2X7RB

Crystal structure of a late fusion intermediate of hiv-1 gp41
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
43
structure length
43
Chain Sequence
MDDDDKMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSMEMBRANE PROTEIN GP41
publication title Crystal Structure of HIV-1 Gp41 Including Both Fusion Peptide and Membrane Proximal External Regions.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 lw12.3 isolate
molecule tags Viral protein
total genus 19
structure length 43
sequence length 43
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2010-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2x7rB00
3MHHC 1SZTA 3K9AA 1QBZA 5HFMA 5CMUA 5CN0A 1I5XA 3WFVA 3B77A 4G2KA 1DLBA 1Y4MA 1EBOA 2P6JA 4FIPC 1QR9A 3B8NA 4FJCC 1K33A 2EZPA 3MHSC 3P30A 5KA6A 1QCEA 2OT5A 1K34A 1QR8A 1I5YA 3CYOA 1ENVA 4N23A 1Y66A 1F23A 2MK3A 1JPXA 2M7WA 3M99B 4FK5C 1MOFA 2EZOA 2LP7A 3GWOA 3B8MA 1DF4A 4N21A 1JQ0A 1DF5A 1MG1A 3CP1A 4JPRA 5HFLA 5KA5A 4E2LA 3H01A 4JF3A 4JGSA 5H9CA 2X7RB 2EBOA
chains in the Genus database with same CATH superfamily
3JSNA 1R6TA 4B3SO 1SERA 5EZYA 5KMGA 1PPJH 1OCCB 4P30A 5B1NA 4X62O 3OEHG 4X64B 4DV0B 1SQGA 2BSKA 4UVCA 4I0XA 3ZMTA 4IGGA 2KQXA 1VF7A 2Q7GA 1FPOA 5KMGB 3CB2A 3RFRA 3K79A 1ORQC 3S3XA 5IY5C 1S0VA 1BQZA 1KYOF 5LYJA 1AJQA 2BSKB 4I0XB 1I0HA 3SPJA 3A2FA 1R1BA 2DWEC 3UM7A 5E79Z 2B1IA 2PYLA 3ZCCA 2ZIOA 4PDRA 1EN4A 2BCCH 2GUZA 1S5HC 4DUZO 2LW7A 5LYJB 1YJ9V 1BE3H 1WP8A 3JATA 5H2FZ 1M93A 4R50A 1OJHA 2YSUB 2GUZB 3JCUZ 2A06H 1G4YB 3HB3B 2JGDA 1MMMA 4PDVA 3X2QB 5C8YA 2DOSA 3EVKA 4G27B 4CH3A 1RPOA 3JATB 2LGQA 4JI3O 1N0JA 1VARA 5CB4A 2DN9A 4UFZA 2BOBC 4LFCB 3BRCA 2Q7HA 3ABUA 2JGDB 2OCCC 3CXCU 1OV9A 3UCSC 2MW2B 5J2UA 5CB4B 4RUEA 1YZBA 2VRZA 4NB5A 1BZKA 4MTFA 5LOVA 1FXVA 1V55B 1Q3EA 2Y0PA 2JGUA 2EIMB 2AGAA 2YS8A 4LF8O 3CP1A 4JI5B 3OM3B 3QO8A 2QM7A 2QSAA 3L73H 1SQVH 2P4VA 5A9GA 4YJ3B 2Y4UA 3A0RA 1QLNA 1KMIZ 1IBLB 4X20B 1HP8A 1VQ5V 1VQ8V 4H13B 2P22C 2YI8A 2YIBD 4PELA 3GWOA 2ZQMA 3W7SA 2Q68A 3BEHA 2EIKC 2RCVA 2B9ZA 2ZR2A 2RJZA 4IYHA 3KG2A 5KHJA 5H6QA 3JAMN 2HKOA 2V7QG 1VIBA 3N2GA 4Z1VA 1YJWV 2YDEA 3P30A 2DWDC 5EBMC 2QM8A 1N33O 2H94A 3MAQA 3OUFA 4QIWF 5H5NA 2ZINA 4CZZA 4DXWA 4I7ZB 3CCRV 1S5LZ 3TGUH 1NJIW 1XREA 3HKBA 1BHAA 4NR1A 4JAUA 4LF9O 4LFAO 4JI7O 3B8NA 1L8DA 4FLUA 2DMXA 1HNXB 2ZE6A 1S76D 4DW0A 1XNQO 2DE0X 1I08A 4DV3B 4J42A 2ZE7A 3SPCA 3ZMSA 1ZLZA 2WA4A 3C3SA 3CD6V 2HJFC 1BCCH 5JVDA 4PDMA 1G6UA 4O4HA 1BS3A 2N05A 4DV1B 1OZ0A 4B7KA 4OPAA 2B5UA 3MDSA 2Q69A 2QWPB 3DSQA 1U97A 2UXNA 4LP8A 4TV9A 4WF9V 4O4HB 3LSSA 2NLJC 4I4TA 4GT1A 3CJHB 4EFEA 3ASNB 2PUSA 2H8PC 4JYAO 1KBHA 1XBLA 5GONA 4I55B 1J5EO 1H2LA 2OIEA 4LNUB 4JYBA 3CCVV 1K34A 1K7DA 1ZX3A 2EINC 1D5NA 3AG3B 4LBEC 5IJ9B 4LC1A 1M56B 2Q6AA 2LFSA 4W4KA 1AI7A 4B3TB 4JGSA 4CH6A 4FLTA 1YF2A 1WA8A 5B1BB 3RBZA 5K1PA 3LUTB 3THOA 2P6JA 4JASA 4K8XA 4JI2O 1YTFB 1NTKH 3ASOC 4YHHB 3W7XA 1WA8B 4EB6B 5BMVA 2E5LO 1YI2V 3RYHA 4KP4A 2IW5A 3LDEA 1SF9A 3LDCA 5LBQA 4DV7B 3K04A 3ABKC 2M6YA 2UXCO 5IYDO 1M1KW 1HR0O 1CP9A 4GX5A 5B3SB 4L87A 1WN7A 1ENVA 3B09A 1Q81W 1P7GA 4GKKB 3OFNG 4NTWA 1Q6UA 4X65O 4DR3B 1OCRB 5JWPA 3PN1A 2R9RB 5LXTA 5IYCO 3K3WA 4TWKA 1H2GA 3JAKA 2HR3A 1W2BU 1WPBA 2LW1A 5IYZA 3AG2C 3N2KA 5LGNA 3K9SA 5LXTB 3WU2Z 2RMKB 3IGAC 1XI1A 4DR5B 1CEZA 4FMTA 2XTAA 2PF4E 5KAFZ 1S3JA 4O4JA 2JEXA 1O9HA 4GUNA 2GTSA 2QKSA 4XDJA 1R6NA 3ML0A 1M57B 5KAIZ 1FFTB 3E22A 4O4JB 2FMLA 2YUAA 1E1RG 1QCEA 1Y74A 3K5MA 5DN6G 4QGPA 1NQTA 4DR7B 2GDSA 4Q6GA 5J2TA 4JI4B 1EFRG 2IBZH 2QM4A 4MTXA 4BIOA 1VF6A 4EFBA 5LA6A 1K5SA 1N34O 3E22B 3PJSK 1WLEA 1US6A 1PNLA 5LGUA 4X66B 4MT8A 4OPHA 3GVMA 3CCEV 4YJ2B 5J2TB 2UXBO 3K08A 3CC2V 3FYEB 4WCEV 1SS3A 3W7WA 4XBFA 5JCOA 4QJFB 2ZM6B 1XMOB 2YIAA 1KP2A 2P4KA 4RQEA 1KB9F 3RYFA 1V9PA 4LCUC 3U10A 4NXMB 3SJCC 4GX1A 3T2MA 1BQ0A 1JFFA 1KU9A 3G80A 3JCZA 4RUFA 3GWKC 3CRCA 3T1YO 1WPXA 2CDYA 2R9IA 1JFFB 1VEWA 3CHXA 2ZXWC 2EX3A 3JASA 3P3PA 4NYKA 4UB8Z 4FFKA 1BGYH 1AILA 3OTOB 4LWSB 3SJQC 3SYCA 5H6RA 1WNSA 5IWAB 1VQKV 1QR9A 5KA6A 5LP6C 1K92A 1FAFA 3C90A 2IJJA 2W6JG 1AR4A 4MS2A 3ZBHA 3STLC 3ETGA 4XDKA 1SQFA 1ZL8A 4KXRA 4IIJA 1FXKA 1XMQB 1V54C 4XDLA 2NNUA 4O2AB 5IJ0A 3K59A 5FLXN 2ZIMA 3L74H 1R3IC 1SQBH 3Q4HA 4PJ0Z 1QNMA 4FM0A 1ZL8B 4IIJB 4RO2A 2YICA 4LF6O 1W0JG 2R72A 4X1KA 1GMGA 5IJ0B 2OCHA 1QLEC 3A0HZ 5FPOA 4KHPB 1QU7A 4WFHA 5B5EZ 1MZFA 1SRYA 3Q4HB 1Y76B 1L0NH 2XAFA 3IC7A 2HLDG 2YXLA 4DUYB 1SA0A 4ZIBA 1OCCC 3O9OA 4BWAA 4JV5B 1SA0B 1Y6XA 2CE4A 3E89A 4R7CA 2JS5A 4DV0O 1IZ3A 5KLVH 3TETA 1SC5B 4HNAA 4MVOA 3B2EE 2ATKC 4OXSA 2P06A 4ZI7B 5DEDA 4HNAB 4FLWA 2AW9A 2K9PA 3AK2A 1RM1B 4F6RA 2WLMA 3WG7B 4ABMA 3FB5C 3JYCA 4R6ZA 3QG5A 3K06A 4KFMA 4HBNA 4A5UB 3X2QC 1IXMA 1TUEB 2OT5A 1NI8A 1GRJA 4B3MB 3FFQA 1VQ7V 3L71H 4DR1O 3CC4V 3SYAA 2OYQA 2EIJB 4J41A 4P9OA 4E2LA 1XDCA 3B40A 2YIBA 4LFCO 2EBOA 4X88A 4DR4O 3EXAA 3ICXA 4OGQB 1KQSU 3MHSC 2CH7A 5CA3A 4JI1O 1GN6A 2CUGA 1V55C 4JYYA 4MVZA 3STZC 1SZXA 2ODMA 1OCOB 2EIMC 1A32A 2CH7B 2A0LA 2RQ6A 3D8CA 3ABTA 1R3LC 3OE7G 4JI5O 1FFXA 3NXSA 1RP3B 4ASUG 1K4DC 3QO5A 2Z5UA 2AXTZ 4K0KB 1FFXB 5EZYB 1HNWB 3H9VA 1IBLO 3LSUA 5CA0A 4W4LA 2BTQA 4FLXA 3WB2A 5LMUB 3AG1B 5BR8B 1K8AW 4MVQA 4YIOA 2D3OW 2BTOA 1AI4A 2UUCO 1I5YA 1NTZH 2YIDA 2BTQB 4WBNA 4E4EA 2CTQA 3VOUA 1XHXA 1AP6A 2ZNIA 2RNBA 1TGOA 4WBNB 3TJTA 4MTGA 4U3JA 4LF4B 5J9PC 2F93B 3SYQA 5CA1A 2IJKA 2JJ2G 4GCZA 5C8YB 1FJGO 4PA7A 1HNXO 2Y69B 4RAIA 2NR5A 3RYCA 3ABLB 4K3AA 4Z1MG 4IYIA 5CA1B 4DV3O 4YY3B 2JS3A 3OR6C 3ABMB 2UXDB 3UO3A 2EZPA 4TQFA 3OUSA 2PY5A 4DR6B 1K3EA 5IDJA 4JYCA 3OTFA 5J2UB 4PA6A 1N32B 2E75B 4DV1O 1XNRB 3ZJZA 1JJOA 4DV2B 1NVPD 5CBFA 3L9DA 5LOVB 3CCUV 3ASNC 3RWRD 5LMNB 2ZT9B 3H1HH 1XHZA 4C7UA 3JD2A 1JVMA 3AG3C 1NU1H 3LNMB 2ADPA 3H01A 2W0FC 1IURA 2G38A 1PM9A 3NR7A 5B1BC 2X0LA 4B3TO 2W0XA 3FB8C 3CCLV 3U11A 4NKGB 1SESA 2B1GA 3F5WC 1JOYA 1WJZA 1N8RW 4MSWC 2L35A 1QQCA 2Q0OC 3N2GB 2QWNB 4YHHO 1GAXA 5EIBC 1HW7A 4J9YB 2LO1A 2RDCA 4DUZB 2WAMA 1NR7A 2EJRA 4H33A 2H3OA 1HNZB 3H1KH 5B3SC 4DV7O 1JX9A 3QTCA 1S77D 5D5PA 2CK3G 4UV9A 2QKAA 3HKBB 3AG4B 1OCRC 4DV4B 3SDLA 4DR3O 1S5JA 1AJNA 1IXBA 2V4DA 1RFYA 2IU3A 5EK0A 1H2NA 5L3DA 3CYOA 1TVKA 1GM9A 5LHIA 1MSWD 1G1XB 2GSMB 5FPRA 4MW3A 3K58A 3HR0A 4MVRA 5LGTA 3JD0A 5JVDB 5B1OA 4QNHB 4DR5O 3DGEA 1TA8A 1COWG 3T1CA 4CC5A 1B06A 1Q82W 4BIZA 1DGSA 2CGOA 4TV9B 4WFBV 1XILA 4I4TB 2VQEB 2JEUA 3OT7A 4JTDB 3ZN0A 4J7JA 1XUQA 5B1AB 1NBMG 4QPJA 3CS5A 1UJWB 5GONB 5CBHA 2Q4PA 4DR7O 2WWWA 1MA1A 4JI4O 1HWYA 4JI6B 2F4VB 3D36A 1I5XA 5LHGA 3E8HA 2PGGA 4ZHQA 1T5EA 3M8AA 5B66Z 3R65A 5K1XA 3QF7A 2QTOA 2PZSA 2YEVA 3CCSV 3IC9A 3ETEA 5TISZ 1FD9A 2OIGA 3ZX6A 5HFMA 2ZM6O 1R73A 1ZUQA 1XMOO 1JCHA 4PA3A 2YEVB 3ZHQA 5BMVB 1DTOA 3L70H 2ZCEA 4MVUA 5L3CA 5JCOC 3RYHB 1M5IA 2QA4V 4NXMO 1K97A 1GN3A 4UCRA 3CX5F 3SPGA 4FLZA 4LF9B 3J81N 3IAYA 3KKYA 3ZHRA 1F7YA 1PL4A 1AI6A 1GO3F 1JMKC 2DW4A 3BABA 1IBKB 5JJEB 4LH6A 3OTOO 4LF5B 1VMGA 5LL6Y 4TQDA 5C93A 1K5QA 5IWAO 4CC6A 1ROPA 4WFEA 3WB1A 3JAKB 1MOFA 4I9WA 4R8CA 2HFEC 5IYZB 2E76B 3N2KB 4JI0B 2AZ2A 3L75H 1Q86W 1I7FA 3SGIA 4TOIA 4U3FH 4G2KA 4NXNB 4MW8A 3M7MX 5EC2C 4DV5B 5JJNB 4GX0A 4RQFA 4JYAB 3BAAA 3VBBA 2BE3A 1GN4A 2QE7G 3CXHF 3OGIB 2WA3A 3OD4A 3OGCC 1Y74B 4UVBA 4KHPO 1MNGA 1THZA 2KKWA 5LA6B 4PA4A 1N36B 2Q5ZA 4DUYO 3D3QA 4U7OA 1LR1A 1YIJV 2P5OA 5EYPA 1M90W 4Z2WA 2XOKG 4LF7B 3E2EA 4JTAB 2E3CA 3TXSA 2KB1A 4JV5O 3MD0A 1R3JC 4UXNA 5CN0A 2D2CB 5EYPB 1Y4MA 3U0ZA 4FIPC 2QDOA 1L0LH 3LDDA 2AHZA 5A2QN 2KSDA 2ZDIC 3RYFB 2GV9A 2HHHB 1YSCA 1HR0B 4BW9A 2EILB 3T4ZA 4O4LA 2AHYA 5H9CA 2UUBB 3RT3C 1YHQV 1OCZB 3FB7C 1RM1C 2P67A 2Q0AA 5JQGA 2ZR3A 3QVNA 3WG7C 2FYUH 5ITZA 5IE9A 2ETNA 2KG7A 3IJ4A 5KX5A 3LSQA 4O4LB 3JASB 4J7ZA 4GZRB 2F95B 1FYJA 3KZIZ 3W7UA 3G6BA 4JI8B 1VQ6V 1DF4A 1AI5A 5ITZB 2Y0IA 5KA5A 1P49A 5EIBD 4PI0A 2EIJC 3E83A 4B3MO 3B4SA 3BPZA 5E1AC 1P4RA 3T1HB 3H1JH 3BCCH 3B77A 2N04A 1F4MA 2BOCC 2JRIA 4OX9B 3E8GA 1FXKB 4UCSA 4CS2A 2XT9A 3S3WA 1NR1A 1W0KG 2ZNJA 1F4NA 4JPRA 1GTOA 2WLLA 4H0LB 1PKXA 1NTMH 2DQ3A 3WFVA 3RW0A 5KHGA 4FVMA 4X1KB 3N27A 1VQ4V 1EBOA 1H38A 3HPLC 2CTRA 3K0GA 2WLLB 3SYOA 2PTMA 5L3FA 2FB5A 3ETDA 4J11A 3DC5A 3OMNB 4F6EA 4X64O 3VQYA 1CPYA 4JTCB 4K0KO 4TV8A 2W6IG 4B3RB 3W7TA 2QKCA 1HNWO 4ZOLA 2FTKA 3AG1C 3I5DA 4X1YA 4PI2A 1KKCA 4YIPA 2XUMA 2OWOA 5LMUO 5BR8O 4TV8B 2XAQA 4P2ZA 1PNKA 2LP7A 1FKAO 4I5SA 4X1YB 3FYIB 2A79B 3K57A 4BW5A 1Q8IA 4UV8A 3BVOA 4BAYA 5CMUA 3L72H 3T1YB 4Q20A 2ADQB 5DECA 2WLKA 3APOA 4I50A 2DYSB 4EKWA 4F6RB 2K1EA 3CEIA 4IHJA 1WAZA 1NVPB 4LF4O 4FFBA 1UPGA 4DW1A 2P90A 1VQMV 3ZRWA 2YI9A 1SZTA 2Y4TA 2Y69C 2ZE8A 2FKXA 4L8JA 4H44B 4IHJB 3ABLC 2OTJV 4FFBB 3JALA 2AZ0A 3ABMC 1EN5A 1FS0G 4PDLA 3CRAA 2Q7EA 4FLYA 2IH1C 1JPXA 3ZRWB 2UXDO 2ILMA 1AROP 4MVMA 1IBMB 3ZN1A 4DR6O 1YEWA 3JALB 4BIUA 1PL0A 3FB6C 1N32O 4DV6B 1XNRO 3SJBC 3BA8A 1B04A 5AG2A 4GLXA 1GH6A 1U96A 4N23A 1SQPH 2IJIA 4FM2A 3CMEV 4FK5C 2VQFB 1IDSA 3ZEDA 2A3QA 1PP9H 3CRMA 2WPDG 2V1DA 3A0BZ 1YXBA 3H1IH 4PHZA 3EFFK 4UUJC 1PNMA 4DYLA 2UUAB 3K5LA 4DR2B 1BL8A 3HKEA 5CA0B 2XAHA 4K35A 3FX7A 2QWRB 3ZRSA 4J7KA 5FL7G 4KL1A 2WLNA 1XL4A 3SR2C 1E1QG 4CH4A 5EBLC 1VQ9V 1VP7A 1WB8A 1JJ2U 4CS3A 3ETQA 3HKEB 3RVYA 2DYRB 1EM1A 1I94B 4GKJB 2CAZC 1G8MA 3BY6A 1F51A 3ZRVA 1NT2B 5L3GA 1HNZO 4H37A 3AG4C 4U3JB 4FZ0A 2UU9B 4LFBB 1MSDA 1XL6A 3JSLA 1B3QA 1P84F 3G4SV 1LUVA 1PD3A 4DR1B 4RWUA 4DV4O 3AG7A 1BT8A 3CPWU 1GK9A 4HZ3A 1X59A 3J7AU 2QJ1A 4UCVA 3RYCB 4DR4B 3OMAB 2ZE5A 2FL4A 4D7TA 2XAJA 4JI1B 4O4IA 3C3TA 3FAVA 3K5OA 5EC1C 2XAGA 4AQYB 4KUMA 3RVZA 1KECA 2Q67A 2CTWA 5D5QA 1NH2D 2PI4A 4UCUA 1JR9A 1WP7A 5FNVA 1Y66A 3ZHTA 2MK3A 4O4IB 4YJ3A 3FAVB 3ZS8C 4UB6Z 1M4UA 4B3SB 4CBCA 5B1AC 2ZD9A 4X20A 4FZ1A 2VQEO 1M56C 4X62B 4ZBMA 3OR7C 5FNVB 3I55V 3D3IA 3R66A 1AB3A 2P7TC 1M9NA 1K73W 4JI6O 2F4VO 2C2AA 1H8EG 2LFRA 3M99B 1D5AA 4JAAA 5IY5B 1N4CA 3APQA 3D36C 4TUYA 2UUCB 3E35A 3ZHSA 3AEIA 5L3EA 2A9HA 2IJHA 3OMIB 3CWBH 5BXZA 1NZ6A 5KUKA 1UFIA 3FKSG 1QR8A 2EJ7A 4TUYB 4CS4A 2M7WA 1GN2A 2R70A 3K0DA 1NKDA 3CRRA 4GKKO 4JI3B 2JJ1G 5EBWC 3G71V 1YITV 3KCXA 2GBOA 3BHPA 1EZJA 1SKVA 1FJGB 1AVMA 2PYJA 1ZWIC 2OCCB 1Q43A 2XASA 1Z2GA 1IBKO 3HKDA 3ZMVA 1LNQA 2DJVA 3JD1A 3P3NA 4LF5O 3IFXA 3GB7C 1DK1A 4HAMA 1TVKB 1CXZB 2Q9LA 1WB7A 1W59A 3CJHA 4JI0O 1M57C 5L3BA 3HKDB 1QVFU 2E74B 4LF8B 4HYOA 3VQWA 4GX2A 4I55A 4NXNO 4DV5O 2YC0A 2HJDA 1D2DA 2ITDC 1YDXA 4LNUA 1MABG 4MVSA 4DK1A 2HVJC 2ZKOA 2WSSG 5IJ9A 5KHHA 1AJPA 2O57A 1KP3A 2Z0AA 3HKCA 1X4TA 4X66O 1VF6C 2ITCC 1Z5WA 1E79G 1K9MW 3P32A 3G67A 4J10A 2EIKB 2JK5C 3B8MA 1N36O 4AI8A 1AR1B 2QR4A 1H2KA 4ZHQB 3HKCB 2IU0A 4EB6A 2X6CA 3F7VC 3CE2A 2R9AA 1N33B 4JZGA 5GTHZ 3UKMA 4JZ2A 4YXWG 4LF7O 4LH7A 3QNEA 3E8FA 2PI5A 4DK0A 1KKDA 2QEXV 1PV0A 4IL6Z 4NTXA 1QVGU 3OAAG 2HVKC 2HP8A 1RPRA 4U7NA 3JD4A 3F5TA 3UT5A 4LFAB 4JI7B 4J80A 2EILC 2HHHO 1VQLV 1OCZC 3JAWA 3SYPA 2UUBO 1XNQB 3RN4A 1ZAUA 3UT5B 2IH3C 2Q8VA 3ZRXA 2LQTA 4K8ZA 4LR3A 3AK3A 2ARHA 1XQ8A 3JAWB 1AR5A 1SETA 2GTAA 1VF5B 4TT3G 4PA9A 2Y48A 3CSXA 3UO2A 4B7EA 4JI8O 3K5NA 2YXHA 3ZMZA 1URFA 3SPHA 1YCIA 3I56V 4DO2A 3AK1A 1K33A 3WB0A 1XMQO 1BMFG 3O65A 5LHHA 3T1HO 2HEPA 5IYBO 3CMAV 2QWOB 3SJAC 2CTPA 3TCUA 4MTOA 4FPPA 1FXKC 2Z3YA 3TXQA 4OX9O 5HFLA 1DF5A 2VWJA 4O2BA 2YXYA 1J5EB 1K4CC 3ZMUA 2X7RB 2JVDA 2XNDG 3A8TA 3SPIA 2EINB 4O2BB 3E86A 2RN9A 4EEQA 4YJ2A 4DRXA 3JD3A 2HG5C 1JQ0A 3EHBB 4TSFG 4CH5A 5GTIZ 4JI2B 1B6QA 3K9AA 4DRXB 1S72V 1H2MA 1N0NA 1KC8W 3ASOB 2E5LB 5BZBA 3ZHUA 2X6BA 4B3RO 2WLIA 4ZKIA 3RYIA 2UXCB 1BSMA 4GYCB 2JIZG 3ABKB 3FD9A 1KD1W 2JDIG 1ZSPA 2WLIB 3VQVA 1SQQH 3RYIB 2NN4A 4X65B 4BR6A 1MZEA 4FJCC 1HDJA 4PD4F 2QWQB 3DC6A 1Y67A 4LWSA 3OEEG 3ZHVA 1YTFD 2DYSC 5DM6V 5JQGB 2WLHA 4P9PA 2A7WA 4G28B 2KG7B 3DTUB 5KX5B 4WFAV 2F66C 3AG2B 1XEQA 3H1LH 5KUMA 5KHKA 2XHBA 1R3KC 4FLVA 1BHBA 3K03A 4O2AA 1NS1A 3T4DA 4WFFA 1Z5VA 4JAVA 2EZOA 4NTYA 4JF3A 4X8AA 2CGNA 1OCOC 3ZIAG 1VQPV 3CC7V 1H8HG 3CCMV 1Q6IA 1ZTEA 1IBMO 4AILC 1JA8A 1GKFA 2Q73A 5IT9N 1XOUA 1L1FA 1Y76A 1N34B 2VWKA 2N74A 1F23A 5JH7A 1O9GA 4DV6O 4IT5A 1TUBA 2UXXA 5BY1A 3CCQV 2UXBB 1H2SB 1RSOA 2X6AA 4UCTA 4QE7A 2IM9A 4FM1A 5JH7B 1YJNV 1QBZA 2DQ0A 3CRQA 4ICGA 2VQFO 4PV1B 4I9QA 5KHIA 1Q90D 1TUBB 1Q7YW 1EZVH 1RSOB 1R6KA 5F2VO 2OTLV 4WFGA 2UUAO 4X1IA 4DR2O 4ZI7A 2F23A 4ZOLB 1MG1A 1KUQA 2ZDIA 3RGBA 3TK1A 1P7BA 3G6EV 3OW2U 1Q6HA 1GM7A 1SQXH 2GHYA 4AHCA 4NVPA 2DYRC 4X1IB 3CCJV 1IVSA 2L6LA 3VQXA 4D6TH 1I94O 1GM8A 2F1MA 2QTSA 4GKJO 1AP5A 3DXRA 1VQNV 2ZXWB 1EN6A 4X89A 5LP6A 4UVAA 3QO7A 4I50B 1YVWA 3MHHC 1J95A 3DXRB 3E8BA 5GW7A 5LP6B 1NH2B 2LGWA 3F7YC 4QPKA 4UCOA 2UU9O 1FXHA 3BA9A 4LFBO 2WLJA 4D7SA 4J9ZB 4YY3O 2F43G 3LNNA 3UQ8A 4N21A 1V54B 4F4LA 1IX9A 3JARA 4LF6B 5JJJB 3BFRA 5CBGA 3KCYA 1DLBA 4QE9A 1VQOV 1TAEA 4DV2O 2QGNA 1OHHG 2EULA 3JARB 4X9QA 2VS0A 1QLEB 4AQYO 5LMNO 1LUWA 4B08A 1QHTA 3J80N 1Q5OA 2LJ2A
chains in the Genus database with same CATH topology
2NNUA 3E35A 3AEIA 1SERA 5L3EA 2A9HA 2IJHA 1OCCB 1R3IC 3OMIB 4P30A 1AI6A 5B1NA 1GO3F 5KUKA 2DW4A 3OEHG 3FKSG 1QR8A 4RO2A 4UVCA 3ZMTA 1W0JG 5C93A 1K5QA 1GMGA 2M7WA 1QLEC 1ROPA 4WFEA 1MOFA 4I9WA 4R8CA 4WFHA 1VQ6V 2HFEC 1SRYA 3K0DA 1NKDA 3K79A 1ORQC 5IY5C 1S0VA 2JJ1G 5EBWC 1AJQA 2XAFA 3IC7A 2HLDG 3G71V 1Q86W 1YITV 4G2KA 4MW8A 5EC2C 3SPJA 4GX0A 2DWEC 3UM7A 1EZJA 2B1IA 1OCCC 4RQFA 3ZCCA 4PDRA 1S5HC 1YJ9V 1ZWIC 2OCCB 2XASA 3E89A 3VBBA 4R7CA 2QE7G 3ZMVA 1LNQA 4R50A 3JD1A 3IFXA 3OGCC 3GB7C 4HAMA 3TETA 2YSUB 4UVBA 1G4YB 3HB3B 4PDVA 4MVOA 3X2QB 4G27B 1THZA 2ATKC 4OXSA 1M57C 1RPOA 5L3BA 1QVFU 4PA4A 4U7OA 4HYOA 1YIJV 2BOBC 4GX2A 3ABUA 1M90W 2ITDC 1MABG 2OCCC 4MVSA 1RM1B 3CXCU 2XOKG 3E2EA 4JTAB 2WLMA 2KB1A 2HVJC 3WG7B 3FB5C 3JYCA 3MD0A 2WSSG 1R3JC 4RUEA 4R6ZA 4UXNA 1AJPA 3K06A 5CN0A 4KFMA 1KP3A 1Y4MA 4FIPC 3X2QC 1IXMA 1TUEB 3LDDA 4MTFA 2AHZA 2OT5A 1FXVA 1V55B 2ITCC 1E79G 1K9MW 3P32A 2ZDIC 2EIMB 2EIKB 2JK5C 1VQ7V 1YSCA 3CC4V 3SYAA 3B8MA 2EIJB 3CP1A 4P9OA 1AR1B 4E2LA 3OM3B 2EILB 3T4ZA 2AHYA 5H9CA 1YHQV 3QO8A 1OCZB 3FB7C 1RM1C 2IU0A 2EBOA 2P67A 2X6CA 3F7VC 2QM7A 2ZR3A 3WG7C 4X88A 3UKMA 4YXWG 1KQSU 3A0RA 3MHSC 1QLNA 3QNEA 5CA3A 1VQ5V 1VQ8V 3E8FA 3LSQA 2PI5A 1KKDA 1V55C 4MVZA 4PELA 2QEXV 3STZC 1QVGU 3GWOA 2ZQMA 3OAAG 3W7SA 2HVKC 1DF4A 1AI5A 2Q68A 1OCOB 2EIMC 2EIKC 1RPRA 3BEHA 4U7NA 5KA5A 3JD4A 2ZR2A 3KG2A 2EIJC 3E83A 2A0LA 5E1AC 5H6QA 2EILC 3ABTA 1R3LC 1P4RA 3OE7G 1VQLV 1OCZC 2HKOA 2V7QG 3B77A 3SYPA 1F4MA 2BOCC 1YJWV 3NXSA 3P30A 4ASUG 2DWDC 1K4DC 3E8GA 5EBMC 1FXKB 2IH3C 3ZRXA 2QM8A 3QO5A 2Z5UA 2H94A 3OUFA 4QIWF 1SETA 4CZZA 1NR1A 1W0KG 4JPRA 1F4NA 4TT3G 4PA9A 1GTOA 2Y48A 4DXWA 2WLLA 3CCRV 1NJIW 1PKXA 3AG1B 1K8AW 2DQ3A 1BHAA 3WFVA 3ZMZA 3RW0A 4JAUA 3SPHA 4MVQA 3I56V 1VQ4V 1EBOA 4DO2A 1H38A 3B8NA 2D3OW 1K33A 3HPLC 1AI4A 3K0GA 1BMFG 5LHHA 1I5YA 2WLLB 5IYBO 3CMAV 3SYOA 3TCUA 4MTOA 5L3FA 4FPPA 1S76D 1FXKC 2Z3YA 3ETDA 5HFLA 1DF5A 3VOUA 3OMNB 1K4CC 3ZMUA 2X7RB 1CPYA 4JTCB 3SPCA 3ZMSA 2W6IG 3W7TA 3CD6V 2HJFC 2XNDG 2FTKA 3AG1C 4PDMA 3SPIA 4MTGA 2EINB 5J9PC 3E86A 1OZ0A 3SYQA 2B5UA 2Q69A 2XAQA 2HG5C 2IJKA 2JJ2G 3JD3A 4P2ZA 1PNKA 4GCZA 2UXNA 2LP7A 4LP8A 1JQ0A 4I5SA 4WF9V 3FYIB 2A79B 3LSSA 2NLJC 3EHBB 4GT1A 4BW5A 4TSFG 4PA7A 3ASNB 2Y69B 2H8PC 4RAIA 4UV8A 1B6QA 3ABLB 3K9AA 4Z1MG 1S72V 4BAYA 5CMUA 3OR6C 4Q20A 3ABMB 2WLKA 1KC8W 3ASOB 2EZPA 4JYBA 5BZBA 3CCVV 2X6BA 1K34A 1K7DA 3OUSA 2DYSB 2EINC 2WLIA 3AG3B 4EKWA 1K3EA 5IDJA 2K1EA 4JYCA 4ZKIA 4LBEC 4LC1A 1M56B 2Q6AA 2LFSA 4PA6A 1NVPB 1AI7A 3ZJZA 4JGSA 2JIZG 1NVPD 3ABKB 5CBFA 1KD1W 2P90A 2JDIG 1VQMV 5B1BB 3CCUV 2WLIB 3RBZA 3ZRWA 1SZTA 3ASNC 2Y69C 3ABLC 3LUTB 2OTJV 2P6JA 4FJCC 4JASA 3ABMC 1FS0G 1YTFB 3ASOC 4PDLA 3JD2A 3W7XA 3OEEG 2IH1C 1JVMA 1JPXA 3ZRWB 2DYSC 3AG3C 5DM6V 2WLHA 1YTFD 1AROP 3LNMB 4P9PA 4MVMA 1YI2V 3ZN1A 3H01A 4KP4A 2IW5A 2W0FC 1PL0A 4BIUA 4G28B 3LDEA 3DTUB 3FB6C 3LDCA 4WFAV 5LBQA 3K04A 3ABKC 3AG2B 5IYDO 1M1KW 1CP9A 5B1BC 4GX5A 5KUMA 2X0LA 5B3SB 3FB8C 1R3KC 3CCLV 4L87A 1SESA 1BHBA 3K03A 1ENVA 2B1GA 4N23A 1Q81W 3F5WC 2IJIA 3OFNG 1JOYA 3T4DA 4WFFA 4JAVA 3CMEV 1N8RW 1OCRB 4FK5C 2EZOA 4MSWC 3W7UA 2R9RB 4JF3A 4X8AA 5IYCO 3K3WA 4TWKA 2WPDG 4J9YB 1H2GA 1OCOC 2V1DA 3ZIAG 1VQPV 3EFFK 3CC7V 1H8HG 2HR3A 2WAMA 3CCMV 1W2BU 4UUJC 1PNMA 1NR7A 2EJRA 4H33A 3AG2C 5LGNA 1GKFA 1BL8A 1L1FA 5B3SC 1JX9A 3IGAC 1F23A 2XAHA 1S77D 2CK3G 4UV9A 1CEZA 4FMTA 3ZRSA 2WLNA 1XL4A 5FL7G 1E1QG 1S3JA 2UXXA 5EBLC 3CCQV 2JEXA 3AG4B 1VQ9V 1OCRC 1JJ2U 2X6AA 3RVYA 2DYRB 2QKSA 4QE7A 1R6NA 1AJNA 3ML0A 1M57B 4XDJA 1YJNV 1QBZA 2DQ0A 2IU3A 1FFTB 5EK0A 1G8MA 3BY6A 5L3DA 1F51A 3ZRVA 1Q7YW 1E1RG 1QCEA 3CYOA 1R6KA 1GM9A 5DN6G 1NQTA 5LHIA 1MSWD 2OTLV 4WFGA 2GSMB 1EFRG 5L3GA 4MTXA 4MW3A 1K5SA 1MG1A 4MVRA 5LGTA 3JD0A 2ZDIA 5B1OA 3TK1A 3PJSK 1WLEA 1P7BA 4QNHB 4H37A 3AG4C 3DGEA 3G6EV 1PNLA 5LGUA 3OW2U 4MT8A 1COWG 1GM7A 3T1CA 3CCEV 2GHYA 1Q82W 2DYRC 1XL6A 3K08A 4BIZA 3G4SV 1PD3A 3CCJV 3CC2V 3FYEB 4WFBV 3CPWU 1GK9A 4WCEV 2JEUA 1GM8A 4JTDB 4HZ3A 3ZN0A 4XBFA 3W7WA 1VQNV 5B1AB 2ZXWB 1NBMG 4QPJA 4X89A 1UJWB 5CBHA 4QJFB 3OMAB 1KP2A 2WWWA 4UVAA 3QO7A 4RQEA 2XAJA 1HWYA 3MHHC 4LCUC 5EC1C 3D36A 2XAGA 1J95A 3E8BA 4GX1A 1I5XA 5GW7A 3T2MA 5LHGA 1NH2B 3E8HA 4KUMA 3JCZA 3F7YC 4RUFA 3RVZA 1KECA 2Q67A 4QPKA 3R65A 1FXHA 1NH2D 2PI4A 2WLJA 1Y66A 2MK3A 2QTOA 4J9ZB 1WPXA 2F43G 2YEVA 3CCSV 4N21A 4CBCA 2R9IA 1V54B 2ZD9A 2ZXWC 3ETEA 5B1AC 4F4LA 1M56C 4ZBMA 3OR7C 3I55V 3D3IA 3SJQC 5HFMA 3SYCA 1R73A 5H6RA 1JCHA 5CBGA 2P7TC 4PA3A 1DLBA 2YEVB 4QE9A 1VQOV 1DTOA 1VQKV 1QR9A 1M9NA 5KA6A 4MVUA 5L3CA 1OHHG 1K73W 1K92A 2QA4V 1K97A 1QLEB 2C2AA 1H8EG 2W6JG 2IJJA 2LFRA 3M99B 4MS2A 3SPGA 3STLC 3ETGA 5IY5B 4XDKA 1FXKA 1V54C 4XDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MHH C;  1SZT A;  3K9A A;  1QBZ A;  5HFM A;  5CMU A;  5CN0 A;  1I5X A;  3WFV A;  3B77 A;  4G2K A;  1DLB A;  1Y4M A;  1EBO A;  2P6J A;  4FIP C;  1QR9 A;  3B8N A;  4FJC C;  1K33 A;  2EZP A;  3MHS C;  3P30 A;  5KA6 A;  1QCE A;  2OT5 A;  1K34 A;  1QR8 A;  1I5Y A;  3CYO A;  1ENV A;  4N23 A;  1Y66 A;  1F23 A;  2MK3 A;  1JPX A;  2M7W A;  3M99 B;  4FK5 C;  1MOF A;  2EZO A;  2LP7 A;  3GWO A;  3B8M A;  1DF4 A;  4N21 A;  1JQ0 A;  1DF5 A;  1MG1 A;  3CP1 A;  4JPR A;  5HFL A;  5KA5 A;  4E2L A;  3H01 A;  4JF3 A;  4JGS A;  5H9C A;  2X7R B;  2EBO A; 
#chains in the Genus database with same CATH topology
 3JSN A;  1R6T A;  4B3S O;  1SER A;  5EZY A;  5KMG A;  1PPJ H;  1OCC B;  4P30 A;  5B1N A;  4X62 O;  3OEH G;  4X64 B;  4DV0 B;  1SQG A;  2BSK A;  4UVC A;  4I0X A;  3ZMT A;  4IGG A;  2KQX A;  1VF7 A;  2Q7G A;  1FPO A;  5KMG B;  3CB2 A;  3RFR A;  3K79 A;  1ORQ C;  3S3X A;  5IY5 C;  1S0V A;  1BQZ A;  1KYO F;  5LYJ A;  1AJQ A;  2BSK B;  4I0X B;  1I0H A;  3SPJ A;  3A2F A;  1R1B A;  2DWE C;  3UM7 A;  5E79 Z;  2B1I A;  2PYL A;  3ZCC A;  2ZIO A;  4PDR A;  1EN4 A;  2BCC H;  2GUZ A;  1S5H C;  4DUZ O;  2LW7 A;  5LYJ B;  1YJ9 V;  1BE3 H;  1WP8 A;  3JAT A;  5H2F Z;  1M93 A;  4R50 A;  1OJH A;  2YSU B;  2GUZ B;  3JCU Z;  2A06 H;  1G4Y B;  3HB3 B;  2JGD A;  1MMM A;  4PDV A;  3X2Q B;  5C8Y A;  2DOS A;  3EVK A;  4G27 B;  4CH3 A;  1RPO A;  3JAT B;  2LGQ A;  4JI3 O;  1N0J A;  1VAR A;  5CB4 A;  2DN9 A;  4UFZ A;  2BOB C;  4LFC B;  3BRC A;  2Q7H A;  3ABU A;  2JGD B;  2OCC C;  3CXC U;  1OV9 A;  3UCS C;  2MW2 B;  5J2U A;  5CB4 B;  4RUE A;  1YZB A;  2VRZ A;  4NB5 A;  1BZK A;  4MTF A;  5LOV A;  1FXV A;  1V55 B;  1Q3E A;  2Y0P A;  2JGU A;  2EIM B;  2AGA A;  2YS8 A;  4LF8 O;  3CP1 A;  4JI5 B;  3OM3 B;  3QO8 A;  2QM7 A;  2QSA A;  3L73 H;  1SQV H;  2P4V A;  5A9G A;  4YJ3 B;  2Y4U A;  3A0R A;  1QLN A;  1KMI Z;  1IBL B;  4X20 B;  1HP8 A;  1VQ5 V;  1VQ8 V;  4H13 B;  2P22 C;  2YI8 A;  2YIB D;  4PEL A;  3GWO A;  2ZQM A;  3W7S A;  2Q68 A;  3BEH A;  2EIK C;  2RCV A;  2B9Z A;  2ZR2 A;  2RJZ A;  4IYH A;  3KG2 A;  5KHJ A;  5H6Q A;  3JAM N;  2HKO A;  2V7Q G;  1VIB A;  3N2G A;  4Z1V A;  1YJW V;  2YDE A;  3P30 A;  2DWD C;  5EBM C;  2QM8 A;  1N33 O;  2H94 A;  3MAQ A;  3OUF A;  4QIW F;  5H5N A;  2ZIN A;  4CZZ A;  4DXW A;  4I7Z B;  3CCR V;  1S5L Z;  3TGU H;  1NJI W;  1XRE A;  3HKB A;  1BHA A;  4NR1 A;  4JAU A;  4LF9 O;  4LFA O;  4JI7 O;  3B8N A;  1L8D A;  4FLU A;  2DMX A;  1HNX B;  2ZE6 A;  1S76 D;  4DW0 A;  1XNQ O;  2DE0 X;  1I08 A;  4DV3 B;  4J42 A;  2ZE7 A;  3SPC A;  3ZMS A;  1ZLZ A;  2WA4 A;  3C3S A;  3CD6 V;  2HJF C;  1BCC H;  5JVD A;  4PDM A;  1G6U A;  4O4H A;  1BS3 A;  2N05 A;  4DV1 B;  1OZ0 A;  4B7K A;  4OPA A;  2B5U A;  3MDS A;  2Q69 A;  2QWP B;  3DSQ A;  1U97 A;  2UXN A;  4LP8 A;  4TV9 A;  4WF9 V;  4O4H B;  3LSS A;  2NLJ C;  4I4T A;  4GT1 A;  3CJH B;  4EFE A;  3ASN B;  2PUS A;  2H8P C;  4JYA O;  1KBH A;  1XBL A;  5GON A;  4I55 B;  1J5E O;  1H2L A;  2OIE A;  4LNU B;  4JYB A;  3CCV V;  1K34 A;  1K7D A;  1ZX3 A;  2EIN C;  1D5N A;  3AG3 B;  4LBE C;  5IJ9 B;  4LC1 A;  1M56 B;  2Q6A A;  2LFS A;  4W4K A;  1AI7 A;  4B3T B;  4JGS A;  4CH6 A;  4FLT A;  1YF2 A;  1WA8 A;  5B1B B;  3RBZ A;  5K1P A;  3LUT B;  3THO A;  2P6J A;  4JAS A;  4K8X A;  4JI2 O;  1YTF B;  1NTK H;  3ASO C;  4YHH B;  3W7X A;  1WA8 B;  4EB6 B;  5BMV A;  2E5L O;  1YI2 V;  3RYH A;  4KP4 A;  2IW5 A;  3LDE A;  1SF9 A;  3LDC A;  5LBQ A;  4DV7 B;  3K04 A;  3ABK C;  2M6Y A;  2UXC O;  5IYD O;  1M1K W;  1HR0 O;  1CP9 A;  4GX5 A;  5B3S B;  4L87 A;  1WN7 A;  1ENV A;  3B09 A;  1Q81 W;  1P7G A;  4GKK B;  3OFN G;  4NTW A;  1Q6U A;  4X65 O;  4DR3 B;  1OCR B;  5JWP A;  3PN1 A;  2R9R B;  5LXT A;  5IYC O;  3K3W A;  4TWK A;  1H2G A;  3JAK A;  2HR3 A;  1W2B U;  1WPB A;  2LW1 A;  5IYZ A;  3AG2 C;  3N2K A;  5LGN A;  3K9S A;  5LXT B;  3WU2 Z;  2RMK B;  3IGA C;  1XI1 A;  4DR5 B;  1CEZ A;  4FMT A;  2XTA A;  2PF4 E;  5KAF Z;  1S3J A;  4O4J A;  2JEX A;  1O9H A;  4GUN A;  2GTS A;  2QKS A;  4XDJ A;  1R6N A;  3ML0 A;  1M57 B;  5KAI Z;  1FFT B;  3E22 A;  4O4J B;  2FML A;  2YUA A;  1E1R G;  1QCE A;  1Y74 A;  3K5M A;  5DN6 G;  4QGP A;  1NQT A;  4DR7 B;  2GDS A;  4Q6G A;  5J2T A;  4JI4 B;  1EFR G;  2IBZ H;  2QM4 A;  4MTX A;  4BIO A;  1VF6 A;  4EFB A;  5LA6 A;  1K5S A;  1N34 O;  3E22 B;  3PJS K;  1WLE A;  1US6 A;  1PNL A;  5LGU A;  4X66 B;  4MT8 A;  4OPH A;  3GVM A;  3CCE V;  4YJ2 B;  5J2T B;  2UXB O;  3K08 A;  3CC2 V;  3FYE B;  4WCE V;  1SS3 A;  3W7W A;  4XBF A;  5JCO A;  4QJF B;  2ZM6 B;  1XMO B;  2YIA A;  1KP2 A;  2P4K A;  4RQE A;  1KB9 F;  3RYF A;  1V9P A;  4LCU C;  3U10 A;  4NXM B;  3SJC C;  4GX1 A;  3T2M A;  1BQ0 A;  1JFF A;  1KU9 A;  3G80 A;  3JCZ A;  4RUF A;  3GWK C;  3CRC A;  3T1Y O;  1WPX A;  2CDY A;  2R9I A;  1JFF B;  1VEW A;  3CHX A;  2ZXW C;  2EX3 A;  3JAS A;  3P3P A;  4NYK A;  4UB8 Z;  4FFK A;  1BGY H;  1AIL A;  3OTO B;  4LWS B;  3SJQ C;  3SYC A;  5H6R A;  1WNS A;  5IWA B;  1VQK V;  1QR9 A;  5KA6 A;  5LP6 C;  1K92 A;  1FAF A;  3C90 A;  2IJJ A;  2W6J G;  1AR4 A;  4MS2 A;  3ZBH A;  3STL C;  3ETG A;  4XDK A;  1SQF A;  1ZL8 A;  4KXR A;  4IIJ A;  1FXK A;  1XMQ B;  1V54 C;  4XDL A;  2NNU A;  4O2A B;  5IJ0 A;  3K59 A;  5FLX N;  2ZIM A;  3L74 H;  1R3I C;  1SQB H;  3Q4H A;  4PJ0 Z;  1QNM A;  4FM0 A;  1ZL8 B;  4IIJ B;  4RO2 A;  2YIC A;  4LF6 O;  1W0J G;  2R72 A;  4X1K A;  1GMG A;  5IJ0 B;  2OCH A;  1QLE C;  3A0H Z;  5FPO A;  4KHP B;  1QU7 A;  4WFH A;  5B5E Z;  1MZF A;  1SRY A;  3Q4H B;  1Y76 B;  1L0N H;  2XAF A;  3IC7 A;  2HLD G;  2YXL A;  4DUY B;  1SA0 A;  4ZIB A;  1OCC C;  3O9O A;  4BWA A;  4JV5 B;  1SA0 B;  1Y6X A;  2CE4 A;  3E89 A;  4R7C A;  2JS5 A;  4DV0 O;  1IZ3 A;  5KLV H;  3TET A;  1SC5 B;  4HNA A;  4MVO A;  3B2E E;  2ATK C;  4OXS A;  2P06 A;  4ZI7 B;  5DED A;  4HNA B;  4FLW A;  2AW9 A;  2K9P A;  3AK2 A;  1RM1 B;  4F6R A;  2WLM A;  3WG7 B;  4ABM A;  3FB5 C;  3JYC A;  4R6Z A;  3QG5 A;  3K06 A;  4KFM A;  4HBN A;  4A5U B;  3X2Q C;  1IXM A;  1TUE B;  2OT5 A;  1NI8 A;  1GRJ A;  4B3M B;  3FFQ A;  1VQ7 V;  3L71 H;  4DR1 O;  3CC4 V;  3SYA A;  2OYQ A;  2EIJ B;  4J41 A;  4P9O A;  4E2L A;  1XDC A;  3B40 A;  2YIB A;  4LFC O;  2EBO A;  4X88 A;  4DR4 O;  3EXA A;  3ICX A;  4OGQ B;  1KQS U;  3MHS C;  2CH7 A;  5CA3 A;  4JI1 O;  1GN6 A;  2CUG A;  1V55 C;  4JYY A;  4MVZ A;  3STZ C;  1SZX A;  2ODM A;  1OCO B;  2EIM C;  1A32 A;  2CH7 B;  2A0L A;  2RQ6 A;  3D8C A;  3ABT A;  1R3L C;  3OE7 G;  4JI5 O;  1FFX A;  3NXS A;  1RP3 B;  4ASU G;  1K4D C;  3QO5 A;  2Z5U A;  2AXT Z;  4K0K B;  1FFX B;  5EZY B;  1HNW B;  3H9V A;  1IBL O;  3LSU A;  5CA0 A;  4W4L A;  2BTQ A;  4FLX A;  3WB2 A;  5LMU B;  3AG1 B;  5BR8 B;  1K8A W;  4MVQ A;  4YIO A;  2D3O W;  2BTO A;  1AI4 A;  2UUC O;  1I5Y A;  1NTZ H;  2YID A;  2BTQ B;  4WBN A;  4E4E A;  2CTQ A;  3VOU A;  1XHX A;  1AP6 A;  2ZNI A;  2RNB A;  1TGO A;  4WBN B;  3TJT A;  4MTG A;  4U3J A;  4LF4 B;  5J9P C;  2F93 B;  3SYQ A;  5CA1 A;  2IJK A;  2JJ2 G;  4GCZ A;  5C8Y B;  1FJG O;  4PA7 A;  1HNX O;  2Y69 B;  4RAI A;  2NR5 A;  3RYC A;  3ABL B;  4K3A A;  4Z1M G;  4IYI A;  5CA1 B;  4DV3 O;  4YY3 B;  2JS3 A;  3OR6 C;  3ABM B;  2UXD B;  3UO3 A;  2EZP A;  4TQF A;  3OUS A;  2PY5 A;  4DR6 B;  1K3E A;  5IDJ A;  4JYC A;  3OTF A;  5J2U B;  4PA6 A;  1N32 B;  2E75 B;  4DV1 O;  1XNR B;  3ZJZ A;  1JJO A;  4DV2 B;  1NVP D;  5CBF A;  3L9D A;  5LOV B;  3CCU V;  3ASN C;  3RWR D;  5LMN B;  2ZT9 B;  3H1H H;  1XHZ A;  4C7U A;  3JD2 A;  1JVM A;  3AG3 C;  1NU1 H;  3LNM B;  2ADP A;  3H01 A;  2W0F C;  1IUR A;  2G38 A;  1PM9 A;  3NR7 A;  5B1B C;  2X0L A;  4B3T O;  2W0X A;  3FB8 C;  3CCL V;  3U11 A;  4NKG B;  1SES A;  2B1G A;  3F5W C;  1JOY A;  1WJZ A;  1N8R W;  4MSW C;  2L35 A;  1QQC A;  2Q0O C;  3N2G B;  2QWN B;  4YHH O;  1GAX A;  5EIB C;  1HW7 A;  4J9Y B;  2LO1 A;  2RDC A;  4DUZ B;  2WAM A;  1NR7 A;  2EJR A;  4H33 A;  2H3O A;  1HNZ B;  3H1K H;  5B3S C;  4DV7 O;  1JX9 A;  3QTC A;  1S77 D;  5D5P A;  2CK3 G;  4UV9 A;  2QKA A;  3HKB B;  3AG4 B;  1OCR C;  4DV4 B;  3SDL A;  4DR3 O;  1S5J A;  1AJN A;  1IXB A;  2V4D A;  1RFY A;  2IU3 A;  5EK0 A;  1H2N A;  5L3D A;  3CYO A;  1TVK A;  1GM9 A;  5LHI A;  1MSW D;  1G1X B;  2GSM B;  5FPR A;  4MW3 A;  3K58 A;  3HR0 A;  4MVR A;  5LGT A;  3JD0 A;  5JVD B;  5B1O A;  4QNH B;  4DR5 O;  3DGE A;  1TA8 A;  1COW G;  3T1C A;  4CC5 A;  1B06 A;  1Q82 W;  4BIZ A;  1DGS A;  2CGO A;  4TV9 B;  4WFB V;  1XIL A;  4I4T B;  2VQE B;  2JEU A;  3OT7 A;  4JTD B;  3ZN0 A;  4J7J A;  1XUQ A;  5B1A B;  1NBM G;  4QPJ A;  3CS5 A;  1UJW B;  5GON B;  5CBH A;  2Q4P A;  4DR7 O;  2WWW A;  1MA1 A;  4JI4 O;  1HWY A;  4JI6 B;  2F4V B;  3D36 A;  1I5X A;  5LHG A;  3E8H A;  2PGG A;  4ZHQ A;  1T5E A;  3M8A A;  5B66 Z;  3R65 A;  5K1X A;  3QF7 A;  2QTO A;  2PZS A;  2YEV A;  3CCS V;  3IC9 A;  3ETE A;  5TIS Z;  1FD9 A;  2OIG A;  3ZX6 A;  5HFM A;  2ZM6 O;  1R73 A;  1ZUQ A;  1XMO O;  1JCH A;  4PA3 A;  2YEV B;  3ZHQ A;  5BMV B;  1DTO A;  3L70 H;  2ZCE A;  4MVU A;  5L3C A;  5JCO C;  3RYH B;  1M5I A;  2QA4 V;  4NXM O;  1K97 A;  1GN3 A;  4UCR A;  3CX5 F;  3SPG A;  4FLZ A;  4LF9 B;  3J81 N;  3IAY A;  3KKY A;  3ZHR A;  1F7Y A;  1PL4 A;  1AI6 A;  1GO3 F;  1JMK C;  2DW4 A;  3BAB A;  1IBK B;  5JJE B;  4LH6 A;  3OTO O;  4LF5 B;  1VMG A;  5LL6 Y;  4TQD A;  5C93 A;  1K5Q A;  5IWA O;  4CC6 A;  1ROP A;  4WFE A;  3WB1 A;  3JAK B;  1MOF A;  4I9W A;  4R8C A;  2HFE C;  5IYZ B;  2E76 B;  3N2K B;  4JI0 B;  2AZ2 A;  3L75 H;  1Q86 W;  1I7F A;  3SGI A;  4TOI A;  4U3F H;  4G2K A;  4NXN B;  4MW8 A;  3M7M X;  5EC2 C;  4DV5 B;  5JJN B;  4GX0 A;  4RQF A;  4JYA B;  3BAA A;  3VBB A;  2BE3 A;  1GN4 A;  2QE7 G;  3CXH F;  3OGI B;  2WA3 A;  3OD4 A;  3OGC C;  1Y74 B;  4UVB A;  4KHP O;  1MNG A;  1THZ A;  2KKW A;  5LA6 B;  4PA4 A;  1N36 B;  2Q5Z A;  4DUY O;  3D3Q A;  4U7O A;  1LR1 A;  1YIJ V;  2P5O A;  5EYP A;  1M90 W;  4Z2W A;  2XOK G;  4LF7 B;  3E2E A;  4JTA B;  2E3C A;  3TXS A;  2KB1 A;  4JV5 O;  3MD0 A;  1R3J C;  4UXN A;  5CN0 A;  2D2C B;  5EYP B;  1Y4M A;  3U0Z A;  4FIP C;  2QDO A;  1L0L H;  3LDD A;  2AHZ A;  5A2Q N;  2KSD A;  2ZDI C;  3RYF B;  2GV9 A;  2HHH B;  1YSC A;  1HR0 B;  4BW9 A;  2EIL B;  3T4Z A;  4O4L A;  2AHY A;  5H9C A;  2UUB B;  3RT3 C;  1YHQ V;  1OCZ B;  3FB7 C;  1RM1 C;  2P67 A;  2Q0A A;  5JQG A;  2ZR3 A;  3QVN A;  3WG7 C;  2FYU H;  5ITZ A;  5IE9 A;  2ETN A;  2KG7 A;  3IJ4 A;  5KX5 A;  3LSQ A;  4O4L B;  3JAS B;  4J7Z A;  4GZR B;  2F95 B;  1FYJ A;  3KZI Z;  3W7U A;  3G6B A;  4JI8 B;  1VQ6 V;  1DF4 A;  1AI5 A;  5ITZ B;  2Y0I A;  5KA5 A;  1P49 A;  5EIB D;  4PI0 A;  2EIJ C;  3E83 A;  4B3M O;  3B4S A;  3BPZ A;  5E1A C;  1P4R A;  3T1H B;  3H1J H;  3BCC H;  3B77 A;  2N04 A;  1F4M A;  2BOC C;  2JRI A;  4OX9 B;  3E8G A;  1FXK B;  4UCS A;  4CS2 A;  2XT9 A;  3S3W A;  1NR1 A;  1W0K G;  2ZNJ A;  1F4N A;  4JPR A;  1GTO A;  2WLL A;  4H0L B;  1PKX A;  1NTM H;  2DQ3 A;  3WFV A;  3RW0 A;  5KHG A;  4FVM A;  4X1K B;  3N27 A;  1VQ4 V;  1EBO A;  1H38 A;  3HPL C;  2CTR A;  3K0G A;  2WLL B;  3SYO A;  2PTM A;  5L3F A;  2FB5 A;  3ETD A;  4J11 A;  3DC5 A;  3OMN B;  4F6E A;  4X64 O;  3VQY A;  1CPY A;  4JTC B;  4K0K O;  4TV8 A;  2W6I G;  4B3R B;  3W7T A;  2QKC A;  1HNW O;  4ZOL A;  2FTK A;  3AG1 C;  3I5D A;  4X1Y A;  4PI2 A;  1KKC A;  4YIP A;  2XUM A;  2OWO A;  5LMU O;  5BR8 O;  4TV8 B;  2XAQ A;  4P2Z A;  1PNK A;  2LP7 A;  1FKA O;  4I5S A;  4X1Y B;  3FYI B;  2A79 B;  3K57 A;  4BW5 A;  1Q8I A;  4UV8 A;  3BVO A;  4BAY A;  5CMU A;  3L72 H;  3T1Y B;  4Q20 A;  2ADQ B;  5DEC A;  2WLK A;  3APO A;  4I50 A;  2DYS B;  4EKW A;  4F6R B;  2K1E A;  3CEI A;  4IHJ A;  1WAZ A;  1NVP B;  4LF4 O;  4FFB A;  1UPG A;  4DW1 A;  2P90 A;  1VQM V;  3ZRW A;  2YI9 A;  1SZT A;  2Y4T A;  2Y69 C;  2ZE8 A;  2FKX A;  4L8J A;  4H44 B;  4IHJ B;  3ABL C;  2OTJ V;  4FFB B;  3JAL A;  2AZ0 A;  3ABM C;  1EN5 A;  1FS0 G;  4PDL A;  3CRA A;  2Q7E A;  4FLY A;  2IH1 C;  1JPX A;  3ZRW B;  2UXD O;  2ILM A;  1ARO P;  4MVM A;  1IBM B;  3ZN1 A;  4DR6 O;  1YEW A;  3JAL B;  4BIU A;  1PL0 A;  3FB6 C;  1N32 O;  4DV6 B;  1XNR O;  3SJB C;  3BA8 A;  1B04 A;  5AG2 A;  4GLX A;  1GH6 A;  1U96 A;  4N23 A;  1SQP H;  2IJI A;  4FM2 A;  3CME V;  4FK5 C;  2VQF B;  1IDS A;  3ZED A;  2A3Q A;  1PP9 H;  3CRM A;  2WPD G;  2V1D A;  3A0B Z;  1YXB A;  3H1I H;  4PHZ A;  3EFF K;  4UUJ C;  1PNM A;  4DYL A;  2UUA B;  3K5L A;  4DR2 B;  1BL8 A;  3HKE A;  5CA0 B;  2XAH A;  4K35 A;  3FX7 A;  2QWR B;  3ZRS A;  4J7K A;  5FL7 G;  4KL1 A;  2WLN A;  1XL4 A;  3SR2 C;  1E1Q G;  4CH4 A;  5EBL C;  1VQ9 V;  1VP7 A;  1WB8 A;  1JJ2 U;  4CS3 A;  3ETQ A;  3HKE B;  3RVY A;  2DYR B;  1EM1 A;  1I94 B;  4GKJ B;  2CAZ C;  1G8M A;  3BY6 A;  1F51 A;  3ZRV A;  1NT2 B;  5L3G A;  1HNZ O;  4H37 A;  3AG4 C;  4U3J B;  4FZ0 A;  2UU9 B;  4LFB B;  1MSD A;  1XL6 A;  3JSL A;  1B3Q A;  1P84 F;  3G4S V;  1LUV A;  1PD3 A;  4DR1 B;  4RWU A;  4DV4 O;  3AG7 A;  1BT8 A;  3CPW U;  1GK9 A;  4HZ3 A;  1X59 A;  3J7A U;  2QJ1 A;  4UCV A;  3RYC B;  4DR4 B;  3OMA B;  2ZE5 A;  2FL4 A;  4D7T A;  2XAJ A;  4JI1 B;  4O4I A;  3C3T A;  3FAV A;  3K5O A;  5EC1 C;  2XAG A;  4AQY B;  4KUM A;  3RVZ A;  1KEC A;  2Q67 A;  2CTW A;  5D5Q A;  1NH2 D;  2PI4 A;  4UCU A;  1JR9 A;  1WP7 A;  5FNV A;  1Y66 A;  3ZHT A;  2MK3 A;  4O4I B;  4YJ3 A;  3FAV B;  3ZS8 C;  4UB6 Z;  1M4U A;  4B3S B;  4CBC A;  5B1A C;  2ZD9 A;  4X20 A;  4FZ1 A;  2VQE O;  1M56 C;  4X62 B;  4ZBM A;  3OR7 C;  5FNV B;  3I55 V;  3D3I A;  3R66 A;  1AB3 A;  2P7T C;  1M9N A;  1K73 W;  4JI6 O;  2F4V O;  2C2A A;  1H8E G;  2LFR A;  3M99 B;  1D5A A;  4JAA A;  5IY5 B;  1N4C A;  3APQ A;  3D36 C;  4TUY A;  2UUC B;  3E35 A;  3ZHS A;  3AEI A;  5L3E A;  2A9H A;  2IJH A;  3OMI B;  3CWB H;  5BXZ A;  1NZ6 A;  5KUK A;  1UFI A;  3FKS G;  1QR8 A;  2EJ7 A;  4TUY B;  4CS4 A;  2M7W A;  1GN2 A;  2R70 A;  3K0D A;  1NKD A;  3CRR A;  4GKK O;  4JI3 B;  2JJ1 G;  5EBW C;  3G71 V;  1YIT V;  3KCX A;  2GBO A;  3BHP A;  1EZJ A;  1SKV A;  1FJG B;  1AVM A;  2PYJ A;  1ZWI C;  2OCC B;  1Q43 A;  2XAS A;  1Z2G A;  1IBK O;  3HKD A;  3ZMV A;  1LNQ A;  2DJV A;  3JD1 A;  3P3N A;  4LF5 O;  3IFX A;  3GB7 C;  1DK1 A;  4HAM A;  1TVK B;  1CXZ B;  2Q9L A;  1WB7 A;  1W59 A;  3CJH A;  4JI0 O;  1M57 C;  5L3B A;  3HKD B;  1QVF U;  2E74 B;  4LF8 B;  4HYO A;  3VQW A;  4GX2 A;  4I55 A;  4NXN O;  4DV5 O;  2YC0 A;  2HJD A;  1D2D A;  2ITD C;  1YDX A;  4LNU A;  1MAB G;  4MVS A;  4DK1 A;  2HVJ C;  2ZKO A;  2WSS G;  5IJ9 A;  5KHH A;  1AJP A;  2O57 A;  1KP3 A;  2Z0A A;  3HKC A;  1X4T A;  4X66 O;  1VF6 C;  2ITC C;  1Z5W A;  1E79 G;  1K9M W;  3P32 A;  3G67 A;  4J10 A;  2EIK B;  2JK5 C;  3B8M A;  1N36 O;  4AI8 A;  1AR1 B;  2QR4 A;  1H2K A;  4ZHQ B;  3HKC B;  2IU0 A;  4EB6 A;  2X6C A;  3F7V C;  3CE2 A;  2R9A A;  1N33 B;  4JZG A;  5GTH Z;  3UKM A;  4JZ2 A;  4YXW G;  4LF7 O;  4LH7 A;  3QNE A;  3E8F A;  2PI5 A;  4DK0 A;  1KKD A;  2QEX V;  1PV0 A;  4IL6 Z;  4NTX A;  1QVG U;  3OAA G;  2HVK C;  2HP8 A;  1RPR A;  4U7N A;  3JD4 A;  3F5T A;  3UT5 A;  4LFA B;  4JI7 B;  4J80 A;  2EIL C;  2HHH O;  1VQL V;  1OCZ C;  3JAW A;  3SYP A;  2UUB O;  1XNQ B;  3RN4 A;  1ZAU A;  3UT5 B;  2IH3 C;  2Q8V A;  3ZRX A;  2LQT A;  4K8Z A;  4LR3 A;  3AK3 A;  2ARH A;  1XQ8 A;  3JAW B;  1AR5 A;  1SET A;  2GTA A;  1VF5 B;  4TT3 G;  4PA9 A;  2Y48 A;  3CSX A;  3UO2 A;  4B7E A;  4JI8 O;  3K5N A;  2YXH A;  3ZMZ A;  1URF A;  3SPH A;  1YCI A;  3I56 V;  4DO2 A;  3AK1 A;  1K33 A;  3WB0 A;  1XMQ O;  1BMF G;  3O65 A;  5LHH A;  3T1H O;  2HEP A;  5IYB O;  3CMA V;  2QWO B;  3SJA C;  2CTP A;  3TCU A;  4MTO A;  4FPP A;  1FXK C;  2Z3Y A;  3TXQ A;  4OX9 O;  5HFL A;  1DF5 A;  2VWJ A;  4O2B A;  2YXY A;  1J5E B;  1K4C C;  3ZMU A;  2X7R B;  2JVD A;  2XND G;  3A8T A;  3SPI A;  2EIN B;  4O2B B;  3E86 A;  2RN9 A;  4EEQ A;  4YJ2 A;  4DRX A;  3JD3 A;  2HG5 C;  1JQ0 A;  3EHB B;  4TSF G;  4CH5 A;  5GTI Z;  4JI2 B;  1B6Q A;  3K9A A;  4DRX B;  1S72 V;  1H2M A;  1N0N A;  1KC8 W;  3ASO B;  2E5L B;  5BZB A;  3ZHU A;  2X6B A;  4B3R O;  2WLI A;  4ZKI A;  3RYI A;  2UXC B;  1BSM A;  4GYC B;  2JIZ G;  3ABK B;  3FD9 A;  1KD1 W;  2JDI G;  1ZSP A;  2WLI B;  3VQV A;  1SQQ H;  3RYI B;  2NN4 A;  4X65 B;  4BR6 A;  1MZE A;  4FJC C;  1HDJ A;  4PD4 F;  2QWQ B;  3DC6 A;  1Y67 A;  4LWS A;  3OEE G;  3ZHV A;  1YTF D;  2DYS C;  5DM6 V;  5JQG B;  2WLH A;  4P9P A;  2A7W A;  4G28 B;  2KG7 B;  3DTU B;  5KX5 B;  4WFA V;  2F66 C;  3AG2 B;  1XEQ A;  3H1L H;  5KUM A;  5KHK A;  2XHB A;  1R3K C;  4FLV A;  1BHB A;  3K03 A;  4O2A A;  1NS1 A;  3T4D A;  4WFF A;  1Z5V A;  4JAV A;  2EZO A;  4NTY A;  4JF3 A;  4X8A A;  2CGN A;  1OCO C;  3ZIA G;  1VQP V;  3CC7 V;  1H8H G;  3CCM V;  1Q6I A;  1ZTE A;  1IBM O;  4AIL C;  1JA8 A;  1GKF A;  2Q73 A;  5IT9 N;  1XOU A;  1L1F A;  1Y76 A;  1N34 B;  2VWK A;  2N74 A;  1F23 A;  5JH7 A;  1O9G A;  4DV6 O;  4IT5 A;  1TUB A;  2UXX A;  5BY1 A;  3CCQ V;  2UXB B;  1H2S B;  1RSO A;  2X6A A;  4UCT A;  4QE7 A;  2IM9 A;  4FM1 A;  5JH7 B;  1YJN V;  1QBZ A;  2DQ0 A;  3CRQ A;  4ICG A;  2VQF O;  4PV1 B;  4I9Q A;  5KHI A;  1Q90 D;  1TUB B;  1Q7Y W;  1EZV H;  1RSO B;  1R6K A;  5F2V O;  2OTL V;  4WFG A;  2UUA O;  4X1I A;  4DR2 O;  4ZI7 A;  2F23 A;  4ZOL B;  1MG1 A;  1KUQ A;  2ZDI A;  3RGB A;  3TK1 A;  1P7B A;  3G6E V;  3OW2 U;  1Q6H A;  1GM7 A;  1SQX H;  2GHY A;  4AHC A;  4NVP A;  2DYR C;  4X1I B;  3CCJ V;  1IVS A;  2L6L A;  3VQX A;  4D6T H;  1I94 O;  1GM8 A;  2F1M A;  2QTS A;  4GKJ O;  1AP5 A;  3DXR A;  1VQN V;  2ZXW B;  1EN6 A;  4X89 A;  5LP6 A;  4UVA A;  3QO7 A;  4I50 B;  1YVW A;  3MHH C;  1J95 A;  3DXR B;  3E8B A;  5GW7 A;  5LP6 B;  1NH2 B;  2LGW A;  3F7Y C;  4QPK A;  4UCO A;  2UU9 O;  1FXH A;  3BA9 A;  4LFB O;  2WLJ A;  4D7S A;  4J9Z B;  4YY3 O;  2F43 G;  3LNN A;  3UQ8 A;  4N21 A;  1V54 B;  4F4L A;  1IX9 A;  3JAR A;  4LF6 B;  5JJJ B;  3BFR A;  5CBG A;  3KCY A;  1DLB A;  4QE9 A;  1VQO V;  1TAE A;  4DV2 O;  2QGN A;  1OHH G;  2EUL A;  3JAR B;  4X9Q A;  2VS0 A;  1QLE B;  4AQY O;  5LMN O;  1LUW A;  4B08 A;  1QHT A;  3J80 N;  1Q5O A;  2LJ2 A; 
#chains in the Genus database with same CATH homology
 2NNU A;  3E35 A;  3AEI A;  1SER A;  5L3E A;  2A9H A;  2IJH A;  1OCC B;  1R3I C;  3OMI B;  4P30 A;  1AI6 A;  5B1N A;  1GO3 F;  5KUK A;  2DW4 A;  3OEH G;  3FKS G;  1QR8 A;  4RO2 A;  4UVC A;  3ZMT A;  1W0J G;  5C93 A;  1K5Q A;  1GMG A;  2M7W A;  1QLE C;  1ROP A;  4WFE A;  1MOF A;  4I9W A;  4R8C A;  4WFH A;  1VQ6 V;  2HFE C;  1SRY A;  3K0D A;  1NKD A;  3K79 A;  1ORQ C;  5IY5 C;  1S0V A;  2JJ1 G;  5EBW C;  1AJQ A;  2XAF A;  3IC7 A;  2HLD G;  3G71 V;  1Q86 W;  1YIT V;  4G2K A;  4MW8 A;  5EC2 C;  3SPJ A;  4GX0 A;  2DWE C;  3UM7 A;  1EZJ A;  2B1I A;  1OCC C;  4RQF A;  3ZCC A;  4PDR A;  1S5H C;  1YJ9 V;  1ZWI C;  2OCC B;  2XAS A;  3E89 A;  3VBB A;  4R7C A;  2QE7 G;  3ZMV A;  1LNQ A;  4R50 A;  3JD1 A;  3IFX A;  3OGC C;  3GB7 C;  4HAM A;  3TET A;  2YSU B;  4UVB A;  1G4Y B;  3HB3 B;  4PDV A;  4MVO A;  3X2Q B;  4G27 B;  1THZ A;  2ATK C;  4OXS A;  1M57 C;  1RPO A;  5L3B A;  1QVF U;  4PA4 A;  4U7O A;  4HYO A;  1YIJ V;  2BOB C;  4GX2 A;  3ABU A;  1M90 W;  2ITD C;  1MAB G;  2OCC C;  4MVS A;  1RM1 B;  3CXC U;  2XOK G;  3E2E A;  4JTA B;  2WLM A;  2KB1 A;  2HVJ C;  3WG7 B;  3FB5 C;  3JYC A;  3MD0 A;  2WSS G;  1R3J C;  4RUE A;  4R6Z A;  4UXN A;  1AJP A;  3K06 A;  5CN0 A;  4KFM A;  1KP3 A;  1Y4M A;  4FIP C;  3X2Q C;  1IXM A;  1TUE B;  3LDD A;  4MTF A;  2AHZ A;  2OT5 A;  1FXV A;  1V55 B;  2ITC C;  1E79 G;  1K9M W;  3P32 A;  2ZDI C;  2EIM B;  2EIK B;  2JK5 C;  1VQ7 V;  1YSC A;  3CC4 V;  3SYA A;  3B8M A;  2EIJ B;  3CP1 A;  4P9O A;  1AR1 B;  4E2L A;  3OM3 B;  2EIL B;  3T4Z A;  2AHY A;  5H9C A;  1YHQ V;  3QO8 A;  1OCZ B;  3FB7 C;  1RM1 C;  2IU0 A;  2EBO A;  2P67 A;  2X6C A;  3F7V C;  2QM7 A;  2ZR3 A;  3WG7 C;  4X88 A;  3UKM A;  4YXW G;  1KQS U;  3A0R A;  3MHS C;  1QLN A;  3QNE A;  5CA3 A;  1VQ5 V;  1VQ8 V;  3E8F A;  3LSQ A;  2PI5 A;  1KKD A;  1V55 C;  4MVZ A;  4PEL A;  2QEX V;  3STZ C;  1QVG U;  3GWO A;  2ZQM A;  3OAA G;  3W7S A;  2HVK C;  1DF4 A;  1AI5 A;  2Q68 A;  1OCO B;  2EIM C;  2EIK C;  1RPR A;  3BEH A;  4U7N A;  5KA5 A;  3JD4 A;  2ZR2 A;  3KG2 A;  2EIJ C;  3E83 A;  2A0L A;  5E1A C;  5H6Q A;  2EIL C;  3ABT A;  1R3L C;  1P4R A;  3OE7 G;  1VQL V;  1OCZ C;  2HKO A;  2V7Q G;  3B77 A;  3SYP A;  1F4M A;  2BOC C;  1YJW V;  3NXS A;  3P30 A;  4ASU G;  2DWD C;  1K4D C;  3E8G A;  5EBM C;  1FXK B;  2IH3 C;  3ZRX A;  2QM8 A;  3QO5 A;  2Z5U A;  2H94 A;  3OUF A;  4QIW F;  1SET A;  4CZZ A;  1NR1 A;  1W0K G;  4JPR A;  1F4N A;  4TT3 G;  4PA9 A;  1GTO A;  2Y48 A;  4DXW A;  2WLL A;  3CCR V;  1NJI W;  1PKX A;  3AG1 B;  1K8A W;  2DQ3 A;  1BHA A;  3WFV A;  3ZMZ A;  3RW0 A;  4JAU A;  3SPH A;  4MVQ A;  3I56 V;  1VQ4 V;  1EBO A;  4DO2 A;  1H38 A;  3B8N A;  2D3O W;  1K33 A;  3HPL C;  1AI4 A;  3K0G A;  1BMF G;  5LHH A;  1I5Y A;  2WLL B;  5IYB O;  3CMA V;  3SYO A;  3TCU A;  4MTO A;  5L3F A;  4FPP A;  1S76 D;  1FXK C;  2Z3Y A;  3ETD A;  5HFL A;  1DF5 A;  3VOU A;  3OMN B;  1K4C C;  3ZMU A;  2X7R B;  1CPY A;  4JTC B;  3SPC A;  3ZMS A;  2W6I G;  3W7T A;  3CD6 V;  2HJF C;  2XND G;  2FTK A;  3AG1 C;  4PDM A;  3SPI A;  4MTG A;  2EIN B;  5J9P C;  3E86 A;  1OZ0 A;  3SYQ A;  2B5U A;  2Q69 A;  2XAQ A;  2HG5 C;  2IJK A;  2JJ2 G;  3JD3 A;  4P2Z A;  1PNK A;  4GCZ A;  2UXN A;  2LP7 A;  4LP8 A;  1JQ0 A;  4I5S A;  4WF9 V;  3FYI B;  2A79 B;  3LSS A;  2NLJ C;  3EHB B;  4GT1 A;  4BW5 A;  4TSF G;  4PA7 A;  3ASN B;  2Y69 B;  2H8P C;  4RAI A;  4UV8 A;  1B6Q A;  3ABL B;  3K9A A;  4Z1M G;  1S72 V;  4BAY A;  5CMU A;  3OR6 C;  4Q20 A;  3ABM B;  2WLK A;  1KC8 W;  3ASO B;  2EZP A;  4JYB A;  5BZB A;  3CCV V;  2X6B A;  1K34 A;  1K7D A;  3OUS A;  2DYS B;  2EIN C;  2WLI A;  3AG3 B;  4EKW A;  1K3E A;  5IDJ A;  2K1E A;  4JYC A;  4ZKI A;  4LBE C;  4LC1 A;  1M56 B;  2Q6A A;  2LFS A;  4PA6 A;  1NVP B;  1AI7 A;  3ZJZ A;  4JGS A;  2JIZ G;  1NVP D;  3ABK B;  5CBF A;  1KD1 W;  2P90 A;  2JDI G;  1VQM V;  5B1B B;  3CCU V;  2WLI B;  3RBZ A;  3ZRW A;  1SZT A;  3ASN C;  2Y69 C;  3ABL C;  3LUT B;  2OTJ V;  2P6J A;  4FJC C;  4JAS A;  3ABM C;  1FS0 G;  1YTF B;  3ASO C;  4PDL A;  3JD2 A;  3W7X A;  3OEE G;  2IH1 C;  1JVM A;  1JPX A;  3ZRW B;  2DYS C;  3AG3 C;  5DM6 V;  2WLH A;  1YTF D;  1ARO P;  3LNM B;  4P9P A;  4MVM A;  1YI2 V;  3ZN1 A;  3H01 A;  4KP4 A;  2IW5 A;  2W0F C;  1PL0 A;  4BIU A;  4G28 B;  3LDE A;  3DTU B;  3FB6 C;  3LDC A;  4WFA V;  5LBQ A;  3K04 A;  3ABK C;  3AG2 B;  5IYD O;  1M1K W;  1CP9 A;  5B1B C;  4GX5 A;  5KUM A;  2X0L A;  5B3S B;  3FB8 C;  1R3K C;  3CCL V;  4L87 A;  1SES A;  1BHB A;  3K03 A;  1ENV A;  2B1G A;  4N23 A;  1Q81 W;  3F5W C;  2IJI A;  3OFN G;  1JOY A;  3T4D A;  4WFF A;  4JAV A;  3CME V;  1N8R W;  1OCR B;  4FK5 C;  2EZO A;  4MSW C;  3W7U A;  2R9R B;  4JF3 A;  4X8A A;  5IYC O;  3K3W A;  4TWK A;  2WPD G;  4J9Y B;  1H2G A;  1OCO C;  2V1D A;  3ZIA G;  1VQP V;  3EFF K;  3CC7 V;  1H8H G;  2HR3 A;  2WAM A;  3CCM V;  1W2B U;  4UUJ C;  1PNM A;  1NR7 A;  2EJR A;  4H33 A;  3AG2 C;  5LGN A;  1GKF A;  1BL8 A;  1L1F A;  5B3S C;  1JX9 A;  3IGA C;  1F23 A;  2XAH A;  1S77 D;  2CK3 G;  4UV9 A;  1CEZ A;  4FMT A;  3ZRS A;  2WLN A;  1XL4 A;  5FL7 G;  1E1Q G;  1S3J A;  2UXX A;  5EBL C;  3CCQ V;  2JEX A;  3AG4 B;  1VQ9 V;  1OCR C;  1JJ2 U;  2X6A A;  3RVY A;  2DYR B;  2QKS A;  4QE7 A;  1R6N A;  1AJN A;  3ML0 A;  1M57 B;  4XDJ A;  1YJN V;  1QBZ A;  2DQ0 A;  2IU3 A;  1FFT B;  5EK0 A;  1G8M A;  3BY6 A;  5L3D A;  1F51 A;  3ZRV A;  1Q7Y W;  1E1R G;  1QCE A;  3CYO A;  1R6K A;  1GM9 A;  5DN6 G;  1NQT A;  5LHI A;  1MSW D;  2OTL V;  4WFG A;  2GSM B;  1EFR G;  5L3G A;  4MTX A;  4MW3 A;  1K5S A;  1MG1 A;  4MVR A;  5LGT A;  3JD0 A;  2ZDI A;  5B1O A;  3TK1 A;  3PJS K;  1WLE A;  1P7B A;  4QNH B;  4H37 A;  3AG4 C;  3DGE A;  3G6E V;  1PNL A;  5LGU A;  3OW2 U;  4MT8 A;  1COW G;  1GM7 A;  3T1C A;  3CCE V;  2GHY A;  1Q82 W;  2DYR C;  1XL6 A;  3K08 A;  4BIZ A;  3G4S V;  1PD3 A;  3CCJ V;  3CC2 V;  3FYE B;  4WFB V;  3CPW U;  1GK9 A;  4WCE V;  2JEU A;  1GM8 A;  4JTD B;  4HZ3 A;  3ZN0 A;  4XBF A;  3W7W A;  1VQN V;  5B1A B;  2ZXW B;  1NBM G;  4QPJ A;  4X89 A;  1UJW B;  5CBH A;  4QJF B;  3OMA B;  1KP2 A;  2WWW A;  4UVA A;  3QO7 A;  4RQE A;  2XAJ A;  1HWY A;  3MHH C;  4LCU C;  5EC1 C;  3D36 A;  2XAG A;  1J95 A;  3E8B A;  4GX1 A;  1I5X A;  5GW7 A;  3T2M A;  5LHG A;  1NH2 B;  3E8H A;  4KUM A;  3JCZ A;  3F7Y C;  4RUF A;  3RVZ A;  1KEC A;  2Q67 A;  4QPK A;  3R65 A;  1FXH A;  1NH2 D;  2PI4 A;  2WLJ A;  1Y66 A;  2MK3 A;  2QTO A;  4J9Z B;  1WPX A;  2F43 G;  2YEV A;  3CCS V;  4N21 A;  4CBC A;  2R9I A;  1V54 B;  2ZD9 A;  2ZXW C;  3ETE A;  5B1A C;  4F4L A;  1M56 C;  4ZBM A;  3OR7 C;  3I55 V;  3D3I A;  3SJQ C;  5HFM A;  3SYC A;  1R73 A;  5H6R A;  1JCH A;  5CBG A;  2P7T C;  4PA3 A;  1DLB A;  2YEV B;  4QE9 A;  1VQO V;  1DTO A;  1VQK V;  1QR9 A;  1M9N A;  5KA6 A;  4MVU A;  5L3C A;  1OHH G;  1K73 W;  1K92 A;  2QA4 V;  1K97 A;  1QLE B;  2C2A A;  1H8E G;  2W6J G;  2IJJ A;  2LFR A;  3M99 B;  4MS2 A;  3SPG A;  3STL C;  3ETG A;  5IY5 B;  4XDK A;  1FXK A;  1V54 C;  4XDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...