1XNQO

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1xnqO00
1DK1A 4DV6O 4JV5O 4JI7O 1F7YA 4JI1O 1IBKO 2UUBO 2DOSA 1YZBA 3T1YO 4DV5O 4OPAA 1KUQA 5BR8O 2ZM6O 4LFAO 1N32O 4DV4O 4NXMO 1N33O 4DV3O 4DV0O 1XMOO 1G1XB 1FYJA 1FJGO 2VQFO 4NXNO 1IBLO 4X65O 3RT3C 1HR0O 4DV1O 4DR3O 1HNXO 1XMQO 1XEQA 5IWAO 4OX9O 2UU9O 4JI4O 2UXCO 4AQYO 3R66A 4LF6O 4DR4O 4LF9O 2N74A 2UUCO 4DUZO 1R1BA 4JI8O 4A5UB 4JI0O 5IT9N 2VQEO 1FKAO 4LF5O 4DR7O 4KHPO 4B3TO 2FKXA 4B3SO 4LF8O 4DR2O 2UXBO 5BY1A 2AGAA 1N34O 2F4VO 1HNWO 2JRIA 4JI6O 4DR1O 4DR6O 4LFCO 4JI3O 3SDLA 4JYAO 1X59A 1XNRO 1N36O 2HHHO 5BXZA 3T1HO 4K0KO 2DJVA 3O65A 1HNZO 4LF7O 1I94O 1AB3A 4GKJO 1J5EO 4DV7O 4JI5O 4DUYO 1A32A 4OPHA 2LW7A 3OTOO 4LFBO 1D2DA 5FLXN 5LL6Y 5LMNO 3J80N 4X64O 1AILA 2ZKOA 5LMUO 5H5NA 4JI2O 4YY3O 4X66O 4DV2O 3JAMN 1R6TA 4YHHO 4B3RO 3J7AU 2Z0AA 3J81N 4B3MO 4DR5O 2UUAO 3M8AA 1IBMO 4LF4O 4X62O 4GKKO 1NS1A 5A2QN 2UXDO 3F5TA 2E5LO 1XNQO
chains in the Genus database with same CATH superfamily
2ZR2A 4DV6O 4FMTA 2NLJC 4GKJB 1AR5A 1WNSA 1ZSPA 3H1KH 2DMXA 3OUFA 4MVMA 4NXMO 2B1IA 2A3QA 5KHJA 4UCUA 4JYCA 1RM1C 3K57A 2QWQB 1XUQA 1M90W 4YXWG 3OR6C 3WU2Z 1EZJA 2F93B 4X65O 3LSUA 1B06A 3ZX6A 5EK0A 4GKKB 1RP3B 2ZDIA 1K97A 3BFRA 4TQFA 4JI0O 1VQ7V 3FAVB 1NVPB 1Q6UA 4IHJA 1QHTA 5B66Z 2ODMA 5LGUA 2YIBA 4AILC 3HKCB 2B5UA 3JAWB 2QKSA 4GCZA 2F1MA 4PA9A 1Y6XA 2NNUA 3K79A 3P32A 2PF4E 3SYCA 4MVQA 3K0GA 4RQFA 1GM7A 3B4SA 4DV7O 1V55B 4OPHA 2WLNA 2R9AA 2BE3A 2AZ0A 1Y74A 3Q4HA 1W2BU 5LMNO 2D2CB 5KMGA 1TVKA 3CXHF 3IAYA 2EULA 1ZL8A 4FPPA 4JI2O 2H8PC 2DYRC 3W7UA 4DW1A 3I55V 3JASB 1QVFU 3OTFA 1TA8A 1DGSA 1HR0B 1B3QA 2HHHB 5D5PA 4I5SA 5JH7B 1SA0B 3E86A 1JCHA 4JI7O 4JZGA 1RPOA 3E8FA 5CA1B 3CX5F 2IJHA 4TUYB 1LNQA 2GUZB 1YHQV 2QWPB 2L35A 3AK2A 3CRMA 3TCUA 1ORQC 4J7JA 1IDSA 4J9ZB 5B5EZ 3B40A 1O9GA 2HJDA 1XMQO 3ZMVA 2ZNJA 1YTFB 1PPJH 4LF6O 4LF9O 4LH6A 4FFBB 4NKGB 2DN9A 4DW0A 4QJFB 1JOYA 3ZRWA 4JI1B 3TXSA 4I55B 2X7RB 2F4VO 2FTKA 3UKMA 3SYOA 2JVDA 2Q7EA 5KUMA 3KG2A 2Q7GA 5FNVB 5KAFZ 5GTIZ 3DTUB 5AG2A 3T4DA 1MG1A 5LYJA 2B9ZA 5C93A 4PD4F 3IJ4A 5IWAB 1R3IC 2IH3C 3LSSA 1MA1A 4DR4B 4GZRB 5LL6Y 2VS0A 4X1IB 3ZHVA 4DV0B 1OCCB 4O2AB 3ZMZA 1M5IA 4LF5B 3K5MA 1CEZA 3UM7A 2E75B 1K7DA 2DWEC 2PUSA 4PA4A 5D5QA 1N34B 2YIAA 4DR6B 3E8HA 4LF4O 1KECA 3SPIA 4FLTA 4UV8A 3AG1B 1NJIW 5J2UA 4EFEA 3MD0A 2Y69B 1WJZA 4JI5B 3OEHG 3VOUA 4LNUB 1VQMV 3CRRA 4PHZA 1NH2D 4DV3O 5IJ0B 2ATKC 5ITZA 2QGNA 4JASA 3OAAG 1TUBA 2BSKA 3DGEA 4UCVA 4LFCB 2XHBA 1S77D 4JF3A 2KQXA 4MTFA 1V54C 2OCCB 1OCOC 1NBMG 1W0JG 3M7MX 1MOFA 2XAQA 4E4EA 2G38A 4H0LB 3C90A 3LSQA 3SR2C 4CC6A 2ADQB 2VQEO 2Q0OC 1Y67A 4PDLA 2XAGA 4DR2O 1WLEA 3UT5A 2CH7A 1OJHA 1KYOF 1P4RA 3P3NA 1X59A 4CS2A 4DR5B 5TISZ 3I5DA 4K0KO 3ZHSA 3DXRA 4TV9A 4LF7O 3AK1A 2UXXA 4ZKIA 2F23A 2XUMA 4DK1A 2E3CA 4UFZA 1VQPV 5BMVB 3N2GB 1L8DA 5LA6A 2GBOA 3WB2A 4CS4A 2UUCB 4I0XA 1PL0A 2V4DA 2XNDG 1EM1A 2PI4A 4JTCB 2M6YA 3WB0A 5DM6V 1BHBA 2XAJA 5KHKA 3CCMV 1VF6C 1FAFA 2QA4V 5L3BA 4YJ2B 4TUYA 1K4CC 1P84F 1R6NA 3JAKB 1J95A 2GSMB 1QLEB 3CP1A 1BGYH 3VBBA 5BR8O 1N32O 1F4NA 2QJ1A 1Q6IA 3ASOC 4CH6A 2DE0X 1YJWV 2EILC 2RN9A 1FYJA 4JI6B 1L1FA 1XQ8A 2VQFO 3RT3C 4PELA 4B7EA 4MT8A 4OX9O 3L71H 4AQYO 2WLIA 4MTXA 3FKSG 4BW9A 1K3EA 2N74A 4PDRA 4J11A 5H6QA 3H1HH 3C3SA 4IIJA 5KHIA 5IE9A 2FKXA 2A9HA 4FJCC 4WBNB 4EFBA 1XNQO 1AJNA 2A7WA 1B04A 4NTWA 3X2QC 5B1AB 1OZ0A 3E89A 1H2GA 4JTDB 5KX5A 1U96A 3CHXA 2Q69A 1YIJV 2Q67A 1U97A 1WB7A 3U11A 2CUGA 2XAHA 1QCEA 3RGBA 2RQ6A 3FYEB 1YI2V 5EBWC 3AG3C 2F43G 3CCEV 1KP3A 4MVOA 3WB1A 2B1GA 3ZN1A 1M9NA 4MSWC 1Q8IA 4U3JA 3MHHC 3DSQA 3CRCA 1I5XA 1XL6A 2Y4TA 5EBLC 1VQ5V 4X66O 4DRXB 4B3SB 4U7NA 3W7XA 4B3MO 3HR0A 2XTAA 2Y0IA 4UV9A 4I4TA 4FM0A 4JYAB 5LGTA 2N05A 1NQTA 2WLLA 3L75H 5CA0A 4F6RB 3F5TA 4X1KB 3CMEV 2ZDIC 1FXKB 2WLJA 1XREA 2LW1A 2JGUA 4CBCA 1NR1A 3G6EV 2JEUA 1J5EB 2EIMC 4O4IA 2ZQMA 2YXLA 1SERA 5LGNA 2LGQA 5CBFA 1VQNV 1ZLZA 3BVOA 4YIPA 3CJHB 5LOVB 4NXNO 1AR1B 3AG7A 1IBLO 5L3CA 1S5LZ 1XHXA 5L3DA 3SGIA 1XL4A 4FFKA 2UUAB 3CD6V 2CE4A 1MSDA 2CK3G 1H2NA 2ZXWC 4XDKA 3CPWU 3APQA 4I50A 2QR4A 1R1BA 3BAAA 5LBQA 4HZ3A 3CCVV 3SYQA 4IYIA 1IBKB 5CB4B 3I56V 2UUBB 2ZIMA 2V7QG 2JGDB 2OYQA 4KP4A 2Z3YA 2EIKB 2A0LA 1I5YA 1WA8A 1S76D 5JJJB 1XMOB 5F2VO 2RMKB 1KP2A 5BMVA 3OEEG 1MABG 3T1HO 4GUNA 1FJGB 4ZOLB 5LP6C 3VQWA 3E22B 2DYSC 3G67A 4G28B 4UCTA 1RSOB 3CCJV 1RPRA 3T1YB 2UU9B 1VIBA 2ZINA 2Q73A 1RFYA 4CS3A 4X64O 5JQGA 4IL6Z 1B6QA 1Z5VA 1CXZB 4LF8B 1LUVA 1R6TA 3J7AU 1HW7A 1GN2A 5CA3A 5EYPB 3ZHRA 1SESA 5JVDA 3TGUH 2QKAA 1FFXB 3LDEA 4JAVA 4F4LA 2W0XA 3ETGA 4WFFA 1GN3A 4NTXA 3B2EE 4X1YB 2CGNA 4GX5A 4DUYB 3BCCH 1EZVH 3QNEA 2ZM6O 5CBHA 3HKBA 4BIOA 5LHHA 4DYLA 5IYDO 1OCZB 5H2FZ 2DWDC 1PV0A 4QGPA 3JARA 3HKEA 4YY3B 1HR0O 3H9VA 4DR3O 3ZRXA 2YIBD 3QTCA 1IBMB 1R3LC 1EFRG 3CCUV 3CC2V 3SPJA 5K1PA 4JV5B 1SQPH 4DR7O 4KHPO 3BRCA 5IYZA 3JYCA 5GONB 2BCCH 3FYIB 4R7CA 2AGAA 2Q9LA 3JD4A 4DV4B 2E76B 4JYBA 4DR1O 1N33B 1VQKV 1S5JA 3CCQV 3JD2A 2DW4A 1AI4A 4IT5A 2JDIG 1F23A 3SPCA 1SQQH 2FL4A 1HNZO 1UFIA 4WFAV 1I08A 3JATA 2P4KA 1QBZA 4LC1A 4TV8B 1A32A 1SKVA 2VRZA 3SJCC 3OTOO 4HNAA 5B1OA 4FLZA 5E1AC 3TJTA 5LMUO 2IJJA 2PGGA 2UXNA 1HNWB 3RYIA 3RYFB 3T4ZA 3FB8C 2QDOA 4EEQA 5KUKA 1JFFA 4WCEV 5IYBO 3ZIAG 4I7ZB 2BTOA 3QO7A 1I94B 4ZHQB 4DV5O 4YJ3A 1MSWD 1F51A 2KG7B 1V55C 4DV0O 5J9PC 1FPOA 5EZYA 5BZBA 4ASUG 2CTPA 2K9PA 1X4TA 1YSCA 3K0DA 1H2KA 5LP6A 4CC5A 2P67A 1K33A 1XDCA 2OTLV 4DV2B 1BSMA 1HNXO 1L0NH 4H37A 1PNMA 3QG5A 1OCRB 2LGWA 2EJRA 1K4DC 1NH2B 2UXDB 3AG4B 1NTZH 4O4LA 1P49A 1PL4A 2PTMA 2RDCA 5C8YB 1XNQB 4DV6B 1R3KC 2R72A 4LWSA 2YI8A 4CH3A 2YEVA 2QTOA 1M57B 4Z1MG 3SYAA 2XAFA 5EBMC 1BZKA 2Q6AA 1YDXA 3JALB 1VP7A 2IM9A 4LH7A 3EXAA 4NXMB 2RNBA 4LFCO 3EVKA 2BTQB 1H2SB 4UVBA 1R73A 4MVZA 4X65B 4D7TA 3JCZA 3ETEA 4K8XA 1FXVA 3VQYA 2ZE5A 4ZI7B 3N2KB 3ZHQA 1S5HC 2JS3A 3L74H 4X20B 1JJOA 1SC5B 4LBEC 1E79G 3K9AA 2PZSA 4YHHO 2YS8A 3F5WC 3LUTB 2QM8A 1VF7A 2GTSA 3B8NA 4UXNA 4DR5O 3KZIZ 1E1RG 1K5QA 3LNMB 4MTOA 2WA3A 2X0LA 4N23A 1WPXA 3WG7B 2ZNIA 3GB7C 1R3JC 3ZHUA 2LFSA 4DV7B 1NTKH 4GX2A 2IJKA 4LCUC 1GKFA 4KFMA 3KCYA 4FK5C 1KKDA 5LMNB 2IU3A 3ZN0A 1IXBA 1DF4A 3ZMUA 4PDMA 3L9DA 4PA6A 1OCCC 3K03A 4N21A 4JI2B 1W0KG 1EN4A 2PYLA 2QE7G 4BWAA 1VQLV 2ADPA 2ZR3A 3H1IH 4F6EA 3RYHB 3K9SA 5IJ9B 1FS0G 4RWUA 1KD1W 3K59A 3AG1C 3BABA 3D36A 4JI7B 3QO8A 1BMFG 5KHGA 1LUWA 1VQ9V 1SQBH 4E2LA 2UXBO 5BY1A 3K5LA 3FAVA 1NKDA 1D5NA 4ZBMA 4MW3A 4JI6O 5B1BC 3DC5A 5J2TB 1WB8A 3LDDA 4U7OA 1DLBA 3FB5C 3QVNA 5BXZA 2ZE8A 4HBNA 1N36O 4G27B 1G4YB 3CMAV 4UB8Z 4EKWA 3HKCA 2RCVA 3BHPA 3P3PA 1BT8A 3JAWA 2WLHA 4RUFA 1Y76B 2HVJC 3RYCB 1XMQB 3DC6A 1WP8A 1P7BA 4MS2A 4KXRA 3FB7C 4LR3A 4PA7A 4LF6B 4CH5A 2Q0AA 4LF9B 4LFBO 5FLXN 4MTGA 3UQ8A 4L8JA 2JS5A 4NYKA 1SS3A 3K58A 3GVMA 2JJ2G 4O4JB 4W4LA 1MMMA 1G6UA 4GYCB 4B3RO 1ZAUA 1NZ6A 2WAMA 3KKYA 3N27A 4O2BB 3JASA 2YUAA 5A2QN 4X8AA 1FD9A 2E5LO 1NI8A 3ZRSA 4BAYA 3M99B 3OMIB 2WSSG 5JH7A 1COWG 1PNKA 1SA0A 5LHGA 2P4VA 3HKDB 4OPAA 3FFQA 1ROPA 5DN6G 5DECA 1VQ4V 3ABLB 1YVWA 2N04A 5CA1A 5LXTB 4H33A 3G71V 3PN1A 2H3OA 2GUZA 2VWKA 4UCSA 4Z2WA 1V9PA 3EHBB 1XILA 2JIZG 2YIDA 5A9GA 5JJEB 2ILMA 4LF4B 3UCSC 2EJ7A 3K04A 4DUZO 3E8GA 5HFLA 4A5UB 5KA5A 4FFBA 1XBLA 1HDJA 4H13B 1M1KW 4UB6Z 1QLEC 4UCOA 1I7FA 4I55A 4DV3B 1ZX3A 4NB5A 5IY5C 3H1LH 4C7UA 5IYCO 4X62B 2DJVA 4UVAA 1EBOA 4O4HB 5FNVA 4TSFG 3KCXA 1N8RW 3E8BA 2A79B 2WPDG 1JX9A 5B1NA 4EB6B 4FLXA 4RQEA 1D2DA 4DO2A 4J7ZA 2NN4A 2CTWA 3O9OA 3H1JH 2VQEB 3X2QB 1KC8W 2EIJB 4X1IA 4FM1A 1AI5A 2FB5A 3CSXA 3JAMN 1SQGA 4DR2B 4O2AA 3BEHA 1WPBA 3TXQA 4WFBV 1BS3A 1EN5A 2M7WA 3ZJZA 2H94A 4K0KB 2WWWA 3OGCC 2P06A 3T1YO 2PI5A 4I9QA 2EINB 1Q81W 2W6IG 3UO2A 3RVYA 3ABKB 1H2LA 1QU7A 1GMGA 4LNUA 3CCLV 3R65A 1KKCA 5IJ0A 3U0ZA 1IX9A 2LO1A 1M56B 3AEIA 4HAMA 4DV1O 2BOBC 5IDJA 3JD3A 1K9MW 1ZWIC 3CXCU 3ABMB 1VQOV 4JI4O 2UXCO 1SF9A 4NVPA 5B3SC 2EIMB 4CH4A 4JI8O 4TOIA 3IGAC 3CYOA 4IHJB 1FXKC 4B3TO 1HWYA 5JJNB 2X6BA 4PJ0Z 2Q5ZA 5BR8B 4TQDA 1N32B 4JGSA 1PKXA 4JAAA 5EIBC 1Y66A 1N0JA 4MVRA 1JMKC 3SDLA 1XHZA 1XNRO 2O57A 2VQFB 3SPGA 1GH6A 2CGOA 2PYJA 4X89A 1AJQA 2JJ1G 4GLXA 4GKJO 1Y74B 3Q4HB 5LHIA 3D3IA 4OX9B 2OIEA 4AQYB 3U10A 5KMGB 1TVKB 1ZL8B 1TAEA 4X9QA 1AILA 3N2GA 4BIZA 2HFEC 3ZRVA 4P2ZA 1Q86W 2Q7HA 2D3OW 2Y48A 3HKDA 1YITV 3BA9A 2RJZA 1QVGU 4GKKO 1NS1A 3UO3A 1H2MA 3CRQA 2DYSB 2X6CA 4K35A 1HP8A 1R6KA 1NR7A 1AJPA 3JD0A 4YJ2A 1DK1A 3AK3A 4BIUA 2QM4A 1H8EG 4UVCA 1K8AW 3AG2B 1AP5A 3JAKA 3W7SA 2Q68A 3JCUZ 2V1DA 3JSNA 3STLC 1G1XB 2LP7A 4J41A 2JK5C 5FL7G 2JEXA 4RUEA 4D6TH 4X66B 3D8CA 2ZE6A 1G8MA 2Y4UA 4B3MB 4P30A 3B8MA 5FPRA 2DQ3A 3PJSK 3ZRWB 1KU9A 3ETDA 3FB6C 2WA4A 4X88A 1TGOA 3ASNB 2CAZC 3A8TA 3ML0A 1VMGA 3OR7C 2OIGA 4WBNA 3CRAA 4GT1A 2HHHO 4D7SA 5LYJB 4XDJA 2FMLA 4NXNB 1GN4A 2IU0A 1IBLB 3S3WA 2WLMA 5KAIZ 4WF9V 1S3JA 2R70A 4IYHA 1QLNA 1RM1B 1TUEB 4BW5A 1Q5OA 4LFAB 4DK0A 1UJWB 1KQSU 3JD1A 5H9CA 4IGGA 1YXBA 3NR7A 1K34A 3RN4A 4QIWF 4DRXA 5J2UB 1GAXA 3CWBH 3T1HB 2HJFC 4KUMA 4QNHB 4GX1A 1Q43A 3F7YC 1F7YA 4JI1O 4F6RA 3D36C 1YZBA 4X1KA 1FXKA 4ZIBA 5ITZB 3ZHTA 1KUQA 1TUBB 2BSKB 3STZC 3MDSA 1Q7YW 2CDYA 4X64B 5KA6A 4JI3B 3CCRV 4FM2A 1GK9A 1Z5WA 4DXWA 3CJHA 5LOVA 3SJQC 5IWAO 1N4CA 4Z1VA 4FZ0A 1XI1A 1MZFA 1OHHG 4DR4O 3RFRA 4FLUA 1SZXA 3CEIA 2XOKG 1K73W 4J7KA 3F7VC 1FKAO 2DYRB 3UT5B 2CH7B 4LF5O 1XOUA 2YICA 1VARA 1GO3F 3BPZA 1DTOA 5GTHZ 5CB4A 1N34O 2ZM6B 2AXTZ 5DEDA 1IZ3A 4DR6O 2JGDA 3E35A 1M93A 4MVSA 3DXRB 4TV9B 4J42A 1THZA 3H01A 3ZBHA 4DR3B 4ZOLA 1Q90D 2BOCC 4JI5O 3E22A 5LA6B 1OCRC 4I0XB 5EC1C 5CMUA 1L0LH 4QE7A 1RSOA 4MVUA 3AG4C 2ZKOA 3HPLC 4R8CA 2A06H 3GWKC 4DR7B 3JSLA 4KHPB 1US6A 2GV9A 3A0HZ 1AI7A 1K5SA 1M57C 4DR1B 3K08A 1YF2A 4NR1A 1GN6A 4L87A 2ZCEA 5EYPA 3OUSA 4JZ2A 4HYOA 1SZTA 2ZE7A 1HNZB 4YIOA 1FFXA 4JI0B 1IXMA 3FX7A 3OMNB 4GX0A 4AHCA 4X1YA 3OTOB 2R9IA 2QM7A 3MHSC 1GRJA 3W7WA 3ABTA 2F95B 1KBHA 3L73H 2ITDC 5LMUB 2GDSA 2P6JA 1NVPD 1WAZA 4WFHA 4TT3G 2WLIB 1PP9H 1YEWA 2CTRA 4U3FH 2LQTA 2P5OA 2XASA 4IIJB 2QWNB 2HEPA 2UUCO 4ABMA 5HFMA 2ITCC 3CC4V 3LNNA 4BR6A 4TWKA 2F66C 3E2EA 1UPGA 4DV5B 3WG7C 1NU1H 2YSUB 5KX5B 2JRIA 4AI8A 4QE9A 5GONA 1JPXA 1H38A 1AP6A 1KMIZ 3S3XA 3CE2A 1HNXB 2P90A 2YXHA 5E79Z 1AR4A 5KLVH 4WFEA 4U3JB 4PV1B 3APOA 3OMAB 4TV8A 4MW8A 3J80N 2Y69C 1ENVA 1V54B 4H44B 2Z5UA 4NTYA 1OCOB 3CB2A 3G4SV 3THOA 5B1BB 1BE3H 4I4TB 1FXHA 2AW9A 2HKOA 2WLLB 3RBZA 5CA0B 2QWOB 4X62O 2OCCC 3TETA 2AHYA 2FYUH 4JAUA 2IBZH 4KL1A 3RYFA 4O4IB 4G2KA 2DOSA 4J10A 2HR3A 2QTSA 2HVKC 3HB3B 1MZEA 1YTFD 4ZHQA 1GTOA 3A0RA 2F4VB 3BY6A 2KG7A 3EFFK 1SETA 1CP9A 5JWPA 2HG5C 2CTQA 3A2FA 5CN0A 2EZOA 3OM3B 4YHHB 2HLDG 3W7TA 2LJ2A 2ETNA 4I50B 2L6LA 4PI0A 3R66A 4RO2A 1NT2B 4P9OA 3ZEDA 3BA8A 1PM9A 5H6RA 1WA8B 2KB1A 5C8YA 4B3SO 4R50A 2AHZA 1OV9A 1F4MA 1Q82W 3OE7G 1JQ0A 4J80A 4UUJC 1E1QG 2W0FC 2YI9A 2QSAA 4JYAO 3B09A 2C2AA 4JTAB 3JALA 3OD4A 5GW7A 3ABLC 3G80A 3SJBC 2YC0A 3T2MA 4OGQB 3IC9A 3ABUA 2BTQA 3C3TA 1J5EO 4J9YB 3ASOB 2LW7A 1Q3EA 2EILB 2ZIOA 5JQGB 2MW2B 4OXSA 3B77A 2YXYA 4FLYA 4ZI7A 1JJ2U 3N2KA 5IY5B 5JVDB 1QQCA 4FIPC 2UXBB 1P7GA 4X20A 1AROP 3J81N 4WFGA 2UUAO 1Y4MA 1N36B 2E74B 2R9RB 5EC2C 3K5OA 1AVMA 5JCOC 1IBKO 2UUBO 4FZ1A 2VWJA 1PD3A 4FLWA 3WFVA 4B08A 3ZCCA 1D5AA 3HKBB 1S0VA 4LFBB 1XMOO 2P7TC 1VQ6V 3JARB 3HKEB 1FJGO 1VQ8V 5B1AC 1GM9A 1KB9F 2XT9A 4RAIA 3SPHA 3LDCA 4R6ZA 3ZMSA 3RW0A 2EIJC 2EZPA 2HP8A 3G6BA 5K1XA 4B3RB 5L3EA 1AI6A 3AG3B 1XEQA 4LF7B 2UU9O 1URFA 1WP7A 2Q8VA 5CBGA 2E5LB 1Z2GA 3RWRD 3RYHA 5IYZB 5IJ9A 1JA8A 4CZZA 5IT9N 3FD9A 4LF8O 5KHHA 4PA3A 2NR5A 2EINC 3K06A 3A0BZ 3T1CA 2W6JG 2IW5A 2OTJV 3IC7A 3ABKC 3JATB 1QR9A 5J2TA 1MNGA 3O65A 5FPOA 1M56C 2QKCA 3TK1A 4QPJA 4HNAB 5B3SB 1FFTB 1Y76A 3RYCA 4DUYO 3L70H 4K3AA 3ABMC 1ZUQA 1VEWA 1YJ9V 1CPYA 2K1EA 4DUZB 2GTAA 5L3GA 5H5NA 3OGIB 1BQ0A 4YY3O 2P22C 3RYIB 3IFXA 4B7KA 3SYPA 1QNMA 4O4JA 2YDEA 2ZT9B 3NXSA 3ICXA 2EX3A 2ZXWB 1IBMO 1JFFB 4FVMA 4XBFA 3ZMTA 5L3FA 3D3QA 1O9HA 4O2BA 1T5EA 1WN7A 4JV5O 1PNLA 4YJ3B 4ICGA 4FLVA 3CS5A 2PY5A 1YCIA 3P30A 4K8ZA 1N0NA 1SRYA 5EZYB 4LFAO 4DV4O 1N33O 2QWRB 5LP6B 2EIKC 2IJIA 2ZD9A 3CC7V 3OT7A 1BL8A 1ZTEA 5LXTA 3VQXA 2KKWA 1YJNV 1VF6A 3CCSV 1IVSA 4O4LB 2KSDA 1SQVH 4LWSB 1LR1A 2IH1C 2YEVB 4XDLA 2LFRA 1I0HA 1Q6HA 1S72V 4QPKA 2DQ0A 1BCCH 1JR9A 1SQXH 3MAQA 1M4UA 4JYYA 4JPRA 3SJAC 3K5NA 3AG2C 3ETQA 1HNWO 3K3WA 1SQFA 3OW2U 4JI3O 4P9PA 1GM8A 2Q4PA 4LP8A 1H8HG 2OWOA 2EBOA 4Q20A 3E83A 2X6AA 1JVMA 3GWOA 4DV1B 1I94O 1AB3A 5JCOA 1EN6A 2OT5A 3RVZA 2Y0PA 4JI4B 2UXCB 1BQZA 1VF5B 4O4HA 1W59A 4PDVA 3QF7A 3VQVA 3QO5A 4EB6A 2MK3A 2WLKA 4UCRA 4JI8B 1BHAA 3OFNG 4PI2A 4I9WA 2GHYA 2AZ2A 4B3TB 1K92A 1QR8A 4DV2O 3ASNC 2QEXV 1OCZC 2Z0AA 5EIBD 1DF5A 4W4KA 3M8AA 4Q6GA 1XNRB 3ZS8C 2UXDO 3L72H 1IURA 2OCHA 2ARHA 1NTMH
chains in the Genus database with same CATH topology
1DK1A 4DV6O 4JV5O 4JI7O 1F7YA 4JI1O 1IBKO 2UUBO 2DOSA 1YZBA 3T1YO 4DV5O 4OPAA 1KUQA 5BR8O 2ZM6O 4LFAO 1N32O 4DV4O 4NXMO 1N33O 4DV3O 4DV0O 1XMOO 1G1XB 1FYJA 1FJGO 2VQFO 4NXNO 1IBLO 4X65O 3RT3C 1HR0O 4DV1O 4DR3O 1HNXO 1XMQO 1XEQA 5IWAO 4OX9O 2UU9O 4JI4O 2UXCO 4AQYO 3R66A 4LF6O 4DR4O 4LF9O 2N74A 2UUCO 4DUZO 1R1BA 4JI8O 4A5UB 4JI0O 5IT9N 2VQEO 1FKAO 4LF5O 4DR7O 4KHPO 4B3TO 2FKXA 4B3SO 4LF8O 4DR2O 2UXBO 5BY1A 2AGAA 1N34O 2F4VO 1HNWO 2JRIA 4JI6O 4DR1O 4DR6O 4LFCO 4JI3O 3SDLA 4JYAO 1X59A 1XNRO 1N36O 2HHHO 5BXZA 3T1HO 4K0KO 2DJVA 3O65A 1HNZO 4LF7O 1I94O 1AB3A 4GKJO 1J5EO 4DV7O 4JI5O 4DUYO 1A32A 4OPHA 2LW7A 3OTOO 4LFBO 1D2DA 5FLXN 5LL6Y 5LMNO 3J80N 4X64O 1AILA 2ZKOA 5LMUO 5H5NA 4JI2O 4YY3O 4X66O 4DV2O 3JAMN 1R6TA 4YHHO 4B3RO 3J7AU 2Z0AA 3J81N 4B3MO 4DR5O 2UUAO 3M8AA 1IBMO 4LF4O 4X62O 4GKKO 1NS1A 5A2QN 2UXDO 3F5TA 2E5LO 1XNQO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DK1 A;  4DV6 O;  4JV5 O;  4JI7 O;  1F7Y A;  4JI1 O;  1IBK O;  2UUB O;  2DOS A;  1YZB A;  3T1Y O;  4DV5 O;  4OPA A;  1KUQ A;  5BR8 O;  2ZM6 O;  4LFA O;  1N32 O;  4DV4 O;  4NXM O;  1N33 O;  4DV3 O;  4DV0 O;  1XMO O;  1G1X B;  1FYJ A;  1FJG O;  2VQF O;  4NXN O;  1IBL O;  4X65 O;  3RT3 C;  1HR0 O;  4DV1 O;  4DR3 O;  1HNX O;  1XMQ O;  1XEQ A;  5IWA O;  4OX9 O;  2UU9 O;  4JI4 O;  2UXC O;  4AQY O;  3R66 A;  4LF6 O;  4DR4 O;  4LF9 O;  2N74 A;  2UUC O;  4DUZ O;  1R1B A;  4JI8 O;  4A5U B;  4JI0 O;  5IT9 N;  2VQE O;  1FKA O;  4LF5 O;  4DR7 O;  4KHP O;  4B3T O;  2FKX A;  4B3S O;  4LF8 O;  4DR2 O;  2UXB O;  5BY1 A;  2AGA A;  1N34 O;  2F4V O;  1HNW O;  2JRI A;  4JI6 O;  4DR1 O;  4DR6 O;  4LFC O;  4JI3 O;  3SDL A;  4JYA O;  1X59 A;  1XNR O;  1N36 O;  2HHH O;  5BXZ A;  3T1H O;  4K0K O;  2DJV A;  3O65 A;  1HNZ O;  4LF7 O;  1I94 O;  1AB3 A;  4GKJ O;  1J5E O;  4DV7 O;  4JI5 O;  4DUY O;  1A32 A;  4OPH A;  2LW7 A;  3OTO O;  4LFB O;  1D2D A;  5FLX N;  5LL6 Y;  5LMN O;  3J80 N;  4X64 O;  1AIL A;  2ZKO A;  5LMU O;  5H5N A;  4JI2 O;  4YY3 O;  4X66 O;  4DV2 O;  3JAM N;  1R6T A;  4YHH O;  4B3R O;  3J7A U;  2Z0A A;  3J81 N;  4B3M O;  4DR5 O;  2UUA O;  3M8A A;  1IBM O;  4LF4 O;  4X62 O;  4GKK O;  1NS1 A;  5A2Q N;  2UXD O;  3F5T A;  2E5L O;  1XNQ O; 
#chains in the Genus database with same CATH topology
 2ZR2 A;  4DV6 O;  4FMT A;  2NLJ C;  4GKJ B;  1AR5 A;  1WNS A;  1ZSP A;  3H1K H;  2DMX A;  3OUF A;  4MVM A;  4NXM O;  2B1I A;  2A3Q A;  5KHJ A;  4UCU A;  4JYC A;  1RM1 C;  3K57 A;  2QWQ B;  1XUQ A;  1M90 W;  4YXW G;  3OR6 C;  3WU2 Z;  1EZJ A;  2F93 B;  4X65 O;  3LSU A;  1B06 A;  3ZX6 A;  5EK0 A;  4GKK B;  1RP3 B;  2ZDI A;  1K97 A;  3BFR A;  4TQF A;  4JI0 O;  1VQ7 V;  3FAV B;  1NVP B;  1Q6U A;  4IHJ A;  1QHT A;  5B66 Z;  2ODM A;  5LGU A;  2YIB A;  4AIL C;  3HKC B;  2B5U A;  3JAW B;  2QKS A;  4GCZ A;  2F1M A;  4PA9 A;  1Y6X A;  2NNU A;  3K79 A;  3P32 A;  2PF4 E;  3SYC A;  4MVQ A;  3K0G A;  4RQF A;  1GM7 A;  3B4S A;  4DV7 O;  1V55 B;  4OPH A;  2WLN A;  2R9A A;  2BE3 A;  2AZ0 A;  1Y74 A;  3Q4H A;  1W2B U;  5LMN O;  2D2C B;  5KMG A;  1TVK A;  3CXH F;  3IAY A;  2EUL A;  1ZL8 A;  4FPP A;  4JI2 O;  2H8P C;  2DYR C;  3W7U A;  4DW1 A;  3I55 V;  3JAS B;  1QVF U;  3OTF A;  1TA8 A;  1DGS A;  1HR0 B;  1B3Q A;  2HHH B;  5D5P A;  4I5S A;  5JH7 B;  1SA0 B;  3E86 A;  1JCH A;  4JI7 O;  4JZG A;  1RPO A;  3E8F A;  5CA1 B;  3CX5 F;  2IJH A;  4TUY B;  1LNQ A;  2GUZ B;  1YHQ V;  2QWP B;  2L35 A;  3AK2 A;  3CRM A;  3TCU A;  1ORQ C;  4J7J A;  1IDS A;  4J9Z B;  5B5E Z;  3B40 A;  1O9G A;  2HJD A;  1XMQ O;  3ZMV A;  2ZNJ A;  1YTF B;  1PPJ H;  4LF6 O;  4LF9 O;  4LH6 A;  4FFB B;  4NKG B;  2DN9 A;  4DW0 A;  4QJF B;  1JOY A;  3ZRW A;  4JI1 B;  3TXS A;  4I55 B;  2X7R B;  2F4V O;  2FTK A;  3UKM A;  3SYO A;  2JVD A;  2Q7E A;  5KUM A;  3KG2 A;  2Q7G A;  5FNV B;  5KAF Z;  5GTI Z;  3DTU B;  5AG2 A;  3T4D A;  1MG1 A;  5LYJ A;  2B9Z A;  5C93 A;  4PD4 F;  3IJ4 A;  5IWA B;  1R3I C;  2IH3 C;  3LSS A;  1MA1 A;  4DR4 B;  4GZR B;  5LL6 Y;  2VS0 A;  4X1I B;  3ZHV A;  4DV0 B;  1OCC B;  4O2A B;  3ZMZ A;  1M5I A;  4LF5 B;  3K5M A;  1CEZ A;  3UM7 A;  2E75 B;  1K7D A;  2DWE C;  2PUS A;  4PA4 A;  5D5Q A;  1N34 B;  2YIA A;  4DR6 B;  3E8H A;  4LF4 O;  1KEC A;  3SPI A;  4FLT A;  4UV8 A;  3AG1 B;  1NJI W;  5J2U A;  4EFE A;  3MD0 A;  2Y69 B;  1WJZ A;  4JI5 B;  3OEH G;  3VOU A;  4LNU B;  1VQM V;  3CRR A;  4PHZ A;  1NH2 D;  4DV3 O;  5IJ0 B;  2ATK C;  5ITZ A;  2QGN A;  4JAS A;  3OAA G;  1TUB A;  2BSK A;  3DGE A;  4UCV A;  4LFC B;  2XHB A;  1S77 D;  4JF3 A;  2KQX A;  4MTF A;  1V54 C;  2OCC B;  1OCO C;  1NBM G;  1W0J G;  3M7M X;  1MOF A;  2XAQ A;  4E4E A;  2G38 A;  4H0L B;  3C90 A;  3LSQ A;  3SR2 C;  4CC6 A;  2ADQ B;  2VQE O;  2Q0O C;  1Y67 A;  4PDL A;  2XAG A;  4DR2 O;  1WLE A;  3UT5 A;  2CH7 A;  1OJH A;  1KYO F;  1P4R A;  3P3N A;  1X59 A;  4CS2 A;  4DR5 B;  5TIS Z;  3I5D A;  4K0K O;  3ZHS A;  3DXR A;  4TV9 A;  4LF7 O;  3AK1 A;  2UXX A;  4ZKI A;  2F23 A;  2XUM A;  4DK1 A;  2E3C A;  4UFZ A;  1VQP V;  5BMV B;  3N2G B;  1L8D A;  5LA6 A;  2GBO A;  3WB2 A;  4CS4 A;  2UUC B;  4I0X A;  1PL0 A;  2V4D A;  2XND G;  1EM1 A;  2PI4 A;  4JTC B;  2M6Y A;  3WB0 A;  5DM6 V;  1BHB A;  2XAJ A;  5KHK A;  3CCM V;  1VF6 C;  1FAF A;  2QA4 V;  5L3B A;  4YJ2 B;  4TUY A;  1K4C C;  1P84 F;  1R6N A;  3JAK B;  1J95 A;  2GSM B;  1QLE B;  3CP1 A;  1BGY H;  3VBB A;  5BR8 O;  1N32 O;  1F4N A;  2QJ1 A;  1Q6I A;  3ASO C;  4CH6 A;  2DE0 X;  1YJW V;  2EIL C;  2RN9 A;  1FYJ A;  4JI6 B;  1L1F A;  1XQ8 A;  2VQF O;  3RT3 C;  4PEL A;  4B7E A;  4MT8 A;  4OX9 O;  3L71 H;  4AQY O;  2WLI A;  4MTX A;  3FKS G;  4BW9 A;  1K3E A;  2N74 A;  4PDR A;  4J11 A;  5H6Q A;  3H1H H;  3C3S A;  4IIJ A;  5KHI A;  5IE9 A;  2FKX A;  2A9H A;  4FJC C;  4WBN B;  4EFB A;  1XNQ O;  1AJN A;  2A7W A;  1B04 A;  4NTW A;  3X2Q C;  5B1A B;  1OZ0 A;  3E89 A;  1H2G A;  4JTD B;  5KX5 A;  1U96 A;  3CHX A;  2Q69 A;  1YIJ V;  2Q67 A;  1U97 A;  1WB7 A;  3U11 A;  2CUG A;  2XAH A;  1QCE A;  3RGB A;  2RQ6 A;  3FYE B;  1YI2 V;  5EBW C;  3AG3 C;  2F43 G;  3CCE V;  1KP3 A;  4MVO A;  3WB1 A;  2B1G A;  3ZN1 A;  1M9N A;  4MSW C;  1Q8I A;  4U3J A;  3MHH C;  3DSQ A;  3CRC A;  1I5X A;  1XL6 A;  2Y4T A;  5EBL C;  1VQ5 V;  4X66 O;  4DRX B;  4B3S B;  4U7N A;  3W7X A;  4B3M O;  3HR0 A;  2XTA A;  2Y0I A;  4UV9 A;  4I4T A;  4FM0 A;  4JYA B;  5LGT A;  2N05 A;  1NQT A;  2WLL A;  3L75 H;  5CA0 A;  4F6R B;  3F5T A;  4X1K B;  3CME V;  2ZDI C;  1FXK B;  2WLJ A;  1XRE A;  2LW1 A;  2JGU A;  4CBC A;  1NR1 A;  3G6E V;  2JEU A;  1J5E B;  2EIM C;  4O4I A;  2ZQM A;  2YXL A;  1SER A;  5LGN A;  2LGQ A;  5CBF A;  1VQN V;  1ZLZ A;  3BVO A;  4YIP A;  3CJH B;  5LOV B;  4NXN O;  1AR1 B;  3AG7 A;  1IBL O;  5L3C A;  1S5L Z;  1XHX A;  5L3D A;  3SGI A;  1XL4 A;  4FFK A;  2UUA B;  3CD6 V;  2CE4 A;  1MSD A;  2CK3 G;  1H2N A;  2ZXW C;  4XDK A;  3CPW U;  3APQ A;  4I50 A;  2QR4 A;  1R1B A;  3BAA A;  5LBQ A;  4HZ3 A;  3CCV V;  3SYQ A;  4IYI A;  1IBK B;  5CB4 B;  3I56 V;  2UUB B;  2ZIM A;  2V7Q G;  2JGD B;  2OYQ A;  4KP4 A;  2Z3Y A;  2EIK B;  2A0L A;  1I5Y A;  1WA8 A;  1S76 D;  5JJJ B;  1XMO B;  5F2V O;  2RMK B;  1KP2 A;  5BMV A;  3OEE G;  1MAB G;  3T1H O;  4GUN A;  1FJG B;  4ZOL B;  5LP6 C;  3VQW A;  3E22 B;  2DYS C;  3G67 A;  4G28 B;  4UCT A;  1RSO B;  3CCJ V;  1RPR A;  3T1Y B;  2UU9 B;  1VIB A;  2ZIN A;  2Q73 A;  1RFY A;  4CS3 A;  4X64 O;  5JQG A;  4IL6 Z;  1B6Q A;  1Z5V A;  1CXZ B;  4LF8 B;  1LUV A;  1R6T A;  3J7A U;  1HW7 A;  1GN2 A;  5CA3 A;  5EYP B;  3ZHR A;  1SES A;  5JVD A;  3TGU H;  2QKA A;  1FFX B;  3LDE A;  4JAV A;  4F4L A;  2W0X A;  3ETG A;  4WFF A;  1GN3 A;  4NTX A;  3B2E E;  4X1Y B;  2CGN A;  4GX5 A;  4DUY B;  3BCC H;  1EZV H;  3QNE A;  2ZM6 O;  5CBH A;  3HKB A;  4BIO A;  5LHH A;  4DYL A;  5IYD O;  1OCZ B;  5H2F Z;  2DWD C;  1PV0 A;  4QGP A;  3JAR A;  3HKE A;  4YY3 B;  1HR0 O;  3H9V A;  4DR3 O;  3ZRX A;  2YIB D;  3QTC A;  1IBM B;  1R3L C;  1EFR G;  3CCU V;  3CC2 V;  3SPJ A;  5K1P A;  4JV5 B;  1SQP H;  4DR7 O;  4KHP O;  3BRC A;  5IYZ A;  3JYC A;  5GON B;  2BCC H;  3FYI B;  4R7C A;  2AGA A;  2Q9L A;  3JD4 A;  4DV4 B;  2E76 B;  4JYB A;  4DR1 O;  1N33 B;  1VQK V;  1S5J A;  3CCQ V;  3JD2 A;  2DW4 A;  1AI4 A;  4IT5 A;  2JDI G;  1F23 A;  3SPC A;  1SQQ H;  2FL4 A;  1HNZ O;  1UFI A;  4WFA V;  1I08 A;  3JAT A;  2P4K A;  1QBZ A;  4LC1 A;  4TV8 B;  1A32 A;  1SKV A;  2VRZ A;  3SJC C;  3OTO O;  4HNA A;  5B1O A;  4FLZ A;  5E1A C;  3TJT A;  5LMU O;  2IJJ A;  2PGG A;  2UXN A;  1HNW B;  3RYI A;  3RYF B;  3T4Z A;  3FB8 C;  2QDO A;  4EEQ A;  5KUK A;  1JFF A;  4WCE V;  5IYB O;  3ZIA G;  4I7Z B;  2BTO A;  3QO7 A;  1I94 B;  4ZHQ B;  4DV5 O;  4YJ3 A;  1MSW D;  1F51 A;  2KG7 B;  1V55 C;  4DV0 O;  5J9P C;  1FPO A;  5EZY A;  5BZB A;  4ASU G;  2CTP A;  2K9P A;  1X4T A;  1YSC A;  3K0D A;  1H2K A;  5LP6 A;  4CC5 A;  2P67 A;  1K33 A;  1XDC A;  2OTL V;  4DV2 B;  1BSM A;  1HNX O;  1L0N H;  4H37 A;  1PNM A;  3QG5 A;  1OCR B;  2LGW A;  2EJR A;  1K4D C;  1NH2 B;  2UXD B;  3AG4 B;  1NTZ H;  4O4L A;  1P49 A;  1PL4 A;  2PTM A;  2RDC A;  5C8Y B;  1XNQ B;  4DV6 B;  1R3K C;  2R72 A;  4LWS A;  2YI8 A;  4CH3 A;  2YEV A;  2QTO A;  1M57 B;  4Z1M G;  3SYA A;  2XAF A;  5EBM C;  1BZK A;  2Q6A A;  1YDX A;  3JAL B;  1VP7 A;  2IM9 A;  4LH7 A;  3EXA A;  4NXM B;  2RNB A;  4LFC O;  3EVK A;  2BTQ B;  1H2S B;  4UVB A;  1R73 A;  4MVZ A;  4X65 B;  4D7T A;  3JCZ A;  3ETE A;  4K8X A;  1FXV A;  3VQY A;  2ZE5 A;  4ZI7 B;  3N2K B;  3ZHQ A;  1S5H C;  2JS3 A;  3L74 H;  4X20 B;  1JJO A;  1SC5 B;  4LBE C;  1E79 G;  3K9A A;  2PZS A;  4YHH O;  2YS8 A;  3F5W C;  3LUT B;  2QM8 A;  1VF7 A;  2GTS A;  3B8N A;  4UXN A;  4DR5 O;  3KZI Z;  1E1R G;  1K5Q A;  3LNM B;  4MTO A;  2WA3 A;  2X0L A;  4N23 A;  1WPX A;  3WG7 B;  2ZNI A;  3GB7 C;  1R3J C;  3ZHU A;  2LFS A;  4DV7 B;  1NTK H;  4GX2 A;  2IJK A;  4LCU C;  1GKF A;  4KFM A;  3KCY A;  4FK5 C;  1KKD A;  5LMN B;  2IU3 A;  3ZN0 A;  1IXB A;  1DF4 A;  3ZMU A;  4PDM A;  3L9D A;  4PA6 A;  1OCC C;  3K03 A;  4N21 A;  4JI2 B;  1W0K G;  1EN4 A;  2PYL A;  2QE7 G;  4BWA A;  1VQL V;  2ADP A;  2ZR3 A;  3H1I H;  4F6E A;  3RYH B;  3K9S A;  5IJ9 B;  1FS0 G;  4RWU A;  1KD1 W;  3K59 A;  3AG1 C;  3BAB A;  3D36 A;  4JI7 B;  3QO8 A;  1BMF G;  5KHG A;  1LUW A;  1VQ9 V;  1SQB H;  4E2L A;  2UXB O;  5BY1 A;  3K5L A;  3FAV A;  1NKD A;  1D5N A;  4ZBM A;  4MW3 A;  4JI6 O;  5B1B C;  3DC5 A;  5J2T B;  1WB8 A;  3LDD A;  4U7O A;  1DLB A;  3FB5 C;  3QVN A;  5BXZ A;  2ZE8 A;  4HBN A;  1N36 O;  4G27 B;  1G4Y B;  3CMA V;  4UB8 Z;  4EKW A;  3HKC A;  2RCV A;  3BHP A;  3P3P A;  1BT8 A;  3JAW A;  2WLH A;  4RUF A;  1Y76 B;  2HVJ C;  3RYC B;  1XMQ B;  3DC6 A;  1WP8 A;  1P7B A;  4MS2 A;  4KXR A;  3FB7 C;  4LR3 A;  4PA7 A;  4LF6 B;  4CH5 A;  2Q0A A;  4LF9 B;  4LFB O;  5FLX N;  4MTG A;  3UQ8 A;  4L8J A;  2JS5 A;  4NYK A;  1SS3 A;  3K58 A;  3GVM A;  2JJ2 G;  4O4J B;  4W4L A;  1MMM A;  1G6U A;  4GYC B;  4B3R O;  1ZAU A;  1NZ6 A;  2WAM A;  3KKY A;  3N27 A;  4O2B B;  3JAS A;  2YUA A;  5A2Q N;  4X8A A;  1FD9 A;  2E5L O;  1NI8 A;  3ZRS A;  4BAY A;  3M99 B;  3OMI B;  2WSS G;  5JH7 A;  1COW G;  1PNK A;  1SA0 A;  5LHG A;  2P4V A;  3HKD B;  4OPA A;  3FFQ A;  1ROP A;  5DN6 G;  5DEC A;  1VQ4 V;  3ABL B;  1YVW A;  2N04 A;  5CA1 A;  5LXT B;  4H33 A;  3G71 V;  3PN1 A;  2H3O A;  2GUZ A;  2VWK A;  4UCS A;  4Z2W A;  1V9P A;  3EHB B;  1XIL A;  2JIZ G;  2YID A;  5A9G A;  5JJE B;  2ILM A;  4LF4 B;  3UCS C;  2EJ7 A;  3K04 A;  4DUZ O;  3E8G A;  5HFL A;  4A5U B;  5KA5 A;  4FFB A;  1XBL A;  1HDJ A;  4H13 B;  1M1K W;  4UB6 Z;  1QLE C;  4UCO A;  1I7F A;  4I55 A;  4DV3 B;  1ZX3 A;  4NB5 A;  5IY5 C;  3H1L H;  4C7U A;  5IYC O;  4X62 B;  2DJV A;  4UVA A;  1EBO A;  4O4H B;  5FNV A;  4TSF G;  3KCX A;  1N8R W;  3E8B A;  2A79 B;  2WPD G;  1JX9 A;  5B1N A;  4EB6 B;  4FLX A;  4RQE A;  1D2D A;  4DO2 A;  4J7Z A;  2NN4 A;  2CTW A;  3O9O A;  3H1J H;  2VQE B;  3X2Q B;  1KC8 W;  2EIJ B;  4X1I A;  4FM1 A;  1AI5 A;  2FB5 A;  3CSX A;  3JAM N;  1SQG A;  4DR2 B;  4O2A A;  3BEH A;  1WPB A;  3TXQ A;  4WFB V;  1BS3 A;  1EN5 A;  2M7W A;  3ZJZ A;  2H94 A;  4K0K B;  2WWW A;  3OGC C;  2P06 A;  3T1Y O;  2PI5 A;  4I9Q A;  2EIN B;  1Q81 W;  2W6I G;  3UO2 A;  3RVY A;  3ABK B;  1H2L A;  1QU7 A;  1GMG A;  4LNU A;  3CCL V;  3R65 A;  1KKC A;  5IJ0 A;  3U0Z A;  1IX9 A;  2LO1 A;  1M56 B;  3AEI A;  4HAM A;  4DV1 O;  2BOB C;  5IDJ A;  3JD3 A;  1K9M W;  1ZWI C;  3CXC U;  3ABM B;  1VQO V;  4JI4 O;  2UXC O;  1SF9 A;  4NVP A;  5B3S C;  2EIM B;  4CH4 A;  4JI8 O;  4TOI A;  3IGA C;  3CYO A;  4IHJ B;  1FXK C;  4B3T O;  1HWY A;  5JJN B;  2X6B A;  4PJ0 Z;  2Q5Z A;  5BR8 B;  4TQD A;  1N32 B;  4JGS A;  1PKX A;  4JAA A;  5EIB C;  1Y66 A;  1N0J A;  4MVR A;  1JMK C;  3SDL A;  1XHZ A;  1XNR O;  2O57 A;  2VQF B;  3SPG A;  1GH6 A;  2CGO A;  2PYJ A;  4X89 A;  1AJQ A;  2JJ1 G;  4GLX A;  4GKJ O;  1Y74 B;  3Q4H B;  5LHI A;  3D3I A;  4OX9 B;  2OIE A;  4AQY B;  3U10 A;  5KMG B;  1TVK B;  1ZL8 B;  1TAE A;  4X9Q A;  1AIL A;  3N2G A;  4BIZ A;  2HFE C;  3ZRV A;  4P2Z A;  1Q86 W;  2Q7H A;  2D3O W;  2Y48 A;  3HKD A;  1YIT V;  3BA9 A;  2RJZ A;  1QVG U;  4GKK O;  1NS1 A;  3UO3 A;  1H2M A;  3CRQ A;  2DYS B;  2X6C A;  4K35 A;  1HP8 A;  1R6K A;  1NR7 A;  1AJP A;  3JD0 A;  4YJ2 A;  1DK1 A;  3AK3 A;  4BIU A;  2QM4 A;  1H8E G;  4UVC A;  1K8A W;  3AG2 B;  1AP5 A;  3JAK A;  3W7S A;  2Q68 A;  3JCU Z;  2V1D A;  3JSN A;  3STL C;  1G1X B;  2LP7 A;  4J41 A;  2JK5 C;  5FL7 G;  2JEX A;  4RUE A;  4D6T H;  4X66 B;  3D8C A;  2ZE6 A;  1G8M A;  2Y4U A;  4B3M B;  4P30 A;  3B8M A;  5FPR A;  2DQ3 A;  3PJS K;  3ZRW B;  1KU9 A;  3ETD A;  3FB6 C;  2WA4 A;  4X88 A;  1TGO A;  3ASN B;  2CAZ C;  3A8T A;  3ML0 A;  1VMG A;  3OR7 C;  2OIG A;  4WBN A;  3CRA A;  4GT1 A;  2HHH O;  4D7S A;  5LYJ B;  4XDJ A;  2FML A;  4NXN B;  1GN4 A;  2IU0 A;  1IBL B;  3S3W A;  2WLM A;  5KAI Z;  4WF9 V;  1S3J A;  2R70 A;  4IYH A;  1QLN A;  1RM1 B;  1TUE B;  4BW5 A;  1Q5O A;  4LFA B;  4DK0 A;  1UJW B;  1KQS U;  3JD1 A;  5H9C A;  4IGG A;  1YXB A;  3NR7 A;  1K34 A;  3RN4 A;  4QIW F;  4DRX A;  5J2U B;  1GAX A;  3CWB H;  3T1H B;  2HJF C;  4KUM A;  4QNH B;  4GX1 A;  1Q43 A;  3F7Y C;  1F7Y A;  4JI1 O;  4F6R A;  3D36 C;  1YZB A;  4X1K A;  1FXK A;  4ZIB A;  5ITZ B;  3ZHT A;  1KUQ A;  1TUB B;  2BSK B;  3STZ C;  3MDS A;  1Q7Y W;  2CDY A;  4X64 B;  5KA6 A;  4JI3 B;  3CCR V;  4FM2 A;  1GK9 A;  1Z5W A;  4DXW A;  3CJH A;  5LOV A;  3SJQ C;  5IWA O;  1N4C A;  4Z1V A;  4FZ0 A;  1XI1 A;  1MZF A;  1OHH G;  4DR4 O;  3RFR A;  4FLU A;  1SZX A;  3CEI A;  2XOK G;  1K73 W;  4J7K A;  3F7V C;  1FKA O;  2DYR B;  3UT5 B;  2CH7 B;  4LF5 O;  1XOU A;  2YIC A;  1VAR A;  1GO3 F;  3BPZ A;  1DTO A;  5GTH Z;  5CB4 A;  1N34 O;  2ZM6 B;  2AXT Z;  5DED A;  1IZ3 A;  4DR6 O;  2JGD A;  3E35 A;  1M93 A;  4MVS A;  3DXR B;  4TV9 B;  4J42 A;  1THZ A;  3H01 A;  3ZBH A;  4DR3 B;  4ZOL A;  1Q90 D;  2BOC C;  4JI5 O;  3E22 A;  5LA6 B;  1OCR C;  4I0X B;  5EC1 C;  5CMU A;  1L0L H;  4QE7 A;  1RSO A;  4MVU A;  3AG4 C;  2ZKO A;  3HPL C;  4R8C A;  2A06 H;  3GWK C;  4DR7 B;  3JSL A;  4KHP B;  1US6 A;  2GV9 A;  3A0H Z;  1AI7 A;  1K5S A;  1M57 C;  4DR1 B;  3K08 A;  1YF2 A;  4NR1 A;  1GN6 A;  4L87 A;  2ZCE A;  5EYP A;  3OUS A;  4JZ2 A;  4HYO A;  1SZT A;  2ZE7 A;  1HNZ B;  4YIO A;  1FFX A;  4JI0 B;  1IXM A;  3FX7 A;  3OMN B;  4GX0 A;  4AHC A;  4X1Y A;  3OTO B;  2R9I A;  2QM7 A;  3MHS C;  1GRJ A;  3W7W A;  3ABT A;  2F95 B;  1KBH A;  3L73 H;  2ITD C;  5LMU B;  2GDS A;  2P6J A;  1NVP D;  1WAZ A;  4WFH A;  4TT3 G;  2WLI B;  1PP9 H;  1YEW A;  2CTR A;  4U3F H;  2LQT A;  2P5O A;  2XAS A;  4IIJ B;  2QWN B;  2HEP A;  2UUC O;  4ABM A;  5HFM A;  2ITC C;  3CC4 V;  3LNN A;  4BR6 A;  4TWK A;  2F66 C;  3E2E A;  1UPG A;  4DV5 B;  3WG7 C;  1NU1 H;  2YSU B;  5KX5 B;  2JRI A;  4AI8 A;  4QE9 A;  5GON A;  1JPX A;  1H38 A;  1AP6 A;  1KMI Z;  3S3X A;  3CE2 A;  1HNX B;  2P90 A;  2YXH A;  5E79 Z;  1AR4 A;  5KLV H;  4WFE A;  4U3J B;  4PV1 B;  3APO A;  3OMA B;  4TV8 A;  4MW8 A;  3J80 N;  2Y69 C;  1ENV A;  1V54 B;  4H44 B;  2Z5U A;  4NTY A;  1OCO B;  3CB2 A;  3G4S V;  3THO A;  5B1B B;  1BE3 H;  4I4T B;  1FXH A;  2AW9 A;  2HKO A;  2WLL B;  3RBZ A;  5CA0 B;  2QWO B;  4X62 O;  2OCC C;  3TET A;  2AHY A;  2FYU H;  4JAU A;  2IBZ H;  4KL1 A;  3RYF A;  4O4I B;  4G2K A;  2DOS A;  4J10 A;  2HR3 A;  2QTS A;  2HVK C;  3HB3 B;  1MZE A;  1YTF D;  4ZHQ A;  1GTO A;  3A0R A;  2F4V B;  3BY6 A;  2KG7 A;  3EFF K;  1SET A;  1CP9 A;  5JWP A;  2HG5 C;  2CTQ A;  3A2F A;  5CN0 A;  2EZO A;  3OM3 B;  4YHH B;  2HLD G;  3W7T A;  2LJ2 A;  2ETN A;  4I50 B;  2L6L A;  4PI0 A;  3R66 A;  4RO2 A;  1NT2 B;  4P9O A;  3ZED A;  3BA8 A;  1PM9 A;  5H6R A;  1WA8 B;  2KB1 A;  5C8Y A;  4B3S O;  4R50 A;  2AHZ A;  1OV9 A;  1F4M A;  1Q82 W;  3OE7 G;  1JQ0 A;  4J80 A;  4UUJ C;  1E1Q G;  2W0F C;  2YI9 A;  2QSA A;  4JYA O;  3B09 A;  2C2A A;  4JTA B;  3JAL A;  3OD4 A;  5GW7 A;  3ABL C;  3G80 A;  3SJB C;  2YC0 A;  3T2M A;  4OGQ B;  3IC9 A;  3ABU A;  2BTQ A;  3C3T A;  1J5E O;  4J9Y B;  3ASO B;  2LW7 A;  1Q3E A;  2EIL B;  2ZIO A;  5JQG B;  2MW2 B;  4OXS A;  3B77 A;  2YXY A;  4FLY A;  4ZI7 A;  1JJ2 U;  3N2K A;  5IY5 B;  5JVD B;  1QQC A;  4FIP C;  2UXB B;  1P7G A;  4X20 A;  1ARO P;  3J81 N;  4WFG A;  2UUA O;  1Y4M A;  1N36 B;  2E74 B;  2R9R B;  5EC2 C;  3K5O A;  1AVM A;  5JCO C;  1IBK O;  2UUB O;  4FZ1 A;  2VWJ A;  1PD3 A;  4FLW A;  3WFV A;  4B08 A;  3ZCC A;  1D5A A;  3HKB B;  1S0V A;  4LFB B;  1XMO O;  2P7T C;  1VQ6 V;  3JAR B;  3HKE B;  1FJG O;  1VQ8 V;  5B1A C;  1GM9 A;  1KB9 F;  2XT9 A;  4RAI A;  3SPH A;  3LDC A;  4R6Z A;  3ZMS A;  3RW0 A;  2EIJ C;  2EZP A;  2HP8 A;  3G6B A;  5K1X A;  4B3R B;  5L3E A;  1AI6 A;  3AG3 B;  1XEQ A;  4LF7 B;  2UU9 O;  1URF A;  1WP7 A;  2Q8V A;  5CBG A;  2E5L B;  1Z2G A;  3RWR D;  3RYH A;  5IYZ B;  5IJ9 A;  1JA8 A;  4CZZ A;  5IT9 N;  3FD9 A;  4LF8 O;  5KHH A;  4PA3 A;  2NR5 A;  2EIN C;  3K06 A;  3A0B Z;  3T1C A;  2W6J G;  2IW5 A;  2OTJ V;  3IC7 A;  3ABK C;  3JAT B;  1QR9 A;  5J2T A;  1MNG A;  3O65 A;  5FPO A;  1M56 C;  2QKC A;  3TK1 A;  4QPJ A;  4HNA B;  5B3S B;  1FFT B;  1Y76 A;  3RYC A;  4DUY O;  3L70 H;  4K3A A;  3ABM C;  1ZUQ A;  1VEW A;  1YJ9 V;  1CPY A;  2K1E A;  4DUZ B;  2GTA A;  5L3G A;  5H5N A;  3OGI B;  1BQ0 A;  4YY3 O;  2P22 C;  3RYI B;  3IFX A;  4B7K A;  3SYP A;  1QNM A;  4O4J A;  2YDE A;  2ZT9 B;  3NXS A;  3ICX A;  2EX3 A;  2ZXW B;  1IBM O;  1JFF B;  4FVM A;  4XBF A;  3ZMT A;  5L3F A;  3D3Q A;  1O9H A;  4O2B A;  1T5E A;  1WN7 A;  4JV5 O;  1PNL A;  4YJ3 B;  4ICG A;  4FLV A;  3CS5 A;  2PY5 A;  1YCI A;  3P30 A;  4K8Z A;  1N0N A;  1SRY A;  5EZY B;  4LFA O;  4DV4 O;  1N33 O;  2QWR B;  5LP6 B;  2EIK C;  2IJI A;  2ZD9 A;  3CC7 V;  3OT7 A;  1BL8 A;  1ZTE A;  5LXT A;  3VQX A;  2KKW A;  1YJN V;  1VF6 A;  3CCS V;  1IVS A;  4O4L B;  2KSD A;  1SQV H;  4LWS B;  1LR1 A;  2IH1 C;  2YEV B;  4XDL A;  2LFR A;  1I0H A;  1Q6H A;  1S72 V;  4QPK A;  2DQ0 A;  1BCC H;  1JR9 A;  1SQX H;  3MAQ A;  1M4U A;  4JYY A;  4JPR A;  3SJA C;  3K5N A;  3AG2 C;  3ETQ A;  1HNW O;  3K3W A;  1SQF A;  3OW2 U;  4JI3 O;  4P9P A;  1GM8 A;  2Q4P A;  4LP8 A;  1H8H G;  2OWO A;  2EBO A;  4Q20 A;  3E83 A;  2X6A A;  1JVM A;  3GWO A;  4DV1 B;  1I94 O;  1AB3 A;  5JCO A;  1EN6 A;  2OT5 A;  3RVZ A;  2Y0P A;  4JI4 B;  2UXC B;  1BQZ A;  1VF5 B;  4O4H A;  1W59 A;  4PDV A;  3QF7 A;  3VQV A;  3QO5 A;  4EB6 A;  2MK3 A;  2WLK A;  4UCR A;  4JI8 B;  1BHA A;  3OFN G;  4PI2 A;  4I9W A;  2GHY A;  2AZ2 A;  4B3T B;  1K92 A;  1QR8 A;  4DV2 O;  3ASN C;  2QEX V;  1OCZ C;  2Z0A A;  5EIB D;  1DF5 A;  4W4K A;  3M8A A;  4Q6G A;  1XNR B;  3ZS8 C;  2UXD O;  3L72 H;  1IUR A;  2OCH A;  2ARH A;  1NTM H; 
#chains in the Genus database with same CATH homology
 1DK1 A;  4DV6 O;  4JV5 O;  4JI7 O;  1F7Y A;  4JI1 O;  1IBK O;  2UUB O;  2DOS A;  1YZB A;  3T1Y O;  4DV5 O;  4OPA A;  1KUQ A;  5BR8 O;  2ZM6 O;  4LFA O;  1N32 O;  4DV4 O;  4NXM O;  1N33 O;  4DV3 O;  4DV0 O;  1XMO O;  1G1X B;  1FYJ A;  1FJG O;  2VQF O;  4NXN O;  1IBL O;  4X65 O;  3RT3 C;  1HR0 O;  4DV1 O;  4DR3 O;  1HNX O;  1XMQ O;  1XEQ A;  5IWA O;  4OX9 O;  2UU9 O;  4JI4 O;  2UXC O;  4AQY O;  3R66 A;  4LF6 O;  4DR4 O;  4LF9 O;  2N74 A;  2UUC O;  4DUZ O;  1R1B A;  4JI8 O;  4A5U B;  4JI0 O;  5IT9 N;  2VQE O;  1FKA O;  4LF5 O;  4DR7 O;  4KHP O;  4B3T O;  2FKX A;  4B3S O;  4LF8 O;  4DR2 O;  2UXB O;  5BY1 A;  2AGA A;  1N34 O;  2F4V O;  1HNW O;  2JRI A;  4JI6 O;  4DR1 O;  4DR6 O;  4LFC O;  4JI3 O;  3SDL A;  4JYA O;  1X59 A;  1XNR O;  1N36 O;  2HHH O;  5BXZ A;  3T1H O;  4K0K O;  2DJV A;  3O65 A;  1HNZ O;  4LF7 O;  1I94 O;  1AB3 A;  4GKJ O;  1J5E O;  4DV7 O;  4JI5 O;  4DUY O;  1A32 A;  4OPH A;  2LW7 A;  3OTO O;  4LFB O;  1D2D A;  5FLX N;  5LL6 Y;  5LMN O;  3J80 N;  4X64 O;  1AIL A;  2ZKO A;  5LMU O;  5H5N A;  4JI2 O;  4YY3 O;  4X66 O;  4DV2 O;  3JAM N;  1R6T A;  4YHH O;  4B3R O;  3J7A U;  2Z0A A;  3J81 N;  4B3M O;  4DR5 O;  2UUA O;  3M8A A;  1IBM O;  4LF4 O;  4X62 O;  4GKK O;  1NS1 A;  5A2Q N;  2UXD O;  3F5T A;  2E5L O;  1XNQ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...