4DV3O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv3O00
1F7YA 5LMNO 4DR7O 4DUZO 4LFBO 2UXBO 4DR5O 1HR0O 1AILA 1DK1A 1XNRO 1FKAO 5A2QN 4JV5O 4X64O 4GKJO 4LF7O 2DJVA 5BR8O 1IBMO 4GKKO 3O65A 4LFAO 4DR3O 2ZM6O 4OPAA 1XMOO 2JRIA 1G1XB 4LFCO 2F4VO 2HHHO 1D2DA 5H5NA 1R1BA 2E5LO 1NS1A 2UUAO 2UXCO 2UUBO 4DUYO 4LF5O 2LW7A 4X65O 4NXMO 4B3SO 3RT3C 4X66O 4LF4O 2ZKOA 4NXNO 2FKXA 4LF9O 4DV6O 5IWAO 4DV7O 4DR4O 1I94O 4DV4O 4KHPO 4YHHO 4JI2O 4AQYO 3R66A 5BY1A 2N74A 1R6TA 1N33O 1A32A 4JI0O 1XEQA 3JAMN 4YY3O 4JI4O 1N32O 4DV5O 1FYJA 3J80N 5BXZA 1N34O 3T1HO 4A5UB 2UXDO 1N36O 3F5TA 3J81N 4OPHA 1X59A 4DV3O 1HNWO 1HNZO 4DV0O 5FLXN 4X62O 1KUQA 4DV1O 4DR2O 1YZBA 5LL6Y 4OX9O 4LF8O 2VQEO 3J7AU 4DR6O 4JI7O 2VQFO 4JI5O 4LF6O 1XMQO 4JI3O 4DR1O 1IBKO 1AB3A 3OTOO 1J5EO 3SDLA 1IBLO 1XNQO 2UU9O 4JYAO 2Z0AA 4B3MO 2AGAA 4JI6O 4B3TO 4JI1O 3T1YO 4K0KO 1FJGO 4B3RO 1HNXO 2DOSA 4JI8O 2UUCO 5LMUO 5IT9N 4DV2O 3M8AA
chains in the Genus database with same CATH superfamily
3HB3B 2UXBO 3M7MX 4BR6A 4MVOA 4C7UA 3FB6C 2LO1A 3CB2A 3WFVA 1KMIZ 3S3XA 4CC6A 5A2QN 1SA0B 5KA6A 3KZIZ 1V54C 4UXNA 2PUSA 4I9WA 4I4TB 1XMOO 1KB9F 1G1XB 4FZ0A 4X9QA 2M7WA 4FLXA 2AZ0A 4LF9B 4DUYO 4PV1B 1IDSA 4DV7B 4B3SO 4DV4B 3OMIB 2CGNA 5EC1C 4BIOA 3TETA 1NT2B 1GO3F 5KMGA 3CC2V 1AI7A 4X20A 2QKAA 1I94O 1N32B 1MMMA 2L35A 4KUMA 3B77A 2YDEA 2WLNA 4IIJA 3UT5A 2WLIA 2JGDA 2WLJA 3X2QB 4DV0O 1OJHA 2HR3A 2QGNA 1T5EA 4DR2O 3P3NA 2QA4V 3L73H 2LW1A 4JYAB 3HPLC 3ABLB 4O2AA 4LF6O 3E35A 3ZRVA 2GUZA 3AG2B 3JASB 4KL1A 3WG7C 2QWOB 2N04A 2R9RB 1K8AW 2A06H 1PNMA 5LMUB 4PA9A 5IYZB 1CXZB 1VEWA 2HJFC 3RYHA 3I5DA 1NZ6A 2YUAA 5CN0A 2OIGA 2QKSA 2P22C 4MVQA 3CJHA 2GTAA 1DK1A 1M57C 1M90W 2BOCC 3G6BA 4U3JB 4CS3A 2CAZC 4TV8A 2PTMA 4KHPB 1VMGA 2Y0PA 2A79B 5LHHA 4GX5A 4MTFA 3O65A 1SA0A 2ZM6O 4LFCO 3T1CA 5LP6A 2JJ2G 3LDDA 5DN6G 1NI8A 3NR7A 1VARA 4CH4A 4I4TA 3CCUV 2E3CA 3ETEA 2ZXWB 2A0LA 4FM0A 3APOA 4LF5O 2OT5A 4FLZA 3H9VA 4YHHB 1KBHA 2ZKOA 4JYCA 3K79A 2IW5A 4WF9V 1SF9A 1S5JA 5C8YA 1OCZB 4AQYO 5LBQA 1N34B 5IY5C 5JVDB 4CH6A 3MAQA 1Y4MA 3ZS8C 3CP1A 2X6CA 4X89A 1QCEA 4J11A 3UO2A 5BMVA 1K92A 3RBZA 4ZI7A 4HAMA 4NYKA 1AROP 1SQBH 4JTCB 2DQ0A 4H44B 4IL6Z 4WFAV 5BR8B 1YI2V 5CBHA 3RVYA 2Q73A 5IJ9A 2HVJC 1RPRA 1WB8A 1YTFD 1QLEC 2OIEA 3HKEB 3JASA 5LXTA 2YS8A 4JAVA 4JI1O 4I50B 3CC4V 1YITV 5LMNB 1XI1A 4PI2A 5LYJB 4EB6B 3RYIB 2CTPA 2JIZG 1KU9A 1G6UA 3CYOA 2Y69C 1ZX3A 3EXAA 3M99B 4AHCA 5K1XA 4UB8Z 3JALA 2Y4UA 2CTRA 1QLNA 4LWSB 1EZJA 2XUMA 4L8JA 1ENVA 2EILC 3QF7A 1US6A 1M9NA 2DW4A 2HHHO 1XDCA 3T4DA 4Q6GA 3LUTB 2ZE6A 3OEEG 2PGGA 2IJKA 4LP8A 3FD9A 1BT8A 1SETA 2ZDIA 3WG7B 3EHBB 1E1RG 1AR4A 4DV5B 2DMXA 3N2KB 5BY1A 1AJPA 2IJIA 3FB7C 3EVKA 3CXCU 4YJ3B 3CMEV 5FNVB 1GN4A 1N36O 5JVDA 2Q67A 5LA6B 1JJ2U 2ADQB 4GX2A 2NN4A 1M57B 2ZR2A 1IBKB 1HR0B 4PI0A 4LF8O 2ZCEA 5CA1A 2XAGA 1TUEB 5GTIZ 2JJ1G 3CXHF 3WU2Z 2ITDC 2ZIMA 4IHJB 1VQLV 1JX9A 2Q9LA 1SZTA 4B3MO 1BMFG 1S5LZ 4JI6O 1B6QA 1MNGA 1FJGO 2P06A 4UCOA 5E1AC 5F2VO 1QHTA 2EULA 2W0FC 3HKEA 4I55B 2W6JG 4D7SA 4O4IA 2X6AA 2P4VA 3ABMB 3AK3A 4MVZA 4WBNA 2RJZA 1Z5WA 2P67A 3ZMZA 1LUWA 3F7VC 2MK3A 5C93A 4WFGA 2R70A 2FTKA 3N27A 4OXSA 2VWKA 4F6RA 5CBGA 2EBOA 1K73W 3JD3A 3RYCB 4BIZA 4XDKA 1QVFU 1K4DC 1FXKB 3SPIA 1FPOA 4LWSA 4ZOLB 2B5UA 1FFXB 1R1BA 2ATKC 1I08A 4X66B 4TQFA 2PI5A 4AI8A 3CCSV 4FM2A 3E86A 4QPJA 3B8MA 5AG2A 2WLLA 3BRCA 2FKXA 1GAXA 1Y6XA 3OFNG 3SYOA 4X1KB 3IAYA 3LSSA 1N33O 4GYCB 3K9AA 2BTQA 3OUFA 4I0XA 3ASOC 4A5UB 3DC5A 3Q4HA 1YSCA 3ZHSA 3SYQA 2RNBA 2Y69B 2Z5UA 1TAEA 1B06A 5FNVA 1BCCH 1X4TA 3G67A 1LUVA 5LA6A 5B3SC 3CRRA 4JI3O 1NH2B 1COWG 4UCVA 4GLXA 4JYBA 5LP6C 2X7RB 4PA6A 1KQSU 2BE3A 1KKDA 4L87A 4B08A 1XQ8A 3SPGA 3JD4A 4DR7B 1BS3A 1TUBB 4DUZB 3H1HH 5JCOA 4B3RO 5GTHZ 1ZWIC 1XNRB 5IYDO 2EIJB 4IYHA 3M8AA 1R3LC 1Y76A 5EZYA 4LFBO 4NTWA 1S5HC 1KP3A 2LFRA 3L70H 1JA8A 4HNAB 1GH6A 3OEHG 1I5XA 3ML0A 3K04A 3ETGA 1RSOB 2YI8A 3JAWA 1D2DA 2HVKC 2RN9A 1SZXA 4LF4B 1FXKA 4KFMA 3FAVB 3X2QC 1TVKA 2MW2B 4MW8A 4YIPA 2CUGA 3ZBHA 2DN9A 3LDEA 2PY5A 4LF9O 4LCUC 3K03A 4JGSA 1VQPV 4FLVA 4FLYA 4DV7O 5B5EZ 4JI0B 4DV4O 2P4KA 4LC1A 2L6LA 2OWOA 4MVMA 1HNZB 5B1BC 1N32O 4O4HB 1M4UA 4X62B 5KMGB 5BXZA 3G6EV 3T1HO 3C90A 3K0GA 1R3KC 3LSUA 4JI7B 1S77D 4JAAA 3ETQA 1R3JC 4RAIA 1IBLB 3K0DA 4IIJB 2DWEC 2CDYA 4FM1A 3UT5B 1S0VA 2WLIB 2JGDB 1Q8IA 3CRAA 3OR6C 3SDLA 1AVMA 1XBLA 4CH5A 3ZHRA 4JYAO 4H13B 3TCUA 2QWRB 2Q7EA 1KP2A 1Q86W 4O2AB 2GUZB 1TGOA 3AK2A 3ABKB 2ZDIC 5LMUO 3OW2U 5IT9N 1TUBA 3F7YC 4LF7B 2ZNJA 5KX5A 4UCUA 1R6NA 5EIBD 2QE7G 3RYHB 1OCZC 1N0NA 2P6JA 2EZOA 3ASOB 3E8HA 3I56V 5KHIA 3JD0A 4TSFG 3HKCA 2ZE8A 3D3QA 5JJNB 3LNNA 1S76D 4TV8B 1M93A 1M56B 1NTZH 2WWWA 5EBMC 5B3SB 2M6YA 1Q6UA 3FAVA 5LP6B 2ITCC 1N4CA 4YHHO 3JSLA 4XDJA 1FD9A 3C3SA 4B3TB 2HFEC 2V7QG 3QO5A 4DV3B 4NTYA 2XT9A 1N34O 1WAZA 2W6IG 5KLVH 3A0HZ 4UVCA 4OX9B 5B66Z 3DXRB 1X59A 1G8MA 2XAQA 4EKWA 5BZBA 5HFMA 4O4HA 3AG1C 4JI5B 5C8YB 4N23A 4DW0A 1KC8W 1YZBA 2YIAA 1WA8A 4G28B 4XBFA 3BA9A 3CC7V 2D2CB 3U11A 4XDLA 3SJCC 5L3FA 3JAKA 1IBMB 2AHZA 2XASA 4R6ZA 4U7NA 5BMVB 2WPDG 4ZI7B 1FAFA 4F6EA 3BAAA 2D3OW 1YJ9V 1YEWA 4JI8O 4G2KA 5IJ9B 5LMNO 1VQ6V 4I7ZB 5IYBO 3BPZA 1Q7YW 4BAYA 2W0XA 3VQWA 2EIMB 5LXTB 4DW1A 1SQPH 4YJ2B 3U0ZA 4O4LA 4JV5O 5L3CA 1GM7A 1EN4A 2F4VB 1IZ3A 3CE2A 5IE9A 5B1BB 3K59A 1K7DA 4MVRA 1Q43A 2K9PA 3IJ4A 2UUBB 4OPAA 4J9ZB 4QNHB 3JYCA 4DRXB 3W7WA 1IURA 4B7KA 5H5NA 4QE7A 3JALB 5IYCO 1FXHA 1GN3A 1GK9A 2GBOA 2OTJV 4DV6B 4NXMO 1SESA 4ZHQA 5EC2C 2BSKA 3QG5A 5FL7G 2QWPB 1M5IA 3BVOA 5LGTA 4Z1VA 5H6QA 5EBLC 1V55C 1PKXA 1SRYA 1KECA 1V9PA 1A32A 5JCOC 5CA0B 4UV9A 1PNLA 1FYJA 4DV5O 1OCRC 1N0JA 5GONB 5CB4B 4DV1B 1OCOC 2C2AA 2VQEB 2VQFB 1YF2A 1OV9A 3ABMC 1YJNV 1IVSA 2Q69A 3DXRA 2Q7GA 4MS2A 2JK5C 4GUNA 2JEUA 4NR1A 2ZT9B 1IBKO 1JPXA 1J5EO 2DYRB 1L0LH 3ZRSA 1ZTEA 3E89A 3ZRXA 4J7ZA 1XMOB 2YIBD 5LGUA 1HNXB 4WFEA 5EYPA 4QE9A 1FXKC 3JARB 2QM8A 1IXMA 3O9OA 4UCTA 5CA1B 1VQ9V 3ZEDA 2P90A 2VWJA 3CMAV 3D3IA 4DR5B 4PDRA 4DUYB 1KKCA 3OM3B 1ZSPA 3AG7A 4HBNA 3GB7C 2B1GA 2PI4A 4BWAA 3D36A 1AILA 5KHJA 3SGIA 2Q5ZA 4FMTA 4JTAB 1XOUA 4DR3B 3GWKC 1P4RA 4MVSA 4K8ZA 4YJ2A 2G38A 3RYFA 4O4IB 2R9IA 2X0LA 4WBNB 3H1JH 3AG1B 3ZCCA 4LNUA 5KHKA 3VBBA 2KB1A 5CMUA 1YDXA 3BFRA 4DV0B 4WFFA 4TQDA 4NXNB 3PJSK 4F6RB 3CD6V 4DRXA 4JTDB 2EX3A 2LW7A 4J7JA 4DR4B 4J9YB 3FFQA 3LSQA 3RT3C 4X66O 1SQGA 1F51A 4JI2B 3CCVV 4CH3A 3RN4A 2AXTZ 2B1IA 3CCMV 4LH7A 3UCSC 1K97A 4YY3B 1NVPB 1OCCB 3CCRV 1DF5A 1XHZA 4TUYB 1U96A 3ZIAG 3BABA 3ZRWB 2X6BA 4RO2A 3J80N 3OMAB 2WLLB 4H33A 1SKVA 1H8HG 1GTOA 3ABUA 1P49A 1GMGA 4LBEC 3IC9A 5CA0A 4DR6B 3VQYA 5GONA 4MTXA 2EIJC 2LFSA 1GN2A 5CB4A 2ZE7A 3QNEA 3TK1A 1XNQB 3J7AU 3LDCA 2WAMA 2QDOA 3VQXA 2KSDA 2BTQB 4JZ2A 5IDJA 4I0XB 2QJ1A 3Q4HB 2ZD9A 5ITZA 3T1YB 5B1OA 1NQTA 2ZM6B 2PF4E 3TGUH 4LFCB 1K9MW 1R73A 2YXHA 5DECA 1L0NH 4YXWG 4FLWA 1HWYA 3THOA 1JMKC 2DOSA 3JARA 3OTFA 4DR7O 1Q5OA 2K1EA 4DUZO 1BHBA 4FFKA 1XNRO 2WLHA 4LH6A 1V55B 3SJBC 4Z2WA 1S3JA 3RGBA 5H2FZ 4AQYB 3JCUZ 2QTOA 1OCRB 1DF4A 3OR7C 2VS0A 4CBCA 2E5LB 1Y76B 1OCOB 1RPOA 5H6RA 5EZYB 3K5MA 3QO7A 4MT8A 3P3PA 1N8RW 1ROPA 4GX1A 4PA3A 4OGQB 1WB7A 1VQ7V 5CBFA 3L72H 4EEQA 3BHPA 3OT7A 3G4SV 4PA4A 5JQGB 1Y74B 1Q6IA 4LF4O 1P7GA 1PD3A 3JAWB 4CS2A 3P32A 1RSOA 1DLBA 4D6TH 1VQ8V 1DTOA 4NVPA 4JASA 4YIOA 4PHZA 1W59A 3ZMTA 2UXDB 3K06A 1TVKB 4JI0O 2CH7B 4JI1B 1PL0A 2ILMA 4TUYA 2Y0IA 4X88A 3ZRWA 1HNZO 5KUMA 3ABKC 4TT3G 1VQKV 3ABTA 4X62O 5HFLA 2XOKG 2WA3A 1L8DA 2FB5A 4MSWC 1NKDA 1WPXA 1BSMA 4B7EA 3ZJZA 4JI7O 2B9ZA 4W4KA 5LOVB 1AR5A 5JJJB 1XHXA 3OTOO 1IBLO 4EFEA 3FX7A 4NKGB 1URFA 3E8BA 1VQNV 2Z0AA 1R3IC 2YICA 2DE0X 4EFBA 1XREA 1JQ0A 1ORQC 2RMKB 2EIKC 2JS5A 3WB1A 1BGYH 1M56C 2JGUA 1F7YA 4X64B 2P7TC 1SC5B 4JZGA 1W0JG 2QM7A 2IM9A 4IT5A 3AG4B 3SJQC 3E8GA 3R65A 1MABG 2GSMB 4GKKB 3K5OA 1WNSA 3ZHVA 5B1AC 2A9HA 3JD1A 4LF7O 2DJVA 1PM9A 3OD4A 2UUAB 3CCQV 3H01A 2WLMA 1F23A 2AW9A 1P7BA 2UXNA 5KX5B 4J80A 3DC6A 4UB6Z 1QBZA 2DWDC 2HG5C 3APQA 1ZLZA 1PV0A 2Q4PA 4JPRA 3K9SA 1THZA 2QWNB 2IBZH 5IWAB 1JFFB 1HW7A 3ZMSA 1EFRG 3B40A 4MW3A 2KKWA 3HKCB 2DYSC 1NR1A 1CP9A 5DM6V 5JQGA 1Y74A 4E2LA 1FXVA 1B04A 1F4NA 2V1DA 5DEDA 3JAMN 1LNQA 4K35A 3CHXA 3CX5F 2H8PC 3BY6A 3JATB 3ZHTA 3F5TA 5IJ0B 2CH7A 3QVNA 3D36C 3W7TA 4DV3O 4ASUG 5LL6Y 4OX9O 2UU9B 3W7SA 2EIMC 4JI5O 3BA8A 1MSDA 4K0KB 2H94A 1YTFB 1B3QA 5LOVA 5H9CA 4TOIA 5KA5A 4X1YA 1WA8B 1AP6A 3VOUA 4DV2B 1QVGU 4H37A 4X8AA 3W7UA 5KUKA 4DXWA 1ZUQA 2IU3A 3JAKB 2E76B 3FB5C 4X1IB 4HYOA 2Q6AA 4QGPA 4GKJB 1FS0G 1NTKH 3L75H 4LFAB 3KCXA 4D7TA 1K5SA 2QEXV 1NBMG 2V4DA 1D5AA 2LQTA 3IFXA 3ZMVA 3W7XA 2PYJA 2UXCB 1AJQA 4HZ3A 5A9GA 1GKFA 2F4VO 1OHHG 3MD0A 3UO3A 4O4LB 4X65B 4NB5A 4TV9A 1AP5A 1VF6A 2YXYA 5EBWC 2UUBO 3ASNB 4IYIA 3HKBB 1FFTB 1VP7A 4DV6O 1F4MA 1JFFA 2HEPA 1VQ5V 2R9AA 3AG3B 4KHPO 3CRCA 2DYRC 1RM1C 1J95A 4PDMA 1ZL8A 2A7WA 4O4JB 3R66A 2NLJC 5JWPA 3STLC 4FIPC 2EIKB 3SPHA 2JEXA 4ZHQB 1HNWB 2BSKB 5KHGA 2XAJA 2F23A 5TISZ 4RQFA 1LR1A 3E8FA 1IX9A 2QSAA 1HDJA 4OPHA 2EINB 4O2BB 2YIBA 1VQOV 3JATA 4DR1B 4FFBA 4DV1O 3DGEA 5IJ0A 5B1AB 2VQEO 5J2UA 3UM7A 2VQFO 3T4ZA 1GM9A 4DK1A 2H3OA 1YJWV 1AB3A 5LHGA 3A0RA 3E2EA 3RWRD 3S3WA 1XILA 1VIBA 1CEZA 1I0HA 1WP7A 1VF7A 5L3DA 1PNKA 2YIDA 1SERA 4W4LA 4UVBA 4BW5A 2IH1C 3OGCC 5KHHA 1HNXO 1Z5VA 4ICGA 2DYSB 3LNMB 1YIJV 2F1MA 1NU1H 1Q3EA 4FLUA 4DR5O 2QWQB 3QO8A 5LGNA 2F95B 4WCEV 5EYPB 3FB8C 3F5WC 3L71H 4X1IA 3TJTA 1P84F 2HP8A 4UVAA 3C3TA 4FK5C 5BR8O 1OCCC 1JJOA 4DR3O 2VRZA 3WB2A 2EJ7A 3T1HB 3B2EE 3G80A 2A3QA 1IXBA 2YEVA 1OZ0A 3RYFB 1AJNA 3OMNB 2F66C 4NXNO 1QR9A 1MOFA 3HKBA 4LNUB 4DR4O 5CA3A 2XAHA 4JI4B 5B1NA 4JI2O 2AZ2A 5EIBC 3U10A 4YY3O 4O4JA 4DO2A 3KCYA 1SQQH 2CTWA 3J81N 2ZNIA 4P30A 3ZHUA 1H2SB 1XMQB 1YVWA 1GM8A 1K34A 2Q7HA 1K3EA 3H1IH 3ICXA 4RUEA 1AI6A 4GCZA 4O2BA 3DTUB 4UV8A 4DR6O 1XL4A 5J2TA 4FZ1A 1NH2D 1XNQO 4PELA 1UPGA 3CSXA 3K08A 5LHIA 3I55V 5KAFZ 3ZX6A 3A8TA 2QM4A 2UUCB 2ODMA 3E22B 3T1YO 4PDVA 2HKOA 2LGWA 2BTOA 2ZINA 2NNUA 2UXBB 1KD1W 1QQCA 1WP8A 2P5OA 5ITZB 2KG7B 1QR8A 3BCCH 3B4SA 2IH3C 1NJIW 1HR0O 2IJJA 1RM1B 2GV9A 2JS3A 2DQ3A 1RP3B 4WFHA 1VF5B 2OCCB 3SPCA 4JAUA 4MTGA 4ABMA 2CE4A 1R6KA 2E5LO 4B3SB 2BOBC 5JJEB 1H2NA 5GW7A 3RW0A 2ARHA 1VQMV 3SR2C 1I94B 2Y4TA 2ADPA 4LR3A 2PZSA 3CCLV 1Z2GA 1V54B 2CGOA 5E79Z 4PJ0Z 1BHAA 4P9PA 1JCHA 1I7FA 1AR1B 4I5SA 2UXDO 4DR2B 1K5QA 4JI8B 1BE3H 5FLXN 4LF6B 1WPBA 5D5QA 1UJWB 3E83A 3FYIB 3SJAC 3AG4C 5IYZA 1MA1A 4JV5B 3MDSA 2HJDA 1H8EG 1UFIA 3GVMA 1EM1A 2XHBA 1EN6A 2RDCA 2YXLA 2WLKA 4R50A 1Y67A 3SYAA 1VF6C 1DGSA 3PN1A 4U3JA 3A0BZ 1XUQA 3OGIB 4U3FH 3E22A 2RQ6A 4CS4A 2EJRA 4NXMB 3B8NA 4ZIBA 2NR5A 4KP4A 1PL4A 1FKAO 1H2LA 2KG7A 1K33A 4RUFA 4X64O 2AHYA 4FLTA 3ZMUA 1MZFA 4GKKO 4J41A 1BQZA 3UKMA 3CPWU 2QTSA 2IU0A 4BW9A 4BIUA 1G4YB 4LF5B 3HKDB 2UXXA 1NS1A 2FYUH 2UUAO 3TXQA 4JF3A 1QNMA 2ZQMA 5JH7B 3VQVA 3K5LA 4I9QA 2F93B 5L3EA 2QKCA 5IWAO 1J5EB 1MSWD 1AI5A 4ZKIA 4QPKA 1R6TA 2R72A 1U97A 3G71V 3CWBH 1YHQV 2EZPA 1H2KA 3OAAG 4Z1MG 1Q90D 5FPOA 3TXSA 2OYQA 2YI9A 1D5NA 1H2GA 3N2GB 1BL8A 2N05A 1GRJA 1NTMH 3KG2A 3AEIA 1KYOF 1K4CC 4I50A 4RQEA 4TWKA 2GHYA 2Q0AA 3SYCA 5LYJA 4EB6A 1BZKA 3RYIA 1VQ4V 2UU9O 2QR4A 5IY5B 3KKYA 1HP8A 2AGAA 5KAIZ 3D8CA 3JD2A 3SPJA 4K0KO 2FMLA 1BQ0A 2JDIG 3CEIA 4DYLA 2OCHA 1Y66A 3OUSA 4UCSA 4P2ZA 3ASNC 1QU7A 4DV2O 2HLDG 2O57A 1PP9H 4ZBMA 4G27B 3OE7G 4X1YB 3FYEB 1CPYA 4FJCC 1JOYA 4N21A 4GKJO 2F43G 1Q82W 2HHHB 3AG3C 1Q6HA 2E75B 4J10A 1QLEB 4LFAO 4MTOA 3ZHQA 4R8CA 1W2BU 1EN5A 1XL6A 2LJ2A 1WLEA 3EFFK 3JCZA 2UXCO 4UUJC 4F4LA 2EINC 3N2KA 3HKDA 4X65O 4J7KA 4P9OA 1SQFA 2XNDG 4YJ3A 1GN6A 3FKSG 1RFYA 5JH7A 2ETNA 5J9PC 4TV9B 4CZZA 2ZR3A 3CRQA 2OTLV 2ZIOA 1N36B 4PA7A 2EILB 1L1FA 1XEQA 4PDLA 4U7OA 3ZN0A 3ETDA 3IC7A 2KQXA 1NR7A 4LF8B 1ZAUA 5K1PA 1HNWO 3K3WA 4IHJA 2GDSA 2Z3YA 1ZL8B 3L74H 1KUQA 1PPJH 3N2GA 4IGGA 1O9HA 3UQ8A 4QIWF 3GWOA 2RCVA 4WFBV 4I55A 4B3MB 2BCCH 4DR1O 1H2MA 4JI6B 3CRMA 1FJGB 4GX0A 1MZEA 2PYLA 1YCIA 4FFBB 4B3TO 5EK0A 4J42A 5J2UB 3SYPA 3H1LH 1WN7A 2CK3G 1YXBA 3K57A 2LGQA 1Q81W 3RYCA 3ZN1A 4MVUA 3MHHC 2Q68A 3IGAC 3A2FA 2XTAA 2WSSG 4ZOLA 4Q20A 4KXRA 2GTSA 1FFXA 2Y48A 3T2MA 1EBOA 1EZVH 3CCEV 3K58A 1W0KG 4RWUA 3ABLC 1IBMO 3AG2C 3WB0A 1JVMA 2JRIA 4K3AA 4K8XA 1M1KW 2Q0OC 4X1KA 4GZRB 3DSQA 4CC5A 4QJFB 4X20B 3L9DA 1WJZA 3QTCA 3RVZA 4E4EA 1E1QG 3H1KH 1SS3A 2YSUB 5D5PA 3OTOB 1N33B 1TA8A 1NVPD 2N74A 2JVDA 2YEVB 5FPRA 3CCJV 4NTXA 5L3BA 4JI4O 2XAFA 3K5NA 3JSNA 3MHSC 4FVMA 3P30A 2E74B 4JYYA 5L3GA 3AK1A 3STZC 3BEHA 4JI3B 1E79G 2ZXWC 1H38A 1SQXH 2WA4A 1XMQO 2ZE5A 4PD4F 1SQVH 2FL4A 4FPPA 4UCRA 4UFZA 2Q8VA 3HR0A 4AILC 4R7CA 2IJHA 4GT1A 4B3RB 3CS5A 3B09A 1S72V 2OCCC 1JR9A 1O9GA 4DK0A 2CTQA 4H0LB 2LP7A 3RFRA 1I5YA 1AI4A 4HNAA 5J2TB 3NXSA 3CJHB 4LFBB 2YC0A 2UUCO 1MG1A
chains in the Genus database with same CATH topology
1F7YA 5LMNO 4DR7O 4DUZO 4LFBO 2UXBO 4DR5O 1HR0O 1AILA 1DK1A 1XNRO 1FKAO 5A2QN 4JV5O 4X64O 4GKJO 4LF7O 2DJVA 5BR8O 1IBMO 4GKKO 3O65A 4LFAO 4DR3O 2ZM6O 4OPAA 1XMOO 2JRIA 1G1XB 4LFCO 2F4VO 2HHHO 1D2DA 5H5NA 1R1BA 2E5LO 1NS1A 2UUAO 2UXCO 2UUBO 4DUYO 4LF5O 2LW7A 4X65O 4NXMO 4B3SO 3RT3C 4X66O 4LF4O 2ZKOA 4NXNO 2FKXA 4LF9O 4DV6O 5IWAO 4DV7O 4DR4O 1I94O 4DV4O 4KHPO 4YHHO 4JI2O 4AQYO 3R66A 5BY1A 2N74A 1R6TA 1N33O 1A32A 4JI0O 1XEQA 3JAMN 4YY3O 4JI4O 1N32O 4DV5O 1FYJA 3J80N 5BXZA 1N34O 3T1HO 4A5UB 2UXDO 1N36O 3F5TA 3J81N 4OPHA 1X59A 4DV3O 1HNWO 1HNZO 4DV0O 5FLXN 4X62O 1KUQA 4DV1O 4DR2O 1YZBA 5LL6Y 4OX9O 4LF8O 2VQEO 3J7AU 4DR6O 4JI7O 2VQFO 4JI5O 4LF6O 1XMQO 4JI3O 4DR1O 1IBKO 1AB3A 3OTOO 1J5EO 3SDLA 1IBLO 1XNQO 2UU9O 4JYAO 2Z0AA 4B3MO 2AGAA 4JI6O 4B3TO 4JI1O 3T1YO 4K0KO 1FJGO 4B3RO 1HNXO 2DOSA 4JI8O 2UUCO 5LMUO 5IT9N 4DV2O 3M8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F7Y A;  5LMN O;  4DR7 O;  4DUZ O;  4LFB O;  2UXB O;  4DR5 O;  1HR0 O;  1AIL A;  1DK1 A;  1XNR O;  1FKA O;  5A2Q N;  4JV5 O;  4X64 O;  4GKJ O;  4LF7 O;  2DJV A;  5BR8 O;  1IBM O;  4GKK O;  3O65 A;  4LFA O;  4DR3 O;  2ZM6 O;  4OPA A;  1XMO O;  2JRI A;  1G1X B;  4LFC O;  2F4V O;  2HHH O;  1D2D A;  5H5N A;  1R1B A;  2E5L O;  1NS1 A;  2UUA O;  2UXC O;  2UUB O;  4DUY O;  4LF5 O;  2LW7 A;  4X65 O;  4NXM O;  4B3S O;  3RT3 C;  4X66 O;  4LF4 O;  2ZKO A;  4NXN O;  2FKX A;  4LF9 O;  4DV6 O;  5IWA O;  4DV7 O;  4DR4 O;  1I94 O;  4DV4 O;  4KHP O;  4YHH O;  4JI2 O;  4AQY O;  3R66 A;  5BY1 A;  2N74 A;  1R6T A;  1N33 O;  1A32 A;  4JI0 O;  1XEQ A;  3JAM N;  4YY3 O;  4JI4 O;  1N32 O;  4DV5 O;  1FYJ A;  3J80 N;  5BXZ A;  1N34 O;  3T1H O;  4A5U B;  2UXD O;  1N36 O;  3F5T A;  3J81 N;  4OPH A;  1X59 A;  4DV3 O;  1HNW O;  1HNZ O;  4DV0 O;  5FLX N;  4X62 O;  1KUQ A;  4DV1 O;  4DR2 O;  1YZB A;  5LL6 Y;  4OX9 O;  4LF8 O;  2VQE O;  3J7A U;  4DR6 O;  4JI7 O;  2VQF O;  4JI5 O;  4LF6 O;  1XMQ O;  4JI3 O;  4DR1 O;  1IBK O;  1AB3 A;  3OTO O;  1J5E O;  3SDL A;  1IBL O;  1XNQ O;  2UU9 O;  4JYA O;  2Z0A A;  4B3M O;  2AGA A;  4JI6 O;  4B3T O;  4JI1 O;  3T1Y O;  4K0K O;  1FJG O;  4B3R O;  1HNX O;  2DOS A;  4JI8 O;  2UUC O;  5LMU O;  5IT9 N;  4DV2 O;  3M8A A; 
#chains in the Genus database with same CATH topology
 3HB3 B;  2UXB O;  3M7M X;  4BR6 A;  4MVO A;  4C7U A;  3FB6 C;  2LO1 A;  3CB2 A;  3WFV A;  1KMI Z;  3S3X A;  4CC6 A;  5A2Q N;  1SA0 B;  5KA6 A;  3KZI Z;  1V54 C;  4UXN A;  2PUS A;  4I9W A;  4I4T B;  1XMO O;  1KB9 F;  1G1X B;  4FZ0 A;  4X9Q A;  2M7W A;  4FLX A;  2AZ0 A;  4LF9 B;  4DUY O;  4PV1 B;  1IDS A;  4DV7 B;  4B3S O;  4DV4 B;  3OMI B;  2CGN A;  5EC1 C;  4BIO A;  3TET A;  1NT2 B;  1GO3 F;  5KMG A;  3CC2 V;  1AI7 A;  4X20 A;  2QKA A;  1I94 O;  1N32 B;  1MMM A;  2L35 A;  4KUM A;  3B77 A;  2YDE A;  2WLN A;  4IIJ A;  3UT5 A;  2WLI A;  2JGD A;  2WLJ A;  3X2Q B;  4DV0 O;  1OJH A;  2HR3 A;  2QGN A;  1T5E A;  4DR2 O;  3P3N A;  2QA4 V;  3L73 H;  2LW1 A;  4JYA B;  3HPL C;  3ABL B;  4O2A A;  4LF6 O;  3E35 A;  3ZRV A;  2GUZ A;  3AG2 B;  3JAS B;  4KL1 A;  3WG7 C;  2QWO B;  2N04 A;  2R9R B;  1K8A W;  2A06 H;  1PNM A;  5LMU B;  4PA9 A;  5IYZ B;  1CXZ B;  1VEW A;  2HJF C;  3RYH A;  3I5D A;  1NZ6 A;  2YUA A;  5CN0 A;  2OIG A;  2QKS A;  2P22 C;  4MVQ A;  3CJH A;  2GTA A;  1DK1 A;  1M57 C;  1M90 W;  2BOC C;  3G6B A;  4U3J B;  4CS3 A;  2CAZ C;  4TV8 A;  2PTM A;  4KHP B;  1VMG A;  2Y0P A;  2A79 B;  5LHH A;  4GX5 A;  4MTF A;  3O65 A;  1SA0 A;  2ZM6 O;  4LFC O;  3T1C A;  5LP6 A;  2JJ2 G;  3LDD A;  5DN6 G;  1NI8 A;  3NR7 A;  1VAR A;  4CH4 A;  4I4T A;  3CCU V;  2E3C A;  3ETE A;  2ZXW B;  2A0L A;  4FM0 A;  3APO A;  4LF5 O;  2OT5 A;  4FLZ A;  3H9V A;  4YHH B;  1KBH A;  2ZKO A;  4JYC A;  3K79 A;  2IW5 A;  4WF9 V;  1SF9 A;  1S5J A;  5C8Y A;  1OCZ B;  4AQY O;  5LBQ A;  1N34 B;  5IY5 C;  5JVD B;  4CH6 A;  3MAQ A;  1Y4M A;  3ZS8 C;  3CP1 A;  2X6C A;  4X89 A;  1QCE A;  4J11 A;  3UO2 A;  5BMV A;  1K92 A;  3RBZ A;  4ZI7 A;  4HAM A;  4NYK A;  1ARO P;  1SQB H;  4JTC B;  2DQ0 A;  4H44 B;  4IL6 Z;  4WFA V;  5BR8 B;  1YI2 V;  5CBH A;  3RVY A;  2Q73 A;  5IJ9 A;  2HVJ C;  1RPR A;  1WB8 A;  1YTF D;  1QLE C;  2OIE A;  3HKE B;  3JAS A;  5LXT A;  2YS8 A;  4JAV A;  4JI1 O;  4I50 B;  3CC4 V;  1YIT V;  5LMN B;  1XI1 A;  4PI2 A;  5LYJ B;  4EB6 B;  3RYI B;  2CTP A;  2JIZ G;  1KU9 A;  1G6U A;  3CYO A;  2Y69 C;  1ZX3 A;  3EXA A;  3M99 B;  4AHC A;  5K1X A;  4UB8 Z;  3JAL A;  2Y4U A;  2CTR A;  1QLN A;  4LWS B;  1EZJ A;  2XUM A;  4L8J A;  1ENV A;  2EIL C;  3QF7 A;  1US6 A;  1M9N A;  2DW4 A;  2HHH O;  1XDC A;  3T4D A;  4Q6G A;  3LUT B;  2ZE6 A;  3OEE G;  2PGG A;  2IJK A;  4LP8 A;  3FD9 A;  1BT8 A;  1SET A;  2ZDI A;  3WG7 B;  3EHB B;  1E1R G;  1AR4 A;  4DV5 B;  2DMX A;  3N2K B;  5BY1 A;  1AJP A;  2IJI A;  3FB7 C;  3EVK A;  3CXC U;  4YJ3 B;  3CME V;  5FNV B;  1GN4 A;  1N36 O;  5JVD A;  2Q67 A;  5LA6 B;  1JJ2 U;  2ADQ B;  4GX2 A;  2NN4 A;  1M57 B;  2ZR2 A;  1IBK B;  1HR0 B;  4PI0 A;  4LF8 O;  2ZCE A;  5CA1 A;  2XAG A;  1TUE B;  5GTI Z;  2JJ1 G;  3CXH F;  3WU2 Z;  2ITD C;  2ZIM A;  4IHJ B;  1VQL V;  1JX9 A;  2Q9L A;  1SZT A;  4B3M O;  1BMF G;  1S5L Z;  4JI6 O;  1B6Q A;  1MNG A;  1FJG O;  2P06 A;  4UCO A;  5E1A C;  5F2V O;  1QHT A;  2EUL A;  2W0F C;  3HKE A;  4I55 B;  2W6J G;  4D7S A;  4O4I A;  2X6A A;  2P4V A;  3ABM B;  3AK3 A;  4MVZ A;  4WBN A;  2RJZ A;  1Z5W A;  2P67 A;  3ZMZ A;  1LUW A;  3F7V C;  2MK3 A;  5C93 A;  4WFG A;  2R70 A;  2FTK A;  3N27 A;  4OXS A;  2VWK A;  4F6R A;  5CBG A;  2EBO A;  1K73 W;  3JD3 A;  3RYC B;  4BIZ A;  4XDK A;  1QVF U;  1K4D C;  1FXK B;  3SPI A;  1FPO A;  4LWS A;  4ZOL B;  2B5U A;  1FFX B;  1R1B A;  2ATK C;  1I08 A;  4X66 B;  4TQF A;  2PI5 A;  4AI8 A;  3CCS V;  4FM2 A;  3E86 A;  4QPJ A;  3B8M A;  5AG2 A;  2WLL A;  3BRC A;  2FKX A;  1GAX A;  1Y6X A;  3OFN G;  3SYO A;  4X1K B;  3IAY A;  3LSS A;  1N33 O;  4GYC B;  3K9A A;  2BTQ A;  3OUF A;  4I0X A;  3ASO C;  4A5U B;  3DC5 A;  3Q4H A;  1YSC A;  3ZHS A;  3SYQ A;  2RNB A;  2Y69 B;  2Z5U A;  1TAE A;  1B06 A;  5FNV A;  1BCC H;  1X4T A;  3G67 A;  1LUV A;  5LA6 A;  5B3S C;  3CRR A;  4JI3 O;  1NH2 B;  1COW G;  4UCV A;  4GLX A;  4JYB A;  5LP6 C;  2X7R B;  4PA6 A;  1KQS U;  2BE3 A;  1KKD A;  4L87 A;  4B08 A;  1XQ8 A;  3SPG A;  3JD4 A;  4DR7 B;  1BS3 A;  1TUB B;  4DUZ B;  3H1H H;  5JCO A;  4B3R O;  5GTH Z;  1ZWI C;  1XNR B;  5IYD O;  2EIJ B;  4IYH A;  3M8A A;  1R3L C;  1Y76 A;  5EZY A;  4LFB O;  4NTW A;  1S5H C;  1KP3 A;  2LFR A;  3L70 H;  1JA8 A;  4HNA B;  1GH6 A;  3OEH G;  1I5X A;  3ML0 A;  3K04 A;  3ETG A;  1RSO B;  2YI8 A;  3JAW A;  1D2D A;  2HVK C;  2RN9 A;  1SZX A;  4LF4 B;  1FXK A;  4KFM A;  3FAV B;  3X2Q C;  1TVK A;  2MW2 B;  4MW8 A;  4YIP A;  2CUG A;  3ZBH A;  2DN9 A;  3LDE A;  2PY5 A;  4LF9 O;  4LCU C;  3K03 A;  4JGS A;  1VQP V;  4FLV A;  4FLY A;  4DV7 O;  5B5E Z;  4JI0 B;  4DV4 O;  2P4K A;  4LC1 A;  2L6L A;  2OWO A;  4MVM A;  1HNZ B;  5B1B C;  1N32 O;  4O4H B;  1M4U A;  4X62 B;  5KMG B;  5BXZ A;  3G6E V;  3T1H O;  3C90 A;  3K0G A;  1R3K C;  3LSU A;  4JI7 B;  1S77 D;  4JAA A;  3ETQ A;  1R3J C;  4RAI A;  1IBL B;  3K0D A;  4IIJ B;  2DWE C;  2CDY A;  4FM1 A;  3UT5 B;  1S0V A;  2WLI B;  2JGD B;  1Q8I A;  3CRA A;  3OR6 C;  3SDL A;  1AVM A;  1XBL A;  4CH5 A;  3ZHR A;  4JYA O;  4H13 B;  3TCU A;  2QWR B;  2Q7E A;  1KP2 A;  1Q86 W;  4O2A B;  2GUZ B;  1TGO A;  3AK2 A;  3ABK B;  2ZDI C;  5LMU O;  3OW2 U;  5IT9 N;  1TUB A;  3F7Y C;  4LF7 B;  2ZNJ A;  5KX5 A;  4UCU A;  1R6N A;  5EIB D;  2QE7 G;  3RYH B;  1OCZ C;  1N0N A;  2P6J A;  2EZO A;  3ASO B;  3E8H A;  3I56 V;  5KHI A;  3JD0 A;  4TSF G;  3HKC A;  2ZE8 A;  3D3Q A;  5JJN B;  3LNN A;  1S76 D;  4TV8 B;  1M93 A;  1M56 B;  1NTZ H;  2WWW A;  5EBM C;  5B3S B;  2M6Y A;  1Q6U A;  3FAV A;  5LP6 B;  2ITC C;  1N4C A;  4YHH O;  3JSL A;  4XDJ A;  1FD9 A;  3C3S A;  4B3T B;  2HFE C;  2V7Q G;  3QO5 A;  4DV3 B;  4NTY A;  2XT9 A;  1N34 O;  1WAZ A;  2W6I G;  5KLV H;  3A0H Z;  4UVC A;  4OX9 B;  5B66 Z;  3DXR B;  1X59 A;  1G8M A;  2XAQ A;  4EKW A;  5BZB A;  5HFM A;  4O4H A;  3AG1 C;  4JI5 B;  5C8Y B;  4N23 A;  4DW0 A;  1KC8 W;  1YZB A;  2YIA A;  1WA8 A;  4G28 B;  4XBF A;  3BA9 A;  3CC7 V;  2D2C B;  3U11 A;  4XDL A;  3SJC C;  5L3F A;  3JAK A;  1IBM B;  2AHZ A;  2XAS A;  4R6Z A;  4U7N A;  5BMV B;  2WPD G;  4ZI7 B;  1FAF A;  4F6E A;  3BAA A;  2D3O W;  1YJ9 V;  1YEW A;  4JI8 O;  4G2K A;  5IJ9 B;  5LMN O;  1VQ6 V;  4I7Z B;  5IYB O;  3BPZ A;  1Q7Y W;  4BAY A;  2W0X A;  3VQW A;  2EIM B;  5LXT B;  4DW1 A;  1SQP H;  4YJ2 B;  3U0Z A;  4O4L A;  4JV5 O;  5L3C A;  1GM7 A;  1EN4 A;  2F4V B;  1IZ3 A;  3CE2 A;  5IE9 A;  5B1B B;  3K59 A;  1K7D A;  4MVR A;  1Q43 A;  2K9P A;  3IJ4 A;  2UUB B;  4OPA A;  4J9Z B;  4QNH B;  3JYC A;  4DRX B;  3W7W A;  1IUR A;  4B7K A;  5H5N A;  4QE7 A;  3JAL B;  5IYC O;  1FXH A;  1GN3 A;  1GK9 A;  2GBO A;  2OTJ V;  4DV6 B;  4NXM O;  1SES A;  4ZHQ A;  5EC2 C;  2BSK A;  3QG5 A;  5FL7 G;  2QWP B;  1M5I A;  3BVO A;  5LGT A;  4Z1V A;  5H6Q A;  5EBL C;  1V55 C;  1PKX A;  1SRY A;  1KEC A;  1V9P A;  1A32 A;  5JCO C;  5CA0 B;  4UV9 A;  1PNL A;  1FYJ A;  4DV5 O;  1OCR C;  1N0J A;  5GON B;  5CB4 B;  4DV1 B;  1OCO C;  2C2A A;  2VQE B;  2VQF B;  1YF2 A;  1OV9 A;  3ABM C;  1YJN V;  1IVS A;  2Q69 A;  3DXR A;  2Q7G A;  4MS2 A;  2JK5 C;  4GUN A;  2JEU A;  4NR1 A;  2ZT9 B;  1IBK O;  1JPX A;  1J5E O;  2DYR B;  1L0L H;  3ZRS A;  1ZTE A;  3E89 A;  3ZRX A;  4J7Z A;  1XMO B;  2YIB D;  5LGU A;  1HNX B;  4WFE A;  5EYP A;  4QE9 A;  1FXK C;  3JAR B;  2QM8 A;  1IXM A;  3O9O A;  4UCT A;  5CA1 B;  1VQ9 V;  3ZED A;  2P90 A;  2VWJ A;  3CMA V;  3D3I A;  4DR5 B;  4PDR A;  4DUY B;  1KKC A;  3OM3 B;  1ZSP A;  3AG7 A;  4HBN A;  3GB7 C;  2B1G A;  2PI4 A;  4BWA A;  3D36 A;  1AIL A;  5KHJ A;  3SGI A;  2Q5Z A;  4FMT A;  4JTA B;  1XOU A;  4DR3 B;  3GWK C;  1P4R A;  4MVS A;  4K8Z A;  4YJ2 A;  2G38 A;  3RYF A;  4O4I B;  2R9I A;  2X0L A;  4WBN B;  3H1J H;  3AG1 B;  3ZCC A;  4LNU A;  5KHK A;  3VBB A;  2KB1 A;  5CMU A;  1YDX A;  3BFR A;  4DV0 B;  4WFF A;  4TQD A;  4NXN B;  3PJS K;  4F6R B;  3CD6 V;  4DRX A;  4JTD B;  2EX3 A;  2LW7 A;  4J7J A;  4DR4 B;  4J9Y B;  3FFQ A;  3LSQ A;  3RT3 C;  4X66 O;  1SQG A;  1F51 A;  4JI2 B;  3CCV V;  4CH3 A;  3RN4 A;  2AXT Z;  2B1I A;  3CCM V;  4LH7 A;  3UCS C;  1K97 A;  4YY3 B;  1NVP B;  1OCC B;  3CCR V;  1DF5 A;  1XHZ A;  4TUY B;  1U96 A;  3ZIA G;  3BAB A;  3ZRW B;  2X6B A;  4RO2 A;  3J80 N;  3OMA B;  2WLL B;  4H33 A;  1SKV A;  1H8H G;  1GTO A;  3ABU A;  1P49 A;  1GMG A;  4LBE C;  3IC9 A;  5CA0 A;  4DR6 B;  3VQY A;  5GON A;  4MTX A;  2EIJ C;  2LFS A;  1GN2 A;  5CB4 A;  2ZE7 A;  3QNE A;  3TK1 A;  1XNQ B;  3J7A U;  3LDC A;  2WAM A;  2QDO A;  3VQX A;  2KSD A;  2BTQ B;  4JZ2 A;  5IDJ A;  4I0X B;  2QJ1 A;  3Q4H B;  2ZD9 A;  5ITZ A;  3T1Y B;  5B1O A;  1NQT A;  2ZM6 B;  2PF4 E;  3TGU H;  4LFC B;  1K9M W;  1R73 A;  2YXH A;  5DEC A;  1L0N H;  4YXW G;  4FLW A;  1HWY A;  3THO A;  1JMK C;  2DOS A;  3JAR A;  3OTF A;  4DR7 O;  1Q5O A;  2K1E A;  4DUZ O;  1BHB A;  4FFK A;  1XNR O;  2WLH A;  4LH6 A;  1V55 B;  3SJB C;  4Z2W A;  1S3J A;  3RGB A;  5H2F Z;  4AQY B;  3JCU Z;  2QTO A;  1OCR B;  1DF4 A;  3OR7 C;  2VS0 A;  4CBC A;  2E5L B;  1Y76 B;  1OCO B;  1RPO A;  5H6R A;  5EZY B;  3K5M A;  3QO7 A;  4MT8 A;  3P3P A;  1N8R W;  1ROP A;  4GX1 A;  4PA3 A;  4OGQ B;  1WB7 A;  1VQ7 V;  5CBF A;  3L72 H;  4EEQ A;  3BHP A;  3OT7 A;  3G4S V;  4PA4 A;  5JQG B;  1Y74 B;  1Q6I A;  4LF4 O;  1P7G A;  1PD3 A;  3JAW B;  4CS2 A;  3P32 A;  1RSO A;  1DLB A;  4D6T H;  1VQ8 V;  1DTO A;  4NVP A;  4JAS A;  4YIO A;  4PHZ A;  1W59 A;  3ZMT A;  2UXD B;  3K06 A;  1TVK B;  4JI0 O;  2CH7 B;  4JI1 B;  1PL0 A;  2ILM A;  4TUY A;  2Y0I A;  4X88 A;  3ZRW A;  1HNZ O;  5KUM A;  3ABK C;  4TT3 G;  1VQK V;  3ABT A;  4X62 O;  5HFL A;  2XOK G;  2WA3 A;  1L8D A;  2FB5 A;  4MSW C;  1NKD A;  1WPX A;  1BSM A;  4B7E A;  3ZJZ A;  4JI7 O;  2B9Z A;  4W4K A;  5LOV B;  1AR5 A;  5JJJ B;  1XHX A;  3OTO O;  1IBL O;  4EFE A;  3FX7 A;  4NKG B;  1URF A;  3E8B A;  1VQN V;  2Z0A A;  1R3I C;  2YIC A;  2DE0 X;  4EFB A;  1XRE A;  1JQ0 A;  1ORQ C;  2RMK B;  2EIK C;  2JS5 A;  3WB1 A;  1BGY H;  1M56 C;  2JGU A;  1F7Y A;  4X64 B;  2P7T C;  1SC5 B;  4JZG A;  1W0J G;  2QM7 A;  2IM9 A;  4IT5 A;  3AG4 B;  3SJQ C;  3E8G A;  3R65 A;  1MAB G;  2GSM B;  4GKK B;  3K5O A;  1WNS A;  3ZHV A;  5B1A C;  2A9H A;  3JD1 A;  4LF7 O;  2DJV A;  1PM9 A;  3OD4 A;  2UUA B;  3CCQ V;  3H01 A;  2WLM A;  1F23 A;  2AW9 A;  1P7B A;  2UXN A;  5KX5 B;  4J80 A;  3DC6 A;  4UB6 Z;  1QBZ A;  2DWD C;  2HG5 C;  3APQ A;  1ZLZ A;  1PV0 A;  2Q4P A;  4JPR A;  3K9S A;  1THZ A;  2QWN B;  2IBZ H;  5IWA B;  1JFF B;  1HW7 A;  3ZMS A;  1EFR G;  3B40 A;  4MW3 A;  2KKW A;  3HKC B;  2DYS C;  1NR1 A;  1CP9 A;  5DM6 V;  5JQG A;  1Y74 A;  4E2L A;  1FXV A;  1B04 A;  1F4N A;  2V1D A;  5DED A;  3JAM N;  1LNQ A;  4K35 A;  3CHX A;  3CX5 F;  2H8P C;  3BY6 A;  3JAT B;  3ZHT A;  3F5T A;  5IJ0 B;  2CH7 A;  3QVN A;  3D36 C;  3W7T A;  4DV3 O;  4ASU G;  5LL6 Y;  4OX9 O;  2UU9 B;  3W7S A;  2EIM C;  4JI5 O;  3BA8 A;  1MSD A;  4K0K B;  2H94 A;  1YTF B;  1B3Q A;  5LOV A;  5H9C A;  4TOI A;  5KA5 A;  4X1Y A;  1WA8 B;  1AP6 A;  3VOU A;  4DV2 B;  1QVG U;  4H37 A;  4X8A A;  3W7U A;  5KUK A;  4DXW A;  1ZUQ A;  2IU3 A;  3JAK B;  2E76 B;  3FB5 C;  4X1I B;  4HYO A;  2Q6A A;  4QGP A;  4GKJ B;  1FS0 G;  1NTK H;  3L75 H;  4LFA B;  3KCX A;  4D7T A;  1K5S A;  2QEX V;  1NBM G;  2V4D A;  1D5A A;  2LQT A;  3IFX A;  3ZMV A;  3W7X A;  2PYJ A;  2UXC B;  1AJQ A;  4HZ3 A;  5A9G A;  1GKF A;  2F4V O;  1OHH G;  3MD0 A;  3UO3 A;  4O4L B;  4X65 B;  4NB5 A;  4TV9 A;  1AP5 A;  1VF6 A;  2YXY A;  5EBW C;  2UUB O;  3ASN B;  4IYI A;  3HKB B;  1FFT B;  1VP7 A;  4DV6 O;  1F4M A;  1JFF A;  2HEP A;  1VQ5 V;  2R9A A;  3AG3 B;  4KHP O;  3CRC A;  2DYR C;  1RM1 C;  1J95 A;  4PDM A;  1ZL8 A;  2A7W A;  4O4J B;  3R66 A;  2NLJ C;  5JWP A;  3STL C;  4FIP C;  2EIK B;  3SPH A;  2JEX A;  4ZHQ B;  1HNW B;  2BSK B;  5KHG A;  2XAJ A;  2F23 A;  5TIS Z;  4RQF A;  1LR1 A;  3E8F A;  1IX9 A;  2QSA A;  1HDJ A;  4OPH A;  2EIN B;  4O2B B;  2YIB A;  1VQO V;  3JAT A;  4DR1 B;  4FFB A;  4DV1 O;  3DGE A;  5IJ0 A;  5B1A B;  2VQE O;  5J2U A;  3UM7 A;  2VQF O;  3T4Z A;  1GM9 A;  4DK1 A;  2H3O A;  1YJW V;  1AB3 A;  5LHG A;  3A0R A;  3E2E A;  3RWR D;  3S3W A;  1XIL A;  1VIB A;  1CEZ A;  1I0H A;  1WP7 A;  1VF7 A;  5L3D A;  1PNK A;  2YID A;  1SER A;  4W4L A;  4UVB A;  4BW5 A;  2IH1 C;  3OGC C;  5KHH A;  1HNX O;  1Z5V A;  4ICG A;  2DYS B;  3LNM B;  1YIJ V;  2F1M A;  1NU1 H;  1Q3E A;  4FLU A;  4DR5 O;  2QWQ B;  3QO8 A;  5LGN A;  2F95 B;  4WCE V;  5EYP B;  3FB8 C;  3F5W C;  3L71 H;  4X1I A;  3TJT A;  1P84 F;  2HP8 A;  4UVA A;  3C3T A;  4FK5 C;  5BR8 O;  1OCC C;  1JJO A;  4DR3 O;  2VRZ A;  3WB2 A;  2EJ7 A;  3T1H B;  3B2E E;  3G80 A;  2A3Q A;  1IXB A;  2YEV A;  1OZ0 A;  3RYF B;  1AJN A;  3OMN B;  2F66 C;  4NXN O;  1QR9 A;  1MOF A;  3HKB A;  4LNU B;  4DR4 O;  5CA3 A;  2XAH A;  4JI4 B;  5B1N A;  4JI2 O;  2AZ2 A;  5EIB C;  3U10 A;  4YY3 O;  4O4J A;  4DO2 A;  3KCY A;  1SQQ H;  2CTW A;  3J81 N;  2ZNI A;  4P30 A;  3ZHU A;  1H2S B;  1XMQ B;  1YVW A;  1GM8 A;  1K34 A;  2Q7H A;  1K3E A;  3H1I H;  3ICX A;  4RUE A;  1AI6 A;  4GCZ A;  4O2B A;  3DTU B;  4UV8 A;  4DR6 O;  1XL4 A;  5J2T A;  4FZ1 A;  1NH2 D;  1XNQ O;  4PEL A;  1UPG A;  3CSX A;  3K08 A;  5LHI A;  3I55 V;  5KAF Z;  3ZX6 A;  3A8T A;  2QM4 A;  2UUC B;  2ODM A;  3E22 B;  3T1Y O;  4PDV A;  2HKO A;  2LGW A;  2BTO A;  2ZIN A;  2NNU A;  2UXB B;  1KD1 W;  1QQC A;  1WP8 A;  2P5O A;  5ITZ B;  2KG7 B;  1QR8 A;  3BCC H;  3B4S A;  2IH3 C;  1NJI W;  1HR0 O;  2IJJ A;  1RM1 B;  2GV9 A;  2JS3 A;  2DQ3 A;  1RP3 B;  4WFH A;  1VF5 B;  2OCC B;  3SPC A;  4JAU A;  4MTG A;  4ABM A;  2CE4 A;  1R6K A;  2E5L O;  4B3S B;  2BOB C;  5JJE B;  1H2N A;  5GW7 A;  3RW0 A;  2ARH A;  1VQM V;  3SR2 C;  1I94 B;  2Y4T A;  2ADP A;  4LR3 A;  2PZS A;  3CCL V;  1Z2G A;  1V54 B;  2CGO A;  5E79 Z;  4PJ0 Z;  1BHA A;  4P9P A;  1JCH A;  1I7F A;  1AR1 B;  4I5S A;  2UXD O;  4DR2 B;  1K5Q A;  4JI8 B;  1BE3 H;  5FLX N;  4LF6 B;  1WPB A;  5D5Q A;  1UJW B;  3E83 A;  3FYI B;  3SJA C;  3AG4 C;  5IYZ A;  1MA1 A;  4JV5 B;  3MDS A;  2HJD A;  1H8E G;  1UFI A;  3GVM A;  1EM1 A;  2XHB A;  1EN6 A;  2RDC A;  2YXL A;  2WLK A;  4R50 A;  1Y67 A;  3SYA A;  1VF6 C;  1DGS A;  3PN1 A;  4U3J A;  3A0B Z;  1XUQ A;  3OGI B;  4U3F H;  3E22 A;  2RQ6 A;  4CS4 A;  2EJR A;  4NXM B;  3B8N A;  4ZIB A;  2NR5 A;  4KP4 A;  1PL4 A;  1FKA O;  1H2L A;  2KG7 A;  1K33 A;  4RUF A;  4X64 O;  2AHY A;  4FLT A;  3ZMU A;  1MZF A;  4GKK O;  4J41 A;  1BQZ A;  3UKM A;  3CPW U;  2QTS A;  2IU0 A;  4BW9 A;  4BIU A;  1G4Y B;  4LF5 B;  3HKD B;  2UXX A;  1NS1 A;  2FYU H;  2UUA O;  3TXQ A;  4JF3 A;  1QNM A;  2ZQM A;  5JH7 B;  3VQV A;  3K5L A;  4I9Q A;  2F93 B;  5L3E A;  2QKC A;  5IWA O;  1J5E B;  1MSW D;  1AI5 A;  4ZKI A;  4QPK A;  1R6T A;  2R72 A;  1U97 A;  3G71 V;  3CWB H;  1YHQ V;  2EZP A;  1H2K A;  3OAA G;  4Z1M G;  1Q90 D;  5FPO A;  3TXS A;  2OYQ A;  2YI9 A;  1D5N A;  1H2G A;  3N2G B;  1BL8 A;  2N05 A;  1GRJ A;  1NTM H;  3KG2 A;  3AEI A;  1KYO F;  1K4C C;  4I50 A;  4RQE A;  4TWK A;  2GHY A;  2Q0A A;  3SYC A;  5LYJ A;  4EB6 A;  1BZK A;  3RYI A;  1VQ4 V;  2UU9 O;  2QR4 A;  5IY5 B;  3KKY A;  1HP8 A;  2AGA A;  5KAI Z;  3D8C A;  3JD2 A;  3SPJ A;  4K0K O;  2FML A;  1BQ0 A;  2JDI G;  3CEI A;  4DYL A;  2OCH A;  1Y66 A;  3OUS A;  4UCS A;  4P2Z A;  3ASN C;  1QU7 A;  4DV2 O;  2HLD G;  2O57 A;  1PP9 H;  4ZBM A;  4G27 B;  3OE7 G;  4X1Y B;  3FYE B;  1CPY A;  4FJC C;  1JOY A;  4N21 A;  4GKJ O;  2F43 G;  1Q82 W;  2HHH B;  3AG3 C;  1Q6H A;  2E75 B;  4J10 A;  1QLE B;  4LFA O;  4MTO A;  3ZHQ A;  4R8C A;  1W2B U;  1EN5 A;  1XL6 A;  2LJ2 A;  1WLE A;  3EFF K;  3JCZ A;  2UXC O;  4UUJ C;  4F4L A;  2EIN C;  3N2K A;  3HKD A;  4X65 O;  4J7K A;  4P9O A;  1SQF A;  2XND G;  4YJ3 A;  1GN6 A;  3FKS G;  1RFY A;  5JH7 A;  2ETN A;  5J9P C;  4TV9 B;  4CZZ A;  2ZR3 A;  3CRQ A;  2OTL V;  2ZIO A;  1N36 B;  4PA7 A;  2EIL B;  1L1F A;  1XEQ A;  4PDL A;  4U7O A;  3ZN0 A;  3ETD A;  3IC7 A;  2KQX A;  1NR7 A;  4LF8 B;  1ZAU A;  5K1P A;  1HNW O;  3K3W A;  4IHJ A;  2GDS A;  2Z3Y A;  1ZL8 B;  3L74 H;  1KUQ A;  1PPJ H;  3N2G A;  4IGG A;  1O9H A;  3UQ8 A;  4QIW F;  3GWO A;  2RCV A;  4WFB V;  4I55 A;  4B3M B;  2BCC H;  4DR1 O;  1H2M A;  4JI6 B;  3CRM A;  1FJG B;  4GX0 A;  1MZE A;  2PYL A;  1YCI A;  4FFB B;  4B3T O;  5EK0 A;  4J42 A;  5J2U B;  3SYP A;  3H1L H;  1WN7 A;  2CK3 G;  1YXB A;  3K57 A;  2LGQ A;  1Q81 W;  3RYC A;  3ZN1 A;  4MVU A;  3MHH C;  2Q68 A;  3IGA C;  3A2F A;  2XTA A;  2WSS G;  4ZOL A;  4Q20 A;  4KXR A;  2GTS A;  1FFX A;  2Y48 A;  3T2M A;  1EBO A;  1EZV H;  3CCE V;  3K58 A;  1W0K G;  4RWU A;  3ABL C;  1IBM O;  3AG2 C;  3WB0 A;  1JVM A;  2JRI A;  4K3A A;  4K8X A;  1M1K W;  2Q0O C;  4X1K A;  4GZR B;  3DSQ A;  4CC5 A;  4QJF B;  4X20 B;  3L9D A;  1WJZ A;  3QTC A;  3RVZ A;  4E4E A;  1E1Q G;  3H1K H;  1SS3 A;  2YSU B;  5D5P A;  3OTO B;  1N33 B;  1TA8 A;  1NVP D;  2N74 A;  2JVD A;  2YEV B;  5FPR A;  3CCJ V;  4NTX A;  5L3B A;  4JI4 O;  2XAF A;  3K5N A;  3JSN A;  3MHS C;  4FVM A;  3P30 A;  2E74 B;  4JYY A;  5L3G A;  3AK1 A;  3STZ C;  3BEH A;  4JI3 B;  1E79 G;  2ZXW C;  1H38 A;  1SQX H;  2WA4 A;  1XMQ O;  2ZE5 A;  4PD4 F;  1SQV H;  2FL4 A;  4FPP A;  4UCR A;  4UFZ A;  2Q8V A;  3HR0 A;  4AIL C;  4R7C A;  2IJH A;  4GT1 A;  4B3R B;  3CS5 A;  3B09 A;  1S72 V;  2OCC C;  1JR9 A;  1O9G A;  4DK0 A;  2CTQ A;  4H0L B;  2LP7 A;  3RFR A;  1I5Y A;  1AI4 A;  4HNA A;  5J2T B;  3NXS A;  3CJH B;  4LFB B;  2YC0 A;  2UUC O;  1MG1 A; 
#chains in the Genus database with same CATH homology
 1F7Y A;  5LMN O;  4DR7 O;  4DUZ O;  4LFB O;  2UXB O;  4DR5 O;  1HR0 O;  1AIL A;  1DK1 A;  1XNR O;  1FKA O;  5A2Q N;  4JV5 O;  4X64 O;  4GKJ O;  4LF7 O;  2DJV A;  5BR8 O;  1IBM O;  4GKK O;  3O65 A;  4LFA O;  4DR3 O;  2ZM6 O;  4OPA A;  1XMO O;  2JRI A;  1G1X B;  4LFC O;  2F4V O;  2HHH O;  1D2D A;  5H5N A;  1R1B A;  2E5L O;  1NS1 A;  2UUA O;  2UXC O;  2UUB O;  4DUY O;  4LF5 O;  2LW7 A;  4X65 O;  4NXM O;  4B3S O;  3RT3 C;  4X66 O;  4LF4 O;  2ZKO A;  4NXN O;  2FKX A;  4LF9 O;  4DV6 O;  5IWA O;  4DV7 O;  4DR4 O;  1I94 O;  4DV4 O;  4KHP O;  4YHH O;  4JI2 O;  4AQY O;  3R66 A;  5BY1 A;  2N74 A;  1R6T A;  1N33 O;  1A32 A;  4JI0 O;  1XEQ A;  3JAM N;  4YY3 O;  4JI4 O;  1N32 O;  4DV5 O;  1FYJ A;  3J80 N;  5BXZ A;  1N34 O;  3T1H O;  4A5U B;  2UXD O;  1N36 O;  3F5T A;  3J81 N;  4OPH A;  1X59 A;  4DV3 O;  1HNW O;  1HNZ O;  4DV0 O;  5FLX N;  4X62 O;  1KUQ A;  4DV1 O;  4DR2 O;  1YZB A;  5LL6 Y;  4OX9 O;  4LF8 O;  2VQE O;  3J7A U;  4DR6 O;  4JI7 O;  2VQF O;  4JI5 O;  4LF6 O;  1XMQ O;  4JI3 O;  4DR1 O;  1IBK O;  1AB3 A;  3OTO O;  1J5E O;  3SDL A;  1IBL O;  1XNQ O;  2UU9 O;  4JYA O;  2Z0A A;  4B3M O;  2AGA A;  4JI6 O;  4B3T O;  4JI1 O;  3T1Y O;  4K0K O;  1FJG O;  4B3R O;  1HNX O;  2DOS A;  4JI8 O;  2UUC O;  5LMU O;  5IT9 N;  4DV2 O;  3M8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...