1XNQO

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1xnqO00
5FLXN 1AILA 2DOSA 1XNRO 2LW7A 3O65A 3RT3C 4JI2O 4A5UB 1J5EO 4LFCO 1IBKO 1HNXO 2N74A 3M8AA 4OPAA 4DR1O 1NS1A 5BR8O 5BXZA 1F7YA 2ZM6O 3T1YO 2HHHO 4JI3O 1XEQA 4DR7O 5LMUO 1N33O 1XNQO 4B3SO 3F5TA 4DR6O 2UXDO 4LFBO 4NXNO 4X62O 2UXBO 1D2DA 4B3TO 2UUCO 5IWAO 4JI4O 2UXCO 4JI6O 3OTOO 1IBMO 4JI8O 1FJGO 4X64O 3SDLA 4NXMO 4JYAO 1XMQO 5H5NA 4GKJO 2UU9O 1FKAO 3J80N 4LF5O 3J7AU 4DV5O 4LFAO 2ZKOA 2VQFO 1X59A 4K0KO 1HR0O 4JI1O 4DV6O 4OPHA 1N34O 3JAMN 4DUYO 4DV7O 4GKKO 2F4VO 4LF6O 4JI7O 2UUBO 3J81N 3T1HO 4JV5O 2JRIA 1FYJA 4DV4O 4X65O 1N36O 4DV1O 5BY1A 4B3RO 1AB3A 2E5LO 4X66O 1R1BA 4LF8O 1IBLO 1G1XB 2DJVA 1DK1A 1YZBA 1HNWO 4DR3O 4DV0O 4DV3O 2Z0AA 4YHHO 5IT9N 1XMOO 4KHPO 4DR5O 2UUAO 2AGAA 1A32A 4DV2O 4DUZO 4LF7O 1N32O 2FKXA 4DR4O 4B3MO 1HNZO 4DR2O 5LMNO 1R6TA 5LL6Y 4JI0O 5A2QN 1KUQA 4LF4O 4JI5O 1I94O 4YY3O 4LF9O 3R66A 2VQEO 4OX9O 4AQYO
chains in the Genus database with same CATH superfamily
3UQ8A 5LMUB 2L35A 4NVPA 1L1FA 2OYQA 3CC4V 2BE3A 3IGAC 3OEHG 1AJNA 1YXBA 2N74A 3M8AA 3RN4A 1Z5WA 5IYDO 3ZMTA 4I7ZB 3CCQV 5LP6A 1S72V 2CTPA 1GM7A 2GHYA 4UCUA 2JK5C 2P4KA 2WLIA 2EILC 2HR3A 3TK1A 4IYHA 4DV6B 1K4CC 3WG7B 1R73A 2HEPA 4RO2A 4X20A 2UUBB 4ZI7A 4LF5O 4DV1B 4UB8Z 3CB2A 1QNMA 3K0DA 3CMEV 2ITCC 4GKKO 3CPWU 2QWQB 3TETA 1D5NA 3SGIA 3OGCC 2HG5C 1N36O 4HNAA 4B3RO 3HKDA 2E5LO 1J5EB 1XDCA 3AK1A 2RJZA 4DR4B 3P32A 5GONB 4R7CA 4LF8O 3DC6A 4GX1A 4NB5A 2E75B 1HNWO 1Z5VA 2YICA 1SESA 1XMOO 3E8BA 1EBOA 2BSKA 3K5OA 2IU3A 4F6RA 5H6RA 4F6EA 4GYCB 1YIJV 2A3QA 2XNDG 4PD4F 2XAGA 1HP8A 1IXBA 1ZWIC 4YJ3B 5KHKA 1NVPD 5E1AC 1TUBA 3D36C 3CC7V 2WLMA 4NXMB 5KA5A 4NTYA 3SYCA 4JAAA 3K5NA 4LBEC 1VF5B 2JS5A 3VOUA 4GLXA 5ITZA 3QNEA 5CMUA 3ETQA 4JI3B 1BHBA 2NLJC 1VQNV 1WN7A 2EZPA 1OCCC 2EZOA 1N0JA 1QHTA 1NTMH 3CCMV 4WFFA 1PNMA 4BWAA 5IWAB 1BL8A 4IHJB 3WB1A 5JWPA 5LA6B 4GCZA 2EINC 4FLZA 2JS3A 3G67A 1P7BA 3K08A 1RPRA 1Q81W 1YHQV 4R8CA 3ZS8C 2ZCEA 5D5QA 4ZBMA 2Q7GA 4CC6A 3N2KB 4J9YB 4BIOA 3ASOB 2UU9O 1JVMA 2AHZA 3P3PA 4X65B 4H37A 4B7KA 3JD1A 2WLLB 4OPHA 3RYHB 5L3CA 3VQXA 3ZIAG 1VMGA 5B1OA 1MOFA 1NBMG 1PPJH 4Q20A 4J41A 1E79G 1KQSU 1YTFD 2P22C 3B4SA 2ZR2A 1AB3A 1JQ0A 4JTAB 3OTFA 4UCVA 3L71H 3RFRA 1IXMA 4JI0B 3K9SA 5GONA 2QM7A 3RYFB 2JJ2G 3A0HZ 2R9AA 2AGAA 1FAFA 2QM8A 5J2UB 4TV8B 5DM6V 2FKXA 1QVFU 2BTOA 4MTXA 4O2AB 4ZHQB 4YJ3A 5LL6Y 5B1AC 3FYIB 3DXRB 1MG1A 1YITV 4AI8A 5FL7G 5JQGB 2QKCA 4DR7B 3WB0A 5L3FA 1VQKV 2Q0AA 1GK9A 2Y69C 3NR7A 2EIJC 1JJ2U 2UXDB 1W2BU 1QR8A 2RDCA 4X1YB 1VQ6V 1R3JC 1SA0B 3MHSC 4H44B 1LR1A 1Q86W 5LA6A 1MMMA 4I4TB 4XDJA 2F95B 4MVOA 5GTIZ 2ZT9B 4X64O 2P5OA 3SDLA 1PL4A 1NT2B 4JI7B 1TGOA 4FLYA 3N2KA 4B3MB 1Q3EA 1NZ6A 1K9MW 3F7VC 3CE2A 1K5QA 4JI5B 1N34O 3D8CA 2CTQA 3H1IH 3JAKB 3JAMN 4RUEA 2WLLA 3RYHA 4ICGA 3J81N 3CCJV 2DYRC 2QDOA 1NR1A 2EIMB 3UT5B 4DV4O 1F23A 4EKWA 3ZEDA 1R6KA 3ZBHA 1PNLA 4DR2B 2GTSA 1JX9A 4K8XA 1Y74B 4H13B 4UCOA 4DV3O 1KP3A 1V9PA 3VQVA 1YJ9V 1UPGA 3RYFA 1O9GA 1E1RG 2X6BA 1NVPB 5J2TB 2KG7B 1VQOV 5B1BC 5J2UA 4TV8A 3G71V 3AK2A 4MVSA 1R6TA 4GT1A 4NTWA 2A0LA 4MVUA 4KUMA 4O2AA 3SJQC 4ZHQA 1R3LC 3CX5F 4QNHB 3G6EV 4P9OA 3CCLV 3JD0A 4FFBB 4LFAB 5FLXN 1KP2A 3RVZA 1XNRO 3RYIA 3KZIZ 4CS4A 2F23A 3K0GA 2HLDG 4LFBB 4MT8A 3W7XA 2ZM6O 3CSXA 4X1YA 2EIKC 2IH1C 5LMUO 5LHIA 1SA0A 5JVDB 3QO8A 4MTFA 1XBLA 1AVMA 3RGBA 4D7TA 4I4TA 4PA3A 1RFYA 3BCCH 2CH7B 2GV9A 1PP9H 2VWKA 4X66B 4DV6O 4LF9B 3EXAA 4JYYA 4JASA 1EM1A 1OCZC 3R65A 1YTFB 2UUBO 5IJ9B 4I50A 5LHGA 4DV1O 4CH4A 5IY5C 4OXSA 4Q6GA 2F66C 3FB5C 3OD4A 1H2SB 3JCZA 5AG2A 3U10A 5KHIA 1VQ5V 1BQ0A 4LF4B 4RQFA 2QEXV 1ZL8B 4G28B 1OCRB 4J80A 2X6CA 1BZKA 3JASB 2P6JA 5CA0B 4DR4O 2H94A 2KG7A 4JI8B 2X0LA 4O4LB 4UFZA 4ASUG 2P7TC 2R9RB 1SQQH 1NQTA 3OFNG 5H9CA 2DOSA 3IJ4A 1EFRG 5L3EA 4FFBA 1BCCH 2QR4A 2EBOA 5LP6C 4E2LA 1P4RA 4JI2O 1T5EA 1HWYA 3IFXA 3FKSG 4FZ0A 2EULA 4IIJB 4B3TB 2K1EA 1BT8A 1XL6A 3THOA 4H0LB 5JCOC 3JALB 4JI3O 4FK5C 4IYIA 4IGGA 3X2QB 5B3SB 4DV5B 1XHXA 3ZMUA 3AEIA 5JVDA 5L3DA 4JI1B 4EEQA 3TJTA 3K9AA 1NJIW 5IWAO 3CCEV 1FJGO 3E2EA 5BMVB 1XMQO 2L6LA 4CC5A 2CUGA 3UCSC 4PA9A 1M9NA 1X4TA 2R72A 4J9ZB 5HFMA 2CH7A 4GZRB 4K35A 5DEDA 1SQGA 2QE7G 1LNQA 3VQYA 1V55B 2Q68A 1JR9A 2DN9A 2V4DA 2KB1A 3ASNC 1Q43A 4UV9A 4FM0A 5IE9A 2CGOA 5K1XA 3CCVV 4DV2B 4X65O 5IJ9A 4KFMA 4JYBA 3SYOA 5KLVH 2JGUA 3CXCU 1SC5B 4PA4A 2ZDIA 4JYCA 4FLUA 3AG3B 4UV8A 3OUSA 4WBNB 3JARB 1EZJA 1QCEA 4MVZA 1KU9A 5FPOA 3BFRA 4FM1A 1EN5A 2LW1A 2NN4A 1H38A 4PDMA 4X1IA 2PYLA 1ZL8A 1AROP 4O4HB 2OIEA 3MD0A 4GX2A 1Y4MA 1ZLZA 4RQEA 2F1MA 1Y76B 4JI0O 3OR6C 4O4LA 1IBKB 3EFFK 4YY3O 4E4EA 4AQYO 1AR5A 2ZIOA 3L9DA 1YCIA 2QWRB 1FXKB 3BEHA 3QTCA 1FPOA 2PTMA 3P3NA 4PI0A 2IM9A 2DQ0A 4NXNB 4TWKA 2Q67A 5KAIZ 1HNXO 3OMIB 4IIJA 2IJIA 4JYAB 4I0XB 5E79Z 4DR7O 1Q6UA 2OCCB 3JALA 2PI4A 1VQ8V 2UXDO 5GW7A 1J95A 4MVMA 4I55A 3OTOO 4QIWF 4I5SA 3G80A 4BAYA 3CRRA 2M6YA 5BMVA 3J80N 1BHAA 1H2NA 1X59A 5LYJB 4Z2WA 1H2KA 2HJFC 3CYOA 4NKGB 1Q7YW 2JEUA 1NU1H 4K3AA 1AI5A 1TAEA 4D7SA 3CD6V 3ABMC 4YHHB 3K5LA 2WLNA 4JI7O 2W6JG 1D5AA 2Y48A 5D5PA 2YIBA 3CWBH 3S3XA 3TXQA 5KMGB 2Z3YA 3E35A 4X89A 1H8HG 1L0NH 2C2AA 5JJEB 1KD1W 2QA4V 3HKCA 1G1XB 1RM1B 3LDCA 3K04A 4WBNA 3JARA 3AG4B 4TV9B 4YIPA 1GN2A 3ZCCA 2JGDB 3L74H 1IDSA 2Q7EA 4DR2O 3AG2C 1WP7A 4UCRA 2XAHA 1HW7A 3HKBB 1Y76A 1I94O 2LFRA 4JAVA 1Q5OA 4DR1B 1OZ0A 4CH3A 2R70A 4L8JA 3A0BZ 3LSSA 3O65A 4JAUA 1M56B 1H2LA 4FLTA 3ABUA 4JI6B 3JSLA 3P30A 4GX5A 1MA1A 1IBMB 1NS1A 4BR6A 3OMAB 2HHHO 2QTSA 1XEQA 2Z5UA 2XUMA 2IBZH 3B2EE 1YEWA 3ZHVA 4X88A 3AG1C 4QJFB 3A8TA 4LFBO 1HR0B 1Q6IA 5K1PA 2OT5A 3M7MX 2JJ1G 2UXCO 1ZUQA 1M57B 5EC1C 2YIDA 1CPYA 5EYPB 2PF4E 5CN0A 4C7UA 5B1NA 1JFFB 5KAFZ 4NR1A 4HYOA 3OE7G 4FLVA 5EIBC 4FLXA 3HR0A 1F4NA 4DK0A 2YI9A 3SPIA 5LXTB 4H33A 4DXWA 3ZMZA 5LYJA 1G6UA 4LR3A 1ZTEA 1ZSPA 2B1GA 2AW9A 1QVGU 2UUAB 2JRIA 3ETDA 4TUYB 4BW5A 2QWPB 1YJNV 1SKVA 1NH2B 2DYSC 4LP8A 1IVSA 1BQZA 1FD9A 4X66O 5KMGA 3I56V 2DMXA 5CA3A 3S3WA 1M90W 2XHBA 1XHZA 1I0HA 1SETA 4JF3A 4OX9B 4IT5A 1L8DA 2UXXA 4TV9A 3GB7C 4ZKIA 2JGDA 5FPRA 5IYZB 2GBOA 4LFCB 4LF4O 3ML0A 2JVDA 3UKMA 3HKBA 2ZD9A 1VF7A 2R9IA 1GM9A 1MABG 3BRCA 3T1YB 3N27A 4K0KB 1PD3A 1WB7A 5EC2C 1QLNA 4TQFA 2AZ0A 4RUFA 2Y4TA 2EINB 3H1HH 4GX0A 2KKWA 3CRMA 2OIGA 4DRXB 4LCUC 2XAFA 1EN6A 1I7FA 3U0ZA 2D2CB 3FYEB 3E8HA 3ICXA 4XBFA 3I5DA 1KECA 3T4DA 2X6AA 4B3TO 3ABTA 5IYCO 1NI8A 2RNBA 1V54B 4PDRA 2HVKC 4QGPA 1F51A 3AG7A 1SZXA 4JV5B 1SQBH 3BY6A 1JFFA 4DV5O 4DYLA 4N21A 1B3QA 3K57A 2G38A 4JI1O 4IHJA 1YDXA 2EIMC 5JJNB 1UFIA 5LXTA 3QO5A 1CXZB 2QM4A 1N8RW 2ZR3A 1AP5A 4KHPB 2JDIG 4TSFG 1K73W 3E86A 3ABKB 2XT9A 1AI4A 1COWG 3OR7C 3JD2A 3SJAC 5L3GA 3RWRD 4TUYA 2ZINA 2IU0A 3IC9A 3CJHB 2CK3G 1HNZB 4PV1B 2DJVA 2VS0A 3E8FA 5LBQA 4JZGA 1Y67A 5B1AB 3OAAG 3KCXA 2ODMA 3RYCB 4HAMA 1WNSA 4DV2O 3FAVB 4QPJA 3ZRVA 3ABLB 3M99B 4LH6A 3K03A 4UCSA 3AK3A 2YEVB 2DQ3A 4ABMA 2Y69B 2EIJB 3LSQA 4MW3A 2CGNA 2PUSA 2VQEO 4PELA 4LF5B 3FD9A 3KKYA 5BZBA 4GKKB 3RW0A 1US6A 2E3CA 4W4KA 1WLEA 3B77A 2UXBB 4PHZA 3OUFA 1IBKO 2N05A 2UUCB 1WA8B 4JI4B 3Q4HB 4J10A 4J7KA 1KMIZ 4DRXA 4WFGA 3JAWB 1ORQC 2HP8A 4DW0A 2CAZC 3JD3A 3OMNB 3DXRA 4Z1VA 2YIAA 3FFQA 1FXHA 4NXNO 4U3JB 2JIZG 5JQGA 2ZXWC 2F4VB 4JYAO 5C8YB 4UCTA 3N2GB 4AHCA 2ATKC 3T1HB 3PN1A 3W7SA 3O9OA 1ROPA 3OW2U 1IX9A 5KUMA 4P2ZA 1ENVA 4WFEA 1TUEB 3LNMB 5IYBO 5JJJB 3ZHTA 4DV0B 5KHHA 1K4DC 1VEWA 4UVBA 1AI7A 2Q6AA 2ZQMA 4LF7B 5IDJA 3BHPA 5B1BB 4Z1MG 3CJHA 1KC8W 4YIOA 3GWKC 3NXSA 4YHHO 5B66Z 2W0XA 3RBZA 4N23A 3W7TA 3JAKA 5KHGA 3RYCA 3IC7A 1SQFA 4QE9A 3FAVA 4PDLA 1NKDA 1KKDA 4CZZA 2XOKG 3UT5A 3ZRXA 1KUQA 2Q5ZA 2YXLA 2YEVA 2WLHA 3TCUA 1AJPA 2WWWA 1P7GA 1Y74A 2RCVA 4TOIA 1MZEA 3CEIA 2EIKB 5EBWC 5F2VO 1DLBA 3STLC 1VQ4V 3CC2V 1Z2GA 1MSWD 4X62B 1J5EO 3BAAA 4MTGA 1WP8A 5J2TA 3X2QC 5B3SC 4DR1O 3ZMSA 3LDEA 4YXWG 1S5LZ 1WA8A 3Q4HA 2XASA 4MSWC 3EHBB 2BTQB 5LGTA 2X7RB 3SR2C 3JAWA 2QKSA 2EX3A 1WAZA 5HFLA 1IZ3A 4JI6O 1IBMO 4U3JA 1G8MA 4LF6B 4NXMO 1I5YA 3APOA 3GWOA 1OCZB 4UXNA 2Q4PA 3SJCC 2RN9A 1K7DA 5C8YA 3N2GA 2WSSG 2NNUA 1VP7A 3J7AU 1KBHA 2GUZB 3KCYA 1DF5A 5KX5B 1XQ8A 1HR0O 2O57A 1G4YB 5IY5B 1H2GA 1YSCA 1FFXB 3H1LH 3ZRWB 3K5MA 4DR3B 3AG3C 1JCHA 1QQCA 3CCSV 4LC1A 5LHHA 1OCOC 1N32B 2W6IG 3ETGA 4WFAV 4TQDA 5LMNB 1QLEC 4RWUA 1OV9A 4O4IB 2ADQB 2UUAO 1A32A 4WFBV 5C93A 5EBLC 2WLJA 1AI6A 1MZFA 1SRYA 4G2KA 3CHXA 1O9HA 3BA9A 3SPCA 5A2QN 4GUNA 2JEXA 3SJBC 1QR9A 2Q0OC 1JJOA 2QKAA 4HBNA 4OX9O 4P9PA 2HFEC 2IJKA 2P67A 1SS3A 4XDLA 3K3WA 2MK3A 5CBFA 3T2MA 3I55V 4DR6B 2HVJC 3T4ZA 5IJ0B 1PL0A 3ZHUA 4LFCO 3JASA 1LUWA 2P90A 1K5SA 4MTOA 5CA0A 2FTKA 1F7YA 2Q8VA 1OJHA 3T1YO 2EJ7A 4J42A 1GN3A 1B06A 4GKJB 3SPGA 3UM7A 1YJWV 2BTQA 2ETNA 2IJJA 1XI1A 4WFHA 4XDKA 5LGUA 5EIBD 4DV7B 4QPKA 4JPRA 4EFBA 1FKAO 3ASNB 2YUAA 2WLKA 3MAQA 3WG7C 2A7WA 3ZN0A 5EBMC 4FFKA 2GUZA 5KX5A 1YF2A 3DSQA 3H1JH 4U7NA 2CE4A 1E1QG 2W0FC 1FFXA 5KHJA 1BS3A 1SQXH 3ZRWA 3DTUB 1XNRB 4JV5O 3IAYA 1K3EA 3C3TA 3K58A 2LO1A 1PM9A 2VWJA 4B7EA 1QBZA 1DK1A 1BGYH 3ZJZA 1Y66A 1YZBA 4CS2A 3QO7A 1WPXA 1K8AW 4KHPO 4O4IA 5DN6G 1VQ9V 4PA7A 3CXHF 3E89A 4B3MO 1HNZO 3JATB 4IL6Z 1BE3H 2WA4A 4UVCA 4JI5O 2YSUB 2LGWA 1XUQA 4PDVA 1M56C 4DO2A 3MDSA 3B09A 2RQ6A 1OHHG 1U97A 1VF6A 3UO2A 3ZHSA 3B40A 3CRAA 2WPDG 1GN4A 5JCOA 2P06A 2PGGA 2Y4UA 5IJ0A 2QTOA 4O4HA 5BXZA 1VARA 2D3OW 3L75H 2WA3A 3CS5A 1M4UA 1M57C 3FX7A 3F5TA 3LDDA 1KB9F 2UXBO 4ZOLB 1R3IC 4G27B 2UUCO 1GMGA 4JI4O 2LGQA 4NTXA 1FXKA 1BSMA 3QVNA 2EILB 2QJ1A 3ABMB 1Q6HA 1VQPV 4LFAO 2V1DA 1THZA 4R50A 4I0XA 1M1KW 1IBLB 2LQTA 2PYJA 3WFVA 4ZIBA 2F4VO 3ASOC 2Y0IA 1PKXA 2FB5A 3T1HO 3E83A 2DWDC 4JI2B 4DUZB 4QE7A 1N0NA 2YI8A 3D3QA 1R1BA 3F5WC 5CB4B 2QGNA 3AG2B 4DV0O 2Z0AA 1NR7A 4AILC 3ZHRA 3ZRSA 1S0VA 2EJRA 2A9HA 4LF7O 1W59A 1R3KC 1RP3B 1FJGB 3UO3A 2OTJV 3JATA 4UVAA 4K8ZA 2FL4A 3C90A 1XMQB 2F43G 1DGSA 4LF9O 3R66A 5BR8B 4JGSA 3JD4A 4LH7A 2NR5A 3VBBA 1URFA 1N33B 2QSAA 4MS2A 1XNQB 2LW7A 1YI2V 2FYUH 4B3SB 2ZE7A 3W7UA 1NTKH 1VQLV 1W0JG 2F93B 4FJCC 1W0KG 1AR1B 3AG1B 3G4SV 5CA1B 2CTRA 2ARHA 4O2BB 1B04A 1OCCB 3JYCA 1P84F 2XAJA 1V54C 3JSNA 2V7QG 2VQFB 1QU7A 2H8PC 3T1CA 2CTWA 5J9PC 4X62O 1GAXA 4DUYB 2OTLV 4ZOLA 1EZVH 3CRQA 4JI8O 1SQPH 2DE0X 3H1KH 3QG5A 2KSDA 2OWOA 2ILMA 4KL1A 2QWNB 3LUTB 1FFTB 1S77D 1GM8A 1JOYA 3ZX6A 2A79B 4O4JB 2DYSB 3ABKC 4YY3B 5H2FZ 3LNNA 2IW5A 4CH5A 2XAQA 4AQYB 4LF6O 1CP9A 1Q82W 3K06A 2YS8A 4DR5B 1FYJA 1XL4A 1SERA 1RSOB 2GSMB 2N04A 3FB7C 1HNXB 5EYPA 2AXTZ 4D6TH 1GO3F 4MW8A 3ABLC 4DR3O 4U3FH 5CB4A 1IURA 3RYIB 1VQMV 5CBHA 1FS0G 5CBGA 2VRZA 3QF7A 4I9QA 1N32O 3OTOB 1S5JA 5LMNO 5A9GA 3SPHA 1WB8A 4FVMA 2ZM6B 2Q73A 1Q8IA 3SYQA 3H9VA 5FNVB 1S5HC 2ZE6A 2ZE8A 5GTHZ 4HZ3A 3D36A 1S76D 1K92A 1AR4A 1FXVA 3PJSK 4OPAA 4UB6Z 5EK0A 3E22B 5H6QA 2DWEC 3CCRV 3WU2Z 5CA1A 2WAMA 4O2BA 5IYZA 5JH7B 1BMFG 2UXNA 2B1IA 3G6BA 1SQVH 3W7WA 4DR6O 4J11A 1D2DA 1PNKA 1GKFA 1NTZH 3MHHC 4FMTA 2M7WA 4I50B 2OCHA 4CBCA 3EVKA 2YIBD 4LWSB 3OM3B 4JTCB 3C3SA 2Q69A 3WB2A 4GKJO 1F4MA 3A2FA 3CMAV 1XOUA 4UUJC 1N36B 4FPPA 4B3RB 3OGIB 2BOBC 3ETEA 2E5LB 1LUVA 1DF4A 1I94B 1P49A 1KYOF 5TISZ 4LF8B 4O4JA 2LFSA 4YJ2B 4DV7O 3CP1A 4CS3A 1HNWB 3STZC 2LP7A 1XMOB 2E76B 3ZMVA 1CEZA 1ZAUA 3L72H 1RSOA 3OEEG 3L73H 4KP4A 2DYRB 1SZTA 2HHHB 4X1KB 3SYAA 2ZDIC 2ADPA 2ZE5A 1GTOA 2H3OA 2ZIMA 5EZYB 2B5UA 3APQA 2ITDC 1WPBA 3H01A 5LOVB 2K9PA 2UXCB 3DGEA 4DK1A 2IJHA 1GH6A 4EB6B 4X8AA 3HKEB 1OCRC 4I9WA 3HB3B 5B5EZ 3DC5A 5DECA 1SF9A 2YDEA 5FNVA 4LNUB 1RPOA 3RT3C 1MSDA 4OGQB 3BA8A 1I5XA 4BIZA 2Q9LA 4A5UB 3HPLC 1N4CA 3VQWA 3B8MA 4MVRA 3ZN1A 1DTOA 2ZXWB 1HDJA 2YC0A 3E22A 2ZNIA 4KXRA 2UU9B 1H2MA 3B8NA 5JH7A 5L3BA 4PA6A 3CCUV 4J7JA 4JZ2A 1ZX3A 1S3JA 3K79A 3FB8C 1Q90D 2E74B 4WCEV 1K97A 2XTAA 4L87A 4TT3G 2AZ2A 3CRCA 4LWSA 3BABA 4F4LA 1TVKB 3U11A 2DW4A 3K59A 2ZKOA 4X1IB 4X9QA 1K33A 3SPJA 3LSUA 4EFEA 3A0RA 1XREA 4YJ2A 2Y0PA 1PV0A 1YVWA 2P4VA 4BW9A 1V55C 2PY5A 3SYPA 4U7OA 1IBLO 1M93A 2BOCC 1VIBA 4X1KA 2KQXA 4DUZO 3F7YC 1VF6C 2LJ2A 5KUKA 5EZYA 2IH3C 2GDSA 3E8GA 2HJDA 3TGUH 4W4LA 5LOVA 3RVYA 4RAIA 1JMKC 4EB6A 2AHYA 3HKEA 1EN4A 1GRJA 1AILA 4I55B 1KKCA 4B08A 4CH6A 4FLWA 1R6NA 4LNUA 1TA8A 2CDYA 3KG2A 4X64B 5BR8O 2BCCH 5LP6B 2YXYA 5KA6A 1FXKC 4R6ZA 1AP6A 1B6QA 1N33O 1XNQO 1UJWB 2WLIB 2RMKB 4B3SO 4PI2A 2YXHA 4FZ1A 1N34B 3D3IA 1L0LH 3L70H 4WF9V 4X20B 1I08A 4ZI7B 2OCCC 5H5NA 3HKCB 2GTAA 1NH2D 4DV4B 4FIPC 2PZSA 1AJQA 2VQFO 4K0KO 2PI5A 1TVKA 3BPZA 1OCOB 4J7ZA 1VQ7V 4DW1A 2VQEB 4DUYO 1MNGA 1K34A 2Q7HA 4BIUA 1JPXA 1QLEB 4DV3B 2QWOB 3GVMA 5LGNA 4HNAB 3HKDB 4JTDB 1U96A 5BY1A 1M5IA 4FM2A 1WJZA 1JA8A 1H8EG 2BSKB 5IT9N 4F6RB 4NYKA 4P30A 4DR5O 3OT7A 2B9ZA 1TUBB 2MW2B 2FMLA 3BVOA 4PJ0Z 1RM1C 2ZNJA 3AG4C 2A06H 5ITZB 4MVQA 1Y6XA 1GN6A 2HKOA 3FB6C 1XILA 3JCUZ 3TXSA 3ZHQA
chains in the Genus database with same CATH topology
5FLXN 1AILA 2DOSA 1XNRO 2LW7A 3O65A 3RT3C 4JI2O 4A5UB 1J5EO 4LFCO 1IBKO 1HNXO 2N74A 3M8AA 4OPAA 4DR1O 1NS1A 5BR8O 5BXZA 1F7YA 2ZM6O 3T1YO 2HHHO 4JI3O 1XEQA 4DR7O 5LMUO 1N33O 1XNQO 4B3SO 3F5TA 4DR6O 2UXDO 4LFBO 4NXNO 4X62O 2UXBO 1D2DA 4B3TO 2UUCO 5IWAO 4JI4O 2UXCO 4JI6O 3OTOO 1IBMO 4JI8O 1FJGO 4X64O 3SDLA 4NXMO 4JYAO 1XMQO 5H5NA 4GKJO 2UU9O 1FKAO 3J80N 4LF5O 3J7AU 4DV5O 4LFAO 2ZKOA 2VQFO 1X59A 4K0KO 1HR0O 4JI1O 4DV6O 4OPHA 1N34O 3JAMN 4DUYO 4DV7O 4GKKO 2F4VO 4LF6O 4JI7O 2UUBO 3J81N 3T1HO 4JV5O 2JRIA 1FYJA 4DV4O 4X65O 1N36O 4DV1O 5BY1A 4B3RO 1AB3A 2E5LO 4X66O 1R1BA 4LF8O 1IBLO 1G1XB 2DJVA 1DK1A 1YZBA 1HNWO 4DR3O 4DV0O 4DV3O 2Z0AA 4YHHO 5IT9N 1XMOO 4KHPO 4DR5O 2UUAO 2AGAA 1A32A 4DV2O 4DUZO 4LF7O 1N32O 2FKXA 4DR4O 4B3MO 1HNZO 4DR2O 5LMNO 1R6TA 5LL6Y 4JI0O 5A2QN 1KUQA 4LF4O 4JI5O 1I94O 4YY3O 4LF9O 3R66A 2VQEO 4OX9O 4AQYO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX N;  1AIL A;  2DOS A;  1XNR O;  2LW7 A;  3O65 A;  3RT3 C;  4JI2 O;  4A5U B;  1J5E O;  4LFC O;  1IBK O;  1HNX O;  2N74 A;  3M8A A;  4OPA A;  4DR1 O;  1NS1 A;  5BR8 O;  5BXZ A;  1F7Y A;  2ZM6 O;  3T1Y O;  2HHH O;  4JI3 O;  1XEQ A;  4DR7 O;  5LMU O;  1N33 O;  1XNQ O;  4B3S O;  3F5T A;  4DR6 O;  2UXD O;  4LFB O;  4NXN O;  4X62 O;  2UXB O;  1D2D A;  4B3T O;  2UUC O;  5IWA O;  4JI4 O;  2UXC O;  4JI6 O;  3OTO O;  1IBM O;  4JI8 O;  1FJG O;  4X64 O;  3SDL A;  4NXM O;  4JYA O;  1XMQ O;  5H5N A;  4GKJ O;  2UU9 O;  1FKA O;  3J80 N;  4LF5 O;  3J7A U;  4DV5 O;  4LFA O;  2ZKO A;  2VQF O;  1X59 A;  4K0K O;  1HR0 O;  4JI1 O;  4DV6 O;  4OPH A;  1N34 O;  3JAM N;  4DUY O;  4DV7 O;  4GKK O;  2F4V O;  4LF6 O;  4JI7 O;  2UUB O;  3J81 N;  3T1H O;  4JV5 O;  2JRI A;  1FYJ A;  4DV4 O;  4X65 O;  1N36 O;  4DV1 O;  5BY1 A;  4B3R O;  1AB3 A;  2E5L O;  4X66 O;  1R1B A;  4LF8 O;  1IBL O;  1G1X B;  2DJV A;  1DK1 A;  1YZB A;  1HNW O;  4DR3 O;  4DV0 O;  4DV3 O;  2Z0A A;  4YHH O;  5IT9 N;  1XMO O;  4KHP O;  4DR5 O;  2UUA O;  2AGA A;  1A32 A;  4DV2 O;  4DUZ O;  4LF7 O;  1N32 O;  2FKX A;  4DR4 O;  4B3M O;  1HNZ O;  4DR2 O;  5LMN O;  1R6T A;  5LL6 Y;  4JI0 O;  5A2Q N;  1KUQ A;  4LF4 O;  4JI5 O;  1I94 O;  4YY3 O;  4LF9 O;  3R66 A;  2VQE O;  4OX9 O;  4AQY O; 
#chains in the Genus database with same CATH topology
 3UQ8 A;  5LMU B;  2L35 A;  4NVP A;  1L1F A;  2OYQ A;  3CC4 V;  2BE3 A;  3IGA C;  3OEH G;  1AJN A;  1YXB A;  2N74 A;  3M8A A;  3RN4 A;  1Z5W A;  5IYD O;  3ZMT A;  4I7Z B;  3CCQ V;  5LP6 A;  1S72 V;  2CTP A;  1GM7 A;  2GHY A;  4UCU A;  2JK5 C;  2P4K A;  2WLI A;  2EIL C;  2HR3 A;  3TK1 A;  4IYH A;  4DV6 B;  1K4C C;  3WG7 B;  1R73 A;  2HEP A;  4RO2 A;  4X20 A;  2UUB B;  4ZI7 A;  4LF5 O;  4DV1 B;  4UB8 Z;  3CB2 A;  1QNM A;  3K0D A;  3CME V;  2ITC C;  4GKK O;  3CPW U;  2QWQ B;  3TET A;  1D5N A;  3SGI A;  3OGC C;  2HG5 C;  1N36 O;  4HNA A;  4B3R O;  3HKD A;  2E5L O;  1J5E B;  1XDC A;  3AK1 A;  2RJZ A;  4DR4 B;  3P32 A;  5GON B;  4R7C A;  4LF8 O;  3DC6 A;  4GX1 A;  4NB5 A;  2E75 B;  1HNW O;  1Z5V A;  2YIC A;  1SES A;  1XMO O;  3E8B A;  1EBO A;  2BSK A;  3K5O A;  2IU3 A;  4F6R A;  5H6R A;  4F6E A;  4GYC B;  1YIJ V;  2A3Q A;  2XND G;  4PD4 F;  2XAG A;  1HP8 A;  1IXB A;  1ZWI C;  4YJ3 B;  5KHK A;  1NVP D;  5E1A C;  1TUB A;  3D36 C;  3CC7 V;  2WLM A;  4NXM B;  5KA5 A;  4NTY A;  3SYC A;  4JAA A;  3K5N A;  4LBE C;  1VF5 B;  2JS5 A;  3VOU A;  4GLX A;  5ITZ A;  3QNE A;  5CMU A;  3ETQ A;  4JI3 B;  1BHB A;  2NLJ C;  1VQN V;  1WN7 A;  2EZP A;  1OCC C;  2EZO A;  1N0J A;  1QHT A;  1NTM H;  3CCM V;  4WFF A;  1PNM A;  4BWA A;  5IWA B;  1BL8 A;  4IHJ B;  3WB1 A;  5JWP A;  5LA6 B;  4GCZ A;  2EIN C;  4FLZ A;  2JS3 A;  3G67 A;  1P7B A;  3K08 A;  1RPR A;  1Q81 W;  1YHQ V;  4R8C A;  3ZS8 C;  2ZCE A;  5D5Q A;  4ZBM A;  2Q7G A;  4CC6 A;  3N2K B;  4J9Y B;  4BIO A;  3ASO B;  2UU9 O;  1JVM A;  2AHZ A;  3P3P A;  4X65 B;  4H37 A;  4B7K A;  3JD1 A;  2WLL B;  4OPH A;  3RYH B;  5L3C A;  3VQX A;  3ZIA G;  1VMG A;  5B1O A;  1MOF A;  1NBM G;  1PPJ H;  4Q20 A;  4J41 A;  1E79 G;  1KQS U;  1YTF D;  2P22 C;  3B4S A;  2ZR2 A;  1AB3 A;  1JQ0 A;  4JTA B;  3OTF A;  4UCV A;  3L71 H;  3RFR A;  1IXM A;  4JI0 B;  3K9S A;  5GON A;  2QM7 A;  3RYF B;  2JJ2 G;  3A0H Z;  2R9A A;  2AGA A;  1FAF A;  2QM8 A;  5J2U B;  4TV8 B;  5DM6 V;  2FKX A;  1QVF U;  2BTO A;  4MTX A;  4O2A B;  4ZHQ B;  4YJ3 A;  5LL6 Y;  5B1A C;  3FYI B;  3DXR B;  1MG1 A;  1YIT V;  4AI8 A;  5FL7 G;  5JQG B;  2QKC A;  4DR7 B;  3WB0 A;  5L3F A;  1VQK V;  2Q0A A;  1GK9 A;  2Y69 C;  3NR7 A;  2EIJ C;  1JJ2 U;  2UXD B;  1W2B U;  1QR8 A;  2RDC A;  4X1Y B;  1VQ6 V;  1R3J C;  1SA0 B;  3MHS C;  4H44 B;  1LR1 A;  1Q86 W;  5LA6 A;  1MMM A;  4I4T B;  4XDJ A;  2F95 B;  4MVO A;  5GTI Z;  2ZT9 B;  4X64 O;  2P5O A;  3SDL A;  1PL4 A;  1NT2 B;  4JI7 B;  1TGO A;  4FLY A;  3N2K A;  4B3M B;  1Q3E A;  1NZ6 A;  1K9M W;  3F7V C;  3CE2 A;  1K5Q A;  4JI5 B;  1N34 O;  3D8C A;  2CTQ A;  3H1I H;  3JAK B;  3JAM N;  4RUE A;  2WLL A;  3RYH A;  4ICG A;  3J81 N;  3CCJ V;  2DYR C;  2QDO A;  1NR1 A;  2EIM B;  3UT5 B;  4DV4 O;  1F23 A;  4EKW A;  3ZED A;  1R6K A;  3ZBH A;  1PNL A;  4DR2 B;  2GTS A;  1JX9 A;  4K8X A;  1Y74 B;  4H13 B;  4UCO A;  4DV3 O;  1KP3 A;  1V9P A;  3VQV A;  1YJ9 V;  1UPG A;  3RYF A;  1O9G A;  1E1R G;  2X6B A;  1NVP B;  5J2T B;  2KG7 B;  1VQO V;  5B1B C;  5J2U A;  4TV8 A;  3G71 V;  3AK2 A;  4MVS A;  1R6T A;  4GT1 A;  4NTW A;  2A0L A;  4MVU A;  4KUM A;  4O2A A;  3SJQ C;  4ZHQ A;  1R3L C;  3CX5 F;  4QNH B;  3G6E V;  4P9O A;  3CCL V;  3JD0 A;  4FFB B;  4LFA B;  5FLX N;  1KP2 A;  3RVZ A;  1XNR O;  3RYI A;  3KZI Z;  4CS4 A;  2F23 A;  3K0G A;  2HLD G;  4LFB B;  4MT8 A;  3W7X A;  2ZM6 O;  3CSX A;  4X1Y A;  2EIK C;  2IH1 C;  5LMU O;  5LHI A;  1SA0 A;  5JVD B;  3QO8 A;  4MTF A;  1XBL A;  1AVM A;  3RGB A;  4D7T A;  4I4T A;  4PA3 A;  1RFY A;  3BCC H;  2CH7 B;  2GV9 A;  1PP9 H;  2VWK A;  4X66 B;  4DV6 O;  4LF9 B;  3EXA A;  4JYY A;  4JAS A;  1EM1 A;  1OCZ C;  3R65 A;  1YTF B;  2UUB O;  5IJ9 B;  4I50 A;  5LHG A;  4DV1 O;  4CH4 A;  5IY5 C;  4OXS A;  4Q6G A;  2F66 C;  3FB5 C;  3OD4 A;  1H2S B;  3JCZ A;  5AG2 A;  3U10 A;  5KHI A;  1VQ5 V;  1BQ0 A;  4LF4 B;  4RQF A;  2QEX V;  1ZL8 B;  4G28 B;  1OCR B;  4J80 A;  2X6C A;  1BZK A;  3JAS B;  2P6J A;  5CA0 B;  4DR4 O;  2H94 A;  2KG7 A;  4JI8 B;  2X0L A;  4O4L B;  4UFZ A;  4ASU G;  2P7T C;  2R9R B;  1SQQ H;  1NQT A;  3OFN G;  5H9C A;  2DOS A;  3IJ4 A;  1EFR G;  5L3E A;  4FFB A;  1BCC H;  2QR4 A;  2EBO A;  5LP6 C;  4E2L A;  1P4R A;  4JI2 O;  1T5E A;  1HWY A;  3IFX A;  3FKS G;  4FZ0 A;  2EUL A;  4IIJ B;  4B3T B;  2K1E A;  1BT8 A;  1XL6 A;  3THO A;  4H0L B;  5JCO C;  3JAL B;  4JI3 O;  4FK5 C;  4IYI A;  4IGG A;  3X2Q B;  5B3S B;  4DV5 B;  1XHX A;  3ZMU A;  3AEI A;  5JVD A;  5L3D A;  4JI1 B;  4EEQ A;  3TJT A;  3K9A A;  1NJI W;  5IWA O;  3CCE V;  1FJG O;  3E2E A;  5BMV B;  1XMQ O;  2L6L A;  4CC5 A;  2CUG A;  3UCS C;  4PA9 A;  1M9N A;  1X4T A;  2R72 A;  4J9Z B;  5HFM A;  2CH7 A;  4GZR B;  4K35 A;  5DED A;  1SQG A;  2QE7 G;  1LNQ A;  3VQY A;  1V55 B;  2Q68 A;  1JR9 A;  2DN9 A;  2V4D A;  2KB1 A;  3ASN C;  1Q43 A;  4UV9 A;  4FM0 A;  5IE9 A;  2CGO A;  5K1X A;  3CCV V;  4DV2 B;  4X65 O;  5IJ9 A;  4KFM A;  4JYB A;  3SYO A;  5KLV H;  2JGU A;  3CXC U;  1SC5 B;  4PA4 A;  2ZDI A;  4JYC A;  4FLU A;  3AG3 B;  4UV8 A;  3OUS A;  4WBN B;  3JAR B;  1EZJ A;  1QCE A;  4MVZ A;  1KU9 A;  5FPO A;  3BFR A;  4FM1 A;  1EN5 A;  2LW1 A;  2NN4 A;  1H38 A;  4PDM A;  4X1I A;  2PYL A;  1ZL8 A;  1ARO P;  4O4H B;  2OIE A;  3MD0 A;  4GX2 A;  1Y4M A;  1ZLZ A;  4RQE A;  2F1M A;  1Y76 B;  4JI0 O;  3OR6 C;  4O4L A;  1IBK B;  3EFF K;  4YY3 O;  4E4E A;  4AQY O;  1AR5 A;  2ZIO A;  3L9D A;  1YCI A;  2QWR B;  1FXK B;  3BEH A;  3QTC A;  1FPO A;  2PTM A;  3P3N A;  4PI0 A;  2IM9 A;  2DQ0 A;  4NXN B;  4TWK A;  2Q67 A;  5KAI Z;  1HNX O;  3OMI B;  4IIJ A;  2IJI A;  4JYA B;  4I0X B;  5E79 Z;  4DR7 O;  1Q6U A;  2OCC B;  3JAL A;  2PI4 A;  1VQ8 V;  2UXD O;  5GW7 A;  1J95 A;  4MVM A;  4I55 A;  3OTO O;  4QIW F;  4I5S A;  3G80 A;  4BAY A;  3CRR A;  2M6Y A;  5BMV A;  3J80 N;  1BHA A;  1H2N A;  1X59 A;  5LYJ B;  4Z2W A;  1H2K A;  2HJF C;  3CYO A;  4NKG B;  1Q7Y W;  2JEU A;  1NU1 H;  4K3A A;  1AI5 A;  1TAE A;  4D7S A;  3CD6 V;  3ABM C;  4YHH B;  3K5L A;  2WLN A;  4JI7 O;  2W6J G;  1D5A A;  2Y48 A;  5D5P A;  2YIB A;  3CWB H;  3S3X A;  3TXQ A;  5KMG B;  2Z3Y A;  3E35 A;  4X89 A;  1H8H G;  1L0N H;  2C2A A;  5JJE B;  1KD1 W;  2QA4 V;  3HKC A;  1G1X B;  1RM1 B;  3LDC A;  3K04 A;  4WBN A;  3JAR A;  3AG4 B;  4TV9 B;  4YIP A;  1GN2 A;  3ZCC A;  2JGD B;  3L74 H;  1IDS A;  2Q7E A;  4DR2 O;  3AG2 C;  1WP7 A;  4UCR A;  2XAH A;  1HW7 A;  3HKB B;  1Y76 A;  1I94 O;  2LFR A;  4JAV A;  1Q5O A;  4DR1 B;  1OZ0 A;  4CH3 A;  2R70 A;  4L8J A;  3A0B Z;  3LSS A;  3O65 A;  4JAU A;  1M56 B;  1H2L A;  4FLT A;  3ABU A;  4JI6 B;  3JSL A;  3P30 A;  4GX5 A;  1MA1 A;  1IBM B;  1NS1 A;  4BR6 A;  3OMA B;  2HHH O;  2QTS A;  1XEQ A;  2Z5U A;  2XUM A;  2IBZ H;  3B2E E;  1YEW A;  3ZHV A;  4X88 A;  3AG1 C;  4QJF B;  3A8T A;  4LFB O;  1HR0 B;  1Q6I A;  5K1P A;  2OT5 A;  3M7M X;  2JJ1 G;  2UXC O;  1ZUQ A;  1M57 B;  5EC1 C;  2YID A;  1CPY A;  5EYP B;  2PF4 E;  5CN0 A;  4C7U A;  5B1N A;  1JFF B;  5KAF Z;  4NR1 A;  4HYO A;  3OE7 G;  4FLV A;  5EIB C;  4FLX A;  3HR0 A;  1F4N A;  4DK0 A;  2YI9 A;  3SPI A;  5LXT B;  4H33 A;  4DXW A;  3ZMZ A;  5LYJ A;  1G6U A;  4LR3 A;  1ZTE A;  1ZSP A;  2B1G A;  2AW9 A;  1QVG U;  2UUA B;  2JRI A;  3ETD A;  4TUY B;  4BW5 A;  2QWP B;  1YJN V;  1SKV A;  1NH2 B;  2DYS C;  4LP8 A;  1IVS A;  1BQZ A;  1FD9 A;  4X66 O;  5KMG A;  3I56 V;  2DMX A;  5CA3 A;  3S3W A;  1M90 W;  2XHB A;  1XHZ A;  1I0H A;  1SET A;  4JF3 A;  4OX9 B;  4IT5 A;  1L8D A;  2UXX A;  4TV9 A;  3GB7 C;  4ZKI A;  2JGD A;  5FPR A;  5IYZ B;  2GBO A;  4LFC B;  4LF4 O;  3ML0 A;  2JVD A;  3UKM A;  3HKB A;  2ZD9 A;  1VF7 A;  2R9I A;  1GM9 A;  1MAB G;  3BRC A;  3T1Y B;  3N27 A;  4K0K B;  1PD3 A;  1WB7 A;  5EC2 C;  1QLN A;  4TQF A;  2AZ0 A;  4RUF A;  2Y4T A;  2EIN B;  3H1H H;  4GX0 A;  2KKW A;  3CRM A;  2OIG A;  4DRX B;  4LCU C;  2XAF A;  1EN6 A;  1I7F A;  3U0Z A;  2D2C B;  3FYE B;  3E8H A;  3ICX A;  4XBF A;  3I5D A;  1KEC A;  3T4D A;  2X6A A;  4B3T O;  3ABT A;  5IYC O;  1NI8 A;  2RNB A;  1V54 B;  4PDR A;  2HVK C;  4QGP A;  1F51 A;  3AG7 A;  1SZX A;  4JV5 B;  1SQB H;  3BY6 A;  1JFF A;  4DV5 O;  4DYL A;  4N21 A;  1B3Q A;  3K57 A;  2G38 A;  4JI1 O;  4IHJ A;  1YDX A;  2EIM C;  5JJN B;  1UFI A;  5LXT A;  3QO5 A;  1CXZ B;  2QM4 A;  1N8R W;  2ZR3 A;  1AP5 A;  4KHP B;  2JDI G;  4TSF G;  1K73 W;  3E86 A;  3ABK B;  2XT9 A;  1AI4 A;  1COW G;  3OR7 C;  3JD2 A;  3SJA C;  5L3G A;  3RWR D;  4TUY A;  2ZIN A;  2IU0 A;  3IC9 A;  3CJH B;  2CK3 G;  1HNZ B;  4PV1 B;  2DJV A;  2VS0 A;  3E8F A;  5LBQ A;  4JZG A;  1Y67 A;  5B1A B;  3OAA G;  3KCX A;  2ODM A;  3RYC B;  4HAM A;  1WNS A;  4DV2 O;  3FAV B;  4QPJ A;  3ZRV A;  3ABL B;  3M99 B;  4LH6 A;  3K03 A;  4UCS A;  3AK3 A;  2YEV B;  2DQ3 A;  4ABM A;  2Y69 B;  2EIJ B;  3LSQ A;  4MW3 A;  2CGN A;  2PUS A;  2VQE O;  4PEL A;  4LF5 B;  3FD9 A;  3KKY A;  5BZB A;  4GKK B;  3RW0 A;  1US6 A;  2E3C A;  4W4K A;  1WLE A;  3B77 A;  2UXB B;  4PHZ A;  3OUF A;  1IBK O;  2N05 A;  2UUC B;  1WA8 B;  4JI4 B;  3Q4H B;  4J10 A;  4J7K A;  1KMI Z;  4DRX A;  4WFG A;  3JAW B;  1ORQ C;  2HP8 A;  4DW0 A;  2CAZ C;  3JD3 A;  3OMN B;  3DXR A;  4Z1V A;  2YIA A;  3FFQ A;  1FXH A;  4NXN O;  4U3J B;  2JIZ G;  5JQG A;  2ZXW C;  2F4V B;  4JYA O;  5C8Y B;  4UCT A;  3N2G B;  4AHC A;  2ATK C;  3T1H B;  3PN1 A;  3W7S A;  3O9O A;  1ROP A;  3OW2 U;  1IX9 A;  5KUM A;  4P2Z A;  1ENV A;  4WFE A;  1TUE B;  3LNM B;  5IYB O;  5JJJ B;  3ZHT A;  4DV0 B;  5KHH A;  1K4D C;  1VEW A;  4UVB A;  1AI7 A;  2Q6A A;  2ZQM A;  4LF7 B;  5IDJ A;  3BHP A;  5B1B B;  4Z1M G;  3CJH A;  1KC8 W;  4YIO A;  3GWK C;  3NXS A;  4YHH O;  5B66 Z;  2W0X A;  3RBZ A;  4N23 A;  3W7T A;  3JAK A;  5KHG A;  3RYC A;  3IC7 A;  1SQF A;  4QE9 A;  3FAV A;  4PDL A;  1NKD A;  1KKD A;  4CZZ A;  2XOK G;  3UT5 A;  3ZRX A;  1KUQ A;  2Q5Z A;  2YXL A;  2YEV A;  2WLH A;  3TCU A;  1AJP A;  2WWW A;  1P7G A;  1Y74 A;  2RCV A;  4TOI A;  1MZE A;  3CEI A;  2EIK B;  5EBW C;  5F2V O;  1DLB A;  3STL C;  1VQ4 V;  3CC2 V;  1Z2G A;  1MSW D;  4X62 B;  1J5E O;  3BAA A;  4MTG A;  1WP8 A;  5J2T A;  3X2Q C;  5B3S C;  4DR1 O;  3ZMS A;  3LDE A;  4YXW G;  1S5L Z;  1WA8 A;  3Q4H A;  2XAS A;  4MSW C;  3EHB B;  2BTQ B;  5LGT A;  2X7R B;  3SR2 C;  3JAW A;  2QKS A;  2EX3 A;  1WAZ A;  5HFL A;  1IZ3 A;  4JI6 O;  1IBM O;  4U3J A;  1G8M A;  4LF6 B;  4NXM O;  1I5Y A;  3APO A;  3GWO A;  1OCZ B;  4UXN A;  2Q4P A;  3SJC C;  2RN9 A;  1K7D A;  5C8Y A;  3N2G A;  2WSS G;  2NNU A;  1VP7 A;  3J7A U;  1KBH A;  2GUZ B;  3KCY A;  1DF5 A;  5KX5 B;  1XQ8 A;  1HR0 O;  2O57 A;  1G4Y B;  5IY5 B;  1H2G A;  1YSC A;  1FFX B;  3H1L H;  3ZRW B;  3K5M A;  4DR3 B;  3AG3 C;  1JCH A;  1QQC A;  3CCS V;  4LC1 A;  5LHH A;  1OCO C;  1N32 B;  2W6I G;  3ETG A;  4WFA V;  4TQD A;  5LMN B;  1QLE C;  4RWU A;  1OV9 A;  4O4I B;  2ADQ B;  2UUA O;  1A32 A;  4WFB V;  5C93 A;  5EBL C;  2WLJ A;  1AI6 A;  1MZF A;  1SRY A;  4G2K A;  3CHX A;  1O9H A;  3BA9 A;  3SPC A;  5A2Q N;  4GUN A;  2JEX A;  3SJB C;  1QR9 A;  2Q0O C;  1JJO A;  2QKA A;  4HBN A;  4OX9 O;  4P9P A;  2HFE C;  2IJK A;  2P67 A;  1SS3 A;  4XDL A;  3K3W A;  2MK3 A;  5CBF A;  3T2M A;  3I55 V;  4DR6 B;  2HVJ C;  3T4Z A;  5IJ0 B;  1PL0 A;  3ZHU A;  4LFC O;  3JAS A;  1LUW A;  2P90 A;  1K5S A;  4MTO A;  5CA0 A;  2FTK A;  1F7Y A;  2Q8V A;  1OJH A;  3T1Y O;  2EJ7 A;  4J42 A;  1GN3 A;  1B06 A;  4GKJ B;  3SPG A;  3UM7 A;  1YJW V;  2BTQ A;  2ETN A;  2IJJ A;  1XI1 A;  4WFH A;  4XDK A;  5LGU A;  5EIB D;  4DV7 B;  4QPK A;  4JPR A;  4EFB A;  1FKA O;  3ASN B;  2YUA A;  2WLK A;  3MAQ A;  3WG7 C;  2A7W A;  3ZN0 A;  5EBM C;  4FFK A;  2GUZ A;  5KX5 A;  1YF2 A;  3DSQ A;  3H1J H;  4U7N A;  2CE4 A;  1E1Q G;  2W0F C;  1FFX A;  5KHJ A;  1BS3 A;  1SQX H;  3ZRW A;  3DTU B;  1XNR B;  4JV5 O;  3IAY A;  1K3E A;  3C3T A;  3K58 A;  2LO1 A;  1PM9 A;  2VWJ A;  4B7E A;  1QBZ A;  1DK1 A;  1BGY H;  3ZJZ A;  1Y66 A;  1YZB A;  4CS2 A;  3QO7 A;  1WPX A;  1K8A W;  4KHP O;  4O4I A;  5DN6 G;  1VQ9 V;  4PA7 A;  3CXH F;  3E89 A;  4B3M O;  1HNZ O;  3JAT B;  4IL6 Z;  1BE3 H;  2WA4 A;  4UVC A;  4JI5 O;  2YSU B;  2LGW A;  1XUQ A;  4PDV A;  1M56 C;  4DO2 A;  3MDS A;  3B09 A;  2RQ6 A;  1OHH G;  1U97 A;  1VF6 A;  3UO2 A;  3ZHS A;  3B40 A;  3CRA A;  2WPD G;  1GN4 A;  5JCO A;  2P06 A;  2PGG A;  2Y4U A;  5IJ0 A;  2QTO A;  4O4H A;  5BXZ A;  1VAR A;  2D3O W;  3L75 H;  2WA3 A;  3CS5 A;  1M4U A;  1M57 C;  3FX7 A;  3F5T A;  3LDD A;  1KB9 F;  2UXB O;  4ZOL B;  1R3I C;  4G27 B;  2UUC O;  1GMG A;  4JI4 O;  2LGQ A;  4NTX A;  1FXK A;  1BSM A;  3QVN A;  2EIL B;  2QJ1 A;  3ABM B;  1Q6H A;  1VQP V;  4LFA O;  2V1D A;  1THZ A;  4R50 A;  4I0X A;  1M1K W;  1IBL B;  2LQT A;  2PYJ A;  3WFV A;  4ZIB A;  2F4V O;  3ASO C;  2Y0I A;  1PKX A;  2FB5 A;  3T1H O;  3E83 A;  2DWD C;  4JI2 B;  4DUZ B;  4QE7 A;  1N0N A;  2YI8 A;  3D3Q A;  1R1B A;  3F5W C;  5CB4 B;  2QGN A;  3AG2 B;  4DV0 O;  2Z0A A;  1NR7 A;  4AIL C;  3ZHR A;  3ZRS A;  1S0V A;  2EJR A;  2A9H A;  4LF7 O;  1W59 A;  1R3K C;  1RP3 B;  1FJG B;  3UO3 A;  2OTJ V;  3JAT A;  4UVA A;  4K8Z A;  2FL4 A;  3C90 A;  1XMQ B;  2F43 G;  1DGS A;  4LF9 O;  3R66 A;  5BR8 B;  4JGS A;  3JD4 A;  4LH7 A;  2NR5 A;  3VBB A;  1URF A;  1N33 B;  2QSA A;  4MS2 A;  1XNQ B;  2LW7 A;  1YI2 V;  2FYU H;  4B3S B;  2ZE7 A;  3W7U A;  1NTK H;  1VQL V;  1W0J G;  2F93 B;  4FJC C;  1W0K G;  1AR1 B;  3AG1 B;  3G4S V;  5CA1 B;  2CTR A;  2ARH A;  4O2B B;  1B04 A;  1OCC B;  3JYC A;  1P84 F;  2XAJ A;  1V54 C;  3JSN A;  2V7Q G;  2VQF B;  1QU7 A;  2H8P C;  3T1C A;  2CTW A;  5J9P C;  4X62 O;  1GAX A;  4DUY B;  2OTL V;  4ZOL A;  1EZV H;  3CRQ A;  4JI8 O;  1SQP H;  2DE0 X;  3H1K H;  3QG5 A;  2KSD A;  2OWO A;  2ILM A;  4KL1 A;  2QWN B;  3LUT B;  1FFT B;  1S77 D;  1GM8 A;  1JOY A;  3ZX6 A;  2A79 B;  4O4J B;  2DYS B;  3ABK C;  4YY3 B;  5H2F Z;  3LNN A;  2IW5 A;  4CH5 A;  2XAQ A;  4AQY B;  4LF6 O;  1CP9 A;  1Q82 W;  3K06 A;  2YS8 A;  4DR5 B;  1FYJ A;  1XL4 A;  1SER A;  1RSO B;  2GSM B;  2N04 A;  3FB7 C;  1HNX B;  5EYP A;  2AXT Z;  4D6T H;  1GO3 F;  4MW8 A;  3ABL C;  4DR3 O;  4U3F H;  5CB4 A;  1IUR A;  3RYI B;  1VQM V;  5CBH A;  1FS0 G;  5CBG A;  2VRZ A;  3QF7 A;  4I9Q A;  1N32 O;  3OTO B;  1S5J A;  5LMN O;  5A9G A;  3SPH A;  1WB8 A;  4FVM A;  2ZM6 B;  2Q73 A;  1Q8I A;  3SYQ A;  3H9V A;  5FNV B;  1S5H C;  2ZE6 A;  2ZE8 A;  5GTH Z;  4HZ3 A;  3D36 A;  1S76 D;  1K92 A;  1AR4 A;  1FXV A;  3PJS K;  4OPA A;  4UB6 Z;  5EK0 A;  3E22 B;  5H6Q A;  2DWE C;  3CCR V;  3WU2 Z;  5CA1 A;  2WAM A;  4O2B A;  5IYZ A;  5JH7 B;  1BMF G;  2UXN A;  2B1I A;  3G6B A;  1SQV H;  3W7W A;  4DR6 O;  4J11 A;  1D2D A;  1PNK A;  1GKF A;  1NTZ H;  3MHH C;  4FMT A;  2M7W A;  4I50 B;  2OCH A;  4CBC A;  3EVK A;  2YIB D;  4LWS B;  3OM3 B;  4JTC B;  3C3S A;  2Q69 A;  3WB2 A;  4GKJ O;  1F4M A;  3A2F A;  3CMA V;  1XOU A;  4UUJ C;  1N36 B;  4FPP A;  4B3R B;  3OGI B;  2BOB C;  3ETE A;  2E5L B;  1LUV A;  1DF4 A;  1I94 B;  1P49 A;  1KYO F;  5TIS Z;  4LF8 B;  4O4J A;  2LFS A;  4YJ2 B;  4DV7 O;  3CP1 A;  4CS3 A;  1HNW B;  3STZ C;  2LP7 A;  1XMO B;  2E76 B;  3ZMV A;  1CEZ A;  1ZAU A;  3L72 H;  1RSO A;  3OEE G;  3L73 H;  4KP4 A;  2DYR B;  1SZT A;  2HHH B;  4X1K B;  3SYA A;  2ZDI C;  2ADP A;  2ZE5 A;  1GTO A;  2H3O A;  2ZIM A;  5EZY B;  2B5U A;  3APQ A;  2ITD C;  1WPB A;  3H01 A;  5LOV B;  2K9P A;  2UXC B;  3DGE A;  4DK1 A;  2IJH A;  1GH6 A;  4EB6 B;  4X8A A;  3HKE B;  1OCR C;  4I9W A;  3HB3 B;  5B5E Z;  3DC5 A;  5DEC A;  1SF9 A;  2YDE A;  5FNV A;  4LNU B;  1RPO A;  3RT3 C;  1MSD A;  4OGQ B;  3BA8 A;  1I5X A;  4BIZ A;  2Q9L A;  4A5U B;  3HPL C;  1N4C A;  3VQW A;  3B8M A;  4MVR A;  3ZN1 A;  1DTO A;  2ZXW B;  1HDJ A;  2YC0 A;  3E22 A;  2ZNI A;  4KXR A;  2UU9 B;  1H2M A;  3B8N A;  5JH7 A;  5L3B A;  4PA6 A;  3CCU V;  4J7J A;  4JZ2 A;  1ZX3 A;  1S3J A;  3K79 A;  3FB8 C;  1Q90 D;  2E74 B;  4WCE V;  1K97 A;  2XTA A;  4L87 A;  4TT3 G;  2AZ2 A;  3CRC A;  4LWS A;  3BAB A;  4F4L A;  1TVK B;  3U11 A;  2DW4 A;  3K59 A;  2ZKO A;  4X1I B;  4X9Q A;  1K33 A;  3SPJ A;  3LSU A;  4EFE A;  3A0R A;  1XRE A;  4YJ2 A;  2Y0P A;  1PV0 A;  1YVW A;  2P4V A;  4BW9 A;  1V55 C;  2PY5 A;  3SYP A;  4U7O A;  1IBL O;  1M93 A;  2BOC C;  1VIB A;  4X1K A;  2KQX A;  4DUZ O;  3F7Y C;  1VF6 C;  2LJ2 A;  5KUK A;  5EZY A;  2IH3 C;  2GDS A;  3E8G A;  2HJD A;  3TGU H;  4W4L A;  5LOV A;  3RVY A;  4RAI A;  1JMK C;  4EB6 A;  2AHY A;  3HKE A;  1EN4 A;  1GRJ A;  1AIL A;  4I55 B;  1KKC A;  4B08 A;  4CH6 A;  4FLW A;  1R6N A;  4LNU A;  1TA8 A;  2CDY A;  3KG2 A;  4X64 B;  5BR8 O;  2BCC H;  5LP6 B;  2YXY A;  5KA6 A;  1FXK C;  4R6Z A;  1AP6 A;  1B6Q A;  1N33 O;  1XNQ O;  1UJW B;  2WLI B;  2RMK B;  4B3S O;  4PI2 A;  2YXH A;  4FZ1 A;  1N34 B;  3D3I A;  1L0L H;  3L70 H;  4WF9 V;  4X20 B;  1I08 A;  4ZI7 B;  2OCC C;  5H5N A;  3HKC B;  2GTA A;  1NH2 D;  4DV4 B;  4FIP C;  2PZS A;  1AJQ A;  2VQF O;  4K0K O;  2PI5 A;  1TVK A;  3BPZ A;  1OCO B;  4J7Z A;  1VQ7 V;  4DW1 A;  2VQE B;  4DUY O;  1MNG A;  1K34 A;  2Q7H A;  4BIU A;  1JPX A;  1QLE B;  4DV3 B;  2QWO B;  3GVM A;  5LGN A;  4HNA B;  3HKD B;  4JTD B;  1U96 A;  5BY1 A;  1M5I A;  4FM2 A;  1WJZ A;  1JA8 A;  1H8E G;  2BSK B;  5IT9 N;  4F6R B;  4NYK A;  4P30 A;  4DR5 O;  3OT7 A;  2B9Z A;  1TUB B;  2MW2 B;  2FML A;  3BVO A;  4PJ0 Z;  1RM1 C;  2ZNJ A;  3AG4 C;  2A06 H;  5ITZ B;  4MVQ A;  1Y6X A;  1GN6 A;  2HKO A;  3FB6 C;  1XIL A;  3JCU Z;  3TXS A;  3ZHQ A; 
#chains in the Genus database with same CATH homology
 5FLX N;  1AIL A;  2DOS A;  1XNR O;  2LW7 A;  3O65 A;  3RT3 C;  4JI2 O;  4A5U B;  1J5E O;  4LFC O;  1IBK O;  1HNX O;  2N74 A;  3M8A A;  4OPA A;  4DR1 O;  1NS1 A;  5BR8 O;  5BXZ A;  1F7Y A;  2ZM6 O;  3T1Y O;  2HHH O;  4JI3 O;  1XEQ A;  4DR7 O;  5LMU O;  1N33 O;  1XNQ O;  4B3S O;  3F5T A;  4DR6 O;  2UXD O;  4LFB O;  4NXN O;  4X62 O;  2UXB O;  1D2D A;  4B3T O;  2UUC O;  5IWA O;  4JI4 O;  2UXC O;  4JI6 O;  3OTO O;  1IBM O;  4JI8 O;  1FJG O;  4X64 O;  3SDL A;  4NXM O;  4JYA O;  1XMQ O;  5H5N A;  4GKJ O;  2UU9 O;  1FKA O;  3J80 N;  4LF5 O;  3J7A U;  4DV5 O;  4LFA O;  2ZKO A;  2VQF O;  1X59 A;  4K0K O;  1HR0 O;  4JI1 O;  4DV6 O;  4OPH A;  1N34 O;  3JAM N;  4DUY O;  4DV7 O;  4GKK O;  2F4V O;  4LF6 O;  4JI7 O;  2UUB O;  3J81 N;  3T1H O;  4JV5 O;  2JRI A;  1FYJ A;  4DV4 O;  4X65 O;  1N36 O;  4DV1 O;  5BY1 A;  4B3R O;  1AB3 A;  2E5L O;  4X66 O;  1R1B A;  4LF8 O;  1IBL O;  1G1X B;  2DJV A;  1DK1 A;  1YZB A;  1HNW O;  4DR3 O;  4DV0 O;  4DV3 O;  2Z0A A;  4YHH O;  5IT9 N;  1XMO O;  4KHP O;  4DR5 O;  2UUA O;  2AGA A;  1A32 A;  4DV2 O;  4DUZ O;  4LF7 O;  1N32 O;  2FKX A;  4DR4 O;  4B3M O;  1HNZ O;  4DR2 O;  5LMN O;  1R6T A;  5LL6 Y;  4JI0 O;  5A2Q N;  1KUQ A;  4LF4 O;  4JI5 O;  1I94 O;  4YY3 O;  4LF9 O;  3R66 A;  2VQE O;  4OX9 O;  4AQY O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...