2Z0AA

Crystal structure of rna-binding domain of ns1 from influenza a virus a/crow/kyoto/t1/2004(h5n1)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
72
structure length
72
Chain Sequence
MDPNTVSSFQVDCFLWHVRKRLADQELGDAPFLDRLRRDQKSLRGRGNTLGLDIETATRAGKQIVERILEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title Crystal structure of RNA-binding domain of NS1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1)
rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 30
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2z0aA00
2UUCO 4DR6O 5IT9N 3J7AU 4LFAO 1FJGO 4DV2O 1N33O 2JRIA 2VQEO 5LMNO 3T1HO 1G1XB 1HNWO 2UUBO 3F5TA 2VQFO 1HNXO 4OPAA 1XNRO 4JI0O 2FKXA 1AILA 2DJVA 2N74A 1IBKO 4B3TO 4JI5O 2UXDO 4NXNO 4K0KO 1YZBA 4X65O 4DUZO 4GKKO 4DR5O 4LF7O 1XMOO 3RT3C 1A32A 5BR8O 4OPHA 1HNZO 4JI3O 5FLXN 4JI6O 3J81N 1J5EO 4DR4O 5BXZA 4B3SO 4DR7O 4DV3O 1XMQO 4DV7O 4X66O 4DR3O 4DV0O 4DV5O 1FYJA 4GKJO 1N34O 1I94O 4B3MO 3OTOO 4LF5O 1IBMO 4YY3O 4DUYO 1N36O 2HHHO 4JI4O 2ZM6O 4YHHO 2Z0AA 2UXCO 5LL6Y 1F7YA 1KUQA 1FKAO 3O65A 1N32O 2LW7A 4LF6O 3SDLA 4OX9O 4DR2O 4LF4O 2AGAA 4JI2O 3R66A 2UXBO 2UUAO 1NS1A 2E5LO 1AB3A 2ZKOA 4JYAO 1XNQO 1D2DA 1XEQA 5A2QN 5H5NA 2UU9O 4X62O 3T1YO 4B3RO 4X64O 1IBLO 4JV5O 1X59A 4NXMO 4LF8O 4LFCO 4DR1O 5IWAO 3JAMN 4JI1O 3M8AA 4LF9O 2F4VO 4A5UB 3J80N 4JI7O 5LMUO 1HR0O 1R1BA 4DV4O 4LFBO 5BY1A 4JI8O 4KHPO 4DV6O 2DOSA 1DK1A 4AQYO 4DV1O 1R6TA
chains in the Genus database with same CATH superfamily
5IYDO 3W7UA 1YHQV 1YJNV 1IZ3A 2ZE7A 2YDEA 4DR2B 2N04A 3ZRWA 1HNXO 3ZJZA 2LP7A 1I5YA 2ZIMA 2HP8A 1XNQB 3ASOC 3LSSA 3ABUA 4FFKA 2UU9B 1GKFA 5GW7A 4DR5O 3QF7A 4LFCB 2W0XA 2Y0IA 3GWOA 1IXBA 4CZZA 2GV9A 2EIMB 4JI1B 1GK9A 2YXLA 3SYOA 1S5LZ 1FFTB 4FZ0A 1XMQO 4CH3A 2LW1A 1FXKB 1XOUA 2XT9A 3FX7A 5J2TB 4B3MO 1VARA 2YIBD 5C8YA 5KA6A 1NZ6A 4BIOA 1L8DA 1VQNV 1YCIA 3IFXA 5KA5A 3KKYA 2WWWA 3HKCA 2EINC 4NTXA 4O4LA 4TV8B 1AI4A 1Q81W 2ADQB 4LCUC 3R66A 4IGGA 3BVOA 4B7EA 2GTAA 3CRAA 4FLYA 1HNZB 4JI3B 5TISZ 2XAJA 4QNHB 4BIZA 2WLNA 4DV7B 3K08A 5HFMA 4GKJB 4P9OA 1RFYA 1LUWA 1ZL8B 2F4VO 2BOCC 3JAKB 1IBMB 1TUEB 2ZR2A 1RM1B 1HR0O 1K5QA 1LNQA 4PDMA 3E89A 3W7XA 4JYCA 1YXBA 3H1KH 4DV1O 4J80A 5H6RA 4IYHA 4PDLA 2K1EA 4CS3A 1CPYA 1N33O 2M6YA 1OCRB 2ZD9A 1G1XB 1HNWO 2ETNA 2KKWA 3E83A 4TOIA 2R9RB 2WLLA 3AG1B 1SF9A 2X6AA 1ZAUA 3H1LH 1NH2D 2HVJC 3K0DA 4PA7A 1NTZH 1VF7A 2PUSA 4WCEV 2BOBC 2F23A 1OCOC 3AG4C 4O2BA 3AG3B 1HW7A 4CH5A 2IJIA 3MHHC 4O4HB 5H6QA 2EIJC 1P49A 2LO1A 2Y4UA 2Q9LA 5CA0A 1K5SA 2XOKG 4QE7A 2DYSC 2KG7B 1AI6A 4NXNB 1B04A 4O4JA 4AQYB 4FFBB 4DUYO 4WF9V 4FLVA 4IT5A 3Q4HB 2IJHA 2VQEB 1VQ8V 1GH6A 4J7JA 3K59A 3JATA 2B1IA 2RMKB 3UO2A 4B7KA 2AHYA 1Q43A 5B1BC 3E22B 4JYBA 2OCCC 1I5XA 3QTCA 1K73W 1V54B 3B8MA 1E79G 1TUBB 2L6LA 3JALA 3CB2A 4LF8O 1XQ8A 2JDIG 1COWG 3ETQA 4FZ1A 1H38A 3I55V 2X6CA 1VQPV 5KX5B 1YITV 4F6EA 4ZI7A 2CDYA 2E76B 4WFFA 3H1HH 1DK1A 3U10A 3JD4A 1WN7A 1WNSA 4L8JA 4MTOA 1DF4A 5CBFA 3LNNA 3P30A 1Q5OA 4LFAO 2EIKC 4FVMA 4XBFA 3SPCA 2PYJA 1M5IA 3F5TA 3HKBA 4U3JB 3VQXA 1H8EG 3AG2B 3H1JH 3N2KB 1ZTEA 3BPZA 4K8XA 4MTGA 1DGSA 1KECA 2F95B 1XI1A 3CCRV 3ZMZA 4BW5A 4NXNO 2B9ZA 2GBOA 4JV5B 3N2GB 4FK5C 3SPGA 4MTXA 3CWBH 2FL4A 1N0JA 1TVKA 4LH7A 2ATKC 2QTOA 1H2KA 1SQQH 4X66O 1JQ0A 3L75H 2DQ3A 4PDRA 5KHHA 4DV6B 2PYLA 1I08A 1PPJH 2RDCA 3OEHG 2WLKA 4R7CA 4PI0A 3CCLV 4JI4O 5CA1A 3D8CA 1AJPA 1WAZA 2WLHA 5LMNB 4DV3B 2UXNA 5EBLC 3T1HB 1L1FA 4QPJA 1HP8A 2PF4E 1RSOB 4YY3B 3M99B 4X65B 2RNBA 2E3CA 3O9OA 4KFMA 3UKMA 2GTSA 1NTMH 4JAAA 5D5QA 1ORQC 5LGTA 4DR4B 2GUZA 2YIDA 2A79B 4GYCB 2QSAA 3A0BZ 4FLWA 4W4LA 3ZN1A 4FLZA 4ZOLB 3J80N 4JI7O 2YS8A 1WB8A 2Q5ZA 2WA3A 1QNMA 5IJ9A 1K8AW 3K58A 3RGBA 3JCUZ 3IGAC 5DEDA 2H8PC 5JQGB 3A0RA 5BMVB 1L0LH 3ZHSA 1FAFA 4OGQB 4UVAA 1AROP 1KQSU 4XDKA 1QVFU 3ABTA 3ZEDA 1S77D 4I7ZB 2UXDO 3ZBHA 3KG2A 4DUZO 1R3LC 4AI8A 3T1YB 1IBLB 1DTOA 1WLEA 2IW5A 2A0LA 3K5LA 1QCEA 5H2FZ 4LF9B 2YEVA 1YVWA 4DV3O 3WG7B 5EZYA 4UXNA 3OTFA 1N34O 1PV0A 3FAVA 1EZVH 4U7OA 1JMKC 3RYFA 1MSDA 5IYZA 5IJ0A 4YY3O 1Z5WA 1PP9H 3JCZA 5B3SB 2EZPA 4MVOA 1YI2V 3E2EA 3BHPA 3O65A 2VS0A 1YJWV 1V55C 2VQFB 1Q90D 4X1IB 3RYCB 3RBZA 4DO2A 5CB4B 2Q67A 3CC2V 5LBQA 3ZHRA 4CH6A 1JFFB 2WLIA 4E4EA 2UXBO 4MW3A 2LQTA 1R3IC 2ZKOA 2RQ6A 4Q20A 5BR8B 3TCUA 5A2QN 1FXVA 1AJQA 1K9MW 5KUKA 2P4KA 3QVNA 3G67A 1DF5A 2CH7B 5DM6V 2O57A 3VQWA 3JSNA 2R9AA 4P9PA 1P7GA 3L72H 4FLTA 2R70A 1YSCA 5LA6B 2QGNA 2JGDB 1SQVH 2L35A 4X64B 2Q7EA 1N0NA 3G80A 5BZBA 4CS4A 1SA0B 1GAXA 4OX9B 2IJKA 4ASUG 1JJOA 3HR0A 1FXKA 3JARB 4WBNB 4WFEA 5J2TA 4YIOA 2QDOA 4AHCA 2HG5C 3E8FA 4TUYB 3BCCH 4I0XA 3FD9A 1IBKO 1MZFA 4B3TO 2UXXA 3CRRA 3SPIA 2P6JA 2XHBA 3GB7C 2RJZA 2YSUB 5B1NA 4CS2A 5JJEB 3RT3C 3JASB 4MVUA 4HBNA 1MA1A 4OPHA 4UCSA 1Q6UA 1UJWB 1EZJA 3IC9A 3L74H 5LMUB 3H9VA 4HZ3A 3K3WA 4F6RA 5DN6G 4JPRA 4UV9A 2Z5UA 4HAMA 2QWQB 2YICA 4R6ZA 4NR1A 2DQ0A 1QQCA 3I5DA 3ZN0A 4OXSA 1LR1A 1HNXB 1KD1W 4HYOA 4O2AB 1ZL8A 3JAKA 5C93A 2CK3G 2QJ1A 4J41A 2FYUH 4IHJB 1OCZC 3K06A 3DSQA 1YDXA 4DR5B 1MMMA 2Q0OC 2F93B 5JCOC 3DXRA 4X62O 4W4KA 4X64O 2ODMA 1QHTA 2IU0A 3S3WA 1XMQB 2XAQA 1XUQA 5IY5B 1IVSA 3BRCA 2DE0X 3D3QA 4B3MB 1H8HG 5D5PA 2CTQA 4DV4O 4LFBO 4X1KB 3MAQA 1R6TA 1EM1A 2DYRB 3SJQC 2A3QA 4DR6O 5IWAB 3QO5A 4O4HA 3GWKC 2AXTZ 4I4TB 1BT8A 5B1AB 1FPOA 3FB6C 3C3TA 2UUBO 1Y74B 2KG7A 4RWUA 3SR2C 5LGUA 1GTOA 4FFBA 5A9GA 2CGNA 4JZGA 3E8HA 4K0KO 4I55B 4PJ0Z 4TQDA 4O4IB 2ZCEA 3THOA 3ETDA 2Y0PA 4EFBA 2F4VB 2QWRB 3B77A 5B5EZ 1M4UA 1HR0B 3UT5B 5ITZB 3OTOO 2ZE6A 2ZR3A 3FB7C 1ZX3A 3AG1C 1GN6A 3DC6A 4LF7B 2OYQA 2QA4V 3E22A 4DV1B 4JAVA 3MD0A 2HHHO 1KU9A 1GM7A 1OCCB 3AK2A 1TUBA 1NR1A 3WB2A 1N33B 4EEQA 5LL6Y 1HNWB 1Q6HA 2V7QG 4R50A 5L3GA 2LW7A 4LP8A 4X88A 4BIUA 5KX5A 2AGAA 2EILC 2E5LO 4JASA 1BSMA 3D36A 2EZOA 1NTKH 1MG1A 1EN6A 5J9PC 3A2FA 4G2KA 3BFRA 1EN5A 1S5HC 2X7RB 1AVMA 3RN4A 5IWAO 4U3JA 3HKDB 3HKEB 3N2KA 5LYJB 4DUYB 1R1BA 2ZDIA 2ZXWC 4QJFB 3N2GA 1W59A 1G6UA 4NKGB 3LDDA 2PY5A 5IT9N 3B40A 2JK5C 3BY6A 3K79A 3OMAB 4DK0A 2GHYA 3T4DA 2HVKC 3W7SA 1G8MA 3BA9A 1NVPB 3SYQA 3P3PA 4ZHQB 1JJ2U 1AILA 1KP3A 2ZE8A 4D7TA 3ZIAG 1NT2B 4XDJA 2HLDG 3ZCCA 2CTRA 4LF7O 5J2UB 4LF8B 4J9ZB 5EIBD 3D36C 4J7KA 3J81N 1Y6XA 1RSOA 1U97A 3ICXA 5EBMC 4FMTA 3CPWU 2V4DA 1KC8W 5IYBO 4LF5O 1AR4A 2BTQB 1QVGU 1NI8A 3WFVA 1VQOV 4LFAB 1BE3H 1J95A 2WPDG 3P3NA 3CD6V 1LUVA 1NR7A 3CC7V 1XHZA 1BS3A 2QKAA 3APOA 4LF6O 1R6KA 4B08A 4DW1A 3PJSK 3K5MA 2GSMB 4ZOLA 3OR7C 5L3BA 1O9GA 3CYOA 1YF2A 4RQFA 4UB6Z 1D2DA 3UM7A 2WA4A 1QU7A 1M93A 4LBEC 5JQGA 4JTCB 1Q8IA 1VQ5V 1QLNA 5BMVA 4X66B 2Q73A 2CTWA 3NXSA 4GLXA 2LGWA 3OUSA 4A5UB 2JGUA 4I50A 4H44B 3GVMA 4TQFA 2BSKB 3CJHB 1GRJA 1QLEC 5K1XA 4KHPO 4JI4B 1R3KC 2JS5A 1F4NA 5L3DA 2EINB 3AK3A 2IH1C 4P30A 1CXZB 4QGPA 1RPRA 1R6NA 5B66Z 2BCCH 4OPAA 1QR8A 4I5SA 4XDLA 3JSLA 4NVPA 5GONA 4TWKA 3CCJV 4UCTA 5CMUA 2QWOB 4GX5A 2VRZA 1VMGA 1TAEA 4X1IA 3RYCA 3W7TA 4TV9B 5CB4A 4UCVA 3RFRA 1YJ9V 4DR7O 4JI7B 1Y76B 1Y66A 1JFFA 3SPHA 5KHJA 5KAIZ 3UCSC 5E1AC 3JD0A 1SC5B 2XAGA 4PA9A 2QKCA 4WFHA 1TGOA 1Y4MA 1F7YA 3OGIB 2P90A 2N05A 2CH7A 2GDSA 1K7DA 4JTDB 1EBOA 1JOYA 2XAHA 3ZMSA 5LA6A 3G4SV 4YJ3B 2UXDB 1P4RA 2MW2B 3AG4B 2UUAO 4DUZB 2JGDA 4JYAO 2XNDG 1SRYA 5IE9A 3C90A 1SA0A 1M56C 4MVZA 3SJBC 5K1PA 4NXMO 2DYSB 3JARA 4WBNA 1N34B 1X4TA 3CRMA 2IJJA 4GX0A 2YUAA 4X9QA 1FXHA 3B4SA 2YI8A 4TUYA 3CS5A 1WP8A 1WPXA 2A7WA 5EYPB 3ABLB 3FB5C 2A06H 3SJAC 4YJ2A 2CAZC 3JASA 1B6QA 1PL0A 3TGUH 2UUCO 4PD4F 3ZHUA 2IBZH 1M1KW 1D5NA 1AR1B 4MS2A 4K8ZA 2W6JG 2UXBB 2WLLB 4JF3A 3LNMB 5B1BB 3KZIZ 2ZNIA 5KMGB 4I9WA 2HEPA 1YZBA 3A8TA 4FPPA 1G4YB 2OIGA 1P84F 4O2BB 1VQLV 3TXQA 2ARHA 4YIPA 1BQ0A 2OTLV 4O2AA 1XNRB 5AG2A 4IHJA 3KCYA 1OHHG 5CA0B 4BAYA 2JEXA 1I94O 1Y67A 3L71H 1KP2A 1K4DC 4X89A 3DTUB 1BHAA 3R65A 2EIKB 2NLJC 3RYIB 4NTWA 4Q6GA 1XL6A 5LHHA 1VP7A 4WFAV 5CA3A 3SDLA 2Q8VA 1OV9A 5LXTA 2LJ2A 1PL4A 1IBKB 4B3TB 5FNVB 4J10A 1AB3A 1N8RW 3EVKA 1AR5A 4X1KA 4WFBV 3ASNB 2UXCB 3E35A 2YIAA 1K4CC 3BABA 3EHBB 3OE7G 2JJ2G 2QM8A 4I4TA 3OGCC 3JALB 4LF4B 4DRXB 1XL4A 3ZRSA 4DR1O 3E8GA 1Y74A 3STLC 4UVCA 1EFRG 1M57B 1GMGA 4X1YB 3HPLC 4CC6A 4I9QA 2WLJA 4I55A 5BY1A 1Z5VA 2XTAA 4O4IA 1Q7YW 4FM0A 2R9IA 2QEXV 1PNLA 1FJGO 5HFLA 5JWPA 2JRIA 3A0HZ 4GUNA 3UT5A 5ITZA 4EFEA 1KBHA 3SYCA 1XNRO 5FPOA 3CRCA 3STZC 4X62B 4J42A 3IJ4A 1WJZA 4D7SA 4UCOA 4RUEA 1JR9A 4G28B 4PDVA 3ETGA 4QIWF 4DV0O 4LNUB 3EXAA 3RWRD 2DN9A 2E74B 4JI5B 4DV4B 4LFBB 3ABMC 4RO2A 4GKKB 3CC4V 5CBGA 2OWOA 2X0LA 1XMOB 1GM8A 4DR6B 1N36O 1NJIW 2UXCO 2UUBB 4DR3B 1N32O 3HKDA 3ETEA 4KP4A 1GM9A 3HKEA 1IXMA 4TV8A 5LYJA 4LF4O 5LGNA 3L70H 4JI2O 1UPGA 4K0KB 3IC7A 2ZM6B 3VQVA 2YI9A 1BCCH 1AJNA 3DGEA 1WA8B 2AZ0A 1P7BA 3VBBA 1XREA 2Q7GA 2Y69B 2V1DA 1T5EA 5KAFZ 3CE2A 2PTMA 3ABKB 2EIMC 2WSSG 4H33A 3OTOB 4GZRB 4E2LA 4ZHQA 4MVSA 1V9PA 2HHHB 2PI4A 1FXKC 3F7YC 4JI8O 1UFIA 3T2MA 1SQXH 3LDCA 2D3OW 5J2UA 1SQGA 5IJ9B 5GTHZ 3OMNB 1CEZA 2HJDA 4FLUA 3OW2U 5KHKA 3K04A 3UQ8A 3H1IH 3JAWB 2E5LB 1MZEA 2VWJA 2P7TC 1MSWD 2BTQA 2DJVA 2P5OA 2HR3A 4JI5O 1S72V 3BAAA 5GTIZ 4GKKO 4K35A 1ROPA 3SYPA 3ZX6A 1XMOO 1KMIZ 3RW0A 5L3EA 1H2LA 1J5EO 3G6EV 1O9HA 5BXZA 4B3SO 5LP6B 5EZYB 4WFGA 4DR3O 2MK3A 3MHSC 4HNAB 3K5OA 3MDSA 3SPJA 1AP6A 3CHXA 5IYZB 2F43G 4UVBA 2ZQMA 1SESA 1RM1C 3FB8C 2IU3A 3Q4HA 2ZM6O 2CGOA 4QPKA 2XAFA 1VQ6V 4UB8Z 3ZRVA 5JH7B 3SGIA 4MVMA 3VOUA 3CCQV 3JD3A 2BSKA 1FD9A 3RYHB 1AP5A 1OCRC 5EC1C 3H01A 2VWKA 1BQZA 1OZ0A 1BMFG 3OEEG 2CE4A 4X8AA 1S76D 3AG7A 2X6BA 1K33A 3CCSV 4B3RO 1X59A 2FB5A 2W0FC 3X2QB 2JEUA 4MW8A 3AG3C 4GCZA 3FFQA 5JVDB 3M8AA 4LF5B 2A9HA 1QBZA 1L0NH 1GN2A 2DOSA 1I0HA 3ZMVA 1QR9A 4ABMA 3J7AU 4DV2O 4LF6B 4ICGA 4TV9A 1OCZB 1Y76A 3K03A 4X20B 3BA8A 4RUFA 2QKSA 2BTOA 2DMXA 1CP9A 1F51A 1SZXA 4I0XB 3FYEB 1N4CA 2Q7HA 5L3CA 1A32A 4EKWA 4LH6A 1YTFB 4KL1A 5FLXN 3ZS8C 2Y48A 3QO7A 2NN4A 1V54C 4N23A 4IIJB 2EULA 3HB3B 4LWSB 4YJ3A 1FYJA 2QWNB 1VQMV 4F6RB 1FS0G 4DYLA 4KHPB 4H0LB 1TA8A 4JGSA 4MT8A 1S3JA 4CH4A 1S0VA 2QTSA 4D6TH 4JI6B 2YIBA 3B2EE 2P4VA 1KUQA 4EB6B 1URFA 3ZMTA 4DR2O 4MSWC 4FIPC 1VQ7V 3K57A 1FFXB 3TXSA 1HWYA 5EYPA 2HFEC 1H2NA 1XNQO 2CTPA 2PGGA 3AG2C 1U96A 2LFRA 1PKXA 2JIZG 1NKDA 2UU9O 3DXRB 1VQ4V 1IDSA 3C3SA 4DR7B 2ZDIC 1H2GA 4LFCO 3JAMN 4JI1O 1KYOF 4L87A 3ASOB 1B06A 2G38A 5F2VO 1GO3F 5KMGA 3LSQA 4JYYA 4UFZA 4YXWG 2Q68A 3CCEV 3AEIA 5FPRA 2JVDA 1SQFA 4U3FH 4CBCA 2ZE5A 1KKCA 3ZHVA 3L73H 3QNEA 3CMEV 2C2AA 2EILB 4NB5A 3N27A 3SYAA 1ZWIC 3P32A 2UUAB 5LOVB 5KUMA 1VQKV 4JYAB 2Q69A 2RCVA 4GX2A 4FLXA 1SERA 3UO3A 3RYIA 1JCHA 4J7ZA 4NXMB 3ABLC 3DC5A 2WAMA 1HNZO 4JI3O 4JI6O 4MVRA 4JI0B 3CRQA 4DV7O 2FTKA 3K9AA 3ZRWB 3QO8A 5FNVA 4GKJO 4BW9A 2ZXWB 5KLVH 2YXYA 3PN1A 4DW0A 3APQA 1IBMO 1MABG 2LGQA 2UUCB 5EIBC 3JD2A 3K0GA 4KXRA 4UV8A 1B3QA 4DRXA 2M7WA 3L9DA 4G27B 3KCXA 4PA6A 2AZ2A 3OR6C 2YC0A 4X1YA 1VF6A 2PI5A 3EFFK 1SS3A 1AI5A 4KUMA 2F66C 4MTFA 4RAIA 2QR4A 2ZINA 1Z2GA 3QG5A 1VIBA 1XEQA 1JPXA 3WB1A 5C8YB 4QE9A 5H5NA 4PA4A 5L3FA 5LHIA 1VQ9V 3LUTB 4Z2WA 3CCVV 3HKCB 1ZUQA 4O4LB 1I94B 4PA3A 3OT7A 4N21A 1NQTA 2QE7G 3WG7C 1OCOB 4H37A 2Q0AA 3SJCC 2D2CB 3LDEA 5H9CA 4AILC 1Q86W 3G6BA 4AQYO 3CCMV 1K92A 1YEWA 4FM2A 2XASA 2EIJB 4JTAB 1YIJV 2OT5A 3ASNC 2EJ7A 1AI7A 4R8CA 1ZSPA 5B3SC 2VQEO 2F1MA 3ZRXA 4LNUA 1KKDA 2XUMA 4JI0O 1XBLA 1M57C 2AW9A 2N74A 1VF6C 2QM7A 1GN3A 2ADPA 5DECA 5LHGA 3F7VC 4JAUA 4MVQA 4DR1B 1NU1H 2ITCC 3CXHF 1F23A 3TETA 3K5NA 1QLEB 3U0ZA 2OCHA 1KB9F 1PD3A 4LC1A 5KHGA 2OCCB 2IM9A 3B09A 4PELA 1XILA 1XHXA 1WA8A 2LFSA 1FJGB 1E1QG 1OJHA 1SZTA 1SKVA 5EK0A 1PNKA 2H94A 2AHZA 3FKSG 1VEWA 2K9PA 3CEIA 5FL7G 4PV1B 4ZKIA 4UCUA 2CUGA 2IH3C 3TK1A 1RPOA 2QWPB 4O4JB 4YHHB 2E75B 3JD1A 1SQPH 1NH2B 4GX1A 4JV5O 1SQBH 3CX5F 2EBOA 2YXHA 3FYIB 4DV0B 2NNUA 3S3XA 2Q4PA 3JAWA 3JATB 2JS3A 4ZBMA 1Q82W 5CBHA 1DLBA 4PI2A 3WB0A 4I50B 1US6A 1N36B 3ML0A 2P67A 1PM9A 3F5WC 2ILMA 1JVMA 4DV6O 4BR6A 4H13B 4IL6Z 3CP1A 4FM1A 1JX9A 3BEHA 4DXWA 1N32B 1ZLZA 4TT3G 3CSXA 3JYCA 5LP6A 5LMNO 3T1HO 2Y69C 4JI2B 4PHZA 4HNAA 4CC5A 5CN0A 5IYCO 3VQYA 1MNGA 1I7FA 4GT1A 2FKXA 3ABKC 2OTJV 1Q6IA 4ZI7B 2B5UA 5EC2C 1M56B 2BE3A 5GONB 4X65O 2ZT9B 3CXCU 3OM3B 2PZSA 5JJNB 4NYKA 2ZNJA 4DR4O 2P06A 3CMAV 5JH7A 3IAYA 1W0JG 3NR7A 2Q6AA 3RYHA 3TJTA 3AK1A 3HKBB 2FMLA 4JI8B 5IY5C 4U7NA 2Z3YA 3E86A 1W0KG 2WLMA 3OD4A 1JA8A 4TSFG 2KQXA 3RVYA 1K97A 1E1RG 4YHHO 1ENVA 2QM4A 4DV5B 1TVKB 2DYRC 2NR5A 3LSUA 5JVDA 4LR3A 4NTYA 5KHIA 5B1AC 3OMIB 5LP6C 4DK1A 1MOFA 5B1OA 1YTFD 1BL8A 1M9NA 1WP7A 1RP3B 4IYIA 5E79Z 1HDJA 3OAAG 3T1YO 3T4ZA 1J5EB 1IBLO 2JJ1G 3I56V 1NVPD 4B3SB 5CA1B 1WB7A 3B8NA 1H2MA 3T1CA 2KB1A 4X20A 1SETA 4LF9O 1EN4A 1R3JC 4J9YB 5JCOA 1WPBA 4J11A 2KSDA 3M7MX 1H2SB 4YJ2B 3D3IA 1THZA 2OIEA 1IX9A 1W2BU 4K3AA 2GUZB 1OCCC 4IIJA 4LWSA 3X2QC 3CCUV 3E8BA 2VQFO 2H3OA 3OFNG 1M90W 5JJJB 2P22C 4JZ2A 4B3RB 1V55B 2DWEC 3ZHQA 5BR8O 1VF5B 3G71V 4EB6A 1PNMA 2DWDC 3ZHTA 4C7UA 4Z1VA 2HJFC 2R72A 2W6IG 4DV5O 1FFXA 3WU2Z 3RVZA 1XDCA 4UUJC 1GN4A 3W7WA 4DV2B 1IURA 2ZIOA 2RN9A 2Z0AA 2HKOA 1FKAO 3K9SA 3U11A 4OX9O 2YEVB 3ZMUA 1BHBA 4Z1MG 5LXTB 4BWAA 1NS1A 4FJCC 3FAVB 5EBWC 3RYFB 5IJ0B 2ITDC 1S5JA 4UCRA 1F4MA 1D5AA 2Y4TA 5IDJA 4RQEA 2EJRA 1K3EA 1R73A 2DW4A 2EX3A 1BZKA 1Q3EA 3OUFA 3ABMB 4P2ZA 5LOVA 1NBMG 4ZIBA 5LMUO 1K34A 3CJHA 2WLIB 1BGYH 4F4LA 2B1GA
chains in the Genus database with same CATH topology
2UUCO 4DR6O 5IT9N 3J7AU 4LFAO 1FJGO 4DV2O 1N33O 2JRIA 2VQEO 5LMNO 3T1HO 1G1XB 1HNWO 2UUBO 3F5TA 2VQFO 1HNXO 4OPAA 1XNRO 4JI0O 2FKXA 1AILA 2DJVA 2N74A 1IBKO 4B3TO 4JI5O 2UXDO 4NXNO 4K0KO 1YZBA 4X65O 4DUZO 4GKKO 4DR5O 4LF7O 1XMOO 3RT3C 1A32A 5BR8O 4OPHA 1HNZO 4JI3O 5FLXN 4JI6O 3J81N 1J5EO 4DR4O 5BXZA 4B3SO 4DR7O 4DV3O 1XMQO 4DV7O 4X66O 4DR3O 4DV0O 4DV5O 1FYJA 4GKJO 1N34O 1I94O 4B3MO 3OTOO 4LF5O 1IBMO 4YY3O 4DUYO 1N36O 2HHHO 4JI4O 2ZM6O 4YHHO 2Z0AA 2UXCO 5LL6Y 1F7YA 1KUQA 1FKAO 3O65A 1N32O 2LW7A 4LF6O 3SDLA 4OX9O 4DR2O 4LF4O 2AGAA 4JI2O 3R66A 2UXBO 2UUAO 1NS1A 2E5LO 1AB3A 2ZKOA 4JYAO 1XNQO 1D2DA 1XEQA 5A2QN 5H5NA 2UU9O 4X62O 3T1YO 4B3RO 4X64O 1IBLO 4JV5O 1X59A 4NXMO 4LF8O 4LFCO 4DR1O 5IWAO 3JAMN 4JI1O 3M8AA 4LF9O 2F4VO 4A5UB 3J80N 4JI7O 5LMUO 1HR0O 1R1BA 4DV4O 4LFBO 5BY1A 4JI8O 4KHPO 4DV6O 2DOSA 1DK1A 4AQYO 4DV1O 1R6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC O;  4DR6 O;  5IT9 N;  3J7A U;  4LFA O;  1FJG O;  4DV2 O;  1N33 O;  2JRI A;  2VQE O;  5LMN O;  3T1H O;  1G1X B;  1HNW O;  2UUB O;  3F5T A;  2VQF O;  1HNX O;  4OPA A;  1XNR O;  4JI0 O;  2FKX A;  1AIL A;  2DJV A;  2N74 A;  1IBK O;  4B3T O;  4JI5 O;  2UXD O;  4NXN O;  4K0K O;  1YZB A;  4X65 O;  4DUZ O;  4GKK O;  4DR5 O;  4LF7 O;  1XMO O;  3RT3 C;  1A32 A;  5BR8 O;  4OPH A;  1HNZ O;  4JI3 O;  5FLX N;  4JI6 O;  3J81 N;  1J5E O;  4DR4 O;  5BXZ A;  4B3S O;  4DR7 O;  4DV3 O;  1XMQ O;  4DV7 O;  4X66 O;  4DR3 O;  4DV0 O;  4DV5 O;  1FYJ A;  4GKJ O;  1N34 O;  1I94 O;  4B3M O;  3OTO O;  4LF5 O;  1IBM O;  4YY3 O;  4DUY O;  1N36 O;  2HHH O;  4JI4 O;  2ZM6 O;  4YHH O;  2Z0A A;  2UXC O;  5LL6 Y;  1F7Y A;  1KUQ A;  1FKA O;  3O65 A;  1N32 O;  2LW7 A;  4LF6 O;  3SDL A;  4OX9 O;  4DR2 O;  4LF4 O;  2AGA A;  4JI2 O;  3R66 A;  2UXB O;  2UUA O;  1NS1 A;  2E5L O;  1AB3 A;  2ZKO A;  4JYA O;  1XNQ O;  1D2D A;  1XEQ A;  5A2Q N;  5H5N A;  2UU9 O;  4X62 O;  3T1Y O;  4B3R O;  4X64 O;  1IBL O;  4JV5 O;  1X59 A;  4NXM O;  4LF8 O;  4LFC O;  4DR1 O;  5IWA O;  3JAM N;  4JI1 O;  3M8A A;  4LF9 O;  2F4V O;  4A5U B;  3J80 N;  4JI7 O;  5LMU O;  1HR0 O;  1R1B A;  4DV4 O;  4LFB O;  5BY1 A;  4JI8 O;  4KHP O;  4DV6 O;  2DOS A;  1DK1 A;  4AQY O;  4DV1 O;  1R6T A; 
#chains in the Genus database with same CATH topology
 5IYD O;  3W7U A;  1YHQ V;  1YJN V;  1IZ3 A;  2ZE7 A;  2YDE A;  4DR2 B;  2N04 A;  3ZRW A;  1HNX O;  3ZJZ A;  2LP7 A;  1I5Y A;  2ZIM A;  2HP8 A;  1XNQ B;  3ASO C;  3LSS A;  3ABU A;  4FFK A;  2UU9 B;  1GKF A;  5GW7 A;  4DR5 O;  3QF7 A;  4LFC B;  2W0X A;  2Y0I A;  3GWO A;  1IXB A;  4CZZ A;  2GV9 A;  2EIM B;  4JI1 B;  1GK9 A;  2YXL A;  3SYO A;  1S5L Z;  1FFT B;  4FZ0 A;  1XMQ O;  4CH3 A;  2LW1 A;  1FXK B;  1XOU A;  2XT9 A;  3FX7 A;  5J2T B;  4B3M O;  1VAR A;  2YIB D;  5C8Y A;  5KA6 A;  1NZ6 A;  4BIO A;  1L8D A;  1VQN V;  1YCI A;  3IFX A;  5KA5 A;  3KKY A;  2WWW A;  3HKC A;  2EIN C;  4NTX A;  4O4L A;  4TV8 B;  1AI4 A;  1Q81 W;  2ADQ B;  4LCU C;  3R66 A;  4IGG A;  3BVO A;  4B7E A;  2GTA A;  3CRA A;  4FLY A;  1HNZ B;  4JI3 B;  5TIS Z;  2XAJ A;  4QNH B;  4BIZ A;  2WLN A;  4DV7 B;  3K08 A;  5HFM A;  4GKJ B;  4P9O A;  1RFY A;  1LUW A;  1ZL8 B;  2F4V O;  2BOC C;  3JAK B;  1IBM B;  1TUE B;  2ZR2 A;  1RM1 B;  1HR0 O;  1K5Q A;  1LNQ A;  4PDM A;  3E89 A;  3W7X A;  4JYC A;  1YXB A;  3H1K H;  4DV1 O;  4J80 A;  5H6R A;  4IYH A;  4PDL A;  2K1E A;  4CS3 A;  1CPY A;  1N33 O;  2M6Y A;  1OCR B;  2ZD9 A;  1G1X B;  1HNW O;  2ETN A;  2KKW A;  3E83 A;  4TOI A;  2R9R B;  2WLL A;  3AG1 B;  1SF9 A;  2X6A A;  1ZAU A;  3H1L H;  1NH2 D;  2HVJ C;  3K0D A;  4PA7 A;  1NTZ H;  1VF7 A;  2PUS A;  4WCE V;  2BOB C;  2F23 A;  1OCO C;  3AG4 C;  4O2B A;  3AG3 B;  1HW7 A;  4CH5 A;  2IJI A;  3MHH C;  4O4H B;  5H6Q A;  2EIJ C;  1P49 A;  2LO1 A;  2Y4U A;  2Q9L A;  5CA0 A;  1K5S A;  2XOK G;  4QE7 A;  2DYS C;  2KG7 B;  1AI6 A;  4NXN B;  1B04 A;  4O4J A;  4AQY B;  4FFB B;  4DUY O;  4WF9 V;  4FLV A;  4IT5 A;  3Q4H B;  2IJH A;  2VQE B;  1VQ8 V;  1GH6 A;  4J7J A;  3K59 A;  3JAT A;  2B1I A;  2RMK B;  3UO2 A;  4B7K A;  2AHY A;  1Q43 A;  5B1B C;  3E22 B;  4JYB A;  2OCC C;  1I5X A;  3QTC A;  1K73 W;  1V54 B;  3B8M A;  1E79 G;  1TUB B;  2L6L A;  3JAL A;  3CB2 A;  4LF8 O;  1XQ8 A;  2JDI G;  1COW G;  3ETQ A;  4FZ1 A;  1H38 A;  3I55 V;  2X6C A;  1VQP V;  5KX5 B;  1YIT V;  4F6E A;  4ZI7 A;  2CDY A;  2E76 B;  4WFF A;  3H1H H;  1DK1 A;  3U10 A;  3JD4 A;  1WN7 A;  1WNS A;  4L8J A;  4MTO A;  1DF4 A;  5CBF A;  3LNN A;  3P30 A;  1Q5O A;  4LFA O;  2EIK C;  4FVM A;  4XBF A;  3SPC A;  2PYJ A;  1M5I A;  3F5T A;  3HKB A;  4U3J B;  3VQX A;  1H8E G;  3AG2 B;  3H1J H;  3N2K B;  1ZTE A;  3BPZ A;  4K8X A;  4MTG A;  1DGS A;  1KEC A;  2F95 B;  1XI1 A;  3CCR V;  3ZMZ A;  4BW5 A;  4NXN O;  2B9Z A;  2GBO A;  4JV5 B;  3N2G B;  4FK5 C;  3SPG A;  4MTX A;  3CWB H;  2FL4 A;  1N0J A;  1TVK A;  4LH7 A;  2ATK C;  2QTO A;  1H2K A;  1SQQ H;  4X66 O;  1JQ0 A;  3L75 H;  2DQ3 A;  4PDR A;  5KHH A;  4DV6 B;  2PYL A;  1I08 A;  1PPJ H;  2RDC A;  3OEH G;  2WLK A;  4R7C A;  4PI0 A;  3CCL V;  4JI4 O;  5CA1 A;  3D8C A;  1AJP A;  1WAZ A;  2WLH A;  5LMN B;  4DV3 B;  2UXN A;  5EBL C;  3T1H B;  1L1F A;  4QPJ A;  1HP8 A;  2PF4 E;  1RSO B;  4YY3 B;  3M99 B;  4X65 B;  2RNB A;  2E3C A;  3O9O A;  4KFM A;  3UKM A;  2GTS A;  1NTM H;  4JAA A;  5D5Q A;  1ORQ C;  5LGT A;  4DR4 B;  2GUZ A;  2YID A;  2A79 B;  4GYC B;  2QSA A;  3A0B Z;  4FLW A;  4W4L A;  3ZN1 A;  4FLZ A;  4ZOL B;  3J80 N;  4JI7 O;  2YS8 A;  1WB8 A;  2Q5Z A;  2WA3 A;  1QNM A;  5IJ9 A;  1K8A W;  3K58 A;  3RGB A;  3JCU Z;  3IGA C;  5DED A;  2H8P C;  5JQG B;  3A0R A;  5BMV B;  1L0L H;  3ZHS A;  1FAF A;  4OGQ B;  4UVA A;  1ARO P;  1KQS U;  4XDK A;  1QVF U;  3ABT A;  3ZED A;  1S77 D;  4I7Z B;  2UXD O;  3ZBH A;  3KG2 A;  4DUZ O;  1R3L C;  4AI8 A;  3T1Y B;  1IBL B;  1DTO A;  1WLE A;  2IW5 A;  2A0L A;  3K5L A;  1QCE A;  5H2F Z;  4LF9 B;  2YEV A;  1YVW A;  4DV3 O;  3WG7 B;  5EZY A;  4UXN A;  3OTF A;  1N34 O;  1PV0 A;  3FAV A;  1EZV H;  4U7O A;  1JMK C;  3RYF A;  1MSD A;  5IYZ A;  5IJ0 A;  4YY3 O;  1Z5W A;  1PP9 H;  3JCZ A;  5B3S B;  2EZP A;  4MVO A;  1YI2 V;  3E2E A;  3BHP A;  3O65 A;  2VS0 A;  1YJW V;  1V55 C;  2VQF B;  1Q90 D;  4X1I B;  3RYC B;  3RBZ A;  4DO2 A;  5CB4 B;  2Q67 A;  3CC2 V;  5LBQ A;  3ZHR A;  4CH6 A;  1JFF B;  2WLI A;  4E4E A;  2UXB O;  4MW3 A;  2LQT A;  1R3I C;  2ZKO A;  2RQ6 A;  4Q20 A;  5BR8 B;  3TCU A;  5A2Q N;  1FXV A;  1AJQ A;  1K9M W;  5KUK A;  2P4K A;  3QVN A;  3G67 A;  1DF5 A;  2CH7 B;  5DM6 V;  2O57 A;  3VQW A;  3JSN A;  2R9A A;  4P9P A;  1P7G A;  3L72 H;  4FLT A;  2R70 A;  1YSC A;  5LA6 B;  2QGN A;  2JGD B;  1SQV H;  2L35 A;  4X64 B;  2Q7E A;  1N0N A;  3G80 A;  5BZB A;  4CS4 A;  1SA0 B;  1GAX A;  4OX9 B;  2IJK A;  4ASU G;  1JJO A;  3HR0 A;  1FXK A;  3JAR B;  4WBN B;  4WFE A;  5J2T A;  4YIO A;  2QDO A;  4AHC A;  2HG5 C;  3E8F A;  4TUY B;  3BCC H;  4I0X A;  3FD9 A;  1IBK O;  1MZF A;  4B3T O;  2UXX A;  3CRR A;  3SPI A;  2P6J A;  2XHB A;  3GB7 C;  2RJZ A;  2YSU B;  5B1N A;  4CS2 A;  5JJE B;  3RT3 C;  3JAS B;  4MVU A;  4HBN A;  1MA1 A;  4OPH A;  4UCS A;  1Q6U A;  1UJW B;  1EZJ A;  3IC9 A;  3L74 H;  5LMU B;  3H9V A;  4HZ3 A;  3K3W A;  4F6R A;  5DN6 G;  4JPR A;  4UV9 A;  2Z5U A;  4HAM A;  2QWQ B;  2YIC A;  4R6Z A;  4NR1 A;  2DQ0 A;  1QQC A;  3I5D A;  3ZN0 A;  4OXS A;  1LR1 A;  1HNX B;  1KD1 W;  4HYO A;  4O2A B;  1ZL8 A;  3JAK A;  5C93 A;  2CK3 G;  2QJ1 A;  4J41 A;  2FYU H;  4IHJ B;  1OCZ C;  3K06 A;  3DSQ A;  1YDX A;  4DR5 B;  1MMM A;  2Q0O C;  2F93 B;  5JCO C;  3DXR A;  4X62 O;  4W4K A;  4X64 O;  2ODM A;  1QHT A;  2IU0 A;  3S3W A;  1XMQ B;  2XAQ A;  1XUQ A;  5IY5 B;  1IVS A;  3BRC A;  2DE0 X;  3D3Q A;  4B3M B;  1H8H G;  5D5P A;  2CTQ A;  4DV4 O;  4LFB O;  4X1K B;  3MAQ A;  1R6T A;  1EM1 A;  2DYR B;  3SJQ C;  2A3Q A;  4DR6 O;  5IWA B;  3QO5 A;  4O4H A;  3GWK C;  2AXT Z;  4I4T B;  1BT8 A;  5B1A B;  1FPO A;  3FB6 C;  3C3T A;  2UUB O;  1Y74 B;  2KG7 A;  4RWU A;  3SR2 C;  5LGU A;  1GTO A;  4FFB A;  5A9G A;  2CGN A;  4JZG A;  3E8H A;  4K0K O;  4I55 B;  4PJ0 Z;  4TQD A;  4O4I B;  2ZCE A;  3THO A;  3ETD A;  2Y0P A;  4EFB A;  2F4V B;  2QWR B;  3B77 A;  5B5E Z;  1M4U A;  1HR0 B;  3UT5 B;  5ITZ B;  3OTO O;  2ZE6 A;  2ZR3 A;  3FB7 C;  1ZX3 A;  3AG1 C;  1GN6 A;  3DC6 A;  4LF7 B;  2OYQ A;  2QA4 V;  3E22 A;  4DV1 B;  4JAV A;  3MD0 A;  2HHH O;  1KU9 A;  1GM7 A;  1OCC B;  3AK2 A;  1TUB A;  1NR1 A;  3WB2 A;  1N33 B;  4EEQ A;  5LL6 Y;  1HNW B;  1Q6H A;  2V7Q G;  4R50 A;  5L3G A;  2LW7 A;  4LP8 A;  4X88 A;  4BIU A;  5KX5 A;  2AGA A;  2EIL C;  2E5L O;  4JAS A;  1BSM A;  3D36 A;  2EZO A;  1NTK H;  1MG1 A;  1EN6 A;  5J9P C;  3A2F A;  4G2K A;  3BFR A;  1EN5 A;  1S5H C;  2X7R B;  1AVM A;  3RN4 A;  5IWA O;  4U3J A;  3HKD B;  3HKE B;  3N2K A;  5LYJ B;  4DUY B;  1R1B A;  2ZDI A;  2ZXW C;  4QJF B;  3N2G A;  1W59 A;  1G6U A;  4NKG B;  3LDD A;  2PY5 A;  5IT9 N;  3B40 A;  2JK5 C;  3BY6 A;  3K79 A;  3OMA B;  4DK0 A;  2GHY A;  3T4D A;  2HVK C;  3W7S A;  1G8M A;  3BA9 A;  1NVP B;  3SYQ A;  3P3P A;  4ZHQ B;  1JJ2 U;  1AIL A;  1KP3 A;  2ZE8 A;  4D7T A;  3ZIA G;  1NT2 B;  4XDJ A;  2HLD G;  3ZCC A;  2CTR A;  4LF7 O;  5J2U B;  4LF8 B;  4J9Z B;  5EIB D;  3D36 C;  4J7K A;  3J81 N;  1Y6X A;  1RSO A;  1U97 A;  3ICX A;  5EBM C;  4FMT A;  3CPW U;  2V4D A;  1KC8 W;  5IYB O;  4LF5 O;  1AR4 A;  2BTQ B;  1QVG U;  1NI8 A;  3WFV A;  1VQO V;  4LFA B;  1BE3 H;  1J95 A;  2WPD G;  3P3N A;  3CD6 V;  1LUV A;  1NR7 A;  3CC7 V;  1XHZ A;  1BS3 A;  2QKA A;  3APO A;  4LF6 O;  1R6K A;  4B08 A;  4DW1 A;  3PJS K;  3K5M A;  2GSM B;  4ZOL A;  3OR7 C;  5L3B A;  1O9G A;  3CYO A;  1YF2 A;  4RQF A;  4UB6 Z;  1D2D A;  3UM7 A;  2WA4 A;  1QU7 A;  1M93 A;  4LBE C;  5JQG A;  4JTC B;  1Q8I A;  1VQ5 V;  1QLN A;  5BMV A;  4X66 B;  2Q73 A;  2CTW A;  3NXS A;  4GLX A;  2LGW A;  3OUS A;  4A5U B;  2JGU A;  4I50 A;  4H44 B;  3GVM A;  4TQF A;  2BSK B;  3CJH B;  1GRJ A;  1QLE C;  5K1X A;  4KHP O;  4JI4 B;  1R3K C;  2JS5 A;  1F4N A;  5L3D A;  2EIN B;  3AK3 A;  2IH1 C;  4P30 A;  1CXZ B;  4QGP A;  1RPR A;  1R6N A;  5B66 Z;  2BCC H;  4OPA A;  1QR8 A;  4I5S A;  4XDL A;  3JSL A;  4NVP A;  5GON A;  4TWK A;  3CCJ V;  4UCT A;  5CMU A;  2QWO B;  4GX5 A;  2VRZ A;  1VMG A;  1TAE A;  4X1I A;  3RYC A;  3W7T A;  4TV9 B;  5CB4 A;  4UCV A;  3RFR A;  1YJ9 V;  4DR7 O;  4JI7 B;  1Y76 B;  1Y66 A;  1JFF A;  3SPH A;  5KHJ A;  5KAI Z;  3UCS C;  5E1A C;  3JD0 A;  1SC5 B;  2XAG A;  4PA9 A;  2QKC A;  4WFH A;  1TGO A;  1Y4M A;  1F7Y A;  3OGI B;  2P90 A;  2N05 A;  2CH7 A;  2GDS A;  1K7D A;  4JTD B;  1EBO A;  1JOY A;  2XAH A;  3ZMS A;  5LA6 A;  3G4S V;  4YJ3 B;  2UXD B;  1P4R A;  2MW2 B;  3AG4 B;  2UUA O;  4DUZ B;  2JGD A;  4JYA O;  2XND G;  1SRY A;  5IE9 A;  3C90 A;  1SA0 A;  1M56 C;  4MVZ A;  3SJB C;  5K1P A;  4NXM O;  2DYS B;  3JAR A;  4WBN A;  1N34 B;  1X4T A;  3CRM A;  2IJJ A;  4GX0 A;  2YUA A;  4X9Q A;  1FXH A;  3B4S A;  2YI8 A;  4TUY A;  3CS5 A;  1WP8 A;  1WPX A;  2A7W A;  5EYP B;  3ABL B;  3FB5 C;  2A06 H;  3SJA C;  4YJ2 A;  2CAZ C;  3JAS A;  1B6Q A;  1PL0 A;  3TGU H;  2UUC O;  4PD4 F;  3ZHU A;  2IBZ H;  1M1K W;  1D5N A;  1AR1 B;  4MS2 A;  4K8Z A;  2W6J G;  2UXB B;  2WLL B;  4JF3 A;  3LNM B;  5B1B B;  3KZI Z;  2ZNI A;  5KMG B;  4I9W A;  2HEP A;  1YZB A;  3A8T A;  4FPP A;  1G4Y B;  2OIG A;  1P84 F;  4O2B B;  1VQL V;  3TXQ A;  2ARH A;  4YIP A;  1BQ0 A;  2OTL V;  4O2A A;  1XNR B;  5AG2 A;  4IHJ A;  3KCY A;  1OHH G;  5CA0 B;  4BAY A;  2JEX A;  1I94 O;  1Y67 A;  3L71 H;  1KP2 A;  1K4D C;  4X89 A;  3DTU B;  1BHA A;  3R65 A;  2EIK B;  2NLJ C;  3RYI B;  4NTW A;  4Q6G A;  1XL6 A;  5LHH A;  1VP7 A;  4WFA V;  5CA3 A;  3SDL A;  2Q8V A;  1OV9 A;  5LXT A;  2LJ2 A;  1PL4 A;  1IBK B;  4B3T B;  5FNV B;  4J10 A;  1AB3 A;  1N8R W;  3EVK A;  1AR5 A;  4X1K A;  4WFB V;  3ASN B;  2UXC B;  3E35 A;  2YIA A;  1K4C C;  3BAB A;  3EHB B;  3OE7 G;  2JJ2 G;  2QM8 A;  4I4T A;  3OGC C;  3JAL B;  4LF4 B;  4DRX B;  1XL4 A;  3ZRS A;  4DR1 O;  3E8G A;  1Y74 A;  3STL C;  4UVC A;  1EFR G;  1M57 B;  1GMG A;  4X1Y B;  3HPL C;  4CC6 A;  4I9Q A;  2WLJ A;  4I55 A;  5BY1 A;  1Z5V A;  2XTA A;  4O4I A;  1Q7Y W;  4FM0 A;  2R9I A;  2QEX V;  1PNL A;  1FJG O;  5HFL A;  5JWP A;  2JRI A;  3A0H Z;  4GUN A;  3UT5 A;  5ITZ A;  4EFE A;  1KBH A;  3SYC A;  1XNR O;  5FPO A;  3CRC A;  3STZ C;  4X62 B;  4J42 A;  3IJ4 A;  1WJZ A;  4D7S A;  4UCO A;  4RUE A;  1JR9 A;  4G28 B;  4PDV A;  3ETG A;  4QIW F;  4DV0 O;  4LNU B;  3EXA A;  3RWR D;  2DN9 A;  2E74 B;  4JI5 B;  4DV4 B;  4LFB B;  3ABM C;  4RO2 A;  4GKK B;  3CC4 V;  5CBG A;  2OWO A;  2X0L A;  1XMO B;  1GM8 A;  4DR6 B;  1N36 O;  1NJI W;  2UXC O;  2UUB B;  4DR3 B;  1N32 O;  3HKD A;  3ETE A;  4KP4 A;  1GM9 A;  3HKE A;  1IXM A;  4TV8 A;  5LYJ A;  4LF4 O;  5LGN A;  3L70 H;  4JI2 O;  1UPG A;  4K0K B;  3IC7 A;  2ZM6 B;  3VQV A;  2YI9 A;  1BCC H;  1AJN A;  3DGE A;  1WA8 B;  2AZ0 A;  1P7B A;  3VBB A;  1XRE A;  2Q7G A;  2Y69 B;  2V1D A;  1T5E A;  5KAF Z;  3CE2 A;  2PTM A;  3ABK B;  2EIM C;  2WSS G;  4H33 A;  3OTO B;  4GZR B;  4E2L A;  4ZHQ A;  4MVS A;  1V9P A;  2HHH B;  2PI4 A;  1FXK C;  3F7Y C;  4JI8 O;  1UFI A;  3T2M A;  1SQX H;  3LDC A;  2D3O W;  5J2U A;  1SQG A;  5IJ9 B;  5GTH Z;  3OMN B;  1CEZ A;  2HJD A;  4FLU A;  3OW2 U;  5KHK A;  3K04 A;  3UQ8 A;  3H1I H;  3JAW B;  2E5L B;  1MZE A;  2VWJ A;  2P7T C;  1MSW D;  2BTQ A;  2DJV A;  2P5O A;  2HR3 A;  4JI5 O;  1S72 V;  3BAA A;  5GTI Z;  4GKK O;  4K35 A;  1ROP A;  3SYP A;  3ZX6 A;  1XMO O;  1KMI Z;  3RW0 A;  5L3E A;  1H2L A;  1J5E O;  3G6E V;  1O9H A;  5BXZ A;  4B3S O;  5LP6 B;  5EZY B;  4WFG A;  4DR3 O;  2MK3 A;  3MHS C;  4HNA B;  3K5O A;  3MDS A;  3SPJ A;  1AP6 A;  3CHX A;  5IYZ B;  2F43 G;  4UVB A;  2ZQM A;  1SES A;  1RM1 C;  3FB8 C;  2IU3 A;  3Q4H A;  2ZM6 O;  2CGO A;  4QPK A;  2XAF A;  1VQ6 V;  4UB8 Z;  3ZRV A;  5JH7 B;  3SGI A;  4MVM A;  3VOU A;  3CCQ V;  3JD3 A;  2BSK A;  1FD9 A;  3RYH B;  1AP5 A;  1OCR C;  5EC1 C;  3H01 A;  2VWK A;  1BQZ A;  1OZ0 A;  1BMF G;  3OEE G;  2CE4 A;  4X8A A;  1S76 D;  3AG7 A;  2X6B A;  1K33 A;  3CCS V;  4B3R O;  1X59 A;  2FB5 A;  2W0F C;  3X2Q B;  2JEU A;  4MW8 A;  3AG3 C;  4GCZ A;  3FFQ A;  5JVD B;  3M8A A;  4LF5 B;  2A9H A;  1QBZ A;  1L0N H;  1GN2 A;  2DOS A;  1I0H A;  3ZMV A;  1QR9 A;  4ABM A;  3J7A U;  4DV2 O;  4LF6 B;  4ICG A;  4TV9 A;  1OCZ B;  1Y76 A;  3K03 A;  4X20 B;  3BA8 A;  4RUF A;  2QKS A;  2BTO A;  2DMX A;  1CP9 A;  1F51 A;  1SZX A;  4I0X B;  3FYE B;  1N4C A;  2Q7H A;  5L3C A;  1A32 A;  4EKW A;  4LH6 A;  1YTF B;  4KL1 A;  5FLX N;  3ZS8 C;  2Y48 A;  3QO7 A;  2NN4 A;  1V54 C;  4N23 A;  4IIJ B;  2EUL A;  3HB3 B;  4LWS B;  4YJ3 A;  1FYJ A;  2QWN B;  1VQM V;  4F6R B;  1FS0 G;  4DYL A;  4KHP B;  4H0L B;  1TA8 A;  4JGS A;  4MT8 A;  1S3J A;  4CH4 A;  1S0V A;  2QTS A;  4D6T H;  4JI6 B;  2YIB A;  3B2E E;  2P4V A;  1KUQ A;  4EB6 B;  1URF A;  3ZMT A;  4DR2 O;  4MSW C;  4FIP C;  1VQ7 V;  3K57 A;  1FFX B;  3TXS A;  1HWY A;  5EYP A;  2HFE C;  1H2N A;  1XNQ O;  2CTP A;  2PGG A;  3AG2 C;  1U96 A;  2LFR A;  1PKX A;  2JIZ G;  1NKD A;  2UU9 O;  3DXR B;  1VQ4 V;  1IDS A;  3C3S A;  4DR7 B;  2ZDI C;  1H2G A;  4LFC O;  3JAM N;  4JI1 O;  1KYO F;  4L87 A;  3ASO B;  1B06 A;  2G38 A;  5F2V O;  1GO3 F;  5KMG A;  3LSQ A;  4JYY A;  4UFZ A;  4YXW G;  2Q68 A;  3CCE V;  3AEI A;  5FPR A;  2JVD A;  1SQF A;  4U3F H;  4CBC A;  2ZE5 A;  1KKC A;  3ZHV A;  3L73 H;  3QNE A;  3CME V;  2C2A A;  2EIL B;  4NB5 A;  3N27 A;  3SYA A;  1ZWI C;  3P32 A;  2UUA B;  5LOV B;  5KUM A;  1VQK V;  4JYA B;  2Q69 A;  2RCV A;  4GX2 A;  4FLX A;  1SER A;  3UO3 A;  3RYI A;  1JCH A;  4J7Z A;  4NXM B;  3ABL C;  3DC5 A;  2WAM A;  1HNZ O;  4JI3 O;  4JI6 O;  4MVR A;  4JI0 B;  3CRQ A;  4DV7 O;  2FTK A;  3K9A A;  3ZRW B;  3QO8 A;  5FNV A;  4GKJ O;  4BW9 A;  2ZXW B;  5KLV H;  2YXY A;  3PN1 A;  4DW0 A;  3APQ A;  1IBM O;  1MAB G;  2LGQ A;  2UUC B;  5EIB C;  3JD2 A;  3K0G A;  4KXR A;  4UV8 A;  1B3Q A;  4DRX A;  2M7W A;  3L9D A;  4G27 B;  3KCX A;  4PA6 A;  2AZ2 A;  3OR6 C;  2YC0 A;  4X1Y A;  1VF6 A;  2PI5 A;  3EFF K;  1SS3 A;  1AI5 A;  4KUM A;  2F66 C;  4MTF A;  4RAI A;  2QR4 A;  2ZIN A;  1Z2G A;  3QG5 A;  1VIB A;  1XEQ A;  1JPX A;  3WB1 A;  5C8Y B;  4QE9 A;  5H5N A;  4PA4 A;  5L3F A;  5LHI A;  1VQ9 V;  3LUT B;  4Z2W A;  3CCV V;  3HKC B;  1ZUQ A;  4O4L B;  1I94 B;  4PA3 A;  3OT7 A;  4N21 A;  1NQT A;  2QE7 G;  3WG7 C;  1OCO B;  4H37 A;  2Q0A A;  3SJC C;  2D2C B;  3LDE A;  5H9C A;  4AIL C;  1Q86 W;  3G6B A;  4AQY O;  3CCM V;  1K92 A;  1YEW A;  4FM2 A;  2XAS A;  2EIJ B;  4JTA B;  1YIJ V;  2OT5 A;  3ASN C;  2EJ7 A;  1AI7 A;  4R8C A;  1ZSP A;  5B3S C;  2VQE O;  2F1M A;  3ZRX A;  4LNU A;  1KKD A;  2XUM A;  4JI0 O;  1XBL A;  1M57 C;  2AW9 A;  2N74 A;  1VF6 C;  2QM7 A;  1GN3 A;  2ADP A;  5DEC A;  5LHG A;  3F7V C;  4JAU A;  4MVQ A;  4DR1 B;  1NU1 H;  2ITC C;  3CXH F;  1F23 A;  3TET A;  3K5N A;  1QLE B;  3U0Z A;  2OCH A;  1KB9 F;  1PD3 A;  4LC1 A;  5KHG A;  2OCC B;  2IM9 A;  3B09 A;  4PEL A;  1XIL A;  1XHX A;  1WA8 A;  2LFS A;  1FJG B;  1E1Q G;  1OJH A;  1SZT A;  1SKV A;  5EK0 A;  1PNK A;  2H94 A;  2AHZ A;  3FKS G;  1VEW A;  2K9P A;  3CEI A;  5FL7 G;  4PV1 B;  4ZKI A;  4UCU A;  2CUG A;  2IH3 C;  3TK1 A;  1RPO A;  2QWP B;  4O4J B;  4YHH B;  2E75 B;  3JD1 A;  1SQP H;  1NH2 B;  4GX1 A;  4JV5 O;  1SQB H;  3CX5 F;  2EBO A;  2YXH A;  3FYI B;  4DV0 B;  2NNU A;  3S3X A;  2Q4P A;  3JAW A;  3JAT B;  2JS3 A;  4ZBM A;  1Q82 W;  5CBH A;  1DLB A;  4PI2 A;  3WB0 A;  4I50 B;  1US6 A;  1N36 B;  3ML0 A;  2P67 A;  1PM9 A;  3F5W C;  2ILM A;  1JVM A;  4DV6 O;  4BR6 A;  4H13 B;  4IL6 Z;  3CP1 A;  4FM1 A;  1JX9 A;  3BEH A;  4DXW A;  1N32 B;  1ZLZ A;  4TT3 G;  3CSX A;  3JYC A;  5LP6 A;  5LMN O;  3T1H O;  2Y69 C;  4JI2 B;  4PHZ A;  4HNA A;  4CC5 A;  5CN0 A;  5IYC O;  3VQY A;  1MNG A;  1I7F A;  4GT1 A;  2FKX A;  3ABK C;  2OTJ V;  1Q6I A;  4ZI7 B;  2B5U A;  5EC2 C;  1M56 B;  2BE3 A;  5GON B;  4X65 O;  2ZT9 B;  3CXC U;  3OM3 B;  2PZS A;  5JJN B;  4NYK A;  2ZNJ A;  4DR4 O;  2P06 A;  3CMA V;  5JH7 A;  3IAY A;  1W0J G;  3NR7 A;  2Q6A A;  3RYH A;  3TJT A;  3AK1 A;  3HKB B;  2FML A;  4JI8 B;  5IY5 C;  4U7N A;  2Z3Y A;  3E86 A;  1W0K G;  2WLM A;  3OD4 A;  1JA8 A;  4TSF G;  2KQX A;  3RVY A;  1K97 A;  1E1R G;  4YHH O;  1ENV A;  2QM4 A;  4DV5 B;  1TVK B;  2DYR C;  2NR5 A;  3LSU A;  5JVD A;  4LR3 A;  4NTY A;  5KHI A;  5B1A C;  3OMI B;  5LP6 C;  4DK1 A;  1MOF A;  5B1O A;  1YTF D;  1BL8 A;  1M9N A;  1WP7 A;  1RP3 B;  4IYI A;  5E79 Z;  1HDJ A;  3OAA G;  3T1Y O;  3T4Z A;  1J5E B;  1IBL O;  2JJ1 G;  3I56 V;  1NVP D;  4B3S B;  5CA1 B;  1WB7 A;  3B8N A;  1H2M A;  3T1C A;  2KB1 A;  4X20 A;  1SET A;  4LF9 O;  1EN4 A;  1R3J C;  4J9Y B;  5JCO A;  1WPB A;  4J11 A;  2KSD A;  3M7M X;  1H2S B;  4YJ2 B;  3D3I A;  1THZ A;  2OIE A;  1IX9 A;  1W2B U;  4K3A A;  2GUZ B;  1OCC C;  4IIJ A;  4LWS A;  3X2Q C;  3CCU V;  3E8B A;  2VQF O;  2H3O A;  3OFN G;  1M90 W;  5JJJ B;  2P22 C;  4JZ2 A;  4B3R B;  1V55 B;  2DWE C;  3ZHQ A;  5BR8 O;  1VF5 B;  3G71 V;  4EB6 A;  1PNM A;  2DWD C;  3ZHT A;  4C7U A;  4Z1V A;  2HJF C;  2R72 A;  2W6I G;  4DV5 O;  1FFX A;  3WU2 Z;  3RVZ A;  1XDC A;  4UUJ C;  1GN4 A;  3W7W A;  4DV2 B;  1IUR A;  2ZIO A;  2RN9 A;  2Z0A A;  2HKO A;  1FKA O;  3K9S A;  3U11 A;  4OX9 O;  2YEV B;  3ZMU A;  1BHB A;  4Z1M G;  5LXT B;  4BWA A;  1NS1 A;  4FJC C;  3FAV B;  5EBW C;  3RYF B;  5IJ0 B;  2ITD C;  1S5J A;  4UCR A;  1F4M A;  1D5A A;  2Y4T A;  5IDJ A;  4RQE A;  2EJR A;  1K3E A;  1R73 A;  2DW4 A;  2EX3 A;  1BZK A;  1Q3E A;  3OUF A;  3ABM B;  4P2Z A;  5LOV A;  1NBM G;  4ZIB A;  5LMU O;  1K34 A;  3CJH A;  2WLI B;  1BGY H;  4F4L A;  2B1G A; 
#chains in the Genus database with same CATH homology
 2UUC O;  4DR6 O;  5IT9 N;  3J7A U;  4LFA O;  1FJG O;  4DV2 O;  1N33 O;  2JRI A;  2VQE O;  5LMN O;  3T1H O;  1G1X B;  1HNW O;  2UUB O;  3F5T A;  2VQF O;  1HNX O;  4OPA A;  1XNR O;  4JI0 O;  2FKX A;  1AIL A;  2DJV A;  2N74 A;  1IBK O;  4B3T O;  4JI5 O;  2UXD O;  4NXN O;  4K0K O;  1YZB A;  4X65 O;  4DUZ O;  4GKK O;  4DR5 O;  4LF7 O;  1XMO O;  3RT3 C;  1A32 A;  5BR8 O;  4OPH A;  1HNZ O;  4JI3 O;  5FLX N;  4JI6 O;  3J81 N;  1J5E O;  4DR4 O;  5BXZ A;  4B3S O;  4DR7 O;  4DV3 O;  1XMQ O;  4DV7 O;  4X66 O;  4DR3 O;  4DV0 O;  4DV5 O;  1FYJ A;  4GKJ O;  1N34 O;  1I94 O;  4B3M O;  3OTO O;  4LF5 O;  1IBM O;  4YY3 O;  4DUY O;  1N36 O;  2HHH O;  4JI4 O;  2ZM6 O;  4YHH O;  2Z0A A;  2UXC O;  5LL6 Y;  1F7Y A;  1KUQ A;  1FKA O;  3O65 A;  1N32 O;  2LW7 A;  4LF6 O;  3SDL A;  4OX9 O;  4DR2 O;  4LF4 O;  2AGA A;  4JI2 O;  3R66 A;  2UXB O;  2UUA O;  1NS1 A;  2E5L O;  1AB3 A;  2ZKO A;  4JYA O;  1XNQ O;  1D2D A;  1XEQ A;  5A2Q N;  5H5N A;  2UU9 O;  4X62 O;  3T1Y O;  4B3R O;  4X64 O;  1IBL O;  4JV5 O;  1X59 A;  4NXM O;  4LF8 O;  4LFC O;  4DR1 O;  5IWA O;  3JAM N;  4JI1 O;  3M8A A;  4LF9 O;  2F4V O;  4A5U B;  3J80 N;  4JI7 O;  5LMU O;  1HR0 O;  1R1B A;  4DV4 O;  4LFB O;  5BY1 A;  4JI8 O;  4KHP O;  4DV6 O;  2DOS A;  1DK1 A;  4AQY O;  4DV1 O;  1R6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...