1XNQO

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1xnqO00
1HR0O 4JI8O 1KUQA 3T1HO 1R6TA 1XMQO 3T1YO 3R66A 4GKKO 4K0KO 2AGAA 1HNZO 3RT3C 1HNXO 4JI7O 4DV6O 1I94O 4LFAO 4LFCO 4DR7O 4DR4O 4LF4O 4KHPO 1DK1A 3M8AA 1IBMO 2N74A 1AILA 4LF6O 4NXMO 2DJVA 3F5TA 1NS1A 4DR1O 3J7AU 2DOSA 2UUAO 4B3MO 1R1BA 2UUBO 4B3RO 4DV2O 4B3SO 1N32O 4DR2O 4DR5O 2UXBO 5BXZA 2JRIA 4YHHO 4LFBO 4OPHA 2UUCO 5FLXN 4JI5O 4X64O 2Z0AA 2VQEO 4DV5O 1XEQA 4JV5O 4DR6O 1IBLO 4NXNO 4JYAO 4X62O 3O65A 1FYJA 1X59A 1F7YA 2LW7A 5BY1A 2HHHO 3J81N 4B3TO 4DR3O 4OX9O 4A5UB 1YZBA 4JI2O 1A32A 1N34O 4JI1O 2UXDO 1XMOO 1G1XB 1D2DA 4DUZO 1J5EO 1AB3A 1XNQO 4DUYO 5IWAO 4LF9O 5LL6Y 1IBKO 4DV4O 4X65O 4LF8O 2UU9O 4JI3O 4DV3O 2VQFO 4X66O 3OTOO 4JI4O 2E5LO 5IT9N 2FKXA 4YY3O 4GKJO 5A2QN 1N36O 4DV0O 4AQYO 1FJGO 4LF5O 5BR8O 2ZKOA 3JAMN 4JI6O 2UXCO 4OPAA 2F4VO 4DV7O 1FKAO 1HNWO 5LMNO 4DV1O 1N33O 4JI0O 2ZM6O 5H5NA 4LF7O 1XNRO 3SDLA 5LMUO 3J80N
chains in the Genus database with same CATH superfamily
4YJ3B 3O9OA 2EIJC 2F66C 1KUQA 4K35A 2Q6AA 1Q3EA 1R6TA 2HR3A 1LR1A 5B3SC 4P9OA 4QPKA 1KC8W 1FXHA 2OIGA 4O4HB 3ZX6A 4X8AA 1K33A 1R3KC 3HKEB 1EFRG 1BZKA 5LYJA 2XAQA 3F5TA 5JJEB 1I0HA 1M9NA 1Q90D 2B5UA 3JARA 2P4VA 1FD9A 1XMQB 3ZHRA 4DR5O 2RNBA 4OPHA 4H44B 3FB8C 4WFGA 2QM7A 4LFCB 1DGSA 2FTKA 4FJCC 3K5LA 2H3OA 1EZJA 4X62O 2XAJA 3BA9A 3AK1A 1QLEB 4B3MB 1WJZA 3H1IH 4C7UA 4UVBA 2GHYA 2HVKC 4P2ZA 3HB3B 4R8CA 1KKCA 3LDEA 3QF7A 3SJQC 3K04A 3JALB 2CGOA 2PGGA 5LXTA 4FLXA 5IWAO 4NTYA 1SA0B 3E22B 2EILC 5DECA 5LYJB 4HBNA 2YEVA 2EZPA 1Q86W 4UCTA 3JARB 1N34B 3RYFA 1ZX3A 5LHIA 3NXSA 4F6RA 3WB1A 4NVPA 5LHHA 4OPAA 5GTHZ 1GRJA 1KP3A 4YJ2A 1YEWA 1FKAO 2AHYA 2RJZA 2BTQA 3ABUA 3CCLV 2ZM6O 5H5NA 3LNMB 1URFA 4G2KA 1VQ9V 2A0LA 4ZHQB 4YY3B 4FLVA 1OZ0A 3ZN0A 1XHXA 3E86A 3WG7C 2Q69A 2YI9A 2CUGA 3K06A 2A06H 4FM2A 4JI7O 5KAFZ 4FZ1A 1VQ5V 4TQFA 2YIBD 1XREA 2YSUB 4U7OA 1ENVA 3CRRA 2YEVB 3HKBA 4DV2O 4RO2A 4DK1A 3RYFB 1R3LC 4AQYB 2JRIA 2IJJA 1Q5OA 4F6RB 1NVPD 2P4KA 3ABLB 2LGWA 2Z0AA 4H0LB 2AZ2A 4YJ2B 3B4SA 4FK5C 1DLBA 2LQTA 2BTQB 4QE9A 3ZEDA 2AHZA 1XNRB 1IZ3A 2GV9A 4Z1VA 4TT3G 4WFHA 2DYSB 2ARHA 4L87A 5EC1C 3TGUH 2XT9A 1XMOO 4DUZO 1AB3A 3A8TA 4FPPA 2WLHA 3CCVV 4J7KA 4NKGB 3KCXA 5C93A 4LH7A 2DMXA 2VWKA 1B3QA 2YI8A 2D3OW 4R50A 2E5LO 3HKBB 4K8ZA 4AHCA 3W7TA 3W7WA 5D5PA 2EJ7A 3L73H 3K08A 3ZRWB 1Q81W 1FJGO 4PI0A 5IYZA 2UXCO 2CH7A 3BY6A 3FB7C 4BIZA 1Z2GA 4X62B 4UB8Z 1FAFA 3JSLA 1SZTA 2VWJA 1M56C 3AG3C 4BW9A 2QE7G 3ASOB 1YJ9V 2AXTZ 3ZJZA 2LFRA 5IYCO 2CGNA 3FFQA 3R66A 1KD1W 4FLTA 1SF9A 3T1CA 4N23A 5IWAB 5IY5C 4F4LA 4D7TA 4B08A 4WCEV 1VMGA 3Q4HA 3D36A 1NS1A 4DR1O 5DEDA 3GB7C 3DC5A 3BA8A 5BXZA 4RQFA 3ABTA 5FLXN 3LUTB 1PNKA 3FB5C 2KG7A 2H94A 5EBMC 2MW2B 3ZRVA 3H01A 1GM9A 2ZM6B 2VS0A 4MVQA 5LGNA 1XI1A 3T4DA 2UXXA 4J10A 1XUQA 2JEUA 3CCQV 2UXDO 2Q0AA 5KHKA 2Q7HA 2RN9A 1Q6UA 1YIJV 4NXNB 1PL4A 3QNEA 5B5EZ 4PA9A 3D3IA 4EFBA 3DC6A 5EYPA 1U97A 3Q4HB 1RSOA 2IJKA 4HNAA 2PY5A 1GN3A 4DV2B 3UKMA 5L3FA 2F93B 4J9ZB 4I9QA 3K0GA 5JH7A 2LGQA 2E76B 4DRXA 2KG7B 3IAYA 4DV7O 3QG5A 5LMNO 1Y6XA 3CB2A 1X4TA 1K7DA 2KQXA 2Y69C 1MABG 1B6QA 5GONA 1HR0O 3K58A 1EN4A 3CPWU 2HG5C 1IXBA 5DN6G 1XMOB 3FAVA 2AGAA 1XQ8A 5LP6B 4DUZB 3AG4C 1GO3F 3L75H 1SQQH 4LF4O 3EXAA 4FMTA 2DYRC 1AILA 3R65A 2RMKB 5EYPB 2ZE7A 1RSOB 4HNAB 5H9CA 2P90A 4B3SO 3CRAA 2Y0PA 1OCRB 4GKKB 1VQ7V 2XAGA 4DRXB 5FPOA 2DWEC 4HZ3A 1TA8A 1BHBA 1RP3B 3UT5A 3CWBH 3OD4A 4JAVA 4MVSA 1TGOA 3SYCA 4ZOLB 4JTCB 4FLWA 1SERA 1OCCC 5JCOA 1P7GA 3CXCU 5GONB 2NN4A 4WFBV 3ETQA 1GAXA 2UXBB 3RYCA 1JFFA 3FAVB 3B77A 1G1XB 4TV9A 3L9DA 5EK0A 1M1KW 1PM9A 3CP1A 4MVRA 2XASA 3OAAG 2F1MA 3S3XA 4Z1MG 2HHHB 1QBZA 4DR1B 2XUMA 4DV3O 2VQFO 5H6QA 5A2QN 1M93A 1VQ8V 5IYBO 1VQLV 2RQ6A 3A0BZ 1MMMA 3JASA 1RFYA 3JAMN 4UCUA 4HAMA 1JVMA 4XBFA 3UT5B 2CTQA 4PA7A 1NU1H 1WN7A 2NR5A 3ASNB 2BOCC 2DQ0A 4E2LA 3ZHTA 1B04A 3JATA 2UXDB 1XMQO 1Y67A 3JAKA 4KXRA 5ITZA 1Q7YW 1JFFB 1UFIA 3RWRD 4I5SA 1I94O 4CS4A 4LFCO 2Q9LA 2P5OA 1MZEA 2P22C 1GKFA 3FD9A 1R6NA 2E75B 4B3MO 1QU7A 3G67A 4JAAA 4TOIA 1BHAA 3I56V 2EINB 4X1YA 4OGQB 5D5QA 3I5DA 5B1AC 5CN0A 3P30A 1P49A 2F43G 3SYOA 3JASB 4BAYA 3JAWA 4DV7B 3K0DA 4H13B 5LMNB 3EHBB 1S0VA 2XAFA 3CC7V 2JGDA 3O65A 5KHIA 1F23A 4JZGA 2JDIG 2QJ1A 1HR0B 1OHHG 2IM9A 1TAEA 1HW7A 3JATB 1N34O 4JI1O 1V54B 3JAKB 1FXKC 5ITZB 4LF4B 1LUWA 4LF9O 5LGUA 1V9PA 1VARA 3CMAV 1KECA 1PNMA 2LW1A 4IIJA 3MHHC 5IT9N 4RQEA 4YY3O 4GKJO 4O2AA 2PF4E 4X1YB 1GN2A 3K5NA 5HFLA 4D7SA 2GTAA 4PDLA 4JPRA 2CTPA 3ABMB 3JAWB 3OR7C 1HNWO 4ASUG 2GSMB 3F7YC 4MVOA 1VQ6V 1W0KG 2JGDB 2XNDG 3QVNA 1DF4A 1F51A 4Q20A 4PELA 1AI7A 4KFMA 3HPLC 3UQ8A 1BE3H 4H37A 1MG1A 1KP2A 4DV6O 3AG2C 1KYOF 5E1AC 2W0FC 4DR4O 2WLLA 1IBMO 2JVDA 4JYBA 2OTLV 4JASA 1OCOB 3ZHVA 3IC9A 4TQDA 4IIJB 5EIBD 4UUJC 4MVMA 4O2AB 4QPJA 4J7ZA 5LA6A 1JR9A 1IDSA 2EX3A 2QEXV 3UO3A 3N27A 4JI5O 2A79B 1ZTEA 4O4LA 2C2AA 4W4LA 3IJ4A 3KKYA 1X59A 3W7XA 3CJHA 4B3TO 3IGAC 1K8AW 4JYYA 2Y4UA 1H2KA 3X2QB 4LFBB 5JWPA 2GTSA 4GYCB 4EB6B 3ZHSA 1I94B 1NT2B 2WLLB 3MDSA 3G4SV 1Q82W 4OX9B 3H1KH 4JI3O 2ZXWB 3OTOO 1M57C 4YIOA 4JI2B 1VF6C 4LBEC 2EIKC 2X7RB 5LA6B 1S5JA 2HEPA 3DSQA 4F6EA 3FX7A 1LNQA 3OMAB 5GW7A 4CS3A 5KLVH 1AI6A 3BEHA 3WFVA 1JJ2U 1SRYA 4UCRA 1YTFB 3CCEV 3CJHB 3CCRV 1NI8A 4GX2A 3F7VC 5B1OA 1GN4A 4JI1B 5CBGA 1HNZO 1L0NH 4NB5A 1CP9A 2ZQMA 5H2FZ 2EIMB 4LF9B 2OCHA 1DK1A 4CH6A 4LF6O 4MW8A 1SQFA 5K1PA 2LP7A 2V4DA 3H1HH 3T2MA 4GKJB 4X88A 3T1YB 2WLMA 5H6RA 3CYOA 1S5LZ 1QCEA 5LXTB 2KKWA 4BIUA 1HNWB 4JV5O 1IBLO 4NXNO 2WWWA 3CXHF 1ZUQA 2IH1C 3ZHUA 5IJ0A 3P32A 1F7YA 5IE9A 2NNUA 3NR7A 3SPGA 2CE4A 3PN1A 2F23A 4JZ2A 3CC4V 4BW5A 4QE7A 1K4DC 2IJHA 2WSSG 1N8RW 4PJ0Z 3K9SA 4WF9V 4DV6B 4DR4B 5LP6C 1IBMB 1MOFA 2WLNA 4MT8A 3ZMTA 2A9HA 2HJDA 3ICXA 4NYKA 3WU2Z 2QWRB 4UFZA 3K79A 2FL4A 3BRCA 4JI5B 3OUFA 1ZWIC 1JA8A 5DM6V 1R3JC 1V55C 1YITV 1WP7A 1E79G 4GLXA 1SETA 1BQZA 1TVKA 1O9HA 2QTSA 5IJ0B 4B3TB 3K03A 5FNVA 1AVMA 3AK2A 2GUZA 5KA6A 2LJ2A 2CTRA 5CB4A 5L3GA 5BR8B 1BGYH 4GKKO 1FFTB 3BCCH 2ADQB 1XHZA 1MNGA 1IX9A 1R6KA 5A9GA 4RUFA 5B1NA 4XDKA 2CTWA 4I50A 4WBNA 4LWSA 3L70H 1TUBA 2IH3C 4JI3B 1GH6A 3OTOB 2YS8A 3FYIB 4FLUA 1N32O 3TK1A 1WA8A 1AROP 2UXBO 3SPJA 2UUCO 4BIOA 1OCZB 4NXMB 2DN9A 3E8BA 2K9PA 4O4JA 4UVCA 1TVKB 1XBLA 2ZNIA 4J42A 2HHHO 2GUZB 5KHHA 3SJCC 2IJIA 1AJQA 2MK3A 1EN6A 5KMGA 3L74H 3AG7A 3ASNC 2Q0OC 5CB4B 5JCOC 3CCSV 1HNZB 2JEXA 1RM1B 1D2DA 1YSCA 2P67A 5IYZB 2ZE6A 1J5EO 4DR6B 1VF7A 1EM1A 2QWQB 2CH7B 3LSUA 2X6CA 2DWDC 3APOA 4LF6B 4I50B 3SJBC 3CCUV 1GK9A 5B1BC 1TUBB 1IVSA 1HP8A 3BAAA 3VQXA 3H1LH 2YIDA 3B40A 1IXMA 3GWOA 4JF3A 4QNHB 4JI6O 1UPGA 4JV5B 2EILB 3IFXA 3LDCA 1IBLB 1AI5A 3AG1C 2PUSA 4CH3A 3VQYA 4GX1A 3PJSK 2PI4A 1N0NA 4TSFG 3L72H 1H38A 3DXRA 3HKCA 2GBOA 3ML0A 3T1HO 4FIPC 1CEZA 1SQBH 5KMGB 2Q7EA 1VP7A 2JJ1G 4EKWA 2JK5C 3QO5A 3CSXA 4OXSA 3JYCA 1YF2A 1JJOA 1SC5B 3WG7B 1NR7A 1NKDA 3ZBHA 4DR2O 3SYQA 2EJRA 4YHHO 3LSQA 2R72A 4UCVA 1ZLZA 1SKVA 3ABKB 2L35A 1NH2D 4KL1A 4NTXA 3U10A 1ORQC 3LNNA 3OEHG 3HKCB 5TISZ 4PD4F 4PDMA 4DW0A 2KSDA 2OCCC 4D6TH 5J2TA 5JH7B 4DV5B 5FPRA 1HWYA 3K5MA 3APQA 4CC6A 1XNQO 5LHGA 3T4ZA 3SGIA 4X65O 1NZ6A 2ZCEA 2IU3A 1KQSU 3TJTA 1PPJH 1N32B 3U11A 2ZDIC 4Q6GA 4RAIA 3RGBA 1COWG 1OCOC 2JS5A 2Z3YA 1ZSPA 2UUCB 4LF5O 2F4VO 2QR4A 1EN5A 3CCJV 3VOUA 3W7UA 4J41A 3C3TA 2UU9B 2QDOA 1E1QG 2WLIA 1NBMG 2BSKA 4IHJA 4EEQA 3JD2A 2XAHA 3ZMVA 1P7BA 3CRMA 3QTCA 5CBFA 5J2TB 3RT3C 1J5EB 2F95B 5KX5A 1FPOA 2ZE8A 1O9GA 1AP6A 5LBQA 1M56B 2Y4TA 3AG3B 4W4KA 1SQVH 2LO1A 4X9QA 2DOSA 2ETNA 1S3JA 1Y4MA 3F5WC 1W2BU 1QLEC 2M7WA 2IU0A 3H1JH 3RYCB 4LFBO 3CCMV 5JQGA 1GTOA 4JI6B 4GT1A 4TV9B 3P3NA 4PA3A 3CS5A 2AZ0A 1Y76A 5J2UA 1Y74A 3FB6C 4OX9O 4YXWG 2WLIB 4MTOA 2BSKB 3T1HB 2PYLA 4R7CA 3VQVA 1K5QA 2JIZG 4JI2O 3ETEA 3BFRA 1Q43A 1H8EG 2PI5A 5KX5B 2PYJA 1BQ0A 1GMGA 5LL6Y 4LR3A 1IBKO 2W0XA 3LDDA 1XDCA 1WLEA 3UCSC 2ZR2A 4Z2WA 4U3FH 2FKXA 4NTWA 4DR2B 4GUNA 3TCUA 1WNSA 1JX9A 1YJWV 4YHHB 2K1EA 5JQGB 3E35A 5KUKA 3P3PA 3M7MX 1US6A 1G6UA 2V7QG 3GVMA 3GWKC 4FM0A 3JCZA 5J2UB 1Y74B 2YDEA 3CE2A 1T5EA 3CRQA 1K5SA 3EFFK 3U0ZA 3J80N 3IC7A 4N21A 2Q7GA 3A0RA 4TV8A 3K57A 4GCZA 3T1YO 3BABA 4LNUA 1XNQB 4MVZA 3B8NA 1YI2V 3CHXA 2EZOA 3BVOA 2Y69B 3VBBA 4CH4A 1QHTA 4GX5A 3ABLC 5KHJA 2N74A 4X65B 2E3CA 1J95A 2DJVA 5CA0A 1I5YA 4JI8B 3D3QA 3WB2A 3SR2C 3MD0A 3AG4B 3K59A 1IURA 4UCSA 1H2GA 4MW3A 4P9PA 5EBWC 4LF5B 2DYRB 3UM7A 1YXBA 4I0XA 1Q8IA 3JD3A 2F4VB 2DYSC 3HKEA 4MTXA 5C8YA 5EIBC 3C3SA 3RYHA 1KKDA 2Q4PA 4JYCA 4U7NA 1MSDA 2LW7A 4IT5A 4ZKIA 3OE7G 4DO2A 1Q6HA 1XL6A 3TETA 4RUEA 4LNUB 3SPIA 1ZL8A 1OCCB 2Q8VA 1NR1A 2ZR3A 1M90W 1RPRA 2O57A 5IJ9A 4UCOA 4DV4O 4TWKA 2M6YA 3G80A 2P6JA 2WA3A 4X66O 2ZE5A 1YCIA 1QVGU 3MHSC 1N36O 1D5AA 3JALA 3ASOC 5BR8O 4I0XB 1SA0A 2Q67A 1JQ0A 3E22A 5C8YB 1UJWB 2CDYA 4LF8B 2FMLA 3STZC 4PHZA 3B8MA 3RYHB 1VF5B 1M4UA 2JS3A 4B7KA 1OCZC 1ROPA 2WA4A 1BS3A 1CXZB 4DV0B 1VQOV 4J80A 2ZNJA 4PA4A 1HDJA 3I55V 3TXQA 4AI8A 1FXVA 1OV9A 3OR6C 4I55A 1BT8A 4J11A 4DR7O 1ZL8B 1RM1C 4UV8A 4O4LB 1IBKB 4L8JA 4JI0B 4NXMO 2Y0IA 5IJ9B 5BMVA 5LMUB 1I5XA 4ZBMA 4ZHQA 2QWPB 2EULA 1FXKA 2YC0A 5IDJA 4YIPA 4MS2A 1FS0G 2WPDG 3BPZA 4MSWC 2XTAA 2ADPA 1S5HC 3RW0A 3D8CA 2JGUA 3ZMUA 2P7TC 4KHPB 4DR6O 3G6BA 3N2GA 2KB1A 1NJIW 4JYAO 4BWAA 3ZCCA 1GN6A 2QTOA 3E2EA 5B1AB 3E8GA 2UUBB 4I9WA 3ZRSA 3D36C 4LC1A 4U3JA 5CA3A 1QR9A 1NTMH 2Z5UA 2VQEB 3K3WA 4I55B 4WFAV 1AR5A 2R70A 3CRCA 1PP9H 2X6AA 1SQPH 4DK0A 3RBZA 5BMVB 4ICGA 2ZT9B 2OT5A 3CEIA 4X1KA 1TUEB 2VRZA 1FXKB 3OUSA 1F4MA 5JJNB 1W0JG 4TUYA 4FZ0A 4R6ZA 1VQPV 4ZI7A 1XILA 2HJFC 5IYDO 5JVDA 4PA6A 5CMUA 4J9YB 4CS2A 4X1IA 3N2GB 1NTKH 3ABKC 4GZRB 2GDSA 3TXSA 5B66Z 1AJNA 1EBOA 1VQMV 2BTOA 3G71V 3KG2A 4FFKA 1BL8A 2OIEA 1H2NA 3ZMZA 2HP8A 1MZFA 2QM4A 4LP8A 3FYEB 4UV9A 3RN4A 3ZRWA 1P84F 2ZIMA 3H9VA 4U3JB 1DF5A 4K0KO 4FLZA 3E8HA 2ODMA 1OCRC 2AW9A 1PL0A 1VEWA 2B1GA 3M8AA 2QGNA 4DV4B 4AILC 2ATKC 4LF7B 2HVJC 3MAQA 2QKSA 3OW2U 4G28B 1K3EA 4X66B 2L6LA 4X1KB 4B3RO 1KB9F 4DW1A 5E79Z 1N36B 2PTMA 4TUYB 3AG2B 4ZI7B 3K5OA 5FL7G 5JVDB 4DV5O 1Z5WA 2D2CB 3DGEA 3ZN1A 4X1IB 2XHBA 5L3DA 1FYJA 2EIJB 3HKDA 1VF6A 2RDCA 3W7SA 3EVKA 4GX0A 1QVFU 1LUVA 4QIWF 5B3SB 1PD3A 4DR5B 2DE0X 2ZD9A 1K92A 2W6JG 1PV0A 3S3WA 2BE3A 1SQGA 3ETDA 3RFRA 1D5NA 3RVZA 2QA4V 3ETGA 2LFSA 4DR7B 3SYPA 4RWUA 2ILMA 4LCUC 1H2MA 2OTJV 3RYIA 1FFXA 1YVWA 2UU9O 1AJPA 4FLYA 2R9AA 5KHGA 4QJFB 3SPCA 3B2EE 4JI4O 2YXHA 5FNVB 1XOUA 3E8FA 2ZIOA 3OGCC 3VQWA 2QSAA 1PNLA 4DXWA 1KBHA 4MTFA 1BSMA 1WB8A 1G4YB 1I08A 3JD4A 4JYAB 1N33O 4DYLA 1G8MA 5EC2C 1M57B 3KCYA 2G38A 3N2KA 3HKDB 2RCVA 4WBNB 1QNMA 4LWSB 2DW4A 2EIKB 1U96A 5K1XA 3A0HZ 2YIBA 4LH6A 1VQ4V 4XDLA 1WA8B 2WLKA 1S72V 1WB7A 2EINC 1THZA 2V1DA 4UVAA 1K73W 2UXNA 1DTOA 1B06A 2A3QA 1KU9A 1NQTA 1W59A 3RYIB 1FFXB 1H2LA 2WAMA 4O4JB 5EZYA 5AG2A 3QO7A 1R1BA 1K4CC 3K9AA 4PDVA 4K8XA 4J7JA 1L0LH 4CC5A 5LP6A 1JCHA 1SESA 4JI7B 1AI4A 1QR8A 2YIAA 1YHQV 3CMEV 3OMIB 1V54C 3SPHA 4FVMA 3THOA 3N2KB 1H2SB 2EBOA 5BY1A 3J81N 4IYHA 1Q6IA 2ITCC 4CH5A 1K9MW 4WFFA 3FKSG 4K0KB 4ABMA 1Z5VA 2Q73A 1QLNA 4DUYO 2IW5A 5CBHA 1F4NA 1NVPB 4ZOLA 4UB6Z 2Q68A 3ABMC 2WLJA 5EZYB 5JJJB 2X0LA 3ZIAG 4B3RB 3DXRB 3OFNG 3G6EV 2P06A 1KMIZ 2XOKG 1VIBA 4MVUA 2HLDG 2NLJC 4DV1O 3CC2V 3DTUB 3SDLA 2E5LB 3WB0A 2E74B 2FB5A 4PDRA 4JI8O 1MSWD 5CA1A 3ZRXA 1BCCH 1FJGB 5L3BA 1V55B 2UXCB 1HNXO 2PZSA 3BHPA 3UO2A 4LFAO 1AP5A 4CZZA 2QWNB 1S76D 4IL6Z 4FFBA 3JCUZ 4NR1A 4UXNA 3J7AU 2UUAO 4JI4B 4FM1A 1WAZA 5L3CA 1Y66A 1AR4A 1YJNV 4PV1B 4B7EA 2HFEC 4JTDB 4X64O 2OWOA 2BCCH 3X2QC 3OGIB 1XEQA 2A7WA 1N33B 1JMKC 2N05A 4DR3O 2W6IG 1N4CA 3CX5F 1WPBA 1K97A 1I7FA 5CA1B 1YZBA 4KP4A 1A32A 2QM8A 2ZXWC 5IY5B 3OTFA 2YXLA 1E1RG 3HR0A 3KZIZ 1EZVH 2QWOB 3B09A 3JSNA 3CD6V 3SYAA 4FFBB 4LF8O 1SZXA 2H8PC 2N04A 3C90A 3SJAC 3M99B 1WPXA 5GTIZ 2Q5ZA 3A2FA 4IHJB 4DV0O 1SS3A 2YUAA 4O4IA 1N0JA 4QGPA 1GM8A 1SQXH 1YTFD 4HYOA 5B1BB 3L71H 1PKXA 2ZINA 5F2VO 2B1IA 4XDJA 3E83A 2YXYA 4MTGA 4BR6A 5LOVA 4JI0O 1QQCA 5LGTA 2EIMC 5LMUO 2QKAA 3OM3B 3OMNB 1OJHA 4O2BA 2X6BA 3AG1B 3QO8A 3STLC 5KAIZ 4H33A 4DUYB 1JOYA 2JJ2G 4KHPO 3JD1A 3AK3A 1R3IC 2YICA 1Y76B 3E89A 5HFMA 4ZIBA 5BZBA 5EBLC 1AR1B 1VQNV 4X20A 2UUBO 1MA1A 3JD0A 4PI2A 1WP8A 4O4IB 3ZMSA 1GM7A 2VQEO 4WFEA 4I4TA 4DV1B 2BOBC 1ZAUA 2ZDIA 1S77D 2QKCA 5LOVB 4KUMA 1NH2B 2R9RB 3ZS8C 1BMFG 3LSSA 1L1FA 4JAUA 2CK3G 4CBCA 4B3SB 1RPOA 1NTZH 1P4RA 4P30A 4X89A 4YJ3A 5L3EA 4A5UB 4O2BB 5KUMA 5J9PC 2HKOA 1R73A 1HNXB 4O4HA 2Y48A 1K34A 4LFAB 4K3AA 1CPYA 2OYQA 2CAZC 2IBZH 1XL4A 4G27B 1VQKV 3OEEG 2UUAB 2OCCB 5KA5A 3OT7A 4X20B 2FYUH 3ZHQA 1YDXA 3RVYA 2ITDC 4IYIA 2R9IA 4JGSA 2B9ZA 4JTAB 4TV8B 4EB6A 4EFEA 4AQYO 2ZKOA 4X64B 4I7ZB 4I4TB 4IGGA 1L8DA 4LF7O 1H8HG 4DR3B 2DQ3A 4DV3B 1XNRO 2VQFB 4E4EA 1M5IA 5CA0B 3AEIA 1JPXA
chains in the Genus database with same CATH topology
1HR0O 4JI8O 1KUQA 3T1HO 1R6TA 1XMQO 3T1YO 3R66A 4GKKO 4K0KO 2AGAA 1HNZO 3RT3C 1HNXO 4JI7O 4DV6O 1I94O 4LFAO 4LFCO 4DR7O 4DR4O 4LF4O 4KHPO 1DK1A 3M8AA 1IBMO 2N74A 1AILA 4LF6O 4NXMO 2DJVA 3F5TA 1NS1A 4DR1O 3J7AU 2DOSA 2UUAO 4B3MO 1R1BA 2UUBO 4B3RO 4DV2O 4B3SO 1N32O 4DR2O 4DR5O 2UXBO 5BXZA 2JRIA 4YHHO 4LFBO 4OPHA 2UUCO 5FLXN 4JI5O 4X64O 2Z0AA 2VQEO 4DV5O 1XEQA 4JV5O 4DR6O 1IBLO 4NXNO 4JYAO 4X62O 3O65A 1FYJA 1X59A 1F7YA 2LW7A 5BY1A 2HHHO 3J81N 4B3TO 4DR3O 4OX9O 4A5UB 1YZBA 4JI2O 1A32A 1N34O 4JI1O 2UXDO 1XMOO 1G1XB 1D2DA 4DUZO 1J5EO 1AB3A 1XNQO 4DUYO 5IWAO 4LF9O 5LL6Y 1IBKO 4DV4O 4X65O 4LF8O 2UU9O 4JI3O 4DV3O 2VQFO 4X66O 3OTOO 4JI4O 2E5LO 5IT9N 2FKXA 4YY3O 4GKJO 5A2QN 1N36O 4DV0O 4AQYO 1FJGO 4LF5O 5BR8O 2ZKOA 3JAMN 4JI6O 2UXCO 4OPAA 2F4VO 4DV7O 1FKAO 1HNWO 5LMNO 4DV1O 1N33O 4JI0O 2ZM6O 5H5NA 4LF7O 1XNRO 3SDLA 5LMUO 3J80N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 O;  4JI8 O;  1KUQ A;  3T1H O;  1R6T A;  1XMQ O;  3T1Y O;  3R66 A;  4GKK O;  4K0K O;  2AGA A;  1HNZ O;  3RT3 C;  1HNX O;  4JI7 O;  4DV6 O;  1I94 O;  4LFA O;  4LFC O;  4DR7 O;  4DR4 O;  4LF4 O;  4KHP O;  1DK1 A;  3M8A A;  1IBM O;  2N74 A;  1AIL A;  4LF6 O;  4NXM O;  2DJV A;  3F5T A;  1NS1 A;  4DR1 O;  3J7A U;  2DOS A;  2UUA O;  4B3M O;  1R1B A;  2UUB O;  4B3R O;  4DV2 O;  4B3S O;  1N32 O;  4DR2 O;  4DR5 O;  2UXB O;  5BXZ A;  2JRI A;  4YHH O;  4LFB O;  4OPH A;  2UUC O;  5FLX N;  4JI5 O;  4X64 O;  2Z0A A;  2VQE O;  4DV5 O;  1XEQ A;  4JV5 O;  4DR6 O;  1IBL O;  4NXN O;  4JYA O;  4X62 O;  3O65 A;  1FYJ A;  1X59 A;  1F7Y A;  2LW7 A;  5BY1 A;  2HHH O;  3J81 N;  4B3T O;  4DR3 O;  4OX9 O;  4A5U B;  1YZB A;  4JI2 O;  1A32 A;  1N34 O;  4JI1 O;  2UXD O;  1XMO O;  1G1X B;  1D2D A;  4DUZ O;  1J5E O;  1AB3 A;  1XNQ O;  4DUY O;  5IWA O;  4LF9 O;  5LL6 Y;  1IBK O;  4DV4 O;  4X65 O;  4LF8 O;  2UU9 O;  4JI3 O;  4DV3 O;  2VQF O;  4X66 O;  3OTO O;  4JI4 O;  2E5L O;  5IT9 N;  2FKX A;  4YY3 O;  4GKJ O;  5A2Q N;  1N36 O;  4DV0 O;  4AQY O;  1FJG O;  4LF5 O;  5BR8 O;  2ZKO A;  3JAM N;  4JI6 O;  2UXC O;  4OPA A;  2F4V O;  4DV7 O;  1FKA O;  1HNW O;  5LMN O;  4DV1 O;  1N33 O;  4JI0 O;  2ZM6 O;  5H5N A;  4LF7 O;  1XNR O;  3SDL A;  5LMU O;  3J80 N; 
#chains in the Genus database with same CATH topology
 4YJ3 B;  3O9O A;  2EIJ C;  2F66 C;  1KUQ A;  4K35 A;  2Q6A A;  1Q3E A;  1R6T A;  2HR3 A;  1LR1 A;  5B3S C;  4P9O A;  4QPK A;  1KC8 W;  1FXH A;  2OIG A;  4O4H B;  3ZX6 A;  4X8A A;  1K33 A;  1R3K C;  3HKE B;  1EFR G;  1BZK A;  5LYJ A;  2XAQ A;  3F5T A;  5JJE B;  1I0H A;  1M9N A;  1Q90 D;  2B5U A;  3JAR A;  2P4V A;  1FD9 A;  1XMQ B;  3ZHR A;  4DR5 O;  2RNB A;  4OPH A;  4H44 B;  3FB8 C;  4WFG A;  2QM7 A;  4LFC B;  1DGS A;  2FTK A;  4FJC C;  3K5L A;  2H3O A;  1EZJ A;  4X62 O;  2XAJ A;  3BA9 A;  3AK1 A;  1QLE B;  4B3M B;  1WJZ A;  3H1I H;  4C7U A;  4UVB A;  2GHY A;  2HVK C;  4P2Z A;  3HB3 B;  4R8C A;  1KKC A;  3LDE A;  3QF7 A;  3SJQ C;  3K04 A;  3JAL B;  2CGO A;  2PGG A;  5LXT A;  4FLX A;  5IWA O;  4NTY A;  1SA0 B;  3E22 B;  2EIL C;  5DEC A;  5LYJ B;  4HBN A;  2YEV A;  2EZP A;  1Q86 W;  4UCT A;  3JAR B;  1N34 B;  3RYF A;  1ZX3 A;  5LHI A;  3NXS A;  4F6R A;  3WB1 A;  4NVP A;  5LHH A;  4OPA A;  5GTH Z;  1GRJ A;  1KP3 A;  4YJ2 A;  1YEW A;  1FKA O;  2AHY A;  2RJZ A;  2BTQ A;  3ABU A;  3CCL V;  2ZM6 O;  5H5N A;  3LNM B;  1URF A;  4G2K A;  1VQ9 V;  2A0L A;  4ZHQ B;  4YY3 B;  4FLV A;  1OZ0 A;  3ZN0 A;  1XHX A;  3E86 A;  3WG7 C;  2Q69 A;  2YI9 A;  2CUG A;  3K06 A;  2A06 H;  4FM2 A;  4JI7 O;  5KAF Z;  4FZ1 A;  1VQ5 V;  4TQF A;  2YIB D;  1XRE A;  2YSU B;  4U7O A;  1ENV A;  3CRR A;  2YEV B;  3HKB A;  4DV2 O;  4RO2 A;  4DK1 A;  3RYF B;  1R3L C;  4AQY B;  2JRI A;  2IJJ A;  1Q5O A;  4F6R B;  1NVP D;  2P4K A;  3ABL B;  2LGW A;  2Z0A A;  4H0L B;  2AZ2 A;  4YJ2 B;  3B4S A;  4FK5 C;  1DLB A;  2LQT A;  2BTQ B;  4QE9 A;  3ZED A;  2AHZ A;  1XNR B;  1IZ3 A;  2GV9 A;  4Z1V A;  4TT3 G;  4WFH A;  2DYS B;  2ARH A;  4L87 A;  5EC1 C;  3TGU H;  2XT9 A;  1XMO O;  4DUZ O;  1AB3 A;  3A8T A;  4FPP A;  2WLH A;  3CCV V;  4J7K A;  4NKG B;  3KCX A;  5C93 A;  4LH7 A;  2DMX A;  2VWK A;  1B3Q A;  2YI8 A;  2D3O W;  4R50 A;  2E5L O;  3HKB B;  4K8Z A;  4AHC A;  3W7T A;  3W7W A;  5D5P A;  2EJ7 A;  3L73 H;  3K08 A;  3ZRW B;  1Q81 W;  1FJG O;  4PI0 A;  5IYZ A;  2UXC O;  2CH7 A;  3BY6 A;  3FB7 C;  4BIZ A;  1Z2G A;  4X62 B;  4UB8 Z;  1FAF A;  3JSL A;  1SZT A;  2VWJ A;  1M56 C;  3AG3 C;  4BW9 A;  2QE7 G;  3ASO B;  1YJ9 V;  2AXT Z;  3ZJZ A;  2LFR A;  5IYC O;  2CGN A;  3FFQ A;  3R66 A;  1KD1 W;  4FLT A;  1SF9 A;  3T1C A;  4N23 A;  5IWA B;  5IY5 C;  4F4L A;  4D7T A;  4B08 A;  4WCE V;  1VMG A;  3Q4H A;  3D36 A;  1NS1 A;  4DR1 O;  5DED A;  3GB7 C;  3DC5 A;  3BA8 A;  5BXZ A;  4RQF A;  3ABT A;  5FLX N;  3LUT B;  1PNK A;  3FB5 C;  2KG7 A;  2H94 A;  5EBM C;  2MW2 B;  3ZRV A;  3H01 A;  1GM9 A;  2ZM6 B;  2VS0 A;  4MVQ A;  5LGN A;  1XI1 A;  3T4D A;  2UXX A;  4J10 A;  1XUQ A;  2JEU A;  3CCQ V;  2UXD O;  2Q0A A;  5KHK A;  2Q7H A;  2RN9 A;  1Q6U A;  1YIJ V;  4NXN B;  1PL4 A;  3QNE A;  5B5E Z;  4PA9 A;  3D3I A;  4EFB A;  3DC6 A;  5EYP A;  1U97 A;  3Q4H B;  1RSO A;  2IJK A;  4HNA A;  2PY5 A;  1GN3 A;  4DV2 B;  3UKM A;  5L3F A;  2F93 B;  4J9Z B;  4I9Q A;  3K0G A;  5JH7 A;  2LGQ A;  2E76 B;  4DRX A;  2KG7 B;  3IAY A;  4DV7 O;  3QG5 A;  5LMN O;  1Y6X A;  3CB2 A;  1X4T A;  1K7D A;  2KQX A;  2Y69 C;  1MAB G;  1B6Q A;  5GON A;  1HR0 O;  3K58 A;  1EN4 A;  3CPW U;  2HG5 C;  1IXB A;  5DN6 G;  1XMO B;  3FAV A;  2AGA A;  1XQ8 A;  5LP6 B;  4DUZ B;  3AG4 C;  1GO3 F;  3L75 H;  1SQQ H;  4LF4 O;  3EXA A;  4FMT A;  2DYR C;  1AIL A;  3R65 A;  2RMK B;  5EYP B;  2ZE7 A;  1RSO B;  4HNA B;  5H9C A;  2P90 A;  4B3S O;  3CRA A;  2Y0P A;  1OCR B;  4GKK B;  1VQ7 V;  2XAG A;  4DRX B;  5FPO A;  2DWE C;  4HZ3 A;  1TA8 A;  1BHB A;  1RP3 B;  3UT5 A;  3CWB H;  3OD4 A;  4JAV A;  4MVS A;  1TGO A;  3SYC A;  4ZOL B;  4JTC B;  4FLW A;  1SER A;  1OCC C;  5JCO A;  1P7G A;  3CXC U;  5GON B;  2NN4 A;  4WFB V;  3ETQ A;  1GAX A;  2UXB B;  3RYC A;  1JFF A;  3FAV B;  3B77 A;  1G1X B;  4TV9 A;  3L9D A;  5EK0 A;  1M1K W;  1PM9 A;  3CP1 A;  4MVR A;  2XAS A;  3OAA G;  2F1M A;  3S3X A;  4Z1M G;  2HHH B;  1QBZ A;  4DR1 B;  2XUM A;  4DV3 O;  2VQF O;  5H6Q A;  5A2Q N;  1M93 A;  1VQ8 V;  5IYB O;  1VQL V;  2RQ6 A;  3A0B Z;  1MMM A;  3JAS A;  1RFY A;  3JAM N;  4UCU A;  4HAM A;  1JVM A;  4XBF A;  3UT5 B;  2CTQ A;  4PA7 A;  1NU1 H;  1WN7 A;  2NR5 A;  3ASN B;  2BOC C;  2DQ0 A;  4E2L A;  3ZHT A;  1B04 A;  3JAT A;  2UXD B;  1XMQ O;  1Y67 A;  3JAK A;  4KXR A;  5ITZ A;  1Q7Y W;  1JFF B;  1UFI A;  3RWR D;  4I5S A;  1I94 O;  4CS4 A;  4LFC O;  2Q9L A;  2P5O A;  1MZE A;  2P22 C;  1GKF A;  3FD9 A;  1R6N A;  2E75 B;  4B3M O;  1QU7 A;  3G67 A;  4JAA A;  4TOI A;  1BHA A;  3I56 V;  2EIN B;  4X1Y A;  4OGQ B;  5D5Q A;  3I5D A;  5B1A C;  5CN0 A;  3P30 A;  1P49 A;  2F43 G;  3SYO A;  3JAS B;  4BAY A;  3JAW A;  4DV7 B;  3K0D A;  4H13 B;  5LMN B;  3EHB B;  1S0V A;  2XAF A;  3CC7 V;  2JGD A;  3O65 A;  5KHI A;  1F23 A;  4JZG A;  2JDI G;  2QJ1 A;  1HR0 B;  1OHH G;  2IM9 A;  1TAE A;  1HW7 A;  3JAT B;  1N34 O;  4JI1 O;  1V54 B;  3JAK B;  1FXK C;  5ITZ B;  4LF4 B;  1LUW A;  4LF9 O;  5LGU A;  1V9P A;  1VAR A;  3CMA V;  1KEC A;  1PNM A;  2LW1 A;  4IIJ A;  3MHH C;  5IT9 N;  4RQE A;  4YY3 O;  4GKJ O;  4O2A A;  2PF4 E;  4X1Y B;  1GN2 A;  3K5N A;  5HFL A;  4D7S A;  2GTA A;  4PDL A;  4JPR A;  2CTP A;  3ABM B;  3JAW B;  3OR7 C;  1HNW O;  4ASU G;  2GSM B;  3F7Y C;  4MVO A;  1VQ6 V;  1W0K G;  2JGD B;  2XND G;  3QVN A;  1DF4 A;  1F51 A;  4Q20 A;  4PEL A;  1AI7 A;  4KFM A;  3HPL C;  3UQ8 A;  1BE3 H;  4H37 A;  1MG1 A;  1KP2 A;  4DV6 O;  3AG2 C;  1KYO F;  5E1A C;  2W0F C;  4DR4 O;  2WLL A;  1IBM O;  2JVD A;  4JYB A;  2OTL V;  4JAS A;  1OCO B;  3ZHV A;  3IC9 A;  4TQD A;  4IIJ B;  5EIB D;  4UUJ C;  4MVM A;  4O2A B;  4QPJ A;  4J7Z A;  5LA6 A;  1JR9 A;  1IDS A;  2EX3 A;  2QEX V;  3UO3 A;  3N27 A;  4JI5 O;  2A79 B;  1ZTE A;  4O4L A;  2C2A A;  4W4L A;  3IJ4 A;  3KKY A;  1X59 A;  3W7X A;  3CJH A;  4B3T O;  3IGA C;  1K8A W;  4JYY A;  2Y4U A;  1H2K A;  3X2Q B;  4LFB B;  5JWP A;  2GTS A;  4GYC B;  4EB6 B;  3ZHS A;  1I94 B;  1NT2 B;  2WLL B;  3MDS A;  3G4S V;  1Q82 W;  4OX9 B;  3H1K H;  4JI3 O;  2ZXW B;  3OTO O;  1M57 C;  4YIO A;  4JI2 B;  1VF6 C;  4LBE C;  2EIK C;  2X7R B;  5LA6 B;  1S5J A;  2HEP A;  3DSQ A;  4F6E A;  3FX7 A;  1LNQ A;  3OMA B;  5GW7 A;  4CS3 A;  5KLV H;  1AI6 A;  3BEH A;  3WFV A;  1JJ2 U;  1SRY A;  4UCR A;  1YTF B;  3CCE V;  3CJH B;  3CCR V;  1NI8 A;  4GX2 A;  3F7V C;  5B1O A;  1GN4 A;  4JI1 B;  5CBG A;  1HNZ O;  1L0N H;  4NB5 A;  1CP9 A;  2ZQM A;  5H2F Z;  2EIM B;  4LF9 B;  2OCH A;  1DK1 A;  4CH6 A;  4LF6 O;  4MW8 A;  1SQF A;  5K1P A;  2LP7 A;  2V4D A;  3H1H H;  3T2M A;  4GKJ B;  4X88 A;  3T1Y B;  2WLM A;  5H6R A;  3CYO A;  1S5L Z;  1QCE A;  5LXT B;  2KKW A;  4BIU A;  1HNW B;  4JV5 O;  1IBL O;  4NXN O;  2WWW A;  3CXH F;  1ZUQ A;  2IH1 C;  3ZHU A;  5IJ0 A;  3P32 A;  1F7Y A;  5IE9 A;  2NNU A;  3NR7 A;  3SPG A;  2CE4 A;  3PN1 A;  2F23 A;  4JZ2 A;  3CC4 V;  4BW5 A;  4QE7 A;  1K4D C;  2IJH A;  2WSS G;  1N8R W;  4PJ0 Z;  3K9S A;  4WF9 V;  4DV6 B;  4DR4 B;  5LP6 C;  1IBM B;  1MOF A;  2WLN A;  4MT8 A;  3ZMT A;  2A9H A;  2HJD A;  3ICX A;  4NYK A;  3WU2 Z;  2QWR B;  4UFZ A;  3K79 A;  2FL4 A;  3BRC A;  4JI5 B;  3OUF A;  1ZWI C;  1JA8 A;  5DM6 V;  1R3J C;  1V55 C;  1YIT V;  1WP7 A;  1E79 G;  4GLX A;  1SET A;  1BQZ A;  1TVK A;  1O9H A;  2QTS A;  5IJ0 B;  4B3T B;  3K03 A;  5FNV A;  1AVM A;  3AK2 A;  2GUZ A;  5KA6 A;  2LJ2 A;  2CTR A;  5CB4 A;  5L3G A;  5BR8 B;  1BGY H;  4GKK O;  1FFT B;  3BCC H;  2ADQ B;  1XHZ A;  1MNG A;  1IX9 A;  1R6K A;  5A9G A;  4RUF A;  5B1N A;  4XDK A;  2CTW A;  4I50 A;  4WBN A;  4LWS A;  3L70 H;  1TUB A;  2IH3 C;  4JI3 B;  1GH6 A;  3OTO B;  2YS8 A;  3FYI B;  4FLU A;  1N32 O;  3TK1 A;  1WA8 A;  1ARO P;  2UXB O;  3SPJ A;  2UUC O;  4BIO A;  1OCZ B;  4NXM B;  2DN9 A;  3E8B A;  2K9P A;  4O4J A;  4UVC A;  1TVK B;  1XBL A;  2ZNI A;  4J42 A;  2HHH O;  2GUZ B;  5KHH A;  3SJC C;  2IJI A;  1AJQ A;  2MK3 A;  1EN6 A;  5KMG A;  3L74 H;  3AG7 A;  3ASN C;  2Q0O C;  5CB4 B;  5JCO C;  3CCS V;  1HNZ B;  2JEX A;  1RM1 B;  1D2D A;  1YSC A;  2P67 A;  5IYZ B;  2ZE6 A;  1J5E O;  4DR6 B;  1VF7 A;  1EM1 A;  2QWQ B;  2CH7 B;  3LSU A;  2X6C A;  2DWD C;  3APO A;  4LF6 B;  4I50 B;  3SJB C;  3CCU V;  1GK9 A;  5B1B C;  1TUB B;  1IVS A;  1HP8 A;  3BAA A;  3VQX A;  3H1L H;  2YID A;  3B40 A;  1IXM A;  3GWO A;  4JF3 A;  4QNH B;  4JI6 O;  1UPG A;  4JV5 B;  2EIL B;  3IFX A;  3LDC A;  1IBL B;  1AI5 A;  3AG1 C;  2PUS A;  4CH3 A;  3VQY A;  4GX1 A;  3PJS K;  2PI4 A;  1N0N A;  4TSF G;  3L72 H;  1H38 A;  3DXR A;  3HKC A;  2GBO A;  3ML0 A;  3T1H O;  4FIP C;  1CEZ A;  1SQB H;  5KMG B;  2Q7E A;  1VP7 A;  2JJ1 G;  4EKW A;  2JK5 C;  3QO5 A;  3CSX A;  4OXS A;  3JYC A;  1YF2 A;  1JJO A;  1SC5 B;  3WG7 B;  1NR7 A;  1NKD A;  3ZBH A;  4DR2 O;  3SYQ A;  2EJR A;  4YHH O;  3LSQ A;  2R72 A;  4UCV A;  1ZLZ A;  1SKV A;  3ABK B;  2L35 A;  1NH2 D;  4KL1 A;  4NTX A;  3U10 A;  1ORQ C;  3LNN A;  3OEH G;  3HKC B;  5TIS Z;  4PD4 F;  4PDM A;  4DW0 A;  2KSD A;  2OCC C;  4D6T H;  5J2T A;  5JH7 B;  4DV5 B;  5FPR A;  1HWY A;  3K5M A;  3APQ A;  4CC6 A;  1XNQ O;  5LHG A;  3T4Z A;  3SGI A;  4X65 O;  1NZ6 A;  2ZCE A;  2IU3 A;  1KQS U;  3TJT A;  1PPJ H;  1N32 B;  3U11 A;  2ZDI C;  4Q6G A;  4RAI A;  3RGB A;  1COW G;  1OCO C;  2JS5 A;  2Z3Y A;  1ZSP A;  2UUC B;  4LF5 O;  2F4V O;  2QR4 A;  1EN5 A;  3CCJ V;  3VOU A;  3W7U A;  4J41 A;  3C3T A;  2UU9 B;  2QDO A;  1E1Q G;  2WLI A;  1NBM G;  2BSK A;  4IHJ A;  4EEQ A;  3JD2 A;  2XAH A;  3ZMV A;  1P7B A;  3CRM A;  3QTC A;  5CBF A;  5J2T B;  3RT3 C;  1J5E B;  2F95 B;  5KX5 A;  1FPO A;  2ZE8 A;  1O9G A;  1AP6 A;  5LBQ A;  1M56 B;  2Y4T A;  3AG3 B;  4W4K A;  1SQV H;  2LO1 A;  4X9Q A;  2DOS A;  2ETN A;  1S3J A;  1Y4M A;  3F5W C;  1W2B U;  1QLE C;  2M7W A;  2IU0 A;  3H1J H;  3RYC B;  4LFB O;  3CCM V;  5JQG A;  1GTO A;  4JI6 B;  4GT1 A;  4TV9 B;  3P3N A;  4PA3 A;  3CS5 A;  2AZ0 A;  1Y76 A;  5J2U A;  1Y74 A;  3FB6 C;  4OX9 O;  4YXW G;  2WLI B;  4MTO A;  2BSK B;  3T1H B;  2PYL A;  4R7C A;  3VQV A;  1K5Q A;  2JIZ G;  4JI2 O;  3ETE A;  3BFR A;  1Q43 A;  1H8E G;  2PI5 A;  5KX5 B;  2PYJ A;  1BQ0 A;  1GMG A;  5LL6 Y;  4LR3 A;  1IBK O;  2W0X A;  3LDD A;  1XDC A;  1WLE A;  3UCS C;  2ZR2 A;  4Z2W A;  4U3F H;  2FKX A;  4NTW A;  4DR2 B;  4GUN A;  3TCU A;  1WNS A;  1JX9 A;  1YJW V;  4YHH B;  2K1E A;  5JQG B;  3E35 A;  5KUK A;  3P3P A;  3M7M X;  1US6 A;  1G6U A;  2V7Q G;  3GVM A;  3GWK C;  4FM0 A;  3JCZ A;  5J2U B;  1Y74 B;  2YDE A;  3CE2 A;  1T5E A;  3CRQ A;  1K5S A;  3EFF K;  3U0Z A;  3J80 N;  3IC7 A;  4N21 A;  2Q7G A;  3A0R A;  4TV8 A;  3K57 A;  4GCZ A;  3T1Y O;  3BAB A;  4LNU A;  1XNQ B;  4MVZ A;  3B8N A;  1YI2 V;  3CHX A;  2EZO A;  3BVO A;  2Y69 B;  3VBB A;  4CH4 A;  1QHT A;  4GX5 A;  3ABL C;  5KHJ A;  2N74 A;  4X65 B;  2E3C A;  1J95 A;  2DJV A;  5CA0 A;  1I5Y A;  4JI8 B;  3D3Q A;  3WB2 A;  3SR2 C;  3MD0 A;  3AG4 B;  3K59 A;  1IUR A;  4UCS A;  1H2G A;  4MW3 A;  4P9P A;  5EBW C;  4LF5 B;  2DYR B;  3UM7 A;  1YXB A;  4I0X A;  1Q8I A;  3JD3 A;  2F4V B;  2DYS C;  3HKE A;  4MTX A;  5C8Y A;  5EIB C;  3C3S A;  3RYH A;  1KKD A;  2Q4P A;  4JYC A;  4U7N A;  1MSD A;  2LW7 A;  4IT5 A;  4ZKI A;  3OE7 G;  4DO2 A;  1Q6H A;  1XL6 A;  3TET A;  4RUE A;  4LNU B;  3SPI A;  1ZL8 A;  1OCC B;  2Q8V A;  1NR1 A;  2ZR3 A;  1M90 W;  1RPR A;  2O57 A;  5IJ9 A;  4UCO A;  4DV4 O;  4TWK A;  2M6Y A;  3G80 A;  2P6J A;  2WA3 A;  4X66 O;  2ZE5 A;  1YCI A;  1QVG U;  3MHS C;  1N36 O;  1D5A A;  3JAL A;  3ASO C;  5BR8 O;  4I0X B;  1SA0 A;  2Q67 A;  1JQ0 A;  3E22 A;  5C8Y B;  1UJW B;  2CDY A;  4LF8 B;  2FML A;  3STZ C;  4PHZ A;  3B8M A;  3RYH B;  1VF5 B;  1M4U A;  2JS3 A;  4B7K A;  1OCZ C;  1ROP A;  2WA4 A;  1BS3 A;  1CXZ B;  4DV0 B;  1VQO V;  4J80 A;  2ZNJ A;  4PA4 A;  1HDJ A;  3I55 V;  3TXQ A;  4AI8 A;  1FXV A;  1OV9 A;  3OR6 C;  4I55 A;  1BT8 A;  4J11 A;  4DR7 O;  1ZL8 B;  1RM1 C;  4UV8 A;  4O4L B;  1IBK B;  4L8J A;  4JI0 B;  4NXM O;  2Y0I A;  5IJ9 B;  5BMV A;  5LMU B;  1I5X A;  4ZBM A;  4ZHQ A;  2QWP B;  2EUL A;  1FXK A;  2YC0 A;  5IDJ A;  4YIP A;  4MS2 A;  1FS0 G;  2WPD G;  3BPZ A;  4MSW C;  2XTA A;  2ADP A;  1S5H C;  3RW0 A;  3D8C A;  2JGU A;  3ZMU A;  2P7T C;  4KHP B;  4DR6 O;  3G6B A;  3N2G A;  2KB1 A;  1NJI W;  4JYA O;  4BWA A;  3ZCC A;  1GN6 A;  2QTO A;  3E2E A;  5B1A B;  3E8G A;  2UUB B;  4I9W A;  3ZRS A;  3D36 C;  4LC1 A;  4U3J A;  5CA3 A;  1QR9 A;  1NTM H;  2Z5U A;  2VQE B;  3K3W A;  4I55 B;  4WFA V;  1AR5 A;  2R70 A;  3CRC A;  1PP9 H;  2X6A A;  1SQP H;  4DK0 A;  3RBZ A;  5BMV B;  4ICG A;  2ZT9 B;  2OT5 A;  3CEI A;  4X1K A;  1TUE B;  2VRZ A;  1FXK B;  3OUS A;  1F4M A;  5JJN B;  1W0J G;  4TUY A;  4FZ0 A;  4R6Z A;  1VQP V;  4ZI7 A;  1XIL A;  2HJF C;  5IYD O;  5JVD A;  4PA6 A;  5CMU A;  4J9Y B;  4CS2 A;  4X1I A;  3N2G B;  1NTK H;  3ABK C;  4GZR B;  2GDS A;  3TXS A;  5B66 Z;  1AJN A;  1EBO A;  1VQM V;  2BTO A;  3G71 V;  3KG2 A;  4FFK A;  1BL8 A;  2OIE A;  1H2N A;  3ZMZ A;  2HP8 A;  1MZF A;  2QM4 A;  4LP8 A;  3FYE B;  4UV9 A;  3RN4 A;  3ZRW A;  1P84 F;  2ZIM A;  3H9V A;  4U3J B;  1DF5 A;  4K0K O;  4FLZ A;  3E8H A;  2ODM A;  1OCR C;  2AW9 A;  1PL0 A;  1VEW A;  2B1G A;  3M8A A;  2QGN A;  4DV4 B;  4AIL C;  2ATK C;  4LF7 B;  2HVJ C;  3MAQ A;  2QKS A;  3OW2 U;  4G28 B;  1K3E A;  4X66 B;  2L6L A;  4X1K B;  4B3R O;  1KB9 F;  4DW1 A;  5E79 Z;  1N36 B;  2PTM A;  4TUY B;  3AG2 B;  4ZI7 B;  3K5O A;  5FL7 G;  5JVD B;  4DV5 O;  1Z5W A;  2D2C B;  3DGE A;  3ZN1 A;  4X1I B;  2XHB A;  5L3D A;  1FYJ A;  2EIJ B;  3HKD A;  1VF6 A;  2RDC A;  3W7S A;  3EVK A;  4GX0 A;  1QVF U;  1LUV A;  4QIW F;  5B3S B;  1PD3 A;  4DR5 B;  2DE0 X;  2ZD9 A;  1K92 A;  2W6J G;  1PV0 A;  3S3W A;  2BE3 A;  1SQG A;  3ETD A;  3RFR A;  1D5N A;  3RVZ A;  2QA4 V;  3ETG A;  2LFS A;  4DR7 B;  3SYP A;  4RWU A;  2ILM A;  4LCU C;  1H2M A;  2OTJ V;  3RYI A;  1FFX A;  1YVW A;  2UU9 O;  1AJP A;  4FLY A;  2R9A A;  5KHG A;  4QJF B;  3SPC A;  3B2E E;  4JI4 O;  2YXH A;  5FNV B;  1XOU A;  3E8F A;  2ZIO A;  3OGC C;  3VQW A;  2QSA A;  1PNL A;  4DXW A;  1KBH A;  4MTF A;  1BSM A;  1WB8 A;  1G4Y B;  1I08 A;  3JD4 A;  4JYA B;  1N33 O;  4DYL A;  1G8M A;  5EC2 C;  1M57 B;  3KCY A;  2G38 A;  3N2K A;  3HKD B;  2RCV A;  4WBN B;  1QNM A;  4LWS B;  2DW4 A;  2EIK B;  1U96 A;  5K1X A;  3A0H Z;  2YIB A;  4LH6 A;  1VQ4 V;  4XDL A;  1WA8 B;  2WLK A;  1S72 V;  1WB7 A;  2EIN C;  1THZ A;  2V1D A;  4UVA A;  1K73 W;  2UXN A;  1DTO A;  1B06 A;  2A3Q A;  1KU9 A;  1NQT A;  1W59 A;  3RYI B;  1FFX B;  1H2L A;  2WAM A;  4O4J B;  5EZY A;  5AG2 A;  3QO7 A;  1R1B A;  1K4C C;  3K9A A;  4PDV A;  4K8X A;  4J7J A;  1L0L H;  4CC5 A;  5LP6 A;  1JCH A;  1SES A;  4JI7 B;  1AI4 A;  1QR8 A;  2YIA A;  1YHQ V;  3CME V;  3OMI B;  1V54 C;  3SPH A;  4FVM A;  3THO A;  3N2K B;  1H2S B;  2EBO A;  5BY1 A;  3J81 N;  4IYH A;  1Q6I A;  2ITC C;  4CH5 A;  1K9M W;  4WFF A;  3FKS G;  4K0K B;  4ABM A;  1Z5V A;  2Q73 A;  1QLN A;  4DUY O;  2IW5 A;  5CBH A;  1F4N A;  1NVP B;  4ZOL A;  4UB6 Z;  2Q68 A;  3ABM C;  2WLJ A;  5EZY B;  5JJJ B;  2X0L A;  3ZIA G;  4B3R B;  3DXR B;  3OFN G;  3G6E V;  2P06 A;  1KMI Z;  2XOK G;  1VIB A;  4MVU A;  2HLD G;  2NLJ C;  4DV1 O;  3CC2 V;  3DTU B;  3SDL A;  2E5L B;  3WB0 A;  2E74 B;  2FB5 A;  4PDR A;  4JI8 O;  1MSW D;  5CA1 A;  3ZRX A;  1BCC H;  1FJG B;  5L3B A;  1V55 B;  2UXC B;  1HNX O;  2PZS A;  3BHP A;  3UO2 A;  4LFA O;  1AP5 A;  4CZZ A;  2QWN B;  1S76 D;  4IL6 Z;  4FFB A;  3JCU Z;  4NR1 A;  4UXN A;  3J7A U;  2UUA O;  4JI4 B;  4FM1 A;  1WAZ A;  5L3C A;  1Y66 A;  1AR4 A;  1YJN V;  4PV1 B;  4B7E A;  2HFE C;  4JTD B;  4X64 O;  2OWO A;  2BCC H;  3X2Q C;  3OGI B;  1XEQ A;  2A7W A;  1N33 B;  1JMK C;  2N05 A;  4DR3 O;  2W6I G;  1N4C A;  3CX5 F;  1WPB A;  1K97 A;  1I7F A;  5CA1 B;  1YZB A;  4KP4 A;  1A32 A;  2QM8 A;  2ZXW C;  5IY5 B;  3OTF A;  2YXL A;  1E1R G;  3HR0 A;  3KZI Z;  1EZV H;  2QWO B;  3B09 A;  3JSN A;  3CD6 V;  3SYA A;  4FFB B;  4LF8 O;  1SZX A;  2H8P C;  2N04 A;  3C90 A;  3SJA C;  3M99 B;  1WPX A;  5GTI Z;  2Q5Z A;  3A2F A;  4IHJ B;  4DV0 O;  1SS3 A;  2YUA A;  4O4I A;  1N0J A;  4QGP A;  1GM8 A;  1SQX H;  1YTF D;  4HYO A;  5B1B B;  3L71 H;  1PKX A;  2ZIN A;  5F2V O;  2B1I A;  4XDJ A;  3E83 A;  2YXY A;  4MTG A;  4BR6 A;  5LOV A;  4JI0 O;  1QQC A;  5LGT A;  2EIM C;  5LMU O;  2QKA A;  3OM3 B;  3OMN B;  1OJH A;  4O2B A;  2X6B A;  3AG1 B;  3QO8 A;  3STL C;  5KAI Z;  4H33 A;  4DUY B;  1JOY A;  2JJ2 G;  4KHP O;  3JD1 A;  3AK3 A;  1R3I C;  2YIC A;  1Y76 B;  3E89 A;  5HFM A;  4ZIB A;  5BZB A;  5EBL C;  1AR1 B;  1VQN V;  4X20 A;  2UUB O;  1MA1 A;  3JD0 A;  4PI2 A;  1WP8 A;  4O4I B;  3ZMS A;  1GM7 A;  2VQE O;  4WFE A;  4I4T A;  4DV1 B;  2BOB C;  1ZAU A;  2ZDI A;  1S77 D;  2QKC A;  5LOV B;  4KUM A;  1NH2 B;  2R9R B;  3ZS8 C;  1BMF G;  3LSS A;  1L1F A;  4JAU A;  2CK3 G;  4CBC A;  4B3S B;  1RPO A;  1NTZ H;  1P4R A;  4P30 A;  4X89 A;  4YJ3 A;  5L3E A;  4A5U B;  4O2B B;  5KUM A;  5J9P C;  2HKO A;  1R73 A;  1HNX B;  4O4H A;  2Y48 A;  1K34 A;  4LFA B;  4K3A A;  1CPY A;  2OYQ A;  2CAZ C;  2IBZ H;  1XL4 A;  4G27 B;  1VQK V;  3OEE G;  2UUA B;  2OCC B;  5KA5 A;  3OT7 A;  4X20 B;  2FYU H;  3ZHQ A;  1YDX A;  3RVY A;  2ITD C;  4IYI A;  2R9I A;  4JGS A;  2B9Z A;  4JTA B;  4TV8 B;  4EB6 A;  4EFE A;  4AQY O;  2ZKO A;  4X64 B;  4I7Z B;  4I4T B;  4IGG A;  1L8D A;  4LF7 O;  1H8H G;  4DR3 B;  2DQ3 A;  4DV3 B;  1XNR O;  2VQF B;  4E4E A;  1M5I A;  5CA0 B;  3AEI A;  1JPX A; 
#chains in the Genus database with same CATH homology
 1HR0 O;  4JI8 O;  1KUQ A;  3T1H O;  1R6T A;  1XMQ O;  3T1Y O;  3R66 A;  4GKK O;  4K0K O;  2AGA A;  1HNZ O;  3RT3 C;  1HNX O;  4JI7 O;  4DV6 O;  1I94 O;  4LFA O;  4LFC O;  4DR7 O;  4DR4 O;  4LF4 O;  4KHP O;  1DK1 A;  3M8A A;  1IBM O;  2N74 A;  1AIL A;  4LF6 O;  4NXM O;  2DJV A;  3F5T A;  1NS1 A;  4DR1 O;  3J7A U;  2DOS A;  2UUA O;  4B3M O;  1R1B A;  2UUB O;  4B3R O;  4DV2 O;  4B3S O;  1N32 O;  4DR2 O;  4DR5 O;  2UXB O;  5BXZ A;  2JRI A;  4YHH O;  4LFB O;  4OPH A;  2UUC O;  5FLX N;  4JI5 O;  4X64 O;  2Z0A A;  2VQE O;  4DV5 O;  1XEQ A;  4JV5 O;  4DR6 O;  1IBL O;  4NXN O;  4JYA O;  4X62 O;  3O65 A;  1FYJ A;  1X59 A;  1F7Y A;  2LW7 A;  5BY1 A;  2HHH O;  3J81 N;  4B3T O;  4DR3 O;  4OX9 O;  4A5U B;  1YZB A;  4JI2 O;  1A32 A;  1N34 O;  4JI1 O;  2UXD O;  1XMO O;  1G1X B;  1D2D A;  4DUZ O;  1J5E O;  1AB3 A;  1XNQ O;  4DUY O;  5IWA O;  4LF9 O;  5LL6 Y;  1IBK O;  4DV4 O;  4X65 O;  4LF8 O;  2UU9 O;  4JI3 O;  4DV3 O;  2VQF O;  4X66 O;  3OTO O;  4JI4 O;  2E5L O;  5IT9 N;  2FKX A;  4YY3 O;  4GKJ O;  5A2Q N;  1N36 O;  4DV0 O;  4AQY O;  1FJG O;  4LF5 O;  5BR8 O;  2ZKO A;  3JAM N;  4JI6 O;  2UXC O;  4OPA A;  2F4V O;  4DV7 O;  1FKA O;  1HNW O;  5LMN O;  4DV1 O;  1N33 O;  4JI0 O;  2ZM6 O;  5H5N A;  4LF7 O;  1XNR O;  3SDL A;  5LMU O;  3J80 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...