1KQSU

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1kqsU00
3CD6V 4WCEV 1KQSU 1K73W 1VQLV 1QVFU 3G6EV 3G4SV 3CCUV 3OW2U 1YITV 3CCSV 3CCQV 1K9MW 1VQNV 3CCLV 1Q86W 1NJIW 1VQ4V 3CMEV 2OTLV 1YHQV 1VQ8V 1YJ9V 1QVGU 3CXCU 1M90W 1KD1W 4WFBV 3CCMV 1VQKV 1YJNV 1VQMV 1W2BU 1Q82W 3CCRV 3G71V 1R73A 1S72V 3CCEV 4WFAV 1YJWV 1Q81W 1K8AW 3I55V 3CCJV 1YI2V 3CMAV 2D3OW 1VQ9V 1VQPV 2QEXV 1N8RW 3CC4V 5DM6V 4WF9V 1VQOV 1YIJV 3CC2V 3CCVV 2QA4V 1JJ2U 1M1KW 2OTJV 1VQ6V 3CPWU 1Q7YW 1VQ7V 3CC7V 3I56V 1KC8W 1VQ5V
chains in the Genus database with same CATH superfamily
2JVDA 1WLEA 1SRYA 3K79A 5CB4B 5LHGA 2ZM6B 4R7CA 1JMKC 1D5AA 1URFA 1L1FA 4GLXA 1EZJA 5EYPB 5IWAO 5H6RA 2YIAA 3APOA 3VBBA 1W0JG 3WG7B 4LH6A 1SQGA 4X66O 3CP1A 2OCHA 3C3TA 4I9WA 4I4TA 2EIKB 4CC5A 1HNXO 3OR6C 4LF9B 1NR1A 2ATKC 2QKAA 1SA0B 1IBKO 2KG7B 1P84F 3ZMUA 1B04A 2EINB 1Y66A 5L3FA 5JH7B 1Q3EA 4DV5O 4R6ZA 4B3RB 3B09A 3K0GA 4NTWA 5H6QA 5LXTB 3CCLV 4I50B 2WLMA 2RMKB 2EX3A 2ZKOA 2QWNB 5L3EA 2IM9A 5BR8O 3H1HH 4OPHA 3HKBB 4RQEA 1F7YA 2UUCO 4J9ZB 4LNUA 1VEWA 1IX9A 1KYOF 1XNQB 3P3PA 3ABMC 1XUQA 1FD9A 5JVDA 2W6IG 1LR1A 2X6CA 4JAUA 5B1OA 1S5LZ 2YEVA 1QR8A 1L8DA 2GV9A 1JJOA 1QLEC 1H2GA 3CMAV 5KA6A 4GKJO 4H44B 1WB8A 1Q90D 2XAJA 2ADPA 3DGEA 4D6TH 2R9RB 1B06A 1CP9A 2YSUB 1HP8A 2ZNJA 2R9AA 2W0XA 4RO2A 5LMNB 1V55B 4X64O 1G8MA 5L3DA 1FFXB 2YXYA 1PNMA 2V4DA 4BIZA 2DJVA 5IJ0A 3SYAA 1SERA 2RQ6A 2B9ZA 1VMGA 5EIBC 5EZYB 4J9YB 1IBMB 1PNKA 4IIJB 2ZXWB 3OUFA 3P32A 4DR1O 5TISZ 3RYFA 3K57A 2JGDA 4CBCA 3ZN1A 1XREA 2HJFC 3CS5A 3O65A 4NTYA 2YXHA 1KBHA 3HKDB 3B40A 3OGIB 1ENVA 4UCUA 2CE4A 1IZ3A 4MW3A 2M6YA 3M99B 3T1CA 5K1PA 2LQTA 4MTFA 2HG5C 2CTWA 2YXLA 3A0RA 1WA8A 4JI4B 1VQ5V 4JYAO 2X6BA 1S5JA 3FD9A 2Q67A 1AB3A 4LC1A 4TV9A 1VQ4V 1I7FA 5LOVB 1GM7A 3KZIZ 2IH3C 4BR6A 4DR5B 1Y76A 2WLLB 1SQPH 3FB8C 1FJGB 5B1AC 3K06A 4YY3O 3TK1A 4BIUA 1N36O 2JDIG 1DK1A 4DK0A 1EN6A 2ETNA 2F4VO 5E79Z 3HKBA 5LGNA 4DV1B 3T4ZA 1X4TA 5J2UA 5FPOA 1ZL8B 3T2MA 1QLEB 2BSKA 3A0HZ 5IJ9B 3THOA 4DYLA 2K1EA 4JI5O 3GB7C 1Z5VA 2LFSA 2ZIOA 1VQ7V 3CSXA 4X1YA 5KHKA 4LFAO 2KQXA 4KP4A 1XHZA 1H8EG 3E89A 4AQYB 4DW0A 1R6NA 2JGUA 4PJ0Z 3ZHQA 4Z1MG 3SPJA 4U3JA 2Q0OC 2QWQB 2BCCH 4DUYO 3OTOO 1AI4A 4YHHB 4JI5B 3L72H 1XI1A 1QVFU 1R6TA 4MW8A 3TETA 2CTQA 2AHZA 5GONA 3EVKA 2P67A 3SPGA 4JI6O 3K5NA 2WLNA 3ZS8C 3KKYA 2D3OW 5CN0A 4UCTA 4JI6B 2GTAA 2QM7A 3ZHTA 4PELA 3ABUA 3KCYA 3E8HA 2BE3A 2P4KA 2BOBC 1Y74A 2N04A 5B1AB 3FYEB 2E3CA 1NT2B 5JCOC 3DXRB 4R50A 3LSQA 3TXSA 3CX5F 1FFTB 1SESA 2Q9LA 4B08A 2Y0PA 4JYAB 1LNQA 5GTHZ 2XTAA 4CC6A 2ITCC 3APQA 3BA9A 4O4LA 4OGQB 3LNNA 1K97A 2UXNA 1BZKA 2HR3A 3E86A 4JI3O 4WFEA 2VWJA 4PV1B 1U97A 4QE7A 3L9DA 5LHIA 2F4VB 2QR4A 1H2LA 2P4VA 4UB6Z 3A2FA 4JASA 4QIWF 3LDCA 3F7VC 3C90A 2YIBA 3SYCA 4FLZA 2ZR3A 4QJFB 4LFBB 5KHGA 2YEVB 2Q7EA 2JS3A 4PI2A 1Q8IA 3CC4V 4GKKO 3F5TA 3FX7A 4F6RB 1XEQA 4LF4B 3GVMA 4Q20A 4BIOA 1M57B 3MHHC 1BS3A 1XILA 5IYZA 3OEEG 1I5YA 4H0LB 1NBMG 4ZOLA 3CCQV 4IHJA 2DWEC 1KD1W 4WFBV 3JAWA 3K58A 2F1MA 3JD0A 4X1KA 2WLIB 1RPRA 2LJ2A 4MVQA 1BL8A 1NH2D 2P7TC 3CRAA 4TV8B 1MOFA 1WP8A 4KHPO 1JQ0A 5B66Z 3H1LH 2ZE7A 3VQWA 3Q4HB 3DC5A 1F51A 5JH7A 3VQXA 4FLTA 3ASNB 3OM3B 2EILB 2A7WA 3A8TA 2EIJB 4DV2O 4K3AA 3P30A 5DEDA 4PDMA 4K0KB 3H1IH 5B1BB 1VQ9V 5GW7A 1OV9A 1AI5A 1O9HA 1SZXA 1K3EA 1YVWA 2AXTZ 3W7SA 4K0KO 3AG1C 3BVOA 4X64B 3IGAC 5CBHA 4DV2B 3JARB 3UQ8A 5FNVB 4PA3A 1TAEA 1I94B 3N2GB 2P22C 1JCHA 1ZTEA 1QU7A 1XQ8A 1GN3A 3OD4A 1Y4MA 2FL4A 2PTMA 1BQZA 1VQPV 1US6A 1XMQB 3WG7C 3RFRA 4I9QA 3MHSC 2LO1A 2E75B 1HWYA 3VQVA 4X20A 2KSDA 1ZLZA 4LFCB 4FPPA 2WA3A 3RYCA 1WNSA 3HKDA 3FYIB 4GKKB 2HVJC 1MSDA 1BHBA 3JSLA 3K5MA 3LDEA 2PYLA 5D5QA 2CH7A 3J81N 5EZYA 1XNRO 1BQ0A 3LUTB 1N0JA 1JX9A 4UCSA 1W0KG 2HLDG 5ITZB 4AILC 2UXXA 1GN2A 1GMGA 2A79B 4W4KA 1M56C 1K34A 2YIDA 5IYCO 1HNXB 2EZPA 3B77A 4DRXB 5B5EZ 4JV5O 2P06A 5JJEB 2X0LA 4X1IA 3ZIAG 2DQ0A 3JD3A 5EC2C 4ZKIA 4Z1VA 2EBOA 4KXRA 3W7WA 1PKXA 3ZBHA 1NTZH 2Q6AA 4ZBMA 5LP6A 2AHYA 4G28B 4MVRA 4B3TB 1HNWO 2Y48A 3QF7A 3HR0A 2EILC 2DYRC 5LYJB 2PI4A 3ML0A 4JI0B 1LUVA 2GBOA 3RT3C 1FYJA 4LF5B 3BRCA 3FB6C 1VF7A 4HNAA 4RUEA 2B5UA 2YIBD 2VQFO 3BABA 1IDSA 3JASB 2Y4TA 2A06H 2O57A 1KU9A 1UFIA 1RSOB 3ZCCA 4O2BA 3EFFK 1W59A 5LP6B 5KUKA 3ZMTA 2RNBA 3QNEA 4FZ1A 2Q0AA 4X62O 3IC7A 1YJNV 4YHHO 1HDJA 1G4YB 3ZX6A 1PL0A 4J7KA 1PL4A 1RM1C 2ILMA 4IT5A 1IXBA 4DR4O 3W7UA 2CDYA 4D7TA 1SQFA 3ZHVA 4DV7B 3CCUV 1O9GA 4YIOA 2Y0IA 5J2UB 4JI7B 2EULA 3AK1A 5CA0B 2HEPA 4CS3A 1JVMA 3TGUH 4LFAB 1SZTA 4LF8B 1R3LC 1E1QG 4LBEC 1M56B 3NXSA 3ASOC 1I08A 1M4UA 1WPXA 1TUBA 1VQ6V 2OTJV 1JOYA 4DR6O 4DR6B 1NS1A 4WCEV 3DSQA 1J5EB 4MTGA 2W0FC 4FMTA 1Z2GA 2XUMA 1IVSA 4LWSA 2WLHA 1F4NA 4JI7O 1EZVH 2WLJA 3H9VA 3E22B 5BMVB 3AG4C 3EHBB 3EXAA 1CXZB 3CMEV 2K9PA 4OPAA 2RDCA 3JATB 2CH7B 2JGDB 4WFAV 1YJWV 1SETA 4FLWA 1OCOC 2HJDA 2JK5C 1N8RW 2QEXV 3T1YB 1AJPA 3STLC 5JQGB 2A9HA 4NKGB 1S0VA 3LSUA 2YS8A 3HKEA 5LMUO 2VQFB 4DV0O 4UFZA 4DK1A 4NVPA 1GN6A 1S72V 3CCJV 2Q7HA 2IJKA 3SYQA 1UJWB 4G2KA 3BPZA 2M7WA 4O2BB 2AW9A 2DWDC 1KKDA 1Q6UA 5IE9A 5HFLA 3T1HO 2ZT9B 2DMXA 4EB6B 2EINC 4LF7B 4CH4A 4K35A 4JPRA 2RN9A 2Y4UA 3J7AU 4RWUA 5LHHA 3B4SA 2KB1A 3FKSG 4GKJB 2P5OA 3CJHA 3H1JH 3ZMSA 4OX9O 5C8YA 1KQSU 3CYOA 5EBMC 3H01A 1LUWA 1YTFB 4XDKA 1I94O 4ZIBA 4UUJC 5B3SB 3JALB 3LSSA 3BY6A 3CCEV 5H5NA 3U0ZA 2FMLA 3SPIA 1YEWA 3ETQA 2ZE6A 4X1YB 4O4JB 2UUCB 4JI2B 3L73H 2PF4E 3SJQC 3OMAB 5IJ9A 1Q6HA 3BHPA 1P4RA 4JI8O 2F93B 4JF3A 2IH1C 4MVMA 4GZRB 3E83A 3PN1A 4NXMO 1QHTA 1K8AW 1I0HA 2N05A 4YJ2B 1D5NA 4LFCO 4DV5B 4QE9A 1ORQC 5L3BA 1OCOB 3HKCB 4X65B 4L8JA 1HR0O 3N27A 5J2TB 4MS2A 4F6RA 2B1IA 5BMVA 3K03A 2XHBA 4MVSA 1EFRG 3G6EV 5KAFZ 2V7QG 3W7XA 1MZEA 3CXCU 1SKVA 4X65O 1AP6A 4HYOA 2WSSG 1W2BU 2MW2B 1XMOO 5CB4A 1VF6A 4U7OA 3OR7C 1WA8B 1N33O 3D36A 1FS0G 2QJ1A 1NTKH 1B3QA 4CS2A 4F4LA 2L6LA 1THZA 2XASA 2OCCC 2ARHA 4MTOA 2BOCC 2RJZA 4WFFA 1N34B 2QTOA 4WFHA 1EN4A 1DTOA 1P49A 1QQCA 3AG2B 3JAKA 1M93A 2CAZC 4YJ3A 1XBLA 4O2AB 1JA8A 4ZI7A 1NTMH 3ASNC 3TJTA 1AR1B 1BMFG 2ADQB 1OCRB 4PI0A 1GK9A 3OW2U 4J7ZA 1AJQA 5H9CA 4FLXA 1D2DA 3K3WA 4B3MB 3P3NA 1IURA 1TA8A 1A32A 1TGOA 1MABG 2ZXWC 1AI6A 1N0NA 3OAAG 2PZSA 3SJAC 1K92A 5KMGB 3QO5A 3TXQA 3K59A 1V54B 3WB2A 2R9IA 3JSNA 4TV8A 4IGGA 2Y69B 4XBFA 2UXCB 2JEUA 4JYBA 4EEQA 2WLIA 5GONB 4GX5A 1H2MA 5A9GA 1BCCH 2Q68A 1EM1A 1V54C 3ABTA 3SPHA 1S76D 5FPRA 3RYHA 1MSWD 3FAVA 1PD3A 4AI8A 3LDDA 5KHIA 1M9NA 1F4MA 5LMUB 3B2EE 4WBNA 1DF5A 2CGOA 4HZ3A 1Y76B 1SQBH 1JPXA 1XHXA 2LW7A 3IJ4A 1FXVA 1MZFA 4UXNA 4B7EA 4U3FH 4FLYA 4N21A 3OTOB 4JYCA 5KMGA 3ETDA 1MMMA 2OCCB 3OMNB 4X1KB 3STZC 4U7NA 3DTUB 1I5XA 3LNMB 4JYYA 1AVMA 3RVYA 4P30A 4QNHB 1HNZB 3BAAA 3JATA 3G71V 1N32B 3ABLC 4BAYA 5EC1C 4UCRA 1MA1A 1EN5A 1PP9H 2Q73A 4X9QA 3E8BA 4JI1B 1F23A 5LL6Y 2GTSA 1J5EO 3NR7A 3CD6V 1K73W 1VF6C 3F7YC 5JCOA 2UXBB 2HVKC 4YIPA 1Q82W 5DN6G 1N36B 1FFXA 4DR7O 1E1RG 2JIZG 2E5LO 4CS4A 1OCZB 3ZHSA 1TUBB 1N32O 3QO7A 4O4HA 3K9AA 1AR4A 3D3QA 3SPCA 4DV6O 2OTLV 2ZD9A 3VQYA 4QPKA 1FPOA 5E1AC 2LGQA 1HNZO 1CPYA 3ICXA 1XL4A 1JFFA 1QBZA 1KP2A 3N2GA 3OT7A 4JI4O 5CA0A 2PUSA 2LFRA 2FB5A 4LH7A 3BCCH 1S3JA 1SF9A 1PM9A 4B3MO 1NZ6A 4G27B 4B7KA 4YJ2A 2OIEA 4CH3A 5EIBD 1NKDA 3ZEDA 1QVGU 4DV3B 2PY5A 3RYHB 3X2QC 4UVAA 4EFEA 4YXWG 4DUZB 2QE7G 1M5IA 4DR1B 2JS5A 4FLVA 1EBOA 5CMUA 4J11A 1RFYA 2FKXA 4BW5A 2H3OA 1RSOA 5B1BC 2OYQA 4UCOA 3L71H 3UO3A 1FJGO 3OUSA 3JASA 1HNWB 3AG1B 1OCCB 2BSKB 1K5QA 3D3IA 4I7ZB 1SA0A 5B1NA 3GWOA 3SYOA 4FFKA 4IL6Z 4PA4A 4JZ2A 1NR7A 1FXHA 1YI2V 4O4IA 4CZZA 4NB5A 2NN4A 5JJJB 1DF4A 2A0LA 1FXKC 3AEIA 4I55A 2GUZB 5LGTA 3AG3C 1Q5OA 1XOUA 1H2KA 3ABKC 4O2AA 5LA6A 4NXNO 1VIBA 3GWKC 5LOVA 5IY5C 3CWBH 3ZRWA 1QNMA 2DQ3A 3TCUA 5DM6V 2UXDO 1AI7A 1GAXA 5KLVH 1H38A 4TQDA 4EFBA 3IFXA 3HPLC 3IC9A 3OMIB 4P2ZA 4WFGA 2PI5A 2YICA 3G6BA 3I55V 3JD2A 1K4DC 3ZJZA 3CB2A 2QKCA 4O4LB 1GKFA 2E74B 5CA1A 4FIPC 1QCEA 2IW5A 3L70H 5EYPA 4LF9O 4YJ3B 1S77D 1OZ0A 4LF6O 1R3KC 4OX9B 2IJJA 1K7DA 3IAYA 4TV9B 2ODMA 2NR5A 1SC5B 4LCUC 4ASUG 3H1KH 1JR9A 2P90A 4TOIA 2JJ2G 1FXKB 4PA7A 4DW1A 4MVUA 3AG2C 3ETEA 2F66C 1TVKA 2FTKA 3KG2A 5BR8B 4JAAA 1Q43A 1Q81W 1AILA 1NI8A 4I0XA 4JI8B 1YIJV 4Q6GA 5KAIZ 4UB8Z 5FNVA 5J2TA 3OEHG 1SS3A 3AK3A 1H2NA 2CGNA 3RW0A 3CJHB 2E76B 4FM1A 4LNUB 2FYUH 4GCZA 3MDSA 2UXDB 1GH6A 4O4IB 2OT5A 4NXNB 4UCVA 1R73A 5CBGA 4HAMA 2JEXA 3T1YO 3X2QB 1KUQA 2XAGA 4H33A 1T5EA 5LXTA 4XDLA 4ICGA 3WU2Z 5L3CA 2UUBB 1M57C 1E79G 1NJIW 5LA6B 1VQ8V 3R66A 2QDOA 2Y69C 2ITDC 5JJNB 3OE7G 2LP7A 4IYHA 5IWAB 2QWPB 3JAWB 2UU9B 4GX2A 3CRCA 1BHAA 3G80A 3HKEB 2ZM6O 2IJIA 1AJNA 1ZAUA 1G1XB 3CPWU 1YZBA 3I5DA 3MAQA 1OCZC 3D36C 4B3SB 5B3SC 4I0XB 2VS0A 4DUZO 3PJSK 1IBLB 1J95A 4I50A 5AG2A 4P9PA 1PNLA 3C3SA 3HB3B 2WPDG 3OGCC 1P7GA 3CCVV 2ZDIC 2QWRB 1OCRC 2Q69A 3SGIA 2QKSA 3SDLA 2AGAA 4K8ZA 4X1IB 5FL7G 4R8CA 5JQGA 1MNGA 5IT9N 3UM7A 1KMIZ 2ZCEA 3RYFB 2QGNA 4MVOA 2WAMA 1KECA 4ZI7B 1YDXA 2Z5UA 5ITZA 1R6KA 3G4SV 3HKCA 1NQTA 1MG1A 2JJ1G 4J42A 5F2VO 2IBZH 2HKOA 2EIMB 5A2QN 1Y6XA 2DE0X 2XAFA 3N2KB 4DO2A 1V9PA 3AG7A 2HP8A 1XDCA 4LF5O 2VRZA 4FJCC 1K9MW 1VQNV 4X89A 4O4JA 3UKMA 4BWAA 4PDVA 2OIGA 5L3GA 3T4DA 1X59A 5EBLC 4ZHQB 2LGWA 2LW1A 1VQOV 3BFRA 3E35A 4MVZA 5H2FZ 5JVDB 2GUZA 4WBNB 4DR4B 5FLXN 4HBNA 1V55C 2R70A 1WPBA 2YDEA 2A3QA 2ZR2A 3BA8A 3SJCC 4U3JB 1YHQV 2E5LB 2EJ7A 4K8XA 1BGYH 5IY5B 4FFBA 2F43G 3CCRV 3RN4A 4DR2O 1WJZA 4H13B 2AZ2A 2AZ0A 4CH6A 3FFQA 4DV1O 3D8CA 1GM9A 3KCXA 1SQVH 3G67A 3RGBA 4FVMA 1Q6IA 5LP6C 5EK0A 2Z0AA 3A0BZ 4PD4F 4YY3B 2HHHB 4JI1O 5KA5A 3ZHUA 3K08A 3JD1A 3QG5A 4H37A 4TUYB 4UV9A 4W4LA 4DR5O 1AP5A 1VARA 5CBFA 5LBQA 2ZNIA 2D2CB 4X88A 4J7JA 2QA4V 3VOUA 2F23A 2UU9O 4GX0A 4J41A 1XL6A 2X7RB 1BE3H 2BTOA 1YCIA 2WLLA 2XT9A 2ZDIA 3S3WA 3O9OA 3ZN0A 4NR1A 4F6EA 4TT3G 2P6JA 4JV5B 5BZBA 4Z2WA 2YI9A 1U96A 4GUNA 3CC2V 1ZX3A 4AHCA 2IJHA 4ZHQA 4X8AA 2IU0A 3F5WC 4J80A 1Q86W 1H8HG 2BTQA 3ABLB 2CK3G 3BEHA 3RYCB 3UT5A 3RBZA 2PGGA 1CEZA 3ZMZA 4QPJA 5K1XA 2HFEC 3JYCA 1KC8W 1VP7A 1N33B 1R1BA 1Y67A 5JWPA 3JAKB 3WB1A 1L0NH 2YI8A 5IJ0B 1M90W 3U11A 1BT8A 2Q8VA 3ABKB 4FK5C 1ZWIC 3ZRVA 1R3IC 3M7MX 1GO3F 3CRQA 3JARA 1WN7A 4N23A 4PHZA 1PPJH 3RYIB 1XMQO 3K0DA 3AK2A 2DYSC 2QM4A 3UCSC 2JRIA 4LF6B 1YJ9V 4DR3B 3ASOB 4TWKA 5D5PA 3SJBC 2GSMB 1Y74B 4LF4O 2EJRA 1G6UA 1OHHG 4ABMA 1OCCC 3SYPA 2EZOA 2YC0A 1JJ2U 1NVPB 4TQFA 5IDJA 3ZRWB 1N34O 4JI2O 2EIJC 1R3JC 3WB0A 2Z3YA 3FAVB 4B3RO 1GM8A 3CRMA 2G38A 1VQKV 4FFBB 1AROP 3S3XA 3UO2A 5GTIZ 1IBKB 4EB6A 4DR3O 5J9PC 1XMOB 4I55B 4KHPB 4GT1A 4GX1A 4TSFG 2QM8A 2WA4A 4JI3B 1TUEB 1GN4A 3JALA 4X66B 2DYRB 4FM2A 2QSAA 2KG7A 2XOKG 1PV0A 4UVBA 1HR0B 1RP3B 2RCVA 3ZMVA 2B1GA 4LF7O 4JTDB 2IU3A 4UVCA 3ABMB 5C8YB 3E8GA 3T1HB 3QO8A 4I4TB 5KUMA 3CRRA 3ETGA 1NH2B 4E2LA 4NXMB 3RVZA 1Q7YW 3E2EA 5C93A 1RPOA 3CC7V 3ZRXA 3JCZA 2CTPA 2XNDG 2YUAA 3CE2A 1YTFD 4DXWA 4LFBO 2HHHO 2DOSA 4GYCB 4FM0A 4IHJB 5LYJA 1VF5B 1N4CA 2VQEB 1NVPD 3L74H 5KX5A 2Q5ZA 5CA3A 1L0LH 2NLJC 1H2SB 4RQFA 4A5UB 3I56V 1DGSA 3E22A 4OXSA 3CEIA 4FLUA 4DV3O 1GRJA 4JTCB 1JFFB 2Q7GA 3UT5B 2DW4A 4LWSB 1YXBA 2ZE5A 2EIKC 3M8AA 3RWRD 1VQMV 4O4HB 4UV8A 2BTQB 4P9OA 2EIMC 2L35A 2F95B 1UPGA 1IXMA 2PYJA 4MSWC 5KHHA 4AQYO 1WP7A 2H8PC 2N74A 4KUMA 3N2KA 2DN9A 3AG4B 5KX5B 4NYKA 4LP8A 4DV6B 1K33A 3B8NA 2KKWA 3R65A 1COWG 3SR2C 1YSCA 1K4CC 3U10A 3W7TA 3K9SA 2VWKA 4FZ0A 2UUAB 5BXZA 4DR7B 5CA1B 4IYIA 3AG3B 4IIJA 3FB7C 4D7SA 3CHXA 1M1KW 2X6AA 5HFMA 4DV0B 3DC6A 5BY1A 1VQLV 2UXBO 3B8MA 3DXRA 1P7BA 1QR9A 1AR5A 4LF8O 4RAIA 3CCMV 4DR2B 4X20B 5IYDO 4DV4O 4KFMA 1ZUQA 1RM1B 2NNUA 3Q4HA 1FKAO 2ZQMA 4DUYB 2CTRA 4J10A 1WAZA 3K04A 4PA9A 4QGPA 2ZE8A 1YITV 2WLKA 3CCSV 4JGSA 4PDRA 2XAQA 3J80N 2GHYA 4HNAB 1ZSPA 2W6JG 4MT8A 4X62B 4JAVA 4DV4B 3QVNA 2CUGA 1BSMA 3WFVA 2DYSB 1B6QA 2QTSA 1K5SA 2ZINA 4KL1A 1SQQH 1OJHA 4E4EA 1KB9F 1KP3A 3OFNG 4TUYA 3JAMN 1YF2A 2GDSA 3K5OA 5EBWC 3ZRSA 1FAFA 4MTXA 2ZIMA 5KHJA 4L87A 4EKWA 5IYBO 4B3SO 2UUAO 1NU1H 4JI0O 4WF9V 1S5HC 1KKCA 3CXHF 1FXKA 3RYIA 2OWOA 4B3TO 1ROPA 2MK3A 3L75H 4DV7O 1ZL8A 2UXCO 5LMNO 2R72A 4C7UA 4ZOLB 2UUBO 4NTXA 2Q4PA 2WWWA 5DECA 5IYZB 3QTCA 1Z5WA 3OTFA 1WB7A 1QLNA 4XDJA 4JZGA 3JCUZ 1DLBA 3JD4A 3K5LA 2C2AA 3ZHRA 1HW7A 2QWOB 3E8FA 3FB5C 4RUFA 1TVKB 2V1DA 4JTAB 4PA6A 4PDLA 4BW9A 1GTOA 1XNQO 4CH5A 1XNRB 3MD0A 2H94A 2VQEO 1IBLO 1SQXH 4DRXA 4LR3A 2XAHA 4I5SA 5LGUA 1IBMO
chains in the Genus database with same CATH topology
1WLEA 1DF5A 1SRYA 3K79A 4HZ3A 2ZR2A 5LHGA 1YHQV 4FPPA 4R7CA 1JPXA 3FYIB 5IY5B 1FXVA 2F43G 3CCRV 1L1FA 4UXNA 1EZJA 5H6RA 3VBBA 4N21A 1W0JG 3WG7B 4JYCA 2HVJC 1GM9A 3ETDA 2OCCB 3CP1A 1BHBA 5EK0A 3LDEA 3OMNB 4I9WA 3STZC 2EIKB 4U7NA 3DTUB 1I5XA 3LNMB 3RVYA 4P30A 4QNHB 5KA5A 3OR6C 3LUTB 3K08A 1JX9A 3G71V 1NR1A 2ATKC 1W0KG 3JD1A 4H37A 2HLDG 3ZMUA 3ABLC 4BAYA 2EINB 2UXXA 4UV9A 5EC1C 1Y66A 5L3FA 5CBFA 1GMGA 2A79B 5LBQA 4R6ZA 1M56C 1K34A 4X88A 2QA4V 3E8BA 3VOUA 5IYCO 1F23A 4GX0A 2EZPA 3B77A 3K0GA 1XL6A 2X7RB 5H6QA 3CD6V 1K73W 3F7YC 2X0LA 3CCLV 2WLLA 2WLMA 3ZIAG 2DQ0A 2ZDIA 2HVKC 3JD3A 3ZN0A 5L3EA 5EC2C 4ZKIA 1Q82W 2EBOA 5DN6G 4TT3G 3W7WA 1PKXA 2P6JA 4RQEA 2Q6AA 5BZBA 4ZBMA 3CC2V 4J9ZB 1E1RG 2JIZG 2AHYA 4G28B 4MVRA 2IJHA 1OCZB 2Y48A 3ABMC 4X8AA 2IU0A 3F5WC 2W6IG 2EILC 2DYRC 3QO7A 2X6CA 1Q86W 2PI4A 3ML0A 3K9AA 3SPCA 2OTLV 1H8HG 2ZD9A 4JAUA 4QPKA 5E1AC 3ABLB 5B1OA 2CK3G 2YEVA 3BEHA 1CPYA 1QR8A 1QBZA 1XL4A 3FB6C 1KP2A 1QLEC 1H2GA 3CMAV 3RBZA 5KA6A 1CEZA 4RUEA 2B5UA 2LFRA 2XAJA 3ZMZA 3DGEA 2R9RB 1CP9A 2YSUB 1S3JA 4QPJA 2HFEC 3JYCA 4G27B 1KC8W 4RO2A 3ZCCA 3EFFK 1V55B 1NKDA 5KUKA 1G8MA 5L3DA 3ZMTA 1QVGU 3QNEA 1M90W 3X2QC 3IC7A 1YJNV 1PNMA 1G4YB 4UVAA 4BIZA 4YXWG 1PL0A 2QE7G 3SYAA 1SERA 3ABKB 1EBOA 5CMUA 4FK5C 4J9YB 1ZWIC 3ZRVA 1RM1C 1R3IC 1GO3F 1PNKA 4BW5A 5B1BC 3W7UA 2ZXWB 3OUFA 4N23A 3P32A 3K0DA 3OUSA 3CCUV 1Q7YW 4CBCA 3AG1B 2DYSC 3ZN1A 1OCCB 2HJFC 1YJ9V 1K5QA 3ASOB 3D3IA 4TWKA 5B1NA 3GWOA 1JVMA 3SYOA 2GSMB 1SZTA 4PA4A 1NR7A 1FXHA 1YI2V 2EJRA 1ENVA 1R3LC 1E1QG 1OHHG 4LBEC 1M56B 4CZZA 1OCCC 4MW3A 3SYPA 2EZOA 3NXSA 1DF4A 3ASOC 3M99B 2A0LA 3T1CA 1JJ2U 1NVPB 1WPXA 2OTJV 1VQ6V 1FXKC 3AEIA 4MTFA 2HG5C 5IDJA 3ZRWB 1JOYA 3A0RA 1VQ5V 2X6BA 4WCEV 2EIJC 2Q67A 4MTGA 5LGTA 3AG3C 4LC1A 1VQ4V 1R3JC 2W0FC 2Z3YA 4FMTA 1GM7A 1GM8A 2IH3C 3ABKC 1VQKV 1AROP 2WLHA 1F4NA 5J9PC 2WLLB 3ZRWA 5DM6V 3TCUA 2DQ3A 2WLJA 5IY5C 4GT1A 1AI7A 4GX1A 4TSFG 2QM8A 3FB8C 1H38A 3AG4C 3K06A 5B1AC 3IFXA 3HPLC 1TUEB 3TK1A 4BIUA 2JDIG 3OMIB 4P2ZA 3EHBB 3CMEV 4WFGA 2DYRB 2PI5A 2XOKG 5LGNA 4UVBA 3T4ZA 3ZMVA 2B1GA 4JTDB 2IU3A 4WFAV 4UVCA 1YJWV 3T2MA 3I55V 3JD2A 1SETA 3ABMB 1QLEB 1OCOC 2JK5C 3E8GA 1N8RW 2QEXV 1K4DC 3QO8A 5KUMA 2K1EA 3ZJZA 3ETGA 1NH2B 1GKFA 1AJPA 4E2LA 4FIPC 3GB7C 3RVZA 3STLC 2LFSA 1QCEA 1RPOA 5C93A 1VQ7V 2IW5A 3CC7V 3E2EA 2A9HA 3ZRXA 4KP4A 3JCZA 1S0VA 2XNDG 1YTFD 1S77D 1OZ0A 1H8EG 4DXWA 1R3KC 2IJJA 1K7DA 3E89A 1R6NA 1S72V 4LCUC 4Z1MG 3CCJV 4ASUG 3SPJA 1NVPD 2IJKA 3SYQA 2P90A 1UJWB 4G2KA 2M7WA 5CA3A 2NLJC 4RQFA 2DWDC 1KKDA 2JJ2G 3I56V 1AI4A 1FXKB 4PA7A 4OXSA 1QVFU 4MVUA 5HFLA 4MW8A 4JTCB 3TETA 3AG2C 3ETEA 2AHZA 2EINC 2FTKA 2DW4A 2P67A 3SPGA 3KG2A 2EIKC 1VQMV 4UV8A 1Q81W 4JPRA 2WLNA 4P9OA 2D3OW 2EIMC 5CN0A 5LHHA 1YIJV 2KB1A 3FKSG 1IXMA 3OEHG 2QM7A 4MSWC 3ZMSA 4PELA 3ABUA 3E8HA 2H8PC 2BOBC 3RW0A 1KQSU 4KUMA 3CYOA 4GCZA 3AG4B 5B1AB 3FYEB 5EBMC 3H01A 4LP8A 1YTFB 1K33A 3B8NA 4XDKA 2OT5A 3R65A 1COWG 4UUJC 1YSCA 1K4CC 5B3SB 3W7TA 4R50A 3LSQA 3LSSA 1R73A 3BY6A 5CBGA 3CCEV 4HAMA 2JEXA 3X2QB 3SPIA 1FFTB 1SESA 2XAGA 4H33A 3AG3B 3FB7C 1LNQA 1M1KW 4XDLA 2X6AA 3SJQC 3OMAB 5HFMA 5L3CA 1P4RA 2ITCC 1VQLV 1M57C 4JF3A 1E79G 2IH1C 3B8MA 1NJIW 4MVMA 1K97A 1VQ8V 2Y69C 1P7BA 1QR9A 2ITDC 2UXNA 3E83A 3OE7G 2HR3A 2LP7A 3E86A 4RAIA 3CCMV 4WFEA 5IYDO 1K8AW 4GX2A 4KFMA 1BHAA 4QE7A 1RM1B 4QE9A 1ORQC 2NNUA 1OCOB 5L3BA 2IJIA 1AJNA 2ZQMA 4MS2A 5LHIA 3CPWU 2B1IA 3K04A 1OCZC 3K03A 4JASA 4MVSA 4PA9A 1EFRG 4QIWF 3G6EV 1YITV 3LDCA 2WLKA 3CCSV 3F7VC 5B3SC 2V7QG 4JGSA 4PDRA 2XAQA 3W7XA 2GHYA 3SYCA 3CXCU 3PJSK 4HYOA 2ZR3A 2WSSG 1W2BU 1J95A 4QJFB 2W6JG 2YEVB 4MT8A 4P9PA 4JAVA 1PNLA 4U7OA 3OR7C 3HB3B 2WPDG 3CC4V 3OGCC 3D36A 1FS0G 2DYSB 3WFVA 4F4LA 1B6QA 3CCVV 4Q20A 1THZA 2ZDIC 1M57B 1K5SA 3MHHC 2XASA 2OCCC 1KP3A 3OEEG 1OCRC 3OFNG 1I5YA 2Q69A 1NBMG 3CCQV 4MTOA 2BOCC 2QKSA 4WFFA 2QTOA 2DWEC 5EBWC 4WFHA 3ZRSA 1DTOA 3AG2B 4MTXA 4WFBV 1KD1W 4L87A 5FL7G 4EKWA 5IYBO 3JD0A 4R8CA 2WLIB 1RPRA 4MVQA 4WF9V 1BL8A 3ASNC 3UM7A 1NH2D 1S5HC 2P7TC 1FXKA 1AR1B 4MVOA 1MOFA 1JQ0A 1ROPA 1BMFG 2WAMA 1KECA 2MK3A 2Z5UA 1OCRB 1R6KA 1GK9A 3G4SV 3OW2U 1F51A 1AJQA 1NQTA 5H9CA 3ASNB 1MG1A 3OM3B 2JJ1G 2EILB 2EIJB 3K3WA 3P30A 2HKOA 4PDMA 2EIMB 2XAFA 4DO2A 5B1BB 2WWWA 1VQ9V 5GW7A 1MABG 2ZXWC 1AI6A 1AI5A 3OAAG 1K92A 1K3EA 3QO5A 3W7SA 1QLNA 3AG1C 1V54B 2R9IA 4XDJA 5CBHA 3IGAC 1DLBA 3JD4A 4FJCC 2C2AA 1K9MW 1VQNV 2Y69B 4PA3A 4X89A 3E8FA 4XBFA 3UKMA 2JEUA 4JYBA 3FB5C 2WLIA 4RUFA 4GX5A 4PDVA 2V1DA 4JTAB 4PA6A 4PDLA 1JCHA 2Q68A 5L3GA 1V54C 3ABTA 1GTOA 3SPHA 1S76D 3MD0A 1Y4MA 2H94A 3T4DA 5EBLC 1MSWD 1VQPV 3WG7C 1VQOV 1PD3A 3E35A 4MVZA 3LDDA 2XAHA 1M9NA 3MHSC 1F4MA 4I5SA 5LGUA 1HWYA 1V55C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 V;  4WCE V;  1KQS U;  1K73 W;  1VQL V;  1QVF U;  3G6E V;  3G4S V;  3CCU V;  3OW2 U;  1YIT V;  3CCS V;  3CCQ V;  1K9M W;  1VQN V;  3CCL V;  1Q86 W;  1NJI W;  1VQ4 V;  3CME V;  2OTL V;  1YHQ V;  1VQ8 V;  1YJ9 V;  1QVG U;  3CXC U;  1M90 W;  1KD1 W;  4WFB V;  3CCM V;  1VQK V;  1YJN V;  1VQM V;  1W2B U;  1Q82 W;  3CCR V;  3G71 V;  1R73 A;  1S72 V;  3CCE V;  4WFA V;  1YJW V;  1Q81 W;  1K8A W;  3I55 V;  3CCJ V;  1YI2 V;  3CMA V;  2D3O W;  1VQ9 V;  1VQP V;  2QEX V;  1N8R W;  3CC4 V;  5DM6 V;  4WF9 V;  1VQO V;  1YIJ V;  3CC2 V;  3CCV V;  2QA4 V;  1JJ2 U;  1M1K W;  2OTJ V;  1VQ6 V;  3CPW U;  1Q7Y W;  1VQ7 V;  3CC7 V;  3I56 V;  1KC8 W;  1VQ5 V; 
#chains in the Genus database with same CATH topology
 2JVD A;  1WLE A;  1SRY A;  3K79 A;  5CB4 B;  5LHG A;  2ZM6 B;  4R7C A;  1JMK C;  1D5A A;  1URF A;  1L1F A;  4GLX A;  1EZJ A;  5EYP B;  5IWA O;  5H6R A;  2YIA A;  3APO A;  3VBB A;  1W0J G;  3WG7 B;  4LH6 A;  1SQG A;  4X66 O;  3CP1 A;  2OCH A;  3C3T A;  4I9W A;  4I4T A;  2EIK B;  4CC5 A;  1HNX O;  3OR6 C;  4LF9 B;  1NR1 A;  2ATK C;  2QKA A;  1SA0 B;  1IBK O;  2KG7 B;  1P84 F;  3ZMU A;  1B04 A;  2EIN B;  1Y66 A;  5L3F A;  5JH7 B;  1Q3E A;  4DV5 O;  4R6Z A;  4B3R B;  3B09 A;  3K0G A;  4NTW A;  5H6Q A;  5LXT B;  3CCL V;  4I50 B;  2WLM A;  2RMK B;  2EX3 A;  2ZKO A;  2QWN B;  5L3E A;  2IM9 A;  5BR8 O;  3H1H H;  4OPH A;  3HKB B;  4RQE A;  1F7Y A;  2UUC O;  4J9Z B;  4LNU A;  1VEW A;  1IX9 A;  1KYO F;  1XNQ B;  3P3P A;  3ABM C;  1XUQ A;  1FD9 A;  5JVD A;  2W6I G;  1LR1 A;  2X6C A;  4JAU A;  5B1O A;  1S5L Z;  2YEV A;  1QR8 A;  1L8D A;  2GV9 A;  1JJO A;  1QLE C;  1H2G A;  3CMA V;  5KA6 A;  4GKJ O;  4H44 B;  1WB8 A;  1Q90 D;  2XAJ A;  2ADP A;  3DGE A;  4D6T H;  2R9R B;  1B06 A;  1CP9 A;  2YSU B;  1HP8 A;  2ZNJ A;  2R9A A;  2W0X A;  4RO2 A;  5LMN B;  1V55 B;  4X64 O;  1G8M A;  5L3D A;  1FFX B;  2YXY A;  1PNM A;  2V4D A;  4BIZ A;  2DJV A;  5IJ0 A;  3SYA A;  1SER A;  2RQ6 A;  2B9Z A;  1VMG A;  5EIB C;  5EZY B;  4J9Y B;  1IBM B;  1PNK A;  4IIJ B;  2ZXW B;  3OUF A;  3P32 A;  4DR1 O;  5TIS Z;  3RYF A;  3K57 A;  2JGD A;  4CBC A;  3ZN1 A;  1XRE A;  2HJF C;  3CS5 A;  3O65 A;  4NTY A;  2YXH A;  1KBH A;  3HKD B;  3B40 A;  3OGI B;  1ENV A;  4UCU A;  2CE4 A;  1IZ3 A;  4MW3 A;  2M6Y A;  3M99 B;  3T1C A;  5K1P A;  2LQT A;  4MTF A;  2HG5 C;  2CTW A;  2YXL A;  3A0R A;  1WA8 A;  4JI4 B;  1VQ5 V;  4JYA O;  2X6B A;  1S5J A;  3FD9 A;  2Q67 A;  1AB3 A;  4LC1 A;  4TV9 A;  1VQ4 V;  1I7F A;  5LOV B;  1GM7 A;  3KZI Z;  2IH3 C;  4BR6 A;  4DR5 B;  1Y76 A;  2WLL B;  1SQP H;  3FB8 C;  1FJG B;  5B1A C;  3K06 A;  4YY3 O;  3TK1 A;  4BIU A;  1N36 O;  2JDI G;  1DK1 A;  4DK0 A;  1EN6 A;  2ETN A;  2F4V O;  5E79 Z;  3HKB A;  5LGN A;  4DV1 B;  3T4Z A;  1X4T A;  5J2U A;  5FPO A;  1ZL8 B;  3T2M A;  1QLE B;  2BSK A;  3A0H Z;  5IJ9 B;  3THO A;  4DYL A;  2K1E A;  4JI5 O;  3GB7 C;  1Z5V A;  2LFS A;  2ZIO A;  1VQ7 V;  3CSX A;  4X1Y A;  5KHK A;  4LFA O;  2KQX A;  4KP4 A;  1XHZ A;  1H8E G;  3E89 A;  4AQY B;  4DW0 A;  1R6N A;  2JGU A;  4PJ0 Z;  3ZHQ A;  4Z1M G;  3SPJ A;  4U3J A;  2Q0O C;  2QWQ B;  2BCC H;  4DUY O;  3OTO O;  1AI4 A;  4YHH B;  4JI5 B;  3L72 H;  1XI1 A;  1QVF U;  1R6T A;  4MW8 A;  3TET A;  2CTQ A;  2AHZ A;  5GON A;  3EVK A;  2P67 A;  3SPG A;  4JI6 O;  3K5N A;  2WLN A;  3ZS8 C;  3KKY A;  2D3O W;  5CN0 A;  4UCT A;  4JI6 B;  2GTA A;  2QM7 A;  3ZHT A;  4PEL A;  3ABU A;  3KCY A;  3E8H A;  2BE3 A;  2P4K A;  2BOB C;  1Y74 A;  2N04 A;  5B1A B;  3FYE B;  2E3C A;  1NT2 B;  5JCO C;  3DXR B;  4R50 A;  3LSQ A;  3TXS A;  3CX5 F;  1FFT B;  1SES A;  2Q9L A;  4B08 A;  2Y0P A;  4JYA B;  1LNQ A;  5GTH Z;  2XTA A;  4CC6 A;  2ITC C;  3APQ A;  3BA9 A;  4O4L A;  4OGQ B;  3LNN A;  1K97 A;  2UXN A;  1BZK A;  2HR3 A;  3E86 A;  4JI3 O;  4WFE A;  2VWJ A;  4PV1 B;  1U97 A;  4QE7 A;  3L9D A;  5LHI A;  2F4V B;  2QR4 A;  1H2L A;  2P4V A;  4UB6 Z;  3A2F A;  4JAS A;  4QIW F;  3LDC A;  3F7V C;  3C90 A;  2YIB A;  3SYC A;  4FLZ A;  2ZR3 A;  4QJF B;  4LFB B;  5KHG A;  2YEV B;  2Q7E A;  2JS3 A;  4PI2 A;  1Q8I A;  3CC4 V;  4GKK O;  3F5T A;  3FX7 A;  4F6R B;  1XEQ A;  4LF4 B;  3GVM A;  4Q20 A;  4BIO A;  1M57 B;  3MHH C;  1BS3 A;  1XIL A;  5IYZ A;  3OEE G;  1I5Y A;  4H0L B;  1NBM G;  4ZOL A;  3CCQ V;  4IHJ A;  2DWE C;  1KD1 W;  4WFB V;  3JAW A;  3K58 A;  2F1M A;  3JD0 A;  4X1K A;  2WLI B;  1RPR A;  2LJ2 A;  4MVQ A;  1BL8 A;  1NH2 D;  2P7T C;  3CRA A;  4TV8 B;  1MOF A;  1WP8 A;  4KHP O;  1JQ0 A;  5B66 Z;  3H1L H;  2ZE7 A;  3VQW A;  3Q4H B;  3DC5 A;  1F51 A;  5JH7 A;  3VQX A;  4FLT A;  3ASN B;  3OM3 B;  2EIL B;  2A7W A;  3A8T A;  2EIJ B;  4DV2 O;  4K3A A;  3P30 A;  5DED A;  4PDM A;  4K0K B;  3H1I H;  5B1B B;  1VQ9 V;  5GW7 A;  1OV9 A;  1AI5 A;  1O9H A;  1SZX A;  1K3E A;  1YVW A;  2AXT Z;  3W7S A;  4K0K O;  3AG1 C;  3BVO A;  4X64 B;  3IGA C;  5CBH A;  4DV2 B;  3JAR B;  3UQ8 A;  5FNV B;  4PA3 A;  1TAE A;  1I94 B;  3N2G B;  2P22 C;  1JCH A;  1ZTE A;  1QU7 A;  1XQ8 A;  1GN3 A;  3OD4 A;  1Y4M A;  2FL4 A;  2PTM A;  1BQZ A;  1VQP V;  1US6 A;  1XMQ B;  3WG7 C;  3RFR A;  4I9Q A;  3MHS C;  2LO1 A;  2E75 B;  1HWY A;  3VQV A;  4X20 A;  2KSD A;  1ZLZ A;  4LFC B;  4FPP A;  2WA3 A;  3RYC A;  1WNS A;  3HKD A;  3FYI B;  4GKK B;  2HVJ C;  1MSD A;  1BHB A;  3JSL A;  3K5M A;  3LDE A;  2PYL A;  5D5Q A;  2CH7 A;  3J81 N;  5EZY A;  1XNR O;  1BQ0 A;  3LUT B;  1N0J A;  1JX9 A;  4UCS A;  1W0K G;  2HLD G;  5ITZ B;  4AIL C;  2UXX A;  1GN2 A;  1GMG A;  2A79 B;  4W4K A;  1M56 C;  1K34 A;  2YID A;  5IYC O;  1HNX B;  2EZP A;  3B77 A;  4DRX B;  5B5E Z;  4JV5 O;  2P06 A;  5JJE B;  2X0L A;  4X1I A;  3ZIA G;  2DQ0 A;  3JD3 A;  5EC2 C;  4ZKI A;  4Z1V A;  2EBO A;  4KXR A;  3W7W A;  1PKX A;  3ZBH A;  1NTZ H;  2Q6A A;  4ZBM A;  5LP6 A;  2AHY A;  4G28 B;  4MVR A;  4B3T B;  1HNW O;  2Y48 A;  3QF7 A;  3HR0 A;  2EIL C;  2DYR C;  5LYJ B;  2PI4 A;  3ML0 A;  4JI0 B;  1LUV A;  2GBO A;  3RT3 C;  1FYJ A;  4LF5 B;  3BRC A;  3FB6 C;  1VF7 A;  4HNA A;  4RUE A;  2B5U A;  2YIB D;  2VQF O;  3BAB A;  1IDS A;  3JAS B;  2Y4T A;  2A06 H;  2O57 A;  1KU9 A;  1UFI A;  1RSO B;  3ZCC A;  4O2B A;  3EFF K;  1W59 A;  5LP6 B;  5KUK A;  3ZMT A;  2RNB A;  3QNE A;  4FZ1 A;  2Q0A A;  4X62 O;  3IC7 A;  1YJN V;  4YHH O;  1HDJ A;  1G4Y B;  3ZX6 A;  1PL0 A;  4J7K A;  1PL4 A;  1RM1 C;  2ILM A;  4IT5 A;  1IXB A;  4DR4 O;  3W7U A;  2CDY A;  4D7T A;  1SQF A;  3ZHV A;  4DV7 B;  3CCU V;  1O9G A;  4YIO A;  2Y0I A;  5J2U B;  4JI7 B;  2EUL A;  3AK1 A;  5CA0 B;  2HEP A;  4CS3 A;  1JVM A;  3TGU H;  4LFA B;  1SZT A;  4LF8 B;  1R3L C;  1E1Q G;  4LBE C;  1M56 B;  3NXS A;  3ASO C;  1I08 A;  1M4U A;  1WPX A;  1TUB A;  1VQ6 V;  2OTJ V;  1JOY A;  4DR6 O;  4DR6 B;  1NS1 A;  4WCE V;  3DSQ A;  1J5E B;  4MTG A;  2W0F C;  4FMT A;  1Z2G A;  2XUM A;  1IVS A;  4LWS A;  2WLH A;  1F4N A;  4JI7 O;  1EZV H;  2WLJ A;  3H9V A;  3E22 B;  5BMV B;  3AG4 C;  3EHB B;  3EXA A;  1CXZ B;  3CME V;  2K9P A;  4OPA A;  2RDC A;  3JAT B;  2CH7 B;  2JGD B;  4WFA V;  1YJW V;  1SET A;  4FLW A;  1OCO C;  2HJD A;  2JK5 C;  1N8R W;  2QEX V;  3T1Y B;  1AJP A;  3STL C;  5JQG B;  2A9H A;  4NKG B;  1S0V A;  3LSU A;  2YS8 A;  3HKE A;  5LMU O;  2VQF B;  4DV0 O;  4UFZ A;  4DK1 A;  4NVP A;  1GN6 A;  1S72 V;  3CCJ V;  2Q7H A;  2IJK A;  3SYQ A;  1UJW B;  4G2K A;  3BPZ A;  2M7W A;  4O2B B;  2AW9 A;  2DWD C;  1KKD A;  1Q6U A;  5IE9 A;  5HFL A;  3T1H O;  2ZT9 B;  2DMX A;  4EB6 B;  2EIN C;  4LF7 B;  4CH4 A;  4K35 A;  4JPR A;  2RN9 A;  2Y4U A;  3J7A U;  4RWU A;  5LHH A;  3B4S A;  2KB1 A;  3FKS G;  4GKJ B;  2P5O A;  3CJH A;  3H1J H;  3ZMS A;  4OX9 O;  5C8Y A;  1KQS U;  3CYO A;  5EBM C;  3H01 A;  1LUW A;  1YTF B;  4XDK A;  1I94 O;  4ZIB A;  4UUJ C;  5B3S B;  3JAL B;  3LSS A;  3BY6 A;  3CCE V;  5H5N A;  3U0Z A;  2FML A;  3SPI A;  1YEW A;  3ETQ A;  2ZE6 A;  4X1Y B;  4O4J B;  2UUC B;  4JI2 B;  3L73 H;  2PF4 E;  3SJQ C;  3OMA B;  5IJ9 A;  1Q6H A;  3BHP A;  1P4R A;  4JI8 O;  2F93 B;  4JF3 A;  2IH1 C;  4MVM A;  4GZR B;  3E83 A;  3PN1 A;  4NXM O;  1QHT A;  1K8A W;  1I0H A;  2N05 A;  4YJ2 B;  1D5N A;  4LFC O;  4DV5 B;  4QE9 A;  1ORQ C;  5L3B A;  1OCO B;  3HKC B;  4X65 B;  4L8J A;  1HR0 O;  3N27 A;  5J2T B;  4MS2 A;  4F6R A;  2B1I A;  5BMV A;  3K03 A;  2XHB A;  4MVS A;  1EFR G;  3G6E V;  5KAF Z;  2V7Q G;  3W7X A;  1MZE A;  3CXC U;  1SKV A;  4X65 O;  1AP6 A;  4HYO A;  2WSS G;  1W2B U;  2MW2 B;  1XMO O;  5CB4 A;  1VF6 A;  4U7O A;  3OR7 C;  1WA8 B;  1N33 O;  3D36 A;  1FS0 G;  2QJ1 A;  1NTK H;  1B3Q A;  4CS2 A;  4F4L A;  2L6L A;  1THZ A;  2XAS A;  2OCC C;  2ARH A;  4MTO A;  2BOC C;  2RJZ A;  4WFF A;  1N34 B;  2QTO A;  4WFH A;  1EN4 A;  1DTO A;  1P49 A;  1QQC A;  3AG2 B;  3JAK A;  1M93 A;  2CAZ C;  4YJ3 A;  1XBL A;  4O2A B;  1JA8 A;  4ZI7 A;  1NTM H;  3ASN C;  3TJT A;  1AR1 B;  1BMF G;  2ADQ B;  1OCR B;  4PI0 A;  1GK9 A;  3OW2 U;  4J7Z A;  1AJQ A;  5H9C A;  4FLX A;  1D2D A;  3K3W A;  4B3M B;  3P3N A;  1IUR A;  1TA8 A;  1A32 A;  1TGO A;  1MAB G;  2ZXW C;  1AI6 A;  1N0N A;  3OAA G;  2PZS A;  3SJA C;  1K92 A;  5KMG B;  3QO5 A;  3TXQ A;  3K59 A;  1V54 B;  3WB2 A;  2R9I A;  3JSN A;  4TV8 A;  4IGG A;  2Y69 B;  4XBF A;  2UXC B;  2JEU A;  4JYB A;  4EEQ A;  2WLI A;  5GON B;  4GX5 A;  1H2M A;  5A9G A;  1BCC H;  2Q68 A;  1EM1 A;  1V54 C;  3ABT A;  3SPH A;  1S76 D;  5FPR A;  3RYH A;  1MSW D;  3FAV A;  1PD3 A;  4AI8 A;  3LDD A;  5KHI A;  1M9N A;  1F4M A;  5LMU B;  3B2E E;  4WBN A;  1DF5 A;  2CGO A;  4HZ3 A;  1Y76 B;  1SQB H;  1JPX A;  1XHX A;  2LW7 A;  3IJ4 A;  1FXV A;  1MZF A;  4UXN A;  4B7E A;  4U3F H;  4FLY A;  4N21 A;  3OTO B;  4JYC A;  5KMG A;  3ETD A;  1MMM A;  2OCC B;  3OMN B;  4X1K B;  3STZ C;  4U7N A;  3DTU B;  1I5X A;  3LNM B;  4JYY A;  1AVM A;  3RVY A;  4P30 A;  4QNH B;  1HNZ B;  3BAA A;  3JAT A;  3G71 V;  1N32 B;  3ABL C;  4BAY A;  5EC1 C;  4UCR A;  1MA1 A;  1EN5 A;  1PP9 H;  2Q73 A;  4X9Q A;  3E8B A;  4JI1 B;  1F23 A;  5LL6 Y;  2GTS A;  1J5E O;  3NR7 A;  3CD6 V;  1K73 W;  1VF6 C;  3F7Y C;  5JCO A;  2UXB B;  2HVK C;  4YIP A;  1Q82 W;  5DN6 G;  1N36 B;  1FFX A;  4DR7 O;  1E1R G;  2JIZ G;  2E5L O;  4CS4 A;  1OCZ B;  3ZHS A;  1TUB B;  1N32 O;  3QO7 A;  4O4H A;  3K9A A;  1AR4 A;  3D3Q A;  3SPC A;  4DV6 O;  2OTL V;  2ZD9 A;  3VQY A;  4QPK A;  1FPO A;  5E1A C;  2LGQ A;  1HNZ O;  1CPY A;  3ICX A;  1XL4 A;  1JFF A;  1QBZ A;  1KP2 A;  3N2G A;  3OT7 A;  4JI4 O;  5CA0 A;  2PUS A;  2LFR A;  2FB5 A;  4LH7 A;  3BCC H;  1S3J A;  1SF9 A;  1PM9 A;  4B3M O;  1NZ6 A;  4G27 B;  4B7K A;  4YJ2 A;  2OIE A;  4CH3 A;  5EIB D;  1NKD A;  3ZED A;  1QVG U;  4DV3 B;  2PY5 A;  3RYH B;  3X2Q C;  4UVA A;  4EFE A;  4YXW G;  4DUZ B;  2QE7 G;  1M5I A;  4DR1 B;  2JS5 A;  4FLV A;  1EBO A;  5CMU A;  4J11 A;  1RFY A;  2FKX A;  4BW5 A;  2H3O A;  1RSO A;  5B1B C;  2OYQ A;  4UCO A;  3L71 H;  3UO3 A;  1FJG O;  3OUS A;  3JAS A;  1HNW B;  3AG1 B;  1OCC B;  2BSK B;  1K5Q A;  3D3I A;  4I7Z B;  1SA0 A;  5B1N A;  3GWO A;  3SYO A;  4FFK A;  4IL6 Z;  4PA4 A;  4JZ2 A;  1NR7 A;  1FXH A;  1YI2 V;  4O4I A;  4CZZ A;  4NB5 A;  2NN4 A;  5JJJ B;  1DF4 A;  2A0L A;  1FXK C;  3AEI A;  4I55 A;  2GUZ B;  5LGT A;  3AG3 C;  1Q5O A;  1XOU A;  1H2K A;  3ABK C;  4O2A A;  5LA6 A;  4NXN O;  1VIB A;  3GWK C;  5LOV A;  5IY5 C;  3CWB H;  3ZRW A;  1QNM A;  2DQ3 A;  3TCU A;  5DM6 V;  2UXD O;  1AI7 A;  1GAX A;  5KLV H;  1H38 A;  4TQD A;  4EFB A;  3IFX A;  3HPL C;  3IC9 A;  3OMI B;  4P2Z A;  4WFG A;  2PI5 A;  2YIC A;  3G6B A;  3I55 V;  3JD2 A;  1K4D C;  3ZJZ A;  3CB2 A;  2QKC A;  4O4L B;  1GKF A;  2E74 B;  5CA1 A;  4FIP C;  1QCE A;  2IW5 A;  3L70 H;  5EYP A;  4LF9 O;  4YJ3 B;  1S77 D;  1OZ0 A;  4LF6 O;  1R3K C;  4OX9 B;  2IJJ A;  1K7D A;  3IAY A;  4TV9 B;  2ODM A;  2NR5 A;  1SC5 B;  4LCU C;  4ASU G;  3H1K H;  1JR9 A;  2P90 A;  4TOI A;  2JJ2 G;  1FXK B;  4PA7 A;  4DW1 A;  4MVU A;  3AG2 C;  3ETE A;  2F66 C;  1TVK A;  2FTK A;  3KG2 A;  5BR8 B;  4JAA A;  1Q43 A;  1Q81 W;  1AIL A;  1NI8 A;  4I0X A;  4JI8 B;  1YIJ V;  4Q6G A;  5KAI Z;  4UB8 Z;  5FNV A;  5J2T A;  3OEH G;  1SS3 A;  3AK3 A;  1H2N A;  2CGN A;  3RW0 A;  3CJH B;  2E76 B;  4FM1 A;  4LNU B;  2FYU H;  4GCZ A;  3MDS A;  2UXD B;  1GH6 A;  4O4I B;  2OT5 A;  4NXN B;  4UCV A;  1R73 A;  5CBG A;  4HAM A;  2JEX A;  3T1Y O;  3X2Q B;  1KUQ A;  2XAG A;  4H33 A;  1T5E A;  5LXT A;  4XDL A;  4ICG A;  3WU2 Z;  5L3C A;  2UUB B;  1M57 C;  1E79 G;  1NJI W;  5LA6 B;  1VQ8 V;  3R66 A;  2QDO A;  2Y69 C;  2ITD C;  5JJN B;  3OE7 G;  2LP7 A;  4IYH A;  5IWA B;  2QWP B;  3JAW B;  2UU9 B;  4GX2 A;  3CRC A;  1BHA A;  3G80 A;  3HKE B;  2ZM6 O;  2IJI A;  1AJN A;  1ZAU A;  1G1X B;  3CPW U;  1YZB A;  3I5D A;  3MAQ A;  1OCZ C;  3D36 C;  4B3S B;  5B3S C;  4I0X B;  2VS0 A;  4DUZ O;  3PJS K;  1IBL B;  1J95 A;  4I50 A;  5AG2 A;  4P9P A;  1PNL A;  3C3S A;  3HB3 B;  2WPD G;  3OGC C;  1P7G A;  3CCV V;  2ZDI C;  2QWR B;  1OCR C;  2Q69 A;  3SGI A;  2QKS A;  3SDL A;  2AGA A;  4K8Z A;  4X1I B;  5FL7 G;  4R8C A;  5JQG A;  1MNG A;  5IT9 N;  3UM7 A;  1KMI Z;  2ZCE A;  3RYF B;  2QGN A;  4MVO A;  2WAM A;  1KEC A;  4ZI7 B;  1YDX A;  2Z5U A;  5ITZ A;  1R6K A;  3G4S V;  3HKC A;  1NQT A;  1MG1 A;  2JJ1 G;  4J42 A;  5F2V O;  2IBZ H;  2HKO A;  2EIM B;  5A2Q N;  1Y6X A;  2DE0 X;  2XAF A;  3N2K B;  4DO2 A;  1V9P A;  3AG7 A;  2HP8 A;  1XDC A;  4LF5 O;  2VRZ A;  4FJC C;  1K9M W;  1VQN V;  4X89 A;  4O4J A;  3UKM A;  4BWA A;  4PDV A;  2OIG A;  5L3G A;  3T4D A;  1X59 A;  5EBL C;  4ZHQ B;  2LGW A;  2LW1 A;  1VQO V;  3BFR A;  3E35 A;  4MVZ A;  5H2F Z;  5JVD B;  2GUZ A;  4WBN B;  4DR4 B;  5FLX N;  4HBN A;  1V55 C;  2R70 A;  1WPB A;  2YDE A;  2A3Q A;  2ZR2 A;  3BA8 A;  3SJC C;  4U3J B;  1YHQ V;  2E5L B;  2EJ7 A;  4K8X A;  1BGY H;  5IY5 B;  4FFB A;  2F43 G;  3CCR V;  3RN4 A;  4DR2 O;  1WJZ A;  4H13 B;  2AZ2 A;  2AZ0 A;  4CH6 A;  3FFQ A;  4DV1 O;  3D8C A;  1GM9 A;  3KCX A;  1SQV H;  3G67 A;  3RGB A;  4FVM A;  1Q6I A;  5LP6 C;  5EK0 A;  2Z0A A;  3A0B Z;  4PD4 F;  4YY3 B;  2HHH B;  4JI1 O;  5KA5 A;  3ZHU A;  3K08 A;  3JD1 A;  3QG5 A;  4H37 A;  4TUY B;  4UV9 A;  4W4L A;  4DR5 O;  1AP5 A;  1VAR A;  5CBF A;  5LBQ A;  2ZNI A;  2D2C B;  4X88 A;  4J7J A;  2QA4 V;  3VOU A;  2F23 A;  2UU9 O;  4GX0 A;  4J41 A;  1XL6 A;  2X7R B;  1BE3 H;  2BTO A;  1YCI A;  2WLL A;  2XT9 A;  2ZDI A;  3S3W A;  3O9O A;  3ZN0 A;  4NR1 A;  4F6E A;  4TT3 G;  2P6J A;  4JV5 B;  5BZB A;  4Z2W A;  2YI9 A;  1U96 A;  4GUN A;  3CC2 V;  1ZX3 A;  4AHC A;  2IJH A;  4ZHQ A;  4X8A A;  2IU0 A;  3F5W C;  4J80 A;  1Q86 W;  1H8H G;  2BTQ A;  3ABL B;  2CK3 G;  3BEH A;  3RYC B;  3UT5 A;  3RBZ A;  2PGG A;  1CEZ A;  3ZMZ A;  4QPJ A;  5K1X A;  2HFE C;  3JYC A;  1KC8 W;  1VP7 A;  1N33 B;  1R1B A;  1Y67 A;  5JWP A;  3JAK B;  3WB1 A;  1L0N H;  2YI8 A;  5IJ0 B;  1M90 W;  3U11 A;  1BT8 A;  2Q8V A;  3ABK B;  4FK5 C;  1ZWI C;  3ZRV A;  1R3I C;  3M7M X;  1GO3 F;  3CRQ A;  3JAR A;  1WN7 A;  4N23 A;  4PHZ A;  1PPJ H;  3RYI B;  1XMQ O;  3K0D A;  3AK2 A;  2DYS C;  2QM4 A;  3UCS C;  2JRI A;  4LF6 B;  1YJ9 V;  4DR3 B;  3ASO B;  4TWK A;  5D5P A;  3SJB C;  2GSM B;  1Y74 B;  4LF4 O;  2EJR A;  1G6U A;  1OHH G;  4ABM A;  1OCC C;  3SYP A;  2EZO A;  2YC0 A;  1JJ2 U;  1NVP B;  4TQF A;  5IDJ A;  3ZRW B;  1N34 O;  4JI2 O;  2EIJ C;  1R3J C;  3WB0 A;  2Z3Y A;  3FAV B;  4B3R O;  1GM8 A;  3CRM A;  2G38 A;  1VQK V;  4FFB B;  1ARO P;  3S3X A;  3UO2 A;  5GTI Z;  1IBK B;  4EB6 A;  4DR3 O;  5J9P C;  1XMO B;  4I55 B;  4KHP B;  4GT1 A;  4GX1 A;  4TSF G;  2QM8 A;  2WA4 A;  4JI3 B;  1TUE B;  1GN4 A;  3JAL A;  4X66 B;  2DYR B;  4FM2 A;  2QSA A;  2KG7 A;  2XOK G;  1PV0 A;  4UVB A;  1HR0 B;  1RP3 B;  2RCV A;  3ZMV A;  2B1G A;  4LF7 O;  4JTD B;  2IU3 A;  4UVC A;  3ABM B;  5C8Y B;  3E8G A;  3T1H B;  3QO8 A;  4I4T B;  5KUM A;  3CRR A;  3ETG A;  1NH2 B;  4E2L A;  4NXM B;  3RVZ A;  1Q7Y W;  3E2E A;  5C93 A;  1RPO A;  3CC7 V;  3ZRX A;  3JCZ A;  2CTP A;  2XND G;  2YUA A;  3CE2 A;  1YTF D;  4DXW A;  4LFB O;  2HHH O;  2DOS A;  4GYC B;  4FM0 A;  4IHJ B;  5LYJ A;  1VF5 B;  1N4C A;  2VQE B;  1NVP D;  3L74 H;  5KX5 A;  2Q5Z A;  5CA3 A;  1L0L H;  2NLJ C;  1H2S B;  4RQF A;  4A5U B;  3I56 V;  1DGS A;  3E22 A;  4OXS A;  3CEI A;  4FLU A;  4DV3 O;  1GRJ A;  4JTC B;  1JFF B;  2Q7G A;  3UT5 B;  2DW4 A;  4LWS B;  1YXB A;  2ZE5 A;  2EIK C;  3M8A A;  3RWR D;  1VQM V;  4O4H B;  4UV8 A;  2BTQ B;  4P9O A;  2EIM C;  2L35 A;  2F95 B;  1UPG A;  1IXM A;  2PYJ A;  4MSW C;  5KHH A;  4AQY O;  1WP7 A;  2H8P C;  2N74 A;  4KUM A;  3N2K A;  2DN9 A;  3AG4 B;  5KX5 B;  4NYK A;  4LP8 A;  4DV6 B;  1K33 A;  3B8N A;  2KKW A;  3R65 A;  1COW G;  3SR2 C;  1YSC A;  1K4C C;  3U10 A;  3W7T A;  3K9S A;  2VWK A;  4FZ0 A;  2UUA B;  5BXZ A;  4DR7 B;  5CA1 B;  4IYI A;  3AG3 B;  4IIJ A;  3FB7 C;  4D7S A;  3CHX A;  1M1K W;  2X6A A;  5HFM A;  4DV0 B;  3DC6 A;  5BY1 A;  1VQL V;  2UXB O;  3B8M A;  3DXR A;  1P7B A;  1QR9 A;  1AR5 A;  4LF8 O;  4RAI A;  3CCM V;  4DR2 B;  4X20 B;  5IYD O;  4DV4 O;  4KFM A;  1ZUQ A;  1RM1 B;  2NNU A;  3Q4H A;  1FKA O;  2ZQM A;  4DUY B;  2CTR A;  4J10 A;  1WAZ A;  3K04 A;  4PA9 A;  4QGP A;  2ZE8 A;  1YIT V;  2WLK A;  3CCS V;  4JGS A;  4PDR A;  2XAQ A;  3J80 N;  2GHY A;  4HNA B;  1ZSP A;  2W6J G;  4MT8 A;  4X62 B;  4JAV A;  4DV4 B;  3QVN A;  2CUG A;  1BSM A;  3WFV A;  2DYS B;  1B6Q A;  2QTS A;  1K5S A;  2ZIN A;  4KL1 A;  1SQQ H;  1OJH A;  4E4E A;  1KB9 F;  1KP3 A;  3OFN G;  4TUY A;  3JAM N;  1YF2 A;  2GDS A;  3K5O A;  5EBW C;  3ZRS A;  1FAF A;  4MTX A;  2ZIM A;  5KHJ A;  4L87 A;  4EKW A;  5IYB O;  4B3S O;  2UUA O;  1NU1 H;  4JI0 O;  4WF9 V;  1S5H C;  1KKC A;  3CXH F;  1FXK A;  3RYI A;  2OWO A;  4B3T O;  1ROP A;  2MK3 A;  3L75 H;  4DV7 O;  1ZL8 A;  2UXC O;  5LMN O;  2R72 A;  4C7U A;  4ZOL B;  2UUB O;  4NTX A;  2Q4P A;  2WWW A;  5DEC A;  5IYZ B;  3QTC A;  1Z5W A;  3OTF A;  1WB7 A;  1QLN A;  4XDJ A;  4JZG A;  3JCU Z;  1DLB A;  3JD4 A;  3K5L A;  2C2A A;  3ZHR A;  1HW7 A;  2QWO B;  3E8F A;  3FB5 C;  4RUF A;  1TVK B;  2V1D A;  4JTA B;  4PA6 A;  4PDL A;  4BW9 A;  1GTO A;  1XNQ O;  4CH5 A;  1XNR B;  3MD0 A;  2H94 A;  2VQE O;  1IBL O;  1SQX H;  4DRX A;  4LR3 A;  2XAH A;  4I5S A;  5LGU A;  1IBM O; 
#chains in the Genus database with same CATH homology
 1WLE A;  1DF5 A;  1SRY A;  3K79 A;  4HZ3 A;  2ZR2 A;  5LHG A;  1YHQ V;  4FPP A;  4R7C A;  1JPX A;  3FYI B;  5IY5 B;  1FXV A;  2F43 G;  3CCR V;  1L1F A;  4UXN A;  1EZJ A;  5H6R A;  3VBB A;  4N21 A;  1W0J G;  3WG7 B;  4JYC A;  2HVJ C;  1GM9 A;  3ETD A;  2OCC B;  3CP1 A;  1BHB A;  5EK0 A;  3LDE A;  3OMN B;  4I9W A;  3STZ C;  2EIK B;  4U7N A;  3DTU B;  1I5X A;  3LNM B;  3RVY A;  4P30 A;  4QNH B;  5KA5 A;  3OR6 C;  3LUT B;  3K08 A;  1JX9 A;  3G71 V;  1NR1 A;  2ATK C;  1W0K G;  3JD1 A;  4H37 A;  2HLD G;  3ZMU A;  3ABL C;  4BAY A;  2EIN B;  2UXX A;  4UV9 A;  5EC1 C;  1Y66 A;  5L3F A;  5CBF A;  1GMG A;  2A79 B;  5LBQ A;  4R6Z A;  1M56 C;  1K34 A;  4X88 A;  2QA4 V;  3E8B A;  3VOU A;  5IYC O;  1F23 A;  4GX0 A;  2EZP A;  3B77 A;  3K0G A;  1XL6 A;  2X7R B;  5H6Q A;  3CD6 V;  1K73 W;  3F7Y C;  2X0L A;  3CCL V;  2WLL A;  2WLM A;  3ZIA G;  2DQ0 A;  2ZDI A;  2HVK C;  3JD3 A;  3ZN0 A;  5L3E A;  5EC2 C;  4ZKI A;  1Q82 W;  2EBO A;  5DN6 G;  4TT3 G;  3W7W A;  1PKX A;  2P6J A;  4RQE A;  2Q6A A;  5BZB A;  4ZBM A;  3CC2 V;  4J9Z B;  1E1R G;  2JIZ G;  2AHY A;  4G28 B;  4MVR A;  2IJH A;  1OCZ B;  2Y48 A;  3ABM C;  4X8A A;  2IU0 A;  3F5W C;  2W6I G;  2EIL C;  2DYR C;  3QO7 A;  2X6C A;  1Q86 W;  2PI4 A;  3ML0 A;  3K9A A;  3SPC A;  2OTL V;  1H8H G;  2ZD9 A;  4JAU A;  4QPK A;  5E1A C;  3ABL B;  5B1O A;  2CK3 G;  2YEV A;  3BEH A;  1CPY A;  1QR8 A;  1QBZ A;  1XL4 A;  3FB6 C;  1KP2 A;  1QLE C;  1H2G A;  3CMA V;  3RBZ A;  5KA6 A;  1CEZ A;  4RUE A;  2B5U A;  2LFR A;  2XAJ A;  3ZMZ A;  3DGE A;  2R9R B;  1CP9 A;  2YSU B;  1S3J A;  4QPJ A;  2HFE C;  3JYC A;  4G27 B;  1KC8 W;  4RO2 A;  3ZCC A;  3EFF K;  1V55 B;  1NKD A;  5KUK A;  1G8M A;  5L3D A;  3ZMT A;  1QVG U;  3QNE A;  1M90 W;  3X2Q C;  3IC7 A;  1YJN V;  1PNM A;  1G4Y B;  4UVA A;  4BIZ A;  4YXW G;  1PL0 A;  2QE7 G;  3SYA A;  1SER A;  3ABK B;  1EBO A;  5CMU A;  4FK5 C;  4J9Y B;  1ZWI C;  3ZRV A;  1RM1 C;  1R3I C;  1GO3 F;  1PNK A;  4BW5 A;  5B1B C;  3W7U A;  2ZXW B;  3OUF A;  4N23 A;  3P32 A;  3K0D A;  3OUS A;  3CCU V;  1Q7Y W;  4CBC A;  3AG1 B;  2DYS C;  3ZN1 A;  1OCC B;  2HJF C;  1YJ9 V;  1K5Q A;  3ASO B;  3D3I A;  4TWK A;  5B1N A;  3GWO A;  1JVM A;  3SYO A;  2GSM B;  1SZT A;  4PA4 A;  1NR7 A;  1FXH A;  1YI2 V;  2EJR A;  1ENV A;  1R3L C;  1E1Q G;  1OHH G;  4LBE C;  1M56 B;  4CZZ A;  1OCC C;  4MW3 A;  3SYP A;  2EZO A;  3NXS A;  1DF4 A;  3ASO C;  3M99 B;  2A0L A;  3T1C A;  1JJ2 U;  1NVP B;  1WPX A;  2OTJ V;  1VQ6 V;  1FXK C;  3AEI A;  4MTF A;  2HG5 C;  5IDJ A;  3ZRW B;  1JOY A;  3A0R A;  1VQ5 V;  2X6B A;  4WCE V;  2EIJ C;  2Q67 A;  4MTG A;  5LGT A;  3AG3 C;  4LC1 A;  1VQ4 V;  1R3J C;  2W0F C;  2Z3Y A;  4FMT A;  1GM7 A;  1GM8 A;  2IH3 C;  3ABK C;  1VQK V;  1ARO P;  2WLH A;  1F4N A;  5J9P C;  2WLL B;  3ZRW A;  5DM6 V;  3TCU A;  2DQ3 A;  2WLJ A;  5IY5 C;  4GT1 A;  1AI7 A;  4GX1 A;  4TSF G;  2QM8 A;  3FB8 C;  1H38 A;  3AG4 C;  3K06 A;  5B1A C;  3IFX A;  3HPL C;  1TUE B;  3TK1 A;  4BIU A;  2JDI G;  3OMI B;  4P2Z A;  3EHB B;  3CME V;  4WFG A;  2DYR B;  2PI5 A;  2XOK G;  5LGN A;  4UVB A;  3T4Z A;  3ZMV A;  2B1G A;  4JTD B;  2IU3 A;  4WFA V;  4UVC A;  1YJW V;  3T2M A;  3I55 V;  3JD2 A;  1SET A;  3ABM B;  1QLE B;  1OCO C;  2JK5 C;  3E8G A;  1N8R W;  2QEX V;  1K4D C;  3QO8 A;  5KUM A;  2K1E A;  3ZJZ A;  3ETG A;  1NH2 B;  1GKF A;  1AJP A;  4E2L A;  4FIP C;  3GB7 C;  3RVZ A;  3STL C;  2LFS A;  1QCE A;  1RPO A;  5C93 A;  1VQ7 V;  2IW5 A;  3CC7 V;  3E2E A;  2A9H A;  3ZRX A;  4KP4 A;  3JCZ A;  1S0V A;  2XND G;  1YTF D;  1S77 D;  1OZ0 A;  1H8E G;  4DXW A;  1R3K C;  2IJJ A;  1K7D A;  3E89 A;  1R6N A;  1S72 V;  4LCU C;  4Z1M G;  3CCJ V;  4ASU G;  3SPJ A;  1NVP D;  2IJK A;  3SYQ A;  2P90 A;  1UJW B;  4G2K A;  2M7W A;  5CA3 A;  2NLJ C;  4RQF A;  2DWD C;  1KKD A;  2JJ2 G;  3I56 V;  1AI4 A;  1FXK B;  4PA7 A;  4OXS A;  1QVF U;  4MVU A;  5HFL A;  4MW8 A;  4JTC B;  3TET A;  3AG2 C;  3ETE A;  2AHZ A;  2EIN C;  2FTK A;  2DW4 A;  2P67 A;  3SPG A;  3KG2 A;  2EIK C;  1VQM V;  4UV8 A;  1Q81 W;  4JPR A;  2WLN A;  4P9O A;  2D3O W;  2EIM C;  5CN0 A;  5LHH A;  1YIJ V;  2KB1 A;  3FKS G;  1IXM A;  3OEH G;  2QM7 A;  4MSW C;  3ZMS A;  4PEL A;  3ABU A;  3E8H A;  2H8P C;  2BOB C;  3RW0 A;  1KQS U;  4KUM A;  3CYO A;  4GCZ A;  3AG4 B;  5B1A B;  3FYE B;  5EBM C;  3H01 A;  4LP8 A;  1YTF B;  1K33 A;  3B8N A;  4XDK A;  2OT5 A;  3R65 A;  1COW G;  4UUJ C;  1YSC A;  1K4C C;  5B3S B;  3W7T A;  4R50 A;  3LSQ A;  3LSS A;  1R73 A;  3BY6 A;  5CBG A;  3CCE V;  4HAM A;  2JEX A;  3X2Q B;  3SPI A;  1FFT B;  1SES A;  2XAG A;  4H33 A;  3AG3 B;  3FB7 C;  1LNQ A;  1M1K W;  4XDL A;  2X6A A;  3SJQ C;  3OMA B;  5HFM A;  5L3C A;  1P4R A;  2ITC C;  1VQL V;  1M57 C;  4JF3 A;  1E79 G;  2IH1 C;  3B8M A;  1NJI W;  4MVM A;  1K97 A;  1VQ8 V;  2Y69 C;  1P7B A;  1QR9 A;  2ITD C;  2UXN A;  3E83 A;  3OE7 G;  2HR3 A;  2LP7 A;  3E86 A;  4RAI A;  3CCM V;  4WFE A;  5IYD O;  1K8A W;  4GX2 A;  4KFM A;  1BHA A;  4QE7 A;  1RM1 B;  4QE9 A;  1ORQ C;  2NNU A;  1OCO B;  5L3B A;  2IJI A;  1AJN A;  2ZQM A;  4MS2 A;  5LHI A;  3CPW U;  2B1I A;  3K04 A;  1OCZ C;  3K03 A;  4JAS A;  4MVS A;  4PA9 A;  1EFR G;  4QIW F;  3G6E V;  1YIT V;  3LDC A;  2WLK A;  3CCS V;  3F7V C;  5B3S C;  2V7Q G;  4JGS A;  4PDR A;  2XAQ A;  3W7X A;  2GHY A;  3SYC A;  3CXC U;  3PJS K;  4HYO A;  2ZR3 A;  2WSS G;  1W2B U;  1J95 A;  4QJF B;  2W6J G;  2YEV B;  4MT8 A;  4P9P A;  4JAV A;  1PNL A;  4U7O A;  3OR7 C;  3HB3 B;  2WPD G;  3CC4 V;  3OGC C;  3D36 A;  1FS0 G;  2DYS B;  3WFV A;  4F4L A;  1B6Q A;  3CCV V;  4Q20 A;  1THZ A;  2ZDI C;  1M57 B;  1K5S A;  3MHH C;  2XAS A;  2OCC C;  1KP3 A;  3OEE G;  1OCR C;  3OFN G;  1I5Y A;  2Q69 A;  1NBM G;  3CCQ V;  4MTO A;  2BOC C;  2QKS A;  4WFF A;  2QTO A;  2DWE C;  5EBW C;  4WFH A;  3ZRS A;  1DTO A;  3AG2 B;  4MTX A;  4WFB V;  1KD1 W;  4L87 A;  5FL7 G;  4EKW A;  5IYB O;  3JD0 A;  4R8C A;  2WLI B;  1RPR A;  4MVQ A;  4WF9 V;  1BL8 A;  3ASN C;  3UM7 A;  1NH2 D;  1S5H C;  2P7T C;  1FXK A;  1AR1 B;  4MVO A;  1MOF A;  1JQ0 A;  1ROP A;  1BMF G;  2WAM A;  1KEC A;  2MK3 A;  2Z5U A;  1OCR B;  1R6K A;  1GK9 A;  3G4S V;  3OW2 U;  1F51 A;  1AJQ A;  1NQT A;  5H9C A;  3ASN B;  1MG1 A;  3OM3 B;  2JJ1 G;  2EIL B;  2EIJ B;  3K3W A;  3P30 A;  2HKO A;  4PDM A;  2EIM B;  2XAF A;  4DO2 A;  5B1B B;  2WWW A;  1VQ9 V;  5GW7 A;  1MAB G;  2ZXW C;  1AI6 A;  1AI5 A;  3OAA G;  1K92 A;  1K3E A;  3QO5 A;  3W7S A;  1QLN A;  3AG1 C;  1V54 B;  2R9I A;  4XDJ A;  5CBH A;  3IGA C;  1DLB A;  3JD4 A;  4FJC C;  2C2A A;  1K9M W;  1VQN V;  2Y69 B;  4PA3 A;  4X89 A;  3E8F A;  4XBF A;  3UKM A;  2JEU A;  4JYB A;  3FB5 C;  2WLI A;  4RUF A;  4GX5 A;  4PDV A;  2V1D A;  4JTA B;  4PA6 A;  4PDL A;  1JCH A;  2Q68 A;  5L3G A;  1V54 C;  3ABT A;  1GTO A;  3SPH A;  1S76 D;  3MD0 A;  1Y4M A;  2H94 A;  3T4D A;  5EBL C;  1MSW D;  1VQP V;  3WG7 C;  1VQO V;  1PD3 A;  3E35 A;  4MVZ A;  3LDD A;  2XAH A;  1M9N A;  3MHS C;  1F4M A;  4I5S A;  5LGU A;  1HWY A;  1V55 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...