4DV3O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv3O00
4DR3O 4LF5O 4NXMO 1HNXO 1KUQA 1G1XB 1A32A 4YHHO 1N36O 1YZBA 1XNRO 4DR7O 1I94O 2N74A 2UUCO 1IBKO 1NS1A 1HR0O 4B3TO 4X65O 4X62O 4B3RO 3OTOO 4DV7O 2JRIA 1F7YA 1IBLO 4DV3O 4GKJO 5BR8O 4OPAA 5LMUO 4DV5O 1R6TA 4A5UB 1XNQO 2UU9O 4KHPO 3JAMN 1AB3A 1R1BA 2ZM6O 4JI0O 2F4VO 2UXCO 2DOSA 1N34O 4LFBO 3SDLA 4JI7O 2Z0AA 4DV0O 4LF9O 4OPHA 3T1YO 1N33O 4X66O 4B3MO 2ZKOA 4GKKO 1FYJA 4OX9O 4DV6O 1XMQO 4DUZO 4DR2O 1XMOO 2UXBO 2VQEO 5BY1A 4DR4O 2FKXA 1IBMO 4JYAO 5BXZA 4JI3O 2LW7A 2AGAA 2VQFO 1HNZO 1D2DA 2UXDO 5H5NA 4AQYO 2UUAO 1DK1A 4K0KO 4JV5O 5IT9N 1J5EO 4NXNO 1XEQA 4DR5O 4YY3O 5FLXN 1FKAO 2DJVA 4DR1O 4LF8O 4X64O 1HNWO 3F5TA 4LF7O 3RT3C 4DV2O 4LF4O 1AILA 4DUYO 3O65A 5LMNO 4DV4O 4JI2O 4JI5O 2UUBO 4LF6O 3R66A 3J81N 1FJGO 3T1HO 4JI8O 4B3SO 4DV1O 3M8AA 4LFAO 2HHHO 1N32O 1X59A 4JI6O 3J80N 3J7AU 4DR6O 5IWAO 4JI1O 2E5LO 4LFCO 5LL6Y 5A2QN 4JI4O
chains in the Genus database with same CATH superfamily
2WSSG 3D36C 3OEHG 1HR0B 2IJKA 1HNXO 1IURA 4MTOA 5IJ0B 3AG2C 3K79A 4X1YA 4J7ZA 4K8XA 4N21A 1IBLB 5EZYB 5E1AC 2PY5A 3B09A 4X62O 4DV7O 3OM3B 4KHPB 4QNHB 3WG7C 4GUNA 4R7CA 3A8TA 4J10A 3CYOA 1XNRB 1KC8W 1H38A 5IYBO 2K9PA 3ETDA 3ZRSA 2HP8A 1VF5B 2PI4A 4JZGA 1R3IC 4H44B 3Q4HA 2AHZA 5DN6G 4MSWC 3TXSA 1XMOB 2XNDG 2UXBB 1W0JG 2MW2B 1I7FA 2VQFB 3CMAV 3ZJZA 4DR2O 4U3JA 4MVRA 1AI6A 3UKMA 3DTUB 1D2DA 3JAWA 1V54B 2P06A 4UCSA 5D5QA 3D36A 5KHHA 3B2EE 5ITZA 4LF4B 4LF7B 2F95B 1GKFA 2QE7G 3CCLV 1D5AA 1GO3F 5CMUA 3OR6C 4B3SB 2FL4A 3L71H 4JI3B 1M57B 1TUBA 5LYJA 4EFBA 4WFFA 1JJOA 3R66A 1H8EG 3CJHA 3H9VA 1LUWA 5EYPA 2Y69C 3M7MX 4LFAO 3FX7A 1X59A 2X7RB 4EB6A 2FYUH 2WLIA 2FB5A 2X0LA 2Y4UA 3QNEA 3F7YC 3OT7A 1DTOA 4UCUA 3JCUZ 4ABMA 4JI8B 4MVSA 4JTCB 4DR6B 2BTOA 4FIPC 2WAMA 4YJ3A 5ITZB 1CPYA 3K9SA 4LH7A 3AG2B 1F7YA 3M99B 3ZHTA 3DXRB 5LMUO 3PN1A 2YIBA 4UCRA 2UUCB 3QTCA 1TUBB 5LYJB 3HKEA 1F4MA 2ZM6O 2WLNA 4PELA 4W4LA 3WG7B 3OTOB 3CCVV 5HFMA 2QWRB 4R8CA 1OCOC 4CC6A 3JAKA 1SQPH 1K7DA 1PV0A 2V1DA 4LF9O 1Y6XA 5H6QA 1WJZA 3ABUA 2QEXV 2QM8A 5KHKA 2YIDA 1XL6A 3BFRA 1NJIW 2P67A 3D3QA 4R50A 2PYLA 4JYYA 2UXDO 3BPZA 5BMVB 5FNVB 5LHGA 4LF6B 4L8JA 2L6LA 1M5IA 1TGOA 3HKEB 2QKSA 2P7TC 1IX9A 3DC6A 4DV4O 1KU9A 4O4JA 3T1HO 5L3DA 3JAKB 3LDEA 1MG1A 4XDJA 2R70A 3JD0A 1HNXB 2XAHA 1XDCA 1EM1A 1GMGA 3E8BA 3H1JH 2PYJA 2Y69B 1L0LH 4NXMO 4GLXA 4X8AA 1VQ9V 4P9PA 4X62B 1NR7A 2M7WA 1I0HA 1Q6UA 3LNNA 2DQ3A 3OD4A 1RSOA 1HWYA 3CE2A 2OT5A 4H33A 1OCCC 4H37A 4X89A 2ZT9B 2KSDA 1VQLV 4QIWF 3WB2A 1YJWV 2W0FC 3K3WA 3AK3A 2XAFA 4KFMA 1Q86W 3JALB 3JYCA 3L70H 4O2BB 1YVWA 4O4JB 2A06H 4DYLA 3H1KH 1KBHA 4LWSB 1GM7A 2F93B 1XUQA 1YJ9V 4DR2B 1N0NA 3BVOA 3N2GA 2QJ1A 1OCOB 3OTFA 1US6A 2IJJA 4I50A 4CS2A 2JGUA 3CPWU 1JA8A 4DR4O 3SPJA 3T1YB 3AG1C 2IM9A 3JASA 4JV5O 2QWNB 4IHJB 1SZTA 3P3NA 1MA1A 5FLXN 5KMGA 3CCSV 3CHXA 4DR1O 5KA5A 3CS5A 1URFA 3F5TA 3X2QC 4LFAB 3ZBHA 2QWQB 1OZ0A 3OAAG 4DR5B 3E8HA 5IYZB 5KHIA 3SPIA 5CA0A 4TUYB 5IWAO 1PPJH 5J2TA 4MVZA 2H3OA 4DK1A 4NYKA 3G71V 1N0JA 2R9AA 3HKDA 4UUJC 3K5OA 1Y67A 3T4ZA 4PDLA 5JJEB 1BSMA 3JASB 3E86A 5KUKA 3SPGA 5LMUB 4HBNA 1PM9A 3CB2A 3SJCC 1IXBA 5KMGB 1QVFU 4P9OA 1SESA 1VQ7V 2DN9A 4MVQA 1CEZA 4MT8A 3G4SV 1LUVA 1OCCB 2O57A 4JAVA 4K8ZA 4LF9B 2F4VO 2EZPA 1XBLA 3R65A 5CA0B 2WLLA 3JARB 1H8HG 1T5EA 3CXCU 1W2BU 2AXTZ 5J2TB 5KA6A 4TWKA 1CXZB 2XAQA 1KP2A 3HKDB 1JQ0A 2VQEO 2ZDIC 5BY1A 4JYAO 3ZN1A 3BY6A 1D5NA 2ZNIA 5JCOC 3ZMVA 4GX1A 5KAFZ 1J95A 4EFEA 4YY3O 1FKAO 4DV4B 4QE7A 3U10A 3AG1B 3SYAA 4X64O 4UV9A 3T1HB 4PA6A 1AR4A 1Q6IA 1YCIA 4PA4A 2JK5C 4DUYO 3HKBA 5J9PC 3DGEA 1ZLZA 2JJ1G 3GVMA 1KECA 5EIBC 2OWOA 1XOUA 2HHHO 3D3IA 4NXMB 3X2QB 1L8DA 3HKCA 3L75H 4I7ZB 1XHXA 3BAAA 2GSMB 2PTMA 5JH7A 4DV1B 4PJ0Z 2B1IA 3AG4C 3RW0A 1I94O 2RNBA 4F6RB 4LNUA 2Q67A 4LBEC 2Y4TA 2LGWA 1AJQA 2NR5A 1GN6A 3K0DA 1N4CA 3K58A 3L73H 4TT3G 4O4IB 2ZDIA 5H2FZ 4A5UB 4BWAA 2D2CB 4ZBMA 2ILMA 4HAMA 2RMKB 1XREA 1KYOF 1K92A 4NVPA 4FLYA 2Z5UA 5B1AB 2ZIOA 1GM8A 5LP6C 2DMXA 1JFFA 1GH6A 2JS5A 4R6ZA 3ABMC 4GKKO 1SA0A 3THOA 3TCUA 1S5HC 1R3JC 2WLHA 2X6BA 2LJ2A 2Y0PA 4LNUB 3HPLC 3L72H 1MMMA 2EJRA 4DR1B 4TSFG 2Q8VA 3AG7A 5IT9N 1M1KW 4NB5A 1V9PA 2ZD9A 1SC5B 5IY5C 3JD3A 1ZTEA 4PDVA 4QE9A 1QR8A 3RGBA 1OCRC 1JVMA 4Z2WA 4MTGA 4I55B 4U7OA 5CN0A 4JI5O 5IJ0A 5IWAB 5CBHA 1PNLA 3C90A 5H6RA 1IZ3A 1HP8A 3STLC 1AR1B 1JFFB 1K5QA 3CCEV 5KHJA 2KG7B 1JR9A 4DV2B 1SA0B 5FPOA 4X20A 4J7KA 4LF5O 1AROP 3VQYA 1NQTA 3TXQA 1S0VA 4JI6B 3VQXA 1NTMH 3GWKC 2YEVA 1YI2V 4I4TB 5LBQA 4O4LA 3AG4B 2M6YA 3G6EV 3TGUH 2AZ0A 1BT8A 1NVPD 1MABG 2YI8A 4PI0A 1U96A 3OUFA 1I08A 1Q6HA 4GCZA 4GX2A 4PI2A 3RYHB 3ZMSA 2VWJA 1SERA 1XNQB 1H2LA 4X20B 5B1OA 1GRJA 2VQEB 2B1GA 4JYAB 1SQQH 4EKWA 1VF7A 1G8MA 1XMQO 4UFZA 5LP6B 2P6JA 1NZ6A 2KQXA 4XDKA 1NR1A 4YY3B 4D7TA 2YEVB 1BHAA 2XT9A 2UUAO 3FB7C 1Z2GA 5H9CA 3UO3A 4X64B 4O4LB 2IH1C 5DM6V 2VS0A 1FS0G 4DW0A 5IY5B 1GN3A 4IT5A 1VQ5V 1FJGO 3CEIA 1OCRB 3ETEA 4J80A 2DQ0A 3OGCC 3FB5C 1SQFA 4MW3A 3WU2Z 1M93A 1QCEA 4RUFA 4MVMA 4LFCO 2AGAA 4I5SA 4WF9V 2QKCA 3DXRA 3RYFB 3ZHSA 1BHBA 2Q6AA 1QBZA 2CTQA 1E1RG 1V55C 1IBKO 2HG5C 2YICA 3OMNB 4MTXA 5GTIZ 3B8NA 1NBMG 4DW1A 2X6AA 1QLNA 4GX0A 1UPGA 1DGSA 1SS3A 3T1CA 4UCOA 1FFXB 2VWKA 4D7SA 5CA1A 2Q4PA 2XASA 4IIJB 4B3RB 3OGIB 2CTRA 1VQPV 4CH3A 1AI4A 1Q90D 2LP7A 4DV3B 2P4VA 3SPCA 5AG2A 2F43G 1B6QA 4FMTA 1PKXA 3T4DA 2JIZG 3IGAC 4OPHA 1JX9A 1SETA 2QWOB 5BMVA 2WPDG 1FXHA 4X66O 1Z5VA 3CXHF 4JI0B 4JPRA 5FNVA 1NI8A 1WA8A 4L87A 2Y0IA 3P3PA 3L9DA 2F66C 1Y66A 3IC7A 3PJSK 5B66Z 4E4EA 1HNZO 1NKDA 4J9YB 2WLMA 4NXNO 3G67A 3LSUA 4JI5B 1EN4A 3E2EA 1YXBA 2LFSA 2QKAA 1HNWO 3N2KA 5CA1B 3RT3C 2CDYA 4AQYB 3SPHA 2DWEC 2DYRC 4UB8Z 5LMNO 2CGNA 4BW5A 3FD9A 1AJNA 2X6CA 1XILA 3NR7A 4QGPA 4PA3A 5EC1C 2Q7EA 1BQ0A 4KP4A 1YSCA 1K34A 3KG2A 2OCCC 3EXAA 1EZVH 4JI1O 2E5LO 2XHBA 3W7UA 1WA8B 4LH6A 1PP9H 2ZR3A 1XHZA 1VQOV 4FLXA 4LR3A 5EIBD 4DR7O 3JALA 4NTXA 2N74A 4O2BA 1FXVA 1GM9A 1B3QA 4FFBB 4O2AB 4DO2A 4LWSA 1V55B 2CH7B 3N2KB 4OPAA 3S3XA 3W7TA 1DF5A 3K5LA 1TUEB 3CWBH 4Z1MG 4DV7B 1MZEA 3APOA 1N34O 4CC5A 3SJAC 3H1IH 4DV0O 2LGQA 2NLJC 2CK3G 2YXYA 1XMQB 1P84F 2QTOA 3NXSA 4IHJA 3CC2V 1AP5A 4OX9O 4X88A 4DV6O 4MVUA 2UUAB 3QO5A 1S3JA 1Q81W 2BSKA 3K04A 2CTPA 2RJZA 2YIAA 1QQCA 4PHZA 2ATKC 4ICGA 3CC4V 5JJNB 4FFKA 1Q43A 4YJ2A 1XL4A 5LHIA 5IYZA 4W4KA 2EILC 1PNKA 4TUYA 4P30A 4BIOA 2YUAA 2Q69A 1YDXA 1B06A 3RFRA 1VEWA 1K8AW 3FB6C 1O9HA 5JVDA 4AHCA 4LFCB 3RN4A 2Z3YA 1Q82W 1H2GA 1WNSA 2JEXA 1HW7A 2UXNA 5EC2C 1N32O 2DYRB 2R72A 4LCUC 3K57A 5IJ9B 1TVKB 4LP8A 4IYIA 4TQDA 4CH6A 1L1FA 3CX5F 2ZR2A 3UM7A 1IBKB 3VQVA 4JTAB 4JI4O 4DR3O 3STZC 2IU0A 2BSKB 5L3GA 1FPOA 1OV9A 2OYQA 2OCCB 5DEDA 2A9HA 2A7WA 1N36O 1VARA 3QO8A 4HYOA 4YJ2B 1BS3A 4CBCA 5B3SC 3G6BA 4QJFB 4B3TO 4AILC 4HNAA 3ZMZA 1EFRG 4O4HA 2V4DA 3K03A 2KKWA 3JARA 2OTLV 4B08A 2BE3A 1GK9A 2PUSA 2UU9O 4YIOA 3ZRXA 4ZIBA 5JVDB 1F23A 1ZUQA 4DK0A 1VMGA 1UJWB 2XOKG 2EINC 4YIPA 2L35A 1YHQV 5CA3A 2ADPA 2Q73A 4X66B 1PNMA 3U0ZA 1O9GA 4JI7O 1ZWIC 1HDJA 3ZCCA 3AEIA 4MW8A 4EEQA 2ZM6B 1AP6A 2HR3A 1NVPB 1FYJA 1SRYA 1HNZB 5EK0A 4PA7A 1K4DC 5L3CA 3CCJV 3B8MA 1S5JA 4NXNB 4DXWA 1YITV 4JAUA 1BQZA 3K06A 2XAJA 4HNAB 5CBFA 1DK1A 4O4HB 1Q5OA 2LFRA 2IH3C 1MSWD 3VOUA 2YI9A 1M9NA 4UCTA 5LMNB 1Y74A 4NKGB 4LF8O 1YF2A 3EFFK 4LC1A 4RQEA 1WP8A 5JQGA 2UXDB 1AILA 2EILB 1Y76B 4ZOLA 1JOYA 1ORQC 4JI1B 2E5LB 4F6RA 2AHYA 3ZEDA 3UT5B 2PI5A 3J80N 4F4LA 3F7VC 2RN9A 3IC9A 3C3TA 4O4IA 3ZX6A 1S77D 2PF4E 3P30A 4GYCB 2AZ2A 2GBOA 3ETGA 1A32A 4BIZA 4FM2A 1XNRO 4FPPA 2DW4A 4CS3A 4RUEA 3KCYA 1Y74B 2LO1A 4FLVA 2YIBD 1N34B 5JQGB 5B3SB 2ARHA 1I5YA 3ABLC 4IGGA 1VQNV 1EN6A 4DV0B 2ZIMA 2GV9A 2P4KA 4ZOLB 5EBLC 2QM7A 1K9MW 2DOSA 4X1KA 2GHYA 1QR9A 3CP1A 3ABTA 3EVKA 4PD4F 4X1IA 4OX9B 1EN5A 3BA8A 4DV6B 3SYPA 4JASA 1TAEA 2IJIA 2EINB 2YXHA 1BMFG 3BABA 4HZ3A 2JEUA 3C3SA 4B7EA 3A0BZ 2WWWA 1R6KA 4WFGA 5JCOA 4WBNB 4I55A 4D6TH 5E79Z 1H2SB 3W7XA 4JI3O 1LNQA 3MD0A 2ZCEA 1AI7A 4JTDB 2IW5A 3ETQA 4JZ2A 3CCMV 2P5OA 3JD2A 1SZXA 1VF6C 3I56V 4IYHA 2ZQMA 3QG5A 2EJ7A 2KG7A 1FXKC 4DR4B 5HFLA 4JV5B 4X1KB 4XBFA 1N32B 2Q7GA 4KUMA 4JI8O 3MAQA 4X1IB 4RO2A 1Q7YW 4JI4B 1KKDA 4JYBA 3E35A 5IDJA 5IYCO 1K97A 4I4TA 4DR6O 3CRAA 1N36B 1QLEC 5C8YB 1NH2D 3OW2U 4B3TB 2VRZA 3IFXA 4NTYA 1Z5WA 1KUQA 4BW9A 2UUCO 3JD4A 2PGGA 5TISZ 4DRXA 2ZXWC 1LR1A 3W7WA 1IDSA 4FM1A 1M4UA 1JJ2U 2UU9B 3OTOO 3RYHA 1KB9F 2W6JG 2QSAA 3DSQA 4GKJO 5BR8O 5IE9A 4U3FH 4ZHQB 1MSDA 1V54C 3K5MA 2JGDB 2QGNA 3F5WC 5LP6A 4LFBO 1VF6A 3ASNC 4CH5A 2XUMA 3U11A 1N33O 3IAYA 4B3MO 3OR7C 2H94A 2F4VB 2A79B 3EHBB 4ASUG 5LGNA 1COWG 2V7QG 2QWPB 4JGSA 1G4YB 4DRXB 2WLKA 4TV9B 3B4SA 2QTSA 1QU7A 2P90A 3RYIA 4WFEA 2E75B 1CP9A 5GTHZ 2GDSA 2RCVA 2W0XA 4PDRA 3AK2A 3RYFA 2UUBO 1NTKH 5CB4B 3J81N 1WPBA 4G2KA 3ABMB 1FXKB 3M8AA 5KX5A 2EBOA 4DUYB 3ML0A 3E8GA 5IYDO 1AVMA 3KKYA 3A2FA 5LOVB 3D8CA 3SYOA 2MK3A 1W59A 3A0HZ 2HLDG 3HB3B 1WPXA 2CTWA 3RYCB 2HHHB 2BCCH 1VQ4V 1KKCA 1FFXA 3MHHC 3SJQC 4IIJA 3RVZA 4J9ZB 1QLEB 1YTFD 2IBZH 2H8PC 1P7GA 2R9RB 2XAGA 3W7SA 1THZA 1P7BA 5GW7A 1WB8A 3RYIB 2IJHA 3ZHQA 2ZXWB 2GUZA 1I94B 4X1YB 3JAMN 1AB3A 3ASOC 4FZ1A 4TV8A 4J42A 1AI5A 1GAXA 1I5XA 5L3FA 2HJDA 2HKOA 1X4TA 3SDLA 3I55V 5KX5B 3FFQA 3OE7G 2JDIG 3ZS8C 2OCHA 3ZMUA 3T1YO 1XQ8A 1VQ6V 1ZSPA 3LSQA 4UCVA 1VQ8V 2K1EA 1KP3A 3ASNB 2P22C 3IJ4A 2ITCC 4NTWA 1DF4A 1WB7A 5LGUA 4DUZO 2FTKA 1R3LC 4PA9A 5B1BC 2LW7A 3Q4HB 2NN4A 4GKKB 3K0GA 3BCCH 4FLUA 1XEQA 4DR5O 2JS3A 4Q20A 3AG3C 1GTOA 2YSUB 2GUZB 2YS8A 2OTJV 3ZHUA 5DECA 3GB7C 5A9GA 4WFAV 4TV8B 4U3JB 2EIMC 3K5NA 4PDMA 3SGIA 2CGOA 3CC7V 3LSSA 1QNMA 1K5SA 3JAWB 1S72V 2LQTA 4IL6Z 1K4CC 1Y4MA 4BR6A 5LGTA 2FMLA 4WFBV 1U97A 1BZKA 3ICXA 3LNMB 2EX3A 3BEHA 4FFBA 4ZI7A 4O2AA 5A2QN 2HVJC 1P4RA 2RDCA 2ZE5A 2CH7A 3H1LH 1KD1W 4CZZA 3CJHB 1YZBA 1PD3A 3P32A 5EYPB 1FD9A 4FVMA 4GKJB 5BR8B 4EB6B 1NT2B 4H0LB 1E79G 2WLIB 1RP3B 3O9OA 4LF5B 2HVKC 1N8RW 2JRIA 2WLJA 1ZAUA 1DLBA 5J2UA 5K1XA 2GTSA 3K9AA 4LFBB 2JJ2G 1BL8A 3WFVA 4K35A 1R1BA 3ZN0A 4B7KA 4G27B 2D3OW 2E3CA 2UXCO 3BA9A 4YJ3B 1N33B 4GT1A 2HEPA 4B3MB 1ROPA 2Z0AA 4E2LA 5JJJB 3ASOB 4ZI7B 5EBWC 1EBOA 2EIJC 4GX5A 1H2NA 4JAAA 1SF9A 3KCXA 1M56C 3TJTA 1BE3H 1IBMO 1Q8IA 1S5LZ 5H5NA 3KZIZ 4I0XA 4TOIA 4FLZA 1XI1A 1GN2A 5EBMC 3ABKC 5J2UB 1WP7A 3ZMTA 5B1BB 2UUBB 2ZE7A 4F6EA 5IJ9A 1TVKA 1VIBA 4UVBA 2CUGA 2DYSC 2ZE6A 4H13B 3O65A 1R73A 3T2MA 4JI2O 4J41A 4Q6GA 3AG3B 1FFTB 1WLEA 2R9IA 3UQ8A 3E83A 3UCSC 2E74B 4DV1O 2EIMB 1ZX3A 3FB8C 1GN4A 1OCZC 1SQGA 3JCZA 4WCEV 4QPKA 3BHPA 4RQFA 1FJGB 4KXRA 1UFIA 2EULA 4YHHO 3OMIB 1BCCH 5FPRA 1YJNV 4I0XB 5B5EZ 3MHSC 4P2ZA 3OMAB 5KUMA 4X65O 2YDEA 1P49A 4OXSA 2W6IG 2PZSA 2YC0A 1WAZA 2EIKC 4JF3A 1NH2B 3I5DA 4DV5O 1KQSU 1R6TA 4J7JA 3OFNG 3H1HH 3SYCA 5B1NA 1F51A 2ZNJA 5L3EA 2BOBC 1RSOB 3TETA 3H01A 2DE0X 3B40A 2ODMA 5KAIZ 5KHGA 4PV1B 4BIUA 4NR1A 2LW1A 4DUZB 4ZKIA 2ZKOA 3FYEB 4OGQB 4I9QA 3ZIAG 5K1PA 1OJHA 3FAVA 5BXZA 2EIJB 4FM0A 1Y76A 2OIEA 4K0KO 2IU3A 2G38A 1OHHG 2QR4A 3N2GB 1J5EO 1VQMV 4J11A 1BGYH 4JYCA 2DJVA 1M56B 4N23A 2CE4A 3UT5A 5GONA 5LXTA 3ZHRA 3CRCA 4I50B 3RWRD 4KL1A 4DV2O 4AI8A 3ABKB 1M90W 1MZFA 2JVDA 1KMIZ 1VP7A 4MVOA 2BOCC 1WN7A 4CH4A 3E89A 1H2KA 3RBZA 2DYSB 2BTQA 1HNWB 4JI6O 2EZOA 2QA4V 5LL6Y 1EZJA 3WB0A 5B1AC 2ADQB 1RM1C 1OCZB 3FAVB 1Q3EA 1S76D 1HR0O 5L3BA 3K08A 4FLTA 3MDSA 1NTZH 1ZL8A 2QDOA 3JATA 4CS4A 4UVAA 1IBLO 4RWUA 5GONB 5LXTB 4C7UA 2UXCB 1JPXA 1NU1H 4DR7B 2E76B 1XNQO 3N27A 3E22A 4KHPO 1G6UA 4MTFA 2YXLA 2EIKB 1YTFB 1R6NA 1TA8A 3HR0A 2CAZC 4WBNA 3OUSA 2BTQB 2XTAA 1QHTA 4RAIA 1AR5A 4YXWG 1JCHA 3RVYA 2HFEC 4UVCA 3CCUV 1IBMB 3L74H 5F2VO 2HJFC 3VBBA 3G80A 1SQXH 3CCQV 1RPOA 1XMOO 2UXBO 1W0KG 1F4NA 3WB1A 2B5UA 2WLLB 2NNUA 3QF7A 2VQFO 1ZL8B 3JATB 4X9QA 3TK1A 3AK1A 1R3KC 1YIJV 1RFYA 3E8FA 2OIGA 2N05A 3APQA 3OEEG 5JWPA 3SR2C 3QVNA 3B77A 4JI2B 5LHHA 2ETNA 3LDDA 3E22B 4GZRB 1PL4A 3K59A 4LF7O 4LF4O 1IXMA 5C8YA 3CRRA 1YEWA 2QM4A 3CSXA 2A3QA 3CRMA 5KLVH 4B3SO 4BAYA 5BZBA 3UO2A 5D5PA 4I9WA 1FAFA 3J7AU 2WA3A 2F1MA 4YHHB 4Z1VA 1K33A 3HKBB 4ZHQA 2Q9LA 1PL0A 4X65B 2B9ZA 1G1XB 1MOFA 2JGDA 1NS1A 3BRCA 1L0NH 2Q0OC 1E1QG 4DV5B 1AJPA 1RM1B 1VQKV 3FKSG 3S3WA 2F23A 4B3RO 3HKCB 4UXNA 4DR3B 2Q0AA 1ENVA 4FLWA 4DV3O 5LA6A 3JD1A 3DC5A 4XDLA 5JH7B 3LUTB 5FL7G 4JI0O 2C2AA 4UB6Z 4UV8A 2UXXA 3ZHVA 4U7NA 4FZ0A 2ITDC 1SQBH 3ZRWA 4TV9A 1MNGA 4G28B 5C93A 3LDCA 2A0LA 1RPRA 2AW9A 1SQVH 3SJBC 4TQFA 3SYQA 4K0KB 4JI7B 2Y48A 1K3EA 2ZE8A 4K3AA 3A0RA 1J5EB 2FKXA 5CBGA 2WA4A 5CB4A 4AQYO 5EZYA 3CMEV 1M57C 3ABLB 3ZRVA 1FXKA 5LA6B 2Q7HA 3VQWA 3CD6V 3JSNA 4WFHA 2GTAA 3FYIB 1SKVA 3JSLA 2RQ6A 1B04A 5LOVA 2Q5ZA 2Q68A 1K73W 2KB1A 4LF6O 3ZRWB 4QPJA 3QO7A 3RYCA 3CCRV 3GWOA 1IVSA 3CRQA 4LF8B 2N04A 4MS2A 4FK5C 2DWDC 4FJCC 1QVGU 2ZINA 1H2MA 1JMKC
chains in the Genus database with same CATH topology
4DR3O 4LF5O 4NXMO 1HNXO 1KUQA 1G1XB 1A32A 4YHHO 1N36O 1YZBA 1XNRO 4DR7O 1I94O 2N74A 2UUCO 1IBKO 1NS1A 1HR0O 4B3TO 4X65O 4X62O 4B3RO 3OTOO 4DV7O 2JRIA 1F7YA 1IBLO 4DV3O 4GKJO 5BR8O 4OPAA 5LMUO 4DV5O 1R6TA 4A5UB 1XNQO 2UU9O 4KHPO 3JAMN 1AB3A 1R1BA 2ZM6O 4JI0O 2F4VO 2UXCO 2DOSA 1N34O 4LFBO 3SDLA 4JI7O 2Z0AA 4DV0O 4LF9O 4OPHA 3T1YO 1N33O 4X66O 4B3MO 2ZKOA 4GKKO 1FYJA 4OX9O 4DV6O 1XMQO 4DUZO 4DR2O 1XMOO 2UXBO 2VQEO 5BY1A 4DR4O 2FKXA 1IBMO 4JYAO 5BXZA 4JI3O 2LW7A 2AGAA 2VQFO 1HNZO 1D2DA 2UXDO 5H5NA 4AQYO 2UUAO 1DK1A 4K0KO 4JV5O 5IT9N 1J5EO 4NXNO 1XEQA 4DR5O 4YY3O 5FLXN 1FKAO 2DJVA 4DR1O 4LF8O 4X64O 1HNWO 3F5TA 4LF7O 3RT3C 4DV2O 4LF4O 1AILA 4DUYO 3O65A 5LMNO 4DV4O 4JI2O 4JI5O 2UUBO 4LF6O 3R66A 3J81N 1FJGO 3T1HO 4JI8O 4B3SO 4DV1O 3M8AA 4LFAO 2HHHO 1N32O 1X59A 4JI6O 3J80N 3J7AU 4DR6O 5IWAO 4JI1O 2E5LO 4LFCO 5LL6Y 5A2QN 4JI4O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 O;  4LF5 O;  4NXM O;  1HNX O;  1KUQ A;  1G1X B;  1A32 A;  4YHH O;  1N36 O;  1YZB A;  1XNR O;  4DR7 O;  1I94 O;  2N74 A;  2UUC O;  1IBK O;  1NS1 A;  1HR0 O;  4B3T O;  4X65 O;  4X62 O;  4B3R O;  3OTO O;  4DV7 O;  2JRI A;  1F7Y A;  1IBL O;  4DV3 O;  4GKJ O;  5BR8 O;  4OPA A;  5LMU O;  4DV5 O;  1R6T A;  4A5U B;  1XNQ O;  2UU9 O;  4KHP O;  3JAM N;  1AB3 A;  1R1B A;  2ZM6 O;  4JI0 O;  2F4V O;  2UXC O;  2DOS A;  1N34 O;  4LFB O;  3SDL A;  4JI7 O;  2Z0A A;  4DV0 O;  4LF9 O;  4OPH A;  3T1Y O;  1N33 O;  4X66 O;  4B3M O;  2ZKO A;  4GKK O;  1FYJ A;  4OX9 O;  4DV6 O;  1XMQ O;  4DUZ O;  4DR2 O;  1XMO O;  2UXB O;  2VQE O;  5BY1 A;  4DR4 O;  2FKX A;  1IBM O;  4JYA O;  5BXZ A;  4JI3 O;  2LW7 A;  2AGA A;  2VQF O;  1HNZ O;  1D2D A;  2UXD O;  5H5N A;  4AQY O;  2UUA O;  1DK1 A;  4K0K O;  4JV5 O;  5IT9 N;  1J5E O;  4NXN O;  1XEQ A;  4DR5 O;  4YY3 O;  5FLX N;  1FKA O;  2DJV A;  4DR1 O;  4LF8 O;  4X64 O;  1HNW O;  3F5T A;  4LF7 O;  3RT3 C;  4DV2 O;  4LF4 O;  1AIL A;  4DUY O;  3O65 A;  5LMN O;  4DV4 O;  4JI2 O;  4JI5 O;  2UUB O;  4LF6 O;  3R66 A;  3J81 N;  1FJG O;  3T1H O;  4JI8 O;  4B3S O;  4DV1 O;  3M8A A;  4LFA O;  2HHH O;  1N32 O;  1X59 A;  4JI6 O;  3J80 N;  3J7A U;  4DR6 O;  5IWA O;  4JI1 O;  2E5L O;  4LFC O;  5LL6 Y;  5A2Q N;  4JI4 O; 
#chains in the Genus database with same CATH topology
 2WSS G;  3D36 C;  3OEH G;  1HR0 B;  2IJK A;  1HNX O;  1IUR A;  4MTO A;  5IJ0 B;  3AG2 C;  3K79 A;  4X1Y A;  4J7Z A;  4K8X A;  4N21 A;  1IBL B;  5EZY B;  5E1A C;  2PY5 A;  3B09 A;  4X62 O;  4DV7 O;  3OM3 B;  4KHP B;  4QNH B;  3WG7 C;  4GUN A;  4R7C A;  3A8T A;  4J10 A;  3CYO A;  1XNR B;  1KC8 W;  1H38 A;  5IYB O;  2K9P A;  3ETD A;  3ZRS A;  2HP8 A;  1VF5 B;  2PI4 A;  4JZG A;  1R3I C;  4H44 B;  3Q4H A;  2AHZ A;  5DN6 G;  4MSW C;  3TXS A;  1XMO B;  2XND G;  2UXB B;  1W0J G;  2MW2 B;  1I7F A;  2VQF B;  3CMA V;  3ZJZ A;  4DR2 O;  4U3J A;  4MVR A;  1AI6 A;  3UKM A;  3DTU B;  1D2D A;  3JAW A;  1V54 B;  2P06 A;  4UCS A;  5D5Q A;  3D36 A;  5KHH A;  3B2E E;  5ITZ A;  4LF4 B;  4LF7 B;  2F95 B;  1GKF A;  2QE7 G;  3CCL V;  1D5A A;  1GO3 F;  5CMU A;  3OR6 C;  4B3S B;  2FL4 A;  3L71 H;  4JI3 B;  1M57 B;  1TUB A;  5LYJ A;  4EFB A;  4WFF A;  1JJO A;  3R66 A;  1H8E G;  3CJH A;  3H9V A;  1LUW A;  5EYP A;  2Y69 C;  3M7M X;  4LFA O;  3FX7 A;  1X59 A;  2X7R B;  4EB6 A;  2FYU H;  2WLI A;  2FB5 A;  2X0L A;  2Y4U A;  3QNE A;  3F7Y C;  3OT7 A;  1DTO A;  4UCU A;  3JCU Z;  4ABM A;  4JI8 B;  4MVS A;  4JTC B;  4DR6 B;  2BTO A;  4FIP C;  2WAM A;  4YJ3 A;  5ITZ B;  1CPY A;  3K9S A;  4LH7 A;  3AG2 B;  1F7Y A;  3M99 B;  3ZHT A;  3DXR B;  5LMU O;  3PN1 A;  2YIB A;  4UCR A;  2UUC B;  3QTC A;  1TUB B;  5LYJ B;  3HKE A;  1F4M A;  2ZM6 O;  2WLN A;  4PEL A;  4W4L A;  3WG7 B;  3OTO B;  3CCV V;  5HFM A;  2QWR B;  4R8C A;  1OCO C;  4CC6 A;  3JAK A;  1SQP H;  1K7D A;  1PV0 A;  2V1D A;  4LF9 O;  1Y6X A;  5H6Q A;  1WJZ A;  3ABU A;  2QEX V;  2QM8 A;  5KHK A;  2YID A;  1XL6 A;  3BFR A;  1NJI W;  2P67 A;  3D3Q A;  4R50 A;  2PYL A;  4JYY A;  2UXD O;  3BPZ A;  5BMV B;  5FNV B;  5LHG A;  4LF6 B;  4L8J A;  2L6L A;  1M5I A;  1TGO A;  3HKE B;  2QKS A;  2P7T C;  1IX9 A;  3DC6 A;  4DV4 O;  1KU9 A;  4O4J A;  3T1H O;  5L3D A;  3JAK B;  3LDE A;  1MG1 A;  4XDJ A;  2R70 A;  3JD0 A;  1HNX B;  2XAH A;  1XDC A;  1EM1 A;  1GMG A;  3E8B A;  3H1J H;  2PYJ A;  2Y69 B;  1L0L H;  4NXM O;  4GLX A;  4X8A A;  1VQ9 V;  4P9P A;  4X62 B;  1NR7 A;  2M7W A;  1I0H A;  1Q6U A;  3LNN A;  2DQ3 A;  3OD4 A;  1RSO A;  1HWY A;  3CE2 A;  2OT5 A;  4H33 A;  1OCC C;  4H37 A;  4X89 A;  2ZT9 B;  2KSD A;  1VQL V;  4QIW F;  3WB2 A;  1YJW V;  2W0F C;  3K3W A;  3AK3 A;  2XAF A;  4KFM A;  1Q86 W;  3JAL B;  3JYC A;  3L70 H;  4O2B B;  1YVW A;  4O4J B;  2A06 H;  4DYL A;  3H1K H;  1KBH A;  4LWS B;  1GM7 A;  2F93 B;  1XUQ A;  1YJ9 V;  4DR2 B;  1N0N A;  3BVO A;  3N2G A;  2QJ1 A;  1OCO B;  3OTF A;  1US6 A;  2IJJ A;  4I50 A;  4CS2 A;  2JGU A;  3CPW U;  1JA8 A;  4DR4 O;  3SPJ A;  3T1Y B;  3AG1 C;  2IM9 A;  3JAS A;  4JV5 O;  2QWN B;  4IHJ B;  1SZT A;  3P3N A;  1MA1 A;  5FLX N;  5KMG A;  3CCS V;  3CHX A;  4DR1 O;  5KA5 A;  3CS5 A;  1URF A;  3F5T A;  3X2Q C;  4LFA B;  3ZBH A;  2QWQ B;  1OZ0 A;  3OAA G;  4DR5 B;  3E8H A;  5IYZ B;  5KHI A;  3SPI A;  5CA0 A;  4TUY B;  5IWA O;  1PPJ H;  5J2T A;  4MVZ A;  2H3O A;  4DK1 A;  4NYK A;  3G71 V;  1N0J A;  2R9A A;  3HKD A;  4UUJ C;  3K5O A;  1Y67 A;  3T4Z A;  4PDL A;  5JJE B;  1BSM A;  3JAS B;  3E86 A;  5KUK A;  3SPG A;  5LMU B;  4HBN A;  1PM9 A;  3CB2 A;  3SJC C;  1IXB A;  5KMG B;  1QVF U;  4P9O A;  1SES A;  1VQ7 V;  2DN9 A;  4MVQ A;  1CEZ A;  4MT8 A;  3G4S V;  1LUV A;  1OCC B;  2O57 A;  4JAV A;  4K8Z A;  4LF9 B;  2F4V O;  2EZP A;  1XBL A;  3R65 A;  5CA0 B;  2WLL A;  3JAR B;  1H8H G;  1T5E A;  3CXC U;  1W2B U;  2AXT Z;  5J2T B;  5KA6 A;  4TWK A;  1CXZ B;  2XAQ A;  1KP2 A;  3HKD B;  1JQ0 A;  2VQE O;  2ZDI C;  5BY1 A;  4JYA O;  3ZN1 A;  3BY6 A;  1D5N A;  2ZNI A;  5JCO C;  3ZMV A;  4GX1 A;  5KAF Z;  1J95 A;  4EFE A;  4YY3 O;  1FKA O;  4DV4 B;  4QE7 A;  3U10 A;  3AG1 B;  3SYA A;  4X64 O;  4UV9 A;  3T1H B;  4PA6 A;  1AR4 A;  1Q6I A;  1YCI A;  4PA4 A;  2JK5 C;  4DUY O;  3HKB A;  5J9P C;  3DGE A;  1ZLZ A;  2JJ1 G;  3GVM A;  1KEC A;  5EIB C;  2OWO A;  1XOU A;  2HHH O;  3D3I A;  4NXM B;  3X2Q B;  1L8D A;  3HKC A;  3L75 H;  4I7Z B;  1XHX A;  3BAA A;  2GSM B;  2PTM A;  5JH7 A;  4DV1 B;  4PJ0 Z;  2B1I A;  3AG4 C;  3RW0 A;  1I94 O;  2RNB A;  4F6R B;  4LNU A;  2Q67 A;  4LBE C;  2Y4T A;  2LGW A;  1AJQ A;  2NR5 A;  1GN6 A;  3K0D A;  1N4C A;  3K58 A;  3L73 H;  4TT3 G;  4O4I B;  2ZDI A;  5H2F Z;  4A5U B;  4BWA A;  2D2C B;  4ZBM A;  2ILM A;  4HAM A;  2RMK B;  1XRE A;  1KYO F;  1K92 A;  4NVP A;  4FLY A;  2Z5U A;  5B1A B;  2ZIO A;  1GM8 A;  5LP6 C;  2DMX A;  1JFF A;  1GH6 A;  2JS5 A;  4R6Z A;  3ABM C;  4GKK O;  1SA0 A;  3THO A;  3TCU A;  1S5H C;  1R3J C;  2WLH A;  2X6B A;  2LJ2 A;  2Y0P A;  4LNU B;  3HPL C;  3L72 H;  1MMM A;  2EJR A;  4DR1 B;  4TSF G;  2Q8V A;  3AG7 A;  5IT9 N;  1M1K W;  4NB5 A;  1V9P A;  2ZD9 A;  1SC5 B;  5IY5 C;  3JD3 A;  1ZTE A;  4PDV A;  4QE9 A;  1QR8 A;  3RGB A;  1OCR C;  1JVM A;  4Z2W A;  4MTG A;  4I55 B;  4U7O A;  5CN0 A;  4JI5 O;  5IJ0 A;  5IWA B;  5CBH A;  1PNL A;  3C90 A;  5H6R A;  1IZ3 A;  1HP8 A;  3STL C;  1AR1 B;  1JFF B;  1K5Q A;  3CCE V;  5KHJ A;  2KG7 B;  1JR9 A;  4DV2 B;  1SA0 B;  5FPO A;  4X20 A;  4J7K A;  4LF5 O;  1ARO P;  3VQY A;  1NQT A;  3TXQ A;  1S0V A;  4JI6 B;  3VQX A;  1NTM H;  3GWK C;  2YEV A;  1YI2 V;  4I4T B;  5LBQ A;  4O4L A;  3AG4 B;  2M6Y A;  3G6E V;  3TGU H;  2AZ0 A;  1BT8 A;  1NVP D;  1MAB G;  2YI8 A;  4PI0 A;  1U96 A;  3OUF A;  1I08 A;  1Q6H A;  4GCZ A;  4GX2 A;  4PI2 A;  3RYH B;  3ZMS A;  2VWJ A;  1SER A;  1XNQ B;  1H2L A;  4X20 B;  5B1O A;  1GRJ A;  2VQE B;  2B1G A;  4JYA B;  1SQQ H;  4EKW A;  1VF7 A;  1G8M A;  1XMQ O;  4UFZ A;  5LP6 B;  2P6J A;  1NZ6 A;  2KQX A;  4XDK A;  1NR1 A;  4YY3 B;  4D7T A;  2YEV B;  1BHA A;  2XT9 A;  2UUA O;  3FB7 C;  1Z2G A;  5H9C A;  3UO3 A;  4X64 B;  4O4L B;  2IH1 C;  5DM6 V;  2VS0 A;  1FS0 G;  4DW0 A;  5IY5 B;  1GN3 A;  4IT5 A;  1VQ5 V;  1FJG O;  3CEI A;  1OCR B;  3ETE A;  4J80 A;  2DQ0 A;  3OGC C;  3FB5 C;  1SQF A;  4MW3 A;  3WU2 Z;  1M93 A;  1QCE A;  4RUF A;  4MVM A;  4LFC O;  2AGA A;  4I5S A;  4WF9 V;  2QKC A;  3DXR A;  3RYF B;  3ZHS A;  1BHB A;  2Q6A A;  1QBZ A;  2CTQ A;  1E1R G;  1V55 C;  1IBK O;  2HG5 C;  2YIC A;  3OMN B;  4MTX A;  5GTI Z;  3B8N A;  1NBM G;  4DW1 A;  2X6A A;  1QLN A;  4GX0 A;  1UPG A;  1DGS A;  1SS3 A;  3T1C A;  4UCO A;  1FFX B;  2VWK A;  4D7S A;  5CA1 A;  2Q4P A;  2XAS A;  4IIJ B;  4B3R B;  3OGI B;  2CTR A;  1VQP V;  4CH3 A;  1AI4 A;  1Q90 D;  2LP7 A;  4DV3 B;  2P4V A;  3SPC A;  5AG2 A;  2F43 G;  1B6Q A;  4FMT A;  1PKX A;  3T4D A;  2JIZ G;  3IGA C;  4OPH A;  1JX9 A;  1SET A;  2QWO B;  5BMV A;  2WPD G;  1FXH A;  4X66 O;  1Z5V A;  3CXH F;  4JI0 B;  4JPR A;  5FNV A;  1NI8 A;  1WA8 A;  4L87 A;  2Y0I A;  3P3P A;  3L9D A;  2F66 C;  1Y66 A;  3IC7 A;  3PJS K;  5B66 Z;  4E4E A;  1HNZ O;  1NKD A;  4J9Y B;  2WLM A;  4NXN O;  3G67 A;  3LSU A;  4JI5 B;  1EN4 A;  3E2E A;  1YXB A;  2LFS A;  2QKA A;  1HNW O;  3N2K A;  5CA1 B;  3RT3 C;  2CDY A;  4AQY B;  3SPH A;  2DWE C;  2DYR C;  4UB8 Z;  5LMN O;  2CGN A;  4BW5 A;  3FD9 A;  1AJN A;  2X6C A;  1XIL A;  3NR7 A;  4QGP A;  4PA3 A;  5EC1 C;  2Q7E A;  1BQ0 A;  4KP4 A;  1YSC A;  1K34 A;  3KG2 A;  2OCC C;  3EXA A;  1EZV H;  4JI1 O;  2E5L O;  2XHB A;  3W7U A;  1WA8 B;  4LH6 A;  1PP9 H;  2ZR3 A;  1XHZ A;  1VQO V;  4FLX A;  4LR3 A;  5EIB D;  4DR7 O;  3JAL A;  4NTX A;  2N74 A;  4O2B A;  1FXV A;  1GM9 A;  1B3Q A;  4FFB B;  4O2A B;  4DO2 A;  4LWS A;  1V55 B;  2CH7 B;  3N2K B;  4OPA A;  3S3X A;  3W7T A;  1DF5 A;  3K5L A;  1TUE B;  3CWB H;  4Z1M G;  4DV7 B;  1MZE A;  3APO A;  1N34 O;  4CC5 A;  3SJA C;  3H1I H;  4DV0 O;  2LGQ A;  2NLJ C;  2CK3 G;  2YXY A;  1XMQ B;  1P84 F;  2QTO A;  3NXS A;  4IHJ A;  3CC2 V;  1AP5 A;  4OX9 O;  4X88 A;  4DV6 O;  4MVU A;  2UUA B;  3QO5 A;  1S3J A;  1Q81 W;  2BSK A;  3K04 A;  2CTP A;  2RJZ A;  2YIA A;  1QQC A;  4PHZ A;  2ATK C;  4ICG A;  3CC4 V;  5JJN B;  4FFK A;  1Q43 A;  4YJ2 A;  1XL4 A;  5LHI A;  5IYZ A;  4W4K A;  2EIL C;  1PNK A;  4TUY A;  4P30 A;  4BIO A;  2YUA A;  2Q69 A;  1YDX A;  1B06 A;  3RFR A;  1VEW A;  1K8A W;  3FB6 C;  1O9H A;  5JVD A;  4AHC A;  4LFC B;  3RN4 A;  2Z3Y A;  1Q82 W;  1H2G A;  1WNS A;  2JEX A;  1HW7 A;  2UXN A;  5EC2 C;  1N32 O;  2DYR B;  2R72 A;  4LCU C;  3K57 A;  5IJ9 B;  1TVK B;  4LP8 A;  4IYI A;  4TQD A;  4CH6 A;  1L1F A;  3CX5 F;  2ZR2 A;  3UM7 A;  1IBK B;  3VQV A;  4JTA B;  4JI4 O;  4DR3 O;  3STZ C;  2IU0 A;  2BSK B;  5L3G A;  1FPO A;  1OV9 A;  2OYQ A;  2OCC B;  5DED A;  2A9H A;  2A7W A;  1N36 O;  1VAR A;  3QO8 A;  4HYO A;  4YJ2 B;  1BS3 A;  4CBC A;  5B3S C;  3G6B A;  4QJF B;  4B3T O;  4AIL C;  4HNA A;  3ZMZ A;  1EFR G;  4O4H A;  2V4D A;  3K03 A;  2KKW A;  3JAR A;  2OTL V;  4B08 A;  2BE3 A;  1GK9 A;  2PUS A;  2UU9 O;  4YIO A;  3ZRX A;  4ZIB A;  5JVD B;  1F23 A;  1ZUQ A;  4DK0 A;  1VMG A;  1UJW B;  2XOK G;  2EIN C;  4YIP A;  2L35 A;  1YHQ V;  5CA3 A;  2ADP A;  2Q73 A;  4X66 B;  1PNM A;  3U0Z A;  1O9G A;  4JI7 O;  1ZWI C;  1HDJ A;  3ZCC A;  3AEI A;  4MW8 A;  4EEQ A;  2ZM6 B;  1AP6 A;  2HR3 A;  1NVP B;  1FYJ A;  1SRY A;  1HNZ B;  5EK0 A;  4PA7 A;  1K4D C;  5L3C A;  3CCJ V;  3B8M A;  1S5J A;  4NXN B;  4DXW A;  1YIT V;  4JAU A;  1BQZ A;  3K06 A;  2XAJ A;  4HNA B;  5CBF A;  1DK1 A;  4O4H B;  1Q5O A;  2LFR A;  2IH3 C;  1MSW D;  3VOU A;  2YI9 A;  1M9N A;  4UCT A;  5LMN B;  1Y74 A;  4NKG B;  4LF8 O;  1YF2 A;  3EFF K;  4LC1 A;  4RQE A;  1WP8 A;  5JQG A;  2UXD B;  1AIL A;  2EIL B;  1Y76 B;  4ZOL A;  1JOY A;  1ORQ C;  4JI1 B;  2E5L B;  4F6R A;  2AHY A;  3ZED A;  3UT5 B;  2PI5 A;  3J80 N;  4F4L A;  3F7V C;  2RN9 A;  3IC9 A;  3C3T A;  4O4I A;  3ZX6 A;  1S77 D;  2PF4 E;  3P30 A;  4GYC B;  2AZ2 A;  2GBO A;  3ETG A;  1A32 A;  4BIZ A;  4FM2 A;  1XNR O;  4FPP A;  2DW4 A;  4CS3 A;  4RUE A;  3KCY A;  1Y74 B;  2LO1 A;  4FLV A;  2YIB D;  1N34 B;  5JQG B;  5B3S B;  2ARH A;  1I5Y A;  3ABL C;  4IGG A;  1VQN V;  1EN6 A;  4DV0 B;  2ZIM A;  2GV9 A;  2P4K A;  4ZOL B;  5EBL C;  2QM7 A;  1K9M W;  2DOS A;  4X1K A;  2GHY A;  1QR9 A;  3CP1 A;  3ABT A;  3EVK A;  4PD4 F;  4X1I A;  4OX9 B;  1EN5 A;  3BA8 A;  4DV6 B;  3SYP A;  4JAS A;  1TAE A;  2IJI A;  2EIN B;  2YXH A;  1BMF G;  3BAB A;  4HZ3 A;  2JEU A;  3C3S A;  4B7E A;  3A0B Z;  2WWW A;  1R6K A;  4WFG A;  5JCO A;  4WBN B;  4I55 A;  4D6T H;  5E79 Z;  1H2S B;  3W7X A;  4JI3 O;  1LNQ A;  3MD0 A;  2ZCE A;  1AI7 A;  4JTD B;  2IW5 A;  3ETQ A;  4JZ2 A;  3CCM V;  2P5O A;  3JD2 A;  1SZX A;  1VF6 C;  3I56 V;  4IYH A;  2ZQM A;  3QG5 A;  2EJ7 A;  2KG7 A;  1FXK C;  4DR4 B;  5HFL A;  4JV5 B;  4X1K B;  4XBF A;  1N32 B;  2Q7G A;  4KUM A;  4JI8 O;  3MAQ A;  4X1I B;  4RO2 A;  1Q7Y W;  4JI4 B;  1KKD A;  4JYB A;  3E35 A;  5IDJ A;  5IYC O;  1K97 A;  4I4T A;  4DR6 O;  3CRA A;  1N36 B;  1QLE C;  5C8Y B;  1NH2 D;  3OW2 U;  4B3T B;  2VRZ A;  3IFX A;  4NTY A;  1Z5W A;  1KUQ A;  4BW9 A;  2UUC O;  3JD4 A;  2PGG A;  5TIS Z;  4DRX A;  2ZXW C;  1LR1 A;  3W7W A;  1IDS A;  4FM1 A;  1M4U A;  1JJ2 U;  2UU9 B;  3OTO O;  3RYH A;  1KB9 F;  2W6J G;  2QSA A;  3DSQ A;  4GKJ O;  5BR8 O;  5IE9 A;  4U3F H;  4ZHQ B;  1MSD A;  1V54 C;  3K5M A;  2JGD B;  2QGN A;  3F5W C;  5LP6 A;  4LFB O;  1VF6 A;  3ASN C;  4CH5 A;  2XUM A;  3U11 A;  1N33 O;  3IAY A;  4B3M O;  3OR7 C;  2H94 A;  2F4V B;  2A79 B;  3EHB B;  4ASU G;  5LGN A;  1COW G;  2V7Q G;  2QWP B;  4JGS A;  1G4Y B;  4DRX B;  2WLK A;  4TV9 B;  3B4S A;  2QTS A;  1QU7 A;  2P90 A;  3RYI A;  4WFE A;  2E75 B;  1CP9 A;  5GTH Z;  2GDS A;  2RCV A;  2W0X A;  4PDR A;  3AK2 A;  3RYF A;  2UUB O;  1NTK H;  5CB4 B;  3J81 N;  1WPB A;  4G2K A;  3ABM B;  1FXK B;  3M8A A;  5KX5 A;  2EBO A;  4DUY B;  3ML0 A;  3E8G A;  5IYD O;  1AVM A;  3KKY A;  3A2F A;  5LOV B;  3D8C A;  3SYO A;  2MK3 A;  1W59 A;  3A0H Z;  2HLD G;  3HB3 B;  1WPX A;  2CTW A;  3RYC B;  2HHH B;  2BCC H;  1VQ4 V;  1KKC A;  1FFX A;  3MHH C;  3SJQ C;  4IIJ A;  3RVZ A;  4J9Z B;  1QLE B;  1YTF D;  2IBZ H;  2H8P C;  1P7G A;  2R9R B;  2XAG A;  3W7S A;  1THZ A;  1P7B A;  5GW7 A;  1WB8 A;  3RYI B;  2IJH A;  3ZHQ A;  2ZXW B;  2GUZ A;  1I94 B;  4X1Y B;  3JAM N;  1AB3 A;  3ASO C;  4FZ1 A;  4TV8 A;  4J42 A;  1AI5 A;  1GAX A;  1I5X A;  5L3F A;  2HJD A;  2HKO A;  1X4T A;  3SDL A;  3I55 V;  5KX5 B;  3FFQ A;  3OE7 G;  2JDI G;  3ZS8 C;  2OCH A;  3ZMU A;  3T1Y O;  1XQ8 A;  1VQ6 V;  1ZSP A;  3LSQ A;  4UCV A;  1VQ8 V;  2K1E A;  1KP3 A;  3ASN B;  2P22 C;  3IJ4 A;  2ITC C;  4NTW A;  1DF4 A;  1WB7 A;  5LGU A;  4DUZ O;  2FTK A;  1R3L C;  4PA9 A;  5B1B C;  2LW7 A;  3Q4H B;  2NN4 A;  4GKK B;  3K0G A;  3BCC H;  4FLU A;  1XEQ A;  4DR5 O;  2JS3 A;  4Q20 A;  3AG3 C;  1GTO A;  2YSU B;  2GUZ B;  2YS8 A;  2OTJ V;  3ZHU A;  5DEC A;  3GB7 C;  5A9G A;  4WFA V;  4TV8 B;  4U3J B;  2EIM C;  3K5N A;  4PDM A;  3SGI A;  2CGO A;  3CC7 V;  3LSS A;  1QNM A;  1K5S A;  3JAW B;  1S72 V;  2LQT A;  4IL6 Z;  1K4C C;  1Y4M A;  4BR6 A;  5LGT A;  2FML A;  4WFB V;  1U97 A;  1BZK A;  3ICX A;  3LNM B;  2EX3 A;  3BEH A;  4FFB A;  4ZI7 A;  4O2A A;  5A2Q N;  2HVJ C;  1P4R A;  2RDC A;  2ZE5 A;  2CH7 A;  3H1L H;  1KD1 W;  4CZZ A;  3CJH B;  1YZB A;  1PD3 A;  3P32 A;  5EYP B;  1FD9 A;  4FVM A;  4GKJ B;  5BR8 B;  4EB6 B;  1NT2 B;  4H0L B;  1E79 G;  2WLI B;  1RP3 B;  3O9O A;  4LF5 B;  2HVK C;  1N8R W;  2JRI A;  2WLJ A;  1ZAU A;  1DLB A;  5J2U A;  5K1X A;  2GTS A;  3K9A A;  4LFB B;  2JJ2 G;  1BL8 A;  3WFV A;  4K35 A;  1R1B A;  3ZN0 A;  4B7K A;  4G27 B;  2D3O W;  2E3C A;  2UXC O;  3BA9 A;  4YJ3 B;  1N33 B;  4GT1 A;  2HEP A;  4B3M B;  1ROP A;  2Z0A A;  4E2L A;  5JJJ B;  3ASO B;  4ZI7 B;  5EBW C;  1EBO A;  2EIJ C;  4GX5 A;  1H2N A;  4JAA A;  1SF9 A;  3KCX A;  1M56 C;  3TJT A;  1BE3 H;  1IBM O;  1Q8I A;  1S5L Z;  5H5N A;  3KZI Z;  4I0X A;  4TOI A;  4FLZ A;  1XI1 A;  1GN2 A;  5EBM C;  3ABK C;  5J2U B;  1WP7 A;  3ZMT A;  5B1B B;  2UUB B;  2ZE7 A;  4F6E A;  5IJ9 A;  1TVK A;  1VIB A;  4UVB A;  2CUG A;  2DYS C;  2ZE6 A;  4H13 B;  3O65 A;  1R73 A;  3T2M A;  4JI2 O;  4J41 A;  4Q6G A;  3AG3 B;  1FFT B;  1WLE A;  2R9I A;  3UQ8 A;  3E83 A;  3UCS C;  2E74 B;  4DV1 O;  2EIM B;  1ZX3 A;  3FB8 C;  1GN4 A;  1OCZ C;  1SQG A;  3JCZ A;  4WCE V;  4QPK A;  3BHP A;  4RQF A;  1FJG B;  4KXR A;  1UFI A;  2EUL A;  4YHH O;  3OMI B;  1BCC H;  5FPR A;  1YJN V;  4I0X B;  5B5E Z;  3MHS C;  4P2Z A;  3OMA B;  5KUM A;  4X65 O;  2YDE A;  1P49 A;  4OXS A;  2W6I G;  2PZS A;  2YC0 A;  1WAZ A;  2EIK C;  4JF3 A;  1NH2 B;  3I5D A;  4DV5 O;  1KQS U;  1R6T A;  4J7J A;  3OFN G;  3H1H H;  3SYC A;  5B1N A;  1F51 A;  2ZNJ A;  5L3E A;  2BOB C;  1RSO B;  3TET A;  3H01 A;  2DE0 X;  3B40 A;  2ODM A;  5KAI Z;  5KHG A;  4PV1 B;  4BIU A;  4NR1 A;  2LW1 A;  4DUZ B;  4ZKI A;  2ZKO A;  3FYE B;  4OGQ B;  4I9Q A;  3ZIA G;  5K1P A;  1OJH A;  3FAV A;  5BXZ A;  2EIJ B;  4FM0 A;  1Y76 A;  2OIE A;  4K0K O;  2IU3 A;  2G38 A;  1OHH G;  2QR4 A;  3N2G B;  1J5E O;  1VQM V;  4J11 A;  1BGY H;  4JYC A;  2DJV A;  1M56 B;  4N23 A;  2CE4 A;  3UT5 A;  5GON A;  5LXT A;  3ZHR A;  3CRC A;  4I50 B;  3RWR D;  4KL1 A;  4DV2 O;  4AI8 A;  3ABK B;  1M90 W;  1MZF A;  2JVD A;  1KMI Z;  1VP7 A;  4MVO A;  2BOC C;  1WN7 A;  4CH4 A;  3E89 A;  1H2K A;  3RBZ A;  2DYS B;  2BTQ A;  1HNW B;  4JI6 O;  2EZO A;  2QA4 V;  5LL6 Y;  1EZJ A;  3WB0 A;  5B1A C;  2ADQ B;  1RM1 C;  1OCZ B;  3FAV B;  1Q3E A;  1S76 D;  1HR0 O;  5L3B A;  3K08 A;  4FLT A;  3MDS A;  1NTZ H;  1ZL8 A;  2QDO A;  3JAT A;  4CS4 A;  4UVA A;  1IBL O;  4RWU A;  5GON B;  5LXT B;  4C7U A;  2UXC B;  1JPX A;  1NU1 H;  4DR7 B;  2E76 B;  1XNQ O;  3N27 A;  3E22 A;  4KHP O;  1G6U A;  4MTF A;  2YXL A;  2EIK B;  1YTF B;  1R6N A;  1TA8 A;  3HR0 A;  2CAZ C;  4WBN A;  3OUS A;  2BTQ B;  2XTA A;  1QHT A;  4RAI A;  1AR5 A;  4YXW G;  1JCH A;  3RVY A;  2HFE C;  4UVC A;  3CCU V;  1IBM B;  3L74 H;  5F2V O;  2HJF C;  3VBB A;  3G80 A;  1SQX H;  3CCQ V;  1RPO A;  1XMO O;  2UXB O;  1W0K G;  1F4N A;  3WB1 A;  2B5U A;  2WLL B;  2NNU A;  3QF7 A;  2VQF O;  1ZL8 B;  3JAT B;  4X9Q A;  3TK1 A;  3AK1 A;  1R3K C;  1YIJ V;  1RFY A;  3E8F A;  2OIG A;  2N05 A;  3APQ A;  3OEE G;  5JWP A;  3SR2 C;  3QVN A;  3B77 A;  4JI2 B;  5LHH A;  2ETN A;  3LDD A;  3E22 B;  4GZR B;  1PL4 A;  3K59 A;  4LF7 O;  4LF4 O;  1IXM A;  5C8Y A;  3CRR A;  1YEW A;  2QM4 A;  3CSX A;  2A3Q A;  3CRM A;  5KLV H;  4B3S O;  4BAY A;  5BZB A;  3UO2 A;  5D5P A;  4I9W A;  1FAF A;  3J7A U;  2WA3 A;  2F1M A;  4YHH B;  4Z1V A;  1K33 A;  3HKB B;  4ZHQ A;  2Q9L A;  1PL0 A;  4X65 B;  2B9Z A;  1G1X B;  1MOF A;  2JGD A;  1NS1 A;  3BRC A;  1L0N H;  2Q0O C;  1E1Q G;  4DV5 B;  1AJP A;  1RM1 B;  1VQK V;  3FKS G;  3S3W A;  2F23 A;  4B3R O;  3HKC B;  4UXN A;  4DR3 B;  2Q0A A;  1ENV A;  4FLW A;  4DV3 O;  5LA6 A;  3JD1 A;  3DC5 A;  4XDL A;  5JH7 B;  3LUT B;  5FL7 G;  4JI0 O;  2C2A A;  4UB6 Z;  4UV8 A;  2UXX A;  3ZHV A;  4U7N A;  4FZ0 A;  2ITD C;  1SQB H;  3ZRW A;  4TV9 A;  1MNG A;  4G28 B;  5C93 A;  3LDC A;  2A0L A;  1RPR A;  2AW9 A;  1SQV H;  3SJB C;  4TQF A;  3SYQ A;  4K0K B;  4JI7 B;  2Y48 A;  1K3E A;  2ZE8 A;  4K3A A;  3A0R A;  1J5E B;  2FKX A;  5CBG A;  2WA4 A;  5CB4 A;  4AQY O;  5EZY A;  3CME V;  1M57 C;  3ABL B;  3ZRV A;  1FXK A;  5LA6 B;  2Q7H A;  3VQW A;  3CD6 V;  3JSN A;  4WFH A;  2GTA A;  3FYI B;  1SKV A;  3JSL A;  2RQ6 A;  1B04 A;  5LOV A;  2Q5Z A;  2Q68 A;  1K73 W;  2KB1 A;  4LF6 O;  3ZRW B;  4QPJ A;  3QO7 A;  3RYC A;  3CCR V;  3GWO A;  1IVS A;  3CRQ A;  4LF8 B;  2N04 A;  4MS2 A;  4FK5 C;  2DWD C;  4FJC C;  1QVG U;  2ZIN A;  1H2M A;  1JMK C; 
#chains in the Genus database with same CATH homology
 4DR3 O;  4LF5 O;  4NXM O;  1HNX O;  1KUQ A;  1G1X B;  1A32 A;  4YHH O;  1N36 O;  1YZB A;  1XNR O;  4DR7 O;  1I94 O;  2N74 A;  2UUC O;  1IBK O;  1NS1 A;  1HR0 O;  4B3T O;  4X65 O;  4X62 O;  4B3R O;  3OTO O;  4DV7 O;  2JRI A;  1F7Y A;  1IBL O;  4DV3 O;  4GKJ O;  5BR8 O;  4OPA A;  5LMU O;  4DV5 O;  1R6T A;  4A5U B;  1XNQ O;  2UU9 O;  4KHP O;  3JAM N;  1AB3 A;  1R1B A;  2ZM6 O;  4JI0 O;  2F4V O;  2UXC O;  2DOS A;  1N34 O;  4LFB O;  3SDL A;  4JI7 O;  2Z0A A;  4DV0 O;  4LF9 O;  4OPH A;  3T1Y O;  1N33 O;  4X66 O;  4B3M O;  2ZKO A;  4GKK O;  1FYJ A;  4OX9 O;  4DV6 O;  1XMQ O;  4DUZ O;  4DR2 O;  1XMO O;  2UXB O;  2VQE O;  5BY1 A;  4DR4 O;  2FKX A;  1IBM O;  4JYA O;  5BXZ A;  4JI3 O;  2LW7 A;  2AGA A;  2VQF O;  1HNZ O;  1D2D A;  2UXD O;  5H5N A;  4AQY O;  2UUA O;  1DK1 A;  4K0K O;  4JV5 O;  5IT9 N;  1J5E O;  4NXN O;  1XEQ A;  4DR5 O;  4YY3 O;  5FLX N;  1FKA O;  2DJV A;  4DR1 O;  4LF8 O;  4X64 O;  1HNW O;  3F5T A;  4LF7 O;  3RT3 C;  4DV2 O;  4LF4 O;  1AIL A;  4DUY O;  3O65 A;  5LMN O;  4DV4 O;  4JI2 O;  4JI5 O;  2UUB O;  4LF6 O;  3R66 A;  3J81 N;  1FJG O;  3T1H O;  4JI8 O;  4B3S O;  4DV1 O;  3M8A A;  4LFA O;  2HHH O;  1N32 O;  1X59 A;  4JI6 O;  3J80 N;  3J7A U;  4DR6 O;  5IWA O;  4JI1 O;  2E5L O;  4LFC O;  5LL6 Y;  5A2Q N;  4JI4 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...