4DV3O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title A structural basis for streptomycin resistance
rcsb
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv3O00
4DR3O 2LW7A 4OPAA 4JI5O 1XNRO 5BR8O 4JI8O 5BY1A 4YHHO 3T1HO 1R6TA 1N33O 4GKKO 2AGAA 1J5EO 4DUYO 3M8AA 2UXBO 4JI1O 4JI3O 1XEQA 1FJGO 4B3MO 1I94O 4DV4O 2UUCO 4LF4O 2FKXA 1X59A 5BXZA 4DV5O 3SDLA 1FKAO 4X62O 1NS1A 1XMOO 1HNXO 4LFBO 4JI4O 1IBMO 3J81N 2ZKOA 1N34O 1XMQO 3J7AU 4LF8O 5FLXN 4DR1O 2UXDO 4GKJO 3T1YO 4DV1O 4DR6O 1IBLO 2UU9O 2F4VO 1IBKO 3O65A 4X65O 4NXNO 4LFCO 1N32O 1N36O 3OTOO 4K0KO 3RT3C 4DR4O 1D2DA 2Z0AA 3F5TA 4X64O 1HNZO 3J80N 4DV2O 4LF6O 1F7YA 4DV7O 4AQYO 2N74A 1HNWO 1A32A 4DR7O 2DOSA 4YY3O 3R66A 4DV6O 4JI0O 2UUBO 1YZBA 4B3RO 5H5NA 2VQEO 5LMUO 1AB3A 4LF5O 4X66O 4JYAO 1AILA 1FYJA 2E5LO 2HHHO 4B3SO 4LF9O 5A2QN 4DR2O 4B3TO 4NXMO 4DV3O 4JI2O 4DV0O 4LF7O 2JRIA 2UUAO 2VQFO 5LMNO 2DJVA 2ZM6O 4JI6O 4JI7O 2UXCO 4OPHA 1HR0O 1XNQO 5IWAO 4DR5O 5LL6Y 4A5UB 4JV5O 1R1BA 1KUQA 5IT9N 4KHPO 1G1XB 1DK1A 3JAMN 4OX9O 4LFAO 4DUZO
chains in the Genus database with same CATH superfamily
4B7KA 3PN1A 4KUMA 5JJJB 2QWQB 2QA4V 1I94B 4GT1A 5K1XA 3P3PA 3I5DA 5KHKA 2RCVA 2ZIOA 3OUFA 1S77D 3QO5A 3H1KH 1I5YA 4D7SA 1QLEB 1ZWIC 4WFGA 5K1PA 2GTAA 3SYPA 3CCSV 2XNDG 2JJ1G 4DR1O 1FAFA 3B4SA 1SQQH 4UCOA 2CTRA 2IH1C 4K35A 1FXVA 4JAUA 2RJZA 3HR0A 1N32B 1M56B 3O65A 1QCEA 1N32O 2WA3A 4MVRA 1XHZA 2W0FC 1R3IC 3F5TA 4JZGA 4I9WA 4X9QA 2Z3YA 1AJPA 1AROP 4GYCB 4FM0A 1A32A 4O4HB 4F6RA 2XASA 3LSSA 4UCRA 3FAVA 1B04A 3ABMC 5IYZA 3G67A 4JYYA 4MTFA 4QNHB 2KB1A 5JQGB 3UT5A 1QNMA 3X2QB 4WBNA 2UXDB 3B77A 4LF9O 1EN6A 1OCRB 3OMIB 1S0VA 1TA8A 2CUGA 5IJ9A 2OTLV 1F4MA 4B7EA 4JGSA 2XAQA 3FD9A 2RN9A 3K06A 3T1YB 1KBHA 4CH4A 1S5HC 3UQ8A 5KA5A 1SA0A 1XUQA 1OJHA 2WLLA 1P4RA 3TETA 3E22B 3MDSA 3JD3A 1K33A 2DYRC 1NBMG 3DC6A 1OCCC 1Y4MA 3JAWA 1COWG 1MOFA 1QR8A 1NTMH 3KCYA 4K8ZA 3JCZA 4B08A 3RYIA 4P2ZA 3ZS8C 1I94O 4X65B 1K4DC 4FM2A 5BXZA 3SPJA 3QNEA 2QM8A 4MSWC 4X62O 3CXCU 1FKAO 4LF4B 4NB5A 3SJAC 1WNSA 1SERA 1HNXO 5KUKA 3JYCA 2DYRB 3BAAA 4LFBB 3JAKA 2FL4A 4GX1A 1KKCA 1XL6A 1VF6A 2EILB 3CCRV 4E2LA 4P9PA 1IBKO 3QF7A 4LFCO 1HNZB 3TXQA 1AI5A 1SQBH 4DR4O 1MG1A 3HKBB 4G28B 2MK3A 5JH7B 4WBNB 3K08A 2M7WA 4X1YA 4UB8Z 4YXWG 1I08A 4RWUA 3DXRB 4PJ0Z 3RFRA 2IW5A 3AG3B 3ZHUA 4F6RB 4B3RO 4UUJC 4TUYB 2M6YA 5LMUO 1AB3A 4O4HA 1WN7A 1YTFB 3OT7A 3KKYA 4DR2B 4JI1B 2YXLA 2BE3A 3JAKB 3GWKC 5IYDO 4FLYA 4DR2O 2JIZG 4JI2O 1MMMA 2JRIA 1N34B 1Y66A 5LMNO 1VF6C 3CRCA 4FFBB 5LXTA 1M57C 3CCQV 3JAWB 3OEHG 4JV5O 1R1BA 3CCLV 3CJHA 4KHPO 1HDJA 3OUSA 4JV5B 4U3JB 2OTJV 4CBCA 2QTOA 4UCUA 1WP7A 4YJ3A 3FB6C 2LW1A 4EFBA 2KKWA 1XNRB 4JF3A 4JI3B 3ZHRA 2R9RB 4PD4F 3CRMA 4JTAB 3EHBB 1M4UA 3ETDA 1G8MA 1YSCA 3M99B 3RYHB 3C3SA 3OM3B 1VQ8V 4D6TH 2OT5A 2E3CA 5CA0A 2HHHB 3W7UA 3JD2A 2EILC 4TV9A 1FXKB 5CB4A 1T5EA 3ABKC 3A0BZ 4CH5A 4PI2A 1DTOA 3HKDB 2YEVA 1IBLB 4ZHQB 4NXMB 1CEZA 3A0RA 2WLIA 2AHYA 5IYZB 3JD1A 1HP8A 4FFBA 4JYCA 4NVPA 2NR5A 3HKCA 2NLJC 5J2TA 1VEWA 3LSQA 3OGCC 2F95B 5LA6B 3H1LH 3KCXA 4IYIA 3F7YC 2CGOA 4GX2A 3SYQA 3B2EE 3OTFA 1Q82W 4WFBV 4Z2WA 4QPJA 1I7FA 4X1IB 5KX5B 4X66B 1VQOV 3ZMSA 1VQ9V 3C3TA 1UJWB 3K57A 2JEUA 1EBOA 1MA1A 2ZINA 3PJSK 4GKJB 1CPYA 3ZMZA 4J41A 1ENVA 5LMUB 1EN4A 2EJ7A 4DV3B 1H2MA 2X6BA 2ZM6O 1LR1A 2UXCO 5D5PA 3AG2C 1OCRC 2DW4A 2Q7GA 2L6LA 2ZXWC 2E75B 4FLWA 2CDYA 4JI2B 2ZE8A 5LHHA 3CEIA 5B5EZ 4OX9O 4B3RB 3CPWU 1P49A 4C7UA 1R3LC 1ZL8B 1GO3F 1PNLA 1K8AW 2X0LA 3R65A 1N33B 4KFMA 3T1HO 3AG7A 1N33O 2R70A 3L71H 4LR3A 3AG1B 4O2BB 1K5SA 3BEHA 4EB6A 4WCEV 2IU3A 4GLXA 3CXHF 1BGYH 4DV6B 2WLNA 3IAYA 5GONB 4LF8B 2F66C 2K9PA 4MVOA 4NYKA 1PPJH 4LF8O 4O4IA 3VQVA 1GN6A 2UXDO 2Q9LA 5A9GA 2Q7HA 2JS3A 3Q4HA 4HNAA 5CBHA 3S3WA 1YJ9V 4QJFB 2EIMC 3RT3C 1CXZB 3T1CA 5KHJA 5EYPA 4J10A 3U0ZA 5FPRA 3G6EV 3QG5A 2EIJB 2ETNA 2N74A 1FJGB 3OD4A 2PYJA 1NKDA 1JQ0A 3ZRXA 1N0JA 3OR6C 5EC2C 4GZRB 5B1OA 1PM9A 2A3QA 1K9MW 3FB8C 3CC2V 2Q0AA 4TQFA 2QSAA 4FVMA 1M5IA 4I4TA 2P6JA 1FYJA 3B09A 2XTAA 1H2KA 4B3SO 4HAMA 2YXYA 4TV8B 2GSMB 5LOVA 2ZE7A 4DV0O 1F51A 2Q69A 2WWWA 4PA9A 1TGOA 1NR7A 1AI4A 1R3KC 2DE0X 1Q86W 5TISZ 1NTZH 3QTCA 4EB6B 2EIJC 1KQSU 4DR1B 2H8PC 2YEVB 3A2FA 1L1FA 3OMAB 1VQLV 2Q68A 2CTWA 2IU0A 5CB4B 4DUZO 2UXCB 1WJZA 3ZIAG 1FFXA 2IJIA 4LFCB 4BIUA 1ZX3A 1M1KW 3D36C 3AK2A 1GM9A 2H3OA 1MSDA 3T4DA 1QU7A 3E22A 3CWBH 4UCTA 1XMQB 4MW8A 2LO1A 2N05A 5IE9A 5LP6C 5KHGA 2ZIMA 2ZCEA 4MVSA 2Q73A 1PD3A 2F1MA 1N34O 3JASA 2ZT9B 4Q20A 3G4SV 4YJ2A 2LQTA 4R50A 3WB1A 1S5LZ 3BRCA 4LP8A 2JS5A 3MD0A 4X1KA 3D3IA 3D8CA 5BMVB 3LSUA 2P90A 4U3JA 3M7MX 3RVYA 4DV4B 4K0KB 1IURA 1IXBA 4DV7O 5DM6V 2UXNA 4O4JB 4PHZA 4DR5B 1E1RG 3QO8A 4N23A 4I50B 1XL4A 5FPOA 4G2KA 1YZBA 2VQEO 5LOVB 2ADQB 3OR7C 2YICA 2QM4A 1OCOC 1AILA 2YI8A 3OEEG 4RAIA 4GKKB 2EJRA 4NXMO 2B1IA 1VQMV 4LF7O 4J7KA 5CA0B 3CSXA 3K5NA 4LNUB 3RW0A 4KXRA 4PI0A 2QTSA 3WG7C 2DQ3A 3JAMN 2Y48A 3E8BA 3UO2A 4LBEC 2A0LA 1BHBA 2QKSA 4H0LB 1K97A 5BR8O 2P06A 2CTQA 3D36A 2AGAA 1J5EO 4DUYO 2QWRB 2CAZC 5CA3A 5KHIA 4DK0A 1IZ3A 4I4TB 3FFQA 1VP7A 4I9QA 4TUYA 4DR6B 2V1DA 1R6KA 3NR7A 2JK5C 4X20B 1JFFA 1I5XA 2AW9A 1W0KG 4R7CA 3JALA 3RVZA 2EINB 5F2VO 4HZ3A 3ABMB 4GKJO 3ABLB 4NR1A 4I55A 4P30A 5KA6A 4QPKA 2A7WA 4DV5B 3A0HZ 5LBQA 3RYCA 1Q81W 1D5NA 4NTXA 5J2UA 1SQXH 1Y76B 2ODMA 4KP4A 3RYCB 4IIJB 2ATKC 4DV1B 3K0GA 2ZR2A 4I55B 3THOA 4DV2O 4BW9A 1Q7YW 3ZRWA 1K7DA 5JQGA 5GTIZ 4EFEA 1BQ0A 1VQ5V 5H6RA 2LJ2A 3ZN1A 4X1IA 4F4LA 1B3QA 1K92A 1SKVA 2R9IA 5KHHA 3TK1A 3N2GB 3P3NA 3E35A 1EM1A 3HKEB 3OMNB 3E86A 2JJ2G 2LGWA 3AK3A 2YI9A 1YXBA 3N2KB 2ZNIA 5D5QA 5J9PC 4DR5O 3ZHSA 5LL6Y 1BE3H 2ITDC 4PA4A 4YJ2B 1Y74B 3BABA 3WFVA 3OAAG 1KUQA 4LF7B 3O9OA 5B1BC 3H1JH 2OIGA 4Z1MG 3CYOA 4LFAO 2UXBB 1NU1H 3B8NA 1R6NA 1UFIA 1N8RW 1YCIA 3BPZA 1VQKV 4JI7B 1QVFU 3G80A 3SR2C 4ZOLA 3JSNA 1I0HA 2BTOA 5KAIZ 1KC8W 1WB8A 1X59A 2DN9A 4TWKA 4PDMA 4NTYA 1H2LA 2QR4A 2DYSC 2YUAA 3E89A 1Y6XA 3SJCC 1AP5A 1LUVA 4BAYA 3GB7C 2Y4TA 3CD6V 4PELA 4DR6O 4I7ZB 2P22C 4WF9V 4CH3A 4QE9A 4IGGA 1HR0B 3K5MA 4BWAA 1HNZO 4LF6O 3APQA 3H1HH 4JI0B 3N2KA 2BTQB 2DYSB 4TV9B 3R66A 4L8JA 3T1HB 3BCCH 5EBLC 2F23A 4MTGA 4JI5B 3ASOC 4B3TB 4FK5C 2DQ0A 5LHIA 1SQGA 1VARA 1EN5A 4FPPA 2FMLA 5B1BB 5J2UB 4CC6A 3ETEA 4OPHA 2G38A 2QWOB 4JAVA 2WLHA 5KMGB 1RPRA 3L72H 4ZOLB 1QQCA 3P30A 4O4LA 3T2MA 2EBOA 1VF7A 4XDKA 3MHHC 1K73W 2IM9A 2LW7A 1XNRO 5HFLA 5AG2A 1XMOB 1ZSPA 4UV8A 4DW1A 5KAFZ 1NR1A 3CRQA 5GTHZ 2UXBO 3UO3A 4JASA 2YIBD 4XDLA 1SRYA 4FLTA 4NKGB 3E8GA 2AZ0A 1U96A 1JX9A 1LUWA 3SPGA 1BHAA 3HB3B 1WA8B 2X7RB 2BSKB 2K1EA 3J81N 2ZKOA 1FD9A 2MW2B 4PA6A 3CMAV 2WLLB 1F23A 2YIAA 4Q6GA 3HKBA 2UU9O 5EC1C 4IT5A 1AR4A 1V55C 2Q7EA 1BZKA 3FYIB 4O2AB 1IBKB 3Q4HB 1D2DA 4EKWA 1M93A 1ZTEA 3SPCA 3WB2A 1NVPD 2Y69C 3GVMA 1S3JA 2GUZB 1JCHA 2DOSA 5EZYB 4I50A 5IJ0B 1YDXA 3CCVV 3JARA 2OWOA 4LH6A 1YJWV 3GWOA 1V55B 3ZCCA 1M57B 4I0XB 3E2EA 1ROPA 1FXHA 2BCCH 1GTOA 1WA8A 3SJQC 2CGNA 2BOBC 4ICGA 2YIBA 3ABTA 3WU2Z 2AXTZ 4OX9B 3NXSA 4DV2B 2PI4A 1TUEB 1V9PA 1ZAUA 3L73H 1G6UA 4OPAA 4LCUC 1ORQC 4ZHQA 4UVAA 2PI5A 1R3JC 4JI3O 2EIMB 2JEXA 2QJ1A 5KMGA 3L74H 3CB2A 1IBMB 1WAZA 1KYOF 1GK9A 2B1GA 4U7OA 1GMGA 4MTOA 2UUCB 4J7ZA 1ZLZA 3ZHQA 1J95A 4QE7A 1HWYA 2VWKA 1QR9A 4NTWA 3APOA 4I5SA 1RP3B 5B3SC 1IBLO 5FL7G 1DGSA 4J80A 4GX5A 3OTOO 2HR3A 4CS2A 2ITCC 3H9VA 3J80N 2RNBA 3ML0A 5LA6A 1N0NA 3TXSA 2VRZA 4AQYO 5JCOC 3CC7V 4MT8A 3VBBA 2IBZH 2JGDB 3CC4V 1ZUQA 3BA8A 4E4EA 4J42A 3ABLC 3ETQA 2H94A 2P4VA 5EIBC 2UU9B 1GN2A 5B3SB 5C8YA 1TVKB 1DLBA 3ASNC 2NN4A 1V54B 2DMXA 4RUEA 4L87A 5BR8B 5JWPA 3LUTB 2Y0IA 5IDJA 3ZMVA 2GUZA 1AI6A 5H6QA 1RM1B 5FNVB 5IY5B 1XNQO 1Z5WA 1FPOA 2A79B 2X6AA 1VIBA 1YVWA 2V7QG 4WFFA 2P4KA 1H8EG 3RN4A 4J11A 3FB5C 1Y76A 2W6JG 2XHBA 5KLVH 1R73A 5B66Z 2O57A 1R6TA 4CS3A 1E79G 3L9DA 1V54C 4TT3G 4UVCA 4QGPA 1XEQA 1Y74A 1JFFB 3L75H 4MVQA 1RM1C 5LHGA 5CBFA 4UCSA 1D5AA 1OZ0A 2FKXA 1RSOA 4UFZA 1IBMO 1IXMA 4ZBMA 1S5JA 3ZHVA 4LF9B 1SA0B 1YEWA 3ABKB 4H13B 2GBOA 1WB7A 1XQ8A 4HNAB 1YI2V 4K0KO 2F43G 4YY3B 1WPXA 3ICXA 1AP6A 4O4LB 4CZZA 1L0LH 1JR9A 2XAGA 4TOIA 1HNWO 5JCOA 1VQ4V 4G27B 3ASNB 1VF5B 2UUBO 1OCZC 2JGDA 4JI4B 2B9ZA 2ZDIA 4CH6A 3D3QA 4X20A 3E8FA 3DGEA 1PV0A 5H9CA 5KX5A 1XOUA 4PDRA 1H38A 4JI6O 4JI7O 3TCUA 3DSQA 5GW7A 4JI8B 2ARHA 4HYOA 2JVDA 1G1XB 1DK1A 1PNMA 4DR3B 4GUNA 2EINC 1SC5B 5LYJA 4DR3O 1E1QG 5C93A 3JCUZ 3CS5A 4FZ1A 1VMGA 3BY6A 1VQ6V 1RPOA 5IJ9B 4RUFA 2Q0OC 4IYHA 4CS4A 1Y67A 4DXWA 1QVGU 3FX7A 1W2BU 1U97A 3W7TA 1L0NH 1TVKA 2VWJA 5ITZA 3SPHA 1BL8A 4JTCB 5DN6G 4K8XA 3CCMV 3AG1C 2ILMA 1FFXB 4DV5O 1GRJA 1IDSA 1JVMA 4BIZA 2GTSA 4LF6B 3K9SA 2UXXA 5FLXN 1M90W 2QGNA 4DV1O 1Q6UA 1N36B 2F4VO 2RDCA 2ZE5A 2NNUA 1X4TA 5EIBD 3QVNA 1MZEA 4GX0A 3IC7A 1TAEA 1OV9A 4I0XA 3HPLC 2OCHA 4U3FH 3K04A 5LMNB 3CJHB 3FKSG 4FLZA 1SETA 4YHHB 4JAAA 1URFA 1OCOB 2AHZA 1FXKA 4YY3O 4MVZA 4DV6O 2QE7G 1EZJA 3AEIA 2EX3A 4UB6Z 1GH6A 2XAHA 3FB7C 2X6CA 2E5LO 3IGAC 2HFEC 3ETGA 4ABMA 4K3AA 2YIDA 1JA8A 3ZRSA 1AI7A 2DWDC 3WG7B 1KMIZ 2Q67A 2QDOA 2XAJA 3TJTA 3JATA 3A8TA 1TUBB 1H2NA 2WAMA 1PP9H 4OGQB 3OFNG 1XI1A 1XDCA 4MVMA 4JI6B 1Q6IA 3BVOA 3CHXA 3W7XA 1KECA 4JI8O 5B1AC 2W0XA 2XOKG 3JD4A 2AZ2A 4TV8A 1S72V 2LP7A 4O4IB 1HW7A 1PL0A 1H2SB 1YJNV 2IJJA 4OXSA 5IJ0A 3F5WC 3ZMTA 4DR4B 2ZXWB 1Q90D 3TGUH 5L3GA 4GCZA 4PDVA 4LFBO 3J7AU 5LP6B 1KKDA 1Q43A 3C90A 3LNMB 5IYBO 5JH7A 1XNQB 1SQFA 1KD1W 2QKAA 2WA4A 2HJDA 2P5OA 4N21A 1ZL8A 3CX5F 2IJHA 2WLKA 4TQDA 1EFRG 4WFAV 3OE7G 2UUAB 1Z5VA 2FB5A 3ZBHA 1F4NA 4LC1A 1GN3A 1XHXA 1AJNA 2RMKB 4J9ZB 5L3FA 1RSOB 4JI0O 5L3EA 1KB9F 1BT8A 4UXNA 2HLDG 1BCCH 1KP2A 5CA1B 5C8YB 1M56C 4UVBA 3SYCA 2JDIG 3VQWA 1OCZB 4YIPA 3AG2B 1K5QA 4X8AA 2Q4PA 2DJVA 1Q5OA 1SF9A 2RQ6A 1K34A 5LGTA 5B1AB 1NT2B 1JOYA 5J2TB 1TUBA 4DR7B 5BY1A 3K59A 1US6A 3U10A 4GKKO 4DW0A 3I56V 1PL4A 5CN0A 4PA7A 3HKDA 2D2CB 2CTPA 4AQYB 4DRXB 5L3CA 1FJGO 1S76D 3RWRD 4CC5A 4LNUA 4X62B 4LF4O 2OCCB 1Q8IA 1JJOA 3B8MA 3W7WA 1W0JG 4JTDB 4JI4O 4DRXA 2EZPA 1VQNV 5L3BA 3G71V 2XAFA 4RQEA 2HG5C 2FYUH 3VOUA 1FXKC 2HP8A 4X88A 3LDEA 1HNXB 1IVSA 3HKCB 1NTKH 4X64B 3IC9A 1KU9A 1AVMA 1J5EB 4X64O 1JJ2U 5EK0A 2WLJA 1MSWD 3IFXA 1JPXA 3EXAA 3JARB 4UV9A 2KQXA 5BMVA 2Q6AA 4H44B 3LDDA 4DUYB 1P84F 4J9YB 1NH2D 4X1KB 3H01A 4FMTA 5H5NA 5LGUA 3UM7A 4JYAB 5L3DA 5DECA 1B6QA 4LF5O 2DWEC 5ITZB 4JYAO 1CP9A 4YIOA 2PYLA 4FFKA 1QBZA 2W6IG 2EIKC 5A2QN 4B3TO 4LWSA 4ZKIA 4AHCA 4X89A 5EZYA 2UUAO 2WPDG 1H2GA 1W59A 5IWAO 5LYJB 3P32A 1P7BA 2PTMA 4A5UB 4JPRA 4DO2A 1WPBA 1YHQV 2B5UA 1SZXA 1SQVH 1YF2A 4B3MB 4YJ3B 4YHHO 2OYQA 3BA9A 3K5OA 2YS8A 4R8CA 1Q3EA 2OCCC 1PNKA 1VQ7V 3M8AA 3EVKA 3N27A 3LNNA 2BSKA 2CH7A 3ZEDA 4ASUG 4DV4O 1G4YB 3ZN0A 2UUCO 4FM1A 4JZ2A 2UUBB 1FFTB 2VS0A 2WLMA 3SPIA 4J7JA 2KG7B 1VQPV 1JMKC 3HKEA 1XMOO 4W4KA 2GV9A 4U7NA 4X1YB 4WFHA 3SYAA 1WLEA 1IX9A 4BIOA 1BS3A 1EZVH 3VQYA 3X2QC 4X65O 3DTUB 4NXNO 3UCSC 4O2AA 3VQXA 1P7GA 2PZSA 2F93B 1OHHG 4IHJB 1K4CC 4LWSB 2HEPA 3IJ4A 3OTOB 5IY5C 4PA3A 3CRRA 4BW5A 3E8HA 3MHSC 4H33A 2Q5ZA 5GONA 3CCUV 3RYFB 1GKFA 3UKMA 4P9OA 2EIKB 5B1NA 1OCCB 1H8HG 3G6BA 3CMEV 2LGQA 2PY5A 3RGBA 1GN4A 1UPGA 4QIWF 4X66O 4TSFG 4B3SB 3EFFK 2XUMA 2A9HA 2ZD9A 1AJQA 4DV3O 4XDJA 4ZIBA 2ZDIC 2LFSA 2HJFC 1HR0O 2WLIB 2IJKA 4MTXA 1Z2GA 5IT9N 3CCJV 3RBZA 1BSMA 3K0DA 5JJEB 3ZX6A 2ADPA 2XT9A 4JI5O 1O9HA 3ABUA 2ZNJA 1YITV 1Q6HA 2R72A 2ZR3A 4UCVA 1QLEC 2P7TC 1XREA 4W4LA 2V4DA 4KHPB 5JVDA 4B3MO 2JGUA 3UT5B 3BHPA 2ZQMA 5CMUA 1MZFA 5FNVA 4WFEA 4Z1VA 2YSUB 1NH2B 3K3WA 3OW2U 3SDLA 1NS1A 4FLVA 3AG3C 1YTFD 5E1AC 3BFRA 4DV7B 4JYBA 5E79Z 3T1YO 2R9AA 2GHYA 3SJBC 4MW3A 2LFRA 4ZI7B 3KG2A 4D7TA 2Y0PA 2BTQA 4ZI7A 2Z0AA 3K58A 1K3EA 2E5LB 1HNWB 2QEXV 1NZ6A 4HBNA 1F7YA 3KZIZ 3N2GA 4NXNB 4FLXA 3JASB 2QWNB 2ZE6A 3DC5A 1GAXA 1WP8A 2Q8VA 3ZHTA 1B06A 2EULA 3RYFA 4LFAB 2Y69B 2IH3C 3DXRA 3RYHA 1NVPB 2N04A 4FZ0A 5CA1A 3SGIA 5EBWC 2E74B 2D3OW 3S3XA 3H1IH 2VQFO 1RFYA 2OIEA 4PV1B 1SQPH 3CRAA 5BZBA 4DK1A 1NI8A 2VQFB 1BMFG 4BR6A 4FLUA 5JVDB 5HFMA 2YDEA 4DV0B 1SZTA 3W7SA 4MS2A 1DF4A 3LDCA 2Z5UA 2PF4E 2KSDA 2Y4UA 4R6ZA 5LXTB 5KUMA 3ASOB 2PGGA 1L8DA 3AK1A 2WSSG 4KL1A 2L35A 3K03A 3CP1A 5IYCO 3MAQA 3B40A 5CBGA 4IL6Z 4JI1O 3STZC 1M9NA 4DUZB 1O9GA 3JALB 2HVKC 3ZJZA 1FS0G 2GDSA 1MNGA 2KG7A 4LF5B 2E76B 1QLNA 3FYEB 1SESA 5JJNB 2ZM6B 1N4CA 2C2AA 3E83A 3JD0A 1XMQO 1GM8A 1LNQA 5LGNA 3ZRWB 3K79A 2QM7A 5DEDA 5EYPB 1SS3A 3JSLA 4IHJA 4RQFA 3CE2A 2HKOA 4LH7A 1YIJV 1N36O 2F4VB 1KP3A 1AR1B 1DF5A 3L70H 5IWAB 3SYOA 2YC0A 3STLC 1THZA 4H37A 4AILC 3U11A 5LP6A 1NJIW 2CK3G 2CE4A 1BQZA 4IIJA 3JATB 2HVJC 3ZRVA 2YXHA 4FIPC 4DR7O 3OGIB 5EBMC 3FAVB 3AG4C 2FTKA 1XBLA 3ZMUA 4O4JA 2CH7B 2VQEB 3F7VC 4EEQA 3WB0A 1MABG 2HHHO 4MVUA 2BOCC 4FJCC 3QO7A 1AR5A 3I55V 2P67A 1GM7A 1PKXA 3K9AA 2QWPB 4DYLA 4XBFA 5H2FZ 1NQTA 2QKCA 4AI8A 1QHTA 4RO2A 1XILA 2PUSA 3CCEV 3RYIB 4F6EA 4O2BA 2A06H 3K5LA 3T4ZA 3AG4B 4PDLA 2EZOA
chains in the Genus database with same CATH topology
4DR3O 2LW7A 4OPAA 4JI5O 1XNRO 5BR8O 4JI8O 5BY1A 4YHHO 3T1HO 1R6TA 1N33O 4GKKO 2AGAA 1J5EO 4DUYO 3M8AA 2UXBO 4JI1O 4JI3O 1XEQA 1FJGO 4B3MO 1I94O 4DV4O 2UUCO 4LF4O 2FKXA 1X59A 5BXZA 4DV5O 3SDLA 1FKAO 4X62O 1NS1A 1XMOO 1HNXO 4LFBO 4JI4O 1IBMO 3J81N 2ZKOA 1N34O 1XMQO 3J7AU 4LF8O 5FLXN 4DR1O 2UXDO 4GKJO 3T1YO 4DV1O 4DR6O 1IBLO 2UU9O 2F4VO 1IBKO 3O65A 4X65O 4NXNO 4LFCO 1N32O 1N36O 3OTOO 4K0KO 3RT3C 4DR4O 1D2DA 2Z0AA 3F5TA 4X64O 1HNZO 3J80N 4DV2O 4LF6O 1F7YA 4DV7O 4AQYO 2N74A 1HNWO 1A32A 4DR7O 2DOSA 4YY3O 3R66A 4DV6O 4JI0O 2UUBO 1YZBA 4B3RO 5H5NA 2VQEO 5LMUO 1AB3A 4LF5O 4X66O 4JYAO 1AILA 1FYJA 2E5LO 2HHHO 4B3SO 4LF9O 5A2QN 4DR2O 4B3TO 4NXMO 4DV3O 4JI2O 4DV0O 4LF7O 2JRIA 2UUAO 2VQFO 5LMNO 2DJVA 2ZM6O 4JI6O 4JI7O 2UXCO 4OPHA 1HR0O 1XNQO 5IWAO 4DR5O 5LL6Y 4A5UB 4JV5O 1R1BA 1KUQA 5IT9N 4KHPO 1G1XB 1DK1A 3JAMN 4OX9O 4LFAO 4DUZO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 O;  2LW7 A;  4OPA A;  4JI5 O;  1XNR O;  5BR8 O;  4JI8 O;  5BY1 A;  4YHH O;  3T1H O;  1R6T A;  1N33 O;  4GKK O;  2AGA A;  1J5E O;  4DUY O;  3M8A A;  2UXB O;  4JI1 O;  4JI3 O;  1XEQ A;  1FJG O;  4B3M O;  1I94 O;  4DV4 O;  2UUC O;  4LF4 O;  2FKX A;  1X59 A;  5BXZ A;  4DV5 O;  3SDL A;  1FKA O;  4X62 O;  1NS1 A;  1XMO O;  1HNX O;  4LFB O;  4JI4 O;  1IBM O;  3J81 N;  2ZKO A;  1N34 O;  1XMQ O;  3J7A U;  4LF8 O;  5FLX N;  4DR1 O;  2UXD O;  4GKJ O;  3T1Y O;  4DV1 O;  4DR6 O;  1IBL O;  2UU9 O;  2F4V O;  1IBK O;  3O65 A;  4X65 O;  4NXN O;  4LFC O;  1N32 O;  1N36 O;  3OTO O;  4K0K O;  3RT3 C;  4DR4 O;  1D2D A;  2Z0A A;  3F5T A;  4X64 O;  1HNZ O;  3J80 N;  4DV2 O;  4LF6 O;  1F7Y A;  4DV7 O;  4AQY O;  2N74 A;  1HNW O;  1A32 A;  4DR7 O;  2DOS A;  4YY3 O;  3R66 A;  4DV6 O;  4JI0 O;  2UUB O;  1YZB A;  4B3R O;  5H5N A;  2VQE O;  5LMU O;  1AB3 A;  4LF5 O;  4X66 O;  4JYA O;  1AIL A;  1FYJ A;  2E5L O;  2HHH O;  4B3S O;  4LF9 O;  5A2Q N;  4DR2 O;  4B3T O;  4NXM O;  4DV3 O;  4JI2 O;  4DV0 O;  4LF7 O;  2JRI A;  2UUA O;  2VQF O;  5LMN O;  2DJV A;  2ZM6 O;  4JI6 O;  4JI7 O;  2UXC O;  4OPH A;  1HR0 O;  1XNQ O;  5IWA O;  4DR5 O;  5LL6 Y;  4A5U B;  4JV5 O;  1R1B A;  1KUQ A;  5IT9 N;  4KHP O;  1G1X B;  1DK1 A;  3JAM N;  4OX9 O;  4LFA O;  4DUZ O; 
#chains in the Genus database with same CATH topology
 4B7K A;  3PN1 A;  4KUM A;  5JJJ B;  2QWQ B;  2QA4 V;  1I94 B;  4GT1 A;  5K1X A;  3P3P A;  3I5D A;  5KHK A;  2RCV A;  2ZIO A;  3OUF A;  1S77 D;  3QO5 A;  3H1K H;  1I5Y A;  4D7S A;  1QLE B;  1ZWI C;  4WFG A;  5K1P A;  2GTA A;  3SYP A;  3CCS V;  2XND G;  2JJ1 G;  4DR1 O;  1FAF A;  3B4S A;  1SQQ H;  4UCO A;  2CTR A;  2IH1 C;  4K35 A;  1FXV A;  4JAU A;  2RJZ A;  3HR0 A;  1N32 B;  1M56 B;  3O65 A;  1QCE A;  1N32 O;  2WA3 A;  4MVR A;  1XHZ A;  2W0F C;  1R3I C;  3F5T A;  4JZG A;  4I9W A;  4X9Q A;  2Z3Y A;  1AJP A;  1ARO P;  4GYC B;  4FM0 A;  1A32 A;  4O4H B;  4F6R A;  2XAS A;  3LSS A;  4UCR A;  3FAV A;  1B04 A;  3ABM C;  5IYZ A;  3G67 A;  4JYY A;  4MTF A;  4QNH B;  2KB1 A;  5JQG B;  3UT5 A;  1QNM A;  3X2Q B;  4WBN A;  2UXD B;  3B77 A;  4LF9 O;  1EN6 A;  1OCR B;  3OMI B;  1S0V A;  1TA8 A;  2CUG A;  5IJ9 A;  2OTL V;  1F4M A;  4B7E A;  4JGS A;  2XAQ A;  3FD9 A;  2RN9 A;  3K06 A;  3T1Y B;  1KBH A;  4CH4 A;  1S5H C;  3UQ8 A;  5KA5 A;  1SA0 A;  1XUQ A;  1OJH A;  2WLL A;  1P4R A;  3TET A;  3E22 B;  3MDS A;  3JD3 A;  1K33 A;  2DYR C;  1NBM G;  3DC6 A;  1OCC C;  1Y4M A;  3JAW A;  1COW G;  1MOF A;  1QR8 A;  1NTM H;  3KCY A;  4K8Z A;  3JCZ A;  4B08 A;  3RYI A;  4P2Z A;  3ZS8 C;  1I94 O;  4X65 B;  1K4D C;  4FM2 A;  5BXZ A;  3SPJ A;  3QNE A;  2QM8 A;  4MSW C;  4X62 O;  3CXC U;  1FKA O;  4LF4 B;  4NB5 A;  3SJA C;  1WNS A;  1SER A;  1HNX O;  5KUK A;  3JYC A;  2DYR B;  3BAA A;  4LFB B;  3JAK A;  2FL4 A;  4GX1 A;  1KKC A;  1XL6 A;  1VF6 A;  2EIL B;  3CCR V;  4E2L A;  4P9P A;  1IBK O;  3QF7 A;  4LFC O;  1HNZ B;  3TXQ A;  1AI5 A;  1SQB H;  4DR4 O;  1MG1 A;  3HKB B;  4G28 B;  2MK3 A;  5JH7 B;  4WBN B;  3K08 A;  2M7W A;  4X1Y A;  4UB8 Z;  4YXW G;  1I08 A;  4RWU A;  3DXR B;  4PJ0 Z;  3RFR A;  2IW5 A;  3AG3 B;  3ZHU A;  4F6R B;  4B3R O;  4UUJ C;  4TUY B;  2M6Y A;  5LMU O;  1AB3 A;  4O4H A;  1WN7 A;  1YTF B;  3OT7 A;  3KKY A;  4DR2 B;  4JI1 B;  2YXL A;  2BE3 A;  3JAK B;  3GWK C;  5IYD O;  4FLY A;  4DR2 O;  2JIZ G;  4JI2 O;  1MMM A;  2JRI A;  1N34 B;  1Y66 A;  5LMN O;  1VF6 C;  3CRC A;  4FFB B;  5LXT A;  1M57 C;  3CCQ V;  3JAW B;  3OEH G;  4JV5 O;  1R1B A;  3CCL V;  3CJH A;  4KHP O;  1HDJ A;  3OUS A;  4JV5 B;  4U3J B;  2OTJ V;  4CBC A;  2QTO A;  4UCU A;  1WP7 A;  4YJ3 A;  3FB6 C;  2LW1 A;  4EFB A;  2KKW A;  1XNR B;  4JF3 A;  4JI3 B;  3ZHR A;  2R9R B;  4PD4 F;  3CRM A;  4JTA B;  3EHB B;  1M4U A;  3ETD A;  1G8M A;  1YSC A;  3M99 B;  3RYH B;  3C3S A;  3OM3 B;  1VQ8 V;  4D6T H;  2OT5 A;  2E3C A;  5CA0 A;  2HHH B;  3W7U A;  3JD2 A;  2EIL C;  4TV9 A;  1FXK B;  5CB4 A;  1T5E A;  3ABK C;  3A0B Z;  4CH5 A;  4PI2 A;  1DTO A;  3HKD B;  2YEV A;  1IBL B;  4ZHQ B;  4NXM B;  1CEZ A;  3A0R A;  2WLI A;  2AHY A;  5IYZ B;  3JD1 A;  1HP8 A;  4FFB A;  4JYC A;  4NVP A;  2NR5 A;  3HKC A;  2NLJ C;  5J2T A;  1VEW A;  3LSQ A;  3OGC C;  2F95 B;  5LA6 B;  3H1L H;  3KCX A;  4IYI A;  3F7Y C;  2CGO A;  4GX2 A;  3SYQ A;  3B2E E;  3OTF A;  1Q82 W;  4WFB V;  4Z2W A;  4QPJ A;  1I7F A;  4X1I B;  5KX5 B;  4X66 B;  1VQO V;  3ZMS A;  1VQ9 V;  3C3T A;  1UJW B;  3K57 A;  2JEU A;  1EBO A;  1MA1 A;  2ZIN A;  3PJS K;  4GKJ B;  1CPY A;  3ZMZ A;  4J41 A;  1ENV A;  5LMU B;  1EN4 A;  2EJ7 A;  4DV3 B;  1H2M A;  2X6B A;  2ZM6 O;  1LR1 A;  2UXC O;  5D5P A;  3AG2 C;  1OCR C;  2DW4 A;  2Q7G A;  2L6L A;  2ZXW C;  2E75 B;  4FLW A;  2CDY A;  4JI2 B;  2ZE8 A;  5LHH A;  3CEI A;  5B5E Z;  4OX9 O;  4B3R B;  3CPW U;  1P49 A;  4C7U A;  1R3L C;  1ZL8 B;  1GO3 F;  1PNL A;  1K8A W;  2X0L A;  3R65 A;  1N33 B;  4KFM A;  3T1H O;  3AG7 A;  1N33 O;  2R70 A;  3L71 H;  4LR3 A;  3AG1 B;  4O2B B;  1K5S A;  3BEH A;  4EB6 A;  4WCE V;  2IU3 A;  4GLX A;  3CXH F;  1BGY H;  4DV6 B;  2WLN A;  3IAY A;  5GON B;  4LF8 B;  2F66 C;  2K9P A;  4MVO A;  4NYK A;  1PPJ H;  4LF8 O;  4O4I A;  3VQV A;  1GN6 A;  2UXD O;  2Q9L A;  5A9G A;  2Q7H A;  2JS3 A;  3Q4H A;  4HNA A;  5CBH A;  3S3W A;  1YJ9 V;  4QJF B;  2EIM C;  3RT3 C;  1CXZ B;  3T1C A;  5KHJ A;  5EYP A;  4J10 A;  3U0Z A;  5FPR A;  3G6E V;  3QG5 A;  2EIJ B;  2ETN A;  2N74 A;  1FJG B;  3OD4 A;  2PYJ A;  1NKD A;  1JQ0 A;  3ZRX A;  1N0J A;  3OR6 C;  5EC2 C;  4GZR B;  5B1O A;  1PM9 A;  2A3Q A;  1K9M W;  3FB8 C;  3CC2 V;  2Q0A A;  4TQF A;  2QSA A;  4FVM A;  1M5I A;  4I4T A;  2P6J A;  1FYJ A;  3B09 A;  2XTA A;  1H2K A;  4B3S O;  4HAM A;  2YXY A;  4TV8 B;  2GSM B;  5LOV A;  2ZE7 A;  4DV0 O;  1F51 A;  2Q69 A;  2WWW A;  4PA9 A;  1TGO A;  1NR7 A;  1AI4 A;  1R3K C;  2DE0 X;  1Q86 W;  5TIS Z;  1NTZ H;  3QTC A;  4EB6 B;  2EIJ C;  1KQS U;  4DR1 B;  2H8P C;  2YEV B;  3A2F A;  1L1F A;  3OMA B;  1VQL V;  2Q68 A;  2CTW A;  2IU0 A;  5CB4 B;  4DUZ O;  2UXC B;  1WJZ A;  3ZIA G;  1FFX A;  2IJI A;  4LFC B;  4BIU A;  1ZX3 A;  1M1K W;  3D36 C;  3AK2 A;  1GM9 A;  2H3O A;  1MSD A;  3T4D A;  1QU7 A;  3E22 A;  3CWB H;  4UCT A;  1XMQ B;  4MW8 A;  2LO1 A;  2N05 A;  5IE9 A;  5LP6 C;  5KHG A;  2ZIM A;  2ZCE A;  4MVS A;  2Q73 A;  1PD3 A;  2F1M A;  1N34 O;  3JAS A;  2ZT9 B;  4Q20 A;  3G4S V;  4YJ2 A;  2LQT A;  4R50 A;  3WB1 A;  1S5L Z;  3BRC A;  4LP8 A;  2JS5 A;  3MD0 A;  4X1K A;  3D3I A;  3D8C A;  5BMV B;  3LSU A;  2P90 A;  4U3J A;  3M7M X;  3RVY A;  4DV4 B;  4K0K B;  1IUR A;  1IXB A;  4DV7 O;  5DM6 V;  2UXN A;  4O4J B;  4PHZ A;  4DR5 B;  1E1R G;  3QO8 A;  4N23 A;  4I50 B;  1XL4 A;  5FPO A;  4G2K A;  1YZB A;  2VQE O;  5LOV B;  2ADQ B;  3OR7 C;  2YIC A;  2QM4 A;  1OCO C;  1AIL A;  2YI8 A;  3OEE G;  4RAI A;  4GKK B;  2EJR A;  4NXM O;  2B1I A;  1VQM V;  4LF7 O;  4J7K A;  5CA0 B;  3CSX A;  3K5N A;  4LNU B;  3RW0 A;  4KXR A;  4PI0 A;  2QTS A;  3WG7 C;  2DQ3 A;  3JAM N;  2Y48 A;  3E8B A;  3UO2 A;  4LBE C;  2A0L A;  1BHB A;  2QKS A;  4H0L B;  1K97 A;  5BR8 O;  2P06 A;  2CTQ A;  3D36 A;  2AGA A;  1J5E O;  4DUY O;  2QWR B;  2CAZ C;  5CA3 A;  5KHI A;  4DK0 A;  1IZ3 A;  4I4T B;  3FFQ A;  1VP7 A;  4I9Q A;  4TUY A;  4DR6 B;  2V1D A;  1R6K A;  3NR7 A;  2JK5 C;  4X20 B;  1JFF A;  1I5X A;  2AW9 A;  1W0K G;  4R7C A;  3JAL A;  3RVZ A;  2EIN B;  5F2V O;  4HZ3 A;  3ABM B;  4GKJ O;  3ABL B;  4NR1 A;  4I55 A;  4P30 A;  5KA6 A;  4QPK A;  2A7W A;  4DV5 B;  3A0H Z;  5LBQ A;  3RYC A;  1Q81 W;  1D5N A;  4NTX A;  5J2U A;  1SQX H;  1Y76 B;  2ODM A;  4KP4 A;  3RYC B;  4IIJ B;  2ATK C;  4DV1 B;  3K0G A;  2ZR2 A;  4I55 B;  3THO A;  4DV2 O;  4BW9 A;  1Q7Y W;  3ZRW A;  1K7D A;  5JQG A;  5GTI Z;  4EFE A;  1BQ0 A;  1VQ5 V;  5H6R A;  2LJ2 A;  3ZN1 A;  4X1I A;  4F4L A;  1B3Q A;  1K92 A;  1SKV A;  2R9I A;  5KHH A;  3TK1 A;  3N2G B;  3P3N A;  3E35 A;  1EM1 A;  3HKE B;  3OMN B;  3E86 A;  2JJ2 G;  2LGW A;  3AK3 A;  2YI9 A;  1YXB A;  3N2K B;  2ZNI A;  5D5Q A;  5J9P C;  4DR5 O;  3ZHS A;  5LL6 Y;  1BE3 H;  2ITD C;  4PA4 A;  4YJ2 B;  1Y74 B;  3BAB A;  3WFV A;  3OAA G;  1KUQ A;  4LF7 B;  3O9O A;  5B1B C;  3H1J H;  2OIG A;  4Z1M G;  3CYO A;  4LFA O;  2UXB B;  1NU1 H;  3B8N A;  1R6N A;  1UFI A;  1N8R W;  1YCI A;  3BPZ A;  1VQK V;  4JI7 B;  1QVF U;  3G80 A;  3SR2 C;  4ZOL A;  3JSN A;  1I0H A;  2BTO A;  5KAI Z;  1KC8 W;  1WB8 A;  1X59 A;  2DN9 A;  4TWK A;  4PDM A;  4NTY A;  1H2L A;  2QR4 A;  2DYS C;  2YUA A;  3E89 A;  1Y6X A;  3SJC C;  1AP5 A;  1LUV A;  4BAY A;  3GB7 C;  2Y4T A;  3CD6 V;  4PEL A;  4DR6 O;  4I7Z B;  2P22 C;  4WF9 V;  4CH3 A;  4QE9 A;  4IGG A;  1HR0 B;  3K5M A;  4BWA A;  1HNZ O;  4LF6 O;  3APQ A;  3H1H H;  4JI0 B;  3N2K A;  2BTQ B;  2DYS B;  4TV9 B;  3R66 A;  4L8J A;  3T1H B;  3BCC H;  5EBL C;  2F23 A;  4MTG A;  4JI5 B;  3ASO C;  4B3T B;  4FK5 C;  2DQ0 A;  5LHI A;  1SQG A;  1VAR A;  1EN5 A;  4FPP A;  2FML A;  5B1B B;  5J2U B;  4CC6 A;  3ETE A;  4OPH A;  2G38 A;  2QWO B;  4JAV A;  2WLH A;  5KMG B;  1RPR A;  3L72 H;  4ZOL B;  1QQC A;  3P30 A;  4O4L A;  3T2M A;  2EBO A;  1VF7 A;  4XDK A;  3MHH C;  1K73 W;  2IM9 A;  2LW7 A;  1XNR O;  5HFL A;  5AG2 A;  1XMO B;  1ZSP A;  4UV8 A;  4DW1 A;  5KAF Z;  1NR1 A;  3CRQ A;  5GTH Z;  2UXB O;  3UO3 A;  4JAS A;  2YIB D;  4XDL A;  1SRY A;  4FLT A;  4NKG B;  3E8G A;  2AZ0 A;  1U96 A;  1JX9 A;  1LUW A;  3SPG A;  1BHA A;  3HB3 B;  1WA8 B;  2X7R B;  2BSK B;  2K1E A;  3J81 N;  2ZKO A;  1FD9 A;  2MW2 B;  4PA6 A;  3CMA V;  2WLL B;  1F23 A;  2YIA A;  4Q6G A;  3HKB A;  2UU9 O;  5EC1 C;  4IT5 A;  1AR4 A;  1V55 C;  2Q7E A;  1BZK A;  3FYI B;  4O2A B;  1IBK B;  3Q4H B;  1D2D A;  4EKW A;  1M93 A;  1ZTE A;  3SPC A;  3WB2 A;  1NVP D;  2Y69 C;  3GVM A;  1S3J A;  2GUZ B;  1JCH A;  2DOS A;  5EZY B;  4I50 A;  5IJ0 B;  1YDX A;  3CCV V;  3JAR A;  2OWO A;  4LH6 A;  1YJW V;  3GWO A;  1V55 B;  3ZCC A;  1M57 B;  4I0X B;  3E2E A;  1ROP A;  1FXH A;  2BCC H;  1GTO A;  1WA8 A;  3SJQ C;  2CGN A;  2BOB C;  4ICG A;  2YIB A;  3ABT A;  3WU2 Z;  2AXT Z;  4OX9 B;  3NXS A;  4DV2 B;  2PI4 A;  1TUE B;  1V9P A;  1ZAU A;  3L73 H;  1G6U A;  4OPA A;  4LCU C;  1ORQ C;  4ZHQ A;  4UVA A;  2PI5 A;  1R3J C;  4JI3 O;  2EIM B;  2JEX A;  2QJ1 A;  5KMG A;  3L74 H;  3CB2 A;  1IBM B;  1WAZ A;  1KYO F;  1GK9 A;  2B1G A;  4U7O A;  1GMG A;  4MTO A;  2UUC B;  4J7Z A;  1ZLZ A;  3ZHQ A;  1J95 A;  4QE7 A;  1HWY A;  2VWK A;  1QR9 A;  4NTW A;  3APO A;  4I5S A;  1RP3 B;  5B3S C;  1IBL O;  5FL7 G;  1DGS A;  4J80 A;  4GX5 A;  3OTO O;  2HR3 A;  4CS2 A;  2ITC C;  3H9V A;  3J80 N;  2RNB A;  3ML0 A;  5LA6 A;  1N0N A;  3TXS A;  2VRZ A;  4AQY O;  5JCO C;  3CC7 V;  4MT8 A;  3VBB A;  2IBZ H;  2JGD B;  3CC4 V;  1ZUQ A;  3BA8 A;  4E4E A;  4J42 A;  3ABL C;  3ETQ A;  2H94 A;  2P4V A;  5EIB C;  2UU9 B;  1GN2 A;  5B3S B;  5C8Y A;  1TVK B;  1DLB A;  3ASN C;  2NN4 A;  1V54 B;  2DMX A;  4RUE A;  4L87 A;  5BR8 B;  5JWP A;  3LUT B;  2Y0I A;  5IDJ A;  3ZMV A;  2GUZ A;  1AI6 A;  5H6Q A;  1RM1 B;  5FNV B;  5IY5 B;  1XNQ O;  1Z5W A;  1FPO A;  2A79 B;  2X6A A;  1VIB A;  1YVW A;  2V7Q G;  4WFF A;  2P4K A;  1H8E G;  3RN4 A;  4J11 A;  3FB5 C;  1Y76 A;  2W6J G;  2XHB A;  5KLV H;  1R73 A;  5B66 Z;  2O57 A;  1R6T A;  4CS3 A;  1E79 G;  3L9D A;  1V54 C;  4TT3 G;  4UVC A;  4QGP A;  1XEQ A;  1Y74 A;  1JFF B;  3L75 H;  4MVQ A;  1RM1 C;  5LHG A;  5CBF A;  4UCS A;  1D5A A;  1OZ0 A;  2FKX A;  1RSO A;  4UFZ A;  1IBM O;  1IXM A;  4ZBM A;  1S5J A;  3ZHV A;  4LF9 B;  1SA0 B;  1YEW A;  3ABK B;  4H13 B;  2GBO A;  1WB7 A;  1XQ8 A;  4HNA B;  1YI2 V;  4K0K O;  2F43 G;  4YY3 B;  1WPX A;  3ICX A;  1AP6 A;  4O4L B;  4CZZ A;  1L0L H;  1JR9 A;  2XAG A;  4TOI A;  1HNW O;  5JCO A;  1VQ4 V;  4G27 B;  3ASN B;  1VF5 B;  2UUB O;  1OCZ C;  2JGD A;  4JI4 B;  2B9Z A;  2ZDI A;  4CH6 A;  3D3Q A;  4X20 A;  3E8F A;  3DGE A;  1PV0 A;  5H9C A;  5KX5 A;  1XOU A;  4PDR A;  1H38 A;  4JI6 O;  4JI7 O;  3TCU A;  3DSQ A;  5GW7 A;  4JI8 B;  2ARH A;  4HYO A;  2JVD A;  1G1X B;  1DK1 A;  1PNM A;  4DR3 B;  4GUN A;  2EIN C;  1SC5 B;  5LYJ A;  4DR3 O;  1E1Q G;  5C93 A;  3JCU Z;  3CS5 A;  4FZ1 A;  1VMG A;  3BY6 A;  1VQ6 V;  1RPO A;  5IJ9 B;  4RUF A;  2Q0O C;  4IYH A;  4CS4 A;  1Y67 A;  4DXW A;  1QVG U;  3FX7 A;  1W2B U;  1U97 A;  3W7T A;  1L0N H;  1TVK A;  2VWJ A;  5ITZ A;  3SPH A;  1BL8 A;  4JTC B;  5DN6 G;  4K8X A;  3CCM V;  3AG1 C;  2ILM A;  1FFX B;  4DV5 O;  1GRJ A;  1IDS A;  1JVM A;  4BIZ A;  2GTS A;  4LF6 B;  3K9S A;  2UXX A;  5FLX N;  1M90 W;  2QGN A;  4DV1 O;  1Q6U A;  1N36 B;  2F4V O;  2RDC A;  2ZE5 A;  2NNU A;  1X4T A;  5EIB D;  3QVN A;  1MZE A;  4GX0 A;  3IC7 A;  1TAE A;  1OV9 A;  4I0X A;  3HPL C;  2OCH A;  4U3F H;  3K04 A;  5LMN B;  3CJH B;  3FKS G;  4FLZ A;  1SET A;  4YHH B;  4JAA A;  1URF A;  1OCO B;  2AHZ A;  1FXK A;  4YY3 O;  4MVZ A;  4DV6 O;  2QE7 G;  1EZJ A;  3AEI A;  2EX3 A;  4UB6 Z;  1GH6 A;  2XAH A;  3FB7 C;  2X6C A;  2E5L O;  3IGA C;  2HFE C;  3ETG A;  4ABM A;  4K3A A;  2YID A;  1JA8 A;  3ZRS A;  1AI7 A;  2DWD C;  3WG7 B;  1KMI Z;  2Q67 A;  2QDO A;  2XAJ A;  3TJT A;  3JAT A;  3A8T A;  1TUB B;  1H2N A;  2WAM A;  1PP9 H;  4OGQ B;  3OFN G;  1XI1 A;  1XDC A;  4MVM A;  4JI6 B;  1Q6I A;  3BVO A;  3CHX A;  3W7X A;  1KEC A;  4JI8 O;  5B1A C;  2W0X A;  2XOK G;  3JD4 A;  2AZ2 A;  4TV8 A;  1S72 V;  2LP7 A;  4O4I B;  1HW7 A;  1PL0 A;  1H2S B;  1YJN V;  2IJJ A;  4OXS A;  5IJ0 A;  3F5W C;  3ZMT A;  4DR4 B;  2ZXW B;  1Q90 D;  3TGU H;  5L3G A;  4GCZ A;  4PDV A;  4LFB O;  3J7A U;  5LP6 B;  1KKD A;  1Q43 A;  3C90 A;  3LNM B;  5IYB O;  5JH7 A;  1XNQ B;  1SQF A;  1KD1 W;  2QKA A;  2WA4 A;  2HJD A;  2P5O A;  4N21 A;  1ZL8 A;  3CX5 F;  2IJH A;  2WLK A;  4TQD A;  1EFR G;  4WFA V;  3OE7 G;  2UUA B;  1Z5V A;  2FB5 A;  3ZBH A;  1F4N A;  4LC1 A;  1GN3 A;  1XHX A;  1AJN A;  2RMK B;  4J9Z B;  5L3F A;  1RSO B;  4JI0 O;  5L3E A;  1KB9 F;  1BT8 A;  4UXN A;  2HLD G;  1BCC H;  1KP2 A;  5CA1 B;  5C8Y B;  1M56 C;  4UVB A;  3SYC A;  2JDI G;  3VQW A;  1OCZ B;  4YIP A;  3AG2 B;  1K5Q A;  4X8A A;  2Q4P A;  2DJV A;  1Q5O A;  1SF9 A;  2RQ6 A;  1K34 A;  5LGT A;  5B1A B;  1NT2 B;  1JOY A;  5J2T B;  1TUB A;  4DR7 B;  5BY1 A;  3K59 A;  1US6 A;  3U10 A;  4GKK O;  4DW0 A;  3I56 V;  1PL4 A;  5CN0 A;  4PA7 A;  3HKD A;  2D2C B;  2CTP A;  4AQY B;  4DRX B;  5L3C A;  1FJG O;  1S76 D;  3RWR D;  4CC5 A;  4LNU A;  4X62 B;  4LF4 O;  2OCC B;  1Q8I A;  1JJO A;  3B8M A;  3W7W A;  1W0J G;  4JTD B;  4JI4 O;  4DRX A;  2EZP A;  1VQN V;  5L3B A;  3G71 V;  2XAF A;  4RQE A;  2HG5 C;  2FYU H;  3VOU A;  1FXK C;  2HP8 A;  4X88 A;  3LDE A;  1HNX B;  1IVS A;  3HKC B;  1NTK H;  4X64 B;  3IC9 A;  1KU9 A;  1AVM A;  1J5E B;  4X64 O;  1JJ2 U;  5EK0 A;  2WLJ A;  1MSW D;  3IFX A;  1JPX A;  3EXA A;  3JAR B;  4UV9 A;  2KQX A;  5BMV A;  2Q6A A;  4H44 B;  3LDD A;  4DUY B;  1P84 F;  4J9Y B;  1NH2 D;  4X1K B;  3H01 A;  4FMT A;  5H5N A;  5LGU A;  3UM7 A;  4JYA B;  5L3D A;  5DEC A;  1B6Q A;  4LF5 O;  2DWE C;  5ITZ B;  4JYA O;  1CP9 A;  4YIO A;  2PYL A;  4FFK A;  1QBZ A;  2W6I G;  2EIK C;  5A2Q N;  4B3T O;  4LWS A;  4ZKI A;  4AHC A;  4X89 A;  5EZY A;  2UUA O;  2WPD G;  1H2G A;  1W59 A;  5IWA O;  5LYJ B;  3P32 A;  1P7B A;  2PTM A;  4A5U B;  4JPR A;  4DO2 A;  1WPB A;  1YHQ V;  2B5U A;  1SZX A;  1SQV H;  1YF2 A;  4B3M B;  4YJ3 B;  4YHH O;  2OYQ A;  3BA9 A;  3K5O A;  2YS8 A;  4R8C A;  1Q3E A;  2OCC C;  1PNK A;  1VQ7 V;  3M8A A;  3EVK A;  3N27 A;  3LNN A;  2BSK A;  2CH7 A;  3ZED A;  4ASU G;  4DV4 O;  1G4Y B;  3ZN0 A;  2UUC O;  4FM1 A;  4JZ2 A;  2UUB B;  1FFT B;  2VS0 A;  2WLM A;  3SPI A;  4J7J A;  2KG7 B;  1VQP V;  1JMK C;  3HKE A;  1XMO O;  4W4K A;  2GV9 A;  4U7N A;  4X1Y B;  4WFH A;  3SYA A;  1WLE A;  1IX9 A;  4BIO A;  1BS3 A;  1EZV H;  3VQY A;  3X2Q C;  4X65 O;  3DTU B;  4NXN O;  3UCS C;  4O2A A;  3VQX A;  1P7G A;  2PZS A;  2F93 B;  1OHH G;  4IHJ B;  1K4C C;  4LWS B;  2HEP A;  3IJ4 A;  3OTO B;  5IY5 C;  4PA3 A;  3CRR A;  4BW5 A;  3E8H A;  3MHS C;  4H33 A;  2Q5Z A;  5GON A;  3CCU V;  3RYF B;  1GKF A;  3UKM A;  4P9O A;  2EIK B;  5B1N A;  1OCC B;  1H8H G;  3G6B A;  3CME V;  2LGQ A;  2PY5 A;  3RGB A;  1GN4 A;  1UPG A;  4QIW F;  4X66 O;  4TSF G;  4B3S B;  3EFF K;  2XUM A;  2A9H A;  2ZD9 A;  1AJQ A;  4DV3 O;  4XDJ A;  4ZIB A;  2ZDI C;  2LFS A;  2HJF C;  1HR0 O;  2WLI B;  2IJK A;  4MTX A;  1Z2G A;  5IT9 N;  3CCJ V;  3RBZ A;  1BSM A;  3K0D A;  5JJE B;  3ZX6 A;  2ADP A;  2XT9 A;  4JI5 O;  1O9H A;  3ABU A;  2ZNJ A;  1YIT V;  1Q6H A;  2R72 A;  2ZR3 A;  4UCV A;  1QLE C;  2P7T C;  1XRE A;  4W4L A;  2V4D A;  4KHP B;  5JVD A;  4B3M O;  2JGU A;  3UT5 B;  3BHP A;  2ZQM A;  5CMU A;  1MZF A;  5FNV A;  4WFE A;  4Z1V A;  2YSU B;  1NH2 B;  3K3W A;  3OW2 U;  3SDL A;  1NS1 A;  4FLV A;  3AG3 C;  1YTF D;  5E1A C;  3BFR A;  4DV7 B;  4JYB A;  5E79 Z;  3T1Y O;  2R9A A;  2GHY A;  3SJB C;  4MW3 A;  2LFR A;  4ZI7 B;  3KG2 A;  4D7T A;  2Y0P A;  2BTQ A;  4ZI7 A;  2Z0A A;  3K58 A;  1K3E A;  2E5L B;  1HNW B;  2QEX V;  1NZ6 A;  4HBN A;  1F7Y A;  3KZI Z;  3N2G A;  4NXN B;  4FLX A;  3JAS B;  2QWN B;  2ZE6 A;  3DC5 A;  1GAX A;  1WP8 A;  2Q8V A;  3ZHT A;  1B06 A;  2EUL A;  3RYF A;  4LFA B;  2Y69 B;  2IH3 C;  3DXR A;  3RYH A;  1NVP B;  2N04 A;  4FZ0 A;  5CA1 A;  3SGI A;  5EBW C;  2E74 B;  2D3O W;  3S3X A;  3H1I H;  2VQF O;  1RFY A;  2OIE A;  4PV1 B;  1SQP H;  3CRA A;  5BZB A;  4DK1 A;  1NI8 A;  2VQF B;  1BMF G;  4BR6 A;  4FLU A;  5JVD B;  5HFM A;  2YDE A;  4DV0 B;  1SZT A;  3W7S A;  4MS2 A;  1DF4 A;  3LDC A;  2Z5U A;  2PF4 E;  2KSD A;  2Y4U A;  4R6Z A;  5LXT B;  5KUM A;  3ASO B;  2PGG A;  1L8D A;  3AK1 A;  2WSS G;  4KL1 A;  2L35 A;  3K03 A;  3CP1 A;  5IYC O;  3MAQ A;  3B40 A;  5CBG A;  4IL6 Z;  4JI1 O;  3STZ C;  1M9N A;  4DUZ B;  1O9G A;  3JAL B;  2HVK C;  3ZJZ A;  1FS0 G;  2GDS A;  1MNG A;  2KG7 A;  4LF5 B;  2E76 B;  1QLN A;  3FYE B;  1SES A;  5JJN B;  2ZM6 B;  1N4C A;  2C2A A;  3E83 A;  3JD0 A;  1XMQ O;  1GM8 A;  1LNQ A;  5LGN A;  3ZRW B;  3K79 A;  2QM7 A;  5DED A;  5EYP B;  1SS3 A;  3JSL A;  4IHJ A;  4RQF A;  3CE2 A;  2HKO A;  4LH7 A;  1YIJ V;  1N36 O;  2F4V B;  1KP3 A;  1AR1 B;  1DF5 A;  3L70 H;  5IWA B;  3SYO A;  2YC0 A;  3STL C;  1THZ A;  4H37 A;  4AIL C;  3U11 A;  5LP6 A;  1NJI W;  2CK3 G;  2CE4 A;  1BQZ A;  4IIJ A;  3JAT B;  2HVJ C;  3ZRV A;  2YXH A;  4FIP C;  4DR7 O;  3OGI B;  5EBM C;  3FAV B;  3AG4 C;  2FTK A;  1XBL A;  3ZMU A;  4O4J A;  2CH7 B;  2VQE B;  3F7V C;  4EEQ A;  3WB0 A;  1MAB G;  2HHH O;  4MVU A;  2BOC C;  4FJC C;  3QO7 A;  1AR5 A;  3I55 V;  2P67 A;  1GM7 A;  1PKX A;  3K9A A;  2QWP B;  4DYL A;  4XBF A;  5H2F Z;  1NQT A;  2QKC A;  4AI8 A;  1QHT A;  4RO2 A;  1XIL A;  2PUS A;  3CCE V;  3RYI B;  4F6E A;  4O2B A;  2A06 H;  3K5L A;  3T4Z A;  3AG4 B;  4PDL A;  2EZO A; 
#chains in the Genus database with same CATH homology
 4DR3 O;  2LW7 A;  4OPA A;  4JI5 O;  1XNR O;  5BR8 O;  4JI8 O;  5BY1 A;  4YHH O;  3T1H O;  1R6T A;  1N33 O;  4GKK O;  2AGA A;  1J5E O;  4DUY O;  3M8A A;  2UXB O;  4JI1 O;  4JI3 O;  1XEQ A;  1FJG O;  4B3M O;  1I94 O;  4DV4 O;  2UUC O;  4LF4 O;  2FKX A;  1X59 A;  5BXZ A;  4DV5 O;  3SDL A;  1FKA O;  4X62 O;  1NS1 A;  1XMO O;  1HNX O;  4LFB O;  4JI4 O;  1IBM O;  3J81 N;  2ZKO A;  1N34 O;  1XMQ O;  3J7A U;  4LF8 O;  5FLX N;  4DR1 O;  2UXD O;  4GKJ O;  3T1Y O;  4DV1 O;  4DR6 O;  1IBL O;  2UU9 O;  2F4V O;  1IBK O;  3O65 A;  4X65 O;  4NXN O;  4LFC O;  1N32 O;  1N36 O;  3OTO O;  4K0K O;  3RT3 C;  4DR4 O;  1D2D A;  2Z0A A;  3F5T A;  4X64 O;  1HNZ O;  3J80 N;  4DV2 O;  4LF6 O;  1F7Y A;  4DV7 O;  4AQY O;  2N74 A;  1HNW O;  1A32 A;  4DR7 O;  2DOS A;  4YY3 O;  3R66 A;  4DV6 O;  4JI0 O;  2UUB O;  1YZB A;  4B3R O;  5H5N A;  2VQE O;  5LMU O;  1AB3 A;  4LF5 O;  4X66 O;  4JYA O;  1AIL A;  1FYJ A;  2E5L O;  2HHH O;  4B3S O;  4LF9 O;  5A2Q N;  4DR2 O;  4B3T O;  4NXM O;  4DV3 O;  4JI2 O;  4DV0 O;  4LF7 O;  2JRI A;  2UUA O;  2VQF O;  5LMN O;  2DJV A;  2ZM6 O;  4JI6 O;  4JI7 O;  2UXC O;  4OPH A;  1HR0 O;  1XNQ O;  5IWA O;  4DR5 O;  5LL6 Y;  4A5U B;  4JV5 O;  1R1B A;  1KUQ A;  5IT9 N;  4KHP O;  1G1X B;  1DK1 A;  3JAM N;  4OX9 O;  4LFA O;  4DUZ O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...