1XQ8A

Human micelle-bound alpha-synuclein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
140
structure length
140
Chain Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of micelle-bound human alpha-synuclein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords Alpha-synuclein
total genus 36
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2004-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01387 Synuclein Synuclein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.700 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xq8A00
1XQ8A 2KKWA
chains in the Genus database with same CATH superfamily
1OHHG 3CXHF 4LWSA 5ITZB 2JGDB 4NXMB 3TGUH 4TUYB 2B9ZA 3UQ8A 4FLZA 4KFMA 4YJ3A 2WLKA 2HLDG 4LF8B 3FB8C 3GVMA 3RYIB 4DW0A 3HKCB 4BIZA 1SESA 4Q20A 4LWSB 4YIPA 3W7WA 4PDLA 2YIAA 4LH6A 1OCCC 4DR2B 1M56C 1RM1B 5LA6B 5F2VO 5LOVA 1AB3A 1YSCA 2AGAA 3B77A 4FIPC 3E8BA 1Q6IA 1WN7A 1V54C 3SPGA 1H2GA 2GUZB 1PL4A 2W6JG 4CS3A 5L3FA 2XASA 4RUEA 1D5AA 1QNMA 3T4ZA 4LCUC 4YY3B 1PM9A 3ML0A 4I55B 1ZX3A 1U96A 2PI4A 2QKAA 1M90W 2X6BA 4U3JA 2UUAB 2BOBC 3HKDA 1SZTA 4JAUA 1P84F 2KKWA 1V55C 2HVJC 3Q4HA 4IYIA 4GZRB 1AR1B 4I4TA 3ABUA 2CTRA 2F95B 3JD0A 1HDJA 4WFBV 1IBLB 5B1BC 4I5SA 4P9OA 2P06A 1FPOA 2AZ2A 1GN2A 1HW7A 3AEIA 1IZ3A 1NH2D 2X0LA 1SQBH 2EILC 3CB2A 1N33O 2LQTA 5FNVA 4KL1A 5LL6Y 3OW2U 3B8NA 2YDEA 4W4KA 4PA7A 2DQ3A 1R6TA 1ROPA 1Y66A 2JS3A 4UVAA 1S0VA 1K34A 3CD6V 4JF3A 2XNDG 4P2ZA 1YDXA 5LHIA 1K33A 1XI1A 3SPHA 1W2BU 4YY3O 4RO2A 2P4VA 4XDKA 4AQYO 3TXSA 4P30A 2ZR2A 1ZTEA 4GUNA 3CRMA 2Y48A 4BWAA 1WB8A 4J7JA 5EZYB 2Y4TA 3RYHB 3AG4B 3QF7A 3SGIA 1NKDA 1V54B 3ZN1A 1AI4A 1JQ0A 2KG7B 1GKFA 1FXKC 1PL0A 3K0GA 4ABMA 4DRXB 4NTXA 3ZN0A 4LF4B 1GM8A 3CJHA 2Q73A 1YJNV 1LUVA 3J80N 5EC2C 3MHHC 1PPJH 5JQGB 5EIBD 3O65A 2L35A 4Z2WA 2XT9A 4DUYO 3BABA 5J2TB 2P5OA 5D5QA 4DYLA 2VWKA 1VQNV 3RFRA 2UUCB 4UFZA 4JYYA 3AK1A 4HAMA 2N74A 1I94B 5EBLC 1ZAUA 2WA4A 4WBNA 1EZVH 4DV7B 2Q7EA 1TUBA 1IBKB 4MVZA 1BHBA 3RT3C 5C8YB 2PF4E 2ZD9A 4U7NA 3T1YB 1GO3F 1GN6A 4MTOA 4I9QA 3M8AA 3H1IH 4MSWC 4WCEV 2P22C 3LNNA 2Q67A 3JALB 2YIBD 1MZEA 1Z5WA 1M93A 3RW0A 4JI0B 1WNSA 4LFBB 2JDIG 3H9VA 3JD3A 2R9RB 2EIJC 2EIMB 1X4TA 4NTYA 5B3SC 3JASA 3NXSA 4MW8A 3N2GA 4LR3A 5GONA 3MHSC 4Z1MG 2DWEC 2CK3G 3ZBHA 2OT5A 1Y74A 3TCUA 1KBHA 3JASB 1VQ5V 1S5LZ 3J81N 3ZHRA 5DECA 1WPBA 5JCOA 5IWAB 4O2BB 2N05A 2GDSA 2A79B 3OUFA 2WAMA 1Y67A 4GX2A 3UT5B 3VBBA 3OE7G 1VP7A 4X65B 5LHHA 1M9NA 2AHZA 2BTOA 4CC5A 1LR1A 1RPRA 2LO1A 3K03A 5TISZ 3E8FA 3K5NA 1QLNA 4GKJB 1DF5A 1B04A 2PTMA 1PD3A 5BR8B 4JYCA 4PELA 3ZRSA 2ZM6O 4HZ3A 1FFXA 2QTOA 4GT1A 4X64B 2PI5A 4GX0A 1VF5B 1IXMA 4FK5C 5IDJA 2BTQA 3UCSC 3LUTB 1V55B 1HR0B 3RYHA 1IBKO 2CE4A 1R3JC 3D36A 3PJSK 3RGBA 3GWOA 1XNRO 2GTAA 4U7OA 2D2CB 2QM7A 3K5LA 1OCOB 5B1AB 1OZ0A 5H6RA 4JI8O 4DV3O 4NXNB 2Y0PA 3T1CA 3AG2B 5LOVB 1M57C 1F51A 4BAYA 3JD4A 2WLLB 3KKYA 1Q5OA 4FLVA 2Z5UA 4Q6GA 2ZKOA 4A5UB 4O4LA 4KHPO 4E4EA 4JI4O 2HHHB 1W0KG 1KP2A 2DE0X 2EULA 3CMAV 1H2SB 3OFNG 3DTUB 1FJGB 3DXRA 3WB1A 1SS3A 3RYCB 1Y6XA 2VQFO 4WFAV 3CCQV 1IXBA 3TJTA 2QE7G 4TSFG 3SPJA 5LGNA 3OEHG 4EB6B 3ETQA 4G28B 1J5EB 4J9YB 1SQQH 5GTIZ 2QJ1A 1IBMB 5C93A 2WWWA 3CPWU 1YJ9V 2Y69C 3L74H 1M57B 2JJ2G 3CRQA 4N21A 4QPKA 3JAWB 3ASOC 3B8MA 2LFSA 3T1YO 3AG1C 4JI1O 3FB6C 3H1JH 3IC9A 3ABLC 4OPAA 5CBGA 2IM9A 3ZIAG 1PV0A 4OX9B 2Y4UA 4ZI7A 2EZPA 2KG7A 3FAVA 3E89A 4BIOA 1AI5A 4LFBO 4LP8A 4DV0B 3OT7A 4C7UA 2RJZA 3APQA 4TWKA 4OX9O 1B6QA 3G4SV 2WSSG 3FAVB 2R9AA 4JTAB 4J42A 3K79A 3CSXA 4I4TB 4UV9A 2QSAA 4GLXA 2JJ1G 2Q0OC 1VF6A 3IJ4A 4DV5B 2CUGA 2UXCO 4DV4O 2JK5C 1B3QA 3FB5C 1Q81W 3CCEV 3OEEG 5BXZA 4JTDB 2RNBA 3LNMB 1FXKB 3JSNA 3OGCC 4O4JB 4AI8A 2HKOA 2UUBB 1XOUA 2VS0A 5KHHA 2F66C 4UV8A 2RN9A 1JCHA 4UUJC 4UVBA 4DUZB 2UU9B 1NS1A 5KUKA 2DYRC 3QO5A 2QKCA 2GUZA 4X1IB 3C3SA 1L0NH 3K04A 3H1HH 1DGSA 1A32A 1KP3A 3DGEA 1QU7A 1WLEA 4ZBMA 3OMAB 3VQVA 3VQWA 2IJKA 4ZI7B 3S3XA 3KZIZ 1KU9A 1AR4A 2E3CA 1AR5A 1NBMG 2M6YA 2YXYA 1N32O 3ETEA 3EFFK 1RP3B 2MW2B 2CGNA 1GAXA 1R3KC 5CB4B 4X20B 2ZINA 3L75H 2H8PC 1Q3EA 3SYQA 1W59A 1H2MA 5LMUB 2KSDA 2F4VO 2YS8A 3FFQA 5KMGA 5CA3A 1BHAA 4FZ1A 3BCCH 4ICGA 2ETNA 3RVZA 1MOFA 5LMNO 1GTOA 4MVSA 1ZLZA 1QR9A 1AILA 2HHHO 4X1YA 5LXTB 1Y4MA 1R3LC 4AQYB 1FXVA 4TUYA 5JH7B 1RM1C 2Q69A 5JQGA 3ICXA 4D6TH 5CBFA 2IU0A 1QLEB 5IYCO 1NVPB 2VWJA 1YEWA 1Q7YW 4KP4A 1R6KA 4I0XA 1VARA 2E5LO 4TV8A 4YJ2A 2BE3A 3P30A 2PUSA 2Q4PA 3ETDA 3JAKA 1HP8A 3M99B 1XL6A 1XHXA 2ATKC 2EX3A 3LSUA 4OGQB 1K4CC 3N2KA 1YI2V 1I08A 5IYBO 1BQZA 4B3SB 4DV2B 1NVPD 2CGOA 5KA5A 4WFEA 4MS2A 5A2QN 1CPYA 1N36B 2FKXA 5IY5C 1BCCH 4PHZA 4WFGA 1Z2GA 3ZS8C 5KMGB 4JPRA 4DR1O 1M56B 4LFCB 2YI9A 2WLIA 5GONB 4JV5B 4LF8O 1WA8A 4PDRA 1Q86W 1XILA 3H1KH 1YZBA 4UCRA 4DRXA 4N23A 2P67A 5LMNB 2JVDA 2AHYA 3BA8A 1Q6HA 5FPRA 3K3WA 1TUBB 4GKJO 3CC2V 2JS5A 3OUSA 5IT9N 3SYCA 4QE7A 1AP6A 1FKAO 1K97A 1VQMV 3APOA 1MMMA 2XOKG 5J2TA 2RDCA 2M7WA 3JCZA 2O57A 4B08A 3QVNA 3HB3B 1TUEB 3STZC 3AK2A 4LNUA 3WB0A 4J10A 4NVPA 5AG2A 1KUQA 1IURA 5CA0B 1AI7A 3CRCA 5EIBC 5A9GA 4DR5B 1AP5A 2P6JA 4H0LB 3T2MA 4K3AA 5DEDA 1XREA 4J9ZB 1OV9A 2EZOA 1OCCB 2A3QA 3SYPA 5LGTA 3KCYA 4ZIBA 1G6UA 5H5NA 3K59A 3ASNC 4PV1B 4DV5O 4UXNA 5KHKA 1VF7A 2NNUA 3U11A 1VQ7V 1TGOA 2UXNA 1SETA 3D36C 2F93B 3CCRV 4J11A 1TVKA 2ITCC 5LP6B 3IFXA 2LP7A 3VQYA 5J9PC 4XBFA 1YJWV 2ZNJA 3M7MX 4JASA 4IHJB 1EN4A 2UXDO 1S5HC 3WU2Z 4F6RA 2VQEB 3ASOB 3CCVV 2W0FC 4CS4A 1O9HA 4CH3A 3SPIA 3SJBC 4JYAB 1HNWB 2QA4V 1GK9A 3L9DA 3STLC 2X6CA 3KCXA 1N0NA 2B1IA 5EK0A 3ZX6A 1K3EA 5JWPA 1NU1H 1MSWD 1NTKH 2EBOA 4O4HA 3RYIA 1JR9A 3WFVA 4G2KA 1JPXA 4FLWA 1IX9A 3L72H 1OJHA 2G38A 2QWQB 2DWDC 1PKXA 3A0RA 5JVDA 2Q9LA 1MABG 1L1FA 3CX5F 4O4LB 4B3TO 3CEIA 4FLTA 4UB6Z 2X6AA 4LH7A 4J41A 1Z5VA 1E79G 4J7ZA 2OCHA 4RAIA 4WF9V 3WG7B 1UJWB 2QEXV 2EINB 3SR2C 3HR0A 2QM8A 2P90A 4TV9A 2VQFB 1L8DA 2IJIA 2DYSC 3OTOB 4QGPA 2ZQMA 4TQFA 3HKDB 5KHIA 2K1EA 3FKSG 4DR7B 2WLJA 1SQGA 5B1AC 1H8EG 2AW9A 4IT5A 4O4IA 3AG2C 4DV6B 2CAZC 2HJDA 2BTQB 4FM2A 1SA0A 4PJ0Z 2EIMC 3E8GA 1N36O 1PNKA 1NR1A 5B3SB 3QO8A 4CZZA 1XMQB 3OR7C 3SJCC 2IH1C 4TOIA 2FL4A 4O4HB 1VQPV 4R7CA 1T5EA 5LYJB 1VQLV 1MZFA 4DV1B 4PI0A 1WB7A 1EZJA 4XDLA 2ZCEA 3HPLC 1I7FA 1ZUQA 4FVMA 2L6LA 1XEQA 1DTOA 2WLMA 4JI4B 3RYFB 4CH6A 2WLIB 1E1RG 4DR6O 1XNRB 1GN3A 3G71V 1DF4A 3ZCCA 4YXWG 1S5JA 3F5TA 1Y74B 1UPGA 1F23A 1F4NA 1XNQO 4B3MB 4DR7O 4BR6A 3NR7A 3F7YC 4JAVA 3UT5A 2QWRB 1VQ8V 2QWNB 2QKSA 2W0XA 1H8HG 3T1HO 3K06A 3JARB 5C8YA 4JYAO 4FMTA 3UO3A 2OCCC 1EBOA 4DUYB 4LF6O 3ZMSA 2EJ7A 1QLEC 4FFBA 4ASUG 1AI6A 4I50A 4DR5O 1M4UA 3HKEB 3E22A 2GTSA 2EIKB 3JD2A 4E2LA 2DN9A 2Y69B 2FMLA 4X89A 2HR3A 2YUAA 4CH5A 1KYOF 4K0KO 1JA8A 2KQXA 1XBLA 4H44B 1X59A 4DR3O 1S3JA 2OIGA 2ILMA 4O2AA 5LHGA 3ABMC 3K9AA 2UXDB 3TETA 3CP1A 2DW4A 2UXBB 3AG3B 3P3NA 5BR8O 2LW7A 4LBEC 5CB4A 2HEPA 2QWPB 2V4DA 4B3RO 1YIJV 1EM1A 3RBZA 3OTOO 4ZOLB 4JZ2A 5IY5B 2Y0IA 1F7YA 4HBNA 4RQEA 3ZEDA 5CA1A 2CTQA 2UU9O 1S77D 2ZIMA 3VOUA 4JTCB 2BOCC 2R72A 2GV9A 3G80A 4F6EA 1WP7A 1YITV 1L0LH 2JEXA 1OCRC 4X62O 3T1HB 4B7EA 1N8RW 1THZA 5J2UB 3LDCA 2PY5A 3QG5A 1N0JA 3SDLA 3JD1A 1VQ4V 2YICA 3UO2A 3CHXA 1XMOO 1URFA 1BMFG 2NN4A 4I0XB 4MTGA 2H94A 4I9WA 1BT8A 1N33B 3CCLV 2XHBA 4PA3A 3L73H 5LBQA 3JALA 5H9CA 3AG7A 3FYIB 1TAEA 2P4KA 1SERA 1N34B 3N2KB 5L3GA 4B3TB 4QE9A 1NZ6A 3CJHB 4UCTA 4LFAB 2BCCH 3MD0A 3OAAG 4AILC 4JAAA 1JJOA 1MA1A 4JI6O 2GHYA 4LF5O 4DV7O 1BSMA 1CP9A 5KHGA 4X64O 2K9PA 3CRRA 5LXTA 4JYBA 4NKGB 1K8AW 4NXNO 3CC7V 4R8CA 3CC4V 1SQVH 5FPOA 4O4IB 2VQEO 1NI8A 3OR6C 1SKVA 3CRAA 4X1KA 4DV1O 3CCMV 4IHJA 5BZBA 3OD4A 3EXAA 1K5QA 1H2KA 1KC8W 3W7UA 3R65A 2A06H 4IGGA 4MW3A 3SYOA 5JJJB 4GX1A 1XMQO 1QVFU 4X66B 4HYOA 3HKCA 2XAGA 3FB7C 1LUWA 2YXLA 3OMNB 5LYJA 3G6BA 4NXMO 1FXHA 4X20A 4FJCC 3IAYA 1K5SA 3CS5A 2ARHA 1J95A 1IBMO 1GM7A 4LF5B 3JATA 5EBMC 3U0ZA 3RYFA 4CBCA 4PDMA 1KMIZ 4NTWA 4MVQA 1QCEA 2Q7HA 4X9QA 3BFRA 4B3MO 4U3JB 4I55A 4Z1VA 3H1LH 2ZDIC 4DR3B 5IYDO 3JAMN 5L3CA 4XDJA 5LP6A 3K58A 2AZ0A 4F6RB 4IIJA 1H38A 4MVUA 1ZWIC 2BSKA 2QM4A 3CWBH 2HJFC 4YHHB 3ZJZA 2V1DA 5IJ0B 1US6A 3DXRB 3RYCA 1R3IC 3E35A 1H2LA 3CXCU 5FNVB 3LDDA 2P7TC 2BSKB 2XAFA 3W7SA 4DV3B 2IJJA 4AHCA 4JI5B 1M1KW 4FM0A 1W0JG 4TQDA 3ZHSA 4HNAA 2Q8VA 2IH3C 3A2FA 3TXQA 2OYQA 4WFHA 4DV0O 1NH2B 4DV4B 1PP9H 1IDSA 4X8AA 4UCUA 4FLXA 4DK0A 5ITZA 1E1QG 3C90A 1SA0B 2EIJB 3FD9A 1ZSPA 2Q68A 1G8MA 2NLJC 2HFEC 2ZE8A 5E1AC 2YIBA 1JMKC 4QIWF 3WB2A 3B4SA 3AG3C 4L8JA 3DC6A 2Q7GA 5L3EA 3AK3A 2ADQB 2ZR3A 3JATB 2CTWA 2ADPA 2WLLA 1K9MW 4EFBA 4DR2O 3ZRWA 3CYOA 2JRIA 3QTCA 3A0HZ 2FB5A 3W7TA 1F4MA 4DR4B 5IYZB 3T4DA 1SRYA 1VQ6V 4LFAO 2JGUA 3ZMTA 5EYPA 3FX7A 1HR0O 3LSSA 1Q82W 4RQFA 3G67A 5CBHA 1DLBA 3P32A 4ZOLA 1I5XA 4KXRA 4I7ZB 1HNXB 5L3BA 1PNLA 2E5LB 5E79Z 1QR8A 2QGNA 4D7SA 4CS2A 1Y76A 4ZHQB 1D2DA 1BE3H 4JI3O 3BY6A 4MT8A 4IL6Z 4JI8B 3IGAC 3K9SA 2JGDA 5GTHZ 4YHHO 1HNZO 4X88A 1G1XB 3RN4A 5KX5B 3CE2A 4EEQA 1D5NA 1DK1A 4NR1A 4JI3B 3N27A 1Q6UA 3JAWA 4X62B 1IVSA 1MG1A 2IU3A 1VIBA 2HG5C 4X1KB 4GX5A 4WBNB 4J80A 1OCZC 4DR6B 3I5DA 2N04A 1Q43A 1RFYA 1V9PA 5B1OA 2RMKB 4FFKA 3E22B 1JFFB 1LNQA 4R6ZA 3R66A 1CXZB 1GN4A 1WPXA 5D5PA 4W4LA 3SYAA 4MVRA 4B7KA 3HKBB 4PDVA 1XL4A 2UUBO 1VQ9V 5B66Z 2RCVA 1VQOV 1JFFA 1WA8B 3B2EE 1AJPA 5DM6V 1JJ2U 4CC6A 4H13B 2EIKC 2HVKC 2CH7A 2LW1A 3E8HA 1HNZB 1HNWO 2W6IG 1KECA 2DYRB 1WP8A 1BGYH 1ZL8A 3K5MA 1U97A 1P49A 2Q6AA 1GRJA 4QPJA 3VQXA 5K1PA 1EN5A 4DV2O 4JV5O 1YHQV 2A9HA 1QHTA 3LSQA 5KX5A 5LGUA 1MNGA 1I5YA 3IC7A 1TA8A 3E2EA 3F5WC 1XDCA 2OTJV 1COWG 4RUFA 3MAQA 2JEUA 1YTFB 1R73A 5B5EZ 4I50B 1KKDA 2ODMA 2VRZA 3BRCA 1FFXB 1K73W 1AROP 2PGGA 4NYKA 5EC1C 4QJFB 2QWOB 1KB9F 2F23A 3A0BZ 2XAJA 2E76B 2ZE5A 4PI2A 1FAFA 3JSLA 2YEVB 4LF9B 2Z0AA 1R1BA 3K57A 4KHPB 3X2QC 3D8CA 3LDEA 4O2AB 3RWRD 5JJEB 4FFBB 3HKBA 1GM9A 2UXBO 3OGIB 4JI6B 2Q0AA 3ZRWB 1FYJA 2KB1A 2YSUB 4PA6A 2ZT9B 1GH6A 1YXBA 5JH7A 3JYCA 5EYPB 1JVMA 5EBWC 1J5EO 3H01A 5IJ9B 2YIDA 3W7XA 3RVYA 2X7RB 1WJZA 2DOSA 3GB7C 2XTAA 3SJQC 2LJ2A 2ZE7A 3ZMUA 2WLHA 3QNEA 4FLYA 2XAHA 4EKWA 2Z3YA 4TV8B 4YJ2B 2CDYA 4H37A 4O4JA 3K5OA 2IW5A 2GBOA 1Y76B 3D3QA 3FYEB 3JARA 1BL8A 1G4YB 5KLVH 3BAAA 5LMUO 2OTLV 1RPOA 4PA4A 4MTFA 4GCZA 2DQ0A 3QO7A 4DXWA 3CCSV 4X1IA 1FS0G 3OTFA 4IYHA 4DR1B 4FPPA 1Q8IA 1NR7A 3BEHA 4P9PA 5K1XA 4J7KA 2OWOA 4OXSA 3OMIB 5EZYA 2ZIOA 3E86A 1YVWA 3ZMVA 5JVDB 5JCOC 4F4LA 4JI7O 1SC5B 1I0HA 1HNXO 4L87A 4LF9O 2C2AA 3UM7A 1FFTB 2B1GA 3BA9A 2PZSA 1XNQB 2NR5A 1BQ0A 4JI7B 4CH4A 1ORQC 2YI8A 2ZM6B 2ITDC 3J7AU 1NTMH 3THOA 3UKMA 5HFMA 2ZNIA 4YIOA 1FD9A 1GMGA 2WA3A 1NTZH 3K0DA 2E74B 5CA1B 1EN6A 4BIUA 1NT2B 4JZGA 1KD1W 1Q90D 5IJ0A 3ZRXA 1MSDA 4LC1A 3BVOA 2H3OA 3L70H 1FXKA 3ZMZA 1AJNA 3MDSA 4LFCO 1XHZA 5J2UA 4X65O 5CA0A 4WFFA 4K35A 2Q5ZA 4B3RB 1KQSU 3WG7C 5KHJA 4DW1A 1N4CA 2FTKA 4D7TA 1AJQA 4K0KB 3BPZA 5GW7A 1VEWA 3D3IA 1YTFD 3EHBB 4GKKO 4DV6O 2F4VB 2OIEA 5FL7G 2LGQA 5LA6A 1JOYA 3ABKB 3ETGA 4FZ0A 4UB8Z 3B09A 4LNUB 2EILB 5IJ9A 1I94O 2IBZH 1RSOA 4TT3G 1YCIA 1QVGU 2CH7B 1M5IA 2ZXWB 2DMXA 1OCOC 3SPCA 3GWKC 3Q4HB 5HFLA 5DN6G 1IBLO 5KAIZ 3ZRVA 5CMUA 2PYJA 4YJ3B 1B06A 2UXXA 4K8ZA 3AG1B 3ZHVA 4JI5O 3E83A 4JI1B 4EFEA 1BS3A 4ZKIA 5H2FZ 2HP8A 1XQ8A 4LF6B 3I56V 1CEZA 3TK1A 3AG4C 3CMEV 1XMOB 2XUMA 1TVKB 4OPHA 2DJVA 3CCJV 4DK1A 3ABKC 2UUCO 3BHPA 5KA6A 4EB6A 3PN1A 4GKKB 1SF9A 4MVOA 2V7QG 4LF7O 1VQKV 3ZHTA 2LFRA 2YEVA 4PD4F 2A0LA 2WPDG 3ABTA 1VF6C 1VMGA 3JAKB 5BMVA 2E75B 2WLNA 5JJNB 3ZHUA 1QQCA 2QDOA 3ASNB 1JX9A 4MTXA 4BW5A 1K92A 4UVCA 3DC5A 2AXTZ 3F7VC 1RSOB 4RWUA 3ZHQA 4JGSA 4JI0O 1PNMA 2D3OW 3B40A 5BY1A 4GYCB 3S3WA 3OM3B 4ZHQA 3HKEA 2F43G 4JI2O 4X1YB 4B3SO 4IIJB 1AVMA 5KAFZ 2QTSA 4O2BA 3L71H 3I55V 5L3DA 2YC0A 2RQ6A 2ZXWC 2IJHA 1K4DC 2JIZG 1O9GA 4UCOA 3KG2A 1ZL8B 4QNHB 1BZKA 3X2QB 1EFRG 2LGWA 2UXCB 1FJGO 3A8TA 4R50A 3JCUZ 2ZDIA 4NB5A 1NQTA 1NJIW 1S76D 4H33A 2F1MA 2EINC 4UCSA 5LP6C 2EJRA 4MVMA 2QR4A 3K08A 3O9OA 5B1NA 3ABMB 2DYSB 1H2NA 4LF7B 2ZE6A 5IE9A 1K7DA 5B1BB 5H6QA 1YF2A 3CCUV 4K8XA 5BMVB 1KKCA 1P4RA 1QBZA 4DR4O 4DUZO 2GSMB 1ENVA 2A7WA 2B5UA 1SZXA 2R70A 3SJAC 1XUQA 5CN0A 1UFIA 2YXHA 3DSQA 1R6NA 4BW9A 1WAZA 5IYZA 1OCRB 4G27B 4PA9A 3EVKA 5KUMA 3P3PA 4DO2A 3C3TA 3U10A 1S72V 4TV9B 3ABLB 1N32B 1OCZB 4LF4O 2OCCB 3G6EV 1P7BA 2UUAO 3N2GB 4U3FH 2CTPA 1SQXH 2PYLA 4FM1A 1N34O 4JI2B 4HNAB 4UCVA 2FYUH 4KUMA 1SQPH 5FLXN 4FLUA 2XAQA 5IWAO 2R9IA 2MK3A 1P7GA 1HWYA 1SQFA 4X66O
chains in the Genus database with same CATH topology
3K5MA 1P49A 5ITZB 4B3MB 4NXMB 3VQXA 4TUYB 3UQ8A 4FLZA 5K1PA 3UT5A 4YJ3A 1QHTA 4LF8B 5KX5A 3JSNA 3RYIB 4O4JB 2UUBB 3HKCB 1TA8A 5KHHA 2F66C 3MAQA 3JARB 5C8YA 4DUZB 2UU9B 2YIAA 4I50B 4LH6A 4X1IB 4DR2B 3BRCA 1FFXB 2PGGA 5LA6B 4DUYB 5LOVA 1DGSA 1WN7A 4PI2A 4FFBA 3VQVA 3JSLA 3VQWA 4LF9B 4I50A 4CS3A 4ZI7B 1M4UA 3HKEB 3E22A 1KU9A 3K57A 4KHPB 2E3CA 1D5AA 4YY3B 4I55B 4O2AB 3RWRD 5JJEB 4U3JA 4FFBB 4CH5A 2UUAB 3HKBA 3HKDA 4JI6B 5CB4B 4X20B 2ZINA 2Q0AA 2KKWA 1Q3EA 5LMUB 4O2AA 2UXDB 3FFQA 4I4TA 5KMGA 2F95B 2UXBB 5JH7A 5EYPB 1IBLB 5CB4A 2HEPA 2V4DA 5IJ9B 1HW7A 4X1YA 4ZOLB 5LXTB 4AQYB 4HBNA 3CB2A 5FNVA 4KL1A 3ZEDA 5CA1A 4TUYA 5JH7B 5JQGA 4FLYA 3ICXA 4TV8B 2ZIMA 4YJ2B 4O4JA 3K5OA 2R72A 2GV9A 3JARA 2VWJA 1YEWA 3BAAA 4X1IA 4TV8A 4YJ2A 3T1HB 3OTFA 5J2UB 2PUSA 4DR1B 2PY5A 1XI1A 1Q8IA 3QG5A 3JAKA 5K1XA 2OWOA 3CHXA 1XHXA 2EX3A 1N33B 3N2KA 5EZYA 2ZIOA 2XHBA 5JVDB 5JCOC 4B3SB 4DV2B 3JALA 1TAEA 4BWAA 1N34B 3N2KB 5EZYB 3BA9A 1N36B 2PZSA 4B3TB 3RYHB 3QF7A 3SGIA 1XNQB 4UCTA 4LFAB 4PHZA 4AILC 1JJOA 4JI7B 4CH4A 3ZS8C 2YI8A 5KMGB 4LFCB 2YI9A 4DRXB 2ZM6B 5GONB 4JV5B 4LF4B 3THOA 5KHGA 5LXTA 2ZNIA 4UCRA 4DRXA 5JQGB 5LMNB 5EIBD 2JVDA 5FPOA 4O4IB 5CA1B 3BA8A 1NT2B 5FPRA 1TUBB 3BABA 5J2TB 2P5OA 5D5QA 5IJ0A 2JS5A 1SKVA 2VWKA 4X1KA 3RFRA 2UUCB 4UFZA 4IHJA 1I94B 1ZAUA 4WBNA 4DV7B 2Q7EA 1TUBA 1XHZA 5J2UA 5CA0A 5J2TA 5JJJB 1IBKB 4B3RB 4X66B 5C8YB 3HKCA 5KHJA 3T1YB 2YXLA 4B08A 5LYJA 4D7TA 4K0KB 4X20A 3BPZA 4I9QA 4LNUA 3IAYA 3WB0A 4NVPA 2F4VB 2P22C 5CA0B 3LNNA 5LA6A 3JALB 2YIBD 5EIBC 4DR5B 4LF5B 1Z5WA 1M93A 3JATA 3U0ZA 4LNUB 4JI0B 1WNSA 4LFBB 5IJ9A 3RYFA 1KMIZ 2Q7HA 1RSOA 1X4TA 3JASA 4U3JB 4I55A 1M5IA 3N2GA 4ZIBA 4LR3A 5GONA 1G6UA 4DR3B 3K59A 5LP6A 3JASB 5KHKA 1VF7A 3K58A 3U11A 1WPBA 5JCOA 4IIJA 1TGOA 4O2BB 4F6RB 5IWAB 2F93B 2PYJA 4YJ3B 4K8ZA 1TVKA 2QM4A 5LP6B 4JI1B 3UT5B 4EFEA 4YHHB 3VQYA 1XQ8A 5IJ0B 4LF6B 2ZNJA 4X65B 3M7MX 3RYCA 4IHJB 2BTOA 4CC5A 3K5NA 5FNVB 1XMOB 4F6RA 2VQEB 4GKJB 1TVKB 4DV3B 4AHCA 4JI5B 4CS4A 4FM0A 1O9HA 4CH3A 1B04A 2PTMA 4TQDA 5BR8B 4DK1A 3SJBC 4HNAA 4JYAB 1HNWB 3BHPA 3A2FA 3PN1A 4EB6A 2OYQA 4GKKB 4DV4B 1FFXA 4X64B 4UCUA 4FLXA 4DK0A 5ITZA 2BTQA 1HR0B 1SA0B 3RYHA 2YIBA 3RGBA 1JMKC 4O4HA 3RYIA 3WB2A 4L8JA 3K5LA 3JAKB 5BMVA 5JJNB 2Q7GA 4FLWA 1QQCA 3JATB 5JVDA 4EFBA 4NXNB 3QTCA 4DR4B 5IYZB 5LOVB 4O4LB 4FLTA 4LH7A 2JGUA 1Z5VA 4GYCB 5EYPA 1Q5OA 4FLVA 4Q6GA 4ZHQA 3HKEA 3SR2C 4TV9A 4O4LA 4X1YB 4ZOLA 2VQFB 1L8DA 4IIJB 3OTOB 2HHHB 4O2BA 1HNXB 2E5LB 4TQFA 1H2SB 3HKDB 5KHIA 4DR7B 1FJGB 1SQGA 2RQ6A 3WB1A 4D7SA 4CS2A 4ZHQB 3RYCB 1O9GA 4JI8B 4UCOA 4O4IA 2UXCB 4EB6B 3ETQA 4DV6B 2CAZC 5KX5B 1J5EB 4EEQA 4JI3B 2QJ1A 1IBMB 3JAWA 4X62B 2F1MA 2BTQB 4UCSA 5LP6C 1SA0A 4FM2A 4X1KB 4WBNB 1XMQB 3SJCC 4LF7B 4TOIA 4DR6B 3JAWB 4O4HB 4K8XA 5BMVB 1Q43A 1T5EA 5LYJB 2IM9A 4DV1B 1V9PA 2R70A 3SJAC 4PI0A 4OX9B 3E22B 1JFFB 2ZCEA 3DSQA 4ZI7A 4BW9A 1I7FA 5IYZA 4FVMA 5D5PA 4DV0B 4JI4B 3HKBB 2RJZA 3RYFB 4CH6A 3U10A 4TV9B 1JFFA 2R9AA 3B2EE 1N32B 3CSXA 4I4TB 4CC6A 1XNRB 3N2GB 4GLXA 1S5JA 2PYLA 4DV5B 4FM1A 1HNZB 4JI2B 4HNAB 4UCVA 4FLUA 1SQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XQ8 A;  2KKW A; 
#chains in the Genus database with same CATH topology
 1OHH G;  3CXH F;  4LWS A;  5ITZ B;  2JGD B;  4NXM B;  3TGU H;  4TUY B;  2B9Z A;  3UQ8 A;  4FLZ A;  4KFM A;  4YJ3 A;  2WLK A;  2HLD G;  4LF8 B;  3FB8 C;  3GVM A;  3RYI B;  4DW0 A;  3HKC B;  4BIZ A;  1SES A;  4Q20 A;  4LWS B;  4YIP A;  3W7W A;  4PDL A;  2YIA A;  4LH6 A;  1OCC C;  4DR2 B;  1M56 C;  1RM1 B;  5LA6 B;  5F2V O;  5LOV A;  1AB3 A;  1YSC A;  2AGA A;  3B77 A;  4FIP C;  3E8B A;  1Q6I A;  1WN7 A;  1V54 C;  3SPG A;  1H2G A;  2GUZ B;  1PL4 A;  2W6J G;  4CS3 A;  5L3F A;  2XAS A;  4RUE A;  1D5A A;  1QNM A;  3T4Z A;  4LCU C;  4YY3 B;  1PM9 A;  3ML0 A;  4I55 B;  1ZX3 A;  1U96 A;  2PI4 A;  2QKA A;  1M90 W;  2X6B A;  4U3J A;  2UUA B;  2BOB C;  3HKD A;  1SZT A;  4JAU A;  1P84 F;  2KKW A;  1V55 C;  2HVJ C;  3Q4H A;  4IYI A;  4GZR B;  1AR1 B;  4I4T A;  3ABU A;  2CTR A;  2F95 B;  3JD0 A;  1HDJ A;  4WFB V;  1IBL B;  5B1B C;  4I5S A;  4P9O A;  2P06 A;  1FPO A;  2AZ2 A;  1GN2 A;  1HW7 A;  3AEI A;  1IZ3 A;  1NH2 D;  2X0L A;  1SQB H;  2EIL C;  3CB2 A;  1N33 O;  2LQT A;  5FNV A;  4KL1 A;  5LL6 Y;  3OW2 U;  3B8N A;  2YDE A;  4W4K A;  4PA7 A;  2DQ3 A;  1R6T A;  1ROP A;  1Y66 A;  2JS3 A;  4UVA A;  1S0V A;  1K34 A;  3CD6 V;  4JF3 A;  2XND G;  4P2Z A;  1YDX A;  5LHI A;  1K33 A;  1XI1 A;  3SPH A;  1W2B U;  4YY3 O;  4RO2 A;  2P4V A;  4XDK A;  4AQY O;  3TXS A;  4P30 A;  2ZR2 A;  1ZTE A;  4GUN A;  3CRM A;  2Y48 A;  4BWA A;  1WB8 A;  4J7J A;  5EZY B;  2Y4T A;  3RYH B;  3AG4 B;  3QF7 A;  3SGI A;  1NKD A;  1V54 B;  3ZN1 A;  1AI4 A;  1JQ0 A;  2KG7 B;  1GKF A;  1FXK C;  1PL0 A;  3K0G A;  4ABM A;  4DRX B;  4NTX A;  3ZN0 A;  4LF4 B;  1GM8 A;  3CJH A;  2Q73 A;  1YJN V;  1LUV A;  3J80 N;  5EC2 C;  3MHH C;  1PPJ H;  5JQG B;  5EIB D;  3O65 A;  2L35 A;  4Z2W A;  2XT9 A;  4DUY O;  3BAB A;  5J2T B;  2P5O A;  5D5Q A;  4DYL A;  2VWK A;  1VQN V;  3RFR A;  2UUC B;  4UFZ A;  4JYY A;  3AK1 A;  4HAM A;  2N74 A;  1I94 B;  5EBL C;  1ZAU A;  2WA4 A;  4WBN A;  1EZV H;  4DV7 B;  2Q7E A;  1TUB A;  1IBK B;  4MVZ A;  1BHB A;  3RT3 C;  5C8Y B;  2PF4 E;  2ZD9 A;  4U7N A;  3T1Y B;  1GO3 F;  1GN6 A;  4MTO A;  4I9Q A;  3M8A A;  3H1I H;  4MSW C;  4WCE V;  2P22 C;  3LNN A;  2Q67 A;  3JAL B;  2YIB D;  1MZE A;  1Z5W A;  1M93 A;  3RW0 A;  4JI0 B;  1WNS A;  4LFB B;  2JDI G;  3H9V A;  3JD3 A;  2R9R B;  2EIJ C;  2EIM B;  1X4T A;  4NTY A;  5B3S C;  3JAS A;  3NXS A;  4MW8 A;  3N2G A;  4LR3 A;  5GON A;  3MHS C;  4Z1M G;  2DWE C;  2CK3 G;  3ZBH A;  2OT5 A;  1Y74 A;  3TCU A;  1KBH A;  3JAS B;  1VQ5 V;  1S5L Z;  3J81 N;  3ZHR A;  5DEC A;  1WPB A;  5JCO A;  5IWA B;  4O2B B;  2N05 A;  2GDS A;  2A79 B;  3OUF A;  2WAM A;  1Y67 A;  4GX2 A;  3UT5 B;  3VBB A;  3OE7 G;  1VP7 A;  4X65 B;  5LHH A;  1M9N A;  2AHZ A;  2BTO A;  4CC5 A;  1LR1 A;  1RPR A;  2LO1 A;  3K03 A;  5TIS Z;  3E8F A;  3K5N A;  1QLN A;  4GKJ B;  1DF5 A;  1B04 A;  2PTM A;  1PD3 A;  5BR8 B;  4JYC A;  4PEL A;  3ZRS A;  2ZM6 O;  4HZ3 A;  1FFX A;  2QTO A;  4GT1 A;  4X64 B;  2PI5 A;  4GX0 A;  1VF5 B;  1IXM A;  4FK5 C;  5IDJ A;  2BTQ A;  3UCS C;  3LUT B;  1V55 B;  1HR0 B;  3RYH A;  1IBK O;  2CE4 A;  1R3J C;  3D36 A;  3PJS K;  3RGB A;  3GWO A;  1XNR O;  2GTA A;  4U7O A;  2D2C B;  2QM7 A;  3K5L A;  1OCO B;  5B1A B;  1OZ0 A;  5H6R A;  4JI8 O;  4DV3 O;  4NXN B;  2Y0P A;  3T1C A;  3AG2 B;  5LOV B;  1M57 C;  1F51 A;  4BAY A;  3JD4 A;  2WLL B;  3KKY A;  1Q5O A;  4FLV A;  2Z5U A;  4Q6G A;  2ZKO A;  4A5U B;  4O4L A;  4KHP O;  4E4E A;  4JI4 O;  2HHH B;  1W0K G;  1KP2 A;  2DE0 X;  2EUL A;  3CMA V;  1H2S B;  3OFN G;  3DTU B;  1FJG B;  3DXR A;  3WB1 A;  1SS3 A;  3RYC B;  1Y6X A;  2VQF O;  4WFA V;  3CCQ V;  1IXB A;  3TJT A;  2QE7 G;  4TSF G;  3SPJ A;  5LGN A;  3OEH G;  4EB6 B;  3ETQ A;  4G28 B;  1J5E B;  4J9Y B;  1SQQ H;  5GTI Z;  2QJ1 A;  1IBM B;  5C93 A;  2WWW A;  3CPW U;  1YJ9 V;  2Y69 C;  3L74 H;  1M57 B;  2JJ2 G;  3CRQ A;  4N21 A;  4QPK A;  3JAW B;  3ASO C;  3B8M A;  2LFS A;  3T1Y O;  3AG1 C;  4JI1 O;  3FB6 C;  3H1J H;  3IC9 A;  3ABL C;  4OPA A;  5CBG A;  2IM9 A;  3ZIA G;  1PV0 A;  4OX9 B;  2Y4U A;  4ZI7 A;  2EZP A;  2KG7 A;  3FAV A;  3E89 A;  4BIO A;  1AI5 A;  4LFB O;  4LP8 A;  4DV0 B;  3OT7 A;  4C7U A;  2RJZ A;  3APQ A;  4TWK A;  4OX9 O;  1B6Q A;  3G4S V;  2WSS G;  3FAV B;  2R9A A;  4JTA B;  4J42 A;  3K79 A;  3CSX A;  4I4T B;  4UV9 A;  2QSA A;  4GLX A;  2JJ1 G;  2Q0O C;  1VF6 A;  3IJ4 A;  4DV5 B;  2CUG A;  2UXC O;  4DV4 O;  2JK5 C;  1B3Q A;  3FB5 C;  1Q81 W;  3CCE V;  3OEE G;  5BXZ A;  4JTD B;  2RNB A;  3LNM B;  1FXK B;  3JSN A;  3OGC C;  4O4J B;  4AI8 A;  2HKO A;  2UUB B;  1XOU A;  2VS0 A;  5KHH A;  2F66 C;  4UV8 A;  2RN9 A;  1JCH A;  4UUJ C;  4UVB A;  4DUZ B;  2UU9 B;  1NS1 A;  5KUK A;  2DYR C;  3QO5 A;  2QKC A;  2GUZ A;  4X1I B;  3C3S A;  1L0N H;  3K04 A;  3H1H H;  1DGS A;  1A32 A;  1KP3 A;  3DGE A;  1QU7 A;  1WLE A;  4ZBM A;  3OMA B;  3VQV A;  3VQW A;  2IJK A;  4ZI7 B;  3S3X A;  3KZI Z;  1KU9 A;  1AR4 A;  2E3C A;  1AR5 A;  1NBM G;  2M6Y A;  2YXY A;  1N32 O;  3ETE A;  3EFF K;  1RP3 B;  2MW2 B;  2CGN A;  1GAX A;  1R3K C;  5CB4 B;  4X20 B;  2ZIN A;  3L75 H;  2H8P C;  1Q3E A;  3SYQ A;  1W59 A;  1H2M A;  5LMU B;  2KSD A;  2F4V O;  2YS8 A;  3FFQ A;  5KMG A;  5CA3 A;  1BHA A;  4FZ1 A;  3BCC H;  4ICG A;  2ETN A;  3RVZ A;  1MOF A;  5LMN O;  1GTO A;  4MVS A;  1ZLZ A;  1QR9 A;  1AIL A;  2HHH O;  4X1Y A;  5LXT B;  1Y4M A;  1R3L C;  4AQY B;  1FXV A;  4TUY A;  5JH7 B;  1RM1 C;  2Q69 A;  5JQG A;  3ICX A;  4D6T H;  5CBF A;  2IU0 A;  1QLE B;  5IYC O;  1NVP B;  2VWJ A;  1YEW A;  1Q7Y W;  4KP4 A;  1R6K A;  4I0X A;  1VAR A;  2E5L O;  4TV8 A;  4YJ2 A;  2BE3 A;  3P30 A;  2PUS A;  2Q4P A;  3ETD A;  3JAK A;  1HP8 A;  3M99 B;  1XL6 A;  1XHX A;  2ATK C;  2EX3 A;  3LSU A;  4OGQ B;  1K4C C;  3N2K A;  1YI2 V;  1I08 A;  5IYB O;  1BQZ A;  4B3S B;  4DV2 B;  1NVP D;  2CGO A;  5KA5 A;  4WFE A;  4MS2 A;  5A2Q N;  1CPY A;  1N36 B;  2FKX A;  5IY5 C;  1BCC H;  4PHZ A;  4WFG A;  1Z2G A;  3ZS8 C;  5KMG B;  4JPR A;  4DR1 O;  1M56 B;  4LFC B;  2YI9 A;  2WLI A;  5GON B;  4JV5 B;  4LF8 O;  1WA8 A;  4PDR A;  1Q86 W;  1XIL A;  3H1K H;  1YZB A;  4UCR A;  4DRX A;  4N23 A;  2P67 A;  5LMN B;  2JVD A;  2AHY A;  3BA8 A;  1Q6H A;  5FPR A;  3K3W A;  1TUB B;  4GKJ O;  3CC2 V;  2JS5 A;  3OUS A;  5IT9 N;  3SYC A;  4QE7 A;  1AP6 A;  1FKA O;  1K97 A;  1VQM V;  3APO A;  1MMM A;  2XOK G;  5J2T A;  2RDC A;  2M7W A;  3JCZ A;  2O57 A;  4B08 A;  3QVN A;  3HB3 B;  1TUE B;  3STZ C;  3AK2 A;  4LNU A;  3WB0 A;  4J10 A;  4NVP A;  5AG2 A;  1KUQ A;  1IUR A;  5CA0 B;  1AI7 A;  3CRC A;  5EIB C;  5A9G A;  4DR5 B;  1AP5 A;  2P6J A;  4H0L B;  3T2M A;  4K3A A;  5DED A;  1XRE A;  4J9Z B;  1OV9 A;  2EZO A;  1OCC B;  2A3Q A;  3SYP A;  5LGT A;  3KCY A;  4ZIB A;  1G6U A;  5H5N A;  3K59 A;  3ASN C;  4PV1 B;  4DV5 O;  4UXN A;  5KHK A;  1VF7 A;  2NNU A;  3U11 A;  1VQ7 V;  1TGO A;  2UXN A;  1SET A;  3D36 C;  2F93 B;  3CCR V;  4J11 A;  1TVK A;  2ITC C;  5LP6 B;  3IFX A;  2LP7 A;  3VQY A;  5J9P C;  4XBF A;  1YJW V;  2ZNJ A;  3M7M X;  4JAS A;  4IHJ B;  1EN4 A;  2UXD O;  1S5H C;  3WU2 Z;  4F6R A;  2VQE B;  3ASO B;  3CCV V;  2W0F C;  4CS4 A;  1O9H A;  4CH3 A;  3SPI A;  3SJB C;  4JYA B;  1HNW B;  2QA4 V;  1GK9 A;  3L9D A;  3STL C;  2X6C A;  3KCX A;  1N0N A;  2B1I A;  5EK0 A;  3ZX6 A;  1K3E A;  5JWP A;  1NU1 H;  1MSW D;  1NTK H;  2EBO A;  4O4H A;  3RYI A;  1JR9 A;  3WFV A;  4G2K A;  1JPX A;  4FLW A;  1IX9 A;  3L72 H;  1OJH A;  2G38 A;  2QWQ B;  2DWD C;  1PKX A;  3A0R A;  5JVD A;  2Q9L A;  1MAB G;  1L1F A;  3CX5 F;  4O4L B;  4B3T O;  3CEI A;  4FLT A;  4UB6 Z;  2X6A A;  4LH7 A;  4J41 A;  1Z5V A;  1E79 G;  4J7Z A;  2OCH A;  4RAI A;  4WF9 V;  3WG7 B;  1UJW B;  2QEX V;  2EIN B;  3SR2 C;  3HR0 A;  2QM8 A;  2P90 A;  4TV9 A;  2VQF B;  1L8D A;  2IJI A;  2DYS C;  3OTO B;  4QGP A;  2ZQM A;  4TQF A;  3HKD B;  5KHI A;  2K1E A;  3FKS G;  4DR7 B;  2WLJ A;  1SQG A;  5B1A C;  1H8E G;  2AW9 A;  4IT5 A;  4O4I A;  3AG2 C;  4DV6 B;  2CAZ C;  2HJD A;  2BTQ B;  4FM2 A;  1SA0 A;  4PJ0 Z;  2EIM C;  3E8G A;  1N36 O;  1PNK A;  1NR1 A;  5B3S B;  3QO8 A;  4CZZ A;  1XMQ B;  3OR7 C;  3SJC C;  2IH1 C;  4TOI A;  2FL4 A;  4O4H B;  1VQP V;  4R7C A;  1T5E A;  5LYJ B;  1VQL V;  1MZF A;  4DV1 B;  4PI0 A;  1WB7 A;  1EZJ A;  4XDL A;  2ZCE A;  3HPL C;  1I7F A;  1ZUQ A;  4FVM A;  2L6L A;  1XEQ A;  1DTO A;  2WLM A;  4JI4 B;  3RYF B;  4CH6 A;  2WLI B;  1E1R G;  4DR6 O;  1XNR B;  1GN3 A;  3G71 V;  1DF4 A;  3ZCC A;  4YXW G;  1S5J A;  3F5T A;  1Y74 B;  1UPG A;  1F23 A;  1F4N A;  1XNQ O;  4B3M B;  4DR7 O;  4BR6 A;  3NR7 A;  3F7Y C;  4JAV A;  3UT5 A;  2QWR B;  1VQ8 V;  2QWN B;  2QKS A;  2W0X A;  1H8H G;  3T1H O;  3K06 A;  3JAR B;  5C8Y A;  4JYA O;  4FMT A;  3UO3 A;  2OCC C;  1EBO A;  4DUY B;  4LF6 O;  3ZMS A;  2EJ7 A;  1QLE C;  4FFB A;  4ASU G;  1AI6 A;  4I50 A;  4DR5 O;  1M4U A;  3HKE B;  3E22 A;  2GTS A;  2EIK B;  3JD2 A;  4E2L A;  2DN9 A;  2Y69 B;  2FML A;  4X89 A;  2HR3 A;  2YUA A;  4CH5 A;  1KYO F;  4K0K O;  1JA8 A;  2KQX A;  1XBL A;  4H44 B;  1X59 A;  4DR3 O;  1S3J A;  2OIG A;  2ILM A;  4O2A A;  5LHG A;  3ABM C;  3K9A A;  2UXD B;  3TET A;  3CP1 A;  2DW4 A;  2UXB B;  3AG3 B;  3P3N A;  5BR8 O;  2LW7 A;  4LBE C;  5CB4 A;  2HEP A;  2QWP B;  2V4D A;  4B3R O;  1YIJ V;  1EM1 A;  3RBZ A;  3OTO O;  4ZOL B;  4JZ2 A;  5IY5 B;  2Y0I A;  1F7Y A;  4HBN A;  4RQE A;  3ZED A;  5CA1 A;  2CTQ A;  2UU9 O;  1S77 D;  2ZIM A;  3VOU A;  4JTC B;  2BOC C;  2R72 A;  2GV9 A;  3G80 A;  4F6E A;  1WP7 A;  1YIT V;  1L0L H;  2JEX A;  1OCR C;  4X62 O;  3T1H B;  4B7E A;  1N8R W;  1THZ A;  5J2U B;  3LDC A;  2PY5 A;  3QG5 A;  1N0J A;  3SDL A;  3JD1 A;  1VQ4 V;  2YIC A;  3UO2 A;  3CHX A;  1XMO O;  1URF A;  1BMF G;  2NN4 A;  4I0X B;  4MTG A;  2H94 A;  4I9W A;  1BT8 A;  1N33 B;  3CCL V;  2XHB A;  4PA3 A;  3L73 H;  5LBQ A;  3JAL A;  5H9C A;  3AG7 A;  3FYI B;  1TAE A;  2P4K A;  1SER A;  1N34 B;  3N2K B;  5L3G A;  4B3T B;  4QE9 A;  1NZ6 A;  3CJH B;  4UCT A;  4LFA B;  2BCC H;  3MD0 A;  3OAA G;  4AIL C;  4JAA A;  1JJO A;  1MA1 A;  4JI6 O;  2GHY A;  4LF5 O;  4DV7 O;  1BSM A;  1CP9 A;  5KHG A;  4X64 O;  2K9P A;  3CRR A;  5LXT A;  4JYB A;  4NKG B;  1K8A W;  4NXN O;  3CC7 V;  4R8C A;  3CC4 V;  1SQV H;  5FPO A;  4O4I B;  2VQE O;  1NI8 A;  3OR6 C;  1SKV A;  3CRA A;  4X1K A;  4DV1 O;  3CCM V;  4IHJ A;  5BZB A;  3OD4 A;  3EXA A;  1K5Q A;  1H2K A;  1KC8 W;  3W7U A;  3R65 A;  2A06 H;  4IGG A;  4MW3 A;  3SYO A;  5JJJ B;  4GX1 A;  1XMQ O;  1QVF U;  4X66 B;  4HYO A;  3HKC A;  2XAG A;  3FB7 C;  1LUW A;  2YXL A;  3OMN B;  5LYJ A;  3G6B A;  4NXM O;  1FXH A;  4X20 A;  4FJC C;  3IAY A;  1K5S A;  3CS5 A;  2ARH A;  1J95 A;  1IBM O;  1GM7 A;  4LF5 B;  3JAT A;  5EBM C;  3U0Z A;  3RYF A;  4CBC A;  4PDM A;  1KMI Z;  4NTW A;  4MVQ A;  1QCE A;  2Q7H A;  4X9Q A;  3BFR A;  4B3M O;  4U3J B;  4I55 A;  4Z1V A;  3H1L H;  2ZDI C;  4DR3 B;  5IYD O;  3JAM N;  5L3C A;  4XDJ A;  5LP6 A;  3K58 A;  2AZ0 A;  4F6R B;  4IIJ A;  1H38 A;  4MVU A;  1ZWI C;  2BSK A;  2QM4 A;  3CWB H;  2HJF C;  4YHH B;  3ZJZ A;  2V1D A;  5IJ0 B;  1US6 A;  3DXR B;  3RYC A;  1R3I C;  3E35 A;  1H2L A;  3CXC U;  5FNV B;  3LDD A;  2P7T C;  2BSK B;  2XAF A;  3W7S A;  4DV3 B;  2IJJ A;  4AHC A;  4JI5 B;  1M1K W;  4FM0 A;  1W0J G;  4TQD A;  3ZHS A;  4HNA A;  2Q8V A;  2IH3 C;  3A2F A;  3TXQ A;  2OYQ A;  4WFH A;  4DV0 O;  1NH2 B;  4DV4 B;  1PP9 H;  1IDS A;  4X8A A;  4UCU A;  4FLX A;  4DK0 A;  5ITZ A;  1E1Q G;  3C90 A;  1SA0 B;  2EIJ B;  3FD9 A;  1ZSP A;  2Q68 A;  1G8M A;  2NLJ C;  2HFE C;  2ZE8 A;  5E1A C;  2YIB A;  1JMK C;  4QIW F;  3WB2 A;  3B4S A;  3AG3 C;  4L8J A;  3DC6 A;  2Q7G A;  5L3E A;  3AK3 A;  2ADQ B;  2ZR3 A;  3JAT B;  2CTW A;  2ADP A;  2WLL A;  1K9M W;  4EFB A;  4DR2 O;  3ZRW A;  3CYO A;  2JRI A;  3QTC A;  3A0H Z;  2FB5 A;  3W7T A;  1F4M A;  4DR4 B;  5IYZ B;  3T4D A;  1SRY A;  1VQ6 V;  4LFA O;  2JGU A;  3ZMT A;  5EYP A;  3FX7 A;  1HR0 O;  3LSS A;  1Q82 W;  4RQF A;  3G67 A;  5CBH A;  1DLB A;  3P32 A;  4ZOL A;  1I5X A;  4KXR A;  4I7Z B;  1HNX B;  5L3B A;  1PNL A;  2E5L B;  5E79 Z;  1QR8 A;  2QGN A;  4D7S A;  4CS2 A;  1Y76 A;  4ZHQ B;  1D2D A;  1BE3 H;  4JI3 O;  3BY6 A;  4MT8 A;  4IL6 Z;  4JI8 B;  3IGA C;  3K9S A;  2JGD A;  5GTH Z;  4YHH O;  1HNZ O;  4X88 A;  1G1X B;  3RN4 A;  5KX5 B;  3CE2 A;  4EEQ A;  1D5N A;  1DK1 A;  4NR1 A;  4JI3 B;  3N27 A;  1Q6U A;  3JAW A;  4X62 B;  1IVS A;  1MG1 A;  2IU3 A;  1VIB A;  2HG5 C;  4X1K B;  4GX5 A;  4WBN B;  4J80 A;  1OCZ C;  4DR6 B;  3I5D A;  2N04 A;  1Q43 A;  1RFY A;  1V9P A;  5B1O A;  2RMK B;  4FFK A;  3E22 B;  1JFF B;  1LNQ A;  4R6Z A;  3R66 A;  1CXZ B;  1GN4 A;  1WPX A;  5D5P A;  4W4L A;  3SYA A;  4MVR A;  4B7K A;  3HKB B;  4PDV A;  1XL4 A;  2UUB O;  1VQ9 V;  5B66 Z;  2RCV A;  1VQO V;  1JFF A;  1WA8 B;  3B2E E;  1AJP A;  5DM6 V;  1JJ2 U;  4CC6 A;  4H13 B;  2EIK C;  2HVK C;  2CH7 A;  2LW1 A;  3E8H A;  1HNZ B;  1HNW O;  2W6I G;  1KEC A;  2DYR B;  1WP8 A;  1BGY H;  1ZL8 A;  3K5M A;  1U97 A;  1P49 A;  2Q6A A;  1GRJ A;  4QPJ A;  3VQX A;  5K1P A;  1EN5 A;  4DV2 O;  4JV5 O;  1YHQ V;  2A9H A;  1QHT A;  3LSQ A;  5KX5 A;  5LGU A;  1MNG A;  1I5Y A;  3IC7 A;  1TA8 A;  3E2E A;  3F5W C;  1XDC A;  2OTJ V;  1COW G;  4RUF A;  3MAQ A;  2JEU A;  1YTF B;  1R73 A;  5B5E Z;  4I50 B;  1KKD A;  2ODM A;  2VRZ A;  3BRC A;  1FFX B;  1K73 W;  1ARO P;  2PGG A;  4NYK A;  5EC1 C;  4QJF B;  2QWO B;  1KB9 F;  2F23 A;  3A0B Z;  2XAJ A;  2E76 B;  2ZE5 A;  4PI2 A;  1FAF A;  3JSL A;  2YEV B;  4LF9 B;  2Z0A A;  1R1B A;  3K57 A;  4KHP B;  3X2Q C;  3D8C A;  3LDE A;  4O2A B;  3RWR D;  5JJE B;  4FFB B;  3HKB A;  1GM9 A;  2UXB O;  3OGI B;  4JI6 B;  2Q0A A;  3ZRW B;  1FYJ A;  2KB1 A;  2YSU B;  4PA6 A;  2ZT9 B;  1GH6 A;  1YXB A;  5JH7 A;  3JYC A;  5EYP B;  1JVM A;  5EBW C;  1J5E O;  3H01 A;  5IJ9 B;  2YID A;  3W7X A;  3RVY A;  2X7R B;  1WJZ A;  2DOS A;  3GB7 C;  2XTA A;  3SJQ C;  2LJ2 A;  2ZE7 A;  3ZMU A;  2WLH A;  3QNE A;  4FLY A;  2XAH A;  4EKW A;  2Z3Y A;  4TV8 B;  4YJ2 B;  2CDY A;  4H37 A;  4O4J A;  3K5O A;  2IW5 A;  2GBO A;  1Y76 B;  3D3Q A;  3FYE B;  3JAR A;  1BL8 A;  1G4Y B;  5KLV H;  3BAA A;  5LMU O;  2OTL V;  1RPO A;  4PA4 A;  4MTF A;  4GCZ A;  2DQ0 A;  3QO7 A;  4DXW A;  3CCS V;  4X1I A;  1FS0 G;  3OTF A;  4IYH A;  4DR1 B;  4FPP A;  1Q8I A;  1NR7 A;  3BEH A;  4P9P A;  5K1X A;  4J7K A;  2OWO A;  4OXS A;  3OMI B;  5EZY A;  2ZIO A;  3E86 A;  1YVW A;  3ZMV A;  5JVD B;  5JCO C;  4F4L A;  4JI7 O;  1SC5 B;  1I0H A;  1HNX O;  4L87 A;  4LF9 O;  2C2A A;  3UM7 A;  1FFT B;  2B1G A;  3BA9 A;  2PZS A;  1XNQ B;  2NR5 A;  1BQ0 A;  4JI7 B;  4CH4 A;  1ORQ C;  2YI8 A;  2ZM6 B;  2ITD C;  3J7A U;  1NTM H;  3THO A;  3UKM A;  5HFM A;  2ZNI A;  4YIO A;  1FD9 A;  1GMG A;  2WA3 A;  1NTZ H;  3K0D A;  2E74 B;  5CA1 B;  1EN6 A;  4BIU A;  1NT2 B;  4JZG A;  1KD1 W;  1Q90 D;  5IJ0 A;  3ZRX A;  1MSD A;  4LC1 A;  3BVO A;  2H3O A;  3L70 H;  1FXK A;  3ZMZ A;  1AJN A;  3MDS A;  4LFC O;  1XHZ A;  5J2U A;  4X65 O;  5CA0 A;  4WFF A;  4K35 A;  2Q5Z A;  4B3R B;  1KQS U;  3WG7 C;  5KHJ A;  4DW1 A;  1N4C A;  2FTK A;  4D7T A;  1AJQ A;  4K0K B;  3BPZ A;  5GW7 A;  1VEW A;  3D3I A;  1YTF D;  3EHB B;  4GKK O;  4DV6 O;  2F4V B;  2OIE A;  5FL7 G;  2LGQ A;  5LA6 A;  1JOY A;  3ABK B;  3ETG A;  4FZ0 A;  4UB8 Z;  3B09 A;  4LNU B;  2EIL B;  5IJ9 A;  1I94 O;  2IBZ H;  1RSO A;  4TT3 G;  1YCI A;  1QVG U;  2CH7 B;  1M5I A;  2ZXW B;  2DMX A;  1OCO C;  3SPC A;  3GWK C;  3Q4H B;  5HFL A;  5DN6 G;  1IBL O;  5KAI Z;  3ZRV A;  5CMU A;  2PYJ A;  4YJ3 B;  1B06 A;  2UXX A;  4K8Z A;  3AG1 B;  3ZHV A;  4JI5 O;  3E83 A;  4JI1 B;  4EFE A;  1BS3 A;  4ZKI A;  5H2F Z;  2HP8 A;  1XQ8 A;  4LF6 B;  3I56 V;  1CEZ A;  3TK1 A;  3AG4 C;  3CME V;  1XMO B;  2XUM A;  1TVK B;  4OPH A;  2DJV A;  3CCJ V;  4DK1 A;  3ABK C;  2UUC O;  3BHP A;  5KA6 A;  4EB6 A;  3PN1 A;  4GKK B;  1SF9 A;  4MVO A;  2V7Q G;  4LF7 O;  1VQK V;  3ZHT A;  2LFR A;  2YEV A;  4PD4 F;  2A0L A;  2WPD G;  3ABT A;  1VF6 C;  1VMG A;  3JAK B;  5BMV A;  2E75 B;  2WLN A;  5JJN B;  3ZHU A;  1QQC A;  2QDO A;  3ASN B;  1JX9 A;  4MTX A;  4BW5 A;  1K92 A;  4UVC A;  3DC5 A;  2AXT Z;  3F7V C;  1RSO B;  4RWU A;  3ZHQ A;  4JGS A;  4JI0 O;  1PNM A;  2D3O W;  3B40 A;  5BY1 A;  4GYC B;  3S3W A;  3OM3 B;  4ZHQ A;  3HKE A;  2F43 G;  4JI2 O;  4X1Y B;  4B3S O;  4IIJ B;  1AVM A;  5KAF Z;  2QTS A;  4O2B A;  3L71 H;  3I55 V;  5L3D A;  2YC0 A;  2RQ6 A;  2ZXW C;  2IJH A;  1K4D C;  2JIZ G;  1O9G A;  4UCO A;  3KG2 A;  1ZL8 B;  4QNH B;  1BZK A;  3X2Q B;  1EFR G;  2LGW A;  2UXC B;  1FJG O;  3A8T A;  4R50 A;  3JCU Z;  2ZDI A;  4NB5 A;  1NQT A;  1NJI W;  1S76 D;  4H33 A;  2F1M A;  2EIN C;  4UCS A;  5LP6 C;  2EJR A;  4MVM A;  2QR4 A;  3K08 A;  3O9O A;  5B1N A;  3ABM B;  2DYS B;  1H2N A;  4LF7 B;  2ZE6 A;  5IE9 A;  1K7D A;  5B1B B;  5H6Q A;  1YF2 A;  3CCU V;  4K8X A;  5BMV B;  1KKC A;  1P4R A;  1QBZ A;  4DR4 O;  4DUZ O;  2GSM B;  1ENV A;  2A7W A;  2B5U A;  1SZX A;  2R70 A;  3SJA C;  1XUQ A;  5CN0 A;  1UFI A;  2YXH A;  3DSQ A;  1R6N A;  4BW9 A;  1WAZ A;  5IYZ A;  1OCR B;  4G27 B;  4PA9 A;  3EVK A;  5KUM A;  3P3P A;  4DO2 A;  3C3T A;  3U10 A;  1S72 V;  4TV9 B;  3ABL B;  1N32 B;  1OCZ B;  4LF4 O;  2OCC B;  3G6E V;  1P7B A;  2UUA O;  3N2G B;  4U3F H;  2CTP A;  1SQX H;  2PYL A;  4FM1 A;  1N34 O;  4JI2 B;  4HNA B;  4UCV A;  2FYU H;  4KUM A;  1SQP H;  5FLX N;  4FLU A;  2XAQ A;  5IWA O;  2R9I A;  2MK3 A;  1P7G A;  1HWY A;  1SQF A;  4X66 O; 
#chains in the Genus database with same CATH homology
 3K5M A;  1P49 A;  5ITZ B;  4B3M B;  4NXM B;  3VQX A;  4TUY B;  3UQ8 A;  4FLZ A;  5K1P A;  3UT5 A;  4YJ3 A;  1QHT A;  4LF8 B;  5KX5 A;  3JSN A;  3RYI B;  4O4J B;  2UUB B;  3HKC B;  1TA8 A;  5KHH A;  2F66 C;  3MAQ A;  3JAR B;  5C8Y A;  4DUZ B;  2UU9 B;  2YIA A;  4I50 B;  4LH6 A;  4X1I B;  4DR2 B;  3BRC A;  1FFX B;  2PGG A;  5LA6 B;  4DUY B;  5LOV A;  1DGS A;  1WN7 A;  4PI2 A;  4FFB A;  3VQV A;  3JSL A;  3VQW A;  4LF9 B;  4I50 A;  4CS3 A;  4ZI7 B;  1M4U A;  3HKE B;  3E22 A;  1KU9 A;  3K57 A;  4KHP B;  2E3C A;  1D5A A;  4YY3 B;  4I55 B;  4O2A B;  3RWR D;  5JJE B;  4U3J A;  4FFB B;  4CH5 A;  2UUA B;  3HKB A;  3HKD A;  4JI6 B;  5CB4 B;  4X20 B;  2ZIN A;  2Q0A A;  2KKW A;  1Q3E A;  5LMU B;  4O2A A;  2UXD B;  3FFQ A;  4I4T A;  5KMG A;  2F95 B;  2UXB B;  5JH7 A;  5EYP B;  1IBL B;  5CB4 A;  2HEP A;  2V4D A;  5IJ9 B;  1HW7 A;  4X1Y A;  4ZOL B;  5LXT B;  4AQY B;  4HBN A;  3CB2 A;  5FNV A;  4KL1 A;  3ZED A;  5CA1 A;  4TUY A;  5JH7 B;  5JQG A;  4FLY A;  3ICX A;  4TV8 B;  2ZIM A;  4YJ2 B;  4O4J A;  3K5O A;  2R72 A;  2GV9 A;  3JAR A;  2VWJ A;  1YEW A;  3BAA A;  4X1I A;  4TV8 A;  4YJ2 A;  3T1H B;  3OTF A;  5J2U B;  2PUS A;  4DR1 B;  2PY5 A;  1XI1 A;  1Q8I A;  3QG5 A;  3JAK A;  5K1X A;  2OWO A;  3CHX A;  1XHX A;  2EX3 A;  1N33 B;  3N2K A;  5EZY A;  2ZIO A;  2XHB A;  5JVD B;  5JCO C;  4B3S B;  4DV2 B;  3JAL A;  1TAE A;  4BWA A;  1N34 B;  3N2K B;  5EZY B;  3BA9 A;  1N36 B;  2PZS A;  4B3T B;  3RYH B;  3QF7 A;  3SGI A;  1XNQ B;  4UCT A;  4LFA B;  4PHZ A;  4AIL C;  1JJO A;  4JI7 B;  4CH4 A;  3ZS8 C;  2YI8 A;  5KMG B;  4LFC B;  2YI9 A;  4DRX B;  2ZM6 B;  5GON B;  4JV5 B;  4LF4 B;  3THO A;  5KHG A;  5LXT A;  2ZNI A;  4UCR A;  4DRX A;  5JQG B;  5LMN B;  5EIB D;  2JVD A;  5FPO A;  4O4I B;  5CA1 B;  3BA8 A;  1NT2 B;  5FPR A;  1TUB B;  3BAB A;  5J2T B;  2P5O A;  5D5Q A;  5IJ0 A;  2JS5 A;  1SKV A;  2VWK A;  4X1K A;  3RFR A;  2UUC B;  4UFZ A;  4IHJ A;  1I94 B;  1ZAU A;  4WBN A;  4DV7 B;  2Q7E A;  1TUB A;  1XHZ A;  5J2U A;  5CA0 A;  5J2T A;  5JJJ B;  1IBK B;  4B3R B;  4X66 B;  5C8Y B;  3HKC A;  5KHJ A;  3T1Y B;  2YXL A;  4B08 A;  5LYJ A;  4D7T A;  4K0K B;  4X20 A;  3BPZ A;  4I9Q A;  4LNU A;  3IAY A;  3WB0 A;  4NVP A;  2F4V B;  2P22 C;  5CA0 B;  3LNN A;  5LA6 A;  3JAL B;  2YIB D;  5EIB C;  4DR5 B;  4LF5 B;  1Z5W A;  1M93 A;  3JAT A;  3U0Z A;  4LNU B;  4JI0 B;  1WNS A;  4LFB B;  5IJ9 A;  3RYF A;  1KMI Z;  2Q7H A;  1RSO A;  1X4T A;  3JAS A;  4U3J B;  4I55 A;  1M5I A;  3N2G A;  4ZIB A;  4LR3 A;  5GON A;  1G6U A;  4DR3 B;  3K59 A;  5LP6 A;  3JAS B;  5KHK A;  1VF7 A;  3K58 A;  3U11 A;  1WPB A;  5JCO A;  4IIJ A;  1TGO A;  4O2B B;  4F6R B;  5IWA B;  2F93 B;  2PYJ A;  4YJ3 B;  4K8Z A;  1TVK A;  2QM4 A;  5LP6 B;  4JI1 B;  3UT5 B;  4EFE A;  4YHH B;  3VQY A;  1XQ8 A;  5IJ0 B;  4LF6 B;  2ZNJ A;  4X65 B;  3M7M X;  3RYC A;  4IHJ B;  2BTO A;  4CC5 A;  3K5N A;  5FNV B;  1XMO B;  4F6R A;  2VQE B;  4GKJ B;  1TVK B;  4DV3 B;  4AHC A;  4JI5 B;  4CS4 A;  4FM0 A;  1O9H A;  4CH3 A;  1B04 A;  2PTM A;  4TQD A;  5BR8 B;  4DK1 A;  3SJB C;  4HNA A;  4JYA B;  1HNW B;  3BHP A;  3A2F A;  3PN1 A;  4EB6 A;  2OYQ A;  4GKK B;  4DV4 B;  1FFX A;  4X64 B;  4UCU A;  4FLX A;  4DK0 A;  5ITZ A;  2BTQ A;  1HR0 B;  1SA0 B;  3RYH A;  2YIB A;  3RGB A;  1JMK C;  4O4H A;  3RYI A;  3WB2 A;  4L8J A;  3K5L A;  3JAK B;  5BMV A;  5JJN B;  2Q7G A;  4FLW A;  1QQC A;  3JAT B;  5JVD A;  4EFB A;  4NXN B;  3QTC A;  4DR4 B;  5IYZ B;  5LOV B;  4O4L B;  4FLT A;  4LH7 A;  2JGU A;  1Z5V A;  4GYC B;  5EYP A;  1Q5O A;  4FLV A;  4Q6G A;  4ZHQ A;  3HKE A;  3SR2 C;  4TV9 A;  4O4L A;  4X1Y B;  4ZOL A;  2VQF B;  1L8D A;  4IIJ B;  3OTO B;  2HHH B;  4O2B A;  1HNX B;  2E5L B;  4TQF A;  1H2S B;  3HKD B;  5KHI A;  4DR7 B;  1FJG B;  1SQG A;  2RQ6 A;  3WB1 A;  4D7S A;  4CS2 A;  4ZHQ B;  3RYC B;  1O9G A;  4JI8 B;  4UCO A;  4O4I A;  2UXC B;  4EB6 B;  3ETQ A;  4DV6 B;  2CAZ C;  5KX5 B;  1J5E B;  4EEQ A;  4JI3 B;  2QJ1 A;  1IBM B;  3JAW A;  4X62 B;  2F1M A;  2BTQ B;  4UCS A;  5LP6 C;  1SA0 A;  4FM2 A;  4X1K B;  4WBN B;  1XMQ B;  3SJC C;  4LF7 B;  4TOI A;  4DR6 B;  3JAW B;  4O4H B;  4K8X A;  5BMV B;  1Q43 A;  1T5E A;  5LYJ B;  2IM9 A;  4DV1 B;  1V9P A;  2R70 A;  3SJA C;  4PI0 A;  4OX9 B;  3E22 B;  1JFF B;  2ZCE A;  3DSQ A;  4ZI7 A;  4BW9 A;  1I7F A;  5IYZ A;  4FVM A;  5D5P A;  4DV0 B;  4JI4 B;  3HKB B;  2RJZ A;  3RYF B;  4CH6 A;  3U10 A;  4TV9 B;  1JFF A;  2R9A A;  3B2E E;  1N32 B;  3CSX A;  4I4T B;  4CC6 A;  1XNR B;  3N2G B;  4GLX A;  1S5J A;  2PYL A;  4DV5 B;  4FM1 A;  1HNZ B;  4JI2 B;  4HNA B;  4UCV A;  4FLU A;  1SQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...