5B3SB

Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 k)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb
molecule tags Oxidoreductase
total genus 69
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b3sB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b3sB02
4G7QB 2R7EA 4HHGA 5IY5B 3FYIB 1OCOB 4AKOA 4X4KA 1FFTB 2BW4A 1B3IA 1PZAA 3EH4B 5B7FA 1E5ZA 2GC4C 4JHVA 2XUWA 3ZDWA 4QKTA 1ZIAA 5I6LA 4YSOA 1ET8A 2HX7A 3T71A 2BWDA 2Q9OA 1GSKA 3NJLA 3AW5A 4TXVB 3KW8A 5I28A 2P80A 3TA4D 2EIJB 4YSSA 1EHKB 7PCYA 1W8EA 2YEVB 9PCYA 2YQBA 1DZ0A 2LLNA 1MG2C 2FQDA 3NSCA 3WKPA 2VM4A 3ABLB 3OQRA 2A3TA 2HZHA 5B7EA 4DP4X 1SDDB 1PAZA 4G7SB 1OE1A 3NP4A 3CVDA 4KO7A 3UABA 2YAOA 1AG6A 1A4CA 2FT6A 5FC9A 1NWOA 2GC7C 4AKQA 3AG4B 4BK5C 2GI0A 3IN0A 1GR7A 1E65A 1WS7A 2Y1AA 4DP5X 2BZ7A 2YAMA 2YAEA 5PAZA 3ZX1A 3GXUB 3BQVA 2XV3A 4DP2X 2E86A 1NPJA 1TEFA 1W6WA 2OV0A 2VW7A 2ZONA 4BWUA 1L9TA 2IWEA 4UF7C 1HAUA 1J9SA 3FSZA 2XU9A 5LDUA 1CURA 1QLEB 4RH4A 3ABKB 2Q5BA 1NPNA 1EZLA 4DPBX 1JVOA 3WG7B 1AS8A 5D4HA 1QHQA 3C75A 1YLBB 2YARA 3D12B 3GDCA 3T6ZA 3FSWA 1RZPA 1L9OA 2IDQA 3AG1B 6PCYA 1ZV2A 1L9SA 4N8UA 1L9QA 1JXGA 1L9PA 1ILUA 2VSKB 1NTDA 5B1JC 1WA2X 2X88A 3S8FB 1FWXA 4DPAX 2PPAA 5F7BA 2YAHA 4HHWA 4NERA 4UANA 2I7OA 3OMIB 1CC3A 1PZBA 4FAAB 4YL4A 1AG0A 4BDVA 2GIMA 3S3BB 3T6XA 2EINB 1J9RA 3H4HA 5TK2A 4KO6A 4YSPA 1HAWA 3SBQA 1KDIA 4K9JA 4A68A 4E9YA 2BP8B 1JVLA 2PP9A 2DY2A 4KO9A 1NICA 3IBOA 4YSTA 3QJQB 4G7RB 3S8GB 2PPDA 2FT8A 4GY4A 4YSUA 2HRHA 3PAVA 3UGEA 4JKNA 2IDUA 3UACA 1XB3A 2W88A 3S3CB 1MG3C 1UATA 1PY0A 1BXUA 1WA0X 4YSDA 5I5IA 1V10A 5AZUA 4AX3A 3PLYA 3OM3B 4WKXA 1RZQA 3NJIA 3PAUA 3EF4A 2P80D 3PAZA 1A8ZA 3FSVA 2XWZA 3FSAA 4JHUA 4E9QA 1OCZB 2MTAA 1TEGA 4WTQA 2UXGA 1NDTA 4A2DA 2VW4A 5E9NA 3OMNB 2DYSB 4Q89A 2UXVA 3IN2A 1XB6A 1OE3A 3NSFA 5B1KA 2PCYA 2FJSA 1GS8A 1SJMA 1SNRA 2XYBA 1GYCA 3DIVA 1BQKA 1ZDSA 1URIA 1SHXA 3S3DB 1PLBA 4A66A 2NRDA 1ASQA 5I26A 1MDAA 1A65A 1JZEA 1KCWA 1AZNA 3FU9A 3SQRA 2PPFA 1SDDA 1PCSA 2H3XC 3CDZB 1J5CA 1HFUA 1V55B 3CVCA 2I7SA 5EHFA 1ETJA 1JXFA 3V9CA 1XB8A 4HIPA 3TASA 2OJ1A 2GB2A 1NIDA 1W6LA 3HB3B 6PAZA 1GS7A 4DPCX 3FPYA 4DP0X 3ASOB 1M9WA 4GP4B 3ABGA 3FT0A 4P5RA 2JKWA 2BW5A 4HAKA 1FA4A 1IKOP 1BQRA 1PLCA 2GSMB 1NINA 4YSAA 3EH5B 2FQFA 1AACA 1KDJA 4KOCA 4A2GA 3QJSB 3PXLA 1AS7A 1T5KA 3FU7B 2PP8A 3FYEB 3UADA 4BXVA 2OCCB 3X1FA 3AG2B 4W9ZA 1X9RA 4F7KA 4FA7B 1OF0A 5I6OA 3EHBB 5A7EA 2XXGA 1BXAA 3PPSA 2TSAA 4BWWA 4E9WA 2WO2B 2PPCA 3ZBMA 4G71B 1MZYA 1JOIA 1WA1X 1AR1B 4DP8X 5ANHA 4E9XA 2JFCA 1GY2A 2PLTA 2XLLA 3NYKA 3NT0A 4CSPA 7PAZA 3QJRB 4KO5A 1DYZA 1IBYA 2HX9A 3FQ1A 1N68A 2WO3B 4G70B 1AZUA 4AI7A 4DP7X 3X1BA 1A4BA 1BXVA 4HCFA 3RYMA 4HCIA 1J9QA 1V54B 2CAKA 3QPKA 1KCBA 2QDVA 3SBPA 3AY2A 1M56B 1A3ZA 1GS6X 1AZCA 1BEXA 1PNDA 2CUAA 1ZPUA 2MRYA 4YVNA 3WKQA 1OCCB 2DWTA 2VM3A 3X1NA 1KYAA 5F7AA 2BP8A 4ENZA 5I6PA 3NP3A 4AKPA 2CJ3A 2XV0A 1RCYA 3V9EA 4A2EA 1IBZA 1PZCA 4HALA 3ASNB 1NIAA 4DP9X 2ZWNA 4ZK8A 1ZDQA 4BWTA 4F2FA 2UX6A 2FQGA 2CALA 3QQXA 3QJUB 4KOBA 2BP0B 1CUOA 3IE9A 2IAAC 1ASPA 4DP6X 2XV2A 1ID2A 3DKHA 4HZ1A 1PF3A 3X2QB 3H56A 3TU6A 1SF5A 1AZRA 2I85A 4A67A 2Y69B 1CYWA 1MZZA 3NJFA 1BYOA 4L0PB 1OE2A 1NZRA 3NJNA 4Q8BA 2CCWA 1SFDA 1J9TA 3MX0B 3GYRA 2J56A 2QT6A 1JZIA 4KNTA 1E30A 4KNUA 1NIFA 2YAPA 3NJGA 3X1GA 1VLXA 2VSMB 2W8CA 1F56A 1X9UA 2YAFA 2H47C 1KV7A 1PNCA 1TU2A 3T6VA 1NWPA 2FTAA 5I5MA 1E5YA 2YAQA 2R7EB 3U25A 1KGYE 1RKRA 2AANA 1JZJA 2IWKA 5B1BB 1GY1A 2EILB 1WS8A 4YSRA 4GP5B 2IH9A 3KW7A 3CDZA 4A2FA 4N4YB 1ILSA 1JXDA 3NSYA 3WNIA 2WSDA 1CYXA 2QPEB 1AZBA 3NJJA 1N70A 1PLAA 3EH3B 1XMEB 2DWSA 2HRGA 2HX8A 2FQEA 3N55A 4W1TA 1AANA 1JZHA 3G5WA 4YVUA 2JXMA 3FPXA 1ET7A 3WNJA 2IH8A 3H4FA 2B3IA 2FWLB 3FU7A 4M3HA 4EF3A 5I6KA 1J5DA 2J5WA 5TK4A 1JZFA 4HCGA 4PCYA 4MFHA 2VW6A 2GBAA 3FQYA 1WAEA 3NJKA 5B1JA 5I6MA 2DYRB 2BHFA 2BO0A 2XX1A 2XVBA 1IC0A 2TSBA 4E9TA 1AS6A 5B1AB 1QNIA 1ASOA 3JT2A 2UXTA 3CG8A 2EIMB 8PAZA 2GHZA 2QPDB 3N2JA 5B3SB 3OMAB 1JZGA 1KBVA 1NIBA 1SFHA 1I53A 3UAAA 3IEAA 3ABMB 4GP8B 2IDSA 2J55A 1PMYA 3WI9A 4YSCA 4PAZA 3TBBA 1OOWA 3FU8A 3UAEA 1OCRB 3SBRA 1BQ5A 1JERA 3MBWB 3L45A 1TKWA 2IWFA 1L9RA 4NB7A 5PCYA 1AAJA 5AFAA 2AFNA 2DV6A 1KBWA 3T6WA 4AZUA 2ZOOA 4GXFA 2IDTA 2PPEA 3PCYA 3DTUB 4UAHA 3WIAA 3T9WA 4CSZA 1BAWA 1BYPA 2HXAA 4KNSA 2IDFA 3ZIYA 1AQ8A 1E67A 2UX7A 3AZUA 4A2HA 4YSEA 2AZAA 2EIKB 3CVBA 1GW0A 2YXVA 4G72B 5I6NA 1ET5A 5B7MA 2XX0A 3BVDB 3CZUB 2ZXWB 2AZUA 3JTBA 4E9RA 5D4IA 4E9VA 2N0MA 1M57B 2XXFA 5D4JA 1SHWA 4QLWA 2PCFA 3TBCA 2H5UA 3FQ2A 2VN3A 2X87A 1IUZA 3NJHA 1AOZA 1ADWA 2BP0A 3FS9A 4BDVB 4P5SA 1NIEA 4BXSV 2BWIA 2J57A 2VMJA 3QJTB 2AVFA 4E9SA 4GYBA 2PP7A 3QJVB 2RACA 3NJMA 2B08A 3X1EA 2FNWA 1R1CA 4NAJA 1OV8A 1ZIBA 2BZCA 1SF3A 4DP1X 4M4RB 3HEIB 5I5JA 2FT7A 1AIZA 1A4AA 3NSDA 2UXFA 3AG3B 2YXWA 3ERXA 2HLEB 2CBPA 4F2EA 4YSQA 3OD3A 2QDWA 5AKRA
chains in the Genus database with same CATH superfamily
5I73C 1BAGA 1MLCA 4J12A 1DLHB 4Y2NA 2EADA 2VLRA 1AY1H 3ML0A 1Z9SB 2CH8A 1GMEA 3IDGB 3PP4L 4LRIC 3EYVA 4AKOA 1ETB1 5BJTB 1V9PA 5DMGC 3TS8A 4JFDE 1XQ8A 2AEIT 4XPHH 4NM8L 4BKLA 1NBZB 2Q7YB 4P2RA 2P42B 1IQDA 2YA1A 4XR8C 5I6LA 1CGTA 2Q9OA 3C8KB 3NJLA 1UZ8A 5HYQA 5K9KB 3UPAA 2BIPA 3KLHC 3FN9A 2F54A 3RVUD 3TA4D 1WF5A 4P9HL 4K2UL 3AS3A 3UIYA 2GIYA 1W8EA 3M7MX 1AR1D 2GBUA 3LQMA 2F61A 4KHTL 1OCZC 2NUTB 2N59A 3QUMH 3TA3C 1KKCA 1DLFL 5HGDA 4F27A 3WKPA 5DUPL 4GRMA 2VM4A 4GUCA 4X4MA 3QWQB 5AAMC 2AGJL 43CAB 3FU0A 5I76A 3VXMA 1F90L 3V0EA 4N90D 5ICYB 3RDTB 3F5WC 4JB9H 1WZMA 4OGQB 2GJJA 4Y2LA 1XCQB 2WXRA 3JBG7 1B4LA 3TV3L 2PR4H 4L9DA 4JI1O 4L8CB 5HYJA 4CH6A 2H45A 3T2MA 4TT3G 3U4EB 3UO1H 2OX5A 3ASWA 4Y4KA 1NUNB 3GMNB 4YJ2B 4S2SA 5JXED 1TEFA 3UL4A 1MRDH 1R5IA 5IGXH 3E2HB 3TYFA 4OIBA 1FIGH 4JI0O 3O41A 1J9SA 3BDYH 1ZAGA 3LV3A 5DEFA 4MVRA 2XQYG 1W0YT 2A9AA 2BINA 3OZLA 3TT1L 1PQZB 2Y24A 4HISA 4NXSA 5KYXA 4UCVA 1FNEB 3BVNA 3CGTA 1A2YA 4HEMA 4WF7A 1XTLA 2MMXA 2XKNA 3QFJB 5D9SA 4IMKC 3W56A 2P48B 4NOFA 4UT7H 1WP8A 1UCBL 4Y7OC 4GW5A 3ZHFA 2A2QT 3C08H 1U8CB 2DEWX 3NZ8B 2E75B 5EUOE 3NZUA 5LCVL 4CGUB 2NW2B 2X1PA 1DBJL 4YDMA 3FSWA 5E1AB 4A39A 3HG4A 1KP2A 3BDXA 5DHYB 2ZCHH 1T1WB 1IM3D 1JWUB 3KYMB 5KYWA 4HLZG 4KXZI 3WL9A 4HFWA 3FT4A 3OR6A 4Z2WA 2Y2YA 4Q97A 4GUQA 4PG2C 1RUAH 2AXHA 2Q3ZA 3NABH 4MMXB 3D25A 3CXHJ 4FDWA 4B9ZA 2I7OA 4X6EB 1CC3A 3FN0H 4YL4A 1JGUH 3IDJB 3VFSB 1LEKA 3RWIB 3W5MA 1G0DA 3HZVA 3UTSB 4UINH 1KFAL 2R9IA 4IW4C 5F89A 3C6LB 3UP1A 3QRFM 1J48A 5DUBA 1GGBH 2PO6D 2YKLL 3K72B 1H6UA 2JS5A 4AE1A 4MZIA 4YJZL 3QW9A 3X12A 1NAMH 4OGYH 1NBVH 2QGEA 5FOJA 3HIZA 4IDJL 5GRYA 5I30H 2DQ3A 2CRIA 3S36L 2BRRL 3ARGA 4NKDB 4JKNA 1JZDC 3WY2A 3K04A 3QQ9D 4NQSA 2FO8A 2NY1C 5CJOL 4YDVA 5KSAB 4M4RA 2BNQA 4BRVA 4LZKA 2AJSL 4DUWA 2YIDA 1AOHA 1HSAA 4V1DD 5F44A 5BVPH 1OCCC 2RMNA 3QDJA 1JDCA 1S7UB 1HH6A 1AXTH 5KX5A 1A1MB 1XH3B 3PL6B 1X5AA 5J12B 1NCJA 4XN9A 3NJIA 5C92A 3OTOO 1YYLH 3PXHA 5JPNB 3FOMA 4DGUA 3DJ9A 2BVQA 2IH1A 4UB0L 3I6KA 2BFVH 4K7PH 1JGIA 3CH1B 5KBMA 4U1KA 5CJXA 2NY3C 3ASNC 3IFPA 1SMAA 2VDNH 5EZLA 5C71A 1UHVA 1OV9A 1ZRUA 1J0JA 2ZX6A 3DJRA 5JW3H 2FLBT 3C5ZC 3TN0B 3K0WA 3RWHA 2H0PA 1XB6A 2Z4QB 3GRWL 43C9A 4KV5F 4R26H 1SJMA 1SNRA 3S3DB 2A9NH 5KVFL 3JD2A 1T1YB 5EPMA 5ID0B 4FG6C 3KPNB 1L0LH 5DRXA 1R3KA 1T5WA 3GMLB 2ICWJ 3RFRA 4LARL 4LPTA 2HT3C 4IJTA 1JZEA 4XP1L 5FAAA 3GZOA 4FJ6A 5I1CL 1LHZA 4ACTA 1PS3A 5EBWB 4CL7A 2B5IC 1ZHNB 4PJAB 2O6DA 2OTUA 1PCSA 2VN6A 4EUPA 4NO0B 2HRLA 1WK0A 4H1LH 32C2A 4PSRA 5MENB 2E59A 3GKZA 2BCKB 2HKFL 4LP4A 1TVHA 4FKHA 3AADB 2Y7QA 5LNDA 1HNWO 3PV6A 3ASOB 3AMLA 2LAAA 3LRGA 3BUTA 4PJAE 2NTSP 3QWRA 4RGNB 2N74A 5DMKB 5F9WC 4OCWH 4KXZH 3FH7A 5DFWH 3RY6C 1G7MB 3GSQB 3QO5A 3FQXA 2FX7L 4H8VA 4PRHA 4BZ2H 2CRZA 5C7XH 4H25A 2E27H 1NS1A 1EO8H 4AGPA 3L6FB 3ZN6A 1O7VA 3WEAA 4OSUH 4ODTH 2CLZA 4ATWA 5JIKA 1L7IH 2O5YL 3VXSA 3EVKA 1NA8A 4F33A 3IFNL 4IJ3B 4RGNE 2KPNA 4ERSL 5ECJE 1HXYB 2PTUA 1SEBB 2DQDL 3ECQA 3RYCA 2XWBB 5GS0D 5IHLB 4ORZC 1EIBA 1KXTA 3S3JA 4AH2A 4F58H 3IPEA 1CL7I 3HC2A 1QLFA 3QJRB 1TQVA 2GEEA 2EEAA 2HRPL 3FN3A 2WZPA 4WWNA 4YHHB 3MO1B 2W9LA 1QO3B 2WO3B 3DK0A 4MHHI 3ZJAA 3P4NB 4KROC 4DP7X 1MJUH 2XTAA 5I16A 4ZOEA 3L4XA 1OPOA 3ZY7A 3NZSA 2XWJB 5HGAA 4HV8A 4F3FB 1PEZA 5E6YA 4EOWH 4OJAA 3C09B 1MCSA 4ODUA 4FJCC 1BEXA 5GHWH 4WFHD 1PD6A 2ZUYA 4XPAH 1AMYA 4CW1A 4LEOA 4P99A 1GMGA 1ORSB 3P3YA 2UUDH 2VRAA 4JREC 4RSVA 1HDJA 4AL8L 3K59A 2JQMA 3B7TA 3ORJA 2JGDA 4E0RB 1RFYA 3V9EA 2NXZD 3MV9B 4HALA 4PY8J 4DJMA 3RU8L 4LRIA 1JXKA 3O6FA 2W6IG 1Z9NA 3F7YC 2D73A 1JVMA 2X4NB 1BMZA 2VXSL 3WXVL 4F9PC 1HCZA 1JRHL 1F4MA 2H94A 4ZI7B 2GUOB 3NAAH 4NKOB 3VNYA 5J11B 2JJTC 2Y5QA 4JO2L 4U0QB 4FX5A 2BNRD 4JKWA 4OLZL 5LWYL 1CUOA 9CGTA 4L3ED 3E8HA 1FO0A 5GGRY 4FFZL 2ESVA 2ZUQB 3HS0C 2UUCO 2JIXA 1KIUB 4WQOA 5C0JB 5D1QA 2WWKO 3ESNA 3EFDL 3ZE1B 5K39A 3MV9E 1M71A 3ZKXC 1MZZA 5CM1A 3LRHA 3BA8A 1YG9A 3OHXA 3ZRFC 5MEQB 5ITZB 1FNHA 1AJPA 5AAMA 1LK3L 2VR4A 3PWVB 3VSUA 5JHDE 1HH9B 1BMFG 4YHMH 2V3EA 5G4NA 5C7ZA 3B2VL 3LVEA 4L1TA 2E9WA 3KYNA 1J1XH 2F7PA 2MQCA 1PZDA 1HZKA 3F5WA 1E4JA 2YRZA 4NSKA 5JLZB 2VL5B 3HPJA 2VMDA 1GJIA 4L4VB 5LBSH 4OCSH 2QKIA 3DC0A 5DHVA 3V8CA 3INUL 4J10A 3ETTA 3MRLB 4HGWA 2EZOA 1B0GA 4BFJA 2WK2A 4HIHA 3TCUA 3ARBB 2E46A 1FL5A 3HI6L 4GKSB 1MCIA 1EHAA 4AENB 1FNLA 4FNQA 4M1GH 2KQXA 1XNQB 1B6DA 5KLVH 1DL7H 3PGDA 1NCIA 2NUPB 2AJZB 2AQRA 5EIVA 1MSWD 1VF5B 3BFRA 3PREA 4OLWH 3VMOA 2APVA 4NIKB 4L4VE 3O2WL 4NHUB 1BBDH 1KBBA 4P9OA 1QKZH 4TUOB 4WKZB 5IROD 3DGDA 3IDXL 1CGSH 1XAUA 2HJFA 3O3DA 4WHYG 3P77A 3H0TA 3MTRA 1H19A 2Q7EA 1RM1C 1R6KA 1KB3A 4IMKA 4BHUA 4JG5A 1AGFB 3T4AC 3HAEH 4A38A 1K6QH 1QOKA 5MHSD 2NSMA 3MV7E 4K3DH 4LVHC 3MV8B 3HPLC 1A4KB 1J5DA 2D0GA 4HT1L 4PCYA 2XZQL 2WXQA 2Y7SA 1YXBA 5B8CB 3VD3A 1YC7A 4I87A 1QEXA 5HHOD 5CEZH 4PG2A 4PJ8C 4S1SL 5CEXB 3BCFA 4JFZH 1EXHA 3TEWA 2XWDA 1F18A 4LCUB 3JT2A 2UXTA 5FKPA 5L2KD 3S48A 5BRZD 4YMPA 1XO8A 2QHRH 3KCPA 5E23A 4YDKH 4NO3B 2OSWA 3OMAB 2ZSVB 3MV8E 4HKXB 1SQQH 2AJYH 3IEAA 2RNBA 4L1LA 4XPFH 2WP3O 4PJHA 2FL4A 4XNAA 1SZTA 3SDDC 5DHXB 3HC3H 1XD0A 3CFKA 1HJCA 1MHHB 1MHPL 4GX0A 1PYWB 3KJ4C 3OHMB 5GTHZ 8FABB 3ES6B 4WI8A 1JCHA 4U2YA 1NLDH 3OZKA 1E9PA 4KJQD 3HB3C 4JN2B 4OQTL 5LN8A 4Z7OB 3BDBA 1TJHL 3VQYA 1UT2A 2PPEA 3B5HA 5EZIH 1JFFA 3TTSA 3GI9H 1BAWA 4MXQC 2WOYA 2Y06L 3GHPA 4KNSA 3QAZC 4MCZB 2GY5A 35C8H 2VXQL 4XE0A 3P3SA 1BFOB 2LHAA 3QHFH 4FXGA 3I75A 2QPSA 2YXVA 3SDXB 2ZE8A 4X4ZA 1G7HB 1BLNA 4OCYH 3BUIA 3NVQA 5DD6B 1KULA 1FGVL 1KTLB 3AAZB 3DPBA 4JZOB 1AI4A 4M56A 4DZBA 1KUMA 3MZGB 3VD0A 2BLFA 1PZUB 5JNYA 3U0PB 1YSCA 3OFNG 4LFHG 1Q86W 3CXHK 4CA4A 2DD8L 5KOMC 1NAKH 3HE6B 2CO7B 3H9SA 3MLUL 1HN1A 4TWKA 1UCTA 2Z92B 3LD8C 3C5ZA 4KRMB 1R6TA 4DUXA 3L9EA 5DFAA 4U6VH 6FABL 5CMAB 4NUJB 3SDXE 4YFEA 1XZ0A 2DQJH 4BXSV 2GAZA 3IDMA 4GO6B 2QKCA 2OSLA 4PJ5B 2DIBA 4DEWA 4JAVA 1Y4MA 5IB3B 1E2VA 3P3PA 4L8DB 3BIBX 4OF5A 1IGJA 1TPXB 5FUOL 3VG9B 4EAEA 1THAA 2ENSA 1HWWA 4Z7VB 1MNNA 1E27A 3L1GA 2B39A 2G5RA 4ISVA 4NZDA 2BZCA 3MR9A 3GBLA 1JF6A 1N0XH 3WKMH 5CBEA 3EG9A 1EZVH 5JW4N 1RIHH 4B7LA 2R69H 5BXFB 4BW5A 5DUMH 2Q67A 3DUUB 4JM2B 2CIKA 5D1ZB 4KX9A 4PJFF 1BD2B 1IZJA 2ID5A 2OIEA 5GRXG 5HHQB 4LOVA 2ARJB 1Y18B 1U8KA 1ZT1A 3MCG1 4OH2A 5F7LB 2NY5H 3H1LH 4ZUSB 5JHDB 3L7EB 3W9EA 2FH6A 2ITDB 1XBRA 4IKIA 1Q8MA 1YMMB 2GC4C 4R4BB 3RY6A 3ZQXA 1QTSA 1ZK5A 5JZ7D 3EXLA 2YS8A 4HWZB 5DJYA 1GZQB 1R4XA 3E0GA 3CIQA 5FOBA 2D7MA 1BQHA 2D2CC 1BD2E 4LOUC 3GS0A 1A9EB 3DC6A 1MW1A 5GGSB 2XWXA 4OJYA 1BCCH 3BPLB 2VLRE 2AXWA 3A4AA 4HC1A 4AGQA 4GI6A 4Z7AA 3K0GA 3I6LD 4KV5E 3TO4B 2A3TA 5FW6A 2DQCL 3UEZA 1YMME 4K0KO 1QBML 1OE1A 5FW7A 5GGTH 4PJ9D 4CVZA 1T0MB 4GKKB 4JI8O 4XMXA 4UQ9A 2DTML 5CBGA 4XN1A 3HBQA 4X7FC 4XWOC 4AKQA 2QFRA 5KVGE 1C5CH 2NY2D 2F54E 4RFNB 3ZLQC 3GRBA 1CK0H 4BYHA 1XGPB 2VIRA 1DR9A 4LBEA 1WWAX 3OGCB 4RIRA 4MTMA 3SKOA 4DEPB 1NFDB 3H9HB 4MNQB 4WNQB 4ZTPH 1OO2A 1OM3H 1HJBC 1KJ2H 5F93C 3VXME 4ESKA 1BPVA 3U4BL 5AW1B 2YD5A 1E9OB 5I1IH 1HQ4B 5JQ6L 1NGZB 4OD3H 4RH4A 4GCZA 2I26N 4PJHF 1JD9A 2IGTA 1K9MW 3FT3B 1Q94A 3SYQA 2FIKB 1DBBL 4KZEL 4JFOA 5HYJE 3LQAH 4XHJC 2IJJA 3F7YA 4KAQL 3HMXL 5DZNA 1MCQA 4LCCB 4MNQE 1B4JH 4G6ML 3RKDD 2BVOB 2ZE7A 2CU9A 2JJTA 2YA0A 3C60D 5CJQL 3QFDB 2N05A 3P30H 2WO4A 2WN3A 1LUVA 2DOCA 3ZRXA 3FB5A 3HS0A 4QXWA 3O4LB 1T0NB 2X88A 5J2TA 1C8QA 4OV6F 1ORQC 1LO4L 1T0OA 4ZPTB 5EIIA 3F7PC 3W7SA 1TJIH 4HEME 5F7BA 2GSIB 1UJ3A 2EDBA 1L5GB 2Q76A 3D05A 4GSUA 2XTJB 1CS6A 4P2OC 1DFBH 1FHGA 1VFMA 1GK9A 3VGFA 3GBML 3OKMB 3KHOA 1YY9C 5J5EA 4ONHA 2EDYA 3U2SB 2ZP0T 2YD1A 3MCKA 3L1OL 4TN9A 4AQAB 3ZO0A 1OCRC 2B8OT 3OB8A 4HWBL 4G8GB 3O4LE 1XF1A 2DY2A 4B0MM 4O00A 4F24A 2DQ0A 3EJYC 4LLWA 3L54A 3BH9B 3O2VL 2AJUH 3TBWA 2Z1PA 4I2XB 1FN4B 2XTJE 3P73A 5B4MD 2WXJA 1NDGB 3MAWA 4WW1B 4Q6KA 1WB8A 4MS2A 2VJXA 3VX0A 2IBZH 3H9VA 1KJMA 1MCFA 1PY0A 4UCUA 4PGEA 3J2PA 4KITB 2IJHA 5IB2A 3F7RA 3L5WA 4M8VA 1FVCB 2Q7AA 3N9GH 4FMVA 3SPJA 4JFEA 4TV8A 2C2AA 3APNA 4WKXA 4Z78A 4XN8A 4RMUA 2HJKA 3BUYB 1R3IH 4HHAA 3U9PH 4H8WC 2KI6A 5HD8C 4LB8A 2YRPA 5DC9B 3TJHD 4MTXA 3OC8A 5F9AC 3W2DL 3W11D 4HWEL 1SQ2N 2UZPA 2Z7YA 4R0LC 4YXKH 2LGNA 2MTAA 1ETZB 1QVOB 4IOIA 4EXKA 5J9PB 1WC7B 5E8PB 5EOQH 3LNGA 1OARL 1N5AB 5IMMA 3QS2A 2ZCZA 3ARWA 4IKJA 1QRND 4FABH 3JASA 1S9XA 4XC3L 1MCJA 5EU7C 4DR6B 4DHLA 2FECL 3WE6A 1CGUA 5M94B 4JI6B 1KC5L 4TSFG 4JW3A 5ISZD 4OTXL 1G6UA 3BWUC 1ZDSA 4PJ8A 4FLTA 2XTSA 4R7DA 3DECA 2GJ6B 3UC0L 3RX8A 1PPJH 4PHXA 3S88H 1NEZA 3A0BZ 2X6UA 2DQEL 1DVSA 4KXDA 2VLKA 4WTWA 3T4YA 4Z3HA 5I1EL 4KP4A 1K97A 3G5YA 5D1XD 1MLBB 2VN7A 5CINH 4LF5B 1KCUH 2BC4A 5CSBA 3CBKB 2OJZH 2N7BA 1BFSA 4UCFA 1RUQL 3SDDA 1D5IH 3QIBB 3AU0A 4YGVB 2OQJA 2Q4PA 2J88L 5IYCO 4NP4L 3W7TA 4K3EL 1IL1A 5DD5H 5DQ9B 5DLML 3KPMB 3VWJB 4FG2A 2D31B 1RFDL 1MH5A 2NDFA 6PAZA 4KWUA 4DP0X 1GTNA 2MCG1 4P5RA 1BZ9B 4IHJB 5CHNB 4RNRB 4E68A 3CEIA 2CTRA 1O9HA 3SYPA 5IT2L 3EJQA 3QC5X 5KVEH 3MUZ1 4WFBV 3BIAX 3FYEB 1NDMA 4L1SA 4N2HA 3KHQA 4O2CB 3ROOB 4HMDA 2N7AA 3Q4HA 5GRWA 4JZNA 1HZHL 1A7NH 3IT8D 1TEYA 4PTTB 4RDQF 5EH1A 3RWGA 5AVVB 4BW9A 5DJ0B 1N0NA 1TVKB 2YD3A 3ECWA 4S0TD 3RA7H 1V7ML 4OZHA 1E28A 2CH7B 1FFRA 1K4DB 2XXGA 1NCDH 2VITA 2QTSA 3QULB 1M53A 3F62A 4N3UA 4HJJH 2K8QA 3HR0A 4FRWA 2VDKH 1A64A 4JDEB 4P4KB 1I75A 5T1MB 1J5IA 3H54A 4X20B 1AXSB 4JJ5B 4KK9D 3L13A 2R0LL 3LN4B 4OD2B 3UMTA 4WU5A 3EKCA 1A6TB 4I48B 3HZKB 2B0SH 3ELQA 3NYKA 1NGYB 4J6RH 4LDLB 1HVXA 2CGOA 1AE6H 1KTBA 1M7IA 1P9MC 3MRMB 4Z18A 1I94O 3FQ1A 3J7AU 1T22B 3DX7B 1CN4A 3VXSE 5AEAA 1ED3A 4KBPA 4YBLB 3TFKD 3ARZA 1GCYA 2LABA 2R83A 5TPWH 2GTWB 1DEEB 4EI5C 7CGTA 1YEHH 3ZN0A 3EYQD 4JDTH 1CD1A 3GSWA 2WQRA 3SSGA 4PRDB 1AZCA 4JTDB 5J06A 1W59A 3PDOB 1F0LA 1NC2D 2DWTA 2VM3A 1QU7A 2G60H 5I18L 5D7IB 5I6PA 2LFEA 5GGQH 5GRVK 2YPVA 3VXRA 2ZXBA 4NKMB 5H2BA 2BVYA 2HT2D 4I77L 4RUEA 4O2EA 5GGUA 4MA8H 4C83A 5JMRA 2VZ3A 3TJEH 5GRUL 3X3FH 5DI8B 1SLVA 2COQA 4DZ8A 2RCSH 1GC1C 3NN8A 5IJKA 4BCXA 4OVVA 3FB7A 3FO2A 3QNEA 1R24A 1XH0A 1W2BU 2F8OA 2R1YA 3MUGA 4KK6C 4XO5A 3UAFA 4NKIL 1N8ZA 1OTUD 2OMWB 1S9VB 2ZXDA 3OC5A 4NQXA 5KSUB 1AQDB 2BSTB 4UDTA 1A5FH 2XQYA 5D7IE 4XPTL 3HLAA 3QEQA 5FM5M 2CXKA 2Z64C 4WBNB 2RD0A 2WKLA 5GONB 2GV9A 2ZXWC 1JPTH 1MWAL 5C08E 3OR7B 3W9DB 1V7NL 1R73A 5BJTA 3TA3B 4RGMC 2E7HA 5ENWA 1S7RB 4DETA 4LWSA 4E36A 1X5XA 1IBKO 4G7YH 2J56A 1CXFA 5AKTA 1Y07A 3OX8B 1UFGA 5IBLC 3MYZA 4DGVH 3FJTA 3OB0H 3TBVB 3TXAA 3NGBB 3CB2A 4NC0B 3ZOAA 2YAFA 1GKEA 1MFAL 4DNLA 2X2YA 2O72A 5AG2A 4UVAA 3E1ZA 1Z2KA 3IETA 5KJRL 2R7EB 3VQXA 1LO5B 1Z1WA 3A6BH 4QEGA 3HI5L 2DDQL 1BZOA 2IWKA 3O2DA 5AL0A 1WS8A 2MWCA 4L1BA 5F7EL 3K0DA 1EGJH 1T7ZA 5IESH 2X0VA 4NZRH 4WIQA 1SQPH 3UAJA 4XP9H 1KBHA 4PJFE 1P4BL 3NJJA 4NWUH 1XCQA 3QJFB 3CS5A 4GX2A 1PLAA 4QHPA 4BAYA 2D3NA 5I1LB 4P5KA 4QRQA 1FYHB 1ND0A 1JFQH 4PJGF 2J44A 2DWEC 1U3ZA 2E7DA 4CU7A 1NGQH 3W39A 4QKXB 1KD1W 4X80H 4W9KC 4KQ4H 5F0MB 3OGIB 1AMXA 4ODVL 3AGWA 4K3AA 3L7FB 5SX5K 4TNFA 4EF3A 1UT1A 1E8WA 3B3IA 1KLUB 3IAQA 3OGOE 3RT3C 2RALA 3QDMB 5GS3A 2XN9B 4JR9L 4NQCB 4LLDA 4LCYA 2WBJA 2UZYB 4AXWA 3BAIA 1FG2B 5TE4H 2AV7A 2CLRA 3WB0A 5IYZB 4P9PA 1ORQA 4YBQC 1I7UB 1RZIA 3LZFL 4FOMA 3IJSB 4H5SA 4NQEA 4U6XB 2IGLA 4G7VL 1HINH 1QAWA 2E9BA 4P2OA 3K9AA 4HUMB 4OZHF 4PWKA 2IPTL 1QLNA 3ZDYF 1I53A 4WEBL 3BPNC 4DR5O 2Z91B 4NPJA 5JHLL 3KBFA 1MWAB 4OGXH 3QDME 2XN9E 4NQCE 1KBGH 3FU8A 4FLYA 3HKCA 2DW4A 3CZEA 5C0AB 4X64B 3SBRA 5HYEA 4DAGL 5IVXB 4G6FB 3SDCC 5CEZD 3ARDC 2JI3A 3DK2A 4XNZC 4WHDA 5FFOA 5DJCB 4WGWB 3OKEB 3WEXB 1CBVL 2ERJC 3ZYZA 3ZT6A 3QO0A 4I9WD 4N2CA 5C3IA 5AB0A 3JTTB 4L8JA 3CN3A 1PX8A 4IHOB 2YD8A 1EFRG 4Q6IC 4ZTOH 2Z35B 1GSMA 1WCBB 3AZUA 1IM9A 2P9RA 3IMBA 4D7BA 3WIHH 4PRPD 2BMKB 4PJHE 1AH1A 2ZINA 1KXQE 4K7FB 2NYYC 4U1GB 1NH2B 5B7MA 2LQTA 1JPST 1DN0B 4QTFA 1GW6A 4G6AC 1FC2D 3ABKC 5HBBA 1PKOA 5D4IA 3G9AB 5D4JA 3TURA 4YDJA 3LTVA 4R0LA 4J1UA 4P4RA 4MS8C 3LPGA 3SE6A 5L6YL 3TWCL 1ECZA 3O9WB 3OZ9L 2X4TB 5I0WA 2IQ9L 2W0FB 3AWEA 1UACL 3L1FA 1EAQA 4FFKA 3KWVA 4TNGA 1RSOB 3DTXB 3M7FB 3T0AA 1W16A 1FAKT 3EGDA 5T1LA 2EO7A 4NLHA 3ZN1A 5C0RL 3N2GA 1RZKC 1E3XA 2RACA 4W9DC 3O6LH 3U36A 1NBCA 5D8JL 4XO3A 1RK0B 1SEQH 2B5IB 5I8KL 3H9SE 5LUMA 5DD1L 1N64L 4R5TA 4AMXA 2IEPA 4N2OA 3HE7A 3VBBA 1MCBA 3BO8A 4JI7O 4U6TA 3OL2A 1H2GA 4OIFA 5ANMB 4TOYH 5B22A 3V2AR 1IBMO 3GUTB 1T89A 5GZOD 1IX2A 5DJDB 4JHAH 3L17A 3WAKA 5J6SA 4Y5YB 3LDEA 5DD3L 2W60A 5L2JA 5JR1H 1BQLH 2N0KA 4RMRA 5LL6Y 3GSNH 1A7RL 1QWNA 1HDMB 4ZOLB 1SC5B 4JM4L 1UQSB 3LB6C 1NCBL 2DLTA 3L3GA 4G8EB 2F93B 2AQ3A 1K5NA 4XCCH 3AT0A 5A2KH 1R3HB 3RY5A 5AVZB 2WQSA 1E5ZA 1I9JH 4JG1L 1PU0A 2ZQKA 1VIWA 4JHVA 5ANME 1YQ2A 3HCVA 5HHMD 2HH0H 1SKVA 2BCKA 5MENA 1MJ7L 4F9LA 2JLPA 4YJ3A 2J1ZA 3T71A 2NZIA 4Y19D 1R3LA 4Y89A 2HN7B 1NM4A 1WUZA 3PWUB 1ACZA 2C9RA 3QJZA 4CC0A 4WTZG 4DGYL 5EN2A 4YSSA 5HYSB 5IFAH 4YXLL 5C09A 2B3RA 2WYZA 4NZJA 2QM7A 1W0VB 1ZTXH 1DZ0A 3GBNL 3V6FA 3OVUB 4U3XA 1KC8W 5K1NA 3I3BA 5LXTB 5JMOC 2MNUA 3EGSB 2OTJV 5K33A 2IANB 3QI9D 1DF5A 1S76D 3L71H 1JTPA 3V6ZB 2QSVA 4YPJA 3ZQWA 3O3BA 1T66D 1F6FB 4JYAB 1H9VA 4JY5L 3FCSB 3B2UC 1RUMH 4X7SL 2GC7C 2FO4B 5IFHL 4EDWL 1INDH 4PW9A 4U6HB 3ZMVA 4ONOA 1E65A 3OXRB 4J3OG 3QYCA 1U3HC 4JFPB 3VD2A 2YMTA 1CQYA 1SGKA 1XGRA 4EI5A 4YXHH 2ATPB 4NVPA 3P3RA 3BPZA 4I5BA 4P9ML 5EOCL 2PYEA 4GXUM 4N5UA 2IANE 3ZR5A 1IGFH 3FQWB 4XNMA 3UDWC 4X66B 4ZFOA 4LQFH 2IJKA 4G2KA 1PY9A 2HLFD 2EECA 3ZYOA 4RAIA 3GK8H 1JPSL 1BDYA 1RHHB 1OP9A 2V5SA 4HYTB 4NNPL 3MNZB 4AM0Q 5KTEL 2DBLH 4F8LA 1K34A 3MJ9L 4Q0XH 1CYGA 1DJWA 3WTUA 1MCOH 1JVOA 1PBYA 1MCPL 1MAMH 1J86A 3PWPD 4HF5H 1QHQA 4R2GD 3UT5B 1MXDA 5BQDA 3PIQB 2MCPL 1COWG 3A4FA 4WV1B 3R8QA 1K3ZA 3KYOB 5C0BA 4JKKA 2PW1A 3TJTA 2X7LB 3AS0A 2O5XH 4M29A 5IEHA 2DN7A 1IXBA 4AQZA 1BOYA 4R7NB 4UTBH 1T4KB 1FWXA 1X7SA 5KN5B 5DO8A 4DPAX 2WBWB 2H1PH 2XFGB 5H94B 4YFLF 3O8XD 5HVGB 3FFQA 3BC9A 5HYSG 1LWJA 2YA2A 3B6SA 3RVUC 3SOBL 1THCA 1Q82W 1AR1C 3QTCA 4OZFB 1U8JA 1JHTA 4LSSL 4I1RA 2VLJD 2JJSC 4JI1B 2XPYA 1K4CB 1MW0A 5EDXA 4A6YL 3VWKD 3S3BB 1J9RA 2F19L 2Y0IA 2SODB 1JTOA 1WP6A 2IOOA 3EAKA 2WLLA 2DLFL 4XCEB 1H6FA 1KN2H 2VKXA 1YJDH 3DOSA 3WFZA 2R29H 1XR9A 1G1KA 2Q2EB 3BWUF 4U1IB 5EORL 1CBJA 1UB5B 1RLWA 3D8CA 3JWOC 5JH7A 5L4FA 3QUYD 2ETWA 3SE8H 4U3CA 2EH7H 2IDUA 3PDDA 4Z9KB 1T7YA 5C0ND 1CCZA 3DX3A 4ONGL 3D2UA 5KSBA 2X9WA 3MA9L 2IDCA 1UVQB 3S96A 5JXEC 1WLEA 3PPEA 1C7TA 3CU7A 5AZUA 4ZFGH 1F8TL 2A4EA 1ZVSB 2DQMA 1DTUA 4U1NB 3CK0H 3CRAA 1KXVC 1WWWX 1FE8L 2GITA 3OJDA 4N25A 1FQ9C 4UV4L 2ADPA 1GL4B 1XIWB 2P8MB 3EF4A 4X99B 1G4YB 1OSPL 4YL9A 1NGPL 1U8PB 3MGTB 4M7KL 1RM1B 1F42A 3IJYB 3CYOA 1YPZA 2AZ2A 4MBRA 3MRKB 1Q9LA 2J12B 2NZ9D 1UH2A 3JWDL 1EDHA 5EEXA 4WRLA 3HPLB 4MYWB 4RVBA 1ZWIA 1JR9A 2ZTBA 5I66B 4DV6O 3WFDL 1N26A 3WEBA 3DETD 4GS7C 4NX0A 2IGFL 2NYZA 4H20H 3KCYA 2X70A 3L72H 1KLGB 2P1YA 1U58B 3GPSA 4WCYH 4JPKL 5D72L 2PW2B 1AGFA 2DIAA 4PCSA 3T2NL 4QHNA 5JUEL 1Z9OA 3L5HA 5L88H 3IVKA 2FTKA 2YC1A 4OZFG 2XKSA 1H3WM 3WN6A 2BY0A 3SQRA 3WN5A 4JYYA 3V4PH 2A83B 2OP4L 3Q5OA 3K7UA 4ZUUA 3L5JA 4RWYL 1NKDA 4DV2B 2VR9A 4JY6A 2G5UA 4AIZB 5EUKA 5KANI 2FHFA 4FM2A 3C6SA 3HHSB 3KJ4B 4MNHA 2ZOKB 4PJGB 4PYGA 1LMIA 5I15L 3WO4C 2FLMA 2PO6C 1PAMA 3ARDA 4WFEA 4XVOA 5I1GL 4IK6A 4N0CD 3HB3B 4F7MB 4A6YB 2VDOH 1Q1JH 2VLKE 4KDWA 4UIKL 3QWOA 2JJ1G 2GPZA 4HAKA 5JOPD 1U36A 3HFMH 3QJOA 2JXMB 3OTOB 3AREA 1MY5A 3QAZB 3QQ9C 2ROYA 2E7LA 4A2GA 2O5NA 4LLUA 4I3SH 2HVJC 2XNDG 3CC5A 4XC1L 3GJEB 2HFTA 3M17B 2HP8A 2DYPB 4PJGE 4TPRH 5C07B 2YGPA 3B7UX 4F7KA 5ADPH 2OMTA 3ZYJA 1UEYA 1Q0EA 2D3LA 1R5WB 2WVTA 2JJ2G 4A1RA 2X4SA 4OFVA 1M3JA 3V9FA 2QWOB 5C3LD 1U8NB 2KQNA 1WA1X 2HKHH 5FA4B 1GGIL 3CX5K 3PJSK 3LD8B 4X8AA 3ATFA 3V6OA 1BFOA 5IB4A 1A7PH 4J7ZA 1VGEH 4NWTL 1E8XA 4LF3A 3APMA 4CH5A 1DQQA 3S3WA 1D7BA 2ADJB 3LH9A 5C07E 2EXWD 4Y9FA 2OKMA 1NQTA 4B9GA 1Y67A 4YK4B 2DYRC 3CVHB 1RPQA 3GSVA 1EAPA 4O4IB 1NGXA 4LKXA 4OZHE 1IBYA 4HK0A 2K70A 2NT1A 5EK0A 1CU4H 3N41B 3ZDYE 4XMTA 4JFUA 3FRUB 3PHSA 4I0PB 3T09A 2CO7A 3PN1A 3FO9B 3OAYH 4BE5A 3IJEA 5T1KB 5CN1A 5B39B 2E56A 4TRPL 3L3IA 4M1CD 3U9UB 1BHAA 3ABMC 1CICD 3JWNC 1OGTB 2M2DA 1EBAA 2Z3FA 1HEZB 2FX9H 3H6AA 4DRXA 2FX8L 3VXUA 5FB8A 4KRPD 4I4TA 4A7QA 3MVSA 3RL2B 5IB3A 1QX1A 1D6EB 4L8DA 1MFEH 1HHIA 1JZ6A 2XV0A 1RCYA 15C8H 3OLEA 3QUKB 4P5MB 4KKLD 2OK0H 3D06A 1DE4B 4N26A 1XEUA 1RPUA 2VDLL 1G1OA 5BZZA 4ZK8A 3RL1B 1M6OB 1KPUB 1F4WL 4F2FA 3LNNA 2VDQL 2ZICA 4NRXA 1GHFL 2BP0B 3ARFD 3CXDL 1QFWI 1UENA 2KHAA 4DERA 5KSBF 3IF1B 4YX2H 3OPZL 3DDFA 3UG5A 4DCQA 4JPQA 4CH3A 3NH7L 2VKWA 2X4UA 2VXTL 3QDGD 3VFOA 4AEIH 2DQTH 4YHZH 2EZPA 4L0PB 2OW7A 3UYPA 3L4YA 1OAZL 1TZIB 4EBQL 1Z6JT 5FPOA 3EFFB 1YPZF 3MRGA 5E4AA 1D5AA 5I8OL 4MX7A 2FUTA 5GS0C 3DV6B 1YY8B 4XOAA 3K5OA 4B9KC 4BFKA 1Z9PA 4OUOA 3QEQE 3VGEA 4UT9H 2DI8A 1ZHKA 3V0JA 1TU2A 5T3ZL 5IWLA 1CFSB 3KS0J 3KM2A 5DYOB 2WXNA 4F7TB 1NSNL 1U3HA 2MH4A 4B9CA 1RKRA 2OJEB 4UBDD 5C0CD 5B39G 5ITBL 5C9JB 3CX2A 2LU7A 3N1QC 3QUHA 3K2MC 1Q0XL 4GP5B 3KDMB 3TNNA 2CUMA 4GBXB 2FL5B 3ZVVA 3VDCA 3CDZA 5C6PB 1ROWA 1Q38A 1V3JA 1WBXA 5LBQA 1J8HB 3EOBA 3UDWA 3HNVH 5F7HA 3LRKA 1QTYT 4M9PA 5SWSD 1G9EA 1JZ2A 2I25N 4F1ZA 3QPQD 1S7VB 4N3TA 2UUBB 1FV1B 1IKNC 1XMEB 4TVPE 5F7YC 3D85B 5IIEB 1ERNA 5DJ2A 4LPXA 1XGPA 3K6IA 4NZUH 2QLVB 1CL7L 3OGCA 4YVUA 2NXZC 1PSKL 4PS7A 1L1FA 2DJMA 3BPCB 4MB3A 4OF3A 5D7EA 1M93A 5IK3A 1J8HE 5DZJA 4GYCB 2GUZB 2UXBO 4XNXH 3UBXI 1HK6A 2O61A 1LQSR 1U95A 3D3VB 4JMXA 4F5CA 1I7TA 5ESAA 4JO1H 5HHNA 3T1HB 1B3QA 2VDLB 3REWB 1MCNA 1NUFA 1RIVH 1U8LA 2FATH 2ICWI 1RJLB 3ZMZA 1W80A 4R8CA 2VDQB 2ENPA 2DQIL 5CKAA 3QXDB 3K8MA 2EIMB 3RVWD 2E3CA 1S5LZ 2MW2B 3ZHTA 1KPRB 4ANKA 2JJSA 1YN7B 4G5ZH 2KMWA 3SGKA 2JK5B 1CLOH 4K07A 4LCWD 3LKQB 4D9QE 4F7EB 5IJDC 3M46A 1UZ6F 1OAXH 3EH1A 4KXAA 3D3VE 4PJDB 4DESA 4JG0H 5BY1A 5F88A 1SMDA 4LHUD 1OCRB 2B1AL 2GIXA 3IU4L 4JI3B 3C2SA 3FXIC 3MBWB 1XXDC 2HG5A 1KBPA 2IWFA 3VRJB 2QGBA 2WA3A 2OAAA 2DV6A 4NQEE 3KMDA 1NVPB 2A6KB 4FZEH 3LJ3A 4NQVA 1W72L 2R56L 4Z0BH 1S7TB 4FD0A 4ABWA 3PABB 1QFWH 1YAIA 4FE9A 2QL1A 5JXEA 3GMQB 5E1QA 1IMHC 3UTPD 5F7FA 1ZV5A 4J8RA 5BRQA 1KKDA 4M7LH 5KG9A 4G72B 4G8GA 4NM4H 2FJUB 3KPLA 1OAUL 3IYLW 2VLLA 2AP2A 2V6HA 1XBDA 4LOEA 4X8CA 2G3MA 4I2XA 4GUOA 1NKOA 5IROC 5HVHB 4CJ0A 4LSQH 3F58L 4AYSA 4KY1L 4Q2ZA 1WN7A 2E9JA 2G75A 2VDRL 1PJWA 1L9MA 1A3QA 5IYDO 3QUZA 4ELKB 5DC4B 4BDVB 3CDGA 2ZE0A 1MRCL 1QMUA 3VA2C 5LDSA 5JA8B 1IM3A 4U0RC 2HTLD 1QVFU 3HC0B 3F7LA 1BEYH 5F21B 2NXYB 3T04D 1ZS2A 3J27A 3A67H 2AVFA 4HMCA 5SV4A 3G5XB 3JV4A 2QJDA 4AYMC 3QJVB 4B3SO 1S9WB 1QLRB 3LRSB 3MUY1 2DQHH 5HFMA 3B2DC 3GXFA 1LVEA 2GSGA 4OIIH 3IFOA 5LP6B 4M43H 5D5MA 5JW4M 1NFIA 2WNKA 4WI9A 2FT7A 4KI5D 4TSAL 5EU7E 3NK4A 4PV8A 2Q2LA 2FSEB 2HLEB 4N86A 2CBPA 4N28A 1O9GA 3HMXA 4NN5B 3RNQB 2A9MH 1NFAA 1XFPA 4MNGA 4PWIA 3ETQA 4PY8I 1LO0L 4KJQC 1U8MB 3PWJB 2V4LA 3JAWA 3RVXD 4LVEA 2LW1A 3QCUL 4WK2B 2PN5A 4DW2L 3I02A 3TIEA 1SYSB 4X6BA 1TZAA 1Y6MR 2GJZB 2VNCA 4RWUA 4N0UB 2HHHO 4X0KB 4Q4IA 2E0PA 4V1DA 1TSHA 1XMOO 2I5YL 3FFCD 3KPMA 4MVOA 1W72B 1OAJA 2A9CA 2KG7B 1ET8A 1DHKA 2HX7A 3E22B 1KZQA 1YN6B 1Q9OB 3HBZA 3GJFH 4X42A 3Q3GB 4Q6GA 4WFGA 4FJYA 2QEJA 2YEVB 3ILPA 1E5UI 2AXJA 3SEPA 1DQKA 4JDZA 3QXAA 2X7RB 4N0UE 3WFEH 1ROCA 4K8RL 2DYSC 1K2DB 2EE2A 4DPRA 3ZTEA 4G7SB 2NSXA 1FAFA 4PJXA 3DRQA 2P46B 2J20A 3K79A 1CF8L 3P4LA 1AG6A 1NCCH 2VDRB 3POCA 5ACZB 4ZQTA 4FF9A 1JUFB 1OF2B 3QULA 3K4DA 3FX7A 3GM8A 4MHHG 4KQ3H 1GH6A 1FBIH 3NFPB 1MFBL 3L75H 1DSFL 1CPUA 2PUQT 1RZ8A 2YAEA 3MYJB 2EILC 1KEMH 2QWQB 1HHGA 2ZSWB 3DO7A 4XCYA 3IXTA 2OV0A 2VW7A 2OYPA 4AQ1B 4I48A 2Y07L 4Y2OA 4PV1B 4OT1L 4XX1G 1M4KA 1SXZA 2KS0A 3IGUA 2BSEA 5T3XL 1F3DH 3L4VA 2MCAA 4QYAA 4QRBA 2B1IA 1S9YA 1Z7JA 2YFOA 2F74A 1ADQL 2VXUH 4DPBX 2OW6A 3WXWL 1AS8A 3DXAD 5D4HA 1OT2A 2E4TA 3MN8A 1BOGB 4PRDA 4KDVA 4NC1C 4R8WH 1HHKB 3SGJA 3PDOA 3MV01 4HIEA 3SY0A 2IFFH 1IC5H 5JW5B 3RI5F 5JXAL 3V5DB 5D5PA 3BAEH 2H7WA 3EO9L 1JGDB 4KKCD 1LXMA 4LSTL 4NFBA 3D69A 1M2VB 3JV6A 4P3WA 2CDEA 4XVJH 5DHEA 3QYMA 4J5VA 3T4ZA 2JELL 4K0KB 1RZJL 5HPMA 2WXIA 4N20A 4JJHA 4LFBB 4HJIA 1LDSA 3DIFB 2C7UA 5DI8A 1UH3A 1JF1B 1FZOB 3EOAB 4WK4B 2VN4A 3V0WH 1SN5A 4JI8B 1PFOA 5A9GA 3ULSB 1FLRH 3KEDA 3CZGA 4UMGA 3MODH 3OSKA 3VM5A 2Y36L 3RVVD 5C0BE 3FFDA 2QTOA 2YOAA 4QRPD 5H37G 1AQDA 4GW1B 1NCOA 4BGLA 3S34L 1B4RA 3AT9A 1WEJH 5EU6B 3V55A 4PJ9C 4OCRL 1NJ9B 1IAKB 4JY4A 3UCRA 1S5HA 5I8CB 1HI6B 4XN5A 5SWZD 1I3GL 4X0NA 1M9SA 2FBRA 4KJPD 5A16B 3IJHB 2ATKA 2NY2C 5TFSL 3RUGB 2V3FA 4N2EA 3BSZL 3KPRD 1WFIA 5F3FA 5ICXB 3RVTD 1H5BC 1CDJA 4O9HL 2V8MA 3AROA 4F8NA 3AXIA 1QYGL 1DBML 4H8QA 3SCMD 2PGGA 3TBYA 2VQ1B 3OUSA 1QR9A 2C3XA 5D5MF 4KHXL 1Y7VA 2BPBA 2F58L 1SETA 1OPGL 2VN5A 2LW7A 1UOWA 3OTTA 3DXRA 1IKNA 4DFIA 5FPRA 3STZC 4R50A 4YZFF 5IM7A 4JI4B 4M5ZL 2DWEB 3VQVA 1JXJA 1A3RL 4GSRA 4LHQB 2ED6A 1YUHB 4OZGA 3OKNB 4JYCA 2GFBA 4LIQH 2H1XA 4FLOA 4MTFA 4JYBA 1AJNA 1BVZA 5DWUL 3D6GA 3VGAC 2LR4A 4ZAKD 2C1PB 3INOA 3GB7B 2X2JA 5D2NB 3ZTNH 3TIDA 3WS3A 2BDNL 3KNBB 1YEGL 3LMJH 3RKDC 1BX2B 3C60C 3BZ5A 1XF2A 1MA1A 4X65O 4ZFFA 4L3EA 4FCAA 1WCQA 5I1JL 1BWMA 1K85A 2H8PA 2DQFA 2NRDA 1BREA 4HULB 5LGHL 4NNYA 4MDRA 3NA4A 2BCCH 3LXUX 4U1HA 4Y1AB 4PJ6A 2ZCLL 1YPZE 2F8VA 3CZFB 4TF4A 3ARTA 1M05B 1N0LB 5DEGB 1IFHH 4JTCB 1DVUA 3FBKA 4U1SA 5CP7A 3GIZH 4NPYA 1WZ1L 2BOBB 3D50A 5T33L 1KQSU 2A6DA 3LKNA 4MDJB 3TPUA 3GEFA 2H32B 3VI4B 5FEBA 3N44F 5LGUA 2IMMA 5IJ0B 4M61B 3K5LA 3IJSA 3QIWB 2UY6A 4PJXF 4UMSA 1K8IB 2R4RH 3HS8A 3SDCB 3TASA 4BH8B 3BX7C 4XNZB 4Y1AE 2J7LA 2YEZB 3EO1A 2WZ5A 3FOLA 4OAWA 3FT0A 5BO1L 2JKWA 3CCQV 3DX9A 4NJ9H 2IIJA 4PWEA 5CGYD 4ZDHA 4Z5RA 4Q6IB 3TCLB 5B4MC 5H4ZA 3W38A 5ALBH 4LLYB 5D4QA 1QR4A 3HUJB 1PZ3A 1KB9K 1UD5A 4M7JL 2EIDA 5CEYA 4FQLH 4Z8FL 2E7CA 3NCWA 1SF9A 1ZHLB 4AGOA 2FO1A 3MDJA 1X9RA 4W9ZA 1SHMA 4BWAA 5E5MB 1OF0A 5JPMC 2Q86B 4Z7QB 3K3QA 4WFEE 4GSDH 2D9CA 5IROA 3BUQA 1HOCA 4JEGB 4PCKA 4KTGA 5I1DB 1KB5H 3TJHC 2ITCC 2XRAL 5EYPA 2BOCA 4UVCA 5F97E 2VH5L 4I89A 3NDYE 5LBGA 3W11C 1TNMA 3ABLC 3W3BA 3G08B 4Y0GA 3DROB 4URTB 1KZYA 2X4RA 3I3EA 3BP6A 4P3DB 2E7BA 4M8QA 4BSWB 3QNZB 3NRPA 4XVTL 4F2MB 1FORH 5FYKL 4Z7QE 2CKBB 3B9KB 5HHOA 4HWNA 5DURD 3KEHA 4JQXC 3U2JA 3CFCL 4EVNB 4CADB 4WTZA 4IK7A 2F53D 3NQIA 4AI7A 4DGIL 5MEPA 5L2KA 4JPVL 2OM5A 4PYHA 1T03L 4PRNB 5FYKU 1J9QA 4RGOH 1PVHA 5HYFA 1UZ6E 4GEIA 4JZJA 2AXFA 5D1XC 4KNQA 4MD4B 3VB8A 2FEDD 1NCUA 4OJCA 1A3ZA 4PP2A 2PWEA 1GS6X 1AO7B 1DDHB 1MCWW 1PNDA 2CUAA 2W07A 2Y5EA 3KVQA 4Z3IA 2O30A 2HR3A 1DVYA 1NKGA 2H26B 1QZNA 4P3CL 1FFOA 5H6RA 2BP8A 3QNXB 3D39B 3PUCA 1FFPA 2Z7ZA 3I2CL 3WHXA 2LLGA 4AKPA 2IBZX 2J6EL 4XN7A 1XZWA 3CMOL 4HXBL 1DO6A 4BCYA 4I18C 3LS4H 3AMKA 3CPLB 3FD9A 2FE0A 1P5UB 3CV5A 3FTWA 3DVIA 4M6OH 5ERWB 3HG1D 4JFFD 4PM1A 5EDSA 5EIBD 5DJ8A 2YN3A 1YMHB 4FXLA 4JAMB 1AO7E 3C2AH 4HUCA 4AC2A 3C5SB 2J1XA 2CJTA 3K2KA 4O5LH 5DR5H 1OJHA 2EYRB 2EJRA 2ADQB 2DH3A 3Q2LA 2NY6D 4QHUA 4XPBH 3U0WL 3S35H 5KMGA 3D39E 5F3HB 3QH3A 4BKSC 1O6SA 4K94L 4AW4A 3RWDB 4WI0B 4AYFA 5LGJB 1XV8A 2FGWH 3WY4A 2CR3A 5E56A 2NPLX 4FTVD 1UGNA 2QQLH 4I85A 1BFVL 5IWAB 4DV1O 4KY2A 4B5EA 1M6UA 3ZHSA 3ZYIA 3NJFA 4GRLA 3NCJL 3HKFA 5JIMA 3QG6A 3UJTH 3L95A 3K91A 2EUXA 1PKQE 4GB9A 4OZGF 4PJIB 3IGAC 3FH5A 2ZD9A 2A99A 5FYJL 3H9ZA 2PYFA 3JWOL 2IOIA 4KK9C 4MKMA 1Q43A 5JOEA 2P22C 1D5MB 1ODAA 2CBMA 2HN7A 3DUSB 3PWUA 1G7JB 3QA3A 4K15A 5FYJU 1A1OB 4OW6A 5K59E 3D87B 5I71B 1A7QL 2IU3A 2GK0B 2X5PA 3Q1SH 5HYSA 1KEGL 2UXNA 4NGHL 2MK3A 4RFOL 2FBJH 1KPVB 3FTVA 1BAFL 1VENA 1O9ZA 5DEZA 3IXAA 4Y2DD 2CK0H 3TFKC 5FO8A 3X13B 4FPPA 1IEAB 4FNSA 5LYJB 1N36O 3EYQC 4A2FA 3VI3A 3V6ZA 5FECA 2XWRA 3FO0H 4Z7UA 1F7YA 4I50A 2APTA 2J8OA 3U83A 2WNXA 1RP8A 1A6AB 2VGLM 4L1DA 1S7QA 4AE0A 1OGAB 2ZOUA 3SKOB 4WUUB 3NIGF 1I7FA 3EYUL 4PRBA 1SHSA 2HT2C 4W1TA 1FRGL 2V2XB 3TYGL 1IC4L 5FYKE 3QJHB 5CCKL 4UT6L 4KKRA 1I3VA 5I19H 1N67A 2IAMD 3DJTA 1O5PA 4M3HA 4XVSH 1X5MA 5I6KA 3L74H 2J5WA 3ETGA 3A6OA 3RQ3A 2R2BA 3N50A 3VTTA 1OTUC 1L6XA 2GBAA 1QNMA 2BJML 3LAFA 3NJKA 4UOW1 5F3BB 5IQOA 3ULVL 3S3XA 4MZ3A 1P4RA 1X44A 1BIHA 4LBAA 4S0HA 3GMOA 1FZKA 1OGAE 3PU7A 2QSAA 2QSQA 2HJLA 2WZ6A 4M5SA 4W6XB 1TZGH 2JB6A 3LKSB 4RX4D 3ZGHA 3OG6B 3G6DH 4H44B 4ZMYA 2VQUA 4PA3A 1GTFA 5TGBA 3WD5L 3W82A 1PMYA 1U8QB 3MRPB 3V0VB 3MOBL 4WO0A 3RIKA 4HBCL 3BHBB 2N3JA 2OMUB 4IIQA 1DVZA 4UILH 5LHHA 3DO3A 5AOMA 3SZKC 1TKWA 5JQ6H 3DMMD 5TQ0H 1DVXA 4BV1A 1BG9A 4AZUA 4TQHA 1FL3B 2BY1A 3LEVL 5C0FB 1GKOA 5JOFA 2AKRA 3SYAA 4LF7O 4RESB 3BPOC 1BVKB 2IDFA 3LHPL 4HS3A 3ZIYA 3BZEA 1ZT4B 1NL0L 1AIFB 3QUMA 1ZE3H 2YZ1A 5EC1B 4G59C 4P8QA 3P02A 2XQBH 3V0DA 2JCCF 3DVGB 2BIQA 2UXDO 1LO3L 3KBEA 3ME0A 4LDCA 4Z3JA 4N90E 2YPLA 4WEEA 3UP6A 1LLAA 2X89D 3HA0A 3STZA 3UGUA 3KPPA 5FYJE 3MREB 4O4YL 3DGCR 1DDTA 4Y16D 1XMQB 1QUNA 3GI8L 4NT6A 4XNQA 1KG0A 1YEFH 4Z7IA 2BRQA 3VSVA 3G5VB 3EBHA 1EFXD 4TV9A 2G3NA 1A47A 2OR9H 3DSNA 1T21A 4QOKD 4ZUTA 5CD3A 3O4OB 1NFKA 1ZSDA 1RUKL 1TCMA 3C60A 4PDLA 3QRLA 4I0XA 3FS9A 1J10A 2G9HA 4AQEB 4GRWF 3MRBB 3KPSB 4KKQA 1CB4A 1OSZA 2BWIA 4OLVL 4RSYA 3VFNB 4AQOA 4V33A 2F8XC 4S1RL 2FR4A 2E6QA 4Y4FD 2B16A 3IJYA 4HC1H 4AYEC 2PP7A 5I8EA 4OZIA 5EA0H 3NJMA 3GMMA 5GRJL 4F15C 1P5VB 1YQVH 1B9KA 1OV8A 2V2WA 2Y1YA 4WY7L 2IQAA 4NRZA 2UU9O 3A5VA 4XGZB 5EU3B 2OBGA 1G6VK 4P2RD 4GAJL 5LAPA 4HD5A 1GZPB 1OHHG 2QDWA 1S5IH 3KR3H 1JNJA 2E47A 1YECL 3D0AA 3UEQA 1I7ZB 4HUVA 1M1XB 2Z31B 1JGLL 4LNRA 2EP6A 5ALCL 3N43F 3SHSA 4LASL 4IMLB 1PD3A 2NR5A 1U2HA 3BIKA 5GGSY 3PG2A 1FFTB 3MRHA 3TZVB 1MIML 4DUYO 2V9QA 2AITA 2KZBA 2HVJB 3N85L 3LKPB 4L3CA 2J5LC 5DQJB 5EF1A 1HNZB 5JPMA 3K8KA 5TF1H 2JKTM 5AD0B 3WSQL 4MA1B 1A6PA 2PCXA 3GC3A 4TXVB 2V17L 2BIIA 4KMQA 1Z5WA 3K0YA 1NAMA 1NZ6A 4L5FL 4Z7UF 3FCTA 1TETL 4Y9CA 5KAIZ 4GQPH 4CNIB 4MTGA 4PB0H 2YQBA 2PWHA 3BSGA 4FMFA 5TE7L 3RAJL 1C08A 2LLNA 4ZS7L 5IW1A 2FQDA 3CSGA 3GSXB 3APFA 4QNPE 5F6HI 1EEZB 3RGHA 2Y7OA 4MAUH 1QRNA 1F4HA 4C7UA 4KQ0A 4LSVL 2BIMA 3F64A 4KO7A 5G5DA 5ISZA 2B4CL 1UWEL 3U1SL 3PHQA 4IBVA 1GN2A 4GX5A 1THZA 1TENA 1BJ1H 3SOTA 3AS2A 1N34B 4JN1H 1MNUH 1PZ5A 5D1XA 4IOFD 3BKCL 2VUKA 4H8PA 1TFPA 4P23D 1YIJV 4PJXE 5A6IA 2J8HA 3L4TA 4RQQA 1VQMV 2QVMA 1RAMA 1DBAL 3TETA 1EBOA 2VZUA 5GZOC 4N2AA 1KLFB 1UYWL 1RPKA 3KXFD 1NPNA 5EEZA 5FGRA 1N4CA 4HH9B 4BQ9A 2UWEA 3EYFB 3MLVL 5ICUA 1DQDL 3BFQG 4LGSB 3QEGH 3VXQA 3UTOA 3LN5B 4IEFA 2I27N 3RYFB 1H3PL 3FQUB 3NEEA 1BF8A 4FQQA 2YARA 1YNTA 2MIZA 1RZ7L 4F20A 3X14A 3MNDA 1G4RA 2IDQA 4OLUL 1SJEB 1N6QL 4LNUA 3Q0HA 3TVMD 2C9UA 1JXGA 3JARA 4H1LA 2GTQA 3TXSA 1T1XB 2ZUTA 3CFEB 1OP3K 1CFTA 1IGYA 5DLLA 1HQRA 5HJ3B 1T5XA 4PA9A 5L3BA 1J05A 4U4IA 4E9LA 3B1TA 1RD6A 4TULH 3GGWA 4Z0XB 5A40E 1KPUA 2GQHA 4QRUA 4G1MA 4Q9QL 1AG0A 3L3HB 5D71L 1RK1B 2IV9A 4HG4K 4S11A 2NY5C 1FPTL 1E3FA 3P4MB 2ZKHL 2VZSA 3K71B 2I60H 4MWFA 4TNEA 4M48L 3QI9C 5ESVB 4CVWA 3MFFA 4LSPL 1T66C 3HR5B 1NICA 1D2PA 4BZ2A 1CJYA 3PJNA 4LPVA 3ZRWA 4YUEH 3B8NA 3F6JA 1OM9A 1UASA 4FFYH 4X5XA 2XJKA 2W88A 3KWWB 4MQXD 3VCLA 3UM7A 3SPHA 1BM3L 4OZIF 3FQTB 1BXUA 25C8H 2XTLA 4L5FE 5I5IA 1LL1A 3MLWL 1UM5H 2C3HA 4TUJB 1VQ6V 1CFVH 4JO4H 4HYOA 3PYCA 4EN3D 1P7KA 2HLFC 3S4SG 5HY9B 3CE2A 5DYOA 1VKXA 4CMMA 1C7SA 4H33A 1JNHA 4I3RL 4K71C 1SZXA 2QVTA 2E76C 3CU1A 4FQ1L 2GT9B 3P40A 2KH2B 2NXZB 1E4WL 4FQHA 3L9BA 4FQXB 3WS6C 3GIVB 4GO8A 4R2GC 5AAWA 4H0LB 2QMKA 2HFGH 5DZAA 4IBUA 1OVZA 1JJOA 3F6IA 2HEPA 4TL4A 5CJ8A 1CLCA 2Q68A 2FB4H 2OL3L 4WFHE 1YEDB 3DIVA 4S10A 4ANWA 2BSSA 1FV1A 1P69B 3VXTA 1IKFL 2RHEA 3B09A 3RGVD 2IXQA 3Q05A 1KIPA 4GKOA 1VQOV 4YPGA 3VXPB 4KTYA 3CJJA 5F7KC 3BKJH 3O8XC 4OUUB 1JDDA 3R1GL 4PW3A 4LF9B 3QWRD 2GUYA 1QSFD 1AHKA 4HZLA 1E4XL 4X8JA 3ULUH 3LQAC 5EO9A 3U1PA 3S5LB 3UMNA 2V1DA 3U4AA 1AD9B 2HMID 4RRPA 4YY3O 1KP3A 2BNRE 4HW6A 3VWKC 3RDJA 3BVUA 4AZ8A 3GLZA 4PRHD 2H9GB 3HNSL 5I23A 4L1HA 3V9CA 1SS3A 2FWUA 2P5WB 1LNUB 3VJ6A 4ZMZA 5HDBB 5KVDL 3CFQA 3LRLA 5F1IA 1M9WA 4PJBB 5AW0B 3O6ML 1IKOP 3ZRCC 3QUYC 1LP9B 3MXVH 4ALAH 2K4WA 2X09A 4W9IC 5D70H 4H13B 5C0NC 1R33A 5A43C 3TGXA 1F13A 1N2RA 2OT5A 4BXVA 4UQBA 4PJDA 1WNSA 4XBGB 3F3HA 2XWCA 5E2UH 1FFQA 3AG2B 3THMH 4FA7B 4Q74A 3NIGE 5J1SC 1LDPL 1KENH 4AYDC 1X4YA 2WZPD 4W68A 4DV6B 1YNKL 5LBSA 5EC2C 5LXGH 3CE1A 1WITA 2WO2B 2GG1A 1S7TA 4NUQA 1TYRA 3QPXL 4EZLA 4NXKA 2CE6A 1J1PL 4PBXA 4UWQB 3IMRA 2UWEF 4JKPH 4I4WB 3QO1B 4IGBD 4P2QD 3U46B 2NZ9C 1E9QA 1MJJA 3IAPA 4GOSA 2XLLA 1YNTF 3MRNA 3O11A 4FFVD 5IW6B 5JORA 2AI0L 1A4JB 3DETC 4QF1A 2CO6B 2PCPB 5IB5B 2FDBP 4PD4F 4G70B 3OKKA 5CA0A 4B7IA 3EJZC 1R3IC 3P11L 1A6ZB 2OL3B 1MCLA 3QPKA 2DIEA 4Q58C 4X8XA 5BRZB 4C56D 2JCCB 5MHSE 5D7KD 3HAEA 3Q8EA 3KL3A 5SWQB 2X1OA 5BUGA 1VQ9V 1MRFL 4HLZH 1MVYA 2N4IA 2YZ8A 3FH8A 4YVNA 5EBGA 3VFUA 4D6TH 3WEOA 1AB3A 1HL8A 2YKKA 2ESVD 3FONA 1TLMA 4ENZA 3VH8G 2JIXD 4M6MH 5TDNB 1CE1L 5D1QD 1UH4A 2V5TA 3LNFA 3G5XA 3KDPB 2L3BA 4DKAA 1OP5K 1EXUB 5IKCB 4N0CC 4PS8A 5L2KE 4B3RO 1F4AA 1Y0LB 3IMSA 3FRPB 1Q6HA 4I9WA 2PCFB 1ICTA 2JCCE 2ROXA 3D7PA 3QNYB 5BRZE 2W91A 1QEWA 5J13B 1SXBA 1VGKA 3Q6FB 2DRUA 4U7OA 4Z7NB 2BHUA 3HRPA 3UPRB 4BH7B 3AG1C 2Y0SA 3P2BA 4PRPA 4KOBA 4PGZA 1E6JL 2ZG2A 1T2JA 3IE9A 3DX8A 3PF2A 3RNQA 1HEHC 5B38A 4BA8A 4FI6A 1J5EB 2LGWA 4HZ1A 4YHLL 4ZMAT 1MI5A 4B3TB 3VFMB 1SF5A 2XFXB 4U1MB 4A67A 4K5LA 1QVGU 5AYQA 3GPEA 4UTAL 2BX5A 4MVMA 4Z95L 1NCAL 4YHKH 2FYVA 5KEZA 2F5BH 2AV1B 4F6RB 3OKOB 3PGFH 4GRWE 4Z7NE 1SFDA 3E8UL 3SE3C 5KVDE 1IGCH 3MNVB 4ZUVA 4QJ4B 2AK1L 1U6AH 4KNTA 3SJAC 1EK3A 4FEMA 4YIQB 3DOHA 1U21A 2EXWC 4N24A 1N3NB 3BVVA 4OKVA 4PGDB 1KV7A 1PNCA 3BWAB 4ZMTA 4FLRA 3NIDF 2XJLA 2K6YA 4JI2B 1PL4A 5GS2H 3E6HA 4X5WB 2EILB 5HDRA 4ELMF 1FXKB 4M1CC 4D7TA 1CICC 4JVUA 4V11A 3PP4H 1ILSA 3NSYA 2YHGA 3WNIA 3AG3C 2PR4L 1JD7A 1A14L 2V2TA 4CN4A 1X7TA 3QEUB 1U97A 4KRPC 3T3MF 3V0IA 5GZOA 5KSVB 1JVKA 3WJMA 4NM8H 4AM0A 4FA8A 4WDIB 4Z1MG 2AJVL 5HJGA 1YDPA 4KKLC 3C8DA 2J73A 5AVYB 3KCWA 1YEKL 1LJMA 1ET7A 4HGMA 4R3SA 4BUGA 3TP4A 4P9HH 1YAZA 4K2UH 3VGDA 3GMRB 1F11B 1HXMB 1PG7L 4KHTH 4OBSA 4RAHA 3OT7A 5HXMA 1DLFH 4O4HB 5DUPH 3HR6A 1JWSB 2AGJH 4ZFZB 1FYTB 3ARFC 1P6AB 4HPYL 3B3BA 1F90H 3VQ1C 4W4OA 1WHOA 3MGOA 2R69A 1JZ7A 2G3XA 1ZHBB 2XNAA 4JDVA 2J3SA 1JGVL 1PDKA 5F0LB 2CCLA 5H8DA 4PRIB 1TO5A 2WXMA 1NC4B 1WE5A 3X11A 3P4OB 3TV3H 1SA0A 3GHBL 3H9YA 3KM1A 5GGVY 1WFOA 5CZRA 4GFTB 4H88L 1R1BA 4ZPVA 2ZNIA 4X88A 3TF7C 4NC1E 1TQBC 1P6WA 3OEHG 3UG4A 3WI9A 2WGXA 2F5AL 3QI9A 3V5HB 3GD1C 5AALA 3SKUD 1SQXH 4PJ9B 4X9IA 2K6WA 3AC0A 1AR4A 1J1OL 4CKQA 3AG4C 3OJVC 1E4KC 2HPTA 4YHPB 5CR8A 3TT1H 4P5TD 1QW8A 4G6KL 1CEZA 4GIAA 1H5BB 4UBDC 1MCWM 1DTOA 5C8JB 5BR8O 5F96L 2YR3A 1M9NA 2Y2WA 3CBJB 1UCBH 3I6LE 2UXXA 3JALB 2YEQA 2CKNA 4GG8A 1Q0YL 5LCVH 3MRRA 3WFCL 3H3PL 5GGTA 1DBJH 4B96A 4AT6B 1E43A 4MVQA 4YFDB 3TBTA 3QPQC 1EO7A 4BFIB 3IMWA 4EDXB 5IZ7A 1I9RL 1QABA 3QORB 4QMEA 3RUGA 3ZMRA 2BSRA 4TLSA 2KLTA 4UM9A 3PWPA 1NMAL 3TO2A 3ZE0B 3R7QA 3D48R 4YWGL 3HLKA 3X3GL 4QXTA 4KRLB 4EQ3A 2L6LA 3F65A 4K9EL 1E6OL 1BSMA 2YUWA 1JGEA 4L9LC 3UJIL 4JFTA 5MI0C 2DMHA 3V0HA 3PQYB 2FJHB 1QNZL 1KFAH 5F9DC 4TUYB 5EU4B 1RP3B 4GO9A 4N6RA 2B7DT 2YKLH 3KE0A 2AQQA 1NBMG 4H2CA 4LF4B 4QD2E 4EKWA 5K1PA 5I74C 4IDJH 1ZGLB 2C1PA 4NAJA 2J8UB 4O02L 3GB7A 3RVWC 3S36H 2BRRH 1L3NA 2HPOA 1JZ3A 2VABA 3NPSB 2AK4D 1FZJB 3TBSB 1VACA 5CJOH 3VWKA 2WJ5A 3ZIAG 1MFDH 3P30A 2AJSH 3C9NA 1FXVA 2WYTA 4B3VA 1G7IA 3QFGA 5MP6L 5GJSH 1DUYA 4WK0B 2WINB 5E7FA 1S7XB 3UCSC 2VQEB 1EUUA 4Y5XB 2LJ2A 2WMPB 3K6NA 5FFGA 3VUAA 3M99B 2AEQL 4UM8A 3F01A 1HIML 1LK2B 2YBRB 3QUYA 2HKOA 4JRWA 3TT3L 4UB0H 3BRFA 3JD4A 1G6RL 1TTCA 2WUBL 3WHE1 4NQDD 4QHKI 3P9WB 2XOTA 3EH4B 3VI4A 1I8UA 3L16A 4FJZA 3L9RA 4NR1A 3NCMA 3QDHA 4IBTA 2XOKG 1O75A 4ZQKA 4NXMB 4WW2A 4V2CB 4JRXB 4A2MA 1K8IA 3GHEL 3IDYB 1UD6A 4ZO8A 3GRWH 5EC2A 2UXCO 4Y9BA 2BTQB 1W9XA 4D0BB 1KT2A 3CUPA 2ITCB 3UTTD 5KVFH 2EO1A 3ML8A 3UO8B 4G1EB 3CPUA 4XXWA 3SE9L 2Z3YA 4LARH 3ABLB 4XB8A 4ANUA 3IGKA 4XP1H 5DS8A 1WJZA 2Q9LA 5I1CH 1PNKA 4B08A 2IM9A 4YHHO 5HI5D 4F8PA 1RSYA 1KTKE 4P05A 3BSZA 1ZA6A 3PNWB 4JRXE 4WI6A 2HJDA 2HTLC 3B5TA 3OAUL 2PF4E 1DQLL 3I74A 2NW3A 5ICZA 1ESOA 4HX1A 3VTMA 1ZANL 4G8IA 2HKFH 1WS7A 3NACH 4HIJA 3ZX1A 3FB8A 4PJ7A 3WUWB 4WENB 1INQA 4M6NL 1RIUH 4IKNA 3HZYA 1QRNE 3CZNA 4Z76A 2P24B 1G94A 2P7TA 4KI5C 1BZ7A 4NBXB 1RJYB 3C6EA 4YHIA 1ZA3B 2XQYK 5ISZE 2Q6AA 4GQQA 4Q4EA 1CXEA 2JI1A 1MHCB 4O02B 4RRPM 3FAXA 5G4OA 3L3KA 3ILQD 1WG3A 4YHNA 2FX7H 4I18B 3CMEV 2HYMA 1EEYB 3D33A 4NQUA 1WAAA 4ZXBA 4XCNB 1MUJB 4UQ3B 3RVXC 1IARB 2O5YH 3FTGB 5CWSA 4MVBD 5CU9A 4ILDA 3IFNH 1AI7A 1NMCB 3UZQB 4ERSH 2AXGA 3QNXA 2EDMA 1CFBA 1QPXA 2DQDH 1RMFL 3M6DA 3KGSA 1HHJA 2BNUA 2ALAA 4HAMA 2PTTA 1G6RB 3T77A 1WFUA 2KZWA 1PZSA 3WDJA 5FFLA 1HL9A 5IW3A 2UWEE 1P5UA 1VJSA 5ERWA 1RULH 2HRPH 4FLHA 5DEDA 2W59A 1IZKA 5B3SC 2A79B 1JK8A 4J3SA 5ILTL 3SE3A 5TDOA 4HKBA 1QR8A 4X1KA 5GQBA 1UGKA 3BEVB 4RA0C 4PPTA 2OI9B 1KV3A 4HNAA 1ES0A 1FVDB 5C8YB 2SEBB 4JFED 1A6VL 4KTEL 5FA3A 5I2IB 3HBPA 5K93A 2C4XA 1TMQA 4X6CA 1RJCA 2DKMA 5IMOA 3RNKA 2A7WA 2ZWYA 1I1AD 5D1ZI 1JHKL 3S8GB 1XNQO 1DJSA 4WGVB 5BZWA 3FTUA 1V54C 3SIKA 1G7QA 4AL8H 3FTXA 3ML9A 4Q56A 1XB3A 4OU3A 3WUWG 1MG3C 1CICA 3APQA 3REVB 2HWZL 3RU8H 4GKJB 2K6ZA 4UI2A 5T5FL 1XHHA 1K9TA 2IALB 3JZYA 2VXSH 3WXVH 1CG9B 3B2EE 1JRHH 1NC2B 1I8LA 4XH2B 5EO1A 1AGEB 3LXBA 4JO2H 5E8EB 5LWYH 4OLZH 4DUZB 2VISA 5IHUL 2MHAA 4CAGA 1AGDA 4MSWC 3EGXA 4FFZH 5I24A 4M1GL 1I4FB 2VS0A 3FSVA 5CILL 2YXYA 4L8BA 4JQIL 2PF6A 1RVFL 3R06A 2ZKMX 3EFDH 3SJQC 1FIEA 2XC8A 5DU7A 1IGTB 1X5GA 2X3CA 5C6WH 5KW9L 3IN2A 1LK3H 2V5MA 1RV6X 3ARFA 4BELD 1ITCA 3BEWA 1JK9A 3DRTB 3WY3A 3B2VH 3ZGIA 4MJ6A 3QZOA 3MSPA 3SDLA 4YNYA 4KKCC 3RTQA 3V7AG 1AYOA 1XGTA 1IC1A 2YMOA 3BZFA 1BWWA 4HSQA 4P49A 3M88A 2OZNA 3NOIA 4WW2F 4WWOA 2CUHA 4LFCO 3MUUA 4RZCA 4ELMB 2WAMA 3QDGA 3I50L 4WWKD 1N5YL 3INUH 1UD3A 3LYRA 5JDJA 2PPFA 4C4UA 4HUXA 4PGCA 1SDDA 1CDGA 1AVAA 2H3XC 3QHTC 4U6YB 3AWGA 3RVVC 2IOMA 3RZCD 3STLC 2JKJA 3HI6H 3SJVD 3BGMB 3PHOA 4U31A 5CCJA 3BYTA 1XI1A 4L4TD 1CFNB 2K45A 4X62B 3KLAB 4L18A 4I7ZB 4AGNA 4FIPC 1E4KA 2ZKYA 5FL7G 5I1AA 1CFMA 2DLEA 4ELME 3I56V 1JV2A 4KVNL 1U30A 3IDNA 3ABGA 4KJPC 3EDKA 2D03L 3IDXH 2YD9A 3B56A 4LU5L 2A9BA 5E6IB 3WDHA 5C0CA 5JHBA 5INCB 3RVTC 5KWYC 4IIJB 3GTVA 2PP8A 1ZLSL 3BW9B 3RB5A 3T3ME 3ZDXF 1ZCRA 4Y7MA 3ULUD 2C3GA 4K7PY 4OLYL 3SCMC 2AGAA 2YI9A 4PJ7F 5CZKA 3QG7L 1JN6A 3DJZA 1BZDA 4HT1H 3S2AA 1H2MA 2XZQH 2P52A 3AACA 5JQIB 4P57B 2OTPA 4DK3A 4MDIA 4XNUL 4H7VA 2ODMA 4UCSA 1YJDC 4XOBA 4AYID 2QVFB 2TSAA 4PGBB 5AVSB 3V0GA 4E9WA 1DBKL 3ZKMD 5EV7A 4S1SH 2G2RA 1JOIA 1SUJA 4PQXA 4X4YA 4BSJA 3WMSA 2R23B 1WICA 4OCLC 5HGHA 1BQZA 4H0IA 2ZT9B 4ZAKC 3CFDB 4C4KT 5FDWA 4R96B 2KL6A 4L9LA 1CIUA 2ZKOA 1FDLL 3LEXA 4ES8A 3NT0A 2DM4A 1EGJA 5DTFB 1NOFA 4NN7C 5CNHA 3VXRD 3ZZQA 2ADYA 2NOYA 5CLTA 3TEYA 4RMVA 2ZZUT 2HX9A 1MHPH 1JG9A 4B41A 2ZXAA 1J12A 4QXUL 1Q81W 1UA3A 2FWOA 3SBPA 4OQTH 1TJHH 3LNIA 2ZCKL 1CT8B 2WN2A 2CBOA 3U7YL 4AQEA 4K5OA 4JL2A 3TNMB 2LP7A 2XAGA 4QHMA 2Y06H 3MNWA 1URFA 1EQWA 1TCRB 3M7OA 5FO9A 4JTAB 2EYTB 4GMSL 1OTSD 2XPZA 3HN5A 2VXQH 4LVNC 5D7LA 3MLSL 1MJ8L 3S7GA 3VFNA 5M95B 1DN2A 3MJ8A 4QT5B 2YPKB 2CJ3A 3RGBA 3RILA 4A2EA 1IBZA 5KA6A 3L2NA 4X6CF 5E6ZA 2ZXGA 2ZWZA 4DP9X 1FGVH 1YNLL 4PJCB 2HFEC 5CUSL 5T5NF 4F92B 2PZSA 5CGYC 3FBQA 1XCTA 2H6PB 2OZ4L 3CHPA 2CALA 2DD8H 5EU3A 4ETQB 2FJGA 5EIQA 5AW8B 3MLUH 4NXNB 4GUNA 3DBXA 3UTQA 2HG0A 1HESA 4X98B 5F9JA 2O4EA 3ZT5A 6FABH 3GSOA 1MHEB 2ZE5A 5E94A 1MNGA 1EANA 4KVPA 3F7VB 2X4OB 4ZSOB 3TU6A 4ADJA 4JZGA 3LDBC 5CEZE 4ZUWB 1M1XA 5HI4D 2Z31A 2CIIB 4HJGA 3E83A 5FGCE 3W5NA 3NFSL 5DRNB 3KJ6L 1JPGB 4I9WE 3BMVA 5C0IA 5FUOH 1KGCE 2CCWA 3QQNA 2OULB 2EC8A 4HA1A 5E4EB 2X9XA 1U93B 5H35B 3UAJD 4PRPE 3WIHA 2YAPA 1AFVL 4NRYB 1FZMA 2W8CA 2Y5TB 1TOXA 4PBDA 3DI3B 1OTTD 2HB0A 3BP4B 3OEEG 2X44D 4JANB 4ZSOE 4WFFD 1I5XA 3BP5B 4LFAB 1G1XB 3V4VL 5DMYA 1WYJA 1CXHA 3U9WA 3IFLL 4TS6A 4XMKL 2CDGB 2COVD 2NR6D 3K6SB 3GSXA 4DR3O 5B1BB 2LE9A 3QGVA 3FUFA 3LIZL 5FF6B 5FK9B 1EWHA 2EQDA 3HKDA 2X0LA