5B3SB

Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 k)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed-valence state at 1.68 angstrom resolution (50 K)
rcsb
total genus 69
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b3sB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b3sB02
1WA2X 2FQDA 3UAEA 3X1BA 3H4HA 4E9VA 3IE9A 3NJKA 1OOWA 4UANA 3ASOB 2IDQA 2TSAA 2XXFA 1MG3C 4TXVB 1ETJA 1A4BA 3OQRA 2OV0A 1J9RA 3NYKA 4GXFA 4JHUA 3UAAA 3X1NA 1BQRA 3ZX1A 3PPSA 2BW5A 1B3IA 1YLBB 2XX0A 5EHFA 4A67A 2IDFA 2HZHA 3OM3B 2XU9A 2WSDA 5B1KA 1PMYA 3EHBB 4G7SB 4MFHA 4A2HA 1GS8A 2VM4A 1AZUA 1A8ZA 4QLWA 1A4CA 4GP8B 1ADWA 1WA1X 1X9UA 4YSOA 2TSBA 1T5KA 2Q5BA 4DPBX 2BW4A 7PCYA 3AZUA 2R7EA 5I6LA 4DPCX 4KNTA 1GS6X 4KO9A 4E9TA 3U25A 1ZV2A 3NJJA 2GC4C 1EHKB 2YAHA 4KO5A 3FU7B 2GB2A 3FPYA 2BWDA 1RKRA 1ET7A 3FU8A 4Q89A 1R1CA 1NIAA 1TU2A 4GP4B 4G7RB 1NWOA 4F2EA 1M9WA 2ZONA 4PAZA 1BAWA 1GYCA 3SBRA 2CALA 4W1TA 1URIA 2DV6A 2OCCB 4YVUA 2H3XC 3QJQB 4WKXA 5AKRA 1JVOA 4DP4X 2GBAA 4M3HA 5IY5B 2HX8A 1JXFA 2YAQA 4QKTA 3TBCA 4P5RA 1N68A 5AZUA 2DYSB 4HHGA 1OCRB 2QDWA 5I5JA 1W6LA 3FSWA 4BDVA 2IWFA 4DP2X 4GYBA 2GHZA 1L9RA 4YSAA 1ASPA 3EH3B 1IBZA 5I6PA 2PCFA 4P5SA 2FTAA 2AANA 2EINB 3FYEB 1BQKA 1NIDA 2FT8A 1PLAA 3NSCA 3FSVA 1A4AA 2VW7A 4NAJA 2GIMA 1RZQA 1L9SA 1PLCA 2DYRB 4G72B 2FT6A 2XXGA 3ABGA 1JZJA 4N4YB 3NP3A 2PPAA 4E9WA 4YSPA 2FQFA 1JZHA 1GSKA 1OCOB 1J5DA 5B1AB 5I6KA 3X1FA 5B1BB 4E9SA 2YAPA 1FWXA 1AS6A 2PPDA 1J9TA 1JZIA 1BEXA 1MG2C 4BXSV 3N2JA 2VSMB 1X9RA 4KOBA 1TKWA 3NSFA 3EH4B 3KW8A 3S8FB 1ZIAA 2H5UA 3OMNB 1QHQA 1KDIA 3UABA 2FT7A 1PAZA 3CVBA 3EH5B 1AZBA 3NSYA 4E9YA 1KGYE 4BK5C 1V55B 5D4JA 2Y69B 2PLTA 3G5WA 1SNRA 4BXVA 2VW4A 4YSQA 2N0MA 3TBBA 4ENZA 3JT2A 3N55A 2YAEA 2H47C 3SBQA 3CDZA 2PCYA 1M56B 1JXDA 2LLNA 1WS7A 2AZAA 1V54B 2ZWNA 1CC3A 2HRHA 2X88A 3WIAA 3ZDWA 4AZUA 2J56A 4DP6X 3NJLA 2GSMB 1ET8A 1ET5A 2CCWA 4UF7C 1HFUA 4F2FA 1L9TA 1XB6A 3WG7B 2R7EB 1SDDB 3FQ1A 2BO0A 4DP0X 2DWTA 4K9JA 2YEVB 2QPEB 3CVDA 3S8GB 4YSTA 2B08A 4HCFA 3RYMA 2J57A 2IDUA 1JZGA 1AR1B 3WNIA 1SHWA 2PP8A 5B7EA 2EIMB 3SBPA 5B1JA 1QLEB 1QNIA 2CJ3A 1L9QA 1KBWA 2I85A 1SF3A 2BZ7A 3DKHA 1ZIBA 1DZ0A 3FSAA 1L9OA 3FS9A 3QJVB 3GXUB 2W88A 5B3SB 2YAMA 1L9PA 2JKWA 2HX7A 4KO6A 4YSCA 2RACA 1W8EA 4KNUA 2XX1A 1ASQA 1EZLA 1IBYA 4A2EA 1CURA 1NIBA 3GDCA 3BQVA 4BWUA 1OV8A 3OMIB 3ABMB 1V10A 4CSPA 1JZEA 1ZDSA 4BWWA 1I53A 7PAZA 1CYWA 5A7EA 4KO7A 2FQGA 3NJFA 1JERA 1ILSA 3FU9A 3S3CB 4A2GA 2YAOA 2XV0A 4YL4A 2QT6A 2YAFA 3IN0A 1GS7A 5FC9A 2P80A 1KYAA 3S3DB 1GR7A 2VW6A 1AANA 3DIVA 1NICA 3DTUB 4YSRA 5I6OA 3KW7A 2ZXWB 4G7QB 3PLYA 2FQEA 2XV3A 2AZUA 1BYPA 1FA4A 2YXWA 3FT0A 3ABLB 3WNJA 3OD3A 4A68A 1WAEA 4HCIA 5LDUA 1KCWA 3FSZA 9PCYA 1OCZB 5TK2A 1NPJA 4GP5B 1AZNA 3PAZA 2EIKB 1AZCA 2IH8A 2DWSA 3JTBA 4DPAX 1A3ZA 4JKNA 1AG0A 5AFAA 3AW5A 3NJGA 3ASNB 2JFCA 5TK4A 4FAAB 2VSKB 2FJSA 5PAZA 4PCYA 2BWIA 2PPCA 3PXLA 2UXGA 5I28A 2A3TA 1ILUA 4JHVA 3T6VA 2HLEB 2XUWA 4CSZA 2XLLA 1FFTB 1GW0A 4L0PB 1OE3A 1A65A 1JZFA 4X4KA 3V9EA 2E86A 2IDTA 1BXVA 1AZRA 4GY4A 1IC0A 2AVFA 4YSUA 6PCYA 3QJUB 2VM3A 1BQ5A 1PCSA 4NERA 4BWTA 1OE1A 3ZBMA 3C75A 4YSDA 2FWLB 3TASA 1MZYA 2CAKA 2W8CA 3QJSB 3T6ZA 3NJNA 1NWPA 3FPXA 4HCGA 4UAHA 2Y1AA 4M4RB 1GY2A 4W9ZA 2HRGA 1J9SA 3NSDA 4E9XA 2J55A 2UXTA 1XB8A 3UADA 1MZZA 2QDVA 1SHXA 4YVNA 2ZOOA 5B7MA 4DP1X 2CBPA 1AS7A 1HAUA 3T6WA 3OMAB 2BP8A 2OJ1A 2PP9A 1PNDA 4FA7B 4HHWA 1MDAA 3D12B 5E9NA 2B3IA 1NTDA 2UXFA 1BXAA 1J5CA 1E30A 1KDJA 3UGEA 1NDTA 2VMJA 2JXMA 2VN3A 3PAUA 5F7BA 1ZDQA 4E9QA 1PNCA 1E5ZA 1PF3A 3HB3B 1PY0A 4RH4A 1TEGA 4HZ1A 1UATA 2HXAA 2WO3B 3TA4D 4DP7X 3QQXA 1CUOA 2XYBA 2IWKA 5PCYA 1NIEA 1OCCB 1SF5A 3SQRA 4HIPA 3S3BB 2UX7A 1PZCA 2XVBA 2I7SA 1JXGA 4DP8X 3QPKA 3T9WA 3PCYA 3NJIA 4BDVB 2BP0A 2PP7A 5I6MA 1SFDA 4KOCA 2J5WA 3WI9A 4ZK8A 1PZAA 3BVDB 1F56A 3X1GA 3NJHA 1AS8A 5I5MA 5B1JC 1DYZA 1GY1A 1J9QA 4EF3A 3TU6A 4G71B 4YSSA 2IWEA 3ERXA 3WKPA 2Q9OA 2YXVA 1SDDA 2MRYA 1IUZA 3MX0B 4HALA 1BXUA 4WTQA 2XV2A 1E67A 1JOIA 3AG1B 3H56A 1PLBA 3AG4B 1AACA 1KV7A 1ZPUA 3HEIB 1E65A 3X1EA 4Q8BA 2X87A 2UX6A 2QPDB 3X2QB 1WA0X 1OF0A 3CZUB 3NT0A 3T6XA 1ID2A 1AG6A 2CUAA 4F7KA 3T71A 4E9RA 3CG8A 3L45A 3ZIYA 3IN2A 8PAZA 2UXVA 2FNWA 4G70B 1NIFA 3UACA 1IKOP 4AI7A 1ASOA 4YSEA 3V9CA 1W6WA 1CYXA 1E5YA 3EF4A 3QJRB 2GI0A 4DP9X 2IAAC 2NRDA 1RZPA 2GC7C 1M57B 3CDZB 1NZRA 3FU7A 4A2FA 5D4IA 3FQ2A 5I5IA 5D4HA 4N8UA 1AAJA 4HAKA 4DP5X 1XB3A 3GYRA 4AX3A 2I7OA 1AIZA 3FYIB 1SFHA 4KNSA 1AQ8A 2EIJB 1WS8A 4AKPA 2MTAA 1SJMA 2BP8B 4NB7A 1KBVA 3CVCA 5I26A 2IDSA 1NINA 3QJTB 1TEFA 3AY2A 2PPEA 3IEAA 5ANHA 3IBOA 4AKQA 2EILB 6PAZA 2YQBA 1HAWA 3WKQA 3FQYA 4AKOA 5F7AA 3ABKB 2WO2B 2XWZA 1JVLA 1N70A 2IH9A 1KCBA 2BHFA 2AFNA 1AOZA 1XMEB 3NJMA 3PAVA 2BZCA 5B7FA 1PZBA 1RCYA 2HX9A 2P80D 3NP4A 4A2DA 1OE2A 2DY2A 3H4FA 3AG3B 3MBWB 3AG2B 2PPFA 2BP0B 4A66A 1BYOA 1VLXA 2YARA 1NPNA 5I6NA
chains in the Genus database with same CATH superfamily
3N2KB 1X5FA 4WW2F 1SUJA 5B38A 3UAEA 3I02A 5F7YC 5JZ7C 4N21A 5I1LB 4X8XA 3OJ2C 1JWSA 1OOWA 3RPKA 3BQUD 4OCXH 2Z31D 1E0OB 4GO8A 2EQDA 5TE7L 3MV7A 4HMEA 1TZ8A 3BWUC 3QH3A 4HJTA 3NZSA 3MRJB 1NH2B 2L7EA 3MRBA 2F4VB 1GM9A 3GIZL 3MA7A 1HCYA 4Z7VB 1OZ0A 1S3JA 1QEWA 1T4KB 1VCAA 3B3BA 4C59B 5F3BA 5E99H 2Y7LA 5GGSA 4F3FA 1S9WB 4HX1A 2KC0A 5EHFA 4YHNB 4HGKC 3HG0A 4G83A 1PZUB 1HHIB 3QDGA 3WTSA 5EWIL 4XO5A 1A9EB 4KXCA 1FYJA 1QA9B 1PNKA 2P5WB 3WO4B 2UUCO 4TL4A 1G8MA 3BEWA 4NO2A 3CCVV 5EZOH 3UCQA 1CN4A 3K8MA 2ENPA 1QTYT 3K5LA 1LILA 1EFRG 2E74C 2TRYA 4G2AA 2UUCB 3NFNA 4KO9A 4W9GC 3G6JF 5TQ2L 1OT4A 3VSVA 5KJRH 1H8NA 4J7RA 1BV8A 3ZZLA 4FABL 1AYOA 3UC0H 2QVTA 4V11A 4GAJL 4WUUD 2VLRD 2DM2A 1RHHA 2EE2A 4I0KA 1G9HA 2A9ML 3UPRB 3GMNA 4H1LA 4Q89A 1YA5A 1ZLUH 3O3UN 2HJLA 2R1WA 1NDMA 1LTXA 4MXQC 1FI8C 4Z7QF 4NUPA 4AEFA 3RILA 2IANE 4OLZH 3IRPX 4U1JB 3Q1SH 1BFOB 4MD0A 1C5CL 2APXA 3PJSB 3UIZA 5B38G 2H2PC 3B3IA 4QJ3B 5IY5B 1KTRL 1QEXA 4TUOA 4N0FA 2RN9A 4CVZA 3MLTB 5CSGA 5DEGB 4QKTA 1AZZC 1URLA 2H45A 1TFHA 4EKWA 3OZ9H 1IM3B 2CTQA 1R3IH 4G7YL 1TYEB 1B6DA 4L29A 1HKLL 4M1CC 4PH8A 4GUQA 2WQWA 4EIGB 5I73B 1NGQL 1FXVA 1O6SA 4Q9QH 3BABA 2W94A 1TCRB 2QWOB 4P5SA 3WNMA 4L3EA 1QLEC 3NIFB 4HUWB 2LV4A 5MEND 2J6EL 2VDPH 3P0YL 3QEHB 2NQCA 1BP3B 5C8YA 1RZQA 4KKAD 1W59A 5TF0A 1UWGL 5GRJL 1T2QH 4YSPA 4FERA 4P5TD 4PA9A 1UKTA 5I15H 4IHOB 5F6IC 3JV0A 3N43F 3EDJA 3BZ4B 3U46B 4CU7A 2DQCH 3PQYB 3IDGB 3HVDA 3NFSH 1ZVSB 5B8CC 4WJ5A 3LDCA 2Z1PA 3ULVC 1FFXB 2PXYC 3P3YA 2UUDH 1NOLA 5C0EB 1KDIA 2EKJA 1NCIA 3HS9A 4H8WH 2IBGA 3ECUA 3CS5A 2B1AL 3RYHA 5EIQA 5AKVA 3L9BA 3QO0A 5DHVH 5EC1A 1G1XB 1BDYA 4N2EA 1A6UH 2EC9T 4NUGH 5GJTH 3VQYA 1AKJB 4YOKA 4R3SA 3SBQA 2C1OA 1JXDA 3DX9A 5EO9B 3RI5F 1V54B 3I9AA 1N6QL 1ZA3A 3GXPA 3CRMA 1TF4A 1MEXH 3ZDWA 1NCAL 3ISWA 3ESNA 4ODVL 3WU1A 5L6YH 3LNFA 5I1AB 1JV5B 1XGUB 2WWKO 3SYAA 2EEXA 1MWAH 4RFEA 3EYSH 1REIA 1MNUL 4MBOA 2KUTA 1AGCA 4GKNB 5J6HB 3BYYA 1KPUA 1YZZA 4NYLA 1IAOB 5JHAA 4WY7H 1T22B 4HQQH 4ZI7A 2VJ8A 2YD0A 1CU4H 4FNSA 3WGUB 4YSTA 2B08A 4IOFC 4XNYL 3ZRCC 2X4TA 5DLML 4F1SA 3S8GB 2FB5A 3WNIA 3W11C 4YBLC 4MMZA 3GXDA 4K71B 4HSCX 3SBPA 1K8DA 3C5ZA 4NENA 4PI0A 4X7SH 4PBVC 3TXSA 3UTTD 3F7VC 3RWRD 5DFWH 3W2DL 5KVEE 2X89A 1XMOO 1WRFA 2W88A 2WMPA 5D1ZA 3SQBB 1UXLA 4PPTA 1ZHLA 4HT1H 1H2LA 1SEBB 5IKCA 2LU4A 3CSFA 4O9HL 3WE1A 1Y4MA 1S9VB 1IV8A 4PP1C 1HH6B 5HDBF 1I8IA 1IGTB 3I3EA 5J89A 4DVRL 3QI9B 4QTHB 5JIPA 3VMNA 5E1AC 1XOUA 1JV2A 4ENEC 4EZMA 5CZVL 2AGJH 1T1WB 2FATL 2JKNA 3O8XD 4FCHA 5IQ7H 3DJTA 3GMLB 5A7EA 3MV9E 4ZUSB 5IYZA 3RVTC 1RZ7L 1JCHA 5F7WC 4FNQA 5LG1A 3F58H 2ZXEB 5DK0A 4F9PA 3CHRA 1OT2A 3WS3A 5CLYA 1DBKH 2H1XA 5TGBB 1WCBA 2NW3B 3FCSA 3TETA 5D7LD 3HMWH 4G5ZH 4D9QD 3LX9A 3CU7A 5LGTA 5KSBB 4OV5B 4F7EB 5LNGA 1JTPA 2HWZL 4Z77B 4B9CA 4AV0A 5EEZA 4J42A 3CDGB 1WV7T 5IFJB 4FQ1H 1X5MA 3LVEA 4JZNA 5MEOB 4YSRA 2XQBL 1N5YH 2F8XC 2ZG3A 4FNTA 1JYVA 4WNQB 3ZN1A 1DO6A 2FQEA 4XODA 1OVZA 5HJGA 5IB3A 3QZOA 3WNJA 4KQ0A 1U8CB 4Z76B 3OD3A 4HIHA 3S37L 4Y1SA 1IL1B 3V7AE 5J11B 1WAEA 3FTSA 4M7ZC 1MIML 1TPXB 1VFMA 3RUGB 3TH2T 4XVUD 4C8XA 2Y07H 3EOBB 2WO4A 1BGYH 3RAJH 3C6LA 3KPLA 4LP5A 3AREB 3OX8A 4DV4O 3F12A 2EE9A 5F6HJ 1EGJH 5C09E 4AVIA 5C07B 3A67H 4GLRH 4P9HC 3MYJB 4ISVA 1MELA 2DMKA 2PWGA 4ZDHA 2LR4A 2EO1A 2D7OA 2DEXX 4OPHA 4Q6IB 3ASNB 2PO6A 2R56H 3P2DA 1BZEA 3WJMA 2EDBA 5KS9E 4R7LA 5ICYA 3NCXA 3TEWA 4FMVA 1KIUA 1UH4A 1GKFA 2N01B 4NCDA 5PAZA 3K57A 5E94B 4LPYA 3BE1L 4W9IC 4FVMA 5EU6B 5GS1C 3DNKA 1RLWA 4M8VA 4JG9A 1KP3A 4GKJB 4DT2A 3QIBA 3BESR 5DTFA 1EZVY 5DRNA 5A2LH 4S1RL 1OY3B 1A65A 2O30A 3WUWA 5GTHZ 2ZYRA 3NDYE 1XF3B 4S0HA 3WN5C 4BV1A 1C1EL 4H8QA 4XCCH 5GSVA 1COWG 1JK9B 4HULB 1J11A 1EJOH 4DAGH 5JHDA 1JCVA 4F33A 3TASA 3QHFH 3BT2H 5HI4C 1OTTD 4EIZC 4F8LA 1UH2A 2IFGA 3MFGB 1NJIW 6TAAA 2YD7A 1L4IA 3RLSA 1DLHA 1ZLSL 1V8HA 3MOAL 4MB3A 3DHJA 4OSUL 2L6LA 2KPNA 5J56B 1XH3B 1Z32X 1ZUQA 5GZNA 1R3KA 5CSZB 1PP9H 3BSZH 1PNLA 2AGAA 4X5WA 3BX7C 5FKAB 5T3XE 4R8CA 1HHHA 3FQNA 5ITBL 3KLAB 1KGUA 2PTTB 4IIJA 1NAML 3HS0B 3K1KC 5FHAH 3GJEA 4LVNB 1KNOA 3PABB 3G04B 1OD9A 1M7XA 4Y5YC 4CZZA 4K07A 1EFXD 2ATPB 4AM0A 1MDAA 3M17A 1KXVC 2AXFA 4PJIB 1GYUA 1VHPA 1Q8IA 3Q6GL 4QHKJ 4RGMC 1F41A 5HD8C 2FR4A 1GKEA 2F19H 5KYYB 1FV1B 1RZ8A 1FKAO 3CH1A 1VQPV 3R18A 4Y9EA 5EF0A 5E2UH 2VRQA 3JWNG 2W9DL 3UT5A 2DZEA 4X4YA 1HE7A 1M57C 5GGQL 4E9QA 3EOTL 2MK3A 4YJ3B 3K8LA 2KLTA 2R0WH 4Z7WF 1M7IA 3NUKA 2DQDH 4TN9A 2E59A 1IVLA 1QUPA 1TYRA 4NLHA 5TE4L 3VNZA 5D2NB 3WFCL 5EOCJ 2V5RA 4XRCB 5DD5L 4QWWD 2H6PB 3BPCA 3ULUE 2QHRH 2E27H 3TNNB 4UM9B 1S9KC 4F8QA 4XMTA 3GZQA 3DBSA 4JJ5B 4PRHD 3IFNL 3PL6B 3KPRA 3JV6A 1JS4A 2F54E 2EYTA 1AD9A 3KH4A 1NMAL 5D96B 1NFIB 1ZWIB 2GPZA 2NX5D 1QBBA 2PP7A 2VKXA 3L3KA 4PJHA 3T4AB 4ATTA 3AU0A 2J73A 1OARL 2MNJB 2P8LB 4LLYB 4P2RD 4O51A 4X9FA 5I5MA 2D0HA 4OTXL 1CQKA 1SYVA 3JBG7 4EF3A 2X6MA 3ZHFA 3E2HC 3QIUD 4WEBL 5JA9A 1IUZA 3FONA 3RBSA 4NUJA 3MNMA 3VFWA 5I23A 2ARJA 1GC1C 5KYWB 2JKLA 3P2TA 1WJZA 3GBEA 4KDTA 5A1AA 1MNNA 1EHLL 3TF4A 3ARFD 2BVYA 3OWEA 2DE0X 1GOHA 1XAUA 2WQAA 4B0MM 2HJFA 1E4KA 1O0VA 2DI8A 4AJWA 2F2HA 4JKMA 4PJDA 3EJSA 4PJ9C 4Q8BA 4YGVA 3VQ1C 4MQXD 4TV8A 4PRPA 3RW0A 1MFBH 5D7JA 3RKDC 5SWSA 4JCWA 3KCPA 1EO5A 2CUAA 4F7KA 3OF6D 3WFDL 1E6OH 2D31B 5C8JB 5EPMA 4AG4H 2ZKOA 4C4BA 3MBEC 1BVKA 3VXRA 3I50L 4HYTB 4ETQB 2ZCHL 3KWVA 3VGBA 4FQ2L 3K71A 4PD4F 4R90H 3GMPB 2BC4B 4TQFA 3NIFE 3ZL4L 2YKLH 3QQ4A 5GGVY 2VERA 3U0WH 5IJVA 1NZRA 3INUH 3GSUA 4JFDA 4OZHA 5GRUH 5MI0B 3D85B 2BX5A 3LNEA 4LSUH 1SJHB 1YG9A 2PWEA 3CFDB 3S3PA 2R1YB 3IAGC 5AW4B 1NBVL 4JQIL 1J8RA 1KTBA 4DP5X 5FPIA 1G6RH 4GRWF 4YHPA 4EI6B 4KK5C 3DPBA 1YQ2A 4HAFA 2N1TE 1JR9A 3MPCA 3QQ9D 4NHUB 1S9XB 4BUQA 1YN6A 2GK0B 1A7NH 4AOFA 4HZLA 2QR0A 1O6TA 3NZHL 1IBBA 2BP8B 1Y7VA 4W6YB 4JZJB 1B0RA 1A4JA 3UFIA 5D7HA 4JFFE 4BELD 5K59E 5IMOB 1MCKA 3CK0H 3V4LA 2YD4A 3IEAA 2A9BA 4G1MB 4UNUA 3T1FB 4N1EA 5C3LD 1W72L 3KPPA 3HUJE 4PRAB 3UCSC 1HN1A 3EG9A 3V52L 2VAAB 2H3KA 5C0AD 2F15A 4K8RD 1IGFL 2EUZA 3OKOA 5E8EA 3B2VL 1TNMA 4F9LC 4HNAA 4OD3L 4Y5VC 1ACYH 2XPGA 2XWZA 4H2AA 3KR3L 4R0LC 1CD1B 1JGDB 4K8RH 1S9YA 4JFEB 1CPUA 3BP4A 2GEEA 3DLQR 5DZOA 4WTZA 4NN7B 2P80D 1IKNA 1XEUA 3NP4A 4Q6KA 1FXHA 1VACA 1D9KA 1XR8B 1RK0A 3QDJB 1G1CA 1XTLA 1F00I 4D9RD 5FO7B 1JFFB 1JF6A 1VF5C 3ZDXB 4AGLA 5LBSA 3RZCA 4XOEA 3WIFB 1ZGLB 1KELL 4YQXH 3S37X 1M42A 4KI5F 3HTLX 4HWBL 4BHUA 3O4LA 2V3DA 5IWLC 3PN1A 1ZHNA 5DF0A 2K70A 3CPLA 3K58A 5LXGL 4MAYA 4GMSL 4FXGA 5AW9B 5ICUA 1KBPA 2BNRE 4MD5A 1K5NB 3L1EA 3TV8A 3X1NA 2ZTBA 2JCCE 4HOZA 4ASUG 4XNMB 4YO0B 5C0DB 2EIJC 3DMMC 5INCA 3N04A 2F93B 1GTNA 5GGRB 5DS2A 3U2JA 4FQXB 1KYOJ 1NGWA 5ACLA 1MFDH 1PMYA 2B4CC 2XI9A 4A2HA 2AJSH 3CSYA 1CLCA 3ZRVA 1R5WA 1EZJA 3LN5B 3QORB 4OX9O 1SM3L 2PYEB 4S11A 4B08A 4YNYB 4TF4A 3A4AA 1YMHB 4AYSA 4PJFA 1FN4A 1T5KA 3JV4B 4P04A 3W9EA 4PR5A 3MAQA 1VEWA 3OAYH 4OW6A 4F15C 4PGEB 4ZOBA 2R7EA 5KANI 2CMRL 4UT6A 4XMPH 3N91A 4RIRB 3TBTB 1QBZA 4YHOL 2Q69A 2NUTB 4WFED 5GZOC 5KSBE 1M1SA 3LDBC 3VWKC 3ABUA 3NJJA 3F64A 4OGXH 3NIGE 5EUOA 4ZSOA 3D0VA 4I9XA 4H13B 2ITEA 3RDTA 3QUHA 2BSDA 4WTZG 4FP8H 1FNEA 4Q20A 2VCOA 4KJYB 1OB1B 4J4PC 1P7QB 1W8NA 3BAXA 2XNAA 5DUPH 3G4SV 1FXKB 3OKEA 4UZGA 3TJEH 1D5IH 1JNLH 1UA7A 3NCJL 4GKSB 4ODUA 4PUBL 3VQMA 1URIA 4XHQA 3H0TA 2Q4PA 4AIZA 4X42A 3ZQ9A 3MNZB 5FYLE 1BD2B 1DJSA 2YAQA 1VKXB 4PJXB 3F7KA 3L8QA 4V33A 1D7DA 3TBCA 2OT5A 3A23A 4QF1B 5C07E 4BH7A 2WLLB 4J7JA 2BVOA 2HKHH 4G1EB 4JPVH 3QEQD 4N0CD 4W4NA 4PJCB 4XVSH 1MJUH 2WSSG 1OW0A 1SEQH 4I9WE 4HHAA 5KVEL 3H1IH 1I7RA 3DOHA 4L4TD 3TBVB 4FNRA 2O6FA 4PG2A 1PD6A 3LPOA 1QWUA 2NNCA 1P9MA 4HEPA 2AANA 3DUSB 1BQKA 1NIDA 2F7PA 2Q5ZA 3NSCA 3SDXF 1DANU 5TE7H 2VW7A 3X12B 4UB6Z 1XIWC 4KFZC 2PW1A 3VB8A 4H20L 1LE5A 4L2LA 2AJZB 1SA0B 2ENQA 5IJ0B 4NWTL 4DHLA 2NY0B 1OGAA 1Z3GL 2E47A 4L37B 4NYKA 4P2QE 4WRLA 5TE6L 4B9ZA 3ZDYE 43C9B 3GIZH 5C6TL 2R8SL 5F89B 3SJVD 4UTAL 3KJ4B 2FJFA 4JTAB 3OEEG 3KXFE 4XO4A 2E76C 1FYTD 4QOKB 3SB3A 2X4QB 1YUHA 2MQ3A 3KGTA 3O11A 4WI4A 4JY6A 1JZIA 1MG2C 4BSVB 5EWIH 3BIKB 5JQ6L 4KK8C 1HIML 4XAKD 3EJYC 1E2VA 1E6JL 2NN4A 4PV9B 4BZ2L 4CS3A 4GAGH 4ZS6C 4AGNA 2Z7UA 3ORJA 1KGYE 4WJG3 4X9QA 4CGTA 4OVVA 5T3ZD 1F0LA 4P57A 3CUPB 3DV4B 3OBAA 5FA4B 5TQ2H 4LCYA 4PU2A 4MD4B 4JDEA 1ZK5A 2CDFB 1YVWA 4FABH 4ZMZA 3TF7C 4N2BA 1T1YB 2P7TA 2GJ6A 5K1JA 3BWAA 4EUPB 4GAJH 3LSOA 2EJRA 5IE9A 3RY5A 5INDA 2IAMC 5IV2A 1JPGB 1K3IA 5FS5A 1RIUL 2A9MH 5CR8A 1F6FB 3UC2A 2XAFA 1CG9B 4U1SA 1OSPL 3QG6A 3OB8A 1YXBA 3BKYL 1AKPA 4P23C 2AQ3A 3VRJB 1C5CH 5ACZB 3QK0A 5EBMC 4DP0X 3V6FA 2BCKA 4JFPB 1Q6IA 3INOA 4FG6D 4ZAKD 1R3IC 3MRIA 4J7KA 3BEHA 1MCHA 4GG8B 2A77L 2R15A 3K2UL 3EBAA 5DC9B 1CGVA 2L8AA 2CO6A 4LF9O 1QSFD 4G7YH 3VRLE 5D7IA 5D2NE 1OHZA 1HKLH 3U10A 3DSFL 3CE1A 5J12C 3ZT6A 2R0ZL 5B39B 1U8OA 1N3NB 4XP5L 1NGQH 3CC5A 3EYFA 5C0BA 5IHHA 4YHHB 2JB5L 4A2EA 2ZWLT 2NNXA 1U58B 3HC0B 3VNYA 2ICWI 1M71B 3Q13A 3UAJC 2J6EH 3P0YH 4BWUA 2ZT9C 2X1PA 3ALPA 5KA6A 1FVDA 1KB5A 3D3VA 4PWIA 2EUXA 4BFJA 4Q7DA 5EBLC 2QMKA 4YH6A 3DGGB 5GRJH 3S5YA 1A6VL 1YJWV 3UPCA 4HCRL 2X5PA 1XBLA 3TA3C 3UTSA 2I07A 3GRWA 2XA8L 2R2CA 1JERA 4H8WC 1B88A 3CC7V 2FEJA 1TLKA 1JGVL 4Y19E 5T3XL 4JCLA 3DA0A 4PLJD 3LRLA 2G2RB 1MCBA 1IGJB 3ETQA 5DWUL 4B7LA 5JTWA 2IPUG 1HEZB 3IT8D 4FXKB 4BSWA 4PGDA 3EOYG 1ZD6A 2B1AH 3L17A 2ZXWB 1MRCL 5I82A 1UJ3C 4ZW5A 3EFFK 1Z9NA 4FDWA 2HFTA 1QU7A 5CFAA 3BAIA 1H5BB 2LVEA 1NU1H 1WUZA 3JQOB 5JCOC 2AV1B 1IRAY 2UYLB 4NN6C 3RIAF 4CDHA 3HG1A 5LDUA 1XGYL 3TLRA 5F0JB 5IDJA 1KJ2A 3VH8A 1N6QH 2R4SL 1UT1A 1AZNA 1L3NA 1DO5A 2J6WA 2ZUSA 1NCAH 4ODVH 5DD3L 5ID1B 4P9PA 2CH8A 3GMMB 4X6BB 1I8MA 1S7UB 1U3NA 4MJIA 5CIPH 2UUAO 2HG5B 2Y24A 4PTTB 2F1EA 3WS6A 1JDAA 1MNUH 5HP5A 5GRYA 3CJHA 4IGGA 1JI2A 2XT9A 1T03L 2XN9B 3Q3GA 2G75B 5KJ7E 3ULUL 2CIKB 4IJ3C 1ZX3A 5KYUB 2J44A 4HPYH 5AG2A 1TOXA 1OGTB 4M61B 4XNYH 5DLMH 4ZUTA 5D5MA 3KCYA 3M1CA 4NQEB 1QZ1A 2VLLA 4UQEA 3X17A 3DX8A 3EUDA 5KAQF 1GW0A 2DQFA 4GRLC 2BERA 5D70L 1OE3A 4UINL 4ODXA 4ZFQA 3W2DH 4IIZA 2CLVA 2VDNL 3Q8EA 1J5EO 2DB8A 4YSUA 2AVFA 3MV7B 4KI5C 4Q2ZA 5IMKB 2VQ1A 4O9HH 4LASL 1E3FA 1FFRA 4LLDA 4NTXA 2X6UA 4PP2B 3ZE1F 3MRBB 4WK2B 4LPUA 1ZXKA 2H2PD 3MA7B 2YIHA 4ZUUB 4DVRH 5F3BB 3BCCH 4U0RC 5CZVH 2RGSA 1J5EB 2FATH 5GGSB 4F3FB 4HX1B 4MASA 4QE9A 4QPEA 2X9XA 3APCA 4AYFA 4JVWA 4D3CL 4B7EA 1JVKA 2A83A 1RZ7H 4JFEE 1UCTA 1QHOA 1XQ4A 4ZMYA 1I8AA 4E9XA 4O2AB 5BCAA 2OJEA 3BEWB 4GCZA 2XTJC 3BZFB 3JYBA 1LP9F 3RJQB 2VNCA 2HWZH 5DFVC 3B9DA 3T0EC 4YS4A 2BP5M 4JM2C 1IVTA 2I9TA 1MZZA 5CEYA 2Y2TA 3NFNB 1HSBB 2XQBH 5MP6L 1DQIA 5IJKC 3H55A 2CE6A 2B3IA 2Y6SC 1MLBB 3SDYL 1IM9B 3S37H 3PJSK 1IZKA 3DC0A 3L5XL 2ZCLL 3JWDC 3RP1A 3U36A 1RERA 3GMNB 2WKLA 4DUWA 1MIMH 2JXMA 3D2UD 1WPBA 2HJLB 2R1WB 3MI6A 1ZLVK 5BZDB 3TBWA 2V5MA 4GEIA 5E56A 1KTCA 2PUSA 3OHXA 2R9HD 2V6HA 2PXYD 2I5YL 3NA9L 1NBCA 3LZQA 4PJEB 1JUFA 4UTBA 4OJFL 4Z6AT 4CVZB 2A7WA 2Z4TA 3NCWA 3OJVC 4XX1E 2X9YA 3SQRA 4N2MA 3V0VA 2ZXQA 3HRZB 4J2QA 5ILTL 4FFBB 4DP8X 2G5UA 2EO7A 1UB5B 3N1QC 1CR9L 3KEDA 3BE1H 4MVOA 3MBWA 3MV8A 4M5ZL 3GTTA 4L29B 5F1IA 5HVHB 1N9PA 1TR7A 3DRTB 3SOBL 4WGVB 2J5WA 5L2JA 2YGQA 1DCEA 1SY6A 1BJ1J 4GPVA 4S1RH 2WD0A 1WISA 4RAUA 3GO1L 3OAZK 1N0XL 4JUTA 3IFPA 1C1EH 2ZD9A 1QBLL 5C8YB 4ZFGL 3HLKA 3VXME 1R73A 2B0SL 3BAKA 1LNUB 3QHTC 2XV2A 3QUYA 3VXTA 4ZOAA 3F85A 4PJ5A 1KV7A 1E4WL 3GXNA 5C7XL 3ALXA 4XDJA 1UA6L 1ZLSH 3MOAH 1G7LA 4JRYB 4OSUH 2YZ8A 2AABL 1LM8V 3B2UC 4KFMA 1IBGL 1JNHB 1WTLA 1ID2A 1WZAA 5IVNA 1ZV5A 2Y0IA 4NGHL 2WK2A 3HFML 3LKQB 2JJ1G 1UEMA 4RGNE 2YN3A 5ITBH 2C9RA 5C08B 2BCMA 1NAMH 4KVPA 2P28B 1TQCB 3QO0B 1YPZE 1Y07A 4F20A 1VADA 4APQD 4ENED 3AM8C 3Q6GH 3WTVA 3KYOA 4UQ2A 5EC2A 2C1OB 4TV9B 3ESVF 1RPQA 1WZLA 1SDYA 1IQWL 3DX9B 4XB7A 1CDBA 4EQ2A 3RVTD 1K8AW 1MIEL 4OI7A 1RXLA 2K4WA 2W9DH 1N6UA 4HAKA 1KWGA 5E9DE 1DLFL 2R9AA 5GGQH 3EOTH 4RFEB 3BRDA 4GI8A 1QUNA 3IGLA 4QOKE 1AGCB 1XHZA 3K8KA 1WT5A 3W9DA 4Z18A 5TE4H 4WU7A 4PGBA 3LZRA 3WFCH 1NVPD 4ZI7B 1KB9K 2BMKB 3EYQD 4MNGA 5DD5H 5HDRA 1CTOA 2X4TB 1OQXA 1RK7A 5ELIA 1CL7L 3W1ZA 3B56A 2ZX6A 3NGBC 3GB7A 4Y4FB 3L13A 5DHYB 3QIWD 3IFNH 4HKZA 5ISZA 5H37A 1K8DB 3C5ZB 4NENB 5CN3A 5HGBB 4KJWD 5CN1A 1NMAH 5DU7A 1F90L 4L2YA 3MNWA 2VO8A 5BOPA 3AQZA 3GKWL 1OARH 5D1ZB 2MCPL 1KYDA 1P84J 4IRJA 4U6HA 2PYFA 2A9HA 4OTXH 1L0PA 3T2QA 1JHKL 3MTRA 4DO4A 5D5PA 1KF9B 3FHQA 4MTGA 1I8IB 3QXUA 4WWNA 3OV6A 4P46A 4RLDA 4DV1B 2JJTA 3D5OF 4WEBH 4X66O 1CFNB 1JV2B 1ZSDA 4L3FA 5FYLL 4Z3IA 5JHLL 1EFQA 2R29A 3MO1B 4O2BB 3AACA 4LDLB 2YIAA 4PLKD 3CZSA 4MNQA 4E36A 2ERJB 1I1AC 5I0VA 1EHLH 3H4FA 2WWOA 5DK0B 4BIOA 2JJUA 3SPJA 4ZMNA 1J8KA 4HWZA 4X66B 3B9EA 4LLQB 1WA2X 3DSQA 3FCSB 3H4HA 3WB1A 2BOCC 2ADGA 1Q81W 3WFHA 2J3SA 4N90D 5E6IA 3Q8AA 3WFDH 5ABZA 4NQSA 3UAFA 4DESA 2DI9A 2JELL 3ECQA 3OQRA 2XKUA 4JRFA 1WTGT 5IREA 3I50H 3QXWA 4TWKA 2ZCHH 1CDGA 1THCA 4LF7O 1T7XA 4FQ2H 4EN3C 2GSIA 4E41E 4E68A 4QRUA 4HIHB 5AD0A 2LLLA 4UIMA 3GD1C 4OB5L 3ZL4H 2ZCKL 5K39A 5BV7C 1XCWA 3LPPA 3S4SA 3H42L 2FL4A 5F7DB 4PMEA 1LWJA 3X11A 5DMIL 1NBVH 4JQIH 2BSRB 4NP4L 2QTOA 1BQ0A 3F5WB 3VD1A 1JMZA 2Y3NA 3VCLB 3BD5A 3BD3A 1B0GB 2J2ZA 4ISVB 4ZDHB 2BW4A 5BRPA 1GZHA 2PO6B 4NI6A 3NZHH 3O4OB 4B3SB 4HXAL 3D1MC 4JRWA 5ICYB 1TZAA 4FTVD 1A66A 3NCBB 3V8OA 4Y4HD 2OYKA 2D8KA 1E8ZA 3FB7C 1CICD 1OK0A 3HPJB 3QIBB 4HUVA 3LNDA 4LLUA 1W72H 2K9PA 1S7WA 2JIXD 2NLJA 3DXAB 4NQDA 3V52H 4J3TA 3GGWB 1K4DA 1T3FA 2KQMA 4I0PA 4LGSB 2XTSA 5HYQA 2C3GA 2XWTA 1EERB 1K34A 2VOTA 1MSWD 3N1MC 1VQ6V 1IGFH 1T0OA 1GK9A 5DD0L 1TXKA 2WQSA 3B2VH 4N2IA 3C60C 4OD3H 2J25A 2AQPA 3KR3H 3MR9A 3JWOL 4NZ8A 3VX0A 4LLWA 5E5RB 4M3HA 1ORQC 1LO3L 4MCMA 4F33B 4PRIB 3MLUL 4JHBA 5B66Z 3MGAA 3B09A 2NPLX 4JL1A 1N68A 4LL1A 1Z7JA 3T0WA 1DLHB 2R72A 4M7LL 4WWKB 1D6VL 4M6OL 5DK3A 3IDMB 1KELH 2C26A 4XE0A 4DP2X 2NY1B 3UM7A 4DTGL 1L9RA 3RWFB 4HWBH 5KG9A 5E08L 5HFMA 2NR6A 3GSXA 5HHME 5BUAA 4CVXA 1HHHB 1YDPA 3FQNB 5HGGS 5LXGH 4GMSH 4NQEE 3FYEB 4IIJB 4W9CC 4YDLC 3S4SG 2WLIA 4AMWA 5F21B 1XEQA 1CMOA 2AP2A 1F18A 3KPQA 4U3JA 5BQDA 1A7QL 2ZR3A 2FT6A 3M17B 2AXFB 4GIPD 4XPTL 2CQVA 3RBGA 1RZ8B 1S8DA 3CH1B 4OCNC 4U1MB 4AUYA 4CMHB 1IAIM 3UT5B 4PJ9D 4CVWA 2Y0PA 3L5JA 1SM3H 4YY3O 1DBJL 1L1FA 2X4SB 3RKDD 1TZOA 1NUNB 1R5VA 3LYRA 1PD1A 3AS2A 3QDGE 4ABVA 3HKBA 3EYVB 5K9QG 2CMRH 2P5PA 4QO1A 4YY3B 3BPCB 3CB2A 4YHOH 2K9FB 4LP4A 3CQPA 2N0MA 4FJZA 3ARYA 3KPRB 1AI4A 2A9AA 1N0LA 3PHQA 5FO9A 2EYTB 1MQ8A 1BT8A 1AD9B 5L88L 2ZWNA 3IMVA 4QXUL 3L3KB 5SV4A 5LXVA 1EAJA 4LPCA 4LO9A 2KZBA 2BP3A 5B3JF 3TZVD 4LWSA 1I4FA 3ROOB 2AJXL 4TM9A 1S5JA 3II1A 1PY4A 3G9VA 1K33A 3NCJH 4PUBH 2WUCL 4NUJB 1NTKH 4TUYA 1GCYA 5LP6B 4X8JA 4NC2B 4O4LA 3OUFA 2IXQA 3A0HZ 1JWMA 2HJFB 1JHTB 5F88A 3MYZA 2H2SC 4PJDB 1NR1A 2XKSA 3BCDA 4YGVB 2ARWA 1MDTA 4TV8B 2BZ7A 4PRPB 5D7JB 3EZJB 5SWSB 5KVEH 4FFKA 4UNTA 3FQ4A 1QOKA 1HHJA 4YDZA 1XCXA 3NZ8B 1QMUA 1JN6A 5DI8A 2AJYL 1CFQB 2Q2EB 4ICXA 5EPMB 1BAFL 1BVKB 3CHPA 3QDMB 3VXRB 3ZE0F 5FUOH 3EBHA 4H20H 4GW1A 3K71B 1W91A 1WFMA 4NWTH 3DGCR 3IM1A 1RUQL 1Z3GH 2WCGA 3F04A 4PJ7F 1CYWA 4Y2DC 5EOTA 5TE6H 5C6TH 4L3EE 2X2IA 1SN0A 2AXGA 5DQJB 3FF8A 2R8SH 3QQ4B 4UTAH 4FLTA 5IJVB 1DQLL 2DQ6A 4JFDB 4JFXB 3TN0A 3L4VA 3O3AA 3J8F7 4J10A 5FDYA 2FUTA 4P2AA 2C9SA 3LZOA 3M7FB 4ZNCD 2MKWA 2M8XA 5L2KE 3WFVA 5JQ6H 5DHEA 4JFOA 4LFBO 1HIMH 2DDQL 1M2VB 4CH4A 1GR7A 1DSFL 4BKSC 4HZLB 1E6JH 1AANA 2QR0B 4BZ2H 3DIVA 4KKPA 4TVSa 1R3JA 5CUSL 1A4JB 4LT7A 3QG5A 2HG0A 2IV9A 1SOKA 4ODBD 1K6QL 1QD0A 3UDWC 4WDIB 3LKNB 1WB7A 2JH2A 1KXHA 3FTXA 2BVUA 3BQUA 1IAIL 3IGAA 3KPPB 4RBPK 4UIKL 5JW3L 5A6LA 5TK2A 2GCYA 2NUPA 5C09D 1RIUH 4W6WB 3SYOA 1QSVA 2XWCA 1AZCA 3OKOB 1LQSR 5E8EB 4Z1PA 2XAHA 1OSPH 3EXAA 2GVYA 1S5HC 5IBLC 1N8ZB 3ARGD 2X40A 2XPGB 3BKYH 1K5SA 4LBEC 4PEEA 1E8YA 1ZAGA 3E7JA 3MUY1 1GOGA 1M1XA 4X9HA 3BP4B 5EZJA 4L0ZA 1PIGA 3OR6A 2R23A 2Y4SA 3G5VB 1VACB 1D9KB 1QFOA 3MJ9L 1E8WA 5E4OA 1U0QA 3PXLA 2A77H 3K2UH 3VWKD 2YUWA 5J06A 1US6A 4YJ2A 2UXGA 1G94A 4QUOA 2A3TA 1HL8A 3VFVA 2OCHA 2DS4A 2DLFL 4D6TH 3ARSA 1RJCA 1SXSA 3MJ6A 1HOEA 4FLVA 2UY6A 4UB0L 3NIDE 3DSFH 2WKGA 4K7PX 2DQUL 2R0ZH 2WVSA 4MAYB 4O02A 4XP5H 5T1LB 1XNQB 1PCXA 2IDTA 2QADC 4FXGB 5B22A 5IHLB 4MD5B 2FLMA 2JB5H 2X4UA 2B59B 2HHHO 4U6YB 5I2IB 1ADQA 4WUUA 5I6XC 3CEIA 4N2LA 3KG2A 3ZBMA 2VLRA 4U6TA 3EKCA 4BH8A 4S2SA 2A6IA 3CPUA 3DGDA 1A6VH 4HCRH 2B8OT 3CSYB 4YIQB 5F2VO 1R5WB 3FQWA 2XA8H 5DS1A 5HHPA 3MRGA 4NKQB 1XGQB 3HE6B 4KKRA 1PV0A 2BNUA 1JGVH 5T3XH 1KIRA 1MJ7L 2WUBL 1FN4B 3IGUA 5C0FB 3P73A 5DWUH 3ILDA 3DX4A 1KFAL 4AQAB 4X5PA 1WB8A 3US1A 3OD4A 3TTSA 2ED6A 1M9SA 1YY8A 2PP9A 2W07A 5CJ8A 5I24A 4HC1L 5DEJA 1MRCH 5IQOA 5FGRA 1BXAA 4PV8A 2R2EB 5EUOB 4ZSOB 3D0VB 2YWYA 1QQCA 3TVMB 4OV6F 4UUJC 3F6JA 1XGYH 3RX5A 4N20A 3EO1A 2NSMA 2XNAB 4ZQTA 2R4SH 3LIUA 2JJSA 2ZUQC 3KHOA 3KVQA 4IMLB 4LAQL 4YX2L 1S72V 1OPGL 4WO4C 5DD3H 2E0PA 4KK8D 3R0NA 4NZFA 3B9KD 3H0TB 1P1ZA 3AITA 4JCMA 1CL7I 4P5TA 4OFQA 5A16B 5JW5A 5LJYH 1WAAA 1SF5A 2O5YL 5KBLA 2OL3A 2JVDA 4HIPA 2UX7A 3UJIL 1MFEL 3QXTA 4NOBA 1T03H 5I76B 3ULUH 3WDJA 4KROC 3CU1A 1CFSB 1JMXA 3CBRA 1PPIA 5EORL 1MHEB 3ULVF 2MEJB 3Q1EA 3L7EA 5DHVA 3EO9L 4DR4O 2CAZC 1GJWA 4KOCA 1PL3A 1ACXA 1QATA 5D70H 1RJYA 1C8PA 3T3PF 4H26A 1T0MB 1AS8A 4UINH 4XO8A 4Y9GA 1GY1A 2E7DA 4OXSA 5I0XA 1J9QA 2CJUL 2VDNH 2P90A 3A4DA 4LLAA 5DRWA 4DR4B 2VUKA 4P23D 2PW1B 3K5SA 1LE5B 4LASH 1XXFC 3RYCA 4LZKA 1A1OB 4FK5C 3RYIA 1PNMA 1ICTA 1PLBA 2FJFB 3HZKA 5C86A 1ZPUA 3HEIB 5I66A 1E9PA 3BDXA 1FBIL 3OMZA 1YUHB 4Z0XB 3AGVA 3TJTA 1W16A 4D3CH 4JY6B 4MZ2A 1OO2A 5JHDE 3CTTA 4JDVA 4U1IB 5AUMB 4FFVD 2ZWKA 1TYJA 4YDVA 4LPXA 1H6FA 4DR7O 4AUUA 3JALB 4I18C 4E4EA 1LHZA 1BBJA 5CJQL 2FIKA 1I8LC 5I8OL 3VFRA 4P57B 5F7LB 3ZE2F 5DVLA 1CBVL 3K6SA 5AWNL 4DR7B 5FR3A 5MP6H 3EF4A 1QFWM 3UTTA 5CZKA 2ZUYA 2ILMA 2CTPA 2XRAL 4GQRA 5DC2A 1HEHC 2P7TB 1VPOL 2GJ6B 3BWAB 5DQ9A 3RIFF 5EZLA 3SDYH 2BHUA 3B34A 3L5XH 2ZCLH 2P4VA 2ZKWA 3TA3D 3SYCA 2Y4TA 1UM4L 2D9CA 1ES0B 5FX3A 1HKFA 3FX7A 4Y16D 3Q8FA 4NO3A 1IU1A 2M2DA 1PL4A 2HN7A 1NTMH 4UCUA 3O8XA 1WS8A 2HKAA 3GVMA 2ZF8A 3U0ZA 4M93C 4Z3JA 4MMXC 2I5YH 3NA9H 1CD9B 4UCFA 1F6LL 4V2CB 2BCKB 2EKSA 4OVUA 2Q3AA 1E9OA 3MRIB 4OJFH 4L4VD 2D7MA 2QVIA 3PHOB 1CF1A 4L8DA 4NZDA 5I0DA 5LA6B 2EEDA 3T08A 2QTSA 2CA3A 5D7LA 2YGOA 5ILTH 3CMEV 3CD6V 5DN6G 1CR9H 2EILB 3S36X 3SBWA 5D7IB 2E5LB 4M5ZH 3FQUB 1ZT4A 4HJ0C 3P4LA 3EIFA 1ZT1A 2OIEA 2YXLA 3SOBH 3TO4C 3MRQA 3CC5B 2E74B 3D4CA 3EYFB 1S7TA 2HFEA 4CAGA 3L1GA 1VQOV 1TZHA 4R96A 3WNPA 3HOGA 2AI0L 3GO1H 1KCBA 1N0XH 2WVTA 3RVZA 4BGLA 1NCNA 2AFNA 5BZZA 4UOZA 3PAVA 4OR1A 4PJHE 1QBLH 2ENYA 2GY5A 4JY4A 4ZFGH 2L7JA 2B0SH 3O45B 2QKIC 2DY2A 1MVYA 1NCUA 3AG3B 3H7LA 5CP3A 1TLMA 3RVUC 1W80A 1E4WH 2PR9A 3G5ZB 1E5BA 5C7XH 1I85A 3MJ8A 1UA6H 3VQLA 2OMXA 5I6NA 4L18A 2FQDA 3K2MC 5MEPA 4S0SD 4BUHA 2AABH 3IE9A 4QRFA 5IUCA 5DSCA 1IBGH 2I69A 3QNZA 5JIKA 2KLRA 4NGHH 4ZMVA 3AXLA 3HFMH 4U1GC 4OKVB 5HVWA 4JYAB 4B95C 3CBKB 2VLKE 2AZ2A 3CZGA 3P54A 1IDSA 3OHMB 4PJDE 4RDQG 4PGDB 5EU3A 3Q8BA 4JO5A 5F1OB 4KITB 4G6JL 3RB5A 4IU2A 4PRPE 3WAJA 5E6UB 4P3DA 3PPSA 3IJEA 1LE9A 3CZFA 2Z0AA 1PD0A 4U3SA 3ZMSA 3L7FA 4CH3A 5C0NC 2VAJA 5EU4A 4AENB 3VXRE 3PXJA 3GRBA 3A6BL 4KQ4L 3WFZA 4KUCF 1PYWA 1MIEH 2FEDC 3I75A 1UZ6F 5LNDA 2NMSA 2XY2A 1MI5B 3UTZA 4ZRGA 5TDPB 1DLFH 3E8VA 5CU9A 2QM7A 4MJIB 2EX3A 2XTJD 4RZCA 4OZHE 2DN7A 4JFDE 1IBMB 3T0ED 4IKLA 1WA8B 4UOQA 1XCTB 2P24A 4UOJA 1TTAA 3F65A 5D4QA 2SEBA 1QFWL 2VM9A 1QSED 4AE0A 2VXQA 5JMRA 2NTFB 5D5MB 3S5LG 1CL7H 3FU7B 5L9DL 1WPXA 1KY6A 2Z0UA 4X5LA 5KS9F 5DC4B 3CVIL 4HLZH 4ZYKA 1HVXA 5C6PB 1G0XA 1F90H 4ODXB 2ZNXA 2EDYA 1F97A 4QRPD 4F7MA 1BIHA 3GKWH 2MCPH 5LKNA 1YAIA 1EFXA 4KV5E 4ZX5A 2JKRM 4WNJA 4Q2ZB 2VQ1B 1JHKH 3I9PA 4LLDB 1HHGA 2C3WA 2BY2A 4WI7A 4UT7L 4IRSD 5FYLH 1ETB1 4IYIA 1JRHI 5JHLH 3CFEA 4P4RB 4R7CA 3WL9A 1Y6NR 3IPBA 4UCVA 1TMCB 1WFJA 5DGRA 4AYFB 1CXZB 4HPOL 4OGQC 5I5JA 4GW5B 4GUPA 1AR1C 2X4PB 3NH7L 7CGTA 3LAFA 2E6JA 3N0AA 1G4MA 2H94A 1QVOA 2FTAA 3GBML 3MRCA 1QO3B 3L3IA 2H32A 1CGTA 4JQVC 4P2QD 4XN7A 4DQAA 5IOPA 2I9TB 3DXRA 2VC2L 4X4XA 2DLIA 2OTUA 3GDBA 1FH5L 4PRHA 4DR6O 2JELH 3O4LE 1RU9L 4TL5A 3N6YA 4P2OC 5F1NA 2NX5A 3PGFL 2JTYA 3F7VB 3DVIA 3I6SA 3RPBA 4OF0A 1WWBX 4P2RA 1YMMD 1T2XA 4E9SA 4OB5H 2YAPA 2ZCKH 5HYSG 2YIDA 2JXMB 5D7KD 4PJBA 3H42H 5FFOA 1R6KA 1LO0L 3BGMB 3QIUA 2R9RB 3II3A 4X4ME 4AQ1C 3B2UD 5DMIH 4JZOA 3TBWB 3D52A 1ZLDA 4LU5L 4N2CA 4NP4H 5E1AB 5KN5A 4KVCL 4I1PA 1DVFC 2R0KL 3NSYA 1EJFA 3ARFA 1Y74A 1OSZA 1V55B 1JUFB 4LHJB 4Z7VF 4FM1A 3LRKA 3U4KA 4C83A 2XZZA 4L9LC 1IIIA 3K04A 4WK4B 4HXAH 2H8PA 1SDAB 1ZT7B 3I9GL 4NJAL 4PJFE 4DKAA 3KLKA 2MNUA 4X1KB 2GTWB 1U2YA 2APSA 3C5XA 3H1LH 1QHPA 5CZXC 3OF6A 5F1IB 4P99A 2AZAA 1RZKC 2CLZA 2XWJB 5D1XB 2Q7HA 3BWSA 5L2JB 3OSKA 1OXYA 4MVQA 3VQXA 1KZQA 2E4TA 2BSBA 3FZUC 2HT3D 5EUOE 1EBAA 4M62L 4ZSOE 1L9TA 4GS7C 1Y1UA 3EHBD 2ZZUT 1XB6A 4YBHA 2A6KA 5DD0H 2A5UA 5GRZA 3SPHA 4JDZA 4PJAB 5IROD 3BXNA 5KSAB 5I16A 3FTVA 3V0HA 3JWOH 5AG9A 3I3BA 1M4UA 1LO3H 3D9AL 3QUYB 1QBML 3MLUH 5FCSH 1DQKA 1U8IA 2WPDG 4NSKA 2EIMB 2YQ2A 1SZXA 4QHNB 3P3SA 2A74C 4M7LH 4P2CG 1HTYA 4K7FA 3E38A 4M6OH 3S2AA 3QRBA 1KN4L 5TDNA 2FO4B 4DTGH 1KLUA 4XGZB 2NXYD 3FO9A 4IM8A 1VESA 4YBQC 5E08H 4KC3B 3D8MA 4BZ1L 2ZUVA 1Y66A 2IOMA 2E9BA 4DR5O 5FUCC 1X5HA 1ZCRA 3SE4A 3FB8A 3S35L 1UD8A 5GS1B 2Q76A 4IGBB 5EO0A 2EE6A 4PJ8C 2ZXAA 4K5PA 1MZFA 1KJMB 2Z7WA 4CSPA 2EVJA 1INDL 1VADB 5D6DC 2FAUA 1A7QH 7PAZA 5C0AA 4KO7A 5FGBA 5CBEA 3U0TA 1UASA 4IIQC 4UOW1 4XPTH 4XMLL 3DJSA 4UQ2B 3H3KA 2CH7A 4DFIA 4HUKB 1GRJA 3WN5B 3IJYA 1U3HC 4D2NA 3G5XA 1OGAE 4HD9A 3WTTA 2OAAA 4FM0A 3QZBA 2F5AL 3NIFF 1NGZB 5F3HB 1MH5B 4MVZA 3O41A 5HY9B 2C4FU 2ZE7A 2P80A 1DBJH 4UWQB 3S3DB 2OSYA 3ZN6A 1YCIA 1MW0A 3WEMA 1BVNP 4MTOA 4PGBB 4KDVA 3HW7A 2GV9A 1TTGA 4MNGB 1HNZO 3FFOA 3FN3A 1T83C 4H8HA 1CLZL 3APFA 1BQLL 2F53D 4A68A 3GB7B 5ISZB 1QR1B 3GSRB 3VTTA 1IAKA 5LGNA 3SKNA 3CN0A 2HVJA 3QXAA 3R06A 5L88H 4PA3A 1HNZB 5D9SA 1BZ7B 4QXUH 1B2WL 3LKSA 3N2GA 4ONGL 3VXPA 2VN5A 5CGMA 2AEOA 4JR9L 4POZC 4BKLA 4U6HB 2PYFB 2GJ6E 2AJXH 1AG0A 1EWHA 4RWHA 3HKCA 3ZTDC 2YD8A 3PU7A 5DS8A 3MOBL 3NJGA 2HP8A 3QF7A 3RWEA 1LEIA 3TM6A 4P46B 2WUCH 4E42A 1CLOL 3FD9A 3GSVA 3SJQC 1ACCA 2HLAB 1DUYA 4IKNA 2EE3A 2ZR2A 1KBBA 3JUZA 5JJJB 2YSUB 5A7BA 1AC0A 2FVNA 3IK2A 3LH2L 4RGOL 4IK7A 1ZVHA 4L8SC 1F1AA 2HLEB 2WNKA 2IH1A 3KYMB 5EEWA 3ZHSA 3OAAG 4UAOB 1AJPA 1OJHA 1K8IB 2HT2D 5E6IB 4AXWB 2D3LA 5DMYA 4WFEA 3H1HH 1KB3A 2YSTA 1P4LB 4NQSB 3MACL 2AJYH 1BAFH 3I6KB 1QLRB 3JD3A 2F66C 2JK5B 4BWTA 4AVKA 1OV9A 3CVHL 4NN5C 2BNQB 4KX7A 3LSSA 2AERT 3DARA 2YQGA 2HEPA 5C0BE 3L5HA 1RUQH 4QRUB 4HCGA 4UAHA 2NY3D 5HDOA 5AD0B 4WENB 1FGNL 5K39B 2HRGA 3S4SB 3DX6A 1DQLH 4LSDA 3VQVA 2GKIA 5BRQA 3KWUA 4CNIA 4Z7AA 5IT2L 4ZMOA 4IKKA 3D3VE 1TVDA 5D55A 1LDSA 3IAQA 3VWJD 1W0JG 3FO1A 2DDQH 1GGIL 1ZKAA 1QASA 1DSFH 2ZDIC 4YVNA 3UTSE 1HNFA 1TTCA 2ZOWA 3FBKA 4JY5L 2CBPA 2VDMB 5FM4A 3VGGA 1I0HA 4PVBA 4JGMA 1BFSA 4I50B 5CUSH 3QEQA 4YLBA 2D03L 3T2PA 2ZX7A 2OKMA 2D4FA 1KIPA 2DLHA 3PV6A 2IH3A 3Q5TA 1AROP 1K6QH 1XTMA 4L4TA 5H4ZA 4AH2A 3CSXA 4U4IA 3U9WA 2WTOA 4AQ8A 2JGUA 4PSPA 4EKJA 1ETA1 1C7SA 3FRUA 4HUVB 4NQDB 1S7WB 2NLJB 4G6ML 1IAIH 4MJ2A 4UIKH 1LO4L 4X2UA 4FA8A 1K4DB 1T3FB 4I0PB 3ZCCA 1YNTB 3BT0A 5E4EC 2E8ZA 5KSBF 5HYQB 4EFBA 5ERWB 3WD5L 4HS6A 1FH2A 3HG2A 5JIIA 4XNZC 5FECB 4WFFD 3HG1E 1QLNA 3ZIMA 3SJVA 3D39D 3KHQA 1A5FL 2R1XA 2VUOA 4NZJA 1D5RA 3RGVD 1FYTA 4S1SL 3V9FA 2PI5A 3UTQB 4AT6A 2YDEA 2E75C 2XVBA 1PG7W 2V5YA 5CD3A 4I4TA 3ZUNC 3R65A 1GA2A 3MJ9H 4K7PY 3RUGF 3PNRB 4WZ9A 3NJIA 1NUFA 4H0IA 1EEYA 5AW6B 1F4YL 2DLFH 2J43A 5KG9B 3H9VA 1H6TA 1T7ZA 4UB0H 2FIRT 1YDPB 2DQUH 4R5TA 3SDCD 1R0AL 1J7VR 2V9UA 4G71B 4ZOEA 5SWZA 1SXCA 3CZJA 3LKOB 3DC5A 4Y0GA 4JZGA 2ZICA 3MDJA 4U3JB 1BAGA 2YRLA 3N5AA 1I9EA 3HLAA 4MJJA 3V6BR 2G4GA 4F7CA 2NT0A 1LVEA 5A43C 4CBCA 3A21A 1S8DB 3K9AA 5EIBD 1AACA 4M8QA 3C8HA 1P4BL 5JDSA 2DJVA 4Y5VB 1RSOA 1OGSA 3T2MA 3OC5A 3MFFB 1OSEA 3BP6B 3APDA 4ZIBA 4RGND 5E0QA 4QHLA 5IG7A 4PRDA 4H4NA 4D7TA 1D5BA 4R2GD 4ZAKA 1R5VB 1MJ7H 2WUBH 2KHAA 3P3TA 3R4DA 1VF5B 2DIBA 1KFAH 2UXVA 3HB3C 1QSFA 2GBOA 3HAEB 5DEFB 5IB5B 1CYXA 4HIXL 4HC1H 5JJNB 3HKZA 4Y2DD 3PP4L 3F84A 3PHQB 3MRLB 5FO9B 2X3CA 3PAYA 2C9QA 2C2AA 2OZNA 2QGDA 4NLAA 4ZD3L 1UURA 2XUMA 4DYLA 5LAXB 2ESVE 5T5NG 1J10A 4LWSB 4KZEL 2AEIT 4YX2H 4LAQH 1OPGH 1QFWI 2EIJB 2VLJB 1T89C 4BQBA 3WO4C 3ULUC 1RJLA 4GMTL 2ZAHA 4FFYL 4TUYB 4HU2A 1IJNA 4PJIF 1F4XL 4LF3A 3QO1A 5KYXA 2CXKA 2O5YH 3ZL2A 1E28A 3UJIH 3IBEA 4O4LB 1MFEH 1VB9A 2IXQB 1JWMB 1XZWA 4U3HA 4CS4A 3ZT7A 3S98A 2LOEA 4Z1MG 4X8GA 2CTRA 5EORH 1PX8A 4JDTL 3SKUD 5KZCD 3EO9H 2QSVA 4F15B 4ZTPL 4XP1L 2N56A 1HP8A 5E23A 2NZ1A 3HJEA 2A2QT 5ES4B 1JN6B 1AI1L 1KUMA 1ZHKA 3D08A 1K3ZA 3KYNB 3MV8E 5LHGA 2CJUH 3LDBB 5IBLD 3NK4A 3NJMA 2IQ9L 3ZMNA 4GW1B 4MDIA 4FNPA 1XSJA 2BSCA 5G4NA 1LO2L 5DJ6B 2J1ZA 4J2XA 2P8PA 2AXGB 5IY5C 1A47A 3AG2B 2JLPA 4TPRL 2Q7EA 1IC5L 3C2SA 3I6LD 1BYOA 1U42A 3NFPA 1FBIH 3O3AB 5C0CE 2PWDA 2AK4D 3DPDA 1U92A 1OAKL 8FABA 3CRQA 3VXQA 4F24A 4PJ5E 4JFOB 3ETGA 3O9WB 5DVOA 5LBSL 4BFGA 4YR6B 4G6KL 4DOHE 3TGUH 4AITA 2UU9O 4IHJA 1Q38A 1ROWA 2R2HB 4XCFL 5CJQH 5I8OH 1R3JB 2OV0A 3KWWB 1QKZL 3OT7A 1JAEA 4JI0O 1SLWA 1CBVH 1ZA6A 1IEAA 5AWNH 3KGSA 1MFUA 3MREA 2XRAH 4LP8A 3H1ZA 5J0BA 2UU9B 2H3NA 2ICWJ 1VPOH 3JAKA 5KHKA 4N8CL 4JI0B 2CG9X 2GCYB 4YDJA 2NUPB 1A8ZA 4GP8B 5CA0A 1UM4H 1S7XA 1SJXA 3S3XA 2TSBA 2WWMC 4CU8A 4YEEA 4W4LA 4G9FB 2HTLD 5IOKA 4WFHD 3LSQA 5EZJB 4F92B 3B1TA 2E76B 2X7RB 5FYJU 3MROA 3OR6B 4I7ZC 4JANA 2FYVA 5AKSA 2DEWX 4M43L 3SD5A 4IQHA 1G84A 1L5GB 3R66A 2F61A 2DF3A 4TYUA 2CBQA 4UT6L 4DV6O 3IC9A 2UY6B 2V2XA 5EU5B 1YC8A 5I1JL 2IALA 3PYCA 1KEGL 2JDIG 1V54C 2IWGA 3KAAA 1M3JA 4A7GF 3EFOA 3IDIA 2FECL 4DEWA 1PS3A 2X4NA 3RQ3A 4DV6B 1YRKA 3BH9A 1IEBA 5BVPL 2AI0H 3B2XA 2AEWA 4WUUB 1UXSB 4DP4X 2HX8A 2RB8A 4BH8B 4U3FH 3KPOA 4YZFE 1MCSA 2GJZB 3D2UA 1DJIA 2ZX9A 2A6IB 4TNGA 1MAKA 2VABB 4HHGA 1BVZA 1SQGA 5JYMA 4ZTOL 2GEQA 3AQXA 4WI8A 5EH1A 3FQWB 4PDRA 1S78C 4EI0A 2A4CA 5HHPB 1AGDB 3MRGB 1FLRL 1G5GA 3NQIA 4EOWL 3FUFA 4MNQE 4O2EA 1CXEA 3FUIA 4DV2B 2PTVA 2D73A 2J12B 4RDBA 5D1ZI 3EGSB 3PIQB 3P73B 7FABL 1K3EA 3SY6A 5HXMA 2BFVL 2DM3A 1HCFX 4QKXB 1YF2A 2DYRB 1AHWC 3MMEA 6CGTA 2W07B 2XTAA 4K3GA 12E8L 3Q2LA 4G6JH 5FK9B 4M02A 4UTCA 3ZDXF 1XGRA 1MJ8L 4E9WA 2ITDA 2HVKA 1G7HA 4EO5A 35C8L 4PV8B 3TJHD 2NOYA 3QI9C 3KL0A 4U6VL 4EVNB 2OBGA 5CILL 2HLDG 2OR9L 2VDPB 4OZIA 5B4MC 2HYMA 3KGUA 2PPDA 4KQ4H 5JPMA 3A6BH 2YPLD 4OUUA 4M56A 1LEKA 3Q2NA 4Q6YA 1TKWA 4R83A 1ZIAA 5HJDA 2JKTM 3CVBA 2FD6L 3NRFA 1P1ZB 2Y7OA 1VARA 4HJEA 5ESQB 2KI6A 5JW5B 2ZSWA 3TXAA 4DW2L 4CC6A 2OL3B 3N44B 4JPKL 3QDHA 3SGDI 3CFCL 1QFWH 2OCCC 4V1DB 5EFIA 4C57C 2YAEA 1U3ZA 3QNXB 3VG9C 2R51A 2PKDA 3L7EB 5DHVB 2K6YA 5DO2C 2VRKA 4M1DL 1A6TA 5L9DH 1UWEL 4HDIB 2X88A 3RWJA 1B2YA 3VXOB 3ARBD 3CVIH 3WIAA 2YOAA 4UQBA 1JWUA 2CWRA 4H26B 3I6GA 3BKML 4OGYL 3GC3A 2Q0OC 3HIZA 3RY6C 2C4FT 5DRWB 5TQ0L 4APQA 2AVGA 3ECBB 2WQXA 2X3AA 3AREC 4NQDE 4L3CB 4H1LH 2YEVB 2NY6D 2YWZA 2QPEB 5DYFA 3RYCB 3VMOA 4X6DB 3LKPB 1MWAB 4UT7H 5E1IA 4Z78A 1SHWA 1KYOK 5TH2B 3VXSB 4TULL 3HZKB 5I66B 1E9PB 2XQYG 4MMYA 3SYPA 1WICA 2G5RA 2GUOB 2PCPA 5CJXA 5LQBL 4HPOH 4X1IB 1FFQA 1X5ZA 3NH7H 2DD8L 43CAA 1I1YB 2ZKXA 5AYUL 4ABUA 1DBBL 1NGYA 2HX7A 3GZKA 3TO4D 2JQAA 3D36A 1E8XA 5HHOD 3GBMH 2BOBA 2FIKB 4ZFZB 1CURA 2Q7YB 3VFRB 1F3DH 4LH6A 4HSAC 3WV0A 2VC2H 3QP3A 4PJXF 1OV8A 1FH5H 3JD0A 3L1FA 3QIWA 3V5DA 3LIZL 1RU9H 1UXMA 3VO0A 4JREB 5T5FA 5DD6B 1M53A 4HUXB 3PGFH 1F3JA 2D9QB 4PJCF 3KLLA 1I7TB 5DQ9B 2EDXA 4LDEB 1AGBA 5GISL 4DV0O 5L2KD 3JT0A 5KLVH 3PWVB 5FF6A 3DROA 2V9TA 3ISYA 4FULA 1I8KA 1KB5L 3JASA 1LO0H 1TTFA 3J07A 2YAOA 3R8QA 3VFMA 1INEL 4CMMA 4NO3B 1EEZA 3FC8A 4LU5H 2FEEL 4N2GA 3ZOAA 5F7KC 4KVCH 1XF2A 1E1QG 3OPUA 2R0KH 1YY9C 4M7LT 4X0NA 4MLSA 5LUMA 2X3BA 4G7QB 1OGPA 2O6DA 4GAFB 4IK6A 5CR1A 3HS0C 5E0FA 2VWEE 2QVFB 3F7RA 4OJYA 3D0LB 3P4NA 5EBWC 5C2BL 3I9GH 4NJAH 5AVSB 3HHSA 9PCYA 1A6PA 1GN2A 4HG4J 1NC2D 3HE7D 4JM2B 2MTPA 1NM9A 3FU5A 4PM1A 4PTUB 2YN5A 4K2UL 3MRKB 2FEDD 4WW2A 1S7TB 2HFEB 2Y5TB 5JW4N 3JWOC 3PWPD 3OTOO 1TZHB 1QRND 5IW1A 3S5LB 4M62H 1K9TA 2F6AA 4OKDA 1KJ2L 3V4VA 4QRRE 5EN2A 3ZDZB 1AIFB 4JY4B 5MHSD 4FTDA 3GLZA 4TVPL 3T8XA 2DH3A 3U6RA 5K9OB 2ADIB 3OTOB 3D9AH 1QBMH 3ENEA 2D7NA 3QFJD 1U6AL 2KLSA 5D2NC 5FWQA 1BZ9A 5AW1B 1VQNV 3VW3L 4G7VL 2XLLA 4R7DB 1HCVA 3PL6C 4N0UA 5DSCB 1KN4H 1CI5A 2VR8A 4LHUG 2QSAA 5D96C 3ZZ1A 2GAZB 5IYCO 3AXLB 1BXVA 3WLBA 1AZRA 4BZ1H 4FTVA 1MZEA 2G9HA 4Y5YA 1AC6A 3KM2A 2W91A 4Y4HA 4DR3O 5I8EB 4F2MB 1H0DB 1CICA 1XCQA 4IU2B 4M29A 1BQZA 1XT5A 4P3DB 3VYNA 5A3IC 1S77D 2JIXA 2W8CA 3IJEB 3QJSB 3G3LA 5B1NA 3CZFB 4NQCB 1INDH 4BFFA 3FPXA 4U3SB 1EHNA 3VFPB 5I19L 3G6JA 4XHJD 5EU4B 4DR3B 1BW8A 3AS0A 3EYOA 4XMLH 2G4EA 4U7MA 1OKEA 5FUZL 5ANMA 1EVTC 2HLFC 3ZHNA 2ZJSL 3U9UA 4H2CA 1AR1D 4LDCA 3UTZB 2F5AH 1UJTA 1PKQB 1OCZC 5DJZB 3UL4A 5SWQB 2LU5A 4HK3J 5HYSB 1FZJA 4HWBA 3RX7A 4XPBL 3UIYA 2A0LC 2XOTA 4PCTA 3MHSC 4HGMA 1L0NH 3DIFA 4GUOA 4P2OD 1K92A 1F86A 1ZTMA 5A2FA 1CLZH 4NBZB 1BQLH 3VFUA 3K0GA 2PTMA 3IDNB 3COOA 1A21A 1JTOA 3SGDH 2W6JG 3K74B 1KLGA 1B2WH 4ONGH 2X10A 5MI0C 4LCWD 4JR9H 1G43A 5ETUA 3ZTNL 1AFVL 4MNHB 5IB4A 3SE6A 1EFXB 4MX7A 2PN5A 2ZUWA 3TA4D 1NR7A 4DP7X 1DVFD 4FS0A 4UV7L 3SKMA 3MOBH 1T6WA 1HHGB 4YXHL 1CLOH 3KM1A 1FVEA 4LKXB 4HBNA 4PREB 4Z9KB 4PJ9A 5FFLA 2HSIA 1SZNA 2CRZA 2X05A 1ZK9A 2XSKA 3ZVVA 4ZXBB 4ZFOA 3KNBB 3LH2H 2BP0A 2W9EL 4RGOH 1JP5A 1B4TA 2FL5B 4MSWC 2K8MA 4UTBL 5FOBB 3L4TA 2H1PL 3FJTA 1JZ4A 1I9JL 2JQMA 4FKEA 2FSEB 3KWXA 4KHXL 4BINA 1THAA 1QVOB 2YJQA 3VA2C 3MRRA 3BYTA 3MRCB 3RE0A 4K23L 4LE8A 2H32B 2I9LA 4UMSA 2Q9OA 4X4XB 3MACH 2WZ5A 3QT2A 5JPNC 4GQZA 1N5AA 2VR6A 1SY6L 3CVHH 5F1NB 4XI5C 1MRFL 2NX5B 3P0VL 1E67A 3QUXD 5E5MB 4LCUA 3AG4B 4GSUA 1D2OA 4NN7C 3TZVA 2W1NA 3NZUA 3QEGL 1FGNH 3ZGIA 4WUUE 4PJBB 2WOYA 3OXRB 2VLRE 2A38A 5IT2H 1OAYL 4BHUI 3E8BA 4JZOB 5KN5B 1CQYA 5AG8A 2FWOA 3HKDA 2K3TA 4GAYB 3B7RL 2G38A 3FU3A 4YBQD 3ARFB 1JD9A 1GGIH 3CDYA 4YDNA 2WB7A 2CBMA 2BSTB 1AHKA 4C83B 4JY5H 2YBRA 4YUEL 1HXKA 4DUZO 4L3AA 4KH2A 2D03H 3L95B 1F42A 3ALWA 1M9NA 2WCPA 5D1QB 2AMGA 1T0NB 4LC1A 2CLZB 3DHPA 4ZUVA 3GXIA 5D4HA 5K33A 4G6MH 1N8OE 4GFXA 1AAJA 4F9LA 1LO4H 4HH9A 4OGAD 4F80A 5MEQB 1XB3A 3GYRA 2APVA 1AIZA 1U3HD 2CDEA 1D5MA 2EEBA 2OA9A 3VD2A 4LCCA 4K5NA 3WD5H 4E5XA 2FBOJ 5HDQL 4NTWA 5KHHA 3QORC 4GW4A 1TVHA 4JDZB 3V6OA 1DVYA 3FH5A 3BXNB 4TNVK 3VVVA 3NCCB 3QCTL 1AZVA 1A5FH 2QHLA 1G6RB 1YECL 2IDSA 1ENVA 2WXJA 4I4WA 5MENE 3D6GA 3NK3A 1XVSA 4S1SH 1SBBA 4GT0A 1TSRA 5DJ8B 4PHZA 2OWOA 2QV2A 1U8IB 2LVCA 4N8PA 3L72H 2HUEA 2RQ8A 3BGFB 1A6WL 4NSKB 4ZO9A 3RL1B 1A7OL 4FQPA 2FYYA 1WAAE 2DQJL 1S5IL 5HJ3B 2AAVA 2JRIA 3IETA 5TDNB 4Z2WA 1VEOA 1F4YH 2W80C 3K0YA 2X0UA 3MRPB 4QXWA 3D34A 1H8LA 3WEAA 4POZD 3NR7A 5H2FZ 2ICES 1M7DB 1DUZA 1OSYA 4PJEF 5EDSA 1R0AH 3PRZA 1FXKC 4RQQA 2Q76B 1HHKA 2D2CC 3FB7B 5EO0B 1L0XA 4R5XA 4D0BB 4QJ5B 2CDGA 3IDYC 1MUJB 3FQTB 4A2DA 2YC0A 1VFOA 3QEUA 4LLMA 3K5RA 1WFUA 4ZW6A 5C09A 3RA7L 3SDAD 5CBEB 1H8HG 5J57B 2CH7B 2HA1A 2JB6B 4PJ0Z 1HILA 3BWZA 2YI9A 3HN5A 3MCLL 4B50A 2E7LC 2ZOTA 3ARGA 1A6AA 1P4BH 3IJYB 5BQ7A 2R29L 3RZWA 1C5BL 2IG2L 3SO3B 3CFBB 4WAFA 2VLKD 1E9QA 3G80A 5KMGA 2N0KA 3BUPA 3WMPA 3P32A 3ASOB 1NUGA 2IDQA 1GIGL 4D7SA 1J9RA 1EUTA 1F58L 1KPVA 3P1VA 4HP5A 3ES6B 3RTQD 1SRYA 4ZG1A 4PA6A 2ZAGA 3Q2WA 4HIXH 2XX0A 3MTXA 1TJHL 2GG1A 3L3OC 2NY0C 1IAKB 4B3TO 1GZQB 2ZXDA 5B1KA 4B3RO 2HVJB 1N59A 3PP4H 1NI8A 1BFTA 4G7SB 3R06B 4ZHQA 4J3OH 4MFHA 4QMEA 4NNXA 1UT2A 3VXPB 4YDLB 3BPNB 3KJ4C 3H7BB 4Y1AD 1ZRUA 4ZD3H 1FORL 5E4AA 3UTTE 5A40E 1U8MB 4QYAA 2DW4A 4U1LB 4BKLB 1H3GA 4KZEH 4B3TB 5IP4A 4B3RB 2XIDA 2Q5BA 4JFHD 5DS8B 4HCRA 4EE2A 3VFOA 4BUGA 4GMTH 1Z9SB 3B83A 3GSVB 4FFYH 4KUCD 3QQ3A 1DUYB 3QAZC 3V7AG 2XFXA 2EXWC 3MRMB 2DPKA 4B9GA 1YI2V 3H53A 4LR3A 4HIQA 4NFBA 5I1EL 5GONA 1A25A 1K2DB 3PJNA 4WI9A 4YPGA 5DEZA 2IH1B 5IEKA 3K5MA 1LK2A 1NC4D 4JDTH 5AOMA 2XVKA 4KUZL 1M9WA 4ZTPH 3RGBA 4XP1H 5D7LE 2CJSA 4D9QE 5KSVB 4B6ZA 1AI1H 1FZMB 1Y76B 1KGCE 4HH8A 1JVOA 2MOQA 4MBRA 3TYGL 2DYPD 1DDHB 2C3VB 2IQ9H 4U05A 1HNYA 1NFDE 3U48A 3UEZA 4Z7OF 4F57L 1HSAB 1LO2H 1KT2A 4LH7A 4P2YA 4LQ1A 4TPRH 3DX6B 4JI7O 1IC5H 1WP6A 3KE0A 2IWFA 3P9MA 4WO0A 4X6CB 5L3BA 2X12A 3MNVA 2P22C 3VXUE 5C92A 3B9KA 3QWNA 1YYML 1TNNA 32C2A 1OAKH 4UQ3A 1IBZA 1A3QA 4PFEA 4A38A 5CWSB 4F6RB 3FO1B 4JI7B 5FB8A 5LBSH 1C16A 2EO9A 1YJDL 4G6KH 4Z7WA 3GI8L 3IDUA 4XCFH 1PLCA 3MX0A 4OLXL 4MJHA 3RFZC 1QKZH 3QEQB 4AYMC 1AD0B 3ULSB 2XJLA 4NS0A 3NP3A 3BFWA 2NNUA 2IH3B 3CCQV 2FQFA 2VZVA 1OM3L 3MXWL 5EF1A 3OGIB 5JOFB 1AJQA 2AHZA 3HR0A 4BW5A 1FL6A 4JAUA 3G71V 2Z34A 4N8CH 3CFIC 1P84K 3RWIA 4P23A 3W37A 2W5PA 4HS6B 1QSZA 2MIZA 5I75B 1P4RA 3A5VA 4W6XB 1PAZA 3EH5B 2J8UB 1D2DA 3SHSA 3UOAB 4WV1A 4BK5C 4DCQB 1BQUA 1IQDA 3GJFA 1Y0LB 3FT4A 4WHDA 2UWEB 3FN0L 3U7YL 4GBXA 4JFUA 4AT6B 4FXKC 4JKLA 4UBDD 4I4TB 1BGXL 4M43H 3VX1A 3DIDA 4FI6A 4I2XA 1XZ0A 1TUBA 1J88A 2H47C 1NH2D 4GSRA 3MRNB 2YXYA 1H5BC 1ZXQA 4XPAL 4UT6H 5DYOB 2YMTA 4UVAA 3OKYA 4B60A 5I1JH 1KEGH 2X44D 4WEEA 5EUKA 5IW6A 5JORA 2X4OA 2Q8AL 4QE7A 5SWZB 3HG3A 2IADA 1QWNA 2P5WD 3BDYL 4C4KT 2OFQA 5BVPH 3HLAB 2HG5C 2ZINA 5HI5C 5HYJD 1V7ML 2Y48A 3TA3A 5DHDA 3OLIA 1U41A 5EIVA 1PDKB 1YYLL 4AC4A 1CTMA 5B7EA 1XGPA 4U33A 4Y16A 1RJZA 2X70A 1SXBA 2IJ0C 2Q7NA 3PDGA 4ZTOH 1TVBA 2I85A 4NX0A 1L9MA 3EO0A 4LGPB 5BOJA 5MERA 2CR0A 5IG7B 4PRDB 1FLRH 3LEVL 3VU2A 4EOWH 1D5BB 1RIVL 2VRAA 3OLGA 4L4VA 3GWOA 1ASQA 2C7UB 4RO2A 1F3RB 2DWEB 5KA5A 1UJ3A 1P0SE 7FABH 4LNUB 3TCTA 3ARZA 1DN0A 2BFVH 3FKUS 1L0YA 1BQSA 3IVKB 12E8H 4R4NC 5E8PB 3MUJA 3ZHKA 1TAEA 3QTCA 1HINL 1MJ8H 2FJGA 35C8H 3MJWA 1GGYA 5L7XL 3TEYA 4PB0L 4U6VH 5CF3A 5CILH 3PWNA 2OR9H 2QADB 4PRHE 2H7WA 3DURA 3QSKB 5IQLA 3U6XS 3GMQB 3RVWC 3S34L 4D0CB 5CHNB 1GMEA 5ALCL 4EEEA 4KY1L 2NX5E 2VZTA 3BN9C 1IM3D 2QGNA 4P2RE 3GMOA 1YQVL 2FD6H 1Z5WA 2ORBL 1HR0O 3NPSB 4PJBE 1T6VN 2V7NA 4F7TA 4NKDB 2XV3A 3C3SA 2AZUA 3QO1B 4LF3B 1BYPA 4H5SB 2YXWA 4JPKH 4ZPTA 5KYXB 3CXDL 1E28B 4CC0A 2CM5A 4N22A 3DBXA 3CFCH 4EQ3A 4XBGB 3JAWA 2WYZA 3OTTA 4IBSA 4RMWA 5J2UB 4HCIA 1HR0B 3QJFA 3TFKC 1FIEA 4DGYL 4JQXC 2EICA 4M1DH 3M1BB 1HQRB 4N1HB 4FLUA 1UWEH 3WY2A 3PAZA 2W65B 4IBWA 4HIEA 3A0OA 2VLMD 2P26A 3BKMH 4OGYH 1JOYA 1U8NB 4JKNA 5AVRB 3HR5A 1MHCA 3PQYD 2WWMD 2WW8A 5TQ0H 3AW5A 4JI1B 3LY6A 3OAZH 5J1SC 5KAIZ 2FJSA 5BMVB 4PW4A 3G6AA 2VXUL 3IXTA 1J48A 2P8PB 1I7UB 5CIPB 3H3PH 2JNZA 4JO8A 4AJYV 2ZUQB 4G8IA 5GGTA 2K1MA 2YIBD 2Y7SA 4TULH 3TCXA 5IR1A 1I3UA 4KY2A 1UD2A 5I28A 1EK3A 3L3HA 5LQBH 3HRZC 3PWUA 4CSZA 1U92B 4FQJL 4KDWA 4MXWL 3ABZA 4L1HA 2EDJA 3BD4A 4M3KB 1NGPL 2DD8H 1AKJD 3QB7C 3SGEI 1KC5L 2WGXA 5AYUH 5HVHC 1DBBH 1RZGA 4WI0A 3L2NA 1LK3L 3AMKA 3VD3A 1QSEA 3CFJA 5JO5A 4G80B 4POUB 4N87A 3O3EB 4QCIB 3V4PA 3CHQA 1S7RB 2PWFA 2QQKL 4KROB 3D09A 4EI5D 5HPMA 5IJKA 3OB0H 1P6FA 3RVYA 1RM1B 3B5HA 3QQDA 3RPIA 1ZA6B 2PTUA 3PG2A 3VYPA 1AQHA 4O02L 1UTDA 1IEAB 3LIZH 4Z5RA 3BP7A 3MREB 4PJDF 2H3NB 4M4RB 4XBFA 1GY2A 1U2CA 3JAKB 4FL4B 1ADQL 1OTSC 3ZN0A 3IMRA 4QRPA 4RMVA 4CDGC 5GISH 2MHAA 4QGPA 5BW7A 2OTWB 3ETEA 2CNZA 4BBWA 4W9LC 5GS0C 3ZZSA 4ALAL 4AYGA 5CA0B 2PW2B 2GTZA 4RMQA 1KB5H 2Q0ZX 2UXTA 1S7XB 2P06A 5C0AE 3ET9F 4XZUB 1U91B 1INEH 4MXVE 2Z92A 5AL8A 1XB8A 5AOLA 4HBCL 4IRSA 4QD2E 3RVXD 2QDVA 4LSRL 4LIQE 2APFA 1MSDA 1BVOA 3MROB 3OMAB 4JANB 2M26A 4O4HB 2OXHB 4FA7B 1P4IL 1JK8B 2WNXA 1TQCC 5EC1C 4ETYA 4DERA 5CEZD 2A73A 1KKCA 3OL2A 5C2BH 4WF9V 4X6FA 1ONQA 3QUZD 2BSKA 1V3LA 3LQAL 5B4MD 4P2QA 5LGYA 5I17B 4NO0B 4IBYA 1ZLZA 5GTIZ 4K2UH 3W56A 3IDIB 2KQXA 2EXYC 3GMRA 1G7PA 4YN3A 2QSQA 4J7ZA 2WO3B 1QPKA 4DV7O 4TVPD 2IWKA 2UXNA 1KJ2H 2ZNWA 2CKBL 4DPRA 1YMMA 4N6QA 5IMLA 1RP3B 2UXXA 1J8SA 3S3BB 3SDXA 3I74A 4TVPH 4KV5F 3WTYA 2NY2B 1JXGA 2VR9A 2F8IA 4X20A 3DTDA 1U6AH 3QUMA 3VFTA 1FPOA 4HLZG 1WIOA 1X6LA 4X98A 2VXTL 4QHMA 4Q97A