1SQQH

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 18
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1sqqH00
3L71H 4D6TH 1SQXH 3CXHF 1EZVH 3H1IH 3TGUH 1KYOF 3CX5F 1SQVH 3L73H 5KLVH 1SQBH 1BCCH 2A06H 3BCCH 3CWBH 3H1HH 1L0NH 3H1LH 1KB9F 3H1KH 1P84F 1NTZH 1NTKH 1L0LH 1NU1H 3L70H 1PPJH 4PD4F 3L75H 2BCCH 2IBZH 3L72H 3H1JH 1PP9H 2FYUH 1BE3H 3L74H 1SQPH 1SQQH 1BGYH 1NTMH 4U3FH
chains in the Genus database with same CATH superfamily
2KSDA 4R7CA 2KQXA 3OE7G 4I4TB 1E1QG 1AR1B 3BVOA 4KL1A 4K3AA 2WWWA 4OX9O 3ZRWB 2F95B 4DR1B 4FK5C 1JOYA 2BSKA 2Q7GA 3CHXA 5FPRA 1B04A 3OGCC 4JI1B 3I56V 2B9ZA 4B3MO 1AP5A 4CH6A 3ETGA 4UVCA 4GUNA 3VQVA 3CX5F 2YSUB 4B3RB 1RSOB 3HR0A 1CEZA 2WLLB 2D3OW 4UVBA 4DV4B 2YIDA 2UUBB 1ZUQA 3EFFK 1WP7A 4NTYA 3OMIB 1SQPH 4QPKA 3T1HO 1WP8A 3CP1A 1Y66A 4PA4A 3RVYA 1J5EB 4J42A 3K03A 1EN5A 2ZQMA 5H2FZ 4BW5A 1W2BU 2O57A 1XL6A 4OPHA 2WLIA 2N74A 2EJ7A 1WAZA 1BZKA 5EZYB 2V4DA 2ZD9A 2ZT9B 5D5QA 2QR4A 3L9DA 1XUQA 2LW1A 2GTAA 4X1IA 2V1DA 1M56B 5HFLA 3OGIB 5LA6A 1JR9A 3P3PA 4JI8B 3W7SA 4DR1O 3SYOA 4WCEV 3FAVA 2R70A 4JI1O 2UXDO 3IJ4A 2WPDG 3VQXA 2LJ2A 1YTFD 4H37A 2QTOA 5EC1C 3JD1A 3LNMB 4B3RO 2DQ0A 3L73H 4UB8Z 3CCUV 5J2UB 4ZHQB 3ASOB 4DR2B 4BW9A 2XHBA 1ZTEA 1N36B 4DV4O 2UUBO 4TV8A 4DR6B 4X89A 2WLJA 2M6YA 3QG5A 2QSAA 4XDKA 3L74H 2OYQA 2LQTA 2R72A 1JA8A 4J7ZA 1J5EO 1VQNV 1QLNA 4FJCC 4Q6GA 3DXRA 5BXZA 3LUTB 2ZINA 2RN9A 4F6RA 1FD9A 1QU7A 2CGNA 3H1JH 5KX5B 4UVAA 1K97A 1HWYA 2LFSA 1Q86W 2L35A 4CBCA 1IURA 2HVJC 4JI8O 2EILB 1CPYA 3PJSK 4L87A 2CGOA 1MABG 3OAAG 2HJDA 4C7UA 4JAAA 4CS3A 3A0BZ 5ITZB 1XNQB 1Y6XA 1R3IC 2ARHA 4DR2O 2DYRB 2ATKC 2RMKB 1N36O 5CB4B 4PA9A 1DF5A 2OWOA 5LBQA 4DR6O 5LMUB 3OEHG 3UQ8A 3IC9A 3UT5B 1H2LA 3JAWB 1KD1W 4K35A 4CS2A 3ZHVA 1IX9A 2DW4A 1VMGA 2IM9A 1VEWA 4MTXA 3E86A 2OIEA 2OCCB 3CCEV 4GKJB 2Q8VA 1X59A 1FKAO 2HG5C 1KBHA 1QR8A 3K3WA 1V55C 4PDRA 2WLMA 3SPCA 3PN1A 1P7GA 5JH7B 4Z2WA 4O2AA 2A9HA 3STLC 3JCZA 5EYPA 2CTWA 5L3BA 3ABMC 3EVKA 2LGQA 1L0LH 1OCZC 3SJCC 1K4CC 1QR9A 5IYZA 3BEHA 2HKOA 2WSSG 1AI7A 4I55A 3CD6V 1Q6IA 3JSNA 1JMKC 5CA1B 2Q7HA 4B08A 1Q82W 2CE4A 1XNQO 5D5PA 5IT9N 2ZXWB 3R65A 3TGUH 4GT1A 2XNDG 4QIWF 2XAGA 1GTOA 1ZL8A 1S5JA 2Y4UA 1RM1C 1TA8A 5LOVA 4BR6A 5LMUO 4I0XB 5KMGA 3H01A 3NXSA 1AJNA 4TSFG 1Q5OA 3K58A 2BSKB 3JASA 4UCSA 5LHIA 4K8XA 1Y76A 2PUSA 5LMNB 2ZE8A 5L3CA 4IL6Z 2A06H 4GKJO 4BIOA 2VQFB 1AI4A 1OCRC 5B1BB 2B1GA 1K4DC 3U0ZA 1KMIZ 4NKGB 2ZE5A 3ZMSA 3KCXA 1WB8A 2IBZH 1W0JG 4Z1MG 3K06A 2Y48A 4DK0A 1Q3EA 2IH3C 3Q4HB 5LP6C 4LNUA 2E74B 4MW8A 2YS8A 1L1FA 1W0KG 1FFTB 3RWRD 3T2MA 5LXTA 1YTFB 3ZN0A 4CZZA 3SJBC 1XHZA 4P9PA 1URFA 4X66B 2WLIB 4JV5B 1EN4A 3RYIA 1JX9A 1VF6C 2GTSA 3CRAA 3SPGA 4X1IB 1YF2A 1PV0A 4XBFA 2YXLA 2UXXA 1ORQC 2BOCC 3ZMZA 5LP6A 4O4HB 2QE7G 3HKDA 1NI8A 2UXBB 2BTOA 1Z5VA 1NR7A 3K0GA 2XOKG 5LYJA 4PI2A 1YI2V 3FYEB 3ZRXA 3CJHA 1GM8A 4NXMB 2E3CA 2ZIOA 4UCRA 4B3TB 1VF5B 5LMNO 3CCVV 4P9OA 1OCOC 1M4UA 2WAMA 1VF6A 2VQFO 4A5UB 5KAFZ 4WFGA 2YC0A 2AXTZ 4HZ3A 4JYCA 2FMLA 2N05A 5LGTA 4X1YA 1DLBA 1OCCC 3WB0A 3BPZA 4RUEA 4YY3B 3TJTA 3U11A 5L3FA 2P6JA 3LSQA 3EXAA 5DN6G 4JI3B 4PA3A 5J9PC 1VQOV 3OEEG 2X6BA 3GWOA 4CH4A 1O9HA 1US6A 4X66O 4TV9A 3CCRV 4JGSA 4JV5O 4F6RB 1FXHA 2KG7A 5J2TA 3SYPA 3OUSA 4E2LA 3QVNA 2BE3A 2VWKA 3S3XA 3P30A 3D3IA 4B3SB 4F6EA 4K0KB 4LFAB 4AQYB 1NH2D 5JVDA 4H44B 2UXBO 5L3GA 5GTHZ 3ICXA 4ZOLA 5LHHA 2PY5A 3B77A 1RPRA 5JQGA 5KA6A 3UO2A 2EULA 1XMOB 2Q4PA 1I94B 2EIMB 4NXMO 5GONA 4UV8A 4J7JA 4B3TO 5BZBA 2HLDG 4LFBB 3SYQA 3RYCA 3K57A 2HHHB 4IT5A 2NN4A 3GB7C 4X65B 2HEPA 2Q68A 2EIJB 3K5NA 4FZ0A 3L75H 4O4LA 2CAZC 1PNMA 1VQ6V 2Q73A 2Y69C 3G6EV 4DV7B 1VP7A 1VQ9V 4GX5A 1K5SA 3SGIA 3J80N 4YIPA 2Q6AA 4YY3O 1AROP 4LF6B 3IGAC 3AK2A 4JI3O 4RO2A 1J95A 4TWKA 3OR7C 4CH3A 4TT3G 1HNXB 5IJ0B 3FB5C 1WPBA 4JI2B 4X88A 4MTFA 3HB3B 2OCHA 4EEQA 1K33A 1SZXA 2ILMA 4O2AB 4B3SO 2XAQA 4K0KO 4LFAO 1D2DA 4AQYO 1EBOA 4HAMA 5KHJA 3LDEA 2QWQB 5EYPB 4PA7A 3ZHTA 1AR4A 3X2QC 3QF7A 3S3WA 3RGBA 1XMOO 2LP7A 1I94O 1WA8A 4LFBO 3ABLB 3LDCA 4DV6B 4WFFA 1H2NA 3GVMA 1JJ2U 2HHHO 1TUEB 4JTDB 1V55B 4YJ2A 4X65O 3CC4V 5BMVB 2X7RB 3UO3A 3OFNG 5JWPA 4R50A 1BL8A 1VQ5V 2XTAA 4IYIA 3ZHQA 1XDCA 5KMGB 2A0LA 4DV7O 4LF4B 4CS4A 1KUQA 4LFCB 3JASB 4FMTA 4KFMA 2JDIG 4BIZA 4TQDA 4PDLA 4LF6O 2CTRA 2P67A 1LNQA 3I55V 2ZE7A 1Y76B 2G38A 2L6LA 1OJHA 3AG4C 4B7KA 1FYJA 3HKEA 5K1XA 2UUAB 2CH7A 1HNXO 3CCQV 1PL4A 3TETA 3NR7A 4CH5A 2YIBA 4JI2O 1DGSA 1KU9A 4NTWA 1M5IA 3KKYA 3K08A 1UFIA 2DN9A 4ZI7A 3N2KA 4LNUB 3AG1C 2XUMA 1MNGA 1K34A 1H38A 1GN6A 4FZ1A 3BY6A 5LXTB 2P06A 2JGDB 2F1MA 3ZHSA 4O4JB 3T4ZA 1L8DA 4FLYA 3JD3A 3RYFA 3M99B 1YCIA 4HBNA 2JEXA 4DV6O 3D8CA 1PL0A 3RYIB 5EIBC 1F4NA 3K79A 4J10A 1R3JC 4EB6A 3SJAC 4H13B 2GV9A 4DW0A 1M57C 1VQMV 2BCCH 5GTIZ 1W59A 2ZNIA 2QWNB 1EN6A 4FLZA 4LF4O 2ZIMA 1XREA 3G4SV 4LFCO 3CJHB 3K0DA 5EC2C 5C8YA 1SQXH 4I50A 4KP4A 4YHHB 3ZBHA 1KECA 3B8NA 4FLUA 2WLKA 4FM0A 3ZMVA 2DQ3A 4I9WA 4B7EA 3W7UA 5B1AC 1ZAUA 2UUAO 5CA0B 1V54B 1YITV 4W4KA 1QVFU 3CXCU 3K04A 2GDSA 1MA1A 4J11A 2DMXA 1KP2A 1SQQH 1NTMH 2YEVA 4J7KA 1NH2B 2BOBC 4FLXA 4JYBA 2ZR2A 3JATB 3JD0A 4LH7A 3HKBB 5H9CA 2P90A 2JGUA 1LUVA 5B3SB 1JCHA 4LH6A 1R6TA 1N0NA 1N34B 1AI5A 4NTXA 2QWRB 4TV9B 3C3SA 3T1CA 2JRIA 1QLEB 2EBOA 1KKCA 2IH1C 2B5UA 2Q0AA 1H8HG 4GLXA 3K5LA 2EZPA 2PI5A 3O9OA 1XOUA 1YJNV 4O4IA 1U97A 2EX3A 3CRCA 3ML0A 1Z5WA 4DK1A 3K5MA 4DO2A 1FFXA 1BHBA 5JQGB 1FJGB 1S77D 2QM8A 2WA4A 2E76B 4JTAB 1Q6UA 3N2GB 1XQ8A 3OT7A 3RT3C 4WBNA 5GONB 5F2VO 4YHHO 3T4DA 1HW7A 3RYCB 2NLJC 1VQLV 3CRRA 2ADPA 4LP8A 4WFAV 2JJ1G 2X6AA 3RFRA 3AEIA 1G1XB 2Q9LA 3AG3B 4O4LB 5IY5C 2Z3YA 3E22B 1O9GA 1SETA 4X62B 2R9AA 3KCYA 1I7FA 2EINB 3TXSA 4JZGA 2K1EA 4AI8A 1P7BA 4N21A 1F4MA 2ZDIC 1G6UA 5E79Z 1PM9A 1IBLB 3E2EA 1F23A 4PV1B 1N34O 1ENVA 4F4LA 4DR5B 4FFBB 3VBBA 3P3NA 2DYSC 3QNEA 4ICGA 3JARB 2ZM6B 3M8AA 2QM4A 2Y69B 1SRYA 4JYAB 2KB1A 2ZDIA 3J7AU 4LCUC 4J9ZB 3ZEDA 4GYCB 1FS0G 1FJGO 3RYHA 4MTOA 3ETDA 2ZKOA 3T1YB 3BCCH 1P4RA 3CEIA 3ZJZA 3B09A 4YJ2B 3OTFA 4JYYA 4QE7A 4U7NA 3VOUA 4IIJA 2PGGA 1MSWD 2EIKC 4X62O 1DF4A 3X2QB 4WF9V 3FD9A 1XMQB 4ABMA 4MTGA 4WFBV 3HKEB 1FPOA 3CSXA 1HP8A 4OPAA 2CUGA 1NKDA 2W6IG 2YIAA 2H3OA 4O2BA 3DC5A 2C2AA 4LBEC 1ZSPA 3WB1A 4DR5O 1XL4A 2JK5C 1CP9A 3ZN1A 1Q81W 3DTUB 3JAKA 4JPRA 2ZM6O 1WB7A 5BR8B 4FM1A 3BRCA 1OZ0A 1YJWV 1BQ0A 5BY1A 4JYAO 1MSDA 3WB2A 3CC2V 2IU3A 3FB6C 5IYBO 1YHQV 3ZS8C 3OTOB 1E79G 3AG4B 3SR2C 1GRJA 4CC6A 4UCUA 2E75B 1FXKC 4MT8A 4DV2B 3TXQA 2VWJA 2YXHA 3FFQA 4JI5B 3RYFB 3T1YO 5AG2A 1SERA 4N23A 1N8RW 3H1HH 2LO1A 5K1PA 4FM2A 1GMGA 4P30A 1H2GA 3CMAV 1K9MW 5KAIZ 3G6BA 3AG1B 1SQGA 5CBHA 2YICA 1YJ9V 1B3QA 4U3FH 3CS5A 3L71H 5IJ9A 2XAJA 5L3DA 2WLLA 4FPPA 4RUFA 5DECA 4I50B 1XMQO 1FXKA 4FLVA 5LA6B 2X6CA 1BHAA 3B40A 1IXBA 2RNBA 2QKAA 3L70H 5KHKA 1PPJH 1E1RG 4PD4F 3FB8C 4AHCA 2Y0PA 3ASNC 1YEWA 3FAVB 3DGEA 4D6TH 4XDLA 2YEVB 2OTLV 4LC1A 2X0LA 5BR8O 5EZYA 2P4VA 3UM7A 2Q0OC 1THZA 4KUMA 5H6RA 4NXNB 4H0LB 1N0JA 3ASOC 3AG7A 2Z5UA 4TV8B 3OTOO 2DWDC 2M7WA 3K5OA 3SYAA 3CCMV 1YIJV 2ODMA 3SPJA 4D7SA 4DV2O 3HKCA 4JI5O 1I08A 2GBOA 4EKWA 1SC5B 4DV0B 2UU9B 3DSQA 3DXRB 3E89A 3F5WC 3ABTA 1Z2GA 2RDCA 1D5NA 2OT5A 2FL4A 4O4IB 4DV5B 1QCEA 4RWUA 2K9PA 1AR5A 1FFXB 2Y4TA 5CA3A 3TK1A 1SA0A 1IBMB 3LDDA 4WBNB 2UXCB 5FLXN 3GWKC 2QDOA 3RBZA 1WLEA 2EILC 1TAEA 1MZFA 3QO5A 4MVOA 4HNAA 1IBKB 2GUZA 2ZNJA 4LF7B 1SESA 1BGYH 2D2CB 3STZC 1T5EA 2H94A 2ZCEA 1M1KW 1G4YB 3DC6A 4BWAA 1IVSA 3OMAB 1F7YA 1RP3B 2YI9A 5LGUA 4LF8B 1I0HA 4KXRA 4JI6B 2FKXA 5KX5A 1N4CA 4NXNO 2AZ2A 1JPXA 4NVPA 2F4VB 5KUKA 3ABUA 3MHHC 2IJHA 1SZTA 2DYRC 4I5SA 1R6KA 2P22C 3LSUA 1DK1A 1NZ6A 1Q43A 2NNUA 1H2SB 2W0XA 1HNZB 4U3JA 3C90A 4DRXA 5IY5B 4DV0O 1VARA 1VIBA 1GM7A 3LNNA 2UU9O 1HDJA 1NU1H 1XEQA 5L3EA 3ABKC 2A3QA 4DV5O 4K8ZA 2P5OA 1PKXA 4NB5A 4JASA 2QWPB 5A9GA 4GKKB 3K59A 3CXHF 5KHIA 3UCSC 2MW2B 3W7TA 1IBMO 2UXCO 3CCJV 3AG2C 1NTKH 1KC8W 2DYSB 2Z0AA 4Q20A 5FL7G 1GO3F 2F23A 4NYKA 1RFYA 3JAWA 3ZCCA 1IBKO 4LF7O 5IYZB 1I5YA 1Q8IA 1S0VA 4RQEA 3RN4A 4I55B 1GN4A 2QM7A 5B5EZ 1KYOF 3CCSV 2EJRA 1QVGU 2HFEC 3A2FA 2HJFC 4LF8O 2E5LB 2LW7A 3BA8A 4JI6O 3WFVA 1MZEA 3H9VA 2F4VO 1ZL8B 1JQ0A 5JH7A 4RAIA 1HR0B 5LOVB 1H2KA 1PP9H 1F51A 3JAMN 4PDVA 4L8JA 4DUZB 1UPGA 4G28B 1NVPD 1XILA 1BQZA 1WNSA 2VRZA 3ABMB 1HNZO 1OCZB 4DR4B 4R8CA 3WG7C 3VQWA 2ADQB 3H1LH 4FLTA 4JI7B 1AP6A 4JF3A 4P2ZA 5CA1A 5DEDA 4Z1VA 3CB2A 1VF7A 5B1BC 2F43G 4UFZA 4GKKO 1VQKV 1RM1B 2KKWA 3E35A 4FIPC 3BHPA 4I0XA 2B1IA 4GX0A 1HNWB 1BSMA 1R3LC 2CK3G 4LF5B 4UCOA 2UXDB 1D5AA 4MVSA 4JZ2A 4RQFA 3SPHA 1OCRB 4X1KA 5IJ9B 2QJ1A 2E5LO 5KHHA 1YSCA 4X9QA 2YIBD 1UJWB 1NR1A 1FXKB 1XNRB 5LP6B 1NBMG 3ZX6A 1HR0O 4LF9B 3HKDB 3Q4HA 2R9IA 3K9SA 3UKMA 1JFFA 2AHYA 2FTKA 4DUZO 2AHZA 3MDSA 5LYJB 4BAYA 3BABA 4MS2A 5H5NA 3E8BA 4DR4O 5LHGA 5KLVH 1XI1A 1BMFG 4GZRB 5CN0A 5TISZ 4UV9A 3H1KH 4JI7O 3BA9A 4X8AA 1AJPA 3JSLA 1PNKA 3SJQC 4X20A 2P7TC 4AILC 4ZBMA 5B66Z 3E83A 3ZHUA 1S76D 4NR1A 2ITCC 3APQA 3A8TA 4X1YB 3CRMA 4O4HA 5H6QA 4DR7B 1JVMA 2DE0X 3ASNB 3HKCB 3OW2U 1S72V 4EFEA 1KB9F 1TVKA 4J80A 1K3EA 4JI0B 1HNWO 1QNMA 4LF5O 3CRQA 3OM3B 4UUJC 3N27A 1OCOB 2VQEB 2PF4E 2N04A 2Q7EA 4H33A 4DXWA 1M9NA 2ZE6A 2KG7B 5EIBD 5J2TB 4MVRA 1SA0B 3G67A 3RVZA 1OCCB 4QJFB 1XNRO 4IHJA 3QO8A 1VQ8V 1IXMA 5JVDB 3HPLC 4LF9O 4JTCB 2FYUH 1BE3H 4ZOLB 3CC7V 1R6NA 4HNAB 2GUZB 1U96A 1KP3A 2Q67A 4LWSA 3G80A 1LUWA 1G8MA 1IZ3A 2EIMC 1YVWA 4GX2A 2A79B 4I9QA 3AK3A 1WJZA 1Q6HA 1FAFA 1I5XA 4HYOA 2EIJC 5EBWC 2GHYA 2XAFA 4MVQA 5FPOA 4QNHB 4YJ3A 3E8GA 5DM6V 4YXWG 4DR7O 4U3JB 4DRXB 2F93B 4JI0O 2CTPA 4UXNA 2YUAA 5CBFA 1GM9A 4KHPB 2VQEO 1CXZB 3JCUZ 4IYHA 2JEUA 5JJEB 1XHXA 4WFHA 4X64B 1K7DA 2UUCB 4JI4B 3R66A 2V7QG 3C3TA 1Q7YW 3B4SA 1GN2A 2IW5A 2F66C 4DW1A 1Y4MA 1EM1A 1NVPB 1NQTA 3JALA 3QTCA 2ITDC 3CE2A 2XT9A 2BTQA 1K73W 1N32B 2HP8A 3ZMTA 1WPXA 4FFKA 4DR3B 2GSMB 4QPJA 3W7WA 2NR5A 3ABKB 1AILA 1WA8B 2DOSA 1S3JA 2MK3A 2P4KA 1DTOA 1EFRG 5IJ0A 3CMEV 2PZSA 1S5HC 3ABLC 4ZIBA 4XDJA 4W4LA 2WLHA 1GAXA 3SPIA 4D7TA 4MVZA 2RCVA 3CYOA 4ZKIA 4GCZA 3AG2B 5KA5A 2RQ6A 5IE9A 4MSWC 3K9AA 1YDXA 2A7WA 1MOFA 1Y74A 1KQSU 2QWOB 3D3QA 5FNVA 5B1OA 3G71V 5CBGA 2JIZG 3RW0A 4TUYA 1SF9A 1IBLO 3BAAA 1Q90D 1OV9A 3ZMUA 4KHPO 2CH7B 1XBLA 5EBMC 3ETEA 3D36C 4YIOA 4OXSA 2ETNA 3EHBB 1WN7A 3AK1A 4PA6A 5EBLC 5BMVA 3QO7A 1BT8A 4X64O 2UUCO 5C93A 5HFMA 4JI4O 2W0FC 4ZI7B 3LSSA 3N2KB 5JCOC 1VQ7V 2PYLA 4PHZA 1R3KC 1TUBA 1EZJA 3A0RA 1N32O 5JJNB 3WG7B 1COWG 4JAVA 1N33B 1SQFA 4I4TA 3ZRSA 4E4EA 4DR3O 3ZRWA 4TOIA 4FLWA 3D36A 2YDEA 3I5DA 4X1KB 3P32A 2QGNA 4DUYB 1QBZA 2DJVA 1K8AW 1AJQA 1TGOA 4EB6B 5IYCO 2AZ0A 3FYIB 5JCOA 2OTJV 1JJOA 5LGNA 2HR3A 3FKSG 3CCLV 1ROPA 2AW9A 1JFFB 1GK9A 1M93A 2WLNA 5GW7A 1RSOA 4G27B 2H8PC 3A0HZ 1GN3A 5C8YB 3CWBH 2OIGA 3ZRVA 3ZIAG 2JGDA 2W6JG 1YZBA 1M56C 3OR6C 4O4JA 3W7XA 1B6QA 4IGGA 4MVUA 2QA4V 1A32A 4X20B 5A2QN 2JS5A 1AB3A 1V54C 3JYCA 5KHGA 1MMMA 2Q69A 2JVDA 3TCUA 1M57B 1SQBH 4ASUG 4R6ZA 4DYLA 1TVKB 1N33O 1H2MA 5B3SC 2PI4A 5B1AB 3KZIZ 3THOA 1EZVH 3JD4A 1FXVA 2YXYA 4J41A 4PDMA 3CPWU 5CA0A 5IYDO 2IJKA 4DUYO 1QLEC 4QGPA 3E8FA 1NTZH 4CC5A 1ZX3A 1ZLZA 2IJJA 4IHJB 2IJIA 2RJZA 2PYJA 3JATA 4I7ZB 5EK0A 5IDJA 3HKBA 2JS3A 4TQFA 4ZHQA 5J2UA 1RPOA 3MAQA 3H1IH 2FB5A 2ZR3A 4LWSB 1SKVA 2QKCA 2QTSA 3SYCA 4J9YB 1MG1A 2EZOA 1KKDA 2UXNA 1SS3A 5IWAB 3FB7C 2PTMA 4BIUA 3M7MX 5B1NA 4DV3B 1GKFA 4PJ0Z 1AVMA 2LGWA 3F7YC 1GH6A 4YJ3B 3AG3C 3F7VC 1BCCH 1BS3A 1R1BA 2XASA 2EINC 4PELA 4JAUA 2AGAA 3WU2Z 5LL6Y 4G2KA 2Q5ZA 4MVMA 3N2GA 1S5LZ 4UCVA 1PD3A 4LR3A 1R73A 3ZHRA 2QKSA 4U7OA 1IDSA 3IAYA 1X4TA 4GX1A 2YI8A 2R9RB 4DV1B 1V9PA 3E22A 2CTQA 1NS1A 2OCCC 5ITZA 3J81N 1M90W 3JALB 2CDYA 2LFRA 2BTQB 3OD4A 1AI6A 1P49A 1SQVH 3RYHB 1PNLA 4FVMA 4PI0A 3ETQA 5CB4A 4OX9B 1B06A 4OGQB 2Y0IA 1Y67A 3O65A 2QEXV 5CMUA 5IWAO 3UT5A 3JD2A 3L72H 4FFBA 5JJJB 3E8HA 3APOA 2VS0A 4B3MB 4DV3O 3FX7A 3KG2A 3JARA 4IIJB 3OUFA 3IC7A 1OHHG 3BFRA 5KUMA 1LR1A 1YXBA 3B8MA 2HVKC 1ZWIC 1L0NH 2WA3A 1K5QA 2ZXWC 1Y74B 4MW3A 5FNVB 4TUYB 2JJ2G 4EFBA 1QHTA 3T1HB 4QE9A 2DWEC 4O2BB 1NT2B 1QQCA 3MHSC 4UB6Z 4WFEA 4UCTA 1VQPV 3MD0A 3JAKB 4DV1O 1P84F 1H8EG 5E1AC 3VQYA 2EIKB 1K92A 3SDLA 3IFXA 3OMNB 2XAHA 1TUBB 3U10A 2IU0A 1NJIW 3F5TA 1VQ4V 3B2EE
chains in the Genus database with same CATH topology
3L71H 4D6TH 1SQXH 3CXHF 1EZVH 3H1IH 3TGUH 1KYOF 3CX5F 1SQVH 3L73H 5KLVH 1SQBH 1BCCH 2A06H 3BCCH 3CWBH 3H1HH 1L0NH 3H1LH 1KB9F 3H1KH 1P84F 1NTZH 1NTKH 1L0LH 1NU1H 3L70H 1PPJH 4PD4F 3L75H 2BCCH 2IBZH 3L72H 3H1JH 1PP9H 2FYUH 1BE3H 3L74H 1SQPH 1SQQH 1BGYH 1NTMH 4U3FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L71 H;  4D6T H;  1SQX H;  3CXH F;  1EZV H;  3H1I H;  3TGU H;  1KYO F;  3CX5 F;  1SQV H;  3L73 H;  5KLV H;  1SQB H;  1BCC H;  2A06 H;  3BCC H;  3CWB H;  3H1H H;  1L0N H;  3H1L H;  1KB9 F;  3H1K H;  1P84 F;  1NTZ H;  1NTK H;  1L0L H;  1NU1 H;  3L70 H;  1PPJ H;  4PD4 F;  3L75 H;  2BCC H;  2IBZ H;  3L72 H;  3H1J H;  1PP9 H;  2FYU H;  1BE3 H;  3L74 H;  1SQP H;  1SQQ H;  1BGY H;  1NTM H;  4U3F H; 
#chains in the Genus database with same CATH topology
 2KSD A;  4R7C A;  2KQX A;  3OE7 G;  4I4T B;  1E1Q G;  1AR1 B;  3BVO A;  4KL1 A;  4K3A A;  2WWW A;  4OX9 O;  3ZRW B;  2F95 B;  4DR1 B;  4FK5 C;  1JOY A;  2BSK A;  2Q7G A;  3CHX A;  5FPR A;  1B04 A;  3OGC C;  4JI1 B;  3I56 V;  2B9Z A;  4B3M O;  1AP5 A;  4CH6 A;  3ETG A;  4UVC A;  4GUN A;  3VQV A;  3CX5 F;  2YSU B;  4B3R B;  1RSO B;  3HR0 A;  1CEZ A;  2WLL B;  2D3O W;  4UVB A;  4DV4 B;  2YID A;  2UUB B;  1ZUQ A;  3EFF K;  1WP7 A;  4NTY A;  3OMI B;  1SQP H;  4QPK A;  3T1H O;  1WP8 A;  3CP1 A;  1Y66 A;  4PA4 A;  3RVY A;  1J5E B;  4J42 A;  3K03 A;  1EN5 A;  2ZQM A;  5H2F Z;  4BW5 A;  1W2B U;  2O57 A;  1XL6 A;  4OPH A;  2WLI A;  2N74 A;  2EJ7 A;  1WAZ A;  1BZK A;  5EZY B;  2V4D A;  2ZD9 A;  2ZT9 B;  5D5Q A;  2QR4 A;  3L9D A;  1XUQ A;  2LW1 A;  2GTA A;  4X1I A;  2V1D A;  1M56 B;  5HFL A;  3OGI B;  5LA6 A;  1JR9 A;  3P3P A;  4JI8 B;  3W7S A;  4DR1 O;  3SYO A;  4WCE V;  3FAV A;  2R70 A;  4JI1 O;  2UXD O;  3IJ4 A;  2WPD G;  3VQX A;  2LJ2 A;  1YTF D;  4H37 A;  2QTO A;  5EC1 C;  3JD1 A;  3LNM B;  4B3R O;  2DQ0 A;  3L73 H;  4UB8 Z;  3CCU V;  5J2U B;  4ZHQ B;  3ASO B;  4DR2 B;  4BW9 A;  2XHB A;  1ZTE A;  1N36 B;  4DV4 O;  2UUB O;  4TV8 A;  4DR6 B;  4X89 A;  2WLJ A;  2M6Y A;  3QG5 A;  2QSA A;  4XDK A;  3L74 H;  2OYQ A;  2LQT A;  2R72 A;  1JA8 A;  4J7Z A;  1J5E O;  1VQN V;  1QLN A;  4FJC C;  4Q6G A;  3DXR A;  5BXZ A;  3LUT B;  2ZIN A;  2RN9 A;  4F6R A;  1FD9 A;  1QU7 A;  2CGN A;  3H1J H;  5KX5 B;  4UVA A;  1K97 A;  1HWY A;  2LFS A;  1Q86 W;  2L35 A;  4CBC A;  1IUR A;  2HVJ C;  4JI8 O;  2EIL B;  1CPY A;  3PJS K;  4L87 A;  2CGO A;  1MAB G;  3OAA G;  2HJD A;  4C7U A;  4JAA A;  4CS3 A;  3A0B Z;  5ITZ B;  1XNQ B;  1Y6X A;  1R3I C;  2ARH A;  4DR2 O;  2DYR B;  2ATK C;  2RMK B;  1N36 O;  5CB4 B;  4PA9 A;  1DF5 A;  2OWO A;  5LBQ A;  4DR6 O;  5LMU B;  3OEH G;  3UQ8 A;  3IC9 A;  3UT5 B;  1H2L A;  3JAW B;  1KD1 W;  4K35 A;  4CS2 A;  3ZHV A;  1IX9 A;  2DW4 A;  1VMG A;  2IM9 A;  1VEW A;  4MTX A;  3E86 A;  2OIE A;  2OCC B;  3CCE V;  4GKJ B;  2Q8V A;  1X59 A;  1FKA O;  2HG5 C;  1KBH A;  1QR8 A;  3K3W A;  1V55 C;  4PDR A;  2WLM A;  3SPC A;  3PN1 A;  1P7G A;  5JH7 B;  4Z2W A;  4O2A A;  2A9H A;  3STL C;  3JCZ A;  5EYP A;  2CTW A;  5L3B A;  3ABM C;  3EVK A;  2LGQ A;  1L0L H;  1OCZ C;  3SJC C;  1K4C C;  1QR9 A;  5IYZ A;  3BEH A;  2HKO A;  2WSS G;  1AI7 A;  4I55 A;  3CD6 V;  1Q6I A;  3JSN A;  1JMK C;  5CA1 B;  2Q7H A;  4B08 A;  1Q82 W;  2CE4 A;  1XNQ O;  5D5P A;  5IT9 N;  2ZXW B;  3R65 A;  3TGU H;  4GT1 A;  2XND G;  4QIW F;  2XAG A;  1GTO A;  1ZL8 A;  1S5J A;  2Y4U A;  1RM1 C;  1TA8 A;  5LOV A;  4BR6 A;  5LMU O;  4I0X B;  5KMG A;  3H01 A;  3NXS A;  1AJN A;  4TSF G;  1Q5O A;  3K58 A;  2BSK B;  3JAS A;  4UCS A;  5LHI A;  4K8X A;  1Y76 A;  2PUS A;  5LMN B;  2ZE8 A;  5L3C A;  4IL6 Z;  2A06 H;  4GKJ O;  4BIO A;  2VQF B;  1AI4 A;  1OCR C;  5B1B B;  2B1G A;  1K4D C;  3U0Z A;  1KMI Z;  4NKG B;  2ZE5 A;  3ZMS A;  3KCX A;  1WB8 A;  2IBZ H;  1W0J G;  4Z1M G;  3K06 A;  2Y48 A;  4DK0 A;  1Q3E A;  2IH3 C;  3Q4H B;  5LP6 C;  4LNU A;  2E74 B;  4MW8 A;  2YS8 A;  1L1F A;  1W0K G;  1FFT B;  3RWR D;  3T2M A;  5LXT A;  1YTF B;  3ZN0 A;  4CZZ A;  3SJB C;  1XHZ A;  4P9P A;  1URF A;  4X66 B;  2WLI B;  4JV5 B;  1EN4 A;  3RYI A;  1JX9 A;  1VF6 C;  2GTS A;  3CRA A;  3SPG A;  4X1I B;  1YF2 A;  1PV0 A;  4XBF A;  2YXL A;  2UXX A;  1ORQ C;  2BOC C;  3ZMZ A;  5LP6 A;  4O4H B;  2QE7 G;  3HKD A;  1NI8 A;  2UXB B;  2BTO A;  1Z5V A;  1NR7 A;  3K0G A;  2XOK G;  5LYJ A;  4PI2 A;  1YI2 V;  3FYE B;  3ZRX A;  3CJH A;  1GM8 A;  4NXM B;  2E3C A;  2ZIO A;  4UCR A;  4B3T B;  1VF5 B;  5LMN O;  3CCV V;  4P9O A;  1OCO C;  1M4U A;  2WAM A;  1VF6 A;  2VQF O;  4A5U B;  5KAF Z;  4WFG A;  2YC0 A;  2AXT Z;  4HZ3 A;  4JYC A;  2FML A;  2N05 A;  5LGT A;  4X1Y A;  1DLB A;  1OCC C;  3WB0 A;  3BPZ A;  4RUE A;  4YY3 B;  3TJT A;  3U11 A;  5L3F A;  2P6J A;  3LSQ A;  3EXA A;  5DN6 G;  4JI3 B;  4PA3 A;  5J9P C;  1VQO V;  3OEE G;  2X6B A;  3GWO A;  4CH4 A;  1O9H A;  1US6 A;  4X66 O;  4TV9 A;  3CCR V;  4JGS A;  4JV5 O;  4F6R B;  1FXH A;  2KG7 A;  5J2T A;  3SYP A;  3OUS A;  4E2L A;  3QVN A;  2BE3 A;  2VWK A;  3S3X A;  3P30 A;  3D3I A;  4B3S B;  4F6E A;  4K0K B;  4LFA B;  4AQY B;  1NH2 D;  5JVD A;  4H44 B;  2UXB O;  5L3G A;  5GTH Z;  3ICX A;  4ZOL A;  5LHH A;  2PY5 A;  3B77 A;  1RPR A;  5JQG A;  5KA6 A;  3UO2 A;  2EUL A;  1XMO B;  2Q4P A;  1I94 B;  2EIM B;  4NXM O;  5GON A;  4UV8 A;  4J7J A;  4B3T O;  5BZB A;  2HLD G;  4LFB B;  3SYQ A;  3RYC A;  3K57 A;  2HHH B;  4IT5 A;  2NN4 A;  3GB7 C;  4X65 B;  2HEP A;  2Q68 A;  2EIJ B;  3K5N A;  4FZ0 A;  3L75 H;  4O4L A;  2CAZ C;  1PNM A;  1VQ6 V;  2Q73 A;  2Y69 C;  3G6E V;  4DV7 B;  1VP7 A;  1VQ9 V;  4GX5 A;  1K5S A;  3SGI A;  3J80 N;  4YIP A;  2Q6A A;  4YY3 O;  1ARO P;  4LF6 B;  3IGA C;  3AK2 A;  4JI3 O;  4RO2 A;  1J95 A;  4TWK A;  3OR7 C;  4CH3 A;  4TT3 G;  1HNX B;  5IJ0 B;  3FB5 C;  1WPB A;  4JI2 B;  4X88 A;  4MTF A;  3HB3 B;  2OCH A;  4EEQ A;  1K33 A;  1SZX A;  2ILM A;  4O2A B;  4B3S O;  2XAQ A;  4K0K O;  4LFA O;  1D2D A;  4AQY O;  1EBO A;  4HAM A;  5KHJ A;  3LDE A;  2QWQ B;  5EYP B;  4PA7 A;  3ZHT A;  1AR4 A;  3X2Q C;  3QF7 A;  3S3W A;  3RGB A;  1XMO O;  2LP7 A;  1I94 O;  1WA8 A;  4LFB O;  3ABL B;  3LDC A;  4DV6 B;  4WFF A;  1H2N A;  3GVM A;  1JJ2 U;  2HHH O;  1TUE B;  4JTD B;  1V55 B;  4YJ2 A;  4X65 O;  3CC4 V;  5BMV B;  2X7R B;  3UO3 A;  3OFN G;  5JWP A;  4R50 A;  1BL8 A;  1VQ5 V;  2XTA A;  4IYI A;  3ZHQ A;  1XDC A;  5KMG B;  2A0L A;  4DV7 O;  4LF4 B;  4CS4 A;  1KUQ A;  4LFC B;  3JAS B;  4FMT A;  4KFM A;  2JDI G;  4BIZ A;  4TQD A;  4PDL A;  4LF6 O;  2CTR A;  2P67 A;  1LNQ A;  3I55 V;  2ZE7 A;  1Y76 B;  2G38 A;  2L6L A;  1OJH A;  3AG4 C;  4B7K A;  1FYJ A;  3HKE A;  5K1X A;  2UUA B;  2CH7 A;  1HNX O;  3CCQ V;  1PL4 A;  3TET A;  3NR7 A;  4CH5 A;  2YIB A;  4JI2 O;  1DGS A;  1KU9 A;  4NTW A;  1M5I A;  3KKY A;  3K08 A;  1UFI A;  2DN9 A;  4ZI7 A;  3N2K A;  4LNU B;  3AG1 C;  2XUM A;  1MNG A;  1K34 A;  1H38 A;  1GN6 A;  4FZ1 A;  3BY6 A;  5LXT B;  2P06 A;  2JGD B;  2F1M A;  3ZHS A;  4O4J B;  3T4Z A;  1L8D A;  4FLY A;  3JD3 A;  3RYF A;  3M99 B;  1YCI A;  4HBN A;  2JEX A;  4DV6 O;  3D8C A;  1PL0 A;  3RYI B;  5EIB C;  1F4N A;  3K79 A;  4J10 A;  1R3J C;  4EB6 A;  3SJA C;  4H13 B;  2GV9 A;  4DW0 A;  1M57 C;  1VQM V;  2BCC H;  5GTI Z;  1W59 A;  2ZNI A;  2QWN B;  1EN6 A;  4FLZ A;  4LF4 O;  2ZIM A;  1XRE A;  3G4S V;  4LFC O;  3CJH B;  3K0D A;  5EC2 C;  5C8Y A;  1SQX H;  4I50 A;  4KP4 A;  4YHH B;  3ZBH A;  1KEC A;  3B8N A;  4FLU A;  2WLK A;  4FM0 A;  3ZMV A;  2DQ3 A;  4I9W A;  4B7E A;  3W7U A;  5B1A C;  1ZAU A;  2UUA O;  5CA0 B;  1V54 B;  1YIT V;  4W4K A;  1QVF U;  3CXC U;  3K04 A;  2GDS A;  1MA1 A;  4J11 A;  2DMX A;  1KP2 A;  1SQQ H;  1NTM H;  2YEV A;  4J7K A;  1NH2 B;  2BOB C;  4FLX A;  4JYB A;  2ZR2 A;  3JAT B;  3JD0 A;  4LH7 A;  3HKB B;  5H9C A;  2P90 A;  2JGU A;  1LUV A;  5B3S B;  1JCH A;  4LH6 A;  1R6T A;  1N0N A;  1N34 B;  1AI5 A;  4NTX A;  2QWR B;  4TV9 B;  3C3S A;  3T1C A;  2JRI A;  1QLE B;  2EBO A;  1KKC A;  2IH1 C;  2B5U A;  2Q0A A;  1H8H G;  4GLX A;  3K5L A;  2EZP A;  2PI5 A;  3O9O A;  1XOU A;  1YJN V;  4O4I A;  1U97 A;  2EX3 A;  3CRC A;  3ML0 A;  1Z5W A;  4DK1 A;  3K5M A;  4DO2 A;  1FFX A;  1BHB A;  5JQG B;  1FJG B;  1S77 D;  2QM8 A;  2WA4 A;  2E76 B;  4JTA B;  1Q6U A;  3N2G B;  1XQ8 A;  3OT7 A;  3RT3 C;  4WBN A;  5GON B;  5F2V O;  4YHH O;  3T4D A;  1HW7 A;  3RYC B;  2NLJ C;  1VQL V;  3CRR A;  2ADP A;  4LP8 A;  4WFA V;  2JJ1 G;  2X6A A;  3RFR A;  3AEI A;  1G1X B;  2Q9L A;  3AG3 B;  4O4L B;  5IY5 C;  2Z3Y A;  3E22 B;  1O9G A;  1SET A;  4X62 B;  2R9A A;  3KCY A;  1I7F A;  2EIN B;  3TXS A;  4JZG A;  2K1E A;  4AI8 A;  1P7B A;  4N21 A;  1F4M A;  2ZDI C;  1G6U A;  5E79 Z;  1PM9 A;  1IBL B;  3E2E A;  1F23 A;  4PV1 B;  1N34 O;  1ENV A;  4F4L A;  4DR5 B;  4FFB B;  3VBB A;  3P3N A;  2DYS C;  3QNE A;  4ICG A;  3JAR B;  2ZM6 B;  3M8A A;  2QM4 A;  2Y69 B;  1SRY A;  4JYA B;  2KB1 A;  2ZDI A;  3J7A U;  4LCU C;  4J9Z B;  3ZED A;  4GYC B;  1FS0 G;  1FJG O;  3RYH A;  4MTO A;  3ETD A;  2ZKO A;  3T1Y B;  3BCC H;  1P4R A;  3CEI A;  3ZJZ A;  3B09 A;  4YJ2 B;  3OTF A;  4JYY A;  4QE7 A;  4U7N A;  3VOU A;  4IIJ A;  2PGG A;  1MSW D;  2EIK C;  4X62 O;  1DF4 A;  3X2Q B;  4WF9 V;  3FD9 A;  1XMQ B;  4ABM A;  4MTG A;  4WFB V;  3HKE B;  1FPO A;  3CSX A;  1HP8 A;  4OPA A;  2CUG A;  1NKD A;  2W6I G;  2YIA A;  2H3O A;  4O2B A;  3DC5 A;  2C2A A;  4LBE C;  1ZSP A;  3WB1 A;  4DR5 O;  1XL4 A;  2JK5 C;  1CP9 A;  3ZN1 A;  1Q81 W;  3DTU B;  3JAK A;  4JPR A;  2ZM6 O;  1WB7 A;  5BR8 B;  4FM1 A;  3BRC A;  1OZ0 A;  1YJW V;  1BQ0 A;  5BY1 A;  4JYA O;  1MSD A;  3WB2 A;  3CC2 V;  2IU3 A;  3FB6 C;  5IYB O;  1YHQ V;  3ZS8 C;  3OTO B;  1E79 G;  3AG4 B;  3SR2 C;  1GRJ A;  4CC6 A;  4UCU A;  2E75 B;  1FXK C;  4MT8 A;  4DV2 B;  3TXQ A;  2VWJ A;  2YXH A;  3FFQ A;  4JI5 B;  3RYF B;  3T1Y O;  5AG2 A;  1SER A;  4N23 A;  1N8R W;  3H1H H;  2LO1 A;  5K1P A;  4FM2 A;  1GMG A;  4P30 A;  1H2G A;  3CMA V;  1K9M W;  5KAI Z;  3G6B A;  3AG1 B;  1SQG A;  5CBH A;  2YIC A;  1YJ9 V;  1B3Q A;  4U3F H;  3CS5 A;  3L71 H;  5IJ9 A;  2XAJ A;  5L3D A;  2WLL A;  4FPP A;  4RUF A;  5DEC A;  4I50 B;  1XMQ O;  1FXK A;  4FLV A;  5LA6 B;  2X6C A;  1BHA A;  3B40 A;  1IXB A;  2RNB A;  2QKA A;  3L70 H;  5KHK A;  1PPJ H;  1E1R G;  4PD4 F;  3FB8 C;  4AHC A;  2Y0P A;  3ASN C;  1YEW A;  3FAV B;  3DGE A;  4D6T H;  4XDL A;  2YEV B;  2OTL V;  4LC1 A;  2X0L A;  5BR8 O;  5EZY A;  2P4V A;  3UM7 A;  2Q0O C;  1THZ A;  4KUM A;  5H6R A;  4NXN B;  4H0L B;  1N0J A;  3ASO C;  3AG7 A;  2Z5U A;  4TV8 B;  3OTO O;  2DWD C;  2M7W A;  3K5O A;  3SYA A;  3CCM V;  1YIJ V;  2ODM A;  3SPJ A;  4D7S A;  4DV2 O;  3HKC A;  4JI5 O;  1I08 A;  2GBO A;  4EKW A;  1SC5 B;  4DV0 B;  2UU9 B;  3DSQ A;  3DXR B;  3E89 A;  3F5W C;  3ABT A;  1Z2G A;  2RDC A;  1D5N A;  2OT5 A;  2FL4 A;  4O4I B;  4DV5 B;  1QCE A;  4RWU A;  2K9P A;  1AR5 A;  1FFX B;  2Y4T A;  5CA3 A;  3TK1 A;  1SA0 A;  1IBM B;  3LDD A;  4WBN B;  2UXC B;  5FLX N;  3GWK C;  2QDO A;  3RBZ A;  1WLE A;  2EIL C;  1TAE A;  1MZF A;  3QO5 A;  4MVO A;  4HNA A;  1IBK B;  2GUZ A;  2ZNJ A;  4LF7 B;  1SES A;  1BGY H;  2D2C B;  3STZ C;  1T5E A;  2H94 A;  2ZCE A;  1M1K W;  1G4Y B;  3DC6 A;  4BWA A;  1IVS A;  3OMA B;  1F7Y A;  1RP3 B;  2YI9 A;  5LGU A;  4LF8 B;  1I0H A;  4KXR A;  4JI6 B;  2FKX A;  5KX5 A;  1N4C A;  4NXN O;  2AZ2 A;  1JPX A;  4NVP A;  2F4V B;  5KUK A;  3ABU A;  3MHH C;  2IJH A;  1SZT A;  2DYR C;  4I5S A;  1R6K A;  2P22 C;  3LSU A;  1DK1 A;  1NZ6 A;  1Q43 A;  2NNU A;  1H2S B;  2W0X A;  1HNZ B;  4U3J A;  3C90 A;  4DRX A;  5IY5 B;  4DV0 O;  1VAR A;  1VIB A;  1GM7 A;  3LNN A;  2UU9 O;  1HDJ A;  1NU1 H;  1XEQ A;  5L3E A;  3ABK C;  2A3Q A;  4DV5 O;  4K8Z A;  2P5O A;  1PKX A;  4NB5 A;  4JAS A;  2QWP B;  5A9G A;  4GKK B;  3K59 A;  3CXH F;  5KHI A;  3UCS C;  2MW2 B;  3W7T A;  1IBM O;  2UXC O;  3CCJ V;  3AG2 C;  1NTK H;  1KC8 W;  2DYS B;  2Z0A A;  4Q20 A;  5FL7 G;  1GO3 F;  2F23 A;  4NYK A;  1RFY A;  3JAW A;  3ZCC A;  1IBK O;  4LF7 O;  5IYZ B;  1I5Y A;  1Q8I A;  1S0V A;  4RQE A;  3RN4 A;  4I55 B;  1GN4 A;  2QM7 A;  5B5E Z;  1KYO F;  3CCS V;  2EJR A;  1QVG U;  2HFE C;  3A2F A;  2HJF C;  4LF8 O;  2E5L B;  2LW7 A;  3BA8 A;  4JI6 O;  3WFV A;  1MZE A;  3H9V A;  2F4V O;  1ZL8 B;  1JQ0 A;  5JH7 A;  4RAI A;  1HR0 B;  5LOV B;  1H2K A;  1PP9 H;  1F51 A;  3JAM N;  4PDV A;  4L8J A;  4DUZ B;  1UPG A;  4G28 B;  1NVP D;  1XIL A;  1BQZ A;  1WNS A;  2VRZ A;  3ABM B;  1HNZ O;  1OCZ B;  4DR4 B;  4R8C A;  3WG7 C;  3VQW A;  2ADQ B;  3H1L H;  4FLT A;  4JI7 B;  1AP6 A;  4JF3 A;  4P2Z A;  5CA1 A;  5DED A;  4Z1V A;  3CB2 A;  1VF7 A;  5B1B C;  2F43 G;  4UFZ A;  4GKK O;  1VQK V;  1RM1 B;  2KKW A;  3E35 A;  4FIP C;  3BHP A;  4I0X A;  2B1I A;  4GX0 A;  1HNW B;  1BSM A;  1R3L C;  2CK3 G;  4LF5 B;  4UCO A;  2UXD B;  1D5A A;  4MVS A;  4JZ2 A;  4RQF A;  3SPH A;  1OCR B;  4X1K A;  5IJ9 B;  2QJ1 A;  2E5L O;  5KHH A;  1YSC A;  4X9Q A;  2YIB D;  1UJW B;  1NR1 A;  1FXK B;  1XNR B;  5LP6 B;  1NBM G;  3ZX6 A;  1HR0 O;  4LF9 B;  3HKD B;  3Q4H A;  2R9I A;  3K9S A;  3UKM A;  1JFF A;  2AHY A;  2FTK A;  4DUZ O;  2AHZ A;  3MDS A;  5LYJ B;  4BAY A;  3BAB A;  4MS2 A;  5H5N A;  3E8B A;  4DR4 O;  5LHG A;  5KLV H;  1XI1 A;  1BMF G;  4GZR B;  5CN0 A;  5TIS Z;  4UV9 A;  3H1K H;  4JI7 O;  3BA9 A;  4X8A A;  1AJP A;  3JSL A;  1PNK A;  3SJQ C;  4X20 A;  2P7T C;  4AIL C;  4ZBM A;  5B66 Z;  3E83 A;  3ZHU A;  1S76 D;  4NR1 A;  2ITC C;  3APQ A;  3A8T A;  4X1Y B;  3CRM A;  4O4H A;  5H6Q A;  4DR7 B;  1JVM A;  2DE0 X;  3ASN B;  3HKC B;  3OW2 U;  1S72 V;  4EFE A;  1KB9 F;  1TVK A;  4J80 A;  1K3E A;  4JI0 B;  1HNW O;  1QNM A;  4LF5 O;  3CRQ A;  3OM3 B;  4UUJ C;  3N27 A;  1OCO B;  2VQE B;  2PF4 E;  2N04 A;  2Q7E A;  4H33 A;  4DXW A;  1M9N A;  2ZE6 A;  2KG7 B;  5EIB D;  5J2T B;  4MVR A;  1SA0 B;  3G67 A;  3RVZ A;  1OCC B;  4QJF B;  1XNR O;  4IHJ A;  3QO8 A;  1VQ8 V;  1IXM A;  5JVD B;  3HPL C;  4LF9 O;  4JTC B;  2FYU H;  1BE3 H;  4ZOL B;  3CC7 V;  1R6N A;  4HNA B;  2GUZ B;  1U96 A;  1KP3 A;  2Q67 A;  4LWS A;  3G80 A;  1LUW A;  1G8M A;  1IZ3 A;  2EIM C;  1YVW A;  4GX2 A;  2A79 B;  4I9Q A;  3AK3 A;  1WJZ A;  1Q6H A;  1FAF A;  1I5X A;  4HYO A;  2EIJ C;  5EBW C;  2GHY A;  2XAF A;  4MVQ A;  5FPO A;  4QNH B;  4YJ3 A;  3E8G A;  5DM6 V;  4YXW G;  4DR7 O;  4U3J B;  4DRX B;  2F93 B;  4JI0 O;  2CTP A;  4UXN A;  2YUA A;  5CBF A;  1GM9 A;  4KHP B;  2VQE O;  1CXZ B;  3JCU Z;  4IYH A;  2JEU A;  5JJE B;  1XHX A;  4WFH A;  4X64 B;  1K7D A;  2UUC B;  4JI4 B;  3R66 A;  2V7Q G;  3C3T A;  1Q7Y W;  3B4S A;  1GN2 A;  2IW5 A;  2F66 C;  4DW1 A;  1Y4M A;  1EM1 A;  1NVP B;  1NQT A;  3JAL A;  3QTC A;  2ITD C;  3CE2 A;  2XT9 A;  2BTQ A;  1K73 W;  1N32 B;  2HP8 A;  3ZMT A;  1WPX A;  4FFK A;  4DR3 B;  2GSM B;  4QPJ A;  3W7W A;  2NR5 A;  3ABK B;  1AIL A;  1WA8 B;  2DOS A;  1S3J A;  2MK3 A;  2P4K A;  1DTO A;  1EFR G;  5IJ0 A;  3CME V;  2PZS A;  1S5H C;  3ABL C;  4ZIB A;  4XDJ A;  4W4L A;  2WLH A;  1GAX A;  3SPI A;  4D7T A;  4MVZ A;  2RCV A;  3CYO A;  4ZKI A;  4GCZ A;  3AG2 B;  5KA5 A;  2RQ6 A;  5IE9 A;  4MSW C;  3K9A A;  1YDX A;  2A7W A;  1MOF A;  1Y74 A;  1KQS U;  2QWO B;  3D3Q A;  5FNV A;  5B1O A;  3G71 V;  5CBG A;  2JIZ G;  3RW0 A;  4TUY A;  1SF9 A;  1IBL O;  3BAA A;  1Q90 D;  1OV9 A;  3ZMU A;  4KHP O;  2CH7 B;  1XBL A;  5EBM C;  3ETE A;  3D36 C;  4YIO A;  4OXS A;  2ETN A;  3EHB B;  1WN7 A;  3AK1 A;  4PA6 A;  5EBL C;  5BMV A;  3QO7 A;  1BT8 A;  4X64 O;  2UUC O;  5C93 A;  5HFM A;  4JI4 O;  2W0F C;  4ZI7 B;  3LSS A;  3N2K B;  5JCO C;  1VQ7 V;  2PYL A;  4PHZ A;  1R3K C;  1TUB A;  1EZJ A;  3A0R A;  1N32 O;  5JJN B;  3WG7 B;  1COW G;  4JAV A;  1N33 B;  1SQF A;  4I4T A;  3ZRS A;  4E4E A;  4DR3 O;  3ZRW A;  4TOI A;  4FLW A;  3D36 A;  2YDE A;  3I5D A;  4X1K B;  3P32 A;  2QGN A;  4DUY B;  1QBZ A;  2DJV A;  1K8A W;  1AJQ A;  1TGO A;  4EB6 B;  5IYC O;  2AZ0 A;  3FYI B;  5JCO A;  2OTJ V;  1JJO A;  5LGN A;  2HR3 A;  3FKS G;  3CCL V;  1ROP A;  2AW9 A;  1JFF B;  1GK9 A;  1M93 A;  2WLN A;  5GW7 A;  1RSO A;  4G27 B;  2H8P C;  3A0H Z;  1GN3 A;  5C8Y B;  3CWB H;  2OIG A;  3ZRV A;  3ZIA G;  2JGD A;  2W6J G;  1YZB A;  1M56 C;  3OR6 C;  4O4J A;  3W7X A;  1B6Q A;  4IGG A;  4MVU A;  2QA4 V;  1A32 A;  4X20 B;  5A2Q N;  2JS5 A;  1AB3 A;  1V54 C;  3JYC A;  5KHG A;  1MMM A;  2Q69 A;  2JVD A;  3TCU A;  1M57 B;  1SQB H;  4ASU G;  4R6Z A;  4DYL A;  1TVK B;  1N33 O;  1H2M A;  5B3S C;  2PI4 A;  5B1A B;  3KZI Z;  3THO A;  1EZV H;  3JD4 A;  1FXV A;  2YXY A;  4J41 A;  4PDM A;  3CPW U;  5CA0 A;  5IYD O;  2IJK A;  4DUY O;  1QLE C;  4QGP A;  3E8F A;  1NTZ H;  4CC5 A;  1ZX3 A;  1ZLZ A;  2IJJ A;  4IHJ B;  2IJI A;  2RJZ A;  2PYJ A;  3JAT A;  4I7Z B;  5EK0 A;  5IDJ A;  3HKB A;  2JS3 A;  4TQF A;  4ZHQ A;  5J2U A;  1RPO A;  3MAQ A;  3H1I H;  2FB5 A;  2ZR3 A;  4LWS B;  1SKV A;  2QKC A;  2QTS A;  3SYC A;  4J9Y B;  1MG1 A;  2EZO A;  1KKD A;  2UXN A;  1SS3 A;  5IWA B;  3FB7 C;  2PTM A;  4BIU A;  3M7M X;  5B1N A;  4DV3 B;  1GKF A;  4PJ0 Z;  1AVM A;  2LGW A;  3F7Y C;  1GH6 A;  4YJ3 B;  3AG3 C;  3F7V C;  1BCC H;  1BS3 A;  1R1B A;  2XAS A;  2EIN C;  4PEL A;  4JAU A;  2AGA A;  3WU2 Z;  5LL6 Y;  4G2K A;  2Q5Z A;  4MVM A;  3N2G A;  1S5L Z;  4UCV A;  1PD3 A;  4LR3 A;  1R73 A;  3ZHR A;  2QKS A;  4U7O A;  1IDS A;  3IAY A;  1X4T A;  4GX1 A;  2YI8 A;  2R9R B;  4DV1 B;  1V9P A;  3E22 A;  2CTQ A;  1NS1 A;  2OCC C;  5ITZ A;  3J81 N;  1M90 W;  3JAL B;  2CDY A;  2LFR A;  2BTQ B;  3OD4 A;  1AI6 A;  1P49 A;  1SQV H;  3RYH B;  1PNL A;  4FVM A;  4PI0 A;  3ETQ A;  5CB4 A;  4OX9 B;  1B06 A;  4OGQ B;  2Y0I A;  1Y67 A;  3O65 A;  2QEX V;  5CMU A;  5IWA O;  3UT5 A;  3JD2 A;  3L72 H;  4FFB A;  5JJJ B;  3E8H A;  3APO A;  2VS0 A;  4B3M B;  4DV3 O;  3FX7 A;  3KG2 A;  3JAR A;  4IIJ B;  3OUF A;  3IC7 A;  1OHH G;  3BFR A;  5KUM A;  1LR1 A;  1YXB A;  3B8M A;  2HVK C;  1ZWI C;  1L0N H;  2WA3 A;  1K5Q A;  2ZXW C;  1Y74 B;  4MW3 A;  5FNV B;  4TUY B;  2JJ2 G;  4EFB A;  1QHT A;  3T1H B;  4QE9 A;  2DWE C;  4O2B B;  1NT2 B;  1QQC A;  3MHS C;  4UB6 Z;  4WFE A;  4UCT A;  1VQP V;  3MD0 A;  3JAK B;  4DV1 O;  1P84 F;  1H8E G;  5E1A C;  3VQY A;  2EIK B;  1K92 A;  3SDL A;  3IFX A;  3OMN B;  2XAH A;  1TUB B;  3U10 A;  2IU0 A;  1NJI W;  3F5T A;  1VQ4 V;  3B2E E; 
#chains in the Genus database with same CATH homology
 3L71 H;  4D6T H;  1SQX H;  3CXH F;  1EZV H;  3H1I H;  3TGU H;  1KYO F;  3CX5 F;  1SQV H;  3L73 H;  5KLV H;  1SQB H;  1BCC H;  2A06 H;  3BCC H;  3CWB H;  3H1H H;  1L0N H;  3H1L H;  1KB9 F;  3H1K H;  1P84 F;  1NTZ H;  1NTK H;  1L0L H;  1NU1 H;  3L70 H;  1PPJ H;  4PD4 F;  3L75 H;  2BCC H;  2IBZ H;  3L72 H;  3H1J H;  1PP9 H;  2FYU H;  1BE3 H;  3L74 H;  1SQP H;  1SQQ H;  1BGY H;  1NTM H;  4U3F H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...