 A;  4BIO A;  1N4C A;  3CE2 A;  4B3T B;  1YIJ V;  1YI2 V;  5JVD B;  5B3S C;  2ZIO A;  2PZS A;  3FX7 A;  3HB3 B;  4JV5 B;  3OMN B;  2YC0 A;  3D8C A;  1GH6 A;  5IT9 N;  4TV8 A;  4J11 A;  3I56 V;  3UO2 A;  1GRJ A;  1QU7 A;  4U3J A;  4GKK O;  1XL4 A;  2QWP B;  2CH7 A;  1F51 A;  5D5P A;  4DUY B;  3CS5 A;  5B66 Z;  5LA6 B;  2DOS A;  4JI7 O;  2HEP A;  4UUJ C;  5LGT A;  2QWQ B;  1R6N A;  3W7X A;  1K5Q A;  1NQT A;  1Y74 A;  5JJE B;  1BHB A;  4O2B A;  5H9C A;  4X64 B;  2AZ0 A;  2IJI A;  1S76 D;  5B1A B;  2GHY A;  1IX9 A;  4B3R O;  1SA0 A;  4FLX A;  4FIP C;  4QJF B;  5KAI Z;  1NTZ H;  1NH2 D;  4BIU A;  4LP8 A;  2WLN A;  3RYH A;  4J7J A;  3ABL C;  3FB8 C;  4L8J A;  2IU3 A;  1BE3 H;  4UVA A;  5EIB C;  4CS4 A;  1R3K C;  4PJ0 Z;  1Y74 B;  4PA3 A;  4UB6 Z;  4OXS A;  4TOI A;  2F66 C;  3JAK B;  1SQQ H;  4U7N A;  3ABK B;  3J7A U;  3APQ A;  2QTO A;  4G28 B;  5JJN B;  4DV5 B;  4QPK A;  1NS1 A;  3QNE A;  1PKX A;  5LMN O;  1Y66 A;  3ZJZ A;  4PA6 A;  1UFI A;  4WFE A;  2B1I A;  3JD3 A;  5CBF A;  1WAZ A;  1M90 W;  4J41 A;  5CA0 B;  1NT2 B;  3DGE A;  2V1D A;  5C8Y A;  4FJC C;  2OTJ V;  4P9O A;  3APO A;  2AGA A;  5LOV B;  3ZMU A;  1H2G A;  4YXW G;  4I4T B;  1WLE A;  2LW7 A;  4FK5 C;  1L0N H;  2Y0P A;  4X66 B;  3K3W A;  4JI5 O;  4UV9 A;  2VS0 A;  4DR4 B;  1EZJ A;  1GN3 A;  2V7Q G;  3B40 A;  3SYO A;  4H13 B;  1MOF A;  3VOU A;  3CC4 V;  3QF7 A;  1OHH G;  2KSD A;  4RAI A;  1EFR G;  3OR6 C;  4J7Z A;  3E22 B;  1K7D A;  1KUQ A;  2IJJ A;  3ABL B;  4QPJ A;  1JFF B;  1FYJ A;  2JJ2 G;  2UXX A;  2QTS A;  1FAF A;  5JH7 B;  5CB4 B;  4KP4 A;  3ZRW B;  1W2B U;  3E8H A;  4NR1 A;  1XMO B;  1TUB A;  1XNQ O;  3BY6 A;  2Q7G A;  4X66 O;  2NNU A;  3BAB A;  1FS0 G;  1NR7 A;  1Q7Y W;  5IY5 C;  5KA6 A;  2WLI B;  2FML A;  2CGO A;  2YDE A;  1XMO O;  5H6Q A;  1KMI Z;  2ZR3 A;  4YJ2 A;  5KMG B;  5CA1 B;  3K08 A;  2WLI A;  3JAL B;  3CXH F;  2R72 A;  4B3S B;  4FLZ A;  2BE3 A;  1A32 A;  4H37 A;  3P3N A;  1YVW A;  4KXR A;  4N23 A;  4JI1 O;  4ZI7 A;  4ZHQ B;  3A8T A;  3VQX A;  3H1L H;  1HWY A;  2Y4T A;  3D36 A;  4X20 A;  4UVB A;  2CK3 G;  2IH1 C;  1QNM A;  3RYH B;  5J9P C;  3RYI A;  2HP8 A;  3ZCC A;  2EBO A;  3RBZ A;  2LO1 A;  1IBM B;  1G6U A;  4LF5 O;  3H1J H;  4ZBM A;  1N33 O;  2YIC A;  4K0K O;  1FFT B;  1IBL B;  3W7W A;  1GN6 A;  4GKJ O;  3N2K B;  3W7T A;  1QHT A;  4DR3 O;  5FL7 G;  1LUW A;  1XOU A;  2DWD C;  5IJ0 B;  1PL4 A;  1YTF D;  4I55 A;  5IWA B;  3JSN A;  1YHQ V;  2B5U A;  4UFZ A;  4X64 O;  1JJO A;  3SPG A;  5CA0 A;  2P5O A;  4X8A A;  1P7B A;  1HNZ O;  5DED A;  4LF9 O;  2JRI A;  1MNG A;  4NTW A;  3OEH G;  2YIB D;  4Z2W A;  1EN6 A;  3JAT B;  1R3J C;  3OD4 A;  3L72 H;  5KUM A;  3BPZ A;  3K5N A;  4R50 A;  1GM9 A;  2IU0 A;  4CC5 A;  4UB8 Z;  2ZNI A;  1XNQ B;  1P84 F;  2DN9 A;  4PDL A;  1O9H A;  4IL6 Z;  3OUS A;  2P90 A;  3B4S A;  5B1A C;  1VQ4 V;  1FXV A;  2R9A A;  3K79 A;  4R8C A;  4TSF G;  4QE7 A;  3CCV V;  3RGB A;  1F4N A;  4CS3 A;  1XMQ O;  3P32 A;  4D6T H;  2UUB O;  4A5U B;  1AR4 A;  2FTK A;  2IH3 C;  4H44 B;  4K8Z A;  5KLV H;  4LF4 O;  1N32 O;  3E83 A;  4QE9 A;  5HFL A;  1FFX A;  3FD9 A;  1PNM A;  3ZBH A;  4BWA A;  1Y76 A;  1FKA O; 
#chains in the Genus database with same CATH homology
 1KB9 F;  1L0L H;  1SQP H;  1NTK H;  4U3F H;  1BE3 H;  3CWB H;  3H1L H;  4PD4 F;  3H1K H;  1NTM H;  3CXH F;  1BCC H;  3H1H H;  1EZV H;  3L71 H;  1SQX H;  3H1I H;  1SQQ H;  2BCC H;  1NU1 H;  4D6T H;  3L72 H;  3L73 H;  2FYU H;  1SQB H;  2A06 H;  5KLV H;  2IBZ H;  1BGY H;  3BCC H;  3H1J H;  1SQV H;  1L0N H;  3TGU H;  3L74 H;  3CX5 F;  1PP9 H;  1NTZ H;  1PPJ H;  3L75 H;  1KYO F;  1P84 F;  3L70 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...