2X7RB

Crystal structure of a late fusion intermediate of hiv-1 gp41
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
43
structure length
43
Chain Sequence
b'MDDDDKMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSMEMBRANE PROTEIN GP41
publication title Crystal Structure of HIV-1 Gp41 Including Both Fusion Peptide and Membrane Proximal External Regions.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 lw12.3 isolate
molecule tags Viral protein
total genus 19
structure length 43
sequence length 43
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2010-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2x7rB00
3B8NA 5HFMA 2P6JA 4JGSA 1I5YA 2EZPA 3B8MA 1DF5A 2EBOA 1Y66A 1ENVA 2OT5A 4JPRA 3K9AA 2X7RB 1K34A 5HFLA 3H01A 4N21A 1QR8A 3GWOA 3M99B 4FK5C 5KA6A 2EZOA 5KA5A 5CN0A 1MOFA 1DF4A 4N23A 2LP7A 1SZTA 4FIPC 1EBOA 2M7WA 1I5XA 2MK3A 1K33A 1F23A 3MHSC 3P30A 4E2LA 1Y4MA 5H9CA 3CYOA 4JF3A 3MHHC 1MG1A 1JQ0A 1QBZA 4G2KA 1QCEA 1DLBA 3WFVA 1JPXA 5CMUA 3B77A 4FJCC 3CP1A 1QR9A
chains in the Genus database with same CATH superfamily
3SGIA 1HNXB 4JI0B 2QM8A 2E5LO 3FYIB 1HW7A 1R3KC 5GW7A 3F5TA 2ADQB 4LWSB 4WCEV 4E4EA 2ZE7A 1DF4A 4TV8A 3A0BZ 1AROP 5B1AB 4DRXB 2HFEC 5E79Z 1YSCA 1UJWB 4AI8A 4JI6O 4MTXA 4P30A 1VQMV 1JQ0A 4DW0A 1R73A 3AG2C 2LFSA 3KG2A 3AG1C 1THZA 3VBBA 3H9VA 1K4DC 3OE7G 3ZRSA 1NH2D 3K79A 1K97A 4DV2O 5B3SB 4NXNO 2UXDO 5L3FA 4PD4F 1LNQA 4NTXA 1Z5VA 1DLBA 4IL6Z 3RW0A 2HHHB 3VQYA 1HNXO 3SJQC 1N4CA 4JI0O 4B3RB 2W0XA 3N2GA 3K06A 4YIOA 4DV4B 2OIEA 3SYOA 4LF8B 1DGSA 5BY1A 5LMNB 4X1YA 4BAYA 1L0NH 1COWG 2Y0IA 1FD9A 5JJNB 2X0LA 3T1HB 4O4IB 5IT9N 5LYJA 4F6EA 2XASA 1EN4A 2DQ3A 2WLIB 3Q4HA 1VQKV 3ZRVA 5EYPB 2CH7B 3EVKA 4RQFA 1AI4A 2QWOB 3ZCCA 3ZMUA 4I4TA 1EZVH 3B4SA 4K8XA 4IHJB 2E3CA 2IJHA 3IFXA 4FZ1A 1BMFG 1YZBA 1E79G 5H6RA 3JARA 2HEPA 5KUKA 4FFBA 2HHHO 3ZN1A 2JVDA 1EN6A 4B3RO 2FL4A 2MW2B 1OCCC 3JYCA 4DV4O 4Z2WA 3AK1A 3ZHSA 3ZMTA 1XOUA 3JALB 2PY5A 5LMNO 4BW5A 3ABLB 2DQ0A 3BAAA 3KCXA 5KAFZ 1Q7YW 1PP9H 3M7MX 3K08A 1YITV 2P90A 4GX1A 1PNKA 4FM0A 5DN6G 1K73W 1N36O 1VQ9V 1Y74A 1F7YA 3L72H 3LSUA 3CJHB 4BIUA 3L75H 3M99B 1KB9F 3WG7C 2H8PC 1SETA 4FM1A 5TISZ 3CCMV 1BT8A 1JJOA 5JCOA 3E89A 2RJZA 4G2KA 3IC7A 5IYZA 3U0ZA 4TOIA 4DV0B 1H2KA 1K8AW 2EINB 5FPOA 3SPCA 2AGAA 3RVZA 5FNVB 1R3JC 2ZIMA 5EIBC 4RUEA 2Q67A 1MZEA 2DMXA 1IBMO 2HJFC 4HBNA 1QLEB 4N23A 4PHZA 3SPGA 2R70A 2Z3YA 1MSDA 3CRMA 4BIZA 3E83A 5LP6A 2EILC 4U7OA 1WB7A 2CAZC 2ZE8A 3EFFK 1XMQB 4DV7B 3BHPA 2EIJC 4X62B 1FFXA 2VS0A 4JI1B 4XDLA 4GX0A 5L3CA 1VQ6V 4K3AA 3CYOA 3PN1A 2Z5UA 4DR7O 4DV0O 2YSUB 4B3SO 4UVAA 5EIBD 3UO2A 3ZEDA 4P9OA 4X8AA 3I56V 1KP3A 2A0LA 3K5OA 1SQFA 4LF7B 2JGUA 3N2GB 3H01A 4J7ZA 1NVPB 1N8RW 3D3QA 4FMTA 1WPXA 3CSXA 1J95A 3AG3B 2CUGA 1IBLB 1SS3A 2LGQA 1M56C 4RAIA 1VQOV 2P22C 1KC8W 1AI5A 2WSSG 2VQEB 4H13B 5LYJB 4DV7O 2X6AA 4F4LA 4F6RB 3OMNB 5JQGA 4PELA 3ZMSA 4X62O 2UXBB 4JI1O 2EIMC 1R1BA 4DK1A 4I4TB 2YIAA 1VARA 2MK3A 3U10A 4KUMA 3D36C 2EULA 3OAAG 3L73H 3JARB 1IXMA 3ASNC 1WP8A 4LF7O 3OW2U 4O4HA 1NTZH 3CE2A 3ASOB 4AQYB 2M6YA 2ZNJA 1VQPV 1F51A 3HKEB 3WU2Z 2GUZA 1I5XA 4R50A 5CA0A 1IBLO 5J9PC 1MNGA 1Y76B 4CH4A 4TSFG 5B1BC 3B2EE 2CE4A 2AXTZ 3J7AU 2YEVA 2VQEO 1BL8A 2HJDA 2JEXA 4L87A 5IY5C 4GKJB 1W0JG 5KAIZ 1SA0B 4I50B 2UXBO 1ZWIC 1R6NA 3AK3A 1Y74B 2DYRC 2LP7A 5L3BA 3CHXA 5CA1A 2B9ZA 5E1AC 4U7NA 5EC2C 3G6BA 4PDVA 3OR6C 3UM7A 4JASA 5KUMA 3STZC 5H5NA 4AQYO 1S76D 3RWRD 5H2FZ 2JGDA 4YXWG 4I0XA 4LNUA 1XNQB 4ZIBA 3K0DA 2Y4TA 5J2TA 2DE0X 4TV9A 1QQCA 4MTFA 1Y4MA 1HP8A 2IW5A 1JFFA 3SJBC 4KHPO 4MVQA 3CCJV 1KMIZ 4R8CA 4GKJO 1GO3F 3OM3B 4DR2O 1CXZB 3WB1A 5LP6B 2UUBB 1MSWD 1TUEB 1JR9A 4WFGA 4HZ3A 3ABMC 5KA6A 3CPWU 3DXRA 1FFTB 1QNMA 1TGOA 3CD6V 2KG7A 1FFXB 4DR4B 5LXTB 1WLEA 3OGIB 4MVSA 2YXLA 4NVPA 3BFRA 1NJIW 1PPJH 4UFZA 5B66Z 1B6QA 1XEQA 1XNQO 2W6JG 3AG7A 3KKYA 3CC4V 1K5QA 1AI6A 1FS0G 1ZSPA 1O9GA 4RUFA 4WFFA 2UU9O 2OCCB 2DYSB 1EFRG 2QDOA 4O2BA 4J41A 1QHTA 3F7YC 3ZHTA 1VQ5V 1FXVA 4KFMA 5IJ0B 5C8YA 2UUBO 3UO3A 3KCYA 2ZDIC 4J9ZB 2HVJC 2R9AA 3L71H 5JQGB 3F5WC 4DR4O 1Q82W 5H9CA 2OWOA 4JI2B 3WB2A 4IT5A 3RYIB 4ZOLA 3QO8A 2P4VA 3K5NA 4O4HB 1SQVH 5HFLA 1F4MA 1NU1H 1XL4A 2IU3A 2F43G 2AHZA 2XAHA 1EBOA 2P06A 1YJNV 1FXKA 3OMIB 3SDLA 4AHCA 1RPRA 1Q6UA 3HKDA 1H2SB 1Q3EA 3B8NA 3CX5F 3JCZA 3W7SA 5KLVH 1J5EB 2XT9A 2D3OW 4MVOA 4N21A 1Q86W 1M5IA 4MW8A 3JAMN 1KQSU 3K5MA 2NR5A 2CK3G 2ZE5A 1QVGU 3LUTB 4WFAV 1S5JA 1HWYA 1NS1A 2JIZG 2X6BA 4JI2O 4FVMA 4DV5B 1BE3H 4AILC 5FPRA 2B1GA 3FKSG 2YDEA 5LHGA 3K5LA 1V55B 4ABMA 1MZFA 1CPYA 4PDLA 4U3FH 1S72V 5JVDB 1K7DA 1PM9A 4I0XB 4LNUB 5EBLC 3SPJA 3G67A 2YC0A 3TXSA 4TV9B 4LFBO 4JAVA 2Y48A 2ZCEA 1KP2A 3T2MA 3ZBHA 1JFFB 3CB2A 1QR9A 1SQBH 1I94B 1J5EO 2GBOA 2AZ0A 1YF2A 1N32B 3C90A 2QWPB 4ZBMA 3H1HH 4MW3A 3HPLC 4I9QA 1NTMH 1UFIA 3DXRB 3AK2A 4DV5O 5K1XA 3RYHA 2Y4UA 2PI5A 3QNEA 2KG7B 2Q0OC 5B3SC 2ARHA 2ZD9A 1FJGB 1MABG 2YXHA 5DECA 1N33B 3CEIA 1YI2V 4I5SA 1JJ2U 5D5QA 1F23A 4B3TB 2QTSA 1MG1A 1SERA 2XHBA 1I94O 1EN5A 1F4NA 3ABUA 5BZBA 3E22A 2JK5C 4GT1A 3LDCA 2ITDC 5BR8O 3K58A 2L35A 5JJEB 3IC9A 3JD1A 1VQNV 4UB8Z 1BHBA 4K0KB 2V1DA 3FB7C 2YI9A 3DSQA 4FLXA 2BTOA 4JYCA 1VQ4V 4MS2A 1ZUQA 4O4JA 2R72A 4RO2A 1VF6C 5HFMA 4FM2A 5CBGA 1FJGO 1ZLZA 1M57B 5LBQA 1JA8A 1IURA 1GN4A 3OUFA 2WLLB 4ZOLB 4D6TH 4LF9B 1N33O 1U97A 3ZRXA 3CCRV 1Y6XA 4B3TO 1OCOB 4UV9A 1FXKB 4GX5A 3ZRWA 2QKCA 4FFKA 3R66A 3ABKB 3HKDB 3TGUH 4Z1MG 5K1PA 4DV1B 4MT8A 5IYBO 2KSDA 4DR3B 3BEHA 4FIPC 1Y67A 4FLYA 1S77D 3A2FA 4TT3G 4LH7A 4Q6GA 2CGNA 2EINC 4LF9O 4X9QA 3A8TA 4PDRA 1IVSA 4O2AA 2XAFA 2Y0PA 4CH3A 4G28B 4I7ZB 4YY3B 3QTCA 1MOFA 3E8HA 1NH2B 3S3WA 4LFCB 2FYUH 2VQFB 4UCOA 2Q68A 1L0LH 1NR1A 1KECA 3SR2C 1HNWB 1E1RG 4PDMA 2IM9A 4WF9V 3TXQA 1I5YA 4K8ZA 1GH6A 5D5PA 2HKOA 2YS8A 4JI5B 4LF8O 3JSLA 4DR3O 5CN0A 3UQ8A 1Q8IA 4DO2A 2ZXWB 3UKMA 1BSMA 4DUZB 3SPHA 1GK9A 4PA3A 1PV0A 3AG1B 4CC5A 3T1HO 1XL6A 2BE3A 1K4CC 3ZHVA 1SQPH 4YY3O 1V54C 3CRAA 2ADPA 1LR1A 5KA5A 3UT5A 4LFCO 2VQFO 2WLMA 1RSOB 3RN4A 4QIWF 4I55A 2EJRA 3BRCA 2XAJA 1HNWO 4ZI7A 4R7CA 2IH1C 1IXBA 3FB5C 3SJAC 4JI5O 3E22B 1G8MA 4LP8A 2F95B 2ZE6A 3GWOA 3TCUA 2EZOA 1NI8A 4DUZO 1E1QG 1SZTA 5KX5A 3TETA 2WAMA 4LBEC 1BZKA 4TV8B 4X89A 5LGTA 2GV9A 1FKAO 4GLXA 2YI8A 3J80N 4O4JB 3TJTA 1DTOA 1DF5A 2QE7G 3D36A 2GTSA 4YIPA 1VQLV 4NTYA 5B5EZ 2WLJA 3W7WA 1SC5B 4FLVA 4IYIA 2Q4PA 1TA8A 1OCCB 3ZMZA 1I7FA 3VQWA 1KUQA 3H1KH 2P7TC 1FPOA 3G6EV 4JGSA 1TUBA 2QWRB 3ZRWB 3I5DA 3HKCA 4YHHB 2ZINA 5IDJA 1YTFB 1QLNA 3QVNA 2JEUA 4A5UB 1K33A 2QM4A 1ZAUA 4TUYA 4X1YB 4WFHA 1RM1B 4JI4B 2JS5A 3A0HZ 1XMQO 5KHJA 4JAAA 3JASA 3Q4HB 1QR8A 4P9PA 4NB5A 1U96A 1MMMA 4UUJC 2P67A 1FXHA 1JVMA 1H8EG 4OGQB 3OEHG 4EFEA 1VQ8V 4MVRA 2AW9A 5B1NA 4FFBB 2XAQA 3FAVA 2EZPA 4WFEA 1H2GA 1FYJA 5IWAB 3OR7C 4YHHO 2R9RB 3TK1A 3JD4A 5L3EA 2UXCB 4P2ZA 2WLHA 3K3WA 1VIBA 3GVMA 3W7TA 1R6TA 3E35A 3T1CA 2LGWA 4R6ZA 2EILB 1AR5A 3O9OA 1D5NA 4ZHQA 3CXHF 2L6LA 5JJJB 3LNMB 1ZTEA 2BSKA 4X20A 3LNNA 5J2UA 2IJIA 2EIJB 4GZRB 3FYEB 2QGNA 4LFAB 4MSWC 5KHKA 4KXRA 3HB3B 2XUMA 3UT5B 1GRJA 1R3IC 3SPIA 2OCCC 1YDXA 5EZYA 2OYQA 2F23A 4MVZA 4DXWA 4J7KA 2WA4A 5JH7A 2F66C 5IYZB 4NYKA 5IWAO 2PYJA 2YUAA 3CCSV 4CBCA 1Z2GA 2UXCO 5EK0A 3VQVA 2RDCA 5GTIZ 4DYLA 4PI0A 2ZDIA 1M56B 5EBMC 1QBZA 1YEWA 1N0NA 2CTPA 5CB4A 2P6JA 1G1XB 5KMGA 4LF5B 3EXAA 2Q7EA 1SQGA 4UVBA 2EIMB 4LFAO 2N04A 1R6KA 3L70H 4TQFA 4X65B 1BHAA 3JATA 3K9SA 4YJ2A 3ASNB 3OEEG 5C93A 3D3IA 3JD2A 4UXNA 1ZL8A 4WBNA 1KKDA 2WLKA 1M93A 3H1IH 1PD3A 5DM6V 1XMOB 3ETQA 1AB3A 3CC7V 2K1EA 2NNUA 2HG5C 1TUBB 2ZQMA 3QG5A 3B40A 3H1LH 3STLC 2QJ1A 4BW9A 4QPJA 1I0HA 2BTQA 5F2VO 2O57A 4TUYB 5B1OA 2DW4A 2IU0A 4LF6B 3IGAC 1BCCH 2DYRB 4BIOA 1JCHA 1OCZC 1BGYH 1V55C 2WA3A 4FLZA 4LH6A 3JASB 5EC1C 4DW1A 2EIKC 5KHIA 1KBHA 3LDDA 2RQ6A 1TVKA 4PV1B 3JAKA 4J7JA 1XMOO 5KHHA 2KQXA 1OCRC 3FAVB 3LSSA 1S5HC 5LA6A 2QKAA 1AP6A 4UCUA 1HR0B 1LUWA 5EBWC 4QE9A 3AG4C 4OPHA 3X2QC 2GUZB 4CH5A 5IYDO 5CA0B 1H2NA 4LF6O 2YIDA 2OCHA 4H33A 3SYQA 3W7XA 2PF4E 2YEVB 4OPAA 5J2UB 3G80A 4X1KA 4X88A 2IJJA 4Q20A 4X1IA 1S3JA 2CDYA 5CA1B 1WB8A 1QCEA 4UCTA 4PA6A 1D5AA 3CP1A 4GCZA 2DWEC 1QVFU 2EJ7A 1AJNA 3K57A 1WJZA 1R3LC 1GKFA 1HR0O 2JGDB 1VF7A 2X6CA 4O4IA 1YIJV 5J2TB 1GMGA 5B1AC 2CGOA 5IYCO 4FLUA 3ABTA 1WAZA 5EYPA 2CH7A 1SESA 3S3XA 1PL0A 3ICXA 4IHJA 5CB4B 4MTGA 5DEDA 5KMGB 1I08A 4ZKIA 5A9GA 3BY6A 1VF6A 3FD9A 1ROPA 2QWNB 4Z1VA 3RVYA 4GKKB 2DJVA 5LGNA 1H2MA 3E8BA 4YJ2B 4XBFA 4JTDB 2R9IA 5ITZA 4UB6Z 1OCOC 4RWUA 3OUSA 3IJ4A 1TAEA 3B09A 1NKDA 3BA8A 2QA4V 1CEZA 5LMUB 2Q7GA 5LL6Y 5BXZA 4C7UA 3CXCU 3ZS8C 3ETGA 3F7VC 3FFQA 1N34B 2RN9A 3CCQV 5LHIA 3QF7A 4O2BB 4FJCC 2P4KA 4QE7A 2PYLA 1N32O 1BS3A 5C8YB 4K35A 4PJ0Z 3G71V 1AP5A 3NR7A 4B08A 2JRIA 3T4DA 2V4DA 2M7WA 4GKKO 4KP4A 2D2CB 4RQEA 5FNVA 1OV9A 2FTKA 3CRRA 1Q90D 1Z5WA 3N27A 1TVKB 3JAKB 4JZGA 4NR1A 5LMUO 1XI1A 4X66B 1N34O 5LA6B 1Q43A 2ZXWC 1SKVA 3ABLC 3DTUB 1EM1A 2YIBD 3C3TA 3THOA 2LW7A 4O4LA 2Y69B 1PNMA 3JAWA 4IYHA 4UCRA 1K9MW 1GN3A 1NZ6A 1BQZA 1W0KG 2A3QA 2IJKA 2CTRA 2ZNIA 1GM9A 4K0KO 1AILA 4X1KB 1H38A 3EHBB 1XHZA 4JI8B 2LW1A 4IIJA 1ORQC 1DK1A 4J10A 3K0GA 4X1IB 1M4UA 3I55V 3CCEV 1AR4A 1EZJA 3L74H 4TQDA 3E86A 5CMUA 1VF5B 3G4SV 4GUNA 3T1YB 2ZR2A 3APOA 3DGEA 2FB5A 2JJ1G 2VWKA 1G6UA 4X66O 2QEXV 4ASUG 1NBMG 2BOBC 1IX9A 4DR1B 4GX2A 1VMGA 1QLEC 4JF3A 1PKXA 3RYCA 1P7GA 2A7WA 4JYBA 1SF9A 1GTOA 2LO1A 2CTQA 4F6RA 2WPDG 3P32A 3ZIAG 1XBLA 4HNAA 2DOSA 1N36B 1HDJA 2PTMA 1K34A 4DV1O 1RFYA 4JI8O 1JOYA 4X64B 3AG2B 1X4TA 3MHHC 3E8GA 3MD0A 3RYHB 1IZ3A 3T1YO 5GTHZ 5ITZB 5GONA 3HKEA 1N0JA 2FKXA 3CRQA 2PI4A 3ZHRA 2OT5A 1WP7A 1IBMB 2K9PA 1Y76A 5AG2A 4DR1O 4CZZA 2ZT9B 4CS2A 2ODMA 2GDSA 3A0RA 2XAGA 2G38A 4IGGA 1Q81W 1VQ7V 1SA0A 3CWBH 4I50A 3VQXA 3AG3C 5LHHA 4DUYB 3CMEV 2B1IA 3MDSA 1RM1C 4FLTA 2N05A 1G4YB 3RFRA 4NKGB 1XHXA 1W2BU 4X64O 1YJ9V 4ICGA 3FX7A 4L8JA 2XOKG 1XILA 4DR7B 2RMKB 4B3SB 4XDKA 3B77A 4CS4A 3JSNA 2ILMA 2Q69A 2H3OA 1X59A 2QTOA 3OD4A 1LUVA 1XDCA 4JI7B 2ZIOA 3CRCA 2Q5ZA 1NVPD 1YTFD 4FK5C 3ASOC 5L3DA 3OMAB 1H2LA 4LR3A 3MHSC 3OGCC 1HNZB 5BMVA 4DK0A 1IDSA 1MA1A 1SQXH 1XNRB 2EX3A 3ETEA 1YVWA 2GSMB 2YICA 4DUYO 2OTJV 1WN7A 4O4LB 2YXYA 4NXMB 1Y66A 1ENVA 2ZR3A 4CS3A 3JAWB 2DN9A 1A32A 1AJQA 3GB7C 4JYYA 5LXTA 4DV3B 4FLWA 1IBKB 3RYFA 5FLXN 2HVKC 2HLDG 2XTAA 4H44B 3SYCA 4IIJB 2XNDG 1JPXA 5CA3A 2V7QG 2QM7A 3LSQA 3CC2V 3ZHUA 1JX9A 1V54B 2UXXA 1PL4A 3APQA 5JCOC 4JI7O 3WG7B 4W4KA 1OZ0A 4YJ3A 2ZKOA 4HYOA 3D8CA 2HP8A 3BA9A 4O2AB 4XDJA 1HNZO 4TWKA 2JJ2G 4E2LA 1XNRO 5IJ9A 5IJ0A 3GWKC 1SQQH 4DR6B 1KKCA 3ZJZA 4H37A 4NXMO 3RYCB 3T4ZA 4EFBA 2EBOA 1GM8A 3ZMVA 3BCCH 2QR4A 5LP6C 4HNAB 1SZXA 2W6IG 1GAXA 1WPBA 4DV3O 1IBKO 1WA8A 2ETNA 2F93B 3ETDA 1M90W 3W7UA 1PNLA 3RYIA 4EKWA 1B04A 2A06H 3N2KA 2FMLA 3MAQA 4DR5B 3UCSC 4FPPA 5A2QN 3P3PA 3CMAV 1AJPA 1GM7A 4QPKA 2OTLV 4JI4O 3IAYA 3K03A 1W59A 2WWWA 3JD3A 1YXBA 3HR0A 5GONB 2ITCC 3JD0A 4JTAB 1P4RA 1P7BA 1VP7A 4FZ0A 4JI3B 4DR6O 1URFA 3BPZA 4KHPB 2DYSC 1S5LZ 2GTAA 3BVOA 4EEQA 3J81N 5JWPA 3QO5A 4I55B 2QWQB 4DR2B 3CCVV 3U11A 4JTCB 4ZI7B 4G27B 1YJWV 4DV6B 4QJFB 4B7KA 4QNHB 2N74A 1KD1W 3P30A 4UVCA 2ATKC 2W0FC 4DR5O 5KX5B 3K04A 4JYAB 4CH6A 5JVDA 3ML0A 1JMKC 2AHYA 2LFRA 5LGUA 4JZ2A 3K9AA 1QU7A 2E76B 1L1FA 1GN6A 5CBFA 4J9YB 1K92A 3SJCC 2UU9B 3CS5A 2BOCC 4J11A 1Q5OA 1KYOF 4W4LA 4JI3O 3SYPA 5IE9A 1D2DA 3RGBA 3K59A 5BMVB 4PA4A 5LOVA 3NXSA 2PUSA 4D7SA 3E8FA 2KKWA 4DV6O 2JS3A 5L3GA 2RCVA 1V9PA 2IBZH 4UCSA 4J80A 2UUAB 1XQ8A 3OTFA 3HKCB 3RT3C 4JV5B 1NR7A 1S0VA 3BABA 4EB6A 5B1BB 4OX9B 1XREA 4JYAO 4KL1A 3RYFB 5IY5B 1UPGA 2RNBA 4B7EA 4LF4B 4LF5O 3RBZA 4B3MB 4JPRA 2DWDC 2UUCB 2X7RB 4JAUA 2H94A 3HKBA 4X65O 3LDEA 4YJ3B 1OJHA 4U3JA 4CC6A 1AR1B 3VOUA 1M9NA 3R65A 2LJ2A 1YCIA 2Q7HA 1O9HA 3OT7A 4PA9A 3FB8C 3FB6C 5IJ9B 1P49A 1Q6HA 1B3QA 3B8MA 4LWSA 3OFNG 4MVMA 2UUAO 3QO7A 3CCLV 3CCUV 4JV5O 3E2EA 4DRXA 1OHHG 4OX9O 1Q6IA 3ZN0A 4MTOA 2HR3A 2LQTA 1WA8B 3H1JH 3C3SA 1RP3B 3JCUZ 3N2KB 3AEIA 2UXNA 2WLLA 4LF4O 2B5UA 4B3MO 1B06A 4ZHQB 2Q9LA 3ABMB 2UUCO 3ZX6A 3O65A 2BSKB 3P3NA 2F1MA 4X20B 4LCUC 5FL7G 2IH3C 4UCVA 2GHYA 2P5OA 4I9WA 1FAFA 3OTOB 4BWAA 3WB0A 2QKSA 5CBHA 1NQTA 2CTWA 4LFBB 1M1KW 1K5SA 4D7TA 1VEWA 4LC1A 1K3EA 1H8HG 5EZYB 4OXSA 5JH7B 2AZ2A 2PGGA 1GN2A 1YHQV 2ZM6B 2BCCH 1AVMA 2YIBA 1XUQA 2OIGA 3DC5A 2WLIA 3WFVA 2PZSA 2WLNA 1SRYA 1OCZB 1NT2B 2NN4A 3M8AA 1CP9A 1M57C 4QGPA 2EIKB 3OTOO 2Z0AA 4HAMA 2JDIG 2C2AA 2VWJA 2F4VB 3PJSK 1US6A 3JATB 2Q6AA 4H0LB 2QSAA 2Q8VA 2VRZA 1OCRB 1L8DA 1FXKC 3KZIZ 4PI2A 2Y69C 5LOVB 1ZL8B 3JALA 4GYCB 4WBNB 5BR8B 2E5LB 1T5EA 3ABKC 4BR6A 4PA7A 2ZM6O 4MVUA 3AG4B 3X2QB 3DC6A 2Q0AA 2A79B 2E74B 4JI6B 4EB6B 4J42A 5H6QA 3CJHA 1KU9A 2BTQB 3L9DA 1BQ0A 1NTKH 1RSOA 1ZX3A 1WNSA 3ZHQA 1P84F 2F4VO 3HKBB 2KB1A 4WFBV 4DV2B 2Q73A 3SYAA 2NLJC 4U3JB 5KHGA 4NXNB 2E75B 2UXDB 1AI7A 1RPOA 4NTWA 2A9HA 4UV8A
chains in the Genus database with same CATH topology
5LHHA 3CMEV 2B1IA 3QO8A 2IJIA 1RM1C 2QM8A 2EIJB 3FYIB 3FYEB 1R3KC 5GW7A 1G4YB 5HFLA 1F4MA 4MSWC 4WCEV 1XL4A 2IU3A 2F43G 2AHZA 2XAHA 1DF4A 3HB3B 1W2BU 1YJ9V 1AROP 1EBOA 5B1AB 1YJNV 1FXKA 2HFEC 3OMIB 1YSCA 1UJWB 1R3IC 3SPIA 2XOKG 4MTXA 4P30A 2OCCC 1VQMV 1JQ0A 1R73A 3AG2C 2LFSA 3KG2A 4MVZA 1RPRA 4DXWA 4XDKA 3B77A 3AG1C 3B8NA 3JCZA 2Q69A 1THZA 3W7SA 3VBBA 2QTOA 3CCSV 1K4DC 4CBCA 3OE7G 2D3OW 4MVOA 4N21A 5EK0A 1NVPD 1Q86W 4MW8A 4FK5C 1YTFD 3ASOC 5L3DA 1KQSU 2CK3G 3ZRSA 1NH2D 1QVGU 3K79A 3LUTB 3OMAB 4WFAV 1K97A 3MHSC 3OGCC 1HWYA 2ZDIA 5B3SB 1M56B 5EBMC 2JIZG 2X6BA 5L3FA 1QBZA 1LNQA 3ETEA 1DLBA 2GSMB 3RW0A 3SJQC 2B1GA 2OTJV 3FKSG 2P6JA 5LHGA 1V55B 3K06A 1CPYA 4UVBA 1Y66A 1ENVA 2EIMB 4PDLA 2ZR3A 1S72V 1R6KA 1AJQA 3SYOA 1K7DA 3GB7C 5EBLC 1BHAA 3SPJA 4BAYA 3ASNB 1COWG 3OEEG 5C93A 2HVKC 2HLDG 3D3IA 4JAVA 3JD2A 3SYCA 2X0LA 2Y48A 4UXNA 1KP2A 2XNDG 3T2MA 1JPXA 5CA3A 2V7QG 2XASA 1QR9A 2QM7A 3LSQA 3CC2V 2DQ3A 1KKDA 1JX9A 2WLIB 1V54B 2WLKA 1VQKV 1PD3A 2UXXA 3ZRVA 5DM6V 3WG7B 3CC7V 2K1EA 2NNUA 2HG5C 1AI4A 4RQFA 1OZ0A 3ZCCA 2ZQMA 4ZBMA 3ZMUA 4MW3A 4HYOA 3STLC 2IJHA 3HPLC 3IFXA 1BMFG 4XDJA 1E79G 4TWKA 5H6RA 2JJ2G 4E2LA 4QPJA 5KUKA 2PI5A 3QNEA 3ZN1A 5B3SC 3ZJZA 4H37A 5B1OA 3JYCA 1OCCC 2DW4A 2IU0A 2ZD9A 3T4ZA 3IGAC 2EBOA 2DYRB 1GM8A 1MABG 1JCHA 3ZMVA 1OCZC 1V55C 3ZMTA 2W6IG 4BW5A 1YI2V 4I5SA 5EC1C 3ABLB 2DQ0A 1JJ2U 3ETDA 1M90W 3W7UA 1F23A 1PNLA 2EIKC 1Q7YW 4EKWA 1MG1A 1SERA 3K08A 1YITV 2P90A 4GX1A 1F4NA 3LDDA 4FPPA 1PNKA 3ABUA 3CMAV 1AJPA 1GM7A 4QPKA 5BZBA 5DN6G 2OTLV 2JK5C 1K73W 4GT1A 3LDCA 2ITDC 3K03A 1VQ9V 2WWWA 3JD3A 1OCRC 3LSSA 3JD1A 4BIUA 2ITCC 1S5HC 3M99B 3WG7C 1VQNV 1BHBA 2H8PC 1SETA 2V1DA 3JD0A 4JTAB 5EBWC 1P4RA 1P7BA 3CCMV 3FB7C 3E89A 4QE9A 4JYCA 3AG4C 3IC7A 4G2KA 3X2QC 5IYDO 1VQ4V 4MS2A 2DYSC 1K8AW 2EINB 4RO2A 4H33A 3SPCA 3QO5A 3RVZA 5HFMA 1R3JC 3SYQA 5CBGA 1M57B 5LBQA 3W7XA 3CCVV 4JTCB 3OUFA 2WLLB 2YEVB 4RUEA 4G27B 2Q67A 1YJWV 3ZRXA 2HJFC 4X88A 4QJFB 3CCRV 2IJJA 4Q20A 1QLEB 4QNHB 4N23A 3SPGA 1KD1W 2Z3YA 3P30A 1S3JA 4BIZA 4UVCA 2ATKC 1OCOB 2W0FC 4UV9A 3K04A 1FXKB 1QCEA 3E83A 4PA6A 4GX5A 2EILC 3ZRWA 3CP1A 4U7OA 4GCZA 2DWEC 3ML0A 1QVFU 1AJNA 3ABKB 3EFFK 2AHYA 2LFRA 1R3LC 5LGUA 1GKFA 3K9AA 4Z1MG 1L1FA 4MT8A 2EIJC 5IYBO 5CBFA 2X6CA 4XDLA 4J9YB 1K92A 3BEHA 4FIPC 4GX0A 1YIJV 5L3CA 2BOCC 1VQ6V 3CYOA 1GMGA 3SYPA 2Z5UA 5B1AC 2YSUB 5IYCO 1S77D 3ABTA 4UVAA 4PA4A 1SESA 3NXSA 4P9OA 4TT3G 4X8AA 1KP3A 2A0LA 3I56V 3E8FA 1PL0A 2EINC 4PDRA 4MTGA 5L3GA 2XAFA 3H01A 4G28B 1NVPB 1N8RW 1MOFA 1NR7A 3E8HA 4FMTA 4ZKIA 1WPXA 1NH2B 3BY6A 1S0VA 1ROPA 5B1BB 3RVYA 1J95A 5LGNA 3AG3B 2Q68A 3E8BA 4XBFA 4JTDB 2R9IA 1NR1A 1KECA 5IY5B 1M56C 1OCOC 1E1RG 4PDMA 4RAIA 1VQOV 4WF9V 1KC8W 1AI5A 2WSSG 3OUSA 3RBZA 1I5YA 4JPRA 2HKOA 2X6AA 4F4LA 2DWDC 3OMNB 2X7RB 4JAUA 1NKDA 4PELA 3ZMSA 2QA4V 1CEZA 2H94A 5CN0A 2EIMC 3CXCU 4DO2A 3ETGA 2ZXWB 3F7VC 3LDEA 3UKMA 2MK3A 4KUMA 3SPHA 1AR1B 3VOUA 1M9NA 1GK9A 3R65A 4PA3A 3AG1B 3OAAG 1XL6A 3CCQV 1IXMA 5LHIA 3ASNC 4FJCC 3FB8C 3FB6C 4PA9A 3OW2U 1K4CC 4QE7A 3B8MA 3OFNG 3ASOB 4MVMA 1V54C 3QO7A 3CCLV 3CCUV 1VQPV 1F51A 5KA5A 3G71V 3E2EA 1OHHG 3T4DA 2M7WA 1I5XA 4R50A 2WLMA 3ZN0A 4MTOA 4KP4A 2HR3A 5J9PC 4QIWF 4RQEA 4TSFG 5B1BC 2EJRA 2FTKA 2XAJA 3AEIA 2UXNA 2WLLA 2YEVA 1BL8A 2B5UA 2JEXA 4R7CA 4L87A 2IH1C 5IY5C 1W0JG 3FB5C 3ABMB 1G8MA 1ZWIC 4LCUC 1R6NA 4LP8A 5FL7G 2IH3C 3GWOA 3TCUA 2EZOA 2DYRC 2GHYA 2LP7A 5L3BA 1E1QG 1SZTA 4I9WA 3TETA 5E1AC 2WAMA 4U7NA 2QKSA 5EC2C 5CBHA 4LBEC 4PDVA 2ZXWC 1NQTA 3OR6C 4X89A 3ABLC 3DTUB 3UM7A 1M1KW 5LGTA 1K5SA 2Y69B 4JASA 5KUMA 3STZC 4LC1A 1K3EA 1H8HG 1PNMA 1S76D 1K9MW 1DTOA 1DF5A 4OXSA 4YXWG 1W0KG 2QE7G 3D36A 2IJKA 1VQLV 3K0DA 1GM9A 2WLJA 1H38A 3W7WA 1YHQV 3EHBB 4MTFA 1ORQC 1Y4MA 2IW5A 3K0GA 3CCEV 1OCCB 3I55V 1EZJA 4MVQA 3ZMZA 2WLIA 3E86A 3WFVA 3CCJV 5CMUA 4R8CA 2WLNA 1GO3F 1SRYA 1OCZB 2P7TC 3G6EV 3G4SV 3OM3B 4JGSA 2ZR2A 1MSWD 3DGEA 3ZRWB 1TUEB 2JJ1G 1CP9A 4WFGA 4HZ3A 3ABMC 1M57C 2EIKB 5KA6A 3CPWU 2QEXV 5IDJA 1YTFB 1FFTB 1QLNA 4ASUG 1NBMG 2BOBC 2JEUA 4HAMA 2JDIG 4GX2A 1K33A 3CD6V 2C2AA 1QLEC 4JF3A 1PKXA 1WLEA 3PJSK 4MVSA 4WFHA 2Q6AA 4JYBA 1RM1B 1NJIW 1GTOA 1OCRB 2WPDG 1FXKC 3P32A 3ZIAG 1B6QA 2Y69C 2W6JG 3CC4V 1K5QA 1AI6A 1FS0G 1K34A 1QR8A 3ABKC 4P9PA 4PA7A 4MVUA 4UUJC 4RUFA 2P67A 4WFFA 2OCCB 3AG4B 3X2QB 1FXHA 1JOYA 2DYSB 3AG2B 1JVMA 1EFRG 1H8EG 2A79B 3MHHC 3F7YC 3OEHG 1VQ5V 3E8GA 1VQ8V 3MD0A 1FXVA 4KFMA 4MVRA 5B1NA 2XAQA 5H6QA 2EZPA 2ZDIC 4WFEA 1H2GA 4J9ZB 2PI4A 3OR7C 2OT5A 2HVJC 2R9RB 3TK1A 3JD4A 5L3EA 4P2ZA 2WLHA 3K3WA 3W7TA 3E35A 3F5WC 3T1CA 4CZZA 1Q82W 2KB1A 4R6ZA 5H9CA 2EILB 4WFBV 3A0RA 2XAGA 3SYAA 2NLJC 1AI7A 1Q81W 1VQ7V 1RPOA 3LNMB 2A9HA 3AG3C 4UV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8N A;  5HFM A;  2P6J A;  4JGS A;  1I5Y A;  2EZP A;  3B8M A;  1DF5 A;  2EBO A;  1Y66 A;  1ENV A;  2OT5 A;  4JPR A;  3K9A A;  2X7R B;  1K34 A;  5HFL A;  3H01 A;  4N21 A;  1QR8 A;  3GWO A;  3M99 B;  4FK5 C;  5KA6 A;  2EZO A;  5KA5 A;  5CN0 A;  1MOF A;  1DF4 A;  4N23 A;  2LP7 A;  1SZT A;  4FIP C;  1EBO A;  2M7W A;  1I5X A;  2MK3 A;  1K33 A;  1F23 A;  3MHS C;  3P30 A;  4E2L A;  1Y4M A;  5H9C A;  3CYO A;  4JF3 A;  3MHH C;  1MG1 A;  1JQ0 A;  1QBZ A;  4G2K A;  1QCE A;  1DLB A;  3WFV A;  1JPX A;  5CMU A;  3B77 A;  4FJC C;  3CP1 A;  1QR9 A; 
#chains in the Genus database with same CATH topology
 3SGI A;  1HNX B;  4JI0 B;  2QM8 A;  2E5L O;  3FYI B;  1HW7 A;  1R3K C;  5GW7 A;  3F5T A;  2ADQ B;  4LWS B;  4WCE V;  4E4E A;  2ZE7 A;  1DF4 A;  4TV8 A;  3A0B Z;  1ARO P;  5B1A B;  4DRX B;  2HFE C;  5E79 Z;  1YSC A;  1UJW B;  4AI8 A;  4JI6 O;  4MTX A;  4P30 A;  1VQM V;  1JQ0 A;  4DW0 A;  1R73 A;  3AG2 C;  2LFS A;  3KG2 A;  3AG1 C;  1THZ A;  3VBB A;  3H9V A;  1K4D C;  3OE7 G;  3ZRS A;  1NH2 D;  3K79 A;  1K97 A;  4DV2 O;  5B3S B;  4NXN O;  2UXD O;  5L3F A;  4PD4 F;  1LNQ A;  4NTX A;  1Z5V A;  1DLB A;  4IL6 Z;  3RW0 A;  2HHH B;  3VQY A;  1HNX O;  3SJQ C;  1N4C A;  4JI0 O;  4B3R B;  2W0X A;  3N2G A;  3K06 A;  4YIO A;  4DV4 B;  2OIE A;  3SYO A;  4LF8 B;  1DGS A;  5BY1 A;  5LMN B;  4X1Y A;  4BAY A;  1L0N H;  1COW G;  2Y0I A;  1FD9 A;  5JJN B;  2X0L A;  3T1H B;  4O4I B;  5IT9 N;  5LYJ A;  4F6E A;  2XAS A;  1EN4 A;  2DQ3 A;  2WLI B;  3Q4H A;  1VQK V;  3ZRV A;  5EYP B;  2CH7 B;  3EVK A;  4RQF A;  1AI4 A;  2QWO B;  3ZCC A;  3ZMU A;  4I4T A;  1EZV H;  3B4S A;  4K8X A;  4IHJ B;  2E3C A;  2IJH A;  3IFX A;  4FZ1 A;  1BMF G;  1YZB A;  1E79 G;  5H6R A;  3JAR A;  2HEP A;  5KUK A;  4FFB A;  2HHH O;  3ZN1 A;  2JVD A;  1EN6 A;  4B3R O;  2FL4 A;  2MW2 B;  1OCC C;  3JYC A;  4DV4 O;  4Z2W A;  3AK1 A;  3ZHS A;  3ZMT A;  1XOU A;  3JAL B;  2PY5 A;  5LMN O;  4BW5 A;  3ABL B;  2DQ0 A;  3BAA A;  3KCX A;  5KAF Z;  1Q7Y W;  1PP9 H;  3M7M X;  3K08 A;  1YIT V;  2P90 A;  4GX1 A;  1PNK A;  4FM0 A;  5DN6 G;  1K73 W;  1N36 O;  1VQ9 V;  1Y74 A;  1F7Y A;  3L72 H;  3LSU A;  3CJH B;  4BIU A;  3L75 H;  3M99 B;  1KB9 F;  3WG7 C;  2H8P C;  1SET A;  4FM1 A;  5TIS Z;  3CCM V;  1BT8 A;  1JJO A;  5JCO A;  3E89 A;  2RJZ A;  4G2K A;  3IC7 A;  5IYZ A;  3U0Z A;  4TOI A;  4DV0 B;  1H2K A;  1K8A W;  2EIN B;  5FPO A;  3SPC A;  2AGA A;  3RVZ A;  5FNV B;  1R3J C;  2ZIM A;  5EIB C;  4RUE A;  2Q67 A;  1MZE A;  2DMX A;  1IBM O;  2HJF C;  4HBN A;  1QLE B;  4N23 A;  4PHZ A;  3SPG A;  2R70 A;  2Z3Y A;  1MSD A;  3CRM A;  4BIZ A;  3E83 A;  5LP6 A;  2EIL C;  4U7O A;  1WB7 A;  2CAZ C;  2ZE8 A;  3EFF K;  1XMQ B;  4DV7 B;  3BHP A;  2EIJ C;  4X62 B;  1FFX A;  2VS0 A;  4JI1 B;  4XDL A;  4GX0 A;  5L3C A;  1VQ6 V;  4K3A A;  3CYO A;  3PN1 A;  2Z5U A;  4DR7 O;  4DV0 O;  2YSU B;  4B3S O;  4UVA A;  5EIB D;  3UO2 A;  3ZED A;  4P9O A;  4X8A A;  3I56 V;  1KP3 A;  2A0L A;  3K5O A;  1SQF A;  4LF7 B;  2JGU A;  3N2G B;  3H01 A;  4J7Z A;  1NVP B;  1N8R W;  3D3Q A;  4FMT A;  1WPX A;  3CSX A;  1J95 A;  3AG3 B;  2CUG A;  1IBL B;  1SS3 A;  2LGQ A;  1M56 C;  4RAI A;  1VQO V;  2P22 C;  1KC8 W;  1AI5 A;  2WSS G;  2VQE B;  4H13 B;  5LYJ B;  4DV7 O;  2X6A A;  4F4L A;  4F6R B;  3OMN B;  5JQG A;  4PEL A;  3ZMS A;  4X62 O;  2UXB B;  4JI1 O;  2EIM C;  1R1B A;  4DK1 A;  4I4T B;  2YIA A;  1VAR A;  2MK3 A;  3U10 A;  4KUM A;  3D36 C;  2EUL A;  3OAA G;  3L73 H;  3JAR B;  1IXM A;  3ASN C;  1WP8 A;  4LF7 O;  3OW2 U;  4O4H A;  1NTZ H;  3CE2 A;  3ASO B;  4AQY B;  2M6Y A;  2ZNJ A;  1VQP V;  1F51 A;  3HKE B;  3WU2 Z;  2GUZ A;  1I5X A;  4R50 A;  5CA0 A;  1IBL O;  5J9P C;  1MNG A;  1Y76 B;  4CH4 A;  4TSF G;  5B1B C;  3B2E E;  2CE4 A;  2AXT Z;  3J7A U;  2YEV A;  2VQE O;  1BL8 A;  2HJD A;  2JEX A;  4L87 A;  5IY5 C;  4GKJ B;  1W0J G;  5KAI Z;  1SA0 B;  4I50 B;  2UXB O;  1ZWI C;  1R6N A;  3AK3 A;  1Y74 B;  2DYR C;  2LP7 A;  5L3B A;  3CHX A;  5CA1 A;  2B9Z A;  5E1A C;  4U7N A;  5EC2 C;  3G6B A;  4PDV A;  3OR6 C;  3UM7 A;  4JAS A;  5KUM A;  3STZ C;  5H5N A;  4AQY O;  1S76 D;  3RWR D;  5H2F Z;  2JGD A;  4YXW G;  4I0X A;  4LNU A;  1XNQ B;  4ZIB A;  3K0D A;  2Y4T A;  5J2T A;  2DE0 X;  4TV9 A;  1QQC A;  4MTF A;  1Y4M A;  1HP8 A;  2IW5 A;  1JFF A;  3SJB C;  4KHP O;  4MVQ A;  3CCJ V;  1KMI Z;  4R8C A;  4GKJ O;  1GO3 F;  3OM3 B;  4DR2 O;  1CXZ B;  3WB1 A;  5LP6 B;  2UUB B;  1MSW D;  1TUE B;  1JR9 A;  4WFG A;  4HZ3 A;  3ABM C;  5KA6 A;  3CPW U;  3DXR A;  1FFT B;  1QNM A;  1TGO A;  3CD6 V;  2KG7 A;  1FFX B;  4DR4 B;  5LXT B;  1WLE A;  3OGI B;  4MVS A;  2YXL A;  4NVP A;  3BFR A;  1NJI W;  1PPJ H;  4UFZ A;  5B66 Z;  1B6Q A;  1XEQ A;  1XNQ O;  2W6J G;  3AG7 A;  3KKY A;  3CC4 V;  1K5Q A;  1AI6 A;  1FS0 G;  1ZSP A;  1O9G A;  4RUF A;  4WFF A;  2UU9 O;  2OCC B;  2DYS B;  1EFR G;  2QDO A;  4O2B A;  4J41 A;  1QHT A;  3F7Y C;  3ZHT A;  1VQ5 V;  1FXV A;  4KFM A;  5IJ0 B;  5C8Y A;  2UUB O;  3UO3 A;  3KCY A;  2ZDI C;  4J9Z B;  2HVJ C;  2R9A A;  3L71 H;  5JQG B;  3F5W C;  4DR4 O;  1Q82 W;  5H9C A;  2OWO A;  4JI2 B;  3WB2 A;  4IT5 A;  3RYI B;  4ZOL A;  3QO8 A;  2P4V A;  3K5N A;  4O4H B;  1SQV H;  5HFL A;  1F4M A;  1NU1 H;  1XL4 A;  2IU3 A;  2F43 G;  2AHZ A;  2XAH A;  1EBO A;  2P06 A;  1YJN V;  1FXK A;  3OMI B;  3SDL A;  4AHC A;  1RPR A;  1Q6U A;  3HKD A;  1H2S B;  1Q3E A;  3B8N A;  3CX5 F;  3JCZ A;  3W7S A;  5KLV H;  1J5E B;  2XT9 A;  2D3O W;  4MVO A;  4N21 A;  1Q86 W;  1M5I A;  4MW8 A;  3JAM N;  1KQS U;  3K5M A;  2NR5 A;  2CK3 G;  2ZE5 A;  1QVG U;  3LUT B;  4WFA V;  1S5J A;  1HWY A;  1NS1 A;  2JIZ G;  2X6B A;  4JI2 O;  4FVM A;  4DV5 B;  1BE3 H;  4AIL C;  5FPR A;  2B1G A;  3FKS G;  2YDE A;  5LHG A;  3K5L A;  1V55 B;  4ABM A;  1MZF A;  1CPY A;  4PDL A;  4U3F H;  1S72 V;  5JVD B;  1K7D A;  1PM9 A;  4I0X B;  4LNU B;  5EBL C;  3SPJ A;  3G67 A;  2YC0 A;  3TXS A;  4TV9 B;  4LFB O;  4JAV A;  2Y48 A;  2ZCE A;  1KP2 A;  3T2M A;  3ZBH A;  1JFF B;  3CB2 A;  1QR9 A;  1SQB H;  1I94 B;  1J5E O;  2GBO A;  2AZ0 A;  1YF2 A;  1N32 B;  3C90 A;  2QWP B;  4ZBM A;  3H1H H;  4MW3 A;  3HPL C;  4I9Q A;  1NTM H;  1UFI A;  3DXR B;  3AK2 A;  4DV5 O;  5K1X A;  3RYH A;  2Y4U A;  2PI5 A;  3QNE A;  2KG7 B;  2Q0O C;  5B3S C;  2ARH A;  2ZD9 A;  1FJG B;  1MAB G;  2YXH A;  5DEC A;  1N33 B;  3CEI A;  1YI2 V;  4I5S A;  1JJ2 U;  5D5Q A;  1F23 A;  4B3T B;  2QTS A;  1MG1 A;  1SER A;  2XHB A;  1I94 O;  1EN5 A;  1F4N A;  3ABU A;  5BZB A;  3E22 A;  2JK5 C;  4GT1 A;  3LDC A;  2ITD C;  5BR8 O;  3K58 A;  2L35 A;  5JJE B;  3IC9 A;  3JD1 A;  1VQN V;  4UB8 Z;  1BHB A;  4K0K B;  2V1D A;  3FB7 C;  2YI9 A;  3DSQ A;  4FLX A;  2BTO A;  4JYC A;  1VQ4 V;  4MS2 A;  1ZUQ A;  4O4J A;  2R72 A;  4RO2 A;  1VF6 C;  5HFM A;  4FM2 A;  5CBG A;  1FJG O;  1ZLZ A;  1M57 B;  5LBQ A;  1JA8 A;  1IUR A;  1GN4 A;  3OUF A;  2WLL B;  4ZOL B;  4D6T H;  4LF9 B;  1N33 O;  1U97 A;  3ZRX A;  3CCR V;  1Y6X A;  4B3T O;  1OCO B;  4UV9 A;  1FXK B;  4GX5 A;  3ZRW A;  2QKC A;  4FFK A;  3R66 A;  3ABK B;  3HKD B;  3TGU H;  4Z1M G;  5K1P A;  4DV1 B;  4MT8 A;  5IYB O;  2KSD A;  4DR3 B;  3BEH A;  4FIP C;  1Y67 A;  4FLY A;  1S77 D;  3A2F A;  4TT3 G;  4LH7 A;  4Q6G A;  2CGN A;  2EIN C;  4LF9 O;  4X9Q A;  3A8T A;  4PDR A;  1IVS A;  4O2A A;  2XAF A;  2Y0P A;  4CH3 A;  4G28 B;  4I7Z B;  4YY3 B;  3QTC A;  1MOF A;  3E8H A;  1NH2 B;  3S3W A;  4LFC B;  2FYU H;  2VQF B;  4UCO A;  2Q68 A;  1L0L H;  1NR1 A;  1KEC A;  3SR2 C;  1HNW B;  1E1R G;  4PDM A;  2IM9 A;  4WF9 V;  3TXQ A;  1I5Y A;  4K8Z A;  1GH6 A;  5D5P A;  2HKO A;  2YS8 A;  4JI5 B;  4LF8 O;  3JSL A;  4DR3 O;  5CN0 A;  3UQ8 A;  1Q8I A;  4DO2 A;  2ZXW B;  3UKM A;  1BSM A;  4DUZ B;  3SPH A;  1GK9 A;  4PA3 A;  1PV0 A;  3AG1 B;  4CC5 A;  3T1H O;  1XL6 A;  2BE3 A;  1K4C C;  3ZHV A;  1SQP H;  4YY3 O;  1V54 C;  3CRA A;  2ADP A;  1LR1 A;  5KA5 A;  3UT5 A;  4LFC O;  2VQF O;  2WLM A;  1RSO B;  3RN4 A;  4QIW F;  4I55 A;  2EJR A;  3BRC A;  2XAJ A;  1HNW O;  4ZI7 A;  4R7C A;  2IH1 C;  1IXB A;  3FB5 C;  3SJA C;  4JI5 O;  3E22 B;  1G8M A;  4LP8 A;  2F95 B;  2ZE6 A;  3GWO A;  3TCU A;  2EZO A;  1NI8 A;  4DUZ O;  1E1Q G;  1SZT A;  5KX5 A;  3TET A;  2WAM A;  4LBE C;  1BZK A;  4TV8 B;  4X89 A;  5LGT A;  2GV9 A;  1FKA O;  4GLX A;  2YI8 A;  3J80 N;  4O4J B;  3TJT A;  1DTO A;  1DF5 A;  2QE7 G;  3D36 A;  2GTS A;  4YIP A;  1VQL V;  4NTY A;  5B5E Z;  2WLJ A;  3W7W A;  1SC5 B;  4FLV A;  4IYI A;  2Q4P A;  1TA8 A;  1OCC B;  3ZMZ A;  1I7F A;  3VQW A;  1KUQ A;  3H1K H;  2P7T C;  1FPO A;  3G6E V;  4JGS A;  1TUB A;  2QWR B;  3ZRW B;  3I5D A;  3HKC A;  4YHH B;  2ZIN A;  5IDJ A;  1YTF B;  1QLN A;  3QVN A;  2JEU A;  4A5U B;  1K33 A;  2QM4 A;  1ZAU A;  4TUY A;  4X1Y B;  4WFH A;  1RM1 B;  4JI4 B;  2JS5 A;  3A0H Z;  1XMQ O;  5KHJ A;  4JAA A;  3JAS A;  3Q4H B;  1QR8 A;  4P9P A;  4NB5 A;  1U96 A;  1MMM A;  4UUJ C;  2P67 A;  1FXH A;  1JVM A;  1H8E G;  4OGQ B;  3OEH G;  4EFE A;  1VQ8 V;  4MVR A;  2AW9 A;  5B1N A;  4FFB B;  2XAQ A;  3FAV A;  2EZP A;  4WFE A;  1H2G A;  1FYJ A;  5IWA B;  3OR7 C;  4YHH O;  2R9R B;  3TK1 A;  3JD4 A;  5L3E A;  2UXC B;  4P2Z A;  2WLH A;  3K3W A;  1VIB A;  3GVM A;  3W7T A;  1R6T A;  3E35 A;  3T1C A;  2LGW A;  4R6Z A;  2EIL B;  1AR5 A;  3O9O A;  1D5N A;  4ZHQ A;  3CXH F;  2L6L A;  5JJJ B;  3LNM B;  1ZTE A;  2BSK A;  4X20 A;  3LNN A;  5J2U A;  2IJI A;  2EIJ B;  4GZR B;  3FYE B;  2QGN A;  4LFA B;  4MSW C;  5KHK A;  4KXR A;  3HB3 B;  2XUM A;  3UT5 B;  1GRJ A;  1R3I C;  3SPI A;  2OCC C;  1YDX A;  5EZY A;  2OYQ A;  2F23 A;  4MVZ A;  4DXW A;  4J7K A;  2WA4 A;  5JH7 A;  2F66 C;  5IYZ B;  4NYK A;  5IWA O;  2PYJ A;  2YUA A;  3CCS V;  4CBC A;  1Z2G A;  2UXC O;  5EK0 A;  3VQV A;  2RDC A;  5GTI Z;  4DYL A;  4PI0 A;  2ZDI A;  1M56 B;  5EBM C;  1QBZ A;  1YEW A;  1N0N A;  2CTP A;  5CB4 A;  2P6J A;  1G1X B;  5KMG A;  4LF5 B;  3EXA A;  2Q7E A;  1SQG A;  4UVB A;  2EIM B;  4LFA O;  2N04 A;  1R6K A;  3L70 H;  4TQF A;  4X65 B;  1BHA A;  3JAT A;  3K9S A;  4YJ2 A;  3ASN B;  3OEE G;  5C93 A;  3D3I A;  3JD2 A;  4UXN A;  1ZL8 A;  4WBN A;  1KKD A;  2WLK A;  1M93 A;  3H1I H;  1PD3 A;  5DM6 V;  1XMO B;  3ETQ A;  1AB3 A;  3CC7 V;  2K1E A;  2NNU A;  2HG5 C;  1TUB B;  2ZQM A;  3QG5 A;  3B40 A;  3H1L H;  3STL C;  2QJ1 A;  4BW9 A;  4QPJ A;  1I0H A;  2BTQ A;  5F2V O;  2O57 A;  4TUY B;  5B1O A;  2DW4 A;  2IU0 A;  4LF6 B;  3IGA C;  1BCC H;  2DYR B;  4BIO A;  1JCH A;  1OCZ C;  1BGY H;  1V55 C;  2WA3 A;  4FLZ A;  4LH6 A;  3JAS B;  5EC1 C;  4DW1 A;  2EIK C;  5KHI A;  1KBH A;  3LDD A;  2RQ6 A;  1TVK A;  4PV1 B;  3JAK A;  4J7J A;  1XMO O;  5KHH A;  2KQX A;  1OCR C;  3FAV B;  3LSS A;  1S5H C;  5LA6 A;  2QKA A;  1AP6 A;  4UCU A;  1HR0 B;  1LUW A;  5EBW C;  4QE9 A;  3AG4 C;  4OPH A;  3X2Q C;  2GUZ B;  4CH5 A;  5IYD O;  5CA0 B;  1H2N A;  4LF6 O;  2YID A;  2OCH A;  4H33 A;  3SYQ A;  3W7X A;  2PF4 E;  2YEV B;  4OPA A;  5J2U B;  3G80 A;  4X1K A;  4X88 A;  2IJJ A;  4Q20 A;  4X1I A;  1S3J A;  2CDY A;  5CA1 B;  1WB8 A;  1QCE A;  4UCT A;  4PA6 A;  1D5A A;  3CP1 A;  4GCZ A;  2DWE C;  1QVF U;  2EJ7 A;  1AJN A;  3K57 A;  1WJZ A;  1R3L C;  1GKF A;  1HR0 O;  2JGD B;  1VF7 A;  2X6C A;  4O4I A;  1YIJ V;  5J2T B;  1GMG A;  5B1A C;  2CGO A;  5IYC O;  4FLU A;  3ABT A;  1WAZ A;  5EYP A;  2CH7 A;  1SES A;  3S3X A;  1PL0 A;  3ICX A;  4IHJ A;  5CB4 B;  4MTG A;  5DED A;  5KMG B;  1I08 A;  4ZKI A;  5A9G A;  3BY6 A;  1VF6 A;  3FD9 A;  1ROP A;  2QWN B;  4Z1V A;  3RVY A;  4GKK B;  2DJV A;  5LGN A;  1H2M A;  3E8B A;  4YJ2 B;  4XBF A;  4JTD B;  2R9I A;  5ITZ A;  4UB6 Z;  1OCO C;  4RWU A;  3OUS A;  3IJ4 A;  1TAE A;  3B09 A;  1NKD A;  3BA8 A;  2QA4 V;  1CEZ A;  5LMU B;  2Q7G A;  5LL6 Y;  5BXZ A;  4C7U A;  3CXC U;  3ZS8 C;  3ETG A;  3F7V C;  3FFQ A;  1N34 B;  2RN9 A;  3CCQ V;  5LHI A;  3QF7 A;  4O2B B;  4FJC C;  2P4K A;  4QE7 A;  2PYL A;  1N32 O;  1BS3 A;  5C8Y B;  4K35 A;  4PJ0 Z;  3G71 V;  1AP5 A;  3NR7 A;  4B08 A;  2JRI A;  3T4D A;  2V4D A;  2M7W A;  4GKK O;  4KP4 A;  2D2C B;  4RQE A;  5FNV A;  1OV9 A;  2FTK A;  3CRR A;  1Q90 D;  1Z5W A;  3N27 A;  1TVK B;  3JAK B;  4JZG A;  4NR1 A;  5LMU O;  1XI1 A;  4X66 B;  1N34 O;  5LA6 B;  1Q43 A;  2ZXW C;  1SKV A;  3ABL C;  3DTU B;  1EM1 A;  2YIB D;  3C3T A;  3THO A;  2LW7 A;  4O4L A;  2Y69 B;  1PNM A;  3JAW A;  4IYH A;  4UCR A;  1K9M W;  1GN3 A;  1NZ6 A;  1BQZ A;  1W0K G;  2A3Q A;  2IJK A;  2CTR A;  2ZNI A;  1GM9 A;  4K0K O;  1AIL A;  4X1K B;  1H38 A;  3EHB B;  1XHZ A;  4JI8 B;  2LW1 A;  4IIJ A;  1ORQ C;  1DK1 A;  4J10 A;  3K0G A;  4X1I B;  1M4U A;  3I55 V;  3CCE V;  1AR4 A;  1EZJ A;  3L74 H;  4TQD A;  3E86 A;  5CMU A;  1VF5 B;  3G4S V;  4GUN A;  3T1Y B;  2ZR2 A;  3APO A;  3DGE A;  2FB5 A;  2JJ1 G;  2VWK A;  1G6U A;  4X66 O;  2QEX V;  4ASU G;  1NBM G;  2BOB C;  1IX9 A;  4DR1 B;  4GX2 A;  1VMG A;  1QLE C;  4JF3 A;  1PKX A;  3RYC A;  1P7G A;  2A7W A;  4JYB A;  1SF9 A;  1GTO A;  2LO1 A;  2CTQ A;  4F6R A;  2WPD G;  3P32 A;  3ZIA G;  1XBL A;  4HNA A;  2DOS A;  1N36 B;  1HDJ A;  2PTM A;  1K34 A;  4DV1 O;  1RFY A;  4JI8 O;  1JOY A;  4X64 B;  3AG2 B;  1X4T A;  3MHH C;  3E8G A;  3MD0 A;  3RYH B;  1IZ3 A;  3T1Y O;  5GTH Z;  5ITZ B;  5GON A;  3HKE A;  1N0J A;  2FKX A;  3CRQ A;  2PI4 A;  3ZHR A;  2OT5 A;  1WP7 A;  1IBM B;  2K9P A;  1Y76 A;  5AG2 A;  4DR1 O;  4CZZ A;  2ZT9 B;  4CS2 A;  2ODM A;  2GDS A;  3A0R A;  2XAG A;  2G38 A;  4IGG A;  1Q81 W;  1VQ7 V;  1SA0 A;  3CWB H;  4I50 A;  3VQX A;  3AG3 C;  5LHH A;  4DUY B;  3CME V;  2B1I A;  3MDS A;  1RM1 C;  4FLT A;  2N05 A;  1G4Y B;  3RFR A;  4NKG B;  1XHX A;  1W2B U;  4X64 O;  1YJ9 V;  4ICG A;  3FX7 A;  4L8J A;  2XOK G;  1XIL A;  4DR7 B;  2RMK B;  4B3S B;  4XDK A;  3B77 A;  4CS4 A;  3JSN A;  2ILM A;  2Q69 A;  2H3O A;  1X59 A;  2QTO A;  3OD4 A;  1LUV A;  1XDC A;  4JI7 B;  2ZIO A;  3CRC A;  2Q5Z A;  1NVP D;  1YTF D;  4FK5 C;  3ASO C;  5L3D A;  3OMA B;  1H2L A;  4LR3 A;  3MHS C;  3OGC C;  1HNZ B;  5BMV A;  4DK0 A;  1IDS A;  1MA1 A;  1SQX H;  1XNR B;  2EX3 A;  3ETE A;  1YVW A;  2GSM B;  2YIC A;  4DUY O;  2OTJ V;  1WN7 A;  4O4L B;  2YXY A;  4NXM B;  1Y66 A;  1ENV A;  2ZR3 A;  4CS3 A;  3JAW B;  2DN9 A;  1A32 A;  1AJQ A;  3GB7 C;  4JYY A;  5LXT A;  4DV3 B;  4FLW A;  1IBK B;  3RYF A;  5FLX N;  2HVK C;  2HLD G;  2XTA A;  4H44 B;  3SYC A;  4IIJ B;  2XND G;  1JPX A;  5CA3 A;  2V7Q G;  2QM7 A;  3LSQ A;  3CC2 V;  3ZHU A;  1JX9 A;  1V54 B;  2UXX A;  1PL4 A;  3APQ A;  5JCO C;  4JI7 O;  3WG7 B;  4W4K A;  1OZ0 A;  4YJ3 A;  2ZKO A;  4HYO A;  3D8C A;  2HP8 A;  3BA9 A;  4O2A B;  4XDJ A;  1HNZ O;  4TWK A;  2JJ2 G;  4E2L A;  1XNR O;  5IJ9 A;  5IJ0 A;  3GWK C;  1SQQ H;  4DR6 B;  1KKC A;  3ZJZ A;  4H37 A;  4NXM O;  3RYC B;  3T4Z A;  4EFB A;  2EBO A;  1GM8 A;  3ZMV A;  3BCC H;  2QR4 A;  5LP6 C;  4HNA B;  1SZX A;  2W6I G;  1GAX A;  1WPB A;  4DV3 O;  1IBK O;  1WA8 A;  2ETN A;  2F93 B;  3ETD A;  1M90 W;  3W7U A;  1PNL A;  3RYI A;  4EKW A;  1B04 A;  2A06 H;  3N2K A;  2FML A;  3MAQ A;  4DR5 B;  3UCS C;  4FPP A;  5A2Q N;  3P3P A;  3CMA V;  1AJP A;  1GM7 A;  4QPK A;  2OTL V;  4JI4 O;  3IAY A;  3K03 A;  1W59 A;  2WWW A;  3JD3 A;  1YXB A;  3HR0 A;  5GON B;  2ITC C;  3JD0 A;  4JTA B;  1P4R A;  1P7B A;  1VP7 A;  4FZ0 A;  4JI3 B;  4DR6 O;  1URF A;  3BPZ A;  4KHP B;  2DYS C;  1S5L Z;  2GTA A;  3BVO A;  4EEQ A;  3J81 N;  5JWP A;  3QO5 A;  4I55 B;  2QWQ B;  4DR2 B;  3CCV V;  3U11 A;  4JTC B;  4ZI7 B;  4G27 B;  1YJW V;  4DV6 B;  4QJF B;  4B7K A;  4QNH B;  2N74 A;  1KD1 W;  3P30 A;  4UVC A;  2ATK C;  2W0F C;  4DR5 O;  5KX5 B;  3K04 A;  4JYA B;  4CH6 A;  5JVD A;  3ML0 A;  1JMK C;  2AHY A;  2LFR A;  5LGU A;  4JZ2 A;  3K9A A;  1QU7 A;  2E76 B;  1L1F A;  1GN6 A;  5CBF A;  4J9Y B;  1K92 A;  3SJC C;  2UU9 B;  3CS5 A;  2BOC C;  4J11 A;  1Q5O A;  1KYO F;  4W4L A;  4JI3 O;  3SYP A;  5IE9 A;  1D2D A;  3RGB A;  3K59 A;  5BMV B;  4PA4 A;  5LOV A;  3NXS A;  2PUS A;  4D7S A;  3E8F A;  2KKW A;  4DV6 O;  2JS3 A;  5L3G A;  2RCV A;  1V9P A;  2IBZ H;  4UCS A;  4J80 A;  2UUA B;  1XQ8 A;  3OTF A;  3HKC B;  3RT3 C;  4JV5 B;  1NR7 A;  1S0V A;  3BAB A;  4EB6 A;  5B1B B;  4OX9 B;  1XRE A;  4JYA O;  4KL1 A;  3RYF B;  5IY5 B;  1UPG A;  2RNB A;  4B7E A;  4LF4 B;  4LF5 O;  3RBZ A;  4B3M B;  4JPR A;  2DWD C;  2UUC B;  2X7R B;  4JAU A;  2H94 A;  3HKB A;  4X65 O;  3LDE A;  4YJ3 B;  1OJH A;  4U3J A;  4CC6 A;  1AR1 B;  3VOU A;  1M9N A;  3R65 A;  2LJ2 A;  1YCI A;  2Q7H A;  1O9H A;  3OT7 A;  4PA9 A;  3FB8 C;  3FB6 C;  5IJ9 B;  1P49 A;  1Q6H A;  1B3Q A;  3B8M A;  4LWS A;  3OFN G;  4MVM A;  2UUA O;  3QO7 A;  3CCL V;  3CCU V;  4JV5 O;  3E2E A;  4DRX A;  1OHH G;  4OX9 O;  1Q6I A;  3ZN0 A;  4MTO A;  2HR3 A;  2LQT A;  1WA8 B;  3H1J H;  3C3S A;  1RP3 B;  3JCU Z;  3N2K B;  3AEI A;  2UXN A;  2WLL A;  4LF4 O;  2B5U A;  4B3M O;  1B06 A;  4ZHQ B;  2Q9L A;  3ABM B;  2UUC O;  3ZX6 A;  3O65 A;  2BSK B;  3P3N A;  2F1M A;  4X20 B;  4LCU C;  5FL7 G;  2IH3 C;  4UCV A;  2GHY A;  2P5O A;  4I9W A;  1FAF A;  3OTO B;  4BWA A;  3WB0 A;  2QKS A;  5CBH A;  1NQT A;  2CTW A;  4LFB B;  1M1K W;  1K5S A;  4D7T A;  1VEW A;  4LC1 A;  1K3E A;  1H8H G;  5EZY B;  4OXS A;  5JH7 B;  2AZ2 A;  2PGG A;  1GN2 A;  1YHQ V;  2ZM6 B;  2BCC H;  1AVM A;  2YIB A;  1XUQ A;  2OIG A;  3DC5 A;  2WLI A;  3WFV A;  2PZS A;  2WLN A;  1SRY A;  1OCZ B;  1NT2 B;  2NN4 A;  3M8A A;  1CP9 A;  1M57 C;  4QGP A;  2EIK B;  3OTO O;  2Z0A A;  4HAM A;  2JDI G;  2C2A A;  2VWJ A;  2F4V B;  3PJS K;  1US6 A;  3JAT B;  2Q6A A;  4H0L B;  2QSA A;  2Q8V A;  2VRZ A;  1OCR B;  1L8D A;  1FXK C;  3KZI Z;  4PI2 A;  2Y69 C;  5LOV B;  1ZL8 B;  3JAL A;  4GYC B;  4WBN B;  5BR8 B;  2E5L B;  1T5E A;  3ABK C;  4BR6 A;  4PA7 A;  2ZM6 O;  4MVU A;  3AG4 B;  3X2Q B;  3DC6 A;  2Q0A A;  2A79 B;  2E74 B;  4JI6 B;  4EB6 B;  4J42 A;  5H6Q A;  3CJH A;  1KU9 A;  2BTQ B;  3L9D A;  1BQ0 A;  1NTK H;  1RSO A;  1ZX3 A;  1WNS A;  3ZHQ A;  1P84 F;  2F4V O;  3HKB B;  2KB1 A;  4WFB V;  4DV2 B;  2Q73 A;  3SYA A;  2NLJ C;  4U3J B;  5KHG A;  4NXN B;  2E75 B;  2UXD B;  1AI7 A;  1RPO A;  4NTW A;  2A9H A;  4UV8 A; 
#chains in the Genus database with same CATH homology
 5LHH A;  3CME V;  2B1I A;  3QO8 A;  2IJI A;  1RM1 C;  2QM8 A;  2EIJ B;  3FYI B;  3FYE B;  1R3K C;  5GW7 A;  1G4Y B;  5HFL A;  1F4M A;  4MSW C;  4WCE V;  1XL4 A;  2IU3 A;  2F43 G;  2AHZ A;  2XAH A;  1DF4 A;  3HB3 B;  1W2B U;  1YJ9 V;  1ARO P;  1EBO A;  5B1A B;  1YJN V;  1FXK A;  2HFE C;  3OMI B;  1YSC A;  1UJW B;  1R3I C;  3SPI A;  2XOK G;  4MTX A;  4P30 A;  2OCC C;  1VQM V;  1JQ0 A;  1R73 A;  3AG2 C;  2LFS A;  3KG2 A;  4MVZ A;  1RPR A;  4DXW A;  4XDK A;  3B77 A;  3AG1 C;  3B8N A;  3JCZ A;  2Q69 A;  1THZ A;  3W7S A;  3VBB A;  2QTO A;  3CCS V;  1K4D C;  4CBC A;  3OE7 G;  2D3O W;  4MVO A;  4N21 A;  5EK0 A;  1NVP D;  1Q86 W;  4MW8 A;  4FK5 C;  1YTF D;  3ASO C;  5L3D A;  1KQS U;  2CK3 G;  3ZRS A;  1NH2 D;  1QVG U;  3K79 A;  3LUT B;  3OMA B;  4WFA V;  1K97 A;  3MHS C;  3OGC C;  1HWY A;  2ZDI A;  5B3S B;  1M56 B;  5EBM C;  2JIZ G;  2X6B A;  5L3F A;  1QBZ A;  1LNQ A;  3ETE A;  1DLB A;  2GSM B;  3RW0 A;  3SJQ C;  2B1G A;  2OTJ V;  3FKS G;  2P6J A;  5LHG A;  1V55 B;  3K06 A;  1CPY A;  4UVB A;  1Y66 A;  1ENV A;  2EIM B;  4PDL A;  2ZR3 A;  1S72 V;  1R6K A;  1AJQ A;  3SYO A;  1K7D A;  3GB7 C;  5EBL C;  1BHA A;  3SPJ A;  4BAY A;  3ASN B;  1COW G;  3OEE G;  5C93 A;  2HVK C;  2HLD G;  3D3I A;  4JAV A;  3JD2 A;  3SYC A;  2X0L A;  2Y48 A;  4UXN A;  1KP2 A;  2XND G;  3T2M A;  1JPX A;  5CA3 A;  2V7Q G;  2XAS A;  1QR9 A;  2QM7 A;  3LSQ A;  3CC2 V;  2DQ3 A;  1KKD A;  1JX9 A;  2WLI B;  1V54 B;  2WLK A;  1VQK V;  1PD3 A;  2UXX A;  3ZRV A;  5DM6 V;  3WG7 B;  3CC7 V;  2K1E A;  2NNU A;  2HG5 C;  1AI4 A;  4RQF A;  1OZ0 A;  3ZCC A;  2ZQM A;  4ZBM A;  3ZMU A;  4MW3 A;  4HYO A;  3STL C;  2IJH A;  3HPL C;  3IFX A;  1BMF G;  4XDJ A;  1E79 G;  4TWK A;  5H6R A;  2JJ2 G;  4E2L A;  4QPJ A;  5KUK A;  2PI5 A;  3QNE A;  3ZN1 A;  5B3S C;  3ZJZ A;  4H37 A;  5B1O A;  3JYC A;  1OCC C;  2DW4 A;  2IU0 A;  2ZD9 A;  3T4Z A;  3IGA C;  2EBO A;  2DYR B;  1GM8 A;  1MAB G;  1JCH A;  3ZMV A;  1OCZ C;  1V55 C;  3ZMT A;  2W6I G;  4BW5 A;  1YI2 V;  4I5S A;  5EC1 C;  3ABL B;  2DQ0 A;  1JJ2 U;  3ETD A;  1M90 W;  3W7U A;  1F23 A;  1PNL A;  2EIK C;  1Q7Y W;  4EKW A;  1MG1 A;  1SER A;  3K08 A;  1YIT V;  2P90 A;  4GX1 A;  1F4N A;  3LDD A;  4FPP A;  1PNK A;  3ABU A;  3CMA V;  1AJP A;  1GM7 A;  4QPK A;  5BZB A;  5DN6 G;  2OTL V;  2JK5 C;  1K73 W;  4GT1 A;  3LDC A;  2ITD C;  3K03 A;  1VQ9 V;  2WWW A;  3JD3 A;  1OCR C;  3LSS A;  3JD1 A;  4BIU A;  2ITC C;  1S5H C;  3M99 B;  3WG7 C;  1VQN V;  1BHB A;  2H8P C;  1SET A;  2V1D A;  3JD0 A;  4JTA B;  5EBW C;  1P4R A;  1P7B A;  3CCM V;  3FB7 C;  3E89 A;  4QE9 A;  4JYC A;  3AG4 C;  3IC7 A;  4G2K A;  3X2Q C;  5IYD O;  1VQ4 V;  4MS2 A;  2DYS C;  1K8A W;  2EIN B;  4RO2 A;  4H33 A;  3SPC A;  3QO5 A;  3RVZ A;  5HFM A;  1R3J C;  3SYQ A;  5CBG A;  1M57 B;  5LBQ A;  3W7X A;  3CCV V;  4JTC B;  3OUF A;  2WLL B;  2YEV B;  4RUE A;  4G27 B;  2Q67 A;  1YJW V;  3ZRX A;  2HJF C;  4X88 A;  4QJF B;  3CCR V;  2IJJ A;  4Q20 A;  1QLE B;  4QNH B;  4N23 A;  3SPG A;  1KD1 W;  2Z3Y A;  3P30 A;  1S3J A;  4BIZ A;  4UVC A;  2ATK C;  1OCO B;  2W0F C;  4UV9 A;  3K04 A;  1FXK B;  1QCE A;  3E83 A;  4PA6 A;  4GX5 A;  2EIL C;  3ZRW A;  3CP1 A;  4U7O A;  4GCZ A;  2DWE C;  3ML0 A;  1QVF U;  1AJN A;  3ABK B;  3EFF K;  2AHY A;  2LFR A;  1R3L C;  5LGU A;  1GKF A;  3K9A A;  4Z1M G;  1L1F A;  4MT8 A;  2EIJ C;  5IYB O;  5CBF A;  2X6C A;  4XDL A;  4J9Y B;  1K92 A;  3BEH A;  4FIP C;  4GX0 A;  1YIJ V;  5L3C A;  2BOC C;  1VQ6 V;  3CYO A;  1GMG A;  3SYP A;  2Z5U A;  5B1A C;  2YSU B;  5IYC O;  1S77 D;  3ABT A;  4UVA A;  4PA4 A;  1SES A;  3NXS A;  4P9O A;  4TT3 G;  4X8A A;  1KP3 A;  2A0L A;  3I56 V;  3E8F A;  1PL0 A;  2EIN C;  4PDR A;  4MTG A;  5L3G A;  2XAF A;  3H01 A;  4G28 B;  1NVP B;  1N8R W;  1MOF A;  1NR7 A;  3E8H A;  4FMT A;  4ZKI A;  1WPX A;  1NH2 B;  3BY6 A;  1S0V A;  1ROP A;  5B1B B;  3RVY A;  1J95 A;  5LGN A;  3AG3 B;  2Q68 A;  3E8B A;  4XBF A;  4JTD B;  2R9I A;  1NR1 A;  1KEC A;  5IY5 B;  1M56 C;  1OCO C;  1E1R G;  4PDM A;  4RAI A;  1VQO V;  4WF9 V;  1KC8 W;  1AI5 A;  2WSS G;  3OUS A;  3RBZ A;  1I5Y A;  4JPR A;  2HKO A;  2X6A A;  4F4L A;  2DWD C;  3OMN B;  2X7R B;  4JAU A;  1NKD A;  4PEL A;  3ZMS A;  2QA4 V;  1CEZ A;  2H94 A;  5CN0 A;  2EIM C;  3CXC U;  4DO2 A;  3ETG A;  2ZXW B;  3F7V C;  3LDE A;  3UKM A;  2MK3 A;  4KUM A;  3SPH A;  1AR1 B;  3VOU A;  1M9N A;  1GK9 A;  3R65 A;  4PA3 A;  3AG1 B;  3OAA G;  1XL6 A;  3CCQ V;  1IXM A;  5LHI A;  3ASN C;  4FJC C;  3FB8 C;  3FB6 C;  4PA9 A;  3OW2 U;  1K4C C;  4QE7 A;  3B8M A;  3OFN G;  3ASO B;  4MVM A;  1V54 C;  3QO7 A;  3CCL V;  3CCU V;  1VQP V;  1F51 A;  5KA5 A;  3G71 V;  3E2E A;  1OHH G;  3T4D A;  2M7W A;  1I5X A;  4R50 A;  2WLM A;  3ZN0 A;  4MTO A;  4KP4 A;  2HR3 A;  5J9P C;  4QIW F;  4RQE A;  4TSF G;  5B1B C;  2EJR A;  2FTK A;  2XAJ A;  3AEI A;  2UXN A;  2WLL A;  2YEV A;  1BL8 A;  2B5U A;  2JEX A;  4R7C A;  4L87 A;  2IH1 C;  5IY5 C;  1W0J G;  3FB5 C;  3ABM B;  1G8M A;  1ZWI C;  4LCU C;  1R6N A;  4LP8 A;  5FL7 G;  2IH3 C;  3GWO A;  3TCU A;  2EZO A;  2DYR C;  2GHY A;  2LP7 A;  5L3B A;  1E1Q G;  1SZT A;  4I9W A;  3TET A;  5E1A C;  2WAM A;  4U7N A;  2QKS A;  5EC2 C;  5CBH A;  4LBE C;  4PDV A;  2ZXW C;  1NQT A;  3OR6 C;  4X89 A;  3ABL C;  3DTU B;  3UM7 A;  1M1K W;  5LGT A;  1K5S A;  2Y69 B;  4JAS A;  5KUM A;  3STZ C;  4LC1 A;  1K3E A;  1H8H G;  1PNM A;  1S76 D;  1K9M W;  1DTO A;  1DF5 A;  4OXS A;  4YXW G;  1W0K G;  2QE7 G;  3D36 A;  2IJK A;  1VQL V;  3K0D A;  1GM9 A;  2WLJ A;  1H38 A;  3W7W A;  1YHQ V;  3EHB B;  4MTF A;  1ORQ C;  1Y4M A;  2IW5 A;  3K0G A;  3CCE V;  1OCC B;  3I55 V;  1EZJ A;  4MVQ A;  3ZMZ A;  2WLI A;  3E86 A;  3WFV A;  3CCJ V;  5CMU A;  4R8C A;  2WLN A;  1GO3 F;  1SRY A;  1OCZ B;  2P7T C;  3G6E V;  3G4S V;  3OM3 B;  4JGS A;  2ZR2 A;  1MSW D;  3DGE A;  3ZRW B;  1TUE B;  2JJ1 G;  1CP9 A;  4WFG A;  4HZ3 A;  3ABM C;  1M57 C;  2EIK B;  5KA6 A;  3CPW U;  2QEX V;  5IDJ A;  1YTF B;  1FFT B;  1QLN A;  4ASU G;  1NBM G;  2BOB C;  2JEU A;  4HAM A;  2JDI G;  4GX2 A;  1K33 A;  3CD6 V;  2C2A A;  1QLE C;  4JF3 A;  1PKX A;  1WLE A;  3PJS K;  4MVS A;  4WFH A;  2Q6A A;  4JYB A;  1RM1 B;  1NJI W;  1GTO A;  1OCR B;  2WPD G;  1FXK C;  3P32 A;  3ZIA G;  1B6Q A;  2Y69 C;  2W6J G;  3CC4 V;  1K5Q A;  1AI6 A;  1FS0 G;  1K34 A;  1QR8 A;  3ABK C;  4P9P A;  4PA7 A;  4MVU A;  4UUJ C;  4RUF A;  2P67 A;  4WFF A;  2OCC B;  3AG4 B;  3X2Q B;  1FXH A;  1JOY A;  2DYS B;  3AG2 B;  1JVM A;  1EFR G;  1H8E G;  2A79 B;  3MHH C;  3F7Y C;  3OEH G;  1VQ5 V;  3E8G A;  1VQ8 V;  3MD0 A;  1FXV A;  4KFM A;  4MVR A;  5B1N A;  2XAQ A;  5H6Q A;  2EZP A;  2ZDI C;  4WFE A;  1H2G A;  4J9Z B;  2PI4 A;  3OR7 C;  2OT5 A;  2HVJ C;  2R9R B;  3TK1 A;  3JD4 A;  5L3E A;  4P2Z A;  2WLH A;  3K3W A;  3W7T A;  3E35 A;  3F5W C;  3T1C A;  4CZZ A;  1Q82 W;  2KB1 A;  4R6Z A;  5H9C A;  2EIL B;  4WFB V;  3A0R A;  2XAG A;  3SYA A;  2NLJ C;  1AI7 A;  1Q81 W;  1VQ7 V;  1RPO A;  3LNM B;  2A9H A;  3AG3 C;  4UV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...