2Z0AA

Crystal structure of rna-binding domain of ns1 from influenza a virus a/crow/kyoto/t1/2004(h5n1)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
72
structure length
72
Chain Sequence
MDPNTVSSFQVDCFLWHVRKRLADQELGDAPFLDRLRRDQKSLRGRGNTLGLDIETATRAGKQIVERILEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title Crystal structure of RNA-binding domain of NS1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1)
rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 30
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2z0aA00
1R6TA 4OX9O 1G1XB 4DR5O 5FLXN 2JRIA 3OTOO 1N34O 3T1HO 2HHHO 5BY1A 4JI2O 1HNZO 4LF7O 4JYAO 5BXZA 4YY3O 3F5TA 3RT3C 4JI3O 1HR0O 4DV5O 1X59A 4GKKO 4NXNO 3M8AA 4DR2O 4KHPO 5LL6Y 1N32O 4LF5O 4DV3O 4GKJO 4DR7O 4LF6O 2UXBO 4JI8O 4LFCO 5LMUO 4DV2O 4X66O 4X62O 4DR3O 4JI6O 2AGAA 4LF9O 4AQYO 5BR8O 1DK1A 3R66A 4OPHA 1F7YA 1IBMO 1NS1A 4OPAA 4DV4O 4B3RO 1HNXO 5IWAO 1FJGO 2VQEO 1J5EO 5LMNO 4NXMO 2E5LO 4LF8O 4DV6O 2F4VO 1R1BA 4DV7O 5IT9N 1XNQO 4B3TO 2UXDO 2LW7A 2ZM6O 3J7AU 1AB3A 4JI7O 4DV1O 1IBLO 2FKXA 4DV0O 2UUCO 4DUYO 2UXCO 1HNWO 4LF4O 5H5NA 1XNRO 2N74A 2UU9O 4B3MO 1N33O 4JI5O 2VQFO 3SDLA 4LFBO 3J80N 4DR4O 1D2DA 4DR1O 2DOSA 1A32A 1AILA 4A5UB 3JAMN 2Z0AA 1KUQA 2UUBO 4YHHO 1IBKO 4DR6O 2ZKOA 4K0KO 1YZBA 3O65A 3T1YO 1XMOO 4JV5O 4JI4O 1I94O 4DUZO 2DJVA 4X65O 5A2QN 1XEQA 4LFAO 4JI0O 1FYJA 1XMQO 3J81N 4B3SO 4JI1O 2UUAO 1FKAO 1N36O 4X64O
chains in the Genus database with same CATH superfamily
2KKWA 2FYUH 4UCSA 1BL8A 1KB9F 1WLEA 3JSLA 4DR5O 5FLXN 5BY1A 4J42A 3BHPA 3FAVA 2BTQA 4MVZA 5LA6B 1EZJA 1NTZH 3ML0A 4DR2B 1OCZB 4CC6A 1GRJA 3ETEA 2JK5C 2GV9A 3W7TA 4JPRA 2QA4V 3E8BA 1XNQB 2KG7B 4J7KA 4KUMA 3SPHA 1FAFA 1Z5WA 4G28B 1YJ9V 2EILB 2JGDA 3B8MA 1SQPH 4FLYA 1YSCA 3RBZA 4ABMA 4X62O 4B3RB 3GB7C 4U7OA 5DEDA 2XAFA 4J9ZB 4LFBB 4NXMB 5L3GA 4LF8B 4OPAA 4DR1B 3JCUZ 1QBZA 5KMGA 4HNAB 3UT5A 3T1YB 3UO2A 3CCRV 1VQNV 2Y69B 1GM9A 2P06A 2WLJA 5J2TA 3CD6V 4I0XB 2RDCA 1PL4A 1HNWO 2A0LA 2EZPA 4TV8B 2XOKG 4JI5O 1D2DA 3FYEB 1H2SB 2HHHB 5EZYB 4R6ZA 1AILA 4EEQA 3WG7C 4YJ2B 3B77A 4CH3A 4FLUA 4MVUA 1KD1W 4X88A 1BCCH 1PD3A 3QTCA 4X65O 4FIPC 2RNBA 3HB3B 2E3CA 4NKGB 2EIMC 2HP8A 1SRYA 3AG2C 2PI4A 4LF9B 3HKCA 3AG4C 4EKWA 3OTOO 1N34O 3NXSA 3RYHA 3APOA 3S3WA 2E76B 2EJRA 2Y48A 3STLC 4CS2A 4O4JA 1EZVH 2YXHA 4UVCA 3SJQC 1EM1A 1JQ0A 3IGAC 4FK5C 3H1IH 4GLXA 3K9SA 2HEPA 5CBGA 5KA5A 3RVZA 3G80A 1XNRB 1NBMG 2Y69C 4AQYO 2EINC 1IXBA 5IDJA 2L35A 1B3QA 1Q7YW 3D36A 2BSKA 2ZDIA 1VF7A 3ZIAG 4BR6A 3LSQA 1S0VA 1EN4A 1IBLO 1M90W 4X1IB 1TUBA 3W7UA 5H5NA 4RQEA 4IIJA 4ZIBA 5BZBA 4JF3A 2VQFO 4DR4O 3RYFA 4UB8Z 5B3SC 4NR1A 3CP1A 5CA0A 2Q0OC 1RFYA 3K59A 3DC5A 3K9AA 2CTQA 2F66C 5A2QN 3EVKA 4LF5B 1FYJA 1H8HG 3LSUA 4D7TA 1GH6A 5FNVB 5CA1A 1QR9A 1F51A 1OCOC 2JS5A 2YEVA 4LF6B 4TOIA 1H2KA 5IJ9B 1Z5VA 1H2GA 5GTIZ 3C90A 3ZHSA 4JI2O 4PDRA 5BXZA 4YY3O 2P67A 3CPWU 2LO1A 5IYCO 4QNHB 4ZHQA 2H94A 4GKKO 1VQKV 4PA3A 4DR7B 2XAQA 2OCCB 4X1YA 1ZLZA 5LL6Y 3U10A 1UPGA 1KBHA 2K9PA 2LFRA 2YIDA 4IT5A 3ZRSA 4AHCA 3UO3A 5L3DA 2BOBC 1XREA 2Y4UA 2UXBO 3A2FA 4J10A 1PNLA 4DR3O 3C3SA 1PKXA 3N2KA 3HKDA 2HKOA 1FXKC 5LMNB 2GUZB 4P9OA 1PNKA 3ZRVA 4BAYA 2A3QA 4K35A 1PM9A 1TVKA 1ZWIC 4B3TO 2LW7A 1FD9A 4U3JA 4XDLA 3OTFA 3ZN0A 1ZSPA 3LUTB 4QJFB 4IL6Z 4YHHB 5IYZA 4QE9A 3AG1B 3SPJA 1OCRB 4DW0A 5K1PA 2XNDG 3GVMA 3SR2C 4CH6A 5JQGB 1K33A 1AROP 3JD4A 4UVBA 2OCHA 5B5EZ 1XEQA 3WB0A 2IM9A 5LYJB 4X20B 1P84F 5JVDA 3TXQA 4BW5A 1D5AA 4MW8A 4W4KA 3L71H 1S3JA 2ZR2A 1DF4A 1BSMA 5L3EA 1GMGA 1IVSA 3UKMA 3QO5A 5JJEB 1SESA 3T4DA 1HW7A 3QO8A 1V55C 3FAVB 4NTXA 2BTQB 5JCOC 4JI3O 5EBWC 3BABA 1BHBA 1S5HC 1BZKA 5LP6A 3E8GA 5B1BB 4PA4A 1IXMA 4LR3A 2V7QG 1TAEA 2C2AA 1Q6IA 1WB8A 2V1DA 2DW4A 2JGDB 4ZKIA 1Y6XA 1Q3EA 2YIAA 4JI6O 1K34A 3R66A 3E22A 5LXTA 4C7UA 3E8FA 4FLWA 1GN4A 2D2CB 2BTOA 4UCVA 4J11A 3AK2A 3IC9A 1NTMH 3H1LH 5JWPA 5KMGB 4HZ3A 3UT5B 1U96A 4HYOA 1SA0A 2H3OA 3DXRA 2UUCB 2UXCB 1T5EA 5J2TB 2ZXWC 4MW3A 3BPZA 2DYRC 3GWKC 1OJHA 2UU9O 3KCYA 1B6QA 1N33O 2LP7A 3J80N 4MVQA 2ILMA 1A32A 2ZE8A 3K04A 4IGGA 2DYSC 4XDJA 3ZMZA 1IBKO 3R65A 5LHIA 3W7XA 2IJJA 1XMQB 1PP9H 4JAUA 2AZ0A 4BIOA 5LHGA 1N32B 2PF4E 3SYCA 4FMTA 1Y76B 4JTAB 1PNMA 2DWEC 1KQSU 3G71V 3SYQA 1N36O 2Q69A 3CCUV 2PZSA 3ABUA 1K8AW 3T1CA 3SJCC 3OGIB 1IBMB 3HKCB 1KECA 3OGCC 1HNXB 3RYHB 1CP9A 2QM7A 4YJ3A 3FB8C 2KB1A 2GHYA 4DV3B 3RFRA 5L3BA 3ICXA 2NN4A 2GSMB 1SKVA 3JAWA 5LGUA 4KHPO 4PDLA 2IJIA 2B1IA 4FZ0A 3Q4HA 4GKJO 4DO2A 4Z1VA 1OHHG 2HVJC 4LH6A 1I5YA 4B3MB 2H8PC 3CYOA 3H01A 1NZ6A 1XL6A 5DM6V 2RN9A 2P4KA 5KA6A 1O9HA 5C93A 1M4UA 1V9PA 1XI1A 3L9DA 1F23A 4PA7A 3JALA 2BSKB 3P3PA 2ZM6O 2JDIG 4O4IA 4CH5A 3WFVA 1NR1A 4DUYO 3C3TA 4MTXA 3JARA 1CPYA 1TUBB 4PDMA 1SZXA 4ASUG 4IIJB 4DR5B 2LFSA 2EIKC 3RW0A 3CXHF 2JEUA 4G27B 3RYFB 4NYKA 1KU9A 4A5UB 1JJOA 1YIJV 3ZHUA 3ABLB 4U3FH 4WFBV 3BA8A 5CA0B 1KP2A 2OYQA 1PL0A 4H33A 2ZKOA 4L87A 1N4CA 4LFAB 1LUVA 4JI0B 3CC7V 3HPLC 4O2BA 1I94O 1J95A 2CTWA 3OE7G 5D5QA 3ASOC 2LGQA 2WLKA 2A7WA 4KXRA 1JFFA 5CA1B 1MMMA 2Y4TA 3FD9A 4PV1B 2YEVB 2ZE5A 1AI6A 4X62B 4LF7B 2WLNA 2A06H 4WCEV 4I7ZB 4MVMA 4JYAO 4FVMA 2QJ1A 2EBOA 1FXVA 1I7FA 4LC1A 5E1AC 4X1KA 1IZ3A 4JASA 1SC5B 4H13B 1R3LC 1QU7A 4X1YB 1XOUA 2ITCC 2VWJA 5B1OA 4UXNA 1NT2B 3D36C 2WSSG 4CH4A 1HNWB 5LMUO 5CA3A 3S3XA 1W59A 3LSSA 4JI5B 1VEWA 3N2KB 1P4RA 3HKDB 1JA8A 2CUGA 2AW9A 3A8TA 4DV7B 3VBBA 1FXHA 2EZOA 2Q5ZA 2Q67A 3TETA 1TVKB 4NB5A 3H1KH 4YIPA 1VF6C 2P5OA 4X65B 4R8CA 4NTYA 2LQTA 4GX0A 5KUKA 2FMLA 4U3JB 1URFA 1NJIW 3EFFK 3X2QC 1N34B 5CBFA 4EFEA 2VRZA 5IYZB 3KCXA 4MT8A 1TGOA 4WFEA 3K5MA 4QPKA 4DUZO 3JAKA 1QCEA 2OIEA 1S5LZ 2FTKA 3E86A 4CS3A 4EB6A 2IJHA 3BA9A 3ZRWA 1FS0G 1H38A 4QE7A 4X64O 5JVDB 3VQVA 4OX9O 3IC7A 4AQYB 2HVKC 4UCTA 1YJNV 4FM2A 4F6EA 5KHGA 2Z5UA 1ENVA 3RT3C 3K5NA 2BCCH 3FB7C 2Q4PA 3M8AA 4DR2O 4JTCB 1F4NA 1OCZC 1P49A 1K4CC 5LP6B 4RO2A 1NI8A 3TJTA 3ZN1A 4LCUC 5C8YA 3ABKB 2PI5A 2EILC 1DK1A 2VQFB 1GN2A 4DR4B 3QG5A 4FLXA 1QVFU 5LXTB 3E22B 4B3RO 2AXTZ 1Y74A 4I55A 4NXMO 2QE7G 4LF8O 3JSNA 3ZMTA 1BMFG 3I56V 1WN7A 3ABTA 1R1BA 3CMEV 1MABG 2IU0A 3UQ8A 1ZTEA 4YXWG 1Q90D 1SA0B 3DXRB 4FFBA 2NR5A 2QKSA 1BS3A 3RN4A 2CGNA 1VQLV 4X8AA 2WA4A 2UUBB 3L72H 3B4SA 4JI2B 5DN6G 3THOA 1XHZA 2V4DA 3K5LA 4K0KO 1YZBA 1GKFA 3TK1A 1DGSA 4GKKB 2E75B 1BE3H 1BHAA 4Z1MG 1O9GA 4FFKA 3CJHA 1WA8A 1VARA 2R9AA 1Y67A 2IH1C 4JZGA 4JI1O 2UUAO 2WPDG 3OM3B 2AHYA 5GW7A 4DR3B 1HNZB 5LOVA 4LWSA 3ZMUA 1R3IC 3MHHC 2Q0AA 4XDKA 2Q6AA 3L75H 4NXNB 4GX2A 4GZRB 1AJNA 2RQ6A 4UB6Z 4YIOA 5LBQA 2WLLA 4YJ3B 2ZD9A 2FB5A 3FKSG 2P22C 3VQYA 4B3TB 3ZJZA 3JAWB 1VQ9V 5CN0A 1WP7A 3ASNB 2CE4A 3Q4HB 2YICA 2XAJA 1HDJA 3OMIB 5KLVH 5IWAB 3ZHQA 4W4LA 3K0DA 1ZL8A 3T4ZA 2YS8A 4DV4O 1MSWD 1J5EO 1WJZA 2F4VB 1FFXA 4I9WA 2DMXA 2UXDO 3RVYA 2IW5A 3JALB 2QGNA 2EULA 4E4EA 5FL7G 3K03A 3IAYA 4UV8A 1L8DA 2PUSA 4DW1A 4O4IB 2F23A 2F95B 3RYIB 2Q7EA 4N23A 3ETQA 2XAHA 4HBNA 3K79A 1VP7A 4D6TH 4X89A 3HR0A 3JARB 4UCRA 3CCQV 3U11A 2HFEC 2Z0AA 3CS5A 2JJ1G 3O65A 4JI3B 1XMOO 2CGOA 1NH2B 1IX9A 1KKDA 2N05A 4O2BB 5IY5B 3J81N 5KX5A 2ZIOA 1QLEB 5HFMA 1JFFB 1N8RW 3K57A 1NKDA 4PDVA 2YIBA 4JI6B 4X9QA 1Q81W 3AK1A 5B1AB 3E2EA 3KZIZ 3MD0A 1VF5B 3ASNC 3TGUH 1X4TA 1VQ8V 1SQXH 1HR0O 3OAAG 3UCSC 1XBLA 1Q86W 1K5SA 5EK0A 2ARHA 4PJ0Z 4X1KB 2R70A 4DR7O 4DV2B 4UCUA 2OCCC 3SPCA 4BIUA 4JI8O 3E89A 2UU9B 3M99B 1SF9A 1MNGA 1FJGB 2VQEB 1GN6A 3G6EV 1F7YA 3JCZA 2KQXA 1EBOA 1CXZB 3B2EE 2XASA 5LMNO 3OEHG 2E5LO 4DV6O 2F1MA 1M9NA 3CWBH 1BQ0A 4JI7B 4UV9A 2PYJA 4GUNA 3CX5F 3J7AU 1AB3A 4F4LA 2GDSA 1F4MA 3K06A 4CC5A 5FPRA 1JX9A 2CTRA 1SQGA 1VQ5V 2CH7A 3CRMA 4FLVA 1VQPV 1JPXA 2AHZA 1NH2D 1SQVH 2CK3G 3DGEA 4I5SA 4YHHO 4KP4A 1MZEA 3AG1C 2HJFC 4JV5O 1S72V 1FPOA 4JI4O 1OCRC 1EN5A 3F5WC 3FB6C 3FB5C 4FPPA 1OCCB 3JAKB 4WFFA 4B3SO 1TA8A 2Q7GA 2A79B 4GKJB 2OT5A 4EB6B 5EIBD 4TSFG 3RYCA 4I4TA 1M56B 3G4SV 3ZRWB 1PV0A 1YVWA 4DK1A 2B9ZA 2IJKA 4ZBMA 3SJBC 1YDXA 3VQXA 1UFIA 1RM1B 1XQ8A 2P7TC 4DV5B 4D7SA 1Q6UA 3STZC 1X59A 2WLHA 3K0GA 2DQ0A 4IYIA 4LH7A 1SS3A 5CB4A 2ZM6B 3JD3A 3NR7A 1JCHA 2Q7HA 3CCVV 3FYIB 3O9OA 4NVPA 1FXKA 2P6JA 3PN1A 3OUFA 5FPOA 1WAZA 2X6CA 5B1BC 4DUYB 1N0NA 4LFCO 4X66O 1I5XA 3ZHVA 3AG7A 5C8YB 1R6NA 4U7NA 3SPIA 2QSAA 3FFQA 3B09A 1Y74B 4P30A 4I55B 4I50A 1MOFA 3CCSV 4O4JB 2ZQMA 1I94B 4H0LB 1AJQA 1DF5A 3LDDA 2P90A 1R3JC 1HP8A 4MTOA 4DV1O 5H9CA 3LDEA 4O4LA 4DV0O 4FFBB 3ZRXA 3ZX6A 5KHIA 2UUCO 2UXCO 3L74H 2N74A 3CXCU 1I08A 3N27A 2EIJB 4XBFA 2JJ2G 1AP5A 3JAMN 4JYAB 4TQFA 4DR6O 3HKEA 5GTHZ 2FL4A 1R73A 3SYOA 1XDCA 1IDSA 1G6UA 2IH3C 2DJVA 3AK3A 1XMQO 5H2FZ 3ETDA 3CJHB 1WA8B 3QNEA 3DSQA 5KAIZ 3EHBB 5LMUB 3CMAV 3SYAA 2R9IA 4J80A 4PHZA 1DTOA 1QQCA 3T1HO 5LOVB 4LWSB 1GO3F 4Z2WA 1WNSA 4J9YB 1W0JG 2OIGA 4F6RA 5ITZA 3VQWA 5JJNB 4CZZA 5KHJA 3CEIA 4WFAV 2K1EA 1M93A 2WLLB 4DV3O 1S5JA 3CRCA 1R3KC 4TQDA 5BR8O 3JD2A 2Q9LA 1ZL8B 1AVMA 4TWKA 1NU1H 2QTSA 4ZHQB 2QTOA 3BVOA 1L1FA 4KFMA 2ZNIA 3OFNG 1H2NA 3CB2A 5H6RA 1FFXB 2ZE7A 1K4DC 2ETNA 4H44B 2B5UA 1U97A 3OUSA 1BGYH 1Q5OA 2P4VA 1LNQA 2ZDIC 2QKCA 4LF4O 4X64B 1YJWV 1K9MW 1SQBH 4TT3G 4L8JA 3SDLA 3WG7B 2LGWA 1P7GA 1AJPA 4TV9A 3OEEG 5EYPA 1KUQA 1M57B 3MAQA 5BMVA 3JATA 3PJSK 4J7ZA 4CS4A 1MG1A 4JYCA 4EFBA 4MVOA 3ABLC 2Q68A 3N2GA 3JD1A 3MDSA 4LFAO 2EIMB 3LNMB 1Z2GA 4JI0O 2ADQB 2YSUB 3AG2B 2X6BA 3E35A 4DRXA 2D3OW 3AG4B 5KX5B 1WPBA 3OTOB 3DTUB 5TISZ 1YF2A 3B8NA 4JZ2A 3LNNA 4E2LA 2GTSA 2HLDG 4LF7O 1XILA 3JYCA 5IJ0A 5E79Z 1LUWA 4J7JA 2ZE6A 4ICGA 4TUYA 1M1KW 3P32A 1PPJH 2W6IG 1VIBA 2JEXA 2GBOA 2YXLA 1MZFA 1N0JA 2EINB 1LR1A 5JJJB 1NQTA 2RJZA 1H2MA 3FX7A 1YITV 4MTGA 4JYBA 1I0HA 4O2AA 4GX1A 2QM8A 2X7RB 3BCCH 2BOCC 5IE9A 3CCMV 2Q73A 5EBLC 1GAXA 4H37A 1SERA 4K3AA 2F43G 1WP8A 1RSOA 4K0KB 4KL1A 4PA9A 3SGIA 1YXBA 1Q82W 2WLIA 5IT9N 4DV7O 2CTPA 2Y0IA 1XNQO 1IBLB 1G4YB 2YUAA 2IU3A 3JASA 1Q43A 4Q20A 1M57C 3L70H 4MTFA 2KSDA 1Q8IA 2ZR3A 2FKXA 4JI1B 1Y76A 2UUAB 4IYHA 5GONA 4JGSA 1GTOA 5H6QA 1RPRA 5B3SB 4LFBO 2CH7B 5LGTA 2O57A 3P30A 4FM1A 4RUFA 4DR1O 2HJDA 1AR5A 1HWYA 2BE3A 3M7MX 3U0ZA 4QGPA 3T1YO 4K8ZA 4B7EA 2R9RB 1OCOB 4LBEC 3BY6A 4ZOLA 1H2LA 2YI9A 3K5OA 1VQ7V 2YIBD 2IBZH 2NLJC 3TCUA 1FKAO 4WFGA 3RYCB 4I4TB 2AZ2A 1JR9A 1GK9A 2DE0X 4YY3B 1G1XB 3H9VA 4UUJC 2JRIA 4RUEA 1B04A 2QWNB 4O4HA 2NNUA 4UVAA 4DV4B 5AG2A 2HHHO 4UCOA 5J2UA 3CSXA 3ZHRA 1J5EB 5LHHA 3APQA 5B66Z 2UXDB 5IYDO 2UXBB 1ZUQA 2RMKB 2YXYA 5CB4B 5EBMC 2XHBA 1Y4MA 3B40A 1FXKB 3QVNA 2ADPA 5LP6C 3SPGA 2W6JG 2AGAA 3CRQA 4LF9O 2DWDC 3G6BA 1NS1A 4WBNA 3ABKC 3QF7A 4LNUA 1VF6A 2N04A 2XUMA 1XMOB 4RAIA 5D5PA 4I50B 4ZI7A 2ODMA 2X0LA 5JH7A 2LJ2A 2PTMA 1QVGU 1WPXA 1VQMV 2G38A 2UXXA 3A0RA 2GTAA 4O4LB 1XNRO 5CMUA 2WA3A 4JAVA 1XUQA 4MS2A 1JMKC 1MSDA 2DOSA 2OTLV 3WB2A 2W0FC 2UUBO 4P2ZA 1NVPB 4N21A 3A0HZ 1HR0B 3HKEB 3HKBA 2Y0PA 3ZBHA 3CHXA 4WF9V 4IHJA 3W7WA 1M5IA 3D3QA 3QO7A 1D5NA 1YI2V 2B1GA 4BWAA 1K92A 1DLBA 4JI8B 4FLZA 1AI5A 3BRCA 1ORQC 1TUEB 1V55B 1GM8A 3P3NA 3RGBA 5LA6A 3TXSA 1HNZO 4DYLA 1K73W 1CEZA 2E5LB 4OGQB 3F7VC 4RWUA 2JVDA 4DV6B 1OZ0A 4P9PA 4F6RB 3K08A 5ITZB 1KP3A 2QKAA 2KG7A 4NXNO 4J41A 1R6KA 3W7SA 1ZX3A 3CCEV 3SYPA 3ZCCA 4LF5O 4PELA 3OMNB 1EFRG 1AI4A 4LF6O 5L3FA 2QDOA 3D3IA 3IFXA 5F2VO 2OTJV 2Q8VA 3F7YC 4JYYA 1KYOF 5EC1C 2R72A 2W0XA 1BQZA 5IWAO 5KUMA 4HNAA 3CCLV 3BEHA 4JV5B 1XL4A 4JI4B 1IURA 1ZAUA 2F4VO 2ZXWB 2DYRB 3AEIA 2EX3A 4I0XA 3KG2A 2DN9A 4B3SB 2YDEA 2DQ3A 1N33B 3CRAA 2ZIMA 1US6A 4TV8A 3ZEDA 3KKYA 1NVPD 2DYSB 1V54B 1GM7A 1K3EA 5EZYA 1IBKB 1YTFB 4AILC 4GYCB 3SJAC 4TV9B 3IJ4A 4YJ2A 3ZMSA 5EYPB 5BMVB 3JATB 2QEXV 3CE2A 3RWRD 3BAAA 1Y66A 4LP8A 1L0LH 1QR8A 3H1JH 2XTAA 3N2GB 3CC4V 1N36B 2UXNA 3JD0A 2M6YA 2HG5C 4PI0A 4BIZA 5IY5C 4LFCB 4DRXB 1SQFA 1JVMA 1R6TA 4GT1A 4X66B 4GX5A 3WB1A 1QLEC 5HFLA 1B06A 5KHKA 3F5TA 5B1AC 2ZCEA 1E79G 4KHPB 2VS0A 3DC6A 3AG3B 5EIBC 4DK0A 5IJ0B 4GCZA 3K3WA 4Q6GA 2JIZG 3H1HH 4TUYB 2ITDC 4HAMA 1JJ2U 1Q6HA 3UM7A 2X6AA 1GN3A 4DV1B 2A9HA 3ZHTA 4DV0B 1KKCA 3OD4A 3OT7A 5A9GA 4DV2O 2JS3A 1WB7A 4O2AB 1FJGO 3OR7C 2VQEO 3EXAA 3CCJV 4AI8A 5LGNA 4PI2A 3I5DA 3ABMB 4DR6B 2CAZC 1EN6A 1RSOB 1V54C 2XT9A 2HR3A 1VQ4V 3MHSC 1AR1B 4B08A 3D8CA 2WLIB 2OWOA 3G67A 4FM0A 2LW1A 1SZTA 2MK3A 4X1IA 2QWOB 4JI7O 5L3CA 1YTFD 3JASB 1JOYA 5KAFZ 2EIKB 1QLNA 1E1RG 5GONB 2M7WA 4MVRA 4I9QA 1W2BU 3T1HB 1YCIA 5IYBO 1AI7A 3I55V 2XAGA 1W0KG 4G2KA 2ZINA 4DXWA 1YHQV 2PY5A 4RQFA 1AP6A 3ETGA 2WAMA 4CBCA 1QNMA 1AR4A 3ASOB 2ATKC 1FFTB 4FZ1A 5FNVA 4QIWF 2PYLA 4R7CA 3GWOA 2F93B 4ZOLB 5IJ9A 2QWPB 2YC0A 3AG3C 1QHTA 1OCCC 2WLMA 4R50A 4OXSA 3ZMVA 2CDYA 1P7BA 1SQQH 1NTKH 5BR8B 1K7DA 1M56C 2WWWA 3OW2U 1OV9A 1MA1A 5J9PC 1VQOV 1ROPA 4O4HB 1NR7A 2JGUA 5J2UB 4QPJA 2YI8A 1XHXA 2QWQB 1RM1C 2QM4A 4DV5O 1E1QG 3T2MA 1N32O 5K1XA 2VWKA 3K58A 4UFZA 1SETA 2QWRB 5EC2C 3ABMC 4MVSA 5JCOA 1S77D 4LF4B 3RYIA 4B7KA 4FLTA 3VOUA 2GUZA 3L73H 3OR6C 4OPHA 1IBMO 1S76D 1THZA 3A0BZ 1YEWA 3ZS8C 1HNXO 1KC8W 1VQ6V 4WBNB 4JAAA 4LNUB 3E83A 1COWG 1G8MA 4ZI7B 1K97A 5DECA 4PA6A 5JH7B 2E74B 3X2QB 1KMIZ 2QR4A 4WFHA 4BW9A 1RPOA 1H8EG 3E8HA 4B3MO 1K5QA 2ZT9B 4JTDB 2ZNJA 1VMGA 2L6LA 5JQGA 2EIJC 5B1NA 4PD4F 4DUZB 5KHHA 5CBHA 3BFRA 2MW2B 3WU2Z 4NTWA 4MSWC 1RP3B 1L0NH 3OMAB 5LYJA 1BT8A 3HKBB 4X20A 2PGGA 3CC2V 4FJCC 2EJ7A 1UJWB 3LDCA 4IHJB 4OX9B 4K8XA 2Z3YA 2RCVA 3CRRA
chains in the Genus database with same CATH topology
1R6TA 4OX9O 1G1XB 4DR5O 5FLXN 2JRIA 3OTOO 1N34O 3T1HO 2HHHO 5BY1A 4JI2O 1HNZO 4LF7O 4JYAO 5BXZA 4YY3O 3F5TA 3RT3C 4JI3O 1HR0O 4DV5O 1X59A 4GKKO 4NXNO 3M8AA 4DR2O 4KHPO 5LL6Y 1N32O 4LF5O 4DV3O 4GKJO 4DR7O 4LF6O 2UXBO 4JI8O 4LFCO 5LMUO 4DV2O 4X66O 4X62O 4DR3O 4JI6O 2AGAA 4LF9O 4AQYO 5BR8O 1DK1A 3R66A 4OPHA 1F7YA 1IBMO 1NS1A 4OPAA 4DV4O 4B3RO 1HNXO 5IWAO 1FJGO 2VQEO 1J5EO 5LMNO 4NXMO 2E5LO 4LF8O 4DV6O 2F4VO 1R1BA 4DV7O 5IT9N 1XNQO 4B3TO 2UXDO 2LW7A 2ZM6O 3J7AU 1AB3A 4JI7O 4DV1O 1IBLO 2FKXA 4DV0O 2UUCO 4DUYO 2UXCO 1HNWO 4LF4O 5H5NA 1XNRO 2N74A 2UU9O 4B3MO 1N33O 4JI5O 2VQFO 3SDLA 4LFBO 3J80N 4DR4O 1D2DA 4DR1O 2DOSA 1A32A 1AILA 4A5UB 3JAMN 2Z0AA 1KUQA 2UUBO 4YHHO 1IBKO 4DR6O 2ZKOA 4K0KO 1YZBA 3O65A 3T1YO 1XMOO 4JV5O 4JI4O 1I94O 4DUZO 2DJVA 4X65O 5A2QN 1XEQA 4LFAO 4JI0O 1FYJA 1XMQO 3J81N 4B3SO 4JI1O 2UUAO 1FKAO 1N36O 4X64O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6T A;  4OX9 O;  1G1X B;  4DR5 O;  5FLX N;  2JRI A;  3OTO O;  1N34 O;  3T1H O;  2HHH O;  5BY1 A;  4JI2 O;  1HNZ O;  4LF7 O;  4JYA O;  5BXZ A;  4YY3 O;  3F5T A;  3RT3 C;  4JI3 O;  1HR0 O;  4DV5 O;  1X59 A;  4GKK O;  4NXN O;  3M8A A;  4DR2 O;  4KHP O;  5LL6 Y;  1N32 O;  4LF5 O;  4DV3 O;  4GKJ O;  4DR7 O;  4LF6 O;  2UXB O;  4JI8 O;  4LFC O;  5LMU O;  4DV2 O;  4X66 O;  4X62 O;  4DR3 O;  4JI6 O;  2AGA A;  4LF9 O;  4AQY O;  5BR8 O;  1DK1 A;  3R66 A;  4OPH A;  1F7Y A;  1IBM O;  1NS1 A;  4OPA A;  4DV4 O;  4B3R O;  1HNX O;  5IWA O;  1FJG O;  2VQE O;  1J5E O;  5LMN O;  4NXM O;  2E5L O;  4LF8 O;  4DV6 O;  2F4V O;  1R1B A;  4DV7 O;  5IT9 N;  1XNQ O;  4B3T O;  2UXD O;  2LW7 A;  2ZM6 O;  3J7A U;  1AB3 A;  4JI7 O;  4DV1 O;  1IBL O;  2FKX A;  4DV0 O;  2UUC O;  4DUY O;  2UXC O;  1HNW O;  4LF4 O;  5H5N A;  1XNR O;  2N74 A;  2UU9 O;  4B3M O;  1N33 O;  4JI5 O;  2VQF O;  3SDL A;  4LFB O;  3J80 N;  4DR4 O;  1D2D A;  4DR1 O;  2DOS A;  1A32 A;  1AIL A;  4A5U B;  3JAM N;  2Z0A A;  1KUQ A;  2UUB O;  4YHH O;  1IBK O;  4DR6 O;  2ZKO A;  4K0K O;  1YZB A;  3O65 A;  3T1Y O;  1XMO O;  4JV5 O;  4JI4 O;  1I94 O;  4DUZ O;  2DJV A;  4X65 O;  5A2Q N;  1XEQ A;  4LFA O;  4JI0 O;  1FYJ A;  1XMQ O;  3J81 N;  4B3S O;  4JI1 O;  2UUA O;  1FKA O;  1N36 O;  4X64 O; 
#chains in the Genus database with same CATH topology
 2KKW A;  2FYU H;  4UCS A;  1BL8 A;  1KB9 F;  1WLE A;  3JSL A;  4DR5 O;  5FLX N;  5BY1 A;  4J42 A;  3BHP A;  3FAV A;  2BTQ A;  4MVZ A;  5LA6 B;  1EZJ A;  1NTZ H;  3ML0 A;  4DR2 B;  1OCZ B;  4CC6 A;  1GRJ A;  3ETE A;  2JK5 C;  2GV9 A;  3W7T A;  4JPR A;  2QA4 V;  3E8B A;  1XNQ B;  2KG7 B;  4J7K A;  4KUM A;  3SPH A;  1FAF A;  1Z5W A;  4G28 B;  1YJ9 V;  2EIL B;  2JGD A;  3B8M A;  1SQP H;  4FLY A;  1YSC A;  3RBZ A;  4ABM A;  4X62 O;  4B3R B;  3GB7 C;  4U7O A;  5DED A;  2XAF A;  4J9Z B;  4LFB B;  4NXM B;  5L3G A;  4LF8 B;  4OPA A;  4DR1 B;  3JCU Z;  1QBZ A;  5KMG A;  4HNA B;  3UT5 A;  3T1Y B;  3UO2 A;  3CCR V;  1VQN V;  2Y69 B;  1GM9 A;  2P06 A;  2WLJ A;  5J2T A;  3CD6 V;  4I0X B;  2RDC A;  1PL4 A;  1HNW O;  2A0L A;  2EZP A;  4TV8 B;  2XOK G;  4JI5 O;  1D2D A;  3FYE B;  1H2S B;  2HHH B;  5EZY B;  4R6Z A;  1AIL A;  4EEQ A;  3WG7 C;  4YJ2 B;  3B77 A;  4CH3 A;  4FLU A;  4MVU A;  1KD1 W;  4X88 A;  1BCC H;  1PD3 A;  3QTC A;  4X65 O;  4FIP C;  2RNB A;  3HB3 B;  2E3C A;  4NKG B;  2EIM C;  2HP8 A;  1SRY A;  3AG2 C;  2PI4 A;  4LF9 B;  3HKC A;  3AG4 C;  4EKW A;  3OTO O;  1N34 O;  3NXS A;  3RYH A;  3APO A;  3S3W A;  2E76 B;  2EJR A;  2Y48 A;  3STL C;  4CS2 A;  4O4J A;  1EZV H;  2YXH A;  4UVC A;  3SJQ C;  1EM1 A;  1JQ0 A;  3IGA C;  4FK5 C;  3H1I H;  4GLX A;  3K9S A;  2HEP A;  5CBG A;  5KA5 A;  3RVZ A;  3G80 A;  1XNR B;  1NBM G;  2Y69 C;  4AQY O;  2EIN C;  1IXB A;  5IDJ A;  2L35 A;  1B3Q A;  1Q7Y W;  3D36 A;  2BSK A;  2ZDI A;  1VF7 A;  3ZIA G;  4BR6 A;  3LSQ A;  1S0V A;  1EN4 A;  1IBL O;  1M90 W;  4X1I B;  1TUB A;  3W7U A;  5H5N A;  4RQE A;  4IIJ A;  4ZIB A;  5BZB A;  4JF3 A;  2VQF O;  4DR4 O;  3RYF A;  4UB8 Z;  5B3S C;  4NR1 A;  3CP1 A;  5CA0 A;  2Q0O C;  1RFY A;  3K59 A;  3DC5 A;  3K9A A;  2CTQ A;  2F66 C;  5A2Q N;  3EVK A;  4LF5 B;  1FYJ A;  1H8H G;  3LSU A;  4D7T A;  1GH6 A;  5FNV B;  5CA1 A;  1QR9 A;  1F51 A;  1OCO C;  2JS5 A;  2YEV A;  4LF6 B;  4TOI A;  1H2K A;  5IJ9 B;  1Z5V A;  1H2G A;  5GTI Z;  3C90 A;  3ZHS A;  4JI2 O;  4PDR A;  5BXZ A;  4YY3 O;  2P67 A;  3CPW U;  2LO1 A;  5IYC O;  4QNH B;  4ZHQ A;  2H94 A;  4GKK O;  1VQK V;  4PA3 A;  4DR7 B;  2XAQ A;  2OCC B;  4X1Y A;  1ZLZ A;  5LL6 Y;  3U10 A;  1UPG A;  1KBH A;  2K9P A;  2LFR A;  2YID A;  4IT5 A;  3ZRS A;  4AHC A;  3UO3 A;  5L3D A;  2BOB C;  1XRE A;  2Y4U A;  2UXB O;  3A2F A;  4J10 A;  1PNL A;  4DR3 O;  3C3S A;  1PKX A;  3N2K A;  3HKD A;  2HKO A;  1FXK C;  5LMN B;  2GUZ B;  4P9O A;  1PNK A;  3ZRV A;  4BAY A;  2A3Q A;  4K35 A;  1PM9 A;  1TVK A;  1ZWI C;  4B3T O;  2LW7 A;  1FD9 A;  4U3J A;  4XDL A;  3OTF A;  3ZN0 A;  1ZSP A;  3LUT B;  4QJF B;  4IL6 Z;  4YHH B;  5IYZ A;  4QE9 A;  3AG1 B;  3SPJ A;  1OCR B;  4DW0 A;  5K1P A;  2XND G;  3GVM A;  3SR2 C;  4CH6 A;  5JQG B;  1K33 A;  1ARO P;  3JD4 A;  4UVB A;  2OCH A;  5B5E Z;  1XEQ A;  3WB0 A;  2IM9 A;  5LYJ B;  4X20 B;  1P84 F;  5JVD A;  3TXQ A;  4BW5 A;  1D5A A;  4MW8 A;  4W4K A;  3L71 H;  1S3J A;  2ZR2 A;  1DF4 A;  1BSM A;  5L3E A;  1GMG A;  1IVS A;  3UKM A;  3QO5 A;  5JJE B;  1SES A;  3T4D A;  1HW7 A;  3QO8 A;  1V55 C;  3FAV B;  4NTX A;  2BTQ B;  5JCO C;  4JI3 O;  5EBW C;  3BAB A;  1BHB A;  1S5H C;  1BZK A;  5LP6 A;  3E8G A;  5B1B B;  4PA4 A;  1IXM A;  4LR3 A;  2V7Q G;  1TAE A;  2C2A A;  1Q6I A;  1WB8 A;  2V1D A;  2DW4 A;  2JGD B;  4ZKI A;  1Y6X A;  1Q3E A;  2YIA A;  4JI6 O;  1K34 A;  3R66 A;  3E22 A;  5LXT A;  4C7U A;  3E8F A;  4FLW A;  1GN4 A;  2D2C B;  2BTO A;  4UCV A;  4J11 A;  3AK2 A;  3IC9 A;  1NTM H;  3H1L H;  5JWP A;  5KMG B;  4HZ3 A;  3UT5 B;  1U96 A;  4HYO A;  1SA0 A;  2H3O A;  3DXR A;  2UUC B;  2UXC B;  1T5E A;  5J2T B;  2ZXW C;  4MW3 A;  3BPZ A;  2DYR C;  3GWK C;  1OJH A;  2UU9 O;  3KCY A;  1B6Q A;  1N33 O;  2LP7 A;  3J80 N;  4MVQ A;  2ILM A;  1A32 A;  2ZE8 A;  3K04 A;  4IGG A;  2DYS C;  4XDJ A;  3ZMZ A;  1IBK O;  3R65 A;  5LHI A;  3W7X A;  2IJJ A;  1XMQ B;  1PP9 H;  4JAU A;  2AZ0 A;  4BIO A;  5LHG A;  1N32 B;  2PF4 E;  3SYC A;  4FMT A;  1Y76 B;  4JTA B;  1PNM A;  2DWE C;  1KQS U;  3G71 V;  3SYQ A;  1N36 O;  2Q69 A;  3CCU V;  2PZS A;  3ABU A;  1K8A W;  3T1C A;  3SJC C;  3OGI B;  1IBM B;  3HKC B;  1KEC A;  3OGC C;  1HNX B;  3RYH B;  1CP9 A;  2QM7 A;  4YJ3 A;  3FB8 C;  2KB1 A;  2GHY A;  4DV3 B;  3RFR A;  5L3B A;  3ICX A;  2NN4 A;  2GSM B;  1SKV A;  3JAW A;  5LGU A;  4KHP O;  4PDL A;  2IJI A;  2B1I A;  4FZ0 A;  3Q4H A;  4GKJ O;  4DO2 A;  4Z1V A;  1OHH G;  2HVJ C;  4LH6 A;  1I5Y A;  4B3M B;  2H8P C;  3CYO A;  3H01 A;  1NZ6 A;  1XL6 A;  5DM6 V;  2RN9 A;  2P4K A;  5KA6 A;  1O9H A;  5C93 A;  1M4U A;  1V9P A;  1XI1 A;  3L9D A;  1F23 A;  4PA7 A;  3JAL A;  2BSK B;  3P3P A;  2ZM6 O;  2JDI G;  4O4I A;  4CH5 A;  3WFV A;  1NR1 A;  4DUY O;  3C3T A;  4MTX A;  3JAR A;  1CPY A;  1TUB B;  4PDM A;  1SZX A;  4ASU G;  4IIJ B;  4DR5 B;  2LFS A;  2EIK C;  3RW0 A;  3CXH F;  2JEU A;  4G27 B;  3RYF B;  4NYK A;  1KU9 A;  4A5U B;  1JJO A;  1YIJ V;  3ZHU A;  3ABL B;  4U3F H;  4WFB V;  3BA8 A;  5CA0 B;  1KP2 A;  2OYQ A;  1PL0 A;  4H33 A;  2ZKO A;  4L87 A;  1N4C A;  4LFA B;  1LUV A;  4JI0 B;  3CC7 V;  3HPL C;  4O2B A;  1I94 O;  1J95 A;  2CTW A;  3OE7 G;  5D5Q A;  3ASO C;  2LGQ A;  2WLK A;  2A7W A;  4KXR A;  1JFF A;  5CA1 B;  1MMM A;  2Y4T A;  3FD9 A;  4PV1 B;  2YEV B;  2ZE5 A;  1AI6 A;  4X62 B;  4LF7 B;  2WLN A;  2A06 H;  4WCE V;  4I7Z B;  4MVM A;  4JYA O;  4FVM A;  2QJ1 A;  2EBO A;  1FXV A;  1I7F A;  4LC1 A;  5E1A C;  4X1K A;  1IZ3 A;  4JAS A;  1SC5 B;  4H13 B;  1R3L C;  1QU7 A;  4X1Y B;  1XOU A;  2ITC C;  2VWJ A;  5B1O A;  4UXN A;  1NT2 B;  3D36 C;  2WSS G;  4CH4 A;  1HNW B;  5LMU O;  5CA3 A;  3S3X A;  1W59 A;  3LSS A;  4JI5 B;  1VEW A;  3N2K B;  1P4R A;  3HKD B;  1JA8 A;  2CUG A;  2AW9 A;  3A8T A;  4DV7 B;  3VBB A;  1FXH A;  2EZO A;  2Q5Z A;  2Q67 A;  3TET A;  1TVK B;  4NB5 A;  3H1K H;  4YIP A;  1VF6 C;  2P5O A;  4X65 B;  4R8C A;  4NTY A;  2LQT A;  4GX0 A;  5KUK A;  2FML A;  4U3J B;  1URF A;  1NJI W;  3EFF K;  3X2Q C;  1N34 B;  5CBF A;  4EFE A;  2VRZ A;  5IYZ B;  3KCX A;  4MT8 A;  1TGO A;  4WFE A;  3K5M A;  4QPK A;  4DUZ O;  3JAK A;  1QCE A;  2OIE A;  1S5L Z;  2FTK A;  3E86 A;  4CS3 A;  4EB6 A;  2IJH A;  3BA9 A;  3ZRW A;  1FS0 G;  1H38 A;  4QE7 A;  4X64 O;  5JVD B;  3VQV A;  4OX9 O;  3IC7 A;  4AQY B;  2HVK C;  4UCT A;  1YJN V;  4FM2 A;  4F6E A;  5KHG A;  2Z5U A;  1ENV A;  3RT3 C;  3K5N A;  2BCC H;  3FB7 C;  2Q4P A;  3M8A A;  4DR2 O;  4JTC B;  1F4N A;  1OCZ C;  1P49 A;  1K4C C;  5LP6 B;  4RO2 A;  1NI8 A;  3TJT A;  3ZN1 A;  4LCU C;  5C8Y A;  3ABK B;  2PI5 A;  2EIL C;  1DK1 A;  2VQF B;  1GN2 A;  4DR4 B;  3QG5 A;  4FLX A;  1QVF U;  5LXT B;  3E22 B;  4B3R O;  2AXT Z;  1Y74 A;  4I55 A;  4NXM O;  2QE7 G;  4LF8 O;  3JSN A;  3ZMT A;  1BMF G;  3I56 V;  1WN7 A;  3ABT A;  1R1B A;  3CME V;  1MAB G;  2IU0 A;  3UQ8 A;  1ZTE A;  4YXW G;  1Q90 D;  1SA0 B;  3DXR B;  4FFB A;  2NR5 A;  2QKS A;  1BS3 A;  3RN4 A;  2CGN A;  1VQL V;  4X8A A;  2WA4 A;  2UUB B;  3L72 H;  3B4S A;  4JI2 B;  5DN6 G;  3THO A;  1XHZ A;  2V4D A;  3K5L A;  4K0K O;  1YZB A;  1GKF A;  3TK1 A;  1DGS A;  4GKK B;  2E75 B;  1BE3 H;  1BHA A;  4Z1M G;  1O9G A;  4FFK A;  3CJH A;  1WA8 A;  1VAR A;  2R9A A;  1Y67 A;  2IH1 C;  4JZG A;  4JI1 O;  2UUA O;  2WPD G;  3OM3 B;  2AHY A;  5GW7 A;  4DR3 B;  1HNZ B;  5LOV A;  4LWS A;  3ZMU A;  1R3I C;  3MHH C;  2Q0A A;  4XDK A;  2Q6A A;  3L75 H;  4NXN B;  4GX2 A;  4GZR B;  1AJN A;  2RQ6 A;  4UB6 Z;  4YIO A;  5LBQ A;  2WLL A;  4YJ3 B;  2ZD9 A;  2FB5 A;  3FKS G;  2P22 C;  3VQY A;  4B3T B;  3ZJZ A;  3JAW B;  1VQ9 V;  5CN0 A;  1WP7 A;  3ASN B;  2CE4 A;  3Q4H B;  2YIC A;  2XAJ A;  1HDJ A;  3OMI B;  5KLV H;  5IWA B;  3ZHQ A;  4W4L A;  3K0D A;  1ZL8 A;  3T4Z A;  2YS8 A;  4DV4 O;  1MSW D;  1J5E O;  1WJZ A;  2F4V B;  1FFX A;  4I9W A;  2DMX A;  2UXD O;  3RVY A;  2IW5 A;  3JAL B;  2QGN A;  2EUL A;  4E4E A;  5FL7 G;  3K03 A;  3IAY A;  4UV8 A;  1L8D A;  2PUS A;  4DW1 A;  4O4I B;  2F23 A;  2F95 B;  3RYI B;  2Q7E A;  4N23 A;  3ETQ A;  2XAH A;  4HBN A;  3K79 A;  1VP7 A;  4D6T H;  4X89 A;  3HR0 A;  3JAR B;  4UCR A;  3CCQ V;  3U11 A;  2HFE C;  2Z0A A;  3CS5 A;  2JJ1 G;  3O65 A;  4JI3 B;  1XMO O;  2CGO A;  1NH2 B;  1IX9 A;  1KKD A;  2N05 A;  4O2B B;  5IY5 B;  3J81 N;  5KX5 A;  2ZIO A;  1QLE B;  5HFM A;  1JFF B;  1N8R W;  3K57 A;  1NKD A;  4PDV A;  2YIB A;  4JI6 B;  4X9Q A;  1Q81 W;  3AK1 A;  5B1A B;  3E2E A;  3KZI Z;  3MD0 A;  1VF5 B;  3ASN C;  3TGU H;  1X4T A;  1VQ8 V;  1SQX H;  1HR0 O;  3OAA G;  3UCS C;  1XBL A;  1Q86 W;  1K5S A;  5EK0 A;  2ARH A;  4PJ0 Z;  4X1K B;  2R70 A;  4DR7 O;  4DV2 B;  4UCU A;  2OCC C;  3SPC A;  4BIU A;  4JI8 O;  3E89 A;  2UU9 B;  3M99 B;  1SF9 A;  1MNG A;  1FJG B;  2VQE B;  1GN6 A;  3G6E V;  1F7Y A;  3JCZ A;  2KQX A;  1EBO A;  1CXZ B;  3B2E E;  2XAS A;  5LMN O;  3OEH G;  2E5L O;  4DV6 O;  2F1M A;  1M9N A;  3CWB H;  1BQ0 A;  4JI7 B;  4UV9 A;  2PYJ A;  4GUN A;  3CX5 F;  3J7A U;  1AB3 A;  4F4L A;  2GDS A;  1F4M A;  3K06 A;  4CC5 A;  5FPR A;  1JX9 A;  2CTR A;  1SQG A;  1VQ5 V;  2CH7 A;  3CRM A;  4FLV A;  1VQP V;  1JPX A;  2AHZ A;  1NH2 D;  1SQV H;  2CK3 G;  3DGE A;  4I5S A;  4YHH O;  4KP4 A;  1MZE A;  3AG1 C;  2HJF C;  4JV5 O;  1S72 V;  1FPO A;  4JI4 O;  1OCR C;  1EN5 A;  3F5W C;  3FB6 C;  3FB5 C;  4FPP A;  1OCC B;  3JAK B;  4WFF A;  4B3S O;  1TA8 A;  2Q7G A;  2A79 B;  4GKJ B;  2OT5 A;  4EB6 B;  5EIB D;  4TSF G;  3RYC A;  4I4T A;  1M56 B;  3G4S V;  3ZRW B;  1PV0 A;  1YVW A;  4DK1 A;  2B9Z A;  2IJK A;  4ZBM A;  3SJB C;  1YDX A;  3VQX A;  1UFI A;  1RM1 B;  1XQ8 A;  2P7T C;  4DV5 B;  4D7S A;  1Q6U A;  3STZ C;  1X59 A;  2WLH A;  3K0G A;  2DQ0 A;  4IYI A;  4LH7 A;  1SS3 A;  5CB4 A;  2ZM6 B;  3JD3 A;  3NR7 A;  1JCH A;  2Q7H A;  3CCV V;  3FYI B;  3O9O A;  4NVP A;  1FXK A;  2P6J A;  3PN1 A;  3OUF A;  5FPO A;  1WAZ A;  2X6C A;  5B1B C;  4DUY B;  1N0N A;  4LFC O;  4X66 O;  1I5X A;  3ZHV A;  3AG7 A;  5C8Y B;  1R6N A;  4U7N A;  3SPI A;  2QSA A;  3FFQ A;  3B09 A;  1Y74 B;  4P30 A;  4I55 B;  4I50 A;  1MOF A;  3CCS V;  4O4J B;  2ZQM A;  1I94 B;  4H0L B;  1AJQ A;  1DF5 A;  3LDD A;  2P90 A;  1R3J C;  1HP8 A;  4MTO A;  4DV1 O;  5H9C A;  3LDE A;  4O4L A;  4DV0 O;  4FFB B;  3ZRX A;  3ZX6 A;  5KHI A;  2UUC O;  2UXC O;  3L74 H;  2N74 A;  3CXC U;  1I08 A;  3N27 A;  2EIJ B;  4XBF A;  2JJ2 G;  1AP5 A;  3JAM N;  4JYA B;  4TQF A;  4DR6 O;  3HKE A;  5GTH Z;  2FL4 A;  1R73 A;  3SYO A;  1XDC A;  1IDS A;  1G6U A;  2IH3 C;  2DJV A;  3AK3 A;  1XMQ O;  5H2F Z;  3ETD A;  3CJH B;  1WA8 B;  3QNE A;  3DSQ A;  5KAI Z;  3EHB B;  5LMU B;  3CMA V;  3SYA A;  2R9I A;  4J80 A;  4PHZ A;  1DTO A;  1QQC A;  3T1H O;  5LOV B;  4LWS B;  1GO3 F;  4Z2W A;  1WNS A;  4J9Y B;  1W0J G;  2OIG A;  4F6R A;  5ITZ A;  3VQW A;  5JJN B;  4CZZ A;  5KHJ A;  3CEI A;  4WFA V;  2K1E A;  1M93 A;  2WLL B;  4DV3 O;  1S5J A;  3CRC A;  1R3K C;  4TQD A;  5BR8 O;  3JD2 A;  2Q9L A;  1ZL8 B;  1AVM A;  4TWK A;  1NU1 H;  2QTS A;  4ZHQ B;  2QTO A;  3BVO A;  1L1F A;  4KFM A;  2ZNI A;  3OFN G;  1H2N A;  3CB2 A;  5H6R A;  1FFX B;  2ZE7 A;  1K4D C;  2ETN A;  4H44 B;  2B5U A;  1U97 A;  3OUS A;  1BGY H;  1Q5O A;  2P4V A;  1LNQ A;  2ZDI C;  2QKC A;  4LF4 O;  4X64 B;  1YJW V;  1K9M W;  1SQB H;  4TT3 G;  4L8J A;  3SDL A;  3WG7 B;  2LGW A;  1P7G A;  1AJP A;  4TV9 A;  3OEE G;  5EYP A;  1KUQ A;  1M57 B;  3MAQ A;  5BMV A;  3JAT A;  3PJS K;  4J7Z A;  4CS4 A;  1MG1 A;  4JYC A;  4EFB A;  4MVO A;  3ABL C;  2Q68 A;  3N2G A;  3JD1 A;  3MDS A;  4LFA O;  2EIM B;  3LNM B;  1Z2G A;  4JI0 O;  2ADQ B;  2YSU B;  3AG2 B;  2X6B A;  3E35 A;  4DRX A;  2D3O W;  3AG4 B;  5KX5 B;  1WPB A;  3OTO B;  3DTU B;  5TIS Z;  1YF2 A;  3B8N A;  4JZ2 A;  3LNN A;  4E2L A;  2GTS A;  2HLD G;  4LF7 O;  1XIL A;  3JYC A;  5IJ0 A;  5E79 Z;  1LUW A;  4J7J A;  2ZE6 A;  4ICG A;  4TUY A;  1M1K W;  3P32 A;  1PPJ H;  2W6I G;  1VIB A;  2JEX A;  2GBO A;  2YXL A;  1MZF A;  1N0J A;  2EIN B;  1LR1 A;  5JJJ B;  1NQT A;  2RJZ A;  1H2M A;  3FX7 A;  1YIT V;  4MTG A;  4JYB A;  1I0H A;  4O2A A;  4GX1 A;  2QM8 A;  2X7R B;  3BCC H;  2BOC C;  5IE9 A;  3CCM V;  2Q73 A;  5EBL C;  1GAX A;  4H37 A;  1SER A;  4K3A A;  2F43 G;  1WP8 A;  1RSO A;  4K0K B;  4KL1 A;  4PA9 A;  3SGI A;  1YXB A;  1Q82 W;  2WLI A;  5IT9 N;  4DV7 O;  2CTP A;  2Y0I A;  1XNQ O;  1IBL B;  1G4Y B;  2YUA A;  2IU3 A;  3JAS A;  1Q43 A;  4Q20 A;  1M57 C;  3L70 H;  4MTF A;  2KSD A;  1Q8I A;  2ZR3 A;  2FKX A;  4JI1 B;  1Y76 A;  2UUA B;  4IYH A;  5GON A;  4JGS A;  1GTO A;  5H6Q A;  1RPR A;  5B3S B;  4LFB O;  2CH7 B;  5LGT A;  2O57 A;  3P30 A;  4FM1 A;  4RUF A;  4DR1 O;  2HJD A;  1AR5 A;  1HWY A;  2BE3 A;  3M7M X;  3U0Z A;  4QGP A;  3T1Y O;  4K8Z A;  4B7E A;  2R9R B;  1OCO B;  4LBE C;  3BY6 A;  4ZOL A;  1H2L A;  2YI9 A;  3K5O A;  1VQ7 V;  2YIB D;  2IBZ H;  2NLJ C;  3TCU A;  1FKA O;  4WFG A;  3RYC B;  4I4T B;  2AZ2 A;  1JR9 A;  1GK9 A;  2DE0 X;  4YY3 B;  1G1X B;  3H9V A;  4UUJ C;  2JRI A;  4RUE A;  1B04 A;  2QWN B;  4O4H A;  2NNU A;  4UVA A;  4DV4 B;  5AG2 A;  2HHH O;  4UCO A;  5J2U A;  3CSX A;  3ZHR A;  1J5E B;  5LHH A;  3APQ A;  5B66 Z;  2UXD B;  5IYD O;  2UXB B;  1ZUQ A;  2RMK B;  2YXY A;  5CB4 B;  5EBM C;  2XHB A;  1Y4M A;  3B40 A;  1FXK B;  3QVN A;  2ADP A;  5LP6 C;  3SPG A;  2W6J G;  2AGA A;  3CRQ A;  4LF9 O;  2DWD C;  3G6B A;  1NS1 A;  4WBN A;  3ABK C;  3QF7 A;  4LNU A;  1VF6 A;  2N04 A;  2XUM A;  1XMO B;  4RAI A;  5D5P A;  4I50 B;  4ZI7 A;  2ODM A;  2X0L A;  5JH7 A;  2LJ2 A;  2PTM A;  1QVG U;  1WPX A;  1VQM V;  2G38 A;  2UXX A;  3A0R A;  2GTA A;  4O4L B;  1XNR O;  5CMU A;  2WA3 A;  4JAV A;  1XUQ A;  4MS2 A;  1JMK C;  1MSD A;  2DOS A;  2OTL V;  3WB2 A;  2W0F C;  2UUB O;  4P2Z A;  1NVP B;  4N21 A;  3A0H Z;  1HR0 B;  3HKE B;  3HKB A;  2Y0P A;  3ZBH A;  3CHX A;  4WF9 V;  4IHJ A;  3W7W A;  1M5I A;  3D3Q A;  3QO7 A;  1D5N A;  1YI2 V;  2B1G A;  4BWA A;  1K92 A;  1DLB A;  4JI8 B;  4FLZ A;  1AI5 A;  3BRC A;  1ORQ C;  1TUE B;  1V55 B;  1GM8 A;  3P3N A;  3RGB A;  5LA6 A;  3TXS A;  1HNZ O;  4DYL A;  1K73 W;  1CEZ A;  2E5L B;  4OGQ B;  3F7V C;  4RWU A;  2JVD A;  4DV6 B;  1OZ0 A;  4P9P A;  4F6R B;  3K08 A;  5ITZ B;  1KP3 A;  2QKA A;  2KG7 A;  4NXN O;  4J41 A;  1R6K A;  3W7S A;  1ZX3 A;  3CCE V;  3SYP A;  3ZCC A;  4LF5 O;  4PEL A;  3OMN B;  1EFR G;  1AI4 A;  4LF6 O;  5L3F A;  2QDO A;  3D3I A;  3IFX A;  5F2V O;  2OTJ V;  2Q8V A;  3F7Y C;  4JYY A;  1KYO F;  5EC1 C;  2R72 A;  2W0X A;  1BQZ A;  5IWA O;  5KUM A;  4HNA A;  3CCL V;  3BEH A;  4JV5 B;  1XL4 A;  4JI4 B;  1IUR A;  1ZAU A;  2F4V O;  2ZXW B;  2DYR B;  3AEI A;  2EX3 A;  4I0X A;  3KG2 A;  2DN9 A;  4B3S B;  2YDE A;  2DQ3 A;  1N33 B;  3CRA A;  2ZIM A;  1US6 A;  4TV8 A;  3ZED A;  3KKY A;  1NVP D;  2DYS B;  1V54 B;  1GM7 A;  1K3E A;  5EZY A;  1IBK B;  1YTF B;  4AIL C;  4GYC B;  3SJA C;  4TV9 B;  3IJ4 A;  4YJ2 A;  3ZMS A;  5EYP B;  5BMV B;  3JAT B;  2QEX V;  3CE2 A;  3RWR D;  3BAA A;  1Y66 A;  4LP8 A;  1L0L H;  1QR8 A;  3H1J H;  2XTA A;  3N2G B;  3CC4 V;  1N36 B;  2UXN A;  3JD0 A;  2M6Y A;  2HG5 C;  4PI0 A;  4BIZ A;  5IY5 C;  4LFC B;  4DRX B;  1SQF A;  1JVM A;  1R6T A;  4GT1 A;  4X66 B;  4GX5 A;  3WB1 A;  1QLE C;  5HFL A;  1B06 A;  5KHK A;  3F5T A;  5B1A C;  2ZCE A;  1E79 G;  4KHP B;  2VS0 A;  3DC6 A;  3AG3 B;  5EIB C;  4DK0 A;  5IJ0 B;  4GCZ A;  3K3W A;  4Q6G A;  2JIZ G;  3H1H H;  4TUY B;  2ITD C;  4HAM A;  1JJ2 U;  1Q6H A;  3UM7 A;  2X6A A;  1GN3 A;  4DV1 B;  2A9H A;  3ZHT A;  4DV0 B;  1KKC A;  3OD4 A;  3OT7 A;  5A9G A;  4DV2 O;  2JS3 A;  1WB7 A;  4O2A B;  1FJG O;  3OR7 C;  2VQE O;  3EXA A;  3CCJ V;  4AI8 A;  5LGN A;  4PI2 A;  3I5D A;  3ABM B;  4DR6 B;  2CAZ C;  1EN6 A;  1RSO B;  1V54 C;  2XT9 A;  2HR3 A;  1VQ4 V;  3MHS C;  1AR1 B;  4B08 A;  3D8C A;  2WLI B;  2OWO A;  3G67 A;  4FM0 A;  2LW1 A;  1SZT A;  2MK3 A;  4X1I A;  2QWO B;  4JI7 O;  5L3C A;  1YTF D;  3JAS B;  1JOY A;  5KAF Z;  2EIK B;  1QLN A;  1E1R G;  5GON B;  2M7W A;  4MVR A;  4I9Q A;  1W2B U;  3T1H B;  1YCI A;  5IYB O;  1AI7 A;  3I55 V;  2XAG A;  1W0K G;  4G2K A;  2ZIN A;  4DXW A;  1YHQ V;  2PY5 A;  4RQF A;  1AP6 A;  3ETG A;  2WAM A;  4CBC A;  1QNM A;  1AR4 A;  3ASO B;  2ATK C;  1FFT B;  4FZ1 A;  5FNV A;  4QIW F;  2PYL A;  4R7C A;  3GWO A;  2F93 B;  4ZOL B;  5IJ9 A;  2QWP B;  2YC0 A;  3AG3 C;  1QHT A;  1OCC C;  2WLM A;  4R50 A;  4OXS A;  3ZMV A;  2CDY A;  1P7B A;  1SQQ H;  1NTK H;  5BR8 B;  1K7D A;  1M56 C;  2WWW A;  3OW2 U;  1OV9 A;  1MA1 A;  5J9P C;  1VQO V;  1ROP A;  4O4H B;  1NR7 A;  2JGU A;  5J2U B;  4QPJ A;  2YI8 A;  1XHX A;  2QWQ B;  1RM1 C;  2QM4 A;  4DV5 O;  1E1Q G;  3T2M A;  1N32 O;  5K1X A;  2VWK A;  3K58 A;  4UFZ A;  1SET A;  2QWR B;  5EC2 C;  3ABM C;  4MVS A;  5JCO A;  1S77 D;  4LF4 B;  3RYI A;  4B7K A;  4FLT A;  3VOU A;  2GUZ A;  3L73 H;  3OR6 C;  4OPH A;  1IBM O;  1S76 D;  1THZ A;  3A0B Z;  1YEW A;  3ZS8 C;  1HNX O;  1KC8 W;  1VQ6 V;  4WBN B;  4JAA A;  4LNU B;  3E83 A;  1COW G;  1G8M A;  4ZI7 B;  1K97 A;  5DEC A;  4PA6 A;  5JH7 B;  2E74 B;  3X2Q B;  1KMI Z;  2QR4 A;  4WFH A;  4BW9 A;  1RPO A;  1H8E G;  3E8H A;  4B3M O;  1K5Q A;  2ZT9 B;  4JTD B;  2ZNJ A;  1VMG A;  2L6L A;  5JQG A;  2EIJ C;  5B1N A;  4PD4 F;  4DUZ B;  5KHH A;  5CBH A;  3BFR A;  2MW2 B;  3WU2 Z;  4NTW A;  4MSW C;  1RP3 B;  1L0N H;  3OMA B;  5LYJ A;  1BT8 A;  3HKB B;  4X20 A;  2PGG A;  3CC2 V;  4FJC C;  2EJ7 A;  1UJW B;  3LDC A;  4IHJ B;  4OX9 B;  4K8X A;  2Z3Y A;  2RCV A;  3CRR A; 
#chains in the Genus database with same CATH homology
 1R6T A;  4OX9 O;  1G1X B;  4DR5 O;  5FLX N;  2JRI A;  3OTO O;  1N34 O;  3T1H O;  2HHH O;  5BY1 A;  4JI2 O;  1HNZ O;  4LF7 O;  4JYA O;  5BXZ A;  4YY3 O;  3F5T A;  3RT3 C;  4JI3 O;  1HR0 O;  4DV5 O;  1X59 A;  4GKK O;  4NXN O;  3M8A A;  4DR2 O;  4KHP O;  5LL6 Y;  1N32 O;  4LF5 O;  4DV3 O;  4GKJ O;  4DR7 O;  4LF6 O;  2UXB O;  4JI8 O;  4LFC O;  5LMU O;  4DV2 O;  4X66 O;  4X62 O;  4DR3 O;  4JI6 O;  2AGA A;  4LF9 O;  4AQY O;  5BR8 O;  1DK1 A;  3R66 A;  4OPH A;  1F7Y A;  1IBM O;  1NS1 A;  4OPA A;  4DV4 O;  4B3R O;  1HNX O;  5IWA O;  1FJG O;  2VQE O;  1J5E O;  5LMN O;  4NXM O;  2E5L O;  4LF8 O;  4DV6 O;  2F4V O;  1R1B A;  4DV7 O;  5IT9 N;  1XNQ O;  4B3T O;  2UXD O;  2LW7 A;  2ZM6 O;  3J7A U;  1AB3 A;  4JI7 O;  4DV1 O;  1IBL O;  2FKX A;  4DV0 O;  2UUC O;  4DUY O;  2UXC O;  1HNW O;  4LF4 O;  5H5N A;  1XNR O;  2N74 A;  2UU9 O;  4B3M O;  1N33 O;  4JI5 O;  2VQF O;  3SDL A;  4LFB O;  3J80 N;  4DR4 O;  1D2D A;  4DR1 O;  2DOS A;  1A32 A;  1AIL A;  4A5U B;  3JAM N;  2Z0A A;  1KUQ A;  2UUB O;  4YHH O;  1IBK O;  4DR6 O;  2ZKO A;  4K0K O;  1YZB A;  3O65 A;  3T1Y O;  1XMO O;  4JV5 O;  4JI4 O;  1I94 O;  4DUZ O;  2DJV A;  4X65 O;  5A2Q N;  1XEQ A;  4LFA O;  4JI0 O;  1FYJ A;  1XMQ O;  3J81 N;  4B3S O;  4JI1 O;  2UUA O;  1FKA O;  1N36 O;  4X64 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...