1KQSU

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1kqsU00
3CC7V 1QVGU 3CMEV 5DM6V 3CCEV 3CCQV 1VQOV 3G6EV 1YJNV 1VQPV 1NJIW 1VQLV 1VQ4V 1YIJV 1K8AW 3I56V 1Q7YW 3G71V 1YJWV 3CCVV 4WCEV 4WFAV 3I55V 3CCJV 3CCMV 2QA4V 2D3OW 1W2BU 1K73W 1JJ2U 1VQ9V 1N8RW 1YHQV 3CCUV 2OTJV 1VQ6V 1VQ7V 1R73A 1YITV 3G4SV 1M90W 3CC4V 1VQ5V 1VQ8V 1Q86W 1YJ9V 3CCRV 3CD6V 1VQKV 1S72V 4WFBV 1M1KW 3CXCU 4WF9V 3CPWU 1Q81W 1VQMV 2QEXV 1VQNV 1KD1W 1Q82W 1QVFU 3CCSV 1KC8W 1YI2V 3CCLV 1K9MW 2OTLV 3OW2U 3CMAV 1KQSU 3CC2V
chains in the Genus database with same CATH superfamily
4XDJA 4LF9B 3ASOC 4NYKA 1LUVA 3EHBB 3K57A 3FAVA 2JJ2G 3HKCB 4X64O 3EXAA 1FFXA 1F4MA 4DV0B 5IJ9B 3APQA 2A3QA 2HKOA 3OGCC 2N04A 1IDSA 3VQWA 3BY6A 1K97A 4LFCB 5A9GA 1JFFB 1XMOB 3K03A 3SPCA 3ZRVA 4LWSB 5J2TA 3AG7A 4MW3A 2DE0X 3ZN1A 2WLIA 4TV9A 3UO3A 2QEXV 1SQQH 2RJZA 5B1BC 4O2AB 1MNGA 1OZ0A 2E5LB 2ZDIA 4YY3B 2Q6AA 1IBLO 4LF6O 3P3NA 1NTMH 2PUSA 2KB1A 2VQFO 2ZDIC 4LFAB 4P9OA 5EIBD 2Q68A 3SPHA 3HPLC 1K33A 1N0JA 2XAQA 4J80A 4MS2A 2Y0PA 2RCVA 5D5QA 2Q9LA 4GKKO 4F6EA 3B40A 3ETEA 3RBZA 4DV1B 5HFLA 5BZBA 4RO2A 5LA6B 5J9PC 4JAVA 4X20B 2PI4A 5DM6V 4KUMA 5JWPA 4JI8B 2XAGA 4WFGA 5K1XA 3QG5A 4YJ2A 3OMNB 1N32B 4R6ZA 2WLJA 4X1KA 4Z2WA 1K5SA 3D3IA 5CMUA 3OEEG 1Q43A 1Y74B 4DR1B 1KP2A 1NR7A 5LXTA 4MTOA 4U3FH 2GUZB 2DYSB 2OT5A 3AG1B 1S0VA 2GSMB 3RYIB 4HBNA 4PDLA 2IH3C 1D2DA 1VF7A 3E8FA 1N33O 4LFBB 3ZIAG 3D3QA 4GX1A 5B1OA 3SJQC 2QWQB 4CH6A 4BWAA 5JQGA 2W0FC 3OW2U 2R9IA 2L35A 1RSOA 2YI9A 1OJHA 5K1PA 1K73W 1AR1B 4TUYB 4K8XA 4UB6Z 2LW7A 4NXMO 1B3QA 1AP5A 2GBOA 3J7AU 1H38A 3OD4A 2QR4A 4PI2A 1GRJA 1QVFU 5KUMA 2JGUA 3E8GA 4UVAA 2HG5C 2QDOA 5EBWC 4Z1VA 4UVBA 1MSDA 2VQFB 3HKEA 3K9SA 5LMNO 1WB8A 4J7KA 2IU3A 1SKVA 1Y4MA 4X65O 3AK1A 3F7YC 3MAQA 5IYCO 2QKAA 5LP6A 4JTDB 5KLVH 3N2KB 4JTAB 5BY1A 2F4VO 5ITZA 1BHAA 4JI0O 3K5OA 3DSQA 3KKYA 4DUYO 3G80A 2LJ2A 1XI1A 4FFBB 2QM4A 3RFRA 3UT5A 1H2NA 3H1KH 3JARB 5KX5A 5J2UA 3H1LH 2WLMA 5EBLC 1WP7A 4JYBA 2ZIMA 3CCQV 2XT9A 5IWAB 2UXNA 2IBZH 4JI5B 4W4LA 4IL6Z 1XNRO 2CH7A 4LF7B 2E75B 2CGNA 2EINC 1AVMA 2EIMC 4FM0A 1GMGA 1YITV 4B3TO 4O4HB 3A0HZ 5KAIZ 1SA0A 4DW1A 2GDSA 1S5LZ 2ZXWC 2PYJA 3ASNC 3K06A 2BOBC 3JD4A 3MHHC 5EIBC 4E2LA 4DRXA 1YVWA 3K04A 1VIBA 5KA6A 2ZM6O 1WJZA 5BXZA 2JGDA 2LGQA 2V7QG 4R7CA 1E79G 1N0NA 5KHHA 2WA3A 2O57A 2W0XA 2PZSA 3CEIA 2RDCA 1DLBA 4MT8A 5C93A 4JI2O 1S77D 4JAAA 1X4TA 4BIOA 1R3JC 4K0KO 2R9RB 5C8YA 3SYOA 3K58A 4WBNB 2QWPB 3SPGA 3CHXA 4JYYA 4D7SA 1ZWIC 1B04A 5JH7A 4CBCA 2OTLV 2BSKB 4DV4B 4H44B 1SQGA 1NTZH 3LDEA 2OWOA 4X1IA 1LUWA 4TV8A 2DQ3A 4MVOA 1VQ5V 5CB4A 1GKFA 4L87A 1SQPH 3T2MA 1KU9A 1PKXA 1COWG 4QIWF 2Y4UA 1OCZB 3SYQA 4B7KA 1FFTB 1NI8A 2Q5ZA 3CCJV 2YEVA 1QQCA 3HKDA 4JYCA 2ZT9B 4O2BA 2YS8A 2RN9A 2GTSA 3ETGA 1WLEA 1SERA 4LF5O 1XDCA 1SQXH 5IJ0A 5E1AC 2AGAA 4QNHB 5HFMA 1JOYA 5BMVA 2CUGA 2JEUA 4JF3A 4KP4A 2BTQB 1Q90D 5IY5B 1N4CA 2FTKA 4UCVA 3F7VC 3VQYA 1Q6UA 5LMUO 2UXBB 1M5IA 3OM3B 1O9GA 4IT5A 4JV5O 4BAYA 3QF7A 2EIJC 4QJFB 2KSDA 4UCTA 3SR2C 4LH7A 4WF9V 5EZYA 1JX9A 5LGUA 2P7TC 3U0ZA 1K9MW 4K35A 4RAIA 1QBZA 3QO5A 3JD1A 1BCCH 1YJNV 3Q4HB 1BT8A 3GWOA 5B1NA 1Y6XA 3SYCA 4JI1O 2DW4A 2QM7A 4N21A 3BAAA 5IY5C 1SZXA 5DECA 4NVPA 3CRCA 5IE9A 4ABMA 2FL4A 1EM1A 3AG3C 2YXYA 3B77A 1QVGU 2H8PC 3VOUA 3OTOO 4FM1A 1EFRG 3JASB 2HFEC 1F7YA 1GM7A 5CA1A 1K3EA 5GTIZ 4DUZO 4JAUA 2ZKOA 2Y69B 3CRRA 4TSFG 5BR8O 4WFBV 2DYRB 4J9YB 1BS3A 3ZBHA 3E22B 5LGTA 2HHHB 2X7RB 4MTGA 2AXTZ 4P9PA 4MSWC 3BVOA 5LL6Y 2A06H 2M7WA 3LDCA 3T1YB 2RQ6A 1HNWO 2ZE7A 2DWEC 4LF9O 4YIOA 4RQFA 1J95A 1AI5A 1PNMA 3S3XA 4WFAV 4ZOLB 1TVKB 2UUBB 1DF4A 1JR9A 2XAJA 4U7NA 1UPGA 3L70H 4O4JA 4X88A 2LO1A 4P30A 1N36B 2Q7HA 3B4SA 4J9ZB 1SESA 3TJTA 2ADPA 1VQOV 2PI5A 2QTOA 4LFCO 1YF2A 1ZL8B 4NTYA 3MHSC 5FNVB 1MZEA 1XMOO 4LNUA 1CPYA 5H6RA 2ARHA 3RYFB 2DQ0A 1H8EG 5KMGB 1VF6C 2KG7A 4TT3G 3D36C 4R8CA 5LHHA 3SYPA 1UFIA 3HB3B 1KD1W 3CJHA 3ZMSA 2E5LO 3BRCA 4YY3O 1CEZA 4I50B 3H1IH 3RVZA 4LFAO 5CBGA 1XNQB 1NU1H 4HNAB 3E86A 3JAWA 2EBOA 4FVMA 4BW5A 5EYPA 3SPJA 4FLZA 2YDEA 2QKSA 3RYCB 2A7WA 1AROP 3LSQA 4FLWA 5L3EA 1KUQA 4LF8B 3N27A 1WB7A 2V4DA 3CXHF 3ASOB 4DV5O 1M57C 1D5AA 3ABMC 2ILMA 1ZUQA 2DOSA 5JVDB 2OCCB 4JI8O 1AR4A 3RYHB 4QGPA 3LNNA 3FAVB 5KHIA 1GAXA 4O4IA 1RP3B 1E1RG 1FFXB 1PPJH 2F93B 3H01A 3OUFA 1VEWA 1HP8A 4F6RA 5FL7G 2JVDA 4PJ0Z 3CP1A 2HLDG 1KYOF 1KC8W 1VP7A 2WLLB 3ZHTA 3ZMTA 3C3SA 1FD9A 4PELA 3E83A 3RW0A 3JCUZ 2WWWA 1RM1C 4LF4B 1P84F 2P06A 4B3RB 4LFBO 2OCCC 2GHYA 3G4SV 1SRYA 5J2TB 5B1BB 4CS4A 1VQ8V 1IZ3A 2EILC 4JI6B 1W0KG 2WLIB 3CRMA 1U97A 4UXNA 4C7UA 2ZQMA 4TV9B 1GTOA 4JZ2A 2P22C 1EZVH 3WU2Z 4X9QA 1XEQA 2YICA 1Y76A 3TETA 1XHZA 4X1YA 1V54C 2OCHA 1NVPB 1R6TA 2YUAA 5LHIA 4BW9A 1R6NA 4EFBA 4LC1A 2EX3A 4FLVA 1SQVH 1A32A 4ZI7B 5DEDA 5LBQA 5GTHZ 1P49A 4DK0A 4JYAB 5KHJA 1VQ7V 3DTUB 4XBFA 1IBMB 4I55A 4HAMA 3OFNG 4YJ2B 2ZNIA 3SJBC 1VQNV 3JCZA 4X1KB 5B5EZ 1NTKH 4DV7B 4I9WA 4GUNA 4DV5B 3QNEA 2X6BA 3G6BA 5LXTB 4YJ3A 3CCVV 2XHBA 4G27B 4TQDA 1M56B 1N8RW 4I9QA 4ZHQA 4PDMA 2Y0IA 1R3KC 4IHJA 4MTXA 1ZX3A 4AQYB 1B6QA 4TQFA 2K9PA 3QO7A 4ASUG 3BCCH 3K0GA 4JI3B 4W4KA 5JQGB 1XMQO 5IWAO 1XREA 4FLYA 2EZPA 1V9PA 4I4TA 2QM8A 3ZRXA 1FKAO 2BTOA 4JI5O 1RSOB 1OCRC 4LF7O 2V1DA 1TAEA 4XDLA 4AHCA 1Q6IA 2N74A 3OUSA 1M56C 4JI7B 2CTRA 4JTCB 4NKGB 3OGIB 5KHKA 3CXCU 3T4DA 1IX9A 4RUEA 1IVSA 2JK5C 2CE4A 1L1FA 5EC1C 1AILA 2Z5UA 3MDSA 3HKEB 1XQ8A 1KKDA 2HR3A 1BQZA 3C90A 5JJEB 1Q5OA 3W7UA 3FB7C 1Y74A 1PM9A 3ETDA 1FPOA 4GT1A 4IIJA 1H2KA 3TK1A 4K3AA 3BEHA 3SDLA 5B1AC 1XL4A 2NR5A 5ITZB 1IXBA 1GM8A 1W2BU 5GW7A 3K5MA 2EULA 1FJGO 2R70A 4MVRA 5FPOA 3UT5B 1EN6A 5KX5B 2UUCB 3O9OA 5J2UB 3H9VA 1YI2V 2JEXA 4X66B 1ENVA 3K79A 4DV4O 4J10A 5LP6C 2EINB 4IYHA 4DV3B 3CCMV 2EIMB 2Y4TA 2CH7B 1JCHA 4FFKA 2CDYA 1QCEA 3ZMZA 2ODMA 2H3OA 1AJPA 1NQTA 2ZXWB 3ASNB 1CXZB 3L73H 1QU7A 4B3SB 3L72H 1SA0B 4HYOA 1XMQB 3BFRA 1QR9A 3KCYA 2XAHA 3IJ4A 1OHHG 5L3BA 4UFZA 3BABA 4YHHB 4DRXB 1EN4A 4FLTA 3C3TA 4LCUC 4FPPA 1KKCA 2C2AA 2JGDB 1AJNA 3RVYA 1Q82W 1BQ0A 3N2GB 3K08A 4CC5A 1KECA 4UUJC 2OYQA 3JAKB 3ZMVA 2JIZG 4FFBA 3FYEB 2ITCC 2UXBO 2E74B 1XOUA 1BZKA 3ZRWA 1G8MA 3DC5A 1KP3A 5C8YB 4BR6A 2UUAB 1I5XA 2B1GA 4PHZA 1K4CC 3FKSG 3EFFK 1PL4A 4DR2B 1ZTEA 3OTFA 2OIGA 1G1XB 4U3JA 2WLKA 2A9HA 3JAMN 2A79B 4B3MO 2DN9A 4O4HA 1R6KA 2EJ7A 1Q8IA 1FJGB 2IW5A 2JDIG 5CB4B 5D5PA 1K7DA 2Q7GA 1H8HG 2VRZA 3BHPA 2E3CA 1U96A 1SZTA 4P2ZA 2YXLA 1TGOA 3IGAC 1G6UA 2YEVB 1VQ6V 2Q8VA 3OEHG 1NH2B 1M1KW 3W7XA 4OPAA 2Q0OC 1OCCB 3TCUA 1KQSU 5IJ0B 1PNLA 4HZ3A 3HKBA 1Y66A 4JPRA 2HHHO 2F95B 4CH5A 3S3WA 4PA6A 3CCUV 2EIJB 5IT9N 2ETNA 4X89A 4EB6A 3FB8C 3QTCA 2BOCC 3VQVA 1S5JA 4FIPC 1KB9F 3T1YO 3FD9A 3G67A 1IBKB 5IDJA 4DYLA 1OCCC 5CBHA 1HNZO 1QLEC 1WN7A 4FLXA 1YJWV 1XUQA 2L6LA 2Q7EA 2ZR3A 4O4LA 3K59A 2UUBO 3E35A 4I0XA 2PF4E 2P90A 2A0LA 1GH6A 5EBMC 3AG3B 4Q20A 1DK1A 1THZA 4H0LB 3CD6V 1N36O 2HVKC 3K5LA 1QR8A 4I5SA 2XTAA 4DR5B 4F4LA 1RPOA 2EJRA 2FKXA 4H33A 4ZIBA 1G4YB 1YTFB 3THOA 4B3MB 3DXRB 2WLHA 1OCOC 5CA1B 2ZIOA 5IYZB 4D7TA 3K0DA 2HJDA 3K3WA 4E4EA 1KMIZ 4QE9A 4CS2A 3ZHSA 2WPDG 4PDVA 3A0BZ 1GN2A 1S76D 1Q3EA 3K5NA 4DXWA 3R66A 3AEIA 4MVUA 3ZJZA 4KL1A 1XNQO 2ZE6A 3ABKC 4UCSA 2HJFC 1HR0B 5KAFZ 1HNXO 1VQMV 2CTQA 4LF8O 1WA8B 2LFRA 1M9NA 2UU9B 3M8AA 1J5EB 3UO2A 1NJIW 4KHPB 3ICXA 1IURA 2JS3A 2NNUA 4DV2B 3CB2A 5L3GA 2VS0A 1SQBH 2ADQB 2EIKC 1K5QA 2M6YA 1T5EA 3ML0A 4O4JB 2FMLA 3X2QC 1PV0A 2MK3A 1WPBA 3ZN0A 1K34A 3JALA 1HNZB 3W7WA 3DGEA 1I94B 4LF4O 4LNUB 1PP9H 4B3RO 2KG7B 1NVPD 1H2LA 4JI6O 2ZE8A 3UCSC 3B8MA 2DJVA 1FXKA 1HDJA 3RN4A 4L8JA 3ABTA 3CJHB 3U11A 1BGYH 3RWRD 2P67A 3ZX6A 1O9HA 3D8CA 1JA8A 2PYLA 1EN5A 5GONA 3OMIB 3JAWB 3AG4B 4QPKA 3IAYA 5EYPB 3UM7A 4DV6B 1TUBA 4FZ0A 4MVSA 1RPRA 5LOVA 1M57B 5L3CA 3HR0A 4Z1MG 1I5YA 1MABG 4A5UB 1CP9A 3CC7V 3ABMB 4AI8A 5CN0A 4GKJB 4LH6A 2IM9A 1ZLZA 3SGIA 3B09A 4JYAO 1JVMA 4DR4B 3K9AA 2ZNJA 3F5TA 3L71H 2R9AA 1BSMA 4OX9B 1IBMO 1HNXB 4O4IB 3AG4C 3JATA 1Z2GA 1F51A 4NTWA 4DV7O 2UXDB 3O65A 1RM1B 1YDXA 4KFMA 1XILA 4PDRA 2D3OW 5DN6G 4WFEA 5CA0A 2EILB 3EVKA 1PNKA 1XL6A 2X6CA 3SPIA 1N34B 4GX0A 2LW1A 3H1JH 1S72V 3CRQA 1PL0A 4AQYO 4I50A 2QWNB 4JI3O 5JJJB 4GLXA 2JRIA 2LFSA 4HNAA 3J81N 4NR1A 1K8AW 2CTWA 2XASA 3GB7C 1V54B 2CGOA 1Y76B 3CRAA 4J7ZA 2B5UA 4LBEC 1ROPA 4JI4B 3RT3C 3LUTB 4J41A 3P32A 4MVMA 3W7TA 4X1YB 4NTXA 4CS3A 4UCRA 4JI7O 1P7GA 2HEPA 3CCRV 1E1QG 1AR5A 1F23A 2UXCB 1WNSA 4MTFA 1R3IC 1Q6HA 2KKWA 2Q69A 1MMMA 5LYJA 2CK3G 4DK1A 3T1HO 3B8NA 5IYBO 2AZ2A 5JVDA 1WPXA 1I7FA 1F4NA 3RYHA 1H2SB 1JJ2U 1ZAUA 2AHYA 1GN4A 3ZHQA 3WB0A 5AG2A 2VQEB 3AK3A 3RGBA 4TOIA 2WLLA 4I55B 1QNMA 3WFVA 3G71V 1NBMG 3CMEV 1L8DA 3P30A 1K92A 1JPXA 4H13B 3HKCA 2QA4V 3JSNA 4YJ3B 3ABUA 4NXNO 5IJ9A 5LGNA 4DR6B 4ZHQB 1I08A 2ZINA 4DR7B 3KCXA 4IHJB 4MW8A 4JZGA 2UUCO 2OIEA 4G2KA 4Q6GA 4X66O 1OCRB 1JFFA 5H5NA 2PGGA 1ZSPA 3JD3A 4I4TB 4LWSA 4DV3O 2IJHA 3OE7G 1NZ6A 1P7BA 5H2FZ 4O2AA 2YSUB 2Z3YA 3VQXA 2YXHA 4ZI7A 2P4KA 1JMKC 4B3SO 3CE2A 1FXVA 5L3FA 1YSCA 2ZD9A 4GX2A 1JJOA 3SYAA 5B3SB 2UXXA 3MD0A 1AI4A 4DR3B 4YHHO 5JJNB 1ORQC 2D2CB 5EC2C 4X62O 4BIUA 1Q81W 2P4VA 3AG2B 4IGGA 5LA6A 2B1IA 4IIJB 4X20A 5B1AB 3CMAV 5FLXN 1VF5B 3T1HB 4IYIA 3LSSA 2XNDG 3FB6C 1SF9A 1X59A 2W6JG 2PY5A 4EKWA 4X64B 3IFXA 5B3SC 3NR7A 2PTMA 1BL8A 1R73A 3A8TA 3JSLA 1EBOA 4WFFA 5KHGA 4FK5C 5FPRA 3LSUA 2UUAO 4CC6A 4GYCB 5LP6B 2P6JA 2GUZA 3AG2C 4OXSA 4DR2O 3RYIA 2IJJA 2H94A 3L9DA 2XAFA 1FXHA 1MG1A 2DYSC 3AG1C 4DO2A 4NXNB 4UCOA 1LNQA 3CC4V 1M4UA 5A2QN 1US6A 1NH2D 4AILC 2YIDA 4UV9A 1IBLB 1KBHA 4LF6B 2QTSA 4EEQA 2DWDC 1AP6A 1P4RA 1R1BA 2CAZC 5LHGA 4LP8A 4TUYA 4UVCA 1MSWD 2E76B 1RFYA 2LGWA 1FYJA 4GKKB 2Q67A 3UKMA 3H1HH 4JASA 4ICGA 2QE7G 2R72A 3OR7C 1GN6A 3W7SA 1SETA 1VQPV 3G6EV 4UV8A 1MOFA 4MVQA 2W6IG 1QHTA 4FJCC 3ZMUA 1GN3A 3OMAB 2IJIA 3T1CA 2XUMA 5CBFA 4PA7A 4X8AA 4WFHA 1FS0G 2IJKA 4X62B 2VWKA 3ZRWB 1H2MA 3JD0A 1XHXA 3N2KA 3T4ZA 4UB8Z 4KXRA 5B66Z 1SS3A 2ITDC 3L75H 4UCUA 2WAMA 3FX7A 3LNMB 1IBKO 4U3JB 1URFA 1YTFD 1N33B 4J11A 3JARA 1M90W 3CWBH 3VBBA 1YCIA 2AW9A 4XDKA 2MW2B 3STLC 4DW0A 2LQTA 1FAFA 2BCCH 1S5HC 3FFQA 2QWOB 2AZ0A 5JH7B 4DR5O 1H2GA 2XOKG 3CCEV 4ZKIA 3I56V 4G28B 1Q7YW 1NS1A 2YIBD 2DMXA 1AB3A 3JYCA 2F23A 4X1IB 3GVMA 4FMTA 4TV8B 1AI7A 2ZE5A 2QSAA 4NXMB 1LR1A 3KG2A 3BA9A 4CH4A 3N2GA 1GM9A 1DF5A 4B7EA 2P5OA 2RMKB 3JAKA 1BE3H 4OPHA 1VARA 5LMNB 3ZCCA 2VWJA 3ZEDA 3HKBB 1MA1A 3E2EA 3U10A 4X65B 3BA8A 1W0JG 4R50A 3PN1A 3HKDB 2Q0AA 1HR0O 4O2BB 4MVZA 2AHZA 4EB6B 5F2VO 2F4VB 2YI8A 3B2EE 1QLEB 3R65A 5H9CA 2UU9O 1J5EO 1VQLV 4JI0B 4KHPO 5BMVB 4DUYB 3I55V 4DV2O 2X0LA 2HVJC 4O4LB 2QGNA 1AI6A 4WBNA 4I0XB 2G38A 2ZCEA 4YXWG 1M93A 2QKCA 2BSKA 4GZRB 5KUKA 5EZYB 1DTOA 1R3LC 3BPZA 4RQEA 3FB5C 3WB2A 1XNRB 1OCOB 4J7JA 4OGQB 3AK2A 1I94O 1L0LH 4B3TB 2Z0AA 3QVNA 5TISZ 3L74H 4BIZA 3F5WC 1K4DC 1JQ0A 2NN4A 5L3DA 3UQ8A 2F66C 1VQ4V 1TUEB 3I5DA 4CZZA 1NT2B 1OCZC 3ABKB 3OAAG 2ZM6B 4H37A 1DGSA 1SQFA 4DV6O 1Z5WA 4PA9A 1IXMA 3DC6A 1BMFG 1NKDA 5H6QA 3CC2V 3APOA 2BTQA 4JI2B 3LDDA 4B08A 4GKJO 5KA5A 2JS5A 2EIKB 3JD2A 1YHQV 4I7ZB 4DR4O 3IC7A 4K0KB 3A0RA 1I0HA 2GV9A 2QJ1A 3TGUH 3E8HA 3OT7A 3X2QB 4OX9O 1D5NA 3CCSV 2WA4A 1XBLA 3Q4HA 1YXBA 3CSXA 2UXDO 4TWKA 4U7OA 3DXRA 2FB5A 2B9ZA 3JALB 3ZHRA 3A2FA 5IYZA 5E79Z 3STZC 2IU0A 3M7MX 1VQKV 1N34O 2FYUH 3KZIZ 4RWUA 1Z5VA 2K1EA 3QO8A 1FXKB 4PV1B 3JASA 2YIBA 2Q4PA 4WCEV 3WB1A 3M99B 2YIAA 2IH1C 3ABLB 4QE7A 3E89A 5JCOA 2JJ1G 3CX5F 3J80N 4JI4O 5GONB 3ZHUA 3ETQA 1WA8A 2OTJV 1WAZA 2Y69C 3CPWU 4LF5B 5JCOC 1SC5B 1EZJA 2UXCO 1TUBB 4FLUA 4YIPA 3E22A 3NXSA 2DYRC 5LOVB 4FM2A 1FXKC 1YIJV 2X6AA 2KQXA 4QPJA 2EZOA 1GK9A 5LMUB 3ZS8C 2HP8A 2ZR2A 1HWYA 3WG7B 3E8BA 4JV5B 2Q73A 3ABLC 2RNBA 2VQEO 4DV0O 4GCZA 2F43G 2WLNA 5CA3A 2BE3A 3JATB 4NB5A 3TXSA 3ZRSA 4ZOLA 1B06A 1TVKA 3PJSK 1VF6A 4JI1B 1TA8A 3D36A 1W59A 1HW7A 1V55B 2CTPA 2QWRB 4J42A 4D6TH 1NR1A 5CA0B 4DR6O 4CH3A 3WG7C 1YJ9V 3FYIB 3OR6C 4DR7O 4ZBMA 4LR3A 2NLJC 4N23A 4PD4F 1AJQA 4F6RB 2ATKC 3SJAC 1QLNA 3CS5A 1L0NH 4FZ1A 3GWKC 3OTOB 1ZL8A 1YZBA 5FNVA 1S3JA 2N05A 4DUZB 3RYFA 1OV9A 5KMGA 5EK0A 4GX5A 4EFEA 3IC9A 1Y67A 2GTAA 4JGSA 1V55C 1BHBA 3ZHVA 5BR8B 1WP8A 2Y48A 1PD3A 3CYOA 2YC0A 5IYDO 4DV1O 2LP7A 4K8ZA 1VMGA 3P3PA 1UJWB 1VQ9V 5LYJB 3TXQA 1YEWA 4RUFA 4PI0A 3RYCA 4DR3O 1MZFA 2WSSG 2F1MA 1N32O 1Q86W 4PA4A 1GO3F 4PA3A 1HNWB 4DR1O 3CCLV 3SJCC
chains in the Genus database with same CATH topology
4XDJA 3AG2C 4OXSA 3ASOC 4P2ZA 5LGTA 2X7RB 2IJJA 2H94A 3EHBB 2XAFA 1FXHA 1MG1A 2DYSC 3IGAC 2JJ2G 4MTGA 3AG1C 4DO2A 2YEVB 1VQ6V 4P9PA 1LNQA 1F4MA 3CC4V 3OEHG 3OGCC 2HKOA 1NH2B 4MSWC 1M1KW 3W7XA 1NH2D 4UV9A 2M7WA 3LDCA 3BY6A 1OCCB 3TCUA 1K97A 1KQSU 2DWEC 1PNLA 2DWDC 1P4RA 4HZ3A 4RQFA 1J95A 5LHGA 1AI5A 1PNMA 4LP8A 1Y66A 4JPRA 4WFAV 4UVCA 3K03A 3SPCA 1DF4A 4PA6A 3ZRVA 1MSWD 3CCUV 2EIJB 2XAJA 4MW3A 4U7NA 3ZN1A 2WLIA 4X89A 4X88A 2Q67A 3FB8C 4P30A 2BOCC 3UKMA 2QEXV 5B1BC 4JASA 2QE7G 1OZ0A 2ZDIA 4FIPC 4J9ZB 2Q6AA 3OR7C 1SESA 3W7SA 1SETA 2KB1A 1VQPV 1VQOV 3G6EV 4UV8A 2PI5A 5IDJA 1OCCC 2QTOA 1MOFA 2ZDIC 2W6IG 4MVQA 1QLEC 4FJCC 3ZMUA 5CBHA 1YJWV 3MHSC 4P9OA 2Q68A 2IJIA 2ZR3A 3OMAB 3T1CA 3E35A 3SPHA 1CPYA 5H6RA 5CBFA 3HPLC 4PA7A 4X8AA 4WFHA 2DQ0A 1FS0G 1H8EG 1K33A 2P90A 2A0LA 2XAQA 2IJKA 4MS2A 4TT3G 3AG3B 4Q20A 5EBMC 1THZA 3ZRWB 3CD6V 3JD0A 4R8CA 5LHHA 3SYPA 3T4ZA 3HB3B 2HVKC 1KD1W 3ETEA 3RBZA 1QR8A 5HFLA 3ZMSA 4I5SA 5BZBA 2ITDC 4RO2A 4F4LA 5J9PC 1RPOA 1CEZA 4JAVA 2EJRA 2PI4A 2WAMA 4KUMA 5DM6V 3LNMB 4H33A 3RVZA 1G4YB 1YTFB 5CBGA 2XAGA 4WFGA 3E86A 2WLHA 1OCOC 1YTFD 2EBOA 4BW5A 3SPJA 2QKSA 1M90W 1AROP 3VBBA 3LSQA 4XDKA 3OMNB 3K0DA 4R6ZA 3STLC 3K3WA 5L3EA 2WLJA 1S5HC 4QE9A 1K5SA 3D3IA 5CMUA 2WPDG 3OEEG 4PDVA 3ASOB 1S76D 1KP2A 1NR7A 1M57C 1H2GA 2XOKG 3CCEV 4MTOA 4DXWA 4ZKIA 2DYSB 2OT5A 3I56V 3ABMC 3AG1B 4G28B 1Q7YW 3AEIA 4MVUA 1S0VA 3ZJZA 2GSMB 2OCCB 4PDLA 2IH3C 3ABKC 3JYCA 3E8FA 4FMTA 3ZIAG 1AI7A 2HJFC 4GX1A 1E1RG 5B1OA 3H01A 3OUFA 3SJQC 5FL7G 1VQMV 3KG2A 3CP1A 2HLDG 2W0FC 1GM9A 1KC8W 2LFRA 1DF5A 1M9NA 2WLLB 3OW2U 2R9IA 3ZMTA 1NJIW 4PELA 3E83A 3ZCCA 3RW0A 2NNUA 2WWWA 1RM1C 5L3GA 1K73W 1AR1B 3E2EA 1W0JG 2EIKC 4R50A 1K5QA 2GHYA 2OCCC 3G4SV 1SRYA 5B1BB 1VQ8V 2EILC 1W0KG 4MVZA 2AHZA 2WLIB 4UXNA 3ML0A 2ZQMA 1H38A 1GTOA 1QVFU 3X2QC 5KUMA 3E8GA 4UVAA 2HG5C 5EBWC 2MK3A 3ZN0A 1QLEB 3R65A 5H9CA 4UVBA 1K34A 1VQLV 3W7WA 3I55V 2IU3A 3DGEA 1Y4MA 3TETA 2X0LA 2HVJC 1V54C 1AI6A 3F7YC 1NVPB 5LHIA 5IYCO 1NVPD 4YXWG 1R6NA 4JTDB 3B8MA 1FXKA 4LC1A 5KUKA 3ABTA 4JTAB 1DTOA 1R3LC 4RQEA 3FB5C 2P67A 1BHAA 5LBQA 1OCOB 1VQ7V 3OMIB 3DTUB 3AG4B 4QPKA 4XBFA 3UM7A 4HAMA 3OFNG 2WLMA 5EBLC 1VQNV 3JCZA 4MVSA 1RPRA 4JYBA 3F5WC 4BIZA 1K4DC 1M57B 5L3CA 4Z1MG 1JQ0A 3CCQV 1I5YA 4I9WA 1MABG 2UXNA 3CC7V 1CP9A 3ABMB 5L3DA 3QNEA 5CN0A 1VQ4V 2X6BA 1TUEB 4CZZA 3CCVV 4G27B 1OCZC 3ABKB 3OAAG 1M56B 1JVMA 2EINC 1N8RW 3K9AA 4H37A 2EIMC 1GMGA 4PDMA 1YITV 1R3KC 4MTXA 4PA9A 1IXMA 3AG4C 1B6QA 3QO7A 4ASUG 3K0GA 1BMFG 2ZXWC 1NKDA 3ASNC 5H6QA 3CC2V 1F51A 3K06A 2EZPA 2BOBC 2QM8A 3ZRXA 3JD4A 4KFMA 3MHHC 1RM1B 3LDDA 5KA5A 1OCRC 2V1DA 4PDRA 2D3OW 4E2LA 5DN6G 2EIKB 3K04A 4WFEA 4XDLA 3JD2A 1YHQV 3OUSA 2EILB 5KA6A 3IC7A 1PNKA 1XL6A 3A0RA 1M56C 2X6CA 3SPIA 2V7QG 1E79G 4JTCB 4R7CA 4GX0A 1S72V 3E8HA 3X2QB 3CXCU 3T4DA 4RUEA 1PL0A 3CCSV 1DLBA 4TWKA 2JK5C 2LFSA 4MT8A 4U7OA 1K8AW 5C93A 5EC1C 2XASA 1L1FA 1S77D 2Z5UA 3GB7C 1V54B 1KKDA 2B5UA 4LBEC 1ROPA 3STZC 2HR3A 2IU0A 1R3JC 3LUTB 3P32A 4MVMA 3W7TA 2R9RB 3SYOA 3SPGA 3W7UA 3CCRV 3FB7C 1E1QG 1VQKV 3ETDA 4GT1A 1F23A 1ZWIC 3TK1A 2K1EA 4MTFA 1R3IC 3QO8A 3BEHA 4CBCA 2OTLV 1FXKB 2Q69A 2CK3G 3B8NA 5IYBO 5B1AC 1WPXA 1F4NA 1XL4A 3LDEA 4WCEV 3M99B 1GM8A 2IH1C 3ABLB 1JJ2U 1W2BU 2AHYA 5GW7A 4QE7A 3E89A 2DQ3A 2JJ1G 4MVOA 1VQ5V 4MVRA 1GKFA 2OTJV 4L87A 2WLLA 2Y69C 3CPWU 1EZJA 3T2MA 3WFVA 1PKXA 1YI2V 2JEXA 1COWG 3NXSA 3G71V 1ENVA 2DYRC 4QIWF 1NBMG 3K79A 3CMEV 1OCZB 3SYQA 3P30A 1FXKC 1YIJV 1K92A 1FFTB 2EINB 1JPXA 2X6AA 2EZOA 1GK9A 4QPJA 3CCJV 2YEVA 3CCMV 2QA4V 2EIMB 3ABUA 1JCHA 2ZR2A 1HWYA 4JYCA 3WG7B 3E8BA 5LGNA 3ABLC 1QCEA 4GCZA 2F43G 2WLNA 3ETGA 5CA3A 3ZMZA 4MW8A 1AJPA 1NQTA 1WLEA 1SERA 2ZXWB 3ASNB 5E1AC 4G2KA 4QNHB 5HFMA 4HYOA 1JOYA 1OCRB 2JEUA 3ZRSA 4JF3A 4KP4A 3PJSK 1QR9A 2XAHA 3JD3A 1OHHG 3D36A 5IY5B 5L3BA 2FTKA 3F7VC 1V55B 2IJHA 1NR1A 3OM3B 3OE7G 1P7BA 4BAYA 2EIJC 4QJFB 4LCUC 4FPPA 3WG7C 1YJ9V 2YSUB 2Z3YA 2C2AA 3FYIB 1AJNA 3OR6C 4WF9V 1JX9A 4ZBMA 2NLJC 3RVYA 5LGUA 1Q82W 4N23A 1AJQA 2ATKC 2P7TC 1QLNA 1K9MW 4RAIA 1QBZA 3QO5A 1FXVA 3JD1A 3K08A 1YJNV 5L3FA 1YSCA 2ZD9A 1KECA 4UUJC 3GWOA 5B1NA 4GX2A 1S3JA 3SYAA 3SYCA 5B3SB 2UXXA 3ZMVA 2JIZG 2DW4A 2QM7A 3FYEB 3MD0A 1AI4A 4N21A 5EK0A 2ITCC 4GX5A 5IY5C 4JGSA 3ZRWA 1V55C 1G8MA 1ORQC 1BHBA 5EC2C 4BIUA 1KP3A 1Q81W 2Y48A 3AG3C 1I5XA 1PD3A 3AG2B 3CYOA 2B1GA 5IYDO 2B1IA 2LP7A 1K4CC 3FKSG 3EFFK 3B77A 5B1AB 3CMAV 1QVGU 1UJWB 2H8PC 1VQ9V 3LSSA 2XNDG 3VOUA 1EFRG 2WLKA 2A9HA 2HFEC 3FB6C 4RUFA 1GM7A 1K3EA 2W6JG 2A79B 4EKWA 4JAUA 3IFXA 5B3SC 1R6KA 2WSSG 1BL8A 1R73A 2Y69B 1EBOA 2IW5A 4TSFG 4WFFA 1Q86W 4PA4A 2JDIG 4WFBV 1GO3F 4FK5C 2DYRB 1K7DA 4PA3A 1H8HG 4J9YB 3CCLV 2P6JA 1SZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 V;  1QVG U;  3CME V;  5DM6 V;  3CCE V;  3CCQ V;  1VQO V;  3G6E V;  1YJN V;  1VQP V;  1NJI W;  1VQL V;  1VQ4 V;  1YIJ V;  1K8A W;  3I56 V;  1Q7Y W;  3G71 V;  1YJW V;  3CCV V;  4WCE V;  4WFA V;  3I55 V;  3CCJ V;  3CCM V;  2QA4 V;  2D3O W;  1W2B U;  1K73 W;  1JJ2 U;  1VQ9 V;  1N8R W;  1YHQ V;  3CCU V;  2OTJ V;  1VQ6 V;  1VQ7 V;  1R73 A;  1YIT V;  3G4S V;  1M90 W;  3CC4 V;  1VQ5 V;  1VQ8 V;  1Q86 W;  1YJ9 V;  3CCR V;  3CD6 V;  1VQK V;  1S72 V;  4WFB V;  1M1K W;  3CXC U;  4WF9 V;  3CPW U;  1Q81 W;  1VQM V;  2QEX V;  1VQN V;  1KD1 W;  1Q82 W;  1QVF U;  3CCS V;  1KC8 W;  1YI2 V;  3CCL V;  1K9M W;  2OTL V;  3OW2 U;  3CMA V;  1KQS U;  3CC2 V; 
#chains in the Genus database with same CATH topology
 4XDJ A;  4LF9 B;  3ASO C;  4NYK A;  1LUV A;  3EHB B;  3K57 A;  3FAV A;  2JJ2 G;  3HKC B;  4X64 O;  3EXA A;  1FFX A;  1F4M A;  4DV0 B;  5IJ9 B;  3APQ A;  2A3Q A;  2HKO A;  3OGC C;  2N04 A;  1IDS A;  3VQW A;  3BY6 A;  1K97 A;  4LFC B;  5A9G A;  1JFF B;  1XMO B;  3K03 A;  3SPC A;  3ZRV A;  4LWS B;  5J2T A;  3AG7 A;  4MW3 A;  2DE0 X;  3ZN1 A;  2WLI A;  4TV9 A;  3UO3 A;  2QEX V;  1SQQ H;  2RJZ A;  5B1B C;  4O2A B;  1MNG A;  1OZ0 A;  2E5L B;  2ZDI A;  4YY3 B;  2Q6A A;  1IBL O;  4LF6 O;  3P3N A;  1NTM H;  2PUS A;  2KB1 A;  2VQF O;  2ZDI C;  4LFA B;  4P9O A;  5EIB D;  2Q68 A;  3SPH A;  3HPL C;  1K33 A;  1N0J A;  2XAQ A;  4J80 A;  4MS2 A;  2Y0P A;  2RCV A;  5D5Q A;  2Q9L A;  4GKK O;  4F6E A;  3B40 A;  3ETE A;  3RBZ A;  4DV1 B;  5HFL A;  5BZB A;  4RO2 A;  5LA6 B;  5J9P C;  4JAV A;  4X20 B;  2PI4 A;  5DM6 V;  4KUM A;  5JWP A;  4JI8 B;  2XAG A;  4WFG A;  5K1X A;  3QG5 A;  4YJ2 A;  3OMN B;  1N32 B;  4R6Z A;  2WLJ A;  4X1K A;  4Z2W A;  1K5S A;  3D3I A;  5CMU A;  3OEE G;  1Q43 A;  1Y74 B;  4DR1 B;  1KP2 A;  1NR7 A;  5LXT A;  4MTO A;  4U3F H;  2GUZ B;  2DYS B;  2OT5 A;  3AG1 B;  1S0V A;  2GSM B;  3RYI B;  4HBN A;  4PDL A;  2IH3 C;  1D2D A;  1VF7 A;  3E8F A;  1N33 O;  4LFB B;  3ZIA G;  3D3Q A;  4GX1 A;  5B1O A;  3SJQ C;  2QWQ B;  4CH6 A;  4BWA A;  5JQG A;  2W0F C;  3OW2 U;  2R9I A;  2L35 A;  1RSO A;  2YI9 A;  1OJH A;  5K1P A;  1K73 W;  1AR1 B;  4TUY B;  4K8X A;  4UB6 Z;  2LW7 A;  4NXM O;  1B3Q A;  1AP5 A;  2GBO A;  3J7A U;  1H38 A;  3OD4 A;  2QR4 A;  4PI2 A;  1GRJ A;  1QVF U;  5KUM A;  2JGU A;  3E8G A;  4UVA A;  2HG5 C;  2QDO A;  5EBW C;  4Z1V A;  4UVB A;  1MSD A;  2VQF B;  3HKE A;  3K9S A;  5LMN O;  1WB8 A;  4J7K A;  2IU3 A;  1SKV A;  1Y4M A;  4X65 O;  3AK1 A;  3F7Y C;  3MAQ A;  5IYC O;  2QKA A;  5LP6 A;  4JTD B;  5KLV H;  3N2K B;  4JTA B;  5BY1 A;  2F4V O;  5ITZ A;  1BHA A;  4JI0 O;  3K5O A;  3DSQ A;  3KKY A;  4DUY O;  3G80 A;  2LJ2 A;  1XI1 A;  4FFB B;  2QM4 A;  3RFR A;  3UT5 A;  1H2N A;  3H1K H;  3JAR B;  5KX5 A;  5J2U A;  3H1L H;  2WLM A;  5EBL C;  1WP7 A;  4JYB A;  2ZIM A;  3CCQ V;  2XT9 A;  5IWA B;  2UXN A;  2IBZ H;  4JI5 B;  4W4L A;  4IL6 Z;  1XNR O;  2CH7 A;  4LF7 B;  2E75 B;  2CGN A;  2EIN C;  1AVM A;  2EIM C;  4FM0 A;  1GMG A;  1YIT V;  4B3T O;  4O4H B;  3A0H Z;  5KAI Z;  1SA0 A;  4DW1 A;  2GDS A;  1S5L Z;  2ZXW C;  2PYJ A;  3ASN C;  3K06 A;  2BOB C;  3JD4 A;  3MHH C;  5EIB C;  4E2L A;  4DRX A;  1YVW A;  3K04 A;  1VIB A;  5KA6 A;  2ZM6 O;  1WJZ A;  5BXZ A;  2JGD A;  2LGQ A;  2V7Q G;  4R7C A;  1E79 G;  1N0N A;  5KHH A;  2WA3 A;  2O57 A;  2W0X A;  2PZS A;  3CEI A;  2RDC A;  1DLB A;  4MT8 A;  5C93 A;  4JI2 O;  1S77 D;  4JAA A;  1X4T A;  4BIO A;  1R3J C;  4K0K O;  2R9R B;  5C8Y A;  3SYO A;  3K58 A;  4WBN B;  2QWP B;  3SPG A;  3CHX A;  4JYY A;  4D7S A;  1ZWI C;  1B04 A;  5JH7 A;  4CBC A;  2OTL V;  2BSK B;  4DV4 B;  4H44 B;  1SQG A;  1NTZ H;  3LDE A;  2OWO A;  4X1I A;  1LUW A;  4TV8 A;  2DQ3 A;  4MVO A;  1VQ5 V;  5CB4 A;  1GKF A;  4L87 A;  1SQP H;  3T2M A;  1KU9 A;  1PKX A;  1COW G;  4QIW F;  2Y4U A;  1OCZ B;  3SYQ A;  4B7K A;  1FFT B;  1NI8 A;  2Q5Z A;  3CCJ V;  2YEV A;  1QQC A;  3HKD A;  4JYC A;  2ZT9 B;  4O2B A;  2YS8 A;  2RN9 A;  2GTS A;  3ETG A;  1WLE A;  1SER A;  4LF5 O;  1XDC A;  1SQX H;  5IJ0 A;  5E1A C;  2AGA A;  4QNH B;  5HFM A;  1JOY A;  5BMV A;  2CUG A;  2JEU A;  4JF3 A;  4KP4 A;  2BTQ B;  1Q90 D;  5IY5 B;  1N4C A;  2FTK A;  4UCV A;  3F7V C;  3VQY A;  1Q6U A;  5LMU O;  2UXB B;  1M5I A;  3OM3 B;  1O9G A;  4IT5 A;  4JV5 O;  4BAY A;  3QF7 A;  2EIJ C;  4QJF B;  2KSD A;  4UCT A;  3SR2 C;  4LH7 A;  4WF9 V;  5EZY A;  1JX9 A;  5LGU A;  2P7T C;  3U0Z A;  1K9M W;  4K35 A;  4RAI A;  1QBZ A;  3QO5 A;  3JD1 A;  1BCC H;  1YJN V;  3Q4H B;  1BT8 A;  3GWO A;  5B1N A;  1Y6X A;  3SYC A;  4JI1 O;  2DW4 A;  2QM7 A;  4N21 A;  3BAA A;  5IY5 C;  1SZX A;  5DEC A;  4NVP A;  3CRC A;  5IE9 A;  4ABM A;  2FL4 A;  1EM1 A;  3AG3 C;  2YXY A;  3B77 A;  1QVG U;  2H8P C;  3VOU A;  3OTO O;  4FM1 A;  1EFR G;  3JAS B;  2HFE C;  1F7Y A;  1GM7 A;  5CA1 A;  1K3E A;  5GTI Z;  4DUZ O;  4JAU A;  2ZKO A;  2Y69 B;  3CRR A;  4TSF G;  5BR8 O;  4WFB V;  2DYR B;  4J9Y B;  1BS3 A;  3ZBH A;  3E22 B;  5LGT A;  2HHH B;  2X7R B;  4MTG A;  2AXT Z;  4P9P A;  4MSW C;  3BVO A;  5LL6 Y;  2A06 H;  2M7W A;  3LDC A;  3T1Y B;  2RQ6 A;  1HNW O;  2ZE7 A;  2DWE C;  4LF9 O;  4YIO A;  4RQF A;  1J95 A;  1AI5 A;  1PNM A;  3S3X A;  4WFA V;  4ZOL B;  1TVK B;  2UUB B;  1DF4 A;  1JR9 A;  2XAJ A;  4U7N A;  1UPG A;  3L70 H;  4O4J A;  4X88 A;  2LO1 A;  4P30 A;  1N36 B;  2Q7H A;  3B4S A;  4J9Z B;  1SES A;  3TJT A;  2ADP A;  1VQO V;  2PI5 A;  2QTO A;  4LFC O;  1YF2 A;  1ZL8 B;  4NTY A;  3MHS C;  5FNV B;  1MZE A;  1XMO O;  4LNU A;  1CPY A;  5H6R A;  2ARH A;  3RYF B;  2DQ0 A;  1H8E G;  5KMG B;  1VF6 C;  2KG7 A;  4TT3 G;  3D36 C;  4R8C A;  5LHH A;  3SYP A;  1UFI A;  3HB3 B;  1KD1 W;  3CJH A;  3ZMS A;  2E5L O;  3BRC A;  4YY3 O;  1CEZ A;  4I50 B;  3H1I H;  3RVZ A;  4LFA O;  5CBG A;  1XNQ B;  1NU1 H;  4HNA B;  3E86 A;  3JAW A;  2EBO A;  4FVM A;  4BW5 A;  5EYP A;  3SPJ A;  4FLZ A;  2YDE A;  2QKS A;  3RYC B;  2A7W A;  1ARO P;  3LSQ A;  4FLW A;  5L3E A;  1KUQ A;  4LF8 B;  3N27 A;  1WB7 A;  2V4D A;  3CXH F;  3ASO B;  4DV5 O;  1M57 C;  1D5A A;  3ABM C;  2ILM A;  1ZUQ A;  2DOS A;  5JVD B;  2OCC B;  4JI8 O;  1AR4 A;  3RYH B;  4QGP A;  3LNN A;  3FAV B;  5KHI A;  1GAX A;  4O4I A;  1RP3 B;  1E1R G;  1FFX B;  1PPJ H;  2F93 B;  3H01 A;  3OUF A;  1VEW A;  1HP8 A;  4F6R A;  5FL7 G;  2JVD A;  4PJ0 Z;  3CP1 A;  2HLD G;  1KYO F;  1KC8 W;  1VP7 A;  2WLL B;  3ZHT A;  3ZMT A;  3C3S A;  1FD9 A;  4PEL A;  3E83 A;  3RW0 A;  3JCU Z;  2WWW A;  1RM1 C;  4LF4 B;  1P84 F;  2P06 A;  4B3R B;  4LFB O;  2OCC C;  2GHY A;  3G4S V;  1SRY A;  5J2T B;  5B1B B;  4CS4 A;  1VQ8 V;  1IZ3 A;  2EIL C;  4JI6 B;  1W0K G;  2WLI B;  3CRM A;  1U97 A;  4UXN A;  4C7U A;  2ZQM A;  4TV9 B;  1GTO A;  4JZ2 A;  2P22 C;  1EZV H;  3WU2 Z;  4X9Q A;  1XEQ A;  2YIC A;  1Y76 A;  3TET A;  1XHZ A;  4X1Y A;  1V54 C;  2OCH A;  1NVP B;  1R6T A;  2YUA A;  5LHI A;  4BW9 A;  1R6N A;  4EFB A;  4LC1 A;  2EX3 A;  4FLV A;  1SQV H;  1A32 A;  4ZI7 B;  5DED A;  5LBQ A;  5GTH Z;  1P49 A;  4DK0 A;  4JYA B;  5KHJ A;  1VQ7 V;  3DTU B;  4XBF A;  1IBM B;  4I55 A;  4HAM A;  3OFN G;  4YJ2 B;  2ZNI A;  3SJB C;  1VQN V;  3JCZ A;  4X1K B;  5B5E Z;  1NTK H;  4DV7 B;  4I9W A;  4GUN A;  4DV5 B;  3QNE A;  2X6B A;  3G6B A;  5LXT B;  4YJ3 A;  3CCV V;  2XHB A;  4G27 B;  4TQD A;  1M56 B;  1N8R W;  4I9Q A;  4ZHQ A;  4PDM A;  2Y0I A;  1R3K C;  4IHJ A;  4MTX A;  1ZX3 A;  4AQY B;  1B6Q A;  4TQF A;  2K9P A;  3QO7 A;  4ASU G;  3BCC H;  3K0G A;  4JI3 B;  4W4K A;  5JQG B;  1XMQ O;  5IWA O;  1XRE A;  4FLY A;  2EZP A;  1V9P A;  4I4T A;  2QM8 A;  3ZRX A;  1FKA O;  2BTO A;  4JI5 O;  1RSO B;  1OCR C;  4LF7 O;  2V1D A;  1TAE A;  4XDL A;  4AHC A;  1Q6I A;  2N74 A;  3OUS A;  1M56 C;  4JI7 B;  2CTR A;  4JTC B;  4NKG B;  3OGI B;  5KHK A;  3CXC U;  3T4D A;  1IX9 A;  4RUE A;  1IVS A;  2JK5 C;  2CE4 A;  1L1F A;  5EC1 C;  1AIL A;  2Z5U A;  3MDS A;  3HKE B;  1XQ8 A;  1KKD A;  2HR3 A;  1BQZ A;  3C90 A;  5JJE B;  1Q5O A;  3W7U A;  3FB7 C;  1Y74 A;  1PM9 A;  3ETD A;  1FPO A;  4GT1 A;  4IIJ A;  1H2K A;  3TK1 A;  4K3A A;  3BEH A;  3SDL A;  5B1A C;  1XL4 A;  2NR5 A;  5ITZ B;  1IXB A;  1GM8 A;  1W2B U;  5GW7 A;  3K5M A;  2EUL A;  1FJG O;  2R70 A;  4MVR A;  5FPO A;  3UT5 B;  1EN6 A;  5KX5 B;  2UUC B;  3O9O A;  5J2U B;  3H9V A;  1YI2 V;  2JEX A;  4X66 B;  1ENV A;  3K79 A;  4DV4 O;  4J10 A;  5LP6 C;  2EIN B;  4IYH A;  4DV3 B;  3CCM V;  2EIM B;  2Y4T A;  2CH7 B;  1JCH A;  4FFK A;  2CDY A;  1QCE A;  3ZMZ A;  2ODM A;  2H3O A;  1AJP A;  1NQT A;  2ZXW B;  3ASN B;  1CXZ B;  3L73 H;  1QU7 A;  4B3S B;  3L72 H;  1SA0 B;  4HYO A;  1XMQ B;  3BFR A;  1QR9 A;  3KCY A;  2XAH A;  3IJ4 A;  1OHH G;  5L3B A;  4UFZ A;  3BAB A;  4YHH B;  4DRX B;  1EN4 A;  4FLT A;  3C3T A;  4LCU C;  4FPP A;  1KKC A;  2C2A A;  2JGD B;  1AJN A;  3RVY A;  1Q82 W;  1BQ0 A;  3N2G B;  3K08 A;  4CC5 A;  1KEC A;  4UUJ C;  2OYQ A;  3JAK B;  3ZMV A;  2JIZ G;  4FFB A;  3FYE B;  2ITC C;  2UXB O;  2E74 B;  1XOU A;  1BZK A;  3ZRW A;  1G8M A;  3DC5 A;  1KP3 A;  5C8Y B;  4BR6 A;  2UUA B;  1I5X A;  2B1G A;  4PHZ A;  1K4C C;  3FKS G;  3EFF K;  1PL4 A;  4DR2 B;  1ZTE A;  3OTF A;  2OIG A;  1G1X B;  4U3J A;  2WLK A;  2A9H A;  3JAM N;  2A79 B;  4B3M O;  2DN9 A;  4O4H A;  1R6K A;  2EJ7 A;  1Q8I A;  1FJG B;  2IW5 A;  2JDI G;  5CB4 B;  5D5P A;  1K7D A;  2Q7G A;  1H8H G;  2VRZ A;  3BHP A;  2E3C A;  1U96 A;  1SZT A;  4P2Z A;  2YXL A;  1TGO A;  3IGA C;  1G6U A;  2YEV B;  1VQ6 V;  2Q8V A;  3OEH G;  1NH2 B;  1M1K W;  3W7X A;  4OPA A;  2Q0O C;  1OCC B;  3TCU A;  1KQS U;  5IJ0 B;  1PNL A;  4HZ3 A;  3HKB A;  1Y66 A;  4JPR A;  2HHH O;  2F95 B;  4CH5 A;  3S3W A;  4PA6 A;  3CCU V;  2EIJ B;  5IT9 N;  2ETN A;  4X89 A;  4EB6 A;  3FB8 C;  3QTC A;  2BOC C;  3VQV A;  1S5J A;  4FIP C;  1KB9 F;  3T1Y O;  3FD9 A;  3G67 A;  1IBK B;  5IDJ A;  4DYL A;  1OCC C;  5CBH A;  1HNZ O;  1QLE C;  1WN7 A;  4FLX A;  1YJW V;  1XUQ A;  2L6L A;  2Q7E A;  2ZR3 A;  4O4L A;  3K59 A;  2UUB O;  3E35 A;  4I0X A;  2PF4 E;  2P90 A;  2A0L A;  1GH6 A;  5EBM C;  3AG3 B;  4Q20 A;  1DK1 A;  1THZ A;  4H0L B;  3CD6 V;  1N36 O;  2HVK C;  3K5L A;  1QR8 A;  4I5S A;  2XTA A;  4DR5 B;  4F4L A;  1RPO A;  2EJR A;  2FKX A;  4H33 A;  4ZIB A;  1G4Y B;  1YTF B;  3THO A;  4B3M B;  3DXR B;  2WLH A;  1OCO C;  5CA1 B;  2ZIO A;  5IYZ B;  4D7T A;  3K0D A;  2HJD A;  3K3W A;  4E4E A;  1KMI Z;  4QE9 A;  4CS2 A;  3ZHS A;  2WPD G;  4PDV A;  3A0B Z;  1GN2 A;  1S76 D;  1Q3E A;  3K5N A;  4DXW A;  3R66 A;  3AEI A;  4MVU A;  3ZJZ A;  4KL1 A;  1XNQ O;  2ZE6 A;  3ABK C;  4UCS A;  2HJF C;  1HR0 B;  5KAF Z;  1HNX O;  1VQM V;  2CTQ A;  4LF8 O;  1WA8 B;  2LFR A;  1M9N A;  2UU9 B;  3M8A A;  1J5E B;  3UO2 A;  1NJI W;  4KHP B;  3ICX A;  1IUR A;  2JS3 A;  2NNU A;  4DV2 B;  3CB2 A;  5L3G A;  2VS0 A;  1SQB H;  2ADQ B;  2EIK C;  1K5Q A;  2M6Y A;  1T5E A;  3ML0 A;  4O4J B;  2FML A;  3X2Q C;  1PV0 A;  2MK3 A;  1WPB A;  3ZN0 A;  1K34 A;  3JAL A;  1HNZ B;  3W7W A;  3DGE A;  1I94 B;  4LF4 O;  4LNU B;  1PP9 H;  4B3R O;  2KG7 B;  1NVP D;  1H2L A;  4JI6 O;  2ZE8 A;  3UCS C;  3B8M A;  2DJV A;  1FXK A;  1HDJ A;  3RN4 A;  4L8J A;  3ABT A;  3CJH B;  3U11 A;  1BGY H;  3RWR D;  2P67 A;  3ZX6 A;  1O9H A;  3D8C A;  1JA8 A;  2PYL A;  1EN5 A;  5GON A;  3OMI B;  3JAW B;  3AG4 B;  4QPK A;  3IAY A;  5EYP B;  3UM7 A;  4DV6 B;  1TUB A;  4FZ0 A;  4MVS A;  1RPR A;  5LOV A;  1M57 B;  5L3C A;  3HR0 A;  4Z1M G;  1I5Y A;  1MAB G;  4A5U B;  1CP9 A;  3CC7 V;  3ABM B;  4AI8 A;  5CN0 A;  4GKJ B;  4LH6 A;  2IM9 A;  1ZLZ A;  3SGI A;  3B09 A;  4JYA O;  1JVM A;  4DR4 B;  3K9A A;  2ZNJ A;  3F5T A;  3L71 H;  2R9A A;  1BSM A;  4OX9 B;  1IBM O;  1HNX B;  4O4I B;  3AG4 C;  3JAT A;  1Z2G A;  1F51 A;  4NTW A;  4DV7 O;  2UXD B;  3O65 A;  1RM1 B;  1YDX A;  4KFM A;  1XIL A;  4PDR A;  2D3O W;  5DN6 G;  4WFE A;  5CA0 A;  2EIL B;  3EVK A;  1PNK A;  1XL6 A;  2X6C A;  3SPI A;  1N34 B;  4GX0 A;  2LW1 A;  3H1J H;  1S72 V;  3CRQ A;  1PL0 A;  4AQY O;  4I50 A;  2QWN B;  4JI3 O;  5JJJ B;  4GLX A;  2JRI A;  2LFS A;  4HNA A;  3J81 N;  4NR1 A;  1K8A W;  2CTW A;  2XAS A;  3GB7 C;  1V54 B;  2CGO A;  1Y76 B;  3CRA A;  4J7Z A;  2B5U A;  4LBE C;  1ROP A;  4JI4 B;  3RT3 C;  3LUT B;  4J41 A;  3P32 A;  4MVM A;  3W7T A;  4X1Y B;  4NTX A;  4CS3 A;  4UCR A;  4JI7 O;  1P7G A;  2HEP A;  3CCR V;  1E1Q G;  1AR5 A;  1F23 A;  2UXC B;  1WNS A;  4MTF A;  1R3I C;  1Q6H A;  2KKW A;  2Q69 A;  1MMM A;  5LYJ A;  2CK3 G;  4DK1 A;  3T1H O;  3B8N A;  5IYB O;  2AZ2 A;  5JVD A;  1WPX A;  1I7F A;  1F4N A;  3RYH A;  1H2S B;  1JJ2 U;  1ZAU A;  2AHY A;  1GN4 A;  3ZHQ A;  3WB0 A;  5AG2 A;  2VQE B;  3AK3 A;  3RGB A;  4TOI A;  2WLL A;  4I55 B;  1QNM A;  3WFV A;  3G71 V;  1NBM G;  3CME V;  1L8D A;  3P30 A;  1K92 A;  1JPX A;  4H13 B;  3HKC A;  2QA4 V;  3JSN A;  4YJ3 B;  3ABU A;  4NXN O;  5IJ9 A;  5LGN A;  4DR6 B;  4ZHQ B;  1I08 A;  2ZIN A;  4DR7 B;  3KCX A;  4IHJ B;  4MW8 A;  4JZG A;  2UUC O;  2OIE A;  4G2K A;  4Q6G A;  4X66 O;  1OCR B;  1JFF A;  5H5N A;  2PGG A;  1ZSP A;  3JD3 A;  4I4T B;  4LWS A;  4DV3 O;  2IJH A;  3OE7 G;  1NZ6 A;  1P7B A;  5H2F Z;  4O2A A;  2YSU B;  2Z3Y A;  3VQX A;  2YXH A;  4ZI7 A;  2P4K A;  1JMK C;  4B3S O;  3CE2 A;  1FXV A;  5L3F A;  1YSC A;  2ZD9 A;  4GX2 A;  1JJO A;  3SYA A;  5B3S B;  2UXX A;  3MD0 A;  1AI4 A;  4DR3 B;  4YHH O;  5JJN B;  1ORQ C;  2D2C B;  5EC2 C;  4X62 O;  4BIU A;  1Q81 W;  2P4V A;  3AG2 B;  4IGG A;  5LA6 A;  2B1I A;  4IIJ B;  4X20 A;  5B1A B;  3CMA V;  5FLX N;  1VF5 B;  3T1H B;  4IYI A;  3LSS A;  2XND G;  3FB6 C;  1SF9 A;  1X59 A;  2W6J G;  2PY5 A;  4EKW A;  4X64 B;  3IFX A;  5B3S C;  3NR7 A;  2PTM A;  1BL8 A;  1R73 A;  3A8T A;  3JSL A;  1EBO A;  4WFF A;  5KHG A;  4FK5 C;  5FPR A;  3LSU A;  2UUA O;  4CC6 A;  4GYC B;  5LP6 B;  2P6J A;  2GUZ A;  3AG2 C;  4OXS A;  4DR2 O;  3RYI A;  2IJJ A;  2H94 A;  3L9D A;  2XAF A;  1FXH A;  1MG1 A;  2DYS C;  3AG1 C;  4DO2 A;  4NXN B;  4UCO A;  1LNQ A;  3CC4 V;  1M4U A;  5A2Q N;  1US6 A;  1NH2 D;  4AIL C;  2YID A;  4UV9 A;  1IBL B;  1KBH A;  4LF6 B;  2QTS A;  4EEQ A;  2DWD C;  1AP6 A;  1P4R A;  1R1B A;  2CAZ C;  5LHG A;  4LP8 A;  4TUY A;  4UVC A;  1MSW D;  2E76 B;  1RFY A;  2LGW A;  1FYJ A;  4GKK B;  2Q67 A;  3UKM A;  3H1H H;  4JAS A;  4ICG A;  2QE7 G;  2R72 A;  3OR7 C;  1GN6 A;  3W7S A;  1SET A;  1VQP V;  3G6E V;  4UV8 A;  1MOF A;  4MVQ A;  2W6I G;  1QHT A;  4FJC C;  3ZMU A;  1GN3 A;  3OMA B;  2IJI A;  3T1C A;  2XUM A;  5CBF A;  4PA7 A;  4X8A A;  4WFH A;  1FS0 G;  2IJK A;  4X62 B;  2VWK A;  3ZRW B;  1H2M A;  3JD0 A;  1XHX A;  3N2K A;  3T4Z A;  4UB8 Z;  4KXR A;  5B66 Z;  1SS3 A;  2ITD C;  3L75 H;  4UCU A;  2WAM A;  3FX7 A;  3LNM B;  1IBK O;  4U3J B;  1URF A;  1YTF D;  1N33 B;  4J11 A;  3JAR A;  1M90 W;  3CWB H;  3VBB A;  1YCI A;  2AW9 A;  4XDK A;  2MW2 B;  3STL C;  4DW0 A;  2LQT A;  1FAF A;  2BCC H;  1S5H C;  3FFQ A;  2QWO B;  2AZ0 A;  5JH7 B;  4DR5 O;  1H2G A;  2XOK G;  3CCE V;  4ZKI A;  3I56 V;  4G28 B;  1Q7Y W;  1NS1 A;  2YIB D;  2DMX A;  1AB3 A;  3JYC A;  2F23 A;  4X1I B;  3GVM A;  4FMT A;  4TV8 B;  1AI7 A;  2ZE5 A;  2QSA A;  4NXM B;  1LR1 A;  3KG2 A;  3BA9 A;  4CH4 A;  3N2G A;  1GM9 A;  1DF5 A;  4B7E A;  2P5O A;  2RMK B;  3JAK A;  1BE3 H;  4OPH A;  1VAR A;  5LMN B;  3ZCC A;  2VWJ A;  3ZED A;  3HKB B;  1MA1 A;  3E2E A;  3U10 A;  4X65 B;  3BA8 A;  1W0J G;  4R50 A;  3PN1 A;  3HKD B;  2Q0A A;  1HR0 O;  4O2B B;  4MVZ A;  2AHZ A;  4EB6 B;  5F2V O;  2F4V B;  2YI8 A;  3B2E E;  1QLE B;  3R65 A;  5H9C A;  2UU9 O;  1J5E O;  1VQL V;  4JI0 B;  4KHP O;  5BMV B;  4DUY B;  3I55 V;  4DV2 O;  2X0L A;  2HVJ C;  4O4L B;  2QGN A;  1AI6 A;  4WBN A;  4I0X B;  2G38 A;  2ZCE A;  4YXW G;  1M93 A;  2QKC A;  2BSK A;  4GZR B;  5KUK A;  5EZY B;  1DTO A;  1R3L C;  3BPZ A;  4RQE A;  3FB5 C;  3WB2 A;  1XNR B;  1OCO B;  4J7J A;  4OGQ B;  3AK2 A;  1I94 O;  1L0L H;  4B3T B;  2Z0A A;  3QVN A;  5TIS Z;  3L74 H;  4BIZ A;  3F5W C;  1K4D C;  1JQ0 A;  2NN4 A;  5L3D A;  3UQ8 A;  2F66 C;  1VQ4 V;  1TUE B;  3I5D A;  4CZZ A;  1NT2 B;  1OCZ C;  3ABK B;  3OAA G;  2ZM6 B;  4H37 A;  1DGS A;  1SQF A;  4DV6 O;  1Z5W A;  4PA9 A;  1IXM A;  3DC6 A;  1BMF G;  1NKD A;  5H6Q A;  3CC2 V;  3APO A;  2BTQ A;  4JI2 B;  3LDD A;  4B08 A;  4GKJ O;  5KA5 A;  2JS5 A;  2EIK B;  3JD2 A;  1YHQ V;  4I7Z B;  4DR4 O;  3IC7 A;  4K0K B;  3A0R A;  1I0H A;  2GV9 A;  2QJ1 A;  3TGU H;  3E8H A;  3OT7 A;  3X2Q B;  4OX9 O;  1D5N A;  3CCS V;  2WA4 A;  1XBL A;  3Q4H A;  1YXB A;  3CSX A;  2UXD O;  4TWK A;  4U7O A;  3DXR A;  2FB5 A;  2B9Z A;  3JAL B;  3ZHR A;  3A2F A;  5IYZ A;  5E79 Z;  3STZ C;  2IU0 A;  3M7M X;  1VQK V;  1N34 O;  2FYU H;  3KZI Z;  4RWU A;  1Z5V A;  2K1E A;  3QO8 A;  1FXK B;  4PV1 B;  3JAS A;  2YIB A;  2Q4P A;  4WCE V;  3WB1 A;  3M99 B;  2YIA A;  2IH1 C;  3ABL B;  4QE7 A;  3E89 A;  5JCO A;  2JJ1 G;  3CX5 F;  3J80 N;  4JI4 O;  5GON B;  3ZHU A;  3ETQ A;  1WA8 A;  2OTJ V;  1WAZ A;  2Y69 C;  3CPW U;  4LF5 B;  5JCO C;  1SC5 B;  1EZJ A;  2UXC O;  1TUB B;  4FLU A;  4YIP A;  3E22 A;  3NXS A;  2DYR C;  5LOV B;  4FM2 A;  1FXK C;  1YIJ V;  2X6A A;  2KQX A;  4QPJ A;  2EZO A;  1GK9 A;  5LMU B;  3ZS8 C;  2HP8 A;  2ZR2 A;  1HWY A;  3WG7 B;  3E8B A;  4JV5 B;  2Q73 A;  3ABL C;  2RNB A;  2VQE O;  4DV0 O;  4GCZ A;  2F43 G;  2WLN A;  5CA3 A;  2BE3 A;  3JAT B;  4NB5 A;  3TXS A;  3ZRS A;  4ZOL A;  1B06 A;  1TVK A;  3PJS K;  1VF6 A;  4JI1 B;  1TA8 A;  3D36 A;  1W59 A;  1HW7 A;  1V55 B;  2CTP A;  2QWR B;  4J42 A;  4D6T H;  1NR1 A;  5CA0 B;  4DR6 O;  4CH3 A;  3WG7 C;  1YJ9 V;  3FYI B;  3OR6 C;  4DR7 O;  4ZBM A;  4LR3 A;  2NLJ C;  4N23 A;  4PD4 F;  1AJQ A;  4F6R B;  2ATK C;  3SJA C;  1QLN A;  3CS5 A;  1L0N H;  4FZ1 A;  3GWK C;  3OTO B;  1ZL8 A;  1YZB A;  5FNV A;  1S3J A;  2N05 A;  4DUZ B;  3RYF A;  1OV9 A;  5KMG A;  5EK0 A;  4GX5 A;  4EFE A;  3IC9 A;  1Y67 A;  2GTA A;  4JGS A;  1V55 C;  1BHB A;  3ZHV A;  5BR8 B;  1WP8 A;  2Y48 A;  1PD3 A;  3CYO A;  2YC0 A;  5IYD O;  4DV1 O;  2LP7 A;  4K8Z A;  1VMG A;  3P3P A;  1UJW B;  1VQ9 V;  5LYJ B;  3TXQ A;  1YEW A;  4RUF A;  4PI0 A;  3RYC A;  4DR3 O;  1MZF A;  2WSS G;  2F1M A;  1N32 O;  1Q86 W;  4PA4 A;  1GO3 F;  4PA3 A;  1HNW B;  4DR1 O;  3CCL V;  3SJC C; 
#chains in the Genus database with same CATH homology
 4XDJ A;  3AG2 C;  4OXS A;  3ASO C;  4P2Z A;  5LGT A;  2X7R B;  2IJJ A;  2H94 A;  3EHB B;  2XAF A;  1FXH A;  1MG1 A;  2DYS C;  3IGA C;  2JJ2 G;  4MTG A;  3AG1 C;  4DO2 A;  2YEV B;  1VQ6 V;  4P9P A;  1LNQ A;  1F4M A;  3CC4 V;  3OEH G;  3OGC C;  2HKO A;  1NH2 B;  4MSW C;  1M1K W;  3W7X A;  1NH2 D;  4UV9 A;  2M7W A;  3LDC A;  3BY6 A;  1OCC B;  3TCU A;  1K97 A;  1KQS U;  2DWE C;  1PNL A;  2DWD C;  1P4R A;  4HZ3 A;  4RQF A;  1J95 A;  5LHG A;  1AI5 A;  1PNM A;  4LP8 A;  1Y66 A;  4JPR A;  4WFA V;  4UVC A;  3K03 A;  3SPC A;  1DF4 A;  4PA6 A;  3ZRV A;  1MSW D;  3CCU V;  2EIJ B;  2XAJ A;  4MW3 A;  4U7N A;  3ZN1 A;  2WLI A;  4X89 A;  4X88 A;  2Q67 A;  3FB8 C;  4P30 A;  2BOC C;  3UKM A;  2QEX V;  5B1B C;  4JAS A;  2QE7 G;  1OZ0 A;  2ZDI A;  4FIP C;  4J9Z B;  2Q6A A;  3OR7 C;  1SES A;  3W7S A;  1SET A;  2KB1 A;  1VQP V;  1VQO V;  3G6E V;  4UV8 A;  2PI5 A;  5IDJ A;  1OCC C;  2QTO A;  1MOF A;  2ZDI C;  2W6I G;  4MVQ A;  1QLE C;  4FJC C;  3ZMU A;  5CBH A;  1YJW V;  3MHS C;  4P9O A;  2Q68 A;  2IJI A;  2ZR3 A;  3OMA B;  3T1C A;  3E35 A;  3SPH A;  1CPY A;  5H6R A;  5CBF A;  3HPL C;  4PA7 A;  4X8A A;  4WFH A;  2DQ0 A;  1FS0 G;  1H8E G;  1K33 A;  2P90 A;  2A0L A;  2XAQ A;  2IJK A;  4MS2 A;  4TT3 G;  3AG3 B;  4Q20 A;  5EBM C;  1THZ A;  3ZRW B;  3CD6 V;  3JD0 A;  4R8C A;  5LHH A;  3SYP A;  3T4Z A;  3HB3 B;  2HVK C;  1KD1 W;  3ETE A;  3RBZ A;  1QR8 A;  5HFL A;  3ZMS A;  4I5S A;  5BZB A;  2ITD C;  4RO2 A;  4F4L A;  5J9P C;  1RPO A;  1CEZ A;  4JAV A;  2EJR A;  2PI4 A;  2WAM A;  4KUM A;  5DM6 V;  3LNM B;  4H33 A;  3RVZ A;  1G4Y B;  1YTF B;  5CBG A;  2XAG A;  4WFG A;  3E86 A;  2WLH A;  1OCO C;  1YTF D;  2EBO A;  4BW5 A;  3SPJ A;  2QKS A;  1M90 W;  1ARO P;  3VBB A;  3LSQ A;  4XDK A;  3OMN B;  3K0D A;  4R6Z A;  3STL C;  3K3W A;  5L3E A;  2WLJ A;  1S5H C;  4QE9 A;  1K5S A;  3D3I A;  5CMU A;  2WPD G;  3OEE G;  4PDV A;  3ASO B;  1S76 D;  1KP2 A;  1NR7 A;  1M57 C;  1H2G A;  2XOK G;  3CCE V;  4MTO A;  4DXW A;  4ZKI A;  2DYS B;  2OT5 A;  3I56 V;  3ABM C;  3AG1 B;  4G28 B;  1Q7Y W;  3AEI A;  4MVU A;  1S0V A;  3ZJZ A;  2GSM B;  2OCC B;  4PDL A;  2IH3 C;  3ABK C;  3JYC A;  3E8F A;  4FMT A;  3ZIA G;  1AI7 A;  2HJF C;  4GX1 A;  1E1R G;  5B1O A;  3H01 A;  3OUF A;  3SJQ C;  5FL7 G;  1VQM V;  3KG2 A;  3CP1 A;  2HLD G;  2W0F C;  1GM9 A;  1KC8 W;  2LFR A;  1DF5 A;  1M9N A;  2WLL B;  3OW2 U;  2R9I A;  3ZMT A;  1NJI W;  4PEL A;  3E83 A;  3ZCC A;  3RW0 A;  2NNU A;  2WWW A;  1RM1 C;  5L3G A;  1K73 W;  1AR1 B;  3E2E A;  1W0J G;  2EIK C;  4R50 A;  1K5Q A;  2GHY A;  2OCC C;  3G4S V;  1SRY A;  5B1B B;  1VQ8 V;  2EIL C;  1W0K G;  4MVZ A;  2AHZ A;  2WLI B;  4UXN A;  3ML0 A;  2ZQM A;  1H38 A;  1GTO A;  1QVF U;  3X2Q C;  5KUM A;  3E8G A;  4UVA A;  2HG5 C;  5EBW C;  2MK3 A;  3ZN0 A;  1QLE B;  3R65 A;  5H9C A;  4UVB A;  1K34 A;  1VQL V;  3W7W A;  3I55 V;  2IU3 A;  3DGE A;  1Y4M A;  3TET A;  2X0L A;  2HVJ C;  1V54 C;  1AI6 A;  3F7Y C;  1NVP B;  5LHI A;  5IYC O;  1NVP D;  4YXW G;  1R6N A;  4JTD B;  3B8M A;  1FXK A;  4LC1 A;  5KUK A;  3ABT A;  4JTA B;  1DTO A;  1R3L C;  4RQE A;  3FB5 C;  2P67 A;  1BHA A;  5LBQ A;  1OCO B;  1VQ7 V;  3OMI B;  3DTU B;  3AG4 B;  4QPK A;  4XBF A;  3UM7 A;  4HAM A;  3OFN G;  2WLM A;  5EBL C;  1VQN V;  3JCZ A;  4MVS A;  1RPR A;  4JYB A;  3F5W C;  4BIZ A;  1K4D C;  1M57 B;  5L3C A;  4Z1M G;  1JQ0 A;  3CCQ V;  1I5Y A;  4I9W A;  1MAB G;  2UXN A;  3CC7 V;  1CP9 A;  3ABM B;  5L3D A;  3QNE A;  5CN0 A;  1VQ4 V;  2X6B A;  1TUE B;  4CZZ A;  3CCV V;  4G27 B;  1OCZ C;  3ABK B;  3OAA G;  1M56 B;  1JVM A;  2EIN C;  1N8R W;  3K9A A;  4H37 A;  2EIM C;  1GMG A;  4PDM A;  1YIT V;  1R3K C;  4MTX A;  4PA9 A;  1IXM A;  3AG4 C;  1B6Q A;  3QO7 A;  4ASU G;  3K0G A;  1BMF G;  2ZXW C;  1NKD A;  3ASN C;  5H6Q A;  3CC2 V;  1F51 A;  3K06 A;  2EZP A;  2BOB C;  2QM8 A;  3ZRX A;  3JD4 A;  4KFM A;  3MHH C;  1RM1 B;  3LDD A;  5KA5 A;  1OCR C;  2V1D A;  4PDR A;  2D3O W;  4E2L A;  5DN6 G;  2EIK B;  3K04 A;  4WFE A;  4XDL A;  3JD2 A;  1YHQ V;  3OUS A;  2EIL B;  5KA6 A;  3IC7 A;  1PNK A;  1XL6 A;  3A0R A;  1M56 C;  2X6C A;  3SPI A;  2V7Q G;  1E79 G;  4JTC B;  4R7C A;  4GX0 A;  1S72 V;  3E8H A;  3X2Q B;  3CXC U;  3T4D A;  4RUE A;  1PL0 A;  3CCS V;  1DLB A;  4TWK A;  2JK5 C;  2LFS A;  4MT8 A;  4U7O A;  1K8A W;  5C93 A;  5EC1 C;  2XAS A;  1L1F A;  1S77 D;  2Z5U A;  3GB7 C;  1V54 B;  1KKD A;  2B5U A;  4LBE C;  1ROP A;  3STZ C;  2HR3 A;  2IU0 A;  1R3J C;  3LUT B;  3P32 A;  4MVM A;  3W7T A;  2R9R B;  3SYO A;  3SPG A;  3W7U A;  3CCR V;  3FB7 C;  1E1Q G;  1VQK V;  3ETD A;  4GT1 A;  1F23 A;  1ZWI C;  3TK1 A;  2K1E A;  4MTF A;  1R3I C;  3QO8 A;  3BEH A;  4CBC A;  2OTL V;  1FXK B;  2Q69 A;  2CK3 G;  3B8N A;  5IYB O;  5B1A C;  1WPX A;  1F4N A;  1XL4 A;  3LDE A;  4WCE V;  3M99 B;  1GM8 A;  2IH1 C;  3ABL B;  1JJ2 U;  1W2B U;  2AHY A;  5GW7 A;  4QE7 A;  3E89 A;  2DQ3 A;  2JJ1 G;  4MVO A;  1VQ5 V;  4MVR A;  1GKF A;  2OTJ V;  4L87 A;  2WLL A;  2Y69 C;  3CPW U;  1EZJ A;  3T2M A;  3WFV A;  1PKX A;  1YI2 V;  2JEX A;  1COW G;  3NXS A;  3G71 V;  1ENV A;  2DYR C;  4QIW F;  1NBM G;  3K79 A;  3CME V;  1OCZ B;  3SYQ A;  3P30 A;  1FXK C;  1YIJ V;  1K92 A;  1FFT B;  2EIN B;  1JPX A;  2X6A A;  2EZO A;  1GK9 A;  4QPJ A;  3CCJ V;  2YEV A;  3CCM V;  2QA4 V;  2EIM B;  3ABU A;  1JCH A;  2ZR2 A;  1HWY A;  4JYC A;  3WG7 B;  3E8B A;  5LGN A;  3ABL C;  1QCE A;  4GCZ A;  2F43 G;  2WLN A;  3ETG A;  5CA3 A;  3ZMZ A;  4MW8 A;  1AJP A;  1NQT A;  1WLE A;  1SER A;  2ZXW B;  3ASN B;  5E1A C;  4G2K A;  4QNH B;  5HFM A;  4HYO A;  1JOY A;  1OCR B;  2JEU A;  3ZRS A;  4JF3 A;  4KP4 A;  3PJS K;  1QR9 A;  2XAH A;  3JD3 A;  1OHH G;  3D36 A;  5IY5 B;  5L3B A;  2FTK A;  3F7V C;  1V55 B;  2IJH A;  1NR1 A;  3OM3 B;  3OE7 G;  1P7B A;  4BAY A;  2EIJ C;  4QJF B;  4LCU C;  4FPP A;  3WG7 C;  1YJ9 V;  2YSU B;  2Z3Y A;  2C2A A;  3FYI B;  1AJN A;  3OR6 C;  4WF9 V;  1JX9 A;  4ZBM A;  2NLJ C;  3RVY A;  5LGU A;  1Q82 W;  4N23 A;  1AJQ A;  2ATK C;  2P7T C;  1QLN A;  1K9M W;  4RAI A;  1QBZ A;  3QO5 A;  1FXV A;  3JD1 A;  3K08 A;  1YJN V;  5L3F A;  1YSC A;  2ZD9 A;  1KEC A;  4UUJ C;  3GWO A;  5B1N A;  4GX2 A;  1S3J A;  3SYA A;  3SYC A;  5B3S B;  2UXX A;  3ZMV A;  2JIZ G;  2DW4 A;  2QM7 A;  3FYE B;  3MD0 A;  1AI4 A;  4N21 A;  5EK0 A;  2ITC C;  4GX5 A;  5IY5 C;  4JGS A;  3ZRW A;  1V55 C;  1G8M A;  1ORQ C;  1BHB A;  5EC2 C;  4BIU A;  1KP3 A;  1Q81 W;  2Y48 A;  3AG3 C;  1I5X A;  1PD3 A;  3AG2 B;  3CYO A;  2B1G A;  5IYD O;  2B1I A;  2LP7 A;  1K4C C;  3FKS G;  3EFF K;  3B77 A;  5B1A B;  3CMA V;  1QVG U;  1UJW B;  2H8P C;  1VQ9 V;  3LSS A;  2XND G;  3VOU A;  1EFR G;  2WLK A;  2A9H A;  2HFE C;  3FB6 C;  4RUF A;  1GM7 A;  1K3E A;  2W6J G;  2A79 B;  4EKW A;  4JAU A;  3IFX A;  5B3S C;  1R6K A;  2WSS G;  1BL8 A;  1R73 A;  2Y69 B;  1EBO A;  2IW5 A;  4TSF G;  4WFF A;  1Q86 W;  4PA4 A;  2JDI G;  4WFB V;  1GO3 F;  4FK5 C;  2DYR B;  1K7D A;  4PA3 A;  1H8H G;  4J9Y B;  3CCL V;  2P6J A;  1SZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...