1KQSU

The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
pubmed rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1kqsU00
1QVFU 2OTLV 1VQMV 1S72V 2QEXV 3OW2U 1VQLV 3CC7V 3G4SV 3CPWU 1Q86W 1KD1W 3CCRV 2D3OW 1VQOV 1M1KW 1VQKV 3CCEV 1Q7YW 1YJNV 3CD6V 1KQSU 5DM6V 1M90W 1K73W 1YJ9V 3CCLV 1NJIW 3G71V 1W2BU 1VQ8V 1K9MW 4WFAV 1VQ5V 3CC2V 3CXCU 1VQ7V 3CCJV 1YITV 3CC4V 3G6EV 3CCUV 3CCVV 1VQPV 1YI2V 2QA4V 3CCQV 1YJWV 1VQ6V 1VQNV 4WFBV 1VQ9V 1QVGU 3CMAV 1Q82W 1K8AW 1VQ4V 3I56V 3CMEV 1YIJV 2OTJV 4WF9V 1N8RW 1JJ2U 1YHQV 1Q81W 1KC8W 3I55V 4WCEV 3CCMV 3CCSV 1R73A
chains in the Genus database with same CATH superfamily
2A0LA 3SPJA 2QSAA 3E86A 1NKDA 1TGOA 5EK0A 3T4DA 2F95B 3JATB 1H2SB 1H2LA 1Q6UA 3CP1A 3BFRA 4JF3A 3HKEB 4Z2WA 4DV3B 1PPJH 5CA0A 2PI4A 5GTIZ 2YC0A 1NZ6A 4XDLA 3W7XA 4IL6Z 4DR4O 4W4LA 4Z1VA 3WG7C 2E75B 1GMGA 3P30A 4AQYO 4GX1A 1AP6A 2PI5A 1H38A 5LP6A 1SQVH 4BIUA 4B3SO 4X1KA 1PL0A 1SERA 4FM0A 1N34B 4K3AA 3LUTB 4LF5O 1GM9A 3D8CA 4DYLA 1N33B 1L8DA 2R9AA 1Z5VA 4DR3O 4JI1B 4DXWA 2OCCB 5LA6B 2JDIG 1XMOB 1HNZO 4ZOLA 4GKJO 3T1YB 2QM7A 3CXCU 1R1BA 2KQXA 1I94B 4QE9A 1DF5A 3OE7G 4X64O 2OT5A 3E89A 5B3SB 2R9RB 5H9CA 2EIKB 2Q4PA 2GBOA 3DGEA 1BHBA 5A9GA 1QHTA 4UVCA 4PDLA 2RJZA 4MTOA 4AI8A 2AZ2A 5EYPA 2WLIA 1PM9A 1HNXO 4MVOA 4WFAV 1HWYA 1NH2D 4MVRA 4GUNA 4X65O 2PF4E 1QVGU 4NXNO 2WLNA 1OZ0A 3KZIZ 4KP4A 1VMGA 3OEEG 5JQGB 3ZRWA 1RM1B 1Z2GA 1Y76B 5LXTA 4I55A 4K8XA 3ML0A 3ZHQA 1B04A 4GKJB 1BZKA 2VWKA 3JATA 2LO1A 2ZM6B 4LF9B 1HDJA 3TK1A 3CRMA 4GX5A 5DN6G 1VF6C 2ZKOA 5L3FA 4FMTA 1IDSA 3BRCA 5IE9A 2H3OA 3SR2C 3BEHA 1UFIA 1AR4A 1KU9A 5LA6A 2MK3A 2YEVB 2ZDIA 2A79B 2BTOA 5L3CA 4KHPB 2Y4UA 1GN6A 1EFRG 4GX0A 3JSLA 2ZXWB 5LP6B 5BR8B 4I55B 1SESA 2WLIB 3M8AA 3DXRB 1D2DA 2Y48A 5AG2A 3D3QA 4O4LA 4BW9A 1YDXA 3RYHA 1TVKA 2Y69B 3ZIAG 4NXMO 3VQXA 2WA4A 3IAYA 1FJGO 2HEPA 4P9PA 3OMAB 2UUCB 3MHSC 1QR8A 3L70H 4ASUG 1HP8A 1M4UA 3FB5C 5E1AC 5LL6Y 2ITDC 1VQPV 4DV7B 1IBMO 3ETGA 5JJJB 3VQWA 2JGUA 1L0LH 4LH6A 4MSWC 2YIAA 3FB8C 2WA3A 3U10A 2VRZA 1US6A 4PD4F 3K59A 4K35A 3RN4A 4HNAB 2A3QA 4DUZB 2VQEO 1VP7A 4JGSA 1WN7A 2ILMA 1Q82W 1QLNA 4N21A 2DW4A 1GO3F 1COWG 2FB5A 4JYCA 2EX3A 2YI9A 1JQ0A 1MA1A 1O9HA 1S5JA 2V4DA 4TQFA 4WFHA 1OCOB 5LGTA 3ZMUA 3QNEA 2M7WA 2RMKB 4UCSA 1QNMA 1FAFA 2BE3A 4JI3B 3ABLB 3CWBH 3I56V 2OIGA 1ZSPA 2OTJV 3STLC 5HFLA 3L74H 2W6IG 1CP9A 1KD1W 4X1IB 3JARA 4D7TA 5DM6V 1OJHA 2BSKB 4MW8A 3WG7B 2RN9A 5ITZB 4LF6B 2RNBA 1SKVA 4X9QA 5JCOC 3E2EA 3Q4HA 4TWKA 4I4TB 5JJEB 1F7YA 5IJ9A 3JD0A 4IT5A 4L8JA 3K5MA 1BT8A 4LWSB 4OX9O 2HHHO 4J9ZB 1IX9A 1VQKV 3AG4B 2OCHA 5GTHZ 1NTZH 1R3LC 2JS3A 3JD1A 4YJ2B 3K9AA 4IHJA 3M7MX 3EXAA 1W0JG 1KC8W 3K06A 3THOA 4CH6A 4X20A 2YXLA 3E8BA 4KUMA 3S3WA 3G6BA 1NQTA 2LFSA 2ARHA 1Q5OA 4O2AB 3RW0A 5JH7A 3W7SA 1IBLO 3O65A 5B5EZ 1Q6HA 2JRIA 1GTOA 3BCCH 2CGNA 1ZAUA 1A32A 1BL8A 2B1IA 1NS1A 4JI0B 2QJ1A 4DR3B 1Q6IA 3QO7A 2VQFO 2PUSA 4DV4B 1M57C 2QA4V 1QBZA 2XNDG 3ZRXA 4PA7A 1M9NA 4FFBA 2EINB 3OMNB 4GT1A 3JAKA 3QO8A 4P2ZA 1H2GA 4LF6O 1KQSU 2QKSA 4DW1A 2F66C 1ZL8A 3JAMN 3F5TA 4LNUA 5EBWC 1N8RW 3CE2A 5JVDA 2V7QG 1H2KA 3OW2U 2K9PA 2EIKC 1Y74A 1VQ8V 4DR2B 5KX5B 4CS2A 4GKKO 4JI6B 4LBEC 2ADQB 3OUSA 2ATKC 3JCUZ 2UUCO 1N32B 2H8PC 1BCCH 2YDEA 3O9OA 5B1OA 2UXBB 4DR4B 1W59A 3SPIA 3MAQA 1GN2A 4I9QA 1LNQA 5IYCO 3RYFA 3CX5F 3APOA 1VQ9V 5H6RA 2QKCA 5CMUA 1ZTEA 3JSNA 2F93B 4LNUB 4DV6B 4DV5O 2Q68A 2UXDB 3CB2A 4DR2O 2WLKA 1R6NA 2YUAA 2EILB 1NBMG 4EFBA 5KX5A 1G4YB 1S0VA 3W7WA 4WFBV 1TVKB 1JFFA 1OCOC 2XHBA 1M56C 4JAVA 3B4SA 1VF6A 4O4LB 4AILC 3C3SA 1YHQV 4X1YB 4UCRA 4TV9B 1M57B 1THZA 2LP7A 1S3JA 2Z0AA 2XAGA 5JJNB 2ZIMA 2BCCH 4J7JA 1RPOA 1KMIZ 4B3SB 3RYIB 3DTUB 3DC6A 1TUBA 5C8YB 1K4DC 2ITCC 2B9ZA 3IGAC 1S76D 4AQYB 4B3TO 5IDJA 5LOVA 2ZE7A 2GTSA 4E4EA 3ZHVA 4JYAB 5J2UB 5CN0A 5B1NA 4GKKB 1LR1A 4JPRA 1JA8A 3SPHA 3P32A 4LF8B 1D5AA 4RUEA 2WPDG 3ABMB 3RYIA 4XDJA 1VARA 5CB4A 4UCVA 4X89A 4LFBO 1EN6A 1ZX3A 2GUZA 2ZNIA 1HR0O 1YTFD 1SETA 5LOVB 4WCEV 3GWKC 1K5QA 1XL6A 2D2CB 3OAAG 1I5YA 1NT2B 3NXSA 2BSKA 1OCCB 3K0GA 3ZRVA 4JAUA 4RQEA 1YI2V 5EYPB 2UXCB 1KBHA 2O57A 5LP6C 1T5EA 4ICGA 1J5EB 2GDSA 1XEQA 4DV2O 3CCSV 2OTLV 2DYSC 3HPLC 4U7NA 5EC2C 3QVNA 3JAKB 3CC2V 3SPCA 1HNXB 5FPOA 1DF4A 4DR5B 1F23A 2YEVA 3ZRSA 1PP9H 1KECA 2WLJA 2ETNA 3IFXA 2DWEC 2JJ2G 5IYBO 2JEUA 3H01A 4ZBMA 3K58A 2JIZG 2Q73A 4PJ0Z 3H9VA 2VWJA 5C8YA 1TUEB 3CCJV 2ZM6O 3J7AU 4YIPA 4CZZA 1ZUQA 1XNRB 4DRXB 2Q8VA 3D36C 2JGDB 3CRQA 3FKSG 3OTOB 4LH7A 5J2TA 1R3JC 4UV9A 5KUKA 2LGWA 3Q4HB 1AJNA 3EVKA 3WB0A 3M99B 1N36O 2DQ0A 1ZL8B 1ZLZA 5CA0B 5LHHA 4O2AA 1K9MW 2M6YA 1PNLA 4R7CA 4E2LA 2KKWA 5JVDB 3BY6A 4WFFA 4O4JB 3LDEA 4WF9V 4YY3O 1VIBA 4DV7O 1EZJA 1RSOB 1YEWA 1NR1A 2HP8A 4MVQA 3RT3C 5C93A 3L73H 2W0FC 1GRJA 2QWNB 2IW5A 1KUQA 1KP2A 1PV0A 3G6EV 1Y6XA 2CH7B 5L3EA 3RYCA 4J80A 5KLVH 4TOIA 1AI5A 4I0XA 2EBOA 5FL7G 2FYUH 2DYRB 3KCYA 1RFYA 2XAFA 3CCMV 1OV9A 4NXNB 2CTPA 1DTOA 3ZEDA 2UUAB 4EB6A 4RO2A 1PNMA 3CJHA 1MSDA 4R6ZA 5CBGA 3WB2A 3F7YC 4FLVA 1KKCA 4CC6A 5J2TB 2P06A 4D7SA 2PYLA 4DR1B 1N32O 4FLZA 1NH2B 3HKEA 2BOCC 4KFMA 1VQ6V 3U11A 1FFTB 4RQFA 4NYKA 3AK3A 3BHPA 5KA6A 3RFRA 2DE0X 4IYHA 4DW0A 4O2BB 1BHAA 1WP7A 1IXMA 4B3MO 4BR6A 1HNWB 2A7WA 3MD0A 2DOSA 2R72A 4EKWA 4DUYO 4RUFA 1RSOA 3ZRWB 4R8CA 3OFNG 2QM8A 2YS8A 3RYCB 4JI3O 3TETA 3DSQA 1YXBA 2P6JA 5KAIZ 4JZGA 1DK1A 1MZFA 2QDOA 3KG2A 3CPWU 1F51A 3ZHRA 1B06A 3JD3A 4MW3A 4J7ZA 3ABTA 2F4VB 4FVMA 5IWAB 3HR0A 5H6QA 3HKCB 1U97A 1GKFA 4EEQA 2BOBC 1YZBA 5B1BB 4EFEA 3E83A 2ZQMA 3ZMZA 4LR3A 2YXHA 3LSSA 3OUFA 2PTMA 4FZ1A 4IIJB 1MSWD 3E35A 2Q6AA 4WBNA 3ASNC 2DJVA 4F6RA 2CDYA 4PI2A 4DV6O 3HKBB 3KKYA 4LF7O 5EIBC 4P30A 5KHHA 3CSXA 4C7UA 4EB6B 1N34O 4OPAA 4JZ2A 2GTAA 1SQGA 3T1CA 5B1BC 1W2BU 2P67A 3HKDB 3CYOA 5F2VO 2DYSB 5KMGB 4LF8O 2LQTA 3SYPA 3W7UA 3JAWB 1SS3A 2QTOA 3CMEV 3T2MA 1UJWB 1LUWA 3JD2A 4X1KB 4JYAO 3BPZA 2YIDA 2NN4A 5H2FZ 4DV3O 2QEXV 1AJPA 4I50B 4JI7O 1P4RA 4LFCO 3CRRA 3LSUA 1YJNV 1KYOF 1P84F 1NVPD 2AW9A 1XNQB 4JI5O 4WBNB 2EIMC 2NLJC 2Y69C 3RBZA 1P7GA 2Y0PA 2HJFC 5GONA 4JI8O 2Q9LA 4B08A 5EIBD 1JPXA 5LMNO 2JEXA 4UVAA 2AZ0A 1I94O 3CC7V 5CA3A 3CCRV 1M90W 1IVSA 1O9GA 3G71V 4DR7O 5LBQA 5JCOA 3JCZA 1AJQA 5EBMC 2JJ1G 4NVPA 1YIJV 3SYCA 1TAEA 3ZMTA 1BS3A 2WLLA 3QO5A 1XQ8A 2IJIA 1K73W 4FM2A 3JAWA 3ETQA 2F23A 2NR5A 4GZRB 1H2MA 3FYIB 2Q69A 2DYRC 1FFXB 1K3EA 3B2EE 3QTCA 4X1IA 2L6LA 3N2KA 1R6KA 5BMVA 4MVUA 3RWRD 5FPRA 3GWOA 3SJAC 1HR0B 2FTKA 2IH3C 2H94A 3QG5A 2D3OW 5KMGA 4LFAO 3ABKC 3G67A 3N2GB 2IU3A 2IJHA 4JI6O 5DEDA 3FFQA 5E79Z 1V54B 4BIZA 3C3TA 3SJCC 5CA1B 4LF9O 4J10A 4TSFG 1B6QA 4TV8A 2WAMA 1EN4A 2V1DA 5K1PA 1KKDA 3CS5A 1XI1A 5KHJA 4G27B 2F4VO 1BSMA 1DLBA 1XBLA 1XUQA 4H0LB 2Y0IA 2UUBO 2EINC 2WLMA 2NNUA 3WFVA 2KG7A 4ZHQB 4DV5B 1MNGA 3ABKB 5CB4B 5H5NA 5HFMA 1B3QA 4KXRA 1M56B 3G80A 5IJ9B 4X64B 1AVMA 3APQA 5GW7A 1AP5A 2RQ6A 1ENVA 3T1YO 2QKAA 4LF4O 1EM1A 2E5LB 3C90A 5L3GA 1NR7A 4PA4A 2A9HA 3CRAA 1YSCA 2W0XA 3JASA 3L75H 1WPXA 3OR7C 1S5HC 2E76B 4FJCC 1QR9A 3H1IH 2OWOA 4O4HA 4CH5A 1ROPA 3ZS8C 1QLEB 3X2QC 1WB8A 4JI4O 4J9YB 2ZR3A 4P9OA 1E79G 3JALB 1GM7A 1S5LZ 5KAFZ 5CBHA 4UVBA 4MTFA 1VQOV 2EULA 1XMOO 2DWDC 4MVZA 5FNVA 1AILA 3B09A 4JTAB 4JI2O 3CRCA 4CC5A 4ZKIA 2B1GA 2ZNJA 1IBMB 1VQ4V 4U7OA 4W4KA 2QTSA 1VF7A 5FLXN 3KCXA 3LNMB 2LGQA 5DECA 2CTRA 4BWAA 4K0KO 2XUMA 4UXNA 5B66Z 3SPGA 2P5OA 1WA8B 4F6RB 2EZOA 3P3NA 2VS0A 3E22A 1Y74B 2GSMB 2Y4TA 3UCSC 2HVJC 3ASOC 1WAZA 3L9DA 5IJ0B 3A0RA 5LHGA 3J81N 1H8EG 1YTFB 1M1KW 1GK9A 2XAHA 3ZHUA 5JH7B 4PELA 4TUYA 1V9PA 2ZIOA 4G28B 2X6BA 5D5PA 2DQ3A 2ODMA 4QJFB 2F1MA 1K8AW 4CH3A 4I50A 3L71H 3AG2B 2Q0AA 3A0HZ 3K04A 3T4ZA 1XREA 1WB7A 3ABLC 2QWPB 2GHYA 4ZOLB 4LF4B 4PA6A 4PA9A 3VQVA 4PHZA 2OIEA 2CAZC 2P7TC 1OCZC 2QE7G 3CC4V 1JOYA 4U3JB 3A2FA 3UO2A 4LFAB 4H44B 3ZN0A 4JI7B 1PKXA 1QVFU 1BE3H 4O2BA 2WSSG 4DR5O 2N04A 2IBZH 1SQXH 3DXRA 5KA5A 1S77D 1WA8A 3QF7A 1K92A 4B7KA 2Z3YA 5IJ0A 2K1EA 1QQCA 3RYHB 5JWPA 3ETEA 3AK1A 4FLWA 1YCIA 4GCZA 2EILC 4UB8Z 4JI2B 4GX2A 3E22B 4GYCB 1FFXA 3H1JH 4IYIA 1SQFA 2XT9A 2XTAA 2IJKA 2BTQA 4FM1A 1XL4A 3WU2Z 5KUMA 2YSUB 3ASNB 4FFKA 1UPGA 5GONB 3GB7C 1EZVH 5IT9N 3J80N 3B40A 2P90A 1SZTA 2HJDA 1FXKA 3LDDA 2MW2B 4X8AA 4FLXA 4ZIBA 3BABA 3K5OA 1VQ7V 1Q3EA 2UXXA 1SQPH 4CBCA 2OCCC 1YF2A 2ZD9A 2PZSA 3T1HB 3NR7A 5IY5C 1MMMA 1D5NA 3OD4A 2P22C 4JI8B 4MTGA 4K8ZA 4I5SA 4ZI7A 1RP3B 4BW5A 4NTYA 1FKAO 1CEZA 3EFFK 4TUYB 2AXTZ 2JK5C 2E5LO 1Q7YW 3RGBA 4FLTA 3H1LH 1WJZA 4FLUA 3MDSA 1TA8A 3JYCA 1IBLB 2Q7EA 3TGUH 4NXMB 2LJ2A 1KB9F 4CH4A 3OMIB 1AI4A 4DK1A 1JJOA 4I4TA 3ZHTA 1VQMV 2AHYA 2EIJC 3X2QB 4IHJB 4RAIA 4FK5C 4X62O 5KHGA 4Q20A 1X4TA 4X66B 1N0JA 2JS5A 2Q5ZA 4DO2A 1LUVA 2HFEC 4UCUA 4K0KB 4X65B 3ETDA 3TCUA 4LFCB 4LF7B 2ZT9B 3B8NA 3ZMVA 1H2NA 3H1KH 2WWWA 3WB1A 1SA0A 1YJ9V 2BTQB 3VQYA 4XBFA 3UT5B 2XOKG 5B1AC 5EBLC 2CE4A 2FKXA 1FYJA 2ZXWC 1V55C 4JTCB 4UCTA 2HHHB 2B5UA 4X20B 1IZ3A 4PA3A 1K97A 3K9SA 4JI4B 1Y66A 5D5QA 5IWAO 4LF5B 4NKGB 4DR6O 3BVOA 4CS4A 3D3IA 3CHXA 2PGGA 3OM3B 2YI8A 1SF9A 3AG1C 3AG7A 1WP8A 4YY3B 4JV5B 4TV9A 1M93A 5BZBA 3FX7A 4KL1A 4OPHA 1EN5A 1URFA 1AR1B 3VBBA 2CH7A 1JR9A 4I7ZB 4QIWF 4J7KA 1ZWIC 3HB3B 3DC5A 4UCOA 2Q67A 1WLEA 3SJBC 2R70A 4DR6B 1VEWA 4BAYA 3K03A 2WLLB 2ZINA 3CJHB 2F43G 1AI6A 3UO3A 5FNVB 4DV2B 1I7FA 1GN3A 4FFBB 4NB5A 4GLXA 2QM4A 2XAJA 1SRYA 1XHZA 2PYJA 1E1RG 3FB7C 2IH1C 2FL4A 3GVMA 4B3MB 3ABUA 4PI0A 3K5LA 1SQBH 4FIPC 1I08A 2Z5UA 4O4IA 1N0NA 1W0KG 1PL4A 3OGIB 1NU1H 4JI1O 3I55V 5EC1C 1Z5WA 2DMXA 3AG3C 1SA0B 4PV1B 2YIBA 1PD3A 2UU9B 2LW1A 4B3RB 2HG5C 5B3SC 3K3WA 4PDMA 1MZEA 3SYQA 3R65A 1DGSA 1J5EO 4FPPA 3OGCC 4D6TH 5IYZA 4HBNA 4F6EA 2EJRA 2QWOB 5LGNA 1V54C 1OCCC 4O4JA 1VQ5V 4DR7B 4DRXA 2XAQA 1QLEC 2KB1A 3W7TA 1Q86W 3BA8A 2XASA 2HKOA 3T1HO 4HAMA 1R3IC 1FXVA 1SQQH 4YHHO 2UXDO 2R9IA 3A0BZ 4MTXA 5LMNB 2L35A 1Y67A 1SZXA 4QGPA 3CCVV 4YJ3A 3IJ4A 3PN1A 3CCQV 1HNZB 4MVSA 3AG4C 1XILA 2P4KA 4DR1O 1RPRA 1SC5B 1Q8IA 3STZC 3SJQC 2A06H 5ITZA 1FPOA 5LMUB 4O4HB 4MVMA 4TT3G 4FZ0A 3BAAA 4XDKA 2X6CA 3TXSA 1YJWV 2YICA 4N23A 5EZYB 1XMQO 4IIJA 4UV8A 4FLYA 3JALA 4B3TB 2IM9A 2E74B 4WFGA 3S3XA 5IYZB 1Y4MA 3HKBA 2GUZB 4X66O 2EJ7A 2YXYA 4I0XB 1N36B 1MG1A 3CD6V 1TUBB 3ZBHA 4R50A 3B8MA 1OHHG 4LC1A 4MT8A 4NR1A 2UXBO 1YVWA 1JX9A 2HR3A 1QU7A 3N27A 2X7RB 2EIMB 1P7BA 3E8GA 4IGGA 3BA9A 1N4CA 4H37A 1VQLV 5BY1A 1I5XA 1IURA 4DV1B 2C2AA 1HNWO 1JCHA 5K1XA 3AEIA 1Y76A 2OYQA 1K7DA 1WPBA 2RCVA 1VQNV 1XOUA 4LFBB 4U3FH 2QWRB 4MS2A 1I0HA 1OCZB 1F4MA 1Q43A 3AK2A 5IY5B 4TV8B 4A5UB 4NTWA 3N2GA 4DV0B 2G38A 1GN4A 4QE7A 2N74A 3LNNA 2LFRA 4AHCA 4UUJC 4OX9B 1G1XB 3CEIA 2KSDA 3OEHG 2CUGA 1JMKC 2DN9A 1K33A 5L3DA 1J95A 3N2KB 4HZ3A 2JVDA 3CXHF 5CA1A 4LP8A 2ZR2A 3ABMC 4G2KA 3CCEV 1R3KC 4OXSA 4DV0O 2IU0A 3UT5A 1NJIW 3TXQA 4JI5B 1IBKB 1XDCA 1QCEA 2ZCEA 4JI0O 1L0NH 4OGQB 5LYJB 3B77A 3SYOA 3F5WC 3ICXA 1XNRO 2N05A 3R66A 1OCRC 1K5SA 3UKMA 2PY5A 2P4VA 2HLDG 2IJJA 4O4IB 2W6JG 2JGDA 1CXZB 3ZN1A 2EZPA 3LSQA 3K08A 5BR8O 4JYBA 1MABG 4HNAA 3CCLV 5KHKA 5EZYA 1AI7A 2LW7A 1YITV 1AROP 1FD9A 3K79A 3A8TA 3H1HH 2X6AA 4DV4O 2ZE6A 1Q90D 3SYAA 4DV1O 2YIBD 3K0DA 3OT7A 4B3RO 2QR4A 1GAXA 3TJTA 1V55B 4QNHB 3RYFB 2AHZA 5CBFA 4DUYB 4YJ2A 5BXZA 2Q7GA 4JV5O 2ZE5A 1XHXA 4YIOA 3D36A 2FMLA 4L87A 3CMAV 2UU9O 4B7EA 2UXCO 4JAAA 1K34A 1BGYH 1R6TA 4U3JA 1NI8A 3HKDA 2ADPA 3IC7A 3OTOO 4ZHQA 3G4SV 4JYYA 4X62B 2RDCA 4LCUC 2VQFB 3ZHSA 3FAVB 5LXTB 1U96A 1FJGB 1XNQO 3EHBB 4YHHB 1P49A 2EIJB 1H8HG 3SGIA 4ZI7B 2GV9A 4UB6Z 3FD9A 3LDCA 1GH6A 4UFZA 3UQ8A 1S72V 4I9WA 2ZDIC 1BQ0A 1XMQB 1CPYA 4QPKA 3IC9A 1AB3A 1F4NA 1MOFA 3I5DA 3RVZA 3JASB 1FXKB 3AG2C 4TQDA 3UM7A 5LMUO 1RM1C 2UUAO 1X59A 4Z1MG 4J42A 3F7VC 4PDVA 5IYDO 4J41A 5BMVB 4HYOA 3K57A 3OTFA 1BQZA 1G6UA 4WFEA 1JVMA 2X0LA 1PNKA 4DK0A 1HW7A 3ZMSA 5J9PC 4H13B 5JQGA 1N33O 3P3PA 5KHIA 3E8FA 2CTWA 3K5NA 5J2UA 3E8HA 1Q81W 1AR5A 3AG1B 1IXBA 1R73A 2HVKC 1FXKC 4F4LA 2E3CA 4H33A 2QWQB 2UUBB 1G8MA 1KP3A 3ZJZA 1BMFG 4KHPO 2AGAA 3CCUV 1FXHA 1GM8A 3L72H 4J11A 3MHHC 5A2QN 3PJSK 3SDLA 3JD4A 2QGNA 3OR6C 4JASA 4JTDB 4YXWG 4Q6GA 1E1QG 4NTXA 3ASOB 3U0ZA 4BIOA 3HKCA 3FB6C 1K4CC 1JFFB 1L1FA 3ZX6A 3JARB 3VOUA 4CS3A 1M5IA 2ZE8A 3ZCCA 4LWSA 4RWUA 5LYJA 5LGUA 4YJ3B 2CTQA 5TISZ 2UXNA 2KG7B 5B1AB 5LHIA 1NVPB 2WLHA 1NTMH 2Q0OC 4DUZO 1VF5B 2Q7HA 3FAVA 3RVYA 1IBKO 4QPJA 1NTKH 1ORQC 1WNSA 4ABMA 1FS0G 1OCRB 4PDRA 2CGOA 2CK3G 5L3BA 3AG3B 1EBOA 4X1YA 4X88A 3FYEB 1JJ2U 2VQEB
chains in the Genus database with same CATH topology
2A0LA 3SPJA 2Q68A 1SRYA 1E1RG 3E86A 2FTKA 1NKDA 2H94A 2IH3C 3FB7C 5EK0A 2D3OW 2IH1C 3T4DA 3ABKC 2WLKA 1R6NA 2IU3A 2IJHA 2EILB 1NBMG 3ABUA 3CP1A 1V54B 4JF3A 4BIZA 1G4YB 1S0VA 4FIPC 2PI4A 3W7WA 4WFBV 1OCOC 2Z5UA 1M56C 4JAVA 1W0KG 1B6QA 4TSFG 4XDLA 3W7XA 1YHQV 2WAMA 2V1DA 3I55V 5EC1C 1M57B 3WG7C 1KKDA 1THZA 2LP7A 1S3JA 1GMGA 2XAGA 3AG3C 3P30A 4G27B 1RPOA 1DLBA 1PD3A 2HG5C 3DTUB 4GX1A 5B3SC 3K3WA 2PI5A 4PDMA 3SYQA 1H38A 2EINC 1K4DC 2ITCC 2WLMA 3IGAC 3R65A 4BIUA 1S76D 2NNUA 1PL0A 1SERA 5IDJA 4FPPA 3WFVA 3LUTB 3OGCC 1GM9A 2EJRA 3ABKB 5LGNA 1V54C 1OCCC 1VQ5V 5HFMA 4DXWA 2OCCB 2XAQA 5CN0A 5B1NA 1QLEC 1M56B 2KB1A 4JPRA 3W7TA 1Q86W 2XASA 2HKOA 2JDIG 4HAMA 3SPHA 1R3IC 1FXVA 3P32A 2R9IA 4MTXA 2QM7A 3CXCU 4RUEA 2WPDG 4QE9A 1DF5A 5GW7A 3ABMB 3CCVV 3CCQV 4MVSA 1ENVA 4XDJA 3OE7G 2OT5A 3AG4C 3E89A 5B3SB 2R9RB 4X89A 1RPRA 5L3GA 1NR7A 4PA4A 1YTFD 5H9CA 1SETA 2EIKB 4WCEV 2A9HA 3STZC 1K5QA 1YSCA 3DGEA 1BHBA 1XL6A 4UVCA 3SJQC 4PDLA 3OAAG 1WPXA 1I5YA 4MTOA 3OR7C 3NXSA 1S5HC 2WLIA 1OCCB 4MVOA 4MVMA 4WFAV 4TT3G 1HWYA 4FJCC 4XDKA 1NH2D 1QR9A 2X6CA 4MVRA 3K0GA 3ZRVA 4JAUA 4RQEA 1YI2V 4N23A 1YJWV 1ROPA 1QVGU 4UV8A 1QLEB 2WLNA 3X2QC 1OZ0A 4KP4A 4WFGA 4J9YB 2ZR3A 3OEEG 4P9OA 1E79G 3CCSV 3ZRWA 1RM1B 2OTLV 1Y4MA 2DYSC 1GM7A 3HPLC 5CBHA 4UVBA 1MG1A 3ML0A 4MTFA 4U7NA 1VQOV 3CD6V 5EC2C 2DWDC 4R50A 3B8MA 4MVZA 3CC2V 3TK1A 3SPCA 1OHHG 4JTAB 4LC1A 4GX5A 5DN6G 4ZKIA 5L3FA 4FMTA 4MT8A 1DF4A 1F23A 2YEVA 2B1GA 3ZRSA 1VQ4V 1KECA 3BEHA 4U7OA 2WLJA 1JX9A 3IFXA 2HR3A 2MK3A 2YEVB 2DWEC 2JJ2G 5IYBO 2JEUA 2ZDIA 3LNMB 2A79B 3H01A 2X7RB 4ZBMA 2EIMB 5L3CA 1P7BA 3E8GA 1VQLV 4H37A 2JIZG 1I5XA 4UXNA 3SPGA 1EFRG 4GX0A 2C2AA 2ZXWB 1JCHA 2EZOA 3AEIA 1TUEB 1SESA 1K7DA 2WLIB 3CCJV 2Y48A 1VQNV 2GSMB 4CZZA 2HVJC 3ASOC 3FKSG 2Y69B 1R3JC 3A0RA 4MS2A 4UV9A 5KUKA 3ZIAG 1OCZB 1F4MA 5LHGA 5IY5B 1H8EG 1AJNA 4P9PA 3OMAB 1YTFB 4QE7A 1M1KW 3M99B 3MHSC 1GK9A 2DQ0A 2XAHA 1QR8A 5LHHA 4PELA 4ASUG 1K9MW 2LFRA 1PNLA 5E1AC 3FB5C 4UUJC 4G28B 4R7CA 2ITDC 1VQPV 2X6BA 4E2LA 3OEHG 2DQ3A 4QJFB 1K8AW 3BY6A 4WFFA 1K33A 3LDEA 5L3DA 4WF9V 1J95A 3ETGA 3AG2B 4HZ3A 3K04A 1EZJA 4MSWC 3T4ZA 4LP8A 2ZR2A 3ABLC 1NR1A 3ABMC 2GHYA 3FB8C 4MVQA 5C93A 4G2KA 4PA6A 4PA9A 2W0FC 3CCEV 1R3KC 4OXSA 2IU0A 2IW5A 2P7TC 1NJIW 1OCZC 2QE7G 1KP2A 3CC4V 3G6EV 1JOYA 4JGSA 1QCEA 3B77A 5L3EA 1Q82W 3SYOA 3F5WC 1AI5A 1QLNA 1OCRC 1K5SA 2DW4A 2EBOA 4N21A 5FL7G 3UKMA 1GO3F 2HLDG 2DYRB 3ZN0A 1COWG 2IJJA 4JYCA 1PKXA 2XAFA 3CCMV 2W6JG 1QVFU 1DTOA 1JQ0A 3ZN1A 2EZPA 3LSQA 4RO2A 3K08A 2WSSG 4WFHA 1PNMA 4JYBA 1MABG 1OCOB 4R6ZA 5KA5A 5CBGA 5LGTA 3CCLV 3ZMUA 1AI7A 3F7YC 3QNEA 1YITV 2M7WA 1S77D 1AROP 1K92A 3K79A 2Z3YA 2K1EA 2X6AA 3ABLB 3ETEA 3I56V 2OTJV 4GCZA 3SYAA 1NH2B 2EILC 3K0DA 2BOCC 4KFMA 1VQ6V 3STLC 5HFLA 4GX2A 1FFTB 4RQFA 1V55B 4QNHB 2W6IG 1CP9A 5KA6A 1KD1W 2AHZA 5DM6V 5CBFA 4MW8A 1BHAA 1IXMA 3WG7B 2IJKA 3MD0A 3E2EA 3D36A 4L87A 4EKWA 4TWKA 4RUFA 3CMAV 4R8CA 3OFNG 1XL4A 2QM8A 3ZRWB 5KUMA 1K34A 3TETA 3JD0A 2YSUB 2P6JA 3ASNB 3GB7C 3IC7A 4J9ZB 3G4SV 2P90A 3KG2A 1F51A 1SZTA 3CPWU 1VQKV 3JD3A 1FXKA 4MW3A 3LDDA 3AG4B 3ABTA 4LCUC 4X8AA 1VQ7V 2UXXA 2OCCC 2ZD9A 5H6QA 4CBCA 1R3LC 3JD1A 5IY5C 3EHBB 3K9AA 1GKFA 2BOBC 2EIJB 1H8HG 5B1BB 3E83A 2ZQMA 4MTGA 4I5SA 3LDCA 1W0JG 1KC8W 3K06A 3ZMZA 4BW5A 3E8BA 1S72V 1CEZA 3LSSA 4KUMA 4I9WA 3EFFK 1NQTA 2LFSA 3OUFA 2ZDIC 3RW0A 3W7SA 2JK5C 1Q7YW 1CPYA 4QPKA 1MSWD 3E35A 2Q6AA 1F4NA 3ASNC 1MOFA 3RVZA 1FXKB 3AG2C 3JYCA 3UM7A 1RM1C 1GTOA 4P30A 4Z1MG 3F7VC 4PDVA 1BL8A 2B1IA 3OMIB 1AI4A 5IYDO 1VQMV 3T1CA 2AHYA 2EIJC 4HYOA 5B1BC 3X2QB 3QO7A 4RAIA 4FK5C 1W2BU 2P67A 4WFEA 1JVMA 3CYOA 1M57C 4Q20A 2X0LA 2DYSB 1PNKA 3SYPA 4DO2A 2HFEC 3W7UA 3ZMSA 2QA4V 1QBZA 5J9PC 2QTOA 3CMEV 3T2MA 1UJWB 2XNDG 3ETDA 3TCUA 3ZRXA 3E8FA 3JD2A 3E8HA 4PA7A 1Q81W 1M9NA 3AG1B 2EINB 1R73A 3B8NA 2HVKC 3ZMVA 3OMNB 1FXKC 1AJPA 4GT1A 4F4LA 2QEXV 1P4RA 4H33A 3QO8A 2WWWA 1G8MA 4P2ZA 1H2GA 1YJNV 1KQSU 1NVPD 1YJ9V 4XBFA 1KP3A 3ZJZA 1BMFG 2EIMC 2QKSA 2NLJC 2Y69C 3CCUV 1FXHA 1GM8A 3RBZA 2XOKG 5B1AC 5EBLC 2HJFC 2ZXWC 3MHHC 1V55C 3PJSK 4JTCB 2B5UA 3JD4A 1N8RW 3OR6C 4JASA 4JTDB 5EBWC 4YXWG 4PA3A 1K97A 1JPXA 1E1QG 1Y66A 2V7QG 2JEXA 4UVAA 3ASOB 3OW2U 3CC7V 5CA3A 3CCRV 3FB6C 1K4CC 1L1FA 1M90W 3D3IA 2EIKC 3OM3B 3G71V 1VQ8V 3AG1C 5LBQA 4LBEC 3OUSA 2ATKC 3JCZA 1AJQA 3VOUA 5EBMC 2JJ1G 2H8PC 3ZCCA 5BZBA 1YIJV 3SYCA 1AR1B 5B1OA 3VBBA 3ZMTA 5LGUA 2UXNA 5B1AB 3SPIA 4QIWF 1ZWIC 5LHIA 3HB3B 2WLHA 2WLLA 1NVPB 3QO5A 2Q67A 3RVYA 1WLEA 2IJIA 4QPJA 1K73W 1ORQC 1LNQA 1FS0G 4BAYA 3K03A 1OCRB 2WLLB 5IYCO 4PDRA 3FYIB 2F43G 2Q69A 2DYRC 1AI6A 1K3EA 1VQ9V 5H6RA 1R6KA 2CK3G 5L3BA 3AG3B 1EBOA 4X88A 5CMUA 3FYEB 1JJ2U 4MVUA 2XAJA 3GWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF U;  2OTL V;  1VQM V;  1S72 V;  2QEX V;  3OW2 U;  1VQL V;  3CC7 V;  3G4S V;  3CPW U;  1Q86 W;  1KD1 W;  3CCR V;  2D3O W;  1VQO V;  1M1K W;  1VQK V;  3CCE V;  1Q7Y W;  1YJN V;  3CD6 V;  1KQS U;  5DM6 V;  1M90 W;  1K73 W;  1YJ9 V;  3CCL V;  1NJI W;  3G71 V;  1W2B U;  1VQ8 V;  1K9M W;  4WFA V;  1VQ5 V;  3CC2 V;  3CXC U;  1VQ7 V;  3CCJ V;  1YIT V;  3CC4 V;  3G6E V;  3CCU V;  3CCV V;  1VQP V;  1YI2 V;  2QA4 V;  3CCQ V;  1YJW V;  1VQ6 V;  1VQN V;  4WFB V;  1VQ9 V;  1QVG U;  3CMA V;  1Q82 W;  1K8A W;  1VQ4 V;  3I56 V;  3CME V;  1YIJ V;  2OTJ V;  4WF9 V;  1N8R W;  1JJ2 U;  1YHQ V;  1Q81 W;  1KC8 W;  3I55 V;  4WCE V;  3CCM V;  3CCS V;  1R73 A; 
#chains in the Genus database with same CATH topology
 2A0L A;  3SPJ A;  2QSA A;  3E86 A;  1NKD A;  1TGO A;  5EK0 A;  3T4D A;  2F95 B;  3JAT B;  1H2S B;  1H2L A;  1Q6U A;  3CP1 A;  3BFR A;  4JF3 A;  3HKE B;  4Z2W A;  4DV3 B;  1PPJ H;  5CA0 A;  2PI4 A;  5GTI Z;  2YC0 A;  1NZ6 A;  4XDL A;  3W7X A;  4IL6 Z;  4DR4 O;  4W4L A;  4Z1V A;  3WG7 C;  2E75 B;  1GMG A;  3P30 A;  4AQY O;  4GX1 A;  1AP6 A;  2PI5 A;  1H38 A;  5LP6 A;  1SQV H;  4BIU A;  4B3S O;  4X1K A;  1PL0 A;  1SER A;  4FM0 A;  1N34 B;  4K3A A;  3LUT B;  4LF5 O;  1GM9 A;  3D8C A;  4DYL A;  1N33 B;  1L8D A;  2R9A A;  1Z5V A;  4DR3 O;  4JI1 B;  4DXW A;  2OCC B;  5LA6 B;  2JDI G;  1XMO B;  1HNZ O;  4ZOL A;  4GKJ O;  3T1Y B;  2QM7 A;  3CXC U;  1R1B A;  2KQX A;  1I94 B;  4QE9 A;  1DF5 A;  3OE7 G;  4X64 O;  2OT5 A;  3E89 A;  5B3S B;  2R9R B;  5H9C A;  2EIK B;  2Q4P A;  2GBO A;  3DGE A;  1BHB A;  5A9G A;  1QHT A;  4UVC A;  4PDL A;  2RJZ A;  4MTO A;  4AI8 A;  2AZ2 A;  5EYP A;  2WLI A;  1PM9 A;  1HNX O;  4MVO A;  4WFA V;  1HWY A;  1NH2 D;  4MVR A;  4GUN A;  4X65 O;  2PF4 E;  1QVG U;  4NXN O;  2WLN A;  1OZ0 A;  3KZI Z;  4KP4 A;  1VMG A;  3OEE G;  5JQG B;  3ZRW A;  1RM1 B;  1Z2G A;  1Y76 B;  5LXT A;  4I55 A;  4K8X A;  3ML0 A;  3ZHQ A;  1B04 A;  4GKJ B;  1BZK A;  2VWK A;  3JAT A;  2LO1 A;  2ZM6 B;  4LF9 B;  1HDJ A;  3TK1 A;  3CRM A;  4GX5 A;  5DN6 G;  1VF6 C;  2ZKO A;  5L3F A;  4FMT A;  1IDS A;  3BRC A;  5IE9 A;  2H3O A;  3SR2 C;  3BEH A;  1UFI A;  1AR4 A;  1KU9 A;  5LA6 A;  2MK3 A;  2YEV B;  2ZDI A;  2A79 B;  2BTO A;  5L3C A;  4KHP B;  2Y4U A;  1GN6 A;  1EFR G;  4GX0 A;  3JSL A;  2ZXW B;  5LP6 B;  5BR8 B;  4I55 B;  1SES A;  2WLI B;  3M8A A;  3DXR B;  1D2D A;  2Y48 A;  5AG2 A;  3D3Q A;  4O4L A;  4BW9 A;  1YDX A;  3RYH A;  1TVK A;  2Y69 B;  3ZIA G;  4NXM O;  3VQX A;  2WA4 A;  3IAY A;  1FJG O;  2HEP A;  4P9P A;  3OMA B;  2UUC B;  3MHS C;  1QR8 A;  3L70 H;  4ASU G;  1HP8 A;  1M4U A;  3FB5 C;  5E1A C;  5LL6 Y;  2ITD C;  1VQP V;  4DV7 B;  1IBM O;  3ETG A;  5JJJ B;  3VQW A;  2JGU A;  1L0L H;  4LH6 A;  4MSW C;  2YIA A;  3FB8 C;  2WA3 A;  3U10 A;  2VRZ A;  1US6 A;  4PD4 F;  3K59 A;  4K35 A;  3RN4 A;  4HNA B;  2A3Q A;  4DUZ B;  2VQE O;  1VP7 A;  4JGS A;  1WN7 A;  2ILM A;  1Q82 W;  1QLN A;  4N21 A;  2DW4 A;  1GO3 F;  1COW G;  2FB5 A;  4JYC A;  2EX3 A;  2YI9 A;  1JQ0 A;  1MA1 A;  1O9H A;  1S5J A;  2V4D A;  4TQF A;  4WFH A;  1OCO B;  5LGT A;  3ZMU A;  3QNE A;  2M7W A;  2RMK B;  4UCS A;  1QNM A;  1FAF A;  2BE3 A;  4JI3 B;  3ABL B;  3CWB H;  3I56 V;  2OIG A;  1ZSP A;  2OTJ V;  3STL C;  5HFL A;  3L74 H;  2W6I G;  1CP9 A;  1KD1 W;  4X1I B;  3JAR A;  4D7T A;  5DM6 V;  1OJH A;  2BSK B;  4MW8 A;  3WG7 B;  2RN9 A;  5ITZ B;  4LF6 B;  2RNB A;  1SKV A;  4X9Q A;  5JCO C;  3E2E A;  3Q4H A;  4TWK A;  4I4T B;  5JJE B;  1F7Y A;  5IJ9 A;  3JD0 A;  4IT5 A;  4L8J A;  3K5M A;  1BT8 A;  4LWS B;  4OX9 O;  2HHH O;  4J9Z B;  1IX9 A;  1VQK V;  3AG4 B;  2OCH A;  5GTH Z;  1NTZ H;  1R3L C;  2JS3 A;  3JD1 A;  4YJ2 B;  3K9A A;  4IHJ A;  3M7M X;  3EXA A;  1W0J G;  1KC8 W;  3K06 A;  3THO A;  4CH6 A;  4X20 A;  2YXL A;  3E8B A;  4KUM A;  3S3W A;  3G6B A;  1NQT A;  2LFS A;  2ARH A;  1Q5O A;  4O2A B;  3RW0 A;  5JH7 A;  3W7S A;  1IBL O;  3O65 A;  5B5E Z;  1Q6H A;  2JRI A;  1GTO A;  3BCC H;  2CGN A;  1ZAU A;  1A32 A;  1BL8 A;  2B1I A;  1NS1 A;  4JI0 B;  2QJ1 A;  4DR3 B;  1Q6I A;  3QO7 A;  2VQF O;  2PUS A;  4DV4 B;  1M57 C;  2QA4 V;  1QBZ A;  2XND G;  3ZRX A;  4PA7 A;  1M9N A;  4FFB A;  2EIN B;  3OMN B;  4GT1 A;  3JAK A;  3QO8 A;  4P2Z A;  1H2G A;  4LF6 O;  1KQS U;  2QKS A;  4DW1 A;  2F66 C;  1ZL8 A;  3JAM N;  3F5T A;  4LNU A;  5EBW C;  1N8R W;  3CE2 A;  5JVD A;  2V7Q G;  1H2K A;  3OW2 U;  2K9P A;  2EIK C;  1Y74 A;  1VQ8 V;  4DR2 B;  5KX5 B;  4CS2 A;  4GKK O;  4JI6 B;  4LBE C;  2ADQ B;  3OUS A;  2ATK C;  3JCU Z;  2UUC O;  1N32 B;  2H8P C;  1BCC H;  2YDE A;  3O9O A;  5B1O A;  2UXB B;  4DR4 B;  1W59 A;  3SPI A;  3MAQ A;  1GN2 A;  4I9Q A;  1LNQ A;  5IYC O;  3RYF A;  3CX5 F;  3APO A;  1VQ9 V;  5H6R A;  2QKC A;  5CMU A;  1ZTE A;  3JSN A;  2F93 B;  4LNU B;  4DV6 B;  4DV5 O;  2Q68 A;  2UXD B;  3CB2 A;  4DR2 O;  2WLK A;  1R6N A;  2YUA A;  2EIL B;  1NBM G;  4EFB A;  5KX5 A;  1G4Y B;  1S0V A;  3W7W A;  4WFB V;  1TVK B;  1JFF A;  1OCO C;  2XHB A;  1M56 C;  4JAV A;  3B4S A;  1VF6 A;  4O4L B;  4AIL C;  3C3S A;  1YHQ V;  4X1Y B;  4UCR A;  4TV9 B;  1M57 B;  1THZ A;  2LP7 A;  1S3J A;  2Z0A A;  2XAG A;  5JJN B;  2ZIM A;  2BCC H;  4J7J A;  1RPO A;  1KMI Z;  4B3S B;  3RYI B;  3DTU B;  3DC6 A;  1TUB A;  5C8Y B;  1K4D C;  2ITC C;  2B9Z A;  3IGA C;  1S76 D;  4AQY B;  4B3T O;  5IDJ A;  5LOV A;  2ZE7 A;  2GTS A;  4E4E A;  3ZHV A;  4JYA B;  5J2U B;  5CN0 A;  5B1N A;  4GKK B;  1LR1 A;  4JPR A;  1JA8 A;  3SPH A;  3P32 A;  4LF8 B;  1D5A A;  4RUE A;  2WPD G;  3ABM B;  3RYI A;  4XDJ A;  1VAR A;  5CB4 A;  4UCV A;  4X89 A;  4LFB O;  1EN6 A;  1ZX3 A;  2GUZ A;  2ZNI A;  1HR0 O;  1YTF D;  1SET A;  5LOV B;  4WCE V;  3GWK C;  1K5Q A;  1XL6 A;  2D2C B;  3OAA G;  1I5Y A;  1NT2 B;  3NXS A;  2BSK A;  1OCC B;  3K0G A;  3ZRV A;  4JAU A;  4RQE A;  1YI2 V;  5EYP B;  2UXC B;  1KBH A;  2O57 A;  5LP6 C;  1T5E A;  4ICG A;  1J5E B;  2GDS A;  1XEQ A;  4DV2 O;  3CCS V;  2OTL V;  2DYS C;  3HPL C;  4U7N A;  5EC2 C;  3QVN A;  3JAK B;  3CC2 V;  3SPC A;  1HNX B;  5FPO A;  1DF4 A;  4DR5 B;  1F23 A;  2YEV A;  3ZRS A;  1PP9 H;  1KEC A;  2WLJ A;  2ETN A;  3IFX A;  2DWE C;  2JJ2 G;  5IYB O;  2JEU A;  3H01 A;  4ZBM A;  3K58 A;  2JIZ G;  2Q73 A;  4PJ0 Z;  3H9V A;  2VWJ A;  5C8Y A;  1TUE B;  3CCJ V;  2ZM6 O;  3J7A U;  4YIP A;  4CZZ A;  1ZUQ A;  1XNR B;  4DRX B;  2Q8V A;  3D36 C;  2JGD B;  3CRQ A;  3FKS G;  3OTO B;  4LH7 A;  5J2T A;  1R3J C;  4UV9 A;  5KUK A;  2LGW A;  3Q4H B;  1AJN A;  3EVK A;  3WB0 A;  3M99 B;  1N36 O;  2DQ0 A;  1ZL8 B;  1ZLZ A;  5CA0 B;  5LHH A;  4O2A A;  1K9M W;  2M6Y A;  1PNL A;  4R7C A;  4E2L A;  2KKW A;  5JVD B;  3BY6 A;  4WFF A;  4O4J B;  3LDE A;  4WF9 V;  4YY3 O;  1VIB A;  4DV7 O;  1EZJ A;  1RSO B;  1YEW A;  1NR1 A;  2HP8 A;  4MVQ A;  3RT3 C;  5C93 A;  3L73 H;  2W0F C;  1GRJ A;  2QWN B;  2IW5 A;  1KUQ A;  1KP2 A;  1PV0 A;  3G6E V;  1Y6X A;  2CH7 B;  5L3E A;  3RYC A;  4J80 A;  5KLV H;  4TOI A;  1AI5 A;  4I0X A;  2EBO A;  5FL7 G;  2FYU H;  2DYR B;  3KCY A;  1RFY A;  2XAF A;  3CCM V;  1OV9 A;  4NXN B;  2CTP A;  1DTO A;  3ZED A;  2UUA B;  4EB6 A;  4RO2 A;  1PNM A;  3CJH A;  1MSD A;  4R6Z A;  5CBG A;  3WB2 A;  3F7Y C;  4FLV A;  1KKC A;  4CC6 A;  5J2T B;  2P06 A;  4D7S A;  2PYL A;  4DR1 B;  1N32 O;  4FLZ A;  1NH2 B;  3HKE A;  2BOC C;  4KFM A;  1VQ6 V;  3U11 A;  1FFT B;  4RQF A;  4NYK A;  3AK3 A;  3BHP A;  5KA6 A;  3RFR A;  2DE0 X;  4IYH A;  4DW0 A;  4O2B B;  1BHA A;  1WP7 A;  1IXM A;  4B3M O;  4BR6 A;  1HNW B;  2A7W A;  3MD0 A;  2DOS A;  2R72 A;  4EKW A;  4DUY O;  4RUF A;  1RSO A;  3ZRW B;  4R8C A;  3OFN G;  2QM8 A;  2YS8 A;  3RYC B;  4JI3 O;  3TET A;  3DSQ A;  1YXB A;  2P6J A;  5KAI Z;  4JZG A;  1DK1 A;  1MZF A;  2QDO A;  3KG2 A;  3CPW U;  1F51 A;  3ZHR A;  1B06 A;  3JD3 A;  4MW3 A;  4J7Z A;  3ABT A;  2F4V B;  4FVM A;  5IWA B;  3HR0 A;  5H6Q A;  3HKC B;  1U97 A;  1GKF A;  4EEQ A;  2BOB C;  1YZB A;  5B1B B;  4EFE A;  3E83 A;  2ZQM A;  3ZMZ A;  4LR3 A;  2YXH A;  3LSS A;  3OUF A;  2PTM A;  4FZ1 A;  4IIJ B;  1MSW D;  3E35 A;  2Q6A A;  4WBN A;  3ASN C;  2DJV A;  4F6R A;  2CDY A;  4PI2 A;  4DV6 O;  3HKB B;  3KKY A;  4LF7 O;  5EIB C;  4P30 A;  5KHH A;  3CSX A;  4C7U A;  4EB6 B;  1N34 O;  4OPA A;  4JZ2 A;  2GTA A;  1SQG A;  3T1C A;  5B1B C;  1W2B U;  2P67 A;  3HKD B;  3CYO A;  5F2V O;  2DYS B;  5KMG B;  4LF8 O;  2LQT A;  3SYP A;  3W7U A;  3JAW B;  1SS3 A;  2QTO A;  3CME V;  3T2M A;  1UJW B;  1LUW A;  3JD2 A;  4X1K B;  4JYA O;  3BPZ A;  2YID A;  2NN4 A;  5H2F Z;  4DV3 O;  2QEX V;  1AJP A;  4I50 B;  4JI7 O;  1P4R A;  4LFC O;  3CRR A;  3LSU A;  1YJN V;  1KYO F;  1P84 F;  1NVP D;  2AW9 A;  1XNQ B;  4JI5 O;  4WBN B;  2EIM C;  2NLJ C;  2Y69 C;  3RBZ A;  1P7G A;  2Y0P A;  2HJF C;  5GON A;  4JI8 O;  2Q9L A;  4B08 A;  5EIB D;  1JPX A;  5LMN O;  2JEX A;  4UVA A;  2AZ0 A;  1I94 O;  3CC7 V;  5CA3 A;  3CCR V;  1M90 W;  1IVS A;  1O9G A;  3G71 V;  4DR7 O;  5LBQ A;  5JCO A;  3JCZ A;  1AJQ A;  5EBM C;  2JJ1 G;  4NVP A;  1YIJ V;  3SYC A;  1TAE A;  3ZMT A;  1BS3 A;  2WLL A;  3QO5 A;  1XQ8 A;  2IJI A;  1K73 W;  4FM2 A;  3JAW A;  3ETQ A;  2F23 A;  2NR5 A;  4GZR B;  1H2M A;  3FYI B;  2Q69 A;  2DYR C;  1FFX B;  1K3E A;  3B2E E;  3QTC A;  4X1I A;  2L6L A;  3N2K A;  1R6K A;  5BMV A;  4MVU A;  3RWR D;  5FPR A;  3GWO A;  3SJA C;  1HR0 B;  2FTK A;  2IH3 C;  2H94 A;  3QG5 A;  2D3O W;  5KMG A;  4LFA O;  3ABK C;  3G67 A;  3N2G B;  2IU3 A;  2IJH A;  4JI6 O;  5DED A;  3FFQ A;  5E79 Z;  1V54 B;  4BIZ A;  3C3T A;  3SJC C;  5CA1 B;  4LF9 O;  4J10 A;  4TSF G;  1B6Q A;  4TV8 A;  2WAM A;  1EN4 A;  2V1D A;  5K1P A;  1KKD A;  3CS5 A;  1XI1 A;  5KHJ A;  4G27 B;  2F4V O;  1BSM A;  1DLB A;  1XBL A;  1XUQ A;  4H0L B;  2Y0I A;  2UUB O;  2EIN C;  2WLM A;  2NNU A;  3WFV A;  2KG7 A;  4ZHQ B;  4DV5 B;  1MNG A;  3ABK B;  5CB4 B;  5H5N A;  5HFM A;  1B3Q A;  4KXR A;  1M56 B;  3G80 A;  5IJ9 B;  4X64 B;  1AVM A;  3APQ A;  5GW7 A;  1AP5 A;  2RQ6 A;  1ENV A;  3T1Y O;  2QKA A;  4LF4 O;  1EM1 A;  2E5L B;  3C90 A;  5L3G A;  1NR7 A;  4PA4 A;  2A9H A;  3CRA A;  1YSC A;  2W0X A;  3JAS A;  3L75 H;  1WPX A;  3OR7 C;  1S5H C;  2E76 B;  4FJC C;  1QR9 A;  3H1I H;  2OWO A;  4O4H A;  4CH5 A;  1ROP A;  3ZS8 C;  1QLE B;  3X2Q C;  1WB8 A;  4JI4 O;  4J9Y B;  2ZR3 A;  4P9O A;  1E79 G;  3JAL B;  1GM7 A;  1S5L Z;  5KAF Z;  5CBH A;  4UVB A;  4MTF A;  1VQO V;  2EUL A;  1XMO O;  2DWD C;  4MVZ A;  5FNV A;  1AIL A;  3B09 A;  4JTA B;  4JI2 O;  3CRC A;  4CC5 A;  4ZKI A;  2B1G A;  2ZNJ A;  1IBM B;  1VQ4 V;  4U7O A;  4W4K A;  2QTS A;  1VF7 A;  5FLX N;  3KCX A;  3LNM B;  2LGQ A;  5DEC A;  2CTR A;  4BWA A;  4K0K O;  2XUM A;  4UXN A;  5B66 Z;  3SPG A;  2P5O A;  1WA8 B;  4F6R B;  2EZO A;  3P3N A;  2VS0 A;  3E22 A;  1Y74 B;  2GSM B;  2Y4T A;  3UCS C;  2HVJ C;  3ASO C;  1WAZ A;  3L9D A;  5IJ0 B;  3A0R A;  5LHG A;  3J81 N;  1H8E G;  1YTF B;  1M1K W;  1GK9 A;  2XAH A;  3ZHU A;  5JH7 B;  4PEL A;  4TUY A;  1V9P A;  2ZIO A;  4G28 B;  2X6B A;  5D5P A;  2DQ3 A;  2ODM A;  4QJF B;  2F1M A;  1K8A W;  4CH3 A;  4I50 A;  3L71 H;  3AG2 B;  2Q0A A;  3A0H Z;  3K04 A;  3T4Z A;  1XRE A;  1WB7 A;  3ABL C;  2QWP B;  2GHY A;  4ZOL B;  4LF4 B;  4PA6 A;  4PA9 A;  3VQV A;  4PHZ A;  2OIE A;  2CAZ C;  2P7T C;  1OCZ C;  2QE7 G;  3CC4 V;  1JOY A;  4U3J B;  3A2F A;  3UO2 A;  4LFA B;  4H44 B;  3ZN0 A;  4JI7 B;  1PKX A;  1QVF U;  1BE3 H;  4O2B A;  2WSS G;  4DR5 O;  2N04 A;  2IBZ H;  1SQX H;  3DXR A;  5KA5 A;  1S77 D;  1WA8 A;  3QF7 A;  1K92 A;  4B7K A;  2Z3Y A;  5IJ0 A;  2K1E A;  1QQC A;  3RYH B;  5JWP A;  3ETE A;  3AK1 A;  4FLW A;  1YCI A;  4GCZ A;  2EIL C;  4UB8 Z;  4JI2 B;  4GX2 A;  3E22 B;  4GYC B;  1FFX A;  3H1J H;  4IYI A;  1SQF A;  2XT9 A;  2XTA A;  2IJK A;  2BTQ A;  4FM1 A;  1XL4 A;  3WU2 Z;  5KUM A;  2YSU B;  3ASN B;  4FFK A;  1UPG A;  5GON B;  3GB7 C;  1EZV H;  5IT9 N;  3J80 N;  3B40 A;  2P90 A;  1SZT A;  2HJD A;  1FXK A;  3LDD A;  2MW2 B;  4X8A A;  4FLX A;  4ZIB A;  3BAB A;  3K5O A;  1VQ7 V;  1Q3E A;  2UXX A;  1SQP H;  4CBC A;  2OCC C;  1YF2 A;  2ZD9 A;  2PZS A;  3T1H B;  3NR7 A;  5IY5 C;  1MMM A;  1D5N A;  3OD4 A;  2P22 C;  4JI8 B;  4MTG A;  4K8Z A;  4I5S A;  4ZI7 A;  1RP3 B;  4BW5 A;  4NTY A;  1FKA O;  1CEZ A;  3EFF K;  4TUY B;  2AXT Z;  2JK5 C;  2E5L O;  1Q7Y W;  3RGB A;  4FLT A;  3H1L H;  1WJZ A;  4FLU A;  3MDS A;  1TA8 A;  3JYC A;  1IBL B;  2Q7E A;  3TGU H;  4NXM B;  2LJ2 A;  1KB9 F;  4CH4 A;  3OMI B;  1AI4 A;  4DK1 A;  1JJO A;  4I4T A;  3ZHT A;  1VQM V;  2AHY A;  2EIJ C;  3X2Q B;  4IHJ B;  4RAI A;  4FK5 C;  4X62 O;  5KHG A;  4Q20 A;  1X4T A;  4X66 B;  1N0J A;  2JS5 A;  2Q5Z A;  4DO2 A;  1LUV A;  2HFE C;  4UCU A;  4K0K B;  4X65 B;  3ETD A;  3TCU A;  4LFC B;  4LF7 B;  2ZT9 B;  3B8N A;  3ZMV A;  1H2N A;  3H1K H;  2WWW A;  3WB1 A;  1SA0 A;  1YJ9 V;  2BTQ B;  3VQY A;  4XBF A;  3UT5 B;  2XOK G;  5B1A C;  5EBL C;  2CE4 A;  2FKX A;  1FYJ A;  2ZXW C;  1V55 C;  4JTC B;  4UCT A;  2HHH B;  2B5U A;  4X20 B;  1IZ3 A;  4PA3 A;  1K97 A;  3K9S A;  4JI4 B;  1Y66 A;  5D5Q A;  5IWA O;  4LF5 B;  4NKG B;  4DR6 O;  3BVO A;  4CS4 A;  3D3I A;  3CHX A;  2PGG A;  3OM3 B;  2YI8 A;  1SF9 A;  3AG1 C;  3AG7 A;  1WP8 A;  4YY3 B;  4JV5 B;  4TV9 A;  1M93 A;  5BZB A;  3FX7 A;  4KL1 A;  4OPH A;  1EN5 A;  1URF A;  1AR1 B;  3VBB A;  2CH7 A;  1JR9 A;  4I7Z B;  4QIW F;  4J7K A;  1ZWI C;  3HB3 B;  3DC5 A;  4UCO A;  2Q67 A;  1WLE A;  3SJB C;  2R70 A;  4DR6 B;  1VEW A;  4BAY A;  3K03 A;  2WLL B;  2ZIN A;  3CJH B;  2F43 G;  1AI6 A;  3UO3 A;  5FNV B;  4DV2 B;  1I7F A;  1GN3 A;  4FFB B;  4NB5 A;  4GLX A;  2QM4 A;  2XAJ A;  1SRY A;  1XHZ A;  2PYJ A;  1E1R G;  3FB7 C;  2IH1 C;  2FL4 A;  3GVM A;  4B3M B;  3ABU A;  4PI0 A;  3K5L A;  1SQB H;  4FIP C;  1I08 A;  2Z5U A;  4O4I A;  1N0N A;  1W0K G;  1PL4 A;  3OGI B;  1NU1 H;  4JI1 O;  3I55 V;  5EC1 C;  1Z5W A;  2DMX A;  3AG3 C;  1SA0 B;  4PV1 B;  2YIB A;  1PD3 A;  2UU9 B;  2LW1 A;  4B3R B;  2HG5 C;  5B3S C;  3K3W A;  4PDM A;  1MZE A;  3SYQ A;  3R65 A;  1DGS A;  1J5E O;  4FPP A;  3OGC C;  4D6T H;  5IYZ A;  4HBN A;  4F6E A;  2EJR A;  2QWO B;  5LGN A;  1V54 C;  1OCC C;  4O4J A;  1VQ5 V;  4DR7 B;  4DRX A;  2XAQ A;  1QLE C;  2KB1 A;  3W7T A;  1Q86 W;  3BA8 A;  2XAS A;  2HKO A;  3T1H O;  4HAM A;  1R3I C;  1FXV A;  1SQQ H;  4YHH O;  2UXD O;  2R9I A;  3A0B Z;  4MTX A;  5LMN B;  2L35 A;  1Y67 A;  1SZX A;  4QGP A;  3CCV V;  4YJ3 A;  3IJ4 A;  3PN1 A;  3CCQ V;  1HNZ B;  4MVS A;  3AG4 C;  1XIL A;  2P4K A;  4DR1 O;  1RPR A;  1SC5 B;  1Q8I A;  3STZ C;  3SJQ C;  2A06 H;  5ITZ A;  1FPO A;  5LMU B;  4O4H B;  4MVM A;  4TT3 G;  4FZ0 A;  3BAA A;  4XDK A;  2X6C A;  3TXS A;  1YJW V;  2YIC A;  4N23 A;  5EZY B;  1XMQ O;  4IIJ A;  4UV8 A;  4FLY A;  3JAL A;  4B3T B;  2IM9 A;  2E74 B;  4WFG A;  3S3X A;  5IYZ B;  1Y4M A;  3HKB A;  2GUZ B;  4X66 O;  2EJ7 A;  2YXY A;  4I0X B;  1N36 B;  1MG1 A;  3CD6 V;  1TUB B;  3ZBH A;  4R50 A;  3B8M A;  1OHH G;  4LC1 A;  4MT8 A;  4NR1 A;  2UXB O;  1YVW A;  1JX9 A;  2HR3 A;  1QU7 A;  3N27 A;  2X7R B;  2EIM B;  1P7B A;  3E8G A;  4IGG A;  3BA9 A;  1N4C A;  4H37 A;  1VQL V;  5BY1 A;  1I5X A;  1IUR A;  4DV1 B;  2C2A A;  1HNW O;  1JCH A;  5K1X A;  3AEI A;  1Y76 A;  2OYQ A;  1K7D A;  1WPB A;  2RCV A;  1VQN V;  1XOU A;  4LFB B;  4U3F H;  2QWR B;  4MS2 A;  1I0H A;  1OCZ B;  1F4M A;  1Q43 A;  3AK2 A;  5IY5 B;  4TV8 B;  4A5U B;  4NTW A;  3N2G A;  4DV0 B;  2G38 A;  1GN4 A;  4QE7 A;  2N74 A;  3LNN A;  2LFR A;  4AHC A;  4UUJ C;  4OX9 B;  1G1X B;  3CEI A;  2KSD A;  3OEH G;  2CUG A;  1JMK C;  2DN9 A;  1K33 A;  5L3D A;  1J95 A;  3N2K B;  4HZ3 A;  2JVD A;  3CXH F;  5CA1 A;  4LP8 A;  2ZR2 A;  3ABM C;  4G2K A;  3CCE V;  1R3K C;  4OXS A;  4DV0 O;  2IU0 A;  3UT5 A;  1NJI W;  3TXQ A;  4JI5 B;  1IBK B;  1XDC A;  1QCE A;  2ZCE A;  4JI0 O;  1L0N H;  4OGQ B;  5LYJ B;  3B77 A;  3SYO A;  3F5W C;  3ICX A;  1XNR O;  2N05 A;  3R66 A;  1OCR C;  1K5S A;  3UKM A;  2PY5 A;  2P4V A;  2HLD G;  2IJJ A;  4O4I B;  2W6J G;  2JGD A;  1CXZ B;  3ZN1 A;  2EZP A;  3LSQ A;  3K08 A;  5BR8 O;  4JYB A;  1MAB G;  4HNA A;  3CCL V;  5KHK A;  5EZY A;  1AI7 A;  2LW7 A;  1YIT V;  1ARO P;  1FD9 A;  3K79 A;  3A8T A;  3H1H H;  2X6A A;  4DV4 O;  2ZE6 A;  1Q90 D;  3SYA A;  4DV1 O;  2YIB D;  3K0D A;  3OT7 A;  4B3R O;  2QR4 A;  1GAX A;  3TJT A;  1V55 B;  4QNH B;  3RYF B;  2AHZ A;  5CBF A;  4DUY B;  4YJ2 A;  5BXZ A;  2Q7G A;  4JV5 O;  2ZE5 A;  1XHX A;  4YIO A;  3D36 A;  2FML A;  4L87 A;  3CMA V;  2UU9 O;  4B7E A;  2UXC O;  4JAA A;  1K34 A;  1BGY H;  1R6T A;  4U3J A;  1NI8 A;  3HKD A;  2ADP A;  3IC7 A;  3OTO O;  4ZHQ A;  3G4S V;  4JYY A;  4X62 B;  2RDC A;  4LCU C;  2VQF B;  3ZHS A;  3FAV B;  5LXT B;  1U96 A;  1FJG B;  1XNQ O;  3EHB B;  4YHH B;  1P49 A;  2EIJ B;  1H8H G;  3SGI A;  4ZI7 B;  2GV9 A;  4UB6 Z;  3FD9 A;  3LDC A;  1GH6 A;  4UFZ A;  3UQ8 A;  1S72 V;  4I9W A;  2ZDI C;  1BQ0 A;  1XMQ B;  1CPY A;  4QPK A;  3IC9 A;  1AB3 A;  1F4N A;  1MOF A;  3I5D A;  3RVZ A;  3JAS B;  1FXK B;  3AG2 C;  4TQD A;  3UM7 A;  5LMU O;  1RM1 C;  2UUA O;  1X59 A;  4Z1M G;  4J42 A;  3F7V C;  4PDV A;  5IYD O;  4J41 A;  5BMV B;  4HYO A;  3K57 A;  3OTF A;  1BQZ A;  1G6U A;  4WFE A;  1JVM A;  2X0L A;  1PNK A;  4DK0 A;  1HW7 A;  3ZMS A;  5J9P C;  4H13 B;  5JQG A;  1N33 O;  3P3P A;  5KHI A;  3E8F A;  2CTW A;  3K5N A;  5J2U A;  3E8H A;  1Q81 W;  1AR5 A;  3AG1 B;  1IXB A;  1R73 A;  2HVK C;  1FXK C;  4F4L A;  2E3C A;  4H33 A;  2QWQ B;  2UUB B;  1G8M A;  1KP3 A;  3ZJZ A;  1BMF G;  4KHP O;  2AGA A;  3CCU V;  1FXH A;  1GM8 A;  3L72 H;  4J11 A;  3MHH C;  5A2Q N;  3PJS K;  3SDL A;  3JD4 A;  2QGN A;  3OR6 C;  4JAS A;  4JTD B;  4YXW G;  4Q6G A;  1E1Q G;  4NTX A;  3ASO B;  3U0Z A;  4BIO A;  3HKC A;  3FB6 C;  1K4C C;  1JFF B;  1L1F A;  3ZX6 A;  3JAR B;  3VOU A;  4CS3 A;  1M5I A;  2ZE8 A;  3ZCC A;  4LWS A;  4RWU A;  5LYJ A;  5LGU A;  4YJ3 B;  2CTQ A;  5TIS Z;  2UXN A;  2KG7 B;  5B1A B;  5LHI A;  1NVP B;  2WLH A;  1NTM H;  2Q0O C;  4DUZ O;  1VF5 B;  2Q7H A;  3FAV A;  3RVY A;  1IBK O;  4QPJ A;  1NTK H;  1ORQ C;  1WNS A;  4ABM A;  1FS0 G;  1OCR B;  4PDR A;  2CGO A;  2CK3 G;  5L3B A;  3AG3 B;  1EBO A;  4X1Y A;  4X88 A;  3FYE B;  1JJ2 U;  2VQE B; 
#chains in the Genus database with same CATH homology
 2A0L A;  3SPJ A;  2Q68 A;  1SRY A;  1E1R G;  3E86 A;  2FTK A;  1NKD A;  2H94 A;  2IH3 C;  3FB7 C;  5EK0 A;  2D3O W;  2IH1 C;  3T4D A;  3ABK C;  2WLK A;  1R6N A;  2IU3 A;  2IJH A;  2EIL B;  1NBM G;  3ABU A;  3CP1 A;  1V54 B;  4JF3 A;  4BIZ A;  1G4Y B;  1S0V A;  4FIP C;  2PI4 A;  3W7W A;  4WFB V;  1OCO C;  2Z5U A;  1M56 C;  4JAV A;  1W0K G;  1B6Q A;  4TSF G;  4XDL A;  3W7X A;  1YHQ V;  2WAM A;  2V1D A;  3I55 V;  5EC1 C;  1M57 B;  3WG7 C;  1KKD A;  1THZ A;  2LP7 A;  1S3J A;  1GMG A;  2XAG A;  3AG3 C;  3P30 A;  4G27 B;  1RPO A;  1DLB A;  1PD3 A;  2HG5 C;  3DTU B;  4GX1 A;  5B3S C;  3K3W A;  2PI5 A;  4PDM A;  3SYQ A;  1H38 A;  2EIN C;  1K4D C;  2ITC C;  2WLM A;  3IGA C;  3R65 A;  4BIU A;  1S76 D;  2NNU A;  1PL0 A;  1SER A;  5IDJ A;  4FPP A;  3WFV A;  3LUT B;  3OGC C;  1GM9 A;  2EJR A;  3ABK B;  5LGN A;  1V54 C;  1OCC C;  1VQ5 V;  5HFM A;  4DXW A;  2OCC B;  2XAQ A;  5CN0 A;  5B1N A;  1QLE C;  1M56 B;  2KB1 A;  4JPR A;  3W7T A;  1Q86 W;  2XAS A;  2HKO A;  2JDI G;  4HAM A;  3SPH A;  1R3I C;  1FXV A;  3P32 A;  2R9I A;  4MTX A;  2QM7 A;  3CXC U;  4RUE A;  2WPD G;  4QE9 A;  1DF5 A;  5GW7 A;  3ABM B;  3CCV V;  3CCQ V;  4MVS A;  1ENV A;  4XDJ A;  3OE7 G;  2OT5 A;  3AG4 C;  3E89 A;  5B3S B;  2R9R B;  4X89 A;  1RPR A;  5L3G A;  1NR7 A;  4PA4 A;  1YTF D;  5H9C A;  1SET A;  2EIK B;  4WCE V;  2A9H A;  3STZ C;  1K5Q A;  1YSC A;  3DGE A;  1BHB A;  1XL6 A;  4UVC A;  3SJQ C;  4PDL A;  3OAA G;  1WPX A;  1I5Y A;  4MTO A;  3OR7 C;  3NXS A;  1S5H C;  2WLI A;  1OCC B;  4MVO A;  4MVM A;  4WFA V;  4TT3 G;  1HWY A;  4FJC C;  4XDK A;  1NH2 D;  1QR9 A;  2X6C A;  4MVR A;  3K0G A;  3ZRV A;  4JAU A;  4RQE A;  1YI2 V;  4N23 A;  1YJW V;  1ROP A;  1QVG U;  4UV8 A;  1QLE B;  2WLN A;  3X2Q C;  1OZ0 A;  4KP4 A;  4WFG A;  4J9Y B;  2ZR3 A;  3OEE G;  4P9O A;  1E79 G;  3CCS V;  3ZRW A;  1RM1 B;  2OTL V;  1Y4M A;  2DYS C;  1GM7 A;  3HPL C;  5CBH A;  4UVB A;  1MG1 A;  3ML0 A;  4MTF A;  4U7N A;  1VQO V;  3CD6 V;  5EC2 C;  2DWD C;  4R50 A;  3B8M A;  4MVZ A;  3CC2 V;  3TK1 A;  3SPC A;  1OHH G;  4JTA B;  4LC1 A;  4GX5 A;  5DN6 G;  4ZKI A;  5L3F A;  4FMT A;  4MT8 A;  1DF4 A;  1F23 A;  2YEV A;  2B1G A;  3ZRS A;  1VQ4 V;  1KEC A;  3BEH A;  4U7O A;  2WLJ A;  1JX9 A;  3IFX A;  2HR3 A;  2MK3 A;  2YEV B;  2DWE C;  2JJ2 G;  5IYB O;  2JEU A;  2ZDI A;  3LNM B;  2A79 B;  3H01 A;  2X7R B;  4ZBM A;  2EIM B;  5L3C A;  1P7B A;  3E8G A;  1VQL V;  4H37 A;  2JIZ G;  1I5X A;  4UXN A;  3SPG A;  1EFR G;  4GX0 A;  2C2A A;  2ZXW B;  1JCH A;  2EZO A;  3AEI A;  1TUE B;  1SES A;  1K7D A;  2WLI B;  3CCJ V;  2Y48 A;  1VQN V;  2GSM B;  4CZZ A;  2HVJ C;  3ASO C;  3FKS G;  2Y69 B;  1R3J C;  3A0R A;  4MS2 A;  4UV9 A;  5KUK A;  3ZIA G;  1OCZ B;  1F4M A;  5LHG A;  5IY5 B;  1H8E G;  1AJN A;  4P9P A;  3OMA B;  1YTF B;  4QE7 A;  1M1K W;  3M99 B;  3MHS C;  1GK9 A;  2DQ0 A;  2XAH A;  1QR8 A;  5LHH A;  4PEL A;  4ASU G;  1K9M W;  2LFR A;  1PNL A;  5E1A C;  3FB5 C;  4UUJ C;  4G28 B;  4R7C A;  2ITD C;  1VQP V;  2X6B A;  4E2L A;  3OEH G;  2DQ3 A;  4QJF B;  1K8A W;  3BY6 A;  4WFF A;  1K33 A;  3LDE A;  5L3D A;  4WF9 V;  1J95 A;  3ETG A;  3AG2 B;  4HZ3 A;  3K04 A;  1EZJ A;  4MSW C;  3T4Z A;  4LP8 A;  2ZR2 A;  3ABL C;  1NR1 A;  3ABM C;  2GHY A;  3FB8 C;  4MVQ A;  5C93 A;  4G2K A;  4PA6 A;  4PA9 A;  2W0F C;  3CCE V;  1R3K C;  4OXS A;  2IU0 A;  2IW5 A;  2P7T C;  1NJI W;  1OCZ C;  2QE7 G;  1KP2 A;  3CC4 V;  3G6E V;  1JOY A;  4JGS A;  1QCE A;  3B77 A;  5L3E A;  1Q82 W;  3SYO A;  3F5W C;  1AI5 A;  1QLN A;  1OCR C;  1K5S A;  2DW4 A;  2EBO A;  4N21 A;  5FL7 G;  3UKM A;  1GO3 F;  2HLD G;  2DYR B;  3ZN0 A;  1COW G;  2IJJ A;  4JYC A;  1PKX A;  2XAF A;  3CCM V;  2W6J G;  1QVF U;  1DTO A;  1JQ0 A;  3ZN1 A;  2EZP A;  3LSQ A;  4RO2 A;  3K08 A;  2WSS G;  4WFH A;  1PNM A;  4JYB A;  1MAB G;  1OCO B;  4R6Z A;  5KA5 A;  5CBG A;  5LGT A;  3CCL V;  3ZMU A;  1AI7 A;  3F7Y C;  3QNE A;  1YIT V;  2M7W A;  1S77 D;  1ARO P;  1K92 A;  3K79 A;  2Z3Y A;  2K1E A;  2X6A A;  3ABL B;  3ETE A;  3I56 V;  2OTJ V;  4GCZ A;  3SYA A;  1NH2 B;  2EIL C;  3K0D A;  2BOC C;  4KFM A;  1VQ6 V;  3STL C;  5HFL A;  4GX2 A;  1FFT B;  4RQF A;  1V55 B;  4QNH B;  2W6I G;  1CP9 A;  5KA6 A;  1KD1 W;  2AHZ A;  5DM6 V;  5CBF A;  4MW8 A;  1BHA A;  1IXM A;  3WG7 B;  2IJK A;  3MD0 A;  3E2E A;  3D36 A;  4L87 A;  4EKW A;  4TWK A;  4RUF A;  3CMA V;  4R8C A;  3OFN G;  1XL4 A;  2QM8 A;  3ZRW B;  5KUM A;  1K34 A;  3TET A;  3JD0 A;  2YSU B;  2P6J A;  3ASN B;  3GB7 C;  3IC7 A;  4J9Z B;  3G4S V;  2P90 A;  3KG2 A;  1F51 A;  1SZT A;  3CPW U;  1VQK V;  3JD3 A;  1FXK A;  4MW3 A;  3LDD A;  3AG4 B;  3ABT A;  4LCU C;  4X8A A;  1VQ7 V;  2UXX A;  2OCC C;  2ZD9 A;  5H6Q A;  4CBC A;  1R3L C;  3JD1 A;  5IY5 C;  3EHB B;  3K9A A;  1GKF A;  2BOB C;  2EIJ B;  1H8H G;  5B1B B;  3E83 A;  2ZQM A;  4MTG A;  4I5S A;  3LDC A;  1W0J G;  1KC8 W;  3K06 A;  3ZMZ A;  4BW5 A;  3E8B A;  1S72 V;  1CEZ A;  3LSS A;  4KUM A;  4I9W A;  3EFF K;  1NQT A;  2LFS A;  3OUF A;  2ZDI C;  3RW0 A;  3W7S A;  2JK5 C;  1Q7Y W;  1CPY A;  4QPK A;  1MSW D;  3E35 A;  2Q6A A;  1F4N A;  3ASN C;  1MOF A;  3RVZ A;  1FXK B;  3AG2 C;  3JYC A;  3UM7 A;  1RM1 C;  1GTO A;  4P30 A;  4Z1M G;  3F7V C;  4PDV A;  1BL8 A;  2B1I A;  3OMI B;  1AI4 A;  5IYD O;  1VQM V;  3T1C A;  2AHY A;  2EIJ C;  4HYO A;  5B1B C;  3X2Q B;  3QO7 A;  4RAI A;  4FK5 C;  1W2B U;  2P67 A;  4WFE A;  1JVM A;  3CYO A;  1M57 C;  4Q20 A;  2X0L A;  2DYS B;  1PNK A;  3SYP A;  4DO2 A;  2HFE C;  3W7U A;  3ZMS A;  2QA4 V;  1QBZ A;  5J9P C;  2QTO A;  3CME V;  3T2M A;  1UJW B;  2XND G;  3ETD A;  3TCU A;  3ZRX A;  3E8F A;  3JD2 A;  3E8H A;  4PA7 A;  1Q81 W;  1M9N A;  3AG1 B;  2EIN B;  1R73 A;  3B8N A;  2HVK C;  3ZMV A;  3OMN B;  1FXK C;  1AJP A;  4GT1 A;  4F4L A;  2QEX V;  1P4R A;  4H33 A;  3QO8 A;  2WWW A;  1G8M A;  4P2Z A;  1H2G A;  1YJN V;  1KQS U;  1NVP D;  1YJ9 V;  4XBF A;  1KP3 A;  3ZJZ A;  1BMF G;  2EIM C;  2QKS A;  2NLJ C;  2Y69 C;  3CCU V;  1FXH A;  1GM8 A;  3RBZ A;  2XOK G;  5B1A C;  5EBL C;  2HJF C;  2ZXW C;  3MHH C;  1V55 C;  3PJS K;  4JTC B;  2B5U A;  3JD4 A;  1N8R W;  3OR6 C;  4JAS A;  4JTD B;  5EBW C;  4YXW G;  4PA3 A;  1K97 A;  1JPX A;  1E1Q G;  1Y66 A;  2V7Q G;  2JEX A;  4UVA A;  3ASO B;  3OW2 U;  3CC7 V;  5CA3 A;  3CCR V;  3FB6 C;  1K4C C;  1L1F A;  1M90 W;  3D3I A;  2EIK C;  3OM3 B;  3G71 V;  1VQ8 V;  3AG1 C;  5LBQ A;  4LBE C;  3OUS A;  2ATK C;  3JCZ A;  1AJQ A;  3VOU A;  5EBM C;  2JJ1 G;  2H8P C;  3ZCC A;  5BZB A;  1YIJ V;  3SYC A;  1AR1 B;  5B1O A;  3VBB A;  3ZMT A;  5LGU A;  2UXN A;  5B1A B;  3SPI A;  4QIW F;  1ZWI C;  5LHI A;  3HB3 B;  2WLH A;  2WLL A;  1NVP B;  3QO5 A;  2Q67 A;  3RVY A;  1WLE A;  2IJI A;  4QPJ A;  1K73 W;  1ORQ C;  1LNQ A;  1FS0 G;  4BAY A;  3K03 A;  1OCR B;  2WLL B;  5IYC O;  4PDR A;  3FYI B;  2F43 G;  2Q69 A;  2DYR C;  1AI6 A;  1K3E A;  1VQ9 V;  5H6R A;  1R6K A;  2CK3 G;  5L3B A;  3AG3 B;  1EBO A;  4X88 A;  5CMU A;  3FYE B;  1JJ2 U;  4MVU A;  2XAJ A;  3GWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...