5B3SB

Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 k)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 69
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b3sB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b3sB02
4KO7A 2FT8A 1BQKA 1L9TA 2XLLA 2PPFA 2LLNA 2CBPA 2FQGA 1N68A 2PCFA 4EF3A 2BZCA 3S3CB 2CALA 2PPAA 1PZBA 2XX1A 4A2DA 3CVCA 4NB7A 3ERXA 2HZHA 3FU7B 1WA0X 2QDWA 1ID2A 3EH3B 1XMEB 1TEFA 1SHXA 3FSVA 1J9QA 1SFHA 3FSZA 2UXTA 2EIMB 2AFNA 4E9YA 1RCYA 5D4HA 1E30A 4KNTA 1UATA 5I6MA 4E9TA 1AOZA 2BP8A 4TXVB 1NDTA 1X9UA 4P5RA 3X1NA 3MX0B 1BYOA 1W6LA 4AX3A 3CDZB 2YAPA 3KW7A 4HIPA 1KYAA 4F7KA 4BWUA 2JXMA 1BXAA 1IKOP 4KO6A 1PLAA 2VSKB 4GP5B 4Q8BA 1ZIBA 2R7EB 3WI9A 5I6OA 4YSQA 3FU8A 1NIDA 3PAVA 1HAWA 3T6WA 3AG3B 1JOIA 1PLBA 1SDDB 1BXUA 1M57B 2DWTA 2DY2A 3QJSB 3NP3A 2J57A 1URIA 1ZDQA 2HX8A 1FFTB 2YXWA 5I6NA 2AANA 4BDVB 2FWLB 1NTDA 2JFCA 3V9EA 1ASOA 4AKOA 2YAFA 2WO3B 3NSYA 4YSEA 4JKNA 3NJFA 1SF3A 3T6VA 4DP5X 1A65A 4E9QA 5E9NA 5B7MA 1IUZA 1NIFA 1AS8A 3TBCA 3DTUB 3ASOB 5D4IA 2YAEA 2Q5BA 4DPBX 3SBPA 1MZZA 1IC0A 2XV3A 1J9SA 1AQ8A 5PAZA 3ABGA 1KDJA 1JZHA 2PP7A 2YAOA 1JZEA 1JVOA 5I6PA 1EZLA 2FQEA 1RZQA 2EIJB 2XV2A 2PPCA 4UANA 2UXFA 1ET7A 2DWSA 2BP0A 3WNIA 5AFAA 1NINA 4DP0X 4E9WA 1BAWA 4YSTA 2I85A 2AZUA 5D4JA 4UAHA 3H56A 3NJGA 4G72B 1ETJA 4QLWA 3ZIYA 3GYRA 2FT6A 4NAJA 5PCYA 1NIBA 1BQ5A 3CVDA 4G7SB 1T5KA 3U25A 1X9RA 1BYPA 4YSPA 1A4BA 4YSSA 1IBZA 4G7RB 3RYMA 2IWKA 3ABMB 1CYWA 2XXFA 3JT2A 3QJTB 1NIEA 2BWDA 4F2FA 2HLEB 3PLYA 4HZ1A 5A7EA 3CDZA 3NSCA 1L9OA 1E5ZA 3WKQA 4YSDA 3V9CA 4AKQA 1SNRA 4RH4A 3AG4B 1N70A 3SQRA 4JHUA 1WA1X 3OM3B 1W8EA 4E9XA 1RZPA 3AW5A 4P5SA 4YVUA 1JERA 1L9RA 4WKXA 1GY2A 1BXVA 1TEGA 2XVBA 3NJLA 1NIAA 1JZGA 2GI0A 5I28A 3G5WA 2IWEA 2XV0A 3OD3A 3CZUB 2YAHA 1WA2X 3FQ1A 2YEVB 3FSAA 4F2EA 2HX9A 4HALA 2GHZA 3WKPA 1OE2A 3S8GB 1W6WA 3DKHA 4YSOA 1TKWA 5AZUA 3X1GA 2GC4C 1M56B 2BW4A 1PCSA 2HX7A 4QKTA 1HAUA 1AR1B 1DZ0A 2BW5A 4YSAA 2VSMB 2CJ3A 3PAUA 1CUOA 2CCWA 5B7EA 3PPSA 1I53A 1OOWA 3HEIB 2EINB 1AG0A 4GY4A 2FQFA 2UX7A 2XX0A 1TU2A 1L9PA 2VW7A 4M4RB 3AG2B 2IDUA 3IBOA 1OCCB 2Y69B 1JZFA 4GXFA 3FPYA 1BQRA 4DP8X 5I5IA 2AZAA 3X1FA 1SHWA 3AY2A 1XB6A 1AANA 1OE1A 2OCCB 1B3IA 2QDVA 4DPCX 3L45A 3NJMA 4BWWA 3CG8A 2H3XC 3WG7B 1AZNA 4A2GA 4GP4B 6PCYA 3ZBMA 3OMNB 1SDDA 3T6ZA 3UABA 4E9VA 3WNJA 1BEXA 2R7EA 1KCWA 3SBQA 1AS6A 3OMIB 2QPEB 2CUAA 4FA7B 1EHKB 4G7QB 2FTAA 2DV6A 5LDUA 2TSBA 3D12B 3EF4A 3S8FB 1FWXA 4KNUA 1WAEA 3FU7A 2W88A 2E86A 1GS8A 3NJNA 1FA4A 1PF3A 1E67A 5B1JC 3JTBA 4YSRA 5I5JA 4AI7A 3EH4B 4N4YB 2I7OA 1JXGA 1WS8A 2A3TA 3WIAA 3ASNB 3QJUB 2WO2B 8PAZA 2J55A 4KO9A 1CC3A 4AKPA 2NRDA 1KGYE 2BP0B 3BVDB 1MG3C 2X87A 1L9QA 6PAZA 3FYIB 1PNDA 2XXGA 1NZRA 3FYEB 2XWZA 2YAMA 1OV8A 4WTQA 2PP9A 2DYSB 3IE9A 2XYBA 1A8ZA 3N55A 1MDAA 3FS9A 3MBWB 2OJ1A 1QNIA 1ZDSA 3ZX1A 1OE3A 3EH5B 1CURA 1E5YA 4E9RA 1R1CA 2QPDB 2YARA 3FU9A 1YLBB 3NP4A 1ET8A 2Y1AA 3X1EA 1AZUA 3X2QB 1AAJA 4M3HA 9PCYA 4YSUA 1PY0A 2XUWA 2I7SA 5I26A 2EIKB 4A2HA 3PAZA 2J56A 2HRHA 1OCRB 2MTAA 1AZBA 2P80A 1ASQA 1AS7A 4Q89A 4A67A 5B1KA 2VM4A 4JHVA 4YL4A 1ZIAA 3UGEA 2BO0A 3ABKB 4CSZA 2GSMB 1JXFA 4DP7X 2PPEA 3SBRA 4BXSV 4HAKA 1SFDA 2VN3A 3S3DB 5TK2A 1QLEB 1KDIA 2BZ7A 4ZK8A 3QJVB 3ZDWA 1PZCA 3UACA 2FNWA 1J9RA 3NSDA 2YQBA 2FJSA 1PMYA 1PLCA 1IBYA 3H4FA 2IDTA 3FQYA 2P80D 3UAAA 2YXVA 4X4KA 3GDCA 1PZAA 3FPXA 1E65A 1A4AA 2H47C 1V54B 3NSFA 1JZIA 2ZXWB 4HHWA 2PLTA 3NJIA 2J5WA 2UXGA 2HXAA 4PCYA 4G70B 4HCFA 1PNCA 5TK4A 5AKRA 4YVNA 4E9SA 1AZCA 1XB8A 1GR7A 1XB3A 1J5CA 3GXUB 3NT0A 1ASPA 2GBAA 1ILSA 3TU6A 1KCBA 3T71A 5ANHA 4DP1X 3PXLA 3QQXA 1KV7A 2YAQA 5F7BA 3KW8A 3N2JA 4MFHA 2B08A 2BP8B 1WS7A 2FQDA 1GYCA 3PCYA 4A66A 2IH9A 1ADWA 5I5MA 1M9WA 2VMJA 2WSDA 4UF7C 1AIZA 5B1BB 3CVBA 1V55B 1AACA 4GYBA 3NJHA 5EHFA 4BK5C 1A3ZA 3NJJA 3FT0A 4KNSA 4AZUA 1AZRA 1VLXA 3FQ2A 2DYRB 1QHQA 3EHBB 1KBWA 3DIVA 1L9SA 2IDSA 3NYKA 4KOCA 4K9JA 1GS6X 1CYXA 4DP9X 5F7AA 3TA4D 2JKWA 4W9ZA 2GIMA 2FT7A 2X88A 2B3IA 3BQVA 2AVFA 4HCGA 1ZV2A 3X1BA 1OCOB 1GY1A 2OV0A 3H4HA 4BWTA 4YSCA 5I6KA 2N0MA 3OMAB 1PAZA 4N8UA 4GP8B 4NERA 2PP8A 1RKRA 4L0PB 3QPKA 3T9WA 4KOBA 4A68A 3S3BB 1A4CA 2BHFA 1ZPUA 2GC7C 2Q9OA 1JVLA 2IDQA 3AZUA 4BXVA 4DP4X 4PAZA 1DYZA 2W8CA 2CAKA 1OF0A 3IN2A 2HRGA 3FSWA 1KBVA 2RACA 2TSAA 1GW0A 3QJRB 1ET5A 1AG6A 1MG2C 3TBBA 2VW4A 1JZJA 4DP2X 3OQRA 2UXVA 3ABLB 2H5UA 1F56A 4CSPA 1MZYA 2IH8A 1J5DA 4HCIA 5FC9A 2IAAC 4A2FA 3UAEA 5IY5B 3IN0A 4A2EA 2EILB 1NWOA 1V10A 1ILUA 4KO5A 4W1TA 3QJQB 7PAZA 5B1AB 1GSKA 2IWFA 1OCZB 2XU9A 1NICA 1J9TA 1JXDA 1NPNA 2VM3A 2GB2A 4DP6X 5B7FA 1GS7A 4ENZA 1SF5A 1SJMA 2ZWNA 4DPAX 2IDFA 7PCYA 1NWPA 4BDVA 2UX6A 2VW6A 2QT6A 2BWIA 2ZOOA 3TASA 3HB3B 1NPJA 2PCYA 3C75A 4FAAB 5I6LA 5B3SB 3T6XA 3NJKA 5B1JA 2MRYA 3AG1B 2PPDA 2ZONA 3UADA 4G71B 4HHGA 1HFUA 3IEAA
chains in the Genus database with same CATH superfamily
4TTDD 4B9GA 1BQKA 3TV3L 2IMMA 5B1AC 3FKUS 3ARBD 5DJAB 5FUOL 2XQ0A 5ADPH 3ILEA 3HIZA 2DAVA 2BZCA 4ZAKB 3ZJZA 1F23A 1U91B 2BC4B 2ZUWA 4AOFA 5T3ZE 3FQ4A 1LK3H 5LG6A 1HCFX 5ID0B 3GEWB 3PJNA 1EFXA 1CGUA 1DSWA 1NCAL 3FQWB 4AC4A 1Q8IA 1ZT7B 3MCYA 4QF1B 4BQCA 4C83B 2C4FT 2OMYA 1EAPA 1GMGA 2BSKA 4X64B 1OT4A 4HBQA 3MJ9H 4IU3B 1HEHC 5KS9A 5B4MC 1YJDH 3SDDB 4X8XA 2VC2B 4LCWD 4OQ1A 4PTTB 5E8EB 4BWUA 3AUVA 4J39A 4R7DB 3TFKC 3AU1A 2UZYB 3CH1B 1IEAA 5KUMA 3OSKA 2UXBB 3EJUA 3L4VA 2QFPA 4NQVA 4PDRA 1AI5A 1ZIBA 2JTDA 2X4TA 4X7FC 4AJVA 2CDFA 3FU8A 2M1KA 1QYGL 3OR7B 4ZS6C 2Y2TA 4FQXC 3T65B 1W0YT 5ADOH 1S76D 1S9YA 1K4DA 1LNUA 1MUJA 3IJHA 4PJBA 3TIDA 3W0WB 1C1EL 5KBNC 1H3PH 1DVFC 4ZFZA 4HVBA 4WEUD 1G7PB 4FYSA 3MRFB 1FIGH 4O4JA 1TITA 1PKQA 1WCBA 5LMUB 4H8UA 4JRLA 4F37F 2YAFA 4NNYB 1A6VH 1K8DB 4JDVB 5F7EL 5EDXA 3ZY7A 3ULVC 4DUZB 1F41A 1QX1A 1I3UA 3HG2A 3RUGF 4EDXB 3GMOA 2QR0B 4P5TA 3TO2B 5T1MA 4X4XA 5HYIA 4LU5L 4GFXA 2E6PA 4XODA 4MD5A 3V0FA 3VFWA 4AYGA 1WP8A 3AM8C 4GRLB 3WKQA 3IAPA 4F58L 3DV6A 4LDEB 5JYLA 3LJ3A 3REVA 3TVMA 3RVTD 1PS3A 5HHOB 4I18C 2PP7A 2YAOA 3EYFA 4KK8C 3NH7H 1UG9A 1HHJB 4TLKA 4OVUA 4W6YB 5D5PA 2XV2A 2PPCA 4WTXA 4M1GH 1DJZA 5AVVB 5FM4A 3T4DA 3QEUB 1YEKH 4QXUL 1FVEB 5B38G 3RDJA 2JJSC 5IG7A 1B3QA 5EIBC 4TVPE 3D0VB 4GMTL 1NCDH 2N7AA 4PP1D 3X11B 3ZHSA 1KGCD 3N42F 1Q72L 2OMWB 3QXAB 4TUOB 3K6SA 5LP6B 1P49A 3GRWA 3V7AG 3T0XA 5HJGA 1ZGLA 3UZQB 3II3A 1CXZB 2HJFC 1IVLA 3ZIYA 4NKOA 4QJ3B 5FW8A 2D7TL 4LSVL 4O51A 1EHAA 3WKMH 1EFRG 3QEGL 3VW3L 3C8HA 5AVYB 4RQQB 4UUJC 4YHLL 4ZOLB 5BMFL 1DDHB 1A4BA 5BPPA 1IBHA 1YMMB 5KA5A 2IPUK 3RYMA 3VWKB 4RGNB 3VFUA 3OF6A 4LLYA 1Z0NA 5ITBL 5EZJB 3D33A 3D1MC 3QJTB 2VZ1A 3BA8A 3GBNL 3GSXB 5A7EA 1LL1A 1L9OA 5F0JB 4L1SA 5T5NG 1FSKB 3G5VA 3HPLB 2Q3AA 4YDKH 2GY7B 4P2OA 1WA1X 4U33A 3OZ9L 5DGQA 3VQMA 4BCYA 3VTAA 4LOUD 2N1TE 4P5SA 5CSGA 5G4MA 4BFIB 4CILA 1KXVA 2A83B 3EO9L 1GOHA 4L4TD 2Y3AA 3PFUA 4R4ND 3HE6B 2XV0A 4L4VB 4F24A 1ZEAL 1RUQL 4PRNA 1OKEA 1MIEH 4NKOB 1JK9B 2K8QA 4HDIA 4NSKA 4Z3JA 1HE7A 2GABA 5HPOA 1KLGA 2QWRB 4JZ2A 5D2LA 4OBSA 2WBJC 4LNUA 2RIKA 4N2HA 2R8SL 4PS7A 3ML8A 4KJQC 2D0HA 3RGVA 3L4TA 4MA3A 4O2CB 1BMFG 2EVFA 5DD6A 1ENVA 1Q0EA 2VLMD 4TKWA 4BIUA 4QY8A 1IKFL 5E79Z 5IWAO 3PGCA 2UX7A 2GT9B 3JUYA 4Q6IC 2NNRA 1WEJH 2Y25A 5A6LA 4A7UA 1P5UC 1JFQL 1OCCB 5MEOA 4N0FB 3MV9D 3WY1A 8FABA 3HCVB 3SPGA 3JARA 1EAPB 4D9RE 2DJ4A 5E7FA 1BVZA 2V2TA 1EANA 1PL4A 1GIGH 1OE1A 2QVKA 4EIUA 3BGMA 2HPTA 3GMRA 1ZWIC 2EO7A 3CG8A 3AWGA 4PJBF 5ECJE 4ZPVA 5LGUA 3FCTA 4P57B 4YFDB 3QXDA 1LDPL 5JVDA 5C0NC 4ZPTA 3LX9A 5GRUL 4Y4KC 1MN4A 5LHGA 3G71V 5AG9A 3FQNA 4WO4B 3ZRFC 1RUAH 1BFOB 1U6AH 4GRMA 2FTAA 4ZBJA 4LF3B 3LZPA 2E6QA 1S9YB 3EW3B 2OZNA 3D4GA 4LH7A 4Z1MG 3HE6D 3KYKL 1GYWA 1E90A 1WAEA 1EQWA 1I8UA 2LOEA 4JFEA 4PJ6A 1SXZA 5ISZB 5D4JA 1ES0B 1L5GB 2DQIH 2NYKA 4PBXA 4TVPD 1T0PB 3P11L 4OZIE 3FUDA 3NTCL 2BSTB 3KYKH 1E28A 4RGOH 5SWZE 4XPTH 3NESA 3HKZA 3QDGE 4Y9GA 4KX7A 1CL7I 4PJ7A 2WYIA 3EUUA 3MV9E 1ETB1 1A6ZA 2PI5A 1QTPA 4FOMA 2ZT9C 3PS6A 4MCYA 5EU3A 1KGUA 3F2LA 1GJUA 3F85A 4NO3A 3X3GL 3V4VL 5EO9A 4CVXB 1E4WH 2Z4TA 5IDJA 2WTOA 4WFGE 1LDPH 1JJOA 3V10A 4HS3B 3GC3A 4X5PA 4TT3G 4OZIA 4FI7A 5KHGA 4C4KT 4WTQA 1R34A 3IE9A 4DV7O 4U05A 3ATDA 2E7LA 2J8HA 4KQ4H 4HWNA 5KOMC 3SE6A 3ZDZF 5DLML 3ARSA 3ETDA 3IGKA 4XNXL 5KAFZ 1KJ2A 3DC6A 1CGYA 4OLZH 1JE6A 5HDBF 4H2AA 1NL0L 3ABKC 4JPVL 3JV6A 2H2SD 3BZFA 3LXUX 4MAYC 1FFRA 2A2QT 4YR6B 5ISZD 3CDYA 3G4SV 2ROYA 5J12C 4YHML 1SETA 3UO1L 4BZYA 3C5JB 5IEKB 5JUEL 3IGUA 4QUOA 2HHHB 1X5XA 2W59A 5I66A 3C90A 1X6LA 5GRVK 4HIJB 3U36A 3BH8A 3DMMC 1EUUA 3ATAA 4JAMA 4HOZA 3L48A 4P2QA 2ZSVB 3V4UL 3ZE0B 2BY1A 3LQAL 3ZHRA 5INDB 4YOKA 3OL2A 3K2UH 1C7TA 4JFHD 2WNWA 5IWAB 3T0BA 2APSA 2ICEC 2B9BA 1ASQA 4PUBH 4PWIA 2DD8H 3HFMH 4GRWH 1SZXA 4KKCD 1U3HD 4PJGB 5D1ZB 2HH0L 4UTBA 3GKWH 2KDGA 3GXMA 4ZPVB 1LEGA 3QNZA 2D31B 3TCXA 3W0WD 4YL4A 2R23A 1PL3A 1ZIAA 3LTVA 4P4KC 3AMKA 3AK1A 1I85C 2GVYA 3GHBH 2KZKA 4OFPA 3TYFA 4BM7A 5L8LB 4DP7X 1FNGB 5JQ6H 4Y8AA 2WZAA 4QAWA 2ZAGA 2OJZH 1QRND 5IK3B 1G1XB 5F3HA 5EOTA 2Z9TA 3Q2CA 4APXB 3UCQA 4JM0A 5DYOB 5CBGA 1UJ3A 1MLBA 2NY7H 5I2IB 2PYEA 4ODWA 4O02B 3CFKB 3K5RA 3AQYA 3UAAA 1U3YA 4LBEA 4MHHI 3RWRD 1SXSA 5LWYL 1FZOB 5JIQA 3UAJC 1ZS8A 1XH3B 2VO5A 3N44F 3BP5B 3OB0K 2FWUA 1DO5A 1G9ML 3GXDA 3P2TA 3SB3A 4PBWD 1YEIL 4WK0B 4L8BA 3QR2A 3D36C 1QLRB 3C2AH 4H1LB 4D8OA 2PTVA 3MODH 1AZCA 2XN9D 4PWHA 3NZ8B 5C0EB 3BUDA 3L9RB 2PGGA 3P73A 4M43L 1KCKA 2G75A 4XN1A 2AXTZ 5E2UL 3T71A 2YKLL 5ANHA 3T2NL 3IU3A 3PXLA 3QQXA 4IIJA 3MACH 1RSFA 3ET9F 1YEGH 2HLDG 1DF5A 2Y06H 4IHJA 4OGXL 3HA0A 1EZVH 4ZPTB 4ICWA 3ZPDA 1ZY9A 5DHXB 1QLNA 4N8CL 1O5PA 5DK2B 1UD5A 1U8LA 1PD3A 4PBVC 4QOKD 2CBOA 3NAAH 1OCOC 2PO6D 4H26B 2YN5A 1OSZA 2XWTA 1XGYL 3VXTB 1NFDA 4TQFA 1V54C 1MJ8H 4WFGD 2IFFH 3UTTD 4Q4IA 4HULB 4IEFA 4MXQC 4MVUA 4Y1SA 3NCEB 4NFDA 3UYPB 1ZSPA 3H9HA 3HAEA 2R9RB 1U92B 2BIQA 3EYOA 4X7TA 2R4SH 3RIAF 2IAMB 2WNGA 2Q7GA 1QQDB 4XPBH 1RZJL 1WJ3A 3TF7C 1BCCH 1JHLH 4IDJL 4I87A 4K8RH 1JPGB 2MKWA 2IOIA 2PY5A 3IM1A 5FA4B 1VFBB 4O5LH 3TA3D 1P4UA 5FNVA 1G87A 1JRHI 1P5VB 3K0YA 5DHVB 5DK0A 1NR1A 3QYMA 3QTCA 2R56L 4OZIF 3IPBA 1E7VA 4LIQL 6FABL 2Y07H 4JI7B 2H7WA 1ZSDA 3TWCH 5B8CB 3OMAB 4UV4H 4Q2ZA 4LB8A 2K9PA 1P6FA 1ZHBB 3BH4A 2E8ZA 1RERA 3ECBA 2XYCA 1IXMA 1ZXQA 4R6UA 5F88A 4NX0A 2I9TB 2HRPH 2BWQA 5I1CH 1GAXA 5CD5C 4MBOA 4YLQT 3ULVD 2WIIA 3Q2WA 2WINA 3MXVL 4U49A 3GI8H 4PR5B 4FQXB 3KHQA 1CLVA 1NGXA 4WU5A 1Z0MA 2FAUA 3TH4T 4I0KA 2JV6A 5D1QB 4YHHO 4G8FB 3BFWA 1HXKA 4P2AA 1G1OA 3E8UL 7FABL 1M6UA 2RH0A 3E22A 2UUBB 1UA6L 2UXVA 2X09A 3L3IB 1EZSA 3FNKA 3SE8L 1QLRA 3NFSH 4P06A 2EILC 4QNHB 2AI0L 3QI9C 2E7HA 1A66A 4IMKC 4LRIA 3VFVA 1T1ZB 2K7QA 1PD1A 4OIIL 5E6RB 1TZ8A 5D72L 3RVXD 3QDGD 5LBGA 4JUTA 1UA6H 2D03L 2RDCA 1DL7H 2MMXA 3ZTDC 4OBRA 1NM9A 4GAYA 5EO0A 1ILUA 4W1TA 4R90H 4ABUA 4EN3A 3MHSC 4X50A 3V5HB 1NPNA 2YKKA 4DR1B 5KYUB 4HFWA 4ABWA 1XGPA 2H1PL 2YRZA 4OT1H 4H88H 1SJMA 3CWBH 2XC8A 3NZSA 5C0DA 3K2IA 4OM0H 4ZYKA 2XWTB 2JKIS 2V9UA 1T7XA 1SOKA 1ZT4A 4NO0D 1JFFA 3QORD 4D0CB 3P3YA 2PYFA 3OG6B 3SJBC 1ADQH 1TQTA 1MJJB 3EVKA 4OF3A 5HDQL 4K94L 3HPLA 4NXNO 1AI1H 4PREA 3VFPB 5AL8A 4F27A 3OKMA 2PPDA 3MD0A 1CGSL 1XH0A 1G4RA 4LF8O 3FUFA 2ICWJ 2E75B 3P73B 1TYEB 2H6PA 5TE6L 4E36A 1HFUA 5DJCB 2JJTC 3ZRXA 3HC2A 3B43A 2QJ1A 4IBZA 3VVVA 1U30A 3W37A 5IR1B 3X11A 2H8PA 3VI3A 3L3HB 5ETUB 1L7TH 3BISA 5DHVA 3H7BB 5DK0B 3SYOA 1FAIL 5KBDA 3CVCA 5LMNO 3ERXA 3HHSA 5I8CA 1FO0B 1XGRB 4KMTL 3ESUF 4YO0A 4NOFA 1I9IH 3FSVA 5AD0B 1JL8A 3ORJA 1FNLA 3L7FB 4DUVA 1ZS2A 4KJQD 5DFWH 2HWZL 1TTAA 3H3BC 2IJ0C 2O5ZL 3L4XA 4W9KC 3WDHA 1XBLA 4JR9L 1DN2A 4UYQA 1XAUA 4QYOA 4XNYH 4AVJA 1O9WA 3IDUA 4OT1L 3TBSB 1A4JB 3BGFB 3G3LA 2BVPB 4J3OG 3MLVH 5HHNA 5LQBH 1U8MB 4ZMWA 2YO3A 3U7YL 1PLAA 3GB7B 3ZE1B 5T33H 3FAVA 2C7UA 3E0GA 3Q2LA 3Q8EA 1Y76B 4GP5B 4DR2B 4NO2B 4JGMA 4I3RH 4NXNB 5C0RL 4FZEL 3N2GA 3WIFA 2GBTA 1RZKC 5CU9A 3I9GH 3K1KC 4MX7B 5D55A 2DY2A 4QHUB 4FNSA 4PA6A 1I1CA 2DD8L 4N8VB 1CK0L 3SYPA 2VERA 2YQ3A 1GZHA 2AAVA 4CGUB 2JJWA 4JFVA 5AEAA 3STLA 1WK0A 1ASOA 3V9EA 5GRWA 4YFLI 4YSEA 5MEND 4XTRC 3P4MA 4RWYH 5EU7C 1RZFL 2P7TB 4HKJB 4GPVA 3ILPB 5G4NA 3MOBH 1S9WA 4HGWB 5L4MA 3TBCA 3DTUB 5DJZA 3ASOB 4X5XA 3IWVA 3DVNA 2OK0L 1M6OB 4KJPD 3EDDA 3UXFA 5IQ7H 3KL5A 3SBPA 4HWEL 3UEZA 4DV2B 1RPRA 5CMAA 1VGKA 1T4KB 1NBVL 4JDEA 4NQDB 4DN4L 4GUNA 1F4HA 5FOBB 2DEYX 2WN3A 1Q3EA 1DDTA 3O81A 4I0XB 4WO4C 5LNGA 3DARA 5I8KL 5CEXA 3HN8A 1MKFA 5EV7A 5IV2A 4P23A 3FO2A 3MKGA 5KMGA 2NOYA 4QR7A 1J0ZA 4BHUI 1KEGL 1DN0B 4NQQA 1HILB 4LVOC 3DMMA 3WIHH 1I9RL 4DEPB 2Y7LA 2DQEH 1NBYA 2R69H 3LKRA 4ABQA 3ZO0A 1SBSL 3QEQA 1N36O 2B59B 2WKOF 3ZDYE 2F1EA 3GIVA 1T6BX 2AP2A 3H9VA 3ZHVA 4FFZA 4PLKD 2LVEA 4PY8I 1QFUL 4JFOB 1UOVA 2R69A 1IAKA 5KA6A 3CEIA 1T2QL 1T5KA 3WXVH 1X9RA 2FX7H 1H0DB 4JI0B 5E1AC 4FFZH 1IGFL 4XBGB 3LVEA 3O41A 3WFBL 4PRIE 1B0IA 1J0IA 4U6YA 1XGTB 3K9AA 4WBNB 2IWKA 3JT2A 3KYOB 4D9QE 2CR0A 1I94B 4HWEH 2YI9A 1MCSA 1XF3B 3P9MA 4JO4H 4MDJB 5DUJA 1B06A 1A1MB 3A6CL 2DW5A 5GGQH 1V7NH 3UJIH 4D7PA 2R4RL 2WAHA 3V6FA 3SGIA 3GNMH 3WKML 4WI2A 2HAZA 4FFVD 3CBJB 2BRRL 4WCYH 3H8NA 4AIXA 1VQ4V 1S7XB 1K92A 3EFDL 1XHXA 1Y6MR 3LS4H 4LCWB 3D7PA 4B27A 5HGDA 2WUCH 3D3IA 1RIHH 3D3VA 3HG3A 4KKCC 5HGBB 3WFZA 5FB8B 4PJ5E 5DVNA 4PS3A 1IGML 1XH1A 5J12B 2BVQB 3SYCA 3S8GB 2HTLC 4YXKL 3QIBC 3G08A 4QXUH 5ESQA 1TA8A 1OAQL 1NBQA 3WKNA 4CW1B 1CE1L 3NCWA 4JM2C 2YRPA 2DLGA 4GAGL 5LHIA 2HTLD 2JJTA 2VT0A 5DJXB 3ZKXB 2C9XA 1YYMH 1FYHB 3PAUA 4FP8L 3GHEH 1LXMA 5EULV 5TPWL 1I53A 2YIBA 5I82A 4MJ6B 2Y36L 2VO8A 5EOCH 1U4EA 3GSOB 1RIVH 4MXQD 1L9PA 1QI5A 1BHAA 1NANI 4KVNL 5D1ZC 1JZFA 4JFED 4DP8X 3GHEL 3X1FA 2A9AA 4LAJH 4FXKB 1VGEH 3LN9A 1A3LL 1GGBL 3V6OE 5I19L 1IB5A 4HK3J 5JXAL 1I94O 2AEWA 1NS1A 3ZRVA 1AANA 1N26A 4R8WL 4BW9A 3Q43A 4EUPA 4MXVE 2FJGA 3B1UA 4I1NB 5MENB 4HPYH 3RWDA 3TEZA 1XZ0B 4E9VA 5JHLH 3SKJH 1CB4A 1I4FB 4ZXBD 3NN8A 5IROD 3CRQA 1RJCA 3RIAK 5DWPA 4QIRA 3RYIB 4W9IC 2OZ4A 3VGBA 1DF4A 1B3JA 3EFDH 4MJJA 1NTMH 2ATKB 4OIAA 4G7QB 2CNZA 2AKRB 5JHLA 2WUCL 1EUTA 5EIIB 3I75B 2HG5B 2E76B 4LEOA 2Y5EA 2WXHA 1YEEH 2HKHH 5DRZB 1P1ZA 3FRUB 4G8GD 3OB0H 5GONB 4O4YL 4XGZB 3U0ZA 1INEH 1PF3A 2VDQH 3E1ZA 3HG5A 3KH3A 5I5JA 2EULA 3RVVC 4JHZA 3W57A 2A3TA 4OM0L 5T3XH 1KWGA 2DW4A 1R3KB 4X4ME 4X80H 3OXSA 1HSBA 4IS6B 3KWWA 4OCRL 1S7UB 4U7OA 4I9QA 1XAKA 3D85B 4MNHA 4XMXA 2EDFA 3BT0A 3B2XA 2NRDA 3HKDA 4JI5O 4R26L 4IRJD 3I50H 4FFVC 3C6LD 3JD4A 2NLJB 4P46B 1DK1A 3AK3A 1VQ6V 1CLZL 3DTXA 1MW3A 2CDEB 2I5YH 5IJ9B 1OV8A 3RI5K 4AM0Q 5A2KH 3TJEH 1IMHC 2XFXB 4HUVB 4YJ3B 1IQDB 1YF2A 4IDLA 3QC5X 3FS9A 4FG6C 1QNIA 4Z7NF 3MV8A 5DQJA 3D8CA 4ZO7A 4ELKA 4KAQL 2ROXA 4AW7A 4Z3TA 4K71B 4Q2ZB 4Z77B 4JRWA 4DUYB 2R1XB 1QSEE 2VLKA 3RWCA 3GM8A 1IM3B 4CGTA 3GS4A 2BTOA 4EBQH 3HFFA 1PFOA 4LLUB 2C3GA 4CJ1A 5I17A 2EEDA 1AKPA 5EBMA 2Z1PA 3SDYH 3NRQA 1RXLA 1HCZA 1U8HB 3SDXF 4W9JC 4PW4A 1TZIA 1DBJH 1BFSA 4P07A 1WZ1L 1RFDH 3LKNB 4W4KA 4J6RH 3Q2NA 3QIUA 1L7IH 2X2UA 5E2WL 1NL0H 3DGEA 2IAMA 2X4UA 1XNRO 4K0KO 4NPJA 4W93A 5CCJA 4D7BA 1VF5C 4DK3A 4AVHA 1G9HA 4QHLA 5I1AA 2EH7H 2GTQA 3U9UA 2DJUA 4N2IA 4NUPA 5AVQB 4YX2L 2GUZA 1FRGL 1XXFC 4MHHG 1X6NA 2BRQA 3ZRSA 3FOMB 3DX0A 3VWJA 3JSNA 3CZJA 3UIYA 3K5MA 1GZQA 5E8OB 3LNHA 1T89A 4RFEA 5J6HA 4OX9O 4L05A 1KC5H 1LEIA 4TV3A 3B4SA 4K3DL 3D0AA 4FJCC 1UC6A 3O9OA 2G38A 1UM6H 4Y9CA 3A5VA 3HZYA 1GGIL 3LKPB 2X7LA 1B04A 5G55A 1AGDA 1E2WA 4RFNC 1J9RA 5HHVL 3VRLE 4IOIB 2RGSA 3DJTA 4CW1A 1D7CA 3LKSA 3RL1A 4RQFA 1G94A 2BINA 2QKIB 1PMYA 1BF8A 4PRPE 1J18A 3QPQC 2EJ1A 3CJJA 5LL6Y 1J11A 3D36A 4M4RA 3NIFE 2BNUA 4OLEA 2ZUVA 5FO8B 1RIUH 3VXOA 4YY3B 1K34A 3BAAA 4L4VE 3WTUA 4QNPF 1NC4B 5CEZE 5JIDA 1IL1B 1CFVH 5EOQH 5BXFB 1I9IL 2J5WA 1FN4B 1RY7B 4Y9EA 2JI2A 4EOWL 2YIAA 3W7XA 2BXYA 4MS8D 4NKMB 5FW6A 4BH7A 1XB8A 1PU0A 2CK0L 4OUOA 3QVNA 3KS0H 4PRPA 1IM9D 2X9ZA 5DZNA 1N5YH 5JJEB 1MSWD 1UT1A 1P84F 3AG7A 4TULH 1QLFB 3QQ4B 2J3SA 3MV8E 5C07D 3DOSB 2IVFC 4JDTH 3ATFA 1KTLA 2VQEO 4YX2H 2D3VA 3GWOA 5IEKA 3GJFB 3QXVA 2ZIMA 4P59H 5D1XB 5DQDL 3T1YO 1IBBA 4OZFB 3GI9L 3KWUA 2P8PA 5MEQB 2FECL 2NY5H 4LT7A 3T0EC 1BHGA 5DMKA 4UF7C 3CH8A 4MDIB 1V55B 1GJWA 1DUZA 3N1GC 1O9VA 1K6QL 5JR1H 3IRZA 4U1JA 3FHQA 4BK5C 3JV5A 5HHPA 2E75C 3B5GA 1C08A 4U1HA 4GSQA 3HS8A 1CS6A 2VC2H 4PJFE 1R3HA 3EO1B 4PYHA 5E2VH 4G80A 4HHAB 4AZ8B 3EHBB 1G6RH 3F7VC 1IEBB 1YPZA 3TV8A 2FHCA 4PRBB 2F95B 3RUGE 3MLSL 2OMNA 1KD1W 3DETD 5AYUL 3TWYA 2WNKA 2O57A 5BV7L 4FS0A 4DV4O 2CHXA 3NGBC 4PQXA 4ODTH 2K7PA 3EFFK 5EG6C 1HI6B 1S7QA 4EAEA 4KGJA 4CVXA 1LEGB 3QNZB 4Z3FA 4X6CA 3APFA 3X13A 3BQVA 4W70A 1JA8A 1X5GA 1R5IB 3SDDD 4BWTA 4J41A 3ESMA 1R3JC 2I07B 1XEUA 5C0AE 1YPZF 1HWWA 2N56A 3BKYL 5C09D 4TSAL 2G3NA 3HMXA 3L3HA 3BRGC 3FTSA 1MFEH 1KBBA 2QKAA 4QPKA 3RJQB 1AZZC 5KVGH 2YUXA 4YEFA 2NY4C 4HUMB 5KVDH 1C16A 4UCVA 5JW4Q 2JGUA 5A16A 4BXVA 2ZWLT 2Y36H 4F9PA 3BPOC 4O02A 1WTLA 3NJVA 1JUFB 2XACC 2HTKD 2AERT 2WVVA 1I7UA 2VQ1A 4Z0XB 3QIUB 5L4IA 3GMPA 1S8DB 1UXMA 4FQLH 2Y9RT 3J7HA 5C08B 5GSRA 5FL7G 3F7VA 4NNXB 4TNEA 4WTWA 3R8BB 5LVEA 3MDSA 2DBJA 2CTWA 5EBMB 1NOLA 4YBQC 1AO7D 3UH8A 3QDGB 4EI6A 3BE1H 2CR3A 2QSCH 1FN4A 4AQEA 2IANA 2OM5A 1F56A 5DWUH 4E5XB 1SA0B 2P7TC 4F7CB 2D31A 3G5YA 3VGHA 5FGCE 5LO7A 3ABLC 4H44C 1UCBL 1RZJH 1WB7A 3CAFA 4N8PA 4W9HC 2XETA 3EFFA 3FUIA 1VF6C 3ZRWB 2D9CA 2IH1B 5C09E 2DTML 3TCUA 5IHUL 1BD2D 3AT0A 5EZYA 2ZWNA 2FO8A 1LEIB 4HUNB 1QFWI 5DYFA 4A7VA 3MLUL 1SOSA 4HEPA 2VE6A 3SOBL 4L3AA 4YDVB 1M2OA 4V11A 4PB9L 4XVJL 5AOIA 2B4CL 4MDIA 2MTPA 1S9WB 5CA1A 3I6GA 2EZ0D 3C5JA 5HDWA 3RVWC 3QRGH 3THMH 3PGDB 3B9KB 2GBVA 1FAKT 3TEXA 3P77B 2P5EB 1Q9LB 1GGIH 1CD0A 3CNKA 3FH5A 1FG2B 2Y1AA 4LRIC 3EH1A 4OGXH 2AQRA 4G5AA 1KB3A 1IBMB 5HYJA 1KEGH 4JFDB 3DIFA 3P2DA 3F5TA 1A7QH 1IC1A 3DRQA 5T3ZH 1GTNA 1Q6IA 3FB5A 3INUH 1ZX3A 2N05A 1SUHA 1XNQO 3LEYL 4KXBA 1F11B 2O6FA 2W9EL 1MI5A 1E4JA 3ULUD 2YICA 1U2HA 4JQVC 4OAWA 3MV7B 3FKSG 1HH6A 3QA3A 2ZX7A 1GK9A 3WB2A 3MBED 4UU9A 5C6PB 2Y0PA 1HEJC 1E30A 4LLYB 3G5XA 4S1RL 2UUCO 4R2GD 3GQFA 4N1EA 5G5DB 2PWHA 1X59A 2X44D 1NCGA 4KMQA 4ZFGH 3P54A 1K8IB 3MX0B 5C6TH 1GM7A 1D5ZA 4NWTL 4UQ2B 4RX4D 5E9DA 4U0QB 4PG9B 1SLXA 1IKOP 1S78C 2D3OW 1C12A 1DBKL 1W0KG 1GGUA 1I3GL 1Q8MA 2WCSA 3DSFL 4W9DC 2Z7ZA 1UVQA 5LNDA 2P3YA 4F8OA 2K78A 4WWID 1F58L 4GKOA 3QIBB 1DQQA 3VRIA 3GWJA 4LLDA 5FK9B 3WTSA 3U2JA 1TTFA 4PRNB 1N0JA 1CPYA 2DLHA 2IANB 4XMVA 4M1DL 4Q6YA 3QEUA 4K73A 1I0HA 4YBLC 4PCTA 4YK4B 3SO3B 1KXQE 3KLQA 4YN3A 1BGYH 4HUWA 3K2KA 1R73A 2VLKB 3RWCB 1DBBH 2HG5A 4UZSA 1X44A 1KCSH 4F7MB 2OXGA 1GH7A 4PB0L 4U6HB 3PN1A 4X7SL 1P1ZB 3ARBB 4OLWL 1ID5I 4FYQA 2BFVH 4FXKC 4KUMA 4XPTL 4NLHA 5L2JA 2XWRA 2Q8AH 1LP9E 1BZKA 1URFA 5DZAA 2GFBA 1XWVA 3MNDA 4M48H 3NA9H 1XR8B 1JVKA 4K3JL 3BLPX 4LCCA 4D7TA 3B2DC 3BSHA 4JRXD 5EU5A 5E6ZA 3ULSA 4QDGA 4AQ8C 3H9SB 4EZKA 2CCLA 2NUTB 4JVPA 5I71B 2CDFB 2CGOA 3QYNA 4GO6B 2W94A 3BN9D 2W6JG 3L4CA 4PGZA 3MOBL 2OWOA 2E7BA 3ZTNL 3OPZH 1BD2E 3FTGA 2LJ2A 5I76B 2EDKA 3PIQB 1ZLUH 5F7WC 3DTXB 5FHAH 2CBTA 4IBWA 1F1GA 1KYOK 1T21A 3E80A 3F01A 4NKDA 4H8WL 1Q9KB 4NPKA 1BA9A 3AJ7A 3MRKB 4WVRA 2JVUA 5LDSA 3S4SG 5IVOA 2F5BL 4EIZC 3LPOA 3UPRB 4QNPE 2H0PA 2QR0A 4FFWC 4KC3B 5CZRA 2FT6A 4RMSA 5E2WH 2O6CA 3G6EV 2HKAA 4LHUD 4OD3L 2Z6FA 1N0NA 4ESKA 2HJLB 3B5TA 5KHIA 1AGCA 5IFHL 1ZT7A 4QF1A 1T2JA 4G8EB 4JQXC 2W9LA 4GMSL 1NIEA 2FJFA 2EIZA 4HZ1A 1D9KA 2WXNA 3RRQA 3VFTB 2Q7YB 2AV7B 3RWGA 1YC7A 2CO6B 2MCAA 4KMLB 2NLJC 3J27A 4PS8A 5CINH 5MHSD 4N3TA 2ZSVA 3RWIB 4WSJA 2QA4V 3SO5A 4JW3A 3OGCB 1FZMB 2VZOA 3IDJA 3V7MA 5EDSA 4HBNA 3CH1A 1KIQA 3QWQB 4JKLA 3EDFA 1NKDA 3DBSA 4NDMA 1JZGA 1FLTX 1W72A 1GOGA 5ANMA 1A6UH 3IJSB 1X4TA 5JH7A 1K3IA 2O1AA 3OR7A 1XEQA 4NZ8A 3MYZA 1JWSA 1ZHKA 3W7TA 4LVNC 2ICEA 5EF2A 1K5NA 4FULA 2OULB 1B0RA 3AQZA 4P9PA 4X2UA 4YSOA 4EI0A 3RT3C 5L3CA 4YDIL 3STLB 4AXWA 3SGEI 3FQWA 1R0AL 2HJLA 2ZTBA 4LBAA 4ODWB 3U1SH 4X20A 1ZVSA 1RP3B 3W2DH 1A3RH 1CZ8L 5HVHB 1OK8A 1UT9A 1JSYA 3BSZL 3KPSE 3LKSB 1AG0A 3F6IA 3AG4C 2R2HA 4Q0XL 2QV4A 3LAFA 2XX0A 5CMAB 1AR5A 4MD5B 4FZ0A 2PTMA 5ALCL 5J9PA 5CCGE 4ENED 3LN5A 2Y69B 4GXFA 5F8RC 4W9FC 5GPRA 5FO8A 4ADIA 3CZFB 4QRQB 3KPNA 3DUSA 3O2DA 1H19A 2MPAH 4XO3A 2QR4A 5D93C 4I0XA 3MRBA 1XOUA 3QDHA 4UIKL 5KVFE 1ZK9A 2XBTA 3MUGA 4JASA 1K72A 1AFVL 4CU8A 3IU3B 2FJHB 3BPLB 4FQCH 3O2DH 4FIPC 5ESVA 1U97A 5IUSA 3QIWA 4A2GA 3VQWA 2NY2D 1HU8A 4J6IA 4WI8A 1NC2A 5C0EA 1RUQH 1I8KA 1AQDA 1BGXH 2BVEA 2MKLC 3MMEB 2YXMA 5DHYB 1LM8V 2CIIB 4OW6A 3OUSA 2F0CA 5CLTA 4GEJA 2RA1A 3ZHUA 2QKIC 4FHBD 4M62H 5INCA 4OZHF 1LP9B 4GAFB 4GUPB 4YQXH 1KENH 2VH5H 2EDJA 2Q0OC 4WO0A 4K3EH 1A21A 1SQXH 4KHXL 4R8CA 5BS0B 4E0RB 3ILPA 2NCEA 2E86A 1TZAA 2VGLM 5AQ0A 4F92B 1OW0C 2EE9A 2PO6C 2XPGA 4GSRA 2VDPL 4DW1A 1VB9A 3AY4C 3CFEA 3CVHL 3GK8H 5JPNA 4PLNC 1ZHLA 2QGCA 3EH4B 4FQJH 1IBKO 3HRZC 3V0WL 2OTWB 1DANU 2V2TB 3BXNA 4HS8H 2VLKD 3MRHB 3R0MA 1G0YR 3L4WA 3MGAA 3PUUA 4P99A 2J55A 2AXGB 1TSRA 5IHHA 2I9LB 3HE7C 4CC0A 4HPOH 2Y0IA 5K93A 2OT5A 1A7PL 1F2QA 1MCOL 2P43B 1ZTEA 1Y67A 1BQZA 2BP0B 1RJYA 4L5FH 2X87A 2A1WH 1NZRA 3FYEB 1KGIA 3T0EB 4PY7A 1FLRL 2DH2A 4CH4A 4JDTL 2YSSB 2L8AA 3BX7C 3MBWB 2OJ1A 3MNWA 2ID5A 4JY5L 1S3KH 5KVEE 4FLZA 4RLDA 5EU6B 2F1MA 3EJRA 4A38A 5DUBA 3CRAA 1T3FB 2VQ4A 2BNQE 5JORA 4PLJD 5LWYH 1R1CA 1AD9B 2A0LA 1XMQB 3O2WL 1YLBB 3N0AA 1YHQV 3S5ZA 3X2QB 1WT5C 5I1LB 1K6QH 4U2ZA 1D9KB 3VFTA 4M8VA 5KVFH 1TVHA 1T1WB 3UTSA 4P5KB 3DVNB 1AI7A 2Y6TE 3VA2C 3WTVA 3ZDXF 4FFZL 3ROOB 5DEJA 2YRLA 2GAZB 2KQXA 2A6IB 4NO5B 1B90A 1BZ8A 5SWZA 3QP3A 2A74C 1M90W 1KB5A 1UXLA 3A0BZ 1U41A 5H5NA 3N40F 1RZGA 2QMJA 3UPAA 2ZKWA 4GAYB 1WGVA 4DKTA 1N9PA 5JOFA 3RGVC 5D9SA 3I75A 2VN5A 4A39A 2NX5A 5LBSH 5AYTA 5DZPA 4AYMC 4UNUA 3S9DB 3IVKB 4HIXH 3SBRA 2EIBA 1F13A 4YDKL 1E3FA 2V5SA 1ERNA 2AGJH 2FLMA 2BZ7A 35C8L 5IKCB 4DO2A 1UOKA 3ZDWA 3UO8B 2C8NA 4QY8B 4HEME 1KNOB 1FQ9C 1YJDL 3AK2A 3TNNB 3A4EA 3DDGA 2BTQB 4YIQB 1OM3L 1CICA 2BHYA 2JKNA 4U31A 1QFWL 2YLKA 5DVMA 5EBMC 1EGJA 3LZRA 5FHBL 1BLNA 4OB5L 2WWMC 3VM7A 4GUCA 3CP1A 4GW5A 1GGYA 3O2WH 3PRZA 1B2WL 4LSQL 3IPFA 3SDCC 2NZ9C 1EGJH 1Q94A 5KW9L 3TJPA 5DQ9A 2B8OT 3JWOL 4D3CH 1JNHB 1RZIA 3U7AA 5ID1A 3UYPA 3AQDA 1X3DA 2ZE6A 3VXRE 3WO3B 4DGUA 1F00I 2EXWC 2Y07L 2O72A 2G5BB 4LKCB 1XB3A 2JJ1G 4CNIB 1RK7A 1KGXA 1VERA 4M93C 2MQ3A 4WF7A 4K55A 4WTZA 1OB1B 4NNYA 1SESA 4KY2A 2VDRB 5HY9B 4ZKIA 3ZUCA 3EOTH 2B08A 5F7FA 1WS7A 4MS2A 3H3PH 4JM2D 4IIZA 3OJDA 4NYKA 3ZZ1A 1HH9A 5I0DA 2X89A 1U8IB 4WGVB 3Q6GL 5BRQA 3AREA 4G6JH 3CVBA 2J4WL 2B77A 3C12A 2VDML 5J11C 4IGGA 1IX2A 3HR5A 2DB8A 2NT0A 3P02A 2WP3T 4F37K 4EDWH 3QPXH 4IHOA 3CFMA 4JI5B 4XPFL 4DK6A 5KLVH 2C4FU 1UOWA 3FTUA 1NEPA 3CZEA 2J12B 4IBQA 1Y4MA 2DYRB 2MW2B 1RI8A 1ZA6A 2F15A 4NJ9L 2N01B 4U1NB 2VAAB 3H1KH 1VHPA 5L2KE 1USQA 2AXJA 4PB0H 4ZAKD 3UZVB 5DMJB 2VR8A 3D0VA 2SEBA 4Y5XA 2VXVL 4P5TC 1VEWA 4IJ3C 4LO9A 1EN5A 1KFGA 1P7QB 3U2IA 4U1LB 5DEZA 4JFYA 4P46A 5MI0C 1SYSA 1YY9D 3T2NH 4JG5A 4WI7A 4FHKA 3NCBB 4ZDHB 4ANVA 3N6YA 1ZLVH 4H26A 5I6KA 3RVYA 3CCVV 2PNDA 2AJXL 4DK5A 1K33A 1HH6B 4UCSA 4L0PB 2ATKA 4AGLA 4EDXA 3ICXA 1J10A 2KBGA 1EEYA 4KRMB 4KROC 3GZOA 4QXGL 3BUTA 3M7OA 1DBJL 4DJMA 1IAMA 3KBEA 4L8SC 5EH1A 3V5KB 3ES6B 3FAWA 5GGTH 1DYZA 4UFZA 1QFOA 3CE1A 5BNXD 3HC0B 1G7LB 3IT8D 3N06B 3WEXA 1AD9A 3QUYA 5HI4D 1UGNA 1G1CA 5JW5A 5CU5A 4EPSA 3AADB 2AABH 3K06A 3HBGA 1GN6A 3JV4B 3LZLA 4MQXD 5I66B 1PEZA 1TQVA 1BVNP 4PRPB 4JI6O 4NQUA 3QO5A 3L9YA 3H6AA 3JWNC 3K72B 4MQXC 5I6XB 5CBAA 4U7SA 5FM5O 2FEDC 3VG9B 2IBZX 4R7DA 4PVNA 1IARB 3K5SA 4XHJD 5HYSG 4MSWA 1H5BC 3EOBA 4AQ1B 3Q1EA 4P3CH 1Z66A 1BYNA 2D73A 1P6WA 1UM5L 2QHRL 4X6BB 1W0WB 4N3UA 4GXUM 5IY5B 5AOLA 3C5SA 3NFPA 5A2FA 1I08A 3IE4A 3JUZA 3VXSA 4KRNA 3K2UL 3AXLA 3QDJA 4NRZA 1MOEA 5J1AB 4ZXBB 1E9PA 1SMAA 3I3DA 3T3MB 1FZKA 4ZUSB 4E68A 4WLCA 4LLWB 4LASH 5DC0A 5LQBL 2CHNA 3I56V 3TO4C 2FL5B 5E8DL 2O6DA 5K1VA 3BUYB 2HT2C 4WUKL 1LE9B 4POZD 1WZKA 2UXCO 3GPEA 3S4SA 4C4BA 2FO4B 4XBMA 3JZYA 2Y1VA 3KPQB 5E1HB 4OZHE 3QWNA 4TUKL 1D5IL 4KTGA 2P8LB 4L9LB 2JNZA 1YDPB 3QNYA 2P24A 3DXAD 4LP5A 2XWXA 5C2BL 3EYSH 3QB7C 4DV4B 2IQAB 2NW2A 1VPOH 4PJFB 3S5LA 1XH3A 5DHYA 3S36H 4MVMA 4H1LH 4HUXB 5FECA 3HR0A 5F9WB 5GIRA 1I7ZA 1V7MH 4L3EB 5CLYA 2P8MA 2NDGA 1SN2A 2PCFA 4HW6A 3EYSL 4YWGL 1UM5H 2QHRH 3V95A 1JRHL 2CALA 4AMKL 1NCCH 1JGLL 1G9EA 4PJXE 3P32A 2X38A 4JN1H 3F12A 5KW9H 1SHXA 4ZG1A 3VJ6A 1NLDH 3FSZA 1TUPA 1QVOA 2EIMB 4GQPH 3NIFB 5IM7B 3NTCH 4DN3H 3IBEA 1HXMB 1D5MB 3HPJA 5I16A 4YUEL 4LSDA 3S4SB 1BBJB 1A3LH 2OLDA 4G43A 4NQXA 2BP8A 3U0TA 3RL2A 3Q8BA 4OIBA 1EHXA 3WJJA 3X1NA 3OKNA 2Y24A 2CH7B 2DJMA 2BHUA 2IXQB 5MERB 3MRRA 5F9JB 2LGNA 2WXJA 4MAYA 3H0TB 3ZHLA 3MUGB 4PRBA 1JYXA 5DRNB 5BUAA 1XD1A 4HCRH 1JV2A 4NQDA 5F72S 5AVWB 1LEKA 3CXHJ 1MF2L 1UH2A 1EFQA 3DX9B 3R65A 4WUUA 3GVMA 3STLC 4GRWB 4U0RB 4UM9B 1OAKL 4R84A 1F4XL 4XMKL 3FN3A 2H94A 4YHOH 1GVIA 5D96C 5JOPE 5ANMB 3PJSK 4HJ0D 1HHHA 3BVNB 4AK1A 4MSWB 1BXUA 3AGVA 5KMGB 3KPRD 4G8GA 3FUMA 4HDIB 3LV3B 4B53A 1H2GA 5JXED 4K9EH 1F02I 4HNAB 1O7VA 3BSGA 3LCYA 1O6VA 3GXNA 3L5XH 4K7PH 4PJ8A 3VXRD 2WO3B 4MNQA 3S97C 4E9QA 3B9KD 3ARZA 1A2YA 1A32A 3F83A 4NSKB 1OSPL 1OAYL 1IUZA 1FO0H 1YVLA 4NNPL 5HGGS 3RTQA 3OHXC 5CEYB 5FXCH 2BZDA 3V8CA 1DCLA 2Q5BA 5L0QB 2BJML 3CS5A 4TWKA 1ITBB 3HC0A 4KXCA 3MRPB 4RDBA 5CO1A 3CRMA 1JZ7A 5T5FH 3W81A 1AXTL 3BPLC 4ES9A 5DR5H 5JDSA 4G8GE 4Z7NE 5CD3B 1H2MA 4G3YL 4OLVH 1UPGA 2QWPB 3FAVB 2KLTA 4FQQA 1LO3L 5KVDL 1K2DA 4LU5H 3ZMRA 1Q1PA 4UOQA 5DC2A 4L1BA 4AYSA 4MCYB 4FLOA 1AYRA 2KZWA 2WZ6A 3C60D 2LW1A 4HJJH 4QD2E 4Y2LA 1DVFB 3SCMD 1D9KD 5DD0H 4LFBB 2B1IA 3O4LB 3ABTA 1ND0B 1MHEA 2MCPH 1NINA 2X9WA 4YPGA 3L1OH 3IXTA 3T2PA 5CZVH 4FFBB 4WFEE 3VI4B 1FZJA 2LGQA 2W07B 3SDXE 4OZFG 1IU1A 3BH9B 3NIDB 3BFOA 2PO6B 3O6FB 1AHKA 3A47A 4LFBO 3WFDL 4GRWE 2VMDA 4G72B 1J8HA 1QSFE 1YMHB 4IMLB 1RSOB 1NGYA 3ARUA 3O9WB 2F5AL 1KIUA 3HMWL 2DQ3A 1CICB 4GRLC 2DWEA 4PWGA 4QPEA 4OU3A 3GBNH 2VABA 3LKOB 4O9HH 4PA9A 3K04A 1P7GA 3RVZA 3ENEA 2JGDB 4I18B 4KI5C 5G5DA 2G4EA 4G6JL 4WFEA 4X8AA 1HHKB 4Z78A 3RKPA 3SJCC 1RUMH 4WFFD 2VMCA 3T0ED 1BWMA 3K81A 5T5FL 5DS8B 1G84A 1CMOA 3B9EA 3EO0A 1J8RA 5E00A 4XXCA 3GWKC 1KFAL 1ZA3B 5JW4N 3HE7D 1Z9LA 3FDWA 4S10A 1PP9H 1JFHA 1DTOA 4QGPA 5FGCB 1NA8A 3QDMB 2DWYA 3OQ3B 3QARA 3RHWF 4FLUA 4JB9H 1SXNA 2BY3A 3PQYD 1AGFB 2WMPB 5IQOA 1GY2A 1RJZA 3CSYB 4WI0A 1T0MB 4K3DH 1WHOA 2HJFB 4UAOC 3T8MA 2AJZA 2H8PB 3B5HA 3VI3B 4AY0A 4AGOA 5D7KD 1YEWA 1WZLA 5AVZB 1M71A 1C7SA 5FGBC 4UUJB 5HGAA 5KN5A 5GRYA 3GLEA 1K73W 1EMTH 4HX1A 5DJCA 4FFTA 1CBJA 1W6WA 1MAML 1I4FA 1TKWA 4JANA 5F9DC 3VWKC 1QTYT 1GGCH 2X6CA 4U6HA 4CUCA 2I32A 4X89A 3K1DA 4U6YB 4AW4A 4FLHA 1QNMA 4Z7VB 1N8ZA 1TIUA 3A4DA 3B2UD 1BAFH 3LYRA 2XXCB 1FSKC 4GG6B 2CXKA 2A74B 5HP5A 4X4ZA 4Y8DC 4ANKA 1TJHH 3QWOA 5T1KB 2Z8VC 4G7YH 2VW7A 5MEPB 2QLVB 2VDMB 3KL3A 4MMXC 4PV9B 3U4BH 4GT7A 1HHIA 5GJTL 1T4WA 2NUTA 1E5AA 3CCMV 3AC0A 5T1JA 4PRPD 4AGMA 3R06B 4KGLA 1ECYA 4P2CG 2OCCB 5AAMC 4DPCX 1KB5B 4Y5VB 2WM0A 1AZNA 1R3LC 1J8KA 2A0LC 2F7QA 4WRLA 5CEXB 4I77H 4DVRH 2X0LA 5D1ZA 3E8GA 2QQLL 5DGRA 4YNYA 1HQRA 2FX9L 3CX2A 3DHUA 3RILA 1BEXA 1MUJB 3TIDB 4RA0C 4G6FD 1SQPH 3VXUA 4PJCE 1AS6A 1HDMA 2WWNA 1RZGB 5IE9A 2C1PA 3QUZC 1KT2A 3GDBA 4ODUA 3UZEA 3VNYA 2FIKB 1A2YB 1AQKL 2B1AL 4X0KA 2ZE5A 1PX8A 4WY7L 4CVZA 5C0IA 4JKWA 2EABA 1H9VA 1U91A 1IVTA 2YWZA 4OJYA 5IZ7A 3O0LA 4NENB 4FVMA 5A1AA 3TT1H 4RGMB 4KZDL 5EPMA 2ZICA 5B1JC 4YSRA 5EZJA 3MNMA 5CD3A 4B3EA 1HOEA 5AG2A 3L6FA 3QUKA 1JXGA 3F7KA 4Z0BH 4WUKH 3RX7A 1ZWIB 3LH9A 3D2TA 5HI5C 4ZFFB 2A9NH 2OMYB 3ASNB 4LSTH 5I1GH 4PJHA 3LH2H 2NR6D 2X3BA 1SS3A 1T5WB 4S1SL 1A14H 4UV4L 4Y4KB 4M1CD 2NXZD 3NEEA 3PXHA 4NLAA 5E8EA 1SRYA 4XBEL 2GIXA 2FEDD 1IC4L 3FU5A 4B9FA 2HJKB 2CKBH 2ITCB 2F54E 4RMQA 5EBWB 5DU7A 4ONGL 3ULVH 4LPTA 2BS9A 1F1DA 2NNAA 3C8KA 3P1VA 4NBXB 3T2LA 2PP9A 4IKNA 3NCCB 2ZSWA 2GHYA 2YGQA 1XIWC 2KMWA 4N2GA 2E46A 3ZK0A 5KYXB 2A7WA 4UZGA 5FYJE 3GSVB 3L73H 2H2SC 4MAYD 2VUOA 3QAQA 1OE3A 1DN0A 4U1KB 1P84J 3LKOA 1HVXA 4MW3A 2V2WA 3AACA 3QZMA 2X05A 1XIWD 4G9FA 5I9QB 1RHHB 1JXKA 4HT1H 2DYRC 5D2NE 2QPDB 1VQNV 3IKKA 5CEZD 1ET8A 5JW4M 4JG9A 1AAJA 1IAIL 3F3HA 3L81A 4NP4H 2PUQT 3WGVB 2AQ1A 1R5VA 1SQBH 1XF3A 1T7WA 3QRBA 4POZC 4QI3A 2XUWA 3HG1B 4P5TB 1FCGA 5HI5D 2CNYA 4J3WA 4YAQB 4IJ3B 2Z34A 3BAEH 2ZNWA 3AS3A 2NY6B 2CBQA 3BD3A 5F6HI 3U11A 2HRHA 5K9QI 2D7QA 3HE7A 3IXAA 4MNQD 4PCKA 1AGFA 1BQ0A 1AR1D 4K0OA 5IROC 2OFQA 4P4KA 3H9SE 4HJTA 2DWXA 4KTDH 4A67A 3KJ6L 4G27B 1ZA3A 4YDIH 2BSBA 5ICXB 3QAZB 4PJCA 1RU9L 4B3MO 2BO0A 2VNCA 3ABKB 5HDOA 4CSZA 1AY1H 3NJXA 1QSVA 2GK2A 5FM5M 5D7IA 1VIBA 4AG4H 1UYWH 1YZZA 1Z5VA 4J4PD 4CMHC 4IKKA 4KVCL 4OGZA 4HAKA 2VN3A 1KDIA 3SOTA 5C0DB 2Y6SD 3U6RA 1CXHA 3SY6A 2ETWA 2GKIA 4DCQB 3LSOB 1PGRB 4IM8A 1WUZA 2FJSA 5H4YA 4BV1A 5EEWA 5ESAB 5IMLB 1U8MA 2IH3A 2WOBA 2CCVA 1FG9C 4JFTA 1AMYA 2N3JA 4F80A 4H20L 1CBVH 5MEOB 4NPYA 3NOIA 4G1EA 1JGDA 2A3QA 1H15B 1QI3A 1QBZA 4GBXA 1T83C 1MCPH 2W9DL 3KDMB 2F54A 1YJNV 3R19A 4I1PA 5K9KB 2N04A 4NKIH 2Q87A 1JDCA 4ZXBC 4BFGA 3VXQB 1CD1A 4KK5C 3L1OL 4R7NB 4WFFA 4P3CL 1I9RH 3OSVA 3B1TA 4DP1X 2ATPB 3K0DA 3BQUA 3IGAC 1ICTA 4KKLD 3O6LH 1KCRL 3B77A 3D2UA 1DUYB 4RAIA 1QVOB 3G6DH 3MLSH 4IOSD 1JV5B 4JYYA 2P48B 3PWVA 4FZ8L 5I1JH 3S5LG 1YQVH 4ONFL 1HYSC 2WVSA 5AVUB 4U4BA 4N24A 5FYKH 3IS1X 4P2QB 3QK0A 5LXGH 3FRPA 5LGHH 5B1BB 1I5YA 2IPUG 2QTEA 3C6LB 5IB3A 1VQOV 2Y1ZA 4JJOA 3NJHA 3QDAA 4HIJA 2NY7L 2H4EA 2ADPA 1A4JA 2YK1H 4FKEA 5F44A 3DBXB 1J95A 4NM4L 4FZ8H 5I1JL 4TVPH 2K1MA 4IBVA 1HS6A 4CMMA 5KYWA 1KBWA 4NKMA 4IBUA 4R7CA 3GB7A 4XNXH 1AQKH 2B1AH 1ACCA 4OD1H 1NDGA 4P9MH 3QQ9D 2ADJB 1EXHA 5EFIA 2NW3B 3WIHA 2ODIA 3MCG1 5JXEC 2ADFH 3E6FB 4RDQG 2XZCL 2ZM6B 2JI1A 3D3VE 4D8PB 5ADPL 3SGDH 4HS3A 3U9UB 4XP1H 1J8HB 5D7IE 1OCOB 2VLRA 4Z7QE 3FUNA 1DFBH 1DSFL 5K9QG 3H55A 1IC7L 2R1WB 1MRCL 1VSCA 1TVBA 4N8UA 2IADA 4Y19E 2V2XB 2O6PA 2APWA 4N9GB 4YO0B 3G9AB 1AQHA 3A67H 3VD0A 3U9PL 5DD3L 4JI1O 1H6TA 3HZKB 1QBMH 4RIRB 3D30A 3ZE0F 1MH5A 2GC7C 2F74A 2WLNA 5BS0A 1A1OA 4DP4X 3PV6A 2WLLB 2UZIH 4WWNA 1HHJA 3WHXA 1S9XA 2J8OA 1L4IA 4OCXH 3H3PL 4YGVA 2EE6A 5ISZA 3D9AL 3GSRB 3MO1B 3FSWA 5D96B 5LGHL 3N50A 1NGPL 5C08D 1MCRA 4JZOB 1RZIB 3HG1A 3K7UA 4U6TA 2O5XL 1N0LA 2H1XA 1JHTB 1ZHNA 3QJHB 1CEZA 1ZVNA 1RZ8B 4YXKH 2EDWA 5EU6D 3ROLB 3U4KA 4MMXA 1OARH 1DJYA 1CDUA 4XX5A 2NN4A 5GRUH 2V5MA 2AQSA 5BUGA 2CO1A 4MGXA 3ARFC 3OKYA 5FYLL 2CDGB 4O4JB 5C07E 4BHUA 2E74B 2EEBA 5LBSA 5ERWB 2QQLH 3CFTA 1YMME 3PP4L 3QJQB 1PZ3A 1J9TA 2DQHH 1MLCA 1U8NB 2J71A 2VSDA 2LQRA 5B7FA 4LL4A 5KSUA 3GSOA 2NUPB 4YXLH 4UI2A 1S5LZ 3QJFA 4X7DC 3GF8A 4BQ6A 2E9IA 4F58H 2BWIA 4WZ9A 3WJMB 35C8H 3VFOA 1BLNB 1RUPL 2C1OB 3OKLA 4CSPA 1Q7YW 1G7MB 1N4XH 1R46A 5IHZB 5B3SB 2CGRL 2AW9A 4FLRA 2MEJB 4UV7H 5DZ9A 5ILTL 5AG8A 5JH7B 3P30H 3FO9B 4ZW7A 3I84A 4XXCC 3V8OA 5IB2B 1P7KA 3BGAA 3TXAA 3SODB 4NFCA 4LCWA 2IFGA 2EDQA 1NFIA 4ONGH 2EX3A 1S7SB 1CICC 2MQGA 2XWBA 4HAMA 5BOPA 3ULVL 3R66A 1M1XB 1V3JA 4WV1A 2LVCA 2V5TA 3TBVB 4C56B 4P9HC 1KYDA 5DJ8A 2EO9A 2XX1A 3BCFA 1FYJA 3KLKA 4PJIB 4WTZG 4ZSOA 3MRMB 2XN1A 3CX5K 3FRUA 3D2UD 3NZUA 2JKRM 3HKEA 3ULVF 4NZUL 4L18A 5TTRA 2O6EA 3R1GL 3N1FC 3D2UB 2J6WA 2XTJD 4OCMC 1H2SB 2HP4A 1FNEA 3O3AB 4IRSB 3RWJB 1H6UA 1TJGL 3DHMA 4OKVA 3VGEA 4Z7WE 2WXIA 3W11C 4P5RA 2IW5A 1CI3M 3PV6B 4KY1L 2P1YA 1XILA 4UAOB 5ITFA 2ZXDA 3RTQD 4XXDB 3CDZB 3D85A 5D6DC 5FGSA 2O61B 3FCGA 5TH2B 3OTFA 3QFJE 1ZT1B 1K85A 3GMMA 3L2MA 2ZCEA 4R96A 3ZCCA 1DQIA 1KTKE 1J1OL 1J87A 3VD4A 3EG9A 5TDOB 2QZQA 3AAZA 1D7BA 4X9QA 4F2MB 1FRGH 1W16A 5HGDB 4FLVA 5SWSB 1OALA 1GTFA 4U3HA 5CIPA 4ZXBA 3MR9B 4IGBB 4NQCA 1SA0A 1SDDB 5E70A 4QO1A 3TZVB 5ID0A 4M3JA 3R0NA 4X6FB 5L88L 4I3RL 4P2YA 1E5UI 1T03L 1BSMA 5EN3A 1WFTA 2WGXA 4QHPA 5H2BB 4GBXD 2HVKC 3T6VA 4UTAL 1F6FB 3EYQC 4NAMA 4DW2H 2BSRA 1OP9A 1N67A 2HFGH 4JRYA 4HJSA 5JO5B 2WBJD 4F20A 2NTSP 3E8HA 2CTQA 4MMYA 3N41B 4JPWL 3B7TA 3CUPA 3U4AA 3QT2A 4OFIA 3OWRA 3OTTA 3VVWA 5KX5B 3BD5A 4X6DA 1A6TB 1I8IB 1KDJA 5JW5B 5E8NB 3DX6A 3MREA 1YUHB 1I9JL 5I6PA 1BX2B 1XQ4A 1ONQB 2Q7YA 3RWGB 4G1MB 1ZTXH 1OAYH 3M7FB 4JG0H 2Y5TB 1LNQA 2G0KA 1IJNA 5DFAA 3R18A 2NY5C 1M7DA 4WDIA 3GSQA 4PG2A 4NN5C 4HU8A 3G6JF 5AOJA 5FKAB 4O2BB 4HQQL 4HH9A 1FAFA 3ASOC 4XNUL 4PWEA 3AY4A 1TUEB 2VJXA 2ZOKB 5HBBA 4XNZB 4FQHA 2YI8A 4EI5C 1TLKA 1BQ5A 4N90E 3BCCH 5IB1B 1I1FA 3TBSA 5EYPA 3T6QC 4WWKA 5IMMA 3H53A 3KLDA 4ZOBA 3II1A 4MA3B 4N20A 3GT6A 1XD0A 3EJSA 4WSKA 3QFGA 2WYHA 4JFDD 4R5VA 3NA9L 2ZG2A 4LVHB 2HFGL 4FGMA 3O8XB 5EBWC 3WY2A 4H0LC 3NSCA 3TEUA 1IGFH 4Y19D 2EDOA 1NEZB 2XG5A 4J8QA 1YTFB 2Y5TA 3F7PC 4S0TD 4UTAA 4WWKC 1JF1A 3SGKC 3RE0A 4X7CC 4FM0A 1T6VN 3OM3B 2ENQA 1NI8A 4QXTA 4TULL 3PQYB 4YZFF 2OCFD 5SWZB 3UL4A 1XSKA 1GN4A 4LHJB 2ZUQB 4ZX3A 2XWJB 3P3PA 4QHNA 5DHEA 6TAAA 4WHYG 1BZEA 4Z5RA 2IWEA 4G6KH 4FJ6A 1KENL 2VH5L 4JN2B 3TIEB 1U21A 3MLYL 2P5EA 3HG4A 3TA3B 5C71A 4B9CA 5IJCC 2COQA 3WEBA 2CHZA 1QPKA 4J3OC 5FLXN 4OX9B 3LDBB 5LGJA 1WVZA 3HFML 1M56B 2YEZA 3VQLA 3OJ2C 3QQDA 2YFOA 3WTXA 2WUBH 2BLFA 3GD1C 2Q0AA 3KPLB 1YEIH 2ALWA 4ELMF 3QIBD 4B3RO 2GW5A 5INCB 1X7QB 4U7KA 4WGKA 4AI8A 1JD9A 1IVSA 3LOWA 4U1IB 4XMWA 4OUUA 5JUEH 3GLDA 4QJ5B 4HJGB 5GS0D 2ICCA 1JNHA 2HRPL 1QFWM 4Q74A 1S7TB 1Z6JT 5DUML 5JHMA 1YMMD 2EUVA 4FP8H 1ES0A 1L5GA 3O45B 1FGVL 1TTBA 3WFHA 1EAJA 5F9JA 4J9ZB 5EO1B 1JTOA 4HG4J 3HAEH 3MCKB 2H26A 2PWGA 1PG7W 1FHGA 3QCVL 3G6DL 4PFEA 4UVAA 3WUWG 4JI8B 4BWWA 2H0JA 4F7PA 2Y48A 4XO9A 4I9WD 1UZ6F 3BC9A 1KTJA 4Z6AT 3JBG7 3L1GA 5C0AB 1PIGA 3JCZA 1N59B 1R3IH 4FTVE 1G5GA 4DFHA 3P3NA 4KUCF 4XRCB 4YHIB 1FVCA 3CMAV 2BOBA 2XPYA 4L2LA 1PJ9A 2VLLA 4GSDL 4HPYL 3TV3H 4DTGL 5LDUA 2FR4A 2X4SB 2KSDA 3EF4A 1SDYA 1USZA 2D7OA 4H8QA 4H13C 5A16B 2Z91A 3Q13A 2ZYIA 1FO0A 5D2NC 4HUWB 2IG2L 4FM1A 1LO3H 5JCOC 1NBZB 3QRGL 3JTBA 1K8DA 4JDVA 4LCCB 4U6XA 3R7RA 1P7HL 4JFHE 2WGNB 1YN6A 1L0NH 1D6VH 5LGKA 3AS2A 2BPBA 3VTMA 4PJ0Z 1NFAA 1T0MA 3BWAB 4GKLA 2FEEL 3KGRA 5J13C 1SOQA 1AJ7L 3WE1A 5DJ0B 4F6RB 3FCSA 1UD8A 2VMEA 2P5WD 4HZLA 4P3WA 2VDRL 3MRLA 2AF2A 1HI6A 1S7QB 3DGDA 5BRZB 2P5PA 4NKDB 3I6KB 5GS1B 5J1TC 1R6NA 3EGSA 4OI7A 2I24N 3FYIB 4NUMA 1Z5LA 3OC8A 4YE0A 1Z2KA 1R3IL 3WS6C 1YQ2A 4AM0A 4P4KD 1HL9A 2MOVA 4Z7UE 1D7DA 1ZDSA 1QMUA 2L7UA 4DOHB 3UP6A 2WXKA 1XGUB 3JVGA 1TVKB 1XTLA 5E4AA 2HVJB 4LF9B 3O3EB 1M3JA 1X7SA 4NC2B 1G6VK 5D7JD 3WUWA 3OPZL 3UPRA 3VFOB 4S1RH 4H8HA 2AK4A 4DETA 2OMTB 2ZCLL 9PCYA 3KPOB 4OZFA 2ZAIA 2XN9B 4UT7H 4X1IB 2HKHL 3LEXA 1KJ3L 1TTCA 3BW9A 3O4LE 1ED3B 1OCWH 2XZQL 1NUFA 3VQVA 4FCAA 5EA0L 2DTSA 1WIPA 3G6JE 3EIFA 4DZBA 5GSRB 2OI9B 3FB6A 2YZ1A 5MENA 2AS5M 4P46C 3POHA 2MTAA 5A2BA 1N5AB 2IEPA 3NIDE 5BZDB 1O9HA 2P80A 2FSEB 4EFEA 3K03A 1CCZA 2WIMA 2DMBA 3G9VA 5B1KA 4F4LA 4PRAA 2FIKA 1WG3A 1P53A 1BOYA 4RMTA 5SWSD 3KPSA 4QTHB 5IB4B 4GKJB 3UGEA 2I5YL 2OYPA 4QPJA 4LKCA 2EZOA 4JI8O 4GUOA 1IC4H 5I1DA 2R51A 1AMXA 1UH4A 3UO2A 4WWPA 5CP3A 2BVOB 4M6NH 4OY9A 5EO0B 2P4KA 4F7EB 2IADB 1R24A 3ZQ9A 4K4KA 1YNTF 3F6JA 3UACA 3BYTA 5CN1A 4KKZA 2V9RA 5JIMA 4IRZA 2OTLV 1CT8A 4XVTL 2P06A 1MH5B 1DBKH 5E99H 4L8CB 1JPFB 4PTTA 1OGSA 2QPSA 1SY6L 3VU2A 4YHLH 3RTQC 4PV9A 5D2NA 3THOA 5F3FA 1VF5B 1NEUA 1RK0B 5IW1A 1U3HA 3LN4A 4BYHA 4H8WC 4JFWA 1R3IC 4NP4L 2HFTA 2HXAA 2YPKB 1FYTE 2WUBL 4PRAB 1OPGL 1L0XA 4KI5F 5FPIA 3VD7A 4HK0A 3Q01A 3B3IA 3V5DA 5HI3C 3X17A 1N0LB 4ISVB 4F7CA 4U1SB 4TNFA 2QE7G 4RFNB 3QQ3A 4ZSOB 4DGVL 2F66C 3OKDB 1JR9A 1U8CB 4B7EA 4CC5A 2NY1B 3VMNA 1RMFL 4P48A 4J3BA 1TSHA 2HUHA 1T1XA 2VN4A 3PCYA 2ZPKL 4NBYB 3SIKA 2ZOLA 4APQB 4PJ5A 1KULA 2QSTA 2AABL 1J0JA 4ETYA 4HJEA 3RYFA 5IBUB 3WU2Z 4S1SH 1ORSB 4FK5C 1Q43A 4UB8Z 2V37A 5C0CD 4OH2A 3V6ZA 3F7LA 2FX7L 2FH6A 5I1LA 5I15L 5FO2A 4IRJB 4DKEH 1JJ2U 2Z31C 2AVGA 2XN9A 3CZKA 3DX9A 1K9TA 3DVFA 4LLQB 4WUUB 5EB9A 1QHQA 3QHFL 3GJFK 2CLRA 4MJ5A 1WAAF 2B1HH 2NW2B 3HNVH 4K9JA 2MFNA 3H0TA 5LMUO 3QIBA 4J3VA 1SYVB 3HAEG 3CFDA 3B37A 3SQOH 1IBKB 3VOUA 1Y76A 1FIGL 4Z7UB 5FKAA 3REWB 4G9DA 1AHWC 4M7ZB 1MWAB 4F6RA 5EU3B 1M93A 4JPKL 1L7TL 4Q9BA 3H4HA 5CCKL 3MODL 5EU6A 1V55C 1M6OA 5IMMB 2LFRA 4PS4H 3WXWH 1T22B 1RZKH 3I6SA 2ZM6O 4BIZA 4GBXC 4YIOA 3TONA 1XX9C 4NRZB 4KKBD 1IQWL 4J27A 5C9JB 3OAUH 3QCUH 1UD3A 4ERSH 2CRIA 3HLAA 3OKNB 2VXTL 1Y74B 1OF0A 2W8CA 3P69A 3MAWA 1NAKH 3QSKB 1MEXH 4YR6A 2A6IA 1HL4A 1SOXA 4BH7B 4L4TE 3ZL4L 1ET5A 1SY6A 2JTYA 3WLBB 2HN7B 1IAIH 2PF6A 1TZIB 2IH3C 4OGAC 1FD9A 3FX7A 1TVHB 1ZS8B 3HNSH 4JFPA 2VRZA 5D1QD 4DP2X 5HVWA 3U2SB 4K8XA 2ZWSA 4LF7B 1Q90A 4Y2DA 1O7DC 5GW7A 4Z3IA 1HINH 3P3TA 1KTLB 3DX7A 5L2KA 1J5DA 4FZEH 3F7YB 5LBVA 3SCMC 5I74C 3DJRA 4HCIA 4NQEA 4WW2F 5KYNA 5SWSA 3BRFA 2IAAC 3FQUB 4Z7IA 3KVQA 5DI8A 1T22A 4XPBL 3AAZB 2NY4B 3ETEA 1GHFL 4JFFD 1PEWA 4UMGA 2NSXA 2G30A 3U48A 5I8KH 4CADB 3VFSA 4DP6X 1RIUL 4OZGB 4KK9C 1CLOH 2APVA 2VOTA 3MJ9A 4XC1H 2Z0AA 2A9ML 4EZLA 3WFHB 2CRMA 2RFXA 4HIIB 2A79B 1B4JL 3BD4A 4UYPA 4G7VL 1WIUA 4KK9D 1UZGA 5FGRA 1NT2B 3LEVH 4IU2A 4X8JA 2NY0B 4G2AA 4XXWA 1ZVYA 5T5NF 1DEEA 5CB4B 2PCYA 2L7EA 5B38B 5KYWB 3WCYA 1XXDC 2ITDB 4AJWA 2C34A 3PP4H 4PJEF 4LLQA 3VSUA 3KZIZ 3KH4A 4IKLA 4P59L 5HGBA 1QPXA 2X42A 1NSNL 1FXVA 4HGMA 4PVLA 1EMTL 1IAOA 3I9IA 2NY5L 4QHNB 1QRNE 4O2AA 3C5SB 1BX2A 1L9TA 3PGFL 3QW9A 2IH1C 1CFSB 5CXPA 2JSFA 2P42B 1JNLH 2J8UB 1JN6B 2QSCL 5BO1L 4Y2OB 1CXLA 3EJYC 3CFBB 4WF9V 1J5HA 2GK0B 5KAQF 1MCBA 4PP1C 3QIUD 1XMEB 3F05A 3VXSE 4H0LB 1MREH 5DMIL 4PPTA 1E4HA 4LK4A 1Q6HA 5IVZB 5C07A 2ZP0T 4DAGL 3OKDA 2HG0A 2K9FB 2PKDA 3MV9A 4WWKB 4Y1TA 5I1KH 1BMGA 2WSPA 2BCCH 3TLRA 1AOZA 2DQ6A 3RU8H 4IOIA 1QWUA 3OAZK 3BESR 3DHJA 4LSPL 4F7KA 4YQXL 4YXLL 2YMOA 2ZXEB 2RMKB 3ZMSA 3UAJD 3UZVA 4AEEA 4Y4HC 4BZ1A 4TPRL 1A6VL 3C8DA 4CC4C 2UVFA 5F2VO 2EEAA 3E83A 4G11A 5CSZB 2IQ9L 2P5OA 1FO0L 5E0FA 2DMHA 2LV4A 1A47A 1J7VR 1U6AL 4G9DB 4A04A 2X0WA 5KSBB 4XI5C 5J06A 4ZMTA 4HZ3A 1U8PA 2A9CA 4JQIL 4L4VA 1NCDL 4R7LA 1FNHA 5KJ7E 3AG3B 3P30L 2DWTA 1WTGT 1TEYA 1UADC 3K5LA 5T3XL 4LCWE 1BSIA 2K1EA 2X4OB 2XVGA 4DP5X 1A65A 4DV5O 4N2BA 1VQLV 1OY3B 5I75C 2N0KA 4Q97A 4Y4FB 3G04A 5LLIC 4DO5A 4ZO6A 2N74A 2R83A 1S5HA 1GPOL 4XVTH 1CFQB 5AAMA 4PSPA 3TO4D 4GS7B 4R6ZA 4DV5B 5FEBA 5JNYA 4DGWC 2ARHA 1DVUA 2DN7A 3R1GH 4TOIA 1AD0A 4UQEA 3RNQA 1JZEA 1MJ8L 1OB0A 2GJ6A 5C0BD 3JARB 3MYJA 1S7SA 1CFTB 3JVGC 2QTSA 4JO3H 4M5ZL 2UXFA 2DYSC 2FEEI 3EZJB 3WIFB 4O9HL 4BQ8A 5KG9B 5D5QA 3CFNA 5FCUH 3ARFA 5E1QA 2E7CA 1EIBA 4LDLB 3PDOA 3QFJA 4PSRA 4YLBA 1EJOL 1SEQL 3X14B 3SKJL 3PL6A 1N59A 2V7NA 3U30B 3BP7A 3ARBC 5IF0B 3M1BB 3KYMB 1CFSA 2DQDL 4D9LL 3NJGA 1ETJA 1HQ4A 2R59A 4F8TA 2YUWA 3GYRA 3G6BA 4Y4KD 1TVKA 1COWG 2J1ZA 1MLBB 5FO9B 3DXAB 2NYYC 1FORH 3Q0HA 4R26H 4L8CA 5LOVA 2YD8A 5KSUB 1XSOA 2R1WA 2R1YB 5CINL 3L7FA 3ZN1A 1PQZB 1BZDA 2Q8AL 4TLUA 4LLMA 5D6CA 1KPRB 5CB4A 1NUNB 3C6EA 3WJLA 4K5OA 2Z7YA 3MYJB 1DBAH 4TVUA 3GUFA 2ZE0A 1VRSA 3SDAC 4PJHB 4C58B 1WB8A 5F7MC 1EX0A 2M6YA 1UWGH 1HNYA 1RZ7H 2H3NA 4LL1A 1E1RG 4YSDA 4AKQA 2OK0H 3M8OH 1X5IA 2XN0A 1XF1A 3FN0H 1KN2H 1V27A 2UWEF 2FSEA 5BOJA 1W8EA 4H33A 1RZPA 1JTTA 3P0VH 3ZW3A 4E9XA 1L9RA 3V4PB 2DLFL 4ZFZB 1UJWB 1R75A 4PJDF 3UG4A 1P7KB 3GBLA 4WAFA 3FHAA 5ABAA 5GZOA 5CBHA 5LGNA 5GS1A 3DIFB 1KN2L 5KBLA 1H3XA 2BSCA 3FSAA 3MRLB 5T1LD 3TBVA 2GHZA 5DFVC 4B7KA 5F1NB 2UXNA 1FNSL 1WAAE 2XQYK 3K08A 1X5ZA 1Z5HA 3T3PF 3ZYZA 1F2XK 5C6TL 1JN6A 4PJ8B 2EADA 1EXUA 4S1DC 4JCLA 5FR3A 2WZPD 1W59A 3VFNB 3VO0A 3VCLB 1CD8A 4MD0B 4MQTB 2EINB 2KKWA 4MDJA 2YIHA 2Q10A 2CM5A 4OF5A 4NQED 5D7KE 1WFNA 3HVNA 4EZJA 2HHHO 3O3EA 3CFCL 4DKDC 2AHZA 2OTUA 1FXKB 3SGEH 2YOAA 4Y2DC 3NIGB 2B3RA 3L95B 5JPMB 1BWWA 4GAJL 3L16A 3SPVB 1G6RA 4UQAA 5I0WA 1BQLH 4BCXA 3LHAA 1BBDH 2KDYA 4R3SB 4DERA 4L2YA 4DUYO 4IS6A 3OB8A 3C5XA 2AJ3B 4LF5B 3C5ZA 4S2SB 1A22B 5DJYA 4EB6B 2EDTA 3P4LA 1MCEA 3EOAA 2CUAA 3O2DL 5HVHC 1CGXA 4OD2A 2GUOB 3VM5A 3VCLA 2X6BA 5IB3B 5K9JH 1G9NC 4I5SA 3ECQA 3E6HA 5DZLA 2P49B 2ENPA 5EEVA 4Y9BA 1FWXA 2VXVH 4UVBA 1XMOO 1XNRB 4Y5YB 1H8SA 3BVTA 4M61A 4RDQF 1EEQA 2YBGA 4Q58C 1BVOA 1Z7JA 2MWCA 2E9WA 2CD0A 1ZJAA 3CUPB 4H5SB 3BCDA 3QDME 2B1OA 4Y2NA 3ZUNC 4K94C 4JFPB 3U2SA 2OR9L 3V0EA 4PH8A 5K39B 4BBWA 1BF5A 43CAA 5T3XD 3N0PB 4PV8B 4NDMB 4G6AC 5DQDH 3A6BL 4HIEB 1T0NA 2Q9LA 5GRJL 4D8PA 5IESL 4QRPB 4JGNA 3IETB 1GRJA 5F6IB 4FTVB 4KTEH 1DFBL 1DSFH 1ETA1 1HNWB 1A02N 3ZMVA 4PA3A 3FUKA 5JDJA 4HLZH 3EOAB 5DHDA 4I50B 1NCWH 5E7BA 4XAWL 3ULUF 5E95B 4TRPH 4FXGA 5T33L 1A7QL 4DSYA 3UROR 4J2XA 4MJIA 2AV1A 2VQTA 3V6OC 4FQLL 3CIQA 2UY6A 3PGCB 1E5YA 5IJBC 1ORQB 4GXUN 2QWNB 2E5LO 2VRQA 4HKBA 3F62A 3GIVB 2AQQA 4J3OH 3NP4A 1YNKH 2XJLA 2A4ZA 3GTTA 4U1HB 2C9UA 3QH3A 1PY0A 2GTZA 5HYQB 43CAB 1LO2L 4Z8FH 5DMIH 4DV3O 5L4FA 4OQTA 3A22A 3CLWA 2IIJA 1Q5OA 3OTOO 3K2MC 1MPAH 5SV4A 1T0NB 4BSWB 2ZKMX 4IRJA 3ETSA 3L1EA 3GXPA 2D0GA 2NR5A 2VQEB 3GTNA 4TSAH 4WU5B 3HN3A 3DXRB 4KKAD 3BY6A 1KN4L 3ZHFA 4Z2WA 5LHDA 1N7ML 4K8RD 5IHUH 5C6WH 3ULUH 4QLRA 2F18A 4XHQA 3MREB 2PN5A 2FWOB 1N6VA 3ZTCC 3V6FB <