2X7RB

Crystal structure of a late fusion intermediate of hiv-1 gp41
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
43
structure length
43
Chain Sequence
MDDDDKMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of HIV-1 Gp41 Including Both Fusion Peptide and Membrane Proximal External Regions.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 lw12.3 isolate
molecule tags Viral protein
molecule keywords TRANSMEMBRANE PROTEIN GP41
total genus 19
structure length 43
sequence length 43
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2010-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2x7rB00
3B8NA 5H9CA 1DF5A 2LP7A 3H01A 3M99B 2EBOA 1QR9A 1MOFA 3CP1A 4E2LA 4N21A 3MHSC 1QCEA 2MK3A 3B8MA 1K34A 2M7WA 1Y66A 1MG1A 1DF4A 1Y4MA 1ENVA 4FK5C 5CMUA 3B77A 1QR8A 5HFMA 1EBOA 1SZTA 1K33A 2EZPA 1DLBA 2X7RB 3GWOA 4N23A 5KA6A 5CN0A 2P6JA 1F23A 4FJCC 3CYOA 4FIPC 1QBZA 2OT5A 5HFLA 1JPXA 1I5XA 4JF3A 3MHHC 1I5YA 5KA5A 1JQ0A 3P30A 2EZOA 4JGSA 4JPRA 4G2KA 3K9AA 3WFVA
chains in the Genus database with same CATH superfamily
2R70A 2KB1A 4DUYO 4K8XA 1BSMA 3HKBA 3CHXA 4ZI7B 1SKVA 1W0JG 1OCOC 3RGBA 3E8FA 4D6TH 5LHHA 3E22A 2PF4E 5B1AC 3ABLC 3BA8A 5L3CA 1VF7A 2P7TC 3EXAA 4LNUB 3M99B 2VQEB 2BTQA 1H8HG 4TV9A 1FJGB 4WFHA 2BTQB 4LF7O 4X64B 5IYZB 1WPXA 3JAKA 3BA9A 4N23A 4U3JA 4DV4O 4JYBA 1YCIA 3G80A 2VWJA 4LFAO 4KUMA 1M1KW 2UUAB 3RYFB 3IAYA 1R6KA 5EIBC 2LQTA 1JFFB 5B1AB 2HHHB 2LW1A 2PGGA 3ZRWB 1QNMA 4JYAO 1HNWO 3QG5A 1QBZA 3R66A 3UQ8A 1JOYA 4DW0A 1VQ5V 2HJDA 1S72V 1XMQO 1QR9A 1L8DA 1XQ8A 3DSQA 1BL8A 4PDMA 1I0HA 2QKAA 3T1HB 3UT5B 2YIBD 1K97A 4X65O 4OGQB 3K5OA 4K35A 5H6QA 3ZRSA 5KHHA 1IXBA 3CCVV 4JI1B 3CWBH 1FS0G 4WFFA 4J9YB 2A3QA 3BABA 3OR6C 1V54C 1V54B 2QM7A 3T1YB 3G4SV 1YTFD 4FIPC 4NVPA 1WP7A 2P4VA 1N36B 3A0HZ 3WB1A 1NBMG 3CRCA 1Y6XA 4FLVA 1H2MA 3FFQA 5GONA 3DXRB 2Q7EA 4GKKO 4LF6B 5LP6B 4ASUG 2P22C 2YDEA 5CB4B 3UO3A 4UCUA 2EINC 3ZHUA 4UVCA 2JEXA 3U0ZA 3J80N 4CC5A 4TOIA 1R6NA 3SPGA 2UUBO 1AI6A 1VQKV 3E8BA 4K3AA 2EIKB 4RWUA 2AZ0A 1QLEC 4GYCB 2OCCB 4LFBO 2ZR2A 3O65A 3JAMN 4H44B 3FYEB 2XASA 1YEWA 4PHZA 3CPWU 3ICXA 4F6RA 2UXCO 2B9ZA 1IBLO 4CS3A 5IJ0B 3ML0A 1SQVH 1J95A 3B2EE 3TCUA 4ICGA 2R72A 2Y0IA 5FPOA 2OTLV 4I55A 3AG2C 1GTOA 4GX5A 2ZE8A 2Y0PA 4G28B 2XAFA 3IJ4A 1SA0A 1DLBA 2X7RB 2OIGA 3OW2U 4DV5O 1HNXO 4MVOA 2OCCC 2XTAA 3SPJA 4NXNB 3PJSK 4N21A 3A0BZ 5LP6C 1V55C 3AG4B 3OUFA 2Y4TA 1XL6A 2ZE6A 5BZBA 2P5OA 2GUZB 2QTSA 4QPJA 2QA4V 1XI1A 4DV6O 4YY3B 4J11A 5KX5B 5CA0B 1VQ6V 4WFEA 2B5UA 4I50A 4JI8B 1SQXH 3S3WA 4PDRA 3K5LA 4ZI7A 1LUWA 2LJ2A 2BCCH 5IWAB 2QTOA 1XILA 2ZIOA 4XBFA 1EFRG 2RQ6A 2PZSA 4DR6O 4DR7O 3K0DA 2P06A 4MVSA 4JTAB 1N33O 4CH5A 1GKFA 5EYPB 3IC9A 4H37A 1S77D 3CD6V 1P7BA 1IVSA 5LBQA 2WA3A 1SZXA 2ZE7A 4X20B 5IYBO 5LMUO 1W59A 1FYJA 1U97A 1AJNA 4TV8A 1H2KA 3ZHRA 1JJ2U 2ITDC 3W7XA 3FYIB 2Y48A 3E8HA 1S76D 3ABMB 1SQFA 4UFZA 3U11A 4DV2B 1LNQA 3H1LH 1KKDA 1I5YA 4KHPO 2EZOA 3JATB 4IYIA 4J41A 1A32A 3B8NA 5H6RA 1KYOF 1CEZA 4I9WA 1DTOA 1JR9A 2A06H 2WLIB 3F7YC 3BCCH 2QWRB 1AJPA 4UB8Z 3A0RA 4BW5A 2Z3YA 4MVUA 3HB3B 1VF6C 1KD1W 1N8RW 2ZIMA 1RP3B 5EC2C 4FZ1A 3FB8C 3E83A 3GB7C 4DUZO 4FVMA 4MTOA 4B7KA 4F6RB 4LFCB 2V7QG 4B3SB 1X4TA 2R9IA 2UXBB 2GHYA 1J5EB 5CN0A 3BEHA 3ZMSA 4B7EA 4JI7O 3H1HH 5CB4A 1HP8A 4X62O 2CDYA 3APOA 1TA8A 4E2LA 5B3SB 3ZMVA 4LF8O 2Q8VA 4PDVA 4Q6GA 2VWKA 4X89A 4P9OA 4Z1VA 1VQ8V 1GO3F 1AVMA 4MW3A 3JAWA 5K1XA 4DV7B 1G8MA 1QR8A 1TUBA 2VQFB 3CCUV 1SZTA 4UXNA 4JI7B 4JV5O 1VIBA 2IM9A 1TGOA 4FMTA 1JMKC 5LGUA 4B08A 5EZYA 2WLLB 4O4HA 2JJ1G 2ZNJA 5CA1B 2EULA 1PPJH 3D3QA 5EIBD 4CH6A 5J2TA 2RDCA 3ZEDA 4FLWA 2MK3A 5TISZ 4DUZB 4JI3B 3T1CA 2XAGA 1CXZB 3LUTB 1AILA 2R9RB 2AGAA 2LGWA 4DR3B 2DYSC 5K1PA 1BS3A 1Z5VA 5F2VO 3LSQA 1L1FA 1E1RG 3ZMTA 5C8YA 1XUQA 2DJVA 4J7ZA 3CCMV 1HDJA 1MZFA 5JVDA 2HVJC 1OCCC 1MA1A 4DV2O 2EILB 2BTOA 1SERA 3RWRD 3CCEV 2W0XA 2H94A 1FPOA 3RW0A 3HKEB 3CCQV 5KAIZ 4G27B 4QGPA 2P90A 4I9QA 5H9CA 1SS3A 2M7WA 1R6TA 4NTXA 4MVRA 1PD3A 3GWKC 2QM8A 2WLKA 1OCZC 4DK0A 2JGDB 3SJBC 4D7TA 3QO5A 3RYCA 2YIDA 1H2LA 2YIBA 1JFFA 4CBCA 1EN5A 4J80A 4PD4F 2CTRA 3IC7A 4LP8A 3OEHG 1SQQH 3EFFK 2PTMA 2CH7A 1P4RA 5LXTA 5IE9A 1VEWA 4MVQA 1X59A 1PNKA 1AI4A 2JEUA 1WP8A 1FD9A 4TV9B 1NH2B 1VARA 3H1JH 3ABUA 4PA4A 4NYKA 5IDJA 5EBWC 1F23A 3CB2A 2BOBC 1GN4A 5A2QN 1E1QG 4HYOA 5LOVB 5B1BC 4MVMA 1QHTA 2B1GA 2PI5A 1VQNV 4G2KA 3GVMA 4I7ZB 4JI3O 2QE7G 4J10A 4DR4B 1NVPD 2AHZA 2E5LB 4X1YA 2A7WA 2RMKB 3SYCA 2L35A 3NXSA 3AG7A 3E22B 2OWOA 2ZCEA 5KX5A 4CZZA 1KKCA 4CC6A 2Y69B 3SJQC 4LWSA 3N2KB 5KA6A 1XMOO 5KMGB 4DRXB 4FFBA 1WPBA 2OT5A 2YC0A 4X8AA 1XNRB 3ASOC 4B3TO 4Z2WA 2YSUB 1IX9A 4O4IA 3KCXA 2QWOB 4DV0O 3JD2A 2F93B 2Q7GA 1YVWA 3CE2A 2ODMA 2CTQA 3I5DA 1RPOA 5B3SC 1HW7A 3JARB 3JSNA 4BWAA 4EB6A 3ETEA 4LFBB 5FLXN 1CPYA 3CC4V 1O9GA 3OUSA 2Q4PA 2XT9A 4UCTA 3ASNB 4QE7A 2IJJA 1YITV 4O2BB 2ZINA 4R6ZA 5ITZB 4JAUA 4K0KO 4RQFA 4LF6O 1IZ3A 4JASA 4OX9O 4NR1A 5FNVB 2Q67A 1YTFB 1XHZA 4BW9A 4K8ZA 4LR3A 4YIPA 4O2AB 4JI6O 3QF7A 2YXHA 1OZ0A 3RVZA 5GONB 4X1KA 3CRRA 1YHQV 1OCRC 2VRZA 1SC5B 3K04A 1WB7A 1Q3EA 2ITCC 3EVKA 2IJHA 2EJRA 4ZIBA 1GM8A 2EJ7A 1ZAUA 4J42A 1VQ9V 5LMUB 5FPRA 3HKCB 4U7NA 4I4TB 4O4JB 1ZTEA 4D7SA 3L70H 1Q6HA 3K5MA 2HKOA 4LF9O 1MSDA 2K9PA 3AK1A 1JX9A 4PV1B 1GAXA 1K8AW 2JJ2G 4DR6B 3TGUH 1R3IC 1ORQC 3ETDA 4EB6B 3K5NA 3PN1A 1WB8A 2FKXA 5KUMA 1H38A 4Q20A 3SPHA 1DK1A 1S5JA 4FLXA 4YY3O 3BPZA 3K79A 1YJWV 2CGNA 4JYAB 3G71V 2F95B 1PP9H 1ROPA 2NLJC 4AQYO 4JZGA 1PNMA 1YDXA 4CH4A 1K4CC 3N2KA 3BY6A 1PL0A 2RJZA 4NXNO 2E76B 5IJ9A 2DOSA 4U3FH 3QVNA 4JAVA 4DV5B 1HNXB 4I50B 1F7YA 1EN6A 1NQTA 4EFBA 3L71H 3DC5A 5LL6Y 2UXDO 2P4KA 2LGQA 1IBLB 1WA8B 4H13B 3JAKB 2DQ0A 2N74A 1H8EG 3GWOA 5LYJA 4GX1A 2MW2B 1SESA 3K3WA 1V55B 5FL7G 5L3GA 5GW7A 4OPHA 4LNUA 3K9AA 2AW9A 3QTCA 4HNAA 1FFXB 3BVOA 2GV9A 2UUBB 1ZX3A 1K73W 3LNMB 3RYCB 2PY5A 5J2UB 1Q81W 4LF4O 1ENVA 2CTPA 1NR1A 3K9SA 3OTOB 1GRJA 3WB2A 2X6AA 4JZ2A 4JTDB 2GBOA 1EZVH 3OMIB 1XEQA 2M6YA 3JD3A 3QO7A 3CXCU 1WAZA 2ZDIA 5BXZA 2FYUH 2EIKC 3FB6C 3CCRV 3W7UA 2Q68A 1NVPB 4IIJA 1L0LH 4PA3A 3ETQA 2CUGA 2OTJV 1G6UA 3T1YO 4I0XB 4L8JA 4A5UB 3LDDA 2XUMA 2QR4A 3HPLC 2Q6AA 4JI0O 2XOKG 3HR0A 3OE7G 2UXDB 4JI1O 4BAYA 2WPDG 2DYSB 1K34A 3IFXA 4RUFA 4YHHB 2YIAA 4GLXA 5E79Z 4QNHB 2ZDIC 4HAMA 4MSWC 5JJEB 2GDSA 2DMXA 2CAZC 4U7OA 1SRYA 5JQGB 3CJHA 3T1HO 5IY5C 4MS2A 5JH7A 3OMAB 5BMVB 2D2CB 1NR7A 3UM7A 4PELA 1YF2A 3E89A 3SJAC 2QJ1A 1KBHA 3CRAA 3JAWB 2JGUA 3OTFA 1XNQB 2XNDG 2LFRA 5LA6B 4B3RB 4AQYB 2AHYA 4JTCB 5BMVA 2WSSG 3VQYA 5JQGA 3AK2A 2ZXWB 4B3RO 3CCLV 1Q5OA 3ABTA 3VOUA 3B77A 4IYHA 4PDLA 4DYLA 5CBFA 4DV4B 4LF9B 3L75H 4J7KA 2F4VB 1VQ7V 1NU1H 4GCZA 4LF7B 3B09A 3O9OA 1SQBH 1I94O 3AG3C 1FJGO 3U10A 2FTKA 2R9AA 3K58A 1OCZB 3TXSA 4YHHO 2VQEO 1FFXA 4IIJB 1FAFA 2GTAA 3A8TA 3ABLB 1D2DA 4JI0B 3OFNG 5LHIA 4XDLA 4P9PA 1SQPH 4U3JB 2RN9A 4UVAA 2Z0AA 1QVFU 2Z5UA 2YEVA 1NTMH 2YXLA 3CSXA 4QIWF 3ZJZA 2F1MA 4UV8A 2ARHA 4TT3G 2ZD9A 1DGSA 4R8CA 3RT3C 3ZIAG 5IYCO 1QCEA 4UVBA 2L6LA 1FXVA 1OCCB 4OX9B 1PKXA 1BGYH 4MT8A 1IXMA 3F7VC 4NXMO 4HZ3A 4L87A 3H1KH 1F4NA 3DGEA 3E8GA 1YI2V 1W2BU 1IURA 4ZHQB 1I7FA 5L3EA 2F66C 5EBLC 5IJ9B 3HKBB 4DR5O 3E86A 3N2GA 3JCZA 5KHJA 2IU3A 2IH3C 2EIJB 1Y76A 4X20A 3MHSC 3ZHTA 3ASOB 1Q90D 2UUCB 2JVDA 4GZRB 4EFEA 1QVGU 3CCJV 2RNBA 1Y76B 2DW4A 3CC7V 4NTWA 1K3EA 4OXSA 1Q82W 3ZCCA 2QWPB 5B1BB 1IDSA 2HP8A 1VP7A 4JGSA 1FKAO 2KG7B 2Q9LA 2GUZA 3MAQA 3B8MA 3B4SA 2KG7A 1YXBA 4UUJC 4IT5A 1FFTB 2IJIA 3CX5F 3AG1C 4B3TB 1XNRO 3L73H 2NNUA 5LMNO 4NB5A 2ZM6O 1XMOB 4FLTA 1N32B 2O57A 1OJHA 3VQWA 5KA5A 1JQ0A 2JS5A 2WLJA 2QEXV 2LP7A 4MTXA 4JI5O 2YS8A 3L9DA 1WNSA 1GK9A 4DR4O 1Y4MA 1ZL8B 3ZRXA 3LDEA 2QKSA 3CC2V 1M57C 1W0KG 2UU9O 4BR6A 3UCSC 4I55B 1UFIA 1O9HA 3OGIB 4DK1A 2ZKOA 4P2ZA 4LCUC 1H2SB 4O2AA 5B1OA 1VQLV 5FNVA 4J7JA 4I5SA 4GKJO 1P84F 5BR8O 3STLC 3SYAA 3THOA 1KB9F 3VQXA 4ZOLA 3P3NA 4IHJA 3AK3A 1B3QA 2X6CA 4BIZA 2ZQMA 1D5NA 3X2QB 5LP6A 4WBNB 1M57B 2WA4A 3SR2C 3D36C 1NTKH 3D8CA 4X1IB 3CP1A 1VQPV 3ASNC 2EX3A 2HFEC 2FL4A 3W7SA 4FLUA 1HWYA 5C8YB 2JIZG 5JJNB 2HLDG 1QLEB 4TUYB 1YJNV 1VF6A 4TQDA 1US6A 1VF5B 1NTZH 4BIOA 3RVYA 2VS0A 3BHPA 4IL6Z 1I5XA 4YJ3A 3JALA 5A9GA 1CP9A 1IBMB 1M9NA 3ABKC 3STZC 5LGTA 2Q73A 1M56B 2PYLA 1LUVA 5ITZA 4JI6B 1ZLZA 5JWPA 3TETA 4DR2O 4O4IB 5E1AC 3E2EA 2A0LA 5AG2A 1PV0A 5KUKA 4KP4A 2Y69C 5JCOA 4KL1A 1K5SA 1Z2GA 2EIMB 3JALB 5IYDO 4YJ3B 4E4EA 2CGOA 4K0KB 3BRCA 3JASB 3JYCA 3FB7C 3RYIA 4I0XA 4TWKA 2DN9A 3F5TA 4B3MB 5EK0A 4PJ0Z 3RYHB 1G4YB 2YXYA 3UT5A 1DF4A 1KMIZ 3CS5A 1XBLA 2Y4UA 2PYJA 1P49A 2AXTZ 3T2MA 3S3XA 3ZRVA 1E79G 1OV9A 1T5EA 3FX7A 3CMEV 1BE3H 2VQFO 3E35A 4GX0A 4YJ2B 1UPGA 4ZOLB 1Y67A 4RO2A 1MABG 3ZRWA 3JCUZ 1YIJV 4LF8B 1SF9A 4DV0B 4FK5C 1WN7A 4R50A 1PL4A 3LSUA 2BSKA 3JD1A 5H5NA 3BAAA 4JI4O 4HNAB 1D5AA 1Y74A 1IBKB 2XHBA 1K9MW 3MD0A 1J5EO 2JDIG 1TUEB 1R3KC 2ADQB 1GH6A 2HVKC 1YJ9V 4LC1A 1VMGA 4B3SO 3EHBB 4LFCO 2LFSA 1AR4A 4UCSA 3SPCA 2E5LO 4JYCA 1FXKB 2GSMB 1WA8A 1ZSPA 2YICA 2PI4A 1U96A 3OMNB 2E74B 2JGDA 4OPAA 1RPRA 4EEQA 4UV9A 1S5LZ 2G38A 4UB6Z 4KHPB 3D3IA 4WFGA 3R65A 4YJ2A 2LO1A 3HKEA 2H8PC 4FPPA 3M8AA 2OCHA 4KXRA 1TVKA 4DV1B 3K0GA 1RM1C 1TAEA 3DTUB 5JVDB 3WG7C 4WFAV 2Q7HA 3OR7C 1KP3A 3OM3B 1QU7A 2EIMC 4AILC 3WU2Z 3ZMZA 4CH3A 4WF9V 2ZNIA 1BT8A 1QLNA 3JASA 1Q6IA 1NJIW 3SPIA 1Z5WA 1N33B 3I55V 3ZS8C 3ZMUA 2B1IA 1Q7YW 1AR5A 4DR7B 3ZBHA 4WBNA 1VQOV 3C3TA 4PI0A 3HKCA 1FXHA 5CA3A 3A2FA 4IHJB 4DR3O 1RM1B 5CA1A 3CYOA 4FM1A 2YEVB 2ATKC 1JPXA 2WLLA 3UKMA 5KLVH 5EZYB 3ZHVA 1SA0B 3G67A 2V4DA 4X1KB 2EIJC 4HBNA 4J9ZB 1RFYA 2IH1C 2DYRC 3Q4HB 5GTIZ 3HKDA 1WLEA 1XREA 5CBHA 4Z1MG 1EBOA 5LGNA 4X1IA 2AZ2A 4JV5B 1N34B 2RCVA 2Q69A 2N04A 4DV7O 3CMAV 3OGCC 1B6QA 4O2BA 3SGIA 4GX2A 1Q86W 2WAMA 3FD9A 1R73A 4X62B 4MTFA 4YIOA 3M7MX 4LH7A 5D5PA 3LSSA 5J2UA 3QO8A 2UXBO 1M5IA 3P30A 1EM1A 3C90A 4AHCA 1RSOA 3ETGA 5LA6A 4LH6A 4TV8B 3FKSG 2D3OW 3T4DA 1KECA 3OAAG 3G6BA 3G6EV 2NR5A 4W4KA 2H3OA 1S0VA 4P30A 1JCHA 4EKWA 4XDKA 4GKKB 4FLYA 5LHGA 4LF5B 4MVZA 4DRXA 1AROP 1MZEA 5L3BA 3AG1B 1PNLA 3TXQA 1EN4A 2HR3A 1K7DA 4FFBB 1MMMA 3JD4A 1AJQA 4LF5O 4LWSB 5CMUA 5JCOC 1N36O 1M93A 1SETA 2CE4A 1F51A 2IW5A 1AI7A 2DWEC 5H2FZ 2XAHA 1COWG 2OYQA 2Q0AA 3H01A 5BY1A 1JJOA 4C7UA 3ZHQA 3N27A 3J81N 4RAIA 1UJWB 1L0NH 1FXKA 4JAAA 1IBKO 2CH7B 1N0NA 4F6EA 4O4LA 4DW1A 4XDJA 1KU9A 3FAVA 1AI5A 3QNEA 1XMQB 1ZUQA 3KKYA 1Y74B 4X9QA 3CRQA 3RYFA 1K92A 3CCSV 5IWAO 1N34O 2BSKB 4I4TA 4O4JA 3RFRA 4JI8O 2NN4A 5L3FA 1KP2A 5LOVA 1HNWB 1V9PA 4DV6B 3AG3B 1NT2B 2HHHO 3OD4A 4B3MO 1Q43A 1MG1A 3X2QC 1YSCA 2HEPA 5KHGA 4LFAB 3LNNA 2ILMA 3JSLA 5C93A 2PUSA 1XOUA 2KKWA 2YI8A 3DXRA 3SYOA 1H2GA 4IGGA 1JVMA 2K1EA 3P3PA 2W6JG 5EBMC 4DR2B 1AR1B 4YXWG 2DQ3A 3RYIB 2HJFC 3RN4A 2JS3A 4RQEA 1K4DC 2V1DA 4KFMA 1KQSU 5HFMA 3LDCA 3VBBA 4PI2A 2UXCB 1R1BA 4MW8A 1R3LC 1SQGA 1R3JC 3K59A 5DM6V 2A9HA 2EINB 3WG7B 1XHXA 3JD0A 3SDLA 5J9PC 3UO2A 4DUYB 4DV1O 5DN6G 5KAFZ 2JRIA 2CTWA 2N05A 2FMLA 4TUYA 4ABMA 5KHIA 3K06A 5JJJB 3JARA 1K5QA 1BHAA 4X66O 2QGNA 1GN2A 2ZE5A 4DO2A 2F23A 1M56C 3CJHB 4UCRA 3ZX6A 5BR8B 4QPKA 2XAJA 2WLMA 4LBEC 4FLZA 3OEEG 4NTYA 5KMGA 4WFBV 1BZKA 1GM9A 3K57A 2QM4A 1FXKC 4NKGB 4ZKIA 1OCRB 4X1YB 2Q0OC 4QE9A 3L74H 1GN3A 1N32O 2WLIA 2WLNA 5DECA 3TJTA 5LMNB 4UCOA 5IYZA 1VQMV 3ZN0A 4FJCC 3SYPA 4FFKA 4JI4B 5CBGA 4ZBMA 5GTHZ 4UCVA 3OT7A 4X65B 2QWNB 5KHKA 2OIEA 3ZN1A 1Q6UA 1KUQA 2A79B 2KQXA 2KSDA 2W0FC 3W7TA 1Y66A 2JK5C 2BOCC 1BMFG 1WJZA 1KC8W 3SJCC 2GTSA 2ADPA 1MSWD 1ZWIC 2Q5ZA 2DE0X 2ETNA 4DV3B 4O4LB 2F43G 4JF3A 1BHBA 1S3JA 3FAVB 3D36A 1N0JA 4F4LA 1ZL8A 1VQ4V 4BIUA 1AB3A 5EYPA 1URFA 1M90W 2XAQA 1GN6A 2QSAA 4GUNA 3IGAC 2IU0A 5LYJB 4GT1A 2HG5C 4FM2A 2UUAO 1K33A 2EZPA 1BQ0A 3K03A 2P6JA 3P32A 2CK3G 5B66Z 3T4ZA 1AP6A 4X64O 3KG2A 1BCCH 2ZXWC 3H1IH 3RYHA 5EC1C 3N2GB 1XL4A 2QDOA 5CA0A 3MDSA 3I56V 2ZT9B 2UXNA 1YZBA 1QQCA 4CS2A 1IBMO 1H2NA 1NI8A 2WWWA 3AG4C 4TQFA 2IJKA 2C2AA 4H33A 1THZA 1P7GA 3F5WC 3FB5C 3TK1A 5J2TB 4MTGA 2EBOA 3C3SA 1N4CA 1Q8IA 4X88A 4O4HB 5L3DA 2QWQB 2P67A 5LXTB 2YUAA 3AG2B 1I94B 1G1XB 4DR1B 3B40A 2F4VO 1XDCA 5IJ0A 3WB0A 1I08A 4ZHQA 3W7WA 1HR0B 4CS4A 1RSOB 2WLHA 1F4MA 2QKCA 1DF5A 1MNGA 4GKJB 1NS1A 4WCEV 1LR1A 1GMGA 3CRMA 1EZJA 3H9VA 4H0LB 4JI2O 4RUEA 4DV3O 4FZ0A 1OHHG 3CXHF 2UU9B 2IBZH 3AEIA 1XNQO 1B04A 3ZHSA 4JPRA 4TSFG 1HNZB 1M4UA 3ABMC 2BE3A 4JI5B 1MOFA 3HKDB 2X0LA 3K08A 3Q4HA 2DYRB 5D5QA 2FB5A 3KZIZ 2ZM6B 1GM7A 4AI8A 4PA9A 3MHHC 2ZR3A 5IY5B 3NR7A 4PA6A 3CEIA 5JH7B 1B06A 2EILC 1OCOB 3APQA 5IT9N 1S5HC 3JATA 4QJFB 3L72H 1HNZO 5B5EZ 4DXWA 1BQZA 5HFLA 3RBZA 4JI2B 2E75B 2UUCO 3SYQA 2UXXA 1JA8A 1AP5A 1TUBB 3BFRA 4FM0A 4R7CA 3DC6A 3WFVA 3KCYA 4DR5B 2DWDC 1NZ6A 2YI9A 2E3CA 3ABKB 3J7AU 4JYYA 4X66B 1TVKB 1HR0O 2LW7A 4NXMB 2W6IG 4W4LA 1NH2D 3OTOO 1PM9A 4DR1O 5B1NA 5DEDA 4PA7A 1NKDA 4LF4B 3VQVA 2X6BA
chains in the Genus database with same CATH topology
2P90A 4QIWF 2KB1A 3ZJZA 3AG1B 5H9CA 1PNLA 4UV8A 4TT3G 3ZIAG 2ZD9A 4R8CA 2HR3A 5IYCO 1K7DA 1QCEA 2M7WA 3JD4A 4UVBA 1AJQA 1FXVA 1OCCB 4MVRA 5CMUA 1PD3A 1PKXA 4MT8A 1W0JG 2QM8A 1OCOC 2WLKA 1SETA 1IXMA 3F7VC 1OCZC 3E8FA 4HZ3A 4L87A 5LHHA 3QO5A 1F51A 1F4NA 3DGEA 3E8GA 3ABLC 5B1AC 2IW5A 1YI2V 1W2BU 4CBCA 5L3EA 5L3CA 5EBLC 1AI7A 2DWEC 3IC7A 2XAHA 3E86A 4LP8A 2P7TC 3EFFK 3OEHG 1COWG 3JCZA 1P4RA 2IU3A 3H01A 3M99B 4MVQA 2IH3C 1PNKA 1AI4A 2EIJB 2JEUA 1H8HG 3MHSC 3ASOB 1NH2B 4WFHA 1QVGU 3CCJV 3ABUA 4PA4A 4RAIA 1UJWB 1FXKA 2DW4A 1WPXA 5IDJA 3CC7V 4N23A 5EBWC 1K3EA 1F23A 4OXSA 2BOBC 1Q82W 1E1QG 4HYOA 3ZCCA 4JYBA 5B1BB 5B1BC 4MVMA 2B1GA 4KUMA 1M1KW 2PI5A 1VQNV 4JGSA 4XDJA 4G2KA 2QE7G 1NVPD 2AHZA 3SYCA 1R6KA 1AI5A 3QNEA 3NXSA 3B8MA 5B1AB 4CZZA 1K92A 3CCSV 4UUJC 3ZRWB 1FFTB 2IJIA 2Y69B 3SJQC 3AG1C 5KA6A 5L3FA 2NNUA 1QBZA 1KP2A 2OT5A 4X8AA 3ASOC 1JOYA 2YSUB 5KA5A 3AG3B 1JQ0A 1VQ5V 2WLJA 1S72V 2LP7A 4MTXA 2QEXV 3JD2A 1QR9A 1BL8A 4PDMA 1GK9A 1MG1A 3X2QC 1YSCA 1Y4MA 3ZRXA 1K97A 1RPOA 2QKSA 3LDEA 5B3SC 1M57C 1W0KG 3CC2V 5C93A 5H6QA 3SYOA 4P2ZA 1H2GA 3ETEA 4LCUC 1CPYA 3ZRSA 5B1OA 3CC4V 1VQLV 1JVMA 2K1EA 4I5SA 2W6JG 5EBMC 3CCVV 1AR1B 4YXWG 2DQ3A 2HJFC 3OUSA 1FS0G 3STLC 4WFFA 3SYAA 3ASNB 4J9YB 4QE7A 2IJJA 3OR6C 4RQEA 1YITV 1K4DC 2V1DA 1V54C 4KFMA 1V54B 5HFMA 3LDCA 2QM7A 4R6ZA 1KQSU 3VBBA 4JAUA 4RQFA 3G4SV 1YTFD 4FIPC 4MW8A 1R3LC 2X6CA 4BIZA 2ZQMA 4JASA 1R3JC 3X2QB 5DM6V 2A9HA 2EINB 1M57B 3WG7B 3JD0A 5J9PC 3CP1A 2Q67A 1NBMG 1YTFB 1VQPV 5DN6G 3ASNC 2HFEC 3W7SA 1HWYA 2JIZG 2HLDG 1OZ0A 1QLEB 3RVZA 1YJNV 3K06A 1YHQV 1OCRC 3RVYA 3K04A 1K5QA 4ASUG 1BHAA 1I5XA 1CP9A 2EINC 2ITCC 4UVCA 1M9NA 2JEXA 3ABKC 3STZC 5LGTA 2IJHA 4DO2A 1M56C 1M56B 2EJRA 3TETA 1R6NA 3SPGA 1GM8A 1AI6A 4QPKA 1VQKV 3E8BA 5E1AC 2XAJA 2EIKB 2WLMA 2A0LA 4LBEC 3E2EA 1QLEC 1VQ9V 5KUKA 3OEEG 4KP4A 2OCCB 2ZR2A 4U7NA 2Y69C 1K5SA 4WFBV 3FYEB 2EIMB 2XASA 5IYDO 1GM9A 2HKOA 3CPWU 3JYCA 3FB7C 1JX9A 4TWKA 1FXKC 4ZKIA 3ML0A 5EK0A 1OCRB 1K8AW 2JJ2G 1J95A 1R3IC 1ORQC 1G4YB 3TCUA 3ETDA 4QE9A 1DF4A 2OTLV 3AG2C 2WLIA 1GTOA 4GX5A 4Q20A 5KUMA 2WLNA 4G28B 2XAFA 1H38A 3SPHA 1DLBA 2X7RB 1VQMV 3T2MA 3ZN0A 4FJCC 3SYPA 3ZRVA 3K79A 1YJWV 1E79G 3CMEV 3OW2U 3G71V 5CBGA 4ZBMA 1ROPA 2NLJC 3E35A 4GX0A 4MVOA 1PNMA 2OCCC 1K4CC 3BY6A 1PL0A 3SPJA 4RO2A 3ZN1A 1MABG 3PJSK 2A79B 2W0FC 4N21A 3ZRWA 1YIJV 1V55C 3AG4B 1Y66A 3OUFA 1XL6A 2JK5C 3W7TA 2BOCC 4FK5C 5BZBA 1BMFG 4JAVA 4R50A 1KC8W 4QPJA 2QA4V 3JD1A 1MSWD 1VQ6V 4WFEA 1ZWIC 2B5UA 1K9MW 3MD0A 4PDRA 2F43G 4JF3A 1BHBA 1NQTA 2JDIG 1TUEB 1S3JA 2QTOA 1R3KC 2HVKC 3D36A 1YJ9V 4XBFA 4LC1A 4F4LA 1EFRG 1VQ4V 3EHBB 4BIUA 2LFSA 3K0DA 3SPCA 4MVSA 4JTAB 1M90W 2XAQA 2IU0A 3IGAC 4GT1A 2HG5C 4JYCA 1GKFA 1FXKB 2DQ0A 2GSMB 4H37A 1S77D 3CD6V 1K33A 2EZPA 1H8EG 3GWOA 1P7BA 3K03A 2P6JA 3P32A 4GX1A 2CK3G 5LBQA 1SESA 3K3WA 1V55B 5IYBO 3T4ZA 5FL7G 2PI4A 3KG2A 5L3GA 5GW7A 2ZXWC 3OMNB 1AJNA 5EC1C 1XL4A 3K9AA 3I56V 2UXNA 1RPRA 1K73W 1JJ2U 3LNMB 2ITDC 3W7XA 3FYIB 1Q81W 2Y48A 4UV9A 1ENVA 1NR1A 3E8HA 1S76D 3D3IA 4WFGA 3ABMB 2X6AA 2WWWA 3AG4C 3R65A 4JTDB 1LNQA 2IJKA 2H8PC 4FPPA 1KKDA 1I5YA 3OMIB 2C2AA 2EZOA 4H33A 1THZA 3F5WC 3FB5C 3TK1A 3B8NA 5H6RA 3JD3A 3K0GA 4MTGA 1RM1C 1CEZA 3QO7A 2EBOA 4I9WA 3CXCU 1DTOA 2WLIB 2ZDIA 3F7YC 4X88A 2EIKC 5L3DA 3FB6C 3CCRV 1AJPA 2P67A 3DTUB 3W7UA 3AG2B 3A0RA 3WG7C 4BW5A 4WFAV 2Q68A 2Z3YA 1NVPB 4MVUA 3OR7C 1KP3A 3OM3B 3HB3B 4PA3A 2EIMC 1KD1W 2OTJV 3ZMZA 1N8RW 4WF9V 3W7WA 5EC2C 3FB8C 1QLNA 3LDDA 3E83A 3GB7C 1NJIW 3HPLC 2Q6AA 3SPIA 2WLHA 1F4MA 1DF5A 2XOKG 4MTOA 3I55V 3ZMUA 1Q7YW 2B1IA 3OE7G 4BAYA 2WPDG 2DYSB 1K34A 3IFXA 2V7QG 4RUFA 4WCEV 1VQOV 1GMGA 4QNHB 1EZJA 2ZDIC 4HAMA 4MSWC 2R9IA 1FXHA 2GHYA 4RUEA 5CA3A 5CN0A 3BEHA 3ZMSA 1RM1B 3CYOA 1OHHG 4U7OA 2YEVB 2ATKC 1JPXA 1SRYA 3AEIA 2WLLA 3UKMA 4JPRA 4TSFG 5IY5C 4MS2A 5B3SB 4E2LA 3OMAB 3ZMVA 1NR7A 3UM7A 3ABMC 4PDVA 4PELA 1MOFA 2X0LA 4P9OA 4X89A 2EIJC 3K08A 1VQ8V 3E89A 4J9ZB 1GO3F 2IH1C 4MW3A 2DYRC 2DYRB 2XNDG 2LFRA 1G8MA 1QR8A 1WLEA 5CBHA 4Z1MG 1EBOA 5LGNA 1SZTA 1GM7A 4UXNA 2AHYA 3CCUV 4FMTA 4JTCB 4PA9A 2WSSG 5LGUA 2WLLB 3MHHC 2ZR3A 2ZXWB 2Q69A 5IY5B 4PA6A 2JJ1G 3CCLV 3CMAV 2EILC 1OCOB 3OGCC 1B6QA 1S5HC 2MK3A 3ABTA 4GX2A 4G27B 3VOUA 3T1CA 4QJFB 1Q86W 2WAMA 1R73A 4DXWA 3B77A 2XAGA 4MTFA 4PDLA 3LUTB 5CBFA 2R9RB 1VQ7V 2DYSC 4GCZA 5HFLA 3LSSA 3QO8A 3RBZA 3P30A 3AG3C 3SYQA 2UXXA 2FTKA 3LSQA 1L1FA 3ETGA 4R7CA 3WFVA 1E1RG 1OCZB 3ZMTA 3CCMV 3FKSG 3ABLB 2D3OW 3T4DA 1KECA 2HVJC 3OAAG 2DWDC 3OFNG 5LHIA 4XDLA 4P9PA 1OCCC 3G6EV 3ABKB 4UVAA 2EILB 1SERA 1S0VA 1QVFU 3CCEV 2Z5UA 4P30A 1JCHA 2W6IG 2YEVA 2H94A 4EKWA 1NH2D 4XDKA 5B1NA 3RW0A 4PA7A 5LHGA 1NKDA 3CCQV 4MVZA 1AROP 2X6BA 5L3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8N A;  5H9C A;  1DF5 A;  2LP7 A;  3H01 A;  3M99 B;  2EBO A;  1QR9 A;  1MOF A;  3CP1 A;  4E2L A;  4N21 A;  3MHS C;  1QCE A;  2MK3 A;  3B8M A;  1K34 A;  2M7W A;  1Y66 A;  1MG1 A;  1DF4 A;  1Y4M A;  1ENV A;  4FK5 C;  5CMU A;  3B77 A;  1QR8 A;  5HFM A;  1EBO A;  1SZT A;  1K33 A;  2EZP A;  1DLB A;  2X7R B;  3GWO A;  4N23 A;  5KA6 A;  5CN0 A;  2P6J A;  1F23 A;  4FJC C;  3CYO A;  4FIP C;  1QBZ A;  2OT5 A;  5HFL A;  1JPX A;  1I5X A;  4JF3 A;  3MHH C;  1I5Y A;  5KA5 A;  1JQ0 A;  3P30 A;  2EZO A;  4JGS A;  4JPR A;  4G2K A;  3K9A A;  3WFV A; 
#chains in the Genus database with same CATH topology
 2R70 A;  2KB1 A;  4DUY O;  4K8X A;  1BSM A;  3HKB A;  3CHX A;  4ZI7 B;  1SKV A;  1W0J G;  1OCO C;  3RGB A;  3E8F A;  4D6T H;  5LHH A;  3E22 A;  2PF4 E;  5B1A C;  3ABL C;  3BA8 A;  5L3C A;  1VF7 A;  2P7T C;  3EXA A;  4LNU B;  3M99 B;  2VQE B;  2BTQ A;  1H8H G;  4TV9 A;  1FJG B;  4WFH A;  2BTQ B;  4LF7 O;  4X64 B;  5IYZ B;  1WPX A;  3JAK A;  3BA9 A;  4N23 A;  4U3J A;  4DV4 O;  4JYB A;  1YCI A;  3G80 A;  2VWJ A;  4LFA O;  4KUM A;  1M1K W;  2UUA B;  3RYF B;  3IAY A;  1R6K A;  5EIB C;  2LQT A;  1JFF B;  5B1A B;  2HHH B;  2LW1 A;  2PGG A;  3ZRW B;  1QNM A;  4JYA O;  1HNW O;  3QG5 A;  1QBZ A;  3R66 A;  3UQ8 A;  1JOY A;  4DW0 A;  1VQ5 V;  2HJD A;  1S72 V;  1XMQ O;  1QR9 A;  1L8D A;  1XQ8 A;  3DSQ A;  1BL8 A;  4PDM A;  1I0H A;  2QKA A;  3T1H B;  3UT5 B;  2YIB D;  1K97 A;  4X65 O;  4OGQ B;  3K5O A;  4K35 A;  5H6Q A;  3ZRS A;  5KHH A;  1IXB A;  3CCV V;  4JI1 B;  3CWB H;  1FS0 G;  4WFF A;  4J9Y B;  2A3Q A;  3BAB A;  3OR6 C;  1V54 C;  1V54 B;  2QM7 A;  3T1Y B;  3G4S V;  1YTF D;  4FIP C;  4NVP A;  1WP7 A;  2P4V A;  1N36 B;  3A0H Z;  3WB1 A;  1NBM G;  3CRC A;  1Y6X A;  4FLV A;  1H2M A;  3FFQ A;  5GON A;  3DXR B;  2Q7E A;  4GKK O;  4LF6 B;  5LP6 B;  4ASU G;  2P22 C;  2YDE A;  5CB4 B;  3UO3 A;  4UCU A;  2EIN C;  3ZHU A;  4UVC A;  2JEX A;  3U0Z A;  3J80 N;  4CC5 A;  4TOI A;  1R6N A;  3SPG A;  2UUB O;  1AI6 A;  1VQK V;  3E8B A;  4K3A A;  2EIK B;  4RWU A;  2AZ0 A;  1QLE C;  4GYC B;  2OCC B;  4LFB O;  2ZR2 A;  3O65 A;  3JAM N;  4H44 B;  3FYE B;  2XAS A;  1YEW A;  4PHZ A;  3CPW U;  3ICX A;  4F6R A;  2UXC O;  2B9Z A;  1IBL O;  4CS3 A;  5IJ0 B;  3ML0 A;  1SQV H;  1J95 A;  3B2E E;  3TCU A;  4ICG A;  2R72 A;  2Y0I A;  5FPO A;  2OTL V;  4I55 A;  3AG2 C;  1GTO A;  4GX5 A;  2ZE8 A;  2Y0P A;  4G28 B;  2XAF A;  3IJ4 A;  1SA0 A;  1DLB A;  2X7R B;  2OIG A;  3OW2 U;  4DV5 O;  1HNX O;  4MVO A;  2OCC C;  2XTA A;  3SPJ A;  4NXN B;  3PJS K;  4N21 A;  3A0B Z;  5LP6 C;  1V55 C;  3AG4 B;  3OUF A;  2Y4T A;  1XL6 A;  2ZE6 A;  5BZB A;  2P5O A;  2GUZ B;  2QTS A;  4QPJ A;  2QA4 V;  1XI1 A;  4DV6 O;  4YY3 B;  4J11 A;  5KX5 B;  5CA0 B;  1VQ6 V;  4WFE A;  2B5U A;  4I50 A;  4JI8 B;  1SQX H;  3S3W A;  4PDR A;  3K5L A;  4ZI7 A;  1LUW A;  2LJ2 A;  2BCC H;  5IWA B;  2QTO A;  1XIL A;  2ZIO A;  4XBF A;  1EFR G;  2RQ6 A;  2PZS A;  4DR6 O;  4DR7 O;  3K0D A;  2P06 A;  4MVS A;  4JTA B;  1N33 O;  4CH5 A;  1GKF A;  5EYP B;  3IC9 A;  4H37 A;  1S77 D;  3CD6 V;  1P7B A;  1IVS A;  5LBQ A;  2WA3 A;  1SZX A;  2ZE7 A;  4X20 B;  5IYB O;  5LMU O;  1W59 A;  1FYJ A;  1U97 A;  1AJN A;  4TV8 A;  1H2K A;  3ZHR A;  1JJ2 U;  2ITD C;  3W7X A;  3FYI B;  2Y48 A;  3E8H A;  1S76 D;  3ABM B;  1SQF A;  4UFZ A;  3U11 A;  4DV2 B;  1LNQ A;  3H1L H;  1KKD A;  1I5Y A;  4KHP O;  2EZO A;  3JAT B;  4IYI A;  4J41 A;  1A32 A;  3B8N A;  5H6R A;  1KYO F;  1CEZ A;  4I9W A;  1DTO A;  1JR9 A;  2A06 H;  2WLI B;  3F7Y C;  3BCC H;  2QWR B;  1AJP A;  4UB8 Z;  3A0R A;  4BW5 A;  2Z3Y A;  4MVU A;  3HB3 B;  1VF6 C;  1KD1 W;  1N8R W;  2ZIM A;  1RP3 B;  5EC2 C;  4FZ1 A;  3FB8 C;  3E83 A;  3GB7 C;  4DUZ O;  4FVM A;  4MTO A;  4B7K A;  4F6R B;  4LFC B;  2V7Q G;  4B3S B;  1X4T A;  2R9I A;  2UXB B;  2GHY A;  1J5E B;  5CN0 A;  3BEH A;  3ZMS A;  4B7E A;  4JI7 O;  3H1H H;  5CB4 A;  1HP8 A;  4X62 O;  2CDY A;  3APO A;  1TA8 A;  4E2L A;  5B3S B;  3ZMV A;  4LF8 O;  2Q8V A;  4PDV A;  4Q6G A;  2VWK A;  4X89 A;  4P9O A;  4Z1V A;  1VQ8 V;  1GO3 F;  1AVM A;  4MW3 A;  3JAW A;  5K1X A;  4DV7 B;  1G8M A;  1QR8 A;  1TUB A;  2VQF B;  3CCU V;  1SZT A;  4UXN A;  4JI7 B;  4JV5 O;  1VIB A;  2IM9 A;  1TGO A;  4FMT A;  1JMK C;  5LGU A;  4B08 A;  5EZY A;  2WLL B;  4O4H A;  2JJ1 G;  2ZNJ A;  5CA1 B;  2EUL A;  1PPJ H;  3D3Q A;  5EIB D;  4CH6 A;  5J2T A;  2RDC A;  3ZED A;  4FLW A;  2MK3 A;  5TIS Z;  4DUZ B;  4JI3 B;  3T1C A;  2XAG A;  1CXZ B;  3LUT B;  1AIL A;  2R9R B;  2AGA A;  2LGW A;  4DR3 B;  2DYS C;  5K1P A;  1BS3 A;  1Z5V A;  5F2V O;  3LSQ A;  1L1F A;  1E1R G;  3ZMT A;  5C8Y A;  1XUQ A;  2DJV A;  4J7Z A;  3CCM V;  1HDJ A;  1MZF A;  5JVD A;  2HVJ C;  1OCC C;  1MA1 A;  4DV2 O;  2EIL B;  2BTO A;  1SER A;  3RWR D;  3CCE V;  2W0X A;  2H94 A;  1FPO A;  3RW0 A;  3HKE B;  3CCQ V;  5KAI Z;  4G27 B;  4QGP A;  2P90 A;  4I9Q A;  5H9C A;  1SS3 A;  2M7W A;  1R6T A;  4NTX A;  4MVR A;  1PD3 A;  3GWK C;  2QM8 A;  2WLK A;  1OCZ C;  4DK0 A;  2JGD B;  3SJB C;  4D7T A;  3QO5 A;  3RYC A;  2YID A;  1H2L A;  2YIB A;  1JFF A;  4CBC A;  1EN5 A;  4J80 A;  4PD4 F;  2CTR A;  3IC7 A;  4LP8 A;  3OEH G;  1SQQ H;  3EFF K;  2PTM A;  2CH7 A;  1P4R A;  5LXT A;  5IE9 A;  1VEW A;  4MVQ A;  1X59 A;  1PNK A;  1AI4 A;  2JEU A;  1WP8 A;  1FD9 A;  4TV9 B;  1NH2 B;  1VAR A;  3H1J H;  3ABU A;  4PA4 A;  4NYK A;  5IDJ A;  5EBW C;  1F23 A;  3CB2 A;  2BOB C;  1GN4 A;  5A2Q N;  1E1Q G;  4HYO A;  5LOV B;  5B1B C;  4MVM A;  1QHT A;  2B1G A;  2PI5 A;  1VQN V;  4G2K A;  3GVM A;  4I7Z B;  4JI3 O;  2QE7 G;  4J10 A;  4DR4 B;  1NVP D;  2AHZ A;  2E5L B;  4X1Y A;  2A7W A;  2RMK B;  3SYC A;  2L35 A;  3NXS A;  3AG7 A;  3E22 B;  2OWO A;  2ZCE A;  5KX5 A;  4CZZ A;  1KKC A;  4CC6 A;  2Y69 B;  3SJQ C;  4LWS A;  3N2K B;  5KA6 A;  1XMO O;  5KMG B;  4DRX B;  4FFB A;  1WPB A;  2OT5 A;  2YC0 A;  4X8A A;  1XNR B;  3ASO C;  4B3T O;  4Z2W A;  2YSU B;  1IX9 A;  4O4I A;  3KCX A;  2QWO B;  4DV0 O;  3JD2 A;  2F93 B;  2Q7G A;  1YVW A;  3CE2 A;  2ODM A;  2CTQ A;  3I5D A;  1RPO A;  5B3S C;  1HW7 A;  3JAR B;  3JSN A;  4BWA A;  4EB6 A;  3ETE A;  4LFB B;  5FLX N;  1CPY A;  3CC4 V;  1O9G A;  3OUS A;  2Q4P A;  2XT9 A;  4UCT A;  3ASN B;  4QE7 A;  2IJJ A;  1YIT V;  4O2B B;  2ZIN A;  4R6Z A;  5ITZ B;  4JAU A;  4K0K O;  4RQF A;  4LF6 O;  1IZ3 A;  4JAS A;  4OX9 O;  4NR1 A;  5FNV B;  2Q67 A;  1YTF B;  1XHZ A;  4BW9 A;  4K8Z A;  4LR3 A;  4YIP A;  4O2A B;  4JI6 O;  3QF7 A;  2YXH A;  1OZ0 A;  3RVZ A;  5GON B;  4X1K A;  3CRR A;  1YHQ V;  1OCR C;  2VRZ A;  1SC5 B;  3K04 A;  1WB7 A;  1Q3E A;  2ITC C;  3EVK A;  2IJH A;  2EJR A;  4ZIB A;  1GM8 A;  2EJ7 A;  1ZAU A;  4J42 A;  1VQ9 V;  5LMU B;  5FPR A;  3HKC B;  4U7N A;  4I4T B;  4O4J B;  1ZTE A;  4D7S A;  3L70 H;  1Q6H A;  3K5M A;  2HKO A;  4LF9 O;  1MSD A;  2K9P A;  3AK1 A;  1JX9 A;  4PV1 B;  1GAX A;  1K8A W;  2JJ2 G;  4DR6 B;  3TGU H;  1R3I C;  1ORQ C;  3ETD A;  4EB6 B;  3K5N A;  3PN1 A;  1WB8 A;  2FKX A;  5KUM A;  1H38 A;  4Q20 A;  3SPH A;  1DK1 A;  1S5J A;  4FLX A;  4YY3 O;  3BPZ A;  3K79 A;  1YJW V;  2CGN A;  4JYA B;  3G71 V;  2F95 B;  1PP9 H;  1ROP A;  2NLJ C;  4AQY O;  4JZG A;  1PNM A;  1YDX A;  4CH4 A;  1K4C C;  3N2K A;  3BY6 A;  1PL0 A;  2RJZ A;  4NXN O;  2E76 B;  5IJ9 A;  2DOS A;  4U3F H;  3QVN A;  4JAV A;  4DV5 B;  1HNX B;  4I50 B;  1F7Y A;  1EN6 A;  1NQT A;  4EFB A;  3L71 H;  3DC5 A;  5LL6 Y;  2UXD O;  2P4K A;  2LGQ A;  1IBL B;  1WA8 B;  4H13 B;  3JAK B;  2DQ0 A;  2N74 A;  1H8E G;  3GWO A;  5LYJ A;  4GX1 A;  2MW2 B;  1SES A;  3K3W A;  1V55 B;  5FL7 G;  5L3G A;  5GW7 A;  4OPH A;  4LNU A;  3K9A A;  2AW9 A;  3QTC A;  4HNA A;  1FFX B;  3BVO A;  2GV9 A;  2UUB B;  1ZX3 A;  1K73 W;  3LNM B;  3RYC B;  2PY5 A;  5J2U B;  1Q81 W;  4LF4 O;  1ENV A;  2CTP A;  1NR1 A;  3K9S A;  3OTO B;  1GRJ A;  3WB2 A;  2X6A A;  4JZ2 A;  4JTD B;  2GBO A;  1EZV H;  3OMI B;  1XEQ A;  2M6Y A;  3JD3 A;  3QO7 A;  3CXC U;  1WAZ A;  2ZDI A;  5BXZ A;  2FYU H;  2EIK C;  3FB6 C;  3CCR V;  3W7U A;  2Q68 A;  1NVP B;  4IIJ A;  1L0L H;  4PA3 A;  3ETQ A;  2CUG A;  2OTJ V;  1G6U A;  3T1Y O;  4I0X B;  4L8J A;  4A5U B;  3LDD A;  2XUM A;  2QR4 A;  3HPL C;  2Q6A A;  4JI0 O;  2XOK G;  3HR0 A;  3OE7 G;  2UXD B;  4JI1 O;  4BAY A;  2WPD G;  2DYS B;  1K34 A;  3IFX A;  4RUF A;  4YHH B;  2YIA A;  4GLX A;  5E79 Z;  4QNH B;  2ZDI C;  4HAM A;  4MSW C;  5JJE B;  2GDS A;  2DMX A;  2CAZ C;  4U7O A;  1SRY A;  5JQG B;  3CJH A;  3T1H O;  5IY5 C;  4MS2 A;  5JH7 A;  3OMA B;  5BMV B;  2D2C B;  1NR7 A;  3UM7 A;  4PEL A;  1YF2 A;  3E89 A;  3SJA C;  2QJ1 A;  1KBH A;  3CRA A;  3JAW B;  2JGU A;  3OTF A;  1XNQ B;  2XND G;  2LFR A;  5LA6 B;  4B3R B;  4AQY B;  2AHY A;  4JTC B;  5BMV A;  2WSS G;  3VQY A;  5JQG A;  3AK2 A;  2ZXW B;  4B3R O;  3CCL V;  1Q5O A;  3ABT A;  3VOU A;  3B77 A;  4IYH A;  4PDL A;  4DYL A;  5CBF A;  4DV4 B;  4LF9 B;  3L75 H;  4J7K A;  2F4V B;  1VQ7 V;  1NU1 H;  4GCZ A;  4LF7 B;  3B09 A;  3O9O A;  1SQB H;  1I94 O;  3AG3 C;  1FJG O;  3U10 A;  2FTK A;  2R9A A;  3K58 A;  1OCZ B;  3TXS A;  4YHH O;  2VQE O;  1FFX A;  4IIJ B;  1FAF A;  2GTA A;  3A8T A;  3ABL B;  1D2D A;  4JI0 B;  3OFN G;  5LHI A;  4XDL A;  4P9P A;  1SQP H;  4U3J B;  2RN9 A;  4UVA A;  2Z0A A;  1QVF U;  2Z5U A;  2YEV A;  1NTM H;  2YXL A;  3CSX A;  4QIW F;  3ZJZ A;  2F1M A;  4UV8 A;  2ARH A;  4TT3 G;  2ZD9 A;  1DGS A;  4R8C A;  3RT3 C;  3ZIA G;  5IYC O;  1QCE A;  4UVB A;  2L6L A;  1FXV A;  1OCC B;  4OX9 B;  1PKX A;  1BGY H;  4MT8 A;  1IXM A;  3F7V C;  4NXM O;  4HZ3 A;  4L87 A;  3H1K H;  1F4N A;  3DGE A;  3E8G A;  1YI2 V;  1W2B U;  1IUR A;  4ZHQ B;  1I7F A;  5L3E A;  2F66 C;  5EBL C;  5IJ9 B;  3HKB B;  4DR5 O;  3E86 A;  3N2G A;  3JCZ A;  5KHJ A;  2IU3 A;  2IH3 C;  2EIJ B;  1Y76 A;  4X20 A;  3MHS C;  3ZHT A;  3ASO B;  1Q90 D;  2UUC B;  2JVD A;  4GZR B;  4EFE A;  1QVG U;  3CCJ V;  2RNB A;  1Y76 B;  2DW4 A;  3CC7 V;  4NTW A;  1K3E A;  4OXS A;  1Q82 W;  3ZCC A;  2QWP B;  5B1B B;  1IDS A;  2HP8 A;  1VP7 A;  4JGS A;  1FKA O;  2KG7 B;  2Q9L A;  2GUZ A;  3MAQ A;  3B8M A;  3B4S A;  2KG7 A;  1YXB A;  4UUJ C;  4IT5 A;  1FFT B;  2IJI A;  3CX5 F;  3AG1 C;  4B3T B;  1XNR O;  3L73 H;  2NNU A;  5LMN O;  4NB5 A;  2ZM6 O;  1XMO B;  4FLT A;  1N32 B;  2O57 A;  1OJH A;  3VQW A;  5KA5 A;  1JQ0 A;  2JS5 A;  2WLJ A;  2QEX V;  2LP7 A;  4MTX A;  4JI5 O;  2YS8 A;  3L9D A;  1WNS A;  1GK9 A;  4DR4 O;  1Y4M A;  1ZL8 B;  3ZRX A;  3LDE A;  2QKS A;  3CC2 V;  1M57 C;  1W0K G;  2UU9 O;  4BR6 A;  3UCS C;  4I55 B;  1UFI A;  1O9H A;  3OGI B;  4DK1 A;  2ZKO A;  4P2Z A;  4LCU C;  1H2S B;  4O2A A;  5B1O A;  1VQL V;  5FNV A;  4J7J A;  4I5S A;  4GKJ O;  1P84 F;  5BR8 O;  3STL C;  3SYA A;  3THO A;  1KB9 F;  3VQX A;  4ZOL A;  3P3N A;  4IHJ A;  3AK3 A;  1B3Q A;  2X6C A;  4BIZ A;  2ZQM A;  1D5N A;  3X2Q B;  5LP6 A;  4WBN B;  1M57 B;  2WA4 A;  3SR2 C;  3D36 C;  1NTK H;  3D8C A;  4X1I B;  3CP1 A;  1VQP V;  3ASN C;  2EX3 A;  2HFE C;  2FL4 A;  3W7S A;  4FLU A;  1HWY A;  5C8Y B;  2JIZ G;  5JJN B;  2HLD G;  1QLE B;  4TUY B;  1YJN V;  1VF6 A;  4TQD A;  1US6 A;  1VF5 B;  1NTZ H;  4BIO A;  3RVY A;  2VS0 A;  3BHP A;  4IL6 Z;  1I5X A;  4YJ3 A;  3JAL A;  5A9G A;  1CP9 A;  1IBM B;  1M9N A;  3ABK C;  3STZ C;  5LGT A;  2Q73 A;  1M56 B;  2PYL A;  1LUV A;  5ITZ A;  4JI6 B;  1ZLZ A;  5JWP A;  3TET A;  4DR2 O;  4O4I B;  5E1A C;  3E2E A;  2A0L A;  5AG2 A;  1PV0 A;  5KUK A;  4KP4 A;  2Y69 C;  5JCO A;  4KL1 A;  1K5S A;  1Z2G A;  2EIM B;  3JAL B;  5IYD O;  4YJ3 B;  4E4E A;  2CGO A;  4K0K B;  3BRC A;  3JAS B;  3JYC A;  3FB7 C;  3RYI A;  4I0X A;  4TWK A;  2DN9 A;  3F5T A;  4B3M B;  5EK0 A;  4PJ0 Z;  3RYH B;  1G4Y B;  2YXY A;  3UT5 A;  1DF4 A;  1KMI Z;  3CS5 A;  1XBL A;  2Y4U A;  2PYJ A;  1P49 A;  2AXT Z;  3T2M A;  3S3X A;  3ZRV A;  1E79 G;  1OV9 A;  1T5E A;  3FX7 A;  3CME V;  1BE3 H;  2VQF O;  3E35 A;  4GX0 A;  4YJ2 B;  1UPG A;  4ZOL B;  1Y67 A;  4RO2 A;  1MAB G;  3ZRW A;  3JCU Z;  1YIJ V;  4LF8 B;  1SF9 A;  4DV0 B;  4FK5 C;  1WN7 A;  4R50 A;  1PL4 A;  3LSU A;  2BSK A;  3JD1 A;  5H5N A;  3BAA A;  4JI4 O;  4HNA B;  1D5A A;  1Y74 A;  1IBK B;  2XHB A;  1K9M W;  3MD0 A;  1J5E O;  2JDI G;  1TUE B;  1R3K C;  2ADQ B;  1GH6 A;  2HVK C;  1YJ9 V;  4LC1 A;  1VMG A;  4B3S O;  3EHB B;  4LFC O;  2LFS A;  1AR4 A;  4UCS A;  3SPC A;  2E5L O;  4JYC A;  1FXK B;  2GSM B;  1WA8 A;  1ZSP A;  2YIC A;  2PI4 A;  1U96 A;  3OMN B;  2E74 B;  2JGD A;  4OPA A;  1RPR A;  4EEQ A;  4UV9 A;  1S5L Z;  2G38 A;  4UB6 Z;  4KHP B;  3D3I A;  4WFG A;  3R65 A;  4YJ2 A;  2LO1 A;  3HKE A;  2H8P C;  4FPP A;  3M8A A;  2OCH A;  4KXR A;  1TVK A;  4DV1 B;  3K0G A;  1RM1 C;  1TAE A;  3DTU B;  5JVD B;  3WG7 C;  4WFA V;  2Q7H A;  3OR7 C;  1KP3 A;  3OM3 B;  1QU7 A;  2EIM C;  4AIL C;  3WU2 Z;  3ZMZ A;  4CH3 A;  4WF9 V;  2ZNI A;  1BT8 A;  1QLN A;  3JAS A;  1Q6I A;  1NJI W;  3SPI A;  1Z5W A;  1N33 B;  3I55 V;  3ZS8 C;  3ZMU A;  2B1I A;  1Q7Y W;  1AR5 A;  4DR7 B;  3ZBH A;  4WBN A;  1VQO V;  3C3T A;  4PI0 A;  3HKC A;  1FXH A;  5CA3 A;  3A2F A;  4IHJ B;  4DR3 O;  1RM1 B;  5CA1 A;  3CYO A;  4FM1 A;  2YEV B;  2ATK C;  1JPX A;  2WLL A;  3UKM A;  5KLV H;  5EZY B;  3ZHV A;  1SA0 B;  3G67 A;  2V4D A;  4X1K B;  2EIJ C;  4HBN A;  4J9Z B;  1RFY A;  2IH1 C;  2DYR C;  3Q4H B;  5GTI Z;  3HKD A;  1WLE A;  1XRE A;  5CBH A;  4Z1M G;  1EBO A;  5LGN A;  4X1I A;  2AZ2 A;  4JV5 B;  1N34 B;  2RCV A;  2Q69 A;  2N04 A;  4DV7 O;  3CMA V;  3OGC C;  1B6Q A;  4O2B A;  3SGI A;  4GX2 A;  1Q86 W;  2WAM A;  3FD9 A;  1R73 A;  4X62 B;  4MTF A;  4YIO A;  3M7M X;  4LH7 A;  5D5P A;  3LSS A;  5J2U A;  3QO8 A;  2UXB O;  1M5I A;  3P30 A;  1EM1 A;  3C90 A;  4AHC A;  1RSO A;  3ETG A;  5LA6 A;  4LH6 A;  4TV8 B;  3FKS G;  2D3O W;  3T4D A;  1KEC A;  3OAA G;  3G6B A;  3G6E V;  2NR5 A;  4W4K A;  2H3O A;  1S0V A;  4P30 A;  1JCH A;  4EKW A;  4XDK A;  4GKK B;  4FLY A;  5LHG A;  4LF5 B;  4MVZ A;  4DRX A;  1ARO P;  1MZE A;  5L3B A;  3AG1 B;  1PNL A;  3TXQ A;  1EN4 A;  2HR3 A;  1K7D A;  4FFB B;  1MMM A;  3JD4 A;  1AJQ A;  4LF5 O;  4LWS B;  5CMU A;  5JCO C;  1N36 O;  1M93 A;  1SET A;  2CE4 A;  1F51 A;  2IW5 A;  1AI7 A;  2DWE C;  5H2F Z;  2XAH A;  1COW G;  2OYQ A;  2Q0A A;  3H01 A;  5BY1 A;  1JJO A;  4C7U A;  3ZHQ A;  3N27 A;  3J81 N;  4RAI A;  1UJW B;  1L0N H;  1FXK A;  4JAA A;  1IBK O;  2CH7 B;  1N0N A;  4F6E A;  4O4L A;  4DW1 A;  4XDJ A;  1KU9 A;  3FAV A;  1AI5 A;  3QNE A;  1XMQ B;  1ZUQ A;  3KKY A;  1Y74 B;  4X9Q A;  3CRQ A;  3RYF A;  1K92 A;  3CCS V;  5IWA O;  1N34 O;  2BSK B;  4I4T A;  4O4J A;  3RFR A;  4JI8 O;  2NN4 A;  5L3F A;  1KP2 A;  5LOV A;  1HNW B;  1V9P A;  4DV6 B;  3AG3 B;  1NT2 B;  2HHH O;  3OD4 A;  4B3M O;  1Q43 A;  1MG1 A;  3X2Q C;  1YSC A;  2HEP A;  5KHG A;  4LFA B;  3LNN A;  2ILM A;  3JSL A;  5C93 A;  2PUS A;  1XOU A;  2KKW A;  2YI8 A;  3DXR A;  3SYO A;  1H2G A;  4IGG A;  1JVM A;  2K1E A;  3P3P A;  2W6J G;  5EBM C;  4DR2 B;  1AR1 B;  4YXW G;  2DQ3 A;  3RYI B;  2HJF C;  3RN4 A;  2JS3 A;  4RQE A;  1K4D C;  2V1D A;  4KFM A;  1KQS U;  5HFM A;  3LDC A;  3VBB A;  4PI2 A;  2UXC B;  1R1B A;  4MW8 A;  1R3L C;  1SQG A;  1R3J C;  3K59 A;  5DM6 V;  2A9H A;  2EIN B;  3WG7 B;  1XHX A;  3JD0 A;  3SDL A;  5J9P C;  3UO2 A;  4DUY B;  4DV1 O;  5DN6 G;  5KAF Z;  2JRI A;  2CTW A;  2N05 A;  2FML A;  4TUY A;  4ABM A;  5KHI A;  3K06 A;  5JJJ B;  3JAR A;  1K5Q A;  1BHA A;  4X66 O;  2QGN A;  1GN2 A;  2ZE5 A;  4DO2 A;  2F23 A;  1M56 C;  3CJH B;  4UCR A;  3ZX6 A;  5BR8 B;  4QPK A;  2XAJ A;  2WLM A;  4LBE C;  4FLZ A;  3OEE G;  4NTY A;  5KMG A;  4WFB V;  1BZK A;  1GM9 A;  3K57 A;  2QM4 A;  1FXK C;  4NKG B;  4ZKI A;  1OCR B;  4X1Y B;  2Q0O C;  4QE9 A;  3L74 H;  1GN3 A;  1N32 O;  2WLI A;  2WLN A;  5DEC A;  3TJT A;  5LMN B;  4UCO A;  5IYZ A;  1VQM V;  3ZN0 A;  4FJC C;  3SYP A;  4FFK A;  4JI4 B;  5CBG A;  4ZBM A;  5GTH Z;  4UCV A;  3OT7 A;  4X65 B;  2QWN B;  5KHK A;  2OIE A;  3ZN1 A;  1Q6U A;  1KUQ A;  2A79 B;  2KQX A;  2KSD A;  2W0F C;  3W7T A;  1Y66 A;  2JK5 C;  2BOC C;  1BMF G;  1WJZ A;  1KC8 W;  3SJC C;  2GTS A;  2ADP A;  1MSW D;  1ZWI C;  2Q5Z A;  2DE0 X;  2ETN A;  4DV3 B;  4O4L B;  2F43 G;  4JF3 A;  1BHB A;  1S3J A;  3FAV B;  3D36 A;  1N0J A;  4F4L A;  1ZL8 A;  1VQ4 V;  4BIU A;  1AB3 A;  5EYP A;  1URF A;  1M90 W;  2XAQ A;  1GN6 A;  2QSA A;  4GUN A;  3IGA C;  2IU0 A;  5LYJ B;  4GT1 A;  2HG5 C;  4FM2 A;  2UUA O;  1K33 A;  2EZP A;  1BQ0 A;  3K03 A;  2P6J A;  3P32 A;  2CK3 G;  5B66 Z;  3T4Z A;  1AP6 A;  4X64 O;  3KG2 A;  1BCC H;  2ZXW C;  3H1I H;  3RYH A;  5EC1 C;  3N2G B;  1XL4 A;  2QDO A;  5CA0 A;  3MDS A;  3I56 V;  2ZT9 B;  2UXN A;  1YZB A;  1QQC A;  4CS2 A;  1IBM O;  1H2N A;  1NI8 A;  2WWW A;  3AG4 C;  4TQF A;  2IJK A;  2C2A A;  4H33 A;  1THZ A;  1P7G A;  3F5W C;  3FB5 C;  3TK1 A;  5J2T B;  4MTG A;  2EBO A;  3C3S A;  1N4C A;  1Q8I A;  4X88 A;  4O4H B;  5L3D A;  2QWQ B;  2P67 A;  5LXT B;  2YUA A;  3AG2 B;  1I94 B;  1G1X B;  4DR1 B;  3B40 A;  2F4V O;  1XDC A;  5IJ0 A;  3WB0 A;  1I08 A;  4ZHQ A;  3W7W A;  1HR0 B;  4CS4 A;  1RSO B;  2WLH A;  1F4M A;  2QKC A;  1DF5 A;  1MNG A;  4GKJ B;  1NS1 A;  4WCE V;  1LR1 A;  1GMG A;  3CRM A;  1EZJ A;  3H9V A;  4H0L B;  4JI2 O;  4RUE A;  4DV3 O;  4FZ0 A;  1OHH G;  3CXH F;  2UU9 B;  2IBZ H;  3AEI A;  1XNQ O;  1B04 A;  3ZHS A;  4JPR A;  4TSF G;  1HNZ B;  1M4U A;  3ABM C;  2BE3 A;  4JI5 B;  1MOF A;  3HKD B;  2X0L A;  3K08 A;  3Q4H A;  2DYR B;  5D5Q A;  2FB5 A;  3KZI Z;  2ZM6 B;  1GM7 A;  4AI8 A;  4PA9 A;  3MHH C;  2ZR3 A;  5IY5 B;  3NR7 A;  4PA6 A;  3CEI A;  5JH7 B;  1B06 A;  2EIL C;  1OCO B;  3APQ A;  5IT9 N;  1S5H C;  3JAT A;  4QJF B;  3L72 H;  1HNZ O;  5B5E Z;  4DXW A;  1BQZ A;  5HFL A;  3RBZ A;  4JI2 B;  2E75 B;  2UUC O;  3SYQ A;  2UXX A;  1JA8 A;  1AP5 A;  1TUB B;  3BFR A;  4FM0 A;  4R7C A;  3DC6 A;  3WFV A;  3KCY A;  4DR5 B;  2DWD C;  1NZ6 A;  2YI9 A;  2E3C A;  3ABK B;  3J7A U;  4JYY A;  4X66 B;  1TVK B;  1HR0 O;  2LW7 A;  4NXM B;  2W6I G;  4W4L A;  1NH2 D;  3OTO O;  1PM9 A;  4DR1 O;  5B1N A;  5DED A;  4PA7 A;  1NKD A;  4LF4 B;  3VQV A;  2X6B A; 
#chains in the Genus database with same CATH homology
 2P90 A;  4QIW F;  2KB1 A;  3ZJZ A;  3AG1 B;  5H9C A;  1PNL A;  4UV8 A;  4TT3 G;  3ZIA G;  2ZD9 A;  4R8C A;  2HR3 A;  5IYC O;  1K7D A;  1QCE A;  2M7W A;  3JD4 A;  4UVB A;  1AJQ A;  1FXV A;  1OCC B;  4MVR A;  5CMU A;  1PD3 A;  1PKX A;  4MT8 A;  1W0J G;  2QM8 A;  1OCO C;  2WLK A;  1SET A;  1IXM A;  3F7V C;  1OCZ C;  3E8F A;  4HZ3 A;  4L87 A;  5LHH A;  3QO5 A;  1F51 A;  1F4N A;  3DGE A;  3E8G A;  3ABL C;  5B1A C;  2IW5 A;  1YI2 V;  1W2B U;  4CBC A;  5L3E A;  5L3C A;  5EBL C;  1AI7 A;  2DWE C;  3IC7 A;  2XAH A;  3E86 A;  4LP8 A;  2P7T C;  3EFF K;  3OEH G;  1COW G;  3JCZ A;  1P4R A;  2IU3 A;  3H01 A;  3M99 B;  4MVQ A;  2IH3 C;  1PNK A;  1AI4 A;  2EIJ B;  2JEU A;  1H8H G;  3MHS C;  3ASO B;  1NH2 B;  4WFH A;  1QVG U;  3CCJ V;  3ABU A;  4PA4 A;  4RAI A;  1UJW B;  1FXK A;  2DW4 A;  1WPX A;  5IDJ A;  3CC7 V;  4N23 A;  5EBW C;  1K3E A;  1F23 A;  4OXS A;  2BOB C;  1Q82 W;  1E1Q G;  4HYO A;  3ZCC A;  4JYB A;  5B1B B;  5B1B C;  4MVM A;  2B1G A;  4KUM A;  1M1K W;  2PI5 A;  1VQN V;  4JGS A;  4XDJ A;  4G2K A;  2QE7 G;  1NVP D;  2AHZ A;  3SYC A;  1R6K A;  1AI5 A;  3QNE A;  3NXS A;  3B8M A;  5B1A B;  4CZZ A;  1K92 A;  3CCS V;  4UUJ C;  3ZRW B;  1FFT B;  2IJI A;  2Y69 B;  3SJQ C;  3AG1 C;  5KA6 A;  5L3F A;  2NNU A;  1QBZ A;  1KP2 A;  2OT5 A;  4X8A A;  3ASO C;  1JOY A;  2YSU B;  5KA5 A;  3AG3 B;  1JQ0 A;  1VQ5 V;  2WLJ A;  1S72 V;  2LP7 A;  4MTX A;  2QEX V;  3JD2 A;  1QR9 A;  1BL8 A;  4PDM A;  1GK9 A;  1MG1 A;  3X2Q C;  1YSC A;  1Y4M A;  3ZRX A;  1K97 A;  1RPO A;  2QKS A;  3LDE A;  5B3S C;  1M57 C;  1W0K G;  3CC2 V;  5C93 A;  5H6Q A;  3SYO A;  4P2Z A;  1H2G A;  3ETE A;  4LCU C;  1CPY A;  3ZRS A;  5B1O A;  3CC4 V;  1VQL V;  1JVM A;  2K1E A;  4I5S A;  2W6J G;  5EBM C;  3CCV V;  1AR1 B;  4YXW G;  2DQ3 A;  2HJF C;  3OUS A;  1FS0 G;  3STL C;  4WFF A;  3SYA A;  3ASN B;  4J9Y B;  4QE7 A;  2IJJ A;  3OR6 C;  4RQE A;  1YIT V;  1K4D C;  2V1D A;  1V54 C;  4KFM A;  1V54 B;  5HFM A;  3LDC A;  2QM7 A;  4R6Z A;  1KQS U;  3VBB A;  4JAU A;  4RQF A;  3G4S V;  1YTF D;  4FIP C;  4MW8 A;  1R3L C;  2X6C A;  4BIZ A;  2ZQM A;  4JAS A;  1R3J C;  3X2Q B;  5DM6 V;  2A9H A;  2EIN B;  1M57 B;  3WG7 B;  3JD0 A;  5J9P C;  3CP1 A;  2Q67 A;  1NBM G;  1YTF B;  1VQP V;  5DN6 G;  3ASN C;  2HFE C;  3W7S A;  1HWY A;  2JIZ G;  2HLD G;  1OZ0 A;  1QLE B;  3RVZ A;  1YJN V;  3K06 A;  1YHQ V;  1OCR C;  3RVY A;  3K04 A;  1K5Q A;  4ASU G;  1BHA A;  1I5X A;  1CP9 A;  2EIN C;  2ITC C;  4UVC A;  1M9N A;  2JEX A;  3ABK C;  3STZ C;  5LGT A;  2IJH A;  4DO2 A;  1M56 C;  1M56 B;  2EJR A;  3TET A;  1R6N A;  3SPG A;  1GM8 A;  1AI6 A;  4QPK A;  1VQK V;  3E8B A;  5E1A C;  2XAJ A;  2EIK B;  2WLM A;  2A0L A;  4LBE C;  3E2E A;  1QLE C;  1VQ9 V;  5KUK A;  3OEE G;  4KP4 A;  2OCC B;  2ZR2 A;  4U7N A;  2Y69 C;  1K5S A;  4WFB V;  3FYE B;  2EIM B;  2XAS A;  5IYD O;  1GM9 A;  2HKO A;  3CPW U;  3JYC A;  3FB7 C;  1JX9 A;  4TWK A;  1FXK C;  4ZKI A;  3ML0 A;  5EK0 A;  1OCR B;  1K8A W;  2JJ2 G;  1J95 A;  1R3I C;  1ORQ C;  1G4Y B;  3TCU A;  3ETD A;  4QE9 A;  1DF4 A;  2OTL V;  3AG2 C;  2WLI A;  1GTO A;  4GX5 A;  4Q20 A;  5KUM A;  2WLN A;  4G28 B;  2XAF A;  1H38 A;  3SPH A;  1DLB A;  2X7R B;  1VQM V;  3T2M A;  3ZN0 A;  4FJC C;  3SYP A;  3ZRV A;  3K79 A;  1YJW V;  1E79 G;  3CME V;  3OW2 U;  3G71 V;  5CBG A;  4ZBM A;  1ROP A;  2NLJ C;  3E35 A;  4GX0 A;  4MVO A;  1PNM A;  2OCC C;  1K4C C;  3BY6 A;  1PL0 A;  3SPJ A;  4RO2 A;  3ZN1 A;  1MAB G;  3PJS K;  2A79 B;  2W0F C;  4N21 A;  3ZRW A;  1YIJ V;  1V55 C;  3AG4 B;  1Y66 A;  3OUF A;  1XL6 A;  2JK5 C;  3W7T A;  2BOC C;  4FK5 C;  5BZB A;  1BMF G;  4JAV A;  4R50 A;  1KC8 W;  4QPJ A;  2QA4 V;  3JD1 A;  1MSW D;  1VQ6 V;  4WFE A;  1ZWI C;  2B5U A;  1K9M W;  3MD0 A;  4PDR A;  2F43 G;  4JF3 A;  1BHB A;  1NQT A;  2JDI G;  1TUE B;  1S3J A;  2QTO A;  1R3K C;  2HVK C;  3D36 A;  1YJ9 V;  4XBF A;  4LC1 A;  4F4L A;  1EFR G;  1VQ4 V;  3EHB B;  4BIU A;  2LFS A;  3K0D A;  3SPC A;  4MVS A;  4JTA B;  1M90 W;  2XAQ A;  2IU0 A;  3IGA C;  4GT1 A;  2HG5 C;  4JYC A;  1GKF A;  1FXK B;  2DQ0 A;  2GSM B;  4H37 A;  1S77 D;  3CD6 V;  1K33 A;  2EZP A;  1H8E G;  3GWO A;  1P7B A;  3K03 A;  2P6J A;  3P32 A;  4GX1 A;  2CK3 G;  5LBQ A;  1SES A;  3K3W A;  1V55 B;  5IYB O;  3T4Z A;  5FL7 G;  2PI4 A;  3KG2 A;  5L3G A;  5GW7 A;  2ZXW C;  3OMN B;  1AJN A;  5EC1 C;  1XL4 A;  3K9A A;  3I56 V;  2UXN A;  1RPR A;  1K73 W;  1JJ2 U;  3LNM B;  2ITD C;  3W7X A;  3FYI B;  1Q81 W;  2Y48 A;  4UV9 A;  1ENV A;  1NR1 A;  3E8H A;  1S76 D;  3D3I A;  4WFG A;  3ABM B;  2X6A A;  2WWW A;  3AG4 C;  3R65 A;  4JTD B;  1LNQ A;  2IJK A;  2H8P C;  4FPP A;  1KKD A;  1I5Y A;  3OMI B;  2C2A A;  2EZO A;  4H33 A;  1THZ A;  3F5W C;  3FB5 C;  3TK1 A;  3B8N A;  5H6R A;  3JD3 A;  3K0G A;  4MTG A;  1RM1 C;  1CEZ A;  3QO7 A;  2EBO A;  4I9W A;  3CXC U;  1DTO A;  2WLI B;  2ZDI A;  3F7Y C;  4X88 A;  2EIK C;  5L3D A;  3FB6 C;  3CCR V;  1AJP A;  2P67 A;  3DTU B;  3W7U A;  3AG2 B;  3A0R A;  3WG7 C;  4BW5 A;  4WFA V;  2Q68 A;  2Z3Y A;  1NVP B;  4MVU A;  3OR7 C;  1KP3 A;  3OM3 B;  3HB3 B;  4PA3 A;  2EIM C;  1KD1 W;  2OTJ V;  3ZMZ A;  1N8R W;  4WF9 V;  3W7W A;  5EC2 C;  3FB8 C;  1QLN A;  3LDD A;  3E83 A;  3GB7 C;  1NJI W;  3HPL C;  2Q6A A;  3SPI A;  2WLH A;  1F4M A;  1DF5 A;  2XOK G;  4MTO A;  3I55 V;  3ZMU A;  1Q7Y W;  2B1I A;  3OE7 G;  4BAY A;  2WPD G;  2DYS B;  1K34 A;  3IFX A;  2V7Q G;  4RUF A;  4WCE V;  1VQO V;  1GMG A;  4QNH B;  1EZJ A;  2ZDI C;  4HAM A;  4MSW C;  2R9I A;  1FXH A;  2GHY A;  4RUE A;  5CA3 A;  5CN0 A;  3BEH A;  3ZMS A;  1RM1 B;  3CYO A;  1OHH G;  4U7O A;  2YEV B;  2ATK C;  1JPX A;  1SRY A;  3AEI A;  2WLL A;  3UKM A;  4JPR A;  4TSF G;  5IY5 C;  4MS2 A;  5B3S B;  4E2L A;  3OMA B;  3ZMV A;  1NR7 A;  3UM7 A;  3ABM C;  4PDV A;  4PEL A;  1MOF A;  2X0L A;  4P9O A;  4X89 A;  2EIJ C;  3K08 A;  1VQ8 V;  3E89 A;  4J9Z B;  1GO3 F;  2IH1 C;  4MW3 A;  2DYR C;  2DYR B;  2XND G;  2LFR A;  1G8M A;  1QR8 A;  1WLE A;  5CBH A;  4Z1M G;  1EBO A;  5LGN A;  1SZT A;  1GM7 A;  4UXN A;  2AHY A;  3CCU V;  4FMT A;  4JTC B;  4PA9 A;  2WSS G;  5LGU A;  2WLL B;  3MHH C;  2ZR3 A;  2ZXW B;  2Q69 A;  5IY5 B;  4PA6 A;  2JJ1 G;  3CCL V;  3CMA V;  2EIL C;  1OCO B;  3OGC C;  1B6Q A;  1S5H C;  2MK3 A;  3ABT A;  4GX2 A;  4G27 B;  3VOU A;  3T1C A;  4QJF B;  1Q86 W;  2WAM A;  1R73 A;  4DXW A;  3B77 A;  2XAG A;  4MTF A;  4PDL A;  3LUT B;  5CBF A;  2R9R B;  1VQ7 V;  2DYS C;  4GCZ A;  5HFL A;  3LSS A;  3QO8 A;  3RBZ A;  3P30 A;  3AG3 C;  3SYQ A;  2UXX A;  2FTK A;  3LSQ A;  1L1F A;  3ETG A;  4R7C A;  3WFV A;  1E1R G;  1OCZ B;  3ZMT A;  3CCM V;  3FKS G;  3ABL B;  2D3O W;  3T4D A;  1KEC A;  2HVJ C;  3OAA G;  2DWD C;  3OFN G;  5LHI A;  4XDL A;  4P9P A;  1OCC C;  3G6E V;  3ABK B;  4UVA A;  2EIL B;  1SER A;  1S0V A;  1QVF U;  3CCE V;  2Z5U A;  4P30 A;  1JCH A;  2W6I G;  2YEV A;  2H94 A;  4EKW A;  1NH2 D;  4XDK A;  5B1N A;  3RW0 A;  4PA7 A;  5LHG A;  1NKD A;  3CCQ V;  4MVZ A;  1ARO P;  2X6B A;  5L3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...