4DV3O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv3O00
4LFAO 4DR1O 1DK1A 4X65O 4JI1O 1KUQA 4DR4O 4DV5O 3T1HO 4GKKO 4DR7O 1N36O 3RT3C 4A5UB 3J80N 4DV0O 2UXBO 2VQFO 5LMNO 5IT9N 3J81N 4OX9O 4JI3O 5H5NA 5BY1A 3T1YO 1R1BA 1G1XB 2UXCO 2F4VO 1HNXO 2HHHO 4B3TO 4DV3O 3SDLA 1XNQO 1YZBA 2UUBO 1XNRO 4JV5O 4NXNO 2Z0AA 1F7YA 2DJVA 2AGAA 1IBLO 1X59A 2VQEO 4JI4O 2E5LO 1XMOO 4B3RO 1FJGO 1HNWO 3JAMN 1XMQO 4DUYO 1HNZO 1HR0O 2UUAO 1AILA 4JI8O 1IBKO 4LF8O 4DUZO 1N33O 4LF9O 4JI6O 2LW7A 4DV6O 2ZM6O 4DV2O 1FKAO 1N34O 4JI5O 1D2DA 2UU9O 5LL6Y 1IBMO 4LF5O 1FYJA 4GKJO 1I94O 4X64O 4JI7O 3OTOO 4X66O 5A2QN 1A32A 2FKXA 4KHPO 4B3MO 5FLXN 4DR6O 4DV1O 4OPHA 4NXMO 5LMUO 3R66A 4AQYO 4B3SO 2UUCO 4LF7O 4LFCO 4JYAO 4DR2O 2JRIA 1NS1A 1R6TA 2DOSA 1XEQA 3O65A 1J5EO 1AB3A 2N74A 4DR3O 4DV7O 4DR5O 2ZKOA 1N32O 4YHHO 4LF6O 4OPAA 4YY3O 5BXZA 3J7AU 4K0KO 2UXDO 4JI0O 4X62O 4DV4O 3F5TA 5IWAO 5BR8O 4LFBO 4LF4O 4JI2O 3M8AA
chains in the Genus database with same CATH superfamily
4K8ZA 4K8XA 1KUQA 3APQA 2Q6AA 4QNHB 4WF9V 4DV5O 1K8AW 1WP8A 2PTMA 4NYKA 2WA4A 1FXKA 1RPRA 1TAEA 4TOIA 1Y76B 2YICA 2BOCC 3I5DA 3EXAA 1S0VA 2FYUH 5LMUB 1O9HA 2P22C 4GZRB 4UCSA 4OXSA 1WAZA 4WFFA 2ZE7A 4HZ3A 4IT5A 4UVCA 2BE3A 3CXCU 2UUBO 4X1IB 5EIBD 4ZBMA 4IHJA 4NXNO 1GTOA 1IZ3A 4ZKIA 3E35A 1XNQB 2LFSA 4O4HB 5A9GA 5IE9A 1YCIA 3W7XA 4DUYO 3K03A 3K0GA 5B1AB 2Q7HA 2UUBB 4QGPA 4ZIBA 4QPJA 3EVKA 1WN7A 4DV2O 3ZIAG 3RVZA 1MA1A 5IYBO 1FKAO 2UXCB 1RSOA 1XOUA 2ZXWC 3T1HB 1R3IC 4O2BB 1GM7A 1R3KC 4MVRA 4EB6A 4MSWC 1FD9A 4B3MO 3HKEB 3VBBA 4LFAB 4X8AA 5J9PC 3JSLA 2YIBA 3T1CA 4GX2A 1HW7A 2F4VB 2HJFC 1N8RW 2CTRA 4DR5O 2CTPA 3CRRA 2OT5A 5CN0A 4DR4B 2NR5A 1GAXA 2V7QG 1HWYA 3J7AU 3LSQA 4GX5A 4PELA 2YIDA 2NN4A 3K9SA 4I4TB 4N21A 2PUSA 1OCZB 3ETEA 4UCUA 4JYYA 4AI8A 4ASUG 1IBLB 4X66B 2JDIG 2KQXA 2QM7A 3HKCA 4DR4O 1K4DC 2UUAB 3J80N 1V54C 4D7TA 1YHQV 3FB8C 1KD1W 1KC8W 2G38A 1SRYA 4G2KA 3ZMSA 4UV8A 3TXSA 3DTUB 1E79G 2YIBD 2W6JG 1IBKB 3QNEA 1G8MA 3AG3B 5JJNB 3ABMB 1QVFU 1F4NA 1YZBA 2IU0A 2D2CB 2CK3G 2DMXA 4O4LB 2AGAA 2IH1C 1Q6UA 1DF5A 1B06A 3ABLB 2E5LO 1XMOO 4UB6Z 5JVDB 1IURA 1H2GA 3ASNB 3JCZA 3ZHTA 3JASA 1SQFA 1DF4A 5CMUA 4IYHA 1VP7A 4WFAV 5D5QA 4ZOLB 2YI9A 1S3JA 1FYJA 1D5NA 4GYCB 2UUCB 3OW2U 1P84F 1S72V 3RBZA 2ITCC 5FLXN 3TK1A 2HG5C 2BOBC 4OPHA 4LNUB 3B77A 1FS0G 1FFXA 3N2KB 1M1KW 4LF7B 4TQFA 2W0XA 1VQLV 4GT1A 2EZOA 1JQ0A 2ZQMA 3JD2A 2P06A 2Q73A 3CP1A 4O2BA 1WLEA 3ZHSA 1AB3A 4J42A 3CCRV 3K57A 1K73W 4JI8B 5FNVB 4JI2O 2P6JA 1QBZA 3SYQA 2QDOA 4YXWG 1Z5WA 4IL6Z 3N2GB 2W6IG 3E89A 3ZRXA 1H2KA 1WA8B 3K04A 4DUZB 2A9HA 1RP3B 5ITZA 3STZC 4W4KA 3OR6C 2HHHB 4I5SA 3J81N 3D36A 4LCUC 5CBHA 2B1IA 2ZR3A 4FVMA 5IJ0A 3VQXA 5KHJA 2UXCO 2BTQA 2YIAA 3CCSV 1TA8A 3WFVA 3CRMA 1P4RA 5B1BB 5JH7B 2QTOA 4ZOLA 2EZPA 4H0LB 3RYHB 1ZX3A 4JI4O 3MDSA 4U7OA 4OX9B 4JPRA 4YY3B 2WLMA 2Q68A 3SPJA 3K5OA 3JAMN 5CA1A 3B8MA 3KG2A 4FPPA 1JPXA 2ZXWB 3UQ8A 1H2MA 3RYCB 2OIGA 4GUNA 4DYLA 4CH6A 5C8YA 1VQKV 5IJ9B 4O2AA 3VQWA 2WLKA 4O2AB 2VQEB 4J80A 3QO5A 2AZ0A 4J10A 4EB6B 2GTSA 5IY5B 5JQGB 3JASB 2OTLV 2XUMA 3JATA 4B3TB 4JI7B 5KX5A 4JI0B 2H94A 1CPYA 1DLBA 3CS5A 3P3NA 3CPWU 2Y69C 3T4DA 1SQBH 1PM9A 2P4VA 4P9PA 3W7UA 1Q86W 1OCCB 5KMGB 5J2UB 3K5NA 3AK2A 1NR7A 1Q43A 2HP8A 4MVMA 1AR5A 3QG5A 1BMFG 5KAFZ 1OCCC 1WNSA 3RVYA 3CD6V 3K0DA 5B3SB 2CUGA 1K5QA 1BT8A 3RYHA 2YUAA 4A5UB 5LP6B 4J7ZA 5D5PA 4OX9O 4PHZA 3CCUV 1QLEC 3ZMZA 2QKSA 4I9WA 4RUEA 5DN6G 1XI1A 3ABUA 2AHZA 1HNWB 1Y66A 5LXTB 4PD4F 3FYEB 1Y6XA 1BE3H 3E22A 3E22B 3KKYA 3LDEA 4LBEC 1V55C 3JAKA 3DC5A 4BW5A 1XNRB 4XDJA 3N27A 1DGSA 2YXYA 1UFIA 4DV3B 1EZVH 1QR9A 4YHHB 1NH2D 3C3SA 3X2QB 3ASOB 1HNWO 2A3QA 5LGTA 1NT2B 2P4KA 1IBKO 4LF8O 1VF6A 2QGNA 2LGQA 4NB5A 1ZTEA 5B1OA 4DV6O 2ZM6O 1FFTB 3CEIA 2R9RB 2FB5A 1JR9A 4FJCC 4U7NA 1ZL8B 1N36B 1I94O 2VWKA 3OUSA 2JJ2G 3G6BA 1GMGA 3AG4B 1NU1H 4D7SA 4UCTA 5CA1B 1XBLA 3OR7C 4WBNB 4DR6O 2XAGA 1K9MW 1MABG 1Y74B 4X1YA 2ILMA 1L1FA 3FYIB 3CC2V 1SA0B 2B5UA 3SPHA 4U3JA 2XAJA 3CCVV 1SERA 1COWG 1TUBB 3HKCB 1V9PA 5LBQA 1XMQB 4DV7O 3G71V 4X88A 3ML0A 1KP2A 4N23A 2GDSA 1HP8A 4X1KB 4B3RB 1K92A 1SQXH 3CC7V 2DYSB 4B08A 3H01A 1Q6HA 3CRAA 5LXTA 3NXSA 3SJCC 1NR1A 2VWJA 2R9IA 4HYOA 2QA4V 5ITZB 3SJBC 4R8CA 4RO2A 1XHXA 1AI6A 4Z2WA 1SKVA 2UXBO 4PDLA 4FLXA 1P7BA 1K5SA 4FLWA 5H5NA 4NTXA 1XDCA 1VQMV 5L3CA 4F6EA 1VQOV 3THOA 3IGAC 4I50A 3D36C 4PDRA 1AP6A 4JZ2A 2PYLA 1HR0B 3P32A 4YIPA 3HKDB 2ODMA 5KHHA 5BMVA 4UV9A 1NH2B 1YSCA 3HPLC 2MW2B 1AI7A 3ETQA 4H44B 4LH7A 4TT3G 1WB8A 2P5OA 5EC1C 4C7UA 3T4ZA 2WLIB 1JMKC 5C8YB 3LNNA 1M57C 1SA0A 1T5EA 1YITV 5EZYB 2ZNJA 2Q67A 4GKJO 4X64O 3JD4A 1EBOA 4ZHQB 4JI4B 2HJDA 2WA3A 1VARA 3SPIA 4RQFA 5IWAB 2GV9A 1M56B 2CTWA 4DR5B 5KX5B 3ZN1A 3H1KH 1ROPA 2X7RB 2GSMB 1M9NA 5CB4A 2DOSA 4JI5B 1N34B 2N74A 1JVMA 4FLZA 1OZ0A 2UXBB 3ZX6A 4X62O 3AG2B 5IWAO 1MZEA 1WJZA 4LFBO 4MVSA 1I94B 2IJKA 2F23A 4J41A 1VIBA 1G4YB 3LUTB 4PA3A 2QKCA 1S5HC 1RM1B 1GM8A 1H38A 5C93A 4DR6B 2B1GA 3T1HO 3AEIA 4GKKO 5DM6V 3RT3C 2F43G 4MW3A 1SQPH 3IFXA 4MS2A 2IM9A 2EBOA 1K4CC 4LF8B 3SJQC 3AK3A 4KXRA 4MTFA 4DR7B 5EK0A 5HFLA 1OCRB 1B6QA 3RWRD 1OJHA 1NVPD 3OUFA 3BPZA 3DC6A 4LR3A 3U10A 1XHZA 1S5JA 5LGNA 1BS3A 3RYIB 2F66C 4MTOA 1L8DA 4G27B 2VRZA 3CJHA 1AI4A 2OYQA 1NVPB 2EINC 5KHIA 1VQ4V 2ADPA 4ABMA 1ZLZA 1D2DA 1YTFD 1IBMO 3JALB 4GX1A 5H9CA 3K06A 3OTFA 4NXNB 4JI7O 3ETDA 4JF3A 5GW7A 2LP7A 4P30A 2EIKC 1THZA 4JTAB 2M6YA 3E86A 1R6KA 4HNAB 2EINB 4HNAA 4JZGA 3AG2C 2HR3A 4KUMA 2ZT9B 1TVKA 2WSSG 4Z1VA 4PA6A 1EFRG 1KYOF 4JASA 4GKKB 2WAMA 4JI3B 1Z5VA 1FXHA 1GRJA 3SGIA 3K3WA 1M90W 1L0NH 1JX9A 3SPGA 4Q6GA 1VQPV 4JV5B 4LFAO 2QM4A 4O4JB 1DK1A 4CC5A 5KUKA 2XTAA 2PGGA 4FM0A 2QJ1A 4LF4B 1V54B 2FMLA 3F7VC 1W0KG 3STLC 4CH4A 5DECA 4TV8A 3KCXA 1QQCA 4DV3O 3SDLA 4DO2A 1JOYA 1EN5A 3RYFB 3BRCA 4IHJB 4EKWA 4FZ0A 1IBLO 4BIZA 2VQEO 2QWOB 1EN6A 3H1IH 2R72A 3GVMA 2ADQB 2A79B 5IYCO 2IJHA 1KP3A 1VF7A 2B9ZA 4JI1B 2FTKA 1ZSPA 3MHSC 4IIJA 1HNZB 3KZIZ 1Z2GA 4DV1B 3ZEDA 1Q81W 3A0HZ 2UXDB 4ZHQA 5EBLC 1BQ0A 1M5IA 5EYPA 5JCOA 1I7FA 1AI5A 1TUEB 5B1AC 1FXVA 4O4JA 5KUMA 2F95B 2P7TC 4JAVA 4DXWA 3U0ZA 1XEQA 1E1QG 4P9OA 1J5EO 3ZHUA 2DW4A 4FLYA 2X6CA 4MVUA 4PA9A 5BXZA 1IX9A 1ENVA 5IY5C 1TGOA 1MZFA 3CRQA 4WBNA 5IYZB 2JIZG 2Q7EA 2LJ2A 4E4EA 4DR1O 3JD3A 2ZE5A 1FXKC 3JCUZ 1KECA 3M99B 2YXLA 4J7KA 4LH6A 2KB1A 4DRXA 3GWOA 1BSMA 2WLNA 3QO7A 3SYPA 1R1BA 1R3JC 2OTJV 2W0FC 3BFRA 2E3CA 3TJTA 1NZ6A 1XNRO 1AJPA 4X20B 2ZCEA 4PV1B 1PPJH 3ASNC 4H33A 4HAMA 2RNBA 2L6LA 1XL6A 4QJFB 1MOFA 5JQGA 1OCOC 5J2TA 2UUAO 1M4UA 1LR1A 4MT8A 1FAFA 4XDKA 4DUZO 1N33O 3A0RA 3OE7G 4PI2A 3X2QC 4LC1A 3ABMC 3F7YC 2LW7A 5K1PA 2EULA 1JJ2U 4YJ2B 1P49A 2R70A 3OMIB 1Q6IA 4I55A 1Q3EA 4R50A 4DV5B 3CRCA 1VQNV 4WFBV 2PI4A 2P67A 2EX3A 3M7MX 4LF5B 2GBOA 5LMUO 1W59A 1FFXB 3N2KA 3P3PA 2IBZH 3F5WC 4B7EA 2LO1A 4DV7B 2YEVB 1QVGU 2ZD9A 1AVMA 2HVJC 4YJ3B 4DR2O 4P2ZA 1US6A 1VQ6V 2X0LA 4MW8A 1N0NA 2AW9A 2DYRC 3HKBB 3HKEA 4PA4A 1CP9A 4BWAA 5LP6C 1PKXA 2YSUB 1GN3A 1MNGA 3I55V 1Y4MA 1B04A 3N2GA 2Q4PA 2ZM6B 2XHBA 1KB9F 4I0XA 3C3TA 3CCQV 2GHYA 4IYIA 2ZIMA 1N36O 2BSKA 1FXKB 3H1LH 2XT9A 1PNMA 5L3EA 2A7WA 5IYZA 3Q4HB 5B1BC 5J2TB 1HNXO 2YS8A 3L74H 3AG3C 1XNQO 3E83A 1AR4A 3ABKB 4X1IA 3RYFA 5LOVA 2E74B 3OFNG 2OCHA 5B1NA 3HKDA 4CS4A 2H8PC 4YIOA 1NI8A 3BAAA 4UVBA 1ZAUA 4O4HA 3L73H 1H2LA 1RFYA 5GONB 2K1EA 3CSXA 3UKMA 3H1HH 2WLIA 4JI6O 5IJ9A 2CAZC 4NTYA 2WLHA 5EZYA 1K97A 1WB7A 3BHPA 2Q7GA 3L9DA 1NQTA 4QPKA 1I08A 4DW1A 3D3QA 2E76B 1YJNV 4FLVA 2RJZA 3ZJZA 1VF6C 4UCVA 4TQDA 5H2FZ 4KHPO 3K58A 1GN4A 3JAWB 4X62B 5KHGA 2JS3A 2F93B 2ZNIA 4LF9B 4JYAO 4OGQB 3OM3B 3SYAA 1E1RG 3CYOA 5KAIZ 1K34A 3AG1B 5DEDA 2QM8A 2UXDO 4DV4O 5LGUA 1GK9A 2RMKB 3CB2A 2WLJA 3OAAG 1RPOA 3ZRWA 1OHHG 4J7JA 5IJ0B 3TXQA 4X65O 1VQ8V 2OIEA 2ZE8A 2JJ1G 5LOVB 1N0JA 4DK0A 2AZ2A 4GKJB 4K3AA 4FMTA 5KLVH 3UO2A 1S77D 1KU9A 2VQFO 4I9QA 2WPDG 5IT9N 2DYSC 5LA6B 1M93A 4CH5A 4TWKA 2JEUA 2RQ6A 4K35A 5GONA 2Q5ZA 3DXRA 2F4VO 1OV9A 3MD0A 4LP8A 4F6RA 3ZN0A 3OT7A 2IH3C 2XNDG 3G4SV 4ZI7B 4MTGA 4JGSA 5B66Z 2EJRA 3ABKC 3WG7C 2NNUA 2LFRA 3PJSK 3OMNB 1O9GA 2CDYA 1PP9H 1VQ9V 1U97A 4CH3A 1SS3A 2HEPA 3NR7A 2UXNA 5L3BA 4LFBB 1VMGA 3CJHB 3ZRVA 4JI8O 3KCYA 4UFZA 1M57B 1VF5B 1PNKA 2CH7B 1ZUQA 3ZMUA 2OCCB 3E8BA 5LL6Y 1WPBA 3JALA 4JYAB 3JARB 3WG7B 1A32A 1VEWA 3OEHG 2WWWA 3OEEG 1J5EB 5CBGA 4B3MB 1XILA 2BCCH 4U3FH 4FIPC 4JYBA 1UJWB 2K9PA 5H6RA 2PI5A 1NS1A 4IGGA 2N04A 2QR4A 1URFA 2CTQA 5EC2C 5LHHA 3K08A 3T2MA 4CBCA 3JAWA 3D8CA 1SESA 4W4LA 4J9YB 1NKDA 2XASA 3L72H 3K79A 3OGIB 1GKFA 4DR3B 5KMGA 3RFRA 3ZRWB 1YJ9V 3VQVA 5EIBC 4BIUA 2HHHO 1PD3A 5JH7A 2DWDC 2QKAA 2H3OA 5LYJA 2DJVA 3JARA 4KHPB 4X65B 3I56V 4QIWF 3R65A 4HBNA 1PL0A 1Q90D 3ASOC 5GTHZ 2GTAA 3DXRB 1EZJA 3AG4C 4LF9O 3RYCA 2VQFB 1YIJV 1R3LC 3CMEV 1G6UA 1KMIZ 2JGUA 2PF4E 4ZI7A 3UCSC 2QTSA 3D3IA 4IIJB 1TUBA 4LF5O 2MK3A 1SC5B 3RW0A 2P90A 5A2QN 4BIOA 1HDJA 1YDXA 4MVZA 2Z5UA 3JYCA 2N05A 1WP7A 5CA0A 4B3SO 2XAQA 1OCZC 4L8JA 4QE9A 4TV9A 3VOUA 2YI8A 3B40A 4JI6B 4LF7O 2KG7B 2PY5A 1ZL8A 4H37A 4BAYA 4KP4A 2EIMC 2Y0IA 1Q8IA 5H6QA 2BSKB 1N4CA 4FFBB 4LF6O 4LFCB 2XAFA 4E2LA 2Q69A 2Y4UA 4DR1B 4B3SB 1YJWV 3CHXA 4G28B 1IBMB 2BTQB 4I50B 4JI1O 1NTMH 2DWEC 4FM2A 2EIMB 1MG1A 3ABLC 4NVPA 5KHKA 4J11A 4JI3O 4DRXB 1JJOA 1ZWIC 1H2SB 4B7KA 4R6ZA 4PJ0Z 3BA9A 1VQ7V 4WFGA 3FAVB 3SYCA 4NTWA 1N33B 4JV5O 4NR1A 2R9AA 4X20A 1BCCH 1GM9A 2E5LB 2LW1A 4K0KB 3L71H 1JCHA 2CGOA 1KKDA 4QE7A 1QNMA 2QWNB 1QR8A 1FJGB 2HVKC 4EFEA 3IC9A 2DN9A 3K5LA 2UU9O 1GN6A 1NTKH 2QSAA 5HFMA 3ZCCA 2DQ0A 1F23A 2JS5A 2EIKB 2BTOA 4PDVA 3OTOO 4X66O 4UCOA 4RUFA 2Q9LA 4RAIA 1PV0A 1XREA 5KA5A 4DR2B 1I0HA 4I4TA 1MSWD 4LWSB 1YTFB 4O4IB 4O4IA 1SZTA 1I5YA 3ABTA 2Y69B 2QWPB 1R6TA 3AG7A 2JK5C 4I7ZB 4DR3O 4YHHO 4DK1A 1W0JG 5L3FA 4FLUA 5L3DA 2CE4A 1XUQA 4D6TH 3ZMVA 3WB2A 1XMOB 3FB5C 4WFEA 4DV2B 1D5AA 1FPOA 4AHCA 1HNXB 1Q5OA 1R73A 5JJEB 1AP5A 3MAQA 1W2BU 1BQZA 4O4LA 2FL4A 2GUZA 3IAYA 4KFMA 1BHBA 3K5MA 3IJ4A 4JAAA 2F1MA 2QEXV 1EM1A 3E8FA 1H8HG 3B2EE 1Y67A 2ARHA 3JD1A 3APOA 5LYJB 2E75B 1GH6A 4I55B 5E79Z 3ICXA 5TISZ 1GO3F 2WLLA 3OTOB 3ZBHA 3LDCA 3LSSA 4B3RO 1AJNA 2IJIA 1S5LZ 1LNQA 1HR0O 1IDSA 3EHBB 4RQEA 3ZHRA 1YXBA 4AILC 1SZXA 1SQGA 3FKSG 1TVKB 1RSOB 3GB7C 2Y0PA 4EEQA 4J9ZB 2PZSA 3TGUH 5JVDA 2JGDB 3ZMTA 3L70H 5FNVA 2DE0X 4UUJC 4DV4B 4NXMO 2Y48A 5BR8B 2X6BA 1P7GA 4AQYO 1IXMA 1AJQA 5B3SC 3S3XA 1QHTA 4CS3A 2Q8VA 4JTCB 4XDLA 3O65A 1SQQH 4FM1A 1SF9A 3BCCH 3WU2Z 2D3OW 3WB1A 3CX5F 4PI0A 4GCZA 3P30A 2LQTA 1VQ5V 4NXMB 1IVSA 2RN9A 3F5TA 3B09A 5BR8O 4AQYB 3G67A 5J2UA 3A8TA 1K7DA 1Y74A 4X1YB 3K59A 4XBFA 2OWOA 4PA7A 2EILB 2JVDA 2ATKC 4MVQA 4X64B 4CZZA 4DR7O 1CEZA 2EIJC 5BMVB 5LP6A 2IU3A 3G6EV 4FK5C 1BL8A 4LF6B 2A0LA 5CA3A 1YI2V 3PN1A 4JYCA 3U11A 4L87A 3WB0A 5FPOA 3FAVA 4CS2A 2EILC 1PNLA 5EBMC 2V4DA 3GWKC 2XOKG 2YC0A 3H1JH 1KKCA 1NBMG 4X9QA 1JA8A 3HR0A 1LUWA 1V55B 3QVNA 3FX7A 2ZDIC 4KL1A 1BGYH 5EYPB 1AILA 3SPCA 4DW0A 1Q7YW 4RWUA 2KSDA 3JD0A 2QWRB 4DV6B 1H2NA 2CH7A 1JFFB 3ETGA 4H13B 1R6NA 3AK1A 3QO8A 4DUYB 3SJAC 5GTIZ 5K1XA 1WPXA 2WLLB 1S76D 2DYRB 4FFBA 2FKXA 4UB8Z 3ZS8C 5L3GA 2AXTZ 5JCOC 3SYOA 2C2AA 2UXXA 1H8EG 1KQSU 1M56C 3G80A 2Q0AA 2QWQB 2YDEA 5LMNB 3DGEA 1BHAA 4YJ3A 2ZR2A 1XL4A 3CCMV 3T1YB 2CGNA 3C90A 5BZBA 4FLTA 4YY3O 1QCEA 4LF4O 3BA8A 5CBFA 3M8AA 4TV9B 3TETA 1RM1C 5IYDO 3IC7A 5E1AC 2KG7A 4I0XB 1WA8A 4R7CA 4DV0O 3ZRSA 3JAKB 2GUZB 2EIJB 3JSNA 2HFEC 5BY1A 1QLNA 3TCUA 3A0BZ 1K33A 1G1XB 4CC6A 2YXHA 2IJJA 4B3TO 1B3QA 3E2EA 4DV0B 2HKOA 1CXZB 1L0LH 2Z0AA 1QLEB 1LUVA 1X59A 4EFBA 4FZ1A 2EJ7A 5KA6A 4PDMA 2OCCC 3ZHVA 5LA6A 2ITDC 1XMQO 1F4MA 1HNZO 2ZDIA 3BVOA 1OCOB 4TUYB 1YVWA 3LSUA 4LWSA 3B4SA 1N32B 4UVAA 4MVOA 1Q82W 4U3JB 2A06H 3S3WA 2M7WA 2RDCA 4BW9A 3CC4V 4TSFG 3DSQA 3BABA 3EFFK 3VQYA 2X6AA 5AG2A 4UCRA 2JGDA 3HKBA 4DV1O 3HB3B 1K3EA 2DQ3A 3R66A 3JATB 1KBHA 5CA0B 1JFFA 3CCJV 3LNMB 5B5EZ 1ORQC 2UUCO 4LFCO 5CB4B 1F51A 2HLDG 3OD4A 5JWPA 4NKGB 3BY6A 1GN2A 1Y76A 5IDJA 3W7WA 3UM7A 3E8GA 4TV8B 1XQ8A 2LGWA 1NTZH 3FFQA 1IXBA 3CCEV 4MTXA 3A2FA 1EN4A 2XAHA 1QU7A 3UT5A 3SR2C 4F4LA 4UXNA 2Q0OC 2ZE6A 2KKWA 3H9VA 4BR6A 1AR1B 5LMNO 3AG1C 4WFHA 1NJIW 3QTCA 3E8HA 2V1DA 3T1YO 2ZINA 3RGBA 3ZHQA 4TUYA 1MSDA 4Z1MG 4F6RB 2QE7G 3B8NA 4GX0A 1OCRC 3UO3A 4GLXA 4JAUA 5JJJB 2PYJA 1F7YA 5EBWC 5F2VO 1SETA 4Q20A 3RYIA 1FJGO 5FL7G 3CWBH 3Q4HA 3LDDA 3FB6C 2UU9B 4X89A 1AROP 4YJ2A 4ICGA 1SQVH 3FB7C 2L35A 1N34O 4JI5O 3FD9A 3OGCC 4FFKA 3CXHF 3QF7A 1MMMA 5LHIA 3W7SA 1X4TA 2JEXA 2AHYA 1YEWA 3RN4A 3OMAB 3L75H 2ETNA 2O57A 3CCLV 3CE2A 4JI2B 3O9OA 2ZIOA 2IW5A 1U96A 3CMAV 5LHGA 4LNUA 4WCEV 2RCVA 2Y4TA 1I5XA 2Z3YA 2NLJC 1PL4A 1J95A 2YEVA 2JRIA 1YF2A 3MHHC 3UT5B 5FPRA 2ZKOA 1N32O 3K9AA 4JTDB 4OPAA 3BEHA 4K0KO 4JI0O 3W7TA 1UPGA 1DTOA 2VS0A 4X1KA 1BZKA
chains in the Genus database with same CATH topology
4LFAO 4DR1O 1DK1A 4X65O 4JI1O 1KUQA 4DR4O 4DV5O 3T1HO 4GKKO 4DR7O 1N36O 3RT3C 4A5UB 3J80N 4DV0O 2UXBO 2VQFO 5LMNO 5IT9N 3J81N 4OX9O 4JI3O 5H5NA 5BY1A 3T1YO 1R1BA 1G1XB 2UXCO 2F4VO 1HNXO 2HHHO 4B3TO 4DV3O 3SDLA 1XNQO 1YZBA 2UUBO 1XNRO 4JV5O 4NXNO 2Z0AA 1F7YA 2DJVA 2AGAA 1IBLO 1X59A 2VQEO 4JI4O 2E5LO 1XMOO 4B3RO 1FJGO 1HNWO 3JAMN 1XMQO 4DUYO 1HNZO 1HR0O 2UUAO 1AILA 4JI8O 1IBKO 4LF8O 4DUZO 1N33O 4LF9O 4JI6O 2LW7A 4DV6O 2ZM6O 4DV2O 1FKAO 1N34O 4JI5O 1D2DA 2UU9O 5LL6Y 1IBMO 4LF5O 1FYJA 4GKJO 1I94O 4X64O 4JI7O 3OTOO 4X66O 5A2QN 1A32A 2FKXA 4KHPO 4B3MO 5FLXN 4DR6O 4DV1O 4OPHA 4NXMO 5LMUO 3R66A 4AQYO 4B3SO 2UUCO 4LF7O 4LFCO 4JYAO 4DR2O 2JRIA 1NS1A 1R6TA 2DOSA 1XEQA 3O65A 1J5EO 1AB3A 2N74A 4DR3O 4DV7O 4DR5O 2ZKOA 1N32O 4YHHO 4LF6O 4OPAA 4YY3O 5BXZA 3J7AU 4K0KO 2UXDO 4JI0O 4X62O 4DV4O 3F5TA 5IWAO 5BR8O 4LFBO 4LF4O 4JI2O 3M8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA O;  4DR1 O;  1DK1 A;  4X65 O;  4JI1 O;  1KUQ A;  4DR4 O;  4DV5 O;  3T1H O;  4GKK O;  4DR7 O;  1N36 O;  3RT3 C;  4A5U B;  3J80 N;  4DV0 O;  2UXB O;  2VQF O;  5LMN O;  5IT9 N;  3J81 N;  4OX9 O;  4JI3 O;  5H5N A;  5BY1 A;  3T1Y O;  1R1B A;  1G1X B;  2UXC O;  2F4V O;  1HNX O;  2HHH O;  4B3T O;  4DV3 O;  3SDL A;  1XNQ O;  1YZB A;  2UUB O;  1XNR O;  4JV5 O;  4NXN O;  2Z0A A;  1F7Y A;  2DJV A;  2AGA A;  1IBL O;  1X59 A;  2VQE O;  4JI4 O;  2E5L O;  1XMO O;  4B3R O;  1FJG O;  1HNW O;  3JAM N;  1XMQ O;  4DUY O;  1HNZ O;  1HR0 O;  2UUA O;  1AIL A;  4JI8 O;  1IBK O;  4LF8 O;  4DUZ O;  1N33 O;  4LF9 O;  4JI6 O;  2LW7 A;  4DV6 O;  2ZM6 O;  4DV2 O;  1FKA O;  1N34 O;  4JI5 O;  1D2D A;  2UU9 O;  5LL6 Y;  1IBM O;  4LF5 O;  1FYJ A;  4GKJ O;  1I94 O;  4X64 O;  4JI7 O;  3OTO O;  4X66 O;  5A2Q N;  1A32 A;  2FKX A;  4KHP O;  4B3M O;  5FLX N;  4DR6 O;  4DV1 O;  4OPH A;  4NXM O;  5LMU O;  3R66 A;  4AQY O;  4B3S O;  2UUC O;  4LF7 O;  4LFC O;  4JYA O;  4DR2 O;  2JRI A;  1NS1 A;  1R6T A;  2DOS A;  1XEQ A;  3O65 A;  1J5E O;  1AB3 A;  2N74 A;  4DR3 O;  4DV7 O;  4DR5 O;  2ZKO A;  1N32 O;  4YHH O;  4LF6 O;  4OPA A;  4YY3 O;  5BXZ A;  3J7A U;  4K0K O;  2UXD O;  4JI0 O;  4X62 O;  4DV4 O;  3F5T A;  5IWA O;  5BR8 O;  4LFB O;  4LF4 O;  4JI2 O;  3M8A A; 
#chains in the Genus database with same CATH topology
 4K8Z A;  4K8X A;  1KUQ A;  3APQ A;  2Q6A A;  4QNH B;  4WF9 V;  4DV5 O;  1K8A W;  1WP8 A;  2PTM A;  4NYK A;  2WA4 A;  1FXK A;  1RPR A;  1TAE A;  4TOI A;  1Y76 B;  2YIC A;  2BOC C;  3I5D A;  3EXA A;  1S0V A;  2FYU H;  5LMU B;  1O9H A;  2P22 C;  4GZR B;  4UCS A;  4OXS A;  1WAZ A;  4WFF A;  2ZE7 A;  4HZ3 A;  4IT5 A;  4UVC A;  2BE3 A;  3CXC U;  2UUB O;  4X1I B;  5EIB D;  4ZBM A;  4IHJ A;  4NXN O;  1GTO A;  1IZ3 A;  4ZKI A;  3E35 A;  1XNQ B;  2LFS A;  4O4H B;  5A9G A;  5IE9 A;  1YCI A;  3W7X A;  4DUY O;  3K03 A;  3K0G A;  5B1A B;  2Q7H A;  2UUB B;  4QGP A;  4ZIB A;  4QPJ A;  3EVK A;  1WN7 A;  4DV2 O;  3ZIA G;  3RVZ A;  1MA1 A;  5IYB O;  1FKA O;  2UXC B;  1RSO A;  1XOU A;  2ZXW C;  3T1H B;  1R3I C;  4O2B B;  1GM7 A;  1R3K C;  4MVR A;  4EB6 A;  4MSW C;  1FD9 A;  4B3M O;  3HKE B;  3VBB A;  4LFA B;  4X8A A;  5J9P C;  3JSL A;  2YIB A;  3T1C A;  4GX2 A;  1HW7 A;  2F4V B;  2HJF C;  1N8R W;  2CTR A;  4DR5 O;  2CTP A;  3CRR A;  2OT5 A;  5CN0 A;  4DR4 B;  2NR5 A;  1GAX A;  2V7Q G;  1HWY A;  3J7A U;  3LSQ A;  4GX5 A;  4PEL A;  2YID A;  2NN4 A;  3K9S A;  4I4T B;  4N21 A;  2PUS A;  1OCZ B;  3ETE A;  4UCU A;  4JYY A;  4AI8 A;  4ASU G;  1IBL B;  4X66 B;  2JDI G;  2KQX A;  2QM7 A;  3HKC A;  4DR4 O;  1K4D C;  2UUA B;  3J80 N;  1V54 C;  4D7T A;  1YHQ V;  3FB8 C;  1KD1 W;  1KC8 W;  2G38 A;  1SRY A;  4G2K A;  3ZMS A;  4UV8 A;  3TXS A;  3DTU B;  1E79 G;  2YIB D;  2W6J G;  1IBK B;  3QNE A;  1G8M A;  3AG3 B;  5JJN B;  3ABM B;  1QVF U;  1F4N A;  1YZB A;  2IU0 A;  2D2C B;  2CK3 G;  2DMX A;  4O4L B;  2AGA A;  2IH1 C;  1Q6U A;  1DF5 A;  1B06 A;  3ABL B;  2E5L O;  1XMO O;  4UB6 Z;  5JVD B;  1IUR A;  1H2G A;  3ASN B;  3JCZ A;  3ZHT A;  3JAS A;  1SQF A;  1DF4 A;  5CMU A;  4IYH A;  1VP7 A;  4WFA V;  5D5Q A;  4ZOL B;  2YI9 A;  1S3J A;  1FYJ A;  1D5N A;  4GYC B;  2UUC B;  3OW2 U;  1P84 F;  1S72 V;  3RBZ A;  2ITC C;  5FLX N;  3TK1 A;  2HG5 C;  2BOB C;  4OPH A;  4LNU B;  3B77 A;  1FS0 G;  1FFX A;  3N2K B;  1M1K W;  4LF7 B;  4TQF A;  2W0X A;  1VQL V;  4GT1 A;  2EZO A;  1JQ0 A;  2ZQM A;  3JD2 A;  2P06 A;  2Q73 A;  3CP1 A;  4O2B A;  1WLE A;  3ZHS A;  1AB3 A;  4J42 A;  3CCR V;  3K57 A;  1K73 W;  4JI8 B;  5FNV B;  4JI2 O;  2P6J A;  1QBZ A;  3SYQ A;  2QDO A;  4YXW G;  1Z5W A;  4IL6 Z;  3N2G B;  2W6I G;  3E89 A;  3ZRX A;  1H2K A;  1WA8 B;  3K04 A;  4DUZ B;  2A9H A;  1RP3 B;  5ITZ A;  3STZ C;  4W4K A;  3OR6 C;  2HHH B;  4I5S A;  3J81 N;  3D36 A;  4LCU C;  5CBH A;  2B1I A;  2ZR3 A;  4FVM A;  5IJ0 A;  3VQX A;  5KHJ A;  2UXC O;  2BTQ A;  2YIA A;  3CCS V;  1TA8 A;  3WFV A;  3CRM A;  1P4R A;  5B1B B;  5JH7 B;  2QTO A;  4ZOL A;  2EZP A;  4H0L B;  3RYH B;  1ZX3 A;  4JI4 O;  3MDS A;  4U7O A;  4OX9 B;  4JPR A;  4YY3 B;  2WLM A;  2Q68 A;  3SPJ A;  3K5O A;  3JAM N;  5CA1 A;  3B8M A;  3KG2 A;  4FPP A;  1JPX A;  2ZXW B;  3UQ8 A;  1H2M A;  3RYC B;  2OIG A;  4GUN A;  4DYL A;  4CH6 A;  5C8Y A;  1VQK V;  5IJ9 B;  4O2A A;  3VQW A;  2WLK A;  4O2A B;  2VQE B;  4J80 A;  3QO5 A;  2AZ0 A;  4J10 A;  4EB6 B;  2GTS A;  5IY5 B;  5JQG B;  3JAS B;  2OTL V;  2XUM A;  3JAT A;  4B3T B;  4JI7 B;  5KX5 A;  4JI0 B;  2H94 A;  1CPY A;  1DLB A;  3CS5 A;  3P3N A;  3CPW U;  2Y69 C;  3T4D A;  1SQB H;  1PM9 A;  2P4V A;  4P9P A;  3W7U A;  1Q86 W;  1OCC B;  5KMG B;  5J2U B;  3K5N A;  3AK2 A;  1NR7 A;  1Q43 A;  2HP8 A;  4MVM A;  1AR5 A;  3QG5 A;  1BMF G;  5KAF Z;  1OCC C;  1WNS A;  3RVY A;  3CD6 V;  3K0D A;  5B3S B;  2CUG A;  1K5Q A;  1BT8 A;  3RYH A;  2YUA A;  4A5U B;  5LP6 B;  4J7Z A;  5D5P A;  4OX9 O;  4PHZ A;  3CCU V;  1QLE C;  3ZMZ A;  2QKS A;  4I9W A;  4RUE A;  5DN6 G;  1XI1 A;  3ABU A;  2AHZ A;  1HNW B;  1Y66 A;  5LXT B;  4PD4 F;  3FYE B;  1Y6X A;  1BE3 H;  3E22 A;  3E22 B;  3KKY A;  3LDE A;  4LBE C;  1V55 C;  3JAK A;  3DC5 A;  4BW5 A;  1XNR B;  4XDJ A;  3N27 A;  1DGS A;  2YXY A;  1UFI A;  4DV3 B;  1EZV H;  1QR9 A;  4YHH B;  1NH2 D;  3C3S A;  3X2Q B;  3ASO B;  1HNW O;  2A3Q A;  5LGT A;  1NT2 B;  2P4K A;  1IBK O;  4LF8 O;  1VF6 A;  2QGN A;  2LGQ A;  4NB5 A;  1ZTE A;  5B1O A;  4DV6 O;  2ZM6 O;  1FFT B;  3CEI A;  2R9R B;  2FB5 A;  1JR9 A;  4FJC C;  4U7N A;  1ZL8 B;  1N36 B;  1I94 O;  2VWK A;  3OUS A;  2JJ2 G;  3G6B A;  1GMG A;  3AG4 B;  1NU1 H;  4D7S A;  4UCT A;  5CA1 B;  1XBL A;  3OR7 C;  4WBN B;  4DR6 O;  2XAG A;  1K9M W;  1MAB G;  1Y74 B;  4X1Y A;  2ILM A;  1L1F A;  3FYI B;  3CC2 V;  1SA0 B;  2B5U A;  3SPH A;  4U3J A;  2XAJ A;  3CCV V;  1SER A;  1COW G;  1TUB B;  3HKC B;  1V9P A;  5LBQ A;  1XMQ B;  4DV7 O;  3G71 V;  4X88 A;  3ML0 A;  1KP2 A;  4N23 A;  2GDS A;  1HP8 A;  4X1K B;  4B3R B;  1K92 A;  1SQX H;  3CC7 V;  2DYS B;  4B08 A;  3H01 A;  1Q6H A;  3CRA A;  5LXT A;  3NXS A;  3SJC C;  1NR1 A;  2VWJ A;  2R9I A;  4HYO A;  2QA4 V;  5ITZ B;  3SJB C;  4R8C A;  4RO2 A;  1XHX A;  1AI6 A;  4Z2W A;  1SKV A;  2UXB O;  4PDL A;  4FLX A;  1P7B A;  1K5S A;  4FLW A;  5H5N A;  4NTX A;  1XDC A;  1VQM V;  5L3C A;  4F6E A;  1VQO V;  3THO A;  3IGA C;  4I50 A;  3D36 C;  4PDR A;  1AP6 A;  4JZ2 A;  2PYL A;  1HR0 B;  3P32 A;  4YIP A;  3HKD B;  2ODM A;  5KHH A;  5BMV A;  4UV9 A;  1NH2 B;  1YSC A;  3HPL C;  2MW2 B;  1AI7 A;  3ETQ A;  4H44 B;  4LH7 A;  4TT3 G;  1WB8 A;  2P5O A;  5EC1 C;  4C7U A;  3T4Z A;  2WLI B;  1JMK C;  5C8Y B;  3LNN A;  1M57 C;  1SA0 A;  1T5E A;  1YIT V;  5EZY B;  2ZNJ A;  2Q67 A;  4GKJ O;  4X64 O;  3JD4 A;  1EBO A;  4ZHQ B;  4JI4 B;  2HJD A;  2WA3 A;  1VAR A;  3SPI A;  4RQF A;  5IWA B;  2GV9 A;  1M56 B;  2CTW A;  4DR5 B;  5KX5 B;  3ZN1 A;  3H1K H;  1ROP A;  2X7R B;  2GSM B;  1M9N A;  5CB4 A;  2DOS A;  4JI5 B;  1N34 B;  2N74 A;  1JVM A;  4FLZ A;  1OZ0 A;  2UXB B;  3ZX6 A;  4X62 O;  3AG2 B;  5IWA O;  1MZE A;  1WJZ A;  4LFB O;  4MVS A;  1I94 B;  2IJK A;  2F23 A;  4J41 A;  1VIB A;  1G4Y B;  3LUT B;  4PA3 A;  2QKC A;  1S5H C;  1RM1 B;  1GM8 A;  1H38 A;  5C93 A;  4DR6 B;  2B1G A;  3T1H O;  3AEI A;  4GKK O;  5DM6 V;  3RT3 C;  2F43 G;  4MW3 A;  1SQP H;  3IFX A;  4MS2 A;  2IM9 A;  2EBO A;  1K4C C;  4LF8 B;  3SJQ C;  3AK3 A;  4KXR A;  4MTF A;  4DR7 B;  5EK0 A;  5HFL A;  1OCR B;  1B6Q A;  3RWR D;  1OJH A;  1NVP D;  3OUF A;  3BPZ A;  3DC6 A;  4LR3 A;  3U10 A;  1XHZ A;  1S5J A;  5LGN A;  1BS3 A;  3RYI B;  2F66 C;  4MTO A;  1L8D A;  4G27 B;  2VRZ A;  3CJH A;  1AI4 A;  2OYQ A;  1NVP B;  2EIN C;  5KHI A;  1VQ4 V;  2ADP A;  4ABM A;  1ZLZ A;  1D2D A;  1YTF D;  1IBM O;  3JAL B;  4GX1 A;  5H9C A;  3K06 A;  3OTF A;  4NXN B;  4JI7 O;  3ETD A;  4JF3 A;  5GW7 A;  2LP7 A;  4P30 A;  2EIK C;  1THZ A;  4JTA B;  2M6Y A;  3E86 A;  1R6K A;  4HNA B;  2EIN B;  4HNA A;  4JZG A;  3AG2 C;  2HR3 A;  4KUM A;  2ZT9 B;  1TVK A;  2WSS G;  4Z1V A;  4PA6 A;  1EFR G;  1KYO F;  4JAS A;  4GKK B;  2WAM A;  4JI3 B;  1Z5V A;  1FXH A;  1GRJ A;  3SGI A;  3K3W A;  1M90 W;  1L0N H;  1JX9 A;  3SPG A;  4Q6G A;  1VQP V;  4JV5 B;  4LFA O;  2QM4 A;  4O4J B;  1DK1 A;  4CC5 A;  5KUK A;  2XTA A;  2PGG A;  4FM0 A;  2QJ1 A;  4LF4 B;  1V54 B;  2FML A;  3F7V C;  1W0K G;  3STL C;  4CH4 A;  5DEC A;  4TV8 A;  3KCX A;  1QQC A;  4DV3 O;  3SDL A;  4DO2 A;  1JOY A;  1EN5 A;  3RYF B;  3BRC A;  4IHJ B;  4EKW A;  4FZ0 A;  1IBL O;  4BIZ A;  2VQE O;  2QWO B;  1EN6 A;  3H1I H;  2R72 A;  3GVM A;  2ADQ B;  2A79 B;  5IYC O;  2IJH A;  1KP3 A;  1VF7 A;  2B9Z A;  4JI1 B;  2FTK A;  1ZSP A;  3MHS C;  4IIJ A;  1HNZ B;  3KZI Z;  1Z2G A;  4DV1 B;  3ZED A;  1Q81 W;  3A0H Z;  2UXD B;  4ZHQ A;  5EBL C;  1BQ0 A;  1M5I A;  5EYP A;  5JCO A;  1I7F A;  1AI5 A;  1TUE B;  5B1A C;  1FXV A;  4O4J A;  5KUM A;  2F95 B;  2P7T C;  4JAV A;  4DXW A;  3U0Z A;  1XEQ A;  1E1Q G;  4P9O A;  1J5E O;  3ZHU A;  2DW4 A;  4FLY A;  2X6C A;  4MVU A;  4PA9 A;  5BXZ A;  1IX9 A;  1ENV A;  5IY5 C;  1TGO A;  1MZF A;  3CRQ A;  4WBN A;  5IYZ B;  2JIZ G;  2Q7E A;  2LJ2 A;  4E4E A;  4DR1 O;  3JD3 A;  2ZE5 A;  1FXK C;  3JCU Z;  1KEC A;  3M99 B;  2YXL A;  4J7K A;  4LH6 A;  2KB1 A;  4DRX A;  3GWO A;  1BSM A;  2WLN A;  3QO7 A;  3SYP A;  1R1B A;  1R3J C;  2OTJ V;  2W0F C;  3BFR A;  2E3C A;  3TJT A;  1NZ6 A;  1XNR O;  1AJP A;  4X20 B;  2ZCE A;  4PV1 B;  1PPJ H;  3ASN C;  4H33 A;  4HAM A;  2RNB A;  2L6L A;  1XL6 A;  4QJF B;  1MOF A;  5JQG A;  1OCO C;  5J2T A;  2UUA O;  1M4U A;  1LR1 A;  4MT8 A;  1FAF A;  4XDK A;  4DUZ O;  1N33 O;  3A0R A;  3OE7 G;  4PI2 A;  3X2Q C;  4LC1 A;  3ABM C;  3F7Y C;  2LW7 A;  5K1P A;  2EUL A;  1JJ2 U;  4YJ2 B;  1P49 A;  2R70 A;  3OMI B;  1Q6I A;  4I55 A;  1Q3E A;  4R50 A;  4DV5 B;  3CRC A;  1VQN V;  4WFB V;  2PI4 A;  2P67 A;  2EX3 A;  3M7M X;  4LF5 B;  2GBO A;  5LMU O;  1W59 A;  1FFX B;  3N2K A;  3P3P A;  2IBZ H;  3F5W C;  4B7E A;  2LO1 A;  4DV7 B;  2YEV B;  1QVG U;  2ZD9 A;  1AVM A;  2HVJ C;  4YJ3 B;  4DR2 O;  4P2Z A;  1US6 A;  1VQ6 V;  2X0L A;  4MW8 A;  1N0N A;  2AW9 A;  2DYR C;  3HKB B;  3HKE A;  4PA4 A;  1CP9 A;  4BWA A;  5LP6 C;  1PKX A;  2YSU B;  1GN3 A;  1MNG A;  3I55 V;  1Y4M A;  1B04 A;  3N2G A;  2Q4P A;  2ZM6 B;  2XHB A;  1KB9 F;  4I0X A;  3C3T A;  3CCQ V;  2GHY A;  4IYI A;  2ZIM A;  1N36 O;  2BSK A;  1FXK B;  3H1L H;  2XT9 A;  1PNM A;  5L3E A;  2A7W A;  5IYZ A;  3Q4H B;  5B1B C;  5J2T B;  1HNX O;  2YS8 A;  3L74 H;  3AG3 C;  1XNQ O;  3E83 A;  1AR4 A;  3ABK B;  4X1I A;  3RYF A;  5LOV A;  2E74 B;  3OFN G;  2OCH A;  5B1N A;  3HKD A;  4CS4 A;  2H8P C;  4YIO A;  1NI8 A;  3BAA A;  4UVB A;  1ZAU A;  4O4H A;  3L73 H;  1H2L A;  1RFY A;  5GON B;  2K1E A;  3CSX A;  3UKM A;  3H1H H;  2WLI A;  4JI6 O;  5IJ9 A;  2CAZ C;  4NTY A;  2WLH A;  5EZY A;  1K97 A;  1WB7 A;  3BHP A;  2Q7G A;  3L9D A;  1NQT A;  4QPK A;  1I08 A;  4DW1 A;  3D3Q A;  2E76 B;  1YJN V;  4FLV A;  2RJZ A;  3ZJZ A;  1VF6 C;  4UCV A;  4TQD A;  5H2F Z;  4KHP O;  3K58 A;  1GN4 A;  3JAW B;  4X62 B;  5KHG A;  2JS3 A;  2F93 B;  2ZNI A;  4LF9 B;  4JYA O;  4OGQ B;  3OM3 B;  3SYA A;  1E1R G;  3CYO A;  5KAI Z;  1K34 A;  3AG1 B;  5DED A;  2QM8 A;  2UXD O;  4DV4 O;  5LGU A;  1GK9 A;  2RMK B;  3CB2 A;  2WLJ A;  3OAA G;  1RPO A;  3ZRW A;  1OHH G;  4J7J A;  5IJ0 B;  3TXQ A;  4X65 O;  1VQ8 V;  2OIE A;  2ZE8 A;  2JJ1 G;  5LOV B;  1N0J A;  4DK0 A;  2AZ2 A;  4GKJ B;  4K3A A;  4FMT A;  5KLV H;  3UO2 A;  1S77 D;  1KU9 A;  2VQF O;  4I9Q A;  2WPD G;  5IT9 N;  2DYS C;  5LA6 B;  1M93 A;  4CH5 A;  4TWK A;  2JEU A;  2RQ6 A;  4K35 A;  5GON A;  2Q5Z A;  3DXR A;  2F4V O;  1OV9 A;  3MD0 A;  4LP8 A;  4F6R A;  3ZN0 A;  3OT7 A;  2IH3 C;  2XND G;  3G4S V;  4ZI7 B;  4MTG A;  4JGS A;  5B66 Z;  2EJR A;  3ABK C;  3WG7 C;  2NNU A;  2LFR A;  3PJS K;  3OMN B;  1O9G A;  2CDY A;  1PP9 H;  1VQ9 V;  1U97 A;  4CH3 A;  1SS3 A;  2HEP A;  3NR7 A;  2UXN A;  5L3B A;  4LFB B;  1VMG A;  3CJH B;  3ZRV A;  4JI8 O;  3KCY A;  4UFZ A;  1M57 B;  1VF5 B;  1PNK A;  2CH7 B;  1ZUQ A;  3ZMU A;  2OCC B;  3E8B A;  5LL6 Y;  1WPB A;  3JAL A;  4JYA B;  3JAR B;  3WG7 B;  1A32 A;  1VEW A;  3OEH G;  2WWW A;  3OEE G;  1J5E B;  5CBG A;  4B3M B;  1XIL A;  2BCC H;  4U3F H;  4FIP C;  4JYB A;  1UJW B;  2K9P A;  5H6R A;  2PI5 A;  1NS1 A;  4IGG A;  2N04 A;  2QR4 A;  1URF A;  2CTQ A;  5EC2 C;  5LHH A;  3K08 A;  3T2M A;  4CBC A;  3JAW A;  3D8C A;  1SES A;  4W4L A;  4J9Y B;  1NKD A;  2XAS A;  3L72 H;  3K79 A;  3OGI B;  1GKF A;  4DR3 B;  5KMG A;  3RFR A;  3ZRW B;  1YJ9 V;  3VQV A;  5EIB C;  4BIU A;  2HHH O;  1PD3 A;  5JH7 A;  2DWD C;  2QKA A;  2H3O A;  5LYJ A;  2DJV A;  3JAR A;  4KHP B;  4X65 B;  3I56 V;  4QIW F;  3R65 A;  4HBN A;  1PL0 A;  1Q90 D;  3ASO C;  5GTH Z;  2GTA A;  3DXR B;  1EZJ A;  3AG4 C;  4LF9 O;  3RYC A;  2VQF B;  1YIJ V;  1R3L C;  3CME V;  1G6U A;  1KMI Z;  2JGU A;  2PF4 E;  4ZI7 A;  3UCS C;  2QTS A;  3D3I A;  4IIJ B;  1TUB A;  4LF5 O;  2MK3 A;  1SC5 B;  3RW0 A;  2P90 A;  5A2Q N;  4BIO A;  1HDJ A;  1YDX A;  4MVZ A;  2Z5U A;  3JYC A;  2N05 A;  1WP7 A;  5CA0 A;  4B3S O;  2XAQ A;  1OCZ C;  4L8J A;  4QE9 A;  4TV9 A;  3VOU A;  2YI8 A;  3B40 A;  4JI6 B;  4LF7 O;  2KG7 B;  2PY5 A;  1ZL8 A;  4H37 A;  4BAY A;  4KP4 A;  2EIM C;  2Y0I A;  1Q8I A;  5H6Q A;  2BSK B;  1N4C A;  4FFB B;  4LF6 O;  4LFC B;  2XAF A;  4E2L A;  2Q69 A;  2Y4U A;  4DR1 B;  4B3S B;  1YJW V;  3CHX A;  4G28 B;  1IBM B;  2BTQ B;  4I50 B;  4JI1 O;  1NTM H;  2DWE C;  4FM2 A;  2EIM B;  1MG1 A;  3ABL C;  4NVP A;  5KHK A;  4J11 A;  4JI3 O;  4DRX B;  1JJO A;  1ZWI C;  1H2S B;  4B7K A;  4R6Z A;  4PJ0 Z;  3BA9 A;  1VQ7 V;  4WFG A;  3FAV B;  3SYC A;  4NTW A;  1N33 B;  4JV5 O;  4NR1 A;  2R9A A;  4X20 A;  1BCC H;  1GM9 A;  2E5L B;  2LW1 A;  4K0K B;  3L71 H;  1JCH A;  2CGO A;  1KKD A;  4QE7 A;  1QNM A;  2QWN B;  1QR8 A;  1FJG B;  2HVK C;  4EFE A;  3IC9 A;  2DN9 A;  3K5L A;  2UU9 O;  1GN6 A;  1NTK H;  2QSA A;  5HFM A;  3ZCC A;  2DQ0 A;  1F23 A;  2JS5 A;  2EIK B;  2BTO A;  4PDV A;  3OTO O;  4X66 O;  4UCO A;  4RUF A;  2Q9L A;  4RAI A;  1PV0 A;  1XRE A;  5KA5 A;  4DR2 B;  1I0H A;  4I4T A;  1MSW D;  4LWS B;  1YTF B;  4O4I B;  4O4I A;  1SZT A;  1I5Y A;  3ABT A;  2Y69 B;  2QWP B;  1R6T A;  3AG7 A;  2JK5 C;  4I7Z B;  4DR3 O;  4YHH O;  4DK1 A;  1W0J G;  5L3F A;  4FLU A;  5L3D A;  2CE4 A;  1XUQ A;  4D6T H;  3ZMV A;  3WB2 A;  1XMO B;  3FB5 C;  4WFE A;  4DV2 B;  1D5A A;  1FPO A;  4AHC A;  1HNX B;  1Q5O A;  1R73 A;  5JJE B;  1AP5 A;  3MAQ A;  1W2B U;  1BQZ A;  4O4L A;  2FL4 A;  2GUZ A;  3IAY A;  4KFM A;  1BHB A;  3K5M A;  3IJ4 A;  4JAA A;  2F1M A;  2QEX V;  1EM1 A;  3E8F A;  1H8H G;  3B2E E;  1Y67 A;  2ARH A;  3JD1 A;  3APO A;  5LYJ B;  2E75 B;  1GH6 A;  4I55 B;  5E79 Z;  3ICX A;  5TIS Z;  1GO3 F;  2WLL A;  3OTO B;  3ZBH A;  3LDC A;  3LSS A;  4B3R O;  1AJN A;  2IJI A;  1S5L Z;  1LNQ A;  1HR0 O;  1IDS A;  3EHB B;  4RQE A;  3ZHR A;  1YXB A;  4AIL C;  1SZX A;  1SQG A;  3FKS G;  1TVK B;  1RSO B;  3GB7 C;  2Y0P A;  4EEQ A;  4J9Z B;  2PZS A;  3TGU H;  5JVD A;  2JGD B;  3ZMT A;  3L70 H;  5FNV A;  2DE0 X;  4UUJ C;  4DV4 B;  4NXM O;  2Y48 A;  5BR8 B;  2X6B A;  1P7G A;  4AQY O;  1IXM A;  1AJQ A;  5B3S C;  3S3X A;  1QHT A;  4CS3 A;  2Q8V A;  4JTC B;  4XDL A;  3O65 A;  1SQQ H;  4FM1 A;  1SF9 A;  3BCC H;  3WU2 Z;  2D3O W;  3WB1 A;  3CX5 F;  4PI0 A;  4GCZ A;  3P30 A;  2LQT A;  1VQ5 V;  4NXM B;  1IVS A;  2RN9 A;  3F5T A;  3B09 A;  5BR8 O;  4AQY B;  3G67 A;  5J2U A;  3A8T A;  1K7D A;  1Y74 A;  4X1Y B;  3K59 A;  4XBF A;  2OWO A;  4PA7 A;  2EIL B;  2JVD A;  2ATK C;  4MVQ A;  4X64 B;  4CZZ A;  4DR7 O;  1CEZ A;  2EIJ C;  5BMV B;  5LP6 A;  2IU3 A;  3G6E V;  4FK5 C;  1BL8 A;  4LF6 B;  2A0L A;  5CA3 A;  1YI2 V;  3PN1 A;  4JYC A;  3U11 A;  4L87 A;  3WB0 A;  5FPO A;  3FAV A;  4CS2 A;  2EIL C;  1PNL A;  5EBM C;  2V4D A;  3GWK C;  2XOK G;  2YC0 A;  3H1J H;  1KKC A;  1NBM G;  4X9Q A;  1JA8 A;  3HR0 A;  1LUW A;  1V55 B;  3QVN A;  3FX7 A;  2ZDI C;  4KL1 A;  1BGY H;  5EYP B;  1AIL A;  3SPC A;  4DW0 A;  1Q7Y W;  4RWU A;  2KSD A;  3JD0 A;  2QWR B;  4DV6 B;  1H2N A;  2CH7 A;  1JFF B;  3ETG A;  4H13 B;  1R6N A;  3AK1 A;  3QO8 A;  4DUY B;  3SJA C;  5GTI Z;  5K1X A;  1WPX A;  2WLL B;  1S76 D;  2DYR B;  4FFB A;  2FKX A;  4UB8 Z;  3ZS8 C;  5L3G A;  2AXT Z;  5JCO C;  3SYO A;  2C2A A;  2UXX A;  1H8E G;  1KQS U;  1M56 C;  3G80 A;  2Q0A A;  2QWQ B;  2YDE A;  5LMN B;  3DGE A;  1BHA A;  4YJ3 A;  2ZR2 A;  1XL4 A;  3CCM V;  3T1Y B;  2CGN A;  3C90 A;  5BZB A;  4FLT A;  4YY3 O;  1QCE A;  4LF4 O;  3BA8 A;  5CBF A;  3M8A A;  4TV9 B;  3TET A;  1RM1 C;  5IYD O;  3IC7 A;  5E1A C;  2KG7 A;  4I0X B;  1WA8 A;  4R7C A;  4DV0 O;  3ZRS A;  3JAK B;  2GUZ B;  2EIJ B;  3JSN A;  2HFE C;  5BY1 A;  1QLN A;  3TCU A;  3A0B Z;  1K33 A;  1G1X B;  4CC6 A;  2YXH A;  2IJJ A;  4B3T O;  1B3Q A;  3E2E A;  4DV0 B;  2HKO A;  1CXZ B;  1L0L H;  2Z0A A;  1QLE B;  1LUV A;  1X59 A;  4EFB A;  4FZ1 A;  2EJ7 A;  5KA6 A;  4PDM A;  2OCC C;  3ZHV A;  5LA6 A;  2ITD C;  1XMQ O;  1F4M A;  1HNZ O;  2ZDI A;  3BVO A;  1OCO B;  4TUY B;  1YVW A;  3LSU A;  4LWS A;  3B4S A;  1N32 B;  4UVA A;  4MVO A;  1Q82 W;  4U3J B;  2A06 H;  3S3W A;  2M7W A;  2RDC A;  4BW9 A;  3CC4 V;  4TSF G;  3DSQ A;  3BAB A;  3EFF K;  3VQY A;  2X6A A;  5AG2 A;  4UCR A;  2JGD A;  3HKB A;  4DV1 O;  3HB3 B;  1K3E A;  2DQ3 A;  3R66 A;  3JAT B;  1KBH A;  5CA0 B;  1JFF A;  3CCJ V;  3LNM B;  5B5E Z;  1ORQ C;  2UUC O;  4LFC O;  5CB4 B;  1F51 A;  2HLD G;  3OD4 A;  5JWP A;  4NKG B;  3BY6 A;  1GN2 A;  1Y76 A;  5IDJ A;  3W7W A;  3UM7 A;  3E8G A;  4TV8 B;  1XQ8 A;  2LGW A;  1NTZ H;  3FFQ A;  1IXB A;  3CCE V;  4MTX A;  3A2F A;  1EN4 A;  2XAH A;  1QU7 A;  3UT5 A;  3SR2 C;  4F4L A;  4UXN A;  2Q0O C;  2ZE6 A;  2KKW A;  3H9V A;  4BR6 A;  1AR1 B;  5LMN O;  3AG1 C;  4WFH A;  1NJI W;  3QTC A;  3E8H A;  2V1D A;  3T1Y O;  2ZIN A;  3RGB A;  3ZHQ A;  4TUY A;  1MSD A;  4Z1M G;  4F6R B;  2QE7 G;  3B8N A;  4GX0 A;  1OCR C;  3UO3 A;  4GLX A;  4JAU A;  5JJJ B;  2PYJ A;  1F7Y A;  5EBW C;  5F2V O;  1SET A;  4Q20 A;  3RYI A;  1FJG O;  5FL7 G;  3CWB H;  3Q4H A;  3LDD A;  3FB6 C;  2UU9 B;  4X89 A;  1ARO P;  4YJ2 A;  4ICG A;  1SQV H;  3FB7 C;  2L35 A;  1N34 O;  4JI5 O;  3FD9 A;  3OGC C;  4FFK A;  3CXH F;  3QF7 A;  1MMM A;  5LHI A;  3W7S A;  1X4T A;  2JEX A;  2AHY A;  1YEW A;  3RN4 A;  3OMA B;  3L75 H;  2ETN A;  2O57 A;  3CCL V;  3CE2 A;  4JI2 B;  3O9O A;  2ZIO A;  2IW5 A;  1U96 A;  3CMA V;  5LHG A;  4LNU A;  4WCE V;  2RCV A;  2Y4T A;  1I5X A;  2Z3Y A;  2NLJ C;  1PL4 A;  1J95 A;  2YEV A;  2JRI A;  1YF2 A;  3MHH C;  3UT5 B;  5FPR A;  2ZKO A;  1N32 O;  3K9A A;  4JTD B;  4OPA A;  3BEH A;  4K0K O;  4JI0 O;  3W7T A;  1UPG A;  1DTO A;  2VS0 A;  4X1K A;  1BZK A; 
#chains in the Genus database with same CATH homology
 4LFA O;  4DR1 O;  1DK1 A;  4X65 O;  4JI1 O;  1KUQ A;  4DR4 O;  4DV5 O;  3T1H O;  4GKK O;  4DR7 O;  1N36 O;  3RT3 C;  4A5U B;  3J80 N;  4DV0 O;  2UXB O;  2VQF O;  5LMN O;  5IT9 N;  3J81 N;  4OX9 O;  4JI3 O;  5H5N A;  5BY1 A;  3T1Y O;  1R1B A;  1G1X B;  2UXC O;  2F4V O;  1HNX O;  2HHH O;  4B3T O;  4DV3 O;  3SDL A;  1XNQ O;  1YZB A;  2UUB O;  1XNR O;  4JV5 O;  4NXN O;  2Z0A A;  1F7Y A;  2DJV A;  2AGA A;  1IBL O;  1X59 A;  2VQE O;  4JI4 O;  2E5L O;  1XMO O;  4B3R O;  1FJG O;  1HNW O;  3JAM N;  1XMQ O;  4DUY O;  1HNZ O;  1HR0 O;  2UUA O;  1AIL A;  4JI8 O;  1IBK O;  4LF8 O;  4DUZ O;  1N33 O;  4LF9 O;  4JI6 O;  2LW7 A;  4DV6 O;  2ZM6 O;  4DV2 O;  1FKA O;  1N34 O;  4JI5 O;  1D2D A;  2UU9 O;  5LL6 Y;  1IBM O;  4LF5 O;  1FYJ A;  4GKJ O;  1I94 O;  4X64 O;  4JI7 O;  3OTO O;  4X66 O;  5A2Q N;  1A32 A;  2FKX A;  4KHP O;  4B3M O;  5FLX N;  4DR6 O;  4DV1 O;  4OPH A;  4NXM O;  5LMU O;  3R66 A;  4AQY O;  4B3S O;  2UUC O;  4LF7 O;  4LFC O;  4JYA O;  4DR2 O;  2JRI A;  1NS1 A;  1R6T A;  2DOS A;  1XEQ A;  3O65 A;  1J5E O;  1AB3 A;  2N74 A;  4DR3 O;  4DV7 O;  4DR5 O;  2ZKO A;  1N32 O;  4YHH O;  4LF6 O;  4OPA A;  4YY3 O;  5BXZ A;  3J7A U;  4K0K O;  2UXD O;  4JI0 O;  4X62 O;  4DV4 O;  3F5T A;  5IWA O;  5BR8 O;  4LFB O;  4LF4 O;  4JI2 O;  3M8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...