2X7RB

Crystal structure of a late fusion intermediate of hiv-1 gp41
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
43
structure length
43
Chain Sequence
MDDDDKMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords TRANSMEMBRANE PROTEIN GP41
publication title Crystal Structure of HIV-1 Gp41 Including Both Fusion Peptide and Membrane Proximal External Regions.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 lw12.3 isolate
total genus 19
structure length 43
sequence length 43
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2010-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2x7rB00
3CP1A 2EBOA 4FIPC 5HFMA 1QR8A 5CN0A 4N21A 5HFLA 1DF5A 2OT5A 4JPRA 5KA6A 2EZPA 3M99B 1I5XA 3P30A 1I5YA 1MG1A 4FK5C 3MHSC 5KA5A 1JQ0A 3WFVA 3CYOA 4N23A 5H9CA 1ENVA 2X7RB 1EBOA 1QCEA 3K9AA 2EZOA 1DLBA 3MHHC 1F23A 2LP7A 4E2LA 5CMUA 4JF3A 3B8MA 4G2KA 2M7WA 1QBZA 1Y66A 2MK3A 2P6JA 3B8NA 1QR9A 1K34A 1DF4A 4FJCC 3GWOA 1K33A 3H01A 4JGSA 1Y4MA 1JPXA 1SZTA 3B77A 1MOFA
chains in the Genus database with same CATH superfamily
2ZE7A 4ZBMA 1R3JC 2BSKB 2PTMA 3RVZA 5LP6A 3K5NA 1TUBA 1VEWA 5H6QA 4NXMO 3K59A 5B1BB 1GN4A 2B5UA 3SPJA 1US6A 1H8HG 2WSSG 4JI5B 5CB4B 4YY3B 1SZTA 1HP8A 1VQPV 4R50A 4BW9A 3LDCA 2EILB 2VQEB 3H1HH 3E8HA 1N36O 5KAFZ 2IW5A 3FKSG 4DUYB 5CBHA 4UCVA 3S3WA 4J10A 4PD4F 1AR1B 1SQPH 2YSUB 2EIJB 4MVUA 2R9IA 3G67A 4JZ2A 3OFNG 3CRQA 1H2NA 3KG2A 3K5MA 5IJ9A 1VQ4V 3B4SA 2EIJC 1VQNV 3BPZA 1E1RG 2XAGA 4DRXA 4FMTA 4AILC 2KG7A 4JYAO 4LNUB 3QTCA 5DM6V 5JJEB 4MVOA 2UUAO 2CDYA 2E75B 2L6LA 2CTQA 3LUTB 3GWOA 3LSUA 2LW1A 2ODMA 1GM8A 1DK1A 3B77A 2QWOB 3CP1A 2L35A 2EIMC 3ZS8C 4DUZB 3E8FA 3ZJZA 4I55A 4G27B 1NT2B 3CHXA 2H3OA 2O57A 1JFFA 3QO5A 1IXMA 4PHZA 4ZOLA 2A0LA 3PJSK 3AK2A 4HBNA 2ZCEA 2XASA 1FJGO 2ADQB 1XOUA 2A3QA 3P32A 4K0KB 4LFCO 1TA8A 3Q4HA 5DN6G 3L71H 1M57B 3ZHQA 4FLVA 4BIOA 2A9HA 4QNHB 4L87A 2VQFB 3E8BA 2WLLA 1QVGU 1H8EG 3JD1A 3MAQA 1M57C 4J9ZB 1PM9A 2AXTZ 2WLKA 3JALB 2QWRB 5JQGA 3JAKB 1HNXB 3RGBA 2IJIA 1RPOA 4JI3B 4JI5O 4J7ZA 1HNZB 4TQDA 3SYCA 3LSSA 2CUGA 1V54B 1GMGA 5D5PA 2R9RB 4XDKA 3N27A 3WB1A 5J2UB 2CH7B 2Y0IA 3THOA 2YXHA 1LUVA 4J41A 1VQLV 2ZE8A 1IBKO 5CA1A 1WB8A 4K8XA 3JD0A 3FB7C 2DN9A 3TXQA 4GUNA 2EZPA 4O4JA 4I50A 4X66B 4JAAA 3CCQV 3SJBC 5IY5C 3OEHG 4TV9B 4P2ZA 1Y74B 4TV8B 4LFBO 2AZ0A 1AI4A 3DC5A 4QGPA 4DR4B 3WG7C 1JPXA 4ABMA 5KMGA 1Q6UA 3G4SV 1NKDA 1QR8A 4H0LB 5C8YA 4DV5B 5LOVA 2XAJA 5FPRA 2DWEC 1NVPD 1BHBA 3HKEA 3SJAC 3JD4A 4C7UA 1SKVA 2KKWA 3DXRA 1FFXA 2BE3A 4FZ1A 1PL0A 3E22B 4WFEA 4X62B 1BT8A 2AHYA 1K34A 5EYPA 4NKGB 2Q73A 2RQ6A 1XI1A 1Q6HA 4DW1A 2BSKA 2X6BA 4X64B 3I56V 2R72A 1AP6A 1JVMA 3RW0A 4ZIBA 1OCOB 3U11A 4DV6O 2E5LO 4QJFB 4I7ZB 1FFTB 3N2GB 3T1HO 3CD6V 3A0HZ 2FYUH 2DOSA 1SS3A 2Q8VA 1XEQA 1Q7YW 3ZRWB 2Q7EA 4TQFA 4W4KA 1ZSPA 4JI3O 1MZEA 4GKJO 1GKFA 3AG7A 1WPXA 1HNZO 1TVKB 3EFFK 4PI0A 2OWOA 4PDLA 4MTFA 2JRIA 3GVMA 3H1LH 3CSXA 1Y4MA 4PA9A 1AJPA 5KAIZ 3K57A 1LNQA 2Q7GA 4GYCB 3APOA 3K79A 3HKCB 4LF8B 1GN3A 1AR5A 4J7KA 4L8JA 1JMKC 2F93B 2ZNJA 3J80N 4X66O 4LNUA 2Y48A 4MW3A 3RYCB 2HFEC 1X4TA 5LHGA 1SERA 1MOFA 4DR7B 4FLZA 2YEVB 3OUFA 4DR4O 3SPGA 3ABKC 1N8RW 4N23A 4PJ0Z 4EEQA 4DV5O 2DQ3A 1R3LC 3M7MX 1J95A 2QKAA 3A0RA 1SA0B 4RO2A 3ZRSA 3E8GA 1Y66A 2MK3A 4U7NA 3O65A 3CEIA 3H01A 4I0XB 3CXHF 4H44B 1PNMA 1VQ8V 1SC5B 1VQ7V 2EINB 4X62O 1GH6A 4DR6B 2IH1C 3FB5C 2D2CB 4X64O 4J42A 5IWAB 1PV0A 4FLTA 3JASB 1JJ2U 3RYFB 2X6AA 3JALA 2YXLA 3P3PA 5CN0A 1H2SB 1S5HC 5J9PC 2ZE5A 5B1NA 1NR7A 2IU0A 2FKXA 3L70H 4YXWG 4OX9B 2DJVA 2X0LA 3LNNA 4X1YA 4BW5A 5LXTB 1NTKH 1MMMA 2BTQB 3F7YC 5J2UA 2CH7A 2X6CA 1OCZC 3FB6C 3VQWA 4CS2A 1PD3A 1Z5VA 1GRJA 4LWSB 2ZDIC 2XUMA 1N0JA 1NH2B 4A5UB 3ZMVA 4ASUG 3JD3A 2YXYA 4GX0A 2HJDA 4QPKA 2HVKC 2N04A 3AG2C 3K9AA 4TV9A 3T1CA 3S3XA 4LF8O 1Y74A 4TV8A 3HKDA 4H13B 1JX9A 5KHIA 2PI5A 2XAHA 1H2LA 1YZBA 4MVZA 4X88A 1VARA 4U3FH 1HR0B 3WU2Z 1K8AW 5KHGA 5B1AC 3OUSA 4WFHA 2RDCA 3JCZA 3P30A 2UUBB 4Z2WA 5LHIA 2EULA 3CRCA 3L72H 2ATKC 1EZJA 4RQFA 4GKKB 2UXXA 3TXSA 3RT3C 4GCZA 3E22A 2FMLA 4DV1B 4NTXA 1ZL8B 4LF9O 1OJHA 2IJHA 1CP9A 1FXVA 4B3MO 3J81N 4QPJA 3STZC 1SQQH 2QWPB 3RN4A 2YC0A 3N2GA 4YJ3B 1QBZA 4YIOA 4FFKA 4R6ZA 2YIAA 3CPWU 5IWAO 4LP8A 1ZX3A 3ETQA 3ZRWA 3ASOB 4R7CA 3SPIA 4NXMB 4JI7O 3RBZA 3UQ8A 1KB9F 1NR1A 2LO1A 4JZGA 1Q5OA 5KUKA 4LBEC 4FLXA 3ABLC 3BVOA 2KSDA 3K0DA 3ASOC 4FFBB 1W0KG 1XMOB 5TISZ 1XQ8A 3IFXA 1YHQV 4IYIA 2P7TC 3TGUH 4X20B 1WN7A 1Y76B 4XBFA 1H2KA 1AVMA 2VS0A 1BS3A 3HKCA 1RSOB 1VQ6V 4MVSA 2XTAA 3CYOA 1ENVA 3UM7A 1LR1A 3OD4A 4J9YB 2YS8A 2QJ1A 5IT9N 4UUJC 4FVMA 1AILA 1OCRB 1GM9A 2QTOA 3T4ZA 3F7VC 3W7SA 5EZYB 1YF2A 4UVBA 3K08A 4XDJA 2YEVA 4ZI7B 4JYAB 2LGWA 4GT1A 4EB6B 3HPLC 1WA8B 2UUAB 2ZIMA 2AZ2A 1AB3A 1V9PA 1SA0A 4BWAA 1I0HA 4EFEA 3H9VA 4GLXA 3JSLA 2P90A 3SYOA 3QVNA 4RUEA 1RPRA 3H1IH 3ZBHA 1KYOF 4JTDB 2MW2B 3U0ZA 1MG1A 5JCOC 1CXZB 3LDEA 1O9GA 4X89A 2RMKB 3JSNA 3ZRVA 3JARB 3NR7A 3ZHUA 3RYFA 5IE9A 1I94O 3D36C 1M90W 3VQXA 3F5WC 5K1PA 3KKYA 4YHHO 2KQXA 1MSWD 5KA5A 2JEUA 3K9SA 1IBMB 5KLVH 1YTFD 5IYBO 4ZHQB 1AR4A 2BTQA 2N74A 2AW9A 1GN2A 2F1MA 1GTOA 5H6RA 4LWSA 1ROPA 1OHHG 2YIBA 1XMOO 1YSCA 4U3JA 1FXKA 5JJNB 1R3IC 3TCUA 4DYLA 1VMGA 3T4DA 2V1DA 4CBCA 1YI2V 3KCYA 1DLBA 4BIUA 4NYKA 1IBKB 3FX7A 5IYZB 2K9PA 3APQA 1IDSA 1L0NH 2DYSB 3G71V 4FLWA 4DR5B 1VP7A 2CAZC 2M6YA 4JTCB 3D3IA 1EFRG 5BZBA 1XL4A 4CS3A 4LFBB 2ZNIA 2Q9LA 5H9CA 2DYSC 2F23A 2RCVA 2ILMA 2EIMB 4PA7A 4AI8A 5CA0B 2PYLA 1ZL8A 2IJKA 4FIPC 2QM8A 1JA8A 4U7OA 1PL4A 1SQVH 1P7GA 3QG5A 3QNEA 2QKSA 4FPPA 3STLC 4NTWA 2QM4A 3CCVV 2B1IA 2ZT9B 4YJ3A 4UV8A 1HWYA 4X1KB 2EBOA 1DF5A 2YICA 5EIBD 4DV6B 1PP9H 2E5LB 1I7FA 2HHHB 1SQGA 3T1HB 1KP3A 4LH6A 4DW0A 1F23A 4FFBA 1IBMO 3AG4C 2YDEA 4GX5A 4TWKA 3OTFA 3FYEB 2A79B 5L3EA 3E89A 2WA4A 5IJ0B 3SR2C 4X20A 1KP2A 4GKJB 1Y76A 4JPRA 4CH5A 1PPJH 2ZM6B 1RSOA 4JI6B 1H38A 3WFVA 2BTOA 3VQYA 4I9WA 1GK9A 2Q6AA 2GTSA 5H2FZ 3B8NA 5KUMA 1Q43A 4PDVA 2DMXA 4K8ZA 5HFMA 5IY5B 2JIZG 1VF6C 4ZI7A 3I5DA 4JYBA 2EJRA 1ZLZA 4FK5C 2UXBB 4DK1A 4EB6A 3BA8A 3WG7B 4UCTA 4DR5O 3BAAA 1H2MA 1IX9A 3K58A 3IC9A 1ZTEA 3ZMZA 4JAVA 5EBLC 2GDSA 3IC7A 2PZSA 3AG3C 3JAWA 3EHBB 1P7BA 1GM7A 4LR3A 5E1AC 5IYDO 5FPOA 3DSQA 4WFFA 1SQBH 1ZUQA 3JARA 4MS2A 4MTGA 4KP4A 3OTOO 2FL4A 5FLXN 3SYAA 4P9OA 1K92A 1OCCB 4P30A 3K06A 1Q8IA 1EN6A 3L73H 5CBGA 3J7AU 5KHJA 3KZIZ 3CWBH 3BEHA 4ZHQA 4B7EA 5LGNA 3OW2U 3PN1A 2HHHO 1M4UA 1OCCC 3CC7V 1S0VA 4CZZA 4JI1B 5CB4A 2Y4TA 2YI8A 1XHZA 1WJZA 4UVAA 2CTWA 2P5OA 2ZQMA 3ABMB 5KHKA 1PKXA 2LFRA 4DR2B 4DR3B 3A0BZ 4LF5O 1F51A 2ZM6O 3ABMC 3AK1A 4JI6O 4BAYA 4O4IB 5IYZA 5LYJB 2D3OW 5EC1C 2R70A 3FAVB 3W7WA 4KUMA 5BY1A 2Q0OC 2JDIG 2E76B 4JTAB 2Q68A 3C3TA 1SQXH 2X7RB 4O2BB 2HR3A 4YJ2B 3F5TA 3IGAC 2UXBO 4D7TA 1IZ3A 2OCCB 2P06A 3CRMA 5ITZB 3ABKB 4DV3B 1R6TA 1N0NA 5LMNB 3CC2V 1RM1B 2F4VB 2OCCC 5JVDB 1MNGA 1MA1A 2WLIB 1IBLB 2PGGA 2DQ0A 1I08A 5D5QA 3K03A 3FB8C 2XT9A 1B06A 1RM1C 3K5OA 4FLUA 4LF9B 5EBWC 4B3MB 3L75H 1K3EA 1BQ0A 3D3QA 4X1KA 4JI2B 1N33O 1NBMG 1FXHA 2VRZA 2GUZB 5F2VO 3G80A 4DO2A 2ZR2A 5B3SC 3UKMA 3W7UA 1NTZH 4BIZA 4FJCC 4JI7B 3FFQA 5E79Z 3JAKA 5IJ0A 1D5AA 4CH3A 1NZ6A 1FYJA 1VQMV 1YITV 1K5SA 4DV0O 4JI1O 2E3CA 1OCZB 1I5YA 1WNSA 2CE4A 1DTOA 1MSDA 2GBOA 3MHHC 4F6EA 4AQYB 5B1OA 2CTRA 3SYQA 2WLNA 4DR2O 1K4DC 3QO8A 1J5EO 4DR3O 3L9DA 2Z3YA 3CCRV 1KUQA 3AG2B 1Q90D 4OGQB 3B40A 1UPGA 1TUBB 1P49A 3UO3A 2DE0X 4FM2A 2OTJV 1YEWA 5B1AB 2XAFA 2ADPA 1XBLA 1SRYA 2Q67A 3K0GA 3CMAV 4QIWF 1BHAA 3EXAA 2XNDG 4DV3O 4B3RB 1M9NA 2PY5A 4KL1A 3SJQC 5EIBC 1N4CA 3TK1A 2W6JG 5LMNO 2LJ2A 1XNRO 1Y67A 1Q81W 2F4VO 4BR6A 4E4EA 2WLHA 2ZR3A 1IBLO 3IJ4A 2Y69B 2XOKG 3SDLA 1S72V 5LGTA 3ASNC 1SESA 1Q86W 2JEXA 2WWWA 1IXBA 1WPBA 2Y69C 1RP3B 1A32A 3HKBB 4JI2O 4J7JA 3ZHRA 3RVYA 1I94B 3X2QB 4NTYA 3T2MA 1QVFU 1XUQA 1EZVH 1P84F 3CS5A 1MABG 4UVCA 4YHHB 1N32B 2GHYA 3X2QC 1S3JA 3ABLB 5LBQA 2IM9A 4OPAA 1Q6IA 4IGGA 1YDXA 1K7DA 4CC6A 2CTPA 2YIDA 1NI8A 4IYHA 4B08A 3CCUV 1CPYA 2ZE6A 1OV9A 2JS3A 3OMIB 1VQ5V 1YJ9V 1TVKA 3RYHB 3TETA 5K1XA 1S77D 2C2AA 1RFYA 4O4IA 4JV5B 4FLYA 2W0FC 3JD2A 5LYJA 4AQYO 1QLEB 3JAMN 5JH7B 4NB5A 3WB0A 1NVPB 2QTSA 1G6UA 1YVWA 2HG5C 4LFAO 3M99B 3ZRXA 1I5XA 2IBZH 5LMUB 2WAMA 1QLEC 4O2BA 4X9QA 3UT5B 1W0JG 2HJFC 1VF5B 4YJ2A 2GTAA 4IL6Z 1AP5A 4TT3G 5AG2A 4LCUC 2WLMA 3RYCA 5ITZA 1LUWA 2ZXWC 5LGUA 5A9GA 2A7WA 3ZN0A 3ZHVA 4O4HB 2RJZA 3CCJV 4LF7B 4JYYA 1AJNA 3P3NA 4K35A 1T5EA 1XNQB 2WLIA 3K5LA 2QGNA 2FTKA 2V4DA 1ORQC 3CRAA 2LQTA 1BMFG 3UCSC 4B3RO 1KMIZ 3BA9A 4MSWC 2GV9A 1BGYH 4I0XA 1X59A 4F6RB 4O4JB 1R1BA 1NQTA 4YIPA 5GONB 2GUZA 1FKAO 4P9PA 2E74B 2LP7A 2Z5UA 1COWG 4Z1VA 3CXCU 4WF9V 5LA6B 3JASA 1IURA 3H1JH 3ZN1A 4Z1MG 3AG1C 4UFZA 2DYRB 2UXCO 2RN9A 1K73W 4MVRA 1TUEB 3BCCH 1SQFA 1N32O 1QCEA 5CBFA 4EKWA 2ZDIA 3K04A 2DYRC 3A2FA 5LXTA 2DW4A 2VWJA 2G38A 4UCUA 1IVSA 1R6KA 1V55B 5EYPB 4WFBV 1G8MA 1GN6A 1DGSA 4IHJB 4DK0A 4WFAV 3QO7A 3LSQA 4J80A 4JV5O 3ZCCA 1V55C 2JGDB 3K3WA 1JR9A 1U97A 1AI7A 4Q20A 2KB1A 1Q3EA 1N34O 2JS5A 2NN4A 3OM3B 1XMQB 5LMUO 1QLNA 3RFRA 1URFA 3LDDA 3R66A 3E86A 5B1BC 4HAMA 2ITDC 4DV7B 3SGIA 2QM7A 1SZXA 2EILC 2QR4A 3IAYA 3BABA 5BMVB 4LF7O 1SF9A 4I4TB 3M8AA 1YJNV 1XNQO 4GX1A 2A06H 2QA4V 2WLJA 2P4KA 3ZMSA 4Q6GA 2UXDB 3JCUZ 2OIEA 4JAUA 3HKBA 1S5LZ 1BE3H 3C3SA 2QWQB 1NU1H 1M56B 2R9AA 2CK3G 4DR1O 2AHZA 4RQEA 3OTOB 1QR9A 2NLJC 1M56C 3B2EE 1JCHA 3HB3B 2Y4UA 1BQZA 1U96A 2YIBD 3N2KB 4WBNB 3W7XA 5EK0A 1NH2D 3E2EA 2ZD9A 3AG4B 1Z2GA 2HKOA 1W59A 2AGAA 3AK3A 4MW8A 3WB2A 2QE7G 4B3TO 3RYHA 4PA6A 1GO3F 4RAIA 2BOBC 1K97A 3ZX6A 4OXSA 1YJWV 2QDOA 3OAAG 5JH7A 2WA3A 2PF4E 4J11A 4LF5B 3G6EV 1YCIA 4PELA 3DGEA 5J2TB 1QHTA 4OPHA 3UT5A 4UB6Z 3G6BA 2F66C 2HP8A 1EN5A 5EZYA 1TAEA 1XMQO 1D5NA 3CX5F 3ETEA 1KC8W 1QNMA 5HFLA 4YY3O 1O9HA 4KHPB 4O4HA 3BFRA 4TOIA 1ZAUA 2NNUA 4X1YB 2UU9B 2OTLV 2EJ7A 3CCLV 1WA8A 2WPDG 2VQEO 1K9MW 2YI9A 5H5NA 4CH6A 2N05A 1W2BU 3EVKA 4DV7O 4DUYO 1V54C 3AG3B 1FD9A 3CB2A 4HNAB 5JCOA 4F6RA 4UXNA 2ZINA 1JOYA 5IYCO 1HNWB 2H94A 4O2AB 4PDRA 5GONA 3O9OA 2HLDG 2UXDO 2Y0PA 3CJHB 3HKDB 3H1KH 3D36A 4GX2A 4D7SA 4LF6B 1FAFA 5LA6A 2UUCB 5L3GA 4R8CA 5CA3A 3CCMV 1N33B 3D8CA 4PA4A 4IIJB 5B5EZ 2BOCC 3L74H 1VQ9V 1WB7A 4HZ3A 2JVDA 3MHSC 3LNMB 3QF7A 4DUZO 2CGNA 4QE7A 1XL6A 4WFGA 4JASA 3B8MA 3MD0A 4CC5A 4TSFG 4O4LB 1NTMH 4DV0B 4UCSA 4IHJA 4N21A 2RNBA 2OYQA 3ZHSA 1SETA 2JJ2G 4K0KO 2JGDA 4RUFA 5LHHA 4I9QA 2NR5A 5FNVB 2VQFO 1J5EB 2Q7HA 1BCCH 2BCCH 5L3BA 2XAQA 5IDJA 3B09A 1AJQA 1OCOC 4FM0A 4X1IB 4JI0B 3GWKC 4RWUA 3KCXA 4H33A 1HNXO 2ARHA 5L3CA 2VWKA 4DV2B 5KX5B 3ICXA 3HR0A 2QWNB 4KHPO 3OT7A 3JATB 3DC6A 5BMVA 1M5IA 2UU9O 2P6JA 4I4TA 4NXNB 1AI6A 1QQCA 4G28B 4FZ0A 5CA0A 1Y6XA 3ETGA 5GW7A 4HYOA 1XNRB 4TUYB 1FS0G 1YTFB 3CCSV 4MTOA 1K4CC 1HNWO 3VBBA 1L1FA 3BY6A 1YXBA 2JJ1G 1DF4A 3CRRA 3DTUB 1B6QA 1PNLA 4LF6O 3JYCA 3RYIB 1HDJA 2UUCO 3ZMUA 5B3SB 3I55V 3RWRD 1S5JA 1M93A 3N2KA 4WBNA 4MTXA 1YIJV 3VQVA 2LW7A 3FYIB 4B3SB 5L3FA 4H37A 4UB8Z 1F4NA 3AEIA 2Q69A 1Q82W 1MZFA 3CE2A 4CH4A 1L8DA 1E1QG 1K33A 3TJTA 1VQKV 1OZ0A 1Z5WA 2JK5C 1E79G 1WP8A 1BSMA 2EINC 1VF7A 5GTIZ 5BR8B 2EZOA 5J2TA 3ABTA 3T1YB 2ITCC 3E35A 2F95B 1VF6A 2DWDC 2F43G 1AROP 2Q5ZA 1THZA 4LH7A 2QSAA 1ZWIC 1VQOV 1NJIW 2EX3A 4LFAB 3U10A 2PI4A 1L0LH 3ZMTA 5LP6B 1BL8A 4MT8A 4JI0O 1KQSU 5FL7G 4DXWA 1UFIA 4XDLA 4I5SA 3BHPA 1WP7A 2FB5A 2YUAA 5LP6C 5GTHZ 4DV2O 4WCEV 4F4LA 4PV1B 2Q4PA 2UXNA 5B66Z 1R3KC 2P22C 1R73A 4HNAA 2Q0AA 4U3JB 1F7YA 1B3QA 3OGCC 2K1EA 4NXNO 1FXKB 5EC2C 3CMEV 2H8PC 2Z0AA 4JI8B 1JQ0A 2IH3C 4O2AA 3ZEDA 4D6TH 4UCRA 3OE7G 1K5QA 2OIGA 3CJHA 3CC4V 1FXKC 3ASNB 3OMNB 1KKCA 5LL6Y 1XDCA 3OMAB 3OEEG 3SPCA 4IT5A 4IIJA 1P4RA 2JGUA 2IJJA 5IJ9B 2PYJA 4X65B 4DR7O 5L3DA 3W7TA 3ZIAG 4DRXB 1EBOA 4KXRA 2KG7B 2QEXV 2PUSA 1D2DA 3MDSA 5DECA 4B3SO 4JI4B 1FPOA 4GZRB 2B1GA 3C90A 2UXCB 4K3AA 4O4LA 5CMUA 5EBMC 5A2QN 2ZKOA 3OR7C 2GSMB 1KECA 2EIKB 1H2GA 3A8TA 4I55B 1KBHA 1JFFB 4DR6O 4LF4B 5FNVA 4DV4B 4E2LA 4ZOLB 1UJWB 2XHBA 2EIKC 3R65A 4B7KA 4JGSA 3NXSA 3OR6C 5JJJB 5BR8O 5DEDA 2W0XA 3ABUA 3T1YO 4UCOA 3Q4HB 4X1IA 2HVJC 5BXZA 1HW7A 3FAVA 3OGIB 1KD1W 2WLLB 3E83A 4NR1A 5KA6A 2LFSA 2P67A 4CS4A 1N34B 4MVMA 4PDMA 4QE9A 1F4MA 2ZIOA 5KX5A 5KHHA 2ZXWB 4OX9O 3JATA 2V7QG 4FM1A 5JQGB 1EM1A 2W6IG 2B9ZA 1N36B 1KKDA 1NS1A 1R6NA 4ICGA 4PI2A 2P4VA 3BRCA 2OT5A 5C93A 1XILA 2IU3A 4TUYA 4UV9A 5JVDA 1B04A 1G4YB 1VIBA 1WLEA 2HEPA 1G1XB 3UO2A 3SPHA 4JI8O 4G2KA 1EN4A 4EFBA 1AI5A 2ETNA 1S76D 3SJCC 4NVPA 1QU7A 1XREA 5CA1B 3RYIA 1OCRC 1TGOA 4I50B 4X8AA 3VOUA 4DR1B 1PNKA 1HR0O 1GAXA 1JJOA 3CCEV 1CEZA 4JF3A 4X65O 5JWPA 1KU9A 2UUBO 3AG1B 2LGQA 1BZKA 1M1KW 3ZHTA 4GKKO 3FD9A 2OCHA 5KMGB 4LC1A 3ETDA 4JYCA 5C8YB 4JI4O 3GB7C 1XHXA 5LOVB 3JAWB 4DV1O 4AHCA 3HKEB 4B3TB 3DXRB 1FJGB 2CGOA 1FFXB 4PA3A 4ZKIA 2QKCA 4MVQA 4LFCB 4KFMA 2M7WA 3SYPA 4LF4O 4DV4O 3ML0A 4W4LA 1WAZA
chains in the Genus database with same CATH topology
4ZBMA 1R3JC 3ETEA 1KC8W 3RVZA 2IJHA 1CP9A 5HFLA 1FXVA 3CC2V 1RM1B 2OCCC 2NNUA 4QPJA 3STZC 5H6QA 2WLIB 2OTLV 3CCLV 2WPDG 1K9MW 2DQ0A 3K03A 3FB8C 5B1BB 2B5UA 3SPJA 1W2BU 1RM1C 1QBZA 1H8HG 2WSSG 1V54C 3AG3B 5EBWC 4R6ZA 1SZTA 3CPWU 4LP8A 1VQPV 1K3EA 4R50A 3LDCA 3ZRWA 1NBMG 1FXHA 3ASOB 4UXNA 2EILB 4R7CA 3SPIA 5IYCO 1JOYA 3RBZA 3E8HA 1NR1A 2H94A 2IW5A 3FKSG 4LBEC 4PDRA 4DO2A 5KUKA 2HLDG 3ABLC 2ZR2A 5CBHA 5B3SC 3UKMA 3W7UA 3K0DA 3ASOC 3D36A 4GX2A 1W0KG 5L3GA 4BIZA 1AR1B 4FJCC 4R8CA 5CA3A 2YSUB 3CCMV 2EIJB 3IFXA 4MVUA 1YHQV 2R9IA 4PA4A 2P7TC 3OFNG 2BOCC 3KG2A 1VQ9V 4XBFA 1VQMV 1YITV 4HZ3A 1VQ4V 1K5SA 2EIJC 1VQNV 1OCZB 1I5YA 3MHSC 3LNMB 4MVSA 1VQ6V 3CYOA 1ENVA 1DTOA 1E1RG 2XAGA 4QE7A 3UM7A 4FMTA 3MHHC 4J9YB 1XL6A 4WFGA 4JASA 3B8MA 4UUJC 5DM6V 3MD0A 1OCRB 4MVOA 5B1OA 1GM9A 2QTOA 3SYQA 2WLNA 4TSFG 3T4ZA 1K4DC 3LUTB 3QO8A 3GWOA 3F7VC 3W7SA 2Z3YA 1GM8A 3B77A 3CP1A 3CCRV 4UVBA 3K08A 4XDJA 2EIMC 2YEVA 3AG2B 3E8FA 4N21A 3ZJZA 4G27B 1SETA 2JJ2G 4RUFA 5LHHA 3QO5A 4GT1A 3HPLC 1IXMA 2A0LA 3PJSK 5L3BA 2OTJV 2XAQA 5IDJA 5B1AB 2XASA 2P90A 1AJQA 1OCOC 3SYOA 2XAFA 4RUEA 3P32A 5DN6G 1SRYA 2Q67A 3K0GA 1M57B 3CMAV 1RPRA 4H33A 2A9HA 4JTDB 4QNHB 4L87A 4QIWF 3E8BA 2WLLA 1BHAA 5L3CA 1H8EG 2XNDG 1QVGU 3JD1A 1MG1A 1M9NA 3SJQC 1NVPD 3TK1A 2W6JG 1M57C 3LDEA 1Q81W 4J9ZB 4X89A 2WLHA 2ZR3A 3ZRVA 2WLKA 2P6JA 1AI6A 2Y69B 2XOKG 1S72V 4G28B 1M90W 5LGTA 3ASNC 3ETGA 2IJIA 1RPOA 1SESA 5GW7A 1Q86W 2JEXA 3F5WC 2WWWA 4HYOA 1MSWD 2Y69C 3SYCA 1FS0G 5KA5A 2JEUA 1YTFB 3LSSA 1V54B 1GMGA 3CCSV 3RVYA 2R9RB 1YTFD 4MTOA 3X2QB 1K4CC 4XDKA 3VBBA 5IYBO 1L1FA 3BY6A 3T2MA 1QVFU 2JJ1G 1DF4A 1GTOA 5H6RA 1MABG 3DTUB 4UVCA 1B6QA 1VQLV 1PNLA 1ROPA 2GHYA 3X2QC 1OHHG 3JYCA 1S3JA 3ABLB 3ZMUA 5B3SB 3I55V 1YSCA 5LBQA 3JD0A 3FB7C 4MTXA 1YIJV 1FXKA 2EZPA 1K7DA 1R3IC 3TCUA 3FYIB 3T4DA 5L3FA 3CCQV 2V1DA 5IY5C 3OEHG 4H37A 4CBCA 3CCUV 1CPYA 1YI2V 4P2ZA 1DLBA 3OMIB 4BIUA 1VQ5V 1YJ9V 1F4NA 3TETA 3AEIA 1AI4A 2Q69A 1S77D 2C2AA 1Q82W 1E1QG 1K33A 2W0FC 3JD2A 3WG7C 1JPXA 1VQKV 3G4SV 1QLEB 2DYSB 1NKDA 1QR8A 3G71V 1NVPB 1OZ0A 2XAJA 4JTCB 2DWEC 2JK5C 1EFRG 2HG5C 1E79G 1XL4A 3D3IA 5BZBA 3M99B 3ZRXA 1I5XA 3JD4A 5H9CA 2WAMA 2EINC 1QLEC 2DYSC 2EZOA 3ABTA 1W0JG 2HJFC 2ITCC 4PA7A 2EIMB 4TT3G 1PL0A 4WFEA 3E35A 2AHYA 2DWDC 1AROP 1K34A 2F43G 4LCUC 2WLMA 1THZA 1ZWIC 1VQOV 1NJIW 2ZXWC 2IJKA 5LGUA 4FIPC 2PI4A 2QM8A 3ZN0A 2X6BA 3ZMTA 3I56V 1BL8A 4U7OA 4MT8A 3CCJV 1KQSU 1JVMA 5FL7G 3RW0A 4DXWA 1AJNA 3QNEA 1OCOB 4XDLA 2WLIA 4I5SA 2QKSA 4FPPA 2FTKA 1BHBA 3STLC 1ORQC 4QJFB 1FFTB 1BMFG 4WCEV 3CCVV 2B1IA 4F4LA 4MSWC 3CD6V 4UV8A 1HWYA 2UXNA 1R3KC 2EBOA 1Q7YW 1R73A 3ZRWB 3OGCC 2K1EA 1DF5A 1FXKB 5EC2C 3CMEV 2H8PC 1NQTA 1JQ0A 2IH3C 1KP3A 1GKFA 4P9PA 3OE7G 1WPXA 1K5QA 1F23A 2LP7A 2Z5UA 3CC4V 1COWG 3CXCU 3EFFK 1FXKC 3ASNB 4WF9V 3OMNB 4PDLA 4MTFA 3AG4C 4GX5A 4TWKA 3OMAB 1Y4MA 3OEEG 4PA9A 1AJPA 3FYEB 3SPCA 2A79B 5L3EA 3ZN1A 3E89A 1LNQA 4Z1MG 3AG1C 2DYRB 1KP2A 1P4RA 2IJJA 1K73W 4MVRA 4JPRA 1TUEB 3K79A 5L3DA 3W7TA 1H38A 3WFVA 3ZIAG 1EBOA 1QCEA 4I9WA 5CBFA 4EKWA 2ZDIA 3K04A 2QEXV 2DYRC 1GK9A 2Q6AA 2DW4A 2Y48A 1R6KA 3B8NA 1V55B 2B1GA 4MW3A 2HFEC 4WFBV 5LHGA 1SERA 5KUMA 1G8MA 5CMUA 1MOFA 5EBMC 4PDVA 5HFMA 4WFAV 5IY5B 2YEVB 2JIZG 3QO7A 3LSQA 3OR7C 2GSMB 3OUFA 1KECA 3SPGA 2EIKB 1H2GA 3ZCCA 4JYBA 1V55C 3K3WA 1AI7A 2EJRA 3ABKC 4FK5C 4Q20A 1N8RW 2KB1A 4N23A 3WG7B 2DQ3A 1R3LC 1J95A 4E2LA 1UJWB 3A0RA 2EIKC 3R65A 3OM3B 4RO2A 3ZRSA 3E8GA 1Y66A 2MK3A 1QLNA 4JGSA 4U7NA 3NXSA 3H01A 3OR6C 3LDDA 3ABUA 1PNMA 3E86A 2HVJC 3ZMZA 1VQ8V 4JAVA 1VQ7V 5B1BC 5EBLC 2EINB 3IC7A 4HAMA 1KD1W 2WLLB 3AG3C 3E83A 2ITDC 2IH1C 5KA6A 2LFSA 2P67A 4MVMA 4PDMA 4QE9A 1F4MA 3EHBB 3FB5C 1P7BA 1GM7A 2QM7A 2EILC 2ZXWB 5E1AC 5IYDO 1JJ2U 4WFFA 2V7QG 2X6AA 1YJNV 4MS2A 2W6IG 4GX1A 4MTGA 4KP4A 1KKDA 1R6NA 2QA4V 2WLJA 5CN0A 3ZMSA 1S5HC 3SYAA 2OT5A 4P9OA 5J9PC 5C93A 1K92A 4JAUA 5B1NA 2IU3A 1NR7A 2IU0A 1OCCB 4P30A 4UV9A 4YXWG 2X0LA 3K06A 4BW5A 1M56B 1G4YB 1WLEA 2CK3G 5CBGA 2AHZA 3BEHA 3SPHA 4RQEA 4G2KA 3F7YC 5LGNA 2X6CA 3OW2U 1OCZC 3FB6C 1QR9A 1PD3A 1OCCC 1AI5A 2NLJC 3CC7V 1S76D 2ZDIC 1S0VA 4CZZA 1M56C 1JCHA 1NH2B 4UVAA 3HB3B 1OCRC 1NH2D 3ZMVA 3W7XA 5EK0A 2ZQMA 3E2EA 3ABMB 4ASUG 3JD3A 4GX0A 4X8AA 1PKXA 3VOUA 1PNKA 2LFRA 2ZD9A 4QPKA 3AG4B 3CCEV 2HVKC 1CEZA 2HKOA 3AG2C 3K9AA 4MW8A 3T1CA 2QE7G 4JF3A 1F51A 3ABMC 1JX9A 3AG1B 2PI5A 4PA6A 2XAHA 1GO3F 4RAIA 2BOBC 4BAYA 4MVZA 1K97A 1M1KW 4X88A 2D3OW 5EC1C 4LC1A 4OXSA 3W7WA 3ETDA 4JYCA 1YJWV 3GB7C 3OAAG 4KUMA 1K8AW 5B1AC 2JDIG 3OUSA 4WFHA 3JCZA 3P30A 4JTAB 2Q68A 3G6EV 5LHIA 4PELA 2X7RB 3DGEA 2HR3A 2ATKC 1EZJA 4PA3A 4ZKIA 4RQFA 2UXXA 4MVQA 4KFMA 4GCZA 2M7WA 3IGAC 3SYPA 2OCCB 3ML0A 3ABKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CP1 A;  2EBO A;  4FIP C;  5HFM A;  1QR8 A;  5CN0 A;  4N21 A;  5HFL A;  1DF5 A;  2OT5 A;  4JPR A;  5KA6 A;  2EZP A;  3M99 B;  1I5X A;  3P30 A;  1I5Y A;  1MG1 A;  4FK5 C;  3MHS C;  5KA5 A;  1JQ0 A;  3WFV A;  3CYO A;  4N23 A;  5H9C A;  1ENV A;  2X7R B;  1EBO A;  1QCE A;  3K9A A;  2EZO A;  1DLB A;  3MHH C;  1F23 A;  2LP7 A;  4E2L A;  5CMU A;  4JF3 A;  3B8M A;  4G2K A;  2M7W A;  1QBZ A;  1Y66 A;  2MK3 A;  2P6J A;  3B8N A;  1QR9 A;  1K34 A;  1DF4 A;  4FJC C;  3GWO A;  1K33 A;  3H01 A;  4JGS A;  1Y4M A;  1JPX A;  1SZT A;  3B77 A;  1MOF A; 
#chains in the Genus database with same CATH topology
 2ZE7 A;  4ZBM A;  1R3J C;  2BSK B;  2PTM A;  3RVZ A;  5LP6 A;  3K5N A;  1TUB A;  1VEW A;  5H6Q A;  4NXM O;  3K59 A;  5B1B B;  1GN4 A;  2B5U A;  3SPJ A;  1US6 A;  1H8H G;  2WSS G;  4JI5 B;  5CB4 B;  4YY3 B;  1SZT A;  1HP8 A;  1VQP V;  4R50 A;  4BW9 A;  3LDC A;  2EIL B;  2VQE B;  3H1H H;  3E8H A;  1N36 O;  5KAF Z;  2IW5 A;  3FKS G;  4DUY B;  5CBH A;  4UCV A;  3S3W A;  4J10 A;  4PD4 F;  1AR1 B;  1SQP H;  2YSU B;  2EIJ B;  4MVU A;  2R9I A;  3G67 A;  4JZ2 A;  3OFN G;  3CRQ A;  1H2N A;  3KG2 A;  3K5M A;  5IJ9 A;  1VQ4 V;  3B4S A;  2EIJ C;  1VQN V;  3BPZ A;  1E1R G;  2XAG A;  4DRX A;  4FMT A;  4AIL C;  2KG7 A;  4JYA O;  4LNU B;  3QTC A;  5DM6 V;  5JJE B;  4MVO A;  2UUA O;  2CDY A;  2E75 B;  2L6L A;  2CTQ A;  3LUT B;  3GWO A;  3LSU A;  2LW1 A;  2ODM A;  1GM8 A;  1DK1 A;  3B77 A;  2QWO B;  3CP1 A;  2L35 A;  2EIM C;  3ZS8 C;  4DUZ B;  3E8F A;  3ZJZ A;  4I55 A;  4G27 B;  1NT2 B;  3CHX A;  2H3O A;  2O57 A;  1JFF A;  3QO5 A;  1IXM A;  4PHZ A;  4ZOL A;  2A0L A;  3PJS K;  3AK2 A;  4HBN A;  2ZCE A;  2XAS A;  1FJG O;  2ADQ B;  1XOU A;  2A3Q A;  3P32 A;  4K0K B;  4LFC O;  1TA8 A;  3Q4H A;  5DN6 G;  3L71 H;  1M57 B;  3ZHQ A;  4FLV A;  4BIO A;  2A9H A;  4QNH B;  4L87 A;  2VQF B;  3E8B A;  2WLL A;  1QVG U;  1H8E G;  3JD1 A;  3MAQ A;  1M57 C;  4J9Z B;  1PM9 A;  2AXT Z;  2WLK A;  3JAL B;  2QWR B;  5JQG A;  3JAK B;  1HNX B;  3RGB A;  2IJI A;  1RPO A;  4JI3 B;  4JI5 O;  4J7Z A;  1HNZ B;  4TQD A;  3SYC A;  3LSS A;  2CUG A;  1V54 B;  1GMG A;  5D5P A;  2R9R B;  4XDK A;  3N27 A;  3WB1 A;  5J2U B;  2CH7 B;  2Y0I A;  3THO A;  2YXH A;  1LUV A;  4J41 A;  1VQL V;  2ZE8 A;  1IBK O;  5CA1 A;  1WB8 A;  4K8X A;  3JD0 A;  3FB7 C;  2DN9 A;  3TXQ A;  4GUN A;  2EZP A;  4O4J A;  4I50 A;  4X66 B;  4JAA A;  3CCQ V;  3SJB C;  5IY5 C;  3OEH G;  4TV9 B;  4P2Z A;  1Y74 B;  4TV8 B;  4LFB O;  2AZ0 A;  1AI4 A;  3DC5 A;  4QGP A;  4DR4 B;  3WG7 C;  1JPX A;  4ABM A;  5KMG A;  1Q6U A;  3G4S V;  1NKD A;  1QR8 A;  4H0L B;  5C8Y A;  4DV5 B;  5LOV A;  2XAJ A;  5FPR A;  2DWE C;  1NVP D;  1BHB A;  3HKE A;  3SJA C;  3JD4 A;  4C7U A;  1SKV A;  2KKW A;  3DXR A;  1FFX A;  2BE3 A;  4FZ1 A;  1PL0 A;  3E22 B;  4WFE A;  4X62 B;  1BT8 A;  2AHY A;  1K34 A;  5EYP A;  4NKG B;  2Q73 A;  2RQ6 A;  1XI1 A;  1Q6H A;  4DW1 A;  2BSK A;  2X6B A;  4X64 B;  3I56 V;  2R72 A;  1AP6 A;  1JVM A;  3RW0 A;  4ZIB A;  1OCO B;  3U11 A;  4DV6 O;  2E5L O;  4QJF B;  4I7Z B;  1FFT B;  3N2G B;  3T1H O;  3CD6 V;  3A0H Z;  2FYU H;  2DOS A;  1SS3 A;  2Q8V A;  1XEQ A;  1Q7Y W;  3ZRW B;  2Q7E A;  4TQF A;  4W4K A;  1ZSP A;  4JI3 O;  1MZE A;  4GKJ O;  1GKF A;  3AG7 A;  1WPX A;  1HNZ O;  1TVK B;  3EFF K;  4PI0 A;  2OWO A;  4PDL A;  4MTF A;  2JRI A;  3GVM A;  3H1L H;  3CSX A;  1Y4M A;  4PA9 A;  1AJP A;  5KAI Z;  3K57 A;  1LNQ A;  2Q7G A;  4GYC B;  3APO A;  3K79 A;  3HKC B;  4LF8 B;  1GN3 A;  1AR5 A;  4J7K A;  4L8J A;  1JMK C;  2F93 B;  2ZNJ A;  3J80 N;  4X66 O;  4LNU A;  2Y48 A;  4MW3 A;  3RYC B;  2HFE C;  1X4T A;  5LHG A;  1SER A;  1MOF A;  4DR7 B;  4FLZ A;  2YEV B;  3OUF A;  4DR4 O;  3SPG A;  3ABK C;  1N8R W;  4N23 A;  4PJ0 Z;  4EEQ A;  4DV5 O;  2DQ3 A;  1R3L C;  3M7M X;  1J95 A;  2QKA A;  3A0R A;  1SA0 B;  4RO2 A;  3ZRS A;  3E8G A;  1Y66 A;  2MK3 A;  4U7N A;  3O65 A;  3CEI A;  3H01 A;  4I0X B;  3CXH F;  4H44 B;  1PNM A;  1VQ8 V;  1SC5 B;  1VQ7 V;  2EIN B;  4X62 O;  1GH6 A;  4DR6 B;  2IH1 C;  3FB5 C;  2D2C B;  4X64 O;  4J42 A;  5IWA B;  1PV0 A;  4FLT A;  3JAS B;  1JJ2 U;  3RYF B;  2X6A A;  3JAL A;  2YXL A;  3P3P A;  5CN0 A;  1H2S B;  1S5H C;  5J9P C;  2ZE5 A;  5B1N A;  1NR7 A;  2IU0 A;  2FKX A;  3L70 H;  4YXW G;  4OX9 B;  2DJV A;  2X0L A;  3LNN A;  4X1Y A;  4BW5 A;  5LXT B;  1NTK H;  1MMM A;  2BTQ B;  3F7Y C;  5J2U A;  2CH7 A;  2X6C A;  1OCZ C;  3FB6 C;  3VQW A;  4CS2 A;  1PD3 A;  1Z5V A;  1GRJ A;  4LWS B;  2ZDI C;  2XUM A;  1N0J A;  1NH2 B;  4A5U B;  3ZMV A;  4ASU G;  3JD3 A;  2YXY A;  4GX0 A;  2HJD A;  4QPK A;  2HVK C;  2N04 A;  3AG2 C;  3K9A A;  4TV9 A;  3T1C A;  3S3X A;  4LF8 O;  1Y74 A;  4TV8 A;  3HKD A;  4H13 B;  1JX9 A;  5KHI A;  2PI5 A;  2XAH A;  1H2L A;  1YZB A;  4MVZ A;  4X88 A;  1VAR A;  4U3F H;  1HR0 B;  3WU2 Z;  1K8A W;  5KHG A;  5B1A C;  3OUS A;  4WFH A;  2RDC A;  3JCZ A;  3P30 A;  2UUB B;  4Z2W A;  5LHI A;  2EUL A;  3CRC A;  3L72 H;  2ATK C;  1EZJ A;  4RQF A;  4GKK B;  2UXX A;  3TXS A;  3RT3 C;  4GCZ A;  3E22 A;  2FML A;  4DV1 B;  4NTX A;  1ZL8 B;  4LF9 O;  1OJH A;  2IJH A;  1CP9 A;  1FXV A;  4B3M O;  3J81 N;  4QPJ A;  3STZ C;  1SQQ H;  2QWP B;  3RN4 A;  2YC0 A;  3N2G A;  4YJ3 B;  1QBZ A;  4YIO A;  4FFK A;  4R6Z A;  2YIA A;  3CPW U;  5IWA O;  4LP8 A;  1ZX3 A;  3ETQ A;  3ZRW A;  3ASO B;  4R7C A;  3SPI A;  4NXM B;  4JI7 O;  3RBZ A;  3UQ8 A;  1KB9 F;  1NR1 A;  2LO1 A;  4JZG A;  1Q5O A;  5KUK A;  4LBE C;  4FLX A;  3ABL C;  3BVO A;  2KSD A;  3K0D A;  3ASO C;  4FFB B;  1W0K G;  1XMO B;  5TIS Z;  1XQ8 A;  3IFX A;  1YHQ V;  4IYI A;  2P7T C;  3TGU H;  4X20 B;  1WN7 A;  1Y76 B;  4XBF A;  1H2K A;  1AVM A;  2VS0 A;  1BS3 A;  3HKC A;  1RSO B;  1VQ6 V;  4MVS A;  2XTA A;  3CYO A;  1ENV A;  3UM7 A;  1LR1 A;  3OD4 A;  4J9Y B;  2YS8 A;  2QJ1 A;  5IT9 N;  4UUJ C;  4FVM A;  1AIL A;  1OCR B;  1GM9 A;  2QTO A;  3T4Z A;  3F7V C;  3W7S A;  5EZY B;  1YF2 A;  4UVB A;  3K08 A;  4XDJ A;  2YEV A;  4ZI7 B;  4JYA B;  2LGW A;  4GT1 A;  4EB6 B;  3HPL C;  1WA8 B;  2UUA B;  2ZIM A;  2AZ2 A;  1AB3 A;  1V9P A;  1SA0 A;  4BWA A;  1I0H A;  4EFE A;  3H9V A;  4GLX A;  3JSL A;  2P90 A;  3SYO A;  3QVN A;  4RUE A;  1RPR A;  3H1I H;  3ZBH A;  1KYO F;  4JTD B;  2MW2 B;  3U0Z A;  1MG1 A;  5JCO C;  1CXZ B;  3LDE A;  1O9G A;  4X89 A;  2RMK B;  3JSN A;  3ZRV A;  3JAR B;  3NR7 A;  3ZHU A;  3RYF A;  5IE9 A;  1I94 O;  3D36 C;  1M90 W;  3VQX A;  3F5W C;  5K1P A;  3KKY A;  4YHH O;  2KQX A;  1MSW D;  5KA5 A;  2JEU A;  3K9S A;  1IBM B;  5KLV H;  1YTF D;  5IYB O;  4ZHQ B;  1AR4 A;  2BTQ A;  2N74 A;  2AW9 A;  1GN2 A;  2F1M A;  1GTO A;  5H6R A;  4LWS A;  1ROP A;  1OHH G;  2YIB A;  1XMO O;  1YSC A;  4U3J A;  1FXK A;  5JJN B;  1R3I C;  3TCU A;  4DYL A;  1VMG A;  3T4D A;  2V1D A;  4CBC A;  1YI2 V;  3KCY A;  1DLB A;  4BIU A;  4NYK A;  1IBK B;  3FX7 A;  5IYZ B;  2K9P A;  3APQ A;  1IDS A;  1L0N H;  2DYS B;  3G71 V;  4FLW A;  4DR5 B;  1VP7 A;  2CAZ C;  2M6Y A;  4JTC B;  3D3I A;  1EFR G;  5BZB A;  1XL4 A;  4CS3 A;  4LFB B;  2ZNI A;  2Q9L A;  5H9C A;  2DYS C;  2F23 A;  2RCV A;  2ILM A;  2EIM B;  4PA7 A;  4AI8 A;  5CA0 B;  2PYL A;  1ZL8 A;  2IJK A;  4FIP C;  2QM8 A;  1JA8 A;  4U7O A;  1PL4 A;  1SQV H;  1P7G A;  3QG5 A;  3QNE A;  2QKS A;  4FPP A;  3STL C;  4NTW A;  2QM4 A;  3CCV V;  2B1I A;  2ZT9 B;  4YJ3 A;  4UV8 A;  1HWY A;  4X1K B;  2EBO A;  1DF5 A;  2YIC A;  5EIB D;  4DV6 B;  1PP9 H;  2E5L B;  1I7F A;  2HHH B;  1SQG A;  3T1H B;  1KP3 A;  4LH6 A;  4DW0 A;  1F23 A;  4FFB A;  1IBM O;  3AG4 C;  2YDE A;  4GX5 A;  4TWK A;  3OTF A;  3FYE B;  2A79 B;  5L3E A;  3E89 A;  2WA4 A;  5IJ0 B;  3SR2 C;  4X20 A;  1KP2 A;  4GKJ B;  1Y76 A;  4JPR A;  4CH5 A;  1PPJ H;  2ZM6 B;  1RSO A;  4JI6 B;  1H38 A;  3WFV A;  2BTO A;  3VQY A;  4I9W A;  1GK9 A;  2Q6A A;  2GTS A;  5H2F Z;  3B8N A;  5KUM A;  1Q43 A;  4PDV A;  2DMX A;  4K8Z A;  5HFM A;  5IY5 B;  2JIZ G;  1VF6 C;  4ZI7 A;  3I5D A;  4JYB A;  2EJR A;  1ZLZ A;  4FK5 C;  2UXB B;  4DK1 A;  4EB6 A;  3BA8 A;  3WG7 B;  4UCT A;  4DR5 O;  3BAA A;  1H2M A;  1IX9 A;  3K58 A;  3IC9 A;  1ZTE A;  3ZMZ A;  4JAV A;  5EBL C;  2GDS A;  3IC7 A;  2PZS A;  3AG3 C;  3JAW A;  3EHB B;  1P7B A;  1GM7 A;  4LR3 A;  5E1A C;  5IYD O;  5FPO A;  3DSQ A;  4WFF A;  1SQB H;  1ZUQ A;  3JAR A;  4MS2 A;  4MTG A;  4KP4 A;  3OTO O;  2FL4 A;  5FLX N;  3SYA A;  4P9O A;  1K92 A;  1OCC B;  4P30 A;  3K06 A;  1Q8I A;  1EN6 A;  3L73 H;  5CBG A;  3J7A U;  5KHJ A;  3KZI Z;  3CWB H;  3BEH A;  4ZHQ A;  4B7E A;  5LGN A;  3OW2 U;  3PN1 A;  2HHH O;  1M4U A;  1OCC C;  3CC7 V;  1S0V A;  4CZZ A;  4JI1 B;  5CB4 A;  2Y4T A;  2YI8 A;  1XHZ A;  1WJZ A;  4UVA A;  2CTW A;  2P5O A;  2ZQM A;  3ABM B;  5KHK A;  1PKX A;  2LFR A;  4DR2 B;  4DR3 B;  3A0B Z;  4LF5 O;  1F51 A;  2ZM6 O;  3ABM C;  3AK1 A;  4JI6 O;  4BAY A;  4O4I B;  5IYZ A;  5LYJ B;  2D3O W;  5EC1 C;  2R70 A;  3FAV B;  3W7W A;  4KUM A;  5BY1 A;  2Q0O C;  2JDI G;  2E76 B;  4JTA B;  2Q68 A;  3C3T A;  1SQX H;  2X7R B;  4O2B B;  2HR3 A;  4YJ2 B;  3F5T A;  3IGA C;  2UXB O;  4D7T A;  1IZ3 A;  2OCC B;  2P06 A;  3CRM A;  5ITZ B;  3ABK B;  4DV3 B;  1R6T A;  1N0N A;  5LMN B;  3CC2 V;  1RM1 B;  2F4V B;  2OCC C;  5JVD B;  1MNG A;  1MA1 A;  2WLI B;  1IBL B;  2PGG A;  2DQ0 A;  1I08 A;  5D5Q A;  3K03 A;  3FB8 C;  2XT9 A;  1B06 A;  1RM1 C;  3K5O A;  4FLU A;  4LF9 B;  5EBW C;  4B3M B;  3L75 H;  1K3E A;  1BQ0 A;  3D3Q A;  4X1K A;  4JI2 B;  1N33 O;  1NBM G;  1FXH A;  2VRZ A;  2GUZ B;  5F2V O;  3G80 A;  4DO2 A;  2ZR2 A;  5B3S C;  3UKM A;  3W7U A;  1NTZ H;  4BIZ A;  4FJC C;  4JI7 B;  3FFQ A;  5E79 Z;  3JAK A;  5IJ0 A;  1D5A A;  4CH3 A;  1NZ6 A;  1FYJ A;  1VQM V;  1YIT V;  1K5S A;  4DV0 O;  4JI1 O;  2E3C A;  1OCZ B;  1I5Y A;  1WNS A;  2CE4 A;  1DTO A;  1MSD A;  2GBO A;  3MHH C;  4F6E A;  4AQY B;  5B1O A;  2CTR A;  3SYQ A;  2WLN A;  4DR2 O;  1K4D C;  3QO8 A;  1J5E O;  4DR3 O;  3L9D A;  2Z3Y A;  3CCR V;  1KUQ A;  3AG2 B;  1Q90 D;  4OGQ B;  3B40 A;  1UPG A;  1TUB B;  1P49 A;  3UO3 A;  2DE0 X;  4FM2 A;  2OTJ V;  1YEW A;  5B1A B;  2XAF A;  2ADP A;  1XBL A;  1SRY A;  2Q67 A;  3K0G A;  3CMA V;  4QIW F;  1BHA A;  3EXA A;  2XND G;  4DV3 O;  4B3R B;  1M9N A;  2PY5 A;  4KL1 A;  3SJQ C;  5EIB C;  1N4C A;  3TK1 A;  2W6J G;  5LMN O;  2LJ2 A;  1XNR O;  1Y67 A;  1Q81 W;  2F4V O;  4BR6 A;  4E4E A;  2WLH A;  2ZR3 A;  1IBL O;  3IJ4 A;  2Y69 B;  2XOK G;  3SDL A;  1S72 V;  5LGT A;  3ASN C;  1SES A;  1Q86 W;  2JEX A;  2WWW A;  1IXB A;  1WPB A;  2Y69 C;  1RP3 B;  1A32 A;  3HKB B;  4JI2 O;  4J7J A;  3ZHR A;  3RVY A;  1I94 B;  3X2Q B;  4NTY A;  3T2M A;  1QVF U;  1XUQ A;  1EZV H;  1P84 F;  3CS5 A;  1MAB G;  4UVC A;  4YHH B;  1N32 B;  2GHY A;  3X2Q C;  1S3J A;  3ABL B;  5LBQ A;  2IM9 A;  4OPA A;  1Q6I A;  4IGG A;  1YDX A;  1K7D A;  4CC6 A;  2CTP A;  2YID A;  1NI8 A;  4IYH A;  4B08 A;  3CCU V;  1CPY A;  2ZE6 A;  1OV9 A;  2JS3 A;  3OMI B;  1VQ5 V;  1YJ9 V;  1TVK A;  3RYH B;  3TET A;  5K1X A;  1S77 D;  2C2A A;  1RFY A;  4O4I A;  4JV5 B;  4FLY A;  2W0F C;  3JD2 A;  5LYJ A;  4AQY O;  1QLE B;  3JAM N;  5JH7 B;  4NB5 A;  3WB0 A;  1NVP B;  2QTS A;  1G6U A;  1YVW A;  2HG5 C;  4LFA O;  3M99 B;  3ZRX A;  1I5X A;  2IBZ H;  5LMU B;  2WAM A;  1QLE C;  4O2B A;  4X9Q A;  3UT5 B;  1W0J G;  2HJF C;  1VF5 B;  4YJ2 A;  2GTA A;  4IL6 Z;  1AP5 A;  4TT3 G;  5AG2 A;  4LCU C;  2WLM A;  3RYC A;  5ITZ A;  1LUW A;  2ZXW C;  5LGU A;  5A9G A;  2A7W A;  3ZN0 A;  3ZHV A;  4O4H B;  2RJZ A;  3CCJ V;  4LF7 B;  4JYY A;  1AJN A;  3P3N A;  4K35 A;  1T5E A;  1XNQ B;  2WLI A;  3K5L A;  2QGN A;  2FTK A;  2V4D A;  1ORQ C;  3CRA A;  2LQT A;  1BMF G;  3UCS C;  4B3R O;  1KMI Z;  3BA9 A;  4MSW C;  2GV9 A;  1BGY H;  4I0X A;  1X59 A;  4F6R B;  4O4J B;  1R1B A;  1NQT A;  4YIP A;  5GON B;  2GUZ A;  1FKA O;  4P9P A;  2E74 B;  2LP7 A;  2Z5U A;  1COW G;  4Z1V A;  3CXC U;  4WF9 V;  5LA6 B;  3JAS A;  1IUR A;  3H1J H;  3ZN1 A;  4Z1M G;  3AG1 C;  4UFZ A;  2DYR B;  2UXC O;  2RN9 A;  1K73 W;  4MVR A;  1TUE B;  3BCC H;  1SQF A;  1N32 O;  1QCE A;  5CBF A;  4EKW A;  2ZDI A;  3K04 A;  2DYR C;  3A2F A;  5LXT A;  2DW4 A;  2VWJ A;  2G38 A;  4UCU A;  1IVS A;  1R6K A;  1V55 B;  5EYP B;  4WFB V;  1G8M A;  1GN6 A;  1DGS A;  4IHJ B;  4DK0 A;  4WFA V;  3QO7 A;  3LSQ A;  4J80 A;  4JV5 O;  3ZCC A;  1V55 C;  2JGD B;  3K3W A;  1JR9 A;  1U97 A;  1AI7 A;  4Q20 A;  2KB1 A;  1Q3E A;  1N34 O;  2JS5 A;  2NN4 A;  3OM3 B;  1XMQ B;  5LMU O;  1QLN A;  3RFR A;  1URF A;  3LDD A;  3R66 A;  3E86 A;  5B1B C;  4HAM A;  2ITD C;  4DV7 B;  3SGI A;  2QM7 A;  1SZX A;  2EIL C;  2QR4 A;  3IAY A;  3BAB A;  5BMV B;  4LF7 O;  1SF9 A;  4I4T B;  3M8A A;  1YJN V;  1XNQ O;  4GX1 A;  2A06 H;  2QA4 V;  2WLJ A;  2P4K A;  3ZMS A;  4Q6G A;  2UXD B;  3JCU Z;  2OIE A;  4JAU A;  3HKB A;  1S5L Z;  1BE3 H;  3C3S A;  2QWQ B;  1NU1 H;  1M56 B;  2R9A A;  2CK3 G;  4DR1 O;  2AHZ A;  4RQE A;  3OTO B;  1QR9 A;  2NLJ C;  1M56 C;  3B2E E;  1JCH A;  3HB3 B;  2Y4U A;  1BQZ A;  1U96 A;  2YIB D;  3N2K B;  4WBN B;  3W7X A;  5EK0 A;  1NH2 D;  3E2E A;  2ZD9 A;  3AG4 B;  1Z2G A;  2HKO A;  1W59 A;  2AGA A;  3AK3 A;  4MW8 A;  3WB2 A;  2QE7 G;  4B3T O;  3RYH A;  4PA6 A;  1GO3 F;  4RAI A;  2BOB C;  1K97 A;  3ZX6 A;  4OXS A;  1YJW V;  2QDO A;  3OAA G;  5JH7 A;  2WA3 A;  2PF4 E;  4J11 A;  4LF5 B;  3G6E V;  1YCI A;  4PEL A;  3DGE A;  5J2T B;  1QHT A;  4OPH A;  3UT5 A;  4UB6 Z;  3G6B A;  2F66 C;  2HP8 A;  1EN5 A;  5EZY A;  1TAE A;  1XMQ O;  1D5N A;  3CX5 F;  3ETE A;  1KC8 W;  1QNM A;  5HFL A;  4YY3 O;  1O9H A;  4KHP B;  4O4H A;  3BFR A;  4TOI A;  1ZAU A;  2NNU A;  4X1Y B;  2UU9 B;  2OTL V;  2EJ7 A;  3CCL V;  1WA8 A;  2WPD G;  2VQE O;  1K9M W;  2YI9 A;  5H5N A;  4CH6 A;  2N05 A;  1W2B U;  3EVK A;  4DV7 O;  4DUY O;  1V54 C;  3AG3 B;  1FD9 A;  3CB2 A;  4HNA B;  5JCO A;  4F6R A;  4UXN A;  2ZIN A;  1JOY A;  5IYC O;  1HNW B;  2H94 A;  4O2A B;  4PDR A;  5GON A;  3O9O A;  2HLD G;  2UXD O;  2Y0P A;  3CJH B;  3HKD B;  3H1K H;  3D36 A;  4GX2 A;  4D7S A;  4LF6 B;  1FAF A;  5LA6 A;  2UUC B;  5L3G A;  4R8C A;  5CA3 A;  3CCM V;  1N33 B;  3D8C A;  4PA4 A;  4IIJ B;  5B5E Z;  2BOC C;  3L74 H;  1VQ9 V;  1WB7 A;  4HZ3 A;  2JVD A;  3MHS C;  3LNM B;  3QF7 A;  4DUZ O;  2CGN A;  4QE7 A;  1XL6 A;  4WFG A;  4JAS A;  3B8M A;  3MD0 A;  4CC5 A;  4TSF G;  4O4L B;  1NTM H;  4DV0 B;  4UCS A;  4IHJ A;  4N21 A;  2RNB A;  2OYQ A;  3ZHS A;  1SET A;  2JJ2 G;  4K0K O;  2JGD A;  4RUF A;  5LHH A;  4I9Q A;  2NR5 A;  5FNV B;  2VQF O;  1J5E B;  2Q7H A;  1BCC H;  2BCC H;  5L3B A;  2XAQ A;  5IDJ A;  3B09 A;  1AJQ A;  1OCO C;  4FM0 A;  4X1I B;  4JI0 B;  3GWK C;  4RWU A;  3KCX A;  4H33 A;  1HNX O;  2ARH A;  5L3C A;  2VWK A;  4DV2 B;  5KX5 B;  3ICX A;  3HR0 A;  2QWN B;  4KHP O;  3OT7 A;  3JAT B;  3DC6 A;  5BMV A;  1M5I A;  2UU9 O;  2P6J A;  4I4T A;  4NXN B;  1AI6 A;  1QQC A;  4G28 B;  4FZ0 A;  5CA0 A;  1Y6X A;  3ETG A;  5GW7 A;  4HYO A;  1XNR B;  4TUY B;  1FS0 G;  1YTF B;  3CCS V;  4MTO A;  1K4C C;  1HNW O;  3VBB A;  1L1F A;  3BY6 A;  1YXB A;  2JJ1 G;  1DF4 A;  3CRR A;  3DTU B;  1B6Q A;  1PNL A;  4LF6 O;  3JYC A;  3RYI B;  1HDJ A;  2UUC O;  3ZMU A;  5B3S B;  3I55 V;  3RWR D;  1S5J A;  1M93 A;  3N2K A;  4WBN A;  4MTX A;  1YIJ V;  3VQV A;  2LW7 A;  3FYI B;  4B3S B;  5L3F A;  4H37 A;  4UB8 Z;  1F4N A;  3AEI A;  2Q69 A;  1Q82 W;  1MZF A;  3CE2 A;  4CH4 A;  1L8D A;  1E1Q G;  1K33 A;  3TJT A;  1VQK V;  1OZ0 A;  1Z5W A;  2JK5 C;  1E79 G;  1WP8 A;  1BSM A;  2EIN C;  1VF7 A;  5GTI Z;  5BR8 B;  2EZO A;  5J2T A;  3ABT A;  3T1Y B;  2ITC C;  3E35 A;  2F95 B;  1VF6 A;  2DWD C;  2F43 G;  1ARO P;  2Q5Z A;  1THZ A;  4LH7 A;  2QSA A;  1ZWI C;  1VQO V;  1NJI W;  2EX3 A;  4LFA B;  3U10 A;  2PI4 A;  1L0L H;  3ZMT A;  5LP6 B;  1BL8 A;  4MT8 A;  4JI0 O;  1KQS U;  5FL7 G;  4DXW A;  1UFI A;  4XDL A;  4I5S A;  3BHP A;  1WP7 A;  2FB5 A;  2YUA A;  5LP6 C;  5GTH Z;  4DV2 O;  4WCE V;  4F4L A;  4PV1 B;  2Q4P A;  2UXN A;  5B66 Z;  1R3K C;  2P22 C;  1R73 A;  4HNA A;  2Q0A A;  4U3J B;  1F7Y A;  1B3Q A;  3OGC C;  2K1E A;  4NXN O;  1FXK B;  5EC2 C;  3CME V;  2H8P C;  2Z0A A;  4JI8 B;  1JQ0 A;  2IH3 C;  4O2A A;  3ZED A;  4D6T H;  4UCR A;  3OE7 G;  1K5Q A;  2OIG A;  3CJH A;  3CC4 V;  1FXK C;  3ASN B;  3OMN B;  1KKC A;  5LL6 Y;  1XDC A;  3OMA B;  3OEE G;  3SPC A;  4IT5 A;  4IIJ A;  1P4R A;  2JGU A;  2IJJ A;  5IJ9 B;  2PYJ A;  4X65 B;  4DR7 O;  5L3D A;  3W7T A;  3ZIA G;  4DRX B;  1EBO A;  4KXR A;  2KG7 B;  2QEX V;  2PUS A;  1D2D A;  3MDS A;  5DEC A;  4B3S O;  4JI4 B;  1FPO A;  4GZR B;  2B1G A;  3C90 A;  2UXC B;  4K3A A;  4O4L A;  5CMU A;  5EBM C;  5A2Q N;  2ZKO A;  3OR7 C;  2GSM B;  1KEC A;  2EIK B;  1H2G A;  3A8T A;  4I55 B;  1KBH A;  1JFF B;  4DR6 O;  4LF4 B;  5FNV A;  4DV4 B;  4E2L A;  4ZOL B;  1UJW B;  2XHB A;  2EIK C;  3R65 A;  4B7K A;  4JGS A;  3NXS A;  3OR6 C;  5JJJ B;  5BR8 O;  5DED A;  2W0X A;  3ABU A;  3T1Y O;  4UCO A;  3Q4H B;  4X1I A;  2HVJ C;  5BXZ A;  1HW7 A;  3FAV A;  3OGI B;  1KD1 W;  2WLL B;  3E83 A;  4NR1 A;  5KA6 A;  2LFS A;  2P67 A;  4CS4 A;  1N34 B;  4MVM A;  4PDM A;  4QE9 A;  1F4M A;  2ZIO A;  5KX5 A;  5KHH A;  2ZXW B;  4OX9 O;  3JAT A;  2V7Q G;  4FM1 A;  5JQG B;  1EM1 A;  2W6I G;  2B9Z A;  1N36 B;  1KKD A;  1NS1 A;  1R6N A;  4ICG A;  4PI2 A;  2P4V A;  3BRC A;  2OT5 A;  5C93 A;  1XIL A;  2IU3 A;  4TUY A;  4UV9 A;  5JVD A;  1B04 A;  1G4Y B;  1VIB A;  1WLE A;  2HEP A;  1G1X B;  3UO2 A;  3SPH A;  4JI8 O;  4G2K A;  1EN4 A;  4EFB A;  1AI5 A;  2ETN A;  1S76 D;  3SJC C;  4NVP A;  1QU7 A;  1XRE A;  5CA1 B;  3RYI A;  1OCR C;  1TGO A;  4I50 B;  4X8A A;  3VOU A;  4DR1 B;  1PNK A;  1HR0 O;  1GAX A;  1JJO A;  3CCE V;  1CEZ A;  4JF3 A;  4X65 O;  5JWP A;  1KU9 A;  2UUB O;  3AG1 B;  2LGQ A;  1BZK A;  1M1K W;  3ZHT A;  4GKK O;  3FD9 A;  2OCH A;  5KMG B;  4LC1 A;  3ETD A;  4JYC A;  5C8Y B;  4JI4 O;  3GB7 C;  1XHX A;  5LOV B;  3JAW B;  4DV1 O;  4AHC A;  3HKE B;  4B3T B;  3DXR B;  1FJG B;  2CGO A;  1FFX B;  4PA3 A;  4ZKI A;  2QKC A;  4MVQ A;  4LFC B;  4KFM A;  2M7W A;  3SYP A;  4LF4 O;  4DV4 O;  3ML0 A;  4W4L A;  1WAZ A; 
#chains in the Genus database with same CATH homology
 4ZBM A;  1R3J C;  3ETE A;  1KC8 W;  3RVZ A;  2IJH A;  1CP9 A;  5HFL A;  1FXV A;  3CC2 V;  1RM1 B;  2OCC C;  2NNU A;  4QPJ A;  3STZ C;  5H6Q A;  2WLI B;  2OTL V;  3CCL V;  2WPD G;  1K9M W;  2DQ0 A;  3K03 A;  3FB8 C;  5B1B B;  2B5U A;  3SPJ A;  1W2B U;  1RM1 C;  1QBZ A;  1H8H G;  2WSS G;  1V54 C;  3AG3 B;  5EBW C;  4R6Z A;  1SZT A;  3CPW U;  4LP8 A;  1VQP V;  1K3E A;  4R50 A;  3LDC A;  3ZRW A;  1NBM G;  1FXH A;  3ASO B;  4UXN A;  2EIL B;  4R7C A;  3SPI A;  5IYC O;  1JOY A;  3RBZ A;  3E8H A;  1NR1 A;  2H94 A;  2IW5 A;  3FKS G;  4LBE C;  4PDR A;  4DO2 A;  5KUK A;  2HLD G;  3ABL C;  2ZR2 A;  5CBH A;  5B3S C;  3UKM A;  3W7U A;  3K0D A;  3ASO C;  3D36 A;  4GX2 A;  1W0K G;  5L3G A;  4BIZ A;  1AR1 B;  4FJC C;  4R8C A;  5CA3 A;  2YSU B;  3CCM V;  2EIJ B;  3IFX A;  4MVU A;  1YHQ V;  2R9I A;  4PA4 A;  2P7T C;  3OFN G;  2BOC C;  3KG2 A;  1VQ9 V;  4XBF A;  1VQM V;  1YIT V;  4HZ3 A;  1VQ4 V;  1K5S A;  2EIJ C;  1VQN V;  1OCZ B;  1I5Y A;  3MHS C;  3LNM B;  4MVS A;  1VQ6 V;  3CYO A;  1ENV A;  1DTO A;  1E1R G;  2XAG A;  4QE7 A;  3UM7 A;  4FMT A;  3MHH C;  4J9Y B;  1XL6 A;  4WFG A;  4JAS A;  3B8M A;  4UUJ C;  5DM6 V;  3MD0 A;  1OCR B;  4MVO A;  5B1O A;  1GM9 A;  2QTO A;  3SYQ A;  2WLN A;  4TSF G;  3T4Z A;  1K4D C;  3LUT B;  3QO8 A;  3GWO A;  3F7V C;  3W7S A;  2Z3Y A;  1GM8 A;  3B77 A;  3CP1 A;  3CCR V;  4UVB A;  3K08 A;  4XDJ A;  2EIM C;  2YEV A;  3AG2 B;  3E8F A;  4N21 A;  3ZJZ A;  4G27 B;  1SET A;  2JJ2 G;  4RUF A;  5LHH A;  3QO5 A;  4GT1 A;  3HPL C;  1IXM A;  2A0L A;  3PJS K;  5L3B A;  2OTJ V;  2XAQ A;  5IDJ A;  5B1A B;  2XAS A;  2P90 A;  1AJQ A;  1OCO C;  3SYO A;  2XAF A;  4RUE A;  3P32 A;  5DN6 G;  1SRY A;  2Q67 A;  3K0G A;  1M57 B;  3CMA V;  1RPR A;  4H33 A;  2A9H A;  4JTD B;  4QNH B;  4L87 A;  4QIW F;  3E8B A;  2WLL A;  1BHA A;  5L3C A;  1H8E G;  2XND G;  1QVG U;  3JD1 A;  1MG1 A;  1M9N A;  3SJQ C;  1NVP D;  3TK1 A;  2W6J G;  1M57 C;  3LDE A;  1Q81 W;  4J9Z B;  4X89 A;  2WLH A;  2ZR3 A;  3ZRV A;  2WLK A;  2P6J A;  1AI6 A;  2Y69 B;  2XOK G;  1S72 V;  4G28 B;  1M90 W;  5LGT A;  3ASN C;  3ETG A;  2IJI A;  1RPO A;  1SES A;  5GW7 A;  1Q86 W;  2JEX A;  3F5W C;  2WWW A;  4HYO A;  1MSW D;  2Y69 C;  3SYC A;  1FS0 G;  5KA5 A;  2JEU A;  1YTF B;  3LSS A;  1V54 B;  1GMG A;  3CCS V;  3RVY A;  2R9R B;  1YTF D;  4MTO A;  3X2Q B;  1K4C C;  4XDK A;  3VBB A;  5IYB O;  1L1F A;  3BY6 A;  3T2M A;  1QVF U;  2JJ1 G;  1DF4 A;  1GTO A;  5H6R A;  1MAB G;  3DTU B;  4UVC A;  1B6Q A;  1VQL V;  1PNL A;  1ROP A;  2GHY A;  3X2Q C;  1OHH G;  3JYC A;  1S3J A;  3ABL B;  3ZMU A;  5B3S B;  3I55 V;  1YSC A;  5LBQ A;  3JD0 A;  3FB7 C;  4MTX A;  1YIJ V;  1FXK A;  2EZP A;  1K7D A;  1R3I C;  3TCU A;  3FYI B;  3T4D A;  5L3F A;  3CCQ V;  2V1D A;  5IY5 C;  3OEH G;  4H37 A;  4CBC A;  3CCU V;  1CPY A;  1YI2 V;  4P2Z A;  1DLB A;  3OMI B;  4BIU A;  1VQ5 V;  1YJ9 V;  1F4N A;  3TET A;  3AEI A;  1AI4 A;  2Q69 A;  1S77 D;  2C2A A;  1Q82 W;  1E1Q G;  1K33 A;  2W0F C;  3JD2 A;  3WG7 C;  1JPX A;  1VQK V;  3G4S V;  1QLE B;  2DYS B;  1NKD A;  1QR8 A;  3G71 V;  1NVP B;  1OZ0 A;  2XAJ A;  4JTC B;  2DWE C;  2JK5 C;  1EFR G;  2HG5 C;  1E79 G;  1XL4 A;  3D3I A;  5BZB A;  3M99 B;  3ZRX A;  1I5X A;  3JD4 A;  5H9C A;  2WAM A;  2EIN C;  1QLE C;  2DYS C;  2EZO A;  3ABT A;  1W0J G;  2HJF C;  2ITC C;  4PA7 A;  2EIM B;  4TT3 G;  1PL0 A;  4WFE A;  3E35 A;  2AHY A;  2DWD C;  1ARO P;  1K34 A;  2F43 G;  4LCU C;  2WLM A;  1THZ A;  1ZWI C;  1VQO V;  1NJI W;  2ZXW C;  2IJK A;  5LGU A;  4FIP C;  2PI4 A;  2QM8 A;  3ZN0 A;  2X6B A;  3ZMT A;  3I56 V;  1BL8 A;  4U7O A;  4MT8 A;  3CCJ V;  1KQS U;  1JVM A;  5FL7 G;  3RW0 A;  4DXW A;  1AJN A;  3QNE A;  1OCO B;  4XDL A;  2WLI A;  4I5S A;  2QKS A;  4FPP A;  2FTK A;  1BHB A;  3STL C;  1ORQ C;  4QJF B;  1FFT B;  1BMF G;  4WCE V;  3CCV V;  2B1I A;  4F4L A;  4MSW C;  3CD6 V;  4UV8 A;  1HWY A;  2UXN A;  1R3K C;  2EBO A;  1Q7Y W;  1R73 A;  3ZRW B;  3OGC C;  2K1E A;  1DF5 A;  1FXK B;  5EC2 C;  3CME V;  2H8P C;  1NQT A;  1JQ0 A;  2IH3 C;  1KP3 A;  1GKF A;  4P9P A;  3OE7 G;  1WPX A;  1K5Q A;  1F23 A;  2LP7 A;  2Z5U A;  3CC4 V;  1COW G;  3CXC U;  3EFF K;  1FXK C;  3ASN B;  4WF9 V;  3OMN B;  4PDL A;  4MTF A;  3AG4 C;  4GX5 A;  4TWK A;  3OMA B;  1Y4M A;  3OEE G;  4PA9 A;  1AJP A;  3FYE B;  3SPC A;  2A79 B;  5L3E A;  3ZN1 A;  3E89 A;  1LNQ A;  4Z1M G;  3AG1 C;  2DYR B;  1KP2 A;  1P4R A;  2IJJ A;  1K73 W;  4MVR A;  4JPR A;  1TUE B;  3K79 A;  5L3D A;  3W7T A;  1H38 A;  3WFV A;  3ZIA G;  1EBO A;  1QCE A;  4I9W A;  5CBF A;  4EKW A;  2ZDI A;  3K04 A;  2QEX V;  2DYR C;  1GK9 A;  2Q6A A;  2DW4 A;  2Y48 A;  1R6K A;  3B8N A;  1V55 B;  2B1G A;  4MW3 A;  2HFE C;  4WFB V;  5LHG A;  1SER A;  5KUM A;  1G8M A;  5CMU A;  1MOF A;  5EBM C;  4PDV A;  5HFM A;  4WFA V;  5IY5 B;  2YEV B;  2JIZ G;  3QO7 A;  3LSQ A;  3OR7 C;  2GSM B;  3OUF A;  1KEC A;  3SPG A;  2EIK B;  1H2G A;  3ZCC A;  4JYB A;  1V55 C;  3K3W A;  1AI7 A;  2EJR A;  3ABK C;  4FK5 C;  4Q20 A;  1N8R W;  2KB1 A;  4N23 A;  3WG7 B;  2DQ3 A;  1R3L C;  1J95 A;  4E2L A;  1UJW B;  3A0R A;  2EIK C;  3R65 A;  3OM3 B;  4RO2 A;  3ZRS A;  3E8G A;  1Y66 A;  2MK3 A;  1QLN A;  4JGS A;  4U7N A;  3NXS A;  3H01 A;  3OR6 C;  3LDD A;  3ABU A;  1PNM A;  3E86 A;  2HVJ C;  3ZMZ A;  1VQ8 V;  4JAV A;  1VQ7 V;  5B1B C;  5EBL C;  2EIN B;  3IC7 A;  4HAM A;  1KD1 W;  2WLL B;  3AG3 C;  3E83 A;  2ITD C;  2IH1 C;  5KA6 A;  2LFS A;  2P67 A;  4MVM A;  4PDM A;  4QE9 A;  1F4M A;  3EHB B;  3FB5 C;  1P7B A;  1GM7 A;  2QM7 A;  2EIL C;  2ZXW B;  5E1A C;  5IYD O;  1JJ2 U;  4WFF A;  2V7Q G;  2X6A A;  1YJN V;  4MS2 A;  2W6I G;  4GX1 A;  4MTG A;  4KP4 A;  1KKD A;  1R6N A;  2QA4 V;  2WLJ A;  5CN0 A;  3ZMS A;  1S5H C;  3SYA A;  2OT5 A;  4P9O A;  5J9P C;  5C93 A;  1K92 A;  4JAU A;  5B1N A;  2IU3 A;  1NR7 A;  2IU0 A;  1OCC B;  4P30 A;  4UV9 A;  4YXW G;  2X0L A;  3K06 A;  4BW5 A;  1M56 B;  1G4Y B;  1WLE A;  2CK3 G;  5CBG A;  2AHZ A;  3BEH A;  3SPH A;  4RQE A;  4G2K A;  3F7Y C;  5LGN A;  2X6C A;  3OW2 U;  1OCZ C;  3FB6 C;  1QR9 A;  1PD3 A;  1OCC C;  1AI5 A;  2NLJ C;  3CC7 V;  1S76 D;  2ZDI C;  1S0V A;  4CZZ A;  1M56 C;  1JCH A;  1NH2 B;  4UVA A;  3HB3 B;  1OCR C;  1NH2 D;  3ZMV A;  3W7X A;  5EK0 A;  2ZQM A;  3E2E A;  3ABM B;  4ASU G;  3JD3 A;  4GX0 A;  4X8A A;  1PKX A;  3VOU A;  1PNK A;  2LFR A;  2ZD9 A;  4QPK A;  3AG4 B;  3CCE V;  2HVK C;  1CEZ A;  2HKO A;  3AG2 C;  3K9A A;  4MW8 A;  3T1C A;  2QE7 G;  4JF3 A;  1F51 A;  3ABM C;  1JX9 A;  3AG1 B;  2PI5 A;  4PA6 A;  2XAH A;  1GO3 F;  4RAI A;  2BOB C;  4BAY A;  4MVZ A;  1K97 A;  1M1K W;  4X88 A;  2D3O W;  5EC1 C;  4LC1 A;  4OXS A;  3W7W A;  3ETD A;  4JYC A;  1YJW V;  3GB7 C;  3OAA G;  4KUM A;  1K8A W;  5B1A C;  2JDI G;  3OUS A;  4WFH A;  3JCZ A;  3P30 A;  4JTA B;  2Q68 A;  3G6E V;  5LHI A;  4PEL A;  2X7R B;  3DGE A;  2HR3 A;  2ATK C;  1EZJ A;  4PA3 A;  4ZKI A;  4RQF A;  2UXX A;  4MVQ A;  4KFM A;  4GCZ A;  2M7W A;  3IGA C;  3SYP A;  2OCC B;  3ML0 A;  3ABK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...