1EZVH

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 28
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1ezvH00
1BGYH 3H1KH 4D6TH 3L74H 1BCCH 1NTKH 1SQVH 3H1JH 1NU1H 3L75H 4U3FH 1SQXH 3CWBH 1SQQH 3H1HH 1BE3H 1KYOF 1NTZH 1L0LH 3L73H 3L72H 1PPJH 3L70H 3L71H 3H1IH 2IBZH 5KLVH 2A06H 1PP9H 1P84F 2FYUH 1EZVH 3TGUH 1SQBH 1SQPH 1KB9F 3BCCH 1L0NH 1NTMH 2BCCH 3CX5F 3H1LH 3CXHF 4PD4F
chains in the Genus database with same CATH superfamily
1PNMA 4TV8B 2NR5A 3WG7C 4X1IB 3OFNG 2F4VO 5CMUA 1NZ6A 1IZ3A 3B40A 1H2NA 2GV9A 2QDOA 3JARA 1IXMA 3CRCA 4GZRB 2QKAA 3CRQA 1Q6HA 1Q90D 2W6IG 1XEQA 3HKBB 4JAAA 4K3AA 3ABKC 5DN6G 4PDLA 2QM4A 1K92A 4MTXA 3F7YC 2OIGA 1SERA 2Q0OC 1B06A 1S3JA 3OEHG 2FYUH 3RYIB 3SYOA 4DR2B 1PM9A 2CE4A 2EX3A 3ZHRA 5JVDB 1S5LZ 1SZXA 4PI0A 3U11A 1GH6A 4LF6B 3CC7V 4PA9A 4LF8O 3E83A 4DV6B 3CD6V 2E75B 1J5EO 1K33A 3RYFB 1M90W 5EZYA 3JAMN 2EIMB 1EN4A 2JRIA 1YF2A 2Q68A 3IC7A 4B3MB 4IHJB 3ZN1A 5FLXN 4DV7B 1QU7A 2EIKC 2XAQA 1E1QG 1GN2A 4QPJA 1JFFA 5C8YB 4G27B 4YY3O 2R9RB 3CCQV 3H1IH 3TJTA 2KSDA 2Q69A 3AG3B 4UFZA 2IJKA 5CA0A 1FJGB 4CC6A 1G1XB 4EB6B 3SPIA 2QWQB 4TUYA 4PA6A 2BTQB 5L3DA 4I0XB 1THZA 4EFBA 1AROP 4DO2A 3CP1A 3OUFA 2WSSG 2UU9O 2GHYA 4JYBA 2LW7A 2IH1C 1VIBA 4B3TO 2YUAA 2CH7B 4FK5C 4R8CA 2HVJC 4DK0A 4OXSA 3O9OA 5L3FA 3K9SA 1MNGA 1RPRA 4TQFA 3LDDA 1BGYH 2ADQB 2PYLA 2Q8VA 3ICXA 1URFA 3T4ZA 3WG7B 5LP6B 4NXNO 1AI6A 1JMKC 3E8HA 4NTWA 3U10A 1M9NA 3UCSC 3ZRXA 1FD9A 1SKVA 3KKYA 2YXHA 1I94B 1NKDA 4X1YB 2Y4TA 3STLC 3ASOC 1Z2GA 1BHBA 4O4JB 3K5OA 3AG4C 3G67A 1R3IC 4JI3B 3M99B 5CB4A 1TGOA 3RVYA 3JALA 2CTRA 3T4DA 3E8BA 1VF6C 4DUYO 5BMVA 3ABKB 1N32B 2ZDIA 4JTAB 1SQBH 3J7AU 1H2KA 4NKGB 4JYCA 4GKKB 4DW1A 2YIBA 3ETDA 1P4RA 5K1XA 1YEWA 2B9ZA 5AG2A 4X62B 3RYCA 4FLZA 1H2SB 2GSMB 3BEHA 1ROPA 3ZMSA 2QJ1A 4UCVA 5HFLA 3KG2A 1QQCA 1ZTEA 3E35A 1V54B 4KUMA 1AI5A 4YJ3B 4DV2O 3D36C 1SQPH 2KG7A 3GVMA 4XDKA 4P2ZA 5J2TA 2LGQA 2WLKA 4DR2O 4U3FH 2YS8A 3AG2C 4JI1O 4ZOLB 5LBQA 1OV9A 4XDLA 3JYCA 4LF7B 2Y48A 4LF6O 1L8DA 2QWNB 4ZI7B 2CAZC 5D5PA 4DV6O 3SDLA 1DF4A 2IJIA 1H2GA 3JD0A 2HR3A 1JR9A 2BOCC 2WPDG 4DV7O 1RSOA 3OAAG 4LFBB 4GX5A 3NXSA 4O2BB 2BSKA 1KC8W 2ZT9B 1H8EG 4TV9A 4J7KA 1TVKA 5LYJB 4X65B 4OX9O 1FJGO 1BZKA 2QSAA 2O57A 4UXNA 1Z5WA 4QE9A 4LF5B 3OM3B 1VQ5V 1PNKA 5IWAB 5B1NA 4DV3B 5JWPA 1BT8A 4MVQA 4GKJO 4KFMA 1VP7A 2NNUA 2OCCC 3TCUA 3DTUB 1V55B 5IYBO 4QNHB 3L75H 3AG4B 1IBKO 3FKSG 3UM7A 3CSXA 4AILC 3JAKA 3AK2A 5LXTA 3FAVA 4UCRA 3UT5A 5LOVB 2B1IA 4RQEA 3CCJV 1YI2V 3K03A 1EN5A 2DYSC 2FB5A 3P3PA 1SRYA 4X9QA 1BHAA 4P30A 2Y4UA 4IL6Z 4RUFA 5EC2C 5FNVB 1QHTA 4GX2A 4YHHB 4FLVA 2OIEA 1H2MA 4HNAB 1SQXH 2YI8A 2Y69B 1MSWD 4N23A 1SA0B 1JQ0A 2YIBD 4DV0B 1M1KW 2QWOB 2LFRA 4JAUA 4GYCB 4DR1O 1N32O 1N33B 2OTLV 2EJRA 2UUAB 4LH7A 1IX9A 4HYOA 4LFAO 1OJHA 2JK5C 4UCSA 1Q3EA 2L6LA 5BXZA 4WBNB 3CCEV 1GRJA 4X62O 2UXDB 1B6QA 3AG2B 3ZIAG 2Q4PA 4P9PA 3VBBA 4F6RA 1OZ0A 5B1AB 4PA7A 1YDXA 2CTPA 5TISZ 5H9CA 5IT9N 2DE0X 3QG5A 4CH4A 1WNSA 3H01A 2DWEC 4JI7B 3CCLV 2WLJA 1QVFU 3ZHVA 3B2EE 4ZBMA 4O2AA 2EZPA 2XAJA 4X1KA 4FZ0A 5L3GA 2CK3G 4IGGA 4BIOA 3WB2A 1L0NH 1FFXA 4LF7O 5D5QA 3HPLC 3ZRVA 3H1KH 2QR4A 4WFAV 2P67A 4K35A 3ASNC 2YI9A 1IDSA 4JI2B 4J11A 1Y74B 3CRMA 5JH7B 3QVNA 2ZE6A 3BY6A 1TUBB 3L72H 3RFRA 1RM1C 2JIZG 5J2UA 1XNRB 1XL4A 4FFKA 3PJSK 5KX5A 1S76D 2PF4E 3HKCB 3DXRA 4J9ZB 4LFBO 3ABTA 3AEIA 3N2KB 3UO2A 2EINC 2Y0PA 1SS3A 2D2CB 4LWSB 2XAHA 4X65O 1FXKA 4PJ0Z 4UB6Z 1F4NA 1QBZA 4B3SB 4LF5O 1WP8A 2RCVA 3A0HZ 3GB7C 2RN9A 1WA8B 5K1PA 2ZNIA 4BW5A 1BL8A 3ABUA 4LH6A 4J42A 5IWAO 1P7GA 4DV3O 1I7FA 1J5EB 1N34B 1KYOF 3CRAA 2E3CA 5EYPA 1R3KC 4FFBA 2JGDA 2DOSA 4PA3A 3WU2Z 2EZOA 1YHQV 3FD9A 2PI4A 1UFIA 4JF3A 2HEPA 1KB9F 2P4VA 2WLLA 3FB8C 3JCUZ 3CCSV 3BVOA 2DYRC 3ZS8C 4G2KA 1S5JA 1Y76B 3CRRA 3JAWB 4F6EA 5H6QA 1XMOO 1I0HA 2UXBB 3T1HB 4YHHO 2UXCB 2K1EA 2QM8A 3S3XA 3IGAC 4JGSA 1N8RW 3E8FA 4QJFB 2MW2B 5KAIZ 1YJ9V 1OCRC 4DV0O 4FIPC 2PI5A 1SC5B 1NI8A 1NU1H 4DR6O 4JI0O 5CBHA 1M56C 3P32A 2BOBC 1IBMB 1N33O 2JJ1G 3MHSC 4JPRA 5LA6B 2QEXV 2UUAO 2EULA 3FYIB 1IBLB 4O4HA 1BMFG 3BA8A 3RYHB 4I4TB 1HWYA 3K79A 4FLYA 2WAMA 4TT3G 2UXDO 2JEUA 4MS2A 3CC2V 3OTOO 4NXNB 3LUTB 2FMLA 1QR8A 3G4SV 3E2EA 3W7XA 2EIJB 1AP6A 2ARHA 4Q20A 2DMXA 1FAFA 3ABLC 2GUZA 5B1OA 2ZE8A 5A9GA 1VQPV 1VQMV 3DC5A 4JI7O 4U3JB 1O9HA 4IIJB 4TWKA 2Q0AA 1IXBA 1XNQB 4TV8A 4QPKA 2F23A 4X1IA 5LP6C 4DUYB 3SGIA 2QA4V 1N0NA 2LP7A 2EINB 2PUSA 4I55A 3L70H 4D7SA 2YICA 4B7KA 4JV5B 4JI2O 2DJVA 3CCMV 1KU9A 1GTOA 4AQYB 2ZE7A 1X59A 3SJAC 1XNRO 5KUMA 3JASB 2Q73A 1EZJA 3ETQA 3F7VC 1CPYA 3W7UA 2BTOA 4K8ZA 1FFTB 4E2LA 4H33A 3TXQA 3B09A 1DK1A 1NR1A 4DR4B 4DV2B 2UXNA 2P4KA 3RYIA 3TGUH 5KMGB 2IU3A 1LUWA 2XTAA 3K0DA 4B3SO 3AG1B 4JI1B 2Q6AA 1KUQA 2VWJA 4GCZA 1SQGA 2DYRB 3Q4HB 5L3EA 1V54C 2RNBA 1VQNV 2VRZA 1GMGA 3AK1A 2RJZA 1N34O 2A0LA 3RYFA 3RW0A 4QE7A 3CXHF 3K06A 5LGTA 4IHJA 1OCRB 4I9WA 5HFMA 1XREA 1YZBA 2KKWA 1NH2B 4JTDB 4I50B 5DECA 5C8YA 4RAIA 5IJ9B 1UJWB 3BA9A 4OPHA 3TXSA 1Y67A 3HKEB 1M56B 2LGWA 1VF7A 1P84F 3RBZA 2UXBO 2B5UA 3T1HO 3ZN0A 2UXCO 2B1GA 1JJOA 1YCIA 4OX9B 3BCCH 1V9PA 2BTQA 4NTYA 4I0XA 4X89A 2GDSA 2F66C 3SYAA 4TQDA 4MVSA 3STZC 4NXMB 1QCEA 1HNWB 3ZEDA 1VQKV 1MA1A 4JI4B 4HBNA 4GKJB 3ABLB 2AGAA 2CH7A 1IBMO 2P5OA 1R6TA 2JS3A 1OHHG 3SPJA 2LQTA 1AR4A 1IBKB 4LNUB 1IBLO 4JTCB 4RUEA 3E8GA 4FMTA 3SYPA 4RO2A 1A32A 4JYAB 5B66Z 2VQFB 5IYZB 1YVWA 1G6UA 1OCOC 2UUBB 2BE3A 3A0RA 3QF7A 3SYCA 1R73A 2Z3YA 4LF9B 3E89A 4JI8B 4X1YA 1F51A 4L8JA 3ETEA 4O4JA 5LMNO 2IJHA 2V4DA 1V55C 1SZTA 3SPHA 4CZZA 3OMAB 4R6ZA 1BQ0A 4MVOA 1XNQO 2UXXA 4DR1B 3EFFK 5KLVH 3CYOA 2Y0IA 1SQFA 4EFEA 1NBMG 4FVMA 4JV5O 3ZX6A 4LFAB 4AQYO 1XBLA 4MVMA 1P7BA 2Y69C 4C7UA 2FL4A 2X6CA 2HFEC 3NR7A 3O65A 3BAAA 4J80A 3FB5C 1UPGA 4WFFA 2W0XA 2Q7HA 3LDEA 3CMEV 3SYQA 2ILMA 3JATB 4X20B 4DR4O 3FB6C 3D3QA 4CH6A 3CS5A 3LNNA 3K0GA 2ZQMA 4UCOA 3L74H 1K5SA 2DQ0A 5IJ0B 3CJHB 2A9HA 4CC5A 5CBFA 1JVMA 1E79G 4ZOLA 2D3OW 1EFRG 4DRXB 4H0LB 1GM8A 5B1AC 3R65A 1NH2D 4KHPB 4X88A 4ZI7A 1Q5OA 2IJJA 3JD4A 1L1FA 4MTFA 1Q6IA 2QKCA 4TOIA 1X4TA 1ZX3A 3RGBA 3N2GB 1SF9A 2QM7A 4UCTA 3SPGA 3H9VA 3G71V 3SJQC 4O2BA 5E79Z 2P90A 4G28B 3M8AA 2ZIMA 5EK0A 5JQGA 4MVZA 4NVPA 3SJBC 3CB2A 1NVPB 5LYJA 1YIJV 3J80N 3OUSA 2Q7EA 3H1HH 1L0LH 4OGQB 5FL7G 3SR2C 5ITZA 1XILA 1YJWV 5GONB 1N0JA 4NB5A 4ZIBA 2EILB 4NXMO 5KA5A 1EN6A 2ATKC 1WN7A 1HNWO 1OCOB 1AI7A 4D7TA 2E5LB 4JI4O 4X64B 1M4UA 2VQEB 3OR7C 4GT1A 1K73W 2CTWA 1AB3A 3CWBH 1I08A 3C90A 2A3QA 3K04A 5LOVA 1O9GA 4XBFA 4MW8A 4MTGA 1VF6A 3P3NA 4JYAO 4FZ1A 1S0VA 2R9IA 2VQFO 1Y66A 4DV1O 1PNLA 4N21A 1VQ4V 2UUBO 5FNVA 1XMOB 3M7MX 1AJQA 4LF9O 1U97A 2M6YA 4JI8O 1EBOA 4HNAA 5LMUB 1SA0A 5KHGA 3A2FA 3W7TA 1IVSA 1PL0A 4IYHA 3W7SA 3JSNA 4DR6B 1Y6XA 4JI0B 2BCCH 2K9PA 4P9OA 3K57A 3D36A 2HG5C 1KQSU 1RP3B 5IYDO 3J81N 1M93A 2HHHB 5BR8O 5B1BC 4WBNA 3OMNB 1FXVA 1M5IA 3ZMUA 1ZL8B 3OTOB 1XUQA 3ABMC 3L9DA 1VQ8V 5LGNA 2Q7GA 1ZWIC 4DK1A 4FLXA 1TAEA 3E86A 5H5NA 2VWKA 4RQFA 3K59A 3OGCC 2AXTZ 4I7ZB 4QIWF 3DC6A 1WPXA 2W0FC 2R9AA 3QO8A 1DGSA 4PHZA 1H2LA 1K4CC 4KHPO 3OGIB 4EKWA 5H2FZ 5FPOA 2EIJC 1P49A 1Y74A 4MW3A 5JH7A 1K9MW 1H38A 1TUBA 1XOUA 2QGNA 4PDMA 5H6RA 1KKCA 4PI2A 1N36B 5EBLC 1NVPD 3F5TA 4NYKA 1MZEA 1G4YB 3ZBHA 3HKCA 3I55V 1F4MA 3BFRA 1YITV 3N2KA 4HAMA 1W0KG 3JD3A 4LWSA 3LNMB 4J7ZA 3CCRV 2AZ2A 5JJNB 5F2VO 5JCOC 2ZIOA 4O4LB 2X6BA 5KUKA 3E22B 1WA8A 2YDEA 2ODMA 2X7RB 2ADPA 1B3QA 4ZHQA 1NTKH 3H1JH 2HLDG 1OCCC 3VOUA 2QKSA 2E5LO 5LHHA 1DLBA 4YJ2A 4X64O 4CS2A 2UUCB 2VQEO 2HJDA 1ZAUA 3T1YB 1JOYA 5EBWC 3DGEA 1XMQB 4R50A 1SESA 3AG1C 4LFCB 1S5HC 1S72V 4MTOA 3A0BZ 1QR9A 3I5DA 1Y76A 4KXRA 1GK9A 3JAWA 5KHIA 1JJ2U 2WA4A 4MVUA 4WF9V 2YC0A 3ZRWB 5B1BB 3THOA 3K5NA 5LMUO 5KA6A 2WLMA 1VEWA 2V7QG 4FM0A 3ABMB 5BY1A 1W0JG 1YSCA 2GTAA 1MMMA 2QTSA 5LA6A 4DR7O 2KB1A 4I9QA 2L35A 2WLIB 1RPOA 2HHHO 3AG7A 2XAGA 1AILA 3RYHA 4I4TA 5IYCO 1J95A 4O4IB 1Y4MA 5GTHZ 3HKDB 2ZR3A 3IC9A 1Q8IA 3K9AA 2GBOA 4UUJC 2QWPB 4L87A 1NS1A 1JPXA 1PP9H 4BAYA 5LMNB 2XT9A 4U3JA 3PN1A 4ICGA 4ABMA 4IIJA 1BSMA 4BIZA 3CCVV 1ZLZA 2H3OA 3HR0A 3LSUA 1MSDA 4CS4A 3RN4A 2YEVB 3OT7A 3MAQA 4UVAA 3EVKA 1GM9A 4W4KA 5JCOA 3VQXA 1N36O 5CA1B 2Z0AA 1IURA 3JASA 2E74B 5EIBC 4Z1VA 1KMIZ 3ZHQA 3C3SA 3HKBA 5KHHA 4I55B 1GN6A 1W59A 1JA8A 1OCCB 2GTSA 2ZXWC 4JAVA 1CEZA 1S77D 1FYJA 2JS5A 3CHXA 3JARB 3K3WA 3CE2A 5KMGA 4UV9A 5JVDA 2ZNJA 2MK3A 2AZ0A 3I56V 1QLEC 3W7WA 4GX0A 4CBCA 4DR3O 3Q4HA 2LFSA 1NR7A 4B3RB 3TK1A 1FXHA 2ZDIC 4UV8A 1I5YA 2DW4A 4AI8A 2UUCO 3IJ4A 1H8HG 1COWG 2AHYA 5CBGA 1HP8A 2XHBA 3T1YO 2F43G 3N27A 2CUGA 1D5AA 1YJNV 2P6JA 3FB7C 2N05A 2W6JG 3CC4V 5IY5C 1XMQO 1SETA 4WFEA 4LFCO 4I50A 1BE3H 5IJ9A 5B5EZ 2XOKG 1EM1A 2FKXA 3HKEA 4GUNA 3JCZA 2H94A 1NQTA 1WLEA 5EZYB 4X66O 4EB6A 1AJNA 2V1DA 5KHKA 1XI1A 1XDCA 2CGOA 4LP8A 4I5SA 1JFFB 4JZ2A 4CS3A 3G6EV 3ZRSA 4LR3A 3P30A 1LR1A 1XHZA 4XDJA 1Q43A 2RDCA 1AR1B 4FM1A 5GTIZ 5CA0B 3BRCA 1KP2A 2P7TC 1FPOA 1JX9A 1ZUQA 3OTFA 4TUYB 1KECA 1K5QA 2LW1A 2R70A 4LNUA 1GM7A 1R1BA 1AR5A 4LCUC 1QLNA 2ITCC 4A5UB 1MABG 3A8TA 4DXWA 4DV4B 1NTZH 1CXZB 2AHZA 2F1MA 5LP6A 5B3SB 5IE9A 2EILC 3BABA 2EBOA 3LSSA 5IYZA 4DV1B 2YSUB 2LO1A 3QO5A 1XL6A 1R3JC 3ZMTA 1TUEB 2JDIG 5BZBA 5FPRA 4FLWA 2AW9A 1WP7A 5CA3A 2CTQA 2DWDC 1WB8A 1SQVH 2IW5A 2P22C 3GWKC 3KCXA 4YIPA 3S3WA 3L73H 2JEXA 3RVZA 5JJEB 5DEDA 1OCZC 4LC1A 2OYQA 1PV0A 1PKXA 1E1RG 1EZVH 2ZXWB 4K0KB 4UVCA 1NTMH 1HNZB 3B8NA 5KAFZ 5BR8B 3CEIA 1VARA 1NT2B 5CB4B 1CP9A 3LDCA 5EBMC 1HDJA 2Q5ZA 4DR5O 4FLTA 4YIOA 3JALB 1KD1W 4EEQA 1QLEB 4JYYA 2YIDA 1WJZA 1K4DC 3WB1A 5BMVB 5E1AC 2ITDC 4YJ3A 4X20A 3JATA 3OR6C 4DW0A 2RMKB 2CGNA 3T2MA 3EXAA 2IU0A 3UQ8A 4JI5B 4OPAA 2PZSA 1M57C 1NJIW 3RYCB 5IJ0A 3K5LA 1F23A 5J9PC 3SPCA 3CJHA 1FS0G 3HB3B 4NTXA 5IY5B 2JVDA 4DRXA 3ZJZA 3UKMA 2PY5A 2N04A 3LSQA 4JI6B 4B3RO 4DV5B 2PTMA 2KG7B 3ML0A 3MD0A 3DSQA 4IYIA 4KL1A 1WAZA 2QE7G 5J2TB 3EHBB 2H8PC 3UO3A 2WLNA 3B77A 1PD3A 1Q86W 3N2GA 2EIKB 1BQZA 2YXLA 1VF5B 4QGPA 2OWOA 3OMIB 2X6AA 4R7CA 3JD1A 1W2BU 4DUZB 1N4CA 1GKFA 4F4LA 1ENVA 4HZ3A 4ASUG 2ETNA 2VS0A 2R72A 4B3MO 3L71H 3G80A 3KCYA 1MOFA 4J10A 1RSOB 5GONA 2RQ6A 2PYJA 2OCHA 2BSKB 5JQGB 4TV9B 1K3EA 3CX5F 3H1LH 1TVKB 1GAXA 3U0ZA 2P06A 2F93B 4MSWC 2NN4A 2XAFA 4U7OA 5ITZB 3K08A 1GN3A 3VQWA 2ZM6B 1VMGA 3OE7G 3C3TA 4BW9A 4WFBV 4Z2WA 1I5XA 3CCUV 4DV4O 4H13B 1OCZB 5EIBD 3RT3C 1R3LC 2HP8A 1MG1A 4TSFG 3ASOB 3MDSA 4IT5A 1FXKC 5LHGA 5L3CA 3B8MA 3QO7A 1D5NA 3JAKB 5LXTB 4GLXA 3FAVB 3UT5B 4CH3A 2QTOA 4BR6A 2HKOA 1U96A 2LJ2A 2FTKA 5LHIA 4J9YB 4CH5A 1XHXA 1AP5A 4PELA 4DYLA 1VQ7V 2Q67A 4PD4F 1I94O 4H44B 1BCCH 4K0KO 4DR7B 4LF4B 3ETGA 5KHJA 3D8CA 2ZINA 1HNZO 3ZHSA 1RFYA 4JI3O 4AHCA 1M57B 1PPJH 4BIUA 5EC1C 5C93A 2A06H 1G8MA 1Z5VA 2M7WA 1YTFB 1WB7A 2NLJC 1K97A 3BHPA 3CMAV 2A79B 1ZL8A 3OD4A 1HR0B 1LNQA 3QNEA 4GKKO 1HNXB 2OT5A 1ZSPA 4JI5O 5DM6V 3JD2A 1KBHA 1GN4A 2WWWA 2C2AA 1K34A 3WB0A 3VQYA 4F6RB 2XASA 1Q7YW 4J7JA 2EJ7A 3TETA 4D6TH 1BS3A 2YIAA 4JI6O 1VQOV 3X2QC 4DV5O 3ZHUA 5LL6Y 3FX7A 4B7EA 4Q6GA 1VQLV 2ZE5A 4W4LA 3ZCCA 1WPBA 2YXYA 4O2AB 4X1KB 3APOA 4UB8Z 3CXCU 2ZD9A 3APQA 2F4VB 3VQVA 1AJPA 1FFXB 1XQ8A 4UCUA 2ZCEA 1KKDA 3IFXA 3GWOA 2CDYA 4GX1A 2WA3A 4DUZO 1AI4A 4KP4A 3SJCC 2X0LA 1TA8A 2IBZH 2G38A 5J2UB 5KX5B 4H37A 4O4LA 5A2QN 3DXRB 3E22A 5LGUA 2ZR2A 3G6BA 3MHHC 1FKAO 4DR3B 2KQXA 1HW7A 2N74A 3FYEB 2OCCB 3CPWU 3K5MA 2OTJV 4PDRA 4B08A 2QWRB 1FXKB 4J41A 3F5WC 5IDJA 1Q82W 1YXBA 5L3BA 4BWAA 3D3IA 4PV1B 1D2DA 2XUMA 2Z5UA 4PA4A 4Z1MG 4RWUA 2JJ2G 2ZM6O 5CN0A 3BPZA 2DYSB 2HVKC 1R6KA 4ZHQB 2DN9A 3IAYA 2WLHA 3KZIZ 4E4EA 4LF8B 2DQ3A 4YJ2B 2JGUA 1SQQH 2IM9A 3AK3A 4JZGA 5EYPB 3WFVA 3ZRWA 4FFBB 2JGDB 3ZMVA 4X66B 4MVRA 4UVBA 2IH3C 1F7YA 1T5EA 3QTCA 1VQ6V 3RWRD 4JASA 4NR1A 3ZMZA 2WLLB 4LBEC 4YY3B 1YTFD 3T1CA 4WCEV 3B4SA 1VQ9V 4FPPA 1DTOA 1QNMA 1K8AW 3OW2U 2E76B 1QVGU 4LF4O 1GO3F 1K7DA 2WLIA 4PDVA 1Q81W 4K8XA 3K58A 5GW7A 1MZFA 2EIMC 2Q9LA 1ORQC 4MT8A 4O4IA 3HKDA 3JSLA 4ZKIA 1Q6UA 2UU9B 4FJCC 1HR0O 1US6A 4B3TB 1JCHA 3OEEG 3X2QB 3AG3C 3ZHTA 1HNXO 4O4HB 2XNDG 5JJJB 1KP3A 4FLUA 1R6NA 1DF5A 1LUVA 4FM2A 1PL4A 2A7WA 4WFGA 2PGGA 3R66A 5B3SC 3ASNB 1B04A 4X8AA 4YXWG 1RM1B 2GUZB 2YEVA 4WFHA 2HJFC 4U7NA 2F95B 1AVMA 2ZKOA 5CA1A 4DR5B 3FFQA
chains in the Genus database with same CATH topology
1BGYH 3H1KH 4D6TH 3L74H 1BCCH 1NTKH 1SQVH 3H1JH 1NU1H 3L75H 4U3FH 1SQXH 3CWBH 1SQQH 3H1HH 1BE3H 1KYOF 1NTZH 1L0LH 3L73H 3L72H 1PPJH 3L70H 3L71H 3H1IH 2IBZH 5KLVH 2A06H 1PP9H 1P84F 2FYUH 1EZVH 3TGUH 1SQBH 1SQPH 1KB9F 3BCCH 1L0NH 1NTMH 2BCCH 3CX5F 3H1LH 3CXHF 4PD4F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY H;  3H1K H;  4D6T H;  3L74 H;  1BCC H;  1NTK H;  1SQV H;  3H1J H;  1NU1 H;  3L75 H;  4U3F H;  1SQX H;  3CWB H;  1SQQ H;  3H1H H;  1BE3 H;  1KYO F;  1NTZ H;  1L0L H;  3L73 H;  3L72 H;  1PPJ H;  3L70 H;  3L71 H;  3H1I H;  2IBZ H;  5KLV H;  2A06 H;  1PP9 H;  1P84 F;  2FYU H;  1EZV H;  3TGU H;  1SQB H;  1SQP H;  1KB9 F;  3BCC H;  1L0N H;  1NTM H;  2BCC H;  3CX5 F;  3H1L H;  3CXH F;  4PD4 F; 
#chains in the Genus database with same CATH topology
 1PNM A;  4TV8 B;  2NR5 A;  3WG7 C;  4X1I B;  3OFN G;  2F4V O;  5CMU A;  1NZ6 A;  1IZ3 A;  3B40 A;  1H2N A;  2GV9 A;  2QDO A;  3JAR A;  1IXM A;  3CRC A;  4GZR B;  2QKA A;  3CRQ A;  1Q6H A;  1Q90 D;  2W6I G;  1XEQ A;  3HKB B;  4JAA A;  4K3A A;  3ABK C;  5DN6 G;  4PDL A;  2QM4 A;  1K92 A;  4MTX A;  3F7Y C;  2OIG A;  1SER A;  2Q0O C;  1B06 A;  1S3J A;  3OEH G;  2FYU H;  3RYI B;  3SYO A;  4DR2 B;  1PM9 A;  2CE4 A;  2EX3 A;  3ZHR A;  5JVD B;  1S5L Z;  1SZX A;  4PI0 A;  3U11 A;  1GH6 A;  4LF6 B;  3CC7 V;  4PA9 A;  4LF8 O;  3E83 A;  4DV6 B;  3CD6 V;  2E75 B;  1J5E O;  1K33 A;  3RYF B;  1M90 W;  5EZY A;  3JAM N;  2EIM B;  1EN4 A;  2JRI A;  1YF2 A;  2Q68 A;  3IC7 A;  4B3M B;  4IHJ B;  3ZN1 A;  5FLX N;  4DV7 B;  1QU7 A;  2EIK C;  2XAQ A;  1E1Q G;  1GN2 A;  4QPJ A;  1JFF A;  5C8Y B;  4G27 B;  4YY3 O;  2R9R B;  3CCQ V;  3H1I H;  3TJT A;  2KSD A;  2Q69 A;  3AG3 B;  4UFZ A;  2IJK A;  5CA0 A;  1FJG B;  4CC6 A;  1G1X B;  4EB6 B;  3SPI A;  2QWQ B;  4TUY A;  4PA6 A;  2BTQ B;  5L3D A;  4I0X B;  1THZ A;  4EFB A;  1ARO P;  4DO2 A;  3CP1 A;  3OUF A;  2WSS G;  2UU9 O;  2GHY A;  4JYB A;  2LW7 A;  2IH1 C;  1VIB A;  4B3T O;  2YUA A;  2CH7 B;  4FK5 C;  4R8C A;  2HVJ C;  4DK0 A;  4OXS A;  3O9O A;  5L3F A;  3K9S A;  1MNG A;  1RPR A;  4TQF A;  3LDD A;  1BGY H;  2ADQ B;  2PYL A;  2Q8V A;  3ICX A;  1URF A;  3T4Z A;  3WG7 B;  5LP6 B;  4NXN O;  1AI6 A;  1JMK C;  3E8H A;  4NTW A;  3U10 A;  1M9N A;  3UCS C;  3ZRX A;  1FD9 A;  1SKV A;  3KKY A;  2YXH A;  1I94 B;  1NKD A;  4X1Y B;  2Y4T A;  3STL C;  3ASO C;  1Z2G A;  1BHB A;  4O4J B;  3K5O A;  3AG4 C;  3G67 A;  1R3I C;  4JI3 B;  3M99 B;  5CB4 A;  1TGO A;  3RVY A;  3JAL A;  2CTR A;  3T4D A;  3E8B A;  1VF6 C;  4DUY O;  5BMV A;  3ABK B;  1N32 B;  2ZDI A;  4JTA B;  1SQB H;  3J7A U;  1H2K A;  4NKG B;  4JYC A;  4GKK B;  4DW1 A;  2YIB A;  3ETD A;  1P4R A;  5K1X A;  1YEW A;  2B9Z A;  5AG2 A;  4X62 B;  3RYC A;  4FLZ A;  1H2S B;  2GSM B;  3BEH A;  1ROP A;  3ZMS A;  2QJ1 A;  4UCV A;  5HFL A;  3KG2 A;  1QQC A;  1ZTE A;  3E35 A;  1V54 B;  4KUM A;  1AI5 A;  4YJ3 B;  4DV2 O;  3D36 C;  1SQP H;  2KG7 A;  3GVM A;  4XDK A;  4P2Z A;  5J2T A;  2LGQ A;  2WLK A;  4DR2 O;  4U3F H;  2YS8 A;  3AG2 C;  4JI1 O;  4ZOL B;  5LBQ A;  1OV9 A;  4XDL A;  3JYC A;  4LF7 B;  2Y48 A;  4LF6 O;  1L8D A;  2QWN B;  4ZI7 B;  2CAZ C;  5D5P A;  4DV6 O;  3SDL A;  1DF4 A;  2IJI A;  1H2G A;  3JD0 A;  2HR3 A;  1JR9 A;  2BOC C;  2WPD G;  4DV7 O;  1RSO A;  3OAA G;  4LFB B;  4GX5 A;  3NXS A;  4O2B B;  2BSK A;  1KC8 W;  2ZT9 B;  1H8E G;  4TV9 A;  4J7K A;  1TVK A;  5LYJ B;  4X65 B;  4OX9 O;  1FJG O;  1BZK A;  2QSA A;  2O57 A;  4UXN A;  1Z5W A;  4QE9 A;  4LF5 B;  3OM3 B;  1VQ5 V;  1PNK A;  5IWA B;  5B1N A;  4DV3 B;  5JWP A;  1BT8 A;  4MVQ A;  4GKJ O;  4KFM A;  1VP7 A;  2NNU A;  2OCC C;  3TCU A;  3DTU B;  1V55 B;  5IYB O;  4QNH B;  3L75 H;  3AG4 B;  1IBK O;  3FKS G;  3UM7 A;  3CSX A;  4AIL C;  3JAK A;  3AK2 A;  5LXT A;  3FAV A;  4UCR A;  3UT5 A;  5LOV B;  2B1I A;  4RQE A;  3CCJ V;  1YI2 V;  3K03 A;  1EN5 A;  2DYS C;  2FB5 A;  3P3P A;  1SRY A;  4X9Q A;  1BHA A;  4P30 A;  2Y4U A;  4IL6 Z;  4RUF A;  5EC2 C;  5FNV B;  1QHT A;  4GX2 A;  4YHH B;  4FLV A;  2OIE A;  1H2M A;  4HNA B;  1SQX H;  2YI8 A;  2Y69 B;  1MSW D;  4N23 A;  1SA0 B;  1JQ0 A;  2YIB D;  4DV0 B;  1M1K W;  2QWO B;  2LFR A;  4JAU A;  4GYC B;  4DR1 O;  1N32 O;  1N33 B;  2OTL V;  2EJR A;  2UUA B;  4LH7 A;  1IX9 A;  4HYO A;  4LFA O;  1OJH A;  2JK5 C;  4UCS A;  1Q3E A;  2L6L A;  5BXZ A;  4WBN B;  3CCE V;  1GRJ A;  4X62 O;  2UXD B;  1B6Q A;  3AG2 B;  3ZIA G;  2Q4P A;  4P9P A;  3VBB A;  4F6R A;  1OZ0 A;  5B1A B;  4PA7 A;  1YDX A;  2CTP A;  5TIS Z;  5H9C A;  5IT9 N;  2DE0 X;  3QG5 A;  4CH4 A;  1WNS A;  3H01 A;  2DWE C;  4JI7 B;  3CCL V;  2WLJ A;  1QVF U;  3ZHV A;  3B2E E;  4ZBM A;  4O2A A;  2EZP A;  2XAJ A;  4X1K A;  4FZ0 A;  5L3G A;  2CK3 G;  4IGG A;  4BIO A;  3WB2 A;  1L0N H;  1FFX A;  4LF7 O;  5D5Q A;  3HPL C;  3ZRV A;  3H1K H;  2QR4 A;  4WFA V;  2P67 A;  4K35 A;  3ASN C;  2YI9 A;  1IDS A;  4JI2 B;  4J11 A;  1Y74 B;  3CRM A;  5JH7 B;  3QVN A;  2ZE6 A;  3BY6 A;  1TUB B;  3L72 H;  3RFR A;  1RM1 C;  2JIZ G;  5J2U A;  1XNR B;  1XL4 A;  4FFK A;  3PJS K;  5KX5 A;  1S76 D;  2PF4 E;  3HKC B;  3DXR A;  4J9Z B;  4LFB O;  3ABT A;  3AEI A;  3N2K B;  3UO2 A;  2EIN C;  2Y0P A;  1SS3 A;  2D2C B;  4LWS B;  2XAH A;  4X65 O;  1FXK A;  4PJ0 Z;  4UB6 Z;  1F4N A;  1QBZ A;  4B3S B;  4LF5 O;  1WP8 A;  2RCV A;  3A0H Z;  3GB7 C;  2RN9 A;  1WA8 B;  5K1P A;  2ZNI A;  4BW5 A;  1BL8 A;  3ABU A;  4LH6 A;  4J42 A;  5IWA O;  1P7G A;  4DV3 O;  1I7F A;  1J5E B;  1N34 B;  1KYO F;  3CRA A;  2E3C A;  5EYP A;  1R3K C;  4FFB A;  2JGD A;  2DOS A;  4PA3 A;  3WU2 Z;  2EZO A;  1YHQ V;  3FD9 A;  2PI4 A;  1UFI A;  4JF3 A;  2HEP A;  1KB9 F;  2P4V A;  2WLL A;  3FB8 C;  3JCU Z;  3CCS V;  3BVO A;  2DYR C;  3ZS8 C;  4G2K A;  1S5J A;  1Y76 B;  3CRR A;  3JAW B;  4F6E A;  5H6Q A;  1XMO O;  1I0H A;  2UXB B;  3T1H B;  4YHH O;  2UXC B;  2K1E A;  2QM8 A;  3S3X A;  3IGA C;  4JGS A;  1N8R W;  3E8F A;  4QJF B;  2MW2 B;  5KAI Z;  1YJ9 V;  1OCR C;  4DV0 O;  4FIP C;  2PI5 A;  1SC5 B;  1NI8 A;  1NU1 H;  4DR6 O;  4JI0 O;  5CBH A;  1M56 C;  3P32 A;  2BOB C;  1IBM B;  1N33 O;  2JJ1 G;  3MHS C;  4JPR A;  5LA6 B;  2QEX V;  2UUA O;  2EUL A;  3FYI B;  1IBL B;  4O4H A;  1BMF G;  3BA8 A;  3RYH B;  4I4T B;  1HWY A;  3K79 A;  4FLY A;  2WAM A;  4TT3 G;  2UXD O;  2JEU A;  4MS2 A;  3CC2 V;  3OTO O;  4NXN B;  3LUT B;  2FML A;  1QR8 A;  3G4S V;  3E2E A;  3W7X A;  2EIJ B;  1AP6 A;  2ARH A;  4Q20 A;  2DMX A;  1FAF A;  3ABL C;  2GUZ A;  5B1O A;  2ZE8 A;  5A9G A;  1VQP V;  1VQM V;  3DC5 A;  4JI7 O;  4U3J B;  1O9H A;  4IIJ B;  4TWK A;  2Q0A A;  1IXB A;  1XNQ B;  4TV8 A;  4QPK A;  2F23 A;  4X1I A;  5LP6 C;  4DUY B;  3SGI A;  2QA4 V;  1N0N A;  2LP7 A;  2EIN B;  2PUS A;  4I55 A;  3L70 H;  4D7S A;  2YIC A;  4B7K A;  4JV5 B;  4JI2 O;  2DJV A;  3CCM V;  1KU9 A;  1GTO A;  4AQY B;  2ZE7 A;  1X59 A;  3SJA C;  1XNR O;  5KUM A;  3JAS B;  2Q73 A;  1EZJ A;  3ETQ A;  3F7V C;  1CPY A;  3W7U A;  2BTO A;  4K8Z A;  1FFT B;  4E2L A;  4H33 A;  3TXQ A;  3B09 A;  1DK1 A;  1NR1 A;  4DR4 B;  4DV2 B;  2UXN A;  2P4K A;  3RYI A;  3TGU H;  5KMG B;  2IU3 A;  1LUW A;  2XTA A;  3K0D A;  4B3S O;  3AG1 B;  4JI1 B;  2Q6A A;  1KUQ A;  2VWJ A;  4GCZ A;  1SQG A;  2DYR B;  3Q4H B;  5L3E A;  1V54 C;  2RNB A;  1VQN V;  2VRZ A;  1GMG A;  3AK1 A;  2RJZ A;  1N34 O;  2A0L A;  3RYF A;  3RW0 A;  4QE7 A;  3CXH F;  3K06 A;  5LGT A;  4IHJ A;  1OCR B;  4I9W A;  5HFM A;  1XRE A;  1YZB A;  2KKW A;  1NH2 B;  4JTD B;  4I50 B;  5DEC A;  5C8Y A;  4RAI A;  5IJ9 B;  1UJW B;  3BA9 A;  4OPH A;  3TXS A;  1Y67 A;  3HKE B;  1M56 B;  2LGW A;  1VF7 A;  1P84 F;  3RBZ A;  2UXB O;  2B5U A;  3T1H O;  3ZN0 A;  2UXC O;  2B1G A;  1JJO A;  1YCI A;  4OX9 B;  3BCC H;  1V9P A;  2BTQ A;  4NTY A;  4I0X A;  4X89 A;  2GDS A;  2F66 C;  3SYA A;  4TQD A;  4MVS A;  3STZ C;  4NXM B;  1QCE A;  1HNW B;  3ZED A;  1VQK V;  1MA1 A;  4JI4 B;  4HBN A;  4GKJ B;  3ABL B;  2AGA A;  2CH7 A;  1IBM O;  2P5O A;  1R6T A;  2JS3 A;  1OHH G;  3SPJ A;  2LQT A;  1AR4 A;  1IBK B;  4LNU B;  1IBL O;  4JTC B;  4RUE A;  3E8G A;  4FMT A;  3SYP A;  4RO2 A;  1A32 A;  4JYA B;  5B66 Z;  2VQF B;  5IYZ B;  1YVW A;  1G6U A;  1OCO C;  2UUB B;  2BE3 A;  3A0R A;  3QF7 A;  3SYC A;  1R73 A;  2Z3Y A;  4LF9 B;  3E89 A;  4JI8 B;  4X1Y A;  1F51 A;  4L8J A;  3ETE A;  4O4J A;  5LMN O;  2IJH A;  2V4D A;  1V55 C;  1SZT A;  3SPH A;  4CZZ A;  3OMA B;  4R6Z A;  1BQ0 A;  4MVO A;  1XNQ O;  2UXX A;  4DR1 B;  3EFF K;  5KLV H;  3CYO A;  2Y0I A;  1SQF A;  4EFE A;  1NBM G;  4FVM A;  4JV5 O;  3ZX6 A;  4LFA B;  4AQY O;  1XBL A;  4MVM A;  1P7B A;  2Y69 C;  4C7U A;  2FL4 A;  2X6C A;  2HFE C;  3NR7 A;  3O65 A;  3BAA A;  4J80 A;  3FB5 C;  1UPG A;  4WFF A;  2W0X A;  2Q7H A;  3LDE A;  3CME V;  3SYQ A;  2ILM A;  3JAT B;  4X20 B;  4DR4 O;  3FB6 C;  3D3Q A;  4CH6 A;  3CS5 A;  3LNN A;  3K0G A;  2ZQM A;  4UCO A;  3L74 H;  1K5S A;  2DQ0 A;  5IJ0 B;  3CJH B;  2A9H A;  4CC5 A;  5CBF A;  1JVM A;  1E79 G;  4ZOL A;  2D3O W;  1EFR G;  4DRX B;  4H0L B;  1GM8 A;  5B1A C;  3R65 A;  1NH2 D;  4KHP B;  4X88 A;  4ZI7 A;  1Q5O A;  2IJJ A;  3JD4 A;  1L1F A;  4MTF A;  1Q6I A;  2QKC A;  4TOI A;  1X4T A;  1ZX3 A;  3RGB A;  3N2G B;  1SF9 A;  2QM7 A;  4UCT A;  3SPG A;  3H9V A;  3G71 V;  3SJQ C;  4O2B A;  5E79 Z;  2P90 A;  4G28 B;  3M8A A;  2ZIM A;  5EK0 A;  5JQG A;  4MVZ A;  4NVP A;  3SJB C;  3CB2 A;  1NVP B;  5LYJ A;  1YIJ V;  3J80 N;  3OUS A;  2Q7E A;  3H1H H;  1L0L H;  4OGQ B;  5FL7 G;  3SR2 C;  5ITZ A;  1XIL A;  1YJW V;  5GON B;  1N0J A;  4NB5 A;  4ZIB A;  2EIL B;  4NXM O;  5KA5 A;  1EN6 A;  2ATK C;  1WN7 A;  1HNW O;  1OCO B;  1AI7 A;  4D7T A;  2E5L B;  4JI4 O;  4X64 B;  1M4U A;  2VQE B;  3OR7 C;  4GT1 A;  1K73 W;  2CTW A;  1AB3 A;  3CWB H;  1I08 A;  3C90 A;  2A3Q A;  3K04 A;  5LOV A;  1O9G A;  4XBF A;  4MW8 A;  4MTG A;  1VF6 A;  3P3N A;  4JYA O;  4FZ1 A;  1S0V A;  2R9I A;  2VQF O;  1Y66 A;  4DV1 O;  1PNL A;  4N21 A;  1VQ4 V;  2UUB O;  5FNV A;  1XMO B;  3M7M X;  1AJQ A;  4LF9 O;  1U97 A;  2M6Y A;  4JI8 O;  1EBO A;  4HNA A;  5LMU B;  1SA0 A;  5KHG A;  3A2F A;  3W7T A;  1IVS A;  1PL0 A;  4IYH A;  3W7S A;  3JSN A;  4DR6 B;  1Y6X A;  4JI0 B;  2BCC H;  2K9P A;  4P9O A;  3K57 A;  3D36 A;  2HG5 C;  1KQS U;  1RP3 B;  5IYD O;  3J81 N;  1M93 A;  2HHH B;  5BR8 O;  5B1B C;  4WBN A;  3OMN B;  1FXV A;  1M5I A;  3ZMU A;  1ZL8 B;  3OTO B;  1XUQ A;  3ABM C;  3L9D A;  1VQ8 V;  5LGN A;  2Q7G A;  1ZWI C;  4DK1 A;  4FLX A;  1TAE A;  3E86 A;  5H5N A;  2VWK A;  4RQF A;  3K59 A;  3OGC C;  2AXT Z;  4I7Z B;  4QIW F;  3DC6 A;  1WPX A;  2W0F C;  2R9A A;  3QO8 A;  1DGS A;  4PHZ A;  1H2L A;  1K4C C;  4KHP O;  3OGI B;  4EKW A;  5H2F Z;  5FPO A;  2EIJ C;  1P49 A;  1Y74 A;  4MW3 A;  5JH7 A;  1K9M W;  1H38 A;  1TUB A;  1XOU A;  2QGN A;  4PDM A;  5H6R A;  1KKC A;  4PI2 A;  1N36 B;  5EBL C;  1NVP D;  3F5T A;  4NYK A;  1MZE A;  1G4Y B;  3ZBH A;  3HKC A;  3I55 V;  1F4M A;  3BFR A;  1YIT V;  3N2K A;  4HAM A;  1W0K G;  3JD3 A;  4LWS A;  3LNM B;  4J7Z A;  3CCR V;  2AZ2 A;  5JJN B;  5F2V O;  5JCO C;  2ZIO A;  4O4L B;  2X6B A;  5KUK A;  3E22 B;  1WA8 A;  2YDE A;  2ODM A;  2X7R B;  2ADP A;  1B3Q A;  4ZHQ A;  1NTK H;  3H1J H;  2HLD G;  1OCC C;  3VOU A;  2QKS A;  2E5L O;  5LHH A;  1DLB A;  4YJ2 A;  4X64 O;  4CS2 A;  2UUC B;  2VQE O;  2HJD A;  1ZAU A;  3T1Y B;  1JOY A;  5EBW C;  3DGE A;  1XMQ B;  4R50 A;  1SES A;  3AG1 C;  4LFC B;  1S5H C;  1S72 V;  4MTO A;  3A0B Z;  1QR9 A;  3I5D A;  1Y76 A;  4KXR A;  1GK9 A;  3JAW A;  5KHI A;  1JJ2 U;  2WA4 A;  4MVU A;  4WF9 V;  2YC0 A;  3ZRW B;  5B1B B;  3THO A;  3K5N A;  5LMU O;  5KA6 A;  2WLM A;  1VEW A;  2V7Q G;  4FM0 A;  3ABM B;  5BY1 A;  1W0J G;  1YSC A;  2GTA A;  1MMM A;  2QTS A;  5LA6 A;  4DR7 O;  2KB1 A;  4I9Q A;  2L35 A;  2WLI B;  1RPO A;  2HHH O;  3AG7 A;  2XAG A;  1AIL A;  3RYH A;  4I4T A;  5IYC O;  1J95 A;  4O4I B;  1Y4M A;  5GTH Z;  3HKD B;  2ZR3 A;  3IC9 A;  1Q8I A;  3K9A A;  2GBO A;  4UUJ C;  2QWP B;  4L87 A;  1NS1 A;  1JPX A;  1PP9 H;  4BAY A;  5LMN B;  2XT9 A;  4U3J A;  3PN1 A;  4ICG A;  4ABM A;  4IIJ A;  1BSM A;  4BIZ A;  3CCV V;  1ZLZ A;  2H3O A;  3HR0 A;  3LSU A;  1MSD A;  4CS4 A;  3RN4 A;  2YEV B;  3OT7 A;  3MAQ A;  4UVA A;  3EVK A;  1GM9 A;  4W4K A;  5JCO A;  3VQX A;  1N36 O;  5CA1 B;  2Z0A A;  1IUR A;  3JAS A;  2E74 B;  5EIB C;  4Z1V A;  1KMI Z;  3ZHQ A;  3C3S A;  3HKB A;  5KHH A;  4I55 B;  1GN6 A;  1W59 A;  1JA8 A;  1OCC B;  2GTS A;  2ZXW C;  4JAV A;  1CEZ A;  1S77 D;  1FYJ A;  2JS5 A;  3CHX A;  3JAR B;  3K3W A;  3CE2 A;  5KMG A;  4UV9 A;  5JVD A;  2ZNJ A;  2MK3 A;  2AZ0 A;  3I56 V;  1QLE C;  3W7W A;  4GX0 A;  4CBC A;  4DR3 O;  3Q4H A;  2LFS A;  1NR7 A;  4B3R B;  3TK1 A;  1FXH A;  2ZDI C;  4UV8 A;  1I5Y A;  2DW4 A;  4AI8 A;  2UUC O;  3IJ4 A;  1H8H G;  1COW G;  2AHY A;  5CBG A;  1HP8 A;  2XHB A;  3T1Y O;  2F43 G;  3N27 A;  2CUG A;  1D5A A;  1YJN V;  2P6J A;  3FB7 C;  2N05 A;  2W6J G;  3CC4 V;  5IY5 C;  1XMQ O;  1SET A;  4WFE A;  4LFC O;  4I50 A;  1BE3 H;  5IJ9 A;  5B5E Z;  2XOK G;  1EM1 A;  2FKX A;  3HKE A;  4GUN A;  3JCZ A;  2H94 A;  1NQT A;  1WLE A;  5EZY B;  4X66 O;  4EB6 A;  1AJN A;  2V1D A;  5KHK A;  1XI1 A;  1XDC A;  2CGO A;  4LP8 A;  4I5S A;  1JFF B;  4JZ2 A;  4CS3 A;  3G6E V;  3ZRS A;  4LR3 A;  3P30 A;  1LR1 A;  1XHZ A;  4XDJ A;  1Q43 A;  2RDC A;  1AR1 B;  4FM1 A;  5GTI Z;  5CA0 B;  3BRC A;  1KP2 A;  2P7T C;  1FPO A;  1JX9 A;  1ZUQ A;  3OTF A;  4TUY B;  1KEC A;  1K5Q A;  2LW1 A;  2R70 A;  4LNU A;  1GM7 A;  1R1B A;  1AR5 A;  4LCU C;  1QLN A;  2ITC C;  4A5U B;  1MAB G;  3A8T A;  4DXW A;  4DV4 B;  1NTZ H;  1CXZ B;  2AHZ A;  2F1M A;  5LP6 A;  5B3S B;  5IE9 A;  2EIL C;  3BAB A;  2EBO A;  3LSS A;  5IYZ A;  4DV1 B;  2YSU B;  2LO1 A;  3QO5 A;  1XL6 A;  1R3J C;  3ZMT A;  1TUE B;  2JDI G;  5BZB A;  5FPR A;  4FLW A;  2AW9 A;  1WP7 A;  5CA3 A;  2CTQ A;  2DWD C;  1WB8 A;  1SQV H;  2IW5 A;  2P22 C;  3GWK C;  3KCX A;  4YIP A;  3S3W A;  3L73 H;  2JEX A;  3RVZ A;  5JJE B;  5DED A;  1OCZ C;  4LC1 A;  2OYQ A;  1PV0 A;  1PKX A;  1E1R G;  1EZV H;  2ZXW B;  4K0K B;  4UVC A;  1NTM H;  1HNZ B;  3B8N A;  5KAF Z;  5BR8 B;  3CEI A;  1VAR A;  1NT2 B;  5CB4 B;  1CP9 A;  3LDC A;  5EBM C;  1HDJ A;  2Q5Z A;  4DR5 O;  4FLT A;  4YIO A;  3JAL B;  1KD1 W;  4EEQ A;  1QLE B;  4JYY A;  2YID A;  1WJZ A;  1K4D C;  3WB1 A;  5BMV B;  5E1A C;  2ITD C;  4YJ3 A;  4X20 A;  3JAT A;  3OR6 C;  4DW0 A;  2RMK B;  2CGN A;  3T2M A;  3EXA A;  2IU0 A;  3UQ8 A;  4JI5 B;  4OPA A;  2PZS A;  1M57 C;  1NJI W;  3RYC B;  5IJ0 A;  3K5L A;  1F23 A;  5J9P C;  3SPC A;  3CJH A;  1FS0 G;  3HB3 B;  4NTX A;  5IY5 B;  2JVD A;  4DRX A;  3ZJZ A;  3UKM A;  2PY5 A;  2N04 A;  3LSQ A;  4JI6 B;  4B3R O;  4DV5 B;  2PTM A;  2KG7 B;  3ML0 A;  3MD0 A;  3DSQ A;  4IYI A;  4KL1 A;  1WAZ A;  2QE7 G;  5J2T B;  3EHB B;  2H8P C;  3UO3 A;  2WLN A;  3B77 A;  1PD3 A;  1Q86 W;  3N2G A;  2EIK B;  1BQZ A;  2YXL A;  1VF5 B;  4QGP A;  2OWO A;  3OMI B;  2X6A A;  4R7C A;  3JD1 A;  1W2B U;  4DUZ B;  1N4C A;  1GKF A;  4F4L A;  1ENV A;  4HZ3 A;  4ASU G;  2ETN A;  2VS0 A;  2R72 A;  4B3M O;  3L71 H;  3G80 A;  3KCY A;  1MOF A;  4J10 A;  1RSO B;  5GON A;  2RQ6 A;  2PYJ A;  2OCH A;  2BSK B;  5JQG B;  4TV9 B;  1K3E A;  3CX5 F;  3H1L H;  1TVK B;  1GAX A;  3U0Z A;  2P06 A;  2F93 B;  4MSW C;  2NN4 A;  2XAF A;  4U7O A;  5ITZ B;  3K08 A;  1GN3 A;  3VQW A;  2ZM6 B;  1VMG A;  3OE7 G;  3C3T A;  4BW9 A;  4WFB V;  4Z2W A;  1I5X A;  3CCU V;  4DV4 O;  4H13 B;  1OCZ B;  5EIB D;  3RT3 C;  1R3L C;  2HP8 A;  1MG1 A;  4TSF G;  3ASO B;  3MDS A;  4IT5 A;  1FXK C;  5LHG A;  5L3C A;  3B8M A;  3QO7 A;  1D5N A;  3JAK B;  5LXT B;  4GLX A;  3FAV B;  3UT5 B;  4CH3 A;  2QTO A;  4BR6 A;  2HKO A;  1U96 A;  2LJ2 A;  2FTK A;  5LHI A;  4J9Y B;  4CH5 A;  1XHX A;  1AP5 A;  4PEL A;  4DYL A;  1VQ7 V;  2Q67 A;  4PD4 F;  1I94 O;  4H44 B;  1BCC H;  4K0K O;  4DR7 B;  4LF4 B;  3ETG A;  5KHJ A;  3D8C A;  2ZIN A;  1HNZ O;  3ZHS A;  1RFY A;  4JI3 O;  4AHC A;  1M57 B;  1PPJ H;  4BIU A;  5EC1 C;  5C93 A;  2A06 H;  1G8M A;  1Z5V A;  2M7W A;  1YTF B;  1WB7 A;  2NLJ C;  1K97 A;  3BHP A;  3CMA V;  2A79 B;  1ZL8 A;  3OD4 A;  1HR0 B;  1LNQ A;  3QNE A;  4GKK O;  1HNX B;  2OT5 A;  1ZSP A;  4JI5 O;  5DM6 V;  3JD2 A;  1KBH A;  1GN4 A;  2WWW A;  2C2A A;  1K34 A;  3WB0 A;  3VQY A;  4F6R B;  2XAS A;  1Q7Y W;  4J7J A;  2EJ7 A;  3TET A;  4D6T H;  1BS3 A;  2YIA A;  4JI6 O;  1VQO V;  3X2Q C;  4DV5 O;  3ZHU A;  5LL6 Y;  3FX7 A;  4B7E A;  4Q6G A;  1VQL V;  2ZE5 A;  4W4L A;  3ZCC A;  1WPB A;  2YXY A;  4O2A B;  4X1K B;  3APO A;  4UB8 Z;  3CXC U;  2ZD9 A;  3APQ A;  2F4V B;  3VQV A;  1AJP A;  1FFX B;  1XQ8 A;  4UCU A;  2ZCE A;  1KKD A;  3IFX A;  3GWO A;  2CDY A;  4GX1 A;  2WA3 A;  4DUZ O;  1AI4 A;  4KP4 A;  3SJC C;  2X0L A;  1TA8 A;  2IBZ H;  2G38 A;  5J2U B;  5KX5 B;  4H37 A;  4O4L A;  5A2Q N;  3DXR B;  3E22 A;  5LGU A;  2ZR2 A;  3G6B A;  3MHH C;  1FKA O;  4DR3 B;  2KQX A;  1HW7 A;  2N74 A;  3FYE B;  2OCC B;  3CPW U;  3K5M A;  2OTJ V;  4PDR A;  4B08 A;  2QWR B;  1FXK B;  4J41 A;  3F5W C;  5IDJ A;  1Q82 W;  1YXB A;  5L3B A;  4BWA A;  3D3I A;  4PV1 B;  1D2D A;  2XUM A;  2Z5U A;  4PA4 A;  4Z1M G;  4RWU A;  2JJ2 G;  2ZM6 O;  5CN0 A;  3BPZ A;  2DYS B;  2HVK C;  1R6K A;  4ZHQ B;  2DN9 A;  3IAY A;  2WLH A;  3KZI Z;  4E4E A;  4LF8 B;  2DQ3 A;  4YJ2 B;  2JGU A;  1SQQ H;  2IM9 A;  3AK3 A;  4JZG A;  5EYP B;  3WFV A;  3ZRW A;  4FFB B;  2JGD B;  3ZMV A;  4X66 B;  4MVR A;  4UVB A;  2IH3 C;  1F7Y A;  1T5E A;  3QTC A;  1VQ6 V;  3RWR D;  4JAS A;  4NR1 A;  3ZMZ A;  2WLL B;  4LBE C;  4YY3 B;  1YTF D;  3T1C A;  4WCE V;  3B4S A;  1VQ9 V;  4FPP A;  1DTO A;  1QNM A;  1K8A W;  3OW2 U;  2E76 B;  1QVG U;  4LF4 O;  1GO3 F;  1K7D A;  2WLI A;  4PDV A;  1Q81 W;  4K8X A;  3K58 A;  5GW7 A;  1MZF A;  2EIM C;  2Q9L A;  1ORQ C;  4MT8 A;  4O4I A;  3HKD A;  3JSL A;  4ZKI A;  1Q6U A;  2UU9 B;  4FJC C;  1HR0 O;  1US6 A;  4B3T B;  1JCH A;  3OEE G;  3X2Q B;  3AG3 C;  3ZHT A;  1HNX O;  4O4H B;  2XND G;  5JJJ B;  1KP3 A;  4FLU A;  1R6N A;  1DF5 A;  1LUV A;  4FM2 A;  1PL4 A;  2A7W A;  4WFG A;  2PGG A;  3R66 A;  5B3S C;  3ASN B;  1B04 A;  4X8A A;  4YXW G;  1RM1 B;  2GUZ B;  2YEV A;  4WFH A;  2HJF C;  4U7N A;  2F95 B;  1AVM A;  2ZKO A;  5CA1 A;  4DR5 B;  3FFQ A; 
#chains in the Genus database with same CATH homology
 1BGY H;  3H1K H;  4D6T H;  3L74 H;  1BCC H;  1NTK H;  1SQV H;  3H1J H;  1NU1 H;  3L75 H;  4U3F H;  1SQX H;  3CWB H;  1SQQ H;  3H1H H;  1BE3 H;  1KYO F;  1NTZ H;  1L0L H;  3L73 H;  3L72 H;  1PPJ H;  3L70 H;  3L71 H;  3H1I H;  2IBZ H;  5KLV H;  2A06 H;  1PP9 H;  1P84 F;  2FYU H;  1EZV H;  3TGU H;  1SQB H;  1SQP H;  1KB9 F;  3BCC H;  1L0N H;  1NTM H;  2BCC H;  3CX5 F;  3H1L H;  3CXH F;  4PD4 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...