2QWPB

Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi form #2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
b'DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFENQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Structural basis of J cochaperone binding and regulation of Hsp70.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone
total genus 30
structure length 92
sequence length 92
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2qwpB00
2QWOB 1N4CA 1WJZA 2EJ7A 2QWRB 1IURA 1BQZA 2CUGA 1NZ6A 2L6LA 2LGWA 2Y4UA 3APOA 4RWUA 1GH6A 2QWPB 2YUAA 2QWQB 3APQA 2CTWA 2CTRA 1BQ0A 1FAFA 2N05A 2QSAA 2Y4TA 3UO3A 2GUZA 2DN9A 1XBLA 2LO1A 2OCHA 3UCSC 2DMXA 1FPOA 2N04A 3BVOA 4IT5A 2GUZB 2KQXA 3AG7A 1HDJA 2CTQA 2QWNB 3UO2A 4J7ZA 4J80A 2YS8A 2M6YA 2PF4E 2CTPA
chains in the Genus database with same CATH superfamily
1J95A 4JI1B 2JGDB 3ABMB 1P4RA 5IY5C 3TJTA 1IX9A 2LGWA 4K3AA 5J2TB 2N74A 4ZHQA 4B3RB 3CJHA 1HNXB 2QTSA 5D5QA 5J2UB 2YI9A 4P9OA 4NXNB 1MG1A 2WSSG 2Y4TA 3SDLA 4KHPB 3FAVA 3E22A 4IYHA 1AI5A 3T4DA 3SJQC 1NI8A 4IYIA 3L72H 4LBEC 2A79B 5IYZA 3OFNG 2ZXWB 1VEWA 3IC7A 1ROPA 4MTXA 1KP2A 2XUMA 2CAZC 3BEHA 1N34O 1Q90D 4DK0A 1QLEB 3OMIB 2ZE5A 5DECA 3HKEA 2BSKA 3MHHC 1FPOA 2YEVB 1XUQA 4UUJC 3IAYA 4RUEA 3CCMV 2ZNJA 1VIBA 1XEQA 4O4LA 1GN3A 3ZRSA 5KHGA 5EK0A 3SPGA 1Q7YW 1ZLZA 4PI2A 3BY6A 2Y69B 1BCCH 1YVWA 5B1BB 4JF3A 4UCTA 2QKSA 3L70H 2OCHA 2PGGA 4JTDB 4DRXA 2UXDO 4ZI7B 2P4VA 1K8AW 2DE0X 1SQFA 4X66B 3UQ8A 2R9AA 4FLZA 2EJ7A 4TQFA 3D3IA 4U3FH 4C7UA 1JFFA 1IBMB 5KHKA 4LF5O 1EZVH 4OX9B 3SPIA 1S76D 3JARA 1JJOA 1Z5WA 1YHQV 1DLBA 1RM1C 2QKCA 3ZMVA 3ASOC 4X1KB 3CC2V 1Y76B 3ZCCA 3AG1C 2ATKC 5AG2A 2WWWA 4QE9A 3CCVV 1XILA 5L3DA 5JQGA 1EBOA 2O57A 2WLIA 4L87A 2HHHO 4ZHQB 1OCCB 1PM9A 3ZN1A 4X88A 4JV5B 1QVFU 1H2SB 3E22B 2IU0A 1Y6XA 5IYZB 2ZKOA 5E1AC 3HKCB 1Q5OA 1SQXH 3N2GA 1XI1A 2LQTA 5JVDA 2Q69A 3WFVA 3J7AU 2IU3A 1YDXA 4DR4O 2ZCEA 3HKEB 1Z5VA 2BSKB 3W7UA 4DR1B 2QJ1A 1MZEA 2HVJC 2AZ2A 4UB8Z 1VQ5V 1G8MA 3SYPA 4LF6B 3CCUV 4J9YB 4DV1B 2Z0AA 1YJ9V 1NVPB 3QO8A 1N32O 2CTRA 2EILC 3J80N 1R3LC 5ITZA 3ASOB 4QNHB 3BPZA 1B6QA 4NTWA 2PI4A 3DSQA 2W6IG 4YHHO 5H5NA 1VQLV 4UCVA 3AG1B 4DRXB 2XT9A 3KCYA 1V9PA 3G80A 2Z5UA 4K8XA 3CRCA 1SQGA 2MK3A 4ZIBA 2XOKG 1JFFB 2A06H 4I4TA 3JARB 5IYDO 1OV9A 1N33O 3AK2A 4Q6GA 5IYBO 3ZS8C 1MNGA 3ZN0A 1ZX3A 2NN4A 4G2KA 4RQFA 2RQ6A 2UUCB 3ZHQA 1N36O 1XL4A 3K59A 1BSMA 5EIBC 3K0DA 5KHHA 1WAZA 5JQGB 2E5LO 1R1BA 2NNUA 2Q0OC 4WFAV 2WLIB 4PI0A 2FMLA 4JI1O 2LJ2A 2WLJA 5EBMC 1PL4A 3ASNB 1HNXO 3A0BZ 1X4TA 5IT9N 4NXNO 4KHPO 4NXMO 3VQXA 1VQPV 2QWQB 2FL4A 3WU2Z 3K9SA 3AG2B 2N05A 2YDEA 3W7TA 3B4SA 1WPBA 3N2GB 5JVDB 3CX5F 5J9PC 2Y0PA 4KL1A 2X6CA 4KP4A 2VRZA 3H1KH 3BA9A 1FXHA 2QWOB 2PZSA 4DW1A 1MZFA 4L8JA 1MMMA 2UUAB 4DV7B 1H38A 4QPJA 4JI7B 1K33A 4XDJA 2QM7A 2UXXA 4CBCA 2B1GA 4MW8A 4O2AA 4PJ0Z 1YIJV 2ZQMA 1MA1A 1KYOF 2PUSA 1R6KA 2OIEA 1CP9A 3APOA 1W59A 1AILA 1Y4MA 4X65B 2R70A 3LSQA 3ABTA 5EC1C 5L3GA 1AI7A 4IT5A 2JS5A 4B7EA 3LNMB 2JIZG 4FLVA 1PV0A 5EYPA 2QA4V 1IBMO 4HNAB 2M7WA 3G4SV 4OX9O 5B1OA 3RYIA 2GV9A 4DR7B 1NU1H 1P7GA 1WPXA 2KG7A 4I0XA 5LOVA 3OUFA 3S3XA 3K06A 5B1NA 1L0LH 4OXSA 5CBFA 3JAMN 2A3QA 5HFMA 4DR3O 3C90A 3THOA 4QGPA 3F7VC 2P4KA 4YJ2B 4BR6A 1XL6A 4UB6Z 5CMUA 2RNBA 1M1KW 5JH7A 1BGYH 1COWG 4JI3B 2Z3YA 3RVYA 4JV5O 2EULA 3NR7A 5IDJA 4DUZB 2YIBA 1K9MW 1YXBA 2VQEB 3G67A 2UUBO 1K4CC 4CH6A 1P84F 3GB7C 4FM0A 3CCQV 5BZBA 2ZIOA 1ORQC 3JASB 1P49A 1OJHA 3RBZA 2EJRA 4FLWA 4TV9A 2Y0IA 4YJ3A 5KHJA 3NXSA 4D6TH 4JAUA 1MABG 1TA8A 4JI0B 2DMXA 4DR1O 3KKYA 1G6UA 2ADPA 2R9RB 1D5NA 3B77A 2GHYA 2KB1A 3ZMZA 4LF6O 4DV1O 2AHZA 4EKWA 5TISZ 4O2AB 4I55A 1QVGU 3RYHA 3IC9A 1HW7A 1OHHG 2W0FC 1I94B 1QHTA 1VMGA 4TUYA 3JAKA 3ETQA 2A7WA 3CYOA 2Y48A 4LF5B 3K3WA 2GTSA 3OE7G 2IJKA 1YTFB 4KUMA 4TT3G 2DYRB 3ZHRA 4B3MB 3FFQA 1N4CA 1TGOA 4U7NA 2ZD9A 3JATA 1XDCA 5EYPB 3ETGA 4UV9A 5E79Z 1H2MA 2C2AA 4HZ3A 2KG7B 4I0XB 1SC5B 3ZHVA 5LOVB 2F4VB 5BXZA 1K73W 1DF4A 5LBQA 1BHBA 2EIJC 5KX5A 4LCUC 3K08A 4JTCB 1QCEA 2UUCO 5J2TA 2L35A 3FB6C 1BQZA 1NZ6A 4U7OA 4BAYA 4J9ZB 3E2EA 3D36C 1M4UA 3JSNA 3ABUA 2ZT9B 4CC6A 2QTOA 3OT7A 2JGUA 1E1QG 5K1XA 3U0ZA 3IJ4A 4ASUG 3CRMA 2EINB 4G28B 4JI8O 1GM9A 3E35A 1F23A 4IGGA 2WLMA 4JI4B 3JCZA 4TV9B 4YJ3B 4GX5A 1Q86W 3GVMA 1HNZO 4Z1VA 1XHZA 1FKAO 2UUAO 3H1IH 4FK5C 1HR0B 1LNQA 4DV7O 2ODMA 3E8GA 2WLLA 4YHHB 2BTQA 4WFBV 5H6RA 1U97A 2V4DA 2QEXV 2YUAA 5LGUA 3ABKC 3T1CA 4EFBA 4FLUA 4I55B 1SQBH 4MTFA 2EIJB 4LNUA 3Q4HB 1AR4A 3RYHB 2AXTZ 2QDOA 1FFTB 1FS0G 1M5IA 4JI6B 3ZBHA 4TUYB 2BCCH 3JAKB 1NR1A 5C8YA 1K5SA 5EBWC 2YIAA 1R3KC 4J41A 5KUMA 3JATB 1R3IC 2WPDG 2PTMA 4X1KA 4FIPC 1RFYA 1PP9H 5B66Z 4FZ1A 2AZ0A 3OEEG 4DR7O 1MSDA 4RUFA 5A2QN 4MSWC 4MVRA 5LMNB 5KX5B 1VQ9V 1AP6A 1K5QA 3K5NA 1S5JA 3CRAA 2EZPA 4CS3A 2IM9A 1TAEA 4BIZA 5KA6A 5LGNA 4NXMB 3HKBB 2IJJA 3H9VA 1B3QA 2GUZB 4I50A 3U10A 4JI3O 3SJCC 3WG7C 1JJ2U 4JZ2A 4PDLA 2VQFB 4LF4O 1R6TA 3FYIB 3HKCA 3CWBH 1NTKH 1YI2V 4UCRA 4J42A 3ABKB 1KB9F 3IGAC 3FYEB 1M9NA 4DUZO 2PYJA 4DUYB 2E76B 2MW2B 2VQEO 1QNMA 4FZ0A 3CCRV 4W4KA 3W7SA 4BWAA 1VP7A 4DV2B 4B7KA 3B8NA 1Y66A 3JALB 4BIUA 3E86A 3W7WA 2QKAA 1VQ8V 1FFXB 1BMFG 4JI0O 3ZRWB 4MTGA 2WLLB 1SA0A 2BTQB 1VQOV 3T1YB 3CXHF 1R73A 4TQDA 3C3SA 3BA8A 5LP6A 3VQVA 5JJJB 3KCXA 3CCJV 1L0NH 4LNUB 4QPKA 2JEXA 1ZTEA 2HVKC 1XHXA 3JYCA 5IY5B 4JAAA 5KLVH 5CB4A 1I94O 1GH6A 2ARHA 2ZNIA 5CA0A 4MVMA 5C8YB 3CMAV 5IYCO 5EZYA 5LMUO 2ZDIC 1M93A 1PD3A 1N0JA 4UV8A 4B3MO 4RO2A 4DR3B 2NLJC 1LUWA 2UXNA 2GSMB 1N8RW 1UFIA 5LP6C 4H37A 3H1HH 2F4VO 3E83A 5B3SC 4OPAA 1BE3H 1E1RG 2AGAA 2Q68A 1EM1A 2NR5A 3IFXA 1Q43A 5FPRA 2KQXA 4HBNA 2GTAA 5DM6V 1UPGA 5IJ0B 2UUBB 1KMIZ 1W0JG 4I50B 1WJZA 3ZIAG 1SF9A 2B5UA 1IDSA 3A0HZ 3QVNA 3QF7A 4RAIA 1VQ4V 3DC6A 1VQMV 2OCCC 2YC0A 4R6ZA 2XAGA 1X59A 2OWOA 3OW2U 3K04A 4MVQA 3E8BA 4DO2A 2ITCC 5CA1B 4MS2A 4YXWG 2YIBD 3TGUH 1VQ6V 4JI4O 4PHZA 1CPYA 2DQ3A 5IJ9A 1GN6A 4WFFA 2UU9B 1OCOC 2K9PA 4GYCB 2GBOA 4UVCA 1RM1B 2ZINA 1XMOB 3SPCA 4DYLA 2IBZH 1HR0O 1SA0B 3J81N 3RN4A 1QR9A 5LP6B 2YICA 4NTYA 4AQYB 2EX3A 1BZKA 2HLDG 5LHIA 3DTUB 5B3SB 2DYSC 4BIOA 3LDEA 4H33A 2Q67A 5CB4B 4CS2A 4JI6O 4FLTA 5CA0B 2D2CB 1IBKO 4HNAA 5EZYB 3ETEA 5K1PA 3BABA 2A9HA 2YI8A 1SQVH 1K3EA 2ZE6A 3ZMUA 4N21A 2OCCB 3R66A 4YJ2A 4X64B 4MW3A 1L1FA 1LR1A 1AROP 5LMNO 5LYJB 2YIDA 2Q73A 4A5UB 2EIKC 4JYYA 4DV0B 4BW5A 2RJZA 1I5YA 2EILB 2QWPB 2LFSA 1H2LA 4K0KB 2VQFO 4JI8B 2LP7A 4I9QA 3H01A 4JTAB 3JASA 1A32A 3A8TA 3CC7V 4DUYO 1AR5A 4J7ZA 2LGQA 1H8EG 1HNZB 2ITDC 2DYSB 2P22C 3OM3B 4JASA 4MVZA 1T5EA 3E89A 5LHHA 1BQ0A 3E8FA 1QQCA 5LL6Y 4B3SB 4DV2O 3WB0A 4YIOA 5FNVB 5HFLA 5IJ9B 3T1HO 4XDLA 3X2QC 1GMGA 4NTXA 1YF2A 4P2ZA 2QM4A 4IHJA 3RYCA 2R72A 4J11A 4DXWA 4UCUA 2ADQB 3JAWA 2WAMA 1K97A 3T1YO 2AHYA 1NKDA 1J5EB 4GX2A 4PDVA 4Z2WA 4PA4A 4X1YA 1F4MA 3GWKC 1FAFA 1Q81W 1SESA 1AJNA 2E74B 1JCHA 2EIKB 2N04A 1OZ0A 3JD1A 1S5LZ 5JWPA 3MAQA 2Q8VA 1VQ7V 2VWKA 3ZHSA 2CTPA 3JCUZ 4IL6Z 4PA3A 1S0VA 5LGTA 5D5PA 1WNSA 3OGIB 1H8HG 1SQPH 4GCZA 2HR3A 4UCOA 1XREA 1QBZA 1OCZC 4NVPA 1Y74A 4CH3A 4JI2B 3B09A 5KMGA 2XAHA 2BOBC 2FTKA 4LF4B 4O4JA 1IBLB 3JD2A 4DR6B 2ZM6B 3MHSC 4PD4F 4TV8B 2F95B 1JMKC 1I08A 1TVKA 4EEQA 3BHPA 5LHGA 1Q3EA 1RPRA 3AK3A 1PPJH 1BHAA 4UVBA 3I56V 4HAMA 4FLYA 3STLC 1H2NA 4B08A 4O4IA 4QIWF 1WB7A 4LF7B 3UO3A 2DN9A 1KECA 1Y67A 1SKVA 3ETDA 5BMVA 1GTOA 4FM1A 4GKKO 3L74H 4LFBB 4DV5B 1WP7A 2XNDG 2PF4E 2UU9O 4IHJB 3RYCB 5FL7G 3F5WC 4PDRA 1WP8A 4CH5A 3Q4HA 1XMOO 1YCIA 4FFKA 4FPPA 4DV6B 2W0XA 3JAWB 1DGSA 2A0LA 2K1EA 5KHIA 1NVPD 2KKWA 2VS0A 4FFBA 4X1YB 2EZOA 2PY5A 1NBMG 1AVMA 3OAAG 3BCCH 4AQYO 2KSDA 3K5MA 5LMUB 3LDCA 3D36A 4XBFA 2CH7A 1JQ0A 1JPXA 4WF9V 4QJFB 1FD9A 1KU9A 4J7JA 4I5SA 2CDYA 1RSOA 3ZEDA 4F4LA 3HPLC 4CH4A 4B3TB 3QO5A 3FB8C 4RQEA 3OMAB 1ZL8B 1Y74B 4X64O 5KA5A 3MD0A 3O65A 3D8CA 3HKBA 2IH1C 5KMGB 1VQKV 1FYJA 4HYOA 5A9GA 3G6EV 2GUZA 4DV4B 2FKXA 3QG5A 4DV0O 4O4JB 1Q8IA 2JJ2G 3T2MA 4E4EA 2JDIG 2V1DA 3OTFA 2B9ZA 1TVKB 1SS3A 3K9AA 2E75B 4JPRA 2H3OA 4JYCA 3CCSV 4K0KO 1QR8A 1I0HA 4WFGA 2DWDC 4X89A 3ZHTA 3EVKA 2P7TC 4EFEA 3ICXA 2G38A 1HP8A 1GO3F 4O4IB 3JALA 1M57C 1AJQA 5DEDA 1SETA 1YEWA 2XAJA 3B8MA 4R8CA 1FFXA 2XAQA 4G27B 3ZRWA 5BMVB 1S72V 3FB7C 4B3SO 4KFMA 3ABMC 1SZTA 1GRJA 2ILMA 3DXRA 4X62B 1QU7A 3RW0A 3UKMA 3CRQA 3LSUA 4D7SA 4PV1B 1TUBB 3SGIA 2RN9A 2BTOA 1NR7A 1VF6C 3OD4A 4FFBB 1FXKC 4ICGA 3K57A 1J5EO 1VQNV 3UO2A 1FJGO 3JD0A 1PNLA 1IBKB 2JEUA 3DC5A 4OGQB 4NYKA 1TUEB 5F2VO 1NQTA 1THZA 2HG5C 3AK1A 1EN4A 2CH7B 1KUQA 1ENVA 1QLEC 5EIBD 2PYLA 1DF5A 5JCOC 3L71H 2Q7HA 2OIGA 4Q20A 4I9WA 1RSOB 5GONA 1IXMA 3RWRD 3UT5B 5H2FZ 5BR8B 4FLXA 3S3WA 1B06A 2CGNA 1IXBA 4I7ZB 2YXHA 3CCEV 2JRIA 4FJCC 4JI2O 5IJ0A 2GDSA 3LDDA 3R65A 4KXRA 4LF9B 2QWNB 2X0LA 4DR6O 1IBLO 1GKFA 2ZM6O 1F4NA 2YXYA 3EFFK 4JI5O 4DK1A 2CGOA 3L75H 3APQA 2WA4A 3M99B 2HFEC 3CPWU 5CA1A 2HKOA 3BVOA 1MOFA 1AI4A 1FXKB 4X8AA 2Q0AA 1I7FA 1HDJA 5LA6A 3T1HB 1QLNA 1K4DC 4K35A 2EBOA 2ZDIA 3QO7A 4LF7O 2YSUB 1GAXA 3H1JH 2H8PC 1VF5B 2Q9LA 3OMNB 4F6RA 1GN4A 5LXTB 4LFBO 4R7CA 3DXRB 3LUTB 4DV5O 1OCCC 1XNRB 2R9IA 1S77D 1EN6A 5GTHZ 1JR9A 4DV6O 3RFRA 3VQYA 2DJVA 1M56C 2Q7EA 1YJWV 4PA9A 1JVMA 3PN1A 1S3JA 3G71V 5L3EA 5KAIZ 1SERA 4JZGA 3AEIA 3WG7B 5JJNB 1NTZH 4D7TA 3K79A 5BY1A 4CC5A 1NH2B 2XAFA 1WA8A 1YTFD 3K5LA 3ZX6A 2HEPA 5GONB 1JX9A 1XNQO 4O2BB 3K58A 5LYJA 3EXAA 2UXBB 1GK9A 4B3TO 3TCUA 4O4HA 3SYOA 4WFEA 4EB6A 2P06A 2QE7G 1V54C 1EZJA 1ZSPA 5C93A 4JGSA 2VWJA 4DV4O 2XTAA 4NKGB 4NB5A 4GX1A 3RT3C 3B2EE 3CJHB 4J7KA 1PNKA 5FLXN 2DW4A 3FAVB 2XHBA 3TETA 2B1IA 2OTLV 3FKSG 1M56B 1ZAUA 1ZWIC 3O9OA 3AG3C 2FYUH 4ZOLA 3WB2A 4GKKB 5LA6B 1F7YA 5FNVA 2UXCB 2BOCC 4J10A 4DR5B 1US6A 1JOYA 5L3CA 3FD9A 3OGCC 1EN5A 2HJFC 1PL0A 3STZC 4F6RB 2D3OW 1B04A 3HKDA 5CBHA 2ZE7A 3N27A 4J80A 1KKDA 4X1IA 1Q6UA 3G6BA 4DR2O 4X62O 3ASNC 1K92A 4LH7A 4O4LB 2ETNA 2F1MA 5CBGA 2Q5ZA 3D3QA 1Z2GA 4H0LB 3F5TA 3AG2C 2RDCA 3ZHUA 3PJSK 3K5OA 1V54B 2CTQA 1AP5A 4GKJB 1URFA 4LFAB 2P6JA 4FMTA 1EFRG 2X7RB 2L6LA 4AILC 3A2FA 3M8AA 4MVUA 1WA8B 3OEHG 4LF8B 1HNWB 3B40A 1GM8A 4K8ZA 4X20A 1SQQH 3FX7A 4AHCA 2F93B 3AG3B 1IVSA 4O4HB 4EB6B 3OUSA 5BR8O 3OTOO 1V55C 4MTOA 1PKXA 2IW5A 2CK3G 3T4ZA 4TV8A 1OCOB 3K0GA 5IWAB 3L9DA 1YZBA 3N2KA 3UM7A 3I55V 4LF9O 3BAAA 1WB8A 2QGNA 4N23A 1XMQB 1DTOA 4MT8A 3SJBC 2E3CA 4B3RO 1F51A 3EHBB 3DGEA 2YS8A 2JVDA 2F23A 1O9GA 2V7QG 4CZZA 5L3FA 2BE3A 4LP8A 1WLEA 1RPOA 4LFCB 1XQ8A 4ZOLB 1DK1A 1RP3B 4E2LA 3JSLA 1AJPA 4NR1A 1OCRC 1PNMA 2QR4A 4WBNA 5B5EZ 3CP1A 1O9HA 1N0NA 1NT2B 3ML0A 4JYAB 2RMKB 4IIJA 4MVSA 3HKDB 1CXZB 4X1IB 1FJGB 2JS3A 3W7XA 1XNRO 2LO1A 5CA3A 4DV3B 1MSWD 3SPHA 3SYCA 1H2KA 5ITZB 1VARA 3SJAC 1V55B 2AW9A 2LW7A 2HJDA 2DWEC 4LR3A 3ZMSA 4TSFG 3CMEV 5H9CA 1KC8W 2WLKA 3P32A 1JA8A 1XOUA 2CTWA 5EBLC 2PI5A 3H1LH 3QTCA 3ZMTA 4F6EA 2IJIA 1WN7A 1XBLA 4PA7A 3P3NA 3RYFA 3OR7C 1NS1A 3LSSA 4X66O 4YY3B 4WFHA 1ZL8A 3BRCA 4X20B 4H13B 2H94A 4I4TB 4XDKA 3QNEA 1NJIW 2Y4UA 4P9PA 5KUKA 1G1XB 1GN2A 3VOUA 1NH2D 4U3JA 2ZIMA 3CC4V 2UXBO 3OR6C 1R3JC 2WA3A 4GT1A 2EIMC 4JI5B 3SYQA 1L8DA 3ZRVA 2OTJV 1OCRB 3X2QB 3SR2C 3TK1A 4TOIA 4UCSA 4WCEV 3GWOA 3N2KB 3HR0A 2DYRC 1NTMH 1H2GA 1KBHA 1BL8A 4GLXA 1G4YB 2WLHA 3TXSA 3AG4C 1N34B 2WLNA 3A0RA 5H6QA 2F66C 4FVMA 3E8HA 5JJEB 2W6JG 2UXCO 2LFRA 3CCLV 4DR5O 1IURA 1GM7A 4WBNB 5GTIZ 5GW7A 5KAFZ 4CS4A 3SYAA 1TUBA 1Q82W 3M7MX 3JD4A 4LWSA 4QE7A 3RVZA 4IIJB 1KKCA 3CHXA 1OCZB 3BFRA 4H44B 3ABLC 3CEIA 4FM2A 3CRRA 3AG7A 1KQSU 1YSCA 1SRYA 2UXDB 1CEZA 2RCVA 2JK5C 4ABMA 2XASA 1HWYA 3L73H 4RWUA 2EIMB 2EINC 4UVAA 3VQWA 1E79G 2F43G 3CSXA 1AB3A 4GKJO 1IZ3A 4LFAO 3K03A 1XNQB 2QM8A 3ZJZA 1S5HC 3RYFB 1I5XA 2LW1A 2P5OA 3UT5A 4R50A 3VBBA 2M6YA 1Q6HA 1AR1B 4LF8O 1HNWO 1AI6A 1UJWB 3RYIB 5FPOA 3AG4B 3JD3A 1W2BU 3CB2A 4U3JB 1W0KG 4PA6A 2X6AA 3ZRXA 1FXVA 2HHHB 2JGDA 3F7YC 2DOSA 2YXLA 4GX0A 5J2UA 3WB1A 4BW9A 2Q6AA 5IWAO 5JH7B 1ZUQA 2P67A 3HB3B 1XMQO 1VF6A 1KP3A 1BS3A 1FXKA 3KZIZ 3ABLB 5CN0A 1K7DA 5B1AC 4YIPA 1KD1W 5L3BA 2Q7GA 4DR4B 3CE2A 4X9QA 4LFCO 3P30A 2QWRB 3KG2A 2CUGA 4LH6A 5JCOA 5LXTA 1M90W 2YEVA 2DQ0A 4DR2B 3P3PA 2ZR3A 3CS5A 1YITV 2QSAA 1YJNV 1N32B 3LNNA 4AI8A 4Z1MG 1U96A 2X6BA 1K34A 4GUNA 2JJ1G 4LWSB 2Q4PA 5DN6G 4JYAO 2ZXWC 3SPJA 4JI7O 4ZKIA 2HP8A 4PELA 4LC1A 3TXQA 3CXCU 4DV3O 1D5AA 4PDMA 4UXNA 2ZR2A 5EC2C 4ZI7A 3RGBA 2OYQA 1P7BA 4MVOA 3UCSC 3U11A 4ZBMA 1R6NA 4JYBA 4X65O 1N33B 4O2BA 1Q6IA 4DW0A 3FB5C 2P90A 3I5DA 4W4LA 4P30A 3OTOB 4TWKA 1VF7A 4YY3O 3MDSA 4OPHA 2Y69C 1M57B 5B1BC 3C3TA 1Y76A 5B1AB 5IE9A 1N36B 1BT8A 1LUVA 2CE4A 2FB5A 2IH3C 1SZXA 2IJHA 4JAVA 1D2DA 4UFZA 2E5LB 3CD6V 2OT5A 4GZRB 2ZE8A
chains in the Genus database with same CATH topology
2QWOB 1N4CA 1WJZA 2EJ7A 2QWRB 1IURA 1BQZA 2CUGA 1NZ6A 2L6LA 2LGWA 2Y4UA 3APOA 4RWUA 1GH6A 2QWPB 2YUAA 2QWQB 3APQA 2CTWA 2CTRA 1BQ0A 1FAFA 2N05A 2QSAA 2Y4TA 3UO3A 2GUZA 2DN9A 1XBLA 2LO1A 2OCHA 3UCSC 2DMXA 1FPOA 2N04A 3BVOA 4IT5A 2GUZB 2KQXA 3AG7A 1HDJA 2CTQA 2QWNB 3UO2A 4J7ZA 4J80A 2YS8A 2M6YA 2PF4E 2CTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWO B;  1N4C A;  1WJZ A;  2EJ7 A;  2QWR B;  1IUR A;  1BQZ A;  2CUG A;  1NZ6 A;  2L6L A;  2LGW A;  2Y4U A;  3APO A;  4RWU A;  1GH6 A;  2QWP B;  2YUA A;  2QWQ B;  3APQ A;  2CTW A;  2CTR A;  1BQ0 A;  1FAF A;  2N05 A;  2QSA A;  2Y4T A;  3UO3 A;  2GUZ A;  2DN9 A;  1XBL A;  2LO1 A;  2OCH A;  3UCS C;  2DMX A;  1FPO A;  2N04 A;  3BVO A;  4IT5 A;  2GUZ B;  2KQX A;  3AG7 A;  1HDJ A;  2CTQ A;  2QWN B;  3UO2 A;  4J7Z A;  4J80 A;  2YS8 A;  2M6Y A;  2PF4 E;  2CTP A; 
#chains in the Genus database with same CATH topology
 1J95 A;  4JI1 B;  2JGD B;  3ABM B;  1P4R A;  5IY5 C;  3TJT A;  1IX9 A;  2LGW A;  4K3A A;  5J2T B;  2N74 A;  4ZHQ A;  4B3R B;  3CJH A;  1HNX B;  2QTS A;  5D5Q A;  5J2U B;  2YI9 A;  4P9O A;  4NXN B;  1MG1 A;  2WSS G;  2Y4T A;  3SDL A;  4KHP B;  3FAV A;  3E22 A;  4IYH A;  1AI5 A;  3T4D A;  3SJQ C;  1NI8 A;  4IYI A;  3L72 H;  4LBE C;  2A79 B;  5IYZ A;  3OFN G;  2ZXW B;  1VEW A;  3IC7 A;  1ROP A;  4MTX A;  1KP2 A;  2XUM A;  2CAZ C;  3BEH A;  1N34 O;  1Q90 D;  4DK0 A;  1QLE B;  3OMI B;  2ZE5 A;  5DEC A;  3HKE A;  2BSK A;  3MHH C;  1FPO A;  2YEV B;  1XUQ A;  4UUJ C;  3IAY A;  4RUE A;  3CCM V;  2ZNJ A;  1VIB A;  1XEQ A;  4O4L A;  1GN3 A;  3ZRS A;  5KHG A;  5EK0 A;  3SPG A;  1Q7Y W;  1ZLZ A;  4PI2 A;  3BY6 A;  2Y69 B;  1BCC H;  1YVW A;  5B1B B;  4JF3 A;  4UCT A;  2QKS A;  3L70 H;  2OCH A;  2PGG A;  4JTD B;  4DRX A;  2UXD O;  4ZI7 B;  2P4V A;  1K8A W;  2DE0 X;  1SQF A;  4X66 B;  3UQ8 A;  2R9A A;  4FLZ A;  2EJ7 A;  4TQF A;  3D3I A;  4U3F H;  4C7U A;  1JFF A;  1IBM B;  5KHK A;  4LF5 O;  1EZV H;  4OX9 B;  3SPI A;  1S76 D;  3JAR A;  1JJO A;  1Z5W A;  1YHQ V;  1DLB A;  1RM1 C;  2QKC A;  3ZMV A;  3ASO C;  4X1K B;  3CC2 V;  1Y76 B;  3ZCC A;  3AG1 C;  2ATK C;  5AG2 A;  2WWW A;  4QE9 A;  3CCV V;  1XIL A;  5L3D A;  5JQG A;  1EBO A;  2O57 A;  2WLI A;  4L87 A;  2HHH O;  4ZHQ B;  1OCC B;  1PM9 A;  3ZN1 A;  4X88 A;  4JV5 B;  1QVF U;  1H2S B;  3E22 B;  2IU0 A;  1Y6X A;  5IYZ B;  2ZKO A;  5E1A C;  3HKC B;  1Q5O A;  1SQX H;  3N2G A;  1XI1 A;  2LQT A;  5JVD A;  2Q69 A;  3WFV A;  3J7A U;  2IU3 A;  1YDX A;  4DR4 O;  2ZCE A;  3HKE B;  1Z5V A;  2BSK B;  3W7U A;  4DR1 B;  2QJ1 A;  1MZE A;  2HVJ C;  2AZ2 A;  4UB8 Z;  1VQ5 V;  1G8M A;  3SYP A;  4LF6 B;  3CCU V;  4J9Y B;  4DV1 B;  2Z0A A;  1YJ9 V;  1NVP B;  3QO8 A;  1N32 O;  2CTR A;  2EIL C;  3J80 N;  1R3L C;  5ITZ A;  3ASO B;  4QNH B;  3BPZ A;  1B6Q A;  4NTW A;  2PI4 A;  3DSQ A;  2W6I G;  4YHH O;  5H5N A;  1VQL V;  4UCV A;  3AG1 B;  4DRX B;  2XT9 A;  3KCY A;  1V9P A;  3G80 A;  2Z5U A;  4K8X A;  3CRC A;  1SQG A;  2MK3 A;  4ZIB A;  2XOK G;  1JFF B;  2A06 H;  4I4T A;  3JAR B;  5IYD O;  1OV9 A;  1N33 O;  3AK2 A;  4Q6G A;  5IYB O;  3ZS8 C;  1MNG A;  3ZN0 A;  1ZX3 A;  2NN4 A;  4G2K A;  4RQF A;  2RQ6 A;  2UUC B;  3ZHQ A;  1N36 O;  1XL4 A;  3K59 A;  1BSM A;  5EIB C;  3K0D A;  5KHH A;  1WAZ A;  5JQG B;  2E5L O;  1R1B A;  2NNU A;  2Q0O C;  4WFA V;  2WLI B;  4PI0 A;  2FML A;  4JI1 O;  2LJ2 A;  2WLJ A;  5EBM C;  1PL4 A;  3ASN B;  1HNX O;  3A0B Z;  1X4T A;  5IT9 N;  4NXN O;  4KHP O;  4NXM O;  3VQX A;  1VQP V;  2QWQ B;  2FL4 A;  3WU2 Z;  3K9S A;  3AG2 B;  2N05 A;  2YDE A;  3W7T A;  3B4S A;  1WPB A;  3N2G B;  5JVD B;  3CX5 F;  5J9P C;  2Y0P A;  4KL1 A;  2X6C A;  4KP4 A;  2VRZ A;  3H1K H;  3BA9 A;  1FXH A;  2QWO B;  2PZS A;  4DW1 A;  1MZF A;  4L8J A;  1MMM A;  2UUA B;  4DV7 B;  1H38 A;  4QPJ A;  4JI7 B;  1K33 A;  4XDJ A;  2QM7 A;  2UXX A;  4CBC A;  2B1G A;  4MW8 A;  4O2A A;  4PJ0 Z;  1YIJ V;  2ZQM A;  1MA1 A;  1KYO F;  2PUS A;  1R6K A;  2OIE A;  1CP9 A;  3APO A;  1W59 A;  1AIL A;  1Y4M A;  4X65 B;  2R70 A;  3LSQ A;  3ABT A;  5EC1 C;  5L3G A;  1AI7 A;  4IT5 A;  2JS5 A;  4B7E A;  3LNM B;  2JIZ G;  4FLV A;  1PV0 A;  5EYP A;  2QA4 V;  1IBM O;  4HNA B;  2M7W A;  3G4S V;  4OX9 O;  5B1O A;  3RYI A;  2GV9 A;  4DR7 B;  1NU1 H;  1P7G A;  1WPX A;  2KG7 A;  4I0X A;  5LOV A;  3OUF A;  3S3X A;  3K06 A;  5B1N A;  1L0L H;  4OXS A;  5CBF A;  3JAM N;  2A3Q A;  5HFM A;  4DR3 O;  3C90 A;  3THO A;  4QGP A;  3F7V C;  2P4K A;  4YJ2 B;  4BR6 A;  1XL6 A;  4UB6 Z;  5CMU A;  2RNB A;  1M1K W;  5JH7 A;  1BGY H;  1COW G;  4JI3 B;  2Z3Y A;  3RVY A;  4JV5 O;  2EUL A;  3NR7 A;  5IDJ A;  4DUZ B;  2YIB A;  1K9M W;  1YXB A;  2VQE B;  3G67 A;  2UUB O;  1K4C C;  4CH6 A;  1P84 F;  3GB7 C;  4FM0 A;  3CCQ V;  5BZB A;  2ZIO A;  1ORQ C;  3JAS B;  1P49 A;  1OJH A;  3RBZ A;  2EJR A;  4FLW A;  4TV9 A;  2Y0I A;  4YJ3 A;  5KHJ A;  3NXS A;  4D6T H;  4JAU A;  1MAB G;  1TA8 A;  4JI0 B;  2DMX A;  4DR1 O;  3KKY A;  1G6U A;  2ADP A;  2R9R B;  1D5N A;  3B77 A;  2GHY A;  2KB1 A;  3ZMZ A;  4LF6 O;  4DV1 O;  2AHZ A;  4EKW A;  5TIS Z;  4O2A B;  4I55 A;  1QVG U;  3RYH A;  3IC9 A;  1HW7 A;  1OHH G;  2W0F C;  1I94 B;  1QHT A;  1VMG A;  4TUY A;  3JAK A;  3ETQ A;  2A7W A;  3CYO A;  2Y48 A;  4LF5 B;  3K3W A;  2GTS A;  3OE7 G;  2IJK A;  1YTF B;  4KUM A;  4TT3 G;  2DYR B;  3ZHR A;  4B3M B;  3FFQ A;  1N4C A;  1TGO A;  4U7N A;  2ZD9 A;  3JAT A;  1XDC A;  5EYP B;  3ETG A;  4UV9 A;  5E79 Z;  1H2M A;  2C2A A;  4HZ3 A;  2KG7 B;  4I0X B;  1SC5 B;  3ZHV A;  5LOV B;  2F4V B;  5BXZ A;  1K73 W;  1DF4 A;  5LBQ A;  1BHB A;  2EIJ C;  5KX5 A;  4LCU C;  3K08 A;  4JTC B;  1QCE A;  2UUC O;  5J2T A;  2L35 A;  3FB6 C;  1BQZ A;  1NZ6 A;  4U7O A;  4BAY A;  4J9Z B;  3E2E A;  3D36 C;  1M4U A;  3JSN A;  3ABU A;  2ZT9 B;  4CC6 A;  2QTO A;  3OT7 A;  2JGU A;  1E1Q G;  5K1X A;  3U0Z A;  3IJ4 A;  4ASU G;  3CRM A;  2EIN B;  4G28 B;  4JI8 O;  1GM9 A;  3E35 A;  1F23 A;  4IGG A;  2WLM A;  4JI4 B;  3JCZ A;  4TV9 B;  4YJ3 B;  4GX5 A;  1Q86 W;  3GVM A;  1HNZ O;  4Z1V A;  1XHZ A;  1FKA O;  2UUA O;  3H1I H;  4FK5 C;  1HR0 B;  1LNQ A;  4DV7 O;  2ODM A;  3E8G A;  2WLL A;  4YHH B;  2BTQ A;  4WFB V;  5H6R A;  1U97 A;  2V4D A;  2QEX V;  2YUA A;  5LGU A;  3ABK C;  3T1C A;  4EFB A;  4FLU A;  4I55 B;  1SQB H;  4MTF A;  2EIJ B;  4LNU A;  3Q4H B;  1AR4 A;  3RYH B;  2AXT Z;  2QDO A;  1FFT B;  1FS0 G;  1M5I A;  4JI6 B;  3ZBH A;  4TUY B;  2BCC H;  3JAK B;  1NR1 A;  5C8Y A;  1K5S A;  5EBW C;  2YIA A;  1R3K C;  4J41 A;  5KUM A;  3JAT B;  1R3I C;  2WPD G;  2PTM A;  4X1K A;  4FIP C;  1RFY A;  1PP9 H;  5B66 Z;  4FZ1 A;  2AZ0 A;  3OEE G;  4DR7 O;  1MSD A;  4RUF A;  5A2Q N;  4MSW C;  4MVR A;  5LMN B;  5KX5 B;  1VQ9 V;  1AP6 A;  1K5Q A;  3K5N A;  1S5J A;  3CRA A;  2EZP A;  4CS3 A;  2IM9 A;  1TAE A;  4BIZ A;  5KA6 A;  5LGN A;  4NXM B;  3HKB B;  2IJJ A;  3H9V A;  1B3Q A;  2GUZ B;  4I50 A;  3U10 A;  4JI3 O;  3SJC C;  3WG7 C;  1JJ2 U;  4JZ2 A;  4PDL A;  2VQF B;  4LF4 O;  1R6T A;  3FYI B;  3HKC A;  3CWB H;  1NTK H;  1YI2 V;  4UCR A;  4J42 A;  3ABK B;  1KB9 F;  3IGA C;  3FYE B;  1M9N A;  4DUZ O;  2PYJ A;  4DUY B;  2E76 B;  2MW2 B;  2VQE O;  1QNM A;  4FZ0 A;  3CCR V;  4W4K A;  3W7S A;  4BWA A;  1VP7 A;  4DV2 B;  4B7K A;  3B8N A;  1Y66 A;  3JAL B;  4BIU A;  3E86 A;  3W7W A;  2QKA A;  1VQ8 V;  1FFX B;  1BMF G;  4JI0 O;  3ZRW B;  4MTG A;  2WLL B;  1SA0 A;  2BTQ B;  1VQO V;  3T1Y B;  3CXH F;  1R73 A;  4TQD A;  3C3S A;  3BA8 A;  5LP6 A;  3VQV A;  5JJJ B;  3KCX A;  3CCJ V;  1L0N H;  4LNU B;  4QPK A;  2JEX A;  1ZTE A;  2HVK C;  1XHX A;  3JYC A;  5IY5 B;  4JAA A;  5KLV H;  5CB4 A;  1I94 O;  1GH6 A;  2ARH A;  2ZNI A;  5CA0 A;  4MVM A;  5C8Y B;  3CMA V;  5IYC O;  5EZY A;  5LMU O;  2ZDI C;  1M93 A;  1PD3 A;  1N0J A;  4UV8 A;  4B3M O;  4RO2 A;  4DR3 B;  2NLJ C;  1LUW A;  2UXN A;  2GSM B;  1N8R W;  1UFI A;  5LP6 C;  4H37 A;  3H1H H;  2F4V O;  3E83 A;  5B3S C;  4OPA A;  1BE3 H;  1E1R G;  2AGA A;  2Q68 A;  1EM1 A;  2NR5 A;  3IFX A;  1Q43 A;  5FPR A;  2KQX A;  4HBN A;  2GTA A;  5DM6 V;  1UPG A;  5IJ0 B;  2UUB B;  1KMI Z;  1W0J G;  4I50 B;  1WJZ A;  3ZIA G;  1SF9 A;  2B5U A;  1IDS A;  3A0H Z;  3QVN A;  3QF7 A;  4RAI A;  1VQ4 V;  3DC6 A;  1VQM V;  2OCC C;  2YC0 A;  4R6Z A;  2XAG A;  1X59 A;  2OWO A;  3OW2 U;  3K04 A;  4MVQ A;  3E8B A;  4DO2 A;  2ITC C;  5CA1 B;  4MS2 A;  4YXW G;  2YIB D;  3TGU H;  1VQ6 V;  4JI4 O;  4PHZ A;  1CPY A;  2DQ3 A;  5IJ9 A;  1GN6 A;  4WFF A;  2UU9 B;  1OCO C;  2K9P A;  4GYC B;  2GBO A;  4UVC A;  1RM1 B;  2ZIN A;  1XMO B;  3SPC A;  4DYL A;  2IBZ H;  1HR0 O;  1SA0 B;  3J81 N;  3RN4 A;  1QR9 A;  5LP6 B;  2YIC A;  4NTY A;  4AQY B;  2EX3 A;  1BZK A;  2HLD G;  5LHI A;  3DTU B;  5B3S B;  2DYS C;  4BIO A;  3LDE A;  4H33 A;  2Q67 A;  5CB4 B;  4CS2 A;  4JI6 O;  4FLT A;  5CA0 B;  2D2C B;  1IBK O;  4HNA A;  5EZY B;  3ETE A;  5K1P A;  3BAB A;  2A9H A;  2YI8 A;  1SQV H;  1K3E A;  2ZE6 A;  3ZMU A;  4N21 A;  2OCC B;  3R66 A;  4YJ2 A;  4X64 B;  4MW3 A;  1L1F A;  1LR1 A;  1ARO P;  5LMN O;  5LYJ B;  2YID A;  2Q73 A;  4A5U B;  2EIK C;  4JYY A;  4DV0 B;  4BW5 A;  2RJZ A;  1I5Y A;  2EIL B;  2QWP B;  2LFS A;  1H2L A;  4K0K B;  2VQF O;  4JI8 B;  2LP7 A;  4I9Q A;  3H01 A;  4JTA B;  3JAS A;  1A32 A;  3A8T A;  3CC7 V;  4DUY O;  1AR5 A;  4J7Z A;  2LGQ A;  1H8E G;  1HNZ B;  2ITD C;  2DYS B;  2P22 C;  3OM3 B;  4JAS A;  4MVZ A;  1T5E A;  3E89 A;  5LHH A;  1BQ0 A;  3E8F A;  1QQC A;  5LL6 Y;  4B3S B;  4DV2 O;  3WB0 A;  4YIO A;  5FNV B;  5HFL A;  5IJ9 B;  3T1H O;  4XDL A;  3X2Q C;  1GMG A;  4NTX A;  1YF2 A;  4P2Z A;  2QM4 A;  4IHJ A;  3RYC A;  2R72 A;  4J11 A;  4DXW A;  4UCU A;  2ADQ B;  3JAW A;  2WAM A;  1K97 A;  3T1Y O;  2AHY A;  1NKD A;  1J5E B;  4GX2 A;  4PDV A;  4Z2W A;  4PA4 A;  4X1Y A;  1F4M A;  3GWK C;  1FAF A;  1Q81 W;  1SES A;  1AJN A;  2E74 B;  1JCH A;  2EIK B;  2N04 A;  1OZ0 A;  3JD1 A;  1S5L Z;  5JWP A;  3MAQ A;  2Q8V A;  1VQ7 V;  2VWK A;  3ZHS A;  2CTP A;  3JCU Z;  4IL6 Z;  4PA3 A;  1S0V A;  5LGT A;  5D5P A;  1WNS A;  3OGI B;  1H8H G;  1SQP H;  4GCZ A;  2HR3 A;  4UCO A;  1XRE A;  1QBZ A;  1OCZ C;  4NVP A;  1Y74 A;  4CH3 A;  4JI2 B;  3B09 A;  5KMG A;  2XAH A;  2BOB C;  2FTK A;  4LF4 B;  4O4J A;  1IBL B;  3JD2 A;  4DR6 B;  2ZM6 B;  3MHS C;  4PD4 F;  4TV8 B;  2F95 B;  1JMK C;  1I08 A;  1TVK A;  4EEQ A;  3BHP A;  5LHG A;  1Q3E A;  1RPR A;  3AK3 A;  1PPJ H;  1BHA A;  4UVB A;  3I56 V;  4HAM A;  4FLY A;  3STL C;  1H2N A;  4B08 A;  4O4I A;  4QIW F;  1WB7 A;  4LF7 B;  3UO3 A;  2DN9 A;  1KEC A;  1Y67 A;  1SKV A;  3ETD A;  5BMV A;  1GTO A;  4FM1 A;  4GKK O;  3L74 H;  4LFB B;  4DV5 B;  1WP7 A;  2XND G;  2PF4 E;  2UU9 O;  4IHJ B;  3RYC B;  5FL7 G;  3F5W C;  4PDR A;  1WP8 A;  4CH5 A;  3Q4H A;  1XMO O;  1YCI A;  4FFK A;  4FPP A;  4DV6 B;  2W0X A;  3JAW B;  1DGS A;  2A0L A;  2K1E A;  5KHI A;  1NVP D;  2KKW A;  2VS0 A;  4FFB A;  4X1Y B;  2EZO A;  2PY5 A;  1NBM G;  1AVM A;  3OAA G;  3BCC H;  4AQY O;  2KSD A;  3K5M A;  5LMU B;  3LDC A;  3D36 A;  4XBF A;  2CH7 A;  1JQ0 A;  1JPX A;  4WF9 V;  4QJF B;  1FD9 A;  1KU9 A;  4J7J A;  4I5S A;  2CDY A;  1RSO A;  3ZED A;  4F4L A;  3HPL C;  4CH4 A;  4B3T B;  3QO5 A;  3FB8 C;  4RQE A;  3OMA B;  1ZL8 B;  1Y74 B;  4X64 O;  5KA5 A;  3MD0 A;  3O65 A;  3D8C A;  3HKB A;  2IH1 C;  5KMG B;  1VQK V;  1FYJ A;  4HYO A;  5A9G A;  3G6E V;  2GUZ A;  4DV4 B;  2FKX A;  3QG5 A;  4DV0 O;  4O4J B;  1Q8I A;  2JJ2 G;  3T2M A;  4E4E A;  2JDI G;  2V1D A;  3OTF A;  2B9Z A;  1TVK B;  1SS3 A;  3K9A A;  2E75 B;  4JPR A;  2H3O A;  4JYC A;  3CCS V;  4K0K O;  1QR8 A;  1I0H A;  4WFG A;  2DWD C;  4X89 A;  3ZHT A;  3EVK A;  2P7T C;  4EFE A;  3ICX A;  2G38 A;  1HP8 A;  1GO3 F;  4O4I B;  3JAL A;  1M57 C;  1AJQ A;  5DED A;  1SET A;  1YEW A;  2XAJ A;  3B8M A;  4R8C A;  1FFX A;  2XAQ A;  4G27 B;  3ZRW A;  5BMV B;  1S72 V;  3FB7 C;  4B3S O;  4KFM A;  3ABM C;  1SZT A;  1GRJ A;  2ILM A;  3DXR A;  4X62 B;  1QU7 A;  3RW0 A;  3UKM A;  3CRQ A;  3LSU A;  4D7S A;  4PV1 B;  1TUB B;  3SGI A;  2RN9 A;  2BTO A;  1NR7 A;  1VF6 C;  3OD4 A;  4FFB B;  1FXK C;  4ICG A;  3K57 A;  1J5E O;  1VQN V;  3UO2 A;  1FJG O;  3JD0 A;  1PNL A;  1IBK B;  2JEU A;  3DC5 A;  4OGQ B;  4NYK A;  1TUE B;  5F2V O;  1NQT A;  1THZ A;  2HG5 C;  3AK1 A;  1EN4 A;  2CH7 B;  1KUQ A;  1ENV A;  1QLE C;  5EIB D;  2PYL A;  1DF5 A;  5JCO C;  3L71 H;  2Q7H A;  2OIG A;  4Q20 A;  4I9W A;  1RSO B;  5GON A;  1IXM A;  3RWR D;  3UT5 B;  5H2F Z;  5BR8 B;  4FLX A;  3S3W A;  1B06 A;  2CGN A;  1IXB A;  4I7Z B;  2YXH A;  3CCE V;  2JRI A;  4FJC C;  4JI2 O;  5IJ0 A;  2GDS A;  3LDD A;  3R65 A;  4KXR A;  4LF9 B;  2QWN B;  2X0L A;  4DR6 O;  1IBL O;  1GKF A;  2ZM6 O;  1F4N A;  2YXY A;  3EFF K;  4JI5 O;  4DK1 A;  2CGO A;  3L75 H;  3APQ A;  2WA4 A;  3M99 B;  2HFE C;  3CPW U;  5CA1 A;  2HKO A;  3BVO A;  1MOF A;  1AI4 A;  1FXK B;  4X8A A;  2Q0A A;  1I7F A;  1HDJ A;  5LA6 A;  3T1H B;  1QLN A;  1K4D C;  4K35 A;  2EBO A;  2ZDI A;  3QO7 A;  4LF7 O;  2YSU B;  1GAX A;  3H1J H;  2H8P C;  1VF5 B;  2Q9L A;  3OMN B;  4F6R A;  1GN4 A;  5LXT B;  4LFB O;  4R7C A;  3DXR B;  3LUT B;  4DV5 O;  1OCC C;  1XNR B;  2R9I A;  1S77 D;  1EN6 A;  5GTH Z;  1JR9 A;  4DV6 O;  3RFR A;  3VQY A;  2DJV A;  1M56 C;  2Q7E A;  1YJW V;  4PA9 A;  1JVM A;  3PN1 A;  1S3J A;  3G71 V;  5L3E A;  5KAI Z;  1SER A;  4JZG A;  3AEI A;  3WG7 B;  5JJN B;  1NTZ H;  4D7T A;  3K79 A;  5BY1 A;  4CC5 A;  1NH2 B;  2XAF A;  1WA8 A;  1YTF D;  3K5L A;  3ZX6 A;  2HEP A;  5GON B;  1JX9 A;  1XNQ O;  4O2B B;  3K58 A;  5LYJ A;  3EXA A;  2UXB B;  1GK9 A;  4B3T O;  3TCU A;  4O4H A;  3SYO A;  4WFE A;  4EB6 A;  2P06 A;  2QE7 G;  1V54 C;  1EZJ A;  1ZSP A;  5C93 A;  4JGS A;  2VWJ A;  4DV4 O;  2XTA A;  4NKG B;  4NB5 A;  4GX1 A;  3RT3 C;  3B2E E;  3CJH B;  4J7K A;  1PNK A;  5FLX N;  2DW4 A;  3FAV B;  2XHB A;  3TET A;  2B1I A;  2OTL V;  3FKS G;  1M56 B;  1ZAU A;  1ZWI C;  3O9O A;  3AG3 C;  2FYU H;  4ZOL A;  3WB2 A;  4GKK B;  5LA6 B;  1F7Y A;  5FNV A;  2UXC B;  2BOC C;  4J10 A;  4DR5 B;  1US6 A;  1JOY A;  5L3C A;  3FD9 A;  3OGC C;  1EN5 A;  2HJF C;  1PL0 A;  3STZ C;  4F6R B;  2D3O W;  1B04 A;  3HKD A;  5CBH A;  2ZE7 A;  3N27 A;  4J80 A;  1KKD A;  4X1I A;  1Q6U A;  3G6B A;  4DR2 O;  4X62 O;  3ASN C;  1K92 A;  4LH7 A;  4O4L B;  2ETN A;  2F1M A;  5CBG A;  2Q5Z A;  3D3Q A;  1Z2G A;  4H0L B;  3F5T A;  3AG2 C;  2RDC A;  3ZHU A;  3PJS K;  3K5O A;  1V54 B;  2CTQ A;  1AP5 A;  4GKJ B;  1URF A;  4LFA B;  2P6J A;  4FMT A;  1EFR G;  2X7R B;  2L6L A;  4AIL C;  3A2F A;  3M8A A;  4MVU A;  1WA8 B;  3OEH G;  4LF8 B;  1HNW B;  3B40 A;  1GM8 A;  4K8Z A;  4X20 A;  1SQQ H;  3FX7 A;  4AHC A;  2F93 B;  3AG3 B;  1IVS A;  4O4H B;  4EB6 B;  3OUS A;  5BR8 O;  3OTO O;  1V55 C;  4MTO A;  1PKX A;  2IW5 A;  2CK3 G;  3T4Z A;  4TV8 A;  1OCO B;  3K0G A;  5IWA B;  3L9D A;  1YZB A;  3N2K A;  3UM7 A;  3I55 V;  4LF9 O;  3BAA A;  1WB8 A;  2QGN A;  4N23 A;  1XMQ B;  1DTO A;  4MT8 A;  3SJB C;  2E3C A;  4B3R O;  1F51 A;  3EHB B;  3DGE A;  2YS8 A;  2JVD A;  2F23 A;  1O9G A;  2V7Q G;  4CZZ A;  5L3F A;  2BE3 A;  4LP8 A;  1WLE A;  1RPO A;  4LFC B;  1XQ8 A;  4ZOL B;  1DK1 A;  1RP3 B;  4E2L A;  3JSL A;  1AJP A;  4NR1 A;  1OCR C;  1PNM A;  2QR4 A;  4WBN A;  5B5E Z;  3CP1 A;  1O9H A;  1N0N A;  1NT2 B;  3ML0 A;  4JYA B;  2RMK B;  4IIJ A;  4MVS A;  3HKD B;  1CXZ B;  4X1I B;  1FJG B;  2JS3 A;  3W7X A;  1XNR O;  2LO1 A;  5CA3 A;  4DV3 B;  1MSW D;  3SPH A;  3SYC A;  1H2K A;  5ITZ B;  1VAR A;  3SJA C;  1V55 B;  2AW9 A;  2LW7 A;  2HJD A;  2DWE C;  4LR3 A;  3ZMS A;  4TSF G;  3CME V;  5H9C A;  1KC8 W;  2WLK A;  3P32 A;  1JA8 A;  1XOU A;  2CTW A;  5EBL C;  2PI5 A;  3H1L H;  3QTC A;  3ZMT A;  4F6E A;  2IJI A;  1WN7 A;  1XBL A;  4PA7 A;  3P3N A;  3RYF A;  3OR7 C;  1NS1 A;  3LSS A;  4X66 O;  4YY3 B;  4WFH A;  1ZL8 A;  3BRC A;  4X20 B;  4H13 B;  2H94 A;  4I4T B;  4XDK A;  3QNE A;  1NJI W;  2Y4U A;  4P9P A;  5KUK A;  1G1X B;  1GN2 A;  3VOU A;  1NH2 D;  4U3J A;  2ZIM A;  3CC4 V;  2UXB O;  3OR6 C;  1R3J C;  2WA3 A;  4GT1 A;  2EIM C;  4JI5 B;  3SYQ A;  1L8D A;  3ZRV A;  2OTJ V;  1OCR B;  3X2Q B;  3SR2 C;  3TK1 A;  4TOI A;  4UCS A;  4WCE V;  3GWO A;  3N2K B;  3HR0 A;  2DYR C;  1NTM H;  1H2G A;  1KBH A;  1BL8 A;  4GLX A;  1G4Y B;  2WLH A;  3TXS A;  3AG4 C;  1N34 B;  2WLN A;  3A0R A;  5H6Q A;  2F66 C;  4FVM A;  3E8H A;  5JJE B;  2W6J G;  2UXC O;  2LFR A;  3CCL V;  4DR5 O;  1IUR A;  1GM7 A;  4WBN B;  5GTI Z;  5GW7 A;  5KAF Z;  4CS4 A;  3SYA A;  1TUB A;  1Q82 W;  3M7M X;  3JD4 A;  4LWS A;  4QE7 A;  3RVZ A;  4IIJ B;  1KKC A;  3CHX A;  1OCZ B;  3BFR A;  4H44 B;  3ABL C;  3CEI A;  4FM2 A;  3CRR A;  3AG7 A;  1KQS U;  1YSC A;  1SRY A;  2UXD B;  1CEZ A;  2RCV A;  2JK5 C;  4ABM A;  2XAS A;  1HWY A;  3L73 H;  4RWU A;  2EIM B;  2EIN C;  4UVA A;  3VQW A;  1E79 G;  2F43 G;  3CSX A;  1AB3 A;  4GKJ O;  1IZ3 A;  4LFA O;  3K03 A;  1XNQ B;  2QM8 A;  3ZJZ A;  1S5H C;  3RYF B;  1I5X A;  2LW1 A;  2P5O A;  3UT5 A;  4R50 A;  3VBB A;  2M6Y A;  1Q6H A;  1AR1 B;  4LF8 O;  1HNW O;  1AI6 A;  1UJW B;  3RYI B;  5FPO A;  3AG4 B;  3JD3 A;  1W2B U;  3CB2 A;  4U3J B;  1W0K G;  4PA6 A;  2X6A A;  3ZRX A;  1FXV A;  2HHH B;  2JGD A;  3F7Y C;  2DOS A;  2YXL A;  4GX0 A;  5J2U A;  3WB1 A;  4BW9 A;  2Q6A A;  5IWA O;  5JH7 B;  1ZUQ A;  2P67 A;  3HB3 B;  1XMQ O;  1VF6 A;  1KP3 A;  1BS3 A;  1FXK A;  3KZI Z;  3ABL B;  5CN0 A;  1K7D A;  5B1A C;  4YIP A;  1KD1 W;  5L3B A;  2Q7G A;  4DR4 B;  3CE2 A;  4X9Q A;  4LFC O;  3P30 A;  2QWR B;  3KG2 A;  2CUG A;  4LH6 A;  5JCO A;  5LXT A;  1M90 W;  2YEV A;  2DQ0 A;  4DR2 B;  3P3P A;  2ZR3 A;  3CS5 A;  1YIT V;  2QSA A;  1YJN V;  1N32 B;  3LNN A;  4AI8 A;  4Z1M G;  1U96 A;  2X6B A;  1K34 A;  4GUN A;  2JJ1 G;  4LWS B;  2Q4P A;  5DN6 G;  4JYA O;  2ZXW C;  3SPJ A;  4JI7 O;  4ZKI A;  2HP8 A;  4PEL A;  4LC1 A;  3TXQ A;  3CXC U;  4DV3 O;  1D5A A;  4PDM A;  4UXN A;  2ZR2 A;  5EC2 C;  4ZI7 A;  3RGB A;  2OYQ A;  1P7B A;  4MVO A;  3UCS C;  3U11 A;  4ZBM A;  1R6N A;  4JYB A;  4X65 O;  1N33 B;  4O2B A;  1Q6I A;  4DW0 A;  3FB5 C;  2P90 A;  3I5D A;  4W4L A;  4P30 A;  3OTO B;  4TWK A;  1VF7 A;  4YY3 O;  3MDS A;  4OPH A;  2Y69 C;  1M57 B;  5B1B C;  3C3T A;  1Y76 A;  5B1A B;  5IE9 A;  1N36 B;  1BT8 A;  1LUV A;  2CE4 A;  2FB5 A;  2IH3 C;  1SZX A;  2IJH A;  4JAV A;  1D2D A;  4UFZ A;  2E5L B;  3CD6 V;  2OT5 A;  4GZR B;  2ZE8 A; 
#chains in the Genus database with same CATH homology
 2QWO B;  1N4C A;  1WJZ A;  2EJ7 A;  2QWR B;  1IUR A;  1BQZ A;  2CUG A;  1NZ6 A;  2L6L A;  2LGW A;  2Y4U A;  3APO A;  4RWU A;  1GH6 A;  2QWP B;  2YUA A;  2QWQ B;  3APQ A;  2CTW A;  2CTR A;  1BQ0 A;  1FAF A;  2N05 A;  2QSA A;  2Y4T A;  3UO3 A;  2GUZ A;  2DN9 A;  1XBL A;  2LO1 A;  2OCH A;  3UCS C;  2DMX A;  1FPO A;  2N04 A;  3BVO A;  4IT5 A;  2GUZ B;  2KQX A;  3AG7 A;  1HDJ A;  2CTQ A;  2QWN B;  3UO2 A;  4J7Z A;  4J80 A;  2YS8 A;  2M6Y A;  2PF4 E;  2CTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...