1XNQO

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1xnqO00
2DJVA 5IWAO 4JV5O 2UUBO 4LF6O 5LL6Y 1FJGO 4YY3O 2FKXA 3JAMN 2UUCO 4LF5O 4JYAO 4LF9O 4DR2O 2UUAO 5BXZA 1N32O 3T1HO 1F7YA 2HHHO 4DV0O 5LMUO 2UXDO 2JRIA 2N74A 4DV5O 2LW7A 4LF7O 2VQEO 4DR6O 2UXBO 4JI1O 4DUZO 4DR5O 4DV2O 1XMOO 1I94O 1XNQO 4DR1O 1R6TA 3T1YO 4NXNO 2UU9O 4JI0O 4OPHA 1N36O 4JI8O 3SDLA 4DR4O 3J7AU 4NXMO 4OX9O 4LFCO 3O65A 1KUQA 4JI4O 2DOSA 1FKAO 4B3SO 1HNXO 1AILA 4B3MO 4GKKO 2VQFO 4JI5O 1HR0O 1A32A 4OPAA 5IT9N 1J5EO 2UXCO 4KHPO 4LFAO 2F4VO 4JI7O 4A5UB 3F5TA 4LF4O 4X65O 1G1XB 1FYJA 1XMQO 3J80N 4K0KO 4DV6O 4DV1O 1N33O 4DV3O 5H5NA 3R66A 4GKJO 4LF8O 1IBLO 4X64O 1NS1A 4JI3O 4X66O 5LMNO 1IBMO 1DK1A 4JI2O 3RT3C 1YZBA 2AGAA 4DR7O 5BR8O 2ZKOA 4DV4O 2Z0AA 1X59A 4YHHO 4B3RO 4B3TO 4X62O 3J81N 5FLXN 5A2QN 1IBKO 4AQYO 1D2DA 1XEQA 3M8AA 4DR3O 2E5LO 4LFBO 4JI6O 5BY1A 1AB3A 2ZM6O 1N34O 1XNRO 4DV7O 4DUYO 1HNZO 1HNWO 3OTOO 1R1BA
chains in the Genus database with same CATH superfamily
2DYSC 4PJ0Z 4B7EA 5CA3A 1KMIZ 2UUBO 3SJBC 1OCRB 2EJRA 4YIOA 4DR2O 3JCUZ 1HWYA 1SQPH 1LR1A 2ITCC 1W2BU 2XAQA 3WB0A 1XREA 1NJIW 2QDOA 5FL7G 3RYIA 2EINB 2NN4A 3JSNA 5B1BB 2X6AA 2WLJA 4FLYA 2IJJA 4UB6Z 3L70H 3SPGA 3B09A 2YSUB 2XAHA 4FLXA 2Z5UA 1ENVA 1K34A 1ZSPA 3DTUB 4I9QA 3AG1C 2CH7A 2XT9A 2LGQA 1K5QA 1QVFU 2QEXV 2NLJC 4WFFA 3VQVA 3CCEV 2XAFA 4H33A 1VF6A 3ASNC 3BABA 3FB8C 4WBNA 3IJ4A 4X64O 2OIEA 1XILA 3K58A 5LMNO 5LP6B 4JTCB 1B6QA 2E3CA 3X2QC 5CB4A 1GRJA 4WCEV 2ZQMA 1YVWA 3K04A 2ZNIA 5B1AB 1PL4A 1M56C 2ETNA 4H37A 3B4SA 1D2DA 4DV2B 5L3EA 1S5HC 1WJZA 3SYAA 1GN6A 4TV8A 3ABLB 3K06A 1NZ6A 5ITZA 3HKBB 4PI2A 4CS2A 4I9WA 4F6RA 3CRRA 3OFNG 3CJHA 4TQDA 1XMOB 5LHIA 4LWSA 1N0JA 1XBLA 3EXAA 4LF5O 4E2LA 2WWWA 5EC1C 2ZDIC 1FXKA 1D5NA 1QQCA 2HLDG 3DSQA 3A0BZ 5DECA 3A8TA 1I0HA 1S5LZ 4YIPA 4I0XA 1KYOF 3FB7C 5K1PA 1O9GA 2Y0PA 2WSSG 4CH3A 1TVKB 4DR1O 3QF7A 4PHZA 1Y66A 3D3IA 4JI2B 3CCQV 5KHGA 3J7AU 1KP2A 1Z2GA 1GH6A 2CAZC 4OX9B 2EINC 1ZTEA 4JI4B 1Y67A 3CMAV 3ABKC 5IYCO 4JI3B 2JGDB 2KQXA 3FD9A 3M7MX 3D3QA 4W4LA 3K5LA 3W7WA 1NR1A 2PGGA 3EHBB 4RUFA 1VMGA 1YI2V 3CYOA 4BIUA 1OCOB 2WLIB 4P30A 4ZHQB 3RVYA 5HFMA 4O4HB 2B1GA 4W4KA 4L87A 4JASA 1IBMO 3BVOA 2FB5A 3JAWB 1EFRG 1JFFB 4J10A 3K79A 3A0RA 1U97A 3FKSG 3K5OA 4MSWC 4DRXB 1P49A 5A2QN 1VF5B 1JCHA 4ZI7B 3CXHF 4NTWA 1THZA 1AI5A 1Q5OA 2X0LA 3RN4A 2B5UA 5E1AC 2Q7EA 2YI8A 5BY1A 5B66Z 1EN4A 2RMKB 2EILB 2E74B 2A9HA 3H1IH 4LF4B 3CRMA 2ZM6B 2ZE7A 3ASOB 2F23A 1IDSA 1KC8W 5LA6B 3T1CA 1HDJA 4LF9O 4CH6A 2HVJC 2JGUA 2IH1C 2F4VB 1H8EG 4MVRA 2FMLA 4TV9B 4X62B 2Q68A 4DR6O 4JI1B 2N05A 1OHHG 2WLHA 1S72V 2OCHA 1P7BA 4CS4A 1XNQO 3HKCA 1JJ2U 4JI7B 4I55B 1NTMH 3K5NA 3TGUH 2CUGA 1SA0B 4BR6A 1Q81W 2JVDA 3O65A 1NKDA 2KB1A 3K03A 1BGYH 3MHHC 3OTOB 4XBFA 2HP8A 1IBKB 1Y6XA 1N0NA 2PYLA 1FJGB 4JI5O 3T4ZA 4DR1B 4KHPO 3RFRA 4MT8A 4O2BB 4JI7O 1PNKA 2JS5A 3W7TA 5LMUB 2R9IA 3P32A 3ZCCA 5JVDA 4X1IB 4JZ2A 1B06A 4DV3O 2P06A 3C90A 2NNUA 1VP7A 1N36B 1RFYA 4JI2O 3ZMUA 4DR7O 5BR8O 4NB5A 5LGTA 1PV0A 5J2TA 4NTXA 4LH6A 1AJNA 1Y4MA 2UXNA 4X1YB 3AEIA 2CK3G 4D7SA 5GONA 2M7WA 4UB8Z 4RO2A 1BCCH 3CSXA 4LF7B 4FZ1A 2RN9A 1XDCA 2DJVA 4LP8A 1SKVA 4LF6O 3ZHSA 1KKDA 2V7QG 5LMNB 5KHHA 2CDYA 1M9NA 1I5XA 3SJAC 1Y76B 3E8BA 2C2AA 4TOIA 3HKDB 1G6UA 4UXNA 3ZRWA 2JRIA 4G27B 3IC9A 5H6QA 2FYUH 2WLLB 3OM3B 2IW5A 3ABMB 4JTDB 4DUZO 4I0XB 2AHZA 2QWPB 5JCOC 3JALA 1EBOA 1K5SA 4WF9V 1L0NH 2WAMA 2DQ3A 4JI4O 1S77D 3ZMSA 4FFBA 3LUTB 2PYJA 3RBZA 3RYHA 5C93A 2YUAA 1NH2D 1SZTA 1RSOA 4J80A 3S3XA 5KMGB 4LF4O 5LP6A 5GTHZ 4O4IB 1XHXA 2YIDA 4ZOLA 2ZR2A 3ZX6A 3R66A 3ETEA 1K73W 1R73A 2LGWA 1AROP 1F4MA 4X1KA 4MTGA 3BA9A 1JVMA 5K1XA 5IJ0B 3ZS8C 1JJOA 4GT1A 3UO3A 1VEWA 1RM1B 4B3TO 4QGPA 1YITV 3K0DA 2N04A 2QA4V 3E35A 3ZHQA 5FPOA 3QNEA 5IYZA 4PA4A 5KX5B 5LP6C 2VQEB 2Q9LA 3MHSC 3OMNB 2RJZA 5EBWC 1EZJA 3CCJV 1ORQC 2JGDA 4YY3O 2UUCB 2FKXA 2QJ1A 3UT5A 1QCEA 1VQNV 1GM8A 2XOKG 3RGBA 2PI4A 4PDRA 4CC5A 1QVGU 3LNMB 4TUYA 1SQVH 3JATA 3BEHA 5IDJA 4G2KA 5EBLC 4JI1O 1JPXA 1XMOO 3VQWA 2LQTA 4H0LB 2EIMC 3UCSC 4O4LB 3JD0A 1CPYA 3SDLA 1BQZA 1M57C 3RWRD 4EKWA 4YHHB 1NU1H 1E1QG 4B3SO 4I5SA 4JYYA 3GWKC 4UCTA 5LYJA 2YXYA 1SQXH 3F7VC 3N2KB 1JA8A 1Q90D 1XL6A 1GN3A 4I7ZB 4ZHQA 1RM1C 5LBQA 2P67A 3OR7C 4BW5A 4X1IA 5LGNA 2D3OW 3JD3A 1US6A 1XMQO 4DW0A 4JTAB 1N33O 2IU0A 1H2SB 2QR4A 1F23A 4DR3B 3FB6C 3F5WC 4QIWF 1WP7A 4Z1MG 3JALB 2YDEA 3ZHUA 1R3JC 1YF2A 2HJDA 5CA1A 5KA5A 1PNLA 2JJ2G 4X1KB 1NR7A 2EBOA 1P4RA 3E8HA 2Q5ZA 3RYCA 3LDCA 3MAQA 2UU9B 3AG7A 5GTIZ 1BL8A 3AG2B 3W7XA 3N2GA 1GN4A 1JQ0A 1VF7A 2ZR3A 5KMGA 1XNRO 4AHCA 1HNZO 1SQQH 4K3AA 1GM7A 1HNXB 3E86A 5EYPB 1S5JA 1FXKC 4B3MB 4MVQA 5B3SB 1R6KA 2EIJC 1YEWA 2BSKB 5L3GA 2P90A 2YC0A 2UXCB 2LFRA 5BXZA 2X6CA 4X89A 4DW1A 3T1HO 3ZRWB 2N74A 5C8YB 4J41A 1JR9A 1HNZB 1BHBA 1TUBB 4DV3B 1I94O 1NTKH 2UU9O 1MMMA 2F95B 1N36O 4B08A 2A06H 5F2VO 1QU7A 2BCCH 5KA6A 5JCOA 3AG3B 4UV9A 3ZEDA 5H9CA 3G4SV 2ZE8A 4FMTA 3WG7B 2ADQB 2YEVA 3B8MA 1PPJH 1A32A 2IH3C 3CPWU 2Q0OC 4WFGA 5LXTB 2A3QA 4LFAO 1B04A 3APQA 1DF4A 1GMGA 4IIJA 5CA1B 4TSFG 3W7UA 4RAIA 5FNVA 5KHKA 4X65B 5L3FA 4QNHB 2CH7B 4GX0A 5JH7A 2YXLA 1IBLO 4DRXA 1PL0A 3I5DA 4BW9A 2Q8VA 1YZBA 1N34B 2Z3YA 2ILMA 4U3JB 4YHHO 3ZN0A 5B3SC 3OW2U 4X62O 3FB5C 2ZDIA 1VQ5V 3ICXA 1QR8A 3AK2A 1KECA 4UCOA 5DM6V 1PM9A 1NI8A 1ZWIC 1N34O 4ABMA 4XDLA 2EIKB 3BAAA 3H1HH 2F93B 2QWNB 5CA0B 1BSMA 1DGSA 1WAZA 4QE7A 1P7GA 1IBLB 1YIJV 3D8CA 4X20B 1V9PA 1SERA 1WLEA 4HNAB 1M56B 2G38A 3ETDA 4FZ0A 3K57A 2LW7A 1K8AW 1VQ8V 2Y48A 5D5QA 3GWOA 2H94A 1FXKB 1H2KA 1JOYA 3VBBA 1R6TA 3BHPA 1V54C 1RPRA 3Q4HB 4OPHA 1IBMB 1XHZA 1YTFD 2WA3A 4C7UA 4MVZA 3D36A 1JMKC 3VQYA 1MNGA 5LYJB 4IGGA 3AG4B 1HR0O 5LGUA 3RYIB 2EIMB 4IHJB 2F4VO 3SYCA 4LR3A 1S0VA 3I56V 3CE2A 1PKXA 2GDSA 4KP4A 3BFRA 2NR5A 4TV8B 4UVBA 4DV6O 4J7ZA 2O57A 2LJ2A 1X4TA 2GTSA 2OTJV 4EFBA 3AG4C 4X66B 3UT5B 5CMUA 1IURA 2EZPA 4R8CA 2ZIOA 2R9RB 1SZXA 3JATB 4F6EA 5KHJA 3QVNA 3K3WA 5KX5A 3G6EV 3M8AA 4DV1B 2GTAA 3C3TA 1AP6A 4GKJB 1MA1A 4PDMA 1VQPV 1FXHA 3CD6V 2DW4A 1VQOV 2ZM6O 3MD0A 4CH5A 4DR5B 1QNMA 3OD4A 4HAMA 3KG2A 3OMAB 5GONB 1Q86W 2Y4TA 3CX5F 1IXMA 2GBOA 3FYIB 1OCZC 4NXMB 3OT7A 3BPZA 3LSSA 4LFAB 4NR1A 1F7YA 1RP3B 2QWQB 2QM4A 4TWKA 5IYBO 1NT2B 2UXBO 1BHAA 4GX2A 4CH4A 1Y76A 4K35A 4DXWA 1TVKA 3CC4V 1ZX3A 4JI0O 4MVSA 2PUSA 1I5YA 1B3QA 1K33A 2CTWA 2WLLA 3QO5A 4JGSA 1OCOC 1NTZH 3E89A 1Q6IA 2P4VA 5EIBC 1M4UA 3IAYA 4B3MO 4GKKO 1YJNV 1D5AA 1KQSU 1FPOA 3OUSA 4X20A 2VQFO 4BIOA 2DWDC 1J5EO 3JCZA 2YIBD 3CEIA 1QHTA 2OT5A 2V4DA 4QE9A 1VARA 5KAIZ 5IJ9B 4IL6Z 3AG2C 5JQGB 4AILC 2OTLV 3JARB 2P4KA 1PD3A 2HVKC 2KKWA 3ZIAG 4UCVA 4RQFA 3HKDA 3JAKA 5IWAB 1VQLV 2ZINA 3Q4HA 2JEXA 4YJ3B 2DQ0A 3RYFB 3UKMA 2X6BA 4TQFA 4DV4O 1X59A 4FIPC 1AI4A 1OCZB 2VRZA 5FLXN 2BOCC 3U0ZA 3K9SA 4K8ZA 4PA6A 3JD1A 1R3LC 1IVSA 2OCCB 2ZIMA 1WB8A 2UXXA 2HKOA 4OGQB 1WPBA 1YJ9V 3HKEA 4R7CA 4DV7O 4DUYO 4X88A 5H6RA 2KG7A 5B1AC 4P2ZA 4ZOLB 1R6NA 3IGAC 1NVPD 4FFKA 4GUNA 5LXTA 5KLVH 1Q8IA 4PDVA 4DV5O 2QGNA 4TV9A 3H1JH 5KHIA 5GW7A 4DR5O 1FXVA 3ZMTA 3T1YO 3HKCB 1XOUA 4FM0A 3B77A 4I4TA 3C3SA 3AK3A 4FLUA 1Y74A 4UFZA 2YXHA 4B3TB 2JIZG 2JS3A 1HNXO 1Q6UA 5CBGA 3CCUV 4CS3A 1I94B 3L74H 4FLVA 5IT9N 3OEHG 3A2FA 1S76D 1UFIA 1BE3H 4X65O 4P9OA 4IYIA 5E79Z 3T2MA 2IJHA 1JFFA 1Z5VA 4HYOA 3PN1A 4ZIBA 4JV5B 3JSLA 2DYSB 1QLEC 3ABKB 4ZI7A 1TUBA 3VOUA 5J2TB 1HNWB 4O4LA 3J81N 4J9YB 4RQEA 4JI0B 1L8DA 4GLXA 1QLEB 3LSQA 5EYPA 4O4JA 1AB3A 2XUMA 1YCIA 4UCRA 3W7SA 1N8RW 3ZJZA 4MVOA 1XMQB 3UQ8A 4PA7A 1R1BA 1L0LH 3HPLC 1VQ4V 4J7JA 4X64B 4FM1A 1LNQA 3HR0A 5EBMC 3CP1A 3QO7A 2P22C 3B8NA 1I7FA 4KUMA 3AG1B 4EB6A 2HHHO 3ZHTA 5LMUO 2ATKC 5EZYB 2PY5A 1CP9A 4K0KB 1MZEA 2P7TC 3E22A 3L9DA 1BQ0A 3B40A 3MDSA 4UCUA 1BMFG 4JYCA 4MTXA 2D2CB 4O4IA 1W0JG 4NYKA 4J42A 4U3FH 1MABG 2XAJA 3ASNB 1AR5A 1KUQA 3SR2C 2ZD9A 4U7NA 1GKFA 4GCZA 4I4TB 2XAGA 4FFBB 5EIBD 2W6JG 2AW9A 1VF6C 2E5LB 3G71V 2A0LA 4FLWA 4PA9A 5IY5C 1Q7YW 3M99B 3KZIZ 3HB3B 1VQ7V 1Q3EA 5J2UA 5A9GA 3JASA 4JI3O 1GTOA 1AI7A 1UJWB 1K9MW 4JYAB 5IJ0A 3JD2A 1AJQA 2ZNJA 1RSOB 2QTOA 3JAWA 3NXSA 3H9VA 5EK0A 2ADPA 2BTOA 3QTCA 2ZT9B 4FM2A 3DGEA 2WA4A 1YSCA 4FVMA 3UO2A 2QKCA 1IXBA 3CRAA 1ZUQA 1ROPA 3P3PA 3GB7C 4DR6B 3K9AA 4ASUG 4JPRA 5IWAO 1LUWA 3L71H 3RYHB 3CJHB 1GM9A 3FX7A 2AZ2A 1H2NA 5LHHA 1N32O 4DV0B 3JARA 5JQGA 3P30A 4OXSA 2GV9A 4DUZB 2ITDC 2EZOA 4NXNO 5AG2A 1J95A 3ZHVA 3WU2Z 3SYPA 2QM8A 3L75H 3LDDA 1GN2A 4XDKA 3D36C 4JAVA 1FFXB 4O2BA 3EFFK 1FKAO 3DXRB 5BMVB 1AILA 4UCSA 1G4YB 3ETGA 4X8AA 3ABMC 1K7DA 3J80N 4BWAA 3CHXA 3RYFA 1PNMA 2R72A 2Y4UA 5H5NA 2YI9A 4MVMA 4LF8B 2CTQA 3E8FA 1NS1A 4LF6B 4MTOA 1N4CA 4WFBV 1JX9A 4QJFB 2WLMA 4DR7B 1NBMG 2ZKOA 1OCRC 3T1HB 1R3KC 2Z0AA 1ZL8A 4B3RO 1M1KW 4DV5B 4CZZA 4PA3A 2OYQA 1SQBH 3CS5A 2JK5C 3CCRV 1XEQA 3ZRSA 5IY5B 3CCLV 4U3JA 1WA8A 4JI6O 3JD4A 4N21A 1WN7A 4ZKIA 4JI8B 4I50B 2X7RB 1RPOA 1MZFA 4PV1B 5BR8B 3U11A 3ABTA 4WFEA 2BTQB 2RQ6A 2YS8A 3ETQA 5JVDB 1VQ6V 3FFQA 4JAAA 5EC2C 4YJ2A 1FFXA 3KKYA 4MW3A 4LF7O 1XNRB 1GK9A 1EN5A 1YDXA 2R70A 1XI1A 4J9ZB 1KU9A 2RCVA 4O2AA 1OJHA 2QE7G 3B2EE 4LF9B 3KCXA 3ZMZA 4PD4F 3OUFA 4UVCA 1YXBA 1TAEA 3K0GA 2EX3A 5DN6G 3T1YB 2UXCO 3TCUA 5CN0A 2Y0IA 4O4JB 3E22B 3QO8A 2XASA 3ZN1A 1H2GA 4FPPA 1AVMA 4UVAA 1VIBA 5FNVB 2BOBC 5B1BC 2DWEC 4YJ2B 3BA8A 4DV1O 5JH7B 2IJIA 3L72H 4D7TA 1M5IA 4LF8O 4G28B 2ARHA 3QG5A 4TT3G 1UPGA 1KKCA 4L8JA 4MW8A 2Q67A 2UUAB 2EIJB 3N27A 4LFCB 3WFVA 1OCCB 2HHHB 3ZMVA 3O9OA 4DK0A 2F66C 3FAVB 2W0XA 4MS2A 4YJ3A 5HFLA 1Q82W 4J11A 1SF9A 4PDLA 1LUVA 5LOVB 1HR0B 2RDCA 2L35A 3THOA 3TXSA 2IJKA 2JDIG 3GVMA 3JASB 1AR1B 4PELA 1SS3A 4DR4B 4BIZA 2CGOA 4JZGA 4NVPA 1YHQV 4GZRB 4FLZA 1MOFA 3X2QB 5KAFZ 2DYRB 4DO2A 1H38A 5IJ9A 1H2MA 4EFEA 3JAMN 2UUCO 1H2LA 1MG1A 2ZCEA 2UUAO 2FL4A 2ZXWB 4IT5A 4DV0O 2PTMA 2XNDG 4B3SB 2VQEO 4AI8A 5L3BA 2DYRC 2YIBA 4X9QA 1J5EB 2DE0X 5CA0A 2QSAA 3T4DA 4EEQA 1V55C 1G8MA 4OX9O 5B1NA 2ZE5A 3RVZA 2LO1A 3OR6C 3G67A 4MTFA 3DC6A 2DOSA 1YJWV 2QTSA 3BRCA 3H01A 4LBEC 1H8HG 4LF5B 3R65A 2WLIA 1F4NA 4KHPB 1HP8A 3F5TA 3LNNA 4PI0A 5JJNB 1XUQA 3WG7C 1TA8A 2B1IA 3G80A 2PZSA 2VS0A 3PJSK 2ODMA 2GUZA 3AG3C 5BMVA 2AGAA 4UV8A 1M90W 2VWJA 2BTQA 3ZRVA 2WPDG 3SJCC 4IIJB 3L73H 3CCMV 1SETA 3H1LH 4LH7A 1IBKO 3CCVV 2UXBB 2HG5C 3ML0A 4AQYO 2XHBA 2W6IG 3TK1A 3FYEB 3K5MA 4DR3O 2E5LO 4R50A 2F43G 2HR3A 2K1EA 3LSUA 3TETA 2QM7A 4LWSB 5H2FZ 4FJCC 3SPIA 4H44B 1SA0A 2H8PC 2JJ1G 2BE3A 4QPJA 2V1DA 2Q6AA 3DXRA 1U96A 2LP7A 5ITZB 2CGNA 1BS3A 4X1YA 1V54B 1DTOA 5L3DA 2JEUA 3LDEA 2CTRA 1N32B 4IHJA 2HEPA 3ZBHA 1Q6HA 1E1RG 4CC6A 2UXDB 1K4CC 2UXDO 1V55B 1YTFB 2OWOA 3EVKA 3OMIB 3TJTA 4R6ZA 5B5EZ 3BCCH 1AR4A 2DMXA 3N2KA 1DF5A 2QWOB 3CWBH 2EULA 2A79B 3S3WA 5LA6A 3APOA 5JWPA 3CCSV 1BT8A 3SPHA 4U7OA 4DR4O 3RW0A 2EIKC 1W59A 3ABUA 4WFHA 1AI6A 3HKEB 3CB2A 1NH2B 1WNSA 2QKAA 1F51A 2ZXWC 1OZ0A 3NR7A 3IC7A 4YY3B 1KB9F 2EJ7A 2KG7B 2VQFB 3OGCC 3P3NA 5CBFA 5B1OA 4NXNB 2HFEC 3ZHRA 2QKSA 1E79G 4NTYA 2CE4A 4A5UB 4F4LA 4TUYB 3SPCA 4UUJC 3ABLC 1QBZA 4JAUA 1Z5WA 1G1XB 4EB6B 1CXZB 3ZRXA 4DYLA 2YICA 3OGIB 1XNQB 5TISZ 4KXRA 2UUBB 1EN6A 3RT3C 1M93A 3SGIA 5KUMA 1SQFA 2XTAA 5J2UB 1I08A 2MK3A 5J9PC 3CXCU 2LW1A 2Q69A 3WB1A 3BY6A 2E76B 1TUEB 1N33B 4Q20A 5D5PA 4LFBB 3OE7G 5IYZB 1DLBA 2W0FC 1COWG 3STZC 2LFSA 4Z1VA 5JJJB 5EZYA 2PI5A 2Y69C 4HNAA 2Q4PA 2WLKA 4ZBMA 1K92A 4GKKB 2H3OA 3OTFA 1PP9H 2GUZB 4P9PA 1TGOA 4XDJA 4QPKA 4B3RB 1P84F 1MSDA 2P6JA 4YXWG 4DV6B 1QLNA 4DUYB 4DV2O 2M6YA 3AK1A 4IYHA 1SESA 1NVPB 3RYCB 2DN9A 1IX9A 4LCUC 5KUKA 3STLC 4BAYA 4F6RB 2OIGA 1L1FA 2Q7GA 3K08A 4KFMA 1R3IC 4B7KA 3E8GA 3K59A 2IBZH 3E83A 1OV9A 3JYCA 2AXTZ 5JJEB 1WP8A 4ICGA 1O9HA 4JYBA 2WLNA 3A0HZ 3OAAG 2QWRB 4RUEA 1KBHA 1K4DC 1AP5A 1KP3A 1WB7A 4GKJO 1FAFA 4MVUA 1KD1W 1DK1A 3I55V 4FK5C 4HBNA 2CTPA 5CBHA 2P5OA 3CRQA 5L3CA 4DK1A 3CMEV 4I55A 4I50A 3ASOC 4N23A 1QR9A 3E2EA 2Q7HA 2YEVB 4LFBO 1W0KG 3SYOA 1T5EA 2Q73A 4GX5A 3HKBA 2B9ZA 3SJQC 3CC7V 2HJFC 1K97A 3IFXA 1HNWO 1M57B 4H13B 5IE9A 1NQTA 3OTOO 4Z2WA 4JV5O 1K3EA 5LL6Y 1FJGO 4KL1A 1S3JA 4LNUB 3SPJA 1SQGA 4GX1A 5BZBA 2BSKA 1SC5B 4JI5B 5LOVA 4HZ3A 4Q6GA 4JYAO 3VQXA 5DEDA 1FFTB 2Y69B 1SRYA 1XQ8A 5C8YA 3CRCA 1URFA 3DC5A 4LNUA 1Q43A 3H1KH 2GSMB 1WPXA 4WBNB 3UM7A 4JI6B 2FTKA 4JI8O 4E4EA 3G6BA 1FD9A 2R9AA 4NXMO 4LFCO 4JF3A 2K9PA 4LC1A 2KSDA 4NKGB 1EZVH 1GO3F 2AHYA 3OEEG 1XL4A 1IZ3A 4D6TH 4OPAA 2AZ0A 3JAKB 1OCCC 1BZKA 3N2GB 2E75B 2L6LA 3U10A 3CC2V 4K8XA 1CEZA 1FYJA 1Y74B 4K0KO 2YIAA 1MSWD 3WB2A 2IM9A 3KCYA 4O4HA 1VQ9V 1WA8B 2A7WA 1VQMV 2PF4E 2VWKA 2GHYA 2ZE6A 4X66O 1FS0G 3FAVA 2EILC 4GYCB 1VQKV 2OCCC 4RWUA 1ZAUA 1ZLZA 2RNBA 4O2AB 2Q0AA 1HW7A 4AQYB 3F7YC 4FLTA 1ZL8B 4CBCA 1AJPA 3SYQA 4DR2B 1EM1A 5FPRA 4J7KA 4WFAV 2IU3A 5CB4B 5LHGA 2MW2B 3TXQA 4DV7B 4DV4B 2F1MA 5IYDO 1GAXA
chains in the Genus database with same CATH topology
2DJVA 5IWAO 4JV5O 2UUBO 4LF6O 5LL6Y 1FJGO 4YY3O 2FKXA 3JAMN 2UUCO 4LF5O 4JYAO 4LF9O 4DR2O 2UUAO 5BXZA 1N32O 3T1HO 1F7YA 2HHHO 4DV0O 5LMUO 2UXDO 2JRIA 2N74A 4DV5O 2LW7A 4LF7O 2VQEO 4DR6O 2UXBO 4JI1O 4DUZO 4DR5O 4DV2O 1XMOO 1I94O 1XNQO 4DR1O 1R6TA 3T1YO 4NXNO 2UU9O 4JI0O 4OPHA 1N36O 4JI8O 3SDLA 4DR4O 3J7AU 4NXMO 4OX9O 4LFCO 3O65A 1KUQA 4JI4O 2DOSA 1FKAO 4B3SO 1HNXO 1AILA 4B3MO 4GKKO 2VQFO 4JI5O 1HR0O 1A32A 4OPAA 5IT9N 1J5EO 2UXCO 4KHPO 4LFAO 2F4VO 4JI7O 4A5UB 3F5TA 4LF4O 4X65O 1G1XB 1FYJA 1XMQO 3J80N 4K0KO 4DV6O 4DV1O 1N33O 4DV3O 5H5NA 3R66A 4GKJO 4LF8O 1IBLO 4X64O 1NS1A 4JI3O 4X66O 5LMNO 1IBMO 1DK1A 4JI2O 3RT3C 1YZBA 2AGAA 4DR7O 5BR8O 2ZKOA 4DV4O 2Z0AA 1X59A 4YHHO 4B3RO 4B3TO 4X62O 3J81N 5FLXN 5A2QN 1IBKO 4AQYO 1D2DA 1XEQA 3M8AA 4DR3O 2E5LO 4LFBO 4JI6O 5BY1A 1AB3A 2ZM6O 1N34O 1XNRO 4DV7O 4DUYO 1HNZO 1HNWO 3OTOO 1R1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJV A;  5IWA O;  4JV5 O;  2UUB O;  4LF6 O;  5LL6 Y;  1FJG O;  4YY3 O;  2FKX A;  3JAM N;  2UUC O;  4LF5 O;  4JYA O;  4LF9 O;  4DR2 O;  2UUA O;  5BXZ A;  1N32 O;  3T1H O;  1F7Y A;  2HHH O;  4DV0 O;  5LMU O;  2UXD O;  2JRI A;  2N74 A;  4DV5 O;  2LW7 A;  4LF7 O;  2VQE O;  4DR6 O;  2UXB O;  4JI1 O;  4DUZ O;  4DR5 O;  4DV2 O;  1XMO O;  1I94 O;  1XNQ O;  4DR1 O;  1R6T A;  3T1Y O;  4NXN O;  2UU9 O;  4JI0 O;  4OPH A;  1N36 O;  4JI8 O;  3SDL A;  4DR4 O;  3J7A U;  4NXM O;  4OX9 O;  4LFC O;  3O65 A;  1KUQ A;  4JI4 O;  2DOS A;  1FKA O;  4B3S O;  1HNX O;  1AIL A;  4B3M O;  4GKK O;  2VQF O;  4JI5 O;  1HR0 O;  1A32 A;  4OPA A;  5IT9 N;  1J5E O;  2UXC O;  4KHP O;  4LFA O;  2F4V O;  4JI7 O;  4A5U B;  3F5T A;  4LF4 O;  4X65 O;  1G1X B;  1FYJ A;  1XMQ O;  3J80 N;  4K0K O;  4DV6 O;  4DV1 O;  1N33 O;  4DV3 O;  5H5N A;  3R66 A;  4GKJ O;  4LF8 O;  1IBL O;  4X64 O;  1NS1 A;  4JI3 O;  4X66 O;  5LMN O;  1IBM O;  1DK1 A;  4JI2 O;  3RT3 C;  1YZB A;  2AGA A;  4DR7 O;  5BR8 O;  2ZKO A;  4DV4 O;  2Z0A A;  1X59 A;  4YHH O;  4B3R O;  4B3T O;  4X62 O;  3J81 N;  5FLX N;  5A2Q N;  1IBK O;  4AQY O;  1D2D A;  1XEQ A;  3M8A A;  4DR3 O;  2E5L O;  4LFB O;  4JI6 O;  5BY1 A;  1AB3 A;  2ZM6 O;  1N34 O;  1XNR O;  4DV7 O;  4DUY O;  1HNZ O;  1HNW O;  3OTO O;  1R1B A; 
#chains in the Genus database with same CATH topology
 2DYS C;  4PJ0 Z;  4B7E A;  5CA3 A;  1KMI Z;  2UUB O;  3SJB C;  1OCR B;  2EJR A;  4YIO A;  4DR2 O;  3JCU Z;  1HWY A;  1SQP H;  1LR1 A;  2ITC C;  1W2B U;  2XAQ A;  3WB0 A;  1XRE A;  1NJI W;  2QDO A;  5FL7 G;  3RYI A;  2EIN B;  2NN4 A;  3JSN A;  5B1B B;  2X6A A;  2WLJ A;  4FLY A;  2IJJ A;  4UB6 Z;  3L70 H;  3SPG A;  3B09 A;  2YSU B;  2XAH A;  4FLX A;  2Z5U A;  1ENV A;  1K34 A;  1ZSP A;  3DTU B;  4I9Q A;  3AG1 C;  2CH7 A;  2XT9 A;  2LGQ A;  1K5Q A;  1QVF U;  2QEX V;  2NLJ C;  4WFF A;  3VQV A;  3CCE V;  2XAF A;  4H33 A;  1VF6 A;  3ASN C;  3BAB A;  3FB8 C;  4WBN A;  3IJ4 A;  4X64 O;  2OIE A;  1XIL A;  3K58 A;  5LMN O;  5LP6 B;  4JTC B;  1B6Q A;  2E3C A;  3X2Q C;  5CB4 A;  1GRJ A;  4WCE V;  2ZQM A;  1YVW A;  3K04 A;  2ZNI A;  5B1A B;  1PL4 A;  1M56 C;  2ETN A;  4H37 A;  3B4S A;  1D2D A;  4DV2 B;  5L3E A;  1S5H C;  1WJZ A;  3SYA A;  1GN6 A;  4TV8 A;  3ABL B;  3K06 A;  1NZ6 A;  5ITZ A;  3HKB B;  4PI2 A;  4CS2 A;  4I9W A;  4F6R A;  3CRR A;  3OFN G;  3CJH A;  4TQD A;  1XMO B;  5LHI A;  4LWS A;  1N0J A;  1XBL A;  3EXA A;  4LF5 O;  4E2L A;  2WWW A;  5EC1 C;  2ZDI C;  1FXK A;  1D5N A;  1QQC A;  2HLD G;  3DSQ A;  3A0B Z;  5DEC A;  3A8T A;  1I0H A;  1S5L Z;  4YIP A;  4I0X A;  1KYO F;  3FB7 C;  5K1P A;  1O9G A;  2Y0P A;  2WSS G;  4CH3 A;  1TVK B;  4DR1 O;  3QF7 A;  4PHZ A;  1Y66 A;  3D3I A;  4JI2 B;  3CCQ V;  5KHG A;  3J7A U;  1KP2 A;  1Z2G A;  1GH6 A;  2CAZ C;  4OX9 B;  2EIN C;  1ZTE A;  4JI4 B;  1Y67 A;  3CMA V;  3ABK C;  5IYC O;  4JI3 B;  2JGD B;  2KQX A;  3FD9 A;  3M7M X;  3D3Q A;  4W4L A;  3K5L A;  3W7W A;  1NR1 A;  2PGG A;  3EHB B;  4RUF A;  1VMG A;  1YI2 V;  3CYO A;  4BIU A;  1OCO B;  2WLI B;  4P30 A;  4ZHQ B;  3RVY A;  5HFM A;  4O4H B;  2B1G A;  4W4K A;  4L87 A;  4JAS A;  1IBM O;  3BVO A;  2FB5 A;  3JAW B;  1EFR G;  1JFF B;  4J10 A;  3K79 A;  3A0R A;  1U97 A;  3FKS G;  3K5O A;  4MSW C;  4DRX B;  1P49 A;  5A2Q N;  1VF5 B;  1JCH A;  4ZI7 B;  3CXH F;  4NTW A;  1THZ A;  1AI5 A;  1Q5O A;  2X0L A;  3RN4 A;  2B5U A;  5E1A C;  2Q7E A;  2YI8 A;  5BY1 A;  5B66 Z;  1EN4 A;  2RMK B;  2EIL B;  2E74 B;  2A9H A;  3H1I H;  4LF4 B;  3CRM A;  2ZM6 B;  2ZE7 A;  3ASO B;  2F23 A;  1IDS A;  1KC8 W;  5LA6 B;  3T1C A;  1HDJ A;  4LF9 O;  4CH6 A;  2HVJ C;  2JGU A;  2IH1 C;  2F4V B;  1H8E G;  4MVR A;  2FML A;  4TV9 B;  4X62 B;  2Q68 A;  4DR6 O;  4JI1 B;  2N05 A;  1OHH G;  2WLH A;  1S72 V;  2OCH A;  1P7B A;  4CS4 A;  1XNQ O;  3HKC A;  1JJ2 U;  4JI7 B;  4I55 B;  1NTM H;  3K5N A;  3TGU H;  2CUG A;  1SA0 B;  4BR6 A;  1Q81 W;  2JVD A;  3O65 A;  1NKD A;  2KB1 A;  3K03 A;  1BGY H;  3MHH C;  3OTO B;  4XBF A;  2HP8 A;  1IBK B;  1Y6X A;  1N0N A;  2PYL A;  1FJG B;  4JI5 O;  3T4Z A;  4DR1 B;  4KHP O;  3RFR A;  4MT8 A;  4O2B B;  4JI7 O;  1PNK A;  2JS5 A;  3W7T A;  5LMU B;  2R9I A;  3P32 A;  3ZCC A;  5JVD A;  4X1I B;  4JZ2 A;  1B06 A;  4DV3 O;  2P06 A;  3C90 A;  2NNU A;  1VP7 A;  1N36 B;  1RFY A;  4JI2 O;  3ZMU A;  4DR7 O;  5BR8 O;  4NB5 A;  5LGT A;  1PV0 A;  5J2T A;  4NTX A;  4LH6 A;  1AJN A;  1Y4M A;  2UXN A;  4X1Y B;  3AEI A;  2CK3 G;  4D7S A;  5GON A;  2M7W A;  4UB8 Z;  4RO2 A;  1BCC H;  3CSX A;  4LF7 B;  4FZ1 A;  2RN9 A;  1XDC A;  2DJV A;  4LP8 A;  1SKV A;  4LF6 O;  3ZHS A;  1KKD A;  2V7Q G;  5LMN B;  5KHH A;  2CDY A;  1M9N A;  1I5X A;  3SJA C;  1Y76 B;  3E8B A;  2C2A A;  4TOI A;  3HKD B;  1G6U A;  4UXN A;  3ZRW A;  2JRI A;  4G27 B;  3IC9 A;  5H6Q A;  2FYU H;  2WLL B;  3OM3 B;  2IW5 A;  3ABM B;  4JTD B;  4DUZ O;  4I0X B;  2AHZ A;  2QWP B;  5JCO C;  3JAL A;  1EBO A;  1K5S A;  4WF9 V;  1L0N H;  2WAM A;  2DQ3 A;  4JI4 O;  1S77 D;  3ZMS A;  4FFB A;  3LUT B;  2PYJ A;  3RBZ A;  3RYH A;  5C93 A;  2YUA A;  1NH2 D;  1SZT A;  1RSO A;  4J80 A;  3S3X A;  5KMG B;  4LF4 O;  5LP6 A;  5GTH Z;  4O4I B;  1XHX A;  2YID A;  4ZOL A;  2ZR2 A;  3ZX6 A;  3R66 A;  3ETE A;  1K73 W;  1R73 A;  2LGW A;  1ARO P;  1F4M A;  4X1K A;  4MTG A;  3BA9 A;  1JVM A;  5K1X A;  5IJ0 B;  3ZS8 C;  1JJO A;  4GT1 A;  3UO3 A;  1VEW A;  1RM1 B;  4B3T O;  4QGP A;  1YIT V;  3K0D A;  2N04 A;  2QA4 V;  3E35 A;  3ZHQ A;  5FPO A;  3QNE A;  5IYZ A;  4PA4 A;  5KX5 B;  5LP6 C;  2VQE B;  2Q9L A;  3MHS C;  3OMN B;  2RJZ A;  5EBW C;  1EZJ A;  3CCJ V;  1ORQ C;  2JGD A;  4YY3 O;  2UUC B;  2FKX A;  2QJ1 A;  3UT5 A;  1QCE A;  1VQN V;  1GM8 A;  2XOK G;  3RGB A;  2PI4 A;  4PDR A;  4CC5 A;  1QVG U;  3LNM B;  4TUY A;  1SQV H;  3JAT A;  3BEH A;  5IDJ A;  4G2K A;  5EBL C;  4JI1 O;  1JPX A;  1XMO O;  3VQW A;  2LQT A;  4H0L B;  2EIM C;  3UCS C;  4O4L B;  3JD0 A;  1CPY A;  3SDL A;  1BQZ A;  1M57 C;  3RWR D;  4EKW A;  4YHH B;  1NU1 H;  1E1Q G;  4B3S O;  4I5S A;  4JYY A;  3GWK C;  4UCT A;  5LYJ A;  2YXY A;  1SQX H;  3F7V C;  3N2K B;  1JA8 A;  1Q90 D;  1XL6 A;  1GN3 A;  4I7Z B;  4ZHQ A;  1RM1 C;  5LBQ A;  2P67 A;  3OR7 C;  4BW5 A;  4X1I A;  5LGN A;  2D3O W;  3JD3 A;  1US6 A;  1XMQ O;  4DW0 A;  4JTA B;  1N33 O;  2IU0 A;  1H2S B;  2QR4 A;  1F23 A;  4DR3 B;  3FB6 C;  3F5W C;  4QIW F;  1WP7 A;  4Z1M G;  3JAL B;  2YDE A;  3ZHU A;  1R3J C;  1YF2 A;  2HJD A;  5CA1 A;  5KA5 A;  1PNL A;  2JJ2 G;  4X1K B;  1NR7 A;  2EBO A;  1P4R A;  3E8H A;  2Q5Z A;  3RYC A;  3LDC A;  3MAQ A;  2UU9 B;  3AG7 A;  5GTI Z;  1BL8 A;  3AG2 B;  3W7X A;  3N2G A;  1GN4 A;  1JQ0 A;  1VF7 A;  2ZR3 A;  5KMG A;  1XNR O;  4AHC A;  1HNZ O;  1SQQ H;  4K3A A;  1GM7 A;  1HNX B;  3E86 A;  5EYP B;  1S5J A;  1FXK C;  4B3M B;  4MVQ A;  5B3S B;  1R6K A;  2EIJ C;  1YEW A;  2BSK B;  5L3G A;  2P90 A;  2YC0 A;  2UXC B;  2LFR A;  5BXZ A;  2X6C A;  4X89 A;  4DW1 A;  3T1H O;  3ZRW B;  2N74 A;  5C8Y B;  4J41 A;  1JR9 A;  1HNZ B;  1BHB A;  1TUB B;  4DV3 B;  1I94 O;  1NTK H;  2UU9 O;  1MMM A;  2F95 B;  1N36 O;  4B08 A;  2A06 H;  5F2V O;  1QU7 A;  2BCC H;  5KA6 A;  5JCO A;  3AG3 B;  4UV9 A;  3ZED A;  5H9C A;  3G4S V;  2ZE8 A;  4FMT A;  3WG7 B;  2ADQ B;  2YEV A;  3B8M A;  1PPJ H;  1A32 A;  2IH3 C;  3CPW U;  2Q0O C;  4WFG A;  5LXT B;  2A3Q A;  4LFA O;  1B04 A;  3APQ A;  1DF4 A;  1GMG A;  4IIJ A;  5CA1 B;  4TSF G;  3W7U A;  4RAI A;  5FNV A;  5KHK A;  4X65 B;  5L3F A;  4QNH B;  2CH7 B;  4GX0 A;  5JH7 A;  2YXL A;  1IBL O;  4DRX A;  1PL0 A;  3I5D A;  4BW9 A;  2Q8V A;  1YZB A;  1N34 B;  2Z3Y A;  2ILM A;  4U3J B;  4YHH O;  3ZN0 A;  5B3S C;  3OW2 U;  4X62 O;  3FB5 C;  2ZDI A;  1VQ5 V;  3ICX A;  1QR8 A;  3AK2 A;  1KEC A;  4UCO A;  5DM6 V;  1PM9 A;  1NI8 A;  1ZWI C;  1N34 O;  4ABM A;  4XDL A;  2EIK B;  3BAA A;  3H1H H;  2F93 B;  2QWN B;  5CA0 B;  1BSM A;  1DGS A;  1WAZ A;  4QE7 A;  1P7G A;  1IBL B;  1YIJ V;  3D8C A;  4X20 B;  1V9P A;  1SER A;  1WLE A;  4HNA B;  1M56 B;  2G38 A;  3ETD A;  4FZ0 A;  3K57 A;  2LW7 A;  1K8A W;  1VQ8 V;  2Y48 A;  5D5Q A;  3GWO A;  2H94 A;  1FXK B;  1H2K A;  1JOY A;  3VBB A;  1R6T A;  3BHP A;  1V54 C;  1RPR A;  3Q4H B;  4OPH A;  1IBM B;  1XHZ A;  1YTF D;  2WA3 A;  4C7U A;  4MVZ A;  3D36 A;  1JMK C;  3VQY A;  1MNG A;  5LYJ B;  4IGG A;  3AG4 B;  1HR0 O;  5LGU A;  3RYI B;  2EIM B;  4IHJ B;  2F4V O;  3SYC A;  4LR3 A;  1S0V A;  3I56 V;  3CE2 A;  1PKX A;  2GDS A;  4KP4 A;  3BFR A;  2NR5 A;  4TV8 B;  4UVB A;  4DV6 O;  4J7Z A;  2O57 A;  2LJ2 A;  1X4T A;  2GTS A;  2OTJ V;  4EFB A;  3AG4 C;  4X66 B;  3UT5 B;  5CMU A;  1IUR A;  2EZP A;  4R8C A;  2ZIO A;  2R9R B;  1SZX A;  3JAT B;  4F6E A;  5KHJ A;  3QVN A;  3K3W A;  5KX5 A;  3G6E V;  3M8A A;  4DV1 B;  2GTA A;  3C3T A;  1AP6 A;  4GKJ B;  1MA1 A;  4PDM A;  1VQP V;  1FXH A;  3CD6 V;  2DW4 A;  1VQO V;  2ZM6 O;  3MD0 A;  4CH5 A;  4DR5 B;  1QNM A;  3OD4 A;  4HAM A;  3KG2 A;  3OMA B;  5GON B;  1Q86 W;  2Y4T A;  3CX5 F;  1IXM A;  2GBO A;  3FYI B;  1OCZ C;  4NXM B;  3OT7 A;  3BPZ A;  3LSS A;  4LFA B;  4NR1 A;  1F7Y A;  1RP3 B;  2QWQ B;  2QM4 A;  4TWK A;  5IYB O;  1NT2 B;  2UXB O;  1BHA A;  4GX2 A;  4CH4 A;  1Y76 A;  4K35 A;  4DXW A;  1TVK A;  3CC4 V;  1ZX3 A;  4JI0 O;  4MVS A;  2PUS A;  1I5Y A;  1B3Q A;  1K33 A;  2CTW A;  2WLL A;  3QO5 A;  4JGS A;  1OCO C;  1NTZ H;  3E89 A;  1Q6I A;  2P4V A;  5EIB C;  1M4U A;  3IAY A;  4B3M O;  4GKK O;  1YJN V;  1D5A A;  1KQS U;  1FPO A;  3OUS A;  4X20 A;  2VQF O;  4BIO A;  2DWD C;  1J5E O;  3JCZ A;  2YIB D;  3CEI A;  1QHT A;  2OT5 A;  2V4D A;  4QE9 A;  1VAR A;  5KAI Z;  5IJ9 B;  4IL6 Z;  3AG2 C;  5JQG B;  4AIL C;  2OTL V;  3JAR B;  2P4K A;  1PD3 A;  2HVK C;  2KKW A;  3ZIA G;  4UCV A;  4RQF A;  3HKD A;  3JAK A;  5IWA B;  1VQL V;  2ZIN A;  3Q4H A;  2JEX A;  4YJ3 B;  2DQ0 A;  3RYF B;  3UKM A;  2X6B A;  4TQF A;  4DV4 O;  1X59 A;  4FIP C;  1AI4 A;  1OCZ B;  2VRZ A;  5FLX N;  2BOC C;  3U0Z A;  3K9S A;  4K8Z A;  4PA6 A;  3JD1 A;  1R3L C;  1IVS A;  2OCC B;  2ZIM A;  1WB8 A;  2UXX A;  2HKO A;  4OGQ B;  1WPB A;  1YJ9 V;  3HKE A;  4R7C A;  4DV7 O;  4DUY O;  4X88 A;  5H6R A;  2KG7 A;  5B1A C;  4P2Z A;  4ZOL B;  1R6N A;  3IGA C;  1NVP D;  4FFK A;  4GUN A;  5LXT A;  5KLV H;  1Q8I A;  4PDV A;  4DV5 O;  2QGN A;  4TV9 A;  3H1J H;  5KHI A;  5GW7 A;  4DR5 O;  1FXV A;  3ZMT A;  3T1Y O;  3HKC B;  1XOU A;  4FM0 A;  3B77 A;  4I4T A;  3C3S A;  3AK3 A;  4FLU A;  1Y74 A;  4UFZ A;  2YXH A;  4B3T B;  2JIZ G;  2JS3 A;  1HNX O;  1Q6U A;  5CBG A;  3CCU V;  4CS3 A;  1I94 B;  3L74 H;  4FLV A;  5IT9 N;  3OEH G;  3A2F A;  1S76 D;  1UFI A;  1BE3 H;  4X65 O;  4P9O A;  4IYI A;  5E79 Z;  3T2M A;  2IJH A;  1JFF A;  1Z5V A;  4HYO A;  3PN1 A;  4ZIB A;  4JV5 B;  3JSL A;  2DYS B;  1QLE C;  3ABK B;  4ZI7 A;  1TUB A;  3VOU A;  5J2T B;  1HNW B;  4O4L A;  3J81 N;  4J9Y B;  4RQE A;  4JI0 B;  1L8D A;  4GLX A;  1QLE B;  3LSQ A;  5EYP A;  4O4J A;  1AB3 A;  2XUM A;  1YCI A;  4UCR A;  3W7S A;  1N8R W;  3ZJZ A;  4MVO A;  1XMQ B;  3UQ8 A;  4PA7 A;  1R1B A;  1L0L H;  3HPL C;  1VQ4 V;  4J7J A;  4X64 B;  4FM1 A;  1LNQ A;  3HR0 A;  5EBM C;  3CP1 A;  3QO7 A;  2P22 C;  3B8N A;  1I7F A;  4KUM A;  3AG1 B;  4EB6 A;  2HHH O;  3ZHT A;  5LMU O;  2ATK C;  5EZY B;  2PY5 A;  1CP9 A;  4K0K B;  1MZE A;  2P7T C;  3E22 A;  3L9D A;  1BQ0 A;  3B40 A;  3MDS A;  4UCU A;  1BMF G;  4JYC A;  4MTX A;  2D2C B;  4O4I A;  1W0J G;  4NYK A;  4J42 A;  4U3F H;  1MAB G;  2XAJ A;  3ASN B;  1AR5 A;  1KUQ A;  3SR2 C;  2ZD9 A;  4U7N A;  1GKF A;  4GCZ A;  4I4T B;  2XAG A;  4FFB B;  5EIB D;  2W6J G;  2AW9 A;  1VF6 C;  2E5L B;  3G71 V;  2A0L A;  4FLW A;  4PA9 A;  5IY5 C;  1Q7Y W;  3M99 B;  3KZI Z;  3HB3 B;  1VQ7 V;  1Q3E A;  5J2U A;  5A9G A;  3JAS A;  4JI3 O;  1GTO A;  1AI7 A;  1UJW B;  1K9M W;  4JYA B;  5IJ0 A;  3JD2 A;  1AJQ A;  2ZNJ A;  1RSO B;  2QTO A;  3JAW A;  3NXS A;  3H9V A;  5EK0 A;  2ADP A;  2BTO A;  3QTC A;  2ZT9 B;  4FM2 A;  3DGE A;  2WA4 A;  1YSC A;  4FVM A;  3UO2 A;  2QKC A;  1IXB A;  3CRA A;  1ZUQ A;  1ROP A;  3P3P A;  3GB7 C;  4DR6 B;  3K9A A;  4ASU G;  4JPR A;  5IWA O;  1LUW A;  3L71 H;  3RYH B;  3CJH B;  1GM9 A;  3FX7 A;  2AZ2 A;  1H2N A;  5LHH A;  1N32 O;  4DV0 B;  3JAR A;  5JQG A;  3P30 A;  4OXS A;  2GV9 A;  4DUZ B;  2ITD C;  2EZO A;  4NXN O;  5AG2 A;  1J95 A;  3ZHV A;  3WU2 Z;  3SYP A;  2QM8 A;  3L75 H;  3LDD A;  1GN2 A;  4XDK A;  3D36 C;  4JAV A;  1FFX B;  4O2B A;  3EFF K;  1FKA O;  3DXR B;  5BMV B;  1AIL A;  4UCS A;  1G4Y B;  3ETG A;  4X8A A;  3ABM C;  1K7D A;  3J80 N;  4BWA A;  3CHX A;  3RYF A;  1PNM A;  2R72 A;  2Y4U A;  5H5N A;  2YI9 A;  4MVM A;  4LF8 B;  2CTQ A;  3E8F A;  1NS1 A;  4LF6 B;  4MTO A;  1N4C A;  4WFB V;  1JX9 A;  4QJF B;  2WLM A;  4DR7 B;  1NBM G;  2ZKO A;  1OCR C;  3T1H B;  1R3K C;  2Z0A A;  1ZL8 A;  4B3R O;  1M1K W;  4DV5 B;  4CZZ A;  4PA3 A;  2OYQ A;  1SQB H;  3CS5 A;  2JK5 C;  3CCR V;  1XEQ A;  3ZRS A;  5IY5 B;  3CCL V;  4U3J A;  1WA8 A;  4JI6 O;  3JD4 A;  4N21 A;  1WN7 A;  4ZKI A;  4JI8 B;  4I50 B;  2X7R B;  1RPO A;  1MZF A;  4PV1 B;  5BR8 B;  3U11 A;  3ABT A;  4WFE A;  2BTQ B;  2RQ6 A;  2YS8 A;  3ETQ A;  5JVD B;  1VQ6 V;  3FFQ A;  4JAA A;  5EC2 C;  4YJ2 A;  1FFX A;  3KKY A;  4MW3 A;  4LF7 O;  1XNR B;  1GK9 A;  1EN5 A;  1YDX A;  2R70 A;  1XI1 A;  4J9Z B;  1KU9 A;  2RCV A;  4O2A A;  1OJH A;  2QE7 G;  3B2E E;  4LF9 B;  3KCX A;  3ZMZ A;  4PD4 F;  3OUF A;  4UVC A;  1YXB A;  1TAE A;  3K0G A;  2EX3 A;  5DN6 G;  3T1Y B;  2UXC O;  3TCU A;  5CN0 A;  2Y0I A;  4O4J B;  3E22 B;  3QO8 A;  2XAS A;  3ZN1 A;  1H2G A;  4FPP A;  1AVM A;  4UVA A;  1VIB A;  5FNV B;  2BOB C;  5B1B C;  2DWE C;  4YJ2 B;  3BA8 A;  4DV1 O;  5JH7 B;  2IJI A;  3L72 H;  4D7T A;  1M5I A;  4LF8 O;  4G28 B;  2ARH A;  3QG5 A;  4TT3 G;  1UPG A;  1KKC A;  4L8J A;  4MW8 A;  2Q67 A;  2UUA B;  2EIJ B;  3N27 A;  4LFC B;  3WFV A;  1OCC B;  2HHH B;  3ZMV A;  3O9O A;  4DK0 A;  2F66 C;  3FAV B;  2W0X A;  4MS2 A;  4YJ3 A;  5HFL A;  1Q82 W;  4J11 A;  1SF9 A;  4PDL A;  1LUV A;  5LOV B;  1HR0 B;  2RDC A;  2L35 A;  3THO A;  3TXS A;  2IJK A;  2JDI G;  3GVM A;  3JAS B;  1AR1 B;  4PEL A;  1SS3 A;  4DR4 B;  4BIZ A;  2CGO A;  4JZG A;  4NVP A;  1YHQ V;  4GZR B;  4FLZ A;  1MOF A;  3X2Q B;  5KAF Z;  2DYR B;  4DO2 A;  1H38 A;  5IJ9 A;  1H2M A;  4EFE A;  3JAM N;  2UUC O;  1H2L A;  1MG1 A;  2ZCE A;  2UUA O;  2FL4 A;  2ZXW B;  4IT5 A;  4DV0 O;  2PTM A;  2XND G;  4B3S B;  2VQE O;  4AI8 A;  5L3B A;  2DYR C;  2YIB A;  4X9Q A;  1J5E B;  2DE0 X;  5CA0 A;  2QSA A;  3T4D A;  4EEQ A;  1V55 C;  1G8M A;  4OX9 O;  5B1N A;  2ZE5 A;  3RVZ A;  2LO1 A;  3OR6 C;  3G67 A;  4MTF A;  3DC6 A;  2DOS A;  1YJW V;  2QTS A;  3BRC A;  3H01 A;  4LBE C;  1H8H G;  4LF5 B;  3R65 A;  2WLI A;  1F4N A;  4KHP B;  1HP8 A;  3F5T A;  3LNN A;  4PI0 A;  5JJN B;  1XUQ A;  3WG7 C;  1TA8 A;  2B1I A;  3G80 A;  2PZS A;  2VS0 A;  3PJS K;  2ODM A;  2GUZ A;  3AG3 C;  5BMV A;  2AGA A;  4UV8 A;  1M90 W;  2VWJ A;  2BTQ A;  3ZRV A;  2WPD G;  3SJC C;  4IIJ B;  3L73 H;  3CCM V;  1SET A;  3H1L H;  4LH7 A;  1IBK O;  3CCV V;  2UXB B;  2HG5 C;  3ML0 A;  4AQY O;  2XHB A;  2W6I G;  3TK1 A;  3FYE B;  3K5M A;  4DR3 O;  2E5L O;  4R50 A;  2F43 G;  2HR3 A;  2K1E A;  3LSU A;  3TET A;  2QM7 A;  4LWS B;  5H2F Z;  4FJC C;  3SPI A;  4H44 B;  1SA0 A;  2H8P C;  2JJ1 G;  2BE3 A;  4QPJ A;  2V1D A;  2Q6A A;  3DXR A;  1U96 A;  2LP7 A;  5ITZ B;  2CGN A;  1BS3 A;  4X1Y A;  1V54 B;  1DTO A;  5L3D A;  2JEU A;  3LDE A;  2CTR A;  1N32 B;  4IHJ A;  2HEP A;  3ZBH A;  1Q6H A;  1E1R G;  4CC6 A;  2UXD B;  1K4C C;  2UXD O;  1V55 B;  1YTF B;  2OWO A;  3EVK A;  3OMI B;  3TJT A;  4R6Z A;  5B5E Z;  3BCC H;  1AR4 A;  2DMX A;  3N2K A;  1DF5 A;  2QWO B;  3CWB H;  2EUL A;  2A79 B;  3S3W A;  5LA6 A;  3APO A;  5JWP A;  3CCS V;  1BT8 A;  3SPH A;  4U7O A;  4DR4 O;  3RW0 A;  2EIK C;  1W59 A;  3ABU A;  4WFH A;  1AI6 A;  3HKE B;  3CB2 A;  1NH2 B;  1WNS A;  2QKA A;  1F51 A;  2ZXW C;  1OZ0 A;  3NR7 A;  3IC7 A;  4YY3 B;  1KB9 F;  2EJ7 A;  2KG7 B;  2VQF B;  3OGC C;  3P3N A;  5CBF A;  5B1O A;  4NXN B;  2HFE C;  3ZHR A;  2QKS A;  1E79 G;  4NTY A;  2CE4 A;  4A5U B;  4F4L A;  4TUY B;  3SPC A;  4UUJ C;  3ABL C;  1QBZ A;  4JAU A;  1Z5W A;  1G1X B;  4EB6 B;  1CXZ B;  3ZRX A;  4DYL A;  2YIC A;  3OGI B;  1XNQ B;  5TIS Z;  4KXR A;  2UUB B;  1EN6 A;  3RT3 C;  1M93 A;  3SGI A;  5KUM A;  1SQF A;  2XTA A;  5J2U B;  1I08 A;  2MK3 A;  5J9P C;  3CXC U;  2LW1 A;  2Q69 A;  3WB1 A;  3BY6 A;  2E76 B;  1TUE B;  1N33 B;  4Q20 A;  5D5P A;  4LFB B;  3OE7 G;  5IYZ B;  1DLB A;  2W0F C;  1COW G;  3STZ C;  2LFS A;  4Z1V A;  5JJJ B;  5EZY A;  2PI5 A;  2Y69 C;  4HNA A;  2Q4P A;  2WLK A;  4ZBM A;  1K92 A;  4GKK B;  2H3O A;  3OTF A;  1PP9 H;  2GUZ B;  4P9P A;  1TGO A;  4XDJ A;  4QPK A;  4B3R B;  1P84 F;  1MSD A;  2P6J A;  4YXW G;  4DV6 B;  1QLN A;  4DUY B;  4DV2 O;  2M6Y A;  3AK1 A;  4IYH A;  1SES A;  1NVP B;  3RYC B;  2DN9 A;  1IX9 A;  4LCU C;  5KUK A;  3STL C;  4BAY A;  4F6R B;  2OIG A;  1L1F A;  2Q7G A;  3K08 A;  4KFM A;  1R3I C;  4B7K A;  3E8G A;  3K59 A;  2IBZ H;  3E83 A;  1OV9 A;  3JYC A;  2AXT Z;  5JJE B;  1WP8 A;  4ICG A;  1O9H A;  4JYB A;  2WLN A;  3A0H Z;  3OAA G;  2QWR B;  4RUE A;  1KBH A;  1K4D C;  1AP5 A;  1KP3 A;  1WB7 A;  4GKJ O;  1FAF A;  4MVU A;  1KD1 W;  1DK1 A;  3I55 V;  4FK5 C;  4HBN A;  2CTP A;  5CBH A;  2P5O A;  3CRQ A;  5L3C A;  4DK1 A;  3CME V;  4I55 A;  4I50 A;  3ASO C;  4N23 A;  1QR9 A;  3E2E A;  2Q7H A;  2YEV B;  4LFB O;  1W0K G;  3SYO A;  1T5E A;  2Q73 A;  4GX5 A;  3HKB A;  2B9Z A;  3SJQ C;  3CC7 V;  2HJF C;  1K97 A;  3IFX A;  1HNW O;  1M57 B;  4H13 B;  5IE9 A;  1NQT A;  3OTO O;  4Z2W A;  4JV5 O;  1K3E A;  5LL6 Y;  1FJG O;  4KL1 A;  1S3J A;  4LNU B;  3SPJ A;  1SQG A;  4GX1 A;  5BZB A;  2BSK A;  1SC5 B;  4JI5 B;  5LOV A;  4HZ3 A;  4Q6G A;  4JYA O;  3VQX A;  5DED A;  1FFT B;  2Y69 B;  1SRY A;  1XQ8 A;  5C8Y A;  3CRC A;  1URF A;  3DC5 A;  4LNU A;  1Q43 A;  3H1K H;  2GSM B;  1WPX A;  4WBN B;  3UM7 A;  4JI6 B;  2FTK A;  4JI8 O;  4E4E A;  3G6B A;  1FD9 A;  2R9A A;  4NXM O;  4LFC O;  4JF3 A;  2K9P A;  4LC1 A;  2KSD A;  4NKG B;  1EZV H;  1GO3 F;  2AHY A;  3OEE G;  1XL4 A;  1IZ3 A;  4D6T H;  4OPA A;  2AZ0 A;  3JAK B;  1OCC C;  1BZK A;  3N2G B;  2E75 B;  2L6L A;  3U10 A;  3CC2 V;  4K8X A;  1CEZ A;  1FYJ A;  1Y74 B;  4K0K O;  2YIA A;  1MSW D;  3WB2 A;  2IM9 A;  3KCY A;  4O4H A;  1VQ9 V;  1WA8 B;  2A7W A;  1VQM V;  2PF4 E;  2VWK A;  2GHY A;  2ZE6 A;  4X66 O;  1FS0 G;  3FAV A;  2EIL C;  4GYC B;  1VQK V;  2OCC C;  4RWU A;  1ZAU A;  1ZLZ A;  2RNB A;  4O2A B;  2Q0A A;  1HW7 A;  4AQY B;  3F7Y C;  4FLT A;  1ZL8 B;  4CBC A;  1AJP A;  3SYQ A;  4DR2 B;  1EM1 A;  5FPR A;  4J7K A;  4WFA V;  2IU3 A;  5CB4 B;  5LHG A;  2MW2 B;  3TXQ A;  4DV7 B;  4DV4 B;  2F1M A;  5IYD O;  1GAX A; 
#chains in the Genus database with same CATH homology
 2DJV A;  5IWA O;  4JV5 O;  2UUB O;  4LF6 O;  5LL6 Y;  1FJG O;  4YY3 O;  2FKX A;  3JAM N;  2UUC O;  4LF5 O;  4JYA O;  4LF9 O;  4DR2 O;  2UUA O;  5BXZ A;  1N32 O;  3T1H O;  1F7Y A;  2HHH O;  4DV0 O;  5LMU O;  2UXD O;  2JRI A;  2N74 A;  4DV5 O;  2LW7 A;  4LF7 O;  2VQE O;  4DR6 O;  2UXB O;  4JI1 O;  4DUZ O;  4DR5 O;  4DV2 O;  1XMO O;  1I94 O;  1XNQ O;  4DR1 O;  1R6T A;  3T1Y O;  4NXN O;  2UU9 O;  4JI0 O;  4OPH A;  1N36 O;  4JI8 O;  3SDL A;  4DR4 O;  3J7A U;  4NXM O;  4OX9 O;  4LFC O;  3O65 A;  1KUQ A;  4JI4 O;  2DOS A;  1FKA O;  4B3S O;  1HNX O;  1AIL A;  4B3M O;  4GKK O;  2VQF O;  4JI5 O;  1HR0 O;  1A32 A;  4OPA A;  5IT9 N;  1J5E O;  2UXC O;  4KHP O;  4LFA O;  2F4V O;  4JI7 O;  4A5U B;  3F5T A;  4LF4 O;  4X65 O;  1G1X B;  1FYJ A;  1XMQ O;  3J80 N;  4K0K O;  4DV6 O;  4DV1 O;  1N33 O;  4DV3 O;  5H5N A;  3R66 A;  4GKJ O;  4LF8 O;  1IBL O;  4X64 O;  1NS1 A;  4JI3 O;  4X66 O;  5LMN O;  1IBM O;  1DK1 A;  4JI2 O;  3RT3 C;  1YZB A;  2AGA A;  4DR7 O;  5BR8 O;  2ZKO A;  4DV4 O;  2Z0A A;  1X59 A;  4YHH O;  4B3R O;  4B3T O;  4X62 O;  3J81 N;  5FLX N;  5A2Q N;  1IBK O;  4AQY O;  1D2D A;  1XEQ A;  3M8A A;  4DR3 O;  2E5L O;  4LFB O;  4JI6 O;  5BY1 A;  1AB3 A;  2ZM6 O;  1N34 O;  1XNR O;  4DV7 O;  4DUY O;  1HNZ O;  1HNW O;  3OTO O;  1R1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...