2Z0AA

Crystal structure of rna-binding domain of ns1 from influenza a virus a/crow/kyoto/t1/2004(h5n1)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
72
structure length
72
Chain Sequence
MDPNTVSSFQVDCFLWHVRKRLADQELGDAPFLDRLRRDQKSLRGRGNTLGLDIETATRAGKQIVERILEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Nonstructural protein 1
publication title Crystal structure of RNA-binding domain of NS1 from influenza A virus A/crow/Kyoto/T1/2004(H5N1)
rcsb
source organism Influenza a virus
total genus 30
structure length 72
sequence length 72
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2z0aA00
2JRIA 2DOSA 1G1XB 4B3SO 4B3MO 2HHHO 1A32A 3J81N 4OX9O 3J80N 1HNZO 4DR5O 4DR4O 4DUZO 4X66O 1XMOO 4JYAO 1XNRO 4JI4O 2F4VO 4YHHO 1N32O 4JI7O 5BR8O 4DV7O 5A2QN 2VQFO 4NXMO 2E5LO 3RT3C 4X62O 3T1YO 4GKKO 1X59A 4JI3O 5IT9N 1NS1A 1FYJA 1R6TA 4LF6O 4DV1O 4DR6O 4DV6O 4AQYO 4DV4O 2UXCO 2LW7A 1IBLO 5IWAO 4OPHA 4LF7O 3OTOO 1D2DA 4LF4O 4DV3O 2FKXA 5BXZA 5LL6Y 4JI2O 4LF5O 3J7AU 4OPAA 4JI8O 3JAMN 4X64O 2UU9O 4JI5O 4DR2O 2Z0AA 1N34O 5FLXN 4DV2O 2UXDO 3F5TA 5H5NA 4DR3O 4K0KO 2VQEO 4LF9O 2ZM6O 4B3TO 1HR0O 3SDLA 4DV0O 4LF8O 4LFCO 1FJGO 1YZBA 1I94O 4LFBO 1XNQO 4DV5O 4GKJO 4DR7O 4LFAO 4JI1O 4KHPO 1FKAO 3M8AA 2DJVA 5LMNO 1XEQA 3T1HO 4JI0O 1IBKO 1AB3A 1HNXO 4DR1O 3O65A 1IBMO 1KUQA 2UUAO 4JI6O 1J5EO 4YY3O 2UXBO 2AGAA 1F7YA 2UUCO 3R66A 2N74A 4A5UB 5BY1A 1N33O 1HNWO 1XMQO 1N36O 4JV5O 4B3RO 4NXNO 5LMUO 1DK1A 1R1BA 4X65O 2ZKOA 2UUBO 1AILA 4DUYO
chains in the Genus database with same CATH superfamily
4ZOLA 2EILB 2XAFA 4MVQA 1H2LA 3RVZA 3AK3A 4DR5O 1R73A 1EN4A 5B1NA 4G27B 5JH7A 1N32O 3B8NA 1QQCA 3N2GB 3CE2A 2EINC 3ZMSA 4RUFA 1E79G 5LYJA 3T1YO 3ETQA 4FK5C 3FYEB 3JCUZ 3ABTA 2BCCH 3FD9A 1R6TA 4O2BB 2KQXA 1TVKA 3X2QB 4BAYA 1P4RA 4MVMA 5BMVB 1MSWD 2P4VA 5LL6Y 4DR5B 2BE3A 4LF5O 2OYQA 4TV9B 3J7AU 3OD4A 4XDLA 3OTFA 1N32B 2PY5A 5FLXN 2WAMA 4IHJB 1EBOA 3RN4A 3E89A 4JZGA 1HR0O 3T1YB 4JTDB 4TOIA 4UFZA 4DR7O 4K3AA 1H8EG 2W0FC 3OR7C 1KYOF 4JI1O 4DUZB 1E1RG 1YCIA 1FFXA 2ODMA 1KB9F 1IBKO 1WB8A 1DF4A 3AG4C 2VS0A 3CYOA 4KP4A 1XILA 2HKOA 5FNVB 3DGEA 3CC2V 2NN4A 1FFTB 4YY3O 5EYPB 2QWQB 2EIJB 3CRMA 1QHTA 1RPRA 1NR7A 3JALA 2A06H 1M1KW 1WN7A 3AG7A 1HR0B 1JR9A 4NTWA 4X89A 3L71H 3FYIB 1P49A 2QJ1A 4JF3A 4DR7B 5H2FZ 5J9PC 2RMKB 4JI1B 4TUYA 4DK0A 1IXMA 4Z2WA 3N2KA 5B1AC 3UCSC 1IBKB 2BOCC 2UXXA 2DWDC 3I5DA 4YY3B 1EZJA 4JASA 3CCUV 2CK3G 3AG2B 1I5XA 4I9QA 3SPCA 3K06A 5J2UB 3B09A 4BW9A 1TUBB 1VQ5V 4NB5A 3E8HA 3RYCA 2QEXV 2PYLA 2QGNA 3U0ZA 4ZI7B 3TXSA 4WFHA 4BIUA 1F51A 5GONB 1JMKC 1BMFG 1LR1A 2JEUA 3EVKA 1R3IC 4X64O 3K5OA 2UU9O 4XDKA 5DN6G 1KU9A 1L0NH 3OMIB 3ETDA 1P7GA 2Y4TA 5H6RA 5CMUA 5LGUA 4LR3A 1IXBA 3TCUA 4LBEC 2YS8A 5IYCO 4TT3G 3FX7A 2QM7A 4Z1MG 5LMNO 3RYHA 4JI0O 3JAWB 4PI0A 4O4HB 1O9HA 4LH7A 1G4YB 5IY5C 5EZYB 1VQ4V 2ZDIC 3SPHA 2DMXA 4X64B 2UU9B 3SR2C 5LHHA 1KQSU 2XHBA 1NU1H 2IJKA 4HAMA 4EEQA 2DWEC 2HVJC 4KL1A 3CCEV 1RP3B 2P90A 3K79A 1AILA 5JVDB 2OT5A 5KMGA 4DO2A 2PI4A 1E1QG 5LMNB 2JS5A 5HFLA 4JI0B 4JI4O 3M7MX 1N0JA 3U10A 2EZPA 2Q67A 2YXLA 4CC5A 1NT2B 2IJHA 4PA3A 4UVBA 3ZEDA 5FPOA 3RT3C 4W4KA 2RNBA 5B3SB 3HB3B 5IYZB 1BQZA 4ZKIA 1XREA 1VQNV 4JI3O 2Y69C 2Y48A 1NS1A 1GN3A 3Q4HA 5EK0A 4CH3A 2UXCO 4JAUA 5IDJA 1FS0G 3OMNB 4E4EA 5JH7B 2XASA 5H6QA 5KHGA 1H2SB 4P30A 4JI4B 3HKDB 5LYJB 3F5TA 5CBHA 1XOUA 4I5SA 4X88A 1TVKB 1WAZA 3OEHG 4Q20A 5CA3A 3O9OA 4JI3B 1NTZH 4LFAO 1BCCH 2UXCB 2B5UA 1RSOA 4MTGA 1FXVA 3ZS8C 4IGGA 2Q8VA 4QIWF 2P7TC 3QNEA 1GM8A 2A9HA 4F6RA 1MSDA 3E2EA 3ABMC 2YIBA 3H1KH 4OGQB 3F5WC 1VQ6V 1KP3A 4PA9A 1ROPA 2QWPB 4FPPA 3K57A 1K4CC 4IYIA 1L8DA 4PA7A 1JCHA 4FZ1A 2OTLV 1S0VA 5KHJA 1PD3A 2YIDA 3MDSA 1SESA 3FAVA 3OAAG 3ZBHA 4LFAB 3K58A 4JYAO 1BS3A 1YSCA 3D36C 3A8TA 3N27A 4B08A 1QLEB 3ASNC 1VQ9V 1WP7A 1R3KC 2R72A 3JALB 5F2VO 4HBNA 4JGSA 1AP6A 1Q90D 2Y4UA 3ZHUA 4UVAA 1G6UA 1KKDA 2LW7A 1M56B 3P3PA 1TAEA 4LP8A 4OXSA 5KAIZ 4TUYB 3MD0A 2ZDIA 5BXZA 3PJSK 5H9CA 1GRJA 4CH6A 4UUJC 4JYAB 3JD4A 4MVRA 5IYDO 1W59A 2ARHA 4DV2O 4WCEV 3VBBA 2EIKB 2F1MA 3ZRVA 1VF6C 1RFYA 2PTMA 3FB7C 4LFBO 1K4DC 3RYCB 1GO3F 1AP5A 1L0LH 2LQTA 1IZ3A 2E75B 4ICGA 3CD6V 2WA4A 4TV8A 2JEXA 4PV1B 2ZNJA 2V4DA 1KP2A 3O65A 3K5MA 4J9ZB 3I55V 3UO2A 4KFMA 3ETEA 3KCXA 1VP7A 2ZCEA 4MVOA 1GN6A 4DV2B 2JGDA 1ENVA 4TQDA 2CH7A 1OCRC 4LFBB 1Q6IA 1NZ6A 3SJBC 2EINB 3RYHB 1QVFU 4XBFA 2RCVA 1SQXH 4WFGA 3IC7A 3B2EE 4FVMA 3QO8A 4I4TB 4AHCA 2LP7A 3FB6C 2WLIA 1XNRO 1MZFA 2XT9A 5LHIA 4JI7O 4CS3A 2GDSA 1PV0A 5EIBD 1Q6UA 1RPOA 1V54C 2Y0PA 5LHGA 4CBCA 2XNDG 4LH6A 4LF6O 4JTAB 2YC0A 3JAKA 3NXSA 4FM1A 1D2DA 1KMIZ 1U96A 2IH1C 4R7CA 2QR4A 1NTMH 4GX5A 1VQKV 4CZZA 3A0HZ 1SQPH 1XNRB 4JI7B 4IIJA 1QU7A 1N34O 3UT5B 4DR3O 5DM6V 4FIPC 3Q4HB 4LF9O 3CMEV 2ZE5A 3TGUH 3AG4B 1QNMA 3K5NA 4DV5O 4F4LA 1H2NA 2Q69A 3ZJZA 4LF6B 3JD1A 3FB5C 2P22C 4KHPO 3H1LH 5LP6C 2ADPA 2FL4A 5KUKA 3F7YC 4J7ZA 5LOVA 4EKWA 3P3NA 3R65A 1NH2B 4JI6O 2JVDA 2YXHA 3DC6A 5E79Z 1AJNA 2CTRA 4FLUA 1M90W 4I55B 4D7SA 1N34B 1EZVH 3L74H 4DR3B 2OIGA 2QM8A 3E35A 4B3RO 4O4LA 5B1AB 4LNUA 4LF9B 1PNMA 3SYPA 2VRZA 2JRIA 1RSOB 4DV5B 1G1XB 3CCQV 2HHHO 2HLDG 2LJ2A 2X0LA 2E74B 1B6QA 4KHPB 4DR4O 3HKBA 1BQ0A 4WBNA 1R6KA 1SERA 4C7UA 1VF6A 2BTQA 4I9WA 1L1FA 1YXBA 2DYRC 2QWOB 2Q0OC 2Q68A 1WNSA 3SGIA 1FPOA 3FAVB 2PGGA 4X9QA 4B3RB 1W0JG 4K8XA 2G38A 1QLNA 5IYBO 2GTSA 3ZCCA 3JYCA 1YJNV 2ITCC 4OPHA 2QTSA 1ZTEA 2HHHB 2Q7GA 2FKXA 1XHZA 4JZ2A 5EBMC 4DR4B 4BR6A 4N23A 3TETA 2H8PC 2P67A 5H5NA 2B1IA 1FXHA 1MA1A 3CCJV 4O4IA 4TSFG 2UXNA 5LGTA 5IY5B 1Q43A 5KX5A 1OCZC 3T2MA 2GBOA 2JJ1G 4IYHA 2ZQMA 1U97A 2ETNA 1ZL8A 1S5HC 5LA6A 2Q7HA 4JAAA 5LGNA 3IFXA 4DR1O 5KHKA 1GAXA 4EB6A 1FAFA 3D8CA 2UXBO 4BWAA 1OCOC 5B1BC 4N21A 4RUEA 2YXYA 1P84F 5C8YA 4NXNO 3LSUA 1NH2D 2E76B 4ZHQA 1NQTA 2YICA 3AK2A 4WFAV 4I50A 1JX9A 4TV8B 4FLTA 1S76D 3SYOA 1ORQC 1Y66A 3SJAC 2WLKA 1AI5A 1DLBA 4UB6Z 4LF5B 1SZXA 5B1OA 1AROP 2Y69B 4U3JA 2ATKC 3SYQA 4TWKA 4DR1B 4WFFA 3RYIB 4UCUA 2UXBB 4D6TH 5JQGA 2JGDB 3WB1A 5GW7A 3ZRSA 5LP6A 2YIBD 2CH7B 2Q9LA 5CB4A 3UM7A 3CCLV 1Z2GA 1JVMA 4NXNB 1MMMA 3OGCC 2ZE8A 1MNGA 5D5QA 2QTOA 2CAZC 5CA1A 5JJJB 2KSDA 2R9RB 2X6AA 1XI1A 2WLIB 3PN1A 5GTIZ 1XHXA 4LCUC 2Q73A 3BABA 2Q7EA 3W7TA 5FL7G 2A7WA 3RGBA 2FYUH 2Z0AA 1CEZA 2UXDO 3LDCA 3ZN0A 1JJ2U 3WG7C 3E86A 3ETGA 5CBFA 1NTKH 2ZM6O 3ABMB 2JIZG 5E1AC 1SZTA 1FKAO 4GT1A 1NJIW 2V7QG 1Y74A 3B4SA 3H1JH 3H01A 4IL6Z 4IIJB 3OM3B 2ZIMA 3ZRXA 3ZHVA 1TGOA 2R9AA 3VQWA 3KG2A 1PM9A 4J10A 1THZA 2UXDB 1S3JA 2EILC 1XMQO 1N36O 2L6LA 4JV5O 3TJTA 1R1BA 4HYOA 2ZM6B 4Z1VA 1GN2A 3BRCA 2YSUB 2UUBO 3ASNB 2ZD9A 4DUYO 4B3SO 2HJDA 1HW7A 5LOVB 2PYJA 3JATA 3CRRA 1F4MA 4X66O 3BPZA 1US6A 3OEEG 4U3FH 2PUSA 5BR8O 1AJPA 2GSMB 4YJ3A 3BCCH 2F95B 2EIMC 3ML0A 5D5PA 3JASA 4GZRB 4X62O 3C3SA 4O4LB 4LNUB 2QA4V 4MVZA 4RWUA 5KAFZ 3W7WA 1XMQB 3STLC 4JV5B 4MTXA 3CSXA 2IJIA 3RW0A 3GWOA 2UUBB 4DUYB 3HKBB 1B3QA 4DV3O 4B3SB 4WBNB 1R3JC 4R8CA 2LFSA 4O2AB 1NVPB 1D5NA 2CE4A 3A0RA 1VQ8V 3WB2A 2BTQB 4X66B 3ASOC 5K1XA 4OPAA 2HEPA 3OMAB 5BR8B 1OCCC 2D2CB 1EFRG 4ZOLB 3BA9A 1YF2A 4O4JA 4W4LA 5J2TA 4X62B 3ZHTA 1FJGO 3QF7A 4MW8A 1CP9A 2A0LA 2DW4A 1YJ9V 5C93A 4DV3B 1T5EA 5FPRA 4FJCC 1AB3A 1BL8A 1IURA 1Y4MA 2GV9A 2EBOA 1YIJV 1OCRB 2YEVA 3GWKC 4O4IB 4KXRA 5ITZA 4MTOA 1HNWO 4J11A 5KX5B 3WFVA 3SJCC 1SQBH 5LMUO 3CS5A 4PDMA 3AG1C 2QWNB 1FJGB 1ZL8B 1HWYA 2KKWA 5LA6B 1XL6A 1HNZO 1QBZA 3ZMVA 3VOUA 4MVSA 3LSSA 2ZXWC 1VEWA 4NXMO 4X20A 4DYLA 3BY6A 4X1IA 4HZ3A 3E8BA 3K0DA 5IT9N 4ZHQB 1FFXB 4QGPA 3ABLB 1HNWB 4I50B 5EC2C 1OHHG 5LMUB 4GLXA 5BZBA 1Q81W 3OTOO 1YDXA 1M9NA 4GX2A 1DF5A 5DEDA 3SPJA 1HNZB 3WB0A 5LXTA 1OJHA 3HKCA 3QG5A 4J80A 4H37A 4NR1A 4PA6A 2IU0A 3CC4V 2RQ6A 4UCRA 4X8AA 5LP6B 4NXMB 5CB4B 2DQ0A 4MSWC 3ZIAG 3UO3A 2P06A 1NVPD 2Y0IA 1CPYA 2LW1A 1YZBA 3N2KB 5CA1B 1CXZB 1BSMA 2QE7G 1F23A 3CEIA 1WB7A 5KLVH 3OTOB 2E3CA 3L73H 4O2BA 5GTHZ 3H9VA 1S77D 2RN9A 2UUAO 4BIOA 2NR5A 5KA5A 2ZIOA 3OR6C 3EXAA 2ADQB 2UUCO 3ABKC 3NR7A 3R66A 1IDSA 4PA4A 4A5UB 1ZLZA 2IU3A 2HR3A 1UJWB 2ZT9B 3FB8C 3LUTB 2XAQA 1I0HA 2Q6AA 4X65O 3SJQC 2LGQA 1Y6XA 1WLEA 3G71V 2WLLA 3CX5F 2DYRB 3L72H 1A32A 4PI2A 1Y74B 2GUZA 5CA0A 1GH6A 4DK1A 4WF9V 3LNMB 2WWWA 4YHHO 3ZRWA 3KZIZ 1Y76A 3A2FA 3K03A 2AW9A 2UUAB 1NR1A 5IJ9A 4QE7A 4GX0A 1PPJH 2UUCB 5B5EZ 2AZ0A 2EJRA 5L3EA 4NYKA 2ITDC 1GM9A 4X65B 3JATB 5IWAO 2YIAA 3CCRV 1KKCA 3H1IH 4ZBMA 4YJ3B 2CGNA 3JCZA 1EN6A 1Z5WA 3IJ4A 1K97A 1OCZB 4YHHB 4R50A 1FXKC 3HKEA 3QO7A 3IAYA 3LSQA 1K73W 1LUVA 2RJZA 1TA8A 1N4CA 4CS4A 1Q86W 5KMGB 3SDLA 3E8GA 4H13B 2K1EA 2ZINA 2PI5A 3L75H 3ICXA 4IT5A 4HNAA 3WU2Z 1OCOB 3M8AA 5B1BB 5IWAB 3K59A 4UCOA 1KUQA 1J5EO 1ZAUA 1M4UA 3W7SA 3FFQA 3CCSV 1YJWV 3IGAC 3C90A 3SPGA 5J2TB 4G2KA 1SQQH 4B7EA 3K3WA 1MG1A 2P5OA 1I08A 3GVMA 2DQ3A 1LUWA 1SA0A 2FB5A 2F23A 4FM0A 1K3EA 1K9MW 4GYCB 4LC1A 2GTAA 1QLEC 3HPLC 3LDEA 1MOFA 2F43G 2CTWA 3THOA 1XMOO 2M6YA 1K33A 1N8RW 1YEWA 2R70A 2YEVB 1M5IA 4QJFB 4P9OA 3K5LA 1VQPV 2Q5ZA 3TXQA 5ITZB 3JAWA 1S5JA 2KG7A 1DTOA 1VIBA 3AK1A 1XQ8A 3L9DA 4F6RB 3CRQA 1VF7A 1SKVA 4LF7O 1S5LZ 4L8JA 1K8AW 2HJFC 4LF4O 1JQ0A 1K7DA 3WG7B 4K35A 4PJ0Z 5JJNB 4JI6B 1URFA 1XMOB 1PKXA 2W0XA 3D3QA 4U7NA 4X20B 4CH5A 2DYSC 1I5YA 4X1IB 1H38A 1K92A 5EC1C 4H0LB 1Q8IA 3E83A 4H33A 4NKGB 1AI6A 1TUEB 5L3DA 1BHAA 3RBZA 1PNLA 1X4TA 4LF7B 2YI9A 5LXTB 2XUMA 3HKCB 4LF4B 2AHYA 3S3XA 5A9GA 4QE9A 2HG5C 3JARA 2XTAA 5JJEB 2OTJV 4WFEA 5BY1A 1V55C 1JFFA 1R6NA 3GB7C 4ABMA 3HKDA 1GK9A 4FLXA 2WA3A 3CCMV 4Q6GA 2XAJA 3LDDA 2DOSA 3LNNA 2EIMB 1BHBA 4OX9O 3DSQA 2QM4A 1W0KG 1FXKA 3TK1A 1AR4A 2IBZH 4DUZO 2N05A 1EN5A 4J9YB 3OUFA 1JA8A 2A3QA 1SQGA 1V9PA 4LWSA 5JCOC 3CXCU 1H2GA 2PZSA 4J42A 2F93B 3K9AA 3K0GA 3JSNA 2NLJC 1Q5OA 2WLLB 2CGOA 4P9PA 3CB2A 3HR0A 5KHHA 3ASOB 4U7OA 4DV1O 4DV4O 2GUZB 5CA0B 1Q82W 1IBLO 3CP1A 1OCCB 3IC9A 4OX9B 2PF4E 3CXHF 1RM1C 1HP8A 3ZRWB 1Y76B 4G28B 1GM7A 3RVYA 4X1YA 2IJJA 5IJ9B 1BE3H 5EBLC 1SS3A 3VQVA 3ZHRA 2N04A 3APOA 3OT7A 2IH3C 4QPJA 1VF5B 4MTFA 1NBMG 4LFCO 2X7RB 2Z5UA 3QO5A 1GTOA 4GKJO 3RFRA 2MW2B 4B7KA 2LFRA 3CC7V 1Y67A 4DV1B 4DV4B 4D7TA 4FM2A 1IBLB 2X6CA 3OW2U 3MHHC 1H2MA 3HKEB 4DRXA 3SYCA 3AG1B 2BSKA 3RYFA 2FMLA 1MABG 2OCCC 2N74A 3JAKB 2P4KA 2Z3YA 4AILC 2AHZA 5KUMA 2XAGA 5CBGA 4HNAB 2ILMA 2QKAA 3FKSG 4UB8Z 2EJ7A 2ZXWB 4LFCB 1M57C 4GKJB 2CDYA 3MHSC 2OIEA 3AG3C 3JD3A 1YTFB 5JWPA 3BFRA 5L3BA 4NTXA 3SYAA 3W7UA 1O9GA 3JSLA 3EHBB 4J41A 4YIOA 3CCVV 2B9ZA 1VMGA 1NKDA 2YI8A 5A2QN 2C2AA 2E5LO 1PL0A 3T4DA 4GX1A 2YUAA 4KUMA 3B8MA 1J95A 1B04A 1SA0B 4PELA 1FYJA 4DR6O 1AI7A 4NTYA 1QR9A 4JPRA 2WSSG 3A0BZ 2HFEC 3JD0A 1AR1B 1VQOV 2P6JA 5IE9A 1F4NA 2GHYA 1BT8A 2YDEA 2OWOA 3X2QC 4JI5O 1OV9A 1XUQA 2KG7B 4DR2O 4I4TA 1QR8A 1W2BU 1G8MA 1N36B 2E5LB 3UKMA 1XDCA 3K9SA 1N0NA 2WLNA 2QKSA 4PD4F 4DR6B 2JGUA 1K5SA 3ABKB 2XAHA 4R6ZA 3DC5A 1XEQA 2R9IA 5JCOA 2H94A 4CS2A 1R3LC 1IBMO 4I0XA 2ZE7A 3G80A 2IW5A 4JI5B 4DR2B 1FD9A 5L3FA 4XDJA 4UVCA 4JYBA 2ZKOA 3UT5A 5IJ0A 3BHPA 4YJ2A 3H1HH 2QDOA 3J81N 1K5QA 2Q4PA 2EIJC 2EULA 3J80N 3C3TA 4ZIBA 4RQEA 3ZMUA 3ABUA 4PHZA 4AI8A 1Q6HA 3JARB 2K9PA 4EFBA 1YI2V 1UPGA 1PNKA 4J7JA 4UV9A 2VQFO 1IBMB 3CMAV 3KKYA 4FZ0A 3P32A 3S3WA 4RAIA 1JFFB 1BGYH 3APQA 1PL4A 2WLMA 3U11A 3UQ8A 3DXRA 1X59A 1YTFD 3E22A 2O57A 4FFBA 3G67A 3CJHA 2ZR2A 2RDCA 4ASUG 4AQYO 4I55A 1P7BA 4UCVA 1FXKB 1V54B 4EB6B 4FMTA 1ZX3A 5L3GA 1WA8A 1WPBA 3AG2C 2ZR3A 4JI2O 3CPWU 4PDRA 4NVPA 4UCTA 4LWSB 3JAMN 1GN4A 5C8YB 4YIPA 4BW5A 3CRAA 2VQFB 2JK5C 4K0KO 4RQFA 3P30A 3K04A 3CHXA 4B3TO 1PP9H 3BEHA 1AI4A 4QNHB 1XNQO 4U3JB 2L35A 4AQYB 1QVGU 5HFMA 4MT8A 4UXNA 4H44B 4X1KA 1KC8W 1IVSA 2DJVA 1KD1W 3T1HO 5JQGB 4X1YB 1SQFA 2ZNIA 1HNXO 4JI2B 3QVNA 1WJZA 1WP8A 1SF9A 2AGAA 4MS2A 3ZMTA 3N2GA 1BZKA 3W7XA 1N33O 1DGSA 4K0KB 5K1PA 2BOBC 3EFFK 4RO2A 4B3TB 4F6EA 4CH4A 1XNQB 5LBQA 4B3MO 1S72V 4UV8A 2X6BA 1GKFA 5KA6A 4I7ZB 1KBHA 4DRXB 2LO1A 3T1HB 3KCYA 1ZUQA 2BSKB 3DTUB 5BMVA 5KHIA 1QCEA 4GUNA 1HNXB 3RYFB 4DV7O 3L70H 4BIZA 1GMGA 4TV9A 1VQMV 3BAAA 3ZMZA 3B40A 4FLYA 4GKKO 4WFBV 4IHJA 1H2KA 2LGWA 2VWKA 4FLVA 1N33B 4L87A 1COWG 5B66Z 1SQVH 1WPXA 2JDIG 3VQYA 4DV6O 4GCZA 2DYSB 2DN9A 4B3MB 5B3SC 3I56V 5AG2A 4P2ZA 5EBWC 2QKCA 2Q0AA 4JYCA 4DXWA 4JI8O 4J7KA 1ZWIC 1I94B 3RWRD 1UFIA 4DV7B 5FNVA 1XBLA 1YVWA 5EYPA 4DW1A 1ZSPA 2VQEO 3ZHQA 1AR5A 1Q3EA 1EM1A 2V1DA 4DV0O 2D3OW 4LF8O 4GKKB 3JD2A 3RYIA 1LNQA 1KECA 2M7WA 4DV6B 1HDJA 3B77A 3CWBH 1B06A 4JAVA 3JASB 1V55B 3F7VC 4MW3A 5CN0A 2WLHA 2BTOA 1AJQA 3ZHSA 2AZ2A 1Z5VA 4JI8B 3CRCA 2EX3A 2NNUA 4FFKA 3G4SV 2AXTZ 1H8HG 2OCHA 2HVKC 2VQEB 2CUGA 4DV0B 2W6IG 4LF8B 5J2UA 2QSAA 4K8ZA 1OZ0A 2IM9A 2WPDG 1TUBA 4UCSA 2CTPA 3AEIA 1D5AA 4MVUA 4EFEA 1VQLV 3VQXA 4I0XB 2F4VO 4ZI7A 4O4JB 5GONA 5EIBC 5L3CA 1MZEA 2XOKG 3ABLC 3OFNG 4FLZA 3D3IA 3BA8A 2QWRB 1RM1B 3BVOA 5IJ0B 4YJ2B 3K08A 2H3OA 3T1CA 2ZE6A 4PDVA 2CTQA 1SC5B 4DW0A 1NI8A 3G6EV 3MAQA 1K34A 3D36A 1M93A 1J5EB 4FLWA 3G6BA 4O4HA 1VQ7V 2F4VB 1M56C 2JS3A 2B1GA 1XL4A 5EZYA 1JJOA 2FTKA 1Q7YW 3DXRB 3E22B 4FFBB 3CJHB 2DE0X 1JPXA 3M99B 4CC6A 2W6JG 1I94O 3SPIA 1IX9A 2F66C 3T4ZA 1JOYA 3E8FA 3OUSA 3ZN1A 1I7FA 1WA8B 5TISZ 3OE7G 2OCCB 2EIKC 4JYYA 1AVMA 5DECA 5JVDA 1YITV 1VARA 2HP8A 2MK3A 4E2LA 4TQFA 2A79B 3ZX6A 1SETA 1M57B 1F7YA 4QPKA 4O2AA 2VWJA 2EZOA 1SRYA 2JJ2G 3OGIB 3AG3B 1YHQV 4JTCB 3QTCA 5IYZA 4PDLA 1DK1A 3STZC 2WLJA 2KB1A 4YXWG 4X1KB
chains in the Genus database with same CATH topology
2JRIA 2DOSA 1G1XB 4B3SO 4B3MO 2HHHO 1A32A 3J81N 4OX9O 3J80N 1HNZO 4DR5O 4DR4O 4DUZO 4X66O 1XMOO 4JYAO 1XNRO 4JI4O 2F4VO 4YHHO 1N32O 4JI7O 5BR8O 4DV7O 5A2QN 2VQFO 4NXMO 2E5LO 3RT3C 4X62O 3T1YO 4GKKO 1X59A 4JI3O 5IT9N 1NS1A 1FYJA 1R6TA 4LF6O 4DV1O 4DR6O 4DV6O 4AQYO 4DV4O 2UXCO 2LW7A 1IBLO 5IWAO 4OPHA 4LF7O 3OTOO 1D2DA 4LF4O 4DV3O 2FKXA 5BXZA 5LL6Y 4JI2O 4LF5O 3J7AU 4OPAA 4JI8O 3JAMN 4X64O 2UU9O 4JI5O 4DR2O 2Z0AA 1N34O 5FLXN 4DV2O 2UXDO 3F5TA 5H5NA 4DR3O 4K0KO 2VQEO 4LF9O 2ZM6O 4B3TO 1HR0O 3SDLA 4DV0O 4LF8O 4LFCO 1FJGO 1YZBA 1I94O 4LFBO 1XNQO 4DV5O 4GKJO 4DR7O 4LFAO 4JI1O 4KHPO 1FKAO 3M8AA 2DJVA 5LMNO 1XEQA 3T1HO 4JI0O 1IBKO 1AB3A 1HNXO 4DR1O 3O65A 1IBMO 1KUQA 2UUAO 4JI6O 1J5EO 4YY3O 2UXBO 2AGAA 1F7YA 2UUCO 3R66A 2N74A 4A5UB 5BY1A 1N33O 1HNWO 1XMQO 1N36O 4JV5O 4B3RO 4NXNO 5LMUO 1DK1A 1R1BA 4X65O 2ZKOA 2UUBO 1AILA 4DUYO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRI A;  2DOS A;  1G1X B;  4B3S O;  4B3M O;  2HHH O;  1A32 A;  3J81 N;  4OX9 O;  3J80 N;  1HNZ O;  4DR5 O;  4DR4 O;  4DUZ O;  4X66 O;  1XMO O;  4JYA O;  1XNR O;  4JI4 O;  2F4V O;  4YHH O;  1N32 O;  4JI7 O;  5BR8 O;  4DV7 O;  5A2Q N;  2VQF O;  4NXM O;  2E5L O;  3RT3 C;  4X62 O;  3T1Y O;  4GKK O;  1X59 A;  4JI3 O;  5IT9 N;  1NS1 A;  1FYJ A;  1R6T A;  4LF6 O;  4DV1 O;  4DR6 O;  4DV6 O;  4AQY O;  4DV4 O;  2UXC O;  2LW7 A;  1IBL O;  5IWA O;  4OPH A;  4LF7 O;  3OTO O;  1D2D A;  4LF4 O;  4DV3 O;  2FKX A;  5BXZ A;  5LL6 Y;  4JI2 O;  4LF5 O;  3J7A U;  4OPA A;  4JI8 O;  3JAM N;  4X64 O;  2UU9 O;  4JI5 O;  4DR2 O;  2Z0A A;  1N34 O;  5FLX N;  4DV2 O;  2UXD O;  3F5T A;  5H5N A;  4DR3 O;  4K0K O;  2VQE O;  4LF9 O;  2ZM6 O;  4B3T O;  1HR0 O;  3SDL A;  4DV0 O;  4LF8 O;  4LFC O;  1FJG O;  1YZB A;  1I94 O;  4LFB O;  1XNQ O;  4DV5 O;  4GKJ O;  4DR7 O;  4LFA O;  4JI1 O;  4KHP O;  1FKA O;  3M8A A;  2DJV A;  5LMN O;  1XEQ A;  3T1H O;  4JI0 O;  1IBK O;  1AB3 A;  1HNX O;  4DR1 O;  3O65 A;  1IBM O;  1KUQ A;  2UUA O;  4JI6 O;  1J5E O;  4YY3 O;  2UXB O;  2AGA A;  1F7Y A;  2UUC O;  3R66 A;  2N74 A;  4A5U B;  5BY1 A;  1N33 O;  1HNW O;  1XMQ O;  1N36 O;  4JV5 O;  4B3R O;  4NXN O;  5LMU O;  1DK1 A;  1R1B A;  4X65 O;  2ZKO A;  2UUB O;  1AIL A;  4DUY O; 
#chains in the Genus database with same CATH topology
 4ZOL A;  2EIL B;  2XAF A;  4MVQ A;  1H2L A;  3RVZ A;  3AK3 A;  4DR5 O;  1R73 A;  1EN4 A;  5B1N A;  4G27 B;  5JH7 A;  1N32 O;  3B8N A;  1QQC A;  3N2G B;  3CE2 A;  2EIN C;  3ZMS A;  4RUF A;  1E79 G;  5LYJ A;  3T1Y O;  3ETQ A;  4FK5 C;  3FYE B;  3JCU Z;  3ABT A;  2BCC H;  3FD9 A;  1R6T A;  4O2B B;  2KQX A;  1TVK A;  3X2Q B;  4BAY A;  1P4R A;  4MVM A;  5BMV B;  1MSW D;  2P4V A;  5LL6 Y;  4DR5 B;  2BE3 A;  4LF5 O;  2OYQ A;  4TV9 B;  3J7A U;  3OD4 A;  4XDL A;  3OTF A;  1N32 B;  2PY5 A;  5FLX N;  2WAM A;  4IHJ B;  1EBO A;  3RN4 A;  3E89 A;  4JZG A;  1HR0 O;  3T1Y B;  4JTD B;  4TOI A;  4UFZ A;  4DR7 O;  4K3A A;  1H8E G;  2W0F C;  3OR7 C;  1KYO F;  4JI1 O;  4DUZ B;  1E1R G;  1YCI A;  1FFX A;  2ODM A;  1KB9 F;  1IBK O;  1WB8 A;  1DF4 A;  3AG4 C;  2VS0 A;  3CYO A;  4KP4 A;  1XIL A;  2HKO A;  5FNV B;  3DGE A;  3CC2 V;  2NN4 A;  1FFT B;  4YY3 O;  5EYP B;  2QWQ B;  2EIJ B;  3CRM A;  1QHT A;  1RPR A;  1NR7 A;  3JAL A;  2A06 H;  1M1K W;  1WN7 A;  3AG7 A;  1HR0 B;  1JR9 A;  4NTW A;  4X89 A;  3L71 H;  3FYI B;  1P49 A;  2QJ1 A;  4JF3 A;  4DR7 B;  5H2F Z;  5J9P C;  2RMK B;  4JI1 B;  4TUY A;  4DK0 A;  1IXM A;  4Z2W A;  3N2K A;  5B1A C;  3UCS C;  1IBK B;  2BOC C;  2UXX A;  2DWD C;  3I5D A;  4YY3 B;  1EZJ A;  4JAS A;  3CCU V;  2CK3 G;  3AG2 B;  1I5X A;  4I9Q A;  3SPC A;  3K06 A;  5J2U B;  3B09 A;  4BW9 A;  1TUB B;  1VQ5 V;  4NB5 A;  3E8H A;  3RYC A;  2QEX V;  2PYL A;  2QGN A;  3U0Z A;  4ZI7 B;  3TXS A;  4WFH A;  4BIU A;  1F51 A;  5GON B;  1JMK C;  1BMF G;  1LR1 A;  2JEU A;  3EVK A;  1R3I C;  4X64 O;  3K5O A;  2UU9 O;  4XDK A;  5DN6 G;  1KU9 A;  1L0N H;  3OMI B;  3ETD A;  1P7G A;  2Y4T A;  5H6R A;  5CMU A;  5LGU A;  4LR3 A;  1IXB A;  3TCU A;  4LBE C;  2YS8 A;  5IYC O;  4TT3 G;  3FX7 A;  2QM7 A;  4Z1M G;  5LMN O;  3RYH A;  4JI0 O;  3JAW B;  4PI0 A;  4O4H B;  1O9H A;  4LH7 A;  1G4Y B;  5IY5 C;  5EZY B;  1VQ4 V;  2ZDI C;  3SPH A;  2DMX A;  4X64 B;  2UU9 B;  3SR2 C;  5LHH A;  1KQS U;  2XHB A;  1NU1 H;  2IJK A;  4HAM A;  4EEQ A;  2DWE C;  2HVJ C;  4KL1 A;  3CCE V;  1RP3 B;  2P90 A;  3K79 A;  1AIL A;  5JVD B;  2OT5 A;  5KMG A;  4DO2 A;  2PI4 A;  1E1Q G;  5LMN B;  2JS5 A;  5HFL A;  4JI0 B;  4JI4 O;  3M7M X;  1N0J A;  3U10 A;  2EZP A;  2Q67 A;  2YXL A;  4CC5 A;  1NT2 B;  2IJH A;  4PA3 A;  4UVB A;  3ZED A;  5FPO A;  3RT3 C;  4W4K A;  2RNB A;  5B3S B;  3HB3 B;  5IYZ B;  1BQZ A;  4ZKI A;  1XRE A;  1VQN V;  4JI3 O;  2Y69 C;  2Y48 A;  1NS1 A;  1GN3 A;  3Q4H A;  5EK0 A;  4CH3 A;  2UXC O;  4JAU A;  5IDJ A;  1FS0 G;  3OMN B;  4E4E A;  5JH7 B;  2XAS A;  5H6Q A;  5KHG A;  1H2S B;  4P30 A;  4JI4 B;  3HKD B;  5LYJ B;  3F5T A;  5CBH A;  1XOU A;  4I5S A;  4X88 A;  1TVK B;  1WAZ A;  3OEH G;  4Q20 A;  5CA3 A;  3O9O A;  4JI3 B;  1NTZ H;  4LFA O;  1BCC H;  2UXC B;  2B5U A;  1RSO A;  4MTG A;  1FXV A;  3ZS8 C;  4IGG A;  2Q8V A;  4QIW F;  2P7T C;  3QNE A;  1GM8 A;  2A9H A;  4F6R A;  1MSD A;  3E2E A;  3ABM C;  2YIB A;  3H1K H;  4OGQ B;  3F5W C;  1VQ6 V;  1KP3 A;  4PA9 A;  1ROP A;  2QWP B;  4FPP A;  3K57 A;  1K4C C;  4IYI A;  1L8D A;  4PA7 A;  1JCH A;  4FZ1 A;  2OTL V;  1S0V A;  5KHJ A;  1PD3 A;  2YID A;  3MDS A;  1SES A;  3FAV A;  3OAA G;  3ZBH A;  4LFA B;  3K58 A;  4JYA O;  1BS3 A;  1YSC A;  3D36 C;  3A8T A;  3N27 A;  4B08 A;  1QLE B;  3ASN C;  1VQ9 V;  1WP7 A;  1R3K C;  2R72 A;  3JAL B;  5F2V O;  4HBN A;  4JGS A;  1AP6 A;  1Q90 D;  2Y4U A;  3ZHU A;  4UVA A;  1G6U A;  1KKD A;  2LW7 A;  1M56 B;  3P3P A;  1TAE A;  4LP8 A;  4OXS A;  5KAI Z;  4TUY B;  3MD0 A;  2ZDI A;  5BXZ A;  3PJS K;  5H9C A;  1GRJ A;  4CH6 A;  4UUJ C;  4JYA B;  3JD4 A;  4MVR A;  5IYD O;  1W59 A;  2ARH A;  4DV2 O;  4WCE V;  3VBB A;  2EIK B;  2F1M A;  3ZRV A;  1VF6 C;  1RFY A;  2PTM A;  3FB7 C;  4LFB O;  1K4D C;  3RYC B;  1GO3 F;  1AP5 A;  1L0L H;  2LQT A;  1IZ3 A;  2E75 B;  4ICG A;  3CD6 V;  2WA4 A;  4TV8 A;  2JEX A;  4PV1 B;  2ZNJ A;  2V4D A;  1KP2 A;  3O65 A;  3K5M A;  4J9Z B;  3I55 V;  3UO2 A;  4KFM A;  3ETE A;  3KCX A;  1VP7 A;  2ZCE A;  4MVO A;  1GN6 A;  4DV2 B;  2JGD A;  1ENV A;  4TQD A;  2CH7 A;  1OCR C;  4LFB B;  1Q6I A;  1NZ6 A;  3SJB C;  2EIN B;  3RYH B;  1QVF U;  4XBF A;  2RCV A;  1SQX H;  4WFG A;  3IC7 A;  3B2E E;  4FVM A;  3QO8 A;  4I4T B;  4AHC A;  2LP7 A;  3FB6 C;  2WLI A;  1XNR O;  1MZF A;  2XT9 A;  5LHI A;  4JI7 O;  4CS3 A;  2GDS A;  1PV0 A;  5EIB D;  1Q6U A;  1RPO A;  1V54 C;  2Y0P A;  5LHG A;  4CBC A;  2XND G;  4LH6 A;  4LF6 O;  4JTA B;  2YC0 A;  3JAK A;  3NXS A;  4FM1 A;  1D2D A;  1KMI Z;  1U96 A;  2IH1 C;  4R7C A;  2QR4 A;  1NTM H;  4GX5 A;  1VQK V;  4CZZ A;  3A0H Z;  1SQP H;  1XNR B;  4JI7 B;  4IIJ A;  1QU7 A;  1N34 O;  3UT5 B;  4DR3 O;  5DM6 V;  4FIP C;  3Q4H B;  4LF9 O;  3CME V;  2ZE5 A;  3TGU H;  3AG4 B;  1QNM A;  3K5N A;  4DV5 O;  4F4L A;  1H2N A;  2Q69 A;  3ZJZ A;  4LF6 B;  3JD1 A;  3FB5 C;  2P22 C;  4KHP O;  3H1L H;  5LP6 C;  2ADP A;  2FL4 A;  5KUK A;  3F7Y C;  4J7Z A;  5LOV A;  4EKW A;  3P3N A;  3R65 A;  1NH2 B;  4JI6 O;  2JVD A;  2YXH A;  3DC6 A;  5E79 Z;  1AJN A;  2CTR A;  4FLU A;  1M90 W;  4I55 B;  4D7S A;  1N34 B;  1EZV H;  3L74 H;  4DR3 B;  2OIG A;  2QM8 A;  3E35 A;  4B3R O;  4O4L A;  5B1A B;  4LNU A;  4LF9 B;  1PNM A;  3SYP A;  2VRZ A;  2JRI A;  1RSO B;  4DV5 B;  1G1X B;  3CCQ V;  2HHH O;  2HLD G;  2LJ2 A;  2X0L A;  2E74 B;  1B6Q A;  4KHP B;  4DR4 O;  3HKB A;  1BQ0 A;  4WBN A;  1R6K A;  1SER A;  4C7U A;  1VF6 A;  2BTQ A;  4I9W A;  1L1F A;  1YXB A;  2DYR C;  2QWO B;  2Q0O C;  2Q68 A;  1WNS A;  3SGI A;  1FPO A;  3FAV B;  2PGG A;  4X9Q A;  4B3R B;  1W0J G;  4K8X A;  2G38 A;  1QLN A;  5IYB O;  2GTS A;  3ZCC A;  3JYC A;  1YJN V;  2ITC C;  4OPH A;  2QTS A;  1ZTE A;  2HHH B;  2Q7G A;  2FKX A;  1XHZ A;  4JZ2 A;  5EBM C;  4DR4 B;  4BR6 A;  4N23 A;  3TET A;  2H8P C;  2P67 A;  5H5N A;  2B1I A;  1FXH A;  1MA1 A;  3CCJ V;  4O4I A;  4TSF G;  2UXN A;  5LGT A;  5IY5 B;  1Q43 A;  5KX5 A;  1OCZ C;  3T2M A;  2GBO A;  2JJ1 G;  4IYH A;  2ZQM A;  1U97 A;  2ETN A;  1ZL8 A;  1S5H C;  5LA6 A;  2Q7H A;  4JAA A;  5LGN A;  3IFX A;  4DR1 O;  5KHK A;  1GAX A;  4EB6 A;  1FAF A;  3D8C A;  2UXB O;  4BWA A;  1OCO C;  5B1B C;  4N21 A;  4RUE A;  2YXY A;  1P84 F;  5C8Y A;  4NXN O;  3LSU A;  1NH2 D;  2E76 B;  4ZHQ A;  1NQT A;  2YIC A;  3AK2 A;  4WFA V;  4I50 A;  1JX9 A;  4TV8 B;  4FLT A;  1S76 D;  3SYO A;  1ORQ C;  1Y66 A;  3SJA C;  2WLK A;  1AI5 A;  1DLB A;  4UB6 Z;  4LF5 B;  1SZX A;  5B1O A;  1ARO P;  2Y69 B;  4U3J A;  2ATK C;  3SYQ A;  4TWK A;  4DR1 B;  4WFF A;  3RYI B;  4UCU A;  2UXB B;  4D6T H;  5JQG A;  2JGD B;  3WB1 A;  5GW7 A;  3ZRS A;  5LP6 A;  2YIB D;  2CH7 B;  2Q9L A;  5CB4 A;  3UM7 A;  3CCL V;  1Z2G A;  1JVM A;  4NXN B;  1MMM A;  3OGC C;  2ZE8 A;  1MNG A;  5D5Q A;  2QTO A;  2CAZ C;  5CA1 A;  5JJJ B;  2KSD A;  2R9R B;  2X6A A;  1XI1 A;  2WLI B;  3PN1 A;  5GTI Z;  1XHX A;  4LCU C;  2Q73 A;  3BAB A;  2Q7E A;  3W7T A;  5FL7 G;  2A7W A;  3RGB A;  2FYU H;  2Z0A A;  1CEZ A;  2UXD O;  3LDC A;  3ZN0 A;  1JJ2 U;  3WG7 C;  3E86 A;  3ETG A;  5CBF A;  1NTK H;  2ZM6 O;  3ABM B;  2JIZ G;  5E1A C;  1SZT A;  1FKA O;  4GT1 A;  1NJI W;  2V7Q G;  1Y74 A;  3B4S A;  3H1J H;  3H01 A;  4IL6 Z;  4IIJ B;  3OM3 B;  2ZIM A;  3ZRX A;  3ZHV A;  1TGO A;  2R9A A;  3VQW A;  3KG2 A;  1PM9 A;  4J10 A;  1THZ A;  2UXD B;  1S3J A;  2EIL C;  1XMQ O;  1N36 O;  2L6L A;  4JV5 O;  3TJT A;  1R1B A;  4HYO A;  2ZM6 B;  4Z1V A;  1GN2 A;  3BRC A;  2YSU B;  2UUB O;  3ASN B;  2ZD9 A;  4DUY O;  4B3S O;  2HJD A;  1HW7 A;  5LOV B;  2PYJ A;  3JAT A;  3CRR A;  1F4M A;  4X66 O;  3BPZ A;  1US6 A;  3OEE G;  4U3F H;  2PUS A;  5BR8 O;  1AJP A;  2GSM B;  4YJ3 A;  3BCC H;  2F95 B;  2EIM C;  3ML0 A;  5D5P A;  3JAS A;  4GZR B;  4X62 O;  3C3S A;  4O4L B;  4LNU B;  2QA4 V;  4MVZ A;  4RWU A;  5KAF Z;  3W7W A;  1XMQ B;  3STL C;  4JV5 B;  4MTX A;  3CSX A;  2IJI A;  3RW0 A;  3GWO A;  2UUB B;  4DUY B;  3HKB B;  1B3Q A;  4DV3 O;  4B3S B;  4WBN B;  1R3J C;  4R8C A;  2LFS A;  4O2A B;  1NVP B;  1D5N A;  2CE4 A;  3A0R A;  1VQ8 V;  3WB2 A;  2BTQ B;  4X66 B;  3ASO C;  5K1X A;  4OPA A;  2HEP A;  3OMA B;  5BR8 B;  1OCC C;  2D2C B;  1EFR G;  4ZOL B;  3BA9 A;  1YF2 A;  4O4J A;  4W4L A;  5J2T A;  4X62 B;  3ZHT A;  1FJG O;  3QF7 A;  4MW8 A;  1CP9 A;  2A0L A;  2DW4 A;  1YJ9 V;  5C93 A;  4DV3 B;  1T5E A;  5FPR A;  4FJC C;  1AB3 A;  1BL8 A;  1IUR A;  1Y4M A;  2GV9 A;  2EBO A;  1YIJ V;  1OCR B;  2YEV A;  3GWK C;  4O4I B;  4KXR A;  5ITZ A;  4MTO A;  1HNW O;  4J11 A;  5KX5 B;  3WFV A;  3SJC C;  1SQB H;  5LMU O;  3CS5 A;  4PDM A;  3AG1 C;  2QWN B;  1FJG B;  1ZL8 B;  1HWY A;  2KKW A;  5LA6 B;  1XL6 A;  1HNZ O;  1QBZ A;  3ZMV A;  3VOU A;  4MVS A;  3LSS A;  2ZXW C;  1VEW A;  4NXM O;  4X20 A;  4DYL A;  3BY6 A;  4X1I A;  4HZ3 A;  3E8B A;  3K0D A;  5IT9 N;  4ZHQ B;  1FFX B;  4QGP A;  3ABL B;  1HNW B;  4I50 B;  5EC2 C;  1OHH G;  5LMU B;  4GLX A;  5BZB A;  1Q81 W;  3OTO O;  1YDX A;  1M9N A;  4GX2 A;  1DF5 A;  5DED A;  3SPJ A;  1HNZ B;  3WB0 A;  5LXT A;  1OJH A;  3HKC A;  3QG5 A;  4J80 A;  4H37 A;  4NR1 A;  4PA6 A;  2IU0 A;  3CC4 V;  2RQ6 A;  4UCR A;  4X8A A;  5LP6 B;  4NXM B;  5CB4 B;  2DQ0 A;  4MSW C;  3ZIA G;  3UO3 A;  2P06 A;  1NVP D;  2Y0I A;  1CPY A;  2LW1 A;  1YZB A;  3N2K B;  5CA1 B;  1CXZ B;  1BSM A;  2QE7 G;  1F23 A;  3CEI A;  1WB7 A;  5KLV H;  3OTO B;  2E3C A;  3L73 H;  4O2B A;  5GTH Z;  3H9V A;  1S77 D;  2RN9 A;  2UUA O;  4BIO A;  2NR5 A;  5KA5 A;  2ZIO A;  3OR6 C;  3EXA A;  2ADQ B;  2UUC O;  3ABK C;  3NR7 A;  3R66 A;  1IDS A;  4PA4 A;  4A5U B;  1ZLZ A;  2IU3 A;  2HR3 A;  1UJW B;  2ZT9 B;  3FB8 C;  3LUT B;  2XAQ A;  1I0H A;  2Q6A A;  4X65 O;  3SJQ C;  2LGQ A;  1Y6X A;  1WLE A;  3G71 V;  2WLL A;  3CX5 F;  2DYR B;  3L72 H;  1A32 A;  4PI2 A;  1Y74 B;  2GUZ A;  5CA0 A;  1GH6 A;  4DK1 A;  4WF9 V;  3LNM B;  2WWW A;  4YHH O;  3ZRW A;  3KZI Z;  1Y76 A;  3A2F A;  3K03 A;  2AW9 A;  2UUA B;  1NR1 A;  5IJ9 A;  4QE7 A;  4GX0 A;  1PPJ H;  2UUC B;  5B5E Z;  2AZ0 A;  2EJR A;  5L3E A;  4NYK A;  2ITD C;  1GM9 A;  4X65 B;  3JAT B;  5IWA O;  2YIA A;  3CCR V;  1KKC A;  3H1I H;  4ZBM A;  4YJ3 B;  2CGN A;  3JCZ A;  1EN6 A;  1Z5W A;  3IJ4 A;  1K97 A;  1OCZ B;  4YHH B;  4R50 A;  1FXK C;  3HKE A;  3QO7 A;  3IAY A;  3LSQ A;  1K73 W;  1LUV A;  2RJZ A;  1TA8 A;  1N4C A;  4CS4 A;  1Q86 W;  5KMG B;  3SDL A;  3E8G A;  4H13 B;  2K1E A;  2ZIN A;  2PI5 A;  3L75 H;  3ICX A;  4IT5 A;  4HNA A;  3WU2 Z;  1OCO B;  3M8A A;  5B1B B;  5IWA B;  3K59 A;  4UCO A;  1KUQ A;  1J5E O;  1ZAU A;  1M4U A;  3W7S A;  3FFQ A;  3CCS V;  1YJW V;  3IGA C;  3C90 A;  3SPG A;  5J2T B;  4G2K A;  1SQQ H;  4B7E A;  3K3W A;  1MG1 A;  2P5O A;  1I08 A;  3GVM A;  2DQ3 A;  1LUW A;  1SA0 A;  2FB5 A;  2F23 A;  4FM0 A;  1K3E A;  1K9M W;  4GYC B;  4LC1 A;  2GTA A;  1QLE C;  3HPL C;  3LDE A;  1MOF A;  2F43 G;  2CTW A;  3THO A;  1XMO O;  2M6Y A;  1K33 A;  1N8R W;  1YEW A;  2R70 A;  2YEV B;  1M5I A;  4QJF B;  4P9O A;  3K5L A;  1VQP V;  2Q5Z A;  3TXQ A;  5ITZ B;  3JAW A;  1S5J A;  2KG7 A;  1DTO A;  1VIB A;  3AK1 A;  1XQ8 A;  3L9D A;  4F6R B;  3CRQ A;  1VF7 A;  1SKV A;  4LF7 O;  1S5L Z;  4L8J A;  1K8A W;  2HJF C;  4LF4 O;  1JQ0 A;  1K7D A;  3WG7 B;  4K35 A;  4PJ0 Z;  5JJN B;  4JI6 B;  1URF A;  1XMO B;  1PKX A;  2W0X A;  3D3Q A;  4U7N A;  4X20 B;  4CH5 A;  2DYS C;  1I5Y A;  4X1I B;  1H38 A;  1K92 A;  5EC1 C;  4H0L B;  1Q8I A;  3E83 A;  4H33 A;  4NKG B;  1AI6 A;  1TUE B;  5L3D A;  1BHA A;  3RBZ A;  1PNL A;  1X4T A;  4LF7 B;  2YI9 A;  5LXT B;  2XUM A;  3HKC B;  4LF4 B;  2AHY A;  3S3X A;  5A9G A;  4QE9 A;  2HG5 C;  3JAR A;  2XTA A;  5JJE B;  2OTJ V;  4WFE A;  5BY1 A;  1V55 C;  1JFF A;  1R6N A;  3GB7 C;  4ABM A;  3HKD A;  1GK9 A;  4FLX A;  2WA3 A;  3CCM V;  4Q6G A;  2XAJ A;  3LDD A;  2DOS A;  3LNN A;  2EIM B;  1BHB A;  4OX9 O;  3DSQ A;  2QM4 A;  1W0K G;  1FXK A;  3TK1 A;  1AR4 A;  2IBZ H;  4DUZ O;  2N05 A;  1EN5 A;  4J9Y B;  3OUF A;  1JA8 A;  2A3Q A;  1SQG A;  1V9P A;  4LWS A;  5JCO C;  3CXC U;  1H2G A;  2PZS A;  4J42 A;  2F93 B;  3K9A A;  3K0G A;  3JSN A;  2NLJ C;  1Q5O A;  2WLL B;  2CGO A;  4P9P A;  3CB2 A;  3HR0 A;  5KHH A;  3ASO B;  4U7O A;  4DV1 O;  4DV4 O;  2GUZ B;  5CA0 B;  1Q82 W;  1IBL O;  3CP1 A;  1OCC B;  3IC9 A;  4OX9 B;  2PF4 E;  3CXH F;  1RM1 C;  1HP8 A;  3ZRW B;  1Y76 B;  4G28 B;  1GM7 A;  3RVY A;  4X1Y A;  2IJJ A;  5IJ9 B;  1BE3 H;  5EBL C;  1SS3 A;  3VQV A;  3ZHR A;  2N04 A;  3APO A;  3OT7 A;  2IH3 C;  4QPJ A;  1VF5 B;  4MTF A;  1NBM G;  4LFC O;  2X7R B;  2Z5U A;  3QO5 A;  1GTO A;  4GKJ O;  3RFR A;  2MW2 B;  4B7K A;  2LFR A;  3CC7 V;  1Y67 A;  4DV1 B;  4DV4 B;  4D7T A;  4FM2 A;  1IBL B;  2X6C A;  3OW2 U;  3MHH C;  1H2M A;  3HKE B;  4DRX A;  3SYC A;  3AG1 B;  2BSK A;  3RYF A;  2FML A;  1MAB G;  2OCC C;  2N74 A;  3JAK B;  2P4K A;  2Z3Y A;  4AIL C;  2AHZ A;  5KUM A;  2XAG A;  5CBG A;  4HNA B;  2ILM A;  2QKA A;  3FKS G;  4UB8 Z;  2EJ7 A;  2ZXW B;  4LFC B;  1M57 C;  4GKJ B;  2CDY A;  3MHS C;  2OIE A;  3AG3 C;  3JD3 A;  1YTF B;  5JWP A;  3BFR A;  5L3B A;  4NTX A;  3SYA A;  3W7U A;  1O9G A;  3JSL A;  3EHB B;  4J41 A;  4YIO A;  3CCV V;  2B9Z A;  1VMG A;  1NKD A;  2YI8 A;  5A2Q N;  2C2A A;  2E5L O;  1PL0 A;  3T4D A;  4GX1 A;  2YUA A;  4KUM A;  3B8M A;  1J95 A;  1B04 A;  1SA0 B;  4PEL A;  1FYJ A;  4DR6 O;  1AI7 A;  4NTY A;  1QR9 A;  4JPR A;  2WSS G;  3A0B Z;  2HFE C;  3JD0 A;  1AR1 B;  1VQO V;  2P6J A;  5IE9 A;  1F4N A;  2GHY A;  1BT8 A;  2YDE A;  2OWO A;  3X2Q C;  4JI5 O;  1OV9 A;  1XUQ A;  2KG7 B;  4DR2 O;  4I4T A;  1QR8 A;  1W2B U;  1G8M A;  1N36 B;  2E5L B;  3UKM A;  1XDC A;  3K9S A;  1N0N A;  2WLN A;  2QKS A;  4PD4 F;  4DR6 B;  2JGU A;  1K5S A;  3ABK B;  2XAH A;  4R6Z A;  3DC5 A;  1XEQ A;  2R9I A;  5JCO A;  2H94 A;  4CS2 A;  1R3L C;  1IBM O;  4I0X A;  2ZE7 A;  3G80 A;  2IW5 A;  4JI5 B;  4DR2 B;  1FD9 A;  5L3F A;  4XDJ A;  4UVC A;  4JYB A;  2ZKO A;  3UT5 A;  5IJ0 A;  3BHP A;  4YJ2 A;  3H1H H;  2QDO A;  3J81 N;  1K5Q A;  2Q4P A;  2EIJ C;  2EUL A;  3J80 N;  3C3T A;  4ZIB A;  4RQE A;  3ZMU A;  3ABU A;  4PHZ A;  4AI8 A;  1Q6H A;  3JAR B;  2K9P A;  4EFB A;  1YI2 V;  1UPG A;  1PNK A;  4J7J A;  4UV9 A;  2VQF O;  1IBM B;  3CMA V;  3KKY A;  4FZ0 A;  3P32 A;  3S3W A;  4RAI A;  1JFF B;  1BGY H;  3APQ A;  1PL4 A;  2WLM A;  3U11 A;  3UQ8 A;  3DXR A;  1X59 A;  1YTF D;  3E22 A;  2O57 A;  4FFB A;  3G67 A;  3CJH A;  2ZR2 A;  2RDC A;  4ASU G;  4AQY O;  4I55 A;  1P7B A;  4UCV A;  1FXK B;  1V54 B;  4EB6 B;  4FMT A;  1ZX3 A;  5L3G A;  1WA8 A;  1WPB A;  3AG2 C;  2ZR3 A;  4JI2 O;  3CPW U;  4PDR A;  4NVP A;  4UCT A;  4LWS B;  3JAM N;  1GN4 A;  5C8Y B;  4YIP A;  4BW5 A;  3CRA A;  2VQF B;  2JK5 C;  4K0K O;  4RQF A;  3P30 A;  3K04 A;  3CHX A;  4B3T O;  1PP9 H;  3BEH A;  1AI4 A;  4QNH B;  1XNQ O;  4U3J B;  2L35 A;  4AQY B;  1QVG U;  5HFM A;  4MT8 A;  4UXN A;  4H44 B;  4X1K A;  1KC8 W;  1IVS A;  2DJV A;  1KD1 W;  3T1H O;  5JQG B;  4X1Y B;  1SQF A;  2ZNI A;  1HNX O;  4JI2 B;  3QVN A;  1WJZ A;  1WP8 A;  1SF9 A;  2AGA A;  4MS2 A;  3ZMT A;  3N2G A;  1BZK A;  3W7X A;  1N33 O;  1DGS A;  4K0K B;  5K1P A;  2BOB C;  3EFF K;  4RO2 A;  4B3T B;  4F6E A;  4CH4 A;  1XNQ B;  5LBQ A;  4B3M O;  1S72 V;  4UV8 A;  2X6B A;  1GKF A;  5KA6 A;  4I7Z B;  1KBH A;  4DRX B;  2LO1 A;  3T1H B;  3KCY A;  1ZUQ A;  2BSK B;  3DTU B;  5BMV A;  5KHI A;  1QCE A;  4GUN A;  1HNX B;  3RYF B;  4DV7 O;  3L70 H;  4BIZ A;  1GMG A;  4TV9 A;  1VQM V;  3BAA A;  3ZMZ A;  3B40 A;  4FLY A;  4GKK O;  4WFB V;  4IHJ A;  1H2K A;  2LGW A;  2VWK A;  4FLV A;  1N33 B;  4L87 A;  1COW G;  5B66 Z;  1SQV H;  1WPX A;  2JDI G;  3VQY A;  4DV6 O;  4GCZ A;  2DYS B;  2DN9 A;  4B3M B;  5B3S C;  3I56 V;  5AG2 A;  4P2Z A;  5EBW C;  2QKC A;  2Q0A A;  4JYC A;  4DXW A;  4JI8 O;  4J7K A;  1ZWI C;  1I94 B;  3RWR D;  1UFI A;  4DV7 B;  5FNV A;  1XBL A;  1YVW A;  5EYP A;  4DW1 A;  1ZSP A;  2VQE O;  3ZHQ A;  1AR5 A;  1Q3E A;  1EM1 A;  2V1D A;  4DV0 O;  2D3O W;  4LF8 O;  4GKK B;  3JD2 A;  3RYI A;  1LNQ A;  1KEC A;  2M7W A;  4DV6 B;  1HDJ A;  3B77 A;  3CWB H;  1B06 A;  4JAV A;  3JAS B;  1V55 B;  3F7V C;  4MW3 A;  5CN0 A;  2WLH A;  2BTO A;  1AJQ A;  3ZHS A;  2AZ2 A;  1Z5V A;  4JI8 B;  3CRC A;  2EX3 A;  2NNU A;  4FFK A;  3G4S V;  2AXT Z;  1H8H G;  2OCH A;  2HVK C;  2VQE B;  2CUG A;  4DV0 B;  2W6I G;  4LF8 B;  5J2U A;  2QSA A;  4K8Z A;  1OZ0 A;  2IM9 A;  2WPD G;  1TUB A;  4UCS A;  2CTP A;  3AEI A;  1D5A A;  4MVU A;  4EFE A;  1VQL V;  3VQX A;  4I0X B;  2F4V O;  4ZI7 A;  4O4J B;  5GON A;  5EIB C;  5L3C A;  1MZE A;  2XOK G;  3ABL C;  3OFN G;  4FLZ A;  3D3I A;  3BA8 A;  2QWR B;  1RM1 B;  3BVO A;  5IJ0 B;  4YJ2 B;  3K08 A;  2H3O A;  3T1C A;  2ZE6 A;  4PDV A;  2CTQ A;  1SC5 B;  4DW0 A;  1NI8 A;  3G6E V;  3MAQ A;  1K34 A;  3D36 A;  1M93 A;  1J5E B;  4FLW A;  3G6B A;  4O4H A;  1VQ7 V;  2F4V B;  1M56 C;  2JS3 A;  2B1G A;  1XL4 A;  5EZY A;  1JJO A;  2FTK A;  1Q7Y W;  3DXR B;  3E22 B;  4FFB B;  3CJH B;  2DE0 X;  1JPX A;  3M99 B;  4CC6 A;  2W6J G;  1I94 O;  3SPI A;  1IX9 A;  2F66 C;  3T4Z A;  1JOY A;  3E8F A;  3OUS A;  3ZN1 A;  1I7F A;  1WA8 B;  5TIS Z;  3OE7 G;  2OCC B;  2EIK C;  4JYY A;  1AVM A;  5DEC A;  5JVD A;  1YIT V;  1VAR A;  2HP8 A;  2MK3 A;  4E2L A;  4TQF A;  2A79 B;  3ZX6 A;  1SET A;  1M57 B;  1F7Y A;  4QPK A;  4O2A A;  2VWJ A;  2EZO A;  1SRY A;  2JJ2 G;  3OGI B;  3AG3 B;  1YHQ V;  4JTC B;  3QTC A;  5IYZ A;  4PDL A;  1DK1 A;  3STZ C;  2WLJ A;  2KB1 A;  4YXW G;  4X1K B; 
#chains in the Genus database with same CATH homology
 2JRI A;  2DOS A;  1G1X B;  4B3S O;  4B3M O;  2HHH O;  1A32 A;  3J81 N;  4OX9 O;  3J80 N;  1HNZ O;  4DR5 O;  4DR4 O;  4DUZ O;  4X66 O;  1XMO O;  4JYA O;  1XNR O;  4JI4 O;  2F4V O;  4YHH O;  1N32 O;  4JI7 O;  5BR8 O;  4DV7 O;  5A2Q N;  2VQF O;  4NXM O;  2E5L O;  3RT3 C;  4X62 O;  3T1Y O;  4GKK O;  1X59 A;  4JI3 O;  5IT9 N;  1NS1 A;  1FYJ A;  1R6T A;  4LF6 O;  4DV1 O;  4DR6 O;  4DV6 O;  4AQY O;  4DV4 O;  2UXC O;  2LW7 A;  1IBL O;  5IWA O;  4OPH A;  4LF7 O;  3OTO O;  1D2D A;  4LF4 O;  4DV3 O;  2FKX A;  5BXZ A;  5LL6 Y;  4JI2 O;  4LF5 O;  3J7A U;  4OPA A;  4JI8 O;  3JAM N;  4X64 O;  2UU9 O;  4JI5 O;  4DR2 O;  2Z0A A;  1N34 O;  5FLX N;  4DV2 O;  2UXD O;  3F5T A;  5H5N A;  4DR3 O;  4K0K O;  2VQE O;  4LF9 O;  2ZM6 O;  4B3T O;  1HR0 O;  3SDL A;  4DV0 O;  4LF8 O;  4LFC O;  1FJG O;  1YZB A;  1I94 O;  4LFB O;  1XNQ O;  4DV5 O;  4GKJ O;  4DR7 O;  4LFA O;  4JI1 O;  4KHP O;  1FKA O;  3M8A A;  2DJV A;  5LMN O;  1XEQ A;  3T1H O;  4JI0 O;  1IBK O;  1AB3 A;  1HNX O;  4DR1 O;  3O65 A;  1IBM O;  1KUQ A;  2UUA O;  4JI6 O;  1J5E O;  4YY3 O;  2UXB O;  2AGA A;  1F7Y A;  2UUC O;  3R66 A;  2N74 A;  4A5U B;  5BY1 A;  1N33 O;  1HNW O;  1XMQ O;  1N36 O;  4JV5 O;  4B3R O;  4NXN O;  5LMU O;  1DK1 A;  1R1B A;  4X65 O;  2ZKO A;  2UUB O;  1AIL A;  4DUY O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...