1SQQH

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 18
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1sqqH00
3L71H 1BE3H 3BCCH 4D6TH 4U3FH 3L70H 1KYOF 1NU1H 2BCCH 1SQBH 1PPJH 3H1IH 1P84F 4PD4F 2A06H 1L0LH 3H1KH 3L74H 1NTZH 3L73H 2IBZH 1BGYH 1L0NH 3H1JH 1KB9F 3H1LH 1SQQH 1NTKH 1SQXH 1EZVH 1SQVH 3CWBH 3H1HH 1SQPH 3L75H 3CXHF 3CX5F 3L72H 3TGUH 1PP9H 1BCCH 1NTMH 2FYUH 5KLVH
chains in the Genus database with same CATH superfamily
5CB4A 3UCSC 4JYAO 2W6IG 4I50A 5KMGB 2OCCC 4X20A 2QWOB 4MW8A 3H1LH 4JI0O 1NTKH 1M57B 2H94A 3KCXA 3N2GA 1SC5B 3CP1A 3IAYA 2IJKA 1XNRB 2YIBD 4MSWC 3SJQC 4UCRA 4DR4B 1BE3H 3K06A 1BS3A 3CCUV 4GKJB 1WP8A 4QE9A 5A9GA 3BFRA 3ABKC 4CS4A 1I0HA 5KHGA 5IWAO 5JWPA 4H0LB 3JAWB 4JYBA 2JJ1G 4WF9V 3ZX6A 3ZRWA 5LYJB 1KYOF 5GW7A 3OTOB 5LGTA 5L3GA 3CRQA 1BQ0A 3ABUA 3P3NA 1WLEA 3LSQA 2HP8A 2R72A 4W4KA 4DV6B 3JSNA 2CTPA 4DUZB 3ZHQA 3QVNA 3ZIAG 4NKGB 3G67A 1YCIA 1ZTEA 5LBQA 4UV9A 2ITCC 4YIOA 2LFRA 2D3OW 2PYLA 5IY5C 4JPRA 4LFBO 5LOVA 2QTSA 2E5LB 4FZ0A 5EBMC 1FXKB 5KA6A 2UUCB 4G28B 4DV1B 1Y6XA 1CEZA 2HEPA 3F5WC 4YJ2B 1Y66A 1H2MA 2F66C 2ZNJA 3VQXA 3J80N 4FLTA 4L87A 2KG7B 1V54B 2AHYA 1VF6A 2YI9A 3CXCU 1L0LH 3K3WA 1Y67A 4ZKIA 4CH6A 3JCZA 2Q0AA 1HW7A 1OCCB 3ZHUA 1I7FA 1XL4A 4GCZA 1Q81W 1XHZA 3CCJV 2XAGA 1SZXA 2ZINA 4IL6Z 1K5SA 1Z5VA 2Z3YA 3E86A 1KQSU 1W59A 2L35A 1QVFU 3STZC 3E2EA 2YEVB 3AG4B 1I08A 1VQ5V 3RVYA 3SYAA 1HNXO 2XASA 4LWSB 3L72H 5FPOA 5LA6A 4MVMA 5FL7G 4DYLA 2XNDG 1VIBA 3G4SV 5LXTB 5JH7A 1AJQA 4Z1MG 1IURA 4CC5A 1R6KA 5DM6V 5EBWC 4QGPA 3ZHRA 3A2FA 4EFBA 3LNMB 3L75H 3CCLV 2A79B 4RAIA 4O4JB 1DTOA 3SPGA 1H2SB 1CXZB 4DK0A 1THZA 4CH3A 4O2AA 2EINB 1BSMA 3WFVA 4JF3A 2DYRB 2IU0A 4DV5B 3WB0A 3FFQA 4K0KO 2RMKB 1PNKA 1LNQA 1V55B 2DWDC 3EVKA 3FX7A 3DSQA 2VWJA 3A0RA 4WFBV 3ASOC 5LMNB 3CJHB 4B3SO 3OMAB 4LH7A 1EN6A 1EBOA 2O57A 1AR5A 4F6EA 1Q6HA 4WCEV 5LGNA 1RFYA 3K58A 4NYKA 4NVPA 5HFLA 2CUGA 4DR3O 2W6JG 1F4NA 1WPXA 3N27A 3OEHG 1R3KC 1US6A 5CMUA 2QEXV 5JVDB 1NTMH 4HAMA 1N33O 5EZYB 4IT5A 4XDLA 1XNQO 1TVKB 4U7NA 4LCUC 2F95B 2ZIMA 4NTYA 3RW0A 2UUBB 5B3SB 1UFIA 3EFFK 1N34O 5EYPA 1SZTA 2WPDG 4DR5B 1SS3A 1KMIZ 1P4RA 5IJ0B 3JAKB 1M56C 3GWKC 2P06A 2Y69C 4P30A 1TA8A 5JJEB 3JAMN 1K8AW 1NR7A 1VQ9V 2CTQA 2UUAB 2CH7A 4CBCA 1S5LZ 5ITZB 4XDKA 1Q3EA 1SQFA 1N32O 1EN5A 4O2BA 2GSMB 1HR0O 3ZJZA 3AK3A 4UCSA 4MS2A 2YIDA 1GN4A 5GTIZ 5BMVA 5LYJA 4RQEA 3ZMSA 3TXSA 2E75B 2PF4E 4J9ZB 4JI2B 4ZOLA 1DF4A 3P30A 3CCMV 2ZDIA 1NQTA 4LF4O 4PA4A 4DR2O 4LF7B 4F6RB 3ZEDA 1IZ3A 3CCRV 3CMAV 2PTMA 3B77A 3HKBA 1FS0G 2YSUB 1KC8W 2IJJA 3WG7C 3QO8A 4JI4O 3Q4HB 1GTOA 1NT2B 4UFZA 2ILMA 3HR0A 3H1KH 2YXHA 4HYOA 1NZ6A 4E2LA 2IM9A 1DGSA 2KB1A 5IE9A 4TV9B 1IBMB 1SESA 4TQDA 3BRCA 4RQFA 1ZL8B 4YJ2A 4ZHQB 1Q82W 1MNGA 4FPPA 4BIUA 4X62O 4P9OA 2OTJV 1MABG 4WBNA 1Q86W 1RSOA 3SYPA 2IH3C 3QF7A 3HPLC 4JAAA 5E79Z 1MSDA 3JD2A 1BQZA 1Z2GA 4YY3B 2QM7A 5JJJB 2V7QG 1JVMA 1XDCA 1SRYA 4BW5A 2UXCO 1B06A 2WSSG 1RM1C 1M4UA 1Y74B 4OX9O 2M6YA 4KUMA 1AJPA 3JSLA 2Y0PA 1VQOV 1SQBH 4X9QA 4YIPA 1VQNV 4LF5O 2GDSA 2G38A 1SETA 2V4DA 3ZMVA 1T5EA 1F23A 3CXHF 4LWSA 4UVCA 1QQCA 4GT1A 2ZCEA 3L9DA 4O4IB 3U11A 2WLKA 4D6TH 3UO3A 3L70H 1MZFA 3W7WA 2EIKB 2LP7A 1PPJH 3DTUB 5B1AC 5KX5B 2EIMB 3FB7C 3W7XA 2UXDO 2HG5C 3U10A 3L73H 4LF6B 5EK0A 2ZXWC 3C90A 2YXLA 4LFCO 1XREA 2DE0X 1SA0A 3TGUH 2ZM6B 1KD1W 4DV4O 1WA8B 3HKCB 3AG1B 3KCYA 4MTXA 4R8CA 3QNEA 3OR6C 2BOCC 3RFRA 1JX9A 3OE7G 4R50A 2YXYA 3ZRXA 2ZQMA 4JTDB 3S3WA 3MHHC 2OT5A 4I0XB 2UXBO 1AJNA 2UXDB 4L8JA 1DLBA 2ZE7A 3K0DA 5LMUO 3RYHB 2DYSC 4X1KB 4PA7A 2FMLA 1X4TA 1G8MA 4X1IB 4KHPB 3T1YO 5J2UB 3APQA 1OCRC 3CRCA 5J9PC 3CX5F 3ZHSA 1FXHA 3HKEB 3THOA 2UXBB 1PL0A 2Q67A 3BABA 1TVKA 4GX1A 3AG7A 3BEHA 3JD3A 4MVUA 1K73W 4DK1A 2XT9A 1MSWD 4DUYB 1E79G 5IT9N 4B3MB 3MDSA 1YEWA 1EZJA 2IJHA 2ITDC 4DV2O 3OM3B 4X66B 2E76B 3JAKA 5TISZ 3KKYA 4FVMA 1M9NA 2ZR2A 3KZIZ 2QWRB 2L6LA 1PL4A 4IIJA 1GKFA 1VMGA 3BVOA 4PI2A 3ZRSA 3ABKB 1PKXA 2EILB 2YDEA 5D5QA 4C7UA 3ZMZA 3CC7V 1WPBA 4DRXB 4TV8A 4DV3O 2XUMA 3SYOA 2DN9A 1ZX3A 2P90A 4ASUG 3OW2U 1L8DA 1PM9A 3OR7C 5C8YA 3TCUA 4FFBB 3CS5A 3DGEA 1VF6C 5CBFA 1IXBA 2CTWA 5LHIA 4J10A 4X64B 1NS1A 2YICA 1OHHG 1TUBB 1AI5A 2JEUA 2NN4A 3OTFA 4QIWF 4DR4O 1H2LA 2GUZA 1XMQB 4F6RA 2NLJC 4IHJA 1DK1A 4GKJO 3P3PA 1UPGA 3ETQA 3Q4HA 4TUYA 1YXBA 3RYCB 2LGWA 3H1IH 4PD4F 1NI8A 2FTKA 1K4CC 1KU9A 4LF9B 2IBZH 5EIBD 4GYCB 2XAJA 3ETEA 2UXNA 4MVRA 2WLHA 5DEDA 1ZL8A 3OTOO 4UCVA 2JDIG 3QG5A 2HLDG 2Q7GA 4FMTA 3FYIB 5H6QA 4DV6O 4DUZO 4FM1A 3W7SA 4E4EA 1FFXA 3JD4A 3FB6C 4X1YB 1YTFB 3CC2V 2LW1A 3TJTA 1GH6A 5F2VO 1VQMV 2UU9B 3LSUA 2RN9A 4N23A 3K5MA 2F4VB 1M1KW 2JGUA 4ZIBA 2E5LO 5IYDO 2IJIA 2UUCO 2EBOA 3ASNC 4KP4A 4DV1O 4KFMA 1I94O 1GRJA 1QR9A 2Q73A 2YIBA 4GZRB 5KAFZ 2WAMA 3H1HH 2HJDA 3QO7A 4J11A 1B04A 3HKDB 3AG3B 1GM7A 3RT3C 4O4IA 1FJGB 3JARB 4Z1VA 1FAFA 5IYCO 1ORQC 3T1CA 2Q7HA 2GHYA 3CC4V 2MK3A 4XBFA 1PV0A 3UM7A 1K4DC 2ZD9A 2Q68A 4PDVA 4JI1B 4JI3B 4DV7B 3RYIB 1I94B 3FKSG 3BPZA 4YXWG 2F43G 2N74A 3ABLB 4MTGA 2HVJC 4AHCA 1LUWA 1QLEB 3E22A 2CGNA 2PUSA 2RDCA 3K08A 1XI1A 1CPYA 3G80A 3W7UA 4LF8B 1BHAA 5CBGA 4J7ZA 1NR1A 2QSAA 1M57C 4I0XA 2LO1A 2DJVA 3P32A 3SJAC 4WFEA 4JTAB 4JAUA 1S72V 1S0VA 3RYHA 2KKWA 3BAAA 1E1RG 1Y4MA 1MOFA 1O9GA 4H33A 4NXNB 3BA8A 1WB7A 1L1FA 4OPHA 2LFSA 3SPCA 1COWG 5J2UA 4G2KA 1GK9A 1IVSA 2QR4A 2DW4A 1K33A 5KLVH 4EKWA 3ABMB 1A32A 4DV5O 2PI5A 1I5YA 3G6EV 2JGDB 5IJ9B 1GM9A 5H2FZ 3GB7C 3D36A 1AP6A 4JI8B 1L0NH 1PD3A 3APOA 1K92A 4UUJC 5AG2A 5LMNO 2ZDIC 4FK5C 1FYJA 4JYCA 1W2BU 4X88A 3T1HB 2BTQB 2Y69B 3K59A 1QCEA 3OMNB 1SERA 3E8FA 5BY1A 2X0LA 2PGGA 1I5XA 4GX5A 3FAVB 3K79A 1JCHA 4PV1B 5H9CA 5IYZB 3K9SA 1ZSPA 3NR7A 2AXTZ 1ZAUA 2JRIA 3BY6A 4DRXA 2Q0OC 2PYJA 5K1XA 1R3JC 1VARA 3B4SA 3IJ4A 2YIAA 2AZ2A 4UCTA 2ODMA 1VQLV 1KECA 4I4TB 2UUBO 3G71V 1F7YA 1OZ0A 1V54C 4I55B 1YSCA 3OFNG 4CZZA 1ZUQA 4Q20A 4FFBA 2QA4V 3K5NA 2WLIB 4DR5O 5L3DA 2A9HA 3K04A 1J5EB 2ZT9B 4IYIA 3FYEB 4DW0A 2DQ3A 4YHHB 5BR8O 4P9PA 2YS8A 3ML0A 2UUAO 2LGQA 2R9AA 3OUFA 3UT5B 4N21A 3RYFB 3NXSA 2BSKB 2HKOA 1W0JG 4MW3A 4O4LB 2VQEB 1YTFD 2X7RB 1W0KG 5KMGA 2YUAA 2B5UA 2D2CB 3VQYA 3R66A 4O4HB 2HVKC 2DWEC 4MTOA 1TGOA 2CDYA 2GBOA 5BR8B 4JI2O 2BE3A 1WP7A 3DXRB 2Z0AA 1OCZC 3OAAG 1VF7A 4MVSA 4B7EA 2DQ0A 4J41A 5BXZA 4YJ3B 4LF7O 1FXVA 1SQQH 4OGQB 3ZN0A 1RM1B 4QJFB 1ROPA 4TOIA 2A3QA 2CE4A 3SPIA 3A0BZ 4JAVA 4DR6B 1X59A 3JAWA 2E3CA 4K8ZA 1FD9A 1JOYA 4PA9A 4DW1A 4X65B 2EIJB 2HHHO 1IBMO 2ZR3A 3H9VA 3PN1A 1NBMG 5IDJA 3CMEV 1RP3B 1DF5A 2A0LA 1V55C 4Z2WA 1SQGA 3HKDA 4FIPC 1OCOC 3VOUA 1H8HG 2EULA 4OXSA 4LNUB 2P67A 4YY3O 3MHSC 2Q7EA 1Q90D 3X2QB 3RWRD 3JCUZ 1FXKA 1U97A 4JTCB 1GN2A 4MT8A 2HHHB 3HB3B 3JATB 3RYIA 1SQPH 4FJCC 5KA5A 4DR7B 1XBLA 1WJZA 1BZKA 1H2NA 4I50B 4U3FH 3OUSA 2OIEA 1YJ9V 2KG7A 1MZEA 1TAEA 4CC6A 2ADPA 1P7GA 2A7WA 3D3IA 2R9RB 5J2TB 1YITV 1D2DA 1BL8A 2Q4PA 5B3SC 2AGAA 5H5NA 3G6BA 3N2GB 3I55V 1JMKC 4W4LA 1OJHA 3SDLA 5K1PA 4NTWA 1F51A 2IH1C 1XOUA 1AP5A 1KP3A 1Q5OA 2JS5A 5KUMA 4U3JB 2B1IA 4J7KA 2DYSB 4LF6O 4JZ2A 5CA0B 5KHKA 1LR1A 2XAHA 2YEVA 4UV8A 1R6NA 2V1DA 3ZRVA 1S5HC 3JASB 2ZM6O 4QNHB 3JD1A 4K3AA 4DR1B 1XL6A 3SR2C 3IC7A 4Q6GA 1XHXA 1R73A 1NH2B 1GMGA 1K7DA 1XQ8A 1PNMA 1AR4A 5LXTA 4PA3A 1UJWB 2JGDA 3D3QA 5IJ9A 2ZKOA 5FLXN 2PZSA 3E89A 2AZ0A 1F4MA 4NXMO 4CH5A 2KQXA 2NNUA 2WLJA 5L3FA 1AILA 3CEIA 3K9AA 4LR3A 5EC2C 4PELA 4O4JA 5B1BC 3CCQV 3I5DA 1MA1A 5KAIZ 3OGCC 4AQYB 3SJCC 3UO2A 4R6ZA 5EC1C 1JJOA 3K0GA 4KHPO 1GN6A 2VS0A 3FAVA 4H13B 4I7ZB 2HJFC 5IYZA 2CGOA 4TT3G 3CRAA 2ARHA 1YIJV 1G1XB 3A0HZ 5B66Z 4NXMB 2FKXA 4FM0A 3CJHA 3W7TA 1K97A 4MTFA 2ZE5A 4UCOA 4DUYO 5LP6B 4JV5O 4I55A 4B3MO 3VQWA 5KHIA 3LUTB 2WLIA 5BZBA 4JI7B 4X66O 4B08A 1XMOB 3M8AA 1AB3A 1KKCA 3RBZA 5JVDA 4BWAA 1GN3A 1QVGU 1M90W 5EIBC 3RYFA 5EZYA 1FPOA 2EJRA 4PDLA 2OCCB 1VQ6V 2F1MA 3LDDA 2OTLV 2Y48A 1H38A 1HDJA 1AI6A 4ICGA 4BAYA 4JV5B 3CPWU 2VRZA 4WFHA 5LA6B 3AG2C 1S5JA 2F23A 5IJ0A 3N2KB 2K1EA 5JH7B 3M99B 3SGIA 2JS3A 4X64O 1WN7A 1ZLZA 2B9ZA 2EIKC 4I9QA 2EIMC 2OYQA 2WA4A 4QPJA 5ITZA 1XMQO 2NR5A 5CA1B 2WA3A 1Q43A 3I56V 2Y4UA 1N36O 3ASNB 1URFA 3T4ZA 4LF9O 4J9YB 1HNWB 2AW9A 3WU2Z 5IYBO 2WLMA 1R3LC 1RPOA 3ZBHA 3EHBB 3JALB 2X6CA 1NKDA 1VQPV 3CYOA 4ZBMA 5LHGA 4NB5A 1R1BA 1IBKB 4GKKO 5JJNB 2BOBC 5B1OA 2CK3G 3BCCH 5IY5B 4I9WA 1KKDA 2XTAA 2P4KA 5B5EZ 4LNUA 2P5OA 2BTOA 4D7TA 1N36B 2R70A 2QKAA 4UB6Z 3TETA 2X6AA 3FB8C 2IU3A 5C93A 4CH4A 4PJ0Z 2UU9O 3AK2A 3TXQA 2XAQA 2F4VO 1HNZB 4TV9A 5CN0A 3JATA 1IBLB 2YI8A 5L3CA 4ZI7B 3B09A 4ZHQA 1VQ8V 5GONB 4LC1A 4GKKB 4B3RB 3U0ZA 5DECA 3RGBA 3D36C 5J2TA 2XOKG 5CBHA 3IC9A 3H1JH 5EYPB 4DV0B 1NH2D 1OV9A 1FJGO 2X6BA 4F4LA 3B2EE 4TSFG 2QM8A 3ABTA 1Y74A 2LW7A 2EJ7A 2M7WA 1KUQA 4U3JA 2CH7B 4JI6B 5CA0A 4HBNA 4JI1O 3E83A 4JI3O 4DV7O 4JYAB 2EILC 1NJIW 4O2BB 2EZOA 4WFAV 3CHXA 1SQXH 2QKSA 4AILC 2EZPA 1XILA 3JASA 2Q6AA 4JI0B 3E8HA 2QJ1A 5BMVB 4LF8O 5CA3A 4EB6B 1XUQA 5JCOA 1Q6UA 3VQVA 4ZOLB 3ZN1A 1K5QA 2OWOA 4PI0A 4HNAB 5KX5A 1K34A 1XEQA 4JZGA 1JFFB 1M93A 2ETNA 5LL6Y 3FD9A 4UVBA 4CS3A 4BR6A 2WWWA 3HKBB 3O9OA 4PHZA 5IWAB 1YI2V 3D8CA 1WA8A 3HKCA 2P22C 4GLXA 4NXNO 1BMFG 4UVAA 5L3BA 1QHTA 1GM8A 4RO2A 4A5UB 1B6QA 3ASOB 3ZMUA 2FL4A 4RUEA 2N04A 4LP8A 1VP7A 3MD0A 3ETGA 4JI8O 2BCCH 4WBNB 1RSOB 5LP6A 2ZE6A 4KL1A 4X1KA 3SYQA 4LFBB 3LNNA 1G4YB 3T1HO 3DC5A 4B3TO 4QPKA 1QR8A 3CWBH 4X1IA 2GTAA 4JI5O 4PA6A 3FB5C 3HKEA 5B1NA 3O65A 1MMMA 1SF9A 2QGNA 1AI7A 4LBEC 3RN4A 2LJ2A 1Q8IA 2Q9LA 4FLVA 1FKAO 4DO2A 1VQKV 2Y0IA 1M56B 1KBHA 3K5LA 1N0JA 4B3TB 3AG3C 3N2KA 4OPAA 1S3JA 3L71H 2QKCA 3OD4A 1OCZB 4MVZA 2RJZA 2K9PA 4JGSA 5D5PA 4JI5B 1J5EO 2Z5UA 3ZCCA 1YHQV 1P84F 1ZWIC 2JVDA 4D7SA 4YHHO 1M5IA 1KB9F 4FLYA 3A8TA 2ZNIA 1ENVA 1FXKC 1K3EA 2PI4A 3KG2A 5CA1A 1SA0B 2WLLB 2KSDA 3WB2A 3LDCA 2VQEO 1IXMA 2JIZG 5HFMA 2C2AA 1NVPB 2B1GA 2N05A 1HNXB 3ABLC 3B40A 1QLEC 3CCEV 1YJNV 3J7AU 3JALA 3J81N 5FNVB 1TUBA 1OCCC 1OCOB 3R65A 1Q6IA 4MVOA 3TK1A 3WG7B 5JQGB 2QWNB 5EBLC 5LHHA 3E8BA 3RYCA 1N8RW 1Q7YW 1H2KA 3CCSV 4J42A 2GTSA 3AG4C 2Y4TA 3QO5A 4DR6O 2XHBA 4K0KB 4UXNA 1YDXA 2CTRA 2JJ2G 3K57A 3BA9A 4X65O 4LFAO 1HWYA 4TWKA 4ZI7A 3H01A 1IDSA 5L3EA 3ABMC 5GONA 4NR1A 2EX3A 4FLWA 4B3SB 2FB5A 3RVZA 1D5NA 4FZ1A 4DXWA 4QE7A 1S77D 2Q8VA 1B3QA 1N0NA 2GV9A 1EZVH 4X1YA 3ZS8C 3E8GA 2QTOA 3K03A 4DR3B 3AK1A 2P4VA 4RUFA 1N4CA 1BT8A 3F7VC 5E1AC 1HP8A 2JK5C 2AHZA 1MG1A 1N33B 4IIJB 2DMXA 3VBBA 3SPHA 4LFAB 1XNQB 3L74H 2QWPB 4DR7O 2EINC 2DYRC 4TV8B 1P49A 3K5OA 1N34B 1EFRG 3SJBC 3SPJA 3UQ8A 5C8YB 3JARA 1H2GA 1NU1H 3IGAC 5B1AB 4EB6A 3B8NA 1WNSA 5A2QN 4FM2A 4WFGA 4BIOA 4GX0A 4HNAA 3AEIA 2ZXWB 5DN6G 2H3OA 4WFFA 1VQ4V 1JFFA 1K9MW 3GWOA 3CSXA 2GUZB 3QTCA 4IHJB 1G6UA 1Y76B 1N32B 4FFKA 5B1BB 3GVMA 2FYUH 5CB4B 1AR1B 1HR0B 1WAZA 1U96A 2H8PC 4TUYB 1H8EG 4EFEA 3C3SA 4X8AA 1SKVA 2RQ6A 4X20B 3C3TA 1YVWA 4DR1O 4J80A 3LDEA 1QU7A 5KUKA 4U7OA 1JR9A 4FLXA 4X89A 2OCHA 4LF4B 4DR2B 2QDOA 3ZMTA 4PDRA 2P7TC 5H6RA 1FFXB 4JI4B 1NTZH 1E1QG 3OMIB 3T2MA 1EN4A 4ABMA 3DC6A 1OCRB 2VQFO 4IGGA 4AI8A 5GTHZ 3E35A 4HZ3A 3STLC 2UXXA 2QWQB 4AQYO 3ZRWB 2Q5ZA 3F7YC 4PDMA 2ZE8A 1YZBA 2EIJC 3OEEG 1VEWA 4X62B 3CCVV 1NVPD 1QLNA 4IYHA 4GUNA 3B8MA 3ZHTA 1SQVH 3AG2B 3ICXA 1V9PA 4P2ZA 1TUEB 2BTQA 4H44B 2UXCB 1P7BA 2VQFB 4K8XA 4OX9B 5LOVB 4JI7O 1QNMA 1AVMA 4TQFA 1RPRA 2PY5A 1XMOO 3X2QC 2RCVA 1JQ0A 1JA8A 4LF5B 3CRRA 2WLLA 4UCUA 4JASA 3ZHVA 2W0FC 3OGIB 4J7JA 1WB8A 2ADQB 3E22B 4I4TA 3EXAA 5KHHA 1O9HA 4XDJA 3CRMA 3OT7A 5FNVA 4BW9A 5FPRA 1YJWV 2XAFA 1BCCH 1D5AA 4LFCB 3UT5A 2MW2B 2BSKA 5JQGA 4I5SA 1AROP 4DV4B 4O4LA 4LH6A 3BHPA 2IW5A 3UKMA 2E74B 1QBZA 2JEXA 2ZIOA 4O4HA 4BIZA 1J95A 4B7KA 1FFTB 2WLNA 1HNWO 4CS2A 4GX2A 2W0XA 5LMUB 2QE7G 3IFXA 5JCOC 3DXRA 1R6TA 4G27B 2DOSA 4FLUA 3M7MX 4YJ3A 1EM1A 1IBKO 2CAZC 4EEQA 3JYCA 4RWUA 1R3IC 1PP9H 1KP2A 4K35A 1JPXA 3PJSK 3T1YB 1GO3F 2LQTA 4NTXA 3LSSA 3CB2A 5KHJA 1LUVA 3AG1C 1S76D 3MAQA 4O2AB 3S3XA 2A06H 4MVQA 1GAXA 2R9IA 1HNZO 3F5TA 4JYYA 2F93B 1BGYH 3CE2A 1IBLO 1BHBA 1VF5B 2VWKA 4H37A 2Q69A 3T4DA 3ETDA 1CP9A 4R7CA 3SYCA 2YC0A 4B3RO 2QM4A 1JJ2U 4DV2B 1AI4A 5LGUA 2HR3A 1IX9A 3WB1A 1Z5WA 1PNLA 3CD6V 4FLZA 4DV0O 1YF2A 2P6JA 5LP6C 2OIGA 2ATKC 2RNBA 3JD0A 2HFEC 1XNRO 1VQ7V 4UB8Z 4KXRA 1Y76A 4JI6O 4DV3B
chains in the Genus database with same CATH topology
3L71H 1BE3H 3BCCH 4D6TH 4U3FH 3L70H 1KYOF 1NU1H 2BCCH 1SQBH 1PPJH 3H1IH 1P84F 4PD4F 2A06H 1L0LH 3H1KH 3L74H 1NTZH 3L73H 2IBZH 1BGYH 1L0NH 3H1JH 1KB9F 3H1LH 1SQQH 1NTKH 1SQXH 1EZVH 1SQVH 3CWBH 3H1HH 1SQPH 3L75H 3CXHF 3CX5F 3L72H 3TGUH 1PP9H 1BCCH 1NTMH 2FYUH 5KLVH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L71 H;  1BE3 H;  3BCC H;  4D6T H;  4U3F H;  3L70 H;  1KYO F;  1NU1 H;  2BCC H;  1SQB H;  1PPJ H;  3H1I H;  1P84 F;  4PD4 F;  2A06 H;  1L0L H;  3H1K H;  3L74 H;  1NTZ H;  3L73 H;  2IBZ H;  1BGY H;  1L0N H;  3H1J H;  1KB9 F;  3H1L H;  1SQQ H;  1NTK H;  1SQX H;  1EZV H;  1SQV H;  3CWB H;  3H1H H;  1SQP H;  3L75 H;  3CXH F;  3CX5 F;  3L72 H;  3TGU H;  1PP9 H;  1BCC H;  1NTM H;  2FYU H;  5KLV H; 
#chains in the Genus database with same CATH topology
 5CB4 A;  3UCS C;  4JYA O;  2W6I G;  4I50 A;  5KMG B;  2OCC C;  4X20 A;  2QWO B;  4MW8 A;  3H1L H;  4JI0 O;  1NTK H;  1M57 B;  2H94 A;  3KCX A;  3N2G A;  1SC5 B;  3CP1 A;  3IAY A;  2IJK A;  1XNR B;  2YIB D;  4MSW C;  3SJQ C;  4UCR A;  4DR4 B;  1BE3 H;  3K06 A;  1BS3 A;  3CCU V;  4GKJ B;  1WP8 A;  4QE9 A;  5A9G A;  3BFR A;  3ABK C;  4CS4 A;  1I0H A;  5KHG A;  5IWA O;  5JWP A;  4H0L B;  3JAW B;  4JYB A;  2JJ1 G;  4WF9 V;  3ZX6 A;  3ZRW A;  5LYJ B;  1KYO F;  5GW7 A;  3OTO B;  5LGT A;  5L3G A;  3CRQ A;  1BQ0 A;  3ABU A;  3P3N A;  1WLE A;  3LSQ A;  2HP8 A;  2R72 A;  4W4K A;  4DV6 B;  3JSN A;  2CTP A;  4DUZ B;  3ZHQ A;  3QVN A;  3ZIA G;  4NKG B;  3G67 A;  1YCI A;  1ZTE A;  5LBQ A;  4UV9 A;  2ITC C;  4YIO A;  2LFR A;  2D3O W;  2PYL A;  5IY5 C;  4JPR A;  4LFB O;  5LOV A;  2QTS A;  2E5L B;  4FZ0 A;  5EBM C;  1FXK B;  5KA6 A;  2UUC B;  4G28 B;  4DV1 B;  1Y6X A;  1CEZ A;  2HEP A;  3F5W C;  4YJ2 B;  1Y66 A;  1H2M A;  2F66 C;  2ZNJ A;  3VQX A;  3J80 N;  4FLT A;  4L87 A;  2KG7 B;  1V54 B;  2AHY A;  1VF6 A;  2YI9 A;  3CXC U;  1L0L H;  3K3W A;  1Y67 A;  4ZKI A;  4CH6 A;  3JCZ A;  2Q0A A;  1HW7 A;  1OCC B;  3ZHU A;  1I7F A;  1XL4 A;  4GCZ A;  1Q81 W;  1XHZ A;  3CCJ V;  2XAG A;  1SZX A;  2ZIN A;  4IL6 Z;  1K5S A;  1Z5V A;  2Z3Y A;  3E86 A;  1KQS U;  1W59 A;  2L35 A;  1QVF U;  3STZ C;  3E2E A;  2YEV B;  3AG4 B;  1I08 A;  1VQ5 V;  3RVY A;  3SYA A;  1HNX O;  2XAS A;  4LWS B;  3L72 H;  5FPO A;  5LA6 A;  4MVM A;  5FL7 G;  4DYL A;  2XND G;  1VIB A;  3G4S V;  5LXT B;  5JH7 A;  1AJQ A;  4Z1M G;  1IUR A;  4CC5 A;  1R6K A;  5DM6 V;  5EBW C;  4QGP A;  3ZHR A;  3A2F A;  4EFB A;  3LNM B;  3L75 H;  3CCL V;  2A79 B;  4RAI A;  4O4J B;  1DTO A;  3SPG A;  1H2S B;  1CXZ B;  4DK0 A;  1THZ A;  4CH3 A;  4O2A A;  2EIN B;  1BSM A;  3WFV A;  4JF3 A;  2DYR B;  2IU0 A;  4DV5 B;  3WB0 A;  3FFQ A;  4K0K O;  2RMK B;  1PNK A;  1LNQ A;  1V55 B;  2DWD C;  3EVK A;  3FX7 A;  3DSQ A;  2VWJ A;  3A0R A;  4WFB V;  3ASO C;  5LMN B;  3CJH B;  4B3S O;  3OMA B;  4LH7 A;  1EN6 A;  1EBO A;  2O57 A;  1AR5 A;  4F6E A;  1Q6H A;  4WCE V;  5LGN A;  1RFY A;  3K58 A;  4NYK A;  4NVP A;  5HFL A;  2CUG A;  4DR3 O;  2W6J G;  1F4N A;  1WPX A;  3N27 A;  3OEH G;  1R3K C;  1US6 A;  5CMU A;  2QEX V;  5JVD B;  1NTM H;  4HAM A;  1N33 O;  5EZY B;  4IT5 A;  4XDL A;  1XNQ O;  1TVK B;  4U7N A;  4LCU C;  2F95 B;  2ZIM A;  4NTY A;  3RW0 A;  2UUB B;  5B3S B;  1UFI A;  3EFF K;  1N34 O;  5EYP A;  1SZT A;  2WPD G;  4DR5 B;  1SS3 A;  1KMI Z;  1P4R A;  5IJ0 B;  3JAK B;  1M56 C;  3GWK C;  2P06 A;  2Y69 C;  4P30 A;  1TA8 A;  5JJE B;  3JAM N;  1K8A W;  1NR7 A;  1VQ9 V;  2CTQ A;  2UUA B;  2CH7 A;  4CBC A;  1S5L Z;  5ITZ B;  4XDK A;  1Q3E A;  1SQF A;  1N32 O;  1EN5 A;  4O2B A;  2GSM B;  1HR0 O;  3ZJZ A;  3AK3 A;  4UCS A;  4MS2 A;  2YID A;  1GN4 A;  5GTI Z;  5BMV A;  5LYJ A;  4RQE A;  3ZMS A;  3TXS A;  2E75 B;  2PF4 E;  4J9Z B;  4JI2 B;  4ZOL A;  1DF4 A;  3P30 A;  3CCM V;  2ZDI A;  1NQT A;  4LF4 O;  4PA4 A;  4DR2 O;  4LF7 B;  4F6R B;  3ZED A;  1IZ3 A;  3CCR V;  3CMA V;  2PTM A;  3B77 A;  3HKB A;  1FS0 G;  2YSU B;  1KC8 W;  2IJJ A;  3WG7 C;  3QO8 A;  4JI4 O;  3Q4H B;  1GTO A;  1NT2 B;  4UFZ A;  2ILM A;  3HR0 A;  3H1K H;  2YXH A;  4HYO A;  1NZ6 A;  4E2L A;  2IM9 A;  1DGS A;  2KB1 A;  5IE9 A;  4TV9 B;  1IBM B;  1SES A;  4TQD A;  3BRC A;  4RQF A;  1ZL8 B;  4YJ2 A;  4ZHQ B;  1Q82 W;  1MNG A;  4FPP A;  4BIU A;  4X62 O;  4P9O A;  2OTJ V;  1MAB G;  4WBN A;  1Q86 W;  1RSO A;  3SYP A;  2IH3 C;  3QF7 A;  3HPL C;  4JAA A;  5E79 Z;  1MSD A;  3JD2 A;  1BQZ A;  1Z2G A;  4YY3 B;  2QM7 A;  5JJJ B;  2V7Q G;  1JVM A;  1XDC A;  1SRY A;  4BW5 A;  2UXC O;  1B06 A;  2WSS G;  1RM1 C;  1M4U A;  1Y74 B;  4OX9 O;  2M6Y A;  4KUM A;  1AJP A;  3JSL A;  2Y0P A;  1VQO V;  1SQB H;  4X9Q A;  4YIP A;  1VQN V;  4LF5 O;  2GDS A;  2G38 A;  1SET A;  2V4D A;  3ZMV A;  1T5E A;  1F23 A;  3CXH F;  4LWS A;  4UVC A;  1QQC A;  4GT1 A;  2ZCE A;  3L9D A;  4O4I B;  3U11 A;  2WLK A;  4D6T H;  3UO3 A;  3L70 H;  1MZF A;  3W7W A;  2EIK B;  2LP7 A;  1PPJ H;  3DTU B;  5B1A C;  5KX5 B;  2EIM B;  3FB7 C;  3W7X A;  2UXD O;  2HG5 C;  3U10 A;  3L73 H;  4LF6 B;  5EK0 A;  2ZXW C;  3C90 A;  2YXL A;  4LFC O;  1XRE A;  2DE0 X;  1SA0 A;  3TGU H;  2ZM6 B;  1KD1 W;  4DV4 O;  1WA8 B;  3HKC B;  3AG1 B;  3KCY A;  4MTX A;  4R8C A;  3QNE A;  3OR6 C;  2BOC C;  3RFR A;  1JX9 A;  3OE7 G;  4R50 A;  2YXY A;  3ZRX A;  2ZQM A;  4JTD B;  3S3W A;  3MHH C;  2OT5 A;  4I0X B;  2UXB O;  1AJN A;  2UXD B;  4L8J A;  1DLB A;  2ZE7 A;  3K0D A;  5LMU O;  3RYH B;  2DYS C;  4X1K B;  4PA7 A;  2FML A;  1X4T A;  1G8M A;  4X1I B;  4KHP B;  3T1Y O;  5J2U B;  3APQ A;  1OCR C;  3CRC A;  5J9P C;  3CX5 F;  3ZHS A;  1FXH A;  3HKE B;  3THO A;  2UXB B;  1PL0 A;  2Q67 A;  3BAB A;  1TVK A;  4GX1 A;  3AG7 A;  3BEH A;  3JD3 A;  4MVU A;  1K73 W;  4DK1 A;  2XT9 A;  1MSW D;  4DUY B;  1E79 G;  5IT9 N;  4B3M B;  3MDS A;  1YEW A;  1EZJ A;  2IJH A;  2ITD C;  4DV2 O;  3OM3 B;  4X66 B;  2E76 B;  3JAK A;  5TIS Z;  3KKY A;  4FVM A;  1M9N A;  2ZR2 A;  3KZI Z;  2QWR B;  2L6L A;  1PL4 A;  4IIJ A;  1GKF A;  1VMG A;  3BVO A;  4PI2 A;  3ZRS A;  3ABK B;  1PKX A;  2EIL B;  2YDE A;  5D5Q A;  4C7U A;  3ZMZ A;  3CC7 V;  1WPB A;  4DRX B;  4TV8 A;  4DV3 O;  2XUM A;  3SYO A;  2DN9 A;  1ZX3 A;  2P90 A;  4ASU G;  3OW2 U;  1L8D A;  1PM9 A;  3OR7 C;  5C8Y A;  3TCU A;  4FFB B;  3CS5 A;  3DGE A;  1VF6 C;  5CBF A;  1IXB A;  2CTW A;  5LHI A;  4J10 A;  4X64 B;  1NS1 A;  2YIC A;  1OHH G;  1TUB B;  1AI5 A;  2JEU A;  2NN4 A;  3OTF A;  4QIW F;  4DR4 O;  1H2L A;  2GUZ A;  1XMQ B;  4F6R A;  2NLJ C;  4IHJ A;  1DK1 A;  4GKJ O;  3P3P A;  1UPG A;  3ETQ A;  3Q4H A;  4TUY A;  1YXB A;  3RYC B;  2LGW A;  3H1I H;  4PD4 F;  1NI8 A;  2FTK A;  1K4C C;  1KU9 A;  4LF9 B;  2IBZ H;  5EIB D;  4GYC B;  2XAJ A;  3ETE A;  2UXN A;  4MVR A;  2WLH A;  5DED A;  1ZL8 A;  3OTO O;  4UCV A;  2JDI G;  3QG5 A;  2HLD G;  2Q7G A;  4FMT A;  3FYI B;  5H6Q A;  4DV6 O;  4DUZ O;  4FM1 A;  3W7S A;  4E4E A;  1FFX A;  3JD4 A;  3FB6 C;  4X1Y B;  1YTF B;  3CC2 V;  2LW1 A;  3TJT A;  1GH6 A;  5F2V O;  1VQM V;  2UU9 B;  3LSU A;  2RN9 A;  4N23 A;  3K5M A;  2F4V B;  1M1K W;  2JGU A;  4ZIB A;  2E5L O;  5IYD O;  2IJI A;  2UUC O;  2EBO A;  3ASN C;  4KP4 A;  4DV1 O;  4KFM A;  1I94 O;  1GRJ A;  1QR9 A;  2Q73 A;  2YIB A;  4GZR B;  5KAF Z;  2WAM A;  3H1H H;  2HJD A;  3QO7 A;  4J11 A;  1B04 A;  3HKD B;  3AG3 B;  1GM7 A;  3RT3 C;  4O4I A;  1FJG B;  3JAR B;  4Z1V A;  1FAF A;  5IYC O;  1ORQ C;  3T1C A;  2Q7H A;  2GHY A;  3CC4 V;  2MK3 A;  4XBF A;  1PV0 A;  3UM7 A;  1K4D C;  2ZD9 A;  2Q68 A;  4PDV A;  4JI1 B;  4JI3 B;  4DV7 B;  3RYI B;  1I94 B;  3FKS G;  3BPZ A;  4YXW G;  2F43 G;  2N74 A;  3ABL B;  4MTG A;  2HVJ C;  4AHC A;  1LUW A;  1QLE B;  3E22 A;  2CGN A;  2PUS A;  2RDC A;  3K08 A;  1XI1 A;  1CPY A;  3G80 A;  3W7U A;  4LF8 B;  1BHA A;  5CBG A;  4J7Z A;  1NR1 A;  2QSA A;  1M57 C;  4I0X A;  2LO1 A;  2DJV A;  3P32 A;  3SJA C;  4WFE A;  4JTA B;  4JAU A;  1S72 V;  1S0V A;  3RYH A;  2KKW A;  3BAA A;  1E1R G;  1Y4M A;  1MOF A;  1O9G A;  4H33 A;  4NXN B;  3BA8 A;  1WB7 A;  1L1F A;  4OPH A;  2LFS A;  3SPC A;  1COW G;  5J2U A;  4G2K A;  1GK9 A;  1IVS A;  2QR4 A;  2DW4 A;  1K33 A;  5KLV H;  4EKW A;  3ABM B;  1A32 A;  4DV5 O;  2PI5 A;  1I5Y A;  3G6E V;  2JGD B;  5IJ9 B;  1GM9 A;  5H2F Z;  3GB7 C;  3D36 A;  1AP6 A;  4JI8 B;  1L0N H;  1PD3 A;  3APO A;  1K92 A;  4UUJ C;  5AG2 A;  5LMN O;  2ZDI C;  4FK5 C;  1FYJ A;  4JYC A;  1W2B U;  4X88 A;  3T1H B;  2BTQ B;  2Y69 B;  3K59 A;  1QCE A;  3OMN B;  1SER A;  3E8F A;  5BY1 A;  2X0L A;  2PGG A;  1I5X A;  4GX5 A;  3FAV B;  3K79 A;  1JCH A;  4PV1 B;  5H9C A;  5IYZ B;  3K9S A;  1ZSP A;  3NR7 A;  2AXT Z;  1ZAU A;  2JRI A;  3BY6 A;  4DRX A;  2Q0O C;  2PYJ A;  5K1X A;  1R3J C;  1VAR A;  3B4S A;  3IJ4 A;  2YIA A;  2AZ2 A;  4UCT A;  2ODM A;  1VQL V;  1KEC A;  4I4T B;  2UUB O;  3G71 V;  1F7Y A;  1OZ0 A;  1V54 C;  4I55 B;  1YSC A;  3OFN G;  4CZZ A;  1ZUQ A;  4Q20 A;  4FFB A;  2QA4 V;  3K5N A;  2WLI B;  4DR5 O;  5L3D A;  2A9H A;  3K04 A;  1J5E B;  2ZT9 B;  4IYI A;  3FYE B;  4DW0 A;  2DQ3 A;  4YHH B;  5BR8 O;  4P9P A;  2YS8 A;  3ML0 A;  2UUA O;  2LGQ A;  2R9A A;  3OUF A;  3UT5 B;  4N21 A;  3RYF B;  3NXS A;  2BSK B;  2HKO A;  1W0J G;  4MW3 A;  4O4L B;  2VQE B;  1YTF D;  2X7R B;  1W0K G;  5KMG A;  2YUA A;  2B5U A;  2D2C B;  3VQY A;  3R66 A;  4O4H B;  2HVK C;  2DWE C;  4MTO A;  1TGO A;  2CDY A;  2GBO A;  5BR8 B;  4JI2 O;  2BE3 A;  1WP7 A;  3DXR B;  2Z0A A;  1OCZ C;  3OAA G;  1VF7 A;  4MVS A;  4B7E A;  2DQ0 A;  4J41 A;  5BXZ A;  4YJ3 B;  4LF7 O;  1FXV A;  1SQQ H;  4OGQ B;  3ZN0 A;  1RM1 B;  4QJF B;  1ROP A;  4TOI A;  2A3Q A;  2CE4 A;  3SPI A;  3A0B Z;  4JAV A;  4DR6 B;  1X59 A;  3JAW A;  2E3C A;  4K8Z A;  1FD9 A;  1JOY A;  4PA9 A;  4DW1 A;  4X65 B;  2EIJ B;  2HHH O;  1IBM O;  2ZR3 A;  3H9V A;  3PN1 A;  1NBM G;  5IDJ A;  3CME V;  1RP3 B;  1DF5 A;  2A0L A;  1V55 C;  4Z2W A;  1SQG A;  3HKD A;  4FIP C;  1OCO C;  3VOU A;  1H8H G;  2EUL A;  4OXS A;  4LNU B;  2P67 A;  4YY3 O;  3MHS C;  2Q7E A;  1Q90 D;  3X2Q B;  3RWR D;  3JCU Z;  1FXK A;  1U97 A;  4JTC B;  1GN2 A;  4MT8 A;  2HHH B;  3HB3 B;  3JAT B;  3RYI A;  1SQP H;  4FJC C;  5KA5 A;  4DR7 B;  1XBL A;  1WJZ A;  1BZK A;  1H2N A;  4I50 B;  4U3F H;  3OUS A;  2OIE A;  1YJ9 V;  2KG7 A;  1MZE A;  1TAE A;  4CC6 A;  2ADP A;  1P7G A;  2A7W A;  3D3I A;  2R9R B;  5J2T B;  1YIT V;  1D2D A;  1BL8 A;  2Q4P A;  5B3S C;  2AGA A;  5H5N A;  3G6B A;  3N2G B;  3I55 V;  1JMK C;  4W4L A;  1OJH A;  3SDL A;  5K1P A;  4NTW A;  1F51 A;  2IH1 C;  1XOU A;  1AP5 A;  1KP3 A;  1Q5O A;  2JS5 A;  5KUM A;  4U3J B;  2B1I A;  4J7K A;  2DYS B;  4LF6 O;  4JZ2 A;  5CA0 B;  5KHK A;  1LR1 A;  2XAH A;  2YEV A;  4UV8 A;  1R6N A;  2V1D A;  3ZRV A;  1S5H C;  3JAS B;  2ZM6 O;  4QNH B;  3JD1 A;  4K3A A;  4DR1 B;  1XL6 A;  3SR2 C;  3IC7 A;  4Q6G A;  1XHX A;  1R73 A;  1NH2 B;  1GMG A;  1K7D A;  1XQ8 A;  1PNM A;  1AR4 A;  5LXT A;  4PA3 A;  1UJW B;  2JGD A;  3D3Q A;  5IJ9 A;  2ZKO A;  5FLX N;  2PZS A;  3E89 A;  2AZ0 A;  1F4M A;  4NXM O;  4CH5 A;  2KQX A;  2NNU A;  2WLJ A;  5L3F A;  1AIL A;  3CEI A;  3K9A A;  4LR3 A;  5EC2 C;  4PEL A;  4O4J A;  5B1B C;  3CCQ V;  3I5D A;  1MA1 A;  5KAI Z;  3OGC C;  4AQY B;  3SJC C;  3UO2 A;  4R6Z A;  5EC1 C;  1JJO A;  3K0G A;  4KHP O;  1GN6 A;  2VS0 A;  3FAV A;  4H13 B;  4I7Z B;  2HJF C;  5IYZ A;  2CGO A;  4TT3 G;  3CRA A;  2ARH A;  1YIJ V;  1G1X B;  3A0H Z;  5B66 Z;  4NXM B;  2FKX A;  4FM0 A;  3CJH A;  3W7T A;  1K97 A;  4MTF A;  2ZE5 A;  4UCO A;  4DUY O;  5LP6 B;  4JV5 O;  4I55 A;  4B3M O;  3VQW A;  5KHI A;  3LUT B;  2WLI A;  5BZB A;  4JI7 B;  4X66 O;  4B08 A;  1XMO B;  3M8A A;  1AB3 A;  1KKC A;  3RBZ A;  5JVD A;  4BWA A;  1GN3 A;  1QVG U;  1M90 W;  5EIB C;  3RYF A;  5EZY A;  1FPO A;  2EJR A;  4PDL A;  2OCC B;  1VQ6 V;  2F1M A;  3LDD A;  2OTL V;  2Y48 A;  1H38 A;  1HDJ A;  1AI6 A;  4ICG A;  4BAY A;  4JV5 B;  3CPW U;  2VRZ A;  4WFH A;  5LA6 B;  3AG2 C;  1S5J A;  2F23 A;  5IJ0 A;  3N2K B;  2K1E A;  5JH7 B;  3M99 B;  3SGI A;  2JS3 A;  4X64 O;  1WN7 A;  1ZLZ A;  2B9Z A;  2EIK C;  4I9Q A;  2EIM C;  2OYQ A;  2WA4 A;  4QPJ A;  5ITZ A;  1XMQ O;  2NR5 A;  5CA1 B;  2WA3 A;  1Q43 A;  3I56 V;  2Y4U A;  1N36 O;  3ASN B;  1URF A;  3T4Z A;  4LF9 O;  4J9Y B;  1HNW B;  2AW9 A;  3WU2 Z;  5IYB O;  2WLM A;  1R3L C;  1RPO A;  3ZBH A;  3EHB B;  3JAL B;  2X6C A;  1NKD A;  1VQP V;  3CYO A;  4ZBM A;  5LHG A;  4NB5 A;  1R1B A;  1IBK B;  4GKK O;  5JJN B;  2BOB C;  5B1O A;  2CK3 G;  3BCC H;  5IY5 B;  4I9W A;  1KKD A;  2XTA A;  2P4K A;  5B5E Z;  4LNU A;  2P5O A;  2BTO A;  4D7T A;  1N36 B;  2R70 A;  2QKA A;  4UB6 Z;  3TET A;  2X6A A;  3FB8 C;  2IU3 A;  5C93 A;  4CH4 A;  4PJ0 Z;  2UU9 O;  3AK2 A;  3TXQ A;  2XAQ A;  2F4V O;  1HNZ B;  4TV9 A;  5CN0 A;  3JAT A;  1IBL B;  2YI8 A;  5L3C A;  4ZI7 B;  3B09 A;  4ZHQ A;  1VQ8 V;  5GON B;  4LC1 A;  4GKK B;  4B3R B;  3U0Z A;  5DEC A;  3RGB A;  3D36 C;  5J2T A;  2XOK G;  5CBH A;  3IC9 A;  3H1J H;  5EYP B;  4DV0 B;  1NH2 D;  1OV9 A;  1FJG O;  2X6B A;  4F4L A;  3B2E E;  4TSF G;  2QM8 A;  3ABT A;  1Y74 A;  2LW7 A;  2EJ7 A;  2M7W A;  1KUQ A;  4U3J A;  2CH7 B;  4JI6 B;  5CA0 A;  4HBN A;  4JI1 O;  3E83 A;  4JI3 O;  4DV7 O;  4JYA B;  2EIL C;  1NJI W;  4O2B B;  2EZO A;  4WFA V;  3CHX A;  1SQX H;  2QKS A;  4AIL C;  2EZP A;  1XIL A;  3JAS A;  2Q6A A;  4JI0 B;  3E8H A;  2QJ1 A;  5BMV B;  4LF8 O;  5CA3 A;  4EB6 B;  1XUQ A;  5JCO A;  1Q6U A;  3VQV A;  4ZOL B;  3ZN1 A;  1K5Q A;  2OWO A;  4PI0 A;  4HNA B;  5KX5 A;  1K34 A;  1XEQ A;  4JZG A;  1JFF B;  1M93 A;  2ETN A;  5LL6 Y;  3FD9 A;  4UVB A;  4CS3 A;  4BR6 A;  2WWW A;  3HKB B;  3O9O A;  4PHZ A;  5IWA B;  1YI2 V;  3D8C A;  1WA8 A;  3HKC A;  2P22 C;  4GLX A;  4NXN O;  1BMF G;  4UVA A;  5L3B A;  1QHT A;  1GM8 A;  4RO2 A;  4A5U B;  1B6Q A;  3ASO B;  3ZMU A;  2FL4 A;  4RUE A;  2N04 A;  4LP8 A;  1VP7 A;  3MD0 A;  3ETG A;  4JI8 O;  2BCC H;  4WBN B;  1RSO B;  5LP6 A;  2ZE6 A;  4KL1 A;  4X1K A;  3SYQ A;  4LFB B;  3LNN A;  1G4Y B;  3T1H O;  3DC5 A;  4B3T O;  4QPK A;  1QR8 A;  3CWB H;  4X1I A;  2GTA A;  4JI5 O;  4PA6 A;  3FB5 C;  3HKE A;  5B1N A;  3O65 A;  1MMM A;  1SF9 A;  2QGN A;  1AI7 A;  4LBE C;  3RN4 A;  2LJ2 A;  1Q8I A;  2Q9L A;  4FLV A;  1FKA O;  4DO2 A;  1VQK V;  2Y0I A;  1M56 B;  1KBH A;  3K5L A;  1N0J A;  4B3T B;  3AG3 C;  3N2K A;  4OPA A;  1S3J A;  3L71 H;  2QKC A;  3OD4 A;  1OCZ B;  4MVZ A;  2RJZ A;  2K9P A;  4JGS A;  5D5P A;  4JI5 B;  1J5E O;  2Z5U A;  3ZCC A;  1YHQ V;  1P84 F;  1ZWI C;  2JVD A;  4D7S A;  4YHH O;  1M5I A;  1KB9 F;  4FLY A;  3A8T A;  2ZNI A;  1ENV A;  1FXK C;  1K3E A;  2PI4 A;  3KG2 A;  5CA1 A;  1SA0 B;  2WLL B;  2KSD A;  3WB2 A;  3LDC A;  2VQE O;  1IXM A;  2JIZ G;  5HFM A;  2C2A A;  1NVP B;  2B1G A;  2N05 A;  1HNX B;  3ABL C;  3B40 A;  1QLE C;  3CCE V;  1YJN V;  3J7A U;  3JAL A;  3J81 N;  5FNV B;  1TUB A;  1OCC C;  1OCO B;  3R65 A;  1Q6I A;  4MVO A;  3TK1 A;  3WG7 B;  5JQG B;  2QWN B;  5EBL C;  5LHH A;  3E8B A;  3RYC A;  1N8R W;  1Q7Y W;  1H2K A;  3CCS V;  4J42 A;  2GTS A;  3AG4 C;  2Y4T A;  3QO5 A;  4DR6 O;  2XHB A;  4K0K B;  4UXN A;  1YDX A;  2CTR A;  2JJ2 G;  3K57 A;  3BA9 A;  4X65 O;  4LFA O;  1HWY A;  4TWK A;  4ZI7 A;  3H01 A;  1IDS A;  5L3E A;  3ABM C;  5GON A;  4NR1 A;  2EX3 A;  4FLW A;  4B3S B;  2FB5 A;  3RVZ A;  1D5N A;  4FZ1 A;  4DXW A;  4QE7 A;  1S77 D;  2Q8V A;  1B3Q A;  1N0N A;  2GV9 A;  1EZV H;  4X1Y A;  3ZS8 C;  3E8G A;  2QTO A;  3K03 A;  4DR3 B;  3AK1 A;  2P4V A;  4RUF A;  1N4C A;  1BT8 A;  3F7V C;  5E1A C;  1HP8 A;  2JK5 C;  2AHZ A;  1MG1 A;  1N33 B;  4IIJ B;  2DMX A;  3VBB A;  3SPH A;  4LFA B;  1XNQ B;  3L74 H;  2QWP B;  4DR7 O;  2EIN C;  2DYR C;  4TV8 B;  1P49 A;  3K5O A;  1N34 B;  1EFR G;  3SJB C;  3SPJ A;  3UQ8 A;  5C8Y B;  3JAR A;  1H2G A;  1NU1 H;  3IGA C;  5B1A B;  4EB6 A;  3B8N A;  1WNS A;  5A2Q N;  4FM2 A;  4WFG A;  4BIO A;  4GX0 A;  4HNA A;  3AEI A;  2ZXW B;  5DN6 G;  2H3O A;  4WFF A;  1VQ4 V;  1JFF A;  1K9M W;  3GWO A;  3CSX A;  2GUZ B;  3QTC A;  4IHJ B;  1G6U A;  1Y76 B;  1N32 B;  4FFK A;  5B1B B;  3GVM A;  2FYU H;  5CB4 B;  1AR1 B;  1HR0 B;  1WAZ A;  1U96 A;  2H8P C;  4TUY B;  1H8E G;  4EFE A;  3C3S A;  4X8A A;  1SKV A;  2RQ6 A;  4X20 B;  3C3T A;  1YVW A;  4DR1 O;  4J80 A;  3LDE A;  1QU7 A;  5KUK A;  4U7O A;  1JR9 A;  4FLX A;  4X89 A;  2OCH A;  4LF4 B;  4DR2 B;  2QDO A;  3ZMT A;  4PDR A;  2P7T C;  5H6R A;  1FFX B;  4JI4 B;  1NTZ H;  1E1Q G;  3OMI B;  3T2M A;  1EN4 A;  4ABM A;  3DC6 A;  1OCR B;  2VQF O;  4IGG A;  4AI8 A;  5GTH Z;  3E35 A;  4HZ3 A;  3STL C;  2UXX A;  2QWQ B;  4AQY O;  3ZRW B;  2Q5Z A;  3F7Y C;  4PDM A;  2ZE8 A;  1YZB A;  2EIJ C;  3OEE G;  1VEW A;  4X62 B;  3CCV V;  1NVP D;  1QLN A;  4IYH A;  4GUN A;  3B8M A;  3ZHT A;  1SQV H;  3AG2 B;  3ICX A;  1V9P A;  4P2Z A;  1TUE B;  2BTQ A;  4H44 B;  2UXC B;  1P7B A;  2VQF B;  4K8X A;  4OX9 B;  5LOV B;  4JI7 O;  1QNM A;  1AVM A;  4TQF A;  1RPR A;  2PY5 A;  1XMO O;  3X2Q C;  2RCV A;  1JQ0 A;  1JA8 A;  4LF5 B;  3CRR A;  2WLL A;  4UCU A;  4JAS A;  3ZHV A;  2W0F C;  3OGI B;  4J7J A;  1WB8 A;  2ADQ B;  3E22 B;  4I4T A;  3EXA A;  5KHH A;  1O9H A;  4XDJ A;  3CRM A;  3OT7 A;  5FNV A;  4BW9 A;  5FPR A;  1YJW V;  2XAF A;  1BCC H;  1D5A A;  4LFC B;  3UT5 A;  2MW2 B;  2BSK A;  5JQG A;  4I5S A;  1ARO P;  4DV4 B;  4O4L A;  4LH6 A;  3BHP A;  2IW5 A;  3UKM A;  2E74 B;  1QBZ A;  2JEX A;  2ZIO A;  4O4H A;  4BIZ A;  1J95 A;  4B7K A;  1FFT B;  2WLN A;  1HNW O;  4CS2 A;  4GX2 A;  2W0X A;  5LMU B;  2QE7 G;  3IFX A;  5JCO C;  3DXR A;  1R6T A;  4G27 B;  2DOS A;  4FLU A;  3M7M X;  4YJ3 A;  1EM1 A;  1IBK O;  2CAZ C;  4EEQ A;  3JYC A;  4RWU A;  1R3I C;  1PP9 H;  1KP2 A;  4K35 A;  1JPX A;  3PJS K;  3T1Y B;  1GO3 F;  2LQT A;  4NTX A;  3LSS A;  3CB2 A;  5KHJ A;  1LUV A;  3AG1 C;  1S76 D;  3MAQ A;  4O2A B;  3S3X A;  2A06 H;  4MVQ A;  1GAX A;  2R9I A;  1HNZ O;  3F5T A;  4JYY A;  2F93 B;  1BGY H;  3CE2 A;  1IBL O;  1BHB A;  1VF5 B;  2VWK A;  4H37 A;  2Q69 A;  3T4D A;  3ETD A;  1CP9 A;  4R7C A;  3SYC A;  2YC0 A;  4B3R O;  2QM4 A;  1JJ2 U;  4DV2 B;  1AI4 A;  5LGU A;  2HR3 A;  1IX9 A;  3WB1 A;  1Z5W A;  1PNL A;  3CD6 V;  4FLZ A;  4DV0 O;  1YF2 A;  2P6J A;  5LP6 C;  2OIG A;  2ATK C;  2RNB A;  3JD0 A;  2HFE C;  1XNR O;  1VQ7 V;  4UB8 Z;  4KXR A;  1Y76 A;  4JI6 O;  4DV3 B; 
#chains in the Genus database with same CATH homology
 3L71 H;  1BE3 H;  3BCC H;  4D6T H;  4U3F H;  3L70 H;  1KYO F;  1NU1 H;  2BCC H;  1SQB H;  1PPJ H;  3H1I H;  1P84 F;  4PD4 F;  2A06 H;  1L0L H;  3H1K H;  3L74 H;  1NTZ H;  3L73 H;  2IBZ H;  1BGY H;  1L0N H;  3H1J H;  1KB9 F;  3H1L H;  1SQQ H;  1NTK H;  1SQX H;  1EZV H;  1SQV H;  3CWB H;  3H1H H;  1SQP H;  3L75 H;  3CXH F;  3CX5 F;  3L72 H;  3TGU H;  1PP9 H;  1BCC H;  1NTM H;  2FYU H;  5KLV H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...