4DV3O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv3O00
4B3RO 1N32O 4DR1O 4LF6O 4JI7O 1F7YA 4OPAA 2UXBO 4OPHA 4B3MO 4YHHO 1HR0O 5FLXN 4JI4O 3F5TA 2FKXA 1N33O 5IWAO 1YZBA 4DR2O 5LMNO 1N34O 4NXMO 1R6TA 4B3TO 4DV7O 1DK1A 1AILA 2N74A 2UUBO 4X62O 5BXZA 1IBLO 4GKJO 4X66O 4JI3O 2LW7A 4JI2O 4LF9O 3RT3C 3M8AA 4JI1O 4DR4O 1XMOO 2UUCO 3J80N 4GKKO 4NXNO 4JI8O 4X65O 5A2QN 2ZM6O 4JV5O 1AB3A 4OX9O 1XNRO 4LF7O 2F4VO 3J7AU 1I94O 3O65A 1HNXO 1XEQA 4YY3O 4K0KO 2UXCO 1N36O 1HNZO 4DV6O 4LF8O 4X64O 3J81N 4DV5O 4DR5O 4JI0O 1IBMO 2UU9O 5BR8O 2DOSA 1G1XB 3JAMN 3T1HO 4DUYO 4DV2O 2ZKOA 4DR6O 4LF4O 4LFAO 3SDLA 4DV3O 4DR7O 5IT9N 1D2DA 5H5NA 1J5EO 5BY1A 1FKAO 3T1YO 1KUQA 1HNWO 2AGAA 2UXDO 4KHPO 1FYJA 4A5UB 2JRIA 1A32A 4LF5O 2VQFO 4DV4O 2E5LO 2DJVA 3R66A 1X59A 5LL6Y 4JI6O 5LMUO 2VQEO 1XMQO 4DUZO 4DR3O 4DV0O 4B3SO 4JI5O 4LFCO 1XNQO 4DV1O 2Z0AA 2UUAO 1IBKO 4JYAO 1FJGO 4LFBO 4AQYO 1R1BA 1NS1A 3OTOO 2HHHO
chains in the Genus database with same CATH superfamily
1Y66A 2YEVA 1IBKB 4TV9B 2FKXA 2JJ1G 1VQ8V 1EN4A 2QWNB 2QWRB 1AJPA 1Q43A 1LR1A 3UQ8A 1BHAA 2YI9A 4GLXA 1RM1C 1H2GA 1TUBB 1OCOB 3K08A 4CH3A 2PI4A 1ROPA 1N4CA 2Q7HA 3ZCCA 4PI0A 1QR8A 3WB0A 3GVMA 2CDYA 4JASA 4L8JA 2FMLA 4X65O 5A2QN 3VQXA 2P7TC 4UV9A 4OX9O 4DUYB 4UCOA 3T4ZA 1Q5OA 1THZA 3AG3B 2A06H 3CCEV 3M7MX 3CYOA 5L3CA 5FPOA 1IXBA 3EXAA 1KYOF 1HNXB 2VQEB 3L73H 3QO8A 1GO3F 1SQFA 2NNUA 5KHHA 4R6ZA 5IJ0B 2GTSA 1AR1B 1KUQA 1HNWO 3DC6A 3RWRD 4D7SA 1IXMA 3ZRWA 3DSQA 2ZIMA 4WFHA 4YJ3A 4UB8Z 4H37A 3C90A 4X1IB 4LF5O 3E89A 4CZZA 2E5LO 5LA6A 5LL6Y 3CCJV 2F1MA 1FXVA 1L8DA 5GTHZ 1XNQO 4DV1O 4O2BB 4B08A 1QQCA 3CB2A 2WWWA 4MW3A 2EIMC 2XAFA 5JWPA 1Q7YW 3ASOC 2EINB 4DR1B 3ZHRA 1BS3A 1NS1A 2LQTA 3AG7A 5IDJA 2KG7A 4FFBA 3GB7C 3AK1A 4J80A 4HZ3A 1Q82W 3WG7C 2W6JG 2CGNA 2ZCEA 4DW0A 5IY5C 5JH7A 3F5TA 2F43G 2N05A 4ZI7A 2CTWA 4ZOLB 3SJBC 1RPRA 1R6TA 1RP3B 3BFRA 4UXNA 3CC4V 1GMGA 2JS3A 3CEIA 3W7SA 4X66O 2JDIG 3RYHA 2EIKC 1XHXA 2NN4A 2BTQA 2KKWA 4I0XB 3UO2A 4NXNO 1H2NA 2Q0AA 2HHHB 4DV2B 3E83A 5EBWC 1O9HA 1IBMB 3RYIA 4UCUA 4WFBV 4YY3O 1N36B 1W59A 2Q6AA 4ZIBA 2BCCH 1N36O 2XOKG 1VARA 4JI5B 2KG7B 4NR1A 2DOSA 2E5LB 4CH6A 4DV2O 4DR6O 1UPGA 5IYBO 3ZX6A 2YI8A 4X1KA 2HR3A 3OFNG 4YXWG 4J10A 2YIDA 4X66B 4NB5A 3CSXA 4J7ZA 1JJOA 3BAAA 3ETGA 2RQ6A 5EBLC 5LGUA 3VBBA 2M6YA 3A0HZ 2WAMA 5CBHA 2GTAA 4X20A 4WCEV 1G4YB 2AW9A 2YIBD 2ETNA 3D3IA 3OAAG 5KMGB 3BHPA 4DR1O 4OPHA 4PA6A 3AK3A 2DWDC 1PNMA 1S5JA 3LDEA 2F23A 3U11A 3OM3B 2VWKA 1I7FA 1KBHA 5GONA 4BIUA 1IX9A 2PY5A 2IW5A 3K9SA 3K5NA 3ZMZA 4KFMA 4LF5B 1N33B 4Z1MG 4NYKA 2QJ1A 4O4JB 5JJJB 2UXBB 1H2SB 4DR4O 4C7UA 3NR7A 3UCSC 1Z2GA 4JPRA 5EC1C 2OYQA 3ZEDA 4CS4A 4PDLA 5CA1A 2DMXA 1ZLZA 4IHJB 4JZ2A 1HP8A 3STLC 4LP8A 2RDCA 1U97A 3GWKC 1W2BU 4TV8B 4BAYA 4LF8O 4IHJA 1RPOA 1SESA 4LWSA 5IYCO 1H38A 4X1YB 4DUYO 3OUSA 4DV3O 1N0JA 1W0JG 2Q7EA 4FLXA 3CCVV 1J5EO 5BY1A 5F2VO 5L3GA 2DN9A 1B3QA 3CRMA 4LF4B 1WB8A 3CPWU 1QHTA 4PHZA 1KKDA 3H01A 5LMUO 4LFCO 1O9GA 1ZX3A 5KLVH 3JD2A 2GV9A 1IBKO 3G71V 5LYJB 2EULA 1S3JA 4D6TH 3HKCB 5KUMA 2A7WA 1IURA 3ZS8C 3G67A 3JARA 1YTFD 3JSNA 5L3BA 4R7CA 4X1YA 2ZINA 2R9AA 3LDCA 1BZKA 4X20B 1SQXH 1Y74B 4JI4O 1PV0A 5JVDB 5IYZB 5IWAO 1YZBA 4LFCB 4CC5A 1EN6A 2EJRA 3CE2A 2LW1A 3ZBHA 3CCSV 5FPRA 4MVRA 2Q69A 4F6RA 1K3EA 3CRAA 2P5OA 5IE9A 4D7TA 5KA6A 2HVJC 2DWEC 2WLIB 2MW2B 1PPJH 3EFFK 1XL4A 4W4KA 3U0ZA 2YSUB 3J80N 2Q0OC 4DV3B 3CRQA 1FS0G 2BTOA 1NTKH 3P3PA 3EHBB 5KUKA 4QJFB 3OW2U 4LF8B 3ABLC 5E79Z 2CE4A 3ZIAG 2ZQMA 1E79G 2JEUA 4K0KO 2IJIA 3AEIA 2LGQA 5CN0A 3E8HA 2XNDG 1NH2B 4NVPA 3SDLA 1V54B 1M56C 2EIJB 4TQFA 1K73W 4TV9A 4DR4B 5IY5B 1PM9A 2AGAA 3L74H 4I4TB 3FYIB 4LCUC 3CC7V 2NLJC 1M56B 2EIJC 3CS5A 2BE3A 4TT3G 3SPIA 3R66A 5GTIZ 4KUMA 1QCEA 5B5EZ 4B3SO 1SQVH 5AG2A 2XTAA 2QKCA 2ZNJA 1P7BA 2WLLA 1FJGO 4I0XA 2OIEA 1KC8W 2QTSA 3JAKB 2BOBC 4O2AB 1ZSPA 1BCCH 3OD4A 4H33A 4KL1A 2ZR2A 4FVMA 2X6AA 1K97A 2JGUA 4K3AA 5B66Z 4UVCA 2ZE8A 4O4LA 4I9QA 3VQVA 4MTGA 1R3KC 1NT2B 2HJFC 4DO2A 4WBNB 4JI6B 1VQPV 1Y76A 4WF9V 4NTYA 2HFEC 1DK1A 1WLEA 2N74A 4BR6A 1EFRG 1D5AA 3JATA 2PGGA 4EB6A 3JAWB 2IH1C 4JI2O 4ZKIA 3RT3C 3M8AA 4JI1O 3I5DA 4B7KA 3CX5F 1XMOO 5KHIA 4LNUB 1FFXA 4HNAA 3THOA 4O2BA 1KB9F 1YTFB 1K4CC 4XDLA 2WLIA 3F7VC 3ZJZA 1TVKA 4KP4A 2UUAB 2A3QA 4J9YB 4FM2A 4YY3B 4PI2A 4DV6O 1KMIZ 3ABMC 1IBMO 5CA0A 3K5OA 4FLTA 3CXHF 1KECA 3T1HO 2PZSA 5LP6B 1VP7A 4PDVA 3K0GA 4NXNB 1Y74A 5EZYB 2LO1A 4I9WA 1NQTA 2UUCB 1QVFU 3OMIB 4PA9A 4JAAA 2B5UA 4FPPA 4TUYB 3W7XA 4TOIA 1OV9A 1ORQC 1YEWA 3RW0A 3BABA 1SQBH 1FPOA 2BTQB 1PD3A 5D5PA 2CH7B 5CB4A 1F51A 2ZDIA 1XNRB 4CH5A 1RM1B 5LOVA 2GBOA 4G27B 4ASUG 2ITDC 3CCUV 2QSAA 3RVYA 3AG4B 1F7YA 3JCUZ 1LUWA 5K1PA 2H94A 3K0DA 2Y0IA 5EYPA 3DGEA 4EFBA 1XNQB 1GH6A 1OCZC 1N34B 3C3TA 2XAGA 3CP1A 2B1GA 3RYHB 4AHCA 2IM9A 4JYYA 4DRXA 3LDDA 1NTMH 3W7UA 2P4KA 1KU9A 1HNWB 1URFA 3CCQV 3QVNA 1NVPB 4JYCA 1H2KA 2OIGA 1SRYA 4X1IA 3AG4C 3HR0A 1HNXO 1QLNA 4JYBA 3WB1A 2NR5A 4RQFA 1R6KA 1NBMG 1YI2V 3E86A 2Q7GA 4FMTA 4X64O 2JIZG 2F66C 4LF7B 3JAMN 2ZKOA 4U7NA 2HEPA 4X65B 5ITZA 1MA1A 2Y4TA 1KKCA 2FTKA 2UXDB 2XASA 2JJ2G 1E1RG 4UVAA 2KSDA 1SERA 5KHGA 2VWJA 3ETEA 1FYJA 3JD3A 2UUBB 4A5UB 5GW7A 2XUMA 1T5EA 5FL7G 3B8MA 4DUZO 5IJ9B 4DR3O 4DV0O 3IC9A 1VQMV 2GUZB 2OCHA 1VQ4V 2UXXA 2GDSA 5DM6V 4LFBO 4DK0A 3SYAA 1GKFA 1I94B 2GUZA 3NXSA 3E8BA 3ABMB 2ZM6B 4ZI7B 2FYUH 4PA7A 2HP8A 2Y69C 4AQYB 1WP8A 4JI7O 1JMKC 2W6IG 1HWYA 1VQ9V 4TUYA 2EIKB 4YHHO 3CXCU 1GM9A 5J2TA 1PP9H 1WB7A 2R70A 3E35A 1CP9A 4DR2O 3ZRXA 3KKYA 5KHKA 2B1IA 1VQNV 1Q86W 1QBZA 3LNMB 2X7RB 3HPLC 3OMAB 1CPYA 1WPBA 1GN6A 1YHQV 3G6EV 2CAZC 3ABTA 3LNNA 4PD4F 1NH2D 4JV5O 4P9OA 4BIZA 4U3FH 2AXTZ 3J7AU 5BR8B 4MTFA 3ZMUA 2PI5A 2R72A 3MHSC 1IZ3A 4ZHQB 1YXBA 4JTCB 3IC7A 3X2QB 2L35A 4DR5O 3KCXA 2K9PA 2QM4A 5B3SB 4DV4B 2ZDIC 4XDKA 1D2DA 4WBNA 2KQXA 2IU3A 3L75H 4UCRA 3L71H 2P6JA 2HJDA 3PJSK 3ZRVA 2CTPA 3ZHSA 2RCVA 2V1DA 3A0BZ 3FYEB 1M57B 1XBLA 3QF7A 1YJ9V 5H2FZ 4MW8A 2VQFO 4B3TB 3RN4A 1R6NA 4EFEA 2WLKA 2ZIOA 4DV5B 3FB6C 3JSLA 2DYSC 2C2AA 4F6EA 1HR0B 4B3MB 2QR4A 1DF5A 1DLBA 1GM8A 2OTJV 1JJ2U 2YUAA 4LF6B 1XOUA 1LNQA 3ZRWB 4TWKA 1S5LZ 2KB1A 1I0HA 3ZHTA 4B7EA 3JD0A 4OPAA 3S3XA 3K59A 5L3EA 3ZHVA 1IBLB 1MNGA 1KP2A 5C8YB 3S3WA 2LJ2A 5IJ9A 5LMNO 5B1AB 3W7WA 1FAFA 5CA0B 3APOA 1GN2A 3CRCA 1FD9A 1YJWV 3AK2A 4YIOA 3SJQC 3M99B 3HKDB 5KMGA 3D36A 1V9PA 2ZD9A 3AG1C 3N2GB 1OCRC 4GX2A 5FNVA 2CTRA 3AG2C 1NR7A 5GONB 1M93A 1F23A 3U10A 2UXCO 1H8HG 3JCZA 3EVKA 3Q4HB 2E3CA 2EBOA 4PA3A 2UU9O 3FB5C 4PDMA 4JF3A 2GHYA 2F4VB 3ZHQA 2XAHA 3ZMVA 3CHXA 4RWUA 1ZTEA 1PL0A 4JTAB 3D8CA 4O4LB 3WB2A 1FFXB 3BA8A 2JVDA 5EC2C 4GKJB 2AHZA 1OCOC 4FFKA 4FZ0A 1DTOA 2WSSG 1Q8IA 4BIOA 2BSKB 3T2MA 1N8RW 2DJVA 1L0LH 1Y6XA 5JCOA 3HKDA 3K57A 2Z0AA 2Z3YA 3PN1A 1G6UA 3KCYA 4N23A 4MT8A 1Z5WA 4ICGA 5LGNA 1AI4A 4MVZA 2FL4A 5E1AC 4UV8A 4X88A 2YS8A 4CH4A 1OZ0A 1KD1W 2Y4UA 2G38A 1JQ0A 1AP6A 1V54C 3TJTA 4B3RO 1P4RA 1MMMA 4MVSA 3G6BA 1Y67A 3E2EA 1Y4MA 1WA8B 2ZE7A 1TAEA 1YIJV 2O57A 3SJCC 5FLXN 4MVUA 1Q3EA 2A9HA 4MSWC 2QTOA 4J41A 3SGIA 2QWPB 1FFTB 3SYQA 4CS3A 1VQ5V 3H1HH 1I5YA 3QTCA 4NXMO 2EJ7A 3CWBH 5LBQA 2Q8VA 4Z2WA 3HKBA 4QPKA 5JJNB 3SJAC 5BXZA 1Q6HA 2CK3G 2BSKA 4LR3A 4GKKO 2CUGA 4O4HB 5L3FA 3TXQA 1JOYA 4JI0B 1AR5A 5CBFA 3RFRA 3ABKC 3ETDA 1HNZO 1FXKB 4DV5O 5JJEB 3FX7A 3AG3C 1HW7A 3X2QC 1K8AW 5B1NA 4O4IA 4LFAO 2R9IA 2Y69B 3B4SA 4JI8B 5IT9N 4OGQB 3H1LH 1GTOA 1ZUQA 3FFQA 3BPZA 3TK1A 4KHPO 4X62B 2Q4PA 3AG1B 1B6QA 3OR6C 4QE7A 3P32A 3IAYA 4DR5B 1VQKV 1SZTA 2EZOA 2HG5C 3OUFA 4WFAV 5ITZB 5B3SC 4TSFG 1J95A 2RMKB 4X1KB 1XHZA 1DGSA 1E1QG 4DK1A 4JV5B 3LSQA 3MHHC 3H1IH 4IYHA 5J2UB 4X9QA 3OTOO 1PKXA 1F4MA 2IU0A 1M90W 2Q68A 1FXKA 5B1BC 2E75B 2WLMA 4GCZA 1TUBA 3QNEA 4QPJA 2LP7A 3AG2B 2V4DA 1WAZA 4JYAB 4OXSA 2IH3C 3WFVA 4I7ZB 4UCTA 1F4NA 1G8MA 3OE7G 5BMVB 1I5XA 4EEQA 4ZHQA 2ZXWB 2D3OW 1P49A 4TV8A 4MVOA 4U3JA 4YHHB 4RQEA 1LUVA 4JI3O 1SETA 3HKBB 5B1OA 4UB6Z 3JATB 1S5HC 2YIAA 3T4DA 2P90A 4CS2A 1QNMA 1MG1A 2DW4A 3RYCA 1I94O 1BE3H 1QVGU 4LFBB 2QWQB 2ZE6A 4GZRB 4PJ0Z 4XDJA 2W0FC 1PNKA 1WNSA 2MK3A 3CCLV 4DV0B 4DR3B 4CBCA 1COWG 3OGIB 4X89A 1M5IA 1NTZH 4DRXB 4FLYA 1BMFG 2A0LA 4O2AA 4UVBA 3T1YO 4H44B 2ARHA 2ADQB 4LF9B 2WA4A 4JI3B 1TA8A 1K92A 3MAQA 1NR1A 3STZC 3K03A 4DV7B 1EBOA 3TXSA 5A9GA 1SA0A 4JTDB 3A2FA 3TETA 3N2KB 4W4LA 4X64B 1VF6A 2V7QG 1JR9A 1ENVA 4I55B 5BZBA 4JYAO 2ZE5A 1YVWA 1K5QA 1YCIA 2RNBA 4EKWA 4WFEA 5JQGB 3VOUA 3UT5A 1N32O 4FK5C 1GAXA 1VQOV 2X6BA 2CGOA 5HFLA 3RBZA 1EN5A 4HNAB 3CCRV 3H9VA 4I5SA 2Z5UA 2CH7A 2WA3A 5CB4B 1MZEA 1AVMA 3RYFB 3P30A 4X62O 1DF4A 4KHPB 3SPCA 1MOFA 2EILC 2LW7A 3I56V 2EIMB 5H6RA 5LXTA 2IJKA 2JGDA 1I08A 2WPDG 2YEVB 2E74B 3OEEG 2PTMA 1AI5A 3D3QA 4YJ2B 1VMGA 1KQSU 4FZ1A 3B2EE 2PYLA 1BT8A 3MD0A 1PNLA 3FKSG 2P67A 1YITV 4DR7O 1SF9A 1SQGA 5H5NA 5DECA 1IDSA 2OWOA 1ZL8A 4X8AA 2ZR3A 4LH7A 4R8CA 5L3DA 1B06A 1R3IC 1BSMA 5KA5A 3JYCA 4I4TA 4UCVA 2YC0A 1WJZA 1R3LC 2OCCB 5LGTA 3K5LA 3LSSA 5D5QA 4DV6B 1JFFA 5BMVA 3E8FA 3CMAV 2P22C 2UXCB 1L0NH 2RJZA 4ZOLA 4ABMA 2XHBA 3UO3A 3ZHUA 2PYJA 3ZMSA 5KAIZ 4FM1A 4B3RB 4Q6GA 4O4JA 3W7TA 3K58A 2Q9LA 4YJ3B 3Q4HA 5B1AC 4JI1B 4JAUA 4E2LA 3BRCA 4Z1VA 4JI2B 4K35A 1W0KG 3WG7B 5LOVB 4R50A 1AJQA 5LP6A 5IJ0A 3JD1A 2JEXA 1IVSA 1OHHG 3ZN1A 2K1EA 4LH6A 1GK9A 5EIBC 2EX3A 2CTQA 2N04A 3SYOA 3ZN0A 1K9MW 4J7KA 1VQLV 1IBLO 3HKCA 4GT1A 4JGSA 2L6LA 3BA9A 3OMNB 2F95B 1M9NA 4DR7B 1JFFB 2XT9A 5LHIA 2F4VO 1R3JC 1FJGB 1XEQA 3ZMTA 3BEHA 2OT5A 3JASB 1Y76B 3F7YC 1VQ7V 4B3SB 1US6A 2XAQA 1ZL8B 1CEZA 3K79A 2VQFB 2JS5A 1TVKB 1BGYH 1Q90D 4KXRA 2M7WA 4IL6Z 1FKAO 1V55B 3CMEV 3GWOA 3B09A 3IJ4A 2QM8A 4LNUA 3APQA 5EIBD 3SPGA 4DV4O 1BHBA 2HLDG 1X59A 4EB6B 2ITCC 1SZXA 4RUFA 4DYLA 4MTXA 3CRRA 1WPXA 1WP7A 1VF6C 4DXWA 1K4DC 4H0LB 5TISZ 1H2MA 1N32B 2DQ0A 1YDXA 1FXHA 1MSWD 5H6QA 1K5SA 3FD9A 3SPJA 4LF6O 2IJJA 3RVZA 1NJIW 1HR0O 2DYRB 3TGUH 3CJHB 4HYOA 5HFMA 1M57C 4QNHB 4J7JA 2DQ3A 1MSDA 3WU2Z 1WN7A 2EINC 2IBZH 1OJHA 1QLEB 1HDJA 3H1KH 2WLLB 4DV7O 3JD4A 3T1CA 5IWAB 1YF2A 1EZJA 3CD6V 4BWAA 1BQ0A 4P9PA 4LF9O 1NKDA 3T1YB 3ASNB 2EILB 1BQZA 3RGBA 1XUQA 5C93A 2QA4V 5CMUA 2ZM6O 1XILA 4TQDA 1S76D 3ASOB 4Q20A 2Q5ZA 3O65A 4PELA 1XQ8A 1VIBA 2R9RB 4F6RB 4H13B 1L1FA 3J81N 4PA4A 4K8ZA 4J9ZB 5LMUB 4G28B 3DXRB 3B8NA 3L70H 5K1XA 3QO7A 4LF4O 1XREA 1SQQH 3ICXA 5DEDA 1D5NA 3JALA 4QIWF 1JVMA 3OGCC 2LGWA 2UXDO 2X0LA 3F5WC 4RUEA 1A32A 3ZRSA 4G2KA 1AI6A 1QU7A 1YSCA 3BY6A 3ABUA 1GN3A 4ZBMA 4AI8A 4DR2B 1P7GA 4UUJC 4P30A 4GYCB 1XDCA 3ETQA 2DYRC 1TUEB 3D36C 1QR9A 1WA8A 4J42A 1S72V 5DN6G 4AQYO 2YXLA 4U3JB 1R1BA 4MVQA 3OTOB 4FLWA 2UXBO 3L9DA 3QO5A 4FIPC 3UT5B 1K33A 1N33O 2H8PC 1RFYA 1NVPD 4DUZB 1SKVA 3IGAC 3VQYA 1N34O 5B1BB 2UUBO 3OEHG 2YXYA 4XBFA 1OCCB 1Z5VA 1Q81W 1OCZB 3IFXA 2PUSA 3SPHA 1CXZB 4BW9A 4E4EA 2JK5C 2EZPA 4JI8O 4LFAB 4NTXA 1M1KW 5KX5A 2Y48A 4LBEC 3BVOA 4N21A 5EYPB 4LF7O 1XNRO 2ILMA 4IGGA 5LYJA 2HKOA 4JAVA 3CCMV 1HNZB 1GM7A 1ZWIC 1JPXA 5J2UA 3FB8C 2QWOB 1KP3A 3P3NA 4QGPA 1AI7A 4JI0O 5KAFZ 1RSOB 5KHJA 1G1XB 4FM0A 4YJ2A 2W0XA 5LP6C 4GKKB 2Q67A 1H2LA 3E22A 4CC6A 1MABG 1SC5B 1X4TA 2LFRA 4HBNA 1OCCC 4WFGA 2A79B 4RO2A 5JQGA 2ZNIA 1M4UA 3B40A 1K34A 4DR6B 2QGNA 2AZ2A 3T1HB 4NXMB 2RN9A 4JI5O 4O4HA 5FNVB 2UUAO 2YICA 3B77A 3N2KA 3K04A 5EZYA 2ADPA 1SA0B 1XI1A 3OR7C 1AJNA 4MVMA 3HB3B 2HHHO 2YDEA 1GRJA 1XL6A 4IIJA 2ODMA 3R65A 2UXNA 3E22B 1NU1H 3RYFA 1JCHA 1NZ6A 5J9PC 1S77D 5CA3A 2OTLV 4I55A 3QG5A 1AILA 3L72H 1VF7A 2PF4E 1TGOA 3DTUB 2ZXWC 1JX9A 3N2GA 3K9AA 4GKJO 2YIBA 1R73A 2QEXV 2ZT9B 4AILC 3JARB 3ML0A 5LA6B 2UUCO 3G4SV 3SYCA 1AB3A 4P2ZA 2QE7G 4UCSA 4K8XA 2UU9B 3I55V 1SQPH 5JVDA 4NTWA 5C8YA 2B9ZA 3LUTB 1U96A 4JZGA 4DV1B 3FAVB 2X6CA 4LC1A 4MTOA 4I50A 3CC2V 3O9OA 1H8EG 4HAMA 2P06A 1N0NA 5JH7B 1AR4A 2QM7A 1XMOB 1PL4A 2WLNA 2OCCC 3KG2A 4PV1B 3LSUA 3KZIZ 4GX1A 5IYDO 1JA8A 4L87A 2IJHA 4FFBB 4WFFA 3K06A 3OT7A 1EZVH 1B04A 2Q73A 3OTFA 4JI6O 1EM1A 2VQEO 5LMNB 1SS3A 2LFSA 3UKMA 3JAKA 2H3OA 2QKAA 4FLVA 1FXKC 5J2TB 1S0VA 4YIPA 3A8TA 1Q6UA 3RYIB 2JGDB 3G80A 1UJWB 4OX9B 5H9CA 3K3WA 2E76B 3HKEB 2WLHA 1OCRB 3C3SA 2HVKC 3UM7A 3BCCH 4U7OA 4LWSB 3JASA 2VRZA 1MZFA 4MS2A 4B3MO 1ZAUA 1VEWA 3JALB 4FLUA 5CA1B 1GN4A 4FJCC 4J11A 3FB7C 4IIJB 3A0RA 4GX0A 4B3TO 2QKSA 1BL8A 5LXTB 1Q6IA 4IYIA 2AHYA 3HKEA 2XAJA 4FLZA 3H1JH 4QE9A 3MDSA 3DC5A 1AROP 2DYSB 3K5MA 5EK0A 4GUNA 2YXHA 5IYZA 3SR2C 5JCOC 1K7DA 2P4VA 2AZ0A 2WLJA 3ABKB 3DXRA 1VQ6V 4K0KB 4F4LA 4UFZA 1NI8A 3N27A 4DW1A 1V55C 1XMQB 3ASNC 5BR8O 1AP5A 5CBGA 3E8GA 2D2CB 3TCUA 2F93B 5LHGA 3CJHA 4I50B 1YJNV 4PDRA 1VF5B 3FAVA 1QLEC 1RSOA 1J5EB 2VS0A 1P84F 1UFIA 2JRIA 2FB5A 4O4IB 3JAWA 4GX5A 4BW5A 2ATKC 1XMQO 2Y0PA 4RAIA 2GSMB 2DE0X 4NKGB 5LHHA 5KX5B 3ABLB 4JI4B 3RYCB 2QDOA 4JI7B 3SYPA 3VQWA 5EBMC 4IT5A 2BOCC
chains in the Genus database with same CATH topology
4B3RO 1N32O 4DR1O 4LF6O 4JI7O 1F7YA 4OPAA 2UXBO 4OPHA 4B3MO 4YHHO 1HR0O 5FLXN 4JI4O 3F5TA 2FKXA 1N33O 5IWAO 1YZBA 4DR2O 5LMNO 1N34O 4NXMO 1R6TA 4B3TO 4DV7O 1DK1A 1AILA 2N74A 2UUBO 4X62O 5BXZA 1IBLO 4GKJO 4X66O 4JI3O 2LW7A 4JI2O 4LF9O 3RT3C 3M8AA 4JI1O 4DR4O 1XMOO 2UUCO 3J80N 4GKKO 4NXNO 4JI8O 4X65O 5A2QN 2ZM6O 4JV5O 1AB3A 4OX9O 1XNRO 4LF7O 2F4VO 3J7AU 1I94O 3O65A 1HNXO 1XEQA 4YY3O 4K0KO 2UXCO 1N36O 1HNZO 4DV6O 4LF8O 4X64O 3J81N 4DV5O 4DR5O 4JI0O 1IBMO 2UU9O 5BR8O 2DOSA 1G1XB 3JAMN 3T1HO 4DUYO 4DV2O 2ZKOA 4DR6O 4LF4O 4LFAO 3SDLA 4DV3O 4DR7O 5IT9N 1D2DA 5H5NA 1J5EO 5BY1A 1FKAO 3T1YO 1KUQA 1HNWO 2AGAA 2UXDO 4KHPO 1FYJA 4A5UB 2JRIA 1A32A 4LF5O 2VQFO 4DV4O 2E5LO 2DJVA 3R66A 1X59A 5LL6Y 4JI6O 5LMUO 2VQEO 1XMQO 4DUZO 4DR3O 4DV0O 4B3SO 4JI5O 4LFCO 1XNQO 4DV1O 2Z0AA 2UUAO 1IBKO 4JYAO 1FJGO 4LFBO 4AQYO 1R1BA 1NS1A 3OTOO 2HHHO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R O;  1N32 O;  4DR1 O;  4LF6 O;  4JI7 O;  1F7Y A;  4OPA A;  2UXB O;  4OPH A;  4B3M O;  4YHH O;  1HR0 O;  5FLX N;  4JI4 O;  3F5T A;  2FKX A;  1N33 O;  5IWA O;  1YZB A;  4DR2 O;  5LMN O;  1N34 O;  4NXM O;  1R6T A;  4B3T O;  4DV7 O;  1DK1 A;  1AIL A;  2N74 A;  2UUB O;  4X62 O;  5BXZ A;  1IBL O;  4GKJ O;  4X66 O;  4JI3 O;  2LW7 A;  4JI2 O;  4LF9 O;  3RT3 C;  3M8A A;  4JI1 O;  4DR4 O;  1XMO O;  2UUC O;  3J80 N;  4GKK O;  4NXN O;  4JI8 O;  4X65 O;  5A2Q N;  2ZM6 O;  4JV5 O;  1AB3 A;  4OX9 O;  1XNR O;  4LF7 O;  2F4V O;  3J7A U;  1I94 O;  3O65 A;  1HNX O;  1XEQ A;  4YY3 O;  4K0K O;  2UXC O;  1N36 O;  1HNZ O;  4DV6 O;  4LF8 O;  4X64 O;  3J81 N;  4DV5 O;  4DR5 O;  4JI0 O;  1IBM O;  2UU9 O;  5BR8 O;  2DOS A;  1G1X B;  3JAM N;  3T1H O;  4DUY O;  4DV2 O;  2ZKO A;  4DR6 O;  4LF4 O;  4LFA O;  3SDL A;  4DV3 O;  4DR7 O;  5IT9 N;  1D2D A;  5H5N A;  1J5E O;  5BY1 A;  1FKA O;  3T1Y O;  1KUQ A;  1HNW O;  2AGA A;  2UXD O;  4KHP O;  1FYJ A;  4A5U B;  2JRI A;  1A32 A;  4LF5 O;  2VQF O;  4DV4 O;  2E5L O;  2DJV A;  3R66 A;  1X59 A;  5LL6 Y;  4JI6 O;  5LMU O;  2VQE O;  1XMQ O;  4DUZ O;  4DR3 O;  4DV0 O;  4B3S O;  4JI5 O;  4LFC O;  1XNQ O;  4DV1 O;  2Z0A A;  2UUA O;  1IBK O;  4JYA O;  1FJG O;  4LFB O;  4AQY O;  1R1B A;  1NS1 A;  3OTO O;  2HHH O; 
#chains in the Genus database with same CATH topology
 1Y66 A;  2YEV A;  1IBK B;  4TV9 B;  2FKX A;  2JJ1 G;  1VQ8 V;  1EN4 A;  2QWN B;  2QWR B;  1AJP A;  1Q43 A;  1LR1 A;  3UQ8 A;  1BHA A;  2YI9 A;  4GLX A;  1RM1 C;  1H2G A;  1TUB B;  1OCO B;  3K08 A;  4CH3 A;  2PI4 A;  1ROP A;  1N4C A;  2Q7H A;  3ZCC A;  4PI0 A;  1QR8 A;  3WB0 A;  3GVM A;  2CDY A;  4JAS A;  4L8J A;  2FML A;  4X65 O;  5A2Q N;  3VQX A;  2P7T C;  4UV9 A;  4OX9 O;  4DUY B;  4UCO A;  3T4Z A;  1Q5O A;  1THZ A;  3AG3 B;  2A06 H;  3CCE V;  3M7M X;  3CYO A;  5L3C A;  5FPO A;  1IXB A;  3EXA A;  1KYO F;  1HNX B;  2VQE B;  3L73 H;  3QO8 A;  1GO3 F;  1SQF A;  2NNU A;  5KHH A;  4R6Z A;  5IJ0 B;  2GTS A;  1AR1 B;  1KUQ A;  1HNW O;  3DC6 A;  3RWR D;  4D7S A;  1IXM A;  3ZRW A;  3DSQ A;  2ZIM A;  4WFH A;  4YJ3 A;  4UB8 Z;  4H37 A;  3C90 A;  4X1I B;  4LF5 O;  3E89 A;  4CZZ A;  2E5L O;  5LA6 A;  5LL6 Y;  3CCJ V;  2F1M A;  1FXV A;  1L8D A;  5GTH Z;  1XNQ O;  4DV1 O;  4O2B B;  4B08 A;  1QQC A;  3CB2 A;  2WWW A;  4MW3 A;  2EIM C;  2XAF A;  5JWP A;  1Q7Y W;  3ASO C;  2EIN B;  4DR1 B;  3ZHR A;  1BS3 A;  1NS1 A;  2LQT A;  3AG7 A;  5IDJ A;  2KG7 A;  4FFB A;  3GB7 C;  3AK1 A;  4J80 A;  4HZ3 A;  1Q82 W;  3WG7 C;  2W6J G;  2CGN A;  2ZCE A;  4DW0 A;  5IY5 C;  5JH7 A;  3F5T A;  2F43 G;  2N05 A;  4ZI7 A;  2CTW A;  4ZOL B;  3SJB C;  1RPR A;  1R6T A;  1RP3 B;  3BFR A;  4UXN A;  3CC4 V;  1GMG A;  2JS3 A;  3CEI A;  3W7S A;  4X66 O;  2JDI G;  3RYH A;  2EIK C;  1XHX A;  2NN4 A;  2BTQ A;  2KKW A;  4I0X B;  3UO2 A;  4NXN O;  1H2N A;  2Q0A A;  2HHH B;  4DV2 B;  3E83 A;  5EBW C;  1O9H A;  1IBM B;  3RYI A;  4UCU A;  4WFB V;  4YY3 O;  1N36 B;  1W59 A;  2Q6A A;  4ZIB A;  2BCC H;  1N36 O;  2XOK G;  1VAR A;  4JI5 B;  2KG7 B;  4NR1 A;  2DOS A;  2E5L B;  4CH6 A;  4DV2 O;  4DR6 O;  1UPG A;  5IYB O;  3ZX6 A;  2YI8 A;  4X1K A;  2HR3 A;  3OFN G;  4YXW G;  4J10 A;  2YID A;  4X66 B;  4NB5 A;  3CSX A;  4J7Z A;  1JJO A;  3BAA A;  3ETG A;  2RQ6 A;  5EBL C;  5LGU A;  3VBB A;  2M6Y A;  3A0H Z;  2WAM A;  5CBH A;  2GTA A;  4X20 A;  4WCE V;  1G4Y B;  2AW9 A;  2YIB D;  2ETN A;  3D3I A;  3OAA G;  5KMG B;  3BHP A;  4DR1 O;  4OPH A;  4PA6 A;  3AK3 A;  2DWD C;  1PNM A;  1S5J A;  3LDE A;  2F23 A;  3U11 A;  3OM3 B;  2VWK A;  1I7F A;  1KBH A;  5GON A;  4BIU A;  1IX9 A;  2PY5 A;  2IW5 A;  3K9S A;  3K5N A;  3ZMZ A;  4KFM A;  4LF5 B;  1N33 B;  4Z1M G;  4NYK A;  2QJ1 A;  4O4J B;  5JJJ B;  2UXB B;  1H2S B;  4DR4 O;  4C7U A;  3NR7 A;  3UCS C;  1Z2G A;  4JPR A;  5EC1 C;  2OYQ A;  3ZED A;  4CS4 A;  4PDL A;  5CA1 A;  2DMX A;  1ZLZ A;  4IHJ B;  4JZ2 A;  1HP8 A;  3STL C;  4LP8 A;  2RDC A;  1U97 A;  3GWK C;  1W2B U;  4TV8 B;  4BAY A;  4LF8 O;  4IHJ A;  1RPO A;  1SES A;  4LWS A;  5IYC O;  1H38 A;  4X1Y B;  4DUY O;  3OUS A;  4DV3 O;  1N0J A;  1W0J G;  2Q7E A;  4FLX A;  3CCV V;  1J5E O;  5BY1 A;  5F2V O;  5L3G A;  2DN9 A;  1B3Q A;  3CRM A;  4LF4 B;  1WB8 A;  3CPW U;  1QHT A;  4PHZ A;  1KKD A;  3H01 A;  5LMU O;  4LFC O;  1O9G A;  1ZX3 A;  5KLV H;  3JD2 A;  2GV9 A;  1IBK O;  3G71 V;  5LYJ B;  2EUL A;  1S3J A;  4D6T H;  3HKC B;  5KUM A;  2A7W A;  1IUR A;  3ZS8 C;  3G67 A;  3JAR A;  1YTF D;  3JSN A;  5L3B A;  4R7C A;  4X1Y A;  2ZIN A;  2R9A A;  3LDC A;  1BZK A;  4X20 B;  1SQX H;  1Y74 B;  4JI4 O;  1PV0 A;  5JVD B;  5IYZ B;  5IWA O;  1YZB A;  4LFC B;  4CC5 A;  1EN6 A;  2EJR A;  3CE2 A;  2LW1 A;  3ZBH A;  3CCS V;  5FPR A;  4MVR A;  2Q69 A;  4F6R A;  1K3E A;  3CRA A;  2P5O A;  5IE9 A;  4D7T A;  5KA6 A;  2HVJ C;  2DWE C;  2WLI B;  2MW2 B;  1PPJ H;  3EFF K;  1XL4 A;  4W4K A;  3U0Z A;  2YSU B;  3J80 N;  2Q0O C;  4DV3 B;  3CRQ A;  1FS0 G;  2BTO A;  1NTK H;  3P3P A;  3EHB B;  5KUK A;  4QJF B;  3OW2 U;  4LF8 B;  3ABL C;  5E79 Z;  2CE4 A;  3ZIA G;  2ZQM A;  1E79 G;  2JEU A;  4K0K O;  2IJI A;  3AEI A;  2LGQ A;  5CN0 A;  3E8H A;  2XND G;  1NH2 B;  4NVP A;  3SDL A;  1V54 B;  1M56 C;  2EIJ B;  4TQF A;  1K73 W;  4TV9 A;  4DR4 B;  5IY5 B;  1PM9 A;  2AGA A;  3L74 H;  4I4T B;  3FYI B;  4LCU C;  3CC7 V;  2NLJ C;  1M56 B;  2EIJ C;  3CS5 A;  2BE3 A;  4TT3 G;  3SPI A;  3R66 A;  5GTI Z;  4KUM A;  1QCE A;  5B5E Z;  4B3S O;  1SQV H;  5AG2 A;  2XTA A;  2QKC A;  2ZNJ A;  1P7B A;  2WLL A;  1FJG O;  4I0X A;  2OIE A;  1KC8 W;  2QTS A;  3JAK B;  2BOB C;  4O2A B;  1ZSP A;  1BCC H;  3OD4 A;  4H33 A;  4KL1 A;  2ZR2 A;  4FVM A;  2X6A A;  1K97 A;  2JGU A;  4K3A A;  5B66 Z;  4UVC A;  2ZE8 A;  4O4L A;  4I9Q A;  3VQV A;  4MTG A;  1R3K C;  1NT2 B;  2HJF C;  4DO2 A;  4WBN B;  4JI6 B;  1VQP V;  1Y76 A;  4WF9 V;  4NTY A;  2HFE C;  1DK1 A;  1WLE A;  2N74 A;  4BR6 A;  1EFR G;  1D5A A;  3JAT A;  2PGG A;  4EB6 A;  3JAW B;  2IH1 C;  4JI2 O;  4ZKI A;  3RT3 C;  3M8A A;  4JI1 O;  3I5D A;  4B7K A;  3CX5 F;  1XMO O;  5KHI A;  4LNU B;  1FFX A;  4HNA A;  3THO A;  4O2B A;  1KB9 F;  1YTF B;  1K4C C;  4XDL A;  2WLI A;  3F7V C;  3ZJZ A;  1TVK A;  4KP4 A;  2UUA B;  2A3Q A;  4J9Y B;  4FM2 A;  4YY3 B;  4PI2 A;  4DV6 O;  1KMI Z;  3ABM C;  1IBM O;  5CA0 A;  3K5O A;  4FLT A;  3CXH F;  1KEC A;  3T1H O;  2PZS A;  5LP6 B;  1VP7 A;  4PDV A;  3K0G A;  4NXN B;  1Y74 A;  5EZY B;  2LO1 A;  4I9W A;  1NQT A;  2UUC B;  1QVF U;  3OMI B;  4PA9 A;  4JAA A;  2B5U A;  4FPP A;  4TUY B;  3W7X A;  4TOI A;  1OV9 A;  1ORQ C;  1YEW A;  3RW0 A;  3BAB A;  1SQB H;  1FPO A;  2BTQ B;  1PD3 A;  5D5P A;  2CH7 B;  5CB4 A;  1F51 A;  2ZDI A;  1XNR B;  4CH5 A;  1RM1 B;  5LOV A;  2GBO A;  4G27 B;  4ASU G;  2ITD C;  3CCU V;  2QSA A;  3RVY A;  3AG4 B;  1F7Y A;  3JCU Z;  1LUW A;  5K1P A;  2H94 A;  3K0D A;  2Y0I A;  5EYP A;  3DGE A;  4EFB A;  1XNQ B;  1GH6 A;  1OCZ C;  1N34 B;  3C3T A;  2XAG A;  3CP1 A;  2B1G A;  3RYH B;  4AHC A;  2IM9 A;  4JYY A;  4DRX A;  3LDD A;  1NTM H;  3W7U A;  2P4K A;  1KU9 A;  1HNW B;  1URF A;  3CCQ V;  3QVN A;  1NVP B;  4JYC A;  1H2K A;  2OIG A;  1SRY A;  4X1I A;  3AG4 C;  3HR0 A;  1HNX O;  1QLN A;  4JYB A;  3WB1 A;  2NR5 A;  4RQF A;  1R6K A;  1NBM G;  1YI2 V;  3E86 A;  2Q7G A;  4FMT A;  4X64 O;  2JIZ G;  2F66 C;  4LF7 B;  3JAM N;  2ZKO A;  4U7N A;  2HEP A;  4X65 B;  5ITZ A;  1MA1 A;  2Y4T A;  1KKC A;  2FTK A;  2UXD B;  2XAS A;  2JJ2 G;  1E1R G;  4UVA A;  2KSD A;  1SER A;  5KHG A;  2VWJ A;  3ETE A;  1FYJ A;  3JD3 A;  2UUB B;  4A5U B;  5GW7 A;  2XUM A;  1T5E A;  5FL7 G;  3B8M A;  4DUZ O;  5IJ9 B;  4DR3 O;  4DV0 O;  3IC9 A;  1VQM V;  2GUZ B;  2OCH A;  1VQ4 V;  2UXX A;  2GDS A;  5DM6 V;  4LFB O;  4DK0 A;  3SYA A;  1GKF A;  1I94 B;  2GUZ A;  3NXS A;  3E8B A;  3ABM B;  2ZM6 B;  4ZI7 B;  2FYU H;  4PA7 A;  2HP8 A;  2Y69 C;  4AQY B;  1WP8 A;  4JI7 O;  1JMK C;  2W6I G;  1HWY A;  1VQ9 V;  4TUY A;  2EIK B;  4YHH O;  3CXC U;  1GM9 A;  5J2T A;  1PP9 H;  1WB7 A;  2R70 A;  3E35 A;  1CP9 A;  4DR2 O;  3ZRX A;  3KKY A;  5KHK A;  2B1I A;  1VQN V;  1Q86 W;  1QBZ A;  3LNM B;  2X7R B;  3HPL C;  3OMA B;  1CPY A;  1WPB A;  1GN6 A;  1YHQ V;  3G6E V;  2CAZ C;  3ABT A;  3LNN A;  4PD4 F;  1NH2 D;  4JV5 O;  4P9O A;  4BIZ A;  4U3F H;  2AXT Z;  3J7A U;  5BR8 B;  4MTF A;  3ZMU A;  2PI5 A;  2R72 A;  3MHS C;  1IZ3 A;  4ZHQ B;  1YXB A;  4JTC B;  3IC7 A;  3X2Q B;  2L35 A;  4DR5 O;  3KCX A;  2K9P A;  2QM4 A;  5B3S B;  4DV4 B;  2ZDI C;  4XDK A;  1D2D A;  4WBN A;  2KQX A;  2IU3 A;  3L75 H;  4UCR A;  3L71 H;  2P6J A;  2HJD A;  3PJS K;  3ZRV A;  2CTP A;  3ZHS A;  2RCV A;  2V1D A;  3A0B Z;  3FYE B;  1M57 B;  1XBL A;  3QF7 A;  1YJ9 V;  5H2F Z;  4MW8 A;  2VQF O;  4B3T B;  3RN4 A;  1R6N A;  4EFE A;  2WLK A;  2ZIO A;  4DV5 B;  3FB6 C;  3JSL A;  2DYS C;  2C2A A;  4F6E A;  1HR0 B;  4B3M B;  2QR4 A;  1DF5 A;  1DLB A;  1GM8 A;  2OTJ V;  1JJ2 U;  2YUA A;  4LF6 B;  1XOU A;  1LNQ A;  3ZRW B;  4TWK A;  1S5L Z;  2KB1 A;  1I0H A;  3ZHT A;  4B7E A;  3JD0 A;  4OPA A;  3S3X A;  3K59 A;  5L3E A;  3ZHV A;  1IBL B;  1MNG A;  1KP2 A;  5C8Y B;  3S3W A;  2LJ2 A;  5IJ9 A;  5LMN O;  5B1A B;  3W7W A;  1FAF A;  5CA0 B;  3APO A;  1GN2 A;  3CRC A;  1FD9 A;  1YJW V;  3AK2 A;  4YIO A;  3SJQ C;  3M99 B;  3HKD B;  5KMG A;  3D36 A;  1V9P A;  2ZD9 A;  3AG1 C;  3N2G B;  1OCR C;  4GX2 A;  5FNV A;  2CTR A;  3AG2 C;  1NR7 A;  5GON B;  1M93 A;  1F23 A;  3U10 A;  2UXC O;  1H8H G;  3JCZ A;  3EVK A;  3Q4H B;  2E3C A;  2EBO A;  4PA3 A;  2UU9 O;  3FB5 C;  4PDM A;  4JF3 A;  2GHY A;  2F4V B;  3ZHQ A;  2XAH A;  3ZMV A;  3CHX A;  4RWU A;  1ZTE A;  1PL0 A;  4JTA B;  3D8C A;  4O4L B;  3WB2 A;  1FFX B;  3BA8 A;  2JVD A;  5EC2 C;  4GKJ B;  2AHZ A;  1OCO C;  4FFK A;  4FZ0 A;  1DTO A;  2WSS G;  1Q8I A;  4BIO A;  2BSK B;  3T2M A;  1N8R W;  2DJV A;  1L0L H;  1Y6X A;  5JCO A;  3HKD A;  3K57 A;  2Z0A A;  2Z3Y A;  3PN1 A;  1G6U A;  3KCY A;  4N23 A;  4MT8 A;  1Z5W A;  4ICG A;  5LGN A;  1AI4 A;  4MVZ A;  2FL4 A;  5E1A C;  4UV8 A;  4X88 A;  2YS8 A;  4CH4 A;  1OZ0 A;  1KD1 W;  2Y4U A;  2G38 A;  1JQ0 A;  1AP6 A;  1V54 C;  3TJT A;  4B3R O;  1P4R A;  1MMM A;  4MVS A;  3G6B A;  1Y67 A;  3E2E A;  1Y4M A;  1WA8 B;  2ZE7 A;  1TAE A;  1YIJ V;  2O57 A;  3SJC C;  5FLX N;  4MVU A;  1Q3E A;  2A9H A;  4MSW C;  2QTO A;  4J41 A;  3SGI A;  2QWP B;  1FFT B;  3SYQ A;  4CS3 A;  1VQ5 V;  3H1H H;  1I5Y A;  3QTC A;  4NXM O;  2EJ7 A;  3CWB H;  5LBQ A;  2Q8V A;  4Z2W A;  3HKB A;  4QPK A;  5JJN B;  3SJA C;  5BXZ A;  1Q6H A;  2CK3 G;  2BSK A;  4LR3 A;  4GKK O;  2CUG A;  4O4H B;  5L3F A;  3TXQ A;  1JOY A;  4JI0 B;  1AR5 A;  5CBF A;  3RFR A;  3ABK C;  3ETD A;  1HNZ O;  1FXK B;  4DV5 O;  5JJE B;  3FX7 A;  3AG3 C;  1HW7 A;  3X2Q C;  1K8A W;  5B1N A;  4O4I A;  4LFA O;  2R9I A;  2Y69 B;  3B4S A;  4JI8 B;  5IT9 N;  4OGQ B;  3H1L H;  1GTO A;  1ZUQ A;  3FFQ A;  3BPZ A;  3TK1 A;  4KHP O;  4X62 B;  2Q4P A;  3AG1 B;  1B6Q A;  3OR6 C;  4QE7 A;  3P32 A;  3IAY A;  4DR5 B;  1VQK V;  1SZT A;  2EZO A;  2HG5 C;  3OUF A;  4WFA V;  5ITZ B;  5B3S C;  4TSF G;  1J95 A;  2RMK B;  4X1K B;  1XHZ A;  1DGS A;  1E1Q G;  4DK1 A;  4JV5 B;  3LSQ A;  3MHH C;  3H1I H;  4IYH A;  5J2U B;  4X9Q A;  3OTO O;  1PKX A;  1F4M A;  2IU0 A;  1M90 W;  2Q68 A;  1FXK A;  5B1B C;  2E75 B;  2WLM A;  4GCZ A;  1TUB A;  3QNE A;  4QPJ A;  2LP7 A;  3AG2 B;  2V4D A;  1WAZ A;  4JYA B;  4OXS A;  2IH3 C;  3WFV A;  4I7Z B;  4UCT A;  1F4N A;  1G8M A;  3OE7 G;  5BMV B;  1I5X A;  4EEQ A;  4ZHQ A;  2ZXW B;  2D3O W;  1P49 A;  4TV8 A;  4MVO A;  4U3J A;  4YHH B;  4RQE A;  1LUV A;  4JI3 O;  1SET A;  3HKB B;  5B1O A;  4UB6 Z;  3JAT B;  1S5H C;  2YIA A;  3T4D A;  2P90 A;  4CS2 A;  1QNM A;  1MG1 A;  2DW4 A;  3RYC A;  1I94 O;  1BE3 H;  1QVG U;  4LFB B;  2QWQ B;  2ZE6 A;  4GZR B;  4PJ0 Z;  4XDJ A;  2W0F C;  1PNK A;  1WNS A;  2MK3 A;  3CCL V;  4DV0 B;  4DR3 B;  4CBC A;  1COW G;  3OGI B;  4X89 A;  1M5I A;  1NTZ H;  4DRX B;  4FLY A;  1BMF G;  2A0L A;  4O2A A;  4UVB A;  3T1Y O;  4H44 B;  2ARH A;  2ADQ B;  4LF9 B;  2WA4 A;  4JI3 B;  1TA8 A;  1K92 A;  3MAQ A;  1NR1 A;  3STZ C;  3K03 A;  4DV7 B;  1EBO A;  3TXS A;  5A9G A;  1SA0 A;  4JTD B;  3A2F A;  3TET A;  3N2K B;  4W4L A;  4X64 B;  1VF6 A;  2V7Q G;  1JR9 A;  1ENV A;  4I55 B;  5BZB A;  4JYA O;  2ZE5 A;  1YVW A;  1K5Q A;  1YCI A;  2RNB A;  4EKW A;  4WFE A;  5JQG B;  3VOU A;  3UT5 A;  1N32 O;  4FK5 C;  1GAX A;  1VQO V;  2X6B A;  2CGO A;  5HFL A;  3RBZ A;  1EN5 A;  4HNA B;  3CCR V;  3H9V A;  4I5S A;  2Z5U A;  2CH7 A;  2WA3 A;  5CB4 B;  1MZE A;  1AVM A;  3RYF B;  3P30 A;  4X62 O;  1DF4 A;  4KHP B;  3SPC A;  1MOF A;  2EIL C;  2LW7 A;  3I56 V;  2EIM B;  5H6R A;  5LXT A;  2IJK A;  2JGD A;  1I08 A;  2WPD G;  2YEV B;  2E74 B;  3OEE G;  2PTM A;  1AI5 A;  3D3Q A;  4YJ2 B;  1VMG A;  1KQS U;  4FZ1 A;  3B2E E;  2PYL A;  1BT8 A;  3MD0 A;  1PNL A;  3FKS G;  2P67 A;  1YIT V;  4DR7 O;  1SF9 A;  1SQG A;  5H5N A;  5DEC A;  1IDS A;  2OWO A;  1ZL8 A;  4X8A A;  2ZR3 A;  4LH7 A;  4R8C A;  5L3D A;  1B06 A;  1R3I C;  1BSM A;  5KA5 A;  3JYC A;  4I4T A;  4UCV A;  2YC0 A;  1WJZ A;  1R3L C;  2OCC B;  5LGT A;  3K5L A;  3LSS A;  5D5Q A;  4DV6 B;  1JFF A;  5BMV A;  3E8F A;  3CMA V;  2P22 C;  2UXC B;  1L0N H;  2RJZ A;  4ZOL A;  4ABM A;  2XHB A;  3UO3 A;  3ZHU A;  2PYJ A;  3ZMS A;  5KAI Z;  4FM1 A;  4B3R B;  4Q6G A;  4O4J A;  3W7T A;  3K58 A;  2Q9L A;  4YJ3 B;  3Q4H A;  5B1A C;  4JI1 B;  4JAU A;  4E2L A;  3BRC A;  4Z1V A;  4JI2 B;  4K35 A;  1W0K G;  3WG7 B;  5LOV B;  4R50 A;  1AJQ A;  5LP6 A;  5IJ0 A;  3JD1 A;  2JEX A;  1IVS A;  1OHH G;  3ZN1 A;  2K1E A;  4LH6 A;  1GK9 A;  5EIB C;  2EX3 A;  2CTQ A;  2N04 A;  3SYO A;  3ZN0 A;  1K9M W;  4J7K A;  1VQL V;  1IBL O;  3HKC A;  4GT1 A;  4JGS A;  2L6L A;  3BA9 A;  3OMN B;  2F95 B;  1M9N A;  4DR7 B;  1JFF B;  2XT9 A;  5LHI A;  2F4V O;  1R3J C;  1FJG B;  1XEQ A;  3ZMT A;  3BEH A;  2OT5 A;  3JAS B;  1Y76 B;  3F7Y C;  1VQ7 V;  4B3S B;  1US6 A;  2XAQ A;  1ZL8 B;  1CEZ A;  3K79 A;  2VQF B;  2JS5 A;  1TVK B;  1BGY H;  1Q90 D;  4KXR A;  2M7W A;  4IL6 Z;  1FKA O;  1V55 B;  3CME V;  3GWO A;  3B09 A;  3IJ4 A;  2QM8 A;  4LNU A;  3APQ A;  5EIB D;  3SPG A;  4DV4 O;  1BHB A;  2HLD G;  1X59 A;  4EB6 B;  2ITC C;  1SZX A;  4RUF A;  4DYL A;  4MTX A;  3CRR A;  1WPX A;  1WP7 A;  1VF6 C;  4DXW A;  1K4D C;  4H0L B;  5TIS Z;  1H2M A;  1N32 B;  2DQ0 A;  1YDX A;  1FXH A;  1MSW D;  5H6Q A;  1K5S A;  3FD9 A;  3SPJ A;  4LF6 O;  2IJJ A;  3RVZ A;  1NJI W;  1HR0 O;  2DYR B;  3TGU H;  3CJH B;  4HYO A;  5HFM A;  1M57 C;  4QNH B;  4J7J A;  2DQ3 A;  1MSD A;  3WU2 Z;  1WN7 A;  2EIN C;  2IBZ H;  1OJH A;  1QLE B;  1HDJ A;  3H1K H;  2WLL B;  4DV7 O;  3JD4 A;  3T1C A;  5IWA B;  1YF2 A;  1EZJ A;  3CD6 V;  4BWA A;  1BQ0 A;  4P9P A;  4LF9 O;  1NKD A;  3T1Y B;  3ASN B;  2EIL B;  1BQZ A;  3RGB A;  1XUQ A;  5C93 A;  2QA4 V;  5CMU A;  2ZM6 O;  1XIL A;  4TQD A;  1S76 D;  3ASO B;  4Q20 A;  2Q5Z A;  3O65 A;  4PEL A;  1XQ8 A;  1VIB A;  2R9R B;  4F6R B;  4H13 B;  1L1F A;  3J81 N;  4PA4 A;  4K8Z A;  4J9Z B;  5LMU B;  4G28 B;  3DXR B;  3B8N A;  3L70 H;  5K1X A;  3QO7 A;  4LF4 O;  1XRE A;  1SQQ H;  3ICX A;  5DED A;  1D5N A;  3JAL A;  4QIW F;  1JVM A;  3OGC C;  2LGW A;  2UXD O;  2X0L A;  3F5W C;  4RUE A;  1A32 A;  3ZRS A;  4G2K A;  1AI6 A;  1QU7 A;  1YSC A;  3BY6 A;  3ABU A;  1GN3 A;  4ZBM A;  4AI8 A;  4DR2 B;  1P7G A;  4UUJ C;  4P30 A;  4GYC B;  1XDC A;  3ETQ A;  2DYR C;  1TUE B;  3D36 C;  1QR9 A;  1WA8 A;  4J42 A;  1S72 V;  5DN6 G;  4AQY O;  2YXL A;  4U3J B;  1R1B A;  4MVQ A;  3OTO B;  4FLW A;  2UXB O;  3L9D A;  3QO5 A;  4FIP C;  3UT5 B;  1K33 A;  1N33 O;  2H8P C;  1RFY A;  1NVP D;  4DUZ B;  1SKV A;  3IGA C;  3VQY A;  1N34 O;  5B1B B;  2UUB O;  3OEH G;  2YXY A;  4XBF A;  1OCC B;  1Z5V A;  1Q81 W;  1OCZ B;  3IFX A;  2PUS A;  3SPH A;  1CXZ B;  4BW9 A;  4E4E A;  2JK5 C;  2EZP A;  4JI8 O;  4LFA B;  4NTX A;  1M1K W;  5KX5 A;  2Y48 A;  4LBE C;  3BVO A;  4N21 A;  5EYP B;  4LF7 O;  1XNR O;  2ILM A;  4IGG A;  5LYJ A;  2HKO A;  4JAV A;  3CCM V;  1HNZ B;  1GM7 A;  1ZWI C;  1JPX A;  5J2U A;  3FB8 C;  2QWO B;  1KP3 A;  3P3N A;  4QGP A;  1AI7 A;  4JI0 O;  5KAF Z;  1RSO B;  5KHJ A;  1G1X B;  4FM0 A;  4YJ2 A;  2W0X A;  5LP6 C;  4GKK B;  2Q67 A;  1H2L A;  3E22 A;  4CC6 A;  1MAB G;  1SC5 B;  1X4T A;  2LFR A;  4HBN A;  1OCC C;  4WFG A;  2A79 B;  4RO2 A;  5JQG A;  2ZNI A;  1M4U A;  3B40 A;  1K34 A;  4DR6 B;  2QGN A;  2AZ2 A;  3T1H B;  4NXM B;  2RN9 A;  4JI5 O;  4O4H A;  5FNV B;  2UUA O;  2YIC A;  3B77 A;  3N2K A;  3K04 A;  5EZY A;  2ADP A;  1SA0 B;  1XI1 A;  3OR7 C;  1AJN A;  4MVM A;  3HB3 B;  2HHH O;  2YDE A;  1GRJ A;  1XL6 A;  4IIJ A;  2ODM A;  3R65 A;  2UXN A;  3E22 B;  1NU1 H;  3RYF A;  1JCH A;  1NZ6 A;  5J9P C;  1S77 D;  5CA3 A;  2OTL V;  4I55 A;  3QG5 A;  1AIL A;  3L72 H;  1VF7 A;  2PF4 E;  1TGO A;  3DTU B;  2ZXW C;  1JX9 A;  3N2G A;  3K9A A;  4GKJ O;  2YIB A;  1R73 A;  2QEX V;  2ZT9 B;  4AIL C;  3JAR B;  3ML0 A;  5LA6 B;  2UUC O;  3G4S V;  3SYC A;  1AB3 A;  4P2Z A;  2QE7 G;  4UCS A;  4K8X A;  2UU9 B;  3I55 V;  1SQP H;  5JVD A;  4NTW A;  5C8Y A;  2B9Z A;  3LUT B;  1U96 A;  4JZG A;  4DV1 B;  3FAV B;  2X6C A;  4LC1 A;  4MTO A;  4I50 A;  3CC2 V;  3O9O A;  1H8E G;  4HAM A;  2P06 A;  1N0N A;  5JH7 B;  1AR4 A;  2QM7 A;  1XMO B;  1PL4 A;  2WLN A;  2OCC C;  3KG2 A;  4PV1 B;  3LSU A;  3KZI Z;  4GX1 A;  5IYD O;  1JA8 A;  4L87 A;  2IJH A;  4FFB B;  4WFF A;  3K06 A;  3OT7 A;  1EZV H;  1B04 A;  2Q73 A;  3OTF A;  4JI6 O;  1EM1 A;  2VQE O;  5LMN B;  1SS3 A;  2LFS A;  3UKM A;  3JAK A;  2H3O A;  2QKA A;  4FLV A;  1FXK C;  5J2T B;  1S0V A;  4YIP A;  3A8T A;  1Q6U A;  3RYI B;  2JGD B;  3G80 A;  1UJW B;  4OX9 B;  5H9C A;  3K3W A;  2E76 B;  3HKE B;  2WLH A;  1OCR B;  3C3S A;  2HVK C;  3UM7 A;  3BCC H;  4U7O A;  4LWS B;  3JAS A;  2VRZ A;  1MZF A;  4MS2 A;  4B3M O;  1ZAU A;  1VEW A;  3JAL B;  4FLU A;  5CA1 B;  1GN4 A;  4FJC C;  4J11 A;  3FB7 C;  4IIJ B;  3A0R A;  4GX0 A;  4B3T O;  2QKS A;  1BL8 A;  5LXT B;  1Q6I A;  4IYI A;  2AHY A;  3HKE A;  2XAJ A;  4FLZ A;  3H1J H;  4QE9 A;  3MDS A;  3DC5 A;  1ARO P;  2DYS B;  3K5M A;  5EK0 A;  4GUN A;  2YXH A;  5IYZ A;  3SR2 C;  5JCO C;  1K7D A;  2P4V A;  2AZ0 A;  2WLJ A;  3ABK B;  3DXR A;  1VQ6 V;  4K0K B;  4F4L A;  4UFZ A;  1NI8 A;  3N27 A;  4DW1 A;  1V55 C;  1XMQ B;  3ASN C;  5BR8 O;  1AP5 A;  5CBG A;  3E8G A;  2D2C B;  3TCU A;  2F93 B;  5LHG A;  3CJH A;  4I50 B;  1YJN V;  4PDR A;  1VF5 B;  3FAV A;  1QLE C;  1RSO A;  1J5E B;  2VS0 A;  1P84 F;  1UFI A;  2JRI A;  2FB5 A;  4O4I B;  3JAW A;  4GX5 A;  4BW5 A;  2ATK C;  1XMQ O;  2Y0P A;  4RAI A;  2GSM B;  2DE0 X;  4NKG B;  5LHH A;  5KX5 B;  3ABL B;  4JI4 B;  3RYC B;  2QDO A;  4JI7 B;  3SYP A;  3VQW A;  5EBM C;  4IT5 A;  2BOC C; 
#chains in the Genus database with same CATH homology
 4B3R O;  1N32 O;  4DR1 O;  4LF6 O;  4JI7 O;  1F7Y A;  4OPA A;  2UXB O;  4OPH A;  4B3M O;  4YHH O;  1HR0 O;  5FLX N;  4JI4 O;  3F5T A;  2FKX A;  1N33 O;  5IWA O;  1YZB A;  4DR2 O;  5LMN O;  1N34 O;  4NXM O;  1R6T A;  4B3T O;  4DV7 O;  1DK1 A;  1AIL A;  2N74 A;  2UUB O;  4X62 O;  5BXZ A;  1IBL O;  4GKJ O;  4X66 O;  4JI3 O;  2LW7 A;  4JI2 O;  4LF9 O;  3RT3 C;  3M8A A;  4JI1 O;  4DR4 O;  1XMO O;  2UUC O;  3J80 N;  4GKK O;  4NXN O;  4JI8 O;  4X65 O;  5A2Q N;  2ZM6 O;  4JV5 O;  1AB3 A;  4OX9 O;  1XNR O;  4LF7 O;  2F4V O;  3J7A U;  1I94 O;  3O65 A;  1HNX O;  1XEQ A;  4YY3 O;  4K0K O;  2UXC O;  1N36 O;  1HNZ O;  4DV6 O;  4LF8 O;  4X64 O;  3J81 N;  4DV5 O;  4DR5 O;  4JI0 O;  1IBM O;  2UU9 O;  5BR8 O;  2DOS A;  1G1X B;  3JAM N;  3T1H O;  4DUY O;  4DV2 O;  2ZKO A;  4DR6 O;  4LF4 O;  4LFA O;  3SDL A;  4DV3 O;  4DR7 O;  5IT9 N;  1D2D A;  5H5N A;  1J5E O;  5BY1 A;  1FKA O;  3T1Y O;  1KUQ A;  1HNW O;  2AGA A;  2UXD O;  4KHP O;  1FYJ A;  4A5U B;  2JRI A;  1A32 A;  4LF5 O;  2VQF O;  4DV4 O;  2E5L O;  2DJV A;  3R66 A;  1X59 A;  5LL6 Y;  4JI6 O;  5LMU O;  2VQE O;  1XMQ O;  4DUZ O;  4DR3 O;  4DV0 O;  4B3S O;  4JI5 O;  4LFC O;  1XNQ O;  4DV1 O;  2Z0A A;  2UUA O;  1IBK O;  4JYA O;  1FJG O;  4LFB O;  4AQY O;  1R1B A;  1NS1 A;  3OTO O;  2HHH O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...