1XQ8A

Human micelle-bound alpha-synuclein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
140
structure length
140
Chain Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of micelle-bound human alpha-synuclein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords Alpha-synuclein
total genus 36
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2004-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01387 Synuclein Synuclein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.700 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1xq8A00
1XQ8A 2KKWA
chains in the Genus database with same CATH superfamily
1L8DA 1A32A 4BR6A 4FPPA 2H94A 3FAVA 2GUZB 1FXKB 3K9SA 3IC9A 1Q86W 4PV1B 5H9CA 1XHZA 4BW9A 3G67A 5LHGA 5IYBO 5L3GA 3DSQA 2A79B 3HKBB 1N36B 4CZZA 1EZVH 3VOUA 3K79A 3M99B 4GX5A 5EZYA 3CE2A 3SDLA 1Q6IA 3CJHB 4QNHB 1CPYA 2RMKB 1YJ9V 2Z5UA 5F2VO 1JMKC 1FFXA 2ZE6A 3FD9A 3KG2A 3ABLC 4DXWA 4X1KB 3LUTB 4MTGA 1AR1B 1BQ0A 4YJ3A 5IJ9B 4X20A 2JJ2G 5JCOC 1KB9F 4JZ2A 2Q7EA 1XUQA 2EIJB 4NTXA 1Z5WA 3SYPA 2DWEC 3IAYA 4MVRA 1RPOA 2XAFA 3H1KH 2XT9A 1S0VA 4ICGA 5A2QN 3ABLB 2M7WA 3N2KB 1R3LC 1DK1A 2XUMA 1VP7A 2IJJA 1WA8B 3JAWA 4F4LA 2HVJC 3JARB 4JI3B 2OCCC 1IBKO 2E76B 3SPJA 3WB0A 4LF6O 3G71V 3F5TA 2UUAO 3FB6C 1R6NA 4FJCC 5H5NA 3QO8A 2LGWA 3ZHVA 2ZKOA 4DV7B 4GKKO 2IJHA 4UV9A 2OCCB 3CRCA 4J11A 3HKBA 1XMQO 3KZIZ 2QKSA 4LNUA 2VQFB 3QF7A 3L9DA 3OTOO 4PA3A 3JAKA 2JIZG 1K7DA 4LBEC 1ROPA 1NH2B 4UB8Z 3W7TA 4DV6B 2RN9A 2IH3C 3NXSA 1FFXB 4O2BB 2B9ZA 2GSMB 1J5EO 2CH7B 3E8GA 2QE7G 4B3RB 1BSMA 5IE9A 5H6RA 4GZRB 5L3EA 4YJ3B 5IJ9A 4NKGB 4R6ZA 4PDMA 1CP9A 1OCRC 3ZS8C 4NVPA 2A3QA 3X2QB 1BMFG 2YUAA 1I5XA 4G28B 1IBLB 3HKDA 3K9AA 1M9NA 1G6UA 2Y69B 1QR9A 1AR4A 1KP3A 4B3MB 4MVZA 2PF4E 2NN4A 3CRAA 1WA8A 3VQVA 1IBMB 5LGTA 2N74A 1K8AW 1OCRB 1NVPB 1N0JA 1BQZA 4FM1A 1GN2A 3I5DA 5L3DA 5IYDO 1ENVA 4J42A 1YHQV 3AG2B 5D5QA 1VQ9V 4DR1B 4XDKA 1UFIA 4MS2A 4JPRA 5EYPA 5IT9N 3SPCA 5JH7A 3AG3B 5B1NA 3EXAA 3UO3A 3B8NA 1IVSA 3R66A 4UXNA 4PDLA 4CS3A 1PKXA 3SJQC 4ZOLA 5EBWC 3CCUV 4DR4B 3W7UA 1VF5B 1TVKA 5BR8B 1H2GA 3RFRA 3D3IA 3SYAA 2GHYA 2FTKA 1I94B 4KL1A 4J7KA 4LWSA 3OGCC 4LFCO 2YI9A 3A0RA 4CS2A 5KMGB 4X88A 2XASA 1PNKA 3W7SA 1MNGA 4WFFA 3ZX6A 1Q5OA 4J80A 4TUYA 3CPWU 2XNDG 3UT5A 4DUYB 3MHHC 4K0KO 1URFA 4I0XA 2DW4A 1NI8A 2ZNIA 3LDEA 4UV8A 2B5UA 3CYOA 1I94O 2OTLV 4UFZA 5CA3A 5CA0B 2XTAA 4YY3B 3VQXA 1IDSA 3OMNB 1XQ8A 4J7JA 4DR3O 3K57A 5LYJB 1N0NA 3RVYA 2F4VO 1LUWA 3OEEG 4LF7B 2YEVA 1VQMV 1R6TA 1UJWB 3CCJV 3ZHQA 5TISZ 3S3WA 4DV4B 5CMUA 1Q90D 2Q8VA 3N27A 3O65A 4P9OA 4TV9B 1PV0A 2P22C 1WJZA 2E3CA 1PL0A 4JV5O 1HP8A 1EM1A 4DRXB 5LXTB 2AZ2A 4IGGA 3LSUA 3ZMVA 5CB4B 1NQTA 4J7ZA 2ZM6O 4JI2B 3DTUB 1XILA 3T1YO 2DJVA 4JI2O 4HZ3A 3S3XA 3QO5A 1YTFB 1K5SA 4I55B 5JQGB 1GO3F 1VMGA 2DYSB 5FPRA 3LNNA 1GMGA 2WLNA 3ML0A 4A5UB 3JARA 3ZJZA 4JI8O 1FD9A 3U10A 1B3QA 5KUMA 4JI1O 4PJ0Z 4JI3O 1NVPD 4LF6B 4KFMA 2DYRC 4MTXA 3BVOA 2WA3A 1M93A 3T1HB 1Y66A 1KU9A 5GONA 2R70A 2WSSG 1GK9A 4J9ZB 3BPZA 1J95A 2VWJA 4X89A 3E83A 1YI2V 2PI4A 2F43G 2QTSA 5A9GA 1U96A 2W0FC 3CRQA 4RO2A 4ZBMA 2ZT9B 1X59A 3M8AA 2LP7A 5LGUA 4JI7B 4KHPB 4UCOA 2Y4UA 1QNMA 5IDJA 4TV8A 2XOKG 3OR6C 4X1IA 4B3SO 3Q4HB 5BZBA 1WP7A 3N2GA 2QKAA 3DC6A 4FZ0A 1WNSA 3ZHTA 2Y69C 1Q43A 2QWRB 3ZN0A 1WB7A 3FKSG 1FXHA 2WLIA 2UUBB 2L35A 2KKWA 1XNQB 2KG7A 2BE3A 2W6JG 2QWOB 1IX9A 5DM6V 4O4JA 5KAFZ 4KXRA 2HKOA 2IW5A 2OTJV 4O4IB 1BHBA 2HR3A 3AG3C 1JFFB 3ETGA 1S77D 3GWOA 5J9PC 2DQ3A 4HNAA 4X1YB 4LFCB 1PPJH 4PDVA 5B1BC 1WPXA 4QJFB 3H1IH 4I50A 5LP6B 2WLJA 4B3TB 2H8PC 2A06H 2Y0IA 3JD0A 2Q0AA 4LC1A 5CBGA 4B3MO 1BCCH 2G38A 4MSWC 1Q7YW 4DV2B 3TJTA 5HFLA 1WPBA 1KMIZ 1N33B 1YVWA 1PNLA 3BY6A 4F6RA 2ZDIC 5J2TA 1P49A 3ZMSA 2KSDA 4H44B 4UCVA 1M90W 2ADQB 2PUSA 3OMAB 4CH4A 1TUEB 3H1LH 2ZM6B 2PI5A 3RYFB 1I5YA 2ZDIA 1OV9A 3OGIB 1H8HG 1XHXA 5B66Z 4IIJB 2GV9A 3RYHA 1SS3A 3WU2Z 1SQXH 3C3TA 2EINC 1Y74A 1F4MA 3ASNB 5C8YB 5LHIA 2Q67A 1Z5VA 3BCCH 3SPHA 3PN1A 1RSOA 2WLLB 3ZRWA 4IHJB 1FXKA 4MVOA 4Z1MG 3K06A 3IC7A 2A0LA 3RYCA 2YIBA 4ZKIA 1I08A 4G27B 1EN5A 2BOBC 3ZBHA 3ASNC 4JASA 3CP1A 4NR1A 4JYAO 1I0HA 1GTOA 3CC7V 4R50A 2RJZA 3JASA 1B6QA 1IXBA 5LA6A 4JF3A 1SERA 4DR6B 1PL4A 3G6BA 1YZBA 2UXXA 1QR8A 3LDDA 4B3SB 3AG1B 5J2TB 3BABA 1NTZH 1Q6UA 1SQQH 3F7YC 1NH2D 1MG1A 2DYSC 4XDLA 3BA8A 3CXHF 2IU0A 3K03A 4EFBA 4E4EA 1ZX3A 5EIBD 1VQOV 3G4SV 1XMOB 3RYFA 2IM9A 1K97A 3THOA 4DV1O 5IYZB 4LF9B 2QGNA 3RWRD 3K59A 2WAMA 4LF9O 3JYCA 1TAEA 4QPJA 5H6QA 1ZWIC 2UXDO 2O57A 3G80A 2BSKB 1JJOA 1JJ2U 5BR8O 2EIMC 2IJKA 1XBLA 1I7FA 4D7SA 5D5PA 4Q6GA 3IJ4A 1FKAO 3OR7C 1P84F 4LF4O 1QLEC 2PZSA 3L74H 1TA8A 3APQA 2BCCH 1V54C 2RNBA 4WBNB 1N32B 3JATA 4BIZA 5EBMC 4MTFA 3GB7C 3G6EV 1FPOA 2UXBB 3T1CA 2YS8A 2EILC 2AGAA 3T4ZA 1OCZC 1QLNA 2YIBD 1QLEB 1VQPV 1KBHA 2KQXA 5EC1C 3BFRA 2E75B 1N36O 3CCSV 3HKDB 1L0LH 1V54B 4GKJB 4DYLA 5KHJA 4FM2A 3CCMV 2LO1A 3BEHA 4PDRA 1VEWA 3N2GB 1Z2GA 1W2BU 5JCOA 5L3FA 4X62B 4HBNA 1SF9A 5KLVH 3JCZA 1FJGO 3WFVA 3ETQA 4B7KA 1AJPA 4JAUA 1K34A 3RVZA 1H2SB 1WB8A 1YSCA 3QO7A 1FS0G 1S5JA 4WFBV 2F23A 1ZL8B 3ETDA 5EZYB 3H9VA 1R6KA 3BRCA 4JI4B 4JI8B 1V55B 2A9HA 3GWKC 4LFAB 3ZHSA 1NS1A 4D7TA 4YHHO 4UCTA 5FPOA 1R3IC 4FFBA 4JYYA 4OX9O 3ZMTA 1J5EB 5LP6A 1MSWD 4X20B 1D5AA 1SQVH 4CBCA 2EJRA 4OPAA 4OXSA 3E2EA 4O2AA 3ABUA 2ZCEA 1XDCA 3TCUA 5FNVA 3JSLA 4MVQA 3QVNA 2EX3A 3OD4A 4X64O 3P32A 1US6A 2OIEA 4DV2O 1HNXO 4GT1A 1XOUA 1N34O 3AG4B 5B1OA 3O9OA 2QWPB 5JVDB 3CCQV 5LOVB 1AB3A 1B06A 2ILMA 3HKCA 1KP2A 5KMGA 4TV8B 1MZEA 4LFBB 2CGOA 2PTMA 1PD3A 2XHBA 1WN7A 1M5IA 4UB6Z 4DV1B 2EINB 5B3SB 1LR1A 3JD4A 2IU3A 2YSUB 3VQYA 3D36C 4DR4O 2YEVB 2UXDB 2AXTZ 3UCSC 2Q4PA 4MVSA 1HDJA 4UVAA 4QPKA 2D2CB 2JEUA 4DR5O 2AW9A 1SQFA 2Y0PA 3E8BA 4TV9A 2W0XA 4IHJA 3B2EE 3CCRV 3E8HA 4FVMA 3WB1A 1D5NA 2QEXV 2ETNA 2WLKA 4L8JA 5DN6G 4FIPC 3CCVV 1RM1B 3QNEA 2UUBO 3K5LA 4YIPA 3CEIA 2P06A 1BHAA 2JS3A 3K5OA 2ZINA 3QTCA 2XAJA 3TGUH 3ZIAG 1RPRA 3APOA 1NTKH 2OWOA 5IWAB 2F95B 3DC5A 2QWNB 2DWDC 2PY5A 4H13B 2B1GA 5IY5B 4GX2A 2QJ1A 1XNRB 2E5LO 1G1XB 2RQ6A 3ABMC 2GUZA 2XAGA 1VQ7V 2C2AA 3SGIA 1AI7A 5GONB 4HYOA 3W7WA 4I55A 2P67A 1SKVA 1K73W 4YIOA 4E2LA 1JA8A 4RQEA 4FLWA 3B4SA 4JI6O 2LJ2A 5BMVB 1TVKB 5CBFA 2Y4TA 3MD0A 2GTSA 4LFAO 1R3KC 1EN4A 2UUCB 2F93B 3OTOB 1NR1A 5J2UB 3H1HH 4I9WA 2ZE5A 1SQGA 3CHXA 1G8MA 2VWKA 2AHYA 3FFQA 2CTWA 5C8YA 2Q9LA 1TGOA 4B3RO 3CC2V 4DR7B 4MTOA 5IYCO 5CBHA 1MZFA 2QWQB 3K58A 4HAMA 4BIOA 4X66O 2JVDA 4BW5A 2XAHA 4C7UA 1HNWB 4LH6A 1VQNV 4FZ1A 3SPIA 2V4DA 1FXKC 3FX7A 4NYKA 2QM8A 2E74B 3ABTA 1SRYA 1AR5A 4X1IB 3K08A 1K9MW 1MA1A 3LSSA 2ZE7A 4OGQB 1P4RA 3WB2A 3D3QA 4K35A 4WFEA 1CXZB 1O9HA 2JDIG 2BTQB 1AI5A 4NXNB 4I50B 4DUYO 5LGNA 2R9RB 5K1PA 4K0KB 4WFGA 3JSNA 2GBOA 4LF8O 3JD2A 1HNWO 3E22B 4DR6O 1KQSU 4CH3A 1K92A 3K0GA 3J80N 1YTFD 2YIDA 1JFFA 2EIJC 4DRXA 4MW8A 4FLXA 3MDSA 3K0DA 5IJ0B 5L3BA 2YICA 2QDOA 1QHTA 2CH7A 4Q20A 4D6TH 4DW0A 1JOYA 4UCSA 4LWSB 2JEXA 1Q6HA 4GLXA 1MSDA 3LNMB 1XEQA 1QBZA 3UM7A 3GVMA 2DMXA 2RCVA 3P3PA 4JGSA 4Z1VA 1NR7A 3LDCA 3FB7C 1N34B 2JGDB 3FYEB 5KHIA 4ZI7B 1K33A 2CTRA 2FMLA 3HB3B 3TK1A 3AEIA 1HR0B 3FAVB 5KA5A 1XNRO 4I9QA 2OYQA 1COWG 3JD3A 4GX1A 1XL6A 3P30A 4GX0A 3FB8C 1OCOC 2YXLA 2Y48A 3M7MX 3B8MA 4R7CA 5JWPA 1SETA 1S72V 2UXCO 3ZEDA 3CMEV 5LYJA 1N33O 4LNUB 2GTAA 2VS0A 2CUGA 1OCOB 2H3OA 2QR4A 4FLTA 3ZCCA 1F51A 1GM7A 3CD6V 1BZKA 4RQFA 3STZC 4ASUG 3X2QC 3H1JH 2YIAA 3OE7G 3CXCU 3RYCB 2X6CA 3JCUZ 3K04A 5LMUO 4WFAV 2QKCA 3J7AU 1QU7A 4DR3B 2LQTA 4ABMA 2PGGA 2P90A 2QM4A 4RAIA 1Q3EA 2HJFC 1YCIA 3CCLV 4DR2B 2D3OW 5HFMA 1IBKB 1DTOA 4GKJO 1EN6A 1VF6A 3L72H 3RBZA 3U11A 4DV6O 1NTMH 1S3JA 2ZQMA 4EB6B 1KKDA 2DOSA 5JVDA 4FLZA 4LH7A 5CA0A 4AI8A 1M4UA 2N04A 2Q73A 5EYPB 3E86A 5CN0A 2EBOA 2Z0AA 4NXNO 3ZN1A 3TXSA 2HLDG 1TUBA 1OHHG 2LW1A 1XNQO 4DV3O 2HEPA 1QVGU 3UO2A 2VQEO 4CH6A 1SZTA 2IJIA 5LL6Y 3C3SA 1M56B 4LF8B 1X4TA 4DV7O 2CGNA 2BSKA 1YF2A 1JVMA 4GCZA 4DR5B 4OPHA 2FB5A 1DGSA 2HJDA 1CEZA 2UU9B 4JZGA 1N4CA 3JALB 4O2BA 3JD1A 4TQFA 4N23A 5ITZA 3K5NA 1YITV 2X7RB 5LMNB 1QCEA 2JGUA 2ITCC 2WA4A 4TOIA 4TWKA 1H8EG 1DF4A 3RT3C 2NR5A 4IIJA 4DV3B 1GM9A 1RFYA 3AK1A 3RYHB 5H2FZ 1XL4A 2WLHA 4JYAB 4JI5O 2PYLA 1G4YB 1NKDA 3E8FA 4CC5A 1VQ8V 1MMMA 5FLXN 1NBMG 2QSAA 2KB1A 4W4KA 1VQKV 1WP8A 2DE0X 2L6LA 1K5QA 4I7ZB 1UPGA 4IYHA 1RSOB 2WLLA 1W0KG 1IBMO 2FYUH 3OUFA 3SJAC 4O4IA 3QG5A 5DEDA 2EIKC 1AVMA 2CDYA 3L73H 1ZLZA 4PHZA 1NU1H 4HNAB 1Y76A 1FYJA 4X8AA 3ZMZA 4K3AA 2LW7A 1WLEA 4IYIA 1D2DA 5K1XA 4JI6B 4O4LB 3HKEA 4ZHQA 3CC4V 2LGQA 4N21A 4UCUA 1BGYH 3J81N 4MVMA 4JI0O 3VBBA 2UUCO 5IJ0A 2QA4V 3JALA 2CE4A 2E5LB 4JI0B 2NNUA 1Y6XA 4DUZB 2GDSA 3AK3A 1B04A 2YC0A 4I4TA 2P7TC 3ZRSA 2YI8A 5J2UA 1OCCC 4RUEA 4DK1A 2MW2B 1KC8W 2DN9A 3WG7B 5IYZA 4GKKB 1GRJA 4NTWA 3VQWA 4YJ2A 4PI0A 1NT2B 3SYCA 1JQ0A 1PM9A 3H01A 5LHHA 3P3NA 4NTYA 1PP9H 1T5EA 2ARHA 4X9QA 5E79Z 1Q8IA 1Y67A 4P9PA 1FFTB 1E1RG 3BHPA 3ASOC 3UQ8A 3KCXA 1R73A 5IWAO 3R65A 1HNZO 4KUMA 4LF4B 2ZXWC 2LFSA 5KX5B 1VQ4V 4WF9V 1GKFA 4IL6Z 1ZAUA 3L75H 3TETA 2P5OA 2Q6AA 4LCUC 1N8RW 3DXRA 3F5WC 4L87A 1EFRG 3ASOB 4X66B 2VQEB 1YEWA 4X65O 2ATKC 1ZUQA 5KHKA 2IBZH 2JK5C 4TQDA 5B1BB 4X65B 3AG2C 4ZHQB 3N2KA 5LP6C 4F6EA 5LXTA 1VQLV 2UU9O 2EZPA 4CC6A 5CB4A 1S76D 4QGPA 5KHHA 4X1KA 2ODMA 1YDXA 5JJJB 1U97A 4K8XA 4DR1O 4JYCA 4LFBO 3T1HO 1M57B 2AZ0A 3CX5F 1QQCA 5KUKA 1V9PA 2DQ0A 3D8CA 4UCRA 4WFHA 2OIGA 2WLIB 5CA1B 2Q68A 4YJ2B 3OW2U 4QIWF 2B1IA 2UXNA 1W0JG 4JTAB 1OJHA 1HWYA 2F1MA 2X0LA 2N05A 1M57C 1OZ0A 2RDCA 5BMVA 3BAAA 1VARA 4DO2A 4DW1A 1HR0O 1GN4A 1LNQA 1JPXA 4PA9A 1YJWV 4MW3A 1AP6A 4YXWG 5BY1A 3A2FA 1KUQA 4K8ZA 4O2AB 3ZRWB 1H2LA 4O4HB 4YY3O 1GH6A 4H0LB 2QTOA 4U3JA 4FLYA 2WLMA 3IGAC 1SESA 5GTHZ 3CS5A 4TT3G 3ETEA 3SR2C 1JR9A 2YXHA 4FM0A 4PELA 3OTFA 1XREA 2P6JA 5LBQA 5C93A 2YXYA 5AG2A 4PA4A 1H2NA 3SPGA 4X62O 4WCEV 4G2KA 3HPLC 1S5HC 5ITZB 2ZD9A 4OX9B 2JJ1G 2Q69A 2YDEA 4NXMO 2MK3A 3STLC 1AJQA 4QE7A 1VIBA 5GW7A 1KECA 3ABKB 1GN6A 4U7OA 2Q7HA 4LF7O 3T1YB 3OUSA 1GM8A 2X6AA 1MABG 4U3FH 2Q5ZA 5CA1A 2AHZA 2HG5C 4O4JB 4R8CA 2ZNJA 4DV4O 4FLVA 1MOFA 3UKMA 1P7GA 2EIKB 3ABKC 2OCHA 3E22A 1EZJA 3T2MA 1H38A 5L3CA 1L0NH 4BIUA 1Y74B 2JRIA 3NR7A 3EHBB 1JX9A 5BXZA 1HNZB 1HW7A 5EC2C 1AJNA 4PA7A 3K3WA 1F7YA 5EBLC 2UUAB 5LMUB 1Y76B 4H37A 4O4HA 4WBNA 4FFBB 1YIJV 1QVFU 1SA0A 5DECA 2ZIMA 2ZE8A 1W59A 2V1DA 2W6IG 1R1BA 3HKEB 4FK5C 2JS5A 4MVUA 4XDJA 4ZOLB 4MT8A 1FAFA 1VF7A 1TUBB 3AG1C 5FNVB 1S5LZ 2DYRB 2X6BA 3JAWB 4DV0B 4F6RB 3F7VC 4U7NA 1NJIW 4LF5O 1OCCB 2P4VA 1VQ6V 2OT5A 1M1KW 4DK0A 3WG7C 2EILB 4LP8A 4ZI7A 1OCZB 1BL8A 2QM7A 3ZMUA 3RYIA 3KCYA 2WPDG 2IH1C 3TXQA 1NZ6A 3BA9A 5LMNO 2Q0OC 1BE3H 1H2KA 3CCEV 1EBOA 5KAIZ 2EIMB 4JYBA 4EKWA 3I55V 1GAXA 1SC5B 5FL7G 3FB5C 4TSFG 4PD4F 5JJEB 4PI2A 3ZHUA 1DLBA 2ZXWB 4JI7O 4KHPO 2JGDA 5GTIZ 3B40A 1IURA 1YJNV 3FYIB 4DR2O 2P4KA 2A7WA 1SQBH 1PNMA 1LUVA 3T4DA 2HHHB 1KKCA 1YXBA 5EIBC 4UUJC 4X1YA 3JATB 1AROP 4BAYA 4GUNA 1BT8A 2BTOA 1XI1A 5EK0A 3JASB 4Z2WA 3OT7A 1SZXA 2XAQA 4RWUA 1E1QG 1E79G 3SJCC 4IT5A 2R9AA 4JI5B 4ZIBA 5JJNB 2CK3G 3C90A 4AQYB 3AK2A 2M6YA 1XMQB 3ZRXA 3MAQA 1R3JC 3RN4A 4AQYO 1H2MA 2VQFO 3DGEA 4NXMB 4DUZO 2F66C 3RYIB 3HKCB 5JH7B 4KP4A 3AG4C 4DR7O 2BTQA 3CRMA 4EB6A 2CAZC 3E89A 1N32O 2HHHO 1K4DC 2NLJC 2FKXA 3SYOA 1V55C 4I4TB 1FXVA 1DF5A 3OAAG 3L71H 3CB2A 3JAMN 4J10A 2R72A 5B1AC 1ZSPA 4UVCA 4FLUA 4UVBA 4XBFA 1ZTEA 2ZR2A 3E35A 1BS3A 1WAZA 3A0BZ 3A0HZ 4CS4A 3LSQA 4LR3A 2EJ7A 3JAKB 3OMIB 3RW0A 4H33A 1KD1W 2CTQA 5B5EZ 1AILA 3KKYA 1Q82W 5B1AB 5KX5A 3AG7A 2UXBO 2V7QG 3UT5B 1KYOF 4B3TO 1F4NA 3W7XA 1XMOO 3DXRB 1F23A 1K4CC 1SQPH 4JAAA 4GYCB 4J41A 4DV0O 2KG7B 3U0ZA 4DV5O 4FMTA 4LF5B 1RM1C 4W4LA 1O9GA 3CRRA 4YHHB 4AHCA 5LA6B 3Q4HA 4P30A 1VQ5V 4P2ZA 5B3SC 3D36A 3OFNG 1JCHA 1P7BA 3HR0A 2HFEC 2K9PA 5KA6A 4NB5A 1Q81W 2Z3YA 3EFFK 5IY5C 3RGBA 1ZL8A 2EZOA 2FL4A 1L1FA 2VRZA 3CWBH 2R9IA 4X64B 1IZ3A 1THZA 1VF6C 3EVKA 3K5MA 1HNXB 1AI6A 2UXCB 2HP8A 3OEHG 1AI4A 3B77A 3OM3B 4B08A 4EEQA 3PJSK 2PYJA 4DV5B 4BWAA 3CSXA 1IXMA 4JTDB 3SYQA 3CJHA 4JTCB 4JI1B 1K3EA 1AP5A 2ZR3A 5E1AC 5KHGA 3CMAV 2ZIOA 4CH5A 1SA0B 2WWWA 4I5SA 4QE9A 4B7EA 1GN3A 3L70H 5JQGA 2ITDC 2LFRA 3ICXA 4JAVA 4U3JB 4EFEA 3SJBC 4O4LA 4TUYB 2F4VB 1IBLO 4FFKA 1Y4MA 1RP3B 2HVKC 5LOVA 2Q7GA 3ABMB 3A8TA 3B09A 3MHSC 4JI4O 4J9YB 2K1EA 3ZHRA 3IFXA 4I0XB 3I56V 1ORQC 2ADPA 1FJGB 4PA6A 3ZRVA 2BOCC 4AILC 1M56C 4RUFA 2EULA 4JV5B 2CTPA
chains in the Genus database with same CATH topology
1L8DA 4LFCB 5C8YA 1TGOA 4I50A 1QQCA 1V9PA 4DR7B 5LP6B 4B3TB 4UCRA 1XHZA 3K58A 4BW9A 5CA1B 4YJ2B 3DSQA 2JVDA 2Q0AA 3HKBB 1N36B 1HNWB 4LH6A 4DV2B 2F1MA 5BMVA 3BAAA 1WPBA 1KMIZ 2V4DA 1N33B 5EZYA 4F6RA 4X1IB 5J2TA 1P49A 3A2FA 1JMKC 4UCVA 2PUSA 1FFXA 4X1KB 4CH4A 3WB2A 4K8ZA 4O2AB 4O4HB 1O9HA 4YJ3A 5IJ9B 2ZM6B 4X20A 3RYFB 5JCOC 2BTQB 4U3JA 2Q7EA 4FLYA 1Z5WA 4NXNB 4I50B 5K1PA 4K0KB 3IAYA 3SR2C 1XHXA 3JSNA 4FM0A 3OTFA 4IIJB 2GV9A 3E22B 3N2KB 3RYHA 4CH3A 3JAWA 5ITZB 3JARB 4JI3B 1JFFA 4OX9B 4DRXA 3WB0A 5C8YB 4FLXA 5IJ0B 1Z5VA 3PN1A 1QHTA 1RSOA 4IHJB 4UCSA 2Q7HA 3RYCA 2YIBA 3T1YB 4GLXA 4DV7B 5CA1A 4O4JB 2ZNJA 4FLVA 3HKBA 2RJZA 3JASA 4LNUA 1N34B 5LA6A 4DR6B 5KHIA 2VQFB 3E22A 3QF7A 4ZI7B 1HR0B 3JAKA 4DV6B 1HNZB 1HW7A 5J2TB 4B3SB 4I9QA 2OYQA 3BABA 1FFXB 3BA8A 4O2BB 2UUAB 5LMUB 4EFBA 4B3RB 4O4HA 4WBNA 5EIBD 4FFBB 4YJ3B 2YXLA 5IJ9A 1XMOB 1SA0A 3M7MX 3RYFA 2IM9A 3THOA 2ZIMA 3ZS8C 5IYZB 4LF9B 4NVPA 3HKEB 3RWRD 2JS5A 3K59A 4ZOLB 1VF7A 1TUBB 1TAEA 5FNVB 3JAWB 3HKDA 3ZEDA 4DV0B 1IBLB 5LYJA 4F6RB 1G6UA 1JJOA 4LNUB 4B3MB 1I7FA 4DK0A 4D7SA 4FLTA 5D5PA 3VQVA 1IBMB 4ZI7A 4Q6GA 3RYIA 4FM1A 2PZSA 3BA9A 2YIAA 1TA8A 5D5QA 4DR1B 3RYCB 4WBNB 1N32B 3JATA 5EYPA 5JH7A 4DR3B 2UXBB 2PGGA 5JJEB 2YIBD 4CS3A 4PI2A 2QM4A 4ZOLA 1Q3EA 4DR4B 3HKDB 1TVKA 5BR8B 4DR2B 4GKJB 5KHJA 4FM2A 1IBKB 3RFRA 3N2GB 5JCOA 1I94B 4X62B 4KL1A 4HBNA 3U11A 3ETQA 2YI9A 4EB6B 5JVDA 4FLZA 4LH7A 5CA0A 4CS2A 5KMGB 1M4UA 2HHHB 5EIBC 4X1YA 3JATB 5EYPB 1Q5OA 1H2SB 4TUYA 1TUBA 2BTOA 1XI1A 3JASB 2HEPA 4CH6A 3UT5A 4DUYB 1S5JA 4LF8B 1X4TA 3SJCC 5EZYB 2R9AA 4JI4B 3BRCA 4JI5B 4ZIBA 4JI8B 4DR5B 5JJNB 4LFAB 2ZNIA 4AQYB 1DGSA 4D7TA 1XMQB 2UU9B 3JALB 3MAQA 4O2BA 4UCTA 5FPOA 4TQFA 4NXMB 2F66C 4FFBA 3RYIB 5ITZA 3K5NA 3HKCB 4UFZA 5JH7B 1J5EB 5LMNB 5LP6A 2JGUA 1D5AA 4X20B 5CA0B 2BTQA 4EB6A 2CAZC 4YY3B 4O2AA 3VQXA 4TOIA 4I4TB 2ZCEA 5FNVA 1XQ8A 3K57A 3JSLA 5LYJB 4LF7B 2EX3A 4IIJA 4DV3B 3CB2A 3RYHB 2R72A 4DV4B 4JYAB 4FLUA 4TV9B 2P22C 2PYLA 4CC5A 2E3CA 3FFQA 5JVDB 4CS4A 5LOVB 4LR3A 3JAKB 3HKCA 4DRXB 5LXTB 5KMGA 4TV8B 3SJAC 4O4IA 5CB4B 4LFBB 3QG5A 2PTMA 5KX5A 2XHBA 4JI2B 4PHZA 1WN7A 1M5IA 3UT5B 4DV1B 4HNAB 4I55B 5JQGB 3VQYA 5FPRA 4GYCB 5K1XA 4JI6B 3LNNA 4O4LB 2UXDB 3HKEA 3JARA 4ZHQA 3U0ZA 4UCUA 4LF5B 1O9GA 3U10A 1SQFA 4YHHB 4AHCA 5LA6B 4TV9A 5IJ0A 3JALA 4JI0B 2E5LB 4IHJA 4LF6B 4DUZB 3B2EE 4FVMA 1B04A 3WB1A 1M93A 4I4TA 3T1HB 2YI8A 5J2UA 1KU9A 5GONA 4L8JA 4DK1A 2R70A 5IYZA 4GKKB 3VQWA 3RGBA 4YJ2A 3K5LA 3BPZA 2VWJA 4X64B 4PI0A 1NT2B 3K5OA 3K5MA 2ZINA 3QTCA 1HNXB 1T5EA 2UXCB 4B08A 1Q8IA 4EEQA 2PYJA 4DV5B 4BWAA 3CSXA 2OWOA 4JI7B 3BHPA 5IWAB 4KHPB 4UCOA 2F95B 2PY5A 3UQ8A 4JI1B 4TV8A 2QJ1A 4X1IA 1XNRB 4LF4B 5KX5B 5KHGA 3N2GA 2ZIOA 4CH5A 2RQ6A 1SA0B 1ZAUA 1WNSA 2P5OA 1Q43A 3SGIA 5JQGA 5GONB 2UUBB 4I55A 1SKVA 4X66B 3ICXA 2VQEB 4U3JB 4EFEA 3SJBC 1YEWA 2KKWA 4O4LA 4TUYB 1XNQB 4FLWA 2F4VB 5KHKA 5BMVB 1TVKB 4TQDA 4X65B 5LOVA 2Q7GA 4ZHQB 3N2KA 4O4JA 5LP6C 5LXTA 2UUCB 4CC6A 2F93B 4O4IB 5CB4A 3OTOB 1JFFB 1FJGB 5KHHA 5J2UB 4X1KA 4AILC 1SQGA 5JJJB 3CHXA 4K8XA 4JV5B 2VWKA 4HNAA 4X1YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XQ8 A;  2KKW A; 
#chains in the Genus database with same CATH topology
 1L8D A;  1A32 A;  4BR6 A;  4FPP A;  2H94 A;  3FAV A;  2GUZ B;  1FXK B;  3K9S A;  3IC9 A;  1Q86 W;  4PV1 B;  5H9C A;  1XHZ A;  4BW9 A;  3G67 A;  5LHG A;  5IYB O;  5L3G A;  3DSQ A;  2A79 B;  3HKB B;  1N36 B;  4CZZ A;  1EZV H;  3VOU A;  3K79 A;  3M99 B;  4GX5 A;  5EZY A;  3CE2 A;  3SDL A;  1Q6I A;  3CJH B;  4QNH B;  1CPY A;  2RMK B;  1YJ9 V;  2Z5U A;  5F2V O;  1JMK C;  1FFX A;  2ZE6 A;  3FD9 A;  3KG2 A;  3ABL C;  4DXW A;  4X1K B;  3LUT B;  4MTG A;  1AR1 B;  1BQ0 A;  4YJ3 A;  5IJ9 B;  4X20 A;  2JJ2 G;  5JCO C;  1KB9 F;  4JZ2 A;  2Q7E A;  1XUQ A;  2EIJ B;  4NTX A;  1Z5W A;  3SYP A;  2DWE C;  3IAY A;  4MVR A;  1RPO A;  2XAF A;  3H1K H;  2XT9 A;  1S0V A;  4ICG A;  5A2Q N;  3ABL B;  2M7W A;  3N2K B;  1R3L C;  1DK1 A;  2XUM A;  1VP7 A;  2IJJ A;  1WA8 B;  3JAW A;  4F4L A;  2HVJ C;  3JAR B;  4JI3 B;  2OCC C;  1IBK O;  2E76 B;  3SPJ A;  3WB0 A;  4LF6 O;  3G71 V;  3F5T A;  2UUA O;  3FB6 C;  1R6N A;  4FJC C;  5H5N A;  3QO8 A;  2LGW A;  3ZHV A;  2ZKO A;  4DV7 B;  4GKK O;  2IJH A;  4UV9 A;  2OCC B;  3CRC A;  4J11 A;  3HKB A;  1XMQ O;  3KZI Z;  2QKS A;  4LNU A;  2VQF B;  3QF7 A;  3L9D A;  3OTO O;  4PA3 A;  3JAK A;  2JIZ G;  1K7D A;  4LBE C;  1ROP A;  1NH2 B;  4UB8 Z;  3W7T A;  4DV6 B;  2RN9 A;  2IH3 C;  3NXS A;  1FFX B;  4O2B B;  2B9Z A;  2GSM B;  1J5E O;  2CH7 B;  3E8G A;  2QE7 G;  4B3R B;  1BSM A;  5IE9 A;  5H6R A;  4GZR B;  5L3E A;  4YJ3 B;  5IJ9 A;  4NKG B;  4R6Z A;  4PDM A;  1CP9 A;  1OCR C;  3ZS8 C;  4NVP A;  2A3Q A;  3X2Q B;  1BMF G;  2YUA A;  1I5X A;  4G28 B;  1IBL B;  3HKD A;  3K9A A;  1M9N A;  1G6U A;  2Y69 B;  1QR9 A;  1AR4 A;  1KP3 A;  4B3M B;  4MVZ A;  2PF4 E;  2NN4 A;  3CRA A;  1WA8 A;  3VQV A;  1IBM B;  5LGT A;  2N74 A;  1K8A W;  1OCR B;  1NVP B;  1N0J A;  1BQZ A;  4FM1 A;  1GN2 A;  3I5D A;  5L3D A;  5IYD O;  1ENV A;  4J42 A;  1YHQ V;  3AG2 B;  5D5Q A;  1VQ9 V;  4DR1 B;  4XDK A;  1UFI A;  4MS2 A;  4JPR A;  5EYP A;  5IT9 N;  3SPC A;  5JH7 A;  3AG3 B;  5B1N A;  3EXA A;  3UO3 A;  3B8N A;  1IVS A;  3R66 A;  4UXN A;  4PDL A;  4CS3 A;  1PKX A;  3SJQ C;  4ZOL A;  5EBW C;  3CCU V;  4DR4 B;  3W7U A;  1VF5 B;  1TVK A;  5BR8 B;  1H2G A;  3RFR A;  3D3I A;  3SYA A;  2GHY A;  2FTK A;  1I94 B;  4KL1 A;  4J7K A;  4LWS A;  3OGC C;  4LFC O;  2YI9 A;  3A0R A;  4CS2 A;  5KMG B;  4X88 A;  2XAS A;  1PNK A;  3W7S A;  1MNG A;  4WFF A;  3ZX6 A;  1Q5O A;  4J80 A;  4TUY A;  3CPW U;  2XND G;  3UT5 A;  4DUY B;  3MHH C;  4K0K O;  1URF A;  4I0X A;  2DW4 A;  1NI8 A;  2ZNI A;  3LDE A;  4UV8 A;  2B5U A;  3CYO A;  1I94 O;  2OTL V;  4UFZ A;  5CA3 A;  5CA0 B;  2XTA A;  4YY3 B;  3VQX A;  1IDS A;  3OMN B;  1XQ8 A;  4J7J A;  4DR3 O;  3K57 A;  5LYJ B;  1N0N A;  3RVY A;  2F4V O;  1LUW A;  3OEE G;  4LF7 B;  2YEV A;  1VQM V;  1R6T A;  1UJW B;  3CCJ V;  3ZHQ A;  5TIS Z;  3S3W A;  4DV4 B;  5CMU A;  1Q90 D;  2Q8V A;  3N27 A;  3O65 A;  4P9O A;  4TV9 B;  1PV0 A;  2P22 C;  1WJZ A;  2E3C A;  1PL0 A;  4JV5 O;  1HP8 A;  1EM1 A;  4DRX B;  5LXT B;  2AZ2 A;  4IGG A;  3LSU A;  3ZMV A;  5CB4 B;  1NQT A;  4J7Z A;  2ZM6 O;  4JI2 B;  3DTU B;  1XIL A;  3T1Y O;  2DJV A;  4JI2 O;  4HZ3 A;  3S3X A;  3QO5 A;  1YTF B;  1K5S A;  4I55 B;  5JQG B;  1GO3 F;  1VMG A;  2DYS B;  5FPR A;  3LNN A;  1GMG A;  2WLN A;  3ML0 A;  4A5U B;  3JAR A;  3ZJZ A;  4JI8 O;  1FD9 A;  3U10 A;  1B3Q A;  5KUM A;  4JI1 O;  4PJ0 Z;  4JI3 O;  1NVP D;  4LF6 B;  4KFM A;  2DYR C;  4MTX A;  3BVO A;  2WA3 A;  1M93 A;  3T1H B;  1Y66 A;  1KU9 A;  5GON A;  2R70 A;  2WSS G;  1GK9 A;  4J9Z B;  3BPZ A;  1J95 A;  2VWJ A;  4X89 A;  3E83 A;  1YI2 V;  2PI4 A;  2F43 G;  2QTS A;  5A9G A;  1U96 A;  2W0F C;  3CRQ A;  4RO2 A;  4ZBM A;  2ZT9 B;  1X59 A;  3M8A A;  2LP7 A;  5LGU A;  4JI7 B;  4KHP B;  4UCO A;  2Y4U A;  1QNM A;  5IDJ A;  4TV8 A;  2XOK G;  3OR6 C;  4X1I A;  4B3S O;  3Q4H B;  5BZB A;  1WP7 A;  3N2G A;  2QKA A;  3DC6 A;  4FZ0 A;  1WNS A;  3ZHT A;  2Y69 C;  1Q43 A;  2QWR B;  3ZN0 A;  1WB7 A;  3FKS G;  1FXH A;  2WLI A;  2UUB B;  2L35 A;  2KKW A;  1XNQ B;  2KG7 A;  2BE3 A;  2W6J G;  2QWO B;  1IX9 A;  5DM6 V;  4O4J A;  5KAF Z;  4KXR A;  2HKO A;  2IW5 A;  2OTJ V;  4O4I B;  1BHB A;  2HR3 A;  3AG3 C;  1JFF B;  3ETG A;  1S77 D;  3GWO A;  5J9P C;  2DQ3 A;  4HNA A;  4X1Y B;  4LFC B;  1PPJ H;  4PDV A;  5B1B C;  1WPX A;  4QJF B;  3H1I H;  4I50 A;  5LP6 B;  2WLJ A;  4B3T B;  2H8P C;  2A06 H;  2Y0I A;  3JD0 A;  2Q0A A;  4LC1 A;  5CBG A;  4B3M O;  1BCC H;  2G38 A;  4MSW C;  1Q7Y W;  4DV2 B;  3TJT A;  5HFL A;  1WPB A;  1KMI Z;  1N33 B;  1YVW A;  1PNL A;  3BY6 A;  4F6R A;  2ZDI C;  5J2T A;  1P49 A;  3ZMS A;  2KSD A;  4H44 B;  4UCV A;  1M90 W;  2ADQ B;  2PUS A;  3OMA B;  4CH4 A;  1TUE B;  3H1L H;  2ZM6 B;  2PI5 A;  3RYF B;  1I5Y A;  2ZDI A;  1OV9 A;  3OGI B;  1H8H G;  1XHX A;  5B66 Z;  4IIJ B;  2GV9 A;  3RYH A;  1SS3 A;  3WU2 Z;  1SQX H;  3C3T A;  2EIN C;  1Y74 A;  1F4M A;  3ASN B;  5C8Y B;  5LHI A;  2Q67 A;  1Z5V A;  3BCC H;  3SPH A;  3PN1 A;  1RSO A;  2WLL B;  3ZRW A;  4IHJ B;  1FXK A;  4MVO A;  4Z1M G;  3K06 A;  3IC7 A;  2A0L A;  3RYC A;  2YIB A;  4ZKI A;  1I08 A;  4G27 B;  1EN5 A;  2BOB C;  3ZBH A;  3ASN C;  4JAS A;  3CP1 A;  4NR1 A;  4JYA O;  1I0H A;  1GTO A;  3CC7 V;  4R50 A;  2RJZ A;  3JAS A;  1B6Q A;  1IXB A;  5LA6 A;  4JF3 A;  1SER A;  4DR6 B;  1PL4 A;  3G6B A;  1YZB A;  2UXX A;  1QR8 A;  3LDD A;  4B3S B;  3AG1 B;  5J2T B;  3BAB A;  1NTZ H;  1Q6U A;  1SQQ H;  3F7Y C;  1NH2 D;  1MG1 A;  2DYS C;  4XDL A;  3BA8 A;  3CXH F;  2IU0 A;  3K03 A;  4EFB A;  4E4E A;  1ZX3 A;  5EIB D;  1VQO V;  3G4S V;  1XMO B;  3RYF A;  2IM9 A;  1K97 A;  3THO A;  4DV1 O;  5IYZ B;  4LF9 B;  2QGN A;  3RWR D;  3K59 A;  2WAM A;  4LF9 O;  3JYC A;  1TAE A;  4QPJ A;  5H6Q A;  1ZWI C;  2UXD O;  2O57 A;  3G80 A;  2BSK B;  1JJO A;  1JJ2 U;  5BR8 O;  2EIM C;  2IJK A;  1XBL A;  1I7F A;  4D7S A;  5D5P A;  4Q6G A;  3IJ4 A;  1FKA O;  3OR7 C;  1P84 F;  4LF4 O;  1QLE C;  2PZS A;  3L74 H;  1TA8 A;  3APQ A;  2BCC H;  1V54 C;  2RNB A;  4WBN B;  1N32 B;  3JAT A;  4BIZ A;  5EBM C;  4MTF A;  3GB7 C;  3G6E V;  1FPO A;  2UXB B;  3T1C A;  2YS8 A;  2EIL C;  2AGA A;  3T4Z A;  1OCZ C;  1QLN A;  2YIB D;  1QLE B;  1VQP V;  1KBH A;  2KQX A;  5EC1 C;  3BFR A;  2E75 B;  1N36 O;  3CCS V;  3HKD B;  1L0L H;  1V54 B;  4GKJ B;  4DYL A;  5KHJ A;  4FM2 A;  3CCM V;  2LO1 A;  3BEH A;  4PDR A;  1VEW A;  3N2G B;  1Z2G A;  1W2B U;  5JCO A;  5L3F A;  4X62 B;  4HBN A;  1SF9 A;  5KLV H;  3JCZ A;  1FJG O;  3WFV A;  3ETQ A;  4B7K A;  1AJP A;  4JAU A;  1K34 A;  3RVZ A;  1H2S B;  1WB8 A;  1YSC A;  3QO7 A;  1FS0 G;  1S5J A;  4WFB V;  2F23 A;  1ZL8 B;  3ETD A;  5EZY B;  3H9V A;  1R6K A;  3BRC A;  4JI4 B;  4JI8 B;  1V55 B;  2A9H A;  3GWK C;  4LFA B;  3ZHS A;  1NS1 A;  4D7T A;  4YHH O;  4UCT A;  5FPO A;  1R3I C;  4FFB A;  4JYY A;  4OX9 O;  3ZMT A;  1J5E B;  5LP6 A;  1MSW D;  4X20 B;  1D5A A;  1SQV H;  4CBC A;  2EJR A;  4OPA A;  4OXS A;  3E2E A;  4O2A A;  3ABU A;  2ZCE A;  1XDC A;  3TCU A;  5FNV A;  3JSL A;  4MVQ A;  3QVN A;  2EX3 A;  3OD4 A;  4X64 O;  3P32 A;  1US6 A;  2OIE A;  4DV2 O;  1HNX O;  4GT1 A;  1XOU A;  1N34 O;  3AG4 B;  5B1O A;  3O9O A;  2QWP B;  5JVD B;  3CCQ V;  5LOV B;  1AB3 A;  1B06 A;  2ILM A;  3HKC A;  1KP2 A;  5KMG A;  4TV8 B;  1MZE A;  4LFB B;  2CGO A;  2PTM A;  1PD3 A;  2XHB A;  1WN7 A;  1M5I A;  4UB6 Z;  4DV1 B;  2EIN B;  5B3S B;  1LR1 A;  3JD4 A;  2IU3 A;  2YSU B;  3VQY A;  3D36 C;  4DR4 O;  2YEV B;  2UXD B;  2AXT Z;  3UCS C;  2Q4P A;  4MVS A;  1HDJ A;  4UVA A;  4QPK A;  2D2C B;  2JEU A;  4DR5 O;  2AW9 A;  1SQF A;  2Y0P A;  3E8B A;  4TV9 A;  2W0X A;  4IHJ A;  3B2E E;  3CCR V;  3E8H A;  4FVM A;  3WB1 A;  1D5N A;  2QEX V;  2ETN A;  2WLK A;  4L8J A;  5DN6 G;  4FIP C;  3CCV V;  1RM1 B;  3QNE A;  2UUB O;  3K5L A;  4YIP A;  3CEI A;  2P06 A;  1BHA A;  2JS3 A;  3K5O A;  2ZIN A;  3QTC A;  2XAJ A;  3TGU H;  3ZIA G;  1RPR A;  3APO A;  1NTK H;  2OWO A;  5IWA B;  2F95 B;  3DC5 A;  2QWN B;  2DWD C;  2PY5 A;  4H13 B;  2B1G A;  5IY5 B;  4GX2 A;  2QJ1 A;  1XNR B;  2E5L O;  1G1X B;  2RQ6 A;  3ABM C;  2GUZ A;  2XAG A;  1VQ7 V;  2C2A A;  3SGI A;  1AI7 A;  5GON B;  4HYO A;  3W7W A;  4I55 A;  2P67 A;  1SKV A;  1K73 W;  4YIO A;  4E2L A;  1JA8 A;  4RQE A;  4FLW A;  3B4S A;  4JI6 O;  2LJ2 A;  5BMV B;  1TVK B;  5CBF A;  2Y4T A;  3MD0 A;  2GTS A;  4LFA O;  1R3K C;  1EN4 A;  2UUC B;  2F93 B;  3OTO B;  1NR1 A;  5J2U B;  3H1H H;  4I9W A;  2ZE5 A;  1SQG A;  3CHX A;  1G8M A;  2VWK A;  2AHY A;  3FFQ A;  2CTW A;  5C8Y A;  2Q9L A;  1TGO A;  4B3R O;  3CC2 V;  4DR7 B;  4MTO A;  5IYC O;  5CBH A;  1MZF A;  2QWQ B;  3K58 A;  4HAM A;  4BIO A;  4X66 O;  2JVD A;  4BW5 A;  2XAH A;  4C7U A;  1HNW B;  4LH6 A;  1VQN V;  4FZ1 A;  3SPI A;  2V4D A;  1FXK C;  3FX7 A;  4NYK A;  2QM8 A;  2E74 B;  3ABT A;  1SRY A;  1AR5 A;  4X1I B;  3K08 A;  1K9M W;  1MA1 A;  3LSS A;  2ZE7 A;  4OGQ B;  1P4R A;  3WB2 A;  3D3Q A;  4K35 A;  4WFE A;  1CXZ B;  1O9H A;  2JDI G;  2BTQ B;  1AI5 A;  4NXN B;  4I50 B;  4DUY O;  5LGN A;  2R9R B;  5K1P A;  4K0K B;  4WFG A;  3JSN A;  2GBO A;  4LF8 O;  3JD2 A;  1HNW O;  3E22 B;  4DR6 O;  1KQS U;  4CH3 A;  1K92 A;  3K0G A;  3J80 N;  1YTF D;  2YID A;  1JFF A;  2EIJ C;  4DRX A;  4MW8 A;  4FLX A;  3MDS A;  3K0D A;  5IJ0 B;  5L3B A;  2YIC A;  2QDO A;  1QHT A;  2CH7 A;  4Q20 A;  4D6T H;  4DW0 A;  1JOY A;  4UCS A;  4LWS B;  2JEX A;  1Q6H A;  4GLX A;  1MSD A;  3LNM B;  1XEQ A;  1QBZ A;  3UM7 A;  3GVM A;  2DMX A;  2RCV A;  3P3P A;  4JGS A;  4Z1V A;  1NR7 A;  3LDC A;  3FB7 C;  1N34 B;  2JGD B;  3FYE B;  5KHI A;  4ZI7 B;  1K33 A;  2CTR A;  2FML A;  3HB3 B;  3TK1 A;  3AEI A;  1HR0 B;  3FAV B;  5KA5 A;  1XNR O;  4I9Q A;  2OYQ A;  1COW G;  3JD3 A;  4GX1 A;  1XL6 A;  3P30 A;  4GX0 A;  3FB8 C;  1OCO C;  2YXL A;  2Y48 A;  3M7M X;  3B8M A;  4R7C A;  5JWP A;  1SET A;  1S72 V;  2UXC O;  3ZED A;  3CME V;  5LYJ A;  1N33 O;  4LNU B;  2GTA A;  2VS0 A;  2CUG A;  1OCO B;  2H3O A;  2QR4 A;  4FLT A;  3ZCC A;  1F51 A;  1GM7 A;  3CD6 V;  1BZK A;  4RQF A;  3STZ C;  4ASU G;  3X2Q C;  3H1J H;  2YIA A;  3OE7 G;  3CXC U;  3RYC B;  2X6C A;  3JCU Z;  3K04 A;  5LMU O;  4WFA V;  2QKC A;  3J7A U;  1QU7 A;  4DR3 B;  2LQT A;  4ABM A;  2PGG A;  2P90 A;  2QM4 A;  4RAI A;  1Q3E A;  2HJF C;  1YCI A;  3CCL V;  4DR2 B;  2D3O W;  5HFM A;  1IBK B;  1DTO A;  4GKJ O;  1EN6 A;  1VF6 A;  3L72 H;  3RBZ A;  3U11 A;  4DV6 O;  1NTM H;  1S3J A;  2ZQM A;  4EB6 B;  1KKD A;  2DOS A;  5JVD A;  4FLZ A;  4LH7 A;  5CA0 A;  4AI8 A;  1M4U A;  2N04 A;  2Q73 A;  5EYP B;  3E86 A;  5CN0 A;  2EBO A;  2Z0A A;  4NXN O;  3ZN1 A;  3TXS A;  2HLD G;  1TUB A;  1OHH G;  2LW1 A;  1XNQ O;  4DV3 O;  2HEP A;  1QVG U;  3UO2 A;  2VQE O;  4CH6 A;  1SZT A;  2IJI A;  5LL6 Y;  3C3S A;  1M56 B;  4LF8 B;  1X4T A;  4DV7 O;  2CGN A;  2BSK A;  1YF2 A;  1JVM A;  4GCZ A;  4DR5 B;  4OPH A;  2FB5 A;  1DGS A;  2HJD A;  1CEZ A;  2UU9 B;  4JZG A;  1N4C A;  3JAL B;  4O2B A;  3JD1 A;  4TQF A;  4N23 A;  5ITZ A;  3K5N A;  1YIT V;  2X7R B;  5LMN B;  1QCE A;  2JGU A;  2ITC C;  2WA4 A;  4TOI A;  4TWK A;  1H8E G;  1DF4 A;  3RT3 C;  2NR5 A;  4IIJ A;  4DV3 B;  1GM9 A;  1RFY A;  3AK1 A;  3RYH B;  5H2F Z;  1XL4 A;  2WLH A;  4JYA B;  4JI5 O;  2PYL A;  1G4Y B;  1NKD A;  3E8F A;  4CC5 A;  1VQ8 V;  1MMM A;  5FLX N;  1NBM G;  2QSA A;  2KB1 A;  4W4K A;  1VQK V;  1WP8 A;  2DE0 X;  2L6L A;  1K5Q A;  4I7Z B;  1UPG A;  4IYH A;  1RSO B;  2WLL A;  1W0K G;  1IBM O;  2FYU H;  3OUF A;  3SJA C;  4O4I A;  3QG5 A;  5DED A;  2EIK C;  1AVM A;  2CDY A;  3L73 H;  1ZLZ A;  4PHZ A;  1NU1 H;  4HNA B;  1Y76 A;  1FYJ A;  4X8A A;  3ZMZ A;  4K3A A;  2LW7 A;  1WLE A;  4IYI A;  1D2D A;  5K1X A;  4JI6 B;  4O4L B;  3HKE A;  4ZHQ A;  3CC4 V;  2LGQ A;  4N21 A;  4UCU A;  1BGY H;  3J81 N;  4MVM A;  4JI0 O;  3VBB A;  2UUC O;  5IJ0 A;  2QA4 V;  3JAL A;  2CE4 A;  2E5L B;  4JI0 B;  2NNU A;  1Y6X A;  4DUZ B;  2GDS A;  3AK3 A;  1B04 A;  2YC0 A;  4I4T A;  2P7T C;  3ZRS A;  2YI8 A;  5J2U A;  1OCC C;  4RUE A;  4DK1 A;  2MW2 B;  1KC8 W;  2DN9 A;  3WG7 B;  5IYZ A;  4GKK B;  1GRJ A;  4NTW A;  3VQW A;  4YJ2 A;  4PI0 A;  1NT2 B;  3SYC A;  1JQ0 A;  1PM9 A;  3H01 A;  5LHH A;  3P3N A;  4NTY A;  1PP9 H;  1T5E A;  2ARH A;  4X9Q A;  5E79 Z;  1Q8I A;  1Y67 A;  4P9P A;  1FFT B;  1E1R G;  3BHP A;  3ASO C;  3UQ8 A;  3KCX A;  1R73 A;  5IWA O;  3R65 A;  1HNZ O;  4KUM A;  4LF4 B;  2ZXW C;  2LFS A;  5KX5 B;  1VQ4 V;  4WF9 V;  1GKF A;  4IL6 Z;  1ZAU A;  3L75 H;  3TET A;  2P5O A;  2Q6A A;  4LCU C;  1N8R W;  3DXR A;  3F5W C;  4L87 A;  1EFR G;  3ASO B;  4X66 B;  2VQE B;  1YEW A;  4X65 O;  2ATK C;  1ZUQ A;  5KHK A;  2IBZ H;  2JK5 C;  4TQD A;  5B1B B;  4X65 B;  3AG2 C;  4ZHQ B;  3N2K A;  5LP6 C;  4F6E A;  5LXT A;  1VQL V;  2UU9 O;  2EZP A;  4CC6 A;  5CB4 A;  1S76 D;  4QGP A;  5KHH A;  4X1K A;  2ODM A;  1YDX A;  5JJJ B;  1U97 A;  4K8X A;  4DR1 O;  4JYC A;  4LFB O;  3T1H O;  1M57 B;  2AZ0 A;  3CX5 F;  1QQC A;  5KUK A;  1V9P A;  2DQ0 A;  3D8C A;  4UCR A;  4WFH A;  2OIG A;  2WLI B;  5CA1 B;  2Q68 A;  4YJ2 B;  3OW2 U;  4QIW F;  2B1I A;  2UXN A;  1W0J G;  4JTA B;  1OJH A;  1HWY A;  2F1M A;  2X0L A;  2N05 A;  1M57 C;  1OZ0 A;  2RDC A;  5BMV A;  3BAA A;  1VAR A;  4DO2 A;  4DW1 A;  1HR0 O;  1GN4 A;  1LNQ A;  1JPX A;  4PA9 A;  1YJW V;  4MW3 A;  1AP6 A;  4YXW G;  5BY1 A;  3A2F A;  1KUQ A;  4K8Z A;  4O2A B;  3ZRW B;  1H2L A;  4O4H B;  4YY3 O;  1GH6 A;  4H0L B;  2QTO A;  4U3J A;  4FLY A;  2WLM A;  3IGA C;  1SES A;  5GTH Z;  3CS5 A;  4TT3 G;  3ETE A;  3SR2 C;  1JR9 A;  2YXH A;  4FM0 A;  4PEL A;  3OTF A;  1XRE A;  2P6J A;  5LBQ A;  5C93 A;  2YXY A;  5AG2 A;  4PA4 A;  1H2N A;  3SPG A;  4X62 O;  4WCE V;  4G2K A;  3HPL C;  1S5H C;  5ITZ B;  2ZD9 A;  4OX9 B;  2JJ1 G;  2Q69 A;  2YDE A;  4NXM O;  2MK3 A;  3STL C;  1AJQ A;  4QE7 A;  1VIB A;  5GW7 A;  1KEC A;  3ABK B;  1GN6 A;  4U7O A;  2Q7H A;  4LF7 O;  3T1Y B;  3OUS A;  1GM8 A;  2X6A A;  1MAB G;  4U3F H;  2Q5Z A;  5CA1 A;  2AHZ A;  2HG5 C;  4O4J B;  4R8C A;  2ZNJ A;  4DV4 O;  4FLV A;  1MOF A;  3UKM A;  1P7G A;  2EIK B;  3ABK C;  2OCH A;  3E22 A;  1EZJ A;  3T2M A;  1H38 A;  5L3C A;  1L0N H;  4BIU A;  1Y74 B;  2JRI A;  3NR7 A;  3EHB B;  1JX9 A;  5BXZ A;  1HNZ B;  1HW7 A;  5EC2 C;  1AJN A;  4PA7 A;  3K3W A;  1F7Y A;  5EBL C;  2UUA B;  5LMU B;  1Y76 B;  4H37 A;  4O4H A;  4WBN A;  4FFB B;  1YIJ V;  1QVF U;  1SA0 A;  5DEC A;  2ZIM A;  2ZE8 A;  1W59 A;  2V1D A;  2W6I G;  1R1B A;  3HKE B;  4FK5 C;  2JS5 A;  4MVU A;  4XDJ A;  4ZOL B;  4MT8 A;  1FAF A;  1VF7 A;  1TUB B;  3AG1 C;  5FNV B;  1S5L Z;  2DYR B;  2X6B A;  3JAW B;  4DV0 B;  4F6R B;  3F7V C;  4U7N A;  1NJI W;  4LF5 O;  1OCC B;  2P4V A;  1VQ6 V;  2OT5 A;  1M1K W;  4DK0 A;  3WG7 C;  2EIL B;  4LP8 A;  4ZI7 A;  1OCZ B;  1BL8 A;  2QM7 A;  3ZMU A;  3RYI A;  3KCY A;  2WPD G;  2IH1 C;  3TXQ A;  1NZ6 A;  3BA9 A;  5LMN O;  2Q0O C;  1BE3 H;  1H2K A;  3CCE V;  1EBO A;  5KAI Z;  2EIM B;  4JYB A;  4EKW A;  3I55 V;  1GAX A;  1SC5 B;  5FL7 G;  3FB5 C;  4TSF G;  4PD4 F;  5JJE B;  4PI2 A;  3ZHU A;  1DLB A;  2ZXW B;  4JI7 O;  4KHP O;  2JGD A;  5GTI Z;  3B40 A;  1IUR A;  1YJN V;  3FYI B;  4DR2 O;  2P4K A;  2A7W A;  1SQB H;  1PNM A;  1LUV A;  3T4D A;  2HHH B;  1KKC A;  1YXB A;  5EIB C;  4UUJ C;  4X1Y A;  3JAT B;  1ARO P;  4BAY A;  4GUN A;  1BT8 A;  2BTO A;  1XI1 A;  5EK0 A;  3JAS B;  4Z2W A;  3OT7 A;  1SZX A;  2XAQ A;  4RWU A;  1E1Q G;  1E79 G;  3SJC C;  4IT5 A;  2R9A A;  4JI5 B;  4ZIB A;  5JJN B;  2CK3 G;  3C90 A;  4AQY B;  3AK2 A;  2M6Y A;  1XMQ B;  3ZRX A;  3MAQ A;  1R3J C;  3RN4 A;  4AQY O;  1H2M A;  2VQF O;  3DGE A;  4NXM B;  4DUZ O;  2F66 C;  3RYI B;  3HKC B;  5JH7 B;  4KP4 A;  3AG4 C;  4DR7 O;  2BTQ A;  3CRM A;  4EB6 A;  2CAZ C;  3E89 A;  1N32 O;  2HHH O;  1K4D C;  2NLJ C;  2FKX A;  3SYO A;  1V55 C;  4I4T B;  1FXV A;  1DF5 A;  3OAA G;  3L71 H;  3CB2 A;  3JAM N;  4J10 A;  2R72 A;  5B1A C;  1ZSP A;  4UVC A;  4FLU A;  4UVB A;  4XBF A;  1ZTE A;  2ZR2 A;  3E35 A;  1BS3 A;  1WAZ A;  3A0B Z;  3A0H Z;  4CS4 A;  3LSQ A;  4LR3 A;  2EJ7 A;  3JAK B;  3OMI B;  3RW0 A;  4H33 A;  1KD1 W;  2CTQ A;  5B5E Z;  1AIL A;  3KKY A;  1Q82 W;  5B1A B;  5KX5 A;  3AG7 A;  2UXB O;  2V7Q G;  3UT5 B;  1KYO F;  4B3T O;  1F4N A;  3W7X A;  1XMO O;  3DXR B;  1F23 A;  1K4C C;  1SQP H;  4JAA A;  4GYC B;  4J41 A;  4DV0 O;  2KG7 B;  3U0Z A;  4DV5 O;  4FMT A;  4LF5 B;  1RM1 C;  4W4L A;  1O9G A;  3CRR A;  4YHH B;  4AHC A;  5LA6 B;  3Q4H A;  4P30 A;  1VQ5 V;  4P2Z A;  5B3S C;  3D36 A;  3OFN G;  1JCH A;  1P7B A;  3HR0 A;  2HFE C;  2K9P A;  5KA6 A;  4NB5 A;  1Q81 W;  2Z3Y A;  3EFF K;  5IY5 C;  3RGB A;  1ZL8 A;  2EZO A;  2FL4 A;  1L1F A;  2VRZ A;  3CWB H;  2R9I A;  4X64 B;  1IZ3 A;  1THZ A;  1VF6 C;  3EVK A;  3K5M A;  1HNX B;  1AI6 A;  2UXC B;  2HP8 A;  3OEH G;  1AI4 A;  3B77 A;  3OM3 B;  4B08 A;  4EEQ A;  3PJS K;  2PYJ A;  4DV5 B;  4BWA A;  3CSX A;  1IXM A;  4JTD B;  3SYQ A;  3CJH A;  4JTC B;  4JI1 B;  1K3E A;  1AP5 A;  2ZR3 A;  5E1A C;  5KHG A;  3CMA V;  2ZIO A;  4CH5 A;  1SA0 B;  2WWW A;  4I5S A;  4QE9 A;  4B7E A;  1GN3 A;  3L70 H;  5JQG A;  2ITD C;  2LFR A;  3ICX A;  4JAV A;  4U3J B;  4EFE A;  3SJB C;  4O4L A;  4TUY B;  2F4V B;  1IBL O;  4FFK A;  1Y4M A;  1RP3 B;  2HVK C;  5LOV A;  2Q7G A;  3ABM B;  3A8T A;  3B09 A;  3MHS C;  4JI4 O;  4J9Y B;  2K1E A;  3ZHR A;  3IFX A;  4I0X B;  3I56 V;  1ORQ C;  2ADP A;  1FJG B;  4PA6 A;  3ZRV A;  2BOC C;  4AIL C;  1M56 C;  4RUF A;  2EUL A;  4JV5 B;  2CTP A; 
#chains in the Genus database with same CATH homology
 1L8D A;  4LFC B;  5C8Y A;  1TGO A;  4I50 A;  1QQC A;  1V9P A;  4DR7 B;  5LP6 B;  4B3T B;  4UCR A;  1XHZ A;  3K58 A;  4BW9 A;  5CA1 B;  4YJ2 B;  3DSQ A;  2JVD A;  2Q0A A;  3HKB B;  1N36 B;  1HNW B;  4LH6 A;  4DV2 B;  2F1M A;  5BMV A;  3BAA A;  1WPB A;  1KMI Z;  2V4D A;  1N33 B;  5EZY A;  4F6R A;  4X1I B;  5J2T A;  1P49 A;  3A2F A;  1JMK C;  4UCV A;  2PUS A;  1FFX A;  4X1K B;  4CH4 A;  3WB2 A;  4K8Z A;  4O2A B;  4O4H B;  1O9H A;  4YJ3 A;  5IJ9 B;  2ZM6 B;  4X20 A;  3RYF B;  5JCO C;  2BTQ B;  4U3J A;  2Q7E A;  4FLY A;  1Z5W A;  4NXN B;  4I50 B;  5K1P A;  4K0K B;  3IAY A;  3SR2 C;  1XHX A;  3JSN A;  4FM0 A;  3OTF A;  4IIJ B;  2GV9 A;  3E22 B;  3N2K B;  3RYH A;  4CH3 A;  3JAW A;  5ITZ B;  3JAR B;  4JI3 B;  1JFF A;  4OX9 B;  4DRX A;  3WB0 A;  5C8Y B;  4FLX A;  5IJ0 B;  1Z5V A;  3PN1 A;  1QHT A;  1RSO A;  4IHJ B;  4UCS A;  2Q7H A;  3RYC A;  2YIB A;  3T1Y B;  4GLX A;  4DV7 B;  5CA1 A;  4O4J B;  2ZNJ A;  4FLV A;  3HKB A;  2RJZ A;  3JAS A;  4LNU A;  1N34 B;  5LA6 A;  4DR6 B;  5KHI A;  2VQF B;  3E22 A;  3QF7 A;  4ZI7 B;  1HR0 B;  3JAK A;  4DV6 B;  1HNZ B;  1HW7 A;  5J2T B;  4B3S B;  4I9Q A;  2OYQ A;  3BAB A;  1FFX B;  3BA8 A;  4O2B B;  2UUA B;  5LMU B;  4EFB A;  4B3R B;  4O4H A;  4WBN A;  5EIB D;  4FFB B;  4YJ3 B;  2YXL A;  5IJ9 A;  1XMO B;  1SA0 A;  3M7M X;  3RYF A;  2IM9 A;  3THO A;  2ZIM A;  3ZS8 C;  5IYZ B;  4LF9 B;  4NVP A;  3HKE B;  3RWR D;  2JS5 A;  3K59 A;  4ZOL B;  1VF7 A;  1TUB B;  1TAE A;  5FNV B;  3JAW B;  3HKD A;  3ZED A;  4DV0 B;  1IBL B;  5LYJ A;  4F6R B;  1G6U A;  1JJO A;  4LNU B;  4B3M B;  1I7F A;  4DK0 A;  4D7S A;  4FLT A;  5D5P A;  3VQV A;  1IBM B;  4ZI7 A;  4Q6G A;  3RYI A;  4FM1 A;  2PZS A;  3BA9 A;  2YIA A;  1TA8 A;  5D5Q A;  4DR1 B;  3RYC B;  4WBN B;  1N32 B;  3JAT A;  5EYP A;  5JH7 A;  4DR3 B;  2UXB B;  2PGG A;  5JJE B;  2YIB D;  4CS3 A;  4PI2 A;  2QM4 A;  4ZOL A;  1Q3E A;  4DR4 B;  3HKD B;  1TVK A;  5BR8 B;  4DR2 B;  4GKJ B;  5KHJ A;  4FM2 A;  1IBK B;  3RFR A;  3N2G B;  5JCO A;  1I94 B;  4X62 B;  4KL1 A;  4HBN A;  3U11 A;  3ETQ A;  2YI9 A;  4EB6 B;  5JVD A;  4FLZ A;  4LH7 A;  5CA0 A;  4CS2 A;  5KMG B;  1M4U A;  2HHH B;  5EIB C;  4X1Y A;  3JAT B;  5EYP B;  1Q5O A;  1H2S B;  4TUY A;  1TUB A;  2BTO A;  1XI1 A;  3JAS B;  2HEP A;  4CH6 A;  3UT5 A;  4DUY B;  1S5J A;  4LF8 B;  1X4T A;  3SJC C;  5EZY B;  2R9A A;  4JI4 B;  3BRC A;  4JI5 B;  4ZIB A;  4JI8 B;  4DR5 B;  5JJN B;  4LFA B;  2ZNI A;  4AQY B;  1DGS A;  4D7T A;  1XMQ B;  2UU9 B;  3JAL B;  3MAQ A;  4O2B A;  4UCT A;  5FPO A;  4TQF A;  4NXM B;  2F66 C;  4FFB A;  3RYI B;  5ITZ A;  3K5N A;  3HKC B;  4UFZ A;  5JH7 B;  1J5E B;  5LMN B;  5LP6 A;  2JGU A;  1D5A A;  4X20 B;  5CA0 B;  2BTQ A;  4EB6 A;  2CAZ C;  4YY3 B;  4O2A A;  3VQX A;  4TOI A;  4I4T B;  2ZCE A;  5FNV A;  1XQ8 A;  3K57 A;  3JSL A;  5LYJ B;  4LF7 B;  2EX3 A;  4IIJ A;  4DV3 B;  3CB2 A;  3RYH B;  2R72 A;  4DV4 B;  4JYA B;  4FLU A;  4TV9 B;  2P22 C;  2PYL A;  4CC5 A;  2E3C A;  3FFQ A;  5JVD B;  4CS4 A;  5LOV B;  4LR3 A;  3JAK B;  3HKC A;  4DRX B;  5LXT B;  5KMG A;  4TV8 B;  3SJA C;  4O4I A;  5CB4 B;  4LFB B;  3QG5 A;  2PTM A;  5KX5 A;  2XHB A;  4JI2 B;  4PHZ A;  1WN7 A;  1M5I A;  3UT5 B;  4DV1 B;  4HNA B;  4I55 B;  5JQG B;  3VQY A;  5FPR A;  4GYC B;  5K1X A;  4JI6 B;  3LNN A;  4O4L B;  2UXD B;  3HKE A;  3JAR A;  4ZHQ A;  3U0Z A;  4UCU A;  4LF5 B;  1O9G A;  3U10 A;  1SQF A;  4YHH B;  4AHC A;  5LA6 B;  4TV9 A;  5IJ0 A;  3JAL A;  4JI0 B;  2E5L B;  4IHJ A;  4LF6 B;  4DUZ B;  3B2E E;  4FVM A;  1B04 A;  3WB1 A;  1M93 A;  4I4T A;  3T1H B;  2YI8 A;  5J2U A;  1KU9 A;  5GON A;  4L8J A;  4DK1 A;  2R70 A;  5IYZ A;  4GKK B;  3VQW A;  3RGB A;  4YJ2 A;  3K5L A;  3BPZ A;  2VWJ A;  4X64 B;  4PI0 A;  1NT2 B;  3K5O A;  3K5M A;  2ZIN A;  3QTC A;  1HNX B;  1T5E A;  2UXC B;  4B08 A;  1Q8I A;  4EEQ A;  2PYJ A;  4DV5 B;  4BWA A;  3CSX A;  2OWO A;  4JI7 B;  3BHP A;  5IWA B;  4KHP B;  4UCO A;  2F95 B;  2PY5 A;  3UQ8 A;  4JI1 B;  4TV8 A;  2QJ1 A;  4X1I A;  1XNR B;  4LF4 B;  5KX5 B;  5KHG A;  3N2G A;  2ZIO A;  4CH5 A;  2RQ6 A;  1SA0 B;  1ZAU A;  1WNS A;  2P5O A;  1Q43 A;  3SGI A;  5JQG A;  5GON B;  2UUB B;  4I55 A;  1SKV A;  4X66 B;  3ICX A;  2VQE B;  4U3J B;  4EFE A;  3SJB C;  1YEW A;  2KKW A;  4O4L A;  4TUY B;  1XNQ B;  4FLW A;  2F4V B;  5KHK A;  5BMV B;  1TVK B;  4TQD A;  4X65 B;  5LOV A;  2Q7G A;  4ZHQ B;  3N2K A;  4O4J A;  5LP6 C;  5LXT A;  2UUC B;  4CC6 A;  2F93 B;  4O4I B;  5CB4 A;  3OTO B;  1JFF B;  1FJG B;  5KHH A;  5J2U B;  4X1K A;  4AIL C;  1SQG A;  5JJJ B;  3CHX A;  4K8X A;  4JV5 B;  2VWK A;  4HNA A;  4X1Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...