1XQ8A

Human micelle-bound alpha-synuclein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
140
structure length
140
Chain Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-synuclein
publication title Structure and dynamics of micelle-bound human alpha-synuclein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 36
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2004-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01387 Synuclein Synuclein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.700 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xq8A00
2KKWA 1XQ8A
chains in the Genus database with same CATH superfamily
4CH6A 4O4IB 2L35A 1JA8A 4BIOA 5K1XA 3FD9A 5FNVA 4JF3A 3AK1A 2CH7A 4UB6Z 2HHHB 1R3JC 2LQTA 2JK5C 1VEWA 4I55B 1BSMA 2Y0PA 4U3FH 4HBNA 1URFA 2UU9O 5IJ9B 1J5EO 2A0LA 4F6EA 4UVAA 2D2CB 3JALB 3D36C 2QA4V 3D8CA 1VARA 4U7NA 4JAAA 2W6JG 2W0FC 5AG2A 3E8BA 3FAVA 1P84F 4DR5B 5BXZA 2X6AA 3OEEG 1VQ4V 5FPOA 2PF4E 4J7KA 3OUSA 4O4JB 1N36B 3AG1C 4H44B 1N8RW 3HKBB 4WCEV 1N33B 2YSUB 4MVRA 4IIJB 2PYJA 5DM6V 2FTKA 1F4NA 3CC2V 2EILB 1B06A 4UV8A 3CRQA 1KU9A 3E86A 3OAAG 1YVWA 3IGAC 4RQEA 1M1KW 2BE3A 1XBLA 2NR5A 3FYIB 5LA6B 5DECA 1Z5WA 1K92A 3JD3A 1QQCA 1AP5A 4DUYO 4JI7O 3T1HO 3K5OA 1X59A 2UXXA 3HPLC 2B1IA 1ZAUA 3OM3B 4IT5A 1DTOA 5KHJA 2DYSC 1RPOA 4MVSA 5J2UA 3JD4A 3CCLV 3OGIB 4GKJO 5GONA 1GK9A 3K9SA 1M9NA 5JH7A 4TUYA 3LSSA 1XEQA 4JYCA 4L8JA 4CS3A 1BE3H 3ZMUA 1CEZA 1FAFA 4J7ZA 2DW4A 3M8AA 2Q5ZA 1N32B 3ETQA 4AILC 3CSXA 4KHPO 3W7UA 4MVUA 1BQ0A 3CC7V 3BA9A 2OYQA 3SPGA 4A5UB 5C8YB 1KUQA 5KA6A 1YXBA 1DGSA 1IBKO 1RFYA 3CYOA 4DV6O 4LR3A 3ZRXA 1Q43A 2XAFA 3RVYA 4NYKA 2CTQA 3ZEDA 1GMGA 1JR9A 2QM4A 2NNUA 4QNHB 4QPJA 4J7JA 2HFEC 5B5EZ 3U11A 4LBEC 4DR7B 3E35A 2IU3A 1NR7A 4YJ2A 2ZDIA 4IYHA 4DR6B 3SJCC 2V1DA 1A32A 2OWOA 3K0GA 4MVZA 2ZD9A 5LMNB 3SYAA 2E76B 4DV0O 2H8PC 3ML0A 2GUZB 3AK3A 2ILMA 4EB6B 1QR9A 1MABG 3N2GB 3OD4A 4LF4O 1FXKC 5EZYB 2O57A 2Q68A 2UUAO 4DO2A 5B3SC 3F5WC 4DV5B 3ABMC 4G27B 1FJGO 4NTWA 2W0XA 1IBLB 2D3OW 4ZHQA 1S5HC 3TGUH 4Q20A 2E5LO 4K8ZA 1HWYA 1GN3A 3N2KB 1O9GA 5EK0A 4KXRA 5LHIA 1OCCC 4UCVA 4LF5B 2ZIOA 5KHKA 1GN2A 5BY1A 2FKXA 4RAIA 2EIKB 5FPRA 2QWRB 1ZUQA 1J95A 1VQ5V 2VRZA 3OT7A 3CEIA 4NTXA 3U10A 3ZRWB 2HVJC 2ZIMA 2EIJC 3ZHRA 3P3PA 1VMGA 2WPDG 5LXTB 1ZSPA 4OX9O 1KB9F 1BQZA 4HZ3A 5LYJA 5EIBD 2BTQA 4BIZA 4X1KB 1EFRG 1YF2A 4X62B 1EBOA 1SA0A 3MD0A 3E8GA 2FYUH 1Q6HA 3L73H 1N4CA 3GWKC 2GHYA 4Z1MG 1MZFA 3AG4C 3AG3B 3O65A 1QVGU 4JZ2A 1WN7A 1NH2D 3D36A 2JVDA 4YIPA 1AP6A 3APQA 4DUZB 2ZE6A 3LNMB 2P90A 1IXMA 1KKDA 2RNBA 5H5NA 2UXNA 2DN9A 2ITDC 1EN4A 4P9PA 1JFFB 1W59A 2RJZA 3LDEA 3ABKB 4IHJB 5LGNA 2P4VA 4NB5A 3I5DA 1OCZB 4ZKIA 1GM9A 3ZHQA 1US6A 3E22A 2VQFB 1MNGA 3L9DA 3H1IH 3K5MA 1H2MA 1SQXH 1VQPV 1UPGA 2VWKA 2WLJA 3VOUA 4X64O 3Q4HA 3B77A 1W2BU 4J42A 5B66Z 2JGUA 5CBHA 2BSKB 1OHHG 3SJBC 4B08A 1B04A 2UUCB 4BIUA 4P9OA 1D5AA 4XBFA 3JAMN 2HEPA 1NJIW 2Y48A 2OTJV 1K5QA 3ZRSA 4E2LA 4FZ1A 4DR2O 1GN6A 4FFBB 1DF5A 2ZNJA 3UM7A 4C7UA 2ZINA 1ZL8B 4R6ZA 2Q67A 3N27A 3AG7A 2DYRB 2Q69A 1V54C 1ZX3A 3VQWA 2ADPA 2WA3A 4O2BB 1H8HG 3FFQA 4YHHB 5IDJA 4YY3O 2AZ2A 2WAMA 4HNAA 1NT2B 2G38A 2Z5UA 3TCUA 4I0XA 4FM0A 1NTKH 3JAKA 5LL6Y 3U0ZA 1WA8A 2NLJC 4QPKA 2CGNA 2YUAA 3OTOO 4Q6GA 2WA4A 1GN4A 1KKCA 1XILA 4TV8A 1WB8A 4FK5C 3RT3C 5CBFA 1H2SB 1FS0G 1NTZH 5H6RA 3ABLC 3RYIA 1VQ7V 5JQGA 4B3RO 1Q7YW 3RW0A 3P3NA 2DJVA 3PJSK 2CK3G 1JOYA 4WFGA 3KG2A 3L70H 2HR3A 2ZCEA 4CH5A 3CRCA 1M90W 4X66B 5JJNB 4B3TB 4GT1A 4B7EA 1NI8A 3A0RA 3CRRA 5LP6A 1DLBA 4KUMA 2R9IA 1MZEA 3ASOB 1Q82W 5LHGA 1YSCA 2EIMB 1RP3B 3HR0A 3HKEB 4DV2B 4FZ0A 4LF9B 4NXNB 1YI2V 2JGDB 4JI5O 5HFLA 1Q81W 1HNWB 1GM7A 2V4DA 1OCRC 2HLDG 1XNRO 5IT9N 1S5JA 1PL4A 3DXRB 3ABLB 1XL4A 5LGTA 4X89A 4JV5B 1P4RA 5JVDA 3CCJV 5HFMA 3QF7A 2DE0X 3NR7A 5J2UB 4G28B 4HYOA 4QE9A 4DV1B 5JH7B 1I7FA 2ZDIC 2AHYA 4DR1O 5D5QA 1AI7A 4I4TA 4J9ZB 4U7OA 2ADQB 1SKVA 1S3JA 4QE7A 3G6EV 2E75B 1N34O 1GTOA 4JI1B 1OCOB 1Q8IA 3ZJZA 3WB2A 2ZE5A 1AI5A 2ZXWC 3ZBHA 1GH6A 2P7TC 1VIBA 1BHAA 5B1NA 2C2AA 4KFMA 5ITZB 3T1YO 1SETA 1KYOF 4NXMO 4DV3O 2RMKB 3P32A 3G4SV 2ZE8A 1XMOO 1SRYA 5LMUB 3UO2A 1MOFA 3AG2B 2KSDA 3T4DA 1AI6A 3VBBA 1NBMG 2WLKA 1Y76A 2OTLV 4UV9A 4MVMA 3B8NA 4PHZA 2Y69B 1K34A 5CA1A 4X1YA 3S3XA 1ORQC 1K4DC 1I94B 3SYCA 1P7BA 3OMNB 4ABMA 2VS0A 2Q7HA 2X6BA 4PELA 3BEHA 3K0DA 4EKWA 5EBLC 2CTRA 2F4VB 5BR8B 4JI2B 3WB1A 3RVZA 1HR0B 2DQ3A 2Q0OC 4E4EA 4AQYB 2EZOA 1K8AW 3ZRVA 1E1RG 5EIBC 5IE9A 2EBOA 4MW3A 3BPZA 4XDJA 2OCCC 1PP9H 5IJ0A 2HVKC 1ENVA 3SPJA 1EM1A 4K35A 3K3WA 3T2MA 2UXDB 3CXHF 1R6KA 4DRXA 5GTHZ 1PD3A 2WSSG 4P30A 1I5XA 3FYEB 1TGOA 3ZIAG 3ASNB 1HNZO 5H2FZ 4OPAA 5EBMC 5IYBO 5DN6G 3ZMTA 1VF6C 5C93A 1OJHA 4DR6O 1V9PA 1TA8A 4EFEA 2OIEA 4B7KA 4BW5A 5LMNO 2WLMA 2XAJA 5KMGB 2CTPA 3STZC 1RSOA 3C3SA 1SERA 3H01A 5J2TB 4X1IB 3B40A 4LF6B 2PZSA 1M56C 2OCCB 5EYPA 1IX9A 2JEUA 4LF8O 5BMVB 2EINC 4LNUA 2PI4A 1YJ9V 1KP2A 2E3CA 4I50B 4HAMA 4DV5O 1YJWV 2BTQB 4O4HA 2K9PA 1THZA 1K3EA 5KAFZ 2F1MA 3CPWU 4JAUA 1WPXA 3K9AA 4RO2A 1U96A 4ZOLB 3JASB 3QVNA 4UCRA 3QNEA 3ABTA 3QTCA 4TWKA 1M5IA 4JI0B 3ETGA 4U3JA 3RBZA 5GTIZ 3JATB 5LOVA 4JI8B 5J9PC 3EHBB 2KQXA 4TSFG 2CTWA 2IU0A 4PDLA 4UCUA 2Q7EA 1W0JG 5CB4A 2IBZH 3HKCA 2EINB 1IURA 2AXTZ 4O4LA 2ZKOA 4R8CA 4YIOA 1ZTEA 1CP9A 1S5LZ 2X0LA 3M7MX 5B1AC 4IL6Z 3AG1B 2E74B 4JI3O 1VP7A 1SESA 5L3DA 4J80A 1HNXO 3LSUA 4CS2A 4LFBB 3E22B 2ZM6O 3UO3A 1FKAO 1QLEC 2UXCO 2P67A 5KHIA 4WFHA 2JEXA 3K58A 3SDLA 1IBMB 3HKDA 1TVKB 1VF7A 3Q4HB 1H2LA 5D5PA 3FB7C 1AJPA 4K8XA 1LR1A 1VF5B 5IYZA 2NN4A 4R7CA 1DF4A 4LF7B 4K0KO 1Y66A 3JSLA 2AZ0A 4FLUA 1QLNA 3APOA 5E1AC 4BAYA 3IC9A 2DYSB 2PTMA 4X20A 4B3SB 1Q5OA 4FLXA 2ETNA 4DR3O 2EJRA 3OTFA 1KP3A 1ROPA 3CRAA 4QIWF 4WFAV 2DQ0A 4MT8A 1DK1A 1VQMV 2ZT9B 4TV9B 4ASUG 5LP6C 1B3QA 1QVFU 1SQBH 3LDCA 3QO5A 4PA6A 2BOCC 2FMLA 4LFAB 2LP7A 2OT5A 3JARB 2XNDG 3OFNG 1SZXA 1Y74A 2CUGA 4H37A 3EVKA 2UUCO 4RUEA 3RYFA 1WA8B 5BZBA 1BHBA 3QO7A 5L3GA 2IW5A 4GX1A 3M99B 5IWAO 5CN0A 5DEDA 3K08A 3K59A 1SZTA 4JZGA 4MTXA 3RYIB 2UU9B 3F7VC 4X9QA 3IFXA 2H94A 2YDEA 2QDOA 3UKMA 2IJKA 4F6RA 5CBGA 3SJQC 4YHHO 2WLIB 1VQ9V 1U97A 2EX3A 2WLLA 3CXCU 4JI4B 2UUBB 3K03A 4O4IA 4DV4B 3CD6V 1SQVH 4WBNA 5CA0A 1XHXA 1M57C 3K06A 4N21A 4PDVA 4O2AA 4X65B 4I55A 2Q4PA 1FXKB 3SGIA 4X88A 4WF9V 3C3TA 4JYAO 3W7TA 5IJ9A 1Y6XA 5B3SB 3OW2U 3ABMB 2YS8A 3JALA 3H9VA 2ODMA 2F43G 3MHSC 1YIJV 2DMXA 1VF6A 1VQKV 3KKYA 3WFVA 3FKSG 4DUYB 4JI7B 1G8MA 1YZBA 4B3TO 4YJ3B 5EBWC 1OCCB 2YXYA 4PJ0Z 4O4JA 4I4TB 1S72V 4JI6O 2Y4TA 1X4TA 2XTAA 1SS3A 3HKBA 2V7QG 4LWSA 2CDYA 3LNNA 5KUMA 5LBQA 1D2DA 1HNWO 5B1BC 2EIJB 3CCEV 2JRIA 3AEIA 4MW8A 3UT5B 2UXBO 3B09A 3ZHUA 1YCIA 5F2VO 3K57A 1AR1B 1VQ8V 1FYJA 4KHPB 4XDLA 4JV5O 3JAWB 1AB3A 4OPHA 3BABA 5LA6A 3SPHA 3F7YC 3T4ZA 2QWPB 4X1YB 4BR6A 3JD2A 4FLVA 4DV7O 1R73A 2AW9A 2PYLA 3KCYA 1NVPB 1R3IC 4X8AA 3W7XA 1ZWIC 1D5NA 4FM1A 2OCHA 3E83A 4ZIBA 3CE2A 2GV9A 3AG4B 1SF9A 1EN5A 1NKDA 4MTGA 1SQFA 3CMEV 1V55C 2QEXV 3G80A 2XASA 3RYCA 5KAIZ 3JSNA 2R9AA 1OV9A 3RWRD 2QKSA 3A8TA 3SPCA 1TAEA 3B8MA 1I5YA 4B3MO 4OGQB 3ZMSA 5KHHA 2LGQA 4GX0A 2KB1A 4LFCB 5C8YA 4GX2A 4OXSA 1L8DA 4LF4B 2RQ6A 3J81N 3JCZA 5FNVB 2QWOB 2P6JA 2CH7B 4J9YB 2HJDA 1Q86W 2UUAB 1FPOA 2A3QA 1KQSU 2X7RB 3CS5A 4BW9A 4D6TH 5K1PA 1HR0O 2QM8A 3H1LH 1FJGB 4MVQA 3L72H 1I08A 1P7GA 1IDSA 3STLC 1K9MW 2E5LB 1GM8A 2BOBC 4GKKB 3RYHA 5EYPB 3KZIZ 3FAVB 4WFBV 4LNUB 3W7WA 1QU7A 3WG7C 1B6QA 3X2QC 2ATKC 4NR1A 2GUZA 2ZE7A 2B9ZA 4EB6A 3N2GA 1HW7A 1UFIA 1V54B 5EZYA 2HHHO 3E2EA 1EN6A 4H0LB 3ZHSA 4ZI7A 4OX9B 2M6YA 3JD1A 3DC6A 3MHHC 5A9GA 2YIDA 4JAVA 2A79B 1XMQB 4DYLA 2IM9A 3BVOA 1XDCA 2Q7GA 4JTAB 2A9HA 3N2KA 3SPIA 4JYBA 1JQ0A 1NZ6A 1NQTA 1LUWA 4DR5O 3L74H 1VQNV 3HKCB 5IYCO 1PKXA 3ZHVA 3CP1A 3WG7B 5JCOA 3ZRWA 1N36O 1COWG 1NS1A 3E8HA 1N33O 4EEQA 1JMKC 3D3QA 2XAQA 4FM2A 1WJZA 5GONB 1G1XB 2Z3YA 3D3IA 5LXTA 4TUYB 2HP8A 3MDSA 5FLXN 1QNMA 1PNLA 3CX5F 4X1KA 2IJJA 4JI0O 5IY5C 2PI5A 1AILA 4JYYA 4H33A 4JI8O 1YJNV 2AGAA 1PNMA 1M93A 1OCRB 4I9QA 3BY6A 2ZNIA 3K79A 5KX5A 4RUFA 1VQOV 2OIGA 4FLWA 2GTAA 2R72A 2IJHA 4RQFA 3ZN0A 1TUBA 4X64B 2ARHA 3OMAB 4ZBMA 4GCZA 1ZLZA 3GVMA 1EZJA 4X20B 3CCVV 4PI2A 4JGSA 2LFRA 1XNQB 2VQEB 4PA4A 1PM9A 4YJ2B 2HJFC 4IHJA 3BAAA 1BZKA 4DR2B 1N32O 2H3OA 4R50A 5KA5A 1SQQH 1PV0A 1QBZA 4CC5A 1YTFD 5E79Z 2QSAA 2ZXWB 4G2KA 3DC5A 1MMMA 4YY3B 2F66C 4GYCB 4GUNA 2GTSA 5EC1C 4NVPA 3SYOA 2IJIA 1AROP 4GLXA 4B3SO 2BSKA 5CMUA 4ZHQB 1IZ3A 3ABUA 3SR2C 2YXLA 2F23A 3OTOB 4DR7O 2Q9LA 5KHGA 1JCHA 2EULA 1R1BA 3VQVA 2F93B 4CH4A 4I7ZB 4B3RB 4QGPA 5L3EA 4LFAO 1KMIZ 2QM7A 2YEVA 5EC2C 3I55V 4WBNB 5CA0B 4UUJC 1WAZA 4O2BA 1R3LC 2X6CA 1M4UA 2LW7A 4PDMA 1Z2GA 1SC5B 2XHBA 2EJ7A 4O2AB 2ZQMA 3NXSA 2EILC 4W4LA 3J7AU 1XQ8A 4LC1A 3K5LA 3CJHA 5LHHA 1R6TA 4PDRA 1WP7A 3ZMVA 5LYJB 3E8FA 2QKCA 1IBLO 4JI5B 2JS3A 1SA0B 5H6QA 1XNRB 1BGYH 2Q8VA 1WP8A 1PL0A 1NH2B 2B1GA 3H1HH 1GAXA 3B4SA 4LF5O 1PNKA 2LJ2A 1R6NA 3EXAA 2P06A 2DOSA 4I9WA 4JI4O 2UUBO 3H1JH 4DV4O 4JPRA 2LGWA 3TJTA 2IH1C 3MAQA 3R66A 4LWSB 1VQ6V 3FB5C 2QKAA 2LO1A 2P4KA 4X65O 1NR1A 3RN4A 4UXNA 1M56B 2GSMB 1AR5A 4DR1B 3UQ8A 2WWWA 4UB8Z 3BFRA 4Z2WA 3A0HZ 4MTOA 3CCSV 3G67A 1BCCH 4DW0A 1H2GA 1SQPH 3PN1A 3ETEA 3HKEA 1Y4MA 1N34B 4F4LA 2JGDA 4X62O 2QJ1A 1L0NH 3S3WA 4CZZA 3T1CA 3BCCH 4PA7A 4DK1A 3T1YB 2RN9A 3DXRA 4NXMB 4DV3B 1S76D 3LSQA 3A2FA 1XMOB 4MSWC 1HDJA 3O9OA 4WFFA 3ZX6A 2YXHA 1YEWA 4DUZO 3RFRA 2IH3C 1F4MA 3RYCB 2XAGA 3ZMZA 2KG7A 1S0VA 3QG5A 4LH6A 4FVMA 2JS5A 3G71V 1FD9A 2XUMA 3WU2Z 2QWNB 3OUFA 2W6IG 5B1AB 2YIBA 1JPXA 4TQDA 1MA1A 4NKGB 1NTMH 2L6LA 5ITZA 3SYPA 1FFXA 2VQFO 5TISZ 4DR4B 4GZRB 2AHZA 3IC7A 3P30A 3IAYA 1QLEB 4HNAB 1JX9A 1FXVA 3JYCA 2YIBD 4PD4F 4I0XB 4JTCB 3KCXA 3JAKB 3F5TA 1G6UA 1KBHA 4CC6A 1HNZB 1MSWD 3CC4V 3RYHB 1L1FA 4FMTA 1F23A 4TV8B 3TXSA 1WLEA 2EIKC 3CRMA 2N74A 1J5EB 5JQGB 3DTUB 5JCOC 1Q6IA 4K3AA 4LFCO 4MS2A 4PV1B 2A7WA 1Z5VA 3R65A 5B1OA 1XHZA 2JJ2G 2Q6AA 1SQGA 3OR7C 4PI0A 4LF8B 5H9CA 3THOA 4MTFA 1YDXA 4UCOA 3SJAC 3EFFK 4ZI7B 5KLVH 5LP6B 1GO3F 4UCTA 3CCMV 2GBOA 1GRJA 3LUTB 4JASA 1I0HA 1JJ2U 5L3FA 4GKKO 2BCCH 2HKOA 2Q0AA 3CCRV 1K5SA 5KMGA 3CB2A 4P2ZA 3BHPA 4DK0A 1WB7A 2QGNA 1XI1A 1Q6UA 3AG3C 2VWJA 2JDIG 4KL1A 4ICGA 5JVDB 5J2TA 4X1IA 4AI8A 1QR8A 3JCUZ 1WNSA 4I5SA 5BMVA 1K97A 2Z0AA 4X66O 3T1HB 4I50A 1NU1H 3ABKC 4JTDB 4TOIA 2GDSA 1CPYA 1OCZC 4DXWA 4KP4A 4IYIA 3J80N 1XMQO 1L0LH 4JI3B 4DV2O 4GKJB 1M57B 4IIJA 1KC8W 4LF9O 4NXNO 3VQXA 3CWBH 1LUVA 4ZOLA 1HNXB 3ZCCA 3JASA 1AJQA 1N0NA 1G4YB 2QR4A 2ZR3A 3C90A 2ZM6B 1H8EG 2UXCB 2CAZC 5KX5B 4YXWG 4RWUA 1R3KC 1TUBB 3JATA 4Z1VA 4J41A 1AI4A 2EZPA 1T5EA 1Y76B 5CA3A 3DGEA 4LCUC 5CA1B 1BT8A 2BTOA 3E89A 3OMIB 3TETA 2YIAA 5GW7A 4DV1O 1XUQA 1E1QG 4FJCC 3OE7G 1YTFB 1IBKB 4K0KB 4TT3G 4DV6B 1JVMA 2QTSA 2XOKG 4CS4A 2RDCA 1XOUA 2WLNA 2DYRC 2LW1A 4JI1O 2CGOA 4DR3B 2JIZG 2R70A 2Y4UA 5B1BB 1TUEB 4D7SA 2MK3A 3AK2A 3IJ4A 3UCSC 4H13B 5KUKA 5IJ0B 1RM1C 2N05A 4PA9A 1TVKA 5LMUO 4DV0B 1KECA 2FB5A 4DRXB 1QHTA 1GKFA 1E79G 1JJOA 2ITCC 4FIPC 4XDKA 3OGCC 1K33A 2ZR2A 1I94O 2M7WA 1XNQO 2VQEO 3ETDA 1Y67A 3SYQA 5IWAB 1AJNA 4NTYA 1MG1A 1VQLV 1Q90D 2F4VO 5BR8O 4JI2O 4AQYO 1AR4A 2LFSA 1HP8A 1LNQA 1W0KG 2YEVB 1V55B 3ZS8C 3BRCA 1RSOB 3TK1A 1IVSA 4EFBA 1K7DA 4GX5A 4TV9A 5A2QN 4N23A 1H2KA 5L3CA 3LDDA 5L3BA 1RM1B 3QO8A 2UXDO 3ASOC 3CJHB 1BL8A 1P49A 2PUSA 1N0JA 3JARA 2EIMC 1OZ0A 4O4HB 2XAHA 2F95B 1PPJH 4D7TA 3K5NA 3OR6C 4AHCA 1S77D 3CHXA 4JYAB 4FLYA 2MW2B 3HB3B 3G6BA 2QE7G 4FLTA 1WPBA 2RCVA 1FXHA 2QTOA 1UJWB 2KKWA 3B2EE 4L87A 1QCEA 4U3JB 1F51A 3CMAV 5LOVB 2WLHA 3RGBA 2WLIA 3JD0A 4FFKA 4LF6O 3ZHTA 2DWDC 1IXBA 5CB4B 1AVMA 4J11A 4FPPA 4DW1A 2QWQB 4O4LB 4JI6B 3X2QB 2DWEC 2PGGA 1OCOC 4QJFB 2P22C 3CCUV 1FXKA 5LGUA 3FB8C 3L71H 3W7SA 2Y0IA 2XT9A 2UXBB 2PY5A 1YITV 3BA8A 3AG2C 4CH3A 3L75H 4FLZA 3ICXA 3HKDB 2Y69C 1XL6A 1F7YA 1YHQV 3H1KH 1KD1W 3WB0A 2A06H 5IYDO 4DV7B 2R9RB 3CCQV 4YJ3A 5JJEB 5IYZB 1BS3A 2KG7B 4PA3A 3DSQA 4CBCA 1EZVH 3GWOA 4UVBA 4LH7A 4W4KA 2CE4A 3A0BZ 1H2NA 2YICA 4UFZA 3UT5A 3ZN1A 4LFBO 3TXQA 4B3MB 1FFXB 1JFFA 1CXZB 2B5UA 2YI8A 3JAWA 5FL7G 1IBMO 4BWAA 5IY5B 2K1EA 1RPRA 1BMFG 5JJJB 5JWPA 3ASNC 1Y74B 3GB7C 1O9HA 3OEHG 3RYFB 1Q3EA 3I56V 2HG5C 4UCSA 2Q73A 2JJ1G 1MSDA 4TQFA 4LF7O 2FL4A 3K04A 4IGGA 1H38A 1FFTB 2YC0A 3VQYA 1XREA 1NVPD 2N04A 4J10A 1K4CC 3FX7A 4F6RB 4LP8A 4UVCA 3FB6C 1K73W 4DR4O 4WFEA 2YI9A 4MVOA 4FFBA 2P5OA 2WLLB 1ZL8A
chains in the Genus database with same CATH topology
4CH6A 4O4IB 3UT5B 5ITZA 5K1XA 1FFXA 5FNVA 4DR4B 3K57A 3HKEB 4DV2B 3IAYA 4LF9B 4NXNB 4KHPB 2HHHB 4HNAB 3JAWB 1HNWB 3BABA 4I55B 2YIBD 5LA6A 2V4DA 4X1YB 4HBNA 3JAKB 4FLVA 1S5JA 1G6UA 5IJ9B 2PYLA 4CC6A 1HNZB 3JALB 3RYHB 4JV5B 5JVDA 4FM1A 4ZIBA 3QF7A 2GV9A 4TV8B 5J2UB 1SQFA 4DV1B 4DR5B 5JH7B 1J5EB 5JQGB 5FPOA 1I7FA 5JCOC 3RYCA 5D5QA 4O4JB 3JSNA 2R9AA 3RWRD 1Z5VA 4I4TA 1N36B 1TAEA 1XHZA 3HKBB 1SKVA 1N33B 1SQGA 4PI0A 4LF8B 4IIJB 3THOA 4JI1B 5KHHA 2PYJA 1Q8IA 4UCOA 3SJAC 3WB2A 4ZI7B 5LP6B 4UCTA 4LFCB 5C8YA 1L8DA 4LF4B 2RQ6A 5ITZB 1KU9A 5FNVB 5LMUB 2Q0AA 2UUAB 5LA6B 4BW9A 5K1PA 1FJGB 1Z5WA 4PHZA 5CA1A 4X1YA 5KMGA 1QQCA 3CB2A 1I94B 3BHPA 4DK0A 3K5OA 1XI1A 2VWJA 2E5LB 2Q7HA 4KL1A 3RYHA 4GKKB 1ZAUA 5JVDB 5J2TA 4X1IA 2F4VB 5BR8B 4JI2B 5KHJA 3WB1A 1HR0B 5EYPB 4AQYB 1WNSA 5J2UA 5GONA 5BMVA 4LNUB 5JH7A 3T1HB 4TUYA 4I50A 5EIBC 4L8JA 4CS3A 3BPZA 4EB6A 4TOIA 3N2GA 1HW7A 1N32B 5IJ0A 3ETQA 4AILC 3CSXA 4JI3B 4GKJB 5EZYA 4IIJA 3VQXA 2UXDB 4DRXA 4ZI7A 4ZOLA 1HNXB 4OX9B 3JASA 3BA9A 2OYQA 5C8YB 2ZM6B 1TGOA 2UXCB 2CAZC 5KX5B 1DGSA 1XMQB 2IM9A 2Q7GA 4LR3A 1Q43A 1TUBB 3JATA 1V9PA 3N2KA 1TA8A 3ZEDA 4EFEA 1T5EA 2QM4A 5CA1B 2BTOA 5KMGB 2YIAA 3HKCB 1IBKB 1RSOA 3U11A 4K0KB 4DR7B 5JCOA 4DV6B 4YJ2A 4DR6B 5J2TB 4X1IB 3SJCC 4LF6B 4CS4A 2PZSA 2OWOA 5LMNB 4EEQA 5EYPA 1JMKC 4FM2A 5GONB 5BMVB 4LNUA 5LXTA 4TUYB 4DR3B 2E3CA 4I50B 2R70A 4D7SA 2BTQB 4O4HA 4EB6B 3N2GB 4X1KA 5IJ0B 2F1MA 5EZYB 1TVKA 4DV0B 4DRXB 4ZOLB 1QHTA 3JASB 4UCRA 4DV5B 1JJOA 1M93A 4I9QA 2ZNIA 1IBLB 3QTCA 5KX5A 4ZHQA 1M5IA 4FLWA 4JI0B 4K8ZA 2R72A 4U3JA 3JATB 5IWAB 5LOVA 1TUBA 4JI8B 4X64B 3N2KB 1O9GA 4UCVA 4LF5B 2ZIOA 5KHKA 4X20B 4UCUA 2Q7EA 4PI2A 5CB4A 5FPRA 3HKCA 1XNQB 3ZS8C 3BRCA 2VQEB 4O4LA 4YJ2B 4EFBA 3U10A 4IHJA 3BAAA 4DR2B 3M7MX 4TV9A 2ZIMA 5LXTB 1P49A 4CC5A 2PUSA 3JARA 4CS2A 4LFBB 3E22B 5LYJA 4O4HB 5EIBD 2BTQA 4YY3B 2F66C 4X1KB 5KHIA 2F95B 4X62B 1SA0A 4D7TA 3K58A 4GYCB 1IBMB 3K5NA 3HKDA 4NVPA 1TVKB 4AHCA 1VF7A 3CHXA 4JYAB 4FLYA 4GLXA 5D5PA 4K8XA 5IYZA 4FLTA 1WPBA 4ZHQB 3SR2C 2YXLA 2KKWA 3B2EE 3OTOB 4LF7B 4U3JB 3JSLA 5LOVB 4FLUA 5KHGA 3RGBA 1WN7A 2JVDA 3VQVA 2F93B 4CH4A 4DUZB 2PTMA 4X20A 4B3SB 1Q5OA 4B3RB 4FLXA 5CB4B 1KMIZ 3OTFA 4WBNB 4O4LB 4JI6B 5CA0B 2PGGA 4O2BA 1JFFB 1M4UA 2RJZA 4IHJB 2P22C 2XHBA 4TV9B 5LP6C 4O2AB 1XQ8A 3K5LA 4LFAB 3JARB 2UXBB 2PY5A 3E22A 5LYJB 2VQFB 3BA8A 3RYFA 4CH3A 4JI5B 3K5MA 1SA0B 4FLZA 3ICXA 3HKDB 1XNRB 2VWKA 3K59A 3WB0A 2UU9B 3RYIB 4DV7B 2JGUA 4YJ3A 3SJBC 4B08A 5JJEB 2UUCB 1B04A 5IYZB 3DSQA 1D5AA 4F6RA 2HEPA 3MAQA 4FFBB 4LH7A 2EX3A 2ZNJA 2ZINA 4JI4B 4DR1B 3UQ8A 2UUBB 4O4IA 4UFZA 4DV4B 3UT5A 3VQWA 4WBNA 5CA0A 4O2BB 1FFXB 4B3MB 1XHXA 1JFFA 3FFQA 3PN1A 4YHHB 3HKEA 1N34B 4HNAA 1NT2B 2YI8A 3JAWA 2QJ1A 4O2AA 4X65B 4I55A 4BWAA 3SGIA 4FM0A 5JJJB 3JAKA 5IJ9A 4DK1A 3T1YB 1O9HA 4NXMB 3U0ZA 4DV3B 3RYFB 1Q3EA 1XMOB 3A2FA 3JALA 4UCSA 4TQFA 4Q6GA 4TV8A 1YEWA 1H2SB 4DUYB 4JI7B 3RYIA 3RFRA 3VQYA 5JQGA 4YJ3B 3RYCB 4O4JA 4I4TB 3QG5A 4LH6A 4F6RB 1X4TA 4FVMA 2JS5A 3HKBA 2YI9A 2ZCEA 3LNNA 4CH5A 4X66B 5JJNB 4FFBA 2P5OA 4B3TB 2YIBA 5LP6A 4TQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KKW A;  1XQ8 A; 
#chains in the Genus database with same CATH topology
 4CH6 A;  4O4I B;  2L35 A;  1JA8 A;  4BIO A;  5K1X A;  3FD9 A;  5FNV A;  4JF3 A;  3AK1 A;  2CH7 A;  4UB6 Z;  2HHH B;  1R3J C;  2LQT A;  2JK5 C;  1VEW A;  4I55 B;  1BSM A;  2Y0P A;  4U3F H;  4HBN A;  1URF A;  2UU9 O;  5IJ9 B;  1J5E O;  2A0L A;  4F6E A;  4UVA A;  2D2C B;  3JAL B;  3D36 C;  2QA4 V;  3D8C A;  1VAR A;  4U7N A;  4JAA A;  2W6J G;  2W0F C;  5AG2 A;  3E8B A;  3FAV A;  1P84 F;  4DR5 B;  5BXZ A;  2X6A A;  3OEE G;  1VQ4 V;  5FPO A;  2PF4 E;  4J7K A;  3OUS A;  4O4J B;  1N36 B;  3AG1 C;  4H44 B;  1N8R W;  3HKB B;  4WCE V;  1N33 B;  2YSU B;  4MVR A;  4IIJ B;  2PYJ A;  5DM6 V;  2FTK A;  1F4N A;  3CC2 V;  2EIL B;  1B06 A;  4UV8 A;  3CRQ A;  1KU9 A;  3E86 A;  3OAA G;  1YVW A;  3IGA C;  4RQE A;  1M1K W;  2BE3 A;  1XBL A;  2NR5 A;  3FYI B;  5LA6 B;  5DEC A;  1Z5W A;  1K92 A;  3JD3 A;  1QQC A;  1AP5 A;  4DUY O;  4JI7 O;  3T1H O;  3K5O A;  1X59 A;  2UXX A;  3HPL C;  2B1I A;  1ZAU A;  3OM3 B;  4IT5 A;  1DTO A;  5KHJ A;  2DYS C;  1RPO A;  4MVS A;  5J2U A;  3JD4 A;  3CCL V;  3OGI B;  4GKJ O;  5GON A;  1GK9 A;  3K9S A;  1M9N A;  5JH7 A;  4TUY A;  3LSS A;  1XEQ A;  4JYC A;  4L8J A;  4CS3 A;  1BE3 H;  3ZMU A;  1CEZ A;  1FAF A;  4J7Z A;  2DW4 A;  3M8A A;  2Q5Z A;  1N32 B;  3ETQ A;  4AIL C;  3CSX A;  4KHP O;  3W7U A;  4MVU A;  1BQ0 A;  3CC7 V;  3BA9 A;  2OYQ A;  3SPG A;  4A5U B;  5C8Y B;  1KUQ A;  5KA6 A;  1YXB A;  1DGS A;  1IBK O;  1RFY A;  3CYO A;  4DV6 O;  4LR3 A;  3ZRX A;  1Q43 A;  2XAF A;  3RVY A;  4NYK A;  2CTQ A;  3ZED A;  1GMG A;  1JR9 A;  2QM4 A;  2NNU A;  4QNH B;  4QPJ A;  4J7J A;  2HFE C;  5B5E Z;  3U11 A;  4LBE C;  4DR7 B;  3E35 A;  2IU3 A;  1NR7 A;  4YJ2 A;  2ZDI A;  4IYH A;  4DR6 B;  3SJC C;  2V1D A;  1A32 A;  2OWO A;  3K0G A;  4MVZ A;  2ZD9 A;  5LMN B;  3SYA A;  2E76 B;  4DV0 O;  2H8P C;  3ML0 A;  2GUZ B;  3AK3 A;  2ILM A;  4EB6 B;  1QR9 A;  1MAB G;  3N2G B;  3OD4 A;  4LF4 O;  1FXK C;  5EZY B;  2O57 A;  2Q68 A;  2UUA O;  4DO2 A;  5B3S C;  3F5W C;  4DV5 B;  3ABM C;  4G27 B;  1FJG O;  4NTW A;  2W0X A;  1IBL B;  2D3O W;  4ZHQ A;  1S5H C;  3TGU H;  4Q20 A;  2E5L O;  4K8Z A;  1HWY A;  1GN3 A;  3N2K B;  1O9G A;  5EK0 A;  4KXR A;  5LHI A;  1OCC C;  4UCV A;  4LF5 B;  2ZIO A;  5KHK A;  1GN2 A;  5BY1 A;  2FKX A;  4RAI A;  2EIK B;  5FPR A;  2QWR B;  1ZUQ A;  1J95 A;  1VQ5 V;  2VRZ A;  3OT7 A;  3CEI A;  4NTX A;  3U10 A;  3ZRW B;  2HVJ C;  2ZIM A;  2EIJ C;  3ZHR A;  3P3P A;  1VMG A;  2WPD G;  5LXT B;  1ZSP A;  4OX9 O;  1KB9 F;  1BQZ A;  4HZ3 A;  5LYJ A;  5EIB D;  2BTQ A;  4BIZ A;  4X1K B;  1EFR G;  1YF2 A;  4X62 B;  1EBO A;  1SA0 A;  3MD0 A;  3E8G A;  2FYU H;  1Q6H A;  3L73 H;  1N4C A;  3GWK C;  2GHY A;  4Z1M G;  1MZF A;  3AG4 C;  3AG3 B;  3O65 A;  1QVG U;  4JZ2 A;  1WN7 A;  1NH2 D;  3D36 A;  2JVD A;  4YIP A;  1AP6 A;  3APQ A;  4DUZ B;  2ZE6 A;  3LNM B;  2P90 A;  1IXM A;  1KKD A;  2RNB A;  5H5N A;  2UXN A;  2DN9 A;  2ITD C;  1EN4 A;  4P9P A;  1JFF B;  1W59 A;  2RJZ A;  3LDE A;  3ABK B;  4IHJ B;  5LGN A;  2P4V A;  4NB5 A;  3I5D A;  1OCZ B;  4ZKI A;  1GM9 A;  3ZHQ A;  1US6 A;  3E22 A;  2VQF B;  1MNG A;  3L9D A;  3H1I H;  3K5M A;  1H2M A;  1SQX H;  1VQP V;  1UPG A;  2VWK A;  2WLJ A;  3VOU A;  4X64 O;  3Q4H A;  3B77 A;  1W2B U;  4J42 A;  5B66 Z;  2JGU A;  5CBH A;  2BSK B;  1OHH G;  3SJB C;  4B08 A;  1B04 A;  2UUC B;  4BIU A;  4P9O A;  1D5A A;  4XBF A;  3JAM N;  2HEP A;  1NJI W;  2Y48 A;  2OTJ V;  1K5Q A;  3ZRS A;  4E2L A;  4FZ1 A;  4DR2 O;  1GN6 A;  4FFB B;  1DF5 A;  2ZNJ A;  3UM7 A;  4C7U A;  2ZIN A;  1ZL8 B;  4R6Z A;  2Q67 A;  3N27 A;  3AG7 A;  2DYR B;  2Q69 A;  1V54 C;  1ZX3 A;  3VQW A;  2ADP A;  2WA3 A;  4O2B B;  1H8H G;  3FFQ A;  4YHH B;  5IDJ A;  4YY3 O;  2AZ2 A;  2WAM A;  4HNA A;  1NT2 B;  2G38 A;  2Z5U A;  3TCU A;  4I0X A;  4FM0 A;  1NTK H;  3JAK A;  5LL6 Y;  3U0Z A;  1WA8 A;  2NLJ C;  4QPK A;  2CGN A;  2YUA A;  3OTO O;  4Q6G A;  2WA4 A;  1GN4 A;  1KKC A;  1XIL A;  4TV8 A;  1WB8 A;  4FK5 C;  3RT3 C;  5CBF A;  1H2S B;  1FS0 G;  1NTZ H;  5H6R A;  3ABL C;  3RYI A;  1VQ7 V;  5JQG A;  4B3R O;  1Q7Y W;  3RW0 A;  3P3N A;  2DJV A;  3PJS K;  2CK3 G;  1JOY A;  4WFG A;  3KG2 A;  3L70 H;  2HR3 A;  2ZCE A;  4CH5 A;  3CRC A;  1M90 W;  4X66 B;  5JJN B;  4B3T B;  4GT1 A;  4B7E A;  1NI8 A;  3A0R A;  3CRR A;  5LP6 A;  1DLB A;  4KUM A;  2R9I A;  1MZE A;  3ASO B;  1Q82 W;  5LHG A;  1YSC A;  2EIM B;  1RP3 B;  3HR0 A;  3HKE B;  4DV2 B;  4FZ0 A;  4LF9 B;  4NXN B;  1YI2 V;  2JGD B;  4JI5 O;  5HFL A;  1Q81 W;  1HNW B;  1GM7 A;  2V4D A;  1OCR C;  2HLD G;  1XNR O;  5IT9 N;  1S5J A;  1PL4 A;  3DXR B;  3ABL B;  1XL4 A;  5LGT A;  4X89 A;  4JV5 B;  1P4R A;  5JVD A;  3CCJ V;  5HFM A;  3QF7 A;  2DE0 X;  3NR7 A;  5J2U B;  4G28 B;  4HYO A;  4QE9 A;  4DV1 B;  5JH7 B;  1I7F A;  2ZDI C;  2AHY A;  4DR1 O;  5D5Q A;  1AI7 A;  4I4T A;  4J9Z B;  4U7O A;  2ADQ B;  1SKV A;  1S3J A;  4QE7 A;  3G6E V;  2E75 B;  1N34 O;  1GTO A;  4JI1 B;  1OCO B;  1Q8I A;  3ZJZ A;  3WB2 A;  2ZE5 A;  1AI5 A;  2ZXW C;  3ZBH A;  1GH6 A;  2P7T C;  1VIB A;  1BHA A;  5B1N A;  2C2A A;  4KFM A;  5ITZ B;  3T1Y O;  1SET A;  1KYO F;  4NXM O;  4DV3 O;  2RMK B;  3P32 A;  3G4S V;  2ZE8 A;  1XMO O;  1SRY A;  5LMU B;  3UO2 A;  1MOF A;  3AG2 B;  2KSD A;  3T4D A;  1AI6 A;  3VBB A;  1NBM G;  2WLK A;  1Y76 A;  2OTL V;  4UV9 A;  4MVM A;  3B8N A;  4PHZ A;  2Y69 B;  1K34 A;  5CA1 A;  4X1Y A;  3S3X A;  1ORQ C;  1K4D C;  1I94 B;  3SYC A;  1P7B A;  3OMN B;  4ABM A;  2VS0 A;  2Q7H A;  2X6B A;  4PEL A;  3BEH A;  3K0D A;  4EKW A;  5EBL C;  2CTR A;  2F4V B;  5BR8 B;  4JI2 B;  3WB1 A;  3RVZ A;  1HR0 B;  2DQ3 A;  2Q0O C;  4E4E A;  4AQY B;  2EZO A;  1K8A W;  3ZRV A;  1E1R G;  5EIB C;  5IE9 A;  2EBO A;  4MW3 A;  3BPZ A;  4XDJ A;  2OCC C;  1PP9 H;  5IJ0 A;  2HVK C;  1ENV A;  3SPJ A;  1EM1 A;  4K35 A;  3K3W A;  3T2M A;  2UXD B;  3CXH F;  1R6K A;  4DRX A;  5GTH Z;  1PD3 A;  2WSS G;  4P30 A;  1I5X A;  3FYE B;  1TGO A;  3ZIA G;  3ASN B;  1HNZ O;  5H2F Z;  4OPA A;  5EBM C;  5IYB O;  5DN6 G;  3ZMT A;  1VF6 C;  5C93 A;  1OJH A;  4DR6 O;  1V9P A;  1TA8 A;  4EFE A;  2OIE A;  4B7K A;  4BW5 A;  5LMN O;  2WLM A;  2XAJ A;  5KMG B;  2CTP A;  3STZ C;  1RSO A;  3C3S A;  1SER A;  3H01 A;  5J2T B;  4X1I B;  3B40 A;  4LF6 B;  2PZS A;  1M56 C;  2OCC B;  5EYP A;  1IX9 A;  2JEU A;  4LF8 O;  5BMV B;  2EIN C;  4LNU A;  2PI4 A;  1YJ9 V;  1KP2 A;  2E3C A;  4I50 B;  4HAM A;  4DV5 O;  1YJW V;  2BTQ B;  4O4H A;  2K9P A;  1THZ A;  1K3E A;  5KAF Z;  2F1M A;  3CPW U;  4JAU A;  1WPX A;  3K9A A;  4RO2 A;  1U96 A;  4ZOL B;  3JAS B;  3QVN A;  4UCR A;  3QNE A;  3ABT A;  3QTC A;  4TWK A;  1M5I A;  4JI0 B;  3ETG A;  4U3J A;  3RBZ A;  5GTI Z;  3JAT B;  5LOV A;  4JI8 B;  5J9P C;  3EHB B;  2KQX A;  4TSF G;  2CTW A;  2IU0 A;  4PDL A;  4UCU A;  2Q7E A;  1W0J G;  5CB4 A;  2IBZ H;  3HKC A;  2EIN B;  1IUR A;  2AXT Z;  4O4L A;  2ZKO A;  4R8C A;  4YIO A;  1ZTE A;  1CP9 A;  1S5L Z;  2X0L A;  3M7M X;  5B1A C;  4IL6 Z;  3AG1 B;  2E74 B;  4JI3 O;  1VP7 A;  1SES A;  5L3D A;  4J80 A;  1HNX O;  3LSU A;  4CS2 A;  4LFB B;  3E22 B;  2ZM6 O;  3UO3 A;  1FKA O;  1QLE C;  2UXC O;  2P67 A;  5KHI A;  4WFH A;  2JEX A;  3K58 A;  3SDL A;  1IBM B;  3HKD A;  1TVK B;  1VF7 A;  3Q4H B;  1H2L A;  5D5P A;  3FB7 C;  1AJP A;  4K8X A;  1LR1 A;  1VF5 B;  5IYZ A;  2NN4 A;  4R7C A;  1DF4 A;  4LF7 B;  4K0K O;  1Y66 A;  3JSL A;  2AZ0 A;  4FLU A;  1QLN A;  3APO A;  5E1A C;  4BAY A;  3IC9 A;  2DYS B;  2PTM A;  4X20 A;  4B3S B;  1Q5O A;  4FLX A;  2ETN A;  4DR3 O;  2EJR A;  3OTF A;  1KP3 A;  1ROP A;  3CRA A;  4QIW F;  4WFA V;  2DQ0 A;  4MT8 A;  1DK1 A;  1VQM V;  2ZT9 B;  4TV9 B;  4ASU G;  5LP6 C;  1B3Q A;  1QVF U;  1SQB H;  3LDC A;  3QO5 A;  4PA6 A;  2BOC C;  2FML A;  4LFA B;  2LP7 A;  2OT5 A;  3JAR B;  2XND G;  3OFN G;  1SZX A;  1Y74 A;  2CUG A;  4H37 A;  3EVK A;  2UUC O;  4RUE A;  3RYF A;  1WA8 B;  5BZB A;  1BHB A;  3QO7 A;  5L3G A;  2IW5 A;  4GX1 A;  3M99 B;  5IWA O;  5CN0 A;  5DED A;  3K08 A;  3K59 A;  1SZT A;  4JZG A;  4MTX A;  3RYI B;  2UU9 B;  3F7V C;  4X9Q A;  3IFX A;  2H94 A;  2YDE A;  2QDO A;  3UKM A;  2IJK A;  4F6R A;  5CBG A;  3SJQ C;  4YHH O;  2WLI B;  1VQ9 V;  1U97 A;  2EX3 A;  2WLL A;  3CXC U;  4JI4 B;  2UUB B;  3K03 A;  4O4I A;  4DV4 B;  3CD6 V;  1SQV H;  4WBN A;  5CA0 A;  1XHX A;  1M57 C;  3K06 A;  4N21 A;  4PDV A;  4O2A A;  4X65 B;  4I55 A;  2Q4P A;  1FXK B;  3SGI A;  4X88 A;  4WF9 V;  3C3T A;  4JYA O;  3W7T A;  5IJ9 A;  1Y6X A;  5B3S B;  3OW2 U;  3ABM B;  2YS8 A;  3JAL A;  3H9V A;  2ODM A;  2F43 G;  3MHS C;  1YIJ V;  2DMX A;  1VF6 A;  1VQK V;  3KKY A;  3WFV A;  3FKS G;  4DUY B;  4JI7 B;  1G8M A;  1YZB A;  4B3T O;  4YJ3 B;  5EBW C;  1OCC B;  2YXY A;  4PJ0 Z;  4O4J A;  4I4T B;  1S72 V;  4JI6 O;  2Y4T A;  1X4T A;  2XTA A;  1SS3 A;  3HKB A;  2V7Q G;  4LWS A;  2CDY A;  3LNN A;  5KUM A;  5LBQ A;  1D2D A;  1HNW O;  5B1B C;  2EIJ B;  3CCE V;  2JRI A;  3AEI A;  4MW8 A;  3UT5 B;  2UXB O;  3B09 A;  3ZHU A;  1YCI A;  5F2V O;  3K57 A;  1AR1 B;  1VQ8 V;  1FYJ A;  4KHP B;  4XDL A;  4JV5 O;  3JAW B;  1AB3 A;  4OPH A;  3BAB A;  5LA6 A;  3SPH A;  3F7Y C;  3T4Z A;  2QWP B;  4X1Y B;  4BR6 A;  3JD2 A;  4FLV A;  4DV7 O;  1R73 A;  2AW9 A;  2PYL A;  3KCY A;  1NVP B;  1R3I C;  4X8A A;  3W7X A;  1ZWI C;  1D5N A;  4FM1 A;  2OCH A;  3E83 A;  4ZIB A;  3CE2 A;  2GV9 A;  3AG4 B;  1SF9 A;  1EN5 A;  1NKD A;  4MTG A;  1SQF A;  3CME V;  1V55 C;  2QEX V;  3G80 A;  2XAS A;  3RYC A;  5KAI Z;  3JSN A;  2R9A A;  1OV9 A;  3RWR D;  2QKS A;  3A8T A;  3SPC A;  1TAE A;  3B8M A;  1I5Y A;  4B3M O;  4OGQ B;  3ZMS A;  5KHH A;  2LGQ A;  4GX0 A;  2KB1 A;  4LFC B;  5C8Y A;  4GX2 A;  4OXS A;  1L8D A;  4LF4 B;  2RQ6 A;  3J81 N;  3JCZ A;  5FNV B;  2QWO B;  2P6J A;  2CH7 B;  4J9Y B;  2HJD A;  1Q86 W;  2UUA B;  1FPO A;  2A3Q A;  1KQS U;  2X7R B;  3CS5 A;  4BW9 A;  4D6T H;  5K1P A;  1HR0 O;  2QM8 A;  3H1L H;  1FJG B;  4MVQ A;  3L72 H;  1I08 A;  1P7G A;  1IDS A;  3STL C;  1K9M W;  2E5L B;  1GM8 A;  2BOB C;  4GKK B;  3RYH A;  5EYP B;  3KZI Z;  3FAV B;  4WFB V;  4LNU B;  3W7W A;  1QU7 A;  3WG7 C;  1B6Q A;  3X2Q C;  2ATK C;  4NR1 A;  2GUZ A;  2ZE7 A;  2B9Z A;  4EB6 A;  3N2G A;  1HW7 A;  1UFI A;  1V54 B;  5EZY A;  2HHH O;  3E2E A;  1EN6 A;  4H0L B;  3ZHS A;  4ZI7 A;  4OX9 B;  2M6Y A;  3JD1 A;  3DC6 A;  3MHH C;  5A9G A;  2YID A;  4JAV A;  2A79 B;  1XMQ B;  4DYL A;  2IM9 A;  3BVO A;  1XDC A;  2Q7G A;  4JTA B;  2A9H A;  3N2K A;  3SPI A;  4JYB A;  1JQ0 A;  1NZ6 A;  1NQT A;  1LUW A;  4DR5 O;  3L74 H;  1VQN V;  3HKC B;  5IYC O;  1PKX A;  3ZHV A;  3CP1 A;  3WG7 B;  5JCO A;  3ZRW A;  1N36 O;  1COW G;  1NS1 A;  3E8H A;  1N33 O;  4EEQ A;  1JMK C;  3D3Q A;  2XAQ A;  4FM2 A;  1WJZ A;  5GON B;  1G1X B;  2Z3Y A;  3D3I A;  5LXT A;  4TUY B;  2HP8 A;  3MDS A;  5FLX N;  1QNM A;  1PNL A;  3CX5 F;  4X1K A;  2IJJ A;  4JI0 O;  5IY5 C;  2PI5 A;  1AIL A;  4JYY A;  4H33 A;  4JI8 O;  1YJN V;  2AGA A;  1PNM A;  1M93 A;  1OCR B;  4I9Q A;  3BY6 A;  2ZNI A;  3K79 A;  5KX5 A;  4RUF A;  1VQO V;  2OIG A;  4FLW A;  2GTA A;  2R72 A;  2IJH A;  4RQF A;  3ZN0 A;  1TUB A;  4X64 B;  2ARH A;  3OMA B;  4ZBM A;  4GCZ A;  1ZLZ A;  3GVM A;  1EZJ A;  4X20 B;  3CCV V;  4PI2 A;  4JGS A;  2LFR A;  1XNQ B;  2VQE B;  4PA4 A;  1PM9 A;  4YJ2 B;  2HJF C;  4IHJ A;  3BAA A;  1BZK A;  4DR2 B;  1N32 O;  2H3O A;  4R50 A;  5KA5 A;  1SQQ H;  1PV0 A;  1QBZ A;  4CC5 A;  1YTF D;  5E79 Z;  2QSA A;  2ZXW B;  4G2K A;  3DC5 A;  1MMM A;  4YY3 B;  2F66 C;  4GYC B;  4GUN A;  2GTS A;  5EC1 C;  4NVP A;  3SYO A;  2IJI A;  1ARO P;  4GLX A;  4B3S O;  2BSK A;  5CMU A;  4ZHQ B;  1IZ3 A;  3ABU A;  3SR2 C;  2YXL A;  2F23 A;  3OTO B;  4DR7 O;  2Q9L A;  5KHG A;  1JCH A;  2EUL A;  1R1B A;  3VQV A;  2F93 B;  4CH4 A;  4I7Z B;  4B3R B;  4QGP A;  5L3E A;  4LFA O;  1KMI Z;  2QM7 A;  2YEV A;  5EC2 C;  3I55 V;  4WBN B;  5CA0 B;  4UUJ C;  1WAZ A;  4O2B A;  1R3L C;  2X6C A;  1M4U A;  2LW7 A;  4PDM A;  1Z2G A;  1SC5 B;  2XHB A;  2EJ7 A;  4O2A B;  2ZQM A;  3NXS A;  2EIL C;  4W4L A;  3J7A U;  1XQ8 A;  4LC1 A;  3K5L A;  3CJH A;  5LHH A;  1R6T A;  4PDR A;  1WP7 A;  3ZMV A;  5LYJ B;  3E8F A;  2QKC A;  1IBL O;  4JI5 B;  2JS3 A;  1SA0 B;  5H6Q A;  1XNR B;  1BGY H;  2Q8V A;  1WP8 A;  1PL0 A;  1NH2 B;  2B1G A;  3H1H H;  1GAX A;  3B4S A;  4LF5 O;  1PNK A;  2LJ2 A;  1R6N A;  3EXA A;  2P06 A;  2DOS A;  4I9W A;  4JI4 O;  2UUB O;  3H1J H;  4DV4 O;  4JPR A;  2LGW A;  3TJT A;  2IH1 C;  3MAQ A;  3R66 A;  4LWS B;  1VQ6 V;  3FB5 C;  2QKA A;  2LO1 A;  2P4K A;  4X65 O;  1NR1 A;  3RN4 A;  4UXN A;  1M56 B;  2GSM B;  1AR5 A;  4DR1 B;  3UQ8 A;  2WWW A;  4UB8 Z;  3BFR A;  4Z2W A;  3A0H Z;  4MTO A;  3CCS V;  3G67 A;  1BCC H;  4DW0 A;  1H2G A;  1SQP H;  3PN1 A;  3ETE A;  3HKE A;  1Y4M A;  1N34 B;  4F4L A;  2JGD A;  4X62 O;  2QJ1 A;  1L0N H;  3S3W A;  4CZZ A;  3T1C A;  3BCC H;  4PA7 A;  4DK1 A;  3T1Y B;  2RN9 A;  3DXR A;  4NXM B;  4DV3 B;  1S76 D;  3LSQ A;  3A2F A;  1XMO B;  4MSW C;  1HDJ A;  3O9O A;  4WFF A;  3ZX6 A;  2YXH A;  1YEW A;  4DUZ O;  3RFR A;  2IH3 C;  1F4M A;  3RYC B;  2XAG A;  3ZMZ A;  2KG7 A;  1S0V A;  3QG5 A;  4LH6 A;  4FVM A;  2JS5 A;  3G71 V;  1FD9 A;  2XUM A;  3WU2 Z;  2QWN B;  3OUF A;  2W6I G;  5B1A B;  2YIB A;  1JPX A;  4TQD A;  1MA1 A;  4NKG B;  1NTM H;  2L6L A;  5ITZ A;  3SYP A;  1FFX A;  2VQF O;  5TIS Z;  4DR4 B;  4GZR B;  2AHZ A;  3IC7 A;  3P30 A;  3IAY A;  1QLE B;  4HNA B;  1JX9 A;  1FXV A;  3JYC A;  2YIB D;  4PD4 F;  4I0X B;  4JTC B;  3KCX A;  3JAK B;  3F5T A;  1G6U A;  1KBH A;  4CC6 A;  1HNZ B;  1MSW D;  3CC4 V;  3RYH B;  1L1F A;  4FMT A;  1F23 A;  4TV8 B;  3TXS A;  1WLE A;  2EIK C;  3CRM A;  2N74 A;  1J5E B;  5JQG B;  3DTU B;  5JCO C;  1Q6I A;  4K3A A;  4LFC O;  4MS2 A;  4PV1 B;  2A7W A;  1Z5V A;  3R65 A;  5B1O A;  1XHZ A;  2JJ2 G;  2Q6A A;  1SQG A;  3OR7 C;  4PI0 A;  4LF8 B;  5H9C A;  3THO A;  4MTF A;  1YDX A;  4UCO A;  3SJA C;  3EFF K;  4ZI7 B;  5KLV H;  5LP6 B;  1GO3 F;  4UCT A;  3CCM V;  2GBO A;  1GRJ A;  3LUT B;  4JAS A;  1I0H A;  1JJ2 U;  5L3F A;  4GKK O;  2BCC H;  2HKO A;  2Q0A A;  3CCR V;  1K5S A;  5KMG A;  3CB2 A;  4P2Z A;  3BHP A;  4DK0 A;  1WB7 A;  2QGN A;  1XI1 A;  1Q6U A;  3AG3 C;  2VWJ A;  2JDI G;  4KL1 A;  4ICG A;  5JVD B;  5J2T A;  4X1I A;  4AI8 A;  1QR8 A;  3JCU Z;  1WNS A;  4I5S A;  5BMV A;  1K97 A;  2Z0A A;  4X66 O;  3T1H B;  4I50 A;  1NU1 H;  3ABK C;  4JTD B;  4TOI A;  2GDS A;  1CPY A;  1OCZ C;  4DXW A;  4KP4 A;  4IYI A;  3J80 N;  1XMQ O;  1L0L H;  4JI3 B;  4DV2 O;  4GKJ B;  1M57 B;  4IIJ A;  1KC8 W;  4LF9 O;  4NXN O;  3VQX A;  3CWB H;  1LUV A;  4ZOL A;  1HNX B;  3ZCC A;  3JAS A;  1AJQ A;  1N0N A;  1G4Y B;  2QR4 A;  2ZR3 A;  3C90 A;  2ZM6 B;  1H8E G;  2UXC B;  2CAZ C;  5KX5 B;  4YXW G;  4RWU A;  1R3K C;  1TUB B;  3JAT A;  4Z1V A;  4J41 A;  1AI4 A;  2EZP A;  1T5E A;  1Y76 B;  5CA3 A;  3DGE A;  4LCU C;  5CA1 B;  1BT8 A;  2BTO A;  3E89 A;  3OMI B;  3TET A;  2YIA A;  5GW7 A;  4DV1 O;  1XUQ A;  1E1Q G;  4FJC C;  3OE7 G;  1YTF B;  1IBK B;  4K0K B;  4TT3 G;  4DV6 B;  1JVM A;  2QTS A;  2XOK G;  4CS4 A;  2RDC A;  1XOU A;  2WLN A;  2DYR C;  2LW1 A;  4JI1 O;  2CGO A;  4DR3 B;  2JIZ G;  2R70 A;  2Y4U A;  5B1B B;  1TUE B;  4D7S A;  2MK3 A;  3AK2 A;  3IJ4 A;  3UCS C;  4H13 B;  5KUK A;  5IJ0 B;  1RM1 C;  2N05 A;  4PA9 A;  1TVK A;  5LMU O;  4DV0 B;  1KEC A;  2FB5 A;  4DRX B;  1QHT A;  1GKF A;  1E79 G;  1JJO A;  2ITC C;  4FIP C;  4XDK A;  3OGC C;  1K33 A;  2ZR2 A;  1I94 O;  2M7W A;  1XNQ O;  2VQE O;  3ETD A;  1Y67 A;  3SYQ A;  5IWA B;  1AJN A;  4NTY A;  1MG1 A;  1VQL V;  1Q90 D;  2F4V O;  5BR8 O;  4JI2 O;  4AQY O;  1AR4 A;  2LFS A;  1HP8 A;  1LNQ A;  1W0K G;  2YEV B;  1V55 B;  3ZS8 C;  3BRC A;  1RSO B;  3TK1 A;  1IVS A;  4EFB A;  1K7D A;  4GX5 A;  4TV9 A;  5A2Q N;  4N23 A;  1H2K A;  5L3C A;  3LDD A;  5L3B A;  1RM1 B;  3QO8 A;  2UXD O;  3ASO C;  3CJH B;  1BL8 A;  1P49 A;  2PUS A;  1N0J A;  3JAR A;  2EIM C;  1OZ0 A;  4O4H B;  2XAH A;  2F95 B;  1PPJ H;  4D7T A;  3K5N A;  3OR6 C;  4AHC A;  1S77 D;  3CHX A;  4JYA B;  4FLY A;  2MW2 B;  3HB3 B;  3G6B A;  2QE7 G;  4FLT A;  1WPB A;  2RCV A;  1FXH A;  2QTO A;  1UJW B;  2KKW A;  3B2E E;  4L87 A;  1QCE A;  4U3J B;  1F51 A;  3CMA V;  5LOV B;  2WLH A;  3RGB A;  2WLI A;  3JD0 A;  4FFK A;  4LF6 O;  3ZHT A;  2DWD C;  1IXB A;  5CB4 B;  1AVM A;  4J11 A;  4FPP A;  4DW1 A;  2QWQ B;  4O4L B;  4JI6 B;  3X2Q B;  2DWE C;  2PGG A;  1OCO C;  4QJF B;  2P22 C;  3CCU V;  1FXK A;  5LGU A;  3FB8 C;  3L71 H;  3W7S A;  2Y0I A;  2XT9 A;  2UXB B;  2PY5 A;  1YIT V;  3BA8 A;  3AG2 C;  4CH3 A;  3L75 H;  4FLZ A;  3ICX A;  3HKD B;  2Y69 C;  1XL6 A;  1F7Y A;  1YHQ V;  3H1K H;  1KD1 W;  3WB0 A;  2A06 H;  5IYD O;  4DV7 B;  2R9R B;  3CCQ V;  4YJ3 A;  5JJE B;  5IYZ B;  1BS3 A;  2KG7 B;  4PA3 A;  3DSQ A;  4CBC A;  1EZV H;  3GWO A;  4UVB A;  4LH7 A;  4W4K A;  2CE4 A;  3A0B Z;  1H2N A;  2YIC A;  4UFZ A;  3UT5 A;  3ZN1 A;  4LFB O;  3TXQ A;  4B3M B;  1FFX B;  1JFF A;  1CXZ B;  2B5U A;  2YI8 A;  3JAW A;  5FL7 G;  1IBM O;  4BWA A;  5IY5 B;  2K1E A;  1RPR A;  1BMF G;  5JJJ B;  5JWP A;  3ASN C;  1Y74 B;  3GB7 C;  1O9H A;  3OEH G;  3RYF B;  1Q3E A;  3I56 V;  2HG5 C;  4UCS A;  2Q73 A;  2JJ1 G;  1MSD A;  4TQF A;  4LF7 O;  2FL4 A;  3K04 A;  4IGG A;  1H38 A;  1FFT B;  2YC0 A;  3VQY A;  1XRE A;  1NVP D;  2N04 A;  4J10 A;  1K4C C;  3FX7 A;  4F6R B;  4LP8 A;  4UVC A;  3FB6 C;  1K73 W;  4DR4 O;  4WFE A;  2YI9 A;  4MVO A;  4FFB A;  2P5O A;  2WLL B;  1ZL8 A; 
#chains in the Genus database with same CATH homology
 4CH6 A;  4O4I B;  3UT5 B;  5ITZ A;  5K1X A;  1FFX A;  5FNV A;  4DR4 B;  3K57 A;  3HKE B;  4DV2 B;  3IAY A;  4LF9 B;  4NXN B;  4KHP B;  2HHH B;  4HNA B;  3JAW B;  1HNW B;  3BAB A;  4I55 B;  2YIB D;  5LA6 A;  2V4D A;  4X1Y B;  4HBN A;  3JAK B;  4FLV A;  1S5J A;  1G6U A;  5IJ9 B;  2PYL A;  4CC6 A;  1HNZ B;  3JAL B;  3RYH B;  4JV5 B;  5JVD A;  4FM1 A;  4ZIB A;  3QF7 A;  2GV9 A;  4TV8 B;  5J2U B;  1SQF A;  4DV1 B;  4DR5 B;  5JH7 B;  1J5E B;  5JQG B;  5FPO A;  1I7F A;  5JCO C;  3RYC A;  5D5Q A;  4O4J B;  3JSN A;  2R9A A;  3RWR D;  1Z5V A;  4I4T A;  1N36 B;  1TAE A;  1XHZ A;  3HKB B;  1SKV A;  1N33 B;  1SQG A;  4PI0 A;  4LF8 B;  4IIJ B;  3THO A;  4JI1 B;  5KHH A;  2PYJ A;  1Q8I A;  4UCO A;  3SJA C;  3WB2 A;  4ZI7 B;  5LP6 B;  4UCT A;  4LFC B;  5C8Y A;  1L8D A;  4LF4 B;  2RQ6 A;  5ITZ B;  1KU9 A;  5FNV B;  5LMU B;  2Q0A A;  2UUA B;  5LA6 B;  4BW9 A;  5K1P A;  1FJG B;  1Z5W A;  4PHZ A;  5CA1 A;  4X1Y A;  5KMG A;  1QQC A;  3CB2 A;  1I94 B;  3BHP A;  4DK0 A;  3K5O A;  1XI1 A;  2VWJ A;  2E5L B;  2Q7H A;  4KL1 A;  3RYH A;  4GKK B;  1ZAU A;  5JVD B;  5J2T A;  4X1I A;  2F4V B;  5BR8 B;  4JI2 B;  5KHJ A;  3WB1 A;  1HR0 B;  5EYP B;  4AQY B;  1WNS A;  5J2U A;  5GON A;  5BMV A;  4LNU B;  5JH7 A;  3T1H B;  4TUY A;  4I50 A;  5EIB C;  4L8J A;  4CS3 A;  3BPZ A;  4EB6 A;  4TOI A;  3N2G A;  1HW7 A;  1N32 B;  5IJ0 A;  3ETQ A;  4AIL C;  3CSX A;  4JI3 B;  4GKJ B;  5EZY A;  4IIJ A;  3VQX A;  2UXD B;  4DRX A;  4ZI7 A;  4ZOL A;  1HNX B;  4OX9 B;  3JAS A;  3BA9 A;  2OYQ A;  5C8Y B;  2ZM6 B;  1TGO A;  2UXC B;  2CAZ C;  5KX5 B;  1DGS A;  1XMQ B;  2IM9 A;  2Q7G A;  4LR3 A;  1Q43 A;  1TUB B;  3JAT A;  1V9P A;  3N2K A;  1TA8 A;  3ZED A;  4EFE A;  1T5E A;  2QM4 A;  5CA1 B;  2BTO A;  5KMG B;  2YIA A;  3HKC B;  1IBK B;  1RSO A;  3U11 A;  4K0K B;  4DR7 B;  5JCO A;  4DV6 B;  4YJ2 A;  4DR6 B;  5J2T B;  4X1I B;  3SJC C;  4LF6 B;  4CS4 A;  2PZS A;  2OWO A;  5LMN B;  4EEQ A;  5EYP A;  1JMK C;  4FM2 A;  5GON B;  5BMV B;  4LNU A;  5LXT A;  4TUY B;  4DR3 B;  2E3C A;  4I50 B;  2R70 A;  4D7S A;  2BTQ B;  4O4H A;  4EB6 B;  3N2G B;  4X1K A;  5IJ0 B;  2F1M A;  5EZY B;  1TVK A;  4DV0 B;  4DRX B;  4ZOL B;  1QHT A;  3JAS B;  4UCR A;  4DV5 B;  1JJO A;  1M93 A;  4I9Q A;  2ZNI A;  1IBL B;  3QTC A;  5KX5 A;  4ZHQ A;  1M5I A;  4FLW A;  4JI0 B;  4K8Z A;  2R72 A;  4U3J A;  3JAT B;  5IWA B;  5LOV A;  1TUB A;  4JI8 B;  4X64 B;  3N2K B;  1O9G A;  4UCV A;  4LF5 B;  2ZIO A;  5KHK A;  4X20 B;  4UCU A;  2Q7E A;  4PI2 A;  5CB4 A;  5FPR A;  3HKC A;  1XNQ B;  3ZS8 C;  3BRC A;  2VQE B;  4O4L A;  4YJ2 B;  4EFB A;  3U10 A;  4IHJ A;  3BAA A;  4DR2 B;  3M7M X;  4TV9 A;  2ZIM A;  5LXT B;  1P49 A;  4CC5 A;  2PUS A;  3JAR A;  4CS2 A;  4LFB B;  3E22 B;  5LYJ A;  4O4H B;  5EIB D;  2BTQ A;  4YY3 B;  2F66 C;  4X1K B;  5KHI A;  2F95 B;  4X62 B;  1SA0 A;  4D7T A;  3K58 A;  4GYC B;  1IBM B;  3K5N A;  3HKD A;  4NVP A;  1TVK B;  4AHC A;  1VF7 A;  3CHX A;  4JYA B;  4FLY A;  4GLX A;  5D5P A;  4K8X A;  5IYZ A;  4FLT A;  1WPB A;  4ZHQ B;  3SR2 C;  2YXL A;  2KKW A;  3B2E E;  3OTO B;  4LF7 B;  4U3J B;  3JSL A;  5LOV B;  4FLU A;  5KHG A;  3RGB A;  1WN7 A;  2JVD A;  3VQV A;  2F93 B;  4CH4 A;  4DUZ B;  2PTM A;  4X20 A;  4B3S B;  1Q5O A;  4B3R B;  4FLX A;  5CB4 B;  1KMI Z;  3OTF A;  4WBN B;  4O4L B;  4JI6 B;  5CA0 B;  2PGG A;  4O2B A;  1JFF B;  1M4U A;  2RJZ A;  4IHJ B;  2P22 C;  2XHB A;  4TV9 B;  5LP6 C;  4O2A B;  1XQ8 A;  3K5L A;  4LFA B;  3JAR B;  2UXB B;  2PY5 A;  3E22 A;  5LYJ B;  2VQF B;  3BA8 A;  3RYF A;  4CH3 A;  4JI5 B;  3K5M A;  1SA0 B;  4FLZ A;  3ICX A;  3HKD B;  1XNR B;  2VWK A;  3K59 A;  3WB0 A;  2UU9 B;  3RYI B;  4DV7 B;  2JGU A;  4YJ3 A;  3SJB C;  4B08 A;  5JJE B;  2UUC B;  1B04 A;  5IYZ B;  3DSQ A;  1D5A A;  4F6R A;  2HEP A;  3MAQ A;  4FFB B;  4LH7 A;  2EX3 A;  2ZNJ A;  2ZIN A;  4JI4 B;  4DR1 B;  3UQ8 A;  2UUB B;  4O4I A;  4UFZ A;  4DV4 B;  3UT5 A;  3VQW A;  4WBN A;  5CA0 A;  4O2B B;  1FFX B;  4B3M B;  1XHX A;  1JFF A;  3FFQ A;  3PN1 A;  4YHH B;  3HKE A;  1N34 B;  4HNA A;  1NT2 B;  2YI8 A;  3JAW A;  2QJ1 A;  4O2A A;  4X65 B;  4I55 A;  4BWA A;  3SGI A;  4FM0 A;  5JJJ B;  3JAK A;  5IJ9 A;  4DK1 A;  3T1Y B;  1O9H A;  4NXM B;  3U0Z A;  4DV3 B;  3RYF B;  1Q3E A;  1XMO B;  3A2F A;  3JAL A;  4UCS A;  4TQF A;  4Q6G A;  4TV8 A;  1YEW A;  1H2S B;  4DUY B;  4JI7 B;  3RYI A;  3RFR A;  3VQY A;  5JQG A;  4YJ3 B;  3RYC B;  4O4J A;  4I4T B;  3QG5 A;  4LH6 A;  4F6R B;  1X4T A;  4FVM A;  2JS5 A;  3HKB A;  2YI9 A;  2ZCE A;  3LNN A;  4CH5 A;  4X66 B;  5JJN B;  4FFB A;  2P5O A;  4B3T B;  2YIB A;  5LP6 A;  4TQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...