1SQQH

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 18
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1sqqH00
3L70H 3L72H 3CWBH 2BCCH 4D6TH 3CXHF 1BGYH 2A06H 2FYUH 1L0NH 1NU1H 1NTZH 1PP9H 1SQQH 1NTMH 2IBZH 3H1LH 1NTKH 1P84F 1SQXH 3L75H 5KLVH 1SQVH 1L0LH 1BCCH 1SQPH 1EZVH 3L74H 4PD4F 3TGUH 1BE3H 3H1JH 3H1HH 3H1IH 1KYOF 4U3FH 3BCCH 3CX5F 3H1KH 1SQBH 3L71H 3L73H 1PPJH 1KB9F
chains in the Genus database with same CATH superfamily
1JX9A 3W7TA 4JI4O 1Y66A 5CA3A 5K1PA 2JS5A 3CPWU 2YUAA 4BR6A 4O2AB 2CUGA 1G1XB 4RWUA 1VARA 1AVMA 1SQPH 2QEXV 2F95B 5LP6B 4H37A 2XAFA 2HHHO 1YTFD 2Q67A 1AI7A 2WAMA 3M8AA 2UXCB 1MSDA 4X1IB 1IBKB 1R3KC 2Y0PA 4MTGA 1FKAO 4JGSA 4LF5O 3SJCC 3L75H 1WN7A 4ZKIA 3BHPA 3P3NA 3HKBB 4JASA 5LHIA 1XOUA 5H2FZ 5ITZB 1W0JG 4FM1A 4B3MO 5IJ0B 4GKKO 5EZYB 1HNXO 1KP3A 3IAYA 2F43G 3MD0A 4KHPB 4JI1O 1FXKB 1BCCH 1Q6UA 1OCOC 4MW3A 2ZM6O 1M56B 4K0KO 3K9AA 2DYSB 3WU2Z 2WA4A 3G71V 4NR1A 3JD3A 2Y0IA 4MS2A 2CE4A 5JCOC 4DV5O 4ASUG 3CCEV 4Z1VA 1XHZA 1RPRA 2L35A 4CZZA 1LR1A 3FYEB 1I7FA 4QNHB 1TA8A 5LBQA 4JTDB 3BVOA 3J7AU 4FLZA 3I5DA 3T1YB 5EYPB 3MDSA 4FVMA 3CE2A 4X1KB 1IDSA 4BIOA 4WFAV 1J95A 1WPXA 3C3SA 4JI8O 4LF7O 2PUSA 3FAVB 1CPYA 4MVQA 1HNWB 4N23A 2FB5A 2ETNA 2PTMA 2ADPA 3ETEA 2WSSG 3DXRB 5J2UA 3RWRD 1DK1A 4I50B 1OV9A 3B09A 1E1QG 4QE7A 2H3OA 2QKAA 2YEVA 1FXVA 1GK9A 1R3JC 3K0DA 2JVDA 5GW7A 1I5XA 5KA6A 3ABMC 1AP5A 3FB7C 2WWWA 3A8TA 5CB4B 1LNQA 2EJ7A 1JCHA 5CA1A 3JSLA 4TUYA 2ODMA 1AILA 4X20A 1AR5A 1IX9A 3B8NA 4MTXA 1Y67A 1KD1W 2C2AA 2VQFO 1NI8A 3SJAC 4JI6O 1Q3EA 5GONB 3JASA 2ZR2A 1SQVH 2W0XA 1TUBA 4EFBA 1XHXA 1SQGA 4LFBO 2ILMA 4G28B 2JEXA 2WLKA 1WB7A 4YHHO 4PA3A 1HR0B 4GKJO 4PJ0Z 3CC2V 1Y76B 2WLIA 1NTMH 1MA1A 3ZIAG 2B5UA 1AI6A 4DYLA 5JQGA 4LR3A 2YIDA 5AG2A 2DMXA 2OIGA 3KKYA 5LHHA 2QDOA 5KA5A 1OCOB 2ZE7A 3K57A 1FJGO 2IH3C 1XILA 3U0ZA 4PDMA 4DUYO 1IBMB 2EZOA 1VQMV 1R6TA 4LFCB 1ROPA 2HLDG 2A7WA 2NNUA 3RYCB 3G6BA 3CRRA 2RN9A 4LF4O 2DQ0A 4EFEA 4GX0A 1I5YA 2JGDB 2QWRB 1L1FA 3FFQA 4W4LA 3SGIA 1ORQC 3ZCCA 4EB6B 1M9NA 3CS5A 3UT5A 3SPHA 4IYHA 3BA9A 1L0LH 1NH2B 4QPJA 1M57C 4FFKA 2ZNIA 2CH7A 4PI2A 5BMVA 1GN2A 2BE3A 4QPKA 5HFLA 2XT9A 5KMGA 4EKWA 1JMKC 3O9OA 5IWAO 5D5QA 1KKDA 2ITDC 3ICXA 3HKCB 3UKMA 5E79Z 4MSWC 3T1HO 3ZMVA 4EEQA 4MVSA 5KAFZ 4DR7B 4ZIBA 2EBOA 2ZDIA 4PA9A 4UCUA 1NZ6A 2P22C 3WFVA 1F4NA 3OD4A 1NQTA 3B2EE 1N32B 1XNRO 4JI3B 4LBEC 1L8DA 3U11A 4UXNA 1SA0B 1I94B 5CA0B 2VQEO 2Q73A 1XMOO 1EN6A 1BSMA 1VQOV 1NU1H 4DV3B 3SYPA 3HR0A 3C90A 2DE0X 1S0VA 4RO2A 4B3RB 2Z3YA 3F5TA 1COWG 1XUQA 4J7ZA 3HKDB 4DV2B 3JATB 3JAMN 1Y74B 4X8AA 1K8AW 4DR5O 3OE7G 4DV7O 1OCCC 3IC7A 1TAEA 2OCHA 2PYJA 4BIUA 4GX1A 2XAHA 5FL7G 1UFIA 3OFNG 4TV8A 2YS8A 2EX3A 2V1DA 2IW5A 4J9ZB 4JZ2A 1JFFB 5L3GA 4U7OA 3AEIA 1IXBA 5IJ9A 1FS0G 3FD9A 3KZIZ 2QTSA 1SQQH 3BY6A 1AR4A 2QWOB 4X65B 3VQVA 2UXBO 2KB1A 1EZVH 4JYAB 1PNLA 3ABKC 3UCSC 1M5IA 3D3QA 4FFBA 3JAWB 3B77A 3THOA 5IYDO 1SC5B 3OEEG 1N4CA 5EBMC 2F4VO 1AI5A 1IXMA 2XNDG 3ZHRA 4I55A 4QIWF 3ZHTA 2JJ2G 1W2BU 1QLEB 3ZJZA 4NXMB 1FXHA 3HKEA 5F2VO 3LDCA 2CK3G 2X7RB 3CCMV 3RFRA 2NN4A 4B3SO 1BE3H 4JTCB 5FPOA 1HW7A 1H2LA 1S77D 1YI2V 4DRXB 2JK5C 4BW5A 1M57B 2N74A 2W6IG 4TSFG 4JYCA 3J80N 1SRYA 1JA8A 3LDDA 4DW1A 4DV0O 4LF9O 5J2TB 4AQYO 2Z0AA 4LF6O 1T5EA 1S5LZ 4JAUA 1QVGU 3OT7A 3H9VA 4I0XA 1MABG 1HWYA 5KX5A 4WBNA 2QKCA 1N33O 3JARB 4UCSA 3APOA 3VQXA 5LP6C 5GTIZ 3FB8C 4DR4B 4J80A 5JJJB 3DSQA 4MT8A 2QE7G 4DV6B 1P84F 4TV9A 1VQNV 1Q6IA 3W7WA 5LXTA 1H2NA 3J81N 3STLC 4HNAB 4JI7B 1HNZB 3SJBC 3A0BZ 1WA8B 4X88A 4NTYA 2RDCA 3D8CA 2LGWA 1F4MA 1EN5A 2ZT9B 4GYCB 4LF8O 4UVCA 2YI9A 4TWKA 3ABLC 3CJHB 3SJQC 5CMUA 4CS2A 2Q0OC 3F5WC 1NTKH 1BL8A 5EC1C 4FZ0A 4DV1O 1AI4A 1VQPV 1THZA 1OCCB 3JSNA 5KHKA 4KHPO 1EBOA 1NVPB 1FXKC 3K5MA 5EC2C 5KX5B 4E4EA 3GVMA 3OUFA 2QGNA 2RCVA 2E5LB 2CGOA 3CCVV 2DYSC 4R50A 5DECA 3CCUV 3ZRWA 3F7YC 4OX9B 4P9PA 1H2SB 3ABUA 2R72A 4PDVA 2NLJC 1XNQB 2UXDB 1KUQA 2GBOA 2QWPB 1FFTB 4KL1A 1AJPA 2YICA 3JCZA 3T1YO 4O2AA 3CHXA 4JI5B 1N36B 1XDCA 1V55C 4H13B 1K33A 4G27B 5LP6A 1GM9A 4TQFA 1VF7A 1ENVA 4YXWG 5EBWC 4GLXA 3ASOB 4F6RB 5J9PC 1AROP 3K5NA 1Z2GA 3H1KH 4DR1B 3VBBA 1JR9A 4K8XA 3TCUA 1QR9A 2D3OW 3TXQA 2KKWA 5B1BC 3ZX6A 1J5EB 1ZAUA 4WFFA 5LA6B 2KSDA 5IDJA 3G80A 2W6JG 3HKBA 1ZL8B 4RAIA 4LFAB 5ITZA 4H33A 3K06A 1TGOA 3I55V 5IJ0A 4DR3O 2OWOA 5EZYA 3ZN1A 4JZGA 1V9PA 4LP8A 1QQCA 3L73H 4XDLA 4RQFA 3ZRVA 4DXWA 2PZSA 1FXKA 4MVOA 3CMAV 4X64B 2RNBA 2ZXWC 3OR6C 5BZBA 1YDXA 2QR4A 2BOCC 4IYIA 3CCQV 2CAZC 2R9RB 1CXZB 2N04A 4UB8Z 1JJ2U 5CN0A 3ABLB 5EYPA 2QM8A 2B1GA 4YY3O 4DW0A 4X1KA 2JIZG 1GAXA 3RVZA 3NXSA 2Z5UA 3RGBA 1PPJH 3AK3A 3JCUZ 1GN3A 2OIEA 3FAVA 1GM8A 3MHSC 3E8HA 2N05A 3CCRV 1PM9A 2Y4TA 3E8BA 4JV5B 2F66C 2IU3A 3VQWA 2HJFC 1FFXB 2QM7A 3PN1A 5EIBD 4CH5A 3BABA 3RYHB 1ZX3A 2ADQB 5D5PA 1KYOF 1K4DC 2JS3A 3DXRA 1XREA 2WPDG 3E8FA 2BSKB 3T4DA 4I50A 1GMGA 1SZXA 3CRCA 3G6EV 3SPGA 2VWJA 4JPRA 3KG2A 1SF9A 2LGQA 3EHBB 5CB4A 2XUMA 4Z1MG 1AB3A 3EVKA 4LC1A 4ZHQB 4X66B 3X2QB 1JOYA 1K7DA 1V55B 4DUZO 3OW2U 1WAZA 2P67A 2K1EA 2FYUH 4Z2WA 5DEDA 5GONA 3JD2A 1B6QA 5LMNB 1M4UA 1JVMA 1WPBA 3JD0A 3SPIA 5LMUB 3H1LH 4E2LA 2FMLA 1D5NA 2P90A 1B3QA 2YXYA 2ZKOA 1ZSPA 2MK3A 4NKGB 2E74B 3BFRA 2ZE8A 4U3FH 2GV9A 1BT8A 5B1BB 5LHGA 1F51A 5LOVB 2DWEC 4LH7A 1Y76A 1KKCA 4JI0O 1PNMA 2QWNB 4NYKA 1XMQB 1I94O 3BRCA 4YIOA 2W0FC 2QJ1A 4DV3O 1GTOA 2EZPA 3APQA 1VQ6V 2DW4A 2BTQB 1F7YA 1IBLB 4H0LB 5A9GA 3RT3C 2UUBO 1GM7A 2ZXWB 4DR6B 3TK1A 4DV2O 3TJTA 5JCOA 3RYCA 3E22B 5IYBO 2Y48A 2PYLA 3ZMSA 1Q82W 4O2BB 3VOUA 5CBHA 2JGDA 5JJEB 3AG3C 1NH2D 1KBHA 1SZTA 1Y4MA 1N0JA 1G4YB 2Q6AA 1ZUQA 5L3DA 4EB6A 4FLUA 1BQ0A 4ABMA 1I08A 1N8RW 5C93A 3GWKC 3ZRXA 4B08A 2UXXA 4X89A 4JAAA 1Q81W 2X6CA 2YXLA 4LF5B 1E79G 1N34O 4JYAO 3HKCA 3QG5A 4KXRA 2CTRA 4QE9A 4B3MB 1BS3A 1HNXB 1BHBA 3N27A 1U96A 2LO1A 3RYIB 2XHBA 4O4LB 1YSCA 1QLEC 2M7WA 3H1HH 1FD9A 4DV4O 1SA0A 1K92A 2YI8A 2ZM6B 1EN4A 2YDEA 5CA0A 1OCRC 4DK1A 4K0KB 4JI2O 1BMFG 2RQ6A 4ZOLB 2P06A 1P4RA 2X6AA 4BIZA 1RM1B 4PHZA 3W7SA 3CXCU 3CCSV 3ZEDA 3HKDA 4LWSB 1HP8A 3OTFA 4YJ3B 5LGTA 3JATA 4NB5A 5IE9A 1Y74A 3Q4HB 4ZI7B 3JALB 4O4IB 4QJFB 2CTQA 4F4LA 3SYOA 3CP1A 5L3EA 3HPLC 4FK5C 4UCTA 1PV0A 3DC5A 4AHCA 4KFMA 4OPAA 2ZNJA 3K79A 3LSUA 4JI8B 4LF7B 4DR4O 1VIBA 2E75B 1JFFA 3FKSG 1A32A 3IGAC 2LP7A 3RYFB 2R9AA 5H6QA 3OTOB 2UU9O 2DYRC 4GUNA 2OTJV 5JWPA 3N2KB 3CD6V 4DR2O 5KHIA 5EBLC 1YJNV 3JAWA 1MZFA 2XTAA 3UO3A 1SS3A 2HVKC 1K97A 5H5NA 4I9QA 3QVNA 1RFYA 1YF2A 4UCVA 3JAKB 4LNUB 4IGGA 4IL6Z 3AG3B 4CS4A 2BTOA 1VQ5V 3DTUB 2RMKB 2EIKC 1U97A 3RVYA 2E5LO 1VQLV 2VQFB 2G38A 4X1YB 3CRMA 4C7UA 2PF4E 2WLLB 2YIAA 5LGNA 4DRXA 4U3JB 4YJ2B 2DQ3A 1G6UA 2LW1A 1WLEA 4LFBB 3A0RA 1VQKV 1XNQO 5J2TA 4O4JB 2AZ2A 3EFFK 2UXDO 1WP7A 2P7TC 1QU7A 4YHHB 1V54B 1VQ9V 2IJHA 3TETA 5GTHZ 2IJIA 4JI5O 1E1RG 3LDEA 1G8MA 2KQXA 3K59A 2DN9A 3JARA 2UUCB 1DLBA 3ASOC 2GUZB 2GTAA 4KP4A 3E83A 4FLYA 2EJRA 4DR1O 4HNAA 4PD4F 1FJGB 1OCRB 4J42A 3TGUH 1S5JA 1WA8A 4R7CA 2H94A 4DUYB 1J5EO 2KG7B 3CMEV 3DC6A 4IIJB 1X59A 4I5SA 4LFAO 4J7KA 3CJHA 2F1MA 4TT3G 1LUVA 4PDLA 4PELA 4L87A 2HG5C 2Q68A 4LF4B 3ETQA 1R6NA 1H8HG 4UV9A 2P4KA 2F23A 1UJWB 1SETA 3OM3B 1ZWIC 3AG1C 1CEZA 3BCCH 1S3JA 2A9HA 4TOIA 4UVAA 3T1CA 3OEHG 4IHJB 2LFSA 2YIBA 3AG7A 3A2FA 5IWAB 2UXCO 2DWDC 4UB6Z 1IBKO 5B1AC 4Q20A 3T2MA 2DYRB 3UM7A 4GCZA 3ZHSA 1TVKB 3SYQA 3CX5F 3ZN0A 4WCEV 3CRAA 1O9GA 4I4TB 3BPZA 3CRQA 2A06H 2XAJA 3DGEA 2EIMB 1H38A 5LL6Y 1XNRB 4NTXA 1R6KA 1IURA 1KU9A 2B9ZA 4IT5A 2JJ1G 1KECA 4F6RA 1XMOB 1UPGA 3QO5A 2OTLV 1B04A 3R66A 5DM6V 5DN6G 2NR5A 1RSOB 3GWOA 4PA4A 2EIKB 2IU0A 1AR1B 2UXNA 2AZ0A 5JJNB 2DJVA 5H6RA 2AXTZ 5LA6A 5FLXN 5B66Z 4N21A 1ZL8A 4B7KA 1FYJA 2P6JA 3ZBHA 4CBCA 5IYZB 4DR5B 4DV7B 2B1IA 3ZMZA 2PI4A 5KHHA 4ICGA 4BAYA 3P32A 3ZHVA 1MG1A 4CC5A 4UVBA 4X66O 4D7SA 3X2QC 1Q90D 1X4TA 1H8EG 1SKVA 1LUWA 3JYCA 4B3TB 3IJ4A 5B1NA 1F23A 3TXSA 5BR8B 3ABTA 5LMNO 1XL4A 1HNWO 2ITCC 2UXBB 2EIJC 4PI0A 4WFEA 4H44B 1BGYH 2GHYA 4HZ3A 4K35A 1NTZH 2IH1C 3ZMTA 2F4VB 3BAAA 1P7BA 1WNSA 5JVDB 4J11A 5LYJB 3QNEA 1PNKA 5IT9N 3A0HZ 4B3SB 1MZEA 3AG1B 2VWKA 4J10A 5CBFA 3K58A 3CYOA 1IBLO 2UUAB 4NXNB 2ZQMA 1FFXA 1US6A 4X62B 1VF6C 2QWQB 4WF9V 5EIBC 3RYHA 2LW7A 2XASA 2O57A 4DV0B 3FB5C 4HYOA 5LGUA 1MNGA 4LF9B 2ZD9A 4P9OA 4DR6O 2X0LA 2BSKA 3KCYA 3CCJV 4AQYB 1MOFA 3D36C 4LF6B 3SDLA 3ZMUA 5B1AB 4YIPA 4CH6A 3W7XA 2Y4UA 2OCCC 3CB2A 2WLMA 1TUEB 4R8CA 3K0GA 4K8ZA 1N33B 3LUTB 3CSXA 4ZHQA 5JH7B 1HR0O 5C8YB 4CC6A 1IZ3A 2AHZA 1NKDA 4O4HB 3RN4A 2EINC 2XAGA 3N2GB 4LF8B 2WA3A 3B40A 2QA4V 3H1JH 3FX7A 2JGUA 3ETGA 2ZINA 5FPRA 4J7JA 1IBMO 1VQ4V 4LFCO 1YJ9V 4MTOA 5LOVA 4UV8A 5FNVB 4DV1B 3L70H 2R9IA 1K5QA 2HFEC 1O9HA 2Y69C 4WFGA 4UCOA 3LSSA 3I56V 3OMIB 2AGAA 3ZHQA 3SPJA 3OGIB 2YXHA 1H2KA 4FLTA 2Q9LA 1BZKA 4CH4A 2BTQA 3AG4B 1VF6A 1AJNA 2R70A 4NVPA 1K5SA 1NS1A 4D6TH 2HP8A 1RM1C 1YVWA 1YIJV 2Q69A 3D36A 1Q8IA 1YTFB 3E22A 4P30A 2YSUB 4GT1A 4AI8A 2EIJB 3K04A 3IC9A 4O2BA 3PJSK 4LH6A 3M7MX 4DR7O 3OR7C 3RW0A 1CP9A 2EILB 1N32O 1L0NH 2PI5A 2JEUA 4JI3O 2PY5A 1N0NA 1FAFA 1SQXH 4GX5A 3OTOO 3L74H 2Q7HA 2FL4A 4FM2A 1Q43A 4G2KA 1BHAA 3WB1A 1RPOA 1YITV 1Q7YW 4JTAB 4B3RO 4DR3B 2A0LA 3B8MA 2A3QA 3RYIA 4XDJA 3K9SA 3CC7V 1D2DA 4O4LA 2IJJA 4JI4B 1SQFA 2Q0AA 2OCCB 2F93B 4CS3A 2AW9A 2EULA 4RUEA 1EM1A 4K3AA 2BOBC 2IM9A 4LCUC 2E3CA 1OZ0A 5BXZA 2WLNA 1JPXA 2JRIA 2V4DA 2OYQA 2HJDA 2HHHB 3CCLV 1S76D 4ZOLA 1XI1A 2OT5A 1S72V 4X9QA 2QM4A 4LWSA 4WFHA 4YJ3A 1VQ7V 1B06A 4X65O 3Q4HA 2Q7EA 1YJWV 4ZI7A 1QBZA 3L9DA 5J2UB 3JALA 4O4IA 3SYAA 2ZDIC 2EINB 1V54C 4FZ1A 1QLNA 1WP8A 3P30A 1DF5A 5K1XA 1Q86W 4YY3B 3CC4V 2WLJA 2YEVB 4GKKB 4XBFA 5KHJA 3GB7C 4PV1B 1JQ0A 3JD1A 2UUCO 1NT2B 3ETDA 3EXAA 2VS0A 2P5OA 1PL4A 4NXMO 2Y69B 5CA1B 5L3FA 4TUYB 4X20B 4JI1B 3STZC 2QKSA 3RYFA 4HAMA 1MSWD 1VQ8V 3N2KA 4MVZA 3SR2C 3E35A 1BQZA 2IBZH 3JASB 3QO7A 1TUBB 3U10A 2HR3A 4DV5B 2HKOA 2ZE6A 1XQ8A 1EFRG 1K34A 1K9MW 1PKXA 3ZS8C 2E76B 2HEPA 3CXHF 2V7QG 4I9WA 3JAKA 4LNUA 3MAQA 1YZBA 2WLIB 4DUZB 5B5EZ 1M90W 3G67A 4X1YA 5JQGB 1WJZA 5HFMA 5L3BA 1NR7A 2WLLA 1M1KW 4U3JA 3C3TA 5CBGA 4YJ2A 1FPOA 4DV6O 3G4SV 4GX2A 2AHYA 2FTKA 3F7VC 2Q8VA 1KP2A 3AG2C 4JI7O 4O4JA 1HNZO 2JDIG 5B3SC 3OUSA 4JAVA 3BA8A 1GKFA 1K73W 5BY1A 1Q6HA 1ZTEA 2EIMC 4JI0B 4HBNA 3ABMB 4AILC 3KCXA 4F6EA 1GO3F 2GDSA 3S3WA 2GUZA 4J9YB 4GZRB 4MVUA 1HDJA 3UT5B 2Q7GA 5IY5C 2ZR3A 4PDRA 2CH7B 4DK0A 5BMVB 1Z5WA 4FPPA 2UUBB 1K3EA 4JI6B 5KMGB 4FM0A 4UUJC 2KG7A 3HB3B 3E8GA 4IIJA 1SQBH 3K08A 2GSMB 1KB9F 1RP3B 3NR7A 5L3CA 4OX9O 1KC8W 4TQDA 3H01A 2ZE5A 1QNMA 3LNMB 1I0HA 3LSQA 4B7EA 3WB2A 5KHGA 1VEWA 2X6BA 1P49A 4GKJB 2DOSA 4MTFA 1N36O 2P4VA 1QCEA 2YC0A 5E1AC 2QTOA 4IHJA 5KUMA 4FLXA 3OAAG 4B3TO 4FJCC 2XOKG 2PGGA 4ZBMA 5BR8O 2XAQA 2D2CB 3O65A 5A2QN 2VRZA 1W0KG 1NR1A 1N34B 3OMAB 3QTCA 1KQSU 1TVKA 4U7NA 4UFZA 1SESA 2LQTA 1Q5OA 1YXBA 1Z5VA 3OMNB 1KMIZ 4I4TA 1OHHG 3JD4A 3CWBH 2BCCH 2Q5ZA 3ASNC 1XEQA 3B4SA 4DV4B 1AP6A 4KUMA 1NVPD 4FLVA 2RJZA 3AK1A 1OCZC 4RQEA 3WB0A 4JI2B 1M93A 1VMGA 4NTWA 1YEWA 3WG7C 4TV8B 3VQYA 1PD3A 1H2MA 2YIBD 5B1OA 1YHQV 2UUAO 1RSOA 4R6ZA 4NXNO 4X62O 4X64O 3S3XA 1VP7A 2A79B 5IJ9B 2WLHA 3BEHA 3K3WA 3ML0A 1DF4A 5KLVH 4UCRA 5IYZA 1EZJA 4Q6GA 2CDYA 3AG2B 3T1HB 4OGQB 2CTWA 4FFBB 5B3SB 4XDKA 1R3IC 4BWAA 3R65A 4I55B 3MHHC 3QF7A 1JJOA 2LJ2A 3HKEB 1PL0A 2IJKA 3QO8A 1GH6A 2UU9B 1WB8A 4I7ZB 1MMMA 2ATKC 2VQEB 3H1IH 3OGCC 4OXSA 3ZHUA 2HVJC 1P7GA 4DR2B 4JV5O 3W7UA 5IY5B 3SPCA 3E86A 4QGPA 2CGNA 2LFRA 4JF3A 1QHTA 2K9PA 5TISZ 2Q4PA 1AJQA 1PP9H 4PA7A 4JYYA 3UQ8A 5JVDA 3K5LA 2QSAA 2L6LA 3LNNA 4BW9A 2H8PC 1YCIA 4I0XB 5LYJA 3ZRSA 5EK0A 3FYIB 4WBNB 3RBZA 3L72H 1M56C 4L8JA 1DTOA 3IFXA 1XL6A 4D7TA 1H2GA 4JYBA 2GTSA 1ZLZA 4W4KA 3AG4C 4MVRA 3AK2A 4TV9B 5IYCO 5LXTB 1IVSA 1DGSA 3M99B 3T4ZA 3E89A 1W59A 5LMUO 4DO2A 3P3PA 3ABKB 4FIPC 1D5AA 1GN4A 3CEIA 4J41A 3D3IA 3SYCA 4CH3A 2M6YA 1S5HC 2ZCEA 1K4CC 4MVMA 2FKXA 1QR8A 5JH7A 5C8YA 3K5OA 1GN6A 5KAIZ 3ASNB 1VF5B 2EILC 4A5UB 1GRJA 5KUKA 4X1IA 2MW2B 3L71H 2ZIMA 1URFA 3UO2A 1XMQO 1NBMG 1OCZB 1OJHA 3K03A 4O4HA 1R1BA 2ZIOA 1QVFU 3WG7B 4FLWA 4FMTA 4PA6A 2ARHA 1NJIW 4WFBV 1XBLA 1SERA 3N2GA 4OPHA 5H9CA 3ZRWB 3FB6C 4P2ZA 4MW8A 1R3LC 4RUFA 3E2EA 2CTPA 5FNVA 1R73A 1Y6XA
chains in the Genus database with same CATH topology
3L70H 3L72H 3CWBH 2BCCH 4D6TH 3CXHF 1BGYH 2A06H 2FYUH 1L0NH 1NU1H 1NTZH 1PP9H 1SQQH 1NTMH 2IBZH 3H1LH 1NTKH 1P84F 1SQXH 3L75H 5KLVH 1SQVH 1L0LH 1BCCH 1SQPH 1EZVH 3L74H 4PD4F 3TGUH 1BE3H 3H1JH 3H1HH 3H1IH 1KYOF 4U3FH 3BCCH 3CX5F 3H1KH 1SQBH 3L71H 3L73H 1PPJH 1KB9F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L70 H;  3L72 H;  3CWB H;  2BCC H;  4D6T H;  3CXH F;  1BGY H;  2A06 H;  2FYU H;  1L0N H;  1NU1 H;  1NTZ H;  1PP9 H;  1SQQ H;  1NTM H;  2IBZ H;  3H1L H;  1NTK H;  1P84 F;  1SQX H;  3L75 H;  5KLV H;  1SQV H;  1L0L H;  1BCC H;  1SQP H;  1EZV H;  3L74 H;  4PD4 F;  3TGU H;  1BE3 H;  3H1J H;  3H1H H;  3H1I H;  1KYO F;  4U3F H;  3BCC H;  3CX5 F;  3H1K H;  1SQB H;  3L71 H;  3L73 H;  1PPJ H;  1KB9 F; 
#chains in the Genus database with same CATH topology
 1JX9 A;  3W7T A;  4JI4 O;  1Y66 A;  5CA3 A;  5K1P A;  2JS5 A;  3CPW U;  2YUA A;  4BR6 A;  4O2A B;  2CUG A;  1G1X B;  4RWU A;  1VAR A;  1AVM A;  1SQP H;  2QEX V;  2F95 B;  5LP6 B;  4H37 A;  2XAF A;  2HHH O;  1YTF D;  2Q67 A;  1AI7 A;  2WAM A;  3M8A A;  2UXC B;  1MSD A;  4X1I B;  1IBK B;  1R3K C;  2Y0P A;  4MTG A;  1FKA O;  4JGS A;  4LF5 O;  3SJC C;  3L75 H;  1WN7 A;  4ZKI A;  3BHP A;  3P3N A;  3HKB B;  4JAS A;  5LHI A;  1XOU A;  5H2F Z;  5ITZ B;  1W0J G;  4FM1 A;  4B3M O;  5IJ0 B;  4GKK O;  5EZY B;  1HNX O;  1KP3 A;  3IAY A;  2F43 G;  3MD0 A;  4KHP B;  4JI1 O;  1FXK B;  1BCC H;  1Q6U A;  1OCO C;  4MW3 A;  2ZM6 O;  1M56 B;  4K0K O;  3K9A A;  2DYS B;  3WU2 Z;  2WA4 A;  3G71 V;  4NR1 A;  3JD3 A;  2Y0I A;  4MS2 A;  2CE4 A;  5JCO C;  4DV5 O;  4ASU G;  3CCE V;  4Z1V A;  1XHZ A;  1RPR A;  2L35 A;  4CZZ A;  1LR1 A;  3FYE B;  1I7F A;  4QNH B;  1TA8 A;  5LBQ A;  4JTD B;  3BVO A;  3J7A U;  4FLZ A;  3I5D A;  3T1Y B;  5EYP B;  3MDS A;  4FVM A;  3CE2 A;  4X1K B;  1IDS A;  4BIO A;  4WFA V;  1J95 A;  1WPX A;  3C3S A;  4JI8 O;  4LF7 O;  2PUS A;  3FAV B;  1CPY A;  4MVQ A;  1HNW B;  4N23 A;  2FB5 A;  2ETN A;  2PTM A;  2ADP A;  3ETE A;  2WSS G;  3DXR B;  5J2U A;  3RWR D;  1DK1 A;  4I50 B;  1OV9 A;  3B09 A;  1E1Q G;  4QE7 A;  2H3O A;  2QKA A;  2YEV A;  1FXV A;  1GK9 A;  1R3J C;  3K0D A;  2JVD A;  5GW7 A;  1I5X A;  5KA6 A;  3ABM C;  1AP5 A;  3FB7 C;  2WWW A;  3A8T A;  5CB4 B;  1LNQ A;  2EJ7 A;  1JCH A;  5CA1 A;  3JSL A;  4TUY A;  2ODM A;  1AIL A;  4X20 A;  1AR5 A;  1IX9 A;  3B8N A;  4MTX A;  1Y67 A;  1KD1 W;  2C2A A;  2VQF O;  1NI8 A;  3SJA C;  4JI6 O;  1Q3E A;  5GON B;  3JAS A;  2ZR2 A;  1SQV H;  2W0X A;  1TUB A;  4EFB A;  1XHX A;  1SQG A;  4LFB O;  2ILM A;  4G28 B;  2JEX A;  2WLK A;  1WB7 A;  4YHH O;  4PA3 A;  1HR0 B;  4GKJ O;  4PJ0 Z;  3CC2 V;  1Y76 B;  2WLI A;  1NTM H;  1MA1 A;  3ZIA G;  2B5U A;  1AI6 A;  4DYL A;  5JQG A;  4LR3 A;  2YID A;  5AG2 A;  2DMX A;  2OIG A;  3KKY A;  5LHH A;  2QDO A;  5KA5 A;  1OCO B;  2ZE7 A;  3K57 A;  1FJG O;  2IH3 C;  1XIL A;  3U0Z A;  4PDM A;  4DUY O;  1IBM B;  2EZO A;  1VQM V;  1R6T A;  4LFC B;  1ROP A;  2HLD G;  2A7W A;  2NNU A;  3RYC B;  3G6B A;  3CRR A;  2RN9 A;  4LF4 O;  2DQ0 A;  4EFE A;  4GX0 A;  1I5Y A;  2JGD B;  2QWR B;  1L1F A;  3FFQ A;  4W4L A;  3SGI A;  1ORQ C;  3ZCC A;  4EB6 B;  1M9N A;  3CS5 A;  3UT5 A;  3SPH A;  4IYH A;  3BA9 A;  1L0L H;  1NH2 B;  4QPJ A;  1M57 C;  4FFK A;  2ZNI A;  2CH7 A;  4PI2 A;  5BMV A;  1GN2 A;  2BE3 A;  4QPK A;  5HFL A;  2XT9 A;  5KMG A;  4EKW A;  1JMK C;  3O9O A;  5IWA O;  5D5Q A;  1KKD A;  2ITD C;  3ICX A;  3HKC B;  3UKM A;  5E79 Z;  4MSW C;  3T1H O;  3ZMV A;  4EEQ A;  4MVS A;  5KAF Z;  4DR7 B;  4ZIB A;  2EBO A;  2ZDI A;  4PA9 A;  4UCU A;  1NZ6 A;  2P22 C;  3WFV A;  1F4N A;  3OD4 A;  1NQT A;  3B2E E;  1N32 B;  1XNR O;  4JI3 B;  4LBE C;  1L8D A;  3U11 A;  4UXN A;  1SA0 B;  1I94 B;  5CA0 B;  2VQE O;  2Q73 A;  1XMO O;  1EN6 A;  1BSM A;  1VQO V;  1NU1 H;  4DV3 B;  3SYP A;  3HR0 A;  3C90 A;  2DE0 X;  1S0V A;  4RO2 A;  4B3R B;  2Z3Y A;  3F5T A;  1COW G;  1XUQ A;  4J7Z A;  3HKD B;  4DV2 B;  3JAT B;  3JAM N;  1Y74 B;  4X8A A;  1K8A W;  4DR5 O;  3OE7 G;  4DV7 O;  1OCC C;  3IC7 A;  1TAE A;  2OCH A;  2PYJ A;  4BIU A;  4GX1 A;  2XAH A;  5FL7 G;  1UFI A;  3OFN G;  4TV8 A;  2YS8 A;  2EX3 A;  2V1D A;  2IW5 A;  4J9Z B;  4JZ2 A;  1JFF B;  5L3G A;  4U7O A;  3AEI A;  1IXB A;  5IJ9 A;  1FS0 G;  3FD9 A;  3KZI Z;  2QTS A;  1SQQ H;  3BY6 A;  1AR4 A;  2QWO B;  4X65 B;  3VQV A;  2UXB O;  2KB1 A;  1EZV H;  4JYA B;  1PNL A;  3ABK C;  3UCS C;  1M5I A;  3D3Q A;  4FFB A;  3JAW B;  3B77 A;  3THO A;  5IYD O;  1SC5 B;  3OEE G;  1N4C A;  5EBM C;  2F4V O;  1AI5 A;  1IXM A;  2XND G;  3ZHR A;  4I55 A;  4QIW F;  3ZHT A;  2JJ2 G;  1W2B U;  1QLE B;  3ZJZ A;  4NXM B;  1FXH A;  3HKE A;  5F2V O;  3LDC A;  2CK3 G;  2X7R B;  3CCM V;  3RFR A;  2NN4 A;  4B3S O;  1BE3 H;  4JTC B;  5FPO A;  1HW7 A;  1H2L A;  1S77 D;  1YI2 V;  4DRX B;  2JK5 C;  4BW5 A;  1M57 B;  2N74 A;  2W6I G;  4TSF G;  4JYC A;  3J80 N;  1SRY A;  1JA8 A;  3LDD A;  4DW1 A;  4DV0 O;  4LF9 O;  5J2T B;  4AQY O;  2Z0A A;  4LF6 O;  1T5E A;  1S5L Z;  4JAU A;  1QVG U;  3OT7 A;  3H9V A;  4I0X A;  1MAB G;  1HWY A;  5KX5 A;  4WBN A;  2QKC A;  1N33 O;  3JAR B;  4UCS A;  3APO A;  3VQX A;  5LP6 C;  5GTI Z;  3FB8 C;  4DR4 B;  4J80 A;  5JJJ B;  3DSQ A;  4MT8 A;  2QE7 G;  4DV6 B;  1P84 F;  4TV9 A;  1VQN V;  1Q6I A;  3W7W A;  5LXT A;  1H2N A;  3J81 N;  3STL C;  4HNA B;  4JI7 B;  1HNZ B;  3SJB C;  3A0B Z;  1WA8 B;  4X88 A;  4NTY A;  2RDC A;  3D8C A;  2LGW A;  1F4M A;  1EN5 A;  2ZT9 B;  4GYC B;  4LF8 O;  4UVC A;  2YI9 A;  4TWK A;  3ABL C;  3CJH B;  3SJQ C;  5CMU A;  4CS2 A;  2Q0O C;  3F5W C;  1NTK H;  1BL8 A;  5EC1 C;  4FZ0 A;  4DV1 O;  1AI4 A;  1VQP V;  1THZ A;  1OCC B;  3JSN A;  5KHK A;  4KHP O;  1EBO A;  1NVP B;  1FXK C;  3K5M A;  5EC2 C;  5KX5 B;  4E4E A;  3GVM A;  3OUF A;  2QGN A;  2RCV A;  2E5L B;  2CGO A;  3CCV V;  2DYS C;  4R50 A;  5DEC A;  3CCU V;  3ZRW A;  3F7Y C;  4OX9 B;  4P9P A;  1H2S B;  3ABU A;  2R72 A;  4PDV A;  2NLJ C;  1XNQ B;  2UXD B;  1KUQ A;  2GBO A;  2QWP B;  1FFT B;  4KL1 A;  1AJP A;  2YIC A;  3JCZ A;  3T1Y O;  4O2A A;  3CHX A;  4JI5 B;  1N36 B;  1XDC A;  1V55 C;  4H13 B;  1K33 A;  4G27 B;  5LP6 A;  1GM9 A;  4TQF A;  1VF7 A;  1ENV A;  4YXW G;  5EBW C;  4GLX A;  3ASO B;  4F6R B;  5J9P C;  1ARO P;  3K5N A;  1Z2G A;  3H1K H;  4DR1 B;  3VBB A;  1JR9 A;  4K8X A;  3TCU A;  1QR9 A;  2D3O W;  3TXQ A;  2KKW A;  5B1B C;  3ZX6 A;  1J5E B;  1ZAU A;  4WFF A;  5LA6 B;  2KSD A;  5IDJ A;  3G80 A;  2W6J G;  3HKB A;  1ZL8 B;  4RAI A;  4LFA B;  5ITZ A;  4H33 A;  3K06 A;  1TGO A;  3I55 V;  5IJ0 A;  4DR3 O;  2OWO A;  5EZY A;  3ZN1 A;  4JZG A;  1V9P A;  4LP8 A;  1QQC A;  3L73 H;  4XDL A;  4RQF A;  3ZRV A;  4DXW A;  2PZS A;  1FXK A;  4MVO A;  3CMA V;  4X64 B;  2RNB A;  2ZXW C;  3OR6 C;  5BZB A;  1YDX A;  2QR4 A;  2BOC C;  4IYI A;  3CCQ V;  2CAZ C;  2R9R B;  1CXZ B;  2N04 A;  4UB8 Z;  1JJ2 U;  5CN0 A;  3ABL B;  5EYP A;  2QM8 A;  2B1G A;  4YY3 O;  4DW0 A;  4X1K A;  2JIZ G;  1GAX A;  3RVZ A;  3NXS A;  2Z5U A;  3RGB A;  1PPJ H;  3AK3 A;  3JCU Z;  1GN3 A;  2OIE A;  3FAV A;  1GM8 A;  3MHS C;  3E8H A;  2N05 A;  3CCR V;  1PM9 A;  2Y4T A;  3E8B A;  4JV5 B;  2F66 C;  2IU3 A;  3VQW A;  2HJF C;  1FFX B;  2QM7 A;  3PN1 A;  5EIB D;  4CH5 A;  3BAB A;  3RYH B;  1ZX3 A;  2ADQ B;  5D5P A;  1KYO F;  1K4D C;  2JS3 A;  3DXR A;  1XRE A;  2WPD G;  3E8F A;  2BSK B;  3T4D A;  4I50 A;  1GMG A;  1SZX A;  3CRC A;  3G6E V;  3SPG A;  2VWJ A;  4JPR A;  3KG2 A;  1SF9 A;  2LGQ A;  3EHB B;  5CB4 A;  2XUM A;  4Z1M G;  1AB3 A;  3EVK A;  4LC1 A;  4ZHQ B;  4X66 B;  3X2Q B;  1JOY A;  1K7D A;  1V55 B;  4DUZ O;  3OW2 U;  1WAZ A;  2P67 A;  2K1E A;  2FYU H;  4Z2W A;  5DED A;  5GON A;  3JD2 A;  1B6Q A;  5LMN B;  1M4U A;  1JVM A;  1WPB A;  3JD0 A;  3SPI A;  5LMU B;  3H1L H;  4E2L A;  2FML A;  1D5N A;  2P90 A;  1B3Q A;  2YXY A;  2ZKO A;  1ZSP A;  2MK3 A;  4NKG B;  2E74 B;  3BFR A;  2ZE8 A;  4U3F H;  2GV9 A;  1BT8 A;  5B1B B;  5LHG A;  1F51 A;  5LOV B;  2DWE C;  4LH7 A;  1Y76 A;  1KKC A;  4JI0 O;  1PNM A;  2QWN B;  4NYK A;  1XMQ B;  1I94 O;  3BRC A;  4YIO A;  2W0F C;  2QJ1 A;  4DV3 O;  1GTO A;  2EZP A;  3APQ A;  1VQ6 V;  2DW4 A;  2BTQ B;  1F7Y A;  1IBL B;  4H0L B;  5A9G A;  3RT3 C;  2UUB O;  1GM7 A;  2ZXW B;  4DR6 B;  3TK1 A;  4DV2 O;  3TJT A;  5JCO A;  3RYC A;  3E22 B;  5IYB O;  2Y48 A;  2PYL A;  3ZMS A;  1Q82 W;  4O2B B;  3VOU A;  5CBH A;  2JGD A;  5JJE B;  3AG3 C;  1NH2 D;  1KBH A;  1SZT A;  1Y4M A;  1N0J A;  1G4Y B;  2Q6A A;  1ZUQ A;  5L3D A;  4EB6 A;  4FLU A;  1BQ0 A;  4ABM A;  1I08 A;  1N8R W;  5C93 A;  3GWK C;  3ZRX A;  4B08 A;  2UXX A;  4X89 A;  4JAA A;  1Q81 W;  2X6C A;  2YXL A;  4LF5 B;  1E79 G;  1N34 O;  4JYA O;  3HKC A;  3QG5 A;  4KXR A;  2CTR A;  4QE9 A;  4B3M B;  1BS3 A;  1HNX B;  1BHB A;  3N27 A;  1U96 A;  2LO1 A;  3RYI B;  2XHB A;  4O4L B;  1YSC A;  1QLE C;  2M7W A;  3H1H H;  1FD9 A;  4DV4 O;  1SA0 A;  1K92 A;  2YI8 A;  2ZM6 B;  1EN4 A;  2YDE A;  5CA0 A;  1OCR C;  4DK1 A;  4K0K B;  4JI2 O;  1BMF G;  2RQ6 A;  4ZOL B;  2P06 A;  1P4R A;  2X6A A;  4BIZ A;  1RM1 B;  4PHZ A;  3W7S A;  3CXC U;  3CCS V;  3ZED A;  3HKD A;  4LWS B;  1HP8 A;  3OTF A;  4YJ3 B;  5LGT A;  3JAT A;  4NB5 A;  5IE9 A;  1Y74 A;  3Q4H B;  4ZI7 B;  3JAL B;  4O4I B;  4QJF B;  2CTQ A;  4F4L A;  3SYO A;  3CP1 A;  5L3E A;  3HPL C;  4FK5 C;  4UCT A;  1PV0 A;  3DC5 A;  4AHC A;  4KFM A;  4OPA A;  2ZNJ A;  3K79 A;  3LSU A;  4JI8 B;  4LF7 B;  4DR4 O;  1VIB A;  2E75 B;  1JFF A;  3FKS G;  1A32 A;  3IGA C;  2LP7 A;  3RYF B;  2R9A A;  5H6Q A;  3OTO B;  2UU9 O;  2DYR C;  4GUN A;  2OTJ V;  5JWP A;  3N2K B;  3CD6 V;  4DR2 O;  5KHI A;  5EBL C;  1YJN V;  3JAW A;  1MZF A;  2XTA A;  3UO3 A;  1SS3 A;  2HVK C;  1K97 A;  5H5N A;  4I9Q A;  3QVN A;  1RFY A;  1YF2 A;  4UCV A;  3JAK B;  4LNU B;  4IGG A;  4IL6 Z;  3AG3 B;  4CS4 A;  2BTO A;  1VQ5 V;  3DTU B;  2RMK B;  2EIK C;  1U97 A;  3RVY A;  2E5L O;  1VQL V;  2VQF B;  2G38 A;  4X1Y B;  3CRM A;  4C7U A;  2PF4 E;  2WLL B;  2YIA A;  5LGN A;  4DRX A;  4U3J B;  4YJ2 B;  2DQ3 A;  1G6U A;  2LW1 A;  1WLE A;  4LFB B;  3A0R A;  1VQK V;  1XNQ O;  5J2T A;  4O4J B;  2AZ2 A;  3EFF K;  2UXD O;  1WP7 A;  2P7T C;  1QU7 A;  4YHH B;  1V54 B;  1VQ9 V;  2IJH A;  3TET A;  5GTH Z;  2IJI A;  4JI5 O;  1E1R G;  3LDE A;  1G8M A;  2KQX A;  3K59 A;  2DN9 A;  3JAR A;  2UUC B;  1DLB A;  3ASO C;  2GUZ B;  2GTA A;  4KP4 A;  3E83 A;  4FLY A;  2EJR A;  4DR1 O;  4HNA A;  4PD4 F;  1FJG B;  1OCR B;  4J42 A;  3TGU H;  1S5J A;  1WA8 A;  4R7C A;  2H94 A;  4DUY B;  1J5E O;  2KG7 B;  3CME V;  3DC6 A;  4IIJ B;  1X59 A;  4I5S A;  4LFA O;  4J7K A;  3CJH A;  2F1M A;  4TT3 G;  1LUV A;  4PDL A;  4PEL A;  4L87 A;  2HG5 C;  2Q68 A;  4LF4 B;  3ETQ A;  1R6N A;  1H8H G;  4UV9 A;  2P4K A;  2F23 A;  1UJW B;  1SET A;  3OM3 B;  1ZWI C;  3AG1 C;  1CEZ A;  3BCC H;  1S3J A;  2A9H A;  4TOI A;  4UVA A;  3T1C A;  3OEH G;  4IHJ B;  2LFS A;  2YIB A;  3AG7 A;  3A2F A;  5IWA B;  2UXC O;  2DWD C;  4UB6 Z;  1IBK O;  5B1A C;  4Q20 A;  3T2M A;  2DYR B;  3UM7 A;  4GCZ A;  3ZHS A;  1TVK B;  3SYQ A;  3CX5 F;  3ZN0 A;  4WCE V;  3CRA A;  1O9G A;  4I4T B;  3BPZ A;  3CRQ A;  2A06 H;  2XAJ A;  3DGE A;  2EIM B;  1H38 A;  5LL6 Y;  1XNR B;  4NTX A;  1R6K A;  1IUR A;  1KU9 A;  2B9Z A;  4IT5 A;  2JJ1 G;  1KEC A;  4F6R A;  1XMO B;  1UPG A;  3QO5 A;  2OTL V;  1B04 A;  3R66 A;  5DM6 V;  5DN6 G;  2NR5 A;  1RSO B;  3GWO A;  4PA4 A;  2EIK B;  2IU0 A;  1AR1 B;  2UXN A;  2AZ0 A;  5JJN B;  2DJV A;  5H6R A;  2AXT Z;  5LA6 A;  5FLX N;  5B66 Z;  4N21 A;  1ZL8 A;  4B7K A;  1FYJ A;  2P6J A;  3ZBH A;  4CBC A;  5IYZ B;  4DR5 B;  4DV7 B;  2B1I A;  3ZMZ A;  2PI4 A;  5KHH A;  4ICG A;  4BAY A;  3P32 A;  3ZHV A;  1MG1 A;  4CC5 A;  4UVB A;  4X66 O;  4D7S A;  3X2Q C;  1Q90 D;  1X4T A;  1H8E G;  1SKV A;  1LUW A;  3JYC A;  4B3T B;  3IJ4 A;  5B1N A;  1F23 A;  3TXS A;  5BR8 B;  3ABT A;  5LMN O;  1XL4 A;  1HNW O;  2ITC C;  2UXB B;  2EIJ C;  4PI0 A;  4WFE A;  4H44 B;  1BGY H;  2GHY A;  4HZ3 A;  4K35 A;  1NTZ H;  2IH1 C;  3ZMT A;  2F4V B;  3BAA A;  1P7B A;  1WNS A;  5JVD B;  4J11 A;  5LYJ B;  3QNE A;  1PNK A;  5IT9 N;  3A0H Z;  4B3S B;  1MZE A;  3AG1 B;  2VWK A;  4J10 A;  5CBF A;  3K58 A;  3CYO A;  1IBL O;  2UUA B;  4NXN B;  2ZQM A;  1FFX A;  1US6 A;  4X62 B;  1VF6 C;  2QWQ B;  4WF9 V;  5EIB C;  3RYH A;  2LW7 A;  2XAS A;  2O57 A;  4DV0 B;  3FB5 C;  4HYO A;  5LGU A;  1MNG A;  4LF9 B;  2ZD9 A;  4P9O A;  4DR6 O;  2X0L A;  2BSK A;  3KCY A;  3CCJ V;  4AQY B;  1MOF A;  3D36 C;  4LF6 B;  3SDL A;  3ZMU A;  5B1A B;  4YIP A;  4CH6 A;  3W7X A;  2Y4U A;  2OCC C;  3CB2 A;  2WLM A;  1TUE B;  4R8C A;  3K0G A;  4K8Z A;  1N33 B;  3LUT B;  3CSX A;  4ZHQ A;  5JH7 B;  1HR0 O;  5C8Y B;  4CC6 A;  1IZ3 A;  2AHZ A;  1NKD A;  4O4H B;  3RN4 A;  2EIN C;  2XAG A;  3N2G B;  4LF8 B;  2WA3 A;  3B40 A;  2QA4 V;  3H1J H;  3FX7 A;  2JGU A;  3ETG A;  2ZIN A;  5FPR A;  4J7J A;  1IBM O;  1VQ4 V;  4LFC O;  1YJ9 V;  4MTO A;  5LOV A;  4UV8 A;  5FNV B;  4DV1 B;  3L70 H;  2R9I A;  1K5Q A;  2HFE C;  1O9H A;  2Y69 C;  4WFG A;  4UCO A;  3LSS A;  3I56 V;  3OMI B;  2AGA A;  3ZHQ A;  3SPJ A;  3OGI B;  2YXH A;  1H2K A;  4FLT A;  2Q9L A;  1BZK A;  4CH4 A;  2BTQ A;  3AG4 B;  1VF6 A;  1AJN A;  2R70 A;  4NVP A;  1K5S A;  1NS1 A;  4D6T H;  2HP8 A;  1RM1 C;  1YVW A;  1YIJ V;  2Q69 A;  3D36 A;  1Q8I A;  1YTF B;  3E22 A;  4P30 A;  2YSU B;  4GT1 A;  4AI8 A;  2EIJ B;  3K04 A;  3IC9 A;  4O2B A;  3PJS K;  4LH6 A;  3M7M X;  4DR7 O;  3OR7 C;  3RW0 A;  1CP9 A;  2EIL B;  1N32 O;  1L0N H;  2PI5 A;  2JEU A;  4JI3 O;  2PY5 A;  1N0N A;  1FAF A;  1SQX H;  4GX5 A;  3OTO O;  3L74 H;  2Q7H A;  2FL4 A;  4FM2 A;  1Q43 A;  4G2K A;  1BHA A;  3WB1 A;  1RPO A;  1YIT V;  1Q7Y W;  4JTA B;  4B3R O;  4DR3 B;  2A0L A;  3B8M A;  2A3Q A;  3RYI A;  4XDJ A;  3K9S A;  3CC7 V;  1D2D A;  4O4L A;  2IJJ A;  4JI4 B;  1SQF A;  2Q0A A;  2OCC B;  2F93 B;  4CS3 A;  2AW9 A;  2EUL A;  4RUE A;  1EM1 A;  4K3A A;  2BOB C;  2IM9 A;  4LCU C;  2E3C A;  1OZ0 A;  5BXZ A;  2WLN A;  1JPX A;  2JRI A;  2V4D A;  2OYQ A;  2HJD A;  2HHH B;  3CCL V;  1S76 D;  4ZOL A;  1XI1 A;  2OT5 A;  1S72 V;  4X9Q A;  2QM4 A;  4LWS A;  4WFH A;  4YJ3 A;  1VQ7 V;  1B06 A;  4X65 O;  3Q4H A;  2Q7E A;  1YJW V;  4ZI7 A;  1QBZ A;  3L9D A;  5J2U B;  3JAL A;  4O4I A;  3SYA A;  2ZDI C;  2EIN B;  1V54 C;  4FZ1 A;  1QLN A;  1WP8 A;  3P30 A;  1DF5 A;  5K1X A;  1Q86 W;  4YY3 B;  3CC4 V;  2WLJ A;  2YEV B;  4GKK B;  4XBF A;  5KHJ A;  3GB7 C;  4PV1 B;  1JQ0 A;  3JD1 A;  2UUC O;  1NT2 B;  3ETD A;  3EXA A;  2VS0 A;  2P5O A;  1PL4 A;  4NXM O;  2Y69 B;  5CA1 B;  5L3F A;  4TUY B;  4X20 B;  4JI1 B;  3STZ C;  2QKS A;  3RYF A;  4HAM A;  1MSW D;  1VQ8 V;  3N2K A;  4MVZ A;  3SR2 C;  3E35 A;  1BQZ A;  2IBZ H;  3JAS B;  3QO7 A;  1TUB B;  3U10 A;  2HR3 A;  4DV5 B;  2HKO A;  2ZE6 A;  1XQ8 A;  1EFR G;  1K34 A;  1K9M W;  1PKX A;  3ZS8 C;  2E76 B;  2HEP A;  3CXH F;  2V7Q G;  4I9W A;  3JAK A;  4LNU A;  3MAQ A;  1YZB A;  2WLI B;  4DUZ B;  5B5E Z;  1M90 W;  3G67 A;  4X1Y A;  5JQG B;  1WJZ A;  5HFM A;  5L3B A;  1NR7 A;  2WLL A;  1M1K W;  4U3J A;  3C3T A;  5CBG A;  4YJ2 A;  1FPO A;  4DV6 O;  3G4S V;  4GX2 A;  2AHY A;  2FTK A;  3F7V C;  2Q8V A;  1KP2 A;  3AG2 C;  4JI7 O;  4O4J A;  1HNZ O;  2JDI G;  5B3S C;  3OUS A;  4JAV A;  3BA8 A;  1GKF A;  1K73 W;  5BY1 A;  1Q6H A;  1ZTE A;  2EIM C;  4JI0 B;  4HBN A;  3ABM B;  4AIL C;  3KCX A;  4F6E A;  1GO3 F;  2GDS A;  3S3W A;  2GUZ A;  4J9Y B;  4GZR B;  4MVU A;  1HDJ A;  3UT5 B;  2Q7G A;  5IY5 C;  2ZR3 A;  4PDR A;  2CH7 B;  4DK0 A;  5BMV B;  1Z5W A;  4FPP A;  2UUB B;  1K3E A;  4JI6 B;  5KMG B;  4FM0 A;  4UUJ C;  2KG7 A;  3HB3 B;  3E8G A;  4IIJ A;  1SQB H;  3K08 A;  2GSM B;  1KB9 F;  1RP3 B;  3NR7 A;  5L3C A;  4OX9 O;  1KC8 W;  4TQD A;  3H01 A;  2ZE5 A;  1QNM A;  3LNM B;  1I0H A;  3LSQ A;  4B7E A;  3WB2 A;  5KHG A;  1VEW A;  2X6B A;  1P49 A;  4GKJ B;  2DOS A;  4MTF A;  1N36 O;  2P4V A;  1QCE A;  2YC0 A;  5E1A C;  2QTO A;  4IHJ A;  5KUM A;  4FLX A;  3OAA G;  4B3T O;  4FJC C;  2XOK G;  2PGG A;  4ZBM A;  5BR8 O;  2XAQ A;  2D2C B;  3O65 A;  5A2Q N;  2VRZ A;  1W0K G;  1NR1 A;  1N34 B;  3OMA B;  3QTC A;  1KQS U;  1TVK A;  4U7N A;  4UFZ A;  1SES A;  2LQT A;  1Q5O A;  1YXB A;  1Z5V A;  3OMN B;  1KMI Z;  4I4T A;  1OHH G;  3JD4 A;  3CWB H;  2BCC H;  2Q5Z A;  3ASN C;  1XEQ A;  3B4S A;  4DV4 B;  1AP6 A;  4KUM A;  1NVP D;  4FLV A;  2RJZ A;  3AK1 A;  1OCZ C;  4RQE A;  3WB0 A;  4JI2 B;  1M93 A;  1VMG A;  4NTW A;  1YEW A;  3WG7 C;  4TV8 B;  3VQY A;  1PD3 A;  1H2M A;  2YIB D;  5B1O A;  1YHQ V;  2UUA O;  1RSO A;  4R6Z A;  4NXN O;  4X62 O;  4X64 O;  3S3X A;  1VP7 A;  2A79 B;  5IJ9 B;  2WLH A;  3BEH A;  3K3W A;  3ML0 A;  1DF4 A;  5KLV H;  4UCR A;  5IYZ A;  1EZJ A;  4Q6G A;  2CDY A;  3AG2 B;  3T1H B;  4OGQ B;  2CTW A;  4FFB B;  5B3S B;  4XDK A;  1R3I C;  4BWA A;  3R65 A;  4I55 B;  3MHH C;  3QF7 A;  1JJO A;  2LJ2 A;  3HKE B;  1PL0 A;  2IJK A;  3QO8 A;  1GH6 A;  2UU9 B;  1WB8 A;  4I7Z B;  1MMM A;  2ATK C;  2VQE B;  3H1I H;  3OGC C;  4OXS A;  3ZHU A;  2HVJ C;  1P7G A;  4DR2 B;  4JV5 O;  3W7U A;  5IY5 B;  3SPC A;  3E86 A;  4QGP A;  2CGN A;  2LFR A;  4JF3 A;  1QHT A;  2K9P A;  5TIS Z;  2Q4P A;  1AJQ A;  1PP9 H;  4PA7 A;  4JYY A;  3UQ8 A;  5JVD A;  3K5L A;  2QSA A;  2L6L A;  3LNN A;  4BW9 A;  2H8P C;  1YCI A;  4I0X B;  5LYJ A;  3ZRS A;  5EK0 A;  3FYI B;  4WBN B;  3RBZ A;  3L72 H;  1M56 C;  4L8J A;  1DTO A;  3IFX A;  1XL6 A;  4D7T A;  1H2G A;  4JYB A;  2GTS A;  1ZLZ A;  4W4K A;  3AG4 C;  4MVR A;  3AK2 A;  4TV9 B;  5IYC O;  5LXT B;  1IVS A;  1DGS A;  3M99 B;  3T4Z A;  3E89 A;  1W59 A;  5LMU O;  4DO2 A;  3P3P A;  3ABK B;  4FIP C;  1D5A A;  1GN4 A;  3CEI A;  4J41 A;  3D3I A;  3SYC A;  4CH3 A;  2M6Y A;  1S5H C;  2ZCE A;  1K4C C;  4MVM A;  2FKX A;  1QR8 A;  5JH7 A;  5C8Y A;  3K5O A;  1GN6 A;  5KAI Z;  3ASN B;  1VF5 B;  2EIL C;  4A5U B;  1GRJ A;  5KUK A;  4X1I A;  2MW2 B;  3L71 H;  2ZIM A;  1URF A;  3UO2 A;  1XMQ O;  1NBM G;  1OCZ B;  1OJH A;  3K03 A;  4O4H A;  1R1B A;  2ZIO A;  1QVF U;  3WG7 B;  4FLW A;  4FMT A;  4PA6 A;  2ARH A;  1NJI W;  4WFB V;  1XBL A;  1SER A;  3N2G A;  4OPH A;  5H9C A;  3ZRW B;  3FB6 C;  4P2Z A;  4MW8 A;  1R3L C;  4RUF A;  3E2E A;  2CTP A;  5FNV A;  1R73 A;  1Y6X A; 
#chains in the Genus database with same CATH homology
 3L70 H;  3L72 H;  3CWB H;  2BCC H;  4D6T H;  3CXH F;  1BGY H;  2A06 H;  2FYU H;  1L0N H;  1NU1 H;  1NTZ H;  1PP9 H;  1SQQ H;  1NTM H;  2IBZ H;  3H1L H;  1NTK H;  1P84 F;  1SQX H;  3L75 H;  5KLV H;  1SQV H;  1L0L H;  1BCC H;  1SQP H;  1EZV H;  3L74 H;  4PD4 F;  3TGU H;  1BE3 H;  3H1J H;  3H1H H;  3H1I H;  1KYO F;  4U3F H;  3BCC H;  3CX5 F;  3H1K H;  1SQB H;  3L71 H;  3L73 H;  1PPJ H;  1KB9 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...