1XNQO

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 32
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1xnqO00
4DR1O 2ZM6O 4K0KO 1D2DA 4LF5O 5BY1A 3OTOO 4LF6O 1NS1A 4OPHA 3O65A 5LL6Y 4NXNO 4B3MO 4KHPO 2DOSA 3T1YO 1FYJA 1G1XB 3M8AA 4YY3O 2JRIA 1XNQO 1N32O 2UXDO 4DV7O 4JYAO 1XMOO 4DR2O 4LF7O 4OX9O 2N74A 4DR6O 5LMUO 4DV1O 4DV3O 2UXBO 2E5LO 2FKXA 4X64O 3SDLA 5BR8O 2DJVA 2UUBO 4JI1O 4DR3O 4GKKO 1R6TA 5H5NA 1FJGO 2UUAO 1AILA 4B3TO 1XMQO 1F7YA 4DV0O 2UUCO 1N34O 1KUQA 3T1HO 2UXCO 4LF4O 1DK1A 1A32A 3J80N 4GKJO 5A2QN 4DV4O 1XNRO 4LFBO 4JI4O 3RT3C 5BXZA 2VQFO 5FLXN 1I94O 2AGAA 1FKAO 4X62O 1YZBA 4JV5O 2UU9O 4LFAO 4JI7O 4X66O 4DUZO 5IT9N 1IBKO 1IBMO 4DR5O 4AQYO 5IWAO 4JI3O 4B3SO 4B3RO 3J81N 2ZKOA 4DV5O 1AB3A 4LFCO 1IBLO 4DR4O 1X59A 5LMNO 4DUYO 4DR7O 4NXMO 4LF9O 4LF8O 4A5UB 4JI8O 2F4VO 4YHHO 1XEQA 4JI0O 2VQEO 1N33O 1J5EO 3JAMN 1HNXO 2LW7A 1HNZO 4X65O 3R66A 1N36O 2HHHO 4JI6O 1HNWO 4JI5O 1HR0O 2Z0AA 4JI2O 4OPAA 4DV2O 4DV6O 3J7AU 3F5TA 1R1BA
chains in the Genus database with same CATH superfamily
2ZINA 4MW3A 2C2AA 2ZNJA 1VQ7V 4P2ZA 1WAZA 4IL6Z 2CAZC 2YI8A 4LF6O 4I7ZB 5GTHZ 4KHPO 4KUMA 2WLIA 5JH7B 1SQPH 1W0KG 5EYPA 4AILC 3AG2B 3CCUV 1VQ4V 4TV9B 2H8PC 5FL7G 1ZUQA 3ABUA 3RYFA 1K9MW 2HFEC 3VQVA 1AR5A 4YJ2A 1VQ9V 3OEEG 3NR7A 4PI2A 3C3TA 1KUQA 3F7YC 3ZHRA 4EFEA 1ROPA 1QLEB 1ZL8B 3IC7A 2UXNA 1QU7A 2P4VA 2P67A 3FD9A 4TV9A 2UU9O 4LFAO 3JALB 2WPDG 3DSQA 4U3JA 1GN2A 2DE0X 3H1JH 1NH2B 1H2NA 4DV5O 1KD1W 1VF6A 3ICXA 4CBCA 5LHGA 4B7KA 3ZMVA 2AZ2A 2DN9A 5KAFZ 1YJWV 4TQDA 1OV9A 4J9ZB 2FL4A 4DR1B 4I9WA 2RMKB 2PGGA 4O2AB 1N33O 4O4JA 1ZLZA 4MVMA 3ZMSA 5BZBA 3R66A 2NN4A 2HHHB 3HKDA 2FTKA 4FFBB 4TUYB 5CA1A 1HNWO 5KHIA 1JQ0A 4NKGB 1HNXB 1NZ6A 4WBNB 5KMGB 4X1KA 2EZPA 2WLHA 2FMLA 1XL6A 5JCOA 5B3SB 4H37A 3FB5C 4I4TA 4PA9A 3G6BA 1QR8A 3ABLB 4YY3O 3U10A 1P7BA 4X88A 5EIBD 1JPXA 1L8DA 2XTAA 1TGOA 1N33B 4UCRA 4DK1A 5LMUO 2QM4A 1PP9H 5BR8O 2JVDA 3ZHUA 4GKKO 1XL4A 3SPIA 2Q73A 2E76B 4EKWA 1DLBA 1ENVA 2KG7A 4XDKA 1K7DA 4XDJA 4CS3A 3LNNA 2Y69C 2M7WA 1NVPB 2EIJB 1X4TA 3K5NA 1TUBA 1OCOB 2YEVA 2OIEA 5EBMC 2UU9B 3ABKB 1KP3A 4BWAA 4CC6A 5LA6B 1IXBA 3K9AA 5JWPA 4HZ3A 4DUZO 3HB3B 1GTOA 3K04A 1FXHA 4LF9B 2LP7A 2IU0A 3BRCA 5KMGA 2A06H 3IC9A 2ZKOA 3E83A 3UKMA 3CS5A 4EEQA 2X7RB 3ZRSA 1F23A 1JJ2U 3TXQA 1GO3F 1S72V 1SRYA 1WP7A 3OTFA 4FIPC 2EZOA 5B1OA 4GX1A 5CMUA 2ZE5A 2CGNA 1Q82W 1JFFB 3BEHA 2F1MA 2AHZA 1JFFA 4L87A 1XHXA 3LDCA 1R6KA 4NYKA 4FLZA 1NH2D 2VS0A 4O2AA 4WBNA 5IWAB 1AJNA 2DQ0A 4QNHB 2GUZA 1OCZC 3OM3B 2Q0AA 1M56B 4YJ3B 1LUWA 2HP8A 1XREA 4GUNA 2D3OW 4RUEA 4K35A 3HKBB 4JTDB 2WSSG 3HKCB 2H94A 3CX5F 3T1YO 3CE2A 1YF2A 3H9VA 1AROP 5JJEB 3E22B 4PA3A 3TETA 5IYZB 3ABMB 1Q6HA 2P06A 3JASB 3VQWA 3SJBC 3D3IA 2XASA 2MK3A 5J9PC 1I94B 5L3GA 2VQFB 1N34O 2CE4A 2BTQB 1AR4A 3IFXA 1A32A 3J80N 2A0LA 4R8CA 3W7XA 1XI1A 3JATA 3KCYA 1SESA 1GKFA 2CTRA 4X1KB 1VP7A 4O4IB 3ETEA 5L3EA 3CYOA 1KKDA 4X66O 1B04A 1KMIZ 4DR5O 5LYJB 1XMOB 2B9ZA 4NTXA 1I08A 2EIKB 2CGOA 4MW8A 1B6QA 3AG3B 1THZA 1YITV 1K5QA 3APQA 2JGDA 3BFRA 1Z2GA 1WPBA 1BS3A 4YHHO 2B1GA 5L3FA 3SPHA 4DV1B 2DWDC 4P9PA 1HNZO 3ZX6A 1M5IA 4Z1VA 2QEXV 3AG4C 3TK1A 1VQOV 1Q6UA 4NTYA 1N0JA 2BE3A 1KYOF 2PI4A 1BL8A 2Y4TA 4YIPA 4X1YB 1YJ9V 4DV6O 3CB2A 3OUFA 2IU3A 4H44B 1MZEA 5LOVA 1DF5A 5DECA 2ZR3A 4DW1A 1Y66A 1S0VA 1XILA 1OCRB 1S3JA 5DEDA 3CC4V 1JX9A 4UB8Z 2WLLA 1FYJA 2DQ3A 3ASOB 4F6EA 4LFBB 1XNQO 4NVPA 4GKJB 2A3QA 1YEWA 1MOFA 2N74A 4DYLA 1XNQB 1NTZH 2Y4UA 2WA3A 1PKXA 4X66B 3TCUA 2UXBO 1XMQB 1PV0A 2GHYA 1IDSA 1VF5B 3ML0A 5A9GA 3JD0A 3F5WC 4W4KA 4UVCA 2BTQA 3OGCC 3W7SA 1HP8A 5HFMA 2AXTZ 2WLJA 1TAEA 2BSKB 3JASA 2QM7A 4D6TH 5BXZA 2D2CB 1I94O 2ZDIC 1S5HC 3ZJZA 1OHHG 2YXHA 5CA3A 1YZBA 1E1RG 4JV5O 3IJ4A 4EB6B 1R3IC 4J7ZA 1K34A 3FB8C 1AP5A 2CUGA 4LF4B 4JZGA 3ZN0A 4I50A 2R9RB 1IBLO 3T1YB 5J2UB 2JGDB 3QNEA 3CCVV 2QDOA 1SC5B 1VARA 2EINC 3C90A 5F2VO 4PV1B 4DRXB 3AK2A 3ZHSA 1J5EO 1I7FA 5IJ9A 2LW7A 3Q4HB 1OJHA 1K8AW 2YIBA 3Q4HA 1OZ0A 1Z5VA 3BAAA 2QTSA 3H1LH 4WFEA 4O2BA 4O4JB 2XHBA 4O2BB 4ABMA 2EILB 2EILC 1PNKA 2Y48A 4XBFA 4R6ZA 1M9NA 3O65A 1Y6XA 4JYCA 4P9OA 2P6JA 2ZM6O 4B3TB 2PYLA 4UV8A 3OT7A 5LGNA 2VWKA 2ZD9A 4MVOA 5H6QA 3IAYA 5LYJA 5KA5A 2XUMA 3JALA 5LHIA 5D5PA 2GTAA 1H2SB 2F95B 3K08A 4MVQA 3UT5A 3OR6C 5LGTA 1NJIW 2DYSC 1FJGO 5H6RA 2B5UA 4AI8A 1B06A 4TQFA 5B1BC 2CDYA 2Q68A 3MD0A 4JI3B 2Q9LA 3KKYA 3DTUB 1XNRO 1S76D 2B1IA 3QVNA 5EC2C 3WU2Z 5IYDO 4JASA 5JVDB 1AVMA 4OGQB 1K3EA 4GX2A 1P7GA 1EN6A 1BQ0A 5JQGA 1QR9A 1GAXA 5KHJA 2LFSA 3ZHQA 1O9HA 3SJAC 1T5EA 4GYCB 3CWBH 3STZC 3MAQA 1HWYA 2HEPA 5LMNO 4U7OA 3WG7B 5CA0B 2AW9A 4P30A 4LF9O 4LF8O 3G6EV 2F4VO 1PL4A 3UM7A 2L35A 3RYCB 4GT1A 4PA4A 3AG1C 5ITZA 3H01A 5DN6G 1FPOA 4DXWA 2RNBA 3CCLV 4G27B 1I5YA 1N36O 3AK3A 3CD6V 1L0LH 3W7WA 1HR0O 3M99B 4J42A 4OPAA 2IH1C 3OGIB 4RO2A 1ORQC 4WFGA 2GV9A 1Y67A 3FYEB 2Q69A 4JI2B 2WLNA 4FZ0A 5H2FZ 4GKKB 1VQ5V 1KBHA 3DXRA 2H3OA 3M8AA 1SF9A 1DF4A 2Q0OC 1ZWIC 5GONA 1IXMA 1QNMA 4DV3O 2QSAA 4TV8B 4UCOA 1Y76B 1NTMH 3LSUA 2UUBO 2L6LA 4JV5B 2A7WA 4KFMA 1PM9A 3AG2C 2VWJA 1FXVA 2ADQB 5H5NA 3EHBB 5B1AC 4Z1MG 3JARA 5LHHA 3HR0A 3T1HO 2UXCO 1QLEC 3E8FA 1DK1A 2JDIG 1OCRC 3UT5B 1WB8A 3ABTA 5FPOA 3IGAC 5CBHA 4PJ0Z 5LGUA 1CPYA 4Q20A 1NR1A 1VQKV 2XAQA 2OCHA 1SS3A 2F93B 1QCEA 1E79G 1S5JA 3DXRB 4GCZA 4XDLA 3ZRVA 2LQTA 2E3CA 4KHPB 1Q5OA 1VQ8V 2IJJA 2P22C 2ITDC 3HKCA 2R9IA 1MG1A 4I0XB 3CCRV 2Q4PA 2ZE6A 4LFAB 2E74B 3NXSA 3JCUZ 3N2GA 2ZXWB 2QA4V 2JGUA 4I5SA 3BVOA 1Q43A 4PDLA 3QO8A 4HBNA 5EBWC 1PNLA 4FPPA 2IW5A 1NU1H 3FYIB 5B1BB 1N0NA 5L3BA 1R1BA 4UV9A 1LR1A 3JD1A 1WA8A 2ITCC 3OTOO 1JJOA 2XNDG 1BZKA 2IJIA 1V55B 4NXNO 1WLEA 1AI7A 4B3MO 1YSCA 1XHZA 2E5LB 4DV7O 5IDJA 1XMOO 2Q7HA 4OX9O 4DR5B 4H33A 2FKXA 1OCCB 3B2EE 3OAAG 5EYPB 2CH7B 4FLUA 2Q7EA 1NT2B 2ZIOA 3JARB 3FAVB 1S5LZ 2LGWA 1HW7A 5EIBC 1YTFB 4UCUA 4MVRA 3HPLC 3D36C 2P90A 4UCTA 2VQFO 1SQQH 1MABG 1G6UA 2AGAA 4NXNB 1WB7A 1FXKA 3N2KB 4R50A 4N21A 1NKDA 1F4NA 3WB2A 3T4ZA 3K57A 1M4UA 1V9PA 5FNVA 4K8ZA 4FLXA 4TT3G 3T1CA 1VQNV 3K9SA 3LUTB 4GX5A 5LOVB 1X59A 4IYIA 2UUAB 4G2KA 3MDSA 1AI4A 2WLLB 2YICA 4R7CA 1SQFA 3SYCA 4JI0B 3K3WA 1COWG 2LGQA 2VQEO 2QWPB 1Q90D 4ZOLB 3L9DA 3JSLA 1QBZA 4FLTA 3VQYA 3JAMN 2JS5A 4MS2A 3QTCA 4X65O 3GB7C 1OCZB 2RJZA 3RYCA 3H1KH 1RSOA 2WA4A 1MNGA 5DM6V 4HAMA 3FB6C 2DYRB 1LUVA 2GSMB 5BY1A 1IVSA 2N04A 4DR3B 1QVFU 2EIJC 4UUJC 2IBZH 3F7VC 4L8JA 4DR6B 5E79Z 2JEXA 1US6A 3N2KA 4ZHQB 4W4LA 2Q5ZA 2UXCB 4MVZA 1Q81W 5HFLA 3L75H 5CBFA 3R65A 3ASOC 4JI1O 3W7UA 5IJ0A 4FM1A 2Q7GA 1Q3EA 2ZCEA 2W0XA 3FX7A 1Y74A 1SKVA 2UUBB 3ABLC 1H2GA 4KL1A 4CS2A 1GN6A 3BY6A 1R3JC 2WLIB 1SQXH 3DC6A 3E89A 1K97A 3RGBA 5LP6B 4TSFG 1YJNV 3K5OA 1FKAO 3RYHA 4TUYA 4LF5B 3CC2V 2VRZA 3S3WA 5BR8B 1H2MA 1M93A 4Z2WA 3S3XA 1SERA 2EINB 2JJ1G 1Y74B 4B3RO 4YY3B 1GM8A 2HLDG 2XT9A 5KA6A 4DUYO 4JAUA 3ZRWA 2EIKC 4KP4A 4IYHA 4JI8O 5IE9A 1Q6IA 5IJ9B 5B5EZ 1HNXO 3BPZA 3B40A 3L73H 1SA0B 1G4YB 4DO2A 2V4DA 2ZR2A 3E8GA 2HHHO 2ADPA 4UB6Z 1M57B 2CTPA 5LP6C 3CRMA 1AI6A 3P3PA 4CC5A 3CXCU 1JR9A 1M56C 4DR1O 5JJNB 4LF5O 2DW4A 1M1KW 1L0NH 1H2KA 4DR4B 3OW2U 4FFKA 4EB6A 4LF7B 4UCVA 4JYAO 2QWOB 3LSSA 2FYUH 4JYBA 1P4RA 1SQBH 1SETA 5AG2A 5EZYA 3SDLA 4X64O 2PI5A 2JIZG 1FJGB 4PI0A 4FLWA 1RPOA 1Q7YW 4DW0A 4K8XA 2UUAO 2IJHA 1BHAA 3D36A 1VEWA 2EBOA 4JI4B 1D5NA 1OCOC 4I9QA 4DV4O 1BE3H 3SJCC 1R73A 2V7QG 4NTWA 2QE7G 1Q8IA 2IJKA 1SQGA 2IH3C 3ABKC 3OFNG 5KLVH 2CK3G 3JD4A 4O4HB 2JK5C 1N8RW 1GRJA 4HNAB 3OUSA 2YXLA 5K1PA 1HDJA 1GM7A 3AG3C 4QE9A 4ZHQA 4NR1A 5K1XA 1FFXA 1ZX3A 5KAIZ 2OCCB 1JA8A 1EM1A 2HG5C 3BHPA 2VQEB 1WJZA 3GWOA 1VQ6V 4F4LA 2PTMA 4JI0O 2ARHA 1NQTA 4J11A 3K5MA 3VBBA 3ETQA 5J2TB 4OX9B 5L3CA 1TA8A 1ZTEA 3L74H 2W6IG 5L3DA 2XAGA 4B7EA 4BW9A 3JAKB 4ZBMA 4J7JA 4IIJB 4LC1A 3J7AU 1V54C 1R3KC 2BTOA 1BGYH 1NS1A 2QWRB 4ICGA 3CCSV 4ZIBA 5C8YA 4LFCB 2EIMB 1BHBA 2PYJA 2UXDO 1GH6A 1Y4MA 4J80A 4MT8A 4DR2B 4WFHA 2RQ6A 1NR7A 4LH6A 4E4EA 5C93A 2YDEA 2YUAA 1H2LA 1OCCC 3BA9A 1AILA 1P84F 1DTOA 2X6BA 2BOCC 4LP8A 1XMQO 2UUCO 3QO5A 4TV8A 4LFBO 3BABA 5GONB 4RQFA 4DV0B 3KG2A 3UQ8A 5IYZA 3JD2A 3W7TA 3P3NA 3AG7A 4BW5A 1EZVH 2EX3A 4DV6B 3JD3A 1YIJV 4DV4B 3JCZA 4FZ1A 4X89A 5ITZB 3A0HZ 2HKOA 1WA8B 4X20B 5TISZ 1AB3A 3OR7C 1R6NA 1GM9A 1XQ8A 3G71V 4NXMO 4A5UB 2ATKC 4X64B 4D7TA 5J2TA 2JJ2G 4UVBA 3ETDA 2YC0A 2XOKG 4CZZA 2EIMC 1M90W 2QKCA 4RUFA 2GDSA 4JI5O 2KQXA 2GBOA 1UPGA 1AR1B 1I0HA 3CHXA 3E86A 1KB9F 5BMVB 1HR0B 1FFTB 4U3FH 2EJ7A 4UXNA 5KUKA 2YSUB 1FXKB 2BSKA 1J95A 2Y69B 4FMTA 3ASNC 1FD9A 4FK5C 4DR2O 2ZIMA 2UXDB 4WFBV 3T4DA 3CJHB 1FFXB 3CCMV 2JEUA 1N34B 3CJHA 5E1AC 4E2LA 2ZE8A 2K9PA 4FM2A 5IJ0B 2DJVA 3JATB 5LA6A 3FAVA 3WB0A 4K0KB 2HJFC 4GX0A 2LJ2A 3DGEA 5KHKA 1F7YA 3ZMTA 1G8MA 3TXSA 1K4CC 4LWSA 4B3RB 3TJTA 4U7NA 2YXYA 4I4TB 3RYIA 3E22A 2HR3A 3HKEA 1RM1C 2QKSA 4X1IA 2W6JG 3P30A 3U0ZA 2ODMA 5B1NA 2OIGA 1BQZA 1QQCA 3FFQA 1L1FA 2WLMA 1RSOB 4MTFA 1RPRA 2BOBC 1XNRB 4AQYO 5IWAO 3ETGA 4PDMA 4JTCB 2YIAA 5CB4A 1UJWB 1CEZA 5KX5A 1QHTA 2V1DA 4CH3A 4J7KA 3O9OA 1BMFG 3K06A 4MTOA 1VF7A 4YJ3A 3LNMB 2ZE7A 4JI1B 3CMAV 2Q67A 4EFBA 3VOUA 3OE7G 4LBEC 5IY5B 1W2BU 4I0XA 1O9GA 3CXHF 2KB1A 4ZI7B 2E75B 5J2UA 1PL0A 4QE7A 4I50B 1D5AA 3MHSC 2FB5A 3D3QA 3I56V 3B77A 5CA0A 3QG5A 2ZM6B 1BT8A 2P7TC 1WNSA 2OWOA 5LXTA 2DYSB 4IGGA 4X20A 1G1XB 1IZ3A 3JSNA 2JRIA 2JS3A 4J10A 3A2FA 4JYAB 1LNQA 3WG7C 1U97A 4AQYB 2O57A 4PA6A 3THOA 3OD4A 4H13B 2WLKA 4X8AA 4OXSA 4PELA 4LWSB 1YI2V 4FLYA 2YI9A 2PY5A 4JPRA 3ZEDA 2HVJC 2WAMA 5B3SC 2NLJC 5A2QN 3CRCA 2UXXA 3LDDA 3MHHC 3WB1A 1YTFD 1NVPD 4X62O 4YJ2B 1RM1B 3SYPA 4JI7O 2OTLV 5BMVA 1NTKH 2LW1A 4B3SO 1JOYA 3E8BA 3CP1A 1MSDA 1K33A 1HNWB 1N32B 5EBLC 4Q6GA 4PDRA 4JZ2A 3A0BZ 4IHJA 1SZTA 1R3LC 1V55C 3RBZA 1TVKA 1XEQA 5CBGA 1VIBA 1YVWA 3RW0A 3H1IH 3G4SV 1MSWD 5JQGB 4JI5B 2HVKC 1YDXA 4NB5A 3RVYA 4JI6B 3ZIAG 4ZOLA 4PA7A 3OTOB 1KECA 3I55V 1GK9A 2X6AA 2Z5UA 2QJ1A 3ZRWB 1CP9A 2QM8A 2ZXWC 1VQLV 4K0KO 1EN4A 1ZAUA 1XBLA 3OMAB 4NXMB 4DR7B 4UCSA 3AG4B 3X2QB 2OT5A 1MMMA 1PPJH 3SYOA 4DR6O 3SPJA 1W0JG 4DV1O 4MVUA 5B66Z 3SYAA 1IX9A 3CRQA 4FLVA 2ZQMA 4DV0O 2UXBB 1AI5A 4FVMA 4MSWC 5FNVB 4LNUB 2F66C 4LNUA 4J9YB 3RFRA 4GKJO 3RVZA 1EN5A 1Y76A 5JH7A 4RWUA 4LF6B 3LDEA 3SYQA 3BCCH 4YIOA 3CCJV 3KCXA 5GTIZ 3GVMA 3ZHVA 1IBMO 1F51A 5D5QA 4ASUG 5EC1C 2ZNIA 3ZMUA 4QJFB 5LBQA 3CCQV 1KQSU 4LFCO 3JYCA 3UO3A 2OTJV 1E1QG 4DR7O 1SQVH 2BCCH 3HKDB 5CA1B 4WFAV 4YHHB 4DV3B 2QWQB 2YS8A 2KKWA 4JAAA 2M6YA 4WCEV 4AHCA 1FXKC 1GN3A 2EULA 4X1YA 3ZHTA 1K5SA 4JI6O 5EK0A 2GTSA 2MW2B 2Z0AA 4WF9V 4JI2O 2QGNA 1IBKB 3F5TA 3FKSG 4TWKA 2X0LA 4CS4A 2P4KA 3K0DA 4TOIA 1D2DA 1F4MA 3FB7C 2Z3YA 3CCEV 2KG7B 1VMGA 2W0FC 5LL6Y 1W59A 2DOSA 3RN4A 1N36B 5H9CA 1N32O 1I5XA 4YXWG 2ETNA 5KX5B 1KP2A 3ZN1A 1IURA 1TUBB 2CTWA 4B3SB 2Y0IA 1H38A 1Z5WA 3CEIA 4LH7A 3I5DA 2E5LO 5KHGA 4JI7B 2RN9A 4JYYA 2F4VB 1NBMG 4LF8B 3RYFB 4X62B 2DMXA 5IYBO 5LMNB 1JVMA 4BIOA 1ZL8A 1V54B 4CH6A 4JI4O 4F6RA 1EFRG 4BIUA 2YEVB 1XOUA 2PZSA 2ZT9B 1PNMA 4ZI7A 3AG1B 1YCIA 1Q86W 1CXZB 5IT9N 1PD3A 3A8TA 4JI3O 2XAHA 2ILMA 4JGSA 3J81N 5JCOC 4D7SA 2YIDA 3EVKA 4DR4O 5FPRA 4DRXA 3QO7A 4BIZA 3L71H 3C3SA 2NR5A 5CB4B 2Q6AA 3K03A 3HKBA 1EBOA 2DYRC 5KUMA 1WP8A 4N23A 4UVAA 3PJSK 3K0GA 1K4DC 3L70H 4I55A 3E8HA 4RAIA 2DWEC 1M57C 2G38A 1VF6C 4ZKIA 1SA0A 4DV2O 2K1EA 3T1HB 4DUZB 2RDCA 1P49A 3RYIB 3D8CA 4JI8B 3ZBHA 4LCUC 4H0LB 1ZSPA 1RFYA 5LP6A 1U96A 3SR2C 1QVGU 4DUYB 4QGPA 3JAWB 2Y0PA 4U3JB 1FS0G 1DGSA 4JF3A 4LF7O 2P5OA 3LSQA 4K3AA 3B8NA 1AP6A 3OMIB 1BCCH 3EXAA 4O4LA 3SJQC 1IBLB 4O4HA 2RCVA 3GWKC 5LMUB 4DV5B 3H1HH 4LF4O 1EZJA 1NI8A 1WPXA 1K92A 3RT3C 4QPKA 4MTGA 3K5LA 2A9HA 2AZ0A 4G28B 1GMGA 2F23A 3PN1A 5EZYB 1JCHA 4I55B 1N4CA 5B1AB 2LO1A 5GW7A 4DK0A 1AJPA 1WN7A 4DV2B 3ZS8C 4GZRB 3KZIZ 2PF4E 1YHQV 3K59A 3JAWA 2QKAA 3T2MA 2CH7A 3N27A 2QR4A 1JMKC 2CTQA 4IIJA 4FM0A 2OCCC 2PUSA 4WFFA 1AJQA 3SGIA 4LR3A 4JAVA 2R70A 4FFBA 4GLXA 4CH5A 5CN0A 3QF7A 2AHYA 3X2QC 3CMEV 3SPCA 3K79A 3E2EA 3CC7V 4J41A 2LFRA 1H8EG 2N05A 4X65B 1TUEB 2Q8VA 4F6RB 2HJDA 2OYQA 2KSDA 3WFVA 3E35A 3A0RA 3OMNB 4PDVA 4OPHA 3RWRD 1BSMA 3P32A 4BAYA 3EFFK 3RYHB 4CH4A 1K73W 2R72A 3B4SA 1S77D 1H8HG 5IY5C 1KC8W 1HNZB 2YIBD 4KXRA 3G67A 3ABMC 3HKEB 3L72H 4X1IB 3ZCCA 3STLC 4BR6A 2ZDIA 1XDCA 4DR3O 3CPWU 1GN4A 2QWNB 3K58A 3VQXA 1R6TA 4PHZA 1XUQA 4B3TO 2NNUA 4RQEA 5JVDA 1KU9A 3CRRA 3CRAA 3BA8A 4C7UA 4O4LB 5JJJB 2UUCB 1QLNA 1RP3B 3ZMZA 5FLXN 3CSXA 3UCSC 2F43G 4B08A 2XAJA 3JAKA 3TGUH 1J5EB 2QTOA 4QIWF 3OEHG 3SPGA 5KHHA 1VQPV 4MVSA 4MTXA 1IBKO 4UFZA 2WWWA 3AEIA 3G80A 3ZRXA 4DV7B 5IYCO 5LXTB 3M7MX 3AK1A 2IM9A 4QPJA 4B3MB 3N2GB 3UO2A 3B8MA 1TVKB 4JTAB 3U11A 1KKCA 3APOA 1B3QA 1URFA 3ASNB 5C8YB 4HNAA 1FAFA 4HYOA 2GUZB 4IT5A 3DC5A 4PD4F 2A79B 3B09A 1YXBA 2XAFA 4O4IA 1SZXA 1MA1A 1UFIA 2EJRA 1VQMV 1MZFA 4X9QA 2R9AA 4FJCC 1IBMB 2X6CA 4IHJB
chains in the Genus database with same CATH topology
4DR1O 2ZM6O 4K0KO 1D2DA 4LF5O 5BY1A 3OTOO 4LF6O 1NS1A 4OPHA 3O65A 5LL6Y 4NXNO 4B3MO 4KHPO 2DOSA 3T1YO 1FYJA 1G1XB 3M8AA 4YY3O 2JRIA 1XNQO 1N32O 2UXDO 4DV7O 4JYAO 1XMOO 4DR2O 4LF7O 4OX9O 2N74A 4DR6O 5LMUO 4DV1O 4DV3O 2UXBO 2E5LO 2FKXA 4X64O 3SDLA 5BR8O 2DJVA 2UUBO 4JI1O 4DR3O 4GKKO 1R6TA 5H5NA 1FJGO 2UUAO 1AILA 4B3TO 1XMQO 1F7YA 4DV0O 2UUCO 1N34O 1KUQA 3T1HO 2UXCO 4LF4O 1DK1A 1A32A 3J80N 4GKJO 5A2QN 4DV4O 1XNRO 4LFBO 4JI4O 3RT3C 5BXZA 2VQFO 5FLXN 1I94O 2AGAA 1FKAO 4X62O 1YZBA 4JV5O 2UU9O 4LFAO 4JI7O 4X66O 4DUZO 5IT9N 1IBKO 1IBMO 4DR5O 4AQYO 5IWAO 4JI3O 4B3SO 4B3RO 3J81N 2ZKOA 4DV5O 1AB3A 4LFCO 1IBLO 4DR4O 1X59A 5LMNO 4DUYO 4DR7O 4NXMO 4LF9O 4LF8O 4A5UB 4JI8O 2F4VO 4YHHO 1XEQA 4JI0O 2VQEO 1N33O 1J5EO 3JAMN 1HNXO 2LW7A 1HNZO 4X65O 3R66A 1N36O 2HHHO 4JI6O 1HNWO 4JI5O 1HR0O 2Z0AA 4JI2O 4OPAA 4DV2O 4DV6O 3J7AU 3F5TA 1R1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR1 O;  2ZM6 O;  4K0K O;  1D2D A;  4LF5 O;  5BY1 A;  3OTO O;  4LF6 O;  1NS1 A;  4OPH A;  3O65 A;  5LL6 Y;  4NXN O;  4B3M O;  4KHP O;  2DOS A;  3T1Y O;  1FYJ A;  1G1X B;  3M8A A;  4YY3 O;  2JRI A;  1XNQ O;  1N32 O;  2UXD O;  4DV7 O;  4JYA O;  1XMO O;  4DR2 O;  4LF7 O;  4OX9 O;  2N74 A;  4DR6 O;  5LMU O;  4DV1 O;  4DV3 O;  2UXB O;  2E5L O;  2FKX A;  4X64 O;  3SDL A;  5BR8 O;  2DJV A;  2UUB O;  4JI1 O;  4DR3 O;  4GKK O;  1R6T A;  5H5N A;  1FJG O;  2UUA O;  1AIL A;  4B3T O;  1XMQ O;  1F7Y A;  4DV0 O;  2UUC O;  1N34 O;  1KUQ A;  3T1H O;  2UXC O;  4LF4 O;  1DK1 A;  1A32 A;  3J80 N;  4GKJ O;  5A2Q N;  4DV4 O;  1XNR O;  4LFB O;  4JI4 O;  3RT3 C;  5BXZ A;  2VQF O;  5FLX N;  1I94 O;  2AGA A;  1FKA O;  4X62 O;  1YZB A;  4JV5 O;  2UU9 O;  4LFA O;  4JI7 O;  4X66 O;  4DUZ O;  5IT9 N;  1IBK O;  1IBM O;  4DR5 O;  4AQY O;  5IWA O;  4JI3 O;  4B3S O;  4B3R O;  3J81 N;  2ZKO A;  4DV5 O;  1AB3 A;  4LFC O;  1IBL O;  4DR4 O;  1X59 A;  5LMN O;  4DUY O;  4DR7 O;  4NXM O;  4LF9 O;  4LF8 O;  4A5U B;  4JI8 O;  2F4V O;  4YHH O;  1XEQ A;  4JI0 O;  2VQE O;  1N33 O;  1J5E O;  3JAM N;  1HNX O;  2LW7 A;  1HNZ O;  4X65 O;  3R66 A;  1N36 O;  2HHH O;  4JI6 O;  1HNW O;  4JI5 O;  1HR0 O;  2Z0A A;  4JI2 O;  4OPA A;  4DV2 O;  4DV6 O;  3J7A U;  3F5T A;  1R1B A; 
#chains in the Genus database with same CATH topology
 2ZIN A;  4MW3 A;  2C2A A;  2ZNJ A;  1VQ7 V;  4P2Z A;  1WAZ A;  4IL6 Z;  2CAZ C;  2YI8 A;  4LF6 O;  4I7Z B;  5GTH Z;  4KHP O;  4KUM A;  2WLI A;  5JH7 B;  1SQP H;  1W0K G;  5EYP A;  4AIL C;  3AG2 B;  3CCU V;  1VQ4 V;  4TV9 B;  2H8P C;  5FL7 G;  1ZUQ A;  3ABU A;  3RYF A;  1K9M W;  2HFE C;  3VQV A;  1AR5 A;  4YJ2 A;  1VQ9 V;  3OEE G;  3NR7 A;  4PI2 A;  3C3T A;  1KUQ A;  3F7Y C;  3ZHR A;  4EFE A;  1ROP A;  1QLE B;  1ZL8 B;  3IC7 A;  2UXN A;  1QU7 A;  2P4V A;  2P67 A;  3FD9 A;  4TV9 A;  2UU9 O;  4LFA O;  3JAL B;  2WPD G;  3DSQ A;  4U3J A;  1GN2 A;  2DE0 X;  3H1J H;  1NH2 B;  1H2N A;  4DV5 O;  1KD1 W;  1VF6 A;  3ICX A;  4CBC A;  5LHG A;  4B7K A;  3ZMV A;  2AZ2 A;  2DN9 A;  5KAF Z;  1YJW V;  4TQD A;  1OV9 A;  4J9Z B;  2FL4 A;  4DR1 B;  4I9W A;  2RMK B;  2PGG A;  4O2A B;  1N33 O;  4O4J A;  1ZLZ A;  4MVM A;  3ZMS A;  5BZB A;  3R66 A;  2NN4 A;  2HHH B;  3HKD A;  2FTK A;  4FFB B;  4TUY B;  5CA1 A;  1HNW O;  5KHI A;  1JQ0 A;  4NKG B;  1HNX B;  1NZ6 A;  4WBN B;  5KMG B;  4X1K A;  2EZP A;  2WLH A;  2FML A;  1XL6 A;  5JCO A;  5B3S B;  4H37 A;  3FB5 C;  4I4T A;  4PA9 A;  3G6B A;  1QR8 A;  3ABL B;  4YY3 O;  3U10 A;  1P7B A;  4X88 A;  5EIB D;  1JPX A;  1L8D A;  2XTA A;  1TGO A;  1N33 B;  4UCR A;  4DK1 A;  5LMU O;  2QM4 A;  1PP9 H;  5BR8 O;  2JVD A;  3ZHU A;  4GKK O;  1XL4 A;  3SPI A;  2Q73 A;  2E76 B;  4EKW A;  1DLB A;  1ENV A;  2KG7 A;  4XDK A;  1K7D A;  4XDJ A;  4CS3 A;  3LNN A;  2Y69 C;  2M7W A;  1NVP B;  2EIJ B;  1X4T A;  3K5N A;  1TUB A;  1OCO B;  2YEV A;  2OIE A;  5EBM C;  2UU9 B;  3ABK B;  1KP3 A;  4BWA A;  4CC6 A;  5LA6 B;  1IXB A;  3K9A A;  5JWP A;  4HZ3 A;  4DUZ O;  3HB3 B;  1GTO A;  3K04 A;  1FXH A;  4LF9 B;  2LP7 A;  2IU0 A;  3BRC A;  5KMG A;  2A06 H;  3IC9 A;  2ZKO A;  3E83 A;  3UKM A;  3CS5 A;  4EEQ A;  2X7R B;  3ZRS A;  1F23 A;  1JJ2 U;  3TXQ A;  1GO3 F;  1S72 V;  1SRY A;  1WP7 A;  3OTF A;  4FIP C;  2EZO A;  5B1O A;  4GX1 A;  5CMU A;  2ZE5 A;  2CGN A;  1Q82 W;  1JFF B;  3BEH A;  2F1M A;  2AHZ A;  1JFF A;  4L87 A;  1XHX A;  3LDC A;  1R6K A;  4NYK A;  4FLZ A;  1NH2 D;  2VS0 A;  4O2A A;  4WBN A;  5IWA B;  1AJN A;  2DQ0 A;  4QNH B;  2GUZ A;  1OCZ C;  3OM3 B;  2Q0A A;  1M56 B;  4YJ3 B;  1LUW A;  2HP8 A;  1XRE A;  4GUN A;  2D3O W;  4RUE A;  4K35 A;  3HKB B;  4JTD B;  2WSS G;  3HKC B;  2H94 A;  3CX5 F;  3T1Y O;  3CE2 A;  1YF2 A;  3H9V A;  1ARO P;  5JJE B;  3E22 B;  4PA3 A;  3TET A;  5IYZ B;  3ABM B;  1Q6H A;  2P06 A;  3JAS B;  3VQW A;  3SJB C;  3D3I A;  2XAS A;  2MK3 A;  5J9P C;  1I94 B;  5L3G A;  2VQF B;  1N34 O;  2CE4 A;  2BTQ B;  1AR4 A;  3IFX A;  1A32 A;  3J80 N;  2A0L A;  4R8C A;  3W7X A;  1XI1 A;  3JAT A;  3KCY A;  1SES A;  1GKF A;  2CTR A;  4X1K B;  1VP7 A;  4O4I B;  3ETE A;  5L3E A;  3CYO A;  1KKD A;  4X66 O;  1B04 A;  1KMI Z;  4DR5 O;  5LYJ B;  1XMO B;  2B9Z A;  4NTX A;  1I08 A;  2EIK B;  2CGO A;  4MW8 A;  1B6Q A;  3AG3 B;  1THZ A;  1YIT V;  1K5Q A;  3APQ A;  2JGD A;  3BFR A;  1Z2G A;  1WPB A;  1BS3 A;  4YHH O;  2B1G A;  5L3F A;  3SPH A;  4DV1 B;  2DWD C;  4P9P A;  1HNZ O;  3ZX6 A;  1M5I A;  4Z1V A;  2QEX V;  3AG4 C;  3TK1 A;  1VQO V;  1Q6U A;  4NTY A;  1N0J A;  2BE3 A;  1KYO F;  2PI4 A;  1BL8 A;  2Y4T A;  4YIP A;  4X1Y B;  1YJ9 V;  4DV6 O;  3CB2 A;  3OUF A;  2IU3 A;  4H44 B;  1MZE A;  5LOV A;  1DF5 A;  5DEC A;  2ZR3 A;  4DW1 A;  1Y66 A;  1S0V A;  1XIL A;  1OCR B;  1S3J A;  5DED A;  3CC4 V;  1JX9 A;  4UB8 Z;  2WLL A;  1FYJ A;  2DQ3 A;  3ASO B;  4F6E A;  4LFB B;  1XNQ O;  4NVP A;  4GKJ B;  2A3Q A;  1YEW A;  1MOF A;  2N74 A;  4DYL A;  1XNQ B;  1NTZ H;  2Y4U A;  2WA3 A;  1PKX A;  4X66 B;  3TCU A;  2UXB O;  1XMQ B;  1PV0 A;  2GHY A;  1IDS A;  1VF5 B;  3ML0 A;  5A9G A;  3JD0 A;  3F5W C;  4W4K A;  4UVC A;  2BTQ A;  3OGC C;  3W7S A;  1HP8 A;  5HFM A;  2AXT Z;  2WLJ A;  1TAE A;  2BSK B;  3JAS A;  2QM7 A;  4D6T H;  5BXZ A;  2D2C B;  1I94 O;  2ZDI C;  1S5H C;  3ZJZ A;  1OHH G;  2YXH A;  5CA3 A;  1YZB A;  1E1R G;  4JV5 O;  3IJ4 A;  4EB6 B;  1R3I C;  4J7Z A;  1K34 A;  3FB8 C;  1AP5 A;  2CUG A;  4LF4 B;  4JZG A;  3ZN0 A;  4I50 A;  2R9R B;  1IBL O;  3T1Y B;  5J2U B;  2JGD B;  3QNE A;  3CCV V;  2QDO A;  1SC5 B;  1VAR A;  2EIN C;  3C90 A;  5F2V O;  4PV1 B;  4DRX B;  3AK2 A;  3ZHS A;  1J5E O;  1I7F A;  5IJ9 A;  2LW7 A;  3Q4H B;  1OJH A;  1K8A W;  2YIB A;  3Q4H A;  1OZ0 A;  1Z5V A;  3BAA A;  2QTS A;  3H1L H;  4WFE A;  4O2B A;  4O4J B;  2XHB A;  4O2B B;  4ABM A;  2EIL B;  2EIL C;  1PNK A;  2Y48 A;  4XBF A;  4R6Z A;  1M9N A;  3O65 A;  1Y6X A;  4JYC A;  4P9O A;  2P6J A;  2ZM6 O;  4B3T B;  2PYL A;  4UV8 A;  3OT7 A;  5LGN A;  2VWK A;  2ZD9 A;  4MVO A;  5H6Q A;  3IAY A;  5LYJ A;  5KA5 A;  2XUM A;  3JAL A;  5LHI A;  5D5P A;  2GTA A;  1H2S B;  2F95 B;  3K08 A;  4MVQ A;  3UT5 A;  3OR6 C;  5LGT A;  1NJI W;  2DYS C;  1FJG O;  5H6R A;  2B5U A;  4AI8 A;  1B06 A;  4TQF A;  5B1B C;  2CDY A;  2Q68 A;  3MD0 A;  4JI3 B;  2Q9L A;  3KKY A;  3DTU B;  1XNR O;  1S76 D;  2B1I A;  3QVN A;  5EC2 C;  3WU2 Z;  5IYD O;  4JAS A;  5JVD B;  1AVM A;  4OGQ B;  1K3E A;  4GX2 A;  1P7G A;  1EN6 A;  1BQ0 A;  5JQG A;  1QR9 A;  1GAX A;  5KHJ A;  2LFS A;  3ZHQ A;  1O9H A;  3SJA C;  1T5E A;  4GYC B;  3CWB H;  3STZ C;  3MAQ A;  1HWY A;  2HEP A;  5LMN O;  4U7O A;  3WG7 B;  5CA0 B;  2AW9 A;  4P30 A;  4LF9 O;  4LF8 O;  3G6E V;  2F4V O;  1PL4 A;  3UM7 A;  2L35 A;  3RYC B;  4GT1 A;  4PA4 A;  3AG1 C;  5ITZ A;  3H01 A;  5DN6 G;  1FPO A;  4DXW A;  2RNB A;  3CCL V;  4G27 B;  1I5Y A;  1N36 O;  3AK3 A;  3CD6 V;  1L0L H;  3W7W A;  1HR0 O;  3M99 B;  4J42 A;  4OPA A;  2IH1 C;  3OGI B;  4RO2 A;  1ORQ C;  4WFG A;  2GV9 A;  1Y67 A;  3FYE B;  2Q69 A;  4JI2 B;  2WLN A;  4FZ0 A;  5H2F Z;  4GKK B;  1VQ5 V;  1KBH A;  3DXR A;  2H3O A;  3M8A A;  1SF9 A;  1DF4 A;  2Q0O C;  1ZWI C;  5GON A;  1IXM A;  1QNM A;  4DV3 O;  2QSA A;  4TV8 B;  4UCO A;  1Y76 B;  1NTM H;  3LSU A;  2UUB O;  2L6L A;  4JV5 B;  2A7W A;  4KFM A;  1PM9 A;  3AG2 C;  2VWJ A;  1FXV A;  2ADQ B;  5H5N A;  3EHB B;  5B1A C;  4Z1M G;  3JAR A;  5LHH A;  3HR0 A;  3T1H O;  2UXC O;  1QLE C;  3E8F A;  1DK1 A;  2JDI G;  1OCR C;  3UT5 B;  1WB8 A;  3ABT A;  5FPO A;  3IGA C;  5CBH A;  4PJ0 Z;  5LGU A;  1CPY A;  4Q20 A;  1NR1 A;  1VQK V;  2XAQ A;  2OCH A;  1SS3 A;  2F93 B;  1QCE A;  1E79 G;  1S5J A;  3DXR B;  4GCZ A;  4XDL A;  3ZRV A;  2LQT A;  2E3C A;  4KHP B;  1Q5O A;  1VQ8 V;  2IJJ A;  2P22 C;  2ITD C;  3HKC A;  2R9I A;  1MG1 A;  4I0X B;  3CCR V;  2Q4P A;  2ZE6 A;  4LFA B;  2E74 B;  3NXS A;  3JCU Z;  3N2G A;  2ZXW B;  2QA4 V;  2JGU A;  4I5S A;  3BVO A;  1Q43 A;  4PDL A;  3QO8 A;  4HBN A;  5EBW C;  1PNL A;  4FPP A;  2IW5 A;  1NU1 H;  3FYI B;  5B1B B;  1N0N A;  5L3B A;  1R1B A;  4UV9 A;  1LR1 A;  3JD1 A;  1WA8 A;  2ITC C;  3OTO O;  1JJO A;  2XND G;  1BZK A;  2IJI A;  1V55 B;  4NXN O;  1WLE A;  1AI7 A;  4B3M O;  1YSC A;  1XHZ A;  2E5L B;  4DV7 O;  5IDJ A;  1XMO O;  2Q7H A;  4OX9 O;  4DR5 B;  4H33 A;  2FKX A;  1OCC B;  3B2E E;  3OAA G;  5EYP B;  2CH7 B;  4FLU A;  2Q7E A;  1NT2 B;  2ZIO A;  3JAR B;  3FAV B;  1S5L Z;  2LGW A;  1HW7 A;  5EIB C;  1YTF B;  4UCU A;  4MVR A;  3HPL C;  3D36 C;  2P90 A;  4UCT A;  2VQF O;  1SQQ H;  1MAB G;  1G6U A;  2AGA A;  4NXN B;  1WB7 A;  1FXK A;  3N2K B;  4R50 A;  4N21 A;  1NKD A;  1F4N A;  3WB2 A;  3T4Z A;  3K57 A;  1M4U A;  1V9P A;  5FNV A;  4K8Z A;  4FLX A;  4TT3 G;  3T1C A;  1VQN V;  3K9S A;  3LUT B;  4GX5 A;  5LOV B;  1X59 A;  4IYI A;  2UUA B;  4G2K A;  3MDS A;  1AI4 A;  2WLL B;  2YIC A;  4R7C A;  1SQF A;  3SYC A;  4JI0 B;  3K3W A;  1COW G;  2LGQ A;  2VQE O;  2QWP B;  1Q90 D;  4ZOL B;  3L9D A;  3JSL A;  1QBZ A;  4FLT A;  3VQY A;  3JAM N;  2JS5 A;  4MS2 A;  3QTC A;  4X65 O;  3GB7 C;  1OCZ B;  2RJZ A;  3RYC A;  3H1K H;  1RSO A;  2WA4 A;  1MNG A;  5DM6 V;  4HAM A;  3FB6 C;  2DYR B;  1LUV A;  2GSM B;  5BY1 A;  1IVS A;  2N04 A;  4DR3 B;  1QVF U;  2EIJ C;  4UUJ C;  2IBZ H;  3F7V C;  4L8J A;  4DR6 B;  5E79 Z;  2JEX A;  1US6 A;  3N2K A;  4ZHQ B;  4W4L A;  2Q5Z A;  2UXC B;  4MVZ A;  1Q81 W;  5HFL A;  3L75 H;  5CBF A;  3R65 A;  3ASO C;  4JI1 O;  3W7U A;  5IJ0 A;  4FM1 A;  2Q7G A;  1Q3E A;  2ZCE A;  2W0X A;  3FX7 A;  1Y74 A;  1SKV A;  2UUB B;  3ABL C;  1H2G A;  4KL1 A;  4CS2 A;  1GN6 A;  3BY6 A;  1R3J C;  2WLI B;  1SQX H;  3DC6 A;  3E89 A;  1K97 A;  3RGB A;  5LP6 B;  4TSF G;  1YJN V;  3K5O A;  1FKA O;  3RYH A;  4TUY A;  4LF5 B;  3CC2 V;  2VRZ A;  3S3W A;  5BR8 B;  1H2M A;  1M93 A;  4Z2W A;  3S3X A;  1SER A;  2EIN B;  2JJ1 G;  1Y74 B;  4B3R O;  4YY3 B;  1GM8 A;  2HLD G;  2XT9 A;  5KA6 A;  4DUY O;  4JAU A;  3ZRW A;  2EIK C;  4KP4 A;  4IYH A;  4JI8 O;  5IE9 A;  1Q6I A;  5IJ9 B;  5B5E Z;  1HNX O;  3BPZ A;  3B40 A;  3L73 H;  1SA0 B;  1G4Y B;  4DO2 A;  2V4D A;  2ZR2 A;  3E8G A;  2HHH O;  2ADP A;  4UB6 Z;  1M57 B;  2CTP A;  5LP6 C;  3CRM A;  1AI6 A;  3P3P A;  4CC5 A;  3CXC U;  1JR9 A;  1M56 C;  4DR1 O;  5JJN B;  4LF5 O;  2DW4 A;  1M1K W;  1L0N H;  1H2K A;  4DR4 B;  3OW2 U;  4FFK A;  4EB6 A;  4LF7 B;  4UCV A;  4JYA O;  2QWO B;  3LSS A;  2FYU H;  4JYB A;  1P4R A;  1SQB H;  1SET A;  5AG2 A;  5EZY A;  3SDL A;  4X64 O;  2PI5 A;  2JIZ G;  1FJG B;  4PI0 A;  4FLW A;  1RPO A;  1Q7Y W;  4DW0 A;  4K8X A;  2UUA O;  2IJH A;  1BHA A;  3D36 A;  1VEW A;  2EBO A;  4JI4 B;  1D5N A;  1OCO C;  4I9Q A;  4DV4 O;  1BE3 H;  3SJC C;  1R73 A;  2V7Q G;  4NTW A;  2QE7 G;  1Q8I A;  2IJK A;  1SQG A;  2IH3 C;  3ABK C;  3OFN G;  5KLV H;  2CK3 G;  3JD4 A;  4O4H B;  2JK5 C;  1N8R W;  1GRJ A;  4HNA B;  3OUS A;  2YXL A;  5K1P A;  1HDJ A;  1GM7 A;  3AG3 C;  4QE9 A;  4ZHQ A;  4NR1 A;  5K1X A;  1FFX A;  1ZX3 A;  5KAI Z;  2OCC B;  1JA8 A;  1EM1 A;  2HG5 C;  3BHP A;  2VQE B;  1WJZ A;  3GWO A;  1VQ6 V;  4F4L A;  2PTM A;  4JI0 O;  2ARH A;  1NQT A;  4J11 A;  3K5M A;  3VBB A;  3ETQ A;  5J2T B;  4OX9 B;  5L3C A;  1TA8 A;  1ZTE A;  3L74 H;  2W6I G;  5L3D A;  2XAG A;  4B7E A;  4BW9 A;  3JAK B;  4ZBM A;  4J7J A;  4IIJ B;  4LC1 A;  3J7A U;  1V54 C;  1R3K C;  2BTO A;  1BGY H;  1NS1 A;  2QWR B;  4ICG A;  3CCS V;  4ZIB A;  5C8Y A;  4LFC B;  2EIM B;  1BHB A;  2PYJ A;  2UXD O;  1GH6 A;  1Y4M A;  4J80 A;  4MT8 A;  4DR2 B;  4WFH A;  2RQ6 A;  1NR7 A;  4LH6 A;  4E4E A;  5C93 A;  2YDE A;  2YUA A;  1H2L A;  1OCC C;  3BA9 A;  1AIL A;  1P84 F;  1DTO A;  2X6B A;  2BOC C;  4LP8 A;  1XMQ O;  2UUC O;  3QO5 A;  4TV8 A;  4LFB O;  3BAB A;  5GON B;  4RQF A;  4DV0 B;  3KG2 A;  3UQ8 A;  5IYZ A;  3JD2 A;  3W7T A;  3P3N A;  3AG7 A;  4BW5 A;  1EZV H;  2EX3 A;  4DV6 B;  3JD3 A;  1YIJ V;  4DV4 B;  3JCZ A;  4FZ1 A;  4X89 A;  5ITZ B;  3A0H Z;  2HKO A;  1WA8 B;  4X20 B;  5TIS Z;  1AB3 A;  3OR7 C;  1R6N A;  1GM9 A;  1XQ8 A;  3G71 V;  4NXM O;  4A5U B;  2ATK C;  4X64 B;  4D7T A;  5J2T A;  2JJ2 G;  4UVB A;  3ETD A;  2YC0 A;  2XOK G;  4CZZ A;  2EIM C;  1M90 W;  2QKC A;  4RUF A;  2GDS A;  4JI5 O;  2KQX A;  2GBO A;  1UPG A;  1AR1 B;  1I0H A;  3CHX A;  3E86 A;  1KB9 F;  5BMV B;  1HR0 B;  1FFT B;  4U3F H;  2EJ7 A;  4UXN A;  5KUK A;  2YSU B;  1FXK B;  2BSK A;  1J95 A;  2Y69 B;  4FMT A;  3ASN C;  1FD9 A;  4FK5 C;  4DR2 O;  2ZIM A;  2UXD B;  4WFB V;  3T4D A;  3CJH B;  1FFX B;  3CCM V;  2JEU A;  1N34 B;  3CJH A;  5E1A C;  4E2L A;  2ZE8 A;  2K9P A;  4FM2 A;  5IJ0 B;  2DJV A;  3JAT B;  5LA6 A;  3FAV A;  3WB0 A;  4K0K B;  2HJF C;  4GX0 A;  2LJ2 A;  3DGE A;  5KHK A;  1F7Y A;  3ZMT A;  1G8M A;  3TXS A;  1K4C C;  4LWS A;  4B3R B;  3TJT A;  4U7N A;  2YXY A;  4I4T B;  3RYI A;  3E22 A;  2HR3 A;  3HKE A;  1RM1 C;  2QKS A;  4X1I A;  2W6J G;  3P30 A;  3U0Z A;  2ODM A;  5B1N A;  2OIG A;  1BQZ A;  1QQC A;  3FFQ A;  1L1F A;  2WLM A;  1RSO B;  4MTF A;  1RPR A;  2BOB C;  1XNR B;  4AQY O;  5IWA O;  3ETG A;  4PDM A;  4JTC B;  2YIA A;  5CB4 A;  1UJW B;  1CEZ A;  5KX5 A;  1QHT A;  2V1D A;  4CH3 A;  4J7K A;  3O9O A;  1BMF G;  3K06 A;  4MTO A;  1VF7 A;  4YJ3 A;  3LNM B;  2ZE7 A;  4JI1 B;  3CMA V;  2Q67 A;  4EFB A;  3VOU A;  3OE7 G;  4LBE C;  5IY5 B;  1W2B U;  4I0X A;  1O9G A;  3CXH F;  2KB1 A;  4ZI7 B;  2E75 B;  5J2U A;  1PL0 A;  4QE7 A;  4I50 B;  1D5A A;  3MHS C;  2FB5 A;  3D3Q A;  3I56 V;  3B77 A;  5CA0 A;  3QG5 A;  2ZM6 B;  1BT8 A;  2P7T C;  1WNS A;  2OWO A;  5LXT A;  2DYS B;  4IGG A;  4X20 A;  1G1X B;  1IZ3 A;  3JSN A;  2JRI A;  2JS3 A;  4J10 A;  3A2F A;  4JYA B;  1LNQ A;  3WG7 C;  1U97 A;  4AQY B;  2O57 A;  4PA6 A;  3THO A;  3OD4 A;  4H13 B;  2WLK A;  4X8A A;  4OXS A;  4PEL A;  4LWS B;  1YI2 V;  4FLY A;  2YI9 A;  2PY5 A;  4JPR A;  3ZED A;  2HVJ C;  2WAM A;  5B3S C;  2NLJ C;  5A2Q N;  3CRC A;  2UXX A;  3LDD A;  3MHH C;  3WB1 A;  1YTF D;  1NVP D;  4X62 O;  4YJ2 B;  1RM1 B;  3SYP A;  4JI7 O;  2OTL V;  5BMV A;  1NTK H;  2LW1 A;  4B3S O;  1JOY A;  3E8B A;  3CP1 A;  1MSD A;  1K33 A;  1HNW B;  1N32 B;  5EBL C;  4Q6G A;  4PDR A;  4JZ2 A;  3A0B Z;  4IHJ A;  1SZT A;  1R3L C;  1V55 C;  3RBZ A;  1TVK A;  1XEQ A;  5CBG A;  1VIB A;  1YVW A;  3RW0 A;  3H1I H;  3G4S V;  1MSW D;  5JQG B;  4JI5 B;  2HVK C;  1YDX A;  4NB5 A;  3RVY A;  4JI6 B;  3ZIA G;  4ZOL A;  4PA7 A;  3OTO B;  1KEC A;  3I55 V;  1GK9 A;  2X6A A;  2Z5U A;  2QJ1 A;  3ZRW B;  1CP9 A;  2QM8 A;  2ZXW C;  1VQL V;  4K0K O;  1EN4 A;  1ZAU A;  1XBL A;  3OMA B;  4NXM B;  4DR7 B;  4UCS A;  3AG4 B;  3X2Q B;  2OT5 A;  1MMM A;  1PPJ H;  3SYO A;  4DR6 O;  3SPJ A;  1W0J G;  4DV1 O;  4MVU A;  5B66 Z;  3SYA A;  1IX9 A;  3CRQ A;  4FLV A;  2ZQM A;  4DV0 O;  2UXB B;  1AI5 A;  4FVM A;  4MSW C;  5FNV B;  4LNU B;  2F66 C;  4LNU A;  4J9Y B;  3RFR A;  4GKJ O;  3RVZ A;  1EN5 A;  1Y76 A;  5JH7 A;  4RWU A;  4LF6 B;  3LDE A;  3SYQ A;  3BCC H;  4YIO A;  3CCJ V;  3KCX A;  5GTI Z;  3GVM A;  3ZHV A;  1IBM O;  1F51 A;  5D5Q A;  4ASU G;  5EC1 C;  2ZNI A;  3ZMU A;  4QJF B;  5LBQ A;  3CCQ V;  1KQS U;  4LFC O;  3JYC A;  3UO3 A;  2OTJ V;  1E1Q G;  4DR7 O;  1SQV H;  2BCC H;  3HKD B;  5CA1 B;  4WFA V;  4YHH B;  4DV3 B;  2QWQ B;  2YS8 A;  2KKW A;  4JAA A;  2M6Y A;  4WCE V;  4AHC A;  1FXK C;  1GN3 A;  2EUL A;  4X1Y A;  3ZHT A;  1K5S A;  4JI6 O;  5EK0 A;  2GTS A;  2MW2 B;  2Z0A A;  4WF9 V;  4JI2 O;  2QGN A;  1IBK B;  3F5T A;  3FKS G;  4TWK A;  2X0L A;  4CS4 A;  2P4K A;  3K0D A;  4TOI A;  1D2D A;  1F4M A;  3FB7 C;  2Z3Y A;  3CCE V;  2KG7 B;  1VMG A;  2W0F C;  5LL6 Y;  1W59 A;  2DOS A;  3RN4 A;  1N36 B;  5H9C A;  1N32 O;  1I5X A;  4YXW G;  2ETN A;  5KX5 B;  1KP2 A;  3ZN1 A;  1IUR A;  1TUB B;  2CTW A;  4B3S B;  2Y0I A;  1H38 A;  1Z5W A;  3CEI A;  4LH7 A;  3I5D A;  2E5L O;  5KHG A;  4JI7 B;  2RN9 A;  4JYY A;  2F4V B;  1NBM G;  4LF8 B;  3RYF B;  4X62 B;  2DMX A;  5IYB O;  5LMN B;  1JVM A;  4BIO A;  1ZL8 A;  1V54 B;  4CH6 A;  4JI4 O;  4F6R A;  1EFR G;  4BIU A;  2YEV B;  1XOU A;  2PZS A;  2ZT9 B;  1PNM A;  4ZI7 A;  3AG1 B;  1YCI A;  1Q86 W;  1CXZ B;  5IT9 N;  1PD3 A;  3A8T A;  4JI3 O;  2XAH A;  2ILM A;  4JGS A;  3J81 N;  5JCO C;  4D7S A;  2YID A;  3EVK A;  4DR4 O;  5FPR A;  4DRX A;  3QO7 A;  4BIZ A;  3L71 H;  3C3S A;  2NR5 A;  5CB4 B;  2Q6A A;  3K03 A;  3HKB A;  1EBO A;  2DYR C;  5KUM A;  1WP8 A;  4N23 A;  4UVA A;  3PJS K;  3K0G A;  1K4D C;  3L70 H;  4I55 A;  3E8H A;  4RAI A;  2DWE C;  1M57 C;  2G38 A;  1VF6 C;  4ZKI A;  1SA0 A;  4DV2 O;  2K1E A;  3T1H B;  4DUZ B;  2RDC A;  1P49 A;  3RYI B;  3D8C A;  4JI8 B;  3ZBH A;  4LCU C;  4H0L B;  1ZSP A;  1RFY A;  5LP6 A;  1U96 A;  3SR2 C;  1QVG U;  4DUY B;  4QGP A;  3JAW B;  2Y0P A;  4U3J B;  1FS0 G;  1DGS A;  4JF3 A;  4LF7 O;  2P5O A;  3LSQ A;  4K3A A;  3B8N A;  1AP6 A;  3OMI B;  1BCC H;  3EXA A;  4O4L A;  3SJQ C;  1IBL B;  4O4H A;  2RCV A;  3GWK C;  5LMU B;  4DV5 B;  3H1H H;  4LF4 O;  1EZJ A;  1NI8 A;  1WPX A;  1K92 A;  3RT3 C;  4QPK A;  4MTG A;  3K5L A;  2A9H A;  2AZ0 A;  4G28 B;  1GMG A;  2F23 A;  3PN1 A;  5EZY B;  1JCH A;  4I55 B;  1N4C A;  5B1A B;  2LO1 A;  5GW7 A;  4DK0 A;  1AJP A;  1WN7 A;  4DV2 B;  3ZS8 C;  4GZR B;  3KZI Z;  2PF4 E;  1YHQ V;  3K59 A;  3JAW A;  2QKA A;  3T2M A;  2CH7 A;  3N27 A;  2QR4 A;  1JMK C;  2CTQ A;  4IIJ A;  4FM0 A;  2OCC C;  2PUS A;  4WFF A;  1AJQ A;  3SGI A;  4LR3 A;  4JAV A;  2R70 A;  4FFB A;  4GLX A;  4CH5 A;  5CN0 A;  3QF7 A;  2AHY A;  3X2Q C;  3CME V;  3SPC A;  3K79 A;  3E2E A;  3CC7 V;  4J41 A;  2LFR A;  1H8E G;  2N05 A;  4X65 B;  1TUE B;  2Q8V A;  4F6R B;  2HJD A;  2OYQ A;  2KSD A;  3WFV A;  3E35 A;  3A0R A;  3OMN B;  4PDV A;  4OPH A;  3RWR D;  1BSM A;  3P32 A;  4BAY A;  3EFF K;  3RYH B;  4CH4 A;  1K73 W;  2R72 A;  3B4S A;  1S77 D;  1H8H G;  5IY5 C;  1KC8 W;  1HNZ B;  2YIB D;  4KXR A;  3G67 A;  3ABM C;  3HKE B;  3L72 H;  4X1I B;  3ZCC A;  3STL C;  4BR6 A;  2ZDI A;  1XDC A;  4DR3 O;  3CPW U;  1GN4 A;  2QWN B;  3K58 A;  3VQX A;  1R6T A;  4PHZ A;  1XUQ A;  4B3T O;  2NNU A;  4RQE A;  5JVD A;  1KU9 A;  3CRR A;  3CRA A;  3BA8 A;  4C7U A;  4O4L B;  5JJJ B;  2UUC B;  1QLN A;  1RP3 B;  3ZMZ A;  5FLX N;  3CSX A;  3UCS C;  2F43 G;  4B08 A;  2XAJ A;  3JAK A;  3TGU H;  1J5E B;  2QTO A;  4QIW F;  3OEH G;  3SPG A;  5KHH A;  1VQP V;  4MVS A;  4MTX A;  1IBK O;  4UFZ A;  2WWW A;  3AEI A;  3G80 A;  3ZRX A;  4DV7 B;  5IYC O;  5LXT B;  3M7M X;  3AK1 A;  2IM9 A;  4QPJ A;  4B3M B;  3N2G B;  3UO2 A;  3B8M A;  1TVK B;  4JTA B;  3U11 A;  1KKC A;  3APO A;  1B3Q A;  1URF A;  3ASN B;  5C8Y B;  4HNA A;  1FAF A;  4HYO A;  2GUZ B;  4IT5 A;  3DC5 A;  4PD4 F;  2A79 B;  3B09 A;  1YXB A;  2XAF A;  4O4I A;  1SZX A;  1MA1 A;  1UFI A;  2EJR A;  1VQM V;  1MZF A;  4X9Q A;  2R9A A;  4FJC C;  1IBM B;  2X6C A;  4IHJ B; 
#chains in the Genus database with same CATH homology
 4DR1 O;  2ZM6 O;  4K0K O;  1D2D A;  4LF5 O;  5BY1 A;  3OTO O;  4LF6 O;  1NS1 A;  4OPH A;  3O65 A;  5LL6 Y;  4NXN O;  4B3M O;  4KHP O;  2DOS A;  3T1Y O;  1FYJ A;  1G1X B;  3M8A A;  4YY3 O;  2JRI A;  1XNQ O;  1N32 O;  2UXD O;  4DV7 O;  4JYA O;  1XMO O;  4DR2 O;  4LF7 O;  4OX9 O;  2N74 A;  4DR6 O;  5LMU O;  4DV1 O;  4DV3 O;  2UXB O;  2E5L O;  2FKX A;  4X64 O;  3SDL A;  5BR8 O;  2DJV A;  2UUB O;  4JI1 O;  4DR3 O;  4GKK O;  1R6T A;  5H5N A;  1FJG O;  2UUA O;  1AIL A;  4B3T O;  1XMQ O;  1F7Y A;  4DV0 O;  2UUC O;  1N34 O;  1KUQ A;  3T1H O;  2UXC O;  4LF4 O;  1DK1 A;  1A32 A;  3J80 N;  4GKJ O;  5A2Q N;  4DV4 O;  1XNR O;  4LFB O;  4JI4 O;  3RT3 C;  5BXZ A;  2VQF O;  5FLX N;  1I94 O;  2AGA A;  1FKA O;  4X62 O;  1YZB A;  4JV5 O;  2UU9 O;  4LFA O;  4JI7 O;  4X66 O;  4DUZ O;  5IT9 N;  1IBK O;  1IBM O;  4DR5 O;  4AQY O;  5IWA O;  4JI3 O;  4B3S O;  4B3R O;  3J81 N;  2ZKO A;  4DV5 O;  1AB3 A;  4LFC O;  1IBL O;  4DR4 O;  1X59 A;  5LMN O;  4DUY O;  4DR7 O;  4NXM O;  4LF9 O;  4LF8 O;  4A5U B;  4JI8 O;  2F4V O;  4YHH O;  1XEQ A;  4JI0 O;  2VQE O;  1N33 O;  1J5E O;  3JAM N;  1HNX O;  2LW7 A;  1HNZ O;  4X65 O;  3R66 A;  1N36 O;  2HHH O;  4JI6 O;  1HNW O;  4JI5 O;  1HR0 O;  2Z0A A;  4JI2 O;  4OPA A;  4DV2 O;  4DV6 O;  3J7A U;  3F5T A;  1R1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...