4DV3O

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a, bound with streptomycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dv3O00
5A2QN 5BXZA 4DV0O 1G1XB 2JRIA 4LF5O 4LF6O 4DV4O 5FLXN 1AILA 4AQYO 4LFCO 4X64O 1XEQA 2UXCO 4X66O 1I94O 4JI2O 4GKKO 4DR6O 3R66A 1HNWO 1N32O 4X65O 4GKJO 2N74A 1YZBA 2VQEO 1IBKO 3O65A 1J5EO 4DUYO 1KUQA 4OPAA 4JV5O 2HHHO 1FKAO 2F4VO 2AGAA 3F5TA 4JI7O 4X62O 3OTOO 4JI1O 4B3SO 4JI4O 1X59A 4KHPO 2ZKOA 4LFAO 3J81N 4JI3O 4OPHA 2UUBO 4JI5O 5H5NA 4B3TO 2Z0AA 2UUCO 2UUAO 2ZM6O 4DV5O 1HNXO 1R6TA 3J80N 2E5LO 4OX9O 1HR0O 1N36O 5IWAO 4LF7O 1XNRO 4DR1O 4DR7O 4DR4O 1FJGO 3JAMN 5BY1A 1IBLO 4DV7O 4DR3O 5LMNO 1N34O 4DV2O 4NXNO 2LW7A 3RT3C 5BR8O 4LF8O 2DOSA 4B3MO 2UU9O 1DK1A 4DV1O 1XMOO 4DUZO 1AB3A 1D2DA 4DR2O 4NXMO 1XNQO 1A32A 3T1HO 4LF4O 3M8AA 4JI0O 3T1YO 1R1BA 4DV6O 1NS1A 5LL6Y 4YHHO 4JI8O 4DR5O 1HNZO 1IBMO 4DV3O 4JI6O 1XMQO 4JYAO 5IT9N 2DJVA 4B3RO 3J7AU 4YY3O 4A5UB 1F7YA 1FYJA 4K0KO 4LFBO 5LMUO 2UXBO 3SDLA 2FKXA 2VQFO 2UXDO 4LF9O 1N33O
chains in the Genus database with same CATH superfamily
1US6A 1GN6A 3D36A 1CXZB 4FLVA 2PGGA 1VQ7V 1NVPD 3BA8A 1AI6A 2E5LB 2ZIMA 1SA0A 5H2FZ 3TXSA 4XDJA 5BMVA 4CS2A 1OJHA 2CH7B 3B09A 2OCCB 3CC2V 5JJJB 5KLVH 5B1OA 3JASA 5BR8B 1R6NA 4PA3A 3CCRV 4U7NA 1Y74B 4RQEA 1QBZA 4LF4B 3HKCA 1GM7A 3G71V 2Q67A 4YHHB 2Q4PA 2HJDA 2UXXA 1XQ8A 4IT5A 3EHBB 4B7EA 4NYKA 3UO3A 2MW2B 1FJGO 1VQ5V 3BCCH 4JASA 4ICGA 3FB5C 5LMNO 5KHIA 2QM4A 4LFBB 1ZL8A 4E4EA 4MW8A 5LBQA 3OFNG 1SESA 4DV0B 4LF6B 4DR2O 2QM8A 1PPJH 4NXMO 4PHZA 4FZ1A 2LFRA 3M8AA 3P32A 1BQ0A 2Z3YA 3ABLC 3OUFA 5LL6Y 4GKKB 4JGSA 2HVKC 5IY5C 2W6IG 2R9AA 4G2KA 1XDCA 4MSWC 4UCVA 5CN0A 4UB8Z 1DTOA 1ZAUA 2ZXWB 1AJPA 1JX9A 1F7YA 4FZ0A 2IH3C 3BPZA 5KA5A 3TXQA 3RW0A 3LSUA 2PF4E 2IM9A 3SYQA 1WA8A 2KG7A 4TV8B 4JI5B 2UUBB 5B3SC 2JRIA 3QTCA 3UT5B 2YEVB 4LFCO 5CA0A 4X64O 3CXCU 4Z2WA 1S5JA 5KMGB 3U11A 3RYCB 1VQ6V 1ZUQA 2QWOB 4DR6O 1QR9A 2AZ2A 1SF9A 4I0XA 1Y76B 4GKJO 3AG3C 1MA1A 3G67A 3VQYA 1DLBA 2ZQMA 2HFEC 2F4VO 3A0BZ 3F5TA 3S3WA 2UU9B 4LNUB 3BA9A 1RPRA 2CK3G 3RN4A 4D7TA 2OTLV 1QLEC 4J9ZB 4GLXA 5IJ0B 4LWSB 1O9HA 3GWKC 1B3QA 5H5NA 3ZHVA 5DECA 3RYFA 2AHZA 1Q90D 3ASNC 3C3TA 2DYSB 1AJQA 4OX9O 1N36O 5LXTA 5GTHZ 4MT8A 3OR6C 1M57C 4J41A 1IBLO 1BZKA 5CB4B 3LDEA 4ZHQB 1P4RA 1WPBA 1GKFA 4DV2O 2UXBB 2QKAA 1K5QA 1FXKC 1PKXA 3GB7C 2YIDA 4DV1O 5DEDA 1D2DA 3CJHB 1HWYA 2WLJA 1H8HG 4H0LB 2KSDA 5K1XA 4K8XA 4UV9A 3FD9A 1M9NA 2Q6AA 1GM9A 2DWEC 4QPJA 4UCUA 2G38A 2ZNIA 1QQCA 3W7XA 4LR3A 1J5EB 4AILC 3SJCC 1AR1B 1VMGA 3HKDB 4JZ2A 1S5HC 2YIBD 3W7TA 4WFBV 4I55A 4WFHA 1N33O 4I50A 4FK5C 4TUYB 2QA4V 3LDDA 4LF5O 1XL6A 3K59A 3WG7C 4F6RA 4X66O 4J80A 1E1RG 3ABKB 1QNMA 2DQ0A 1FS0G 1HDJA 5CBGA 1XUQA 2P5OA 4CC5A 1MG1A 4EB6A 1SA0B 4DUZB 4X62O 5EYPA 3KZIZ 2LW1A 5BMVB 4JYBA 1SQFA 4GYCB 3F7VC 5HFLA 3L74H 4JI3O 4DV6B 1AI5A 2EX3A 2LGWA 3ZHQA 1TA8A 3ZHTA 5EZYA 1W59A 4MW3A 3ZRSA 1R3KC 4I4TA 4DV7O 3MAQA 1HP8A 2BOCC 1BGYH 1GH6A 4FLYA 2UXNA 3JD3A 3AG1B 4LF9B 1RSOB 1VQKV 2VRZA 2QM7A 5FNVB 4UVAA 1AB3A 4PDRA 2QKCA 2IH1C 3CXHF 4X1KA 3TCUA 3HKBA 2YICA 4O2AA 3B8MA 1P84F 5L3DA 1WLEA 3OGCC 3K79A 1IZ3A 3UCSC 1BHAA 4ZBMA 4I9QA 4A5UB 1S77D 2DMXA 3G80A 5GTIZ 1NTZH 4B3SB 3BHPA 4JI4B 2V1DA 1I5YA 2YIBA 4LFAB 1AI7A 3JD2A 3DGEA 3L72H 4TSFG 5IYZB 4G27B 2L6LA 3JARA 5CBFA 1DF4A 3FB6C 1VARA 4PA7A 3N2GB 1CP9A 1L8DA 2IW5A 4X65O 1YITV 2Q9LA 2ZE8A 1CPYA 4GX1A 4DUYO 4LCUC 4Q6GA 3OGIB 1NTMH 1KP2A 3OMAB 2V4DA 2PY5A 1DF5A 1S3JA 2N04A 3A0RA 3RBZA 3T1YB 1QVFU 5JJEB 1Y67A 1HNXO 1GMGA 4FLTA 1IBMB 3OEHG 2E75B 4DK0A 2Y69B 2RNBA 4JI6B 3RYHA 2PYLA 4JYAB 2XNDG 4N21A 5LYJA 2Q68A 1ZTEA 4K0KB 5JQGA 1K34A 1F51A 4TV9A 1JVMA 2DOSA 4B3MO 5DN6G 3CSXA 1PL0A 2YXLA 5DM6V 2ADPA 1K33A 2F95B 1IURA 4CC6A 4O2BA 2YIAA 3IC7A 1SQBH 1P7BA 3U0ZA 2LP7A 1N32B 5EBLC 4DV3O 3ZIAG 4FLUA 4P2ZA 2EIKB 1XOUA 3T4DA 2DJVA 3E8GA 4CBCA 1K73W 4Z1MG 2IJIA 1MMMA 2XAGA 3AG2C 4R6ZA 2ODMA 4I9WA 3M99B 2ATKC 3H1LH 3QG5A 4B3TB 3ZMUA 4DV4O 1FPOA 4CS4A 1OCOC 3MDSA 4X20A 2WA4A 1KMIZ 4DR7B 4DR4B 3FYIB 3JAWA 1PNMA 2RN9A 5LOVA 3SPCA 4I55B 2HP8A 4DW1A 2N74A 3K9AA 1SKVA 2R9RB 1KUQA 4CH4A 1Z5VA 1VQMV 2F1MA 1JFFA 3K03A 1XREA 2MK3A 1AROP 3JYCA 4DV5O 1R6TA 1JPXA 3UKMA 4JI8B 3DXRB 3VQXA 4EFBA 5F2VO 4FM0A 4KL1A 4LF7O 3RVZA 1I5XA 4QPKA 5EYPB 2WLIA 3ABLB 3K04A 4BIZA 1Z2GA 5EC1C 3N27A 4ZKIA 1UFIA 4NXNO 5IY5B 5LA6A 2JDIG 4YJ2A 3I55V 4MVQA 4ABMA 3QNEA 4NKGB 4JYCA 5H6RA 3ETDA 3HKEB 3CWBH 5L3FA 1OCCC 3QVNA 4UFZA 3FKSG 3AK3A 5B3SB 2EJ7A 3G6BA 5KHKA 1GM8A 1W0JG 2OCHA 5K1PA 3JCZA 2QWPB 2GUZA 4X1KB 4GT1A 2ZDIA 3FAVB 4GUNA 3HR0A 4O2AB 1JCHA 3SDLA 4LP8A 3ZEDA 3THOA 3AG3B 4RQFA 5A2QN 1QR8A 1N8RW 5GW7A 2Z5UA 5EIBC 3ASOC 3D3IA 5L3EA 3E83A 3K5MA 1QLEB 5IJ9A 2ZR3A 2EILC 5LHHA 1FJGB 1LUVA 2BE3A 4H37A 1BSMA 5LMNB 3Q4HB 1I08A 2JGDB 4ZI7A 2PUSA 1M57B 2C2AA 2IU3A 4QIWF 3A8TA 1BL8A 3JARB 3SPHA 2QEXV 4DR2B 2ZINA 4NXMB 1Q81W 2LO1A 1FXKB 2UUCO 2X6BA 2QWQB 4UVBA 3KCXA 2X6CA 3CPWU 5IYCO 4DR1O 5JVDA 4R7CA 1KC8W 3CMAV 1GO3F 2ZNJA 2WLMA 1M5IA 1LNQA 2BTQA 1N34O 3X2QC 2X0LA 3ABMC 1PM9A 1I0HA 3AG4B 3K57A 1G6UA 2ZR2A 1YDXA 2EIJC 2OT5A 3RYHB 1M1KW 3VOUA 4ZOLA 4LFCB 1GAXA 4X64B 1VP7A 4O4IA 5LYJB 1YI2V 1GRJA 1YHQV 2GSMB 2CUGA 5J2TA 4MVRA 3STLC 4DR6B 3WFVA 1VQNV 2GHYA 4BW5A 3PN1A 1NJIW 4TV9B 2CTPA 5D5QA 1YCIA 4GKJB 3WG7B 1R3LC 1WB8A 3ABUA 3B77A 2Q73A 3K3WA 2F4VB 4DK1A 1YTFB 4O2BB 4J11A 4FLXA 1Q6IA 3LSSA 1W0KG 1ZWIC 1YJWV 1KECA 3DC6A 2A79B 1N0NA 3CMEV 4FPPA 1Q6UA 4OX9B 1N36B 1XHZA 2UXCO 4UVCA 1D5NA 5KHGA 4WBNA 1IBLB 3F7YC 3JATA 3C90A 1XL4A 2YS8A 4Z1VA 4RWUA 3LNNA 2PZSA 4DV2B 3C3SA 2VQEO 1AR4A 2EINC 1COWG 2HHHO 1FKAO 2GTAA 3CCSV 4DV1B 4IIJB 3ETQA 4JI7O 3ZN0A 2QGNA 1Q86W 4FFBA 3WB2A 5LOVB 4OPHA 2P7TC 4MVZA 1NI8A 2UUAO 3P3NA 1K7DA 1FD9A 1SQVH 2K1EA 3RYIB 3SYCA 1TVKA 3CC4V 2Y4UA 5J9PC 4DR3O 3E2EA 2A0LA 3T4ZA 5C8YB 5A9GA 4L87A 1N33B 3CP1A 4CH3A 1M56C 3TJTA 5GONA 1XMOO 4LF5B 3ZRVA 1A32A 2WLIB 3LDCA 5IYBO 4X66B 2WLHA 1MZEA 2GBOA 5LGNA 3N2KA 1G4YB 3SJQC 4HZ3A 3ML0A 2Q7EA 1WNSA 3CYOA 4X62B 2VQFO 4B08A 1JOYA 2JGUA 4JI3B 4O4JA 5BXZA 2OWOA 1IXBA 2NN4A 2IJJA 5LGUA 2DQ3A 2Q8VA 5KAFZ 4AQYO 3K08A 1OCZC 1SERA 4DXWA 2GUZB 4RUEA 1T5EA 4O4HA 4MVSA 3CRMA 1JQ0A 4DV7B 3E8BA 2JJ1G 2DE0X 5EBMC 1HNWO 2IJHA 3SPIA 4X88A 4DW0A 2OIGA 1H2KA 1J95A 1L0NH 1Q7YW 4FM2A 4NR1A 4QGPA 4J7KA 5KA6A 1WN7A 1ZSPA 2CTRA 4IHJA 4FVMA 3L73H 4JPRA 3JALA 1OZ0A 1PP9H 2XUMA 4ZI7B 2QJ1A 1KD1W 1EZJA 2ZIOA 1EFRG 2Y48A 3KG2A 2YXYA 1HR0O 2ILMA 3DC5A 1IXMA 3I5DA 4NTWA 3SPJA 1OCRC 3OTFA 1ZLZA 3B2EE 1WAZA 1XBLA 1JA8A 4IYHA 4CZZA 1NH2B 4KUMA 3HPLC 4AI8A 3CCUV 1TAEA 2ZCEA 1Y6XA 1Q3EA 2CTQA 3JASB 2NNUA 3AG2B 1TUBA 2BTQB 4TT3G 2RJZA 5B1AB 4UB6Z 1OCOB 3ZJZA 3HKCB 5ITZA 4X65B 1EBOA 2LGQA 1UPGA 1SQXH 2ZXWC 3JSLA 2A7WA 4ZOLB 4DUYB 4MVMA 4DYLA 3K5OA 1NU1H 2WLKA 2QWRB 4WFEA 2BSKA 2KQXA 2D3OW 3FB8C 1U97A 1YF2A 2UXDO 4ZIBA 1SQQH 1G1XB 1VF6C 1HNXB 4O4LA 1ZL8B 3OMIB 1YIJV 3P3PA 4GZRB 1GN2A 2IJKA 1H8EG 2O57A 2RMKB 4JI2O 3CS5A 4WF9V 2ITCC 3EFFK 1F4NA 5LP6A 4DRXA 3K58A 4YIOA 1YZBA 2XAJA 2R9IA 4B3MB 1YXBA 2YUAA 1S76D 1FAFA 4JI1O 1K3EA 3CHXA 3JATB 4P30A 2QKSA 1H2LA 4HNAA 2DN9A 3JAKA 3B8NA 4MS2A 4QE7A 2ZM6O 1H2MA 1YJ9V 2KB1A 1KKCA 1WA8B 3FB7C 1H2SB 2KG7B 4DV3B 5JWPA 1OCCB 3ZX6A 3ZMTA 2D2CB 5CA0B 1EZVH 4FFBB 1NVPB 2WSSG 1FFXA 3K06A 3E8HA 3CC7V 2LW7A 1B6QA 4KXRA 3OAAG 1QU7A 2ZDIC 2EULA 4K3AA 5B1NA 1NKDA 4I0XB 3ZS8C 4DV4B 4YIPA 1XNQO 2CH7A 3T1HO 2K9PA 3ZMVA 1EN4A 2W0XA 1R1BA 3G6EV 1MOFA 4G28B 1NS1A 4RAIA 1CEZA 4K35A 3BY6A 2JK5C 1Q8IA 2F43G 3ASOB 4UCTA 4DR5O 4JAUA 3SPGA 2Q5ZA 1XMQO 5GONB 3OD4A 4B3RO 3RYFB 2NLJC 4PI2A 1S5LZ 3STZC 3SYAA 5LXTB 2AW9A 1S0VA 4NTXA 4X8AA 4JF3A 5LMUO 3CX5F 5H6QA 4DV5B 2H3OA 3RVYA 4LF7B 3CCEV 5KHHA 1I94O 3CE2A 2XOKG 3R66A 3T1CA 1PNLA 2IBZH 2W0FC 1WJZA 4J7JA 2R70A 2H8PC 4NXNB 4FMTA 4L8JA 2Q69A 4J7ZA 4JV5O 3K0DA 2ITDC 4O4HB 1NZ6A 1F23A 3X2QB 3ABMB 4KHPO 1R3IC 3J81N 4WFGA 3SR2C 4AHCA 1B04A 1X4TA 1G8MA 3J80N 2EIJB 3NXSA 4I50B 5IWAO 3JSNA 3JALB 4TV8A 1BMFG 4F6RB 3BFRA 4UUJC 4BW9A 5CBHA 1VF6A 3UT5A 2YEVA 4JI0B 3E22A 3AK2A 2JS3A 3UM7A 2AZ0A 2GTSA 1KKDA 2ZT9B 2ETNA 4JTDB 3WB0A 3P30A 4FLZA 4JAAA 3SJAC 2LQTA 2VS0A 3LUTB 1RM1C 4EB6B 1H2NA 4CS3A 4NVPA 3RWRD 2HVJC 1WPXA 2YC0A 2QSAA 3BAAA 1NH2D 1JJOA 2WLNA 5BZBA 5IJ0A 4LWSA 4IL6Z 1SQPH 1TUBB 5EZYB 3QO5A 4U7OA 1NT2B 2HKOA 5KX5A 3CEIA 1V55C 3VQWA 4I4TB 1Q82W 2EINB 5ITZB 3VQVA 2UUCB 4BWAA 4ASUG 1MABG 1SZXA 3MHSC 2QDOA 4YXWG 4DR1B 3K5NA 2XAHA 4WFFA 2A06H 2BSKB 3HKBB 1MZFA 1AR5A 1N34B 3APQA 2H94A 4MTOA 3JD4A 4MVUA 3G4SV 1VQOV 1R73A 4P9PA 4NB5A 1VQ8V 2FB5A 2WA3A 5EC2C 3JD1A 1YVWA 1BT8A 3WU2Z 1M93A 2ZKOA 3SYOA 1M56B 3K0GA 2OTJV 2JJ2G 3ZCCA 1S72V 3ASNB 4P9OA 5AG2A 1XNRO 3H1JH 4TUYA 4HNAB 1IDSA 4J10A 2WLLA 1V54C 1P49A 5FL7G 2EIMC 4LF8O 3K5LA 4UCSA 1BS3A 1ROPA 3H1HH 3DSQA 2B1GA 2ZE7A 2UXCB 1THZA 1IX9A 1FFXB 2XT9A 1XI1A 3FYEB 4X9QA 2P06A 5E79Z 3L70H 4KFMA 2RCVA 1URFA 1OCZB 1HNZO 5KUKA 2EIKC 2E3CA 2VQEB 3R65A 3ZMSA 2F66C 1EN6A 2LJ2A 4YY3O 2JEXA 2HHHB 3BRCA 1FYJA 3TK1A 3U10A 3UQ8A 4JI7B 4GX0A 4Q20A 1VIBA 2ZE5A 3RFRA 3SJBC 2GDSA 5JQGB 3W7SA 1M90W 2UUAB 5EIBD 1AILA 2OYQA 2Q7GA 1W2BU 3D3QA 1RSOA 4W4KA 4DR3B 3L9DA 2P4VA 3JD0A 5FNVA 3H01A 4U3JA 5D5PA 1PD3A 1IBKO 1BCCH 3GVMA 1KBHA 1D5AA 4X1YA 4MVOA 3MHHC 1XMOB 1OCRB 2FTKA 5J2UA 3OTOO 3OUSA 2EBOA 2WWWA 4TQDA 1PL4A 3F5WC 1K5SA 3B40A 1NBMG 1LUWA 2DYRC 2E5LO 3DTUB 5LHGA 1JR9A 3NR7A 3KKYA 3CRAA 3IAYA 1R3JC 3H1IH 3ZHUA 2JVDA 4MTXA 4X20B 4NTYA 4EFEA 2B9ZA 1V9PA 4YJ3A 2HEPA 4BIUA 1L0LH 2ZD9A 3RT3C 2VQFB 3JAWB 5BR8O 3CRRA 1QHTA 5IYZA 1AP5A 3N2GA 4AQYB 4LF4O 3WB1A 1JFFB 1H38A 4YHHO 4HAMA 5HFMA 3CCMV 1HNWB 3E22B 4R8CA 3OR7C 3CRCA 4JYYA 5CA1A 1AP6A 5IT9N 2L35A 4W4LA 3ZRXA 5LP6C 3CCLV 3T2MA 3ZHRA 4X1IA 5B1BC 3ZN1A 1SC5B 3KCYA 3HB3B 4LFBO 2PI5A 3OT7A 3RGBA 1Y66A 4KP4A 2CGOA 3OMNB 5LHIA 2XHBA 2OIEA 4DV0O 4LF6O 1SRYA 2N05A 2VWKA 4PI0A 1SETA 5LA6B 3UO2A 4YJ2B 1QVGU 1HR0B 1VF5B 3FFQA 1PV0A 3IFXA 2EJRA 2QE7G 4GKKO 5KX5B 4WFAV 4K8ZA 1RPOA 1K9MW 1SS3A 5KUMA 3ETEA 1K97A 4D6TH 4OPAA 2AGAA 1KYOF 3APOA 1Q5OA 4HBNA 3IJ4A 3EXAA 2UUBO 4JI5O 4WCEV 1P7GA 4PELA 2Z0AA 2Y0IA 1WP7A 2QWNB 2YXHA 2OCCC 2Q0AA 1JJ2U 3L75H 4I7ZB 1M4UA 5IJ9B 4DO2A 1HW7A 2PTMA 3AG4C 1GN3A 2UXDB 1Y4MA 1JMKC 1K4CC 2UU9O 5IYDO 2CTWA 4TWKA 3E89A 5L3GA 1IVSA 3K9SA 3CCJV 4JI2B 1L1FA 1AJNA 2WLLB 2CAZC 4GX2A 1BE3H 1R6KA 2P22C 1AVMA 5E1AC 3ZRWA 1NR7A 3QO8A 1BQZA 3A0HZ 4MTGA 3E35A 3TETA 1Q6HA 3OE7G 4JI1B 5JVDB 2UXBO 1E1QG 4PA9A 2FKXA 1VF7A 3DXRA 2HG5C 3ZMZA 2Q0OC 5B66Z 3BABA 2BTOA 1VQ9V 2ZM6B 2JEUA 4FLWA 5EBWC 2JS5A 4F6EA 3B4SA 1NR1A 1Q43A 2P6JA 2YI8A 2FYUH 2WAMA 3S3XA 2YDEA 2FMLA 1WB7A 2HR3A 5JH7A 2HJFC 4O4IB 2CE4A 5H9CA 2E74B 2PYJA 4CH6A 2R72A 5J2TB 1DGSA 3HKEA 3O65A 1J5EO 4GCZA 4B7KA 2AXTZ 3IGAC 5JCOC 4JZGA 3GWOA 4XDKA 1RP3B 1GN4A 4J42A 1XNQB 2RQ6A 1FXVA 3T1HB 4FFKA 1KP3A 4U3JB 1YTFD 1F4MA 4DR5B 1OHHG 3FAVA 4X1YB 4OGQB 1O9GA 1XMQB 3AK1A 3CCVV 5J2UB 1RM1B 3LSQA 4B3RB 3MD0A 1RFYA 4JTCB 3SYPA 2AHYA 1K4DC 1TGOA 1MSDA 4WBNB 5LMUB 4F4LA 4BR6A 1TUEB 3OEEG 2RDCA 4TQFA 4DUZO 4LBEC 1PNKA 2DYSC 4N23A 5KHJA 3JCUZ 1V55B 4PJ0Z 3BVOA 3Q4HA 2JGDA 1I94B 4DV6O 3CD6V 3H9VA 4YJ3B 4XBFA 2P67A 5CA3A 3M7MX 1NQTA 4UV8A 2GV9A 4JV5B 4EKWA 1FXKA 1TVKB 4X89A 2PI4A 1AI4A 3ETGA 4OXSA 4KHPB 4QNHB 5KAIZ 4LF9O 3E86A 5FPRA 2FL4A 5CA1B 3FX7A 3IC9A 1K8AW 5IDJA 1Y74A 2EZOA 5IWAB 4X1IB 2X6AA 1BHBA 4RUFA 5FPOA 2EILB 3OM3B 3SGIA 1FXHA 2A9HA 1QLNA 2Y0PA 4FJCC 4IGGA 1FFTB 3VBBA 3A2FA 3N2KB 4CH5A 4RO2A 3CRQA 4B3SO 4JI4O 1XILA 1X59A 4LH6A 3BEHA 2IU0A 1V54B 3ABKC 4LFAO 4UCOA 2EIMB 5JJNB 2F23A 5C93A 4JAVA 1K92A 4PDMA 2EZPA 2ADQB 1WP8A 3D36C 3L71H 4O4JB 5L3CA 2YI9A 3LNMB 3AEIA 5BY1A 1EM1A 2XAQA 1VQPV 4R50A 3O9OA 2ARHA 4PDLA 4H44B 4PD4F 1MSWD 1DK1A 2ZE6A 2A3QA 2XTAA 3I56V 2WPDG 2VWJA 1E79G 2BOBC 1H2GA 3H1KH 2XASA 3T1YO 2V7QG 4I5SA 4C7UA 3CCQV 5B1AC 1KU9A 4H13B 4IHJB 3AG7A 2CDYA 3QF7A 2X7RB 4BAYA 2XAFA 1IBMO 2JIZG 2NR5A 5JCOA 4IIJA 5TISZ 4JI6O 3QO7A 1ZX3A 3AG1C 2Q7HA 4JYAO 3J7AU 3CB2A 5KMGA 3ABTA 4K0KO 3RYCA 1KQSU 1UJWB 4UXNA 4EEQA 2BCCH 2M7WA 3RYIA 1OV9A 1Y76A 1YJNV 1LR1A 5B5EZ 1VQ4V 1B06A 3ZRWB 5IE9A 5FLXN 1ORQC 2CGNA 3W7WA 4D7SA 1XEQA 1VQLV 4LNUA 5LGTA 2Y4TA 2B5UA 1XNRB 3PJSK 2B1IA 2W6JG 5C8YA 4H33A 1NTKH 3D8CA 1Z5WA 1N32O 2DYRB 1ENVA 1VEWA 3ZHSA 2P4KA 4U3FH 4QE9A 4LF8B 5CMUA 4IYIA 1YSCA 2DW4A 3OW2U 1KB9F 3ZBHA 5CB4A 4ZHQA 2QTSA 2YSUB 3W7UA 4GX5A 5JH7B 1N4CA 1GTOA 1EN5A 4PDVA 2P90A 4B3TO 1U96A 1YEWA 2KKWA 1XHXA 1HNZB 2HLDG 1N0JA 2M6YA 4DR7O 3CJHA 4DR4O 3JAMN 4O4LB 4YY3B 3E8FA 3TGUH 4E2LA 4JTAB 1QCEA 5LP6B 4DRXB 4LC1A 5B1BB 4TOIA 1I7FA 4PV1B 1SZTA 1SQGA 2Y69C 2F93B 4JI0O 4LH7A 2E76B 3HKDA 4FM1A 3ICXA 4UCRA 5L3BA 2QTOA 1GK9A 2QR4A 4FIPC 4JI8O 4QJFB 3EVKA 3JAKB 1MNGA 4BIOA 1IBKB 4J9YB 4PA4A 4MTFA 2DWDC 3OTOB 4HYOA 4PA6A 4XDLA 5EK0A 2LFSA
chains in the Genus database with same CATH topology
5A2QN 5BXZA 4DV0O 1G1XB 2JRIA 4LF5O 4LF6O 4DV4O 5FLXN 1AILA 4AQYO 4LFCO 4X64O 1XEQA 2UXCO 4X66O 1I94O 4JI2O 4GKKO 4DR6O 3R66A 1HNWO 1N32O 4X65O 4GKJO 2N74A 1YZBA 2VQEO 1IBKO 3O65A 1J5EO 4DUYO 1KUQA 4OPAA 4JV5O 2HHHO 1FKAO 2F4VO 2AGAA 3F5TA 4JI7O 4X62O 3OTOO 4JI1O 4B3SO 4JI4O 1X59A 4KHPO 2ZKOA 4LFAO 3J81N 4JI3O 4OPHA 2UUBO 4JI5O 5H5NA 4B3TO 2Z0AA 2UUCO 2UUAO 2ZM6O 4DV5O 1HNXO 1R6TA 3J80N 2E5LO 4OX9O 1HR0O 1N36O 5IWAO 4LF7O 1XNRO 4DR1O 4DR7O 4DR4O 1FJGO 3JAMN 5BY1A 1IBLO 4DV7O 4DR3O 5LMNO 1N34O 4DV2O 4NXNO 2LW7A 3RT3C 5BR8O 4LF8O 2DOSA 4B3MO 2UU9O 1DK1A 4DV1O 1XMOO 4DUZO 1AB3A 1D2DA 4DR2O 4NXMO 1XNQO 1A32A 3T1HO 4LF4O 3M8AA 4JI0O 3T1YO 1R1BA 4DV6O 1NS1A 5LL6Y 4YHHO 4JI8O 4DR5O 1HNZO 1IBMO 4DV3O 4JI6O 1XMQO 4JYAO 5IT9N 2DJVA 4B3RO 3J7AU 4YY3O 4A5UB 1F7YA 1FYJA 4K0KO 4LFBO 5LMUO 2UXBO 3SDLA 2FKXA 2VQFO 2UXDO 4LF9O 1N33O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q N;  5BXZ A;  4DV0 O;  1G1X B;  2JRI A;  4LF5 O;  4LF6 O;  4DV4 O;  5FLX N;  1AIL A;  4AQY O;  4LFC O;  4X64 O;  1XEQ A;  2UXC O;  4X66 O;  1I94 O;  4JI2 O;  4GKK O;  4DR6 O;  3R66 A;  1HNW O;  1N32 O;  4X65 O;  4GKJ O;  2N74 A;  1YZB A;  2VQE O;  1IBK O;  3O65 A;  1J5E O;  4DUY O;  1KUQ A;  4OPA A;  4JV5 O;  2HHH O;  1FKA O;  2F4V O;  2AGA A;  3F5T A;  4JI7 O;  4X62 O;  3OTO O;  4JI1 O;  4B3S O;  4JI4 O;  1X59 A;  4KHP O;  2ZKO A;  4LFA O;  3J81 N;  4JI3 O;  4OPH A;  2UUB O;  4JI5 O;  5H5N A;  4B3T O;  2Z0A A;  2UUC O;  2UUA O;  2ZM6 O;  4DV5 O;  1HNX O;  1R6T A;  3J80 N;  2E5L O;  4OX9 O;  1HR0 O;  1N36 O;  5IWA O;  4LF7 O;  1XNR O;  4DR1 O;  4DR7 O;  4DR4 O;  1FJG O;  3JAM N;  5BY1 A;  1IBL O;  4DV7 O;  4DR3 O;  5LMN O;  1N34 O;  4DV2 O;  4NXN O;  2LW7 A;  3RT3 C;  5BR8 O;  4LF8 O;  2DOS A;  4B3M O;  2UU9 O;  1DK1 A;  4DV1 O;  1XMO O;  4DUZ O;  1AB3 A;  1D2D A;  4DR2 O;  4NXM O;  1XNQ O;  1A32 A;  3T1H O;  4LF4 O;  3M8A A;  4JI0 O;  3T1Y O;  1R1B A;  4DV6 O;  1NS1 A;  5LL6 Y;  4YHH O;  4JI8 O;  4DR5 O;  1HNZ O;  1IBM O;  4DV3 O;  4JI6 O;  1XMQ O;  4JYA O;  5IT9 N;  2DJV A;  4B3R O;  3J7A U;  4YY3 O;  4A5U B;  1F7Y A;  1FYJ A;  4K0K O;  4LFB O;  5LMU O;  2UXB O;  3SDL A;  2FKX A;  2VQF O;  2UXD O;  4LF9 O;  1N33 O; 
#chains in the Genus database with same CATH topology
 1US6 A;  1GN6 A;  3D36 A;  1CXZ B;  4FLV A;  2PGG A;  1VQ7 V;  1NVP D;  3BA8 A;  1AI6 A;  2E5L B;  2ZIM A;  1SA0 A;  5H2F Z;  3TXS A;  4XDJ A;  5BMV A;  4CS2 A;  1OJH A;  2CH7 B;  3B09 A;  2OCC B;  3CC2 V;  5JJJ B;  5KLV H;  5B1O A;  3JAS A;  5BR8 B;  1R6N A;  4PA3 A;  3CCR V;  4U7N A;  1Y74 B;  4RQE A;  1QBZ A;  4LF4 B;  3HKC A;  1GM7 A;  3G71 V;  2Q67 A;  4YHH B;  2Q4P A;  2HJD A;  2UXX A;  1XQ8 A;  4IT5 A;  3EHB B;  4B7E A;  4NYK A;  3UO3 A;  2MW2 B;  1FJG O;  1VQ5 V;  3BCC H;  4JAS A;  4ICG A;  3FB5 C;  5LMN O;  5KHI A;  2QM4 A;  4LFB B;  1ZL8 A;  4E4E A;  4MW8 A;  5LBQ A;  3OFN G;  1SES A;  4DV0 B;  4LF6 B;  4DR2 O;  2QM8 A;  1PPJ H;  4NXM O;  4PHZ A;  4FZ1 A;  2LFR A;  3M8A A;  3P32 A;  1BQ0 A;  2Z3Y A;  3ABL C;  3OUF A;  5LL6 Y;  4GKK B;  4JGS A;  2HVK C;  5IY5 C;  2W6I G;  2R9A A;  4G2K A;  1XDC A;  4MSW C;  4UCV A;  5CN0 A;  4UB8 Z;  1DTO A;  1ZAU A;  2ZXW B;  1AJP A;  1JX9 A;  1F7Y A;  4FZ0 A;  2IH3 C;  3BPZ A;  5KA5 A;  3TXQ A;  3RW0 A;  3LSU A;  2PF4 E;  2IM9 A;  3SYQ A;  1WA8 A;  2KG7 A;  4TV8 B;  4JI5 B;  2UUB B;  5B3S C;  2JRI A;  3QTC A;  3UT5 B;  2YEV B;  4LFC O;  5CA0 A;  4X64 O;  3CXC U;  4Z2W A;  1S5J A;  5KMG B;  3U11 A;  3RYC B;  1VQ6 V;  1ZUQ A;  2QWO B;  4DR6 O;  1QR9 A;  2AZ2 A;  1SF9 A;  4I0X A;  1Y76 B;  4GKJ O;  3AG3 C;  1MA1 A;  3G67 A;  3VQY A;  1DLB A;  2ZQM A;  2HFE C;  2F4V O;  3A0B Z;  3F5T A;  3S3W A;  2UU9 B;  4LNU B;  3BA9 A;  1RPR A;  2CK3 G;  3RN4 A;  4D7T A;  2OTL V;  1QLE C;  4J9Z B;  4GLX A;  5IJ0 B;  4LWS B;  1O9H A;  3GWK C;  1B3Q A;  5H5N A;  3ZHV A;  5DEC A;  3RYF A;  2AHZ A;  1Q90 D;  3ASN C;  3C3T A;  2DYS B;  1AJQ A;  4OX9 O;  1N36 O;  5LXT A;  5GTH Z;  4MT8 A;  3OR6 C;  1M57 C;  4J41 A;  1IBL O;  1BZK A;  5CB4 B;  3LDE A;  4ZHQ B;  1P4R A;  1WPB A;  1GKF A;  4DV2 O;  2UXB B;  2QKA A;  1K5Q A;  1FXK C;  1PKX A;  3GB7 C;  2YID A;  4DV1 O;  5DED A;  1D2D A;  3CJH B;  1HWY A;  2WLJ A;  1H8H G;  4H0L B;  2KSD A;  5K1X A;  4K8X A;  4UV9 A;  3FD9 A;  1M9N A;  2Q6A A;  1GM9 A;  2DWE C;  4QPJ A;  4UCU A;  2G38 A;  2ZNI A;  1QQC A;  3W7X A;  4LR3 A;  1J5E B;  4AIL C;  3SJC C;  1AR1 B;  1VMG A;  3HKD B;  4JZ2 A;  1S5H C;  2YIB D;  3W7T A;  4WFB V;  4I55 A;  4WFH A;  1N33 O;  4I50 A;  4FK5 C;  4TUY B;  2QA4 V;  3LDD A;  4LF5 O;  1XL6 A;  3K59 A;  3WG7 C;  4F6R A;  4X66 O;  4J80 A;  1E1R G;  3ABK B;  1QNM A;  2DQ0 A;  1FS0 G;  1HDJ A;  5CBG A;  1XUQ A;  2P5O A;  4CC5 A;  1MG1 A;  4EB6 A;  1SA0 B;  4DUZ B;  4X62 O;  5EYP A;  3KZI Z;  2LW1 A;  5BMV B;  4JYB A;  1SQF A;  4GYC B;  3F7V C;  5HFL A;  3L74 H;  4JI3 O;  4DV6 B;  1AI5 A;  2EX3 A;  2LGW A;  3ZHQ A;  1TA8 A;  3ZHT A;  5EZY A;  1W59 A;  4MW3 A;  3ZRS A;  1R3K C;  4I4T A;  4DV7 O;  3MAQ A;  1HP8 A;  2BOC C;  1BGY H;  1GH6 A;  4FLY A;  2UXN A;  3JD3 A;  3AG1 B;  4LF9 B;  1RSO B;  1VQK V;  2VRZ A;  2QM7 A;  5FNV B;  4UVA A;  1AB3 A;  4PDR A;  2QKC A;  2IH1 C;  3CXH F;  4X1K A;  3TCU A;  3HKB A;  2YIC A;  4O2A A;  3B8M A;  1P84 F;  5L3D A;  1WLE A;  3OGC C;  3K79 A;  1IZ3 A;  3UCS C;  1BHA A;  4ZBM A;  4I9Q A;  4A5U B;  1S77 D;  2DMX A;  3G80 A;  5GTI Z;  1NTZ H;  4B3S B;  3BHP A;  4JI4 B;  2V1D A;  1I5Y A;  2YIB A;  4LFA B;  1AI7 A;  3JD2 A;  3DGE A;  3L72 H;  4TSF G;  5IYZ B;  4G27 B;  2L6L A;  3JAR A;  5CBF A;  1DF4 A;  3FB6 C;  1VAR A;  4PA7 A;  3N2G B;  1CP9 A;  1L8D A;  2IW5 A;  4X65 O;  1YIT V;  2Q9L A;  2ZE8 A;  1CPY A;  4GX1 A;  4DUY O;  4LCU C;  4Q6G A;  3OGI B;  1NTM H;  1KP2 A;  3OMA B;  2V4D A;  2PY5 A;  1DF5 A;  1S3J A;  2N04 A;  3A0R A;  3RBZ A;  3T1Y B;  1QVF U;  5JJE B;  1Y67 A;  1HNX O;  1GMG A;  4FLT A;  1IBM B;  3OEH G;  2E75 B;  4DK0 A;  2Y69 B;  2RNB A;  4JI6 B;  3RYH A;  2PYL A;  4JYA B;  2XND G;  4N21 A;  5LYJ A;  2Q68 A;  1ZTE A;  4K0K B;  5JQG A;  1K34 A;  1F51 A;  4TV9 A;  1JVM A;  2DOS A;  4B3M O;  5DN6 G;  3CSX A;  1PL0 A;  2YXL A;  5DM6 V;  2ADP A;  1K33 A;  2F95 B;  1IUR A;  4CC6 A;  4O2B A;  2YIA A;  3IC7 A;  1SQB H;  1P7B A;  3U0Z A;  2LP7 A;  1N32 B;  5EBL C;  4DV3 O;  3ZIA G;  4FLU A;  4P2Z A;  2EIK B;  1XOU A;  3T4D A;  2DJV A;  3E8G A;  4CBC A;  1K73 W;  4Z1M G;  2IJI A;  1MMM A;  2XAG A;  3AG2 C;  4R6Z A;  2ODM A;  4I9W A;  3M99 B;  2ATK C;  3H1L H;  3QG5 A;  4B3T B;  3ZMU A;  4DV4 O;  1FPO A;  4CS4 A;  1OCO C;  3MDS A;  4X20 A;  2WA4 A;  1KMI Z;  4DR7 B;  4DR4 B;  3FYI B;  3JAW A;  1PNM A;  2RN9 A;  5LOV A;  3SPC A;  4I55 B;  2HP8 A;  4DW1 A;  2N74 A;  3K9A A;  1SKV A;  2R9R B;  1KUQ A;  4CH4 A;  1Z5V A;  1VQM V;  2F1M A;  1JFF A;  3K03 A;  1XRE A;  2MK3 A;  1ARO P;  3JYC A;  4DV5 O;  1R6T A;  1JPX A;  3UKM A;  4JI8 B;  3DXR B;  3VQX A;  4EFB A;  5F2V O;  4FM0 A;  4KL1 A;  4LF7 O;  3RVZ A;  1I5X A;  4QPK A;  5EYP B;  2WLI A;  3ABL B;  3K04 A;  4BIZ A;  1Z2G A;  5EC1 C;  3N27 A;  4ZKI A;  1UFI A;  4NXN O;  5IY5 B;  5LA6 A;  2JDI G;  4YJ2 A;  3I55 V;  4MVQ A;  4ABM A;  3QNE A;  4NKG B;  4JYC A;  5H6R A;  3ETD A;  3HKE B;  3CWB H;  5L3F A;  1OCC C;  3QVN A;  4UFZ A;  3FKS G;  3AK3 A;  5B3S B;  2EJ7 A;  3G6B A;  5KHK A;  1GM8 A;  1W0J G;  2OCH A;  5K1P A;  3JCZ A;  2QWP B;  2GUZ A;  4X1K B;  4GT1 A;  2ZDI A;  3FAV B;  4GUN A;  3HR0 A;  4O2A B;  1JCH A;  3SDL A;  4LP8 A;  3ZED A;  3THO A;  3AG3 B;  4RQF A;  5A2Q N;  1QR8 A;  1N8R W;  5GW7 A;  2Z5U A;  5EIB C;  3ASO C;  3D3I A;  5L3E A;  3E83 A;  3K5M A;  1QLE B;  5IJ9 A;  2ZR3 A;  2EIL C;  5LHH A;  1FJG B;  1LUV A;  2BE3 A;  4H37 A;  1BSM A;  5LMN B;  3Q4H B;  1I08 A;  2JGD B;  4ZI7 A;  2PUS A;  1M57 B;  2C2A A;  2IU3 A;  4QIW F;  3A8T A;  1BL8 A;  3JAR B;  3SPH A;  2QEX V;  4DR2 B;  2ZIN A;  4NXM B;  1Q81 W;  2LO1 A;  1FXK B;  2UUC O;  2X6B A;  2QWQ B;  4UVB A;  3KCX A;  2X6C A;  3CPW U;  5IYC O;  4DR1 O;  5JVD A;  4R7C A;  1KC8 W;  3CMA V;  1GO3 F;  2ZNJ A;  2WLM A;  1M5I A;  1LNQ A;  2BTQ A;  1N34 O;  3X2Q C;  2X0L A;  3ABM C;  1PM9 A;  1I0H A;  3AG4 B;  3K57 A;  1G6U A;  2ZR2 A;  1YDX A;  2EIJ C;  2OT5 A;  3RYH B;  1M1K W;  3VOU A;  4ZOL A;  4LFC B;  1GAX A;  4X64 B;  1VP7 A;  4O4I A;  5LYJ B;  1YI2 V;  1GRJ A;  1YHQ V;  2GSM B;  2CUG A;  5J2T A;  4MVR A;  3STL C;  4DR6 B;  3WFV A;  1VQN V;  2GHY A;  4BW5 A;  3PN1 A;  1NJI W;  4TV9 B;  2CTP A;  5D5Q A;  1YCI A;  4GKJ B;  3WG7 B;  1R3L C;  1WB8 A;  3ABU A;  3B77 A;  2Q73 A;  3K3W A;  2F4V B;  4DK1 A;  1YTF B;  4O2B B;  4J11 A;  4FLX A;  1Q6I A;  3LSS A;  1W0K G;  1ZWI C;  1YJW V;  1KEC A;  3DC6 A;  2A79 B;  1N0N A;  3CME V;  4FPP A;  1Q6U A;  4OX9 B;  1N36 B;  1XHZ A;  2UXC O;  4UVC A;  1D5N A;  5KHG A;  4WBN A;  1IBL B;  3F7Y C;  3JAT A;  3C90 A;  1XL4 A;  2YS8 A;  4Z1V A;  4RWU A;  3LNN A;  2PZS A;  4DV2 B;  3C3S A;  2VQE O;  1AR4 A;  2EIN C;  1COW G;  2HHH O;  1FKA O;  2GTA A;  3CCS V;  4DV1 B;  4IIJ B;  3ETQ A;  4JI7 O;  3ZN0 A;  2QGN A;  1Q86 W;  4FFB A;  3WB2 A;  5LOV B;  4OPH A;  2P7T C;  4MVZ A;  1NI8 A;  2UUA O;  3P3N A;  1K7D A;  1FD9 A;  1SQV H;  2K1E A;  3RYI B;  3SYC A;  1TVK A;  3CC4 V;  2Y4U A;  5J9P C;  4DR3 O;  3E2E A;  2A0L A;  3T4Z A;  5C8Y B;  5A9G A;  4L87 A;  1N33 B;  3CP1 A;  4CH3 A;  1M56 C;  3TJT A;  5GON A;  1XMO O;  4LF5 B;  3ZRV A;  1A32 A;  2WLI B;  3LDC A;  5IYB O;  4X66 B;  2WLH A;  1MZE A;  2GBO A;  5LGN A;  3N2K A;  1G4Y B;  3SJQ C;  4HZ3 A;  3ML0 A;  2Q7E A;  1WNS A;  3CYO A;  4X62 B;  2VQF O;  4B08 A;  1JOY A;  2JGU A;  4JI3 B;  4O4J A;  5BXZ A;  2OWO A;  1IXB A;  2NN4 A;  2IJJ A;  5LGU A;  2DQ3 A;  2Q8V A;  5KAF Z;  4AQY O;  3K08 A;  1OCZ C;  1SER A;  4DXW A;  2GUZ B;  4RUE A;  1T5E A;  4O4H A;  4MVS A;  3CRM A;  1JQ0 A;  4DV7 B;  3E8B A;  2JJ1 G;  2DE0 X;  5EBM C;  1HNW O;  2IJH A;  3SPI A;  4X88 A;  4DW0 A;  2OIG A;  1H2K A;  1J95 A;  1L0N H;  1Q7Y W;  4FM2 A;  4NR1 A;  4QGP A;  4J7K A;  5KA6 A;  1WN7 A;  1ZSP A;  2CTR A;  4IHJ A;  4FVM A;  3L73 H;  4JPR A;  3JAL A;  1OZ0 A;  1PP9 H;  2XUM A;  4ZI7 B;  2QJ1 A;  1KD1 W;  1EZJ A;  2ZIO A;  1EFR G;  2Y48 A;  3KG2 A;  2YXY A;  1HR0 O;  2ILM A;  3DC5 A;  1IXM A;  3I5D A;  4NTW A;  3SPJ A;  1OCR C;  3OTF A;  1ZLZ A;  3B2E E;  1WAZ A;  1XBL A;  1JA8 A;  4IYH A;  4CZZ A;  1NH2 B;  4KUM A;  3HPL C;  4AI8 A;  3CCU V;  1TAE A;  2ZCE A;  1Y6X A;  1Q3E A;  2CTQ A;  3JAS B;  2NNU A;  3AG2 B;  1TUB A;  2BTQ B;  4TT3 G;  2RJZ A;  5B1A B;  4UB6 Z;  1OCO B;  3ZJZ A;  3HKC B;  5ITZ A;  4X65 B;  1EBO A;  2LGQ A;  1UPG A;  1SQX H;  2ZXW C;  3JSL A;  2A7W A;  4ZOL B;  4DUY B;  4MVM A;  4DYL A;  3K5O A;  1NU1 H;  2WLK A;  2QWR B;  4WFE A;  2BSK A;  2KQX A;  2D3O W;  3FB8 C;  1U97 A;  1YF2 A;  2UXD O;  4ZIB A;  1SQQ H;  1G1X B;  1VF6 C;  1HNX B;  4O4L A;  1ZL8 B;  3OMI B;  1YIJ V;  3P3P A;  4GZR B;  1GN2 A;  2IJK A;  1H8E G;  2O57 A;  2RMK B;  4JI2 O;  3CS5 A;  4WF9 V;  2ITC C;  3EFF K;  1F4N A;  5LP6 A;  4DRX A;  3K58 A;  4YIO A;  1YZB A;  2XAJ A;  2R9I A;  4B3M B;  1YXB A;  2YUA A;  1S76 D;  1FAF A;  4JI1 O;  1K3E A;  3CHX A;  3JAT B;  4P30 A;  2QKS A;  1H2L A;  4HNA A;  2DN9 A;  3JAK A;  3B8N A;  4MS2 A;  4QE7 A;  2ZM6 O;  1H2M A;  1YJ9 V;  2KB1 A;  1KKC A;  1WA8 B;  3FB7 C;  1H2S B;  2KG7 B;  4DV3 B;  5JWP A;  1OCC B;  3ZX6 A;  3ZMT A;  2D2C B;  5CA0 B;  1EZV H;  4FFB B;  1NVP B;  2WSS G;  1FFX A;  3K06 A;  3E8H A;  3CC7 V;  2LW7 A;  1B6Q A;  4KXR A;  3OAA G;  1QU7 A;  2ZDI C;  2EUL A;  4K3A A;  5B1N A;  1NKD A;  4I0X B;  3ZS8 C;  4DV4 B;  4YIP A;  1XNQ O;  2CH7 A;  3T1H O;  2K9P A;  3ZMV A;  1EN4 A;  2W0X A;  1R1B A;  3G6E V;  1MOF A;  4G28 B;  1NS1 A;  4RAI A;  1CEZ A;  4K35 A;  3BY6 A;  2JK5 C;  1Q8I A;  2F43 G;  3ASO B;  4UCT A;  4DR5 O;  4JAU A;  3SPG A;  2Q5Z A;  1XMQ O;  5GON B;  3OD4 A;  4B3R O;  3RYF B;  2NLJ C;  4PI2 A;  1S5L Z;  3STZ C;  3SYA A;  5LXT B;  2AW9 A;  1S0V A;  4NTX A;  4X8A A;  4JF3 A;  5LMU O;  3CX5 F;  5H6Q A;  4DV5 B;  2H3O A;  3RVY A;  4LF7 B;  3CCE V;  5KHH A;  1I94 O;  3CE2 A;  2XOK G;  3R66 A;  3T1C A;  1PNL A;  2IBZ H;  2W0F C;  1WJZ A;  4J7J A;  2R70 A;  2H8P C;  4NXN B;  4FMT A;  4L8J A;  2Q69 A;  4J7Z A;  4JV5 O;  3K0D A;  2ITD C;  4O4H B;  1NZ6 A;  1F23 A;  3X2Q B;  3ABM B;  4KHP O;  1R3I C;  3J81 N;  4WFG A;  3SR2 C;  4AHC A;  1B04 A;  1X4T A;  1G8M A;  3J80 N;  2EIJ B;  3NXS A;  4I50 B;  5IWA O;  3JSN A;  3JAL B;  4TV8 A;  1BMF G;  4F6R B;  3BFR A;  4UUJ C;  4BW9 A;  5CBH A;  1VF6 A;  3UT5 A;  2YEV A;  4JI0 B;  3E22 A;  3AK2 A;  2JS3 A;  3UM7 A;  2AZ0 A;  2GTS A;  1KKD A;  2ZT9 B;  2ETN A;  4JTD B;  3WB0 A;  3P30 A;  4FLZ A;  4JAA A;  3SJA C;  2LQT A;  2VS0 A;  3LUT B;  1RM1 C;  4EB6 B;  1H2N A;  4CS3 A;  4NVP A;  3RWR D;  2HVJ C;  1WPX A;  2YC0 A;  2QSA A;  3BAA A;  1NH2 D;  1JJO A;  2WLN A;  5BZB A;  5IJ0 A;  4LWS A;  4IL6 Z;  1SQP H;  1TUB B;  5EZY B;  3QO5 A;  4U7O A;  1NT2 B;  2HKO A;  5KX5 A;  3CEI A;  1V55 C;  3VQW A;  4I4T B;  1Q82 W;  2EIN B;  5ITZ B;  3VQV A;  2UUC B;  4BWA A;  4ASU G;  1MAB G;  1SZX A;  3MHS C;  2QDO A;  4YXW G;  4DR1 B;  3K5N A;  2XAH A;  4WFF A;  2A06 H;  2BSK B;  3HKB B;  1MZF A;  1AR5 A;  1N34 B;  3APQ A;  2H94 A;  4MTO A;  3JD4 A;  4MVU A;  3G4S V;  1VQO V;  1R73 A;  4P9P A;  4NB5 A;  1VQ8 V;  2FB5 A;  2WA3 A;  5EC2 C;  3JD1 A;  1YVW A;  1BT8 A;  3WU2 Z;  1M93 A;  2ZKO A;  3SYO A;  1M56 B;  3K0G A;  2OTJ V;  2JJ2 G;  3ZCC A;  1S72 V;  3ASN B;  4P9O A;  5AG2 A;  1XNR O;  3H1J H;  4TUY A;  4HNA B;  1IDS A;  4J10 A;  2WLL A;  1V54 C;  1P49 A;  5FL7 G;  2EIM C;  4LF8 O;  3K5L A;  4UCS A;  1BS3 A;  1ROP A;  3H1H H;  3DSQ A;  2B1G A;  2ZE7 A;  2UXC B;  1THZ A;  1IX9 A;  1FFX B;  2XT9 A;  1XI1 A;  3FYE B;  4X9Q A;  2P06 A;  5E79 Z;  3L70 H;  4KFM A;  2RCV A;  1URF A;  1OCZ B;  1HNZ O;  5KUK A;  2EIK C;  2E3C A;  2VQE B;  3R65 A;  3ZMS A;  2F66 C;  1EN6 A;  2LJ2 A;  4YY3 O;  2JEX A;  2HHH B;  3BRC A;  1FYJ A;  3TK1 A;  3U10 A;  3UQ8 A;  4JI7 B;  4GX0 A;  4Q20 A;  1VIB A;  2ZE5 A;  3RFR A;  3SJB C;  2GDS A;  5JQG B;  3W7S A;  1M90 W;  2UUA B;  5EIB D;  1AIL A;  2OYQ A;  2Q7G A;  1W2B U;  3D3Q A;  1RSO A;  4W4K A;  4DR3 B;  3L9D A;  2P4V A;  3JD0 A;  5FNV A;  3H01 A;  4U3J A;  5D5P A;  1PD3 A;  1IBK O;  1BCC H;  3GVM A;  1KBH A;  1D5A A;  4X1Y A;  4MVO A;  3MHH C;  1XMO B;  1OCR B;  2FTK A;  5J2U A;  3OTO O;  3OUS A;  2EBO A;  2WWW A;  4TQD A;  1PL4 A;  3F5W C;  1K5S A;  3B40 A;  1NBM G;  1LUW A;  2DYR C;  2E5L O;  3DTU B;  5LHG A;  1JR9 A;  3NR7 A;  3KKY A;  3CRA A;  3IAY A;  1R3J C;  3H1I H;  3ZHU A;  2JVD A;  4MTX A;  4X20 B;  4NTY A;  4EFE A;  2B9Z A;  1V9P A;  4YJ3 A;  2HEP A;  4BIU A;  1L0L H;  2ZD9 A;  3RT3 C;  2VQF B;  3JAW B;  5BR8 O;  3CRR A;  1QHT A;  5IYZ A;  1AP5 A;  3N2G A;  4AQY B;  4LF4 O;  3WB1 A;  1JFF B;  1H38 A;  4YHH O;  4HAM A;  5HFM A;  3CCM V;  1HNW B;  3E22 B;  4R8C A;  3OR7 C;  3CRC A;  4JYY A;  5CA1 A;  1AP6 A;  5IT9 N;  2L35 A;  4W4L A;  3ZRX A;  5LP6 C;  3CCL V;  3T2M A;  3ZHR A;  4X1I A;  5B1B C;  3ZN1 A;  1SC5 B;  3KCY A;  3HB3 B;  4LFB O;  2PI5 A;  3OT7 A;  3RGB A;  1Y66 A;  4KP4 A;  2CGO A;  3OMN B;  5LHI A;  2XHB A;  2OIE A;  4DV0 O;  4LF6 O;  1SRY A;  2N05 A;  2VWK A;  4PI0 A;  1SET A;  5LA6 B;  3UO2 A;  4YJ2 B;  1QVG U;  1HR0 B;  1VF5 B;  3FFQ A;  1PV0 A;  3IFX A;  2EJR A;  2QE7 G;  4GKK O;  5KX5 B;  4WFA V;  4K8Z A;  1RPO A;  1K9M W;  1SS3 A;  5KUM A;  3ETE A;  1K97 A;  4D6T H;  4OPA A;  2AGA A;  1KYO F;  3APO A;  1Q5O A;  4HBN A;  3IJ4 A;  3EXA A;  2UUB O;  4JI5 O;  4WCE V;  1P7G A;  4PEL A;  2Z0A A;  2Y0I A;  1WP7 A;  2QWN B;  2YXH A;  2OCC C;  2Q0A A;  1JJ2 U;  3L75 H;  4I7Z B;  1M4U A;  5IJ9 B;  4DO2 A;  1HW7 A;  2PTM A;  3AG4 C;  1GN3 A;  2UXD B;  1Y4M A;  1JMK C;  1K4C C;  2UU9 O;  5IYD O;  2CTW A;  4TWK A;  3E89 A;  5L3G A;  1IVS A;  3K9S A;  3CCJ V;  4JI2 B;  1L1F A;  1AJN A;  2WLL B;  2CAZ C;  4GX2 A;  1BE3 H;  1R6K A;  2P22 C;  1AVM A;  5E1A C;  3ZRW A;  1NR7 A;  3QO8 A;  1BQZ A;  3A0H Z;  4MTG A;  3E35 A;  3TET A;  1Q6H A;  3OE7 G;  4JI1 B;  5JVD B;  2UXB O;  1E1Q G;  4PA9 A;  2FKX A;  1VF7 A;  3DXR A;  2HG5 C;  3ZMZ A;  2Q0O C;  5B66 Z;  3BAB A;  2BTO A;  1VQ9 V;  2ZM6 B;  2JEU A;  4FLW A;  5EBW C;  2JS5 A;  4F6E A;  3B4S A;  1NR1 A;  1Q43 A;  2P6J A;  2YI8 A;  2FYU H;  2WAM A;  3S3X A;  2YDE A;  2FML A;  1WB7 A;  2HR3 A;  5JH7 A;  2HJF C;  4O4I B;  2CE4 A;  5H9C A;  2E74 B;  2PYJ A;  4CH6 A;  2R72 A;  5J2T B;  1DGS A;  3HKE A;  3O65 A;  1J5E O;  4GCZ A;  4B7K A;  2AXT Z;  3IGA C;  5JCO C;  4JZG A;  3GWO A;  4XDK A;  1RP3 B;  1GN4 A;  4J42 A;  1XNQ B;  2RQ6 A;  1FXV A;  3T1H B;  4FFK A;  1KP3 A;  4U3J B;  1YTF D;  1F4M A;  4DR5 B;  1OHH G;  3FAV A;  4X1Y B;  4OGQ B;  1O9G A;  1XMQ B;  3AK1 A;  3CCV V;  5J2U B;  1RM1 B;  3LSQ A;  4B3R B;  3MD0 A;  1RFY A;  4JTC B;  3SYP A;  2AHY A;  1K4D C;  1TGO A;  1MSD A;  4WBN B;  5LMU B;  4F4L A;  4BR6 A;  1TUE B;  3OEE G;  2RDC A;  4TQF A;  4DUZ O;  4LBE C;  1PNK A;  2DYS C;  4N23 A;  5KHJ A;  3JCU Z;  1V55 B;  4PJ0 Z;  3BVO A;  3Q4H A;  2JGD A;  1I94 B;  4DV6 O;  3CD6 V;  3H9V A;  4YJ3 B;  4XBF A;  2P67 A;  5CA3 A;  3M7M X;  1NQT A;  4UV8 A;  2GV9 A;  4JV5 B;  4EKW A;  1FXK A;  1TVK B;  4X89 A;  2PI4 A;  1AI4 A;  3ETG A;  4OXS A;  4KHP B;  4QNH B;  5KAI Z;  4LF9 O;  3E86 A;  5FPR A;  2FL4 A;  5CA1 B;  3FX7 A;  3IC9 A;  1K8A W;  5IDJ A;  1Y74 A;  2EZO A;  5IWA B;  4X1I B;  2X6A A;  1BHB A;  4RUF A;  5FPO A;  2EIL B;  3OM3 B;  3SGI A;  1FXH A;  2A9H A;  1QLN A;  2Y0P A;  4FJC C;  4IGG A;  1FFT B;  3VBB A;  3A2F A;  3N2K B;  4CH5 A;  4RO2 A;  3CRQ A;  4B3S O;  4JI4 O;  1XIL A;  1X59 A;  4LH6 A;  3BEH A;  2IU0 A;  1V54 B;  3ABK C;  4LFA O;  4UCO A;  2EIM B;  5JJN B;  2F23 A;  5C93 A;  4JAV A;  1K92 A;  4PDM A;  2EZP A;  2ADQ B;  1WP8 A;  3D36 C;  3L71 H;  4O4J B;  5L3C A;  2YI9 A;  3LNM B;  3AEI A;  5BY1 A;  1EM1 A;  2XAQ A;  1VQP V;  4R50 A;  3O9O A;  2ARH A;  4PDL A;  4H44 B;  4PD4 F;  1MSW D;  1DK1 A;  2ZE6 A;  2A3Q A;  2XTA A;  3I56 V;  2WPD G;  2VWJ A;  1E79 G;  2BOB C;  1H2G A;  3H1K H;  2XAS A;  3T1Y O;  2V7Q G;  4I5S A;  4C7U A;  3CCQ V;  5B1A C;  1KU9 A;  4H13 B;  4IHJ B;  3AG7 A;  2CDY A;  3QF7 A;  2X7R B;  4BAY A;  2XAF A;  1IBM O;  2JIZ G;  2NR5 A;  5JCO A;  4IIJ A;  5TIS Z;  4JI6 O;  3QO7 A;  1ZX3 A;  3AG1 C;  2Q7H A;  4JYA O;  3J7A U;  3CB2 A;  5KMG A;  3ABT A;  4K0K O;  3RYC A;  1KQS U;  1UJW B;  4UXN A;  4EEQ A;  2BCC H;  2M7W A;  3RYI A;  1OV9 A;  1Y76 A;  1YJN V;  1LR1 A;  5B5E Z;  1VQ4 V;  1B06 A;  3ZRW B;  5IE9 A;  5FLX N;  1ORQ C;  2CGN A;  3W7W A;  4D7S A;  1XEQ A;  1VQL V;  4LNU A;  5LGT A;  2Y4T A;  2B5U A;  1XNR B;  3PJS K;  2B1I A;  2W6J G;  5C8Y A;  4H33 A;  1NTK H;  3D8C A;  1Z5W A;  1N32 O;  2DYR B;  1ENV A;  1VEW A;  3ZHS A;  2P4K A;  4U3F H;  4QE9 A;  4LF8 B;  5CMU A;  4IYI A;  1YSC A;  2DW4 A;  3OW2 U;  1KB9 F;  3ZBH A;  5CB4 A;  4ZHQ A;  2QTS A;  2YSU B;  3W7U A;  4GX5 A;  5JH7 B;  1N4C A;  1GTO A;  1EN5 A;  4PDV A;  2P90 A;  4B3T O;  1U96 A;  1YEW A;  2KKW A;  1XHX A;  1HNZ B;  2HLD G;  1N0J A;  2M6Y A;  4DR7 O;  3CJH A;  4DR4 O;  3JAM N;  4O4L B;  4YY3 B;  3E8F A;  3TGU H;  4E2L A;  4JTA B;  1QCE A;  5LP6 B;  4DRX B;  4LC1 A;  5B1B B;  4TOI A;  1I7F A;  4PV1 B;  1SZT A;  1SQG A;  2Y69 C;  2F93 B;  4JI0 O;  4LH7 A;  2E76 B;  3HKD A;  4FM1 A;  3ICX A;  4UCR A;  5L3B A;  2QTO A;  1GK9 A;  2QR4 A;  4FIP C;  4JI8 O;  4QJF B;  3EVK A;  3JAK B;  1MNG A;  4BIO A;  1IBK B;  4J9Y B;  4PA4 A;  4MTF A;  2DWD C;  3OTO B;  4HYO A;  4PA6 A;  4XDL A;  5EK0 A;  2LFS A; 
#chains in the Genus database with same CATH homology
 5A2Q N;  5BXZ A;  4DV0 O;  1G1X B;  2JRI A;  4LF5 O;  4LF6 O;  4DV4 O;  5FLX N;  1AIL A;  4AQY O;  4LFC O;  4X64 O;  1XEQ A;  2UXC O;  4X66 O;  1I94 O;  4JI2 O;  4GKK O;  4DR6 O;  3R66 A;  1HNW O;  1N32 O;  4X65 O;  4GKJ O;  2N74 A;  1YZB A;  2VQE O;  1IBK O;  3O65 A;  1J5E O;  4DUY O;  1KUQ A;  4OPA A;  4JV5 O;  2HHH O;  1FKA O;  2F4V O;  2AGA A;  3F5T A;  4JI7 O;  4X62 O;  3OTO O;  4JI1 O;  4B3S O;  4JI4 O;  1X59 A;  4KHP O;  2ZKO A;  4LFA O;  3J81 N;  4JI3 O;  4OPH A;  2UUB O;  4JI5 O;  5H5N A;  4B3T O;  2Z0A A;  2UUC O;  2UUA O;  2ZM6 O;  4DV5 O;  1HNX O;  1R6T A;  3J80 N;  2E5L O;  4OX9 O;  1HR0 O;  1N36 O;  5IWA O;  4LF7 O;  1XNR O;  4DR1 O;  4DR7 O;  4DR4 O;  1FJG O;  3JAM N;  5BY1 A;  1IBL O;  4DV7 O;  4DR3 O;  5LMN O;  1N34 O;  4DV2 O;  4NXN O;  2LW7 A;  3RT3 C;  5BR8 O;  4LF8 O;  2DOS A;  4B3M O;  2UU9 O;  1DK1 A;  4DV1 O;  1XMO O;  4DUZ O;  1AB3 A;  1D2D A;  4DR2 O;  4NXM O;  1XNQ O;  1A32 A;  3T1H O;  4LF4 O;  3M8A A;  4JI0 O;  3T1Y O;  1R1B A;  4DV6 O;  1NS1 A;  5LL6 Y;  4YHH O;  4JI8 O;  4DR5 O;  1HNZ O;  1IBM O;  4DV3 O;  4JI6 O;  1XMQ O;  4JYA O;  5IT9 N;  2DJV A;  4B3R O;  3J7A U;  4YY3 O;  4A5U B;  1F7Y A;  1FYJ A;  4K0K O;  4LFB O;  5LMU O;  2UXB O;  3SDL A;  2FKX A;  2VQF O;  2UXD O;  4LF9 O;  1N33 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...