1KQSU

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1kqsU00
3CC7V 1VQMV 1YIJV 2QA4V 1QVGU 1K73W 1K8AW 3CCMV 4WCEV 1Q86W 4WFBV 3CCEV 3CCUV 3G71V 2QEXV 3CD6V 1VQ7V 1VQPV 1N8RW 1YJWV 1KC8W 1VQ5V 5DM6V 3CMAV 3CPWU 3CCSV 1W2BU 1Q7YW 1YI2V 1Q82W 1JJ2U 1VQLV 3CCVV 3CCJV 1VQKV 1VQ9V 2OTLV 1KD1W 2OTJV 1YJNV 1VQ8V 1VQ4V 3CXCU 3CC4V 3G6EV 1VQ6V 3OW2U 1YHQV 3I55V 3CCQV 1YITV 3CMEV 1VQOV 3G4SV 1VQNV 3CC2V 1NJIW 4WFAV 1K9MW 1M90W 1YJ9V 1M1KW 3CCRV 3I56V 3CCLV 1S72V 2D3OW 1R73A 4WF9V 1QVFU 1Q81W 1KQSU
chains in the Genus database with same CATH superfamily
2P5OA 2WLIB 3L71H 3JAKB 4HZ3A 1L1FA 4XDJA 1V55C 5JVDB 4LH6A 1R3IC 1Q6HA 3ABUA 5L3DA 1I0HA 2YICA 4NXMO 5CBFA 3K5LA 1DF5A 2YEVB 4O2AB 3OE7G 1T5EA 3SPHA 1N34O 1K5QA 3L75H 3ABKC 4FLZA 1GAXA 2RDCA 4NXMB 2A06H 2EIMB 4X20A 3K5OA 1N34B 4NTYA 3CJHB 4FLUA 4U7NA 2EINB 1PNLA 3N2GB 5LGUA 2HEPA 2OIGA 3OGCC 4X62O 1VF6C 1I5XA 1FXKB 1EN6A 4ICGA 2ZNJA 4JI4O 1AP5A 1JOYA 2HJDA 4OPAA 5LL6Y 2PF4E 3ZRXA 3A0RA 5H5NA 4X62B 1IXMA 5LHIA 4BAYA 4H37A 5KUKA 2QM8A 4JI4B 1E1RG 2P4VA 1SQVH 1AJPA 2QM7A 4LR3A 4J11A 3S3XA 5HFLA 1KP3A 4C7UA 1PNKA 3AK3A 1N8RW 1MABG 3PN1A 3IC7A 3LDEA 4N23A 2WLHA 2F43G 2ZR2A 3D36C 2A9HA 3OAAG 1Q43A 5KMGA 2Q69A 4EKWA 4Z1MG 5IYCO 4YJ3B 3K08A 1X4TA 5CA1A 2UUBO 2BSKA 5KHIA 3AG1B 4DW0A 1B06A 2Q0OC 3ZRWB 5B66Z 2Y69C 4FMTA 5ITZA 1AILA 2KB1A 1BQZA 3HPLC 3I5DA 4DR2O 2ZXWB 3JALA 2UUBB 1DLBA 5J2TB 2EIMC 3MAQA 1D2DA 5IE9A 2F66C 4PDMA 4JF3A 1JJOA 4PDVA 5GTHZ 1R3LC 5KHHA 1R6KA 2A3QA 4ZKIA 3LSUA 4DR2B 4OGQB 2P90A 4EEQA 5LP6B 4NTXA 1FXKC 2JVDA 2BCCH 2RQ6A 2ODMA 1MA1A 3OR7C 4RQFA 4CH3A 1SC5B 3RYCB 4DK1A 1OCOC 4Q20A 4D7SA 4DV2O 2E74B 5C93A 1HNWO 4PA4A 1DK1A 5H2FZ 2UXDB 3SJBC 5JJNB 2BOCC 3K5MA 3E86A 3GB7C 4DR4B 5FNVA 4W4LA 1W59A 3CRCA 2FKXA 1XHXA 2BTOA 2CTWA 4MVZA 4DV2B 4Z2WA 2YIDA 1HNWB 3JSLA 1M90W 1N33B 2DE0X 2BE3A 3E83A 1Q81W 3SYCA 2LW1A 1YIJV 1VQMV 1H8HG 2ADPA 1B6QA 3K03A 3AG1C 1VF6A 2RN9A 4JI3O 4YY3O 1VQLV 2QWQB 3N2KB 2H3OA 4UVCA 5F2VO 3T1HO 1E79G 1TVKA 4I55B 3FAVA 2OYQA 2MK3A 1URFA 1NJIW 3K04A 1XI1A 1PD3A 1EN5A 4CS3A 3GVMA 4JI3B 3T2MA 2XAFA 5IJ0A 1GN2A 5KHJA 3T1HB 5JH7A 4LNUA 4EB6A 3C3SA 5A9GA 2W0FC 4AHCA 4TT3G 1VF7A 2WLIA 3JAKA 3D36A 3W7UA 4BW5A 2OCHA 5JVDA 3O9OA 4FIPC 1H2GA 2EJ7A 4KXRA 3H1JH 2GTSA 1NTKH 2YEVA 4O2AA 3CRMA 4YIOA 2LP7A 2QWOB 1DGSA 1FKAO 2WLLA 1M1KW 2IM9A 1NS1A 4I9QA 4DUZO 2Y4TA 1K92A 1XNQB 2F1MA 4IGGA 1A32A 3CCSV 2F93B 3E22A 4U3JB 3CJHA 1EN4A 2YC0A 4JYBA 3N2GA 2EIJB 1NH2B 4WBNB 4K3AA 4UCTA 3FB7C 3W7SA 1NBMG 1S5LZ 1FXKA 4X64O 4DUZB 4LFBO 1N32O 3TK1A 5KHGA 2JRIA 4UV8A 3J80N 3HR0A 4GX5A 3ZRVA 3E8BA 1BCCH 2E76B 3ZHVA 4X1YB 2Q7GA 4X64B 3G6BA 5EIBC 2GUZB 4LFBB 3R66A 5LOVA 3OW2U 3CWBH 4LF9O 1N32B 3SPJA 4TWKA 3CRQA 4FFBA 1PM9A 3CCLV 1MZEA 2OT5A 4KHPO 4UXNA 2XT9A 1FFTB 2ZM6O 1M56C 4ZI7B 4HNAA 2X0LA 1M57B 2V7QG 2YSUB 3IFXA 1HR0B 1K7DA 3QO5A 4KHPB 4B3MB 3R65A 1WP8A 3CCRV 2ZM6B 4JYYA 2Q9LA 1GN6A 2ITDC 4CH5A 1Q3EA 1ENVA 4GLXA 1R3KC 3J81N 5EK0A 5B1OA 4K8XA 1BE3H 3CXHF 4FM0A 2QWPB 4TV8B 4DV0O 2EIJC 4DV6O 5JCOC 5IYDO 1ZAUA 3EHBB 3RGBA 1YTFD 5LP6A 1HWYA 4XDKA 3CCEV 3DXRB 5B3SB 1GH6A 4IIJB 3UO3A 2QDOA 3ZMVA 4B08A 3HKEA 3TJTA 1SETA 4K8ZA 1FYJA 5L3EA 2IU0A 4DV0B 3UT5B 3RYCA 1AB3A 2CTRA 4DV6B 2X7RB 3G6EV 2DMXA 1RPRA 5GTIZ 4X9QA 3CCUV 2QWNB 1Q6IA 1EM1A 5LBQA 2E75B 2KG7B 2AGAA 5FPOA 2ZCEA 4NYKA 1K3EA 5LYJB 1P49A 3U10A 1XDCA 1NR1A 4DV7O 5IY5B 4RAIA 1L0LH 1ZWIC 2EIKC 4GX2A 4K0KO 2UXXA 3VQYA 4LF7O 4Q6GA 2ZIOA 4FLWA 3KCXA 4PD4F 4DV7B 3UKMA 4LF4O 4GKJO 1Y76B 3UQ8A 3GWKC 2NNUA 4I55A 4LC1A 4K0KB 3BA9A 4DR5O 4LF7B 1G6UA 3P3NA 4J7ZA 2YI9A 3MHHC 1ZL8B 4B3TO 1UPGA 2CGNA 5KAIZ 4LF4B 1Z2GA 4GKJB 1OCZB 3ZIAG 3CCMV 3E89A 2H94A 3Q4HB 1AI7A 3AG3B 4B3TB 2E5LO 5LHHA 3BFRA 2IH3C 3B40A 5B1AB 3OEEG 4J80A 4WFAV 3ASOC 2DYRB 4WF9V 2Q0AA 2DWEC 2QWRB 4KL1A 3OTOB 4E2LA 5LMNO 3QVNA 5LMUO 2E5LB 4FZ1A 4LBEC 3ZMUA 5IYBO 4F6EA 3RT3C 4O2BB 1GN4A 5LHGA 3BCCH 3QG5A 3FYEB 5LMNB 4ZHQB 1K9MW 2LJ2A 4GYCB 1IZ3A 4I50B 5LMUB 1XL4A 2JK5C 3CC7V 2DWDC 4U3JA 2WLJA 3SPGA 1MSDA 3JD4A 2NLJC 1FFXB 1V9PA 3CMAV 1GK9A 1NT2B 5BY1A 4WBNA 5EZYB 2B5UA 3RYHA 1NU1H 1KD1W 2QTSA 4KUMA 4WFGA 5KA6A 2LW7A 2Q73A 3L70H 5L3GA 1F4MA 3K59A 3JAWB 1TAEA 2HHHO 1EZJA 3OMIB 1VF5B 3DSQA 2EX3A 2FB5A 3ZS8C 4X1YA 2XTAA 1GM7A 4GKKB 4TSFG 4PA3A 1OCZC 3G67A 2GUZA 3ZN1A 3KCYA 1JFFA 5H9CA 4MW8A 2HHHB 4MVOA 1VEWA 1OHHG 2JDIG 2H8PC 3T4DA 2Q5ZA 3W7XA 2EZPA 2XNDG 2XAGA 2EILB 1VQOV 3AG3C 1SZXA 4NTWA 4F6RA 3ZHRA 4ZI7A 1FXHA 4IYHA 2BTQB 4X66O 3JCUZ 4LF5O 1W0KG 2FYUH 3ZHUA 1NH2D 1U97A 1JJ2U 1WLEA 5E79Z 2HP8A 3CXCU 2Y0PA 2PGGA 4BW9A 2F23A 2VWJA 4UVAA 4X66B 4IHJB 4LF5B 3D8CA 2WPDG 1K73W 1IBKO 2V1DA 1WPXA 2Y0IA 1AJNA 3ZEDA 5CBGA 2ATKC 5KA5A 4P2ZA 4TV8A 1DF4A 2HR3A 2PI4A 4I9WA 1IBKB 2ADQB 5IWAO 1X59A 3U11A 4CH6A 3VQWA 1BZKA 4PI2A 1CXZB 4IYIA 3NXSA 1HP8A 4IIJA 4P9OA 3K0DA 1SA0B 2YIAA 1FJGO 2P06A 2R9AA 1XHZA 2Z3YA 1QNMA 5IWAB 3CCJV 3N27A 4DV5O 1BSMA 2YI8A 2XAHA 3CCQV 2IW5A 3L73H 1FJGB 4PELA 4DR6O 3DTUB 4JI0O 3JATB 3QTCA 5IYZB 1YXBA 1I7FA 4OXSA 1VMGA 3C3TA 1B3QA 4QPJA 2ZNIA 1XEQA 1L8DA 3E2EA 1Z5WA 4QE7A 3RVYA 1YTFB 4DV5B 4J42A 3FYIB 1XMQO 5JJJB 3W7TA 4DR6B 5BR8O 3ABTA 4DV4O 4FZ0A 1AR4A 2QR4A 2HLDG 4E4EA 1PPJH 4U7OA 1YDXA 1Y76A 4I4TB 1Q86W 4TQFA 2V4DA 3K06A 2P67A 2WAMA 3JD1A 1XMQB 5BR8B 2ZQMA 3TCUA 3JASB 1SZTA 1ZL8A 2WLMA 1R3JC 3L9DA 5EC2C 3AK2A 2G38A 4PA7A 1E1QG 4CC5A 3G4SV 4NR1A 3O65A 4R7CA 5IT9N 1VIBA 2EINC 3OMNB 4QGPA 2FMLA 1UJWB 2XAQA 3MDSA 4CBCA 1S76D 1WA8A 4H13B 3ZMTA 3CHXA 4IL6Z 2Q67A 4ZOLB 3VBBA 3WB1A 4TUYB 3A2FA 3RBZA 4O4LB 4JAVA 1RSOA 3ZRSA 3OR6C 3JD3A 4O2BA 4G27B 3P3PA 1KB9F 2GDSA 4I50A 3ML0A 4PHZA 3TXQA 1B04A 2MW2B 5EBLC 3JARB 4B3SO 1QLNA 1FFXA 1AVMA 1MSWD 2UXNA 5EZYA 1JA8A 1MMMA 1M93A 1NVPD 1RP3B 3SYQA 1S3JA 1LUWA 2R70A 3ABMB 2IJHA 3M8AA 4J10A 3X2QB 2Q8VA 4B3SB 4UCRA 2E3CA 3FFQA 4GUNA 1VQNV 2ZXWC 4DRXB 2R9IA 2AHYA 4N21A 4MSWC 1GTOA 4MTFA 3TGUH 2KQXA 4UFZA 4BIZA 1BQ0A 1SESA 4YY3B 1FS0G 2CK3G 3ABLB 4GZRB 2A79B 1GM9A 3WFVA 2ARHA 1H8EG 5FPRA 1H2NA 2IJKA 4X8AA 3K3WA 2ZDIC 5LP6C 3I55V 2XHBA 3AK1A 5J2UA 2BTQA 3K58A 1QLEB 4MVMA 2UU9O 1EFRG 3OTFA 2RCVA 5LGTA 4HYOA 5LA6B 4J9ZB 4CS4A 5LXTB 4GX0A 2M7WA 5CBHA 2CE4A 3A0BZ 4IHJA 4I5SA 4NKGB 4O4HB 2UU9B 4TOIA 1SQXH 3STZC 2ZKOA 2D3OW 3B09A 3THOA 2AZ0A 4YJ2B 1GKFA 3GWOA 3OEHG 2D2CB 1O9HA 3ASNB 3CE2A 3F7YC 1HNZO 3RVZA 2QSAA 4O4IB 1SA0A 2A0LA 3L74H 1VQ4V 2YXYA 5KX5B 5L3FA 1KQSU 1YZBA 5K1PA 2QA4V 5BMVB 5KAFZ 2N74A 1H2SB 4HBNA 4LWSB 4NVPA 2YXHA 1KU9A 1TUEB 4AILC 1HNZB 2OTLV 4MVUA 2IBZH 3VQVA 2CAZC 3RN4A 2VRZA 1AJQA 5IYZA 1K5SA 3CRRA 1VP7A 1CEZA 1ZX3A 1RFYA 3JCZA 4W4KA 3LDCA 4JGSA 3JSNA 3G71V 2R9RB 3H1KH 2JGUA 1QLEC 2AXTZ 3SYPA 1NTMH 5D5QA 1K4DC 2OCCB 4YJ3A 4LF9B 1VQKV 5A2QN 5DN6G 1P7GA 4TQDA 1OCCB 4IT5A 1K97A 2B1IA 1KKCA 1VQ6V 2GTAA 3JYCA 3M7MX 3G80A 3TXSA 4H0LB 3ZRWA 4X89A 2LQTA 1QVGU 4QPKA 4P9PA 3CS5A 3CSXA 1R6NA 2PUSA 3JASA 2KKWA 4R6ZA 4R8CA 4QJFB 3SYOA 4QE9A 5J2TA 4FJCC 4NXNO 5H6RA 1OJHA 3HKCB 5CA0B 1YITV 1GRJA 5DECA 2VS0A 2QM4A 4DR7O 2CGOA 3KKYA 2ZDIA 1WP7A 1J95A 4ZOLA 3MHSC 1OZ0A 3VOUA 3QO7A 4A5UB 3ZMSA 4O4LA 3ZHSA 4X20B 4GT1A 3KZIZ 1BGYH 1KYOF 4JI1O 4DV1O 2Z0AA 1XL6A 3KG2A 4DR7B 1H2KA 1KUQA 1KP2A 3OFNG 3APOA 3BA8A 2RNBA 3D3IA 1TUBB 4JZ2A 3ETEA 2FTKA 4LH7A 4JI6O 5C8YB 1W2BU 2W6JG 4JI1B 2XAJA 5FL7G 3ZBHA 3CCVV 1SQGA 4WFFA 1M4UA 2LGWA 2UUCO 5KUMA 3JD2A 3T4ZA 3CEIA 2OCCC 1YSCA 1NI8A 1M57C 1OCCC 4JI6B 3OD4A 2YDEA 3ETDA 1XREA 4FM1A 2JJ2G 5DM6V 3N2KA 5LGNA 4DUYO 3S3WA 1AROP 1IBMO 4MW3A 4I7ZB 4UB8Z 2IU3A 1NR7A 1VQ8V 4DRXA 4X1KB 1YVWA 2UXBO 2WA4A 1Q6UA 1QR9A 1EBOA 4P30A 1PNMA 3SJAC 2CUGA 1L0NH 4DV3O 4DUYB 1IX9A 1IBMB 2LFRA 4PDLA 4WFBV 5CMUA 2P4KA 5L3CA 4XDLA 3F5TA 4DR5B 5B1NA 1KMIZ 3FKSG 5K1XA 2YUAA 1BHBA 4LF6O 2UXBB 2P7TC 2ETNA 5IDJA 1NVPB 5B3SC 1RPOA 2DW4A 3AG2B 4G2KA 2ILMA 4DV3B 1WN7A 1D5AA 1K33A 3STLC 2CH7B 4CH4A 4LF6B 5LA6A 1FD9A 5LXTA 3EVKA 1VQPV 4X88A 1COWG 4LFAO 3BY6A 1Q7YW 3WB0A 3ETQA 4BWAA 3UO2A 4LF8O 1CP9A 3DGEA 2N04A 4G28B 2Z5UA 4U3FH 1IDSA 2P6JA 3LUTB 5IY5C 2XASA 4LFAB 1ROPA 2M6YA 4JTDB 4EFEA 2R72A 5JWPA 1M9NA 3RWRD 4YJ2A 1PKXA 3BRCA 4QNHB 4LF8B 1I08A 1AI6A 4JI7O 3CP1A 4JI5O 4J9YB 3H1HH 1OV9A 4YXWG 4KP4A 5KX5A 2EBOA 3FB5C 5BMVA 1BS3A 1GO3F 1K8AW 3DC5A 2WSSG 5HFMA 4RQEA 4DR1O 4FM2A 1YEWA 4JI7B 4JAAA 4JI5B 3F5WC 1Y4MA 3BEHA 1YF2A 3K0GA 2ZE5A 3SJQC 4R50A 4MVRA 1ORQC 1EZVH 4UB6Z 2ZINA 4DR1B 3D3QA 3PJSK 4DK0A 3I56V 3SJCC 3FX7A 4I0XB 5B1AC 3H9VA 1SRYA 2DYRC 2QGNA 3B77A 1OCRB 4PJ0Z 5JH7B 3B4SA 1S5HC 1JPXA 2WWWA 2IH1C 2DN9A 3OM3B 4PV1B 1N36O 1MOFA 4LFCO 2ZE6A 5GONB 1KKDA 4FK5C 4MT8A 4CC6A 1AI5A 2N05A 1PL0A 1SQFA 3F7VC 5H6QA 3HKCA 5CA0A 1Y67A 4K35A 1N36B 4NB5A 2Y69B 4LFCB 2PY5A 1THZA 2WLLB 3DXRA 3LNMB 3SDLA 1XOUA 5J9PC 3WG7B 3OUFA 4MVSA 3HB3B 2PZSA 3CPWU 4F4LA 3BHPA 1MZFA 2L35A 3ETGA 3UT5A 1NKDA 3P30A 1LR1A 1GN3A 3E22B 2JEXA 1Z5VA 1TUBA 1ZSPA 1N0NA 2YIBD 1XQ8A 2KG7A 3ZJZA 4ASUG 5C8YA 3LDDA 2EILC 5LYJA 2GSMB 2ZD9A 1G8MA 3APQA 2PYLA 2QTOA 1OCOB 3IGAC 3OUSA 2OTJV 5DEDA 1MNGA 4JI0B 2LGQA 2GHYA 2UUAO 4MS2A 2XOKG 1OCRC 5LOVB 2ZIMA 1W0JG 5CB4B 2JGDB 4PA6A 4FFBB 1KECA 3WB2A 4JASA 2UUAB 4X1KA 1Y6XA 1Q90D 1NTZH 4HNAB 4DV4B 1VQ9V 3RYIB 2CDYA 3FB6C 4RWUA 1YHQV 1ZLZA 3C90A 1WB8A 3ZMZA 3CC2V 1P84F 3AEIA 1V54B 1P4RA 1GMGA 3AG7A 3Q4HA 4H44B 4DXWA 4X1IB 1G1XB 1H2LA 2ZT9B 3WG7C 4J7JA 2XUMA 4MVQA 4ABMA 4WFEA 2HVKC 1Y66A 3TETA 2CH7A 4FLTA 1XBLA 1R73A 1JQ0A 1QCEA 4LP8A 4FLVA 5CA3A 2GBOA 2QKAA 2VWKA 1WNSA 2HFEC 4B3RO 3SGIA 1Q8IA 3HKEB 2UXDO 1R6TA 3IAYA 1SQPH 3B2EE 1FPOA 1HW7A 5KHKA 4ZHQA 4DR4O 1XNRO 4J41A 5AG2A 2JJ1G 1S72V 1N0JA 4X65O 1YCIA 2K1EA 4HAMA 2UXCO 1RM1B 3CB2A 4B3RB 1N33O 3HKBB 4JPRA 4PDRA 4DR3O 1XNRB 4L8JA 2F95B 3JAWA 3H1IH 4X65B 3J7AU 1PV0A 2L6LA 2UXCB 2O57A 3M99B 1HNXO 4UVBA 4D6TH 4DO2A 1IXBA 3T1CA 3DC6A 3RYFB 4BIOA 2VQFO 4D7TA 3CX5F 4DR3B 2ZR3A 4JI8O 4BIUA 2NN4A 1SKVA 2LO1A 1AP6A 2JIZG 5D5PA 3BVOA 1V54C 3L72H 4FFKA 1S77D 2JEUA 1HNXB 4JTCB 1NQTA 2VQFB 4I0XA 3EFFK 4JI8B 3CRAA 4UCOA 2CTPA 5IJ9B 4WCEV 1UFIA 2X6CA 5EYPB 2QEXV 4L87A 4FLYA 1BL8A 3FB8C 4GCZA 1JMKC 3JAMN 3FD9A 2AZ2A 3K79A 2IJJA 4H33A 4MTOA 2NR5A 1LUVA 1M56B 3E8FA 3E35A 5JQGB 5GONA 3HKDB 1K34A 2PYJA 4BR6A 1QR8A 2W0XA 1RM1C 4JTAB 5TISZ 1XNQO 1WAZA 2LFSA 1BMFG 2B1GA 3CMEV 1CPYA 2IJIA 4O4JB 1KBHA 2DQ0A 4JYAO 2YXLA 1Y74B 3ABMC 3X2QC 3QO8A 4PA9A 5EC1C 3OT7A 4ZIBA 4TV9B 1Q82W 1F4NA 2Y4UA 5BXZA 2ZE8A 3MD0A 2BOBC 4JYAB 2DOSA 2DQ3A 1H38A 1QQCA 2WLKA 3RYHB 3JATA 4MTXA 3ABLC 1LNQA 1AI4A 2HKOA 4UCVA 3CD6V 3QF7A 2HJFC 1J5EO 2RJZA 1SQQH 1SS3A 2CTQA 1JFFB 5CB4A 2JGDA 4RUEA 5B5EZ 1HR0O 1WPBA 4MTGA 2AHZA 4B3MO 2OWOA 4I4TA 1ZUQA 3ZHQA 1AR1B 4JI2O 4F6RB 5E1AC 1J5EB 4YHHO 2EIKB 1SERA 4AI8A 3H1LH 3LSSA 3RYIA 4J7KA 3QNEA 5CN0A 1JR9A 4LCUC 3EXAA 1YJNV 4XBFA 4JI2B 5GW7A 1AR5A 1I94O 4YHHB 1QVFU 4JYCA 3K9SA 1IBLO 3K57A 2ZE7A 3ASNC 4X1IA 4PI0A 3K5NA 3K9AA 3SPCA 4NXNB 2PTMA 2B9ZA 1I94B 4TUYA 3LNNA 1IBLB 1US6A 1XMOO 3E8GA 1F7YA 1PL4A 4FLXA 4RO2A 1JVMA 1R1BA 2Q7HA 1YJWV 3ZHTA 2JS5A 3IC9A 3ASOB 4DV1B 1XMOB 3ZX6A 1WJZA 3BAAA 4RUFA 3BABA 1U96A 1ZTEA 3JARA 2Q68A 1FAFA 2QJ1A 2PI5A 3HKBA 1M5IA 4FVMA 1N4CA 2FL4A 4GX1A 1VQ5V 5JJEB 3B8MA 2GV9A 2UUCB 2QKCA 1JCHA 5KMGB 2YS8A 1QU7A 3RYFA 4UCSA 4JV5O 2QE7G 1YJ9V 3A8TA 4CS2A 3VQXA 1K4CC 3UCSC 3T1YO 4CZZA 5CA1B 2BSKB 1Q5OA 3BPZA 1IVSA 1S5JA 2C2AA 3AG4B 2W6IG 4JV5B 5ITZB 3ICXA 4ZBMA 1D5NA 3SPIA 3T1YB 5L3BA 3E8HA 3JALB 2WA3A 5IJ9A 4OX9O 3IJ4A 5EYPA 5B1BB 1PP9H 4B7EA 4JAUA 1MG1A 2Q6AA 3SYAA 1VQ7V 2RMKB 3OTOO 1WB7A 1JX9A 2DYSB 3NR7A 5FLXN 1WA8B 1F23A 4UUJC 4EFBA 1QHTA 4UV9A 4O4HA 4OX9B 2X6BA 4WFHA 5JQGA 3H01A 3RFRA 3RW0A 3ZN0A 3HKDA 1F51A 4KFMA 1V55B 2P22C 2HG5C 1RSOB 2JS3A 1TGOA 1O9GA 4DYLA 2OIEA 4B7KA 1NZ6A 3SR2C 1S0VA 2WLNA 1XUQA 5EBMC 1FXVA 4UCUA 3LSQA 3WU2Z 1I5YA 1XILA 4O4JA 3ABKB 2DJVA 4O4IA 5FNVB 1TA8A 1Y74A 3A0HZ 1SQBH 2Q7EA 2EZOA 1SF9A 3UM7A 5BZBA 2QKSA 4YIPA 1H2MA 5EIBD 1VARA 4TV9A 3B8NA 4LWSA 2EULA 2F4VO 2EJRA 4AQYO 3JD0A 2ITCC 5JCOA 5EBWC 3P32A 1GM8A 4GKKO 1G4YB 3ZCCA 2X6AA 2VQEO 3CC4V 2KSDA 3AG4C 1P7BA 1TVKB 2F4VB 4QIWF 2Q4PA 4DW1A 4OPHA 3FAVB 4AQYB 3U0ZA 3OGIB 5KLVH 3AG2C 2HVJC 4JZGA 1BHAA 1QBZA 2Y48A 1IURA 1BT8A 1KC8W 5B1BC 2VQEB 1YI2V 5IJ0B 4Z1VA 3W7WA 2K9PA 3CYOA 4LNUB 4EB6B 1HDJA 2A7WA 2DYSC 1DTOA 4FPPA 3OMAB 2AW9A 5J2UB 2YIBA
chains in the Genus database with same CATH topology
1QCEA 4LP8A 2QA4V 2WLIB 5CA3A 4HZ3A 1L1FA 3UKMA 4XDJA 1V55C 2HFEC 1R3IC 3ABUA 1TUEB 2NNUA 4LC1A 5L3DA 2OTLV 4MVUA 5CBFA 1DF5A 3MHHC 1AJQA 1K5SA 2YEVB 3OE7G 3SPHA 2JJ1G 1CEZA 1S72V 1K5QA 3ABKC 3JCZA 2K1EA 4HAMA 1OCZB 3LDCA 3ZIAG 4JGSA 3CCMV 1RM1B 3E89A 3G71V 2H94A 2R9RB 4JPRA 1QLEC 4PDRA 1AI7A 3SYPA 2EIMB 1K4DC 2OCCB 3AG3B 1VQKV 5LHHA 5DN6G 2IH3C 1OCCB 5B1AB 1K97A 2B1IA 3OEEG 2EINB 4U7NA 1PNLA 3JYCA 1VQ6V 5LGUA 3M99B 4UVBA 3OGCC 4WFAV 3ASOC 4DO2A 3ZRWA 2DYRB 4X89A 3T1CA 1I5XA 2DWEC 4WF9V 1QVGU 1FXKB 4QPKA 4P9PA 4E2LA 1R6NA 1JOYA 2ZR3A 4BIUA 4LBEC 4R6ZA 2JIZG 3ZMUA 4R8CA 1V54C 5IYBO 3ZRXA 3A0RA 3SYOA 4QJFB 1S77D 4QE9A 2JEUA 4FJCC 5H6RA 1IXMA 5LHIA 4JTCB 1NQTA 5LHGA 4BAYA 4H37A 5KUKA 2QM8A 3FYEB 1E1RG 3EFFK 1K9MW 1XL4A 2JK5C 1YITV 1AJPA 2QM7A 3CC7V 4WCEV 2DWDC 2ZDIA 2X6CA 1J95A 2WLJA 3SPGA 5HFLA 1KP3A 2QEXV 1PNKA 3MHSC 1N8RW 3JD4A 1MABG 4L87A 2NLJC 1OZ0A 3IC7A 1BL8A 3CMAV 3LDEA 4N23A 3FB8C 3VOUA 1GK9A 2WLHA 2F43G 2ZR2A 4GCZA 3OAAG 2A9HA 2Q69A 3QO7A 2B5UA 4EKWA 4Z1MG 3ZMSA 5IYCO 1KD1W 4KUMA 3K79A 2IJJA 3K08A 4GT1A 4H33A 4WFGA 5KA6A 4MTOA 5L3GA 1F4MA 1XL6A 3KG2A 1M56B 3E8FA 1KP2A 3E35A 1EZJA 3OFNG 3AG1B 3OMIB 1K34A 3D3IA 3ZRWB 3ETEA 2FTKA 1QR8A 2Y69C 4FMTA 1GM7A 4TSFG 2KB1A 3HPLC 4PA3A 1OCZC 2W6JG 1W2BU 1RM1C 2XAJA 4JTAB 5FL7G 3ZN1A 2ZXWB 3CCVV 5H9CA 1DLBA 4MW8A 4WFFA 4MVOA 2LFSA 1OHHG 2JDIG 5KUMA 3JD2A 2H8PC 3T4DA 3W7XA 1BMFG 2EZPA 2XNDG 2XAGA 2EILB 2EIMC 2B1GA 3T4ZA 1CPYA 2OCCC 3AG3C 3CMEV 1YSCA 2IJIA 1VQOV 4PDMA 2DQ0A 4JF3A 4PDVA 1M57C 1OCCC 1R3LC 3ABMC 1FXHA 1R6KA 3X2QC 3QO8A 4ZKIA 4PA9A 5EC1C 3ETDA 2JJ2G 2P90A 1W0KG 5DM6V 5LGNA 1Q82W 1FXKC 1F4NA 1AROP 1NH2D 1JJ2U 4MW3A 1WLEA 3MD0A 2BOBC 2DQ3A 2IU3A 1NR7A 1VQ8V 3CXCU 1H38A 2WLKA 4MTXA 3OR7C 1QR9A 3ABLC 4RQFA 1EBOA 4UVAA 4P30A 1LNQA 1OCOC 1AI4A 4Q20A 1PNMA 2WPDG 5C93A 1K73W 2HKOA 2LFRA 2V1DA 4PA4A 4PDLA 5CMUA 4WFBV 1WPXA 1AJNA 5L3CA 3CD6V 4XDLA 5CBGA 2ATKC 5B1NA 2BOCC 2HJFC 3FKSG 3E86A 1BHBA 5KA5A 4P2ZA 1DF4A 2P7TC 3GB7C 5IDJA 1NVPB 5B3SC 1RPOA 2DW4A 2HR3A 3AG2B 4MVZA 2PI4A 4G2KA 4I9WA 4RUEA 1M90W 4MTGA 2AHZA 3NXSA 1Q81W 3E83A 3SYCA 1K33A 3STLC 1VQMV 1AR1B 1YIJV 4P9OA 3K0DA 5E1AC 1H8HG 1B6QA 2EIKB 3K03A 3AG1C 1VQPV 1SERA 4X88A 2Z3YA 3LSSA 1COWG 3BY6A 1Q7YW 3QNEA 1VQLV 5CN0A 3CCJV 4LCUC 4UVCA 1E79G 1YJNV 1CP9A 4XBFA 3DGEA 2XAHA 2MK3A 4G28B 5GW7A 2IW5A 3CCQV 2Z5UA 4PELA 1NJIW 3DTUB 3K04A 2P6JA 3LUTB 5IY5C 1QVFU 1PD3A 4JYCA 2XASA 4OXSA 1ROPA 4JTDB 4QPJA 3ASNC 3E2EA 3T2MA 2XAFA 1M9NA 3K9AA 4QE7A 1PKXA 3RVYA 4QNHB 1YTFB 3SPCA 1AI6A 3FYIB 3CP1A 3W7TA 2W0FC 4J9YB 4YXWG 3ABTA 4KP4A 4TT3G 2EBOA 3FB5C 2HLDG 2WLIA 3E8GA 3D36A 3W7UA 4U7OA 1GO3F 4BW5A 1K8AW 2WSSG 5HFMA 4RQEA 4RO2A 1JVMA 1Q86W 3K06A 4FIPC 2P67A 2WAMA 3JD1A 3F5WC 1Y4MA 1H2GA 1YJWV 3BEHA 2ZQMA 3K0GA 3TCUA 1SZTA 3ASOB 2WLMA 3SJQC 1R3JC 2YEVA 4R50A 4MVRA 1ORQC 5EC2C 2LP7A 4PA7A 4RUFA 1E1QG 3G4SV 2WLLA 1M1KW 4R7CA 3PJSK 2Q68A 3I56V 5B1AC 2PI5A 2EINC 3OMNB 1SRYA 1UJWB 2XAQA 1K92A 4CBCA 1S76D 2DYRC 4GX1A 1VQ5V 3ZMTA 3CCSV 3B8MA 3B77A 2Q67A 3VBBA 4JYBA 1OCRB 2EIJB 1S5HC 1NH2B 1JCHA 3RBZA 3W7SA 3FB7C 1NBMG 1JPXA 1FXKA 2QE7G 4JAVA 3ZRSA 1YJ9V 2WWWA 2IH1C 1K4CC 3OM3B 3OR6C 4CZZA 1MOFA 3TK1A 4UV8A 1KKDA 3JD3A 4FK5C 4MT8A 1AI5A 4GX5A 3ZRVA 3E8BA 2C2AA 3AG4B 1PL0A 2W6IG 3F7VC 5H6QA 4G27B 4ZBMA 3SPIA 5L3BA 3E8HA 3ML0A 3OW2U 3SPJA 2Y69B 4TWKA 3CCLV 2OT5A 1THZA 5EBLC 2WLLB 3LNMB 5B1BB 4UXNA 1FFTB 1QLNA 4JAUA 1MSWD 1MG1A 2UXNA 1M56C 3WG7B 2Q6AA 3SYAA 5J9PC 1VQ7V 3OUFA 4MVSA 3HB3B 1NVPD 3CPWU 4F4LA 1JX9A 2DYSB 3SYQA 1S3JA 2X0LA 3ETGA 1NKDA 3P30A 1F23A 4UUJC 1M57B 2JEXA 2V7QG 2YSUB 3IFXA 4UV9A 3ABMB 2IJHA 2X6BA 1K7DA 3QO5A 3X2QB 4WFHA 3R65A 3H01A 3RW0A 3ZN0A 1VQNV 1F51A 4KFMA 2ZXWC 3CCRV 1V55B 2R9IA 2AHYA 4MSWC 2HG5C 1GTOA 2ITDC 4MTFA 4N21A 3ZJZA 4ASUG 3LDDA 2EILC 4BIZA 1SESA 1ENVA 1FS0G 2CK3G 1S0VA 1R3KC 2WLNA 2GSMB 2ZD9A 5EK0A 5B1OA 1G8MA 3ABLB 5EBMC 1FXVA 2A79B 1GM9A 3LSQA 2QTOA 3WFVA 1H8EG 1OCOB 3IGAC 3OUSA 1I5YA 2OTJV 2IJKA 3ABKB 4X8AA 3K3WA 2GHYA 2ZDIC 4MS2A 3I55V 2EZOA 3UM7A 5BZBA 2XOKG 2QKSA 1OCRC 2EIJC 1W0JG 1QLEB 4MVMA 5IYDO 4PA6A 3EHBB 1YTFD 1KECA 3B8NA 1HWYA 4XDKA 3CCEV 1EFRG 2EJRA 5B3SB 3JD0A 3ZMVA 4JASA 2ITCC 1SETA 5LGTA 4HYOA 5L3EA 5EBWC 4J9ZB 3P32A 4GX0A 2M7WA 2IU0A 1GM8A 5CBHA 1VQ9V 1G4YB 3ZCCA 2X6AA 3FB6C 2X7RB 3CC4V 3G6EV 4I5SA 1YHQV 3AG4C 1P7BA 1RPRA 3ZMZA 3CC2V 3STZC 4QIWF 2D3OW 3CCUV 3AG2C 2HVJC 3AEIA 1V54B 1P4RA 1GMGA 1QBZA 5LBQA 1BHAA 2Y48A 1KC8W 1K3EA 4DXWA 5B1BC 1YI2V 1NR1A 1GKFA 5IY5B 4RAIA 3GWOA 3WG7C 1ZWIC 3OEHG 2EIKC 3CYOA 3W7WA 4GX2A 4MVQA 4WFEA 3ASNB 2HVKC 1Y66A 2DYSC 1DTOA 2UXXA 4FPPA 3F7YC 3OMAB 3TETA 3RVZA 2A0LA 1VQ4V 1R73A 1JQ0A 5L3FA 1KQSU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 V;  1VQM V;  1YIJ V;  2QA4 V;  1QVG U;  1K73 W;  1K8A W;  3CCM V;  4WCE V;  1Q86 W;  4WFB V;  3CCE V;  3CCU V;  3G71 V;  2QEX V;  3CD6 V;  1VQ7 V;  1VQP V;  1N8R W;  1YJW V;  1KC8 W;  1VQ5 V;  5DM6 V;  3CMA V;  3CPW U;  3CCS V;  1W2B U;  1Q7Y W;  1YI2 V;  1Q82 W;  1JJ2 U;  1VQL V;  3CCV V;  3CCJ V;  1VQK V;  1VQ9 V;  2OTL V;  1KD1 W;  2OTJ V;  1YJN V;  1VQ8 V;  1VQ4 V;  3CXC U;  3CC4 V;  3G6E V;  1VQ6 V;  3OW2 U;  1YHQ V;  3I55 V;  3CCQ V;  1YIT V;  3CME V;  1VQO V;  3G4S V;  1VQN V;  3CC2 V;  1NJI W;  4WFA V;  1K9M W;  1M90 W;  1YJ9 V;  1M1K W;  3CCR V;  3I56 V;  3CCL V;  1S72 V;  2D3O W;  1R73 A;  4WF9 V;  1QVF U;  1Q81 W;  1KQS U; 
#chains in the Genus database with same CATH topology
 2P5O A;  2WLI B;  3L71 H;  3JAK B;  4HZ3 A;  1L1F A;  4XDJ A;  1V55 C;  5JVD B;  4LH6 A;  1R3I C;  1Q6H A;  3ABU A;  5L3D A;  1I0H A;  2YIC A;  4NXM O;  5CBF A;  3K5L A;  1DF5 A;  2YEV B;  4O2A B;  3OE7 G;  1T5E A;  3SPH A;  1N34 O;  1K5Q A;  3L75 H;  3ABK C;  4FLZ A;  1GAX A;  2RDC A;  4NXM B;  2A06 H;  2EIM B;  4X20 A;  3K5O A;  1N34 B;  4NTY A;  3CJH B;  4FLU A;  4U7N A;  2EIN B;  1PNL A;  3N2G B;  5LGU A;  2HEP A;  2OIG A;  3OGC C;  4X62 O;  1VF6 C;  1I5X A;  1FXK B;  1EN6 A;  4ICG A;  2ZNJ A;  4JI4 O;  1AP5 A;  1JOY A;  2HJD A;  4OPA A;  5LL6 Y;  2PF4 E;  3ZRX A;  3A0R A;  5H5N A;  4X62 B;  1IXM A;  5LHI A;  4BAY A;  4H37 A;  5KUK A;  2QM8 A;  4JI4 B;  1E1R G;  2P4V A;  1SQV H;  1AJP A;  2QM7 A;  4LR3 A;  4J11 A;  3S3X A;  5HFL A;  1KP3 A;  4C7U A;  1PNK A;  3AK3 A;  1N8R W;  1MAB G;  3PN1 A;  3IC7 A;  3LDE A;  4N23 A;  2WLH A;  2F43 G;  2ZR2 A;  3D36 C;  2A9H A;  3OAA G;  1Q43 A;  5KMG A;  2Q69 A;  4EKW A;  4Z1M G;  5IYC O;  4YJ3 B;  3K08 A;  1X4T A;  5CA1 A;  2UUB O;  2BSK A;  5KHI A;  3AG1 B;  4DW0 A;  1B06 A;  2Q0O C;  3ZRW B;  5B66 Z;  2Y69 C;  4FMT A;  5ITZ A;  1AIL A;  2KB1 A;  1BQZ A;  3HPL C;  3I5D A;  4DR2 O;  2ZXW B;  3JAL A;  2UUB B;  1DLB A;  5J2T B;  2EIM C;  3MAQ A;  1D2D A;  5IE9 A;  2F66 C;  4PDM A;  4JF3 A;  1JJO A;  4PDV A;  5GTH Z;  1R3L C;  5KHH A;  1R6K A;  2A3Q A;  4ZKI A;  3LSU A;  4DR2 B;  4OGQ B;  2P90 A;  4EEQ A;  5LP6 B;  4NTX A;  1FXK C;  2JVD A;  2BCC H;  2RQ6 A;  2ODM A;  1MA1 A;  3OR7 C;  4RQF A;  4CH3 A;  1SC5 B;  3RYC B;  4DK1 A;  1OCO C;  4Q20 A;  4D7S A;  4DV2 O;  2E74 B;  5C93 A;  1HNW O;  4PA4 A;  1DK1 A;  5H2F Z;  2UXD B;  3SJB C;  5JJN B;  2BOC C;  3K5M A;  3E86 A;  3GB7 C;  4DR4 B;  5FNV A;  4W4L A;  1W59 A;  3CRC A;  2FKX A;  1XHX A;  2BTO A;  2CTW A;  4MVZ A;  4DV2 B;  4Z2W A;  2YID A;  1HNW B;  3JSL A;  1M90 W;  1N33 B;  2DE0 X;  2BE3 A;  3E83 A;  1Q81 W;  3SYC A;  2LW1 A;  1YIJ V;  1VQM V;  1H8H G;  2ADP A;  1B6Q A;  3K03 A;  3AG1 C;  1VF6 A;  2RN9 A;  4JI3 O;  4YY3 O;  1VQL V;  2QWQ B;  3N2K B;  2H3O A;  4UVC A;  5F2V O;  3T1H O;  1E79 G;  1TVK A;  4I55 B;  3FAV A;  2OYQ A;  2MK3 A;  1URF A;  1NJI W;  3K04 A;  1XI1 A;  1PD3 A;  1EN5 A;  4CS3 A;  3GVM A;  4JI3 B;  3T2M A;  2XAF A;  5IJ0 A;  1GN2 A;  5KHJ A;  3T1H B;  5JH7 A;  4LNU A;  4EB6 A;  3C3S A;  5A9G A;  2W0F C;  4AHC A;  4TT3 G;  1VF7 A;  2WLI A;  3JAK A;  3D36 A;  3W7U A;  4BW5 A;  2OCH A;  5JVD A;  3O9O A;  4FIP C;  1H2G A;  2EJ7 A;  4KXR A;  3H1J H;  2GTS A;  1NTK H;  2YEV A;  4O2A A;  3CRM A;  4YIO A;  2LP7 A;  2QWO B;  1DGS A;  1FKA O;  2WLL A;  1M1K W;  2IM9 A;  1NS1 A;  4I9Q A;  4DUZ O;  2Y4T A;  1K92 A;  1XNQ B;  2F1M A;  4IGG A;  1A32 A;  3CCS V;  2F93 B;  3E22 A;  4U3J B;  3CJH A;  1EN4 A;  2YC0 A;  4JYB A;  3N2G A;  2EIJ B;  1NH2 B;  4WBN B;  4K3A A;  4UCT A;  3FB7 C;  3W7S A;  1NBM G;  1S5L Z;  1FXK A;  4X64 O;  4DUZ B;  4LFB O;  1N32 O;  3TK1 A;  5KHG A;  2JRI A;  4UV8 A;  3J80 N;  3HR0 A;  4GX5 A;  3ZRV A;  3E8B A;  1BCC H;  2E76 B;  3ZHV A;  4X1Y B;  2Q7G A;  4X64 B;  3G6B A;  5EIB C;  2GUZ B;  4LFB B;  3R66 A;  5LOV A;  3OW2 U;  3CWB H;  4LF9 O;  1N32 B;  3SPJ A;  4TWK A;  3CRQ A;  4FFB A;  1PM9 A;  3CCL V;  1MZE A;  2OT5 A;  4KHP O;  4UXN A;  2XT9 A;  1FFT B;  2ZM6 O;  1M56 C;  4ZI7 B;  4HNA A;  2X0L A;  1M57 B;  2V7Q G;  2YSU B;  3IFX A;  1HR0 B;  1K7D A;  3QO5 A;  4KHP B;  4B3M B;  3R65 A;  1WP8 A;  3CCR V;  2ZM6 B;  4JYY A;  2Q9L A;  1GN6 A;  2ITD C;  4CH5 A;  1Q3E A;  1ENV A;  4GLX A;  1R3K C;  3J81 N;  5EK0 A;  5B1O A;  4K8X A;  1BE3 H;  3CXH F;  4FM0 A;  2QWP B;  4TV8 B;  4DV0 O;  2EIJ C;  4DV6 O;  5JCO C;  5IYD O;  1ZAU A;  3EHB B;  3RGB A;  1YTF D;  5LP6 A;  1HWY A;  4XDK A;  3CCE V;  3DXR B;  5B3S B;  1GH6 A;  4IIJ B;  3UO3 A;  2QDO A;  3ZMV A;  4B08 A;  3HKE A;  3TJT A;  1SET A;  4K8Z A;  1FYJ A;  5L3E A;  2IU0 A;  4DV0 B;  3UT5 B;  3RYC A;  1AB3 A;  2CTR A;  4DV6 B;  2X7R B;  3G6E V;  2DMX A;  1RPR A;  5GTI Z;  4X9Q A;  3CCU V;  2QWN B;  1Q6I A;  1EM1 A;  5LBQ A;  2E75 B;  2KG7 B;  2AGA A;  5FPO A;  2ZCE A;  4NYK A;  1K3E A;  5LYJ B;  1P49 A;  3U10 A;  1XDC A;  1NR1 A;  4DV7 O;  5IY5 B;  4RAI A;  1L0L H;  1ZWI C;  2EIK C;  4GX2 A;  4K0K O;  2UXX A;  3VQY A;  4LF7 O;  4Q6G A;  2ZIO A;  4FLW A;  3KCX A;  4PD4 F;  4DV7 B;  3UKM A;  4LF4 O;  4GKJ O;  1Y76 B;  3UQ8 A;  3GWK C;  2NNU A;  4I55 A;  4LC1 A;  4K0K B;  3BA9 A;  4DR5 O;  4LF7 B;  1G6U A;  3P3N A;  4J7Z A;  2YI9 A;  3MHH C;  1ZL8 B;  4B3T O;  1UPG A;  2CGN A;  5KAI Z;  4LF4 B;  1Z2G A;  4GKJ B;  1OCZ B;  3ZIA G;  3CCM V;  3E89 A;  2H94 A;  3Q4H B;  1AI7 A;  3AG3 B;  4B3T B;  2E5L O;  5LHH A;  3BFR A;  2IH3 C;  3B40 A;  5B1A B;  3OEE G;  4J80 A;  4WFA V;  3ASO C;  2DYR B;  4WF9 V;  2Q0A A;  2DWE C;  2QWR B;  4KL1 A;  3OTO B;  4E2L A;  5LMN O;  3QVN A;  5LMU O;  2E5L B;  4FZ1 A;  4LBE C;  3ZMU A;  5IYB O;  4F6E A;  3RT3 C;  4O2B B;  1GN4 A;  5LHG A;  3BCC H;  3QG5 A;  3FYE B;  5LMN B;  4ZHQ B;  1K9M W;  2LJ2 A;  4GYC B;  1IZ3 A;  4I50 B;  5LMU B;  1XL4 A;  2JK5 C;  3CC7 V;  2DWD C;  4U3J A;  2WLJ A;  3SPG A;  1MSD A;  3JD4 A;  2NLJ C;  1FFX B;  1V9P A;  3CMA V;  1GK9 A;  1NT2 B;  5BY1 A;  4WBN A;  5EZY B;  2B5U A;  3RYH A;  1NU1 H;  1KD1 W;  2QTS A;  4KUM A;  4WFG A;  5KA6 A;  2LW7 A;  2Q73 A;  3L70 H;  5L3G A;  1F4M A;  3K59 A;  3JAW B;  1TAE A;  2HHH O;  1EZJ A;  3OMI B;  1VF5 B;  3DSQ A;  2EX3 A;  2FB5 A;  3ZS8 C;  4X1Y A;  2XTA A;  1GM7 A;  4GKK B;  4TSF G;  4PA3 A;  1OCZ C;  3G67 A;  2GUZ A;  3ZN1 A;  3KCY A;  1JFF A;  5H9C A;  4MW8 A;  2HHH B;  4MVO A;  1VEW A;  1OHH G;  2JDI G;  2H8P C;  3T4D A;  2Q5Z A;  3W7X A;  2EZP A;  2XND G;  2XAG A;  2EIL B;  1VQO V;  3AG3 C;  1SZX A;  4NTW A;  4F6R A;  3ZHR A;  4ZI7 A;  1FXH A;  4IYH A;  2BTQ B;  4X66 O;  3JCU Z;  4LF5 O;  1W0K G;  2FYU H;  3ZHU A;  1NH2 D;  1U97 A;  1JJ2 U;  1WLE A;  5E79 Z;  2HP8 A;  3CXC U;  2Y0P A;  2PGG A;  4BW9 A;  2F23 A;  2VWJ A;  4UVA A;  4X66 B;  4IHJ B;  4LF5 B;  3D8C A;  2WPD G;  1K73 W;  1IBK O;  2V1D A;  1WPX A;  2Y0I A;  1AJN A;  3ZED A;  5CBG A;  2ATK C;  5KA5 A;  4P2Z A;  4TV8 A;  1DF4 A;  2HR3 A;  2PI4 A;  4I9W A;  1IBK B;  2ADQ B;  5IWA O;  1X59 A;  3U11 A;  4CH6 A;  3VQW A;  1BZK A;  4PI2 A;  1CXZ B;  4IYI A;  3NXS A;  1HP8 A;  4IIJ A;  4P9O A;  3K0D A;  1SA0 B;  2YIA A;  1FJG O;  2P06 A;  2R9A A;  1XHZ A;  2Z3Y A;  1QNM A;  5IWA B;  3CCJ V;  3N27 A;  4DV5 O;  1BSM A;  2YI8 A;  2XAH A;  3CCQ V;  2IW5 A;  3L73 H;  1FJG B;  4PEL A;  4DR6 O;  3DTU B;  4JI0 O;  3JAT B;  3QTC A;  5IYZ B;  1YXB A;  1I7F A;  4OXS A;  1VMG A;  3C3T A;  1B3Q A;  4QPJ A;  2ZNI A;  1XEQ A;  1L8D A;  3E2E A;  1Z5W A;  4QE7 A;  3RVY A;  1YTF B;  4DV5 B;  4J42 A;  3FYI B;  1XMQ O;  5JJJ B;  3W7T A;  4DR6 B;  5BR8 O;  3ABT A;  4DV4 O;  4FZ0 A;  1AR4 A;  2QR4 A;  2HLD G;  4E4E A;  1PPJ H;  4U7O A;  1YDX A;  1Y76 A;  4I4T B;  1Q86 W;  4TQF A;  2V4D A;  3K06 A;  2P67 A;  2WAM A;  3JD1 A;  1XMQ B;  5BR8 B;  2ZQM A;  3TCU A;  3JAS B;  1SZT A;  1ZL8 A;  2WLM A;  1R3J C;  3L9D A;  5EC2 C;  3AK2 A;  2G38 A;  4PA7 A;  1E1Q G;  4CC5 A;  3G4S V;  4NR1 A;  3O65 A;  4R7C A;  5IT9 N;  1VIB A;  2EIN C;  3OMN B;  4QGP A;  2FML A;  1UJW B;  2XAQ A;  3MDS A;  4CBC A;  1S76 D;  1WA8 A;  4H13 B;  3ZMT A;  3CHX A;  4IL6 Z;  2Q67 A;  4ZOL B;  3VBB A;  3WB1 A;  4TUY B;  3A2F A;  3RBZ A;  4O4L B;  4JAV A;  1RSO A;  3ZRS A;  3OR6 C;  3JD3 A;  4O2B A;  4G27 B;  3P3P A;  1KB9 F;  2GDS A;  4I50 A;  3ML0 A;  4PHZ A;  3TXQ A;  1B04 A;  2MW2 B;  5EBL C;  3JAR B;  4B3S O;  1QLN A;  1FFX A;  1AVM A;  1MSW D;  2UXN A;  5EZY A;  1JA8 A;  1MMM A;  1M93 A;  1NVP D;  1RP3 B;  3SYQ A;  1S3J A;  1LUW A;  2R70 A;  3ABM B;  2IJH A;  3M8A A;  4J10 A;  3X2Q B;  2Q8V A;  4B3S B;  4UCR A;  2E3C A;  3FFQ A;  4GUN A;  1VQN V;  2ZXW C;  4DRX B;  2R9I A;  2AHY A;  4N21 A;  4MSW C;  1GTO A;  4MTF A;  3TGU H;  2KQX A;  4UFZ A;  4BIZ A;  1BQ0 A;  1SES A;  4YY3 B;  1FS0 G;  2CK3 G;  3ABL B;  4GZR B;  2A79 B;  1GM9 A;  3WFV A;  2ARH A;  1H8E G;  5FPR A;  1H2N A;  2IJK A;  4X8A A;  3K3W A;  2ZDI C;  5LP6 C;  3I55 V;  2XHB A;  3AK1 A;  5J2U A;  2BTQ A;  3K58 A;  1QLE B;  4MVM A;  2UU9 O;  1EFR G;  3OTF A;  2RCV A;  5LGT A;  4HYO A;  5LA6 B;  4J9Z B;  4CS4 A;  5LXT B;  4GX0 A;  2M7W A;  5CBH A;  2CE4 A;  3A0B Z;  4IHJ A;  4I5S A;  4NKG B;  4O4H B;  2UU9 B;  4TOI A;  1SQX H;  3STZ C;  2ZKO A;  2D3O W;  3B09 A;  3THO A;  2AZ0 A;  4YJ2 B;  1GKF A;  3GWO A;  3OEH G;  2D2C B;  1O9H A;  3ASN B;  3CE2 A;  3F7Y C;  1HNZ O;  3RVZ A;  2QSA A;  4O4I B;  1SA0 A;  2A0L A;  3L74 H;  1VQ4 V;  2YXY A;  5KX5 B;  5L3F A;  1KQS U;  1YZB A;  5K1P A;  2QA4 V;  5BMV B;  5KAF Z;  2N74 A;  1H2S B;  4HBN A;  4LWS B;  4NVP A;  2YXH A;  1KU9 A;  1TUE B;  4AIL C;  1HNZ B;  2OTL V;  4MVU A;  2IBZ H;  3VQV A;  2CAZ C;  3RN4 A;  2VRZ A;  1AJQ A;  5IYZ A;  1K5S A;  3CRR A;  1VP7 A;  1CEZ A;  1ZX3 A;  1RFY A;  3JCZ A;  4W4K A;  3LDC A;  4JGS A;  3JSN A;  3G71 V;  2R9R B;  3H1K H;  2JGU A;  1QLE C;  2AXT Z;  3SYP A;  1NTM H;  5D5Q A;  1K4D C;  2OCC B;  4YJ3 A;  4LF9 B;  1VQK V;  5A2Q N;  5DN6 G;  1P7G A;  4TQD A;  1OCC B;  4IT5 A;  1K97 A;  2B1I A;  1KKC A;  1VQ6 V;  2GTA A;  3JYC A;  3M7M X;  3G80 A;  3TXS A;  4H0L B;  3ZRW A;  4X89 A;  2LQT A;  1QVG U;  4QPK A;  4P9P A;  3CS5 A;  3CSX A;  1R6N A;  2PUS A;  3JAS A;  2KKW A;  4R6Z A;  4R8C A;  4QJF B;  3SYO A;  4QE9 A;  5J2T A;  4FJC C;  4NXN O;  5H6R A;  1OJH A;  3HKC B;  5CA0 B;  1YIT V;  1GRJ A;  5DEC A;  2VS0 A;  2QM4 A;  4DR7 O;  2CGO A;  3KKY A;  2ZDI A;  1WP7 A;  1J95 A;  4ZOL A;  3MHS C;  1OZ0 A;  3VOU A;  3QO7 A;  4A5U B;  3ZMS A;  4O4L A;  3ZHS A;  4X20 B;  4GT1 A;  3KZI Z;  1BGY H;  1KYO F;  4JI1 O;  4DV1 O;  2Z0A A;  1XL6 A;  3KG2 A;  4DR7 B;  1H2K A;  1KUQ A;  1KP2 A;  3OFN G;  3APO A;  3BA8 A;  2RNB A;  3D3I A;  1TUB B;  4JZ2 A;  3ETE A;  2FTK A;  4LH7 A;  4JI6 O;  5C8Y B;  1W2B U;  2W6J G;  4JI1 B;  2XAJ A;  5FL7 G;  3ZBH A;  3CCV V;  1SQG A;  4WFF A;  1M4U A;  2LGW A;  2UUC O;  5KUM A;  3JD2 A;  3T4Z A;  3CEI A;  2OCC C;  1YSC A;  1NI8 A;  1M57 C;  1OCC C;  4JI6 B;  3OD4 A;  2YDE A;  3ETD A;  1XRE A;  4FM1 A;  2JJ2 G;  5DM6 V;  3N2K A;  5LGN A;  4DUY O;  3S3W A;  1ARO P;  1IBM O;  4MW3 A;  4I7Z B;  4UB8 Z;  2IU3 A;  1NR7 A;  1VQ8 V;  4DRX A;  4X1K B;  1YVW A;  2UXB O;  2WA4 A;  1Q6U A;  1QR9 A;  1EBO A;  4P30 A;  1PNM A;  3SJA C;  2CUG A;  1L0N H;  4DV3 O;  4DUY B;  1IX9 A;  1IBM B;  2LFR A;  4PDL A;  4WFB V;  5CMU A;  2P4K A;  5L3C A;  4XDL A;  3F5T A;  4DR5 B;  5B1N A;  1KMI Z;  3FKS G;  5K1X A;  2YUA A;  1BHB A;  4LF6 O;  2UXB B;  2P7T C;  2ETN A;  5IDJ A;  1NVP B;  5B3S C;  1RPO A;  2DW4 A;  3AG2 B;  4G2K A;  2ILM A;  4DV3 B;  1WN7 A;  1D5A A;  1K33 A;  3STL C;  2CH7 B;  4CH4 A;  4LF6 B;  5LA6 A;  1FD9 A;  5LXT A;  3EVK A;  1VQP V;  4X88 A;  1COW G;  4LFA O;  3BY6 A;  1Q7Y W;  3WB0 A;  3ETQ A;  4BWA A;  3UO2 A;  4LF8 O;  1CP9 A;  3DGE A;  2N04 A;  4G28 B;  2Z5U A;  4U3F H;  1IDS A;  2P6J A;  3LUT B;  5IY5 C;  2XAS A;  4LFA B;  1ROP A;  2M6Y A;  4JTD B;  4EFE A;  2R72 A;  5JWP A;  1M9N A;  3RWR D;  4YJ2 A;  1PKX A;  3BRC A;  4QNH B;  4LF8 B;  1I08 A;  1AI6 A;  4JI7 O;  3CP1 A;  4JI5 O;  4J9Y B;  3H1H H;  1OV9 A;  4YXW G;  4KP4 A;  5KX5 A;  2EBO A;  3FB5 C;  5BMV A;  1BS3 A;  1GO3 F;  1K8A W;  3DC5 A;  2WSS G;  5HFM A;  4RQE A;  4DR1 O;  4FM2 A;  1YEW A;  4JI7 B;  4JAA A;  4JI5 B;  3F5W C;  1Y4M A;  3BEH A;  1YF2 A;  3K0G A;  2ZE5 A;  3SJQ C;  4R50 A;  4MVR A;  1ORQ C;  1EZV H;  4UB6 Z;  2ZIN A;  4DR1 B;  3D3Q A;  3PJS K;  4DK0 A;  3I56 V;  3SJC C;  3FX7 A;  4I0X B;  5B1A C;  3H9V A;  1SRY A;  2DYR C;  2QGN A;  3B77 A;  1OCR B;  4PJ0 Z;  5JH7 B;  3B4S A;  1S5H C;  1JPX A;  2WWW A;  2IH1 C;  2DN9 A;  3OM3 B;  4PV1 B;  1N36 O;  1MOF A;  4LFC O;  2ZE6 A;  5GON B;  1KKD A;  4FK5 C;  4MT8 A;  4CC6 A;  1AI5 A;  2N05 A;  1PL0 A;  1SQF A;  3F7V C;  5H6Q A;  3HKC A;  5CA0 A;  1Y67 A;  4K35 A;  1N36 B;  4NB5 A;  2Y69 B;  4LFC B;  2PY5 A;  1THZ A;  2WLL B;  3DXR A;  3LNM B;  3SDL A;  1XOU A;  5J9P C;  3WG7 B;  3OUF A;  4MVS A;  3HB3 B;  2PZS A;  3CPW U;  4F4L A;  3BHP A;  1MZF A;  2L35 A;  3ETG A;  3UT5 A;  1NKD A;  3P30 A;  1LR1 A;  1GN3 A;  3E22 B;  2JEX A;  1Z5V A;  1TUB A;  1ZSP A;  1N0N A;  2YIB D;  1XQ8 A;  2KG7 A;  3ZJZ A;  4ASU G;  5C8Y A;  3LDD A;  2EIL C;  5LYJ A;  2GSM B;  2ZD9 A;  1G8M A;  3APQ A;  2PYL A;  2QTO A;  1OCO B;  3IGA C;  3OUS A;  2OTJ V;  5DED A;  1MNG A;  4JI0 B;  2LGQ A;  2GHY A;  2UUA O;  4MS2 A;  2XOK G;  1OCR C;  5LOV B;  2ZIM A;  1W0J G;  5CB4 B;  2JGD B;  4PA6 A;  4FFB B;  1KEC A;  3WB2 A;  4JAS A;  2UUA B;  4X1K A;  1Y6X A;  1Q90 D;  1NTZ H;  4HNA B;  4DV4 B;  1VQ9 V;  3RYI B;  2CDY A;  3FB6 C;  4RWU A;  1YHQ V;  1ZLZ A;  3C90 A;  1WB8 A;  3ZMZ A;  3CC2 V;  1P84 F;  3AEI A;  1V54 B;  1P4R A;  1GMG A;  3AG7 A;  3Q4H A;  4H44 B;  4DXW A;  4X1I B;  1G1X B;  1H2L A;  2ZT9 B;  3WG7 C;  4J7J A;  2XUM A;  4MVQ A;  4ABM A;  4WFE A;  2HVK C;  1Y66 A;  3TET A;  2CH7 A;  4FLT A;  1XBL A;  1R73 A;  1JQ0 A;  1QCE A;  4LP8 A;  4FLV A;  5CA3 A;  2GBO A;  2QKA A;  2VWK A;  1WNS A;  2HFE C;  4B3R O;  3SGI A;  1Q8I A;  3HKE B;  2UXD O;  1R6T A;  3IAY A;  1SQP H;  3B2E E;  1FPO A;  1HW7 A;  5KHK A;  4ZHQ A;  4DR4 O;  1XNR O;  4J41 A;  5AG2 A;  2JJ1 G;  1S72 V;  1N0J A;  4X65 O;  1YCI A;  2K1E A;  4HAM A;  2UXC O;  1RM1 B;  3CB2 A;  4B3R B;  1N33 O;  3HKB B;  4JPR A;  4PDR A;  4DR3 O;  1XNR B;  4L8J A;  2F95 B;  3JAW A;  3H1I H;  4X65 B;  3J7A U;  1PV0 A;  2L6L A;  2UXC B;  2O57 A;  3M99 B;  1HNX O;  4UVB A;  4D6T H;  4DO2 A;  1IXB A;  3T1C A;  3DC6 A;  3RYF B;  4BIO A;  2VQF O;  4D7T A;  3CX5 F;  4DR3 B;  2ZR3 A;  4JI8 O;  4BIU A;  2NN4 A;  1SKV A;  2LO1 A;  1AP6 A;  2JIZ G;  5D5P A;  3BVO A;  1V54 C;  3L72 H;  4FFK A;  1S77 D;  2JEU A;  1HNX B;  4JTC B;  1NQT A;  2VQF B;  4I0X A;  3EFF K;  4JI8 B;  3CRA A;  4UCO A;  2CTP A;  5IJ9 B;  4WCE V;  1UFI A;  2X6C A;  5EYP B;  2QEX V;  4L87 A;  4FLY A;  1BL8 A;  3FB8 C;  4GCZ A;  1JMK C;  3JAM N;  3FD9 A;  2AZ2 A;  3K79 A;  2IJJ A;  4H33 A;  4MTO A;  2NR5 A;  1LUV A;  1M56 B;  3E8F A;  3E35 A;  5JQG B;  5GON A;  3HKD B;  1K34 A;  2PYJ A;  4BR6 A;  1QR8 A;  2W0X A;  1RM1 C;  4JTA B;  5TIS Z;  1XNQ O;  1WAZ A;  2LFS A;  1BMF G;  2B1G A;  3CME V;  1CPY A;  2IJI A;  4O4J B;  1KBH A;  2DQ0 A;  4JYA O;  2YXL A;  1Y74 B;  3ABM C;  3X2Q C;  3QO8 A;  4PA9 A;  5EC1 C;  3OT7 A;  4ZIB A;  4TV9 B;  1Q82 W;  1F4N A;  2Y4U A;  5BXZ A;  2ZE8 A;  3MD0 A;  2BOB C;  4JYA B;  2DOS A;  2DQ3 A;  1H38 A;  1QQC A;  2WLK A;  3RYH B;  3JAT A;  4MTX A;  3ABL C;  1LNQ A;  1AI4 A;  2HKO A;  4UCV A;  3CD6 V;  3QF7 A;  2HJF C;  1J5E O;  2RJZ A;  1SQQ H;  1SS3 A;  2CTQ A;  1JFF B;  5CB4 A;  2JGD A;  4RUE A;  5B5E Z;  1HR0 O;  1WPB A;  4MTG A;  2AHZ A;  4B3M O;  2OWO A;  4I4T A;  1ZUQ A;  3ZHQ A;  1AR1 B;  4JI2 O;  4F6R B;  5E1A C;  1J5E B;  4YHH O;  2EIK B;  1SER A;  4AI8 A;  3H1L H;  3LSS A;  3RYI A;  4J7K A;  3QNE A;  5CN0 A;  1JR9 A;  4LCU C;  3EXA A;  1YJN V;  4XBF A;  4JI2 B;  5GW7 A;  1AR5 A;  1I94 O;  4YHH B;  1QVF U;  4JYC A;  3K9S A;  1IBL O;  3K57 A;  2ZE7 A;  3ASN C;  4X1I A;  4PI0 A;  3K5N A;  3K9A A;  3SPC A;  4NXN B;  2PTM A;  2B9Z A;  1I94 B;  4TUY A;  3LNN A;  1IBL B;  1US6 A;  1XMO O;  3E8G A;  1F7Y A;  1PL4 A;  4FLX A;  4RO2 A;  1JVM A;  1R1B A;  2Q7H A;  1YJW V;  3ZHT A;  2JS5 A;  3IC9 A;  3ASO B;  4DV1 B;  1XMO B;  3ZX6 A;  1WJZ A;  3BAA A;  4RUF A;  3BAB A;  1U96 A;  1ZTE A;  3JAR A;  2Q68 A;  1FAF A;  2QJ1 A;  2PI5 A;  3HKB A;  1M5I A;  4FVM A;  1N4C A;  2FL4 A;  4GX1 A;  1VQ5 V;  5JJE B;  3B8M A;  2GV9 A;  2UUC B;  2QKC A;  1JCH A;  5KMG B;  2YS8 A;  1QU7 A;  3RYF A;  4UCS A;  4JV5 O;  2QE7 G;  1YJ9 V;  3A8T A;  4CS2 A;  3VQX A;  1K4C C;  3UCS C;  3T1Y O;  4CZZ A;  5CA1 B;  2BSK B;  1Q5O A;  3BPZ A;  1IVS A;  1S5J A;  2C2A A;  3AG4 B;  2W6I G;  4JV5 B;  5ITZ B;  3ICX A;  4ZBM A;  1D5N A;  3SPI A;  3T1Y B;  5L3B A;  3E8H A;  3JAL B;  2WA3 A;  5IJ9 A;  4OX9 O;  3IJ4 A;  5EYP A;  5B1B B;  1PP9 H;  4B7E A;  4JAU A;  1MG1 A;  2Q6A A;  3SYA A;  1VQ7 V;  2RMK B;  3OTO O;  1WB7 A;  1JX9 A;  2DYS B;  3NR7 A;  5FLX N;  1WA8 B;  1F23 A;  4UUJ C;  4EFB A;  1QHT A;  4UV9 A;  4O4H A;  4OX9 B;  2X6B A;  4WFH A;  5JQG A;  3H01 A;  3RFR A;  3RW0 A;  3ZN0 A;  3HKD A;  1F51 A;  4KFM A;  1V55 B;  2P22 C;  2HG5 C;  1RSO B;  2JS3 A;  1TGO A;  1O9G A;  4DYL A;  2OIE A;  4B7K A;  1NZ6 A;  3SR2 C;  1S0V A;  2WLN A;  1XUQ A;  5EBM C;  1FXV A;  4UCU A;  3LSQ A;  3WU2 Z;  1I5Y A;  1XIL A;  4O4J A;  3ABK B;  2DJV A;  4O4I A;  5FNV B;  1TA8 A;  1Y74 A;  3A0H Z;  1SQB H;  2Q7E A;  2EZO A;  1SF9 A;  3UM7 A;  5BZB A;  2QKS A;  4YIP A;  1H2M A;  5EIB D;  1VAR A;  4TV9 A;  3B8N A;  4LWS A;  2EUL A;  2F4V O;  2EJR A;  4AQY O;  3JD0 A;  2ITC C;  5JCO A;  5EBW C;  3P32 A;  1GM8 A;  4GKK O;  1G4Y B;  3ZCC A;  2X6A A;  2VQE O;  3CC4 V;  2KSD A;  3AG4 C;  1P7B A;  1TVK B;  2F4V B;  4QIW F;  2Q4P A;  4DW1 A;  4OPH A;  3FAV B;  4AQY B;  3U0Z A;  3OGI B;  5KLV H;  3AG2 C;  2HVJ C;  4JZG A;  1BHA A;  1QBZ A;  2Y48 A;  1IUR A;  1BT8 A;  1KC8 W;  5B1B C;  2VQE B;  1YI2 V;  5IJ0 B;  4Z1V A;  3W7W A;  2K9P A;  3CYO A;  4LNU B;  4EB6 B;  1HDJ A;  2A7W A;  2DYS C;  1DTO A;  4FPP A;  3OMA B;  2AW9 A;  5J2U B;  2YIB A; 
#chains in the Genus database with same CATH homology
 1QCE A;  4LP8 A;  2QA4 V;  2WLI B;  5CA3 A;  4HZ3 A;  1L1F A;  3UKM A;  4XDJ A;  1V55 C;  2HFE C;  1R3I C;  3ABU A;  1TUE B;  2NNU A;  4LC1 A;  5L3D A;  2OTL V;  4MVU A;  5CBF A;  1DF5 A;  3MHH C;  1AJQ A;  1K5S A;  2YEV B;  3OE7 G;  3SPH A;  2JJ1 G;  1CEZ A;  1S72 V;  1K5Q A;  3ABK C;  3JCZ A;  2K1E A;  4HAM A;  1OCZ B;  3LDC A;  3ZIA G;  4JGS A;  3CCM V;  1RM1 B;  3E89 A;  3G71 V;  2H94 A;  2R9R B;  4JPR A;  1QLE C;  4PDR A;  1AI7 A;  3SYP A;  2EIM B;  1K4D C;  2OCC B;  3AG3 B;  1VQK V;  5LHH A;  5DN6 G;  2IH3 C;  1OCC B;  5B1A B;  1K97 A;  2B1I A;  3OEE G;  2EIN B;  4U7N A;  1PNL A;  3JYC A;  1VQ6 V;  5LGU A;  3M99 B;  4UVB A;  3OGC C;  4WFA V;  3ASO C;  4DO2 A;  3ZRW A;  2DYR B;  4X89 A;  3T1C A;  1I5X A;  2DWE C;  4WF9 V;  1QVG U;  1FXK B;  4QPK A;  4P9P A;  4E2L A;  1R6N A;  1JOY A;  2ZR3 A;  4BIU A;  4LBE C;  4R6Z A;  2JIZ G;  3ZMU A;  4R8C A;  1V54 C;  5IYB O;  3ZRX A;  3A0R A;  3SYO A;  4QJF B;  1S77 D;  4QE9 A;  2JEU A;  4FJC C;  5H6R A;  1IXM A;  5LHI A;  4JTC B;  1NQT A;  5LHG A;  4BAY A;  4H37 A;  5KUK A;  2QM8 A;  3FYE B;  1E1R G;  3EFF K;  1K9M W;  1XL4 A;  2JK5 C;  1YIT V;  1AJP A;  2QM7 A;  3CC7 V;  4WCE V;  2DWD C;  2ZDI A;  2X6C A;  1J95 A;  2WLJ A;  3SPG A;  5HFL A;  1KP3 A;  2QEX V;  1PNK A;  3MHS C;  1N8R W;  3JD4 A;  1MAB G;  4L87 A;  2NLJ C;  1OZ0 A;  3IC7 A;  1BL8 A;  3CMA V;  3LDE A;  4N23 A;  3FB8 C;  3VOU A;  1GK9 A;  2WLH A;  2F43 G;  2ZR2 A;  4GCZ A;  3OAA G;  2A9H A;  2Q69 A;  3QO7 A;  2B5U A;  4EKW A;  4Z1M G;  3ZMS A;  5IYC O;  1KD1 W;  4KUM A;  3K79 A;  2IJJ A;  3K08 A;  4GT1 A;  4H33 A;  4WFG A;  5KA6 A;  4MTO A;  5L3G A;  1F4M A;  1XL6 A;  3KG2 A;  1M56 B;  3E8F A;  1KP2 A;  3E35 A;  1EZJ A;  3OFN G;  3AG1 B;  3OMI B;  1K34 A;  3D3I A;  3ZRW B;  3ETE A;  2FTK A;  1QR8 A;  2Y69 C;  4FMT A;  1GM7 A;  4TSF G;  2KB1 A;  3HPL C;  4PA3 A;  1OCZ C;  2W6J G;  1W2B U;  1RM1 C;  2XAJ A;  4JTA B;  5FL7 G;  3ZN1 A;  2ZXW B;  3CCV V;  5H9C A;  1DLB A;  4MW8 A;  4WFF A;  4MVO A;  2LFS A;  1OHH G;  2JDI G;  5KUM A;  3JD2 A;  2H8P C;  3T4D A;  3W7X A;  1BMF G;  2EZP A;  2XND G;  2XAG A;  2EIL B;  2EIM C;  2B1G A;  3T4Z A;  1CPY A;  2OCC C;  3AG3 C;  3CME V;  1YSC A;  2IJI A;  1VQO V;  4PDM A;  2DQ0 A;  4JF3 A;  4PDV A;  1M57 C;  1OCC C;  1R3L C;  3ABM C;  1FXH A;  1R6K A;  3X2Q C;  3QO8 A;  4ZKI A;  4PA9 A;  5EC1 C;  3ETD A;  2JJ2 G;  2P90 A;  1W0K G;  5DM6 V;  5LGN A;  1Q82 W;  1FXK C;  1F4N A;  1ARO P;  1NH2 D;  1JJ2 U;  4MW3 A;  1WLE A;  3MD0 A;  2BOB C;  2DQ3 A;  2IU3 A;  1NR7 A;  1VQ8 V;  3CXC U;  1H38 A;  2WLK A;  4MTX A;  3OR7 C;  1QR9 A;  3ABL C;  4RQF A;  1EBO A;  4UVA A;  4P30 A;  1LNQ A;  1OCO C;  1AI4 A;  4Q20 A;  1PNM A;  2WPD G;  5C93 A;  1K73 W;  2HKO A;  2LFR A;  2V1D A;  4PA4 A;  4PDL A;  5CMU A;  4WFB V;  1WPX A;  1AJN A;  5L3C A;  3CD6 V;  4XDL A;  5CBG A;  2ATK C;  5B1N A;  2BOC C;  2HJF C;  3FKS G;  3E86 A;  1BHB A;  5KA5 A;  4P2Z A;  1DF4 A;  2P7T C;  3GB7 C;  5IDJ A;  1NVP B;  5B3S C;  1RPO A;  2DW4 A;  2HR3 A;  3AG2 B;  4MVZ A;  2PI4 A;  4G2K A;  4I9W A;  4RUE A;  1M90 W;  4MTG A;  2AHZ A;  3NXS A;  1Q81 W;  3E83 A;  3SYC A;  1K33 A;  3STL C;  1VQM V;  1AR1 B;  1YIJ V;  4P9O A;  3K0D A;  5E1A C;  1H8H G;  1B6Q A;  2EIK B;  3K03 A;  3AG1 C;  1VQP V;  1SER A;  4X88 A;  2Z3Y A;  3LSS A;  1COW G;  3BY6 A;  1Q7Y W;  3QNE A;  1VQL V;  5CN0 A;  3CCJ V;  4LCU C;  4UVC A;  1E79 G;  1YJN V;  1CP9 A;  4XBF A;  3DGE A;  2XAH A;  2MK3 A;  4G28 B;  5GW7 A;  2IW5 A;  3CCQ V;  2Z5U A;  4PEL A;  1NJI W;  3DTU B;  3K04 A;  2P6J A;  3LUT B;  5IY5 C;  1QVF U;  1PD3 A;  4JYC A;  2XAS A;  4OXS A;  1ROP A;  4JTD B;  4QPJ A;  3ASN C;  3E2E A;  3T2M A;  2XAF A;  1M9N A;  3K9A A;  4QE7 A;  1PKX A;  3RVY A;  4QNH B;  1YTF B;  3SPC A;  1AI6 A;  3FYI B;  3CP1 A;  3W7T A;  2W0F C;  4J9Y B;  4YXW G;  3ABT A;  4KP4 A;  4TT3 G;  2EBO A;  3FB5 C;  2HLD G;  2WLI A;  3E8G A;  3D36 A;  3W7U A;  4U7O A;  1GO3 F;  4BW5 A;  1K8A W;  2WSS G;  5HFM A;  4RQE A;  4RO2 A;  1JVM A;  1Q86 W;  3K06 A;  4FIP C;  2P67 A;  2WAM A;  3JD1 A;  3F5W C;  1Y4M A;  1H2G A;  1YJW V;  3BEH A;  2ZQM A;  3K0G A;  3TCU A;  1SZT A;  3ASO B;  2WLM A;  3SJQ C;  1R3J C;  2YEV A;  4R50 A;  4MVR A;  1ORQ C;  5EC2 C;  2LP7 A;  4PA7 A;  4RUF A;  1E1Q G;  3G4S V;  2WLL A;  1M1K W;  4R7C A;  3PJS K;  2Q68 A;  3I56 V;  5B1A C;  2PI5 A;  2EIN C;  3OMN B;  1SRY A;  1UJW B;  2XAQ A;  1K92 A;  4CBC A;  1S76 D;  2DYR C;  4GX1 A;  1VQ5 V;  3ZMT A;  3CCS V;  3B8M A;  3B77 A;  2Q67 A;  3VBB A;  4JYB A;  1OCR B;  2EIJ B;  1S5H C;  1NH2 B;  1JCH A;  3RBZ A;  3W7S A;  3FB7 C;  1NBM G;  1JPX A;  1FXK A;  2QE7 G;  4JAV A;  3ZRS A;  1YJ9 V;  2WWW A;  2IH1 C;  1K4C C;  3OM3 B;  3OR6 C;  4CZZ A;  1MOF A;  3TK1 A;  4UV8 A;  1KKD A;  3JD3 A;  4FK5 C;  4MT8 A;  1AI5 A;  4GX5 A;  3ZRV A;  3E8B A;  2C2A A;  3AG4 B;  1PL0 A;  2W6I G;  3F7V C;  5H6Q A;  4G27 B;  4ZBM A;  3SPI A;  5L3B A;  3E8H A;  3ML0 A;  3OW2 U;  3SPJ A;  2Y69 B;  4TWK A;  3CCL V;  2OT5 A;  1THZ A;  5EBL C;  2WLL B;  3LNM B;  5B1B B;  4UXN A;  1FFT B;  1QLN A;  4JAU A;  1MSW D;  1MG1 A;  2UXN A;  1M56 C;  3WG7 B;  2Q6A A;  3SYA A;  5J9P C;  1VQ7 V;  3OUF A;  4MVS A;  3HB3 B;  1NVP D;  3CPW U;  4F4L A;  1JX9 A;  2DYS B;  3SYQ A;  1S3J A;  2X0L A;  3ETG A;  1NKD A;  3P30 A;  1F23 A;  4UUJ C;  1M57 B;  2JEX A;  2V7Q G;  2YSU B;  3IFX A;  4UV9 A;  3ABM B;  2IJH A;  2X6B A;  1K7D A;  3QO5 A;  3X2Q B;  4WFH A;  3R65 A;  3H01 A;  3RW0 A;  3ZN0 A;  1VQN V;  1F51 A;  4KFM A;  2ZXW C;  3CCR V;  1V55 B;  2R9I A;  2AHY A;  4MSW C;  2HG5 C;  1GTO A;  2ITD C;  4MTF A;  4N21 A;  3ZJZ A;  4ASU G;  3LDD A;  2EIL C;  4BIZ A;  1SES A;  1ENV A;  1FS0 G;  2CK3 G;  1S0V A;  1R3K C;  2WLN A;  2GSM B;  2ZD9 A;  5EK0 A;  5B1O A;  1G8M A;  3ABL B;  5EBM C;  1FXV A;  2A79 B;  1GM9 A;  3LSQ A;  2QTO A;  3WFV A;  1H8E G;  1OCO B;  3IGA C;  3OUS A;  1I5Y A;  2OTJ V;  2IJK A;  3ABK B;  4X8A A;  3K3W A;  2GHY A;  2ZDI C;  4MS2 A;  3I55 V;  2EZO A;  3UM7 A;  5BZB A;  2XOK G;  2QKS A;  1OCR C;  2EIJ C;  1W0J G;  1QLE B;  4MVM A;  5IYD O;  4PA6 A;  3EHB B;  1YTF D;  1KEC A;  3B8N A;  1HWY A;  4XDK A;  3CCE V;  1EFR G;  2EJR A;  5B3S B;  3JD0 A;  3ZMV A;  4JAS A;  2ITC C;  1SET A;  5LGT A;  4HYO A;  5L3E A;  5EBW C;  4J9Z B;  3P32 A;  4GX0 A;  2M7W A;  2IU0 A;  1GM8 A;  5CBH A;  1VQ9 V;  1G4Y B;  3ZCC A;  2X6A A;  3FB6 C;  2X7R B;  3CC4 V;  3G6E V;  4I5S A;  1YHQ V;  3AG4 C;  1P7B A;  1RPR A;  3ZMZ A;  3CC2 V;  3STZ C;  4QIW F;  2D3O W;  3CCU V;  3AG2 C;  2HVJ C;  3AEI A;  1V54 B;  1P4R A;  1GMG A;  1QBZ A;  5LBQ A;  1BHA A;  2Y48 A;  1KC8 W;  1K3E A;  4DXW A;  5B1B C;  1YI2 V;  1NR1 A;  1GKF A;  5IY5 B;  4RAI A;  3GWO A;  3WG7 C;  1ZWI C;  3OEH G;  2EIK C;  3CYO A;  3W7W A;  4GX2 A;  4MVQ A;  4WFE A;  3ASN B;  2HVK C;  1Y66 A;  2DYS C;  1DTO A;  2UXX A;  4FPP A;  3F7Y C;  3OMA B;  3TET A;  3RVZ A;  2A0L A;  1VQ4 V;  1R73 A;  1JQ0 A;  5L3F A;  1KQS U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...