2QWPB

Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi form #2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Structural basis of J cochaperone binding and regulation of Hsp70.
pubmed doi rcsb
source organism Bos taurus
molecule tags Chaperone
total genus 30
structure length 92
sequence length 92
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2qwpB00
2CTQA 2DMXA 1WJZA 2GUZB 2N04A 2PF4E 2Y4UA 2Y4TA 2CTPA 2N05A 3UO2A 3UCSC 1IURA 3APQA 1BQ0A 1BQZA 2QWQB 2KQXA 1XBLA 2QWPB 2GUZA 2QWRB 2CUGA 1GH6A 3BVOA 2CTRA 2CTWA 2QWNB 4IT5A 1NZ6A 2LGWA 2YUAA 3APOA 3AG7A 3UO3A 2QWOB 1N4CA 2YS8A 1FPOA 1HDJA 2EJ7A 2LO1A 4J80A 4J7ZA 2L6LA 2M6YA 2OCHA 1FAFA 2DN9A 4RWUA 2QSAA
chains in the Genus database with same CATH superfamily
1PV0A 3QTCA 1L1FA 3K5OA 3STZC 1L0NH 3S3WA 4GX1A 2GTSA 1Q3EA 4WCEV 3RYFB 4DR2B 2AHYA 3K3WA 2PTMA 3KZIZ 4X89A 1MZFA 2QWNB 5B1NA 1SETA 4RQEA 1US6A 2F4VB 1JFFA 4O2BB 3L9DA 1E1QG 1K4CC 4JYYA 2ZR2A 1WLEA 4DR5B 4TUYB 4I5SA 1QLEC 5B3SC 2ZE8A 4HZ3A 5JWPA 4J11A 3F5WC 1BQZA 4X64B 5E79Z 4O2AA 1EM1A 4RUFA 3BEHA 1H8HG 2VQEO 1M1KW 2P22C 1IBMB 5TISZ 5LHHA 1M9NA 4BWAA 2JGDB 1LUVA 3FYEB 3DC5A 4L8JA 5JQGA 2RQ6A 2Y69C 5H2FZ 4LF8O 1E1RG 4I50B 3C3TA 5KMGB 4LF7B 2R70A 2QWQB 4GUNA 4PDVA 5KAIZ 2A3QA 3OW2U 3APOA 3E8GA 5LA6A 1PP9H 1Q81W 1TGOA 5CA1A 2M7WA 2Q73A 2YIDA 3AK2A 4ZOLB 2XAGA 3FB5C 4J42A 2RDCA 1I5YA 3BPZA 4LNUA 4RAIA 5JJJB 4KXRA 3K0DA 3JASA 2RMKB 5CB4B 2UXCB 2QWRB 3QO8A 3K04A 3ZRVA 3B4SA 5FNVA 1JPXA 5EIBC 1FYJA 3P3PA 4FM2A 3RYHB 1XDCA 4R8CA 4QE9A 5EYPA 3N27A 4LBEC 1NH2B 2Y48A 3D36C 2ZIMA 2YEVB 2WA3A 5B1OA 2K1EA 1NU1H 2DYSC 1PPJH 4LF5B 2GUZA 2E75B 4JAUA 2QE7G 1W59A 2KB1A 5LHGA 1YTFD 3SJCC 1K9MW 1KKCA 4PDLA 3TETA 4B3MO 3K9SA 4BIZA 3JD4A 3QVNA 1SZXA 4JAAA 2QTSA 3ASOC 2OCCC 3CJHB 3O9OA 2LQTA 4ZI7B 5KA6A 5BR8B 3A0BZ 1N33B 2AHZA 2MW2B 4WFHA 4J7JA 4RQFA 3A0RA 3KCXA 3CXCU 3CSXA 2LO1A 1LR1A 1FXVA 5IT9N 3X2QB 2Y4UA 1HR0O 4TV8B 5C8YA 1CP9A 4FZ0A 2HEPA 1M56B 4XBFA 3CRAA 3LDCA 3JCZA 4JI3O 4K8XA 3CWBH 3K59A 2ZE5A 2WWWA 1RSOB 3GVMA 4I4TB 1BSMA 4DR1B 1G1XB 2PYLA 3L73H 2JIZG 2UUBO 1NTZH 2BTQB 1COWG 2G38A 4FM1A 1K97A 1KECA 1OCZC 4X65B 4GX2A 3WG7C 3P32A 1QBZA 1BGYH 1TVKB 4DR4O 3VQVA 3TXSA 1Y76B 4DXWA 5B3SB 4DW0A 1GM9A 1VQOV 4IIJB 3VBBA 1KP2A 1AROP 4O2BA 5LP6B 3MHHC 2CH7A 1XMQB 5B1AC 2NR5A 3JALB 3OMIB 2IJHA 2DYRC 4TUYA 2WPDG 3ZHTA 1U97A 4LF6B 2QWOB 2WLMA 2YS8A 3CX5F 3CCQV 1DGSA 2JDIG 4NB5A 4JI8O 4DV2B 3HKBB 4GZRB 3ABLC 4MW3A 3N2GB 4UV9A 2VS0A 3SPIA 3T1HO 3CD6V 3CB2A 3ABKB 5LOVB 4UXNA 3ZHVA 2ZM6O 4I50A 5KMGA 1SC5B 4KHPB 5BXZA 1ZTEA 2AGAA 3AG1C 4TV9B 5C93A 2KG7B 1H2NA 5A2QN 3SPJA 1YVWA 2P90A 4Z2WA 4ICGA 1XEQA 5KX5B 4ZOLA 3ML0A 3W7WA 1VF6C 3ETDA 2UUCB 1XNQO 1JVMA 2HR3A 3N2KB 4JI4B 1SQFA 3DTUB 4I9QA 3CCUV 1XOUA 3KG2A 5CB4A 5EBMC 1K34A 3RVZA 1N0JA 1THZA 3OUSA 1NTMH 3UO2A 4LR3A 2IH1C 1NR7A 1KQSU 1WN7A 2ZQMA 3T4ZA 1XMOB 3CHXA 4IL6Z 4CC5A 3LNMB 3OR6C 2HHHO 4XDJA 5J2TA 3T1YO 1AI4A 2QA4V 1HP8A 1FKAO 1S5LZ 2HVKC 4X8AA 1VF5B 3SJQC 3H9VA 5IY5B 4U3JB 3ASOB 2XAJA 4TWKA 1V9PA 1H2GA 3QF7A 4MVUA 4BIOA 3K57A 5KHHA 4OX9O 4DV0B 1JJOA 2LW1A 2IJKA 4AQYO 2OT5A 3AG4B 1OJHA 2Q0OC 4MVRA 5EC1C 2VQFB 3LUTB 1L0LH 2W0XA 1ZWIC 5EBWC 4ZIBA 1BHAA 5J9PC 4FLVA 1VF7A 2HJFC 2Q69A 2QR4A 3E22B 1Q43A 1YJNV 2YIBA 2DJVA 3F5TA 4GT1A 4UVCA 4JAVA 3UQ8A 2VQEB 4TV8A 2LJ2A 4JTCB 1IBKB 1GN4A 1WPXA 4DR7O 2UUAO 3LDDA 2A79B 3BABA 3TK1A 4LF8B 3MD0A 5K1PA 3B09A 3BFRA 2Q67A 4YY3O 4QE7A 4X1KA 4NTWA 4DK0A 1VQ8V 2XTAA 1JFFB 4LWSB 2QM4A 4WFEA 2ITDC 5IYZA 2BTQA 5H6QA 1GKFA 4I0XB 3MAQA 4FLXA 4JI2O 2D3OW 2AW9A 2C2AA 1FXKC 1HNZO 3PN1A 2YICA 1JJ2U 1TVKA 5JVDB 1VQKV 4CZZA 3FB6C 4GLXA 1YF2A 2JK5C 2Q6AA 2R9AA 1Y76A 3K5MA 4NTXA 2JGUA 4LF9O 2OYQA 4IIJA 2UU9O 3NR7A 5CA3A 2PI4A 1K73W 1Y66A 1ZSPA 1RM1B 3JALA 5LL6Y 2EINC 2XASA 1NH2D 2PZSA 4CC6A 3I55V 3G71V 1QVFU 1AI7A 5LYJA 5LA6B 1R73A 5JJNB 1B04A 1DTOA 4Q20A 4B7KA 3BVOA 4I7ZB 5KHIA 2LW7A 1SQGA 3N2GA 4JASA 1YZBA 4KFMA 4K0KO 1K7DA 4UCRA 4LNUB 2BCCH 2ZXWC 1ZAUA 1QLNA 4I55A 5CBFA 3JASB 1F4MA 2BOCC 1LUWA 1NS1A 1U96A 1KKDA 1SERA 2HP8A 1XQ8A 4QGPA 2N74A 3OTOB 1H8EG 5FL7G 2R72A 5CBHA 3CRRA 1N34B 1XL4A 2CTWA 1BMFG 4MVSA 1KU9A 5KX5A 1FD9A 1ORQC 3H1HH 1N4CA 3RGBA 2HLDG 4NVPA 3N2KA 2GUZB 2YIBD 4FLYA 2EILB 4JI3B 3D36A 5IWAO 4X20A 3AEIA 5L3CA 5JH7A 2GTAA 5DECA 3RYCB 3ZMVA 2E5LB 1TUBA 2UUBB 5EC2C 3ZHQA 4DR6O 2QKAA 3OEEG 2YSUB 5EBLC 1IX9A 3JD0A 4PDMA 4EFBA 4AHCA 5KHJA 1VQ5V 1S5HC 3I5DA 4BAYA 1I94O 1S77D 1FJGO 1UFIA 4U3JA 1PKXA 1W0JG 1Q82W 2OTLV 1RPOA 3CCSV 5C8YB 2BTOA 5BY1A 1J95A 1Q5OA 1SF9A 2P06A 2OCHA 2P4KA 4WFBV 1H2SB 1WP7A 5B5EZ 3UM7A 1A32A 2A7WA 2FL4A 3IFXA 3SYCA 3AK3A 3K9AA 3E22A 1EN5A 3NXSA 4KUMA 2YUAA 2DWEC 3IGAC 3L70H 1OCCB 4JI8B 1I5XA 3ZBHA 2WSSG 5GW7A 1UPGA 1M5IA 3WB0A 4JV5O 1BZKA 3T1HB 3JD2A 2EIMB 1HNWO 4MVOA 1PNMA 3RYIB 2X6BA 5FLXN 1UJWB 3HKDB 2ZM6B 3TXQA 1QR9A 5LXTB 4B3SO 3QNEA 4MW8A 3ZN1A 4LWSA 4LFAO 4DV1O 2CH7B 3A2FA 4I0XA 2ODMA 1VQ4V 1GN3A 2IU0A 4LH7A 3K58A 1KD1W 3APQA 4F6EA 5KAFZ 1M93A 3OGCC 1VQLV 1SZTA 1RFYA 4AILC 1EFRG 2W0FC 1R3KC 4CS2A 5JVDA 2EZPA 1P84F 3H1JH 1HNXO 5KHKA 4X62B 1NVPB 2Q68A 4D6TH 3UT5B 2NN4A 2PGGA 5LGTA 3BRCA 1QR8A 1Q8IA 4OPAA 2ARHA 3HB3B 2F93B 1V55B 3E8FA 4DV7O 1E79G 3H01A 5IJ0B 3ZRXA 2A06H 1IVSA 4DK1A 4E4EA 3DC6A 5DEDA 1HDJA 4RO2A 4UV8A 4NXMB 4GX0A 4PHZA 4DV4B 4ASUG 2ATKC 3B77A 1PD3A 2EX3A 1W0KG 3H1KH 4AQYB 4LFBB 1J5EO 1VF6A 1DK1A 3SJAC 2X6AA 3AG7A 1VQMV 2GV9A 5GONA 4UFZA 3FX7A 2ZDIC 4JYBA 5KUKA 3OUFA 2LFRA 4QPKA 4DV5O 3T1CA 4EFEA 1YITV 5CN0A 1VARA 1R1BA 5J2TB 2PUSA 3STLC 3JAKB 1R6KA 2BSKB 2WLIA 4PI0A 1SKVA 4DV6O 1IDSA 3AG3B 5L3DA 1N36O 1BCCH 1B3QA 3T2MA 4YY3B 1K3EA 3RYCA 2EIJB 2N05A 3CP1A 3IJ4A 5DM6V 1EZJA 4P30A 2CGNA 1F23A 1AR1B 1IZ3A 4UB6Z 3M99B 5B66Z 3SYAA 4O4HB 3E2EA 1OCRB 2LGQA 3AK1A 3VOUA 1ZUQA 5KUMA 4JTDB 3W7TA 1FFXB 2QM7A 4NXNB 1KC8W 4EKWA 2PF4E 4B3RB 2A0LA 3GWOA 4JI6B 4DR3B 1CXZB 1NBMG 4YHHO 4LF9B 4G27B 4FLUA 1XI1A 3SDLA 3IAYA 2UU9B 3RWRD 2IBZH 5JCOA 1GRJA 1GN2A 2H8PC 4PA6A 4JI7B 4JI5B 3RFRA 1H2KA 3ABMC 3OAAG 4X1KB 4U7NA 1KMIZ 2F1MA 4LCUC 3E35A 3JYCA 3CMEV 2W6IG 5IYZB 1M57C 1Q6IA 1Q6UA 1MSDA 5CA0A 2ADQB 3QO5A 3L74H 2XAHA 4F6RB 3WU2Z 5CBGA 3BAAA 4N23A 4K0KB 3CC4V 1QVGU 2L35A 3ZIAG 3RYIA 1WNSA 1AJQA 2D2CB 2EJ7A 5JJEB 3HKDA 1YEWA 3HPLC 1QNMA 4UCUA 5LXTA 1QLEB 4JF3A 1BS3A 3U0ZA 1FXKA 1CPYA 1AI6A 4PDRA 2B9ZA 3OM3B 4FFBA 2LFSA 4P9PA 1BHBA 5LGNA 4PD4F 1YCIA 3FD9A 3K79A 1SESA 4WFGA 1NZ6A 3JCUZ 1D5AA 1VQ6V 2H94A 4A5UB 3D8CA 2ZKOA 5LMUO 3AG2C 5LYJB 1FXHA 2Y69B 5LBQA 4JI0B 3Q4HB 1FFTB 1PNLA 1IBLB 4LFCO 1TA8A 3UT5A 2OTJV 3ZMZA 4JI1O 4PJ0Z 3JSNA 3ZRWA 2EIKC 4I55B 1RPRA 1Q7YW 3SGIA 4FIPC 3UO3A 4DR6B 2VRZA 1AJNA 3ZN0A 5IJ0A 1SS3A 1D2DA 3R65A 2DOSA 4R7CA 4HNAB 1R3IC 5IJ9A 2DW4A 1KUQA 2QKCA 1KP3A 3IC9A 5B1BC 4DR2O 3WB2A 1R3LC 4MVZA 3FAVA 2DWDC 3RBZA 4JYAB 4LH6A 2F4VO 3ZS8C 3CYOA 4X20B 3BA8A 3ZX6A 5JH7B 4WFFA 3B40A 1S76D 4DR5O 2DYSB 1G8MA 4OPHA 3D3IA 3K06A 4DUYB 4X64O 1TUBB 5GTIZ 2B5UA 4B3TO 1Y74B 4LC1A 1RP3B 2JJ1G 1W2BU 4X9QA 5LMNB 3JAWA 1IBMO 3C90A 4O4LB 4C7UA 3JSLA 3VQYA 4J80A 2Q0AA 3JAKA 1V54C 4JV5B 2BSKA 1HNWB 1K33A 2OCCB 4J9YB 3K08A 4OXSA 4E2LA 2UXBO 4LF7O 2Y0IA 4GKKO 3OEHG 4PI2A 1WB8A 1VMGA 3K03A 4X66O 5H6RA 4DW1A 3E8HA 4H0LB 4LFAB 2R9IA 4H13B 4DV1B 3DXRA 4O4HA 3E89A 4YIOA 4GCZA 4W4LA 3KKYA 3EVKA 3BA9A 1NKDA 4CBCA 1F7YA 3CCRV 1TUEB 3M7MX 4IHJB 1FFXA 4LF4O 2O57A 1PNKA 3OD4A 4TQFA 5BZBA 3ABMB 4MVQA 2K9PA 4QPJA 2L6LA 3RT3C 2DN9A 4D7SA 4QNHB 1BT8A 2IM9A 1NVPD 3QG5A 3D3QA 4TQDA 1OCZB 4FLWA 2VWKA 1R6NA 4D7TA 4UCOA 2P4VA 4Z1MG 3WG7B 3W7SA 3JARB 4LF5O 4KL1A 2E74B 4P2ZA 4NR1A 3G4SV 1GTOA 4NTYA 4F6RA 2FB5A 3HKCB 4GKJO 3KCYA 5B1AB 2Z0AA 2AZ2A 2JS5A 5IYBO 2Q7EA 2ZIOA 2CAZC 1K92A 2DYRB 2KQXA 2Z3YA 5IYCO 2AXTZ 2Q7GA 5BR8O 3TGUH 2DQ0A 3CS5A 4DRXA 1AILA 1S5JA 1QQCA 4XDLA 3ABLB 2UXNA 2N04A 4X88A 2R9RB 2KSDA 1VIBA 1WP8A 4HBNA 1JQ0A 3Q4HA 1GM8A 1PL4A 1QHTA 1T5EA 1N36B 1VEWA 3AG1B 3SR2C 4B3MB 2HJDA 4X1YA 3SPCA 3B2EE 2ZINA 5DN6G 1YJWV 1SQPH 4ABMA 4L87A 1EN6A 5F2VO 5GONB 2QGNA 4CH3A 3JAMN 3CCLV 4FPPA 1B06A 4HNAA 1NT2B 2UXDO 4JZ2A 2BOBC 4JZGA 3H1IH 3CC7V 2BE3A 2ADPA 1R3JC 1HR0B 2ZDIA 2P7TC 4J41A 3CCMV 1Z5WA 4BIUA 3CPWU 2WLIB 1NR1A 1Q6HA 1XMQO 4N21A 1BE3H 2HFEC 3ABTA 3JATA 2PY5A 3A0HZ 3ETEA 4K35A 2ZE7A 3CC2V 2V4DA 1V54B 3ZJZA 3EXAA 4O4IA 1DF4A 1Y74A 2F43G 3SYQA 2XT9A 4O4LA 4DV2O 4U3FH 3J80N 1SA0B 1AR4A 1XNRO 4WBNB 4QIWF 4DR4B 4KHPO 3SJBC 4H44B 1SQXH 3SPGA 1OCOC 4UCSA 3RVYA 4MTGA 4DUZO 2RJZA 2YXHA 1GMGA 3HR0A 3L71H 1AP6A 4EB6A 4IHJA 1MABG 3U10A 2YDEA 4JI4O 1OHHG 5LMUB 4YIPA 5CA0B 1MMMA 2EULA 3M8AA 3A8TA 5ITZA 3J81N 3CMAV 5K1XA 1QU7A 1GO3F 2Y4TA 4LFCB 2XAFA 2ZNIA 2CTPA 2MK3A 4RUEA 4JI1B 1BL8A 2YI8A 1S3JA 4MS2A 1YI2V 2ZR3A 4MTFA 4YJ2B 1P4RA 1M56C 3B8MA 2NLJC 1IXBA 2IH3C 1FXKB 1K5SA 1SQQH 4FLZA 1JOYA 3JARA 4UUJC 3LSSA 4FFBB 1IURA 3OT7A 1AJPA 4FMTA 1XNQB 4DV0O 1KBHA 2P5OA 3HKCA 4JTAB 3R66A 1JR9A 5H9CA 5EIBD 2OWOA 1Q86W 1YIJV 2VQFO 3HKEA 4TT3G 1YDXA 2EINB 5L3BA 3IC7A 2Q8VA 3ZRWB 4KP4A 1WJZA 3P3NA 4NKGB 2DE0X 3C3SA 3W7XA 4B3TB 1EN4A 2JVDA 5LP6C 1GM7A 2XHBA 3RW0A 2HHHB 3L72H 3T1YB 1IXMA 3RN4A 2ZXWB 3L75H 1IBKO 1WA8B 5IJ9B 2F66C 2B1GA 4FFKA 2WAMA 1I7FA 1H38A 4MVMA 1N8RW 2UXBB 3FAVB 4GKKB 4OX9B 4X66B 5E1AC 5D5PA 5EZYA 3ABKC 2CTRA 2ZT9B 2ZE6A 5IE9A 5LHIA 2XAQA 2Q4PA 5FPOA 3LSUA 2IJJA 4AI8A 3ETQA 3ASNC 2F23A 2HKOA 3F7VC 4OGQB 3LDEA 4LF4B 5EK0A 3JAWB 4FVMA 2YXYA 1AB3A 4IYHA 1JX9A 5IDJA 4DR7B 2ZNJA 2UUAB 1QCEA 4UVAA 1Z5VA 2CE4A 3ETGA 1O9HA 5AG2A 3E86A 3VQWA 1KYOF 4H37A 3F7YC 3DXRB 3O65A 4JI2B 3OMNB 4HYOA 4XDKA 3T4DA 2IW5A 1OCOB 2YIAA 4CH6A 3TJTA 1HNZB 4GKJB 3J7AU 1WAZA 1SA0A 4BW9A 1Q90D 4WBNA 1MNGA 1Z2GA 5IY5C 4JGSA 4I9WA 2XUMA 1BQ0A 3OTOO 4Q6GA 3QO7A 3ZHRA 1JMKC 3I56V 2EJRA 2AZ0A 4ZKIA 2IU3A 1N34O 3K5LA 2LGWA 1H2MA 1K4DC 3SYOA 3AG4C 1GAXA 1NTKH 2X6CA 1X59A 4X1IA 1OZ0A 2DQ3A 4FJCC 3K5NA 1ROPA 5CMUA 2Q7HA 2XOKG 4PA9A 1N32O 1ZL8A 5D5QA 1K8AW 3DGEA 3G67A 1AVMA 2HVJC 4FK5C 4EEQA 2E5LO 1FPOA 1P7GA 4U7OA 4ZHQB 4TOIA 4YJ2A 4J10A 2QSAA 1WB7A 1S72V 5BMVA 5A9GA 5KHGA 1VP7A 2CGOA 1FS0G 1EBOA 1XREA 1NJIW 2CUGA 1GH6A 2UXDB 4DRXB 4UCVA 3FYIB 3THOA 1JCHA 2WA4A 5H5NA 3B8NA 4O4JB 3E8BA 2GBOA 3RYFA 3LNNA 3OR7C 4DV3O 5LGUA 4FZ1A 4BW5A 4FLTA 4G28B 2GHYA 2UXXA 1TAEA 3WB1A 5IWAB 2GDSA 3UKMA 1OV9A 4PA3A 5HFMA 4J9ZB 3G80A 4X1YB 2IJIA 2Y0PA 1URFA 3BY6A 1I0HA 1B6QA 2X7RB 3CRMA 1F51A 2ITCC 1RM1C 2QM8A 4H33A 4PA7A 1WA8A 2JGDA 1I94B 1FJGB 4FM0A 5GTHZ 2E76B 1XNRB 4B08A 1VQ9V 1VQNV 1Y6XA 3E83A 4UCTA 3SPHA 3ASNB 4DUZB 1SQBH 4RWUA 3CRCA 4J7KA 3JATB 1M90W 2QDOA 3CCVV 3EFFK 2Z5UA 1G4YB 2B1IA 4O4IB 4PELA 1ENVA 4JYCA 3ZRSA 3ZMSA 4X62O 1MZEA 1O9GA 1DLBA 2YC0A 4P9OA 1NI8A 2PI5A 1KB9F 4CH5A 3RYHA 3UCSC 1GK9A 4YJ3B 2EILC 2P6JA 2EZOA 1YXBA 2WLLB 4B3SB 2YEVA 1XUQA 1GN6A 3W7UA 2FKXA 4K3AA 3H1LH 4IYIA 1AR5A 2CK3G 2QEXV 2RN9A 2Q9LA 1L8DA 1I08A 3JD1A 1VQ7V 4NXMO 2FTKA 3ABUA 3CCEV 4DV4O 3ZCCA 4EB6B 1AI5A 2UXCO 3CEIA 1R6TA 1WPBA 4LFBO 4IGGA 1HNXB 3MHSC 3CJHA 5ITZB 4DO2A 4ZI7A 2ZD9A 3PJSK 1HW7A 1ZLZA 4NYKA 4B7EA 1M57B 2CTQA 2QKSA 5J2UB 5L3FA 5JCOC 4DV7B 2VWJA 2P67A 4WFAV 1XBLA 1YTFB 1SQVH 2WLNA 1K5QA 3JD3A 3GB7C 3BCCH 3MDSA 2YI9A 1M4UA 4CS3A 1RSOA 2V7QG 4I4TA 2JEXA 1OCCC 4F4LA 3CCJV 1SRYA 4MT8A 4CS4A 1MA1A 2NNUA 4ZHQA 3OGIB 2GSMB 4K8ZA 1YSCA 2EIMC 4MTXA 3HKEB 1X4TA 3OFNG 1J5EB 5L3GA 1P49A 1N33O 3AG2B 3CRQA 1YHQV 2YXLA 2WLJA 4TSFG 4DV5B 3CXHF 2WLHA 4O2AB 4NXNO 3ZMTA 1P7BA 4O4JA 5FPRA 2ZCEA 4B3RO 1VQPV 1MG1A 4JI6O 1AP5A 2EIKB 4DR3O 2H3OA 1XHZA 3OE7G 5L3EA 2JEUA 3OMAB 3TCUA 4MTOA 5JQGB 5KLVH 4IT5A 4DV6B 5LP6A 4JI7O 2W6JG 2OIEA 4JI5O 5IYDO 4DR1O 1H2LA 2QJ1A 1JA8A 5EZYB 1F4NA 2LP7A 1XILA 2WLKA 4UVBA 3G6BA 5B1BB 4CH4A 3ICXA 5CA1B 2PYJA 2KKWA 1Y4MA 3K0GA 4X65O 3GWKC 2RCVA 3HKBA 1HWYA 1V55C 1XHXA 4LP8A 3ZEDA 3OTFA 2FYUH 3LSQA 1S0VA 4JPRA 5LOVA 2JJ2G 3FKSG 5FNVB 1MOFA 4W4KA 1CEZA 2JS3A 4YHHB 4TV9A 2KG7A 5EYPB 1ZX3A 4YXWG 4R50A 3SYPA 1LNQA 3U11A 3ZHUA 2X0LA 4UB8Z 4LF6O 2FMLA 4JI0O 4G2KA 4PV1B 4DYLA 1IBLO 3EHBB 1N32B 3FFQA 4BR6A 3ZHSA 1NQTA 4MSWC 1MSWD 2V1DA 3S3XA 4YJ3A 3G6EV 5KA5A 3AG3C 2M6YA 1PM9A 2WLLA 1YJ9V 2CDYA 2DMXA 4R6ZA 2QTOA 2HG5C 1N0NA 4QJFB 2EIJC 5HFLA 4PA4A 2ILMA 2UUCO 1EZVH 1OCRC 2JRIA 4X1IB 1Y67A 4DV3B 1XL6A 4JYAO 2Q5ZA 3P30A 2RNBA 1FAFA 4WF9V 2A9HA 1ZL8B 3FB7C 4GX5A 2XNDG 1PL0A 3X2QC 2OIGA 4DUYO 2QWPB 3ZMUA 1DF5A 4GYCB 1XMOO 3FB8C 5J2UA 5BMVB 3VQXA 5LMNO 2F95B 3DSQA 4Z1VA 2EBOA 4J7ZA 3WFVA 1G6UA 3CE2A 4HAMA 1D5NA 2E3CA 4ZBMA 2ETNA 3BHPA
chains in the Genus database with same CATH topology
2CTQA 2DMXA 1WJZA 2GUZB 2N04A 2PF4E 2Y4UA 2Y4TA 2CTPA 2N05A 3UO2A 3UCSC 1IURA 3APQA 1BQ0A 1BQZA 2QWQB 2KQXA 1XBLA 2QWPB 2GUZA 2QWRB 2CUGA 1GH6A 3BVOA 2CTRA 2CTWA 2QWNB 4IT5A 1NZ6A 2LGWA 2YUAA 3APOA 3AG7A 3UO3A 2QWOB 1N4CA 2YS8A 1FPOA 1HDJA 2EJ7A 2LO1A 4J80A 4J7ZA 2L6LA 2M6YA 2OCHA 1FAFA 2DN9A 4RWUA 2QSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTQ A;  2DMX A;  1WJZ A;  2GUZ B;  2N04 A;  2PF4 E;  2Y4U A;  2Y4T A;  2CTP A;  2N05 A;  3UO2 A;  3UCS C;  1IUR A;  3APQ A;  1BQ0 A;  1BQZ A;  2QWQ B;  2KQX A;  1XBL A;  2QWP B;  2GUZ A;  2QWR B;  2CUG A;  1GH6 A;  3BVO A;  2CTR A;  2CTW A;  2QWN B;  4IT5 A;  1NZ6 A;  2LGW A;  2YUA A;  3APO A;  3AG7 A;  3UO3 A;  2QWO B;  1N4C A;  2YS8 A;  1FPO A;  1HDJ A;  2EJ7 A;  2LO1 A;  4J80 A;  4J7Z A;  2L6L A;  2M6Y A;  2OCH A;  1FAF A;  2DN9 A;  4RWU A;  2QSA A; 
#chains in the Genus database with same CATH topology
 1PV0 A;  3QTC A;  1L1F A;  3K5O A;  3STZ C;  1L0N H;  3S3W A;  4GX1 A;  2GTS A;  1Q3E A;  4WCE V;  3RYF B;  4DR2 B;  2AHY A;  3K3W A;  2PTM A;  3KZI Z;  4X89 A;  1MZF A;  2QWN B;  5B1N A;  1SET A;  4RQE A;  1US6 A;  2F4V B;  1JFF A;  4O2B B;  3L9D A;  1E1Q G;  1K4C C;  4JYY A;  2ZR2 A;  1WLE A;  4DR5 B;  4TUY B;  4I5S A;  1QLE C;  5B3S C;  2ZE8 A;  4HZ3 A;  5JWP A;  4J11 A;  3F5W C;  1BQZ A;  4X64 B;  5E79 Z;  4O2A A;  1EM1 A;  4RUF A;  3BEH A;  1H8H G;  2VQE O;  1M1K W;  2P22 C;  1IBM B;  5TIS Z;  5LHH A;  1M9N A;  4BWA A;  2JGD B;  1LUV A;  3FYE B;  3DC5 A;  4L8J A;  5JQG A;  2RQ6 A;  2Y69 C;  5H2F Z;  4LF8 O;  1E1R G;  4I50 B;  3C3T A;  5KMG B;  4LF7 B;  2R70 A;  2QWQ B;  4GUN A;  4PDV A;  5KAI Z;  2A3Q A;  3OW2 U;  3APO A;  3E8G A;  5LA6 A;  1PP9 H;  1Q81 W;  1TGO A;  5CA1 A;  2M7W A;  2Q73 A;  2YID A;  3AK2 A;  4ZOL B;  2XAG A;  3FB5 C;  4J42 A;  2RDC A;  1I5Y A;  3BPZ A;  4LNU A;  4RAI A;  5JJJ B;  4KXR A;  3K0D A;  3JAS A;  2RMK B;  5CB4 B;  2UXC B;  2QWR B;  3QO8 A;  3K04 A;  3ZRV A;  3B4S A;  5FNV A;  1JPX A;  5EIB C;  1FYJ A;  3P3P A;  4FM2 A;  3RYH B;  1XDC A;  4R8C A;  4QE9 A;  5EYP A;  3N27 A;  4LBE C;  1NH2 B;  2Y48 A;  3D36 C;  2ZIM A;  2YEV B;  2WA3 A;  5B1O A;  2K1E A;  1NU1 H;  2DYS C;  1PPJ H;  4LF5 B;  2GUZ A;  2E75 B;  4JAU A;  2QE7 G;  1W59 A;  2KB1 A;  5LHG A;  1YTF D;  3SJC C;  1K9M W;  1KKC A;  4PDL A;  3TET A;  4B3M O;  3K9S A;  4BIZ A;  3JD4 A;  3QVN A;  1SZX A;  4JAA A;  2QTS A;  3ASO C;  2OCC C;  3CJH B;  3O9O A;  2LQT A;  4ZI7 B;  5KA6 A;  5BR8 B;  3A0B Z;  1N33 B;  2AHZ A;  2MW2 B;  4WFH A;  4J7J A;  4RQF A;  3A0R A;  3KCX A;  3CXC U;  3CSX A;  2LO1 A;  1LR1 A;  1FXV A;  5IT9 N;  3X2Q B;  2Y4U A;  1HR0 O;  4TV8 B;  5C8Y A;  1CP9 A;  4FZ0 A;  2HEP A;  1M56 B;  4XBF A;  3CRA A;  3LDC A;  3JCZ A;  4JI3 O;  4K8X A;  3CWB H;  3K59 A;  2ZE5 A;  2WWW A;  1RSO B;  3GVM A;  4I4T B;  1BSM A;  4DR1 B;  1G1X B;  2PYL A;  3L73 H;  2JIZ G;  2UUB O;  1NTZ H;  2BTQ B;  1COW G;  2G38 A;  4FM1 A;  1K97 A;  1KEC A;  1OCZ C;  4X65 B;  4GX2 A;  3WG7 C;  3P32 A;  1QBZ A;  1BGY H;  1TVK B;  4DR4 O;  3VQV A;  3TXS A;  1Y76 B;  4DXW A;  5B3S B;  4DW0 A;  1GM9 A;  1VQO V;  4IIJ B;  3VBB A;  1KP2 A;  1ARO P;  4O2B A;  5LP6 B;  3MHH C;  2CH7 A;  1XMQ B;  5B1A C;  2NR5 A;  3JAL B;  3OMI B;  2IJH A;  2DYR C;  4TUY A;  2WPD G;  3ZHT A;  1U97 A;  4LF6 B;  2QWO B;  2WLM A;  2YS8 A;  3CX5 F;  3CCQ V;  1DGS A;  2JDI G;  4NB5 A;  4JI8 O;  4DV2 B;  3HKB B;  4GZR B;  3ABL C;  4MW3 A;  3N2G B;  4UV9 A;  2VS0 A;  3SPI A;  3T1H O;  3CD6 V;  3CB2 A;  3ABK B;  5LOV B;  4UXN A;  3ZHV A;  2ZM6 O;  4I50 A;  5KMG A;  1SC5 B;  4KHP B;  5BXZ A;  1ZTE A;  2AGA A;  3AG1 C;  4TV9 B;  5C93 A;  2KG7 B;  1H2N A;  5A2Q N;  3SPJ A;  1YVW A;  2P90 A;  4Z2W A;  4ICG A;  1XEQ A;  5KX5 B;  4ZOL A;  3ML0 A;  3W7W A;  1VF6 C;  3ETD A;  2UUC B;  1XNQ O;  1JVM A;  2HR3 A;  3N2K B;  4JI4 B;  1SQF A;  3DTU B;  4I9Q A;  3CCU V;  1XOU A;  3KG2 A;  5CB4 A;  5EBM C;  1K34 A;  3RVZ A;  1N0J A;  1THZ A;  3OUS A;  1NTM H;  3UO2 A;  4LR3 A;  2IH1 C;  1NR7 A;  1KQS U;  1WN7 A;  2ZQM A;  3T4Z A;  1XMO B;  3CHX A;  4IL6 Z;  4CC5 A;  3LNM B;  3OR6 C;  2HHH O;  4XDJ A;  5J2T A;  3T1Y O;  1AI4 A;  2QA4 V;  1HP8 A;  1FKA O;  1S5L Z;  2HVK C;  4X8A A;  1VF5 B;  3SJQ C;  3H9V A;  5IY5 B;  4U3J B;  3ASO B;  2XAJ A;  4TWK A;  1V9P A;  1H2G A;  3QF7 A;  4MVU A;  4BIO A;  3K57 A;  5KHH A;  4OX9 O;  4DV0 B;  1JJO A;  2LW1 A;  2IJK A;  4AQY O;  2OT5 A;  3AG4 B;  1OJH A;  2Q0O C;  4MVR A;  5EC1 C;  2VQF B;  3LUT B;  1L0L H;  2W0X A;  1ZWI C;  5EBW C;  4ZIB A;  1BHA A;  5J9P C;  4FLV A;  1VF7 A;  2HJF C;  2Q69 A;  2QR4 A;  3E22 B;  1Q43 A;  1YJN V;  2YIB A;  2DJV A;  3F5T A;  4GT1 A;  4UVC A;  4JAV A;  3UQ8 A;  2VQE B;  4TV8 A;  2LJ2 A;  4JTC B;  1IBK B;  1GN4 A;  1WPX A;  4DR7 O;  2UUA O;  3LDD A;  2A79 B;  3BAB A;  3TK1 A;  4LF8 B;  3MD0 A;  5K1P A;  3B09 A;  3BFR A;  2Q67 A;  4YY3 O;  4QE7 A;  4X1K A;  4NTW A;  4DK0 A;  1VQ8 V;  2XTA A;  1JFF B;  4LWS B;  2QM4 A;  4WFE A;  2ITD C;  5IYZ A;  2BTQ A;  5H6Q A;  1GKF A;  4I0X B;  3MAQ A;  4FLX A;  4JI2 O;  2D3O W;  2AW9 A;  2C2A A;  1FXK C;  1HNZ O;  3PN1 A;  2YIC A;  1JJ2 U;  1TVK A;  5JVD B;  1VQK V;  4CZZ A;  3FB6 C;  4GLX A;  1YF2 A;  2JK5 C;  2Q6A A;  2R9A A;  1Y76 A;  3K5M A;  4NTX A;  2JGU A;  4LF9 O;  2OYQ A;  4IIJ A;  2UU9 O;  3NR7 A;  5CA3 A;  2PI4 A;  1K73 W;  1Y66 A;  1ZSP A;  1RM1 B;  3JAL A;  5LL6 Y;  2EIN C;  2XAS A;  1NH2 D;  2PZS A;  4CC6 A;  3I55 V;  3G71 V;  1QVF U;  1AI7 A;  5LYJ A;  5LA6 B;  1R73 A;  5JJN B;  1B04 A;  1DTO A;  4Q20 A;  4B7K A;  3BVO A;  4I7Z B;  5KHI A;  2LW7 A;  1SQG A;  3N2G A;  4JAS A;  1YZB A;  4KFM A;  4K0K O;  1K7D A;  4UCR A;  4LNU B;  2BCC H;  2ZXW C;  1ZAU A;  1QLN A;  4I55 A;  5CBF A;  3JAS B;  1F4M A;  2BOC C;  1LUW A;  1NS1 A;  1U96 A;  1KKD A;  1SER A;  2HP8 A;  1XQ8 A;  4QGP A;  2N74 A;  3OTO B;  1H8E G;  5FL7 G;  2R72 A;  5CBH A;  3CRR A;  1N34 B;  1XL4 A;  2CTW A;  1BMF G;  4MVS A;  1KU9 A;  5KX5 A;  1FD9 A;  1ORQ C;  3H1H H;  1N4C A;  3RGB A;  2HLD G;  4NVP A;  3N2K A;  2GUZ B;  2YIB D;  4FLY A;  2EIL B;  4JI3 B;  3D36 A;  5IWA O;  4X20 A;  3AEI A;  5L3C A;  5JH7 A;  2GTA A;  5DEC A;  3RYC B;  3ZMV A;  2E5L B;  1TUB A;  2UUB B;  5EC2 C;  3ZHQ A;  4DR6 O;  2QKA A;  3OEE G;  2YSU B;  5EBL C;  1IX9 A;  3JD0 A;  4PDM A;  4EFB A;  4AHC A;  5KHJ A;  1VQ5 V;  1S5H C;  3I5D A;  4BAY A;  1I94 O;  1S77 D;  1FJG O;  1UFI A;  4U3J A;  1PKX A;  1W0J G;  1Q82 W;  2OTL V;  1RPO A;  3CCS V;  5C8Y B;  2BTO A;  5BY1 A;  1J95 A;  1Q5O A;  1SF9 A;  2P06 A;  2OCH A;  2P4K A;  4WFB V;  1H2S B;  1WP7 A;  5B5E Z;  3UM7 A;  1A32 A;  2A7W A;  2FL4 A;  3IFX A;  3SYC A;  3AK3 A;  3K9A A;  3E22 A;  1EN5 A;  3NXS A;  4KUM A;  2YUA A;  2DWE C;  3IGA C;  3L70 H;  1OCC B;  4JI8 B;  1I5X A;  3ZBH A;  2WSS G;  5GW7 A;  1UPG A;  1M5I A;  3WB0 A;  4JV5 O;  1BZK A;  3T1H B;  3JD2 A;  2EIM B;  1HNW O;  4MVO A;  1PNM A;  3RYI B;  2X6B A;  5FLX N;  1UJW B;  3HKD B;  2ZM6 B;  3TXQ A;  1QR9 A;  5LXT B;  4B3S O;  3QNE A;  4MW8 A;  3ZN1 A;  4LWS A;  4LFA O;  4DV1 O;  2CH7 B;  3A2F A;  4I0X A;  2ODM A;  1VQ4 V;  1GN3 A;  2IU0 A;  4LH7 A;  3K58 A;  1KD1 W;  3APQ A;  4F6E A;  5KAF Z;  1M93 A;  3OGC C;  1VQL V;  1SZT A;  1RFY A;  4AIL C;  1EFR G;  2W0F C;  1R3K C;  4CS2 A;  5JVD A;  2EZP A;  1P84 F;  3H1J H;  1HNX O;  5KHK A;  4X62 B;  1NVP B;  2Q68 A;  4D6T H;  3UT5 B;  2NN4 A;  2PGG A;  5LGT A;  3BRC A;  1QR8 A;  1Q8I A;  4OPA A;  2ARH A;  3HB3 B;  2F93 B;  1V55 B;  3E8F A;  4DV7 O;  1E79 G;  3H01 A;  5IJ0 B;  3ZRX A;  2A06 H;  1IVS A;  4DK1 A;  4E4E A;  3DC6 A;  5DED A;  1HDJ A;  4RO2 A;  4UV8 A;  4NXM B;  4GX0 A;  4PHZ A;  4DV4 B;  4ASU G;  2ATK C;  3B77 A;  1PD3 A;  2EX3 A;  1W0K G;  3H1K H;  4AQY B;  4LFB B;  1J5E O;  1VF6 A;  1DK1 A;  3SJA C;  2X6A A;  3AG7 A;  1VQM V;  2GV9 A;  5GON A;  4UFZ A;  3FX7 A;  2ZDI C;  4JYB A;  5KUK A;  3OUF A;  2LFR A;  4QPK A;  4DV5 O;  3T1C A;  4EFE A;  1YIT V;  5CN0 A;  1VAR A;  1R1B A;  5J2T B;  2PUS A;  3STL C;  3JAK B;  1R6K A;  2BSK B;  2WLI A;  4PI0 A;  1SKV A;  4DV6 O;  1IDS A;  3AG3 B;  5L3D A;  1N36 O;  1BCC H;  1B3Q A;  3T2M A;  4YY3 B;  1K3E A;  3RYC A;  2EIJ B;  2N05 A;  3CP1 A;  3IJ4 A;  5DM6 V;  1EZJ A;  4P30 A;  2CGN A;  1F23 A;  1AR1 B;  1IZ3 A;  4UB6 Z;  3M99 B;  5B66 Z;  3SYA A;  4O4H B;  3E2E A;  1OCR B;  2LGQ A;  3AK1 A;  3VOU A;  1ZUQ A;  5KUM A;  4JTD B;  3W7T A;  1FFX B;  2QM7 A;  4NXN B;  1KC8 W;  4EKW A;  2PF4 E;  4B3R B;  2A0L A;  3GWO A;  4JI6 B;  4DR3 B;  1CXZ B;  1NBM G;  4YHH O;  4LF9 B;  4G27 B;  4FLU A;  1XI1 A;  3SDL A;  3IAY A;  2UU9 B;  3RWR D;  2IBZ H;  5JCO A;  1GRJ A;  1GN2 A;  2H8P C;  4PA6 A;  4JI7 B;  4JI5 B;  3RFR A;  1H2K A;  3ABM C;  3OAA G;  4X1K B;  4U7N A;  1KMI Z;  2F1M A;  4LCU C;  3E35 A;  3JYC A;  3CME V;  2W6I G;  5IYZ B;  1M57 C;  1Q6I A;  1Q6U A;  1MSD A;  5CA0 A;  2ADQ B;  3QO5 A;  3L74 H;  2XAH A;  4F6R B;  3WU2 Z;  5CBG A;  3BAA A;  4N23 A;  4K0K B;  3CC4 V;  1QVG U;  2L35 A;  3ZIA G;  3RYI A;  1WNS A;  1AJQ A;  2D2C B;  2EJ7 A;  5JJE B;  3HKD A;  1YEW A;  3HPL C;  1QNM A;  4UCU A;  5LXT A;  1QLE B;  4JF3 A;  1BS3 A;  3U0Z A;  1FXK A;  1CPY A;  1AI6 A;  4PDR A;  2B9Z A;  3OM3 B;  4FFB A;  2LFS A;  4P9P A;  1BHB A;  5LGN A;  4PD4 F;  1YCI A;  3FD9 A;  3K79 A;  1SES A;  4WFG A;  1NZ6 A;  3JCU Z;  1D5A A;  1VQ6 V;  2H94 A;  4A5U B;  3D8C A;  2ZKO A;  5LMU O;  3AG2 C;  5LYJ B;  1FXH A;  2Y69 B;  5LBQ A;  4JI0 B;  3Q4H B;  1FFT B;  1PNL A;  1IBL B;  4LFC O;  1TA8 A;  3UT5 A;  2OTJ V;  3ZMZ A;  4JI1 O;  4PJ0 Z;  3JSN A;  3ZRW A;  2EIK C;  4I55 B;  1RPR A;  1Q7Y W;  3SGI A;  4FIP C;  3UO3 A;  4DR6 B;  2VRZ A;  1AJN A;  3ZN0 A;  5IJ0 A;  1SS3 A;  1D2D A;  3R65 A;  2DOS A;  4R7C A;  4HNA B;  1R3I C;  5IJ9 A;  2DW4 A;  1KUQ A;  2QKC A;  1KP3 A;  3IC9 A;  5B1B C;  4DR2 O;  3WB2 A;  1R3L C;  4MVZ A;  3FAV A;  2DWD C;  3RBZ A;  4JYA B;  4LH6 A;  2F4V O;  3ZS8 C;  3CYO A;  4X20 B;  3BA8 A;  3ZX6 A;  5JH7 B;  4WFF A;  3B40 A;  1S76 D;  4DR5 O;  2DYS B;  1G8M A;  4OPH A;  3D3I A;  3K06 A;  4DUY B;  4X64 O;  1TUB B;  5GTI Z;  2B5U A;  4B3T O;  1Y74 B;  4LC1 A;  1RP3 B;  2JJ1 G;  1W2B U;  4X9Q A;  5LMN B;  3JAW A;  1IBM O;  3C90 A;  4O4L B;  4C7U A;  3JSL A;  3VQY A;  4J80 A;  2Q0A A;  3JAK A;  1V54 C;  4JV5 B;  2BSK A;  1HNW B;  1K33 A;  2OCC B;  4J9Y B;  3K08 A;  4OXS A;  4E2L A;  2UXB O;  4LF7 O;  2Y0I A;  4GKK O;  3OEH G;  4PI2 A;  1WB8 A;  1VMG A;  3K03 A;  4X66 O;  5H6R A;  4DW1 A;  3E8H A;  4H0L B;  4LFA B;  2R9I A;  4H13 B;  4DV1 B;  3DXR A;  4O4H A;  3E89 A;  4YIO A;  4GCZ A;  4W4L A;  3KKY A;  3EVK A;  3BA9 A;  1NKD A;  4CBC A;  1F7Y A;  3CCR V;  1TUE B;  3M7M X;  4IHJ B;  1FFX A;  4LF4 O;  2O57 A;  1PNK A;  3OD4 A;  4TQF A;  5BZB A;  3ABM B;  4MVQ A;  2K9P A;  4QPJ A;  2L6L A;  3RT3 C;  2DN9 A;  4D7S A;  4QNH B;  1BT8 A;  2IM9 A;  1NVP D;  3QG5 A;  3D3Q A;  4TQD A;  1OCZ B;  4FLW A;  2VWK A;  1R6N A;  4D7T A;  4UCO A;  2P4V A;  4Z1M G;  3WG7 B;  3W7S A;  3JAR B;  4LF5 O;  4KL1 A;  2E74 B;  4P2Z A;  4NR1 A;  3G4S V;  1GTO A;  4NTY A;  4F6R A;  2FB5 A;  3HKC B;  4GKJ O;  3KCY A;  5B1A B;  2Z0A A;  2AZ2 A;  2JS5 A;  5IYB O;  2Q7E A;  2ZIO A;  2CAZ C;  1K92 A;  2DYR B;  2KQX A;  2Z3Y A;  5IYC O;  2AXT Z;  2Q7G A;  5BR8 O;  3TGU H;  2DQ0 A;  3CS5 A;  4DRX A;  1AIL A;  1S5J A;  1QQC A;  4XDL A;  3ABL B;  2UXN A;  2N04 A;  4X88 A;  2R9R B;  2KSD A;  1VIB A;  1WP8 A;  4HBN A;  1JQ0 A;  3Q4H A;  1GM8 A;  1PL4 A;  1QHT A;  1T5E A;  1N36 B;  1VEW A;  3AG1 B;  3SR2 C;  4B3M B;  2HJD A;  4X1Y A;  3SPC A;  3B2E E;  2ZIN A;  5DN6 G;  1YJW V;  1SQP H;  4ABM A;  4L87 A;  1EN6 A;  5F2V O;  5GON B;  2QGN A;  4CH3 A;  3JAM N;  3CCL V;  4FPP A;  1B06 A;  4HNA A;  1NT2 B;  2UXD O;  4JZ2 A;  2BOB C;  4JZG A;  3H1I H;  3CC7 V;  2BE3 A;  2ADP A;  1R3J C;  1HR0 B;  2ZDI A;  2P7T C;  4J41 A;  3CCM V;  1Z5W A;  4BIU A;  3CPW U;  2WLI B;  1NR1 A;  1Q6H A;  1XMQ O;  4N21 A;  1BE3 H;  2HFE C;  3ABT A;  3JAT A;  2PY5 A;  3A0H Z;  3ETE A;  4K35 A;  2ZE7 A;  3CC2 V;  2V4D A;  1V54 B;  3ZJZ A;  3EXA A;  4O4I A;  1DF4 A;  1Y74 A;  2F43 G;  3SYQ A;  2XT9 A;  4O4L A;  4DV2 O;  4U3F H;  3J80 N;  1SA0 B;  1AR4 A;  1XNR O;  4WBN B;  4QIW F;  4DR4 B;  4KHP O;  3SJB C;  4H44 B;  1SQX H;  3SPG A;  1OCO C;  4UCS A;  3RVY A;  4MTG A;  4DUZ O;  2RJZ A;  2YXH A;  1GMG A;  3HR0 A;  3L71 H;  1AP6 A;  4EB6 A;  4IHJ A;  1MAB G;  3U10 A;  2YDE A;  4JI4 O;  1OHH G;  5LMU B;  4YIP A;  5CA0 B;  1MMM A;  2EUL A;  3M8A A;  3A8T A;  5ITZ A;  3J81 N;  3CMA V;  5K1X A;  1QU7 A;  1GO3 F;  2Y4T A;  4LFC B;  2XAF A;  2ZNI A;  2CTP A;  2MK3 A;  4RUE A;  4JI1 B;  1BL8 A;  2YI8 A;  1S3J A;  4MS2 A;  1YI2 V;  2ZR3 A;  4MTF A;  4YJ2 B;  1P4R A;  1M56 C;  3B8M A;  2NLJ C;  1IXB A;  2IH3 C;  1FXK B;  1K5S A;  1SQQ H;  4FLZ A;  1JOY A;  3JAR A;  4UUJ C;  3LSS A;  4FFB B;  1IUR A;  3OT7 A;  1AJP A;  4FMT A;  1XNQ B;  4DV0 O;  1KBH A;  2P5O A;  3HKC A;  4JTA B;  3R66 A;  1JR9 A;  5H9C A;  5EIB D;  2OWO A;  1Q86 W;  1YIJ V;  2VQF O;  3HKE A;  4TT3 G;  1YDX A;  2EIN B;  5L3B A;  3IC7 A;  2Q8V A;  3ZRW B;  4KP4 A;  1WJZ A;  3P3N A;  4NKG B;  2DE0 X;  3C3S A;  3W7X A;  4B3T B;  1EN4 A;  2JVD A;  5LP6 C;  1GM7 A;  2XHB A;  3RW0 A;  2HHH B;  3L72 H;  3T1Y B;  1IXM A;  3RN4 A;  2ZXW B;  3L75 H;  1IBK O;  1WA8 B;  5IJ9 B;  2F66 C;  2B1G A;  4FFK A;  2WAM A;  1I7F A;  1H38 A;  4MVM A;  1N8R W;  2UXB B;  3FAV B;  4GKK B;  4OX9 B;  4X66 B;  5E1A C;  5D5P A;  5EZY A;  3ABK C;  2CTR A;  2ZT9 B;  2ZE6 A;  5IE9 A;  5LHI A;  2XAQ A;  2Q4P A;  5FPO A;  3LSU A;  2IJJ A;  4AI8 A;  3ETQ A;  3ASN C;  2F23 A;  2HKO A;  3F7V C;  4OGQ B;  3LDE A;  4LF4 B;  5EK0 A;  3JAW B;  4FVM A;  2YXY A;  1AB3 A;  4IYH A;  1JX9 A;  5IDJ A;  4DR7 B;  2ZNJ A;  2UUA B;  1QCE A;  4UVA A;  1Z5V A;  2CE4 A;  3ETG A;  1O9H A;  5AG2 A;  3E86 A;  3VQW A;  1KYO F;  4H37 A;  3F7Y C;  3DXR B;  3O65 A;  4JI2 B;  3OMN B;  4HYO A;  4XDK A;  3T4D A;  2IW5 A;  1OCO B;  2YIA A;  4CH6 A;  3TJT A;  1HNZ B;  4GKJ B;  3J7A U;  1WAZ A;  1SA0 A;  4BW9 A;  1Q90 D;  4WBN A;  1MNG A;  1Z2G A;  5IY5 C;  4JGS A;  4I9W A;  2XUM A;  1BQ0 A;  3OTO O;  4Q6G A;  3QO7 A;  3ZHR A;  1JMK C;  3I56 V;  2EJR A;  2AZ0 A;  4ZKI A;  2IU3 A;  1N34 O;  3K5L A;  2LGW A;  1H2M A;  1K4D C;  3SYO A;  3AG4 C;  1GAX A;  1NTK H;  2X6C A;  1X59 A;  4X1I A;  1OZ0 A;  2DQ3 A;  4FJC C;  3K5N A;  1ROP A;  5CMU A;  2Q7H A;  2XOK G;  4PA9 A;  1N32 O;  1ZL8 A;  5D5Q A;  1K8A W;  3DGE A;  3G67 A;  1AVM A;  2HVJ C;  4FK5 C;  4EEQ A;  2E5L O;  1FPO A;  1P7G A;  4U7O A;  4ZHQ B;  4TOI A;  4YJ2 A;  4J10 A;  2QSA A;  1WB7 A;  1S72 V;  5BMV A;  5A9G A;  5KHG A;  1VP7 A;  2CGO A;  1FS0 G;  1EBO A;  1XRE A;  1NJI W;  2CUG A;  1GH6 A;  2UXD B;  4DRX B;  4UCV A;  3FYI B;  3THO A;  1JCH A;  2WA4 A;  5H5N A;  3B8N A;  4O4J B;  3E8B A;  2GBO A;  3RYF A;  3LNN A;  3OR7 C;  4DV3 O;  5LGU A;  4FZ1 A;  4BW5 A;  4FLT A;  4G28 B;  2GHY A;  2UXX A;  1TAE A;  3WB1 A;  5IWA B;  2GDS A;  3UKM A;  1OV9 A;  4PA3 A;  5HFM A;  4J9Z B;  3G80 A;  4X1Y B;  2IJI A;  2Y0P A;  1URF A;  3BY6 A;  1I0H A;  1B6Q A;  2X7R B;  3CRM A;  1F51 A;  2ITC C;  1RM1 C;  2QM8 A;  4H33 A;  4PA7 A;  1WA8 A;  2JGD A;  1I94 B;  1FJG B;  4FM0 A;  5GTH Z;  2E76 B;  1XNR B;  4B08 A;  1VQ9 V;  1VQN V;  1Y6X A;  3E83 A;  4UCT A;  3SPH A;  3ASN B;  4DUZ B;  1SQB H;  4RWU A;  3CRC A;  4J7K A;  3JAT B;  1M90 W;  2QDO A;  3CCV V;  3EFF K;  2Z5U A;  1G4Y B;  2B1I A;  4O4I B;  4PEL A;  1ENV A;  4JYC A;  3ZRS A;  3ZMS A;  4X62 O;  1MZE A;  1O9G A;  1DLB A;  2YC0 A;  4P9O A;  1NI8 A;  2PI5 A;  1KB9 F;  4CH5 A;  3RYH A;  3UCS C;  1GK9 A;  4YJ3 B;  2EIL C;  2P6J A;  2EZO A;  1YXB A;  2WLL B;  4B3S B;  2YEV A;  1XUQ A;  1GN6 A;  3W7U A;  2FKX A;  4K3A A;  3H1L H;  4IYI A;  1AR5 A;  2CK3 G;  2QEX V;  2RN9 A;  2Q9L A;  1L8D A;  1I08 A;  3JD1 A;  1VQ7 V;  4NXM O;  2FTK A;  3ABU A;  3CCE V;  4DV4 O;  3ZCC A;  4EB6 B;  1AI5 A;  2UXC O;  3CEI A;  1R6T A;  1WPB A;  4LFB O;  4IGG A;  1HNX B;  3MHS C;  3CJH A;  5ITZ B;  4DO2 A;  4ZI7 A;  2ZD9 A;  3PJS K;  1HW7 A;  1ZLZ A;  4NYK A;  4B7E A;  1M57 B;  2CTQ A;  2QKS A;  5J2U B;  5L3F A;  5JCO C;  4DV7 B;  2VWJ A;  2P67 A;  4WFA V;  1XBL A;  1YTF B;  1SQV H;  2WLN A;  1K5Q A;  3JD3 A;  3GB7 C;  3BCC H;  3MDS A;  2YI9 A;  1M4U A;  4CS3 A;  1RSO A;  2V7Q G;  4I4T A;  2JEX A;  1OCC C;  4F4L A;  3CCJ V;  1SRY A;  4MT8 A;  4CS4 A;  1MA1 A;  2NNU A;  4ZHQ A;  3OGI B;  2GSM B;  4K8Z A;  1YSC A;  2EIM C;  4MTX A;  3HKE B;  1X4T A;  3OFN G;  1J5E B;  5L3G A;  1P49 A;  1N33 O;  3AG2 B;  3CRQ A;  1YHQ V;  2YXL A;  2WLJ A;  4TSF G;  4DV5 B;  3CXH F;  2WLH A;  4O2A B;  4NXN O;  3ZMT A;  1P7B A;  4O4J A;  5FPR A;  2ZCE A;  4B3R O;  1VQP V;  1MG1 A;  4JI6 O;  1AP5 A;  2EIK B;  4DR3 O;  2H3O A;  1XHZ A;  3OE7 G;  5L3E A;  2JEU A;  3OMA B;  3TCU A;  4MTO A;  5JQG B;  5KLV H;  4IT5 A;  4DV6 B;  5LP6 A;  4JI7 O;  2W6J G;  2OIE A;  4JI5 O;  5IYD O;  4DR1 O;  1H2L A;  2QJ1 A;  1JA8 A;  5EZY B;  1F4N A;  2LP7 A;  1XIL A;  2WLK A;  4UVB A;  3G6B A;  5B1B B;  4CH4 A;  3ICX A;  5CA1 B;  2PYJ A;  2KKW A;  1Y4M A;  3K0G A;  4X65 O;  3GWK C;  2RCV A;  3HKB A;  1HWY A;  1V55 C;  1XHX A;  4LP8 A;  3ZED A;  3OTF A;  2FYU H;  3LSQ A;  1S0V A;  4JPR A;  5LOV A;  2JJ2 G;  3FKS G;  5FNV B;  1MOF A;  4W4K A;  1CEZ A;  2JS3 A;  4YHH B;  4TV9 A;  2KG7 A;  5EYP B;  1ZX3 A;  4YXW G;  4R50 A;  3SYP A;  1LNQ A;  3U11 A;  3ZHU A;  2X0L A;  4UB8 Z;  4LF6 O;  2FML A;  4JI0 O;  4G2K A;  4PV1 B;  4DYL A;  1IBL O;  3EHB B;  1N32 B;  3FFQ A;  4BR6 A;  3ZHS A;  1NQT A;  4MSW C;  1MSW D;  2V1D A;  3S3X A;  4YJ3 A;  3G6E V;  5KA5 A;  3AG3 C;  2M6Y A;  1PM9 A;  2WLL A;  1YJ9 V;  2CDY A;  2DMX A;  4R6Z A;  2QTO A;  2HG5 C;  1N0N A;  4QJF B;  2EIJ C;  5HFL A;  4PA4 A;  2ILM A;  2UUC O;  1EZV H;  1OCR C;  2JRI A;  4X1I B;  1Y67 A;  4DV3 B;  1XL6 A;  4JYA O;  2Q5Z A;  3P30 A;  2RNB A;  1FAF A;  4WF9 V;  2A9H A;  1ZL8 B;  3FB7 C;  4GX5 A;  2XND G;  1PL0 A;  3X2Q C;  2OIG A;  4DUY O;  2QWP B;  3ZMU A;  1DF5 A;  4GYC B;  1XMO O;  3FB8 C;  5J2U A;  5BMV B;  3VQX A;  5LMN O;  2F95 B;  3DSQ A;  4Z1V A;  2EBO A;  4J7Z A;  3WFV A;  1G6U A;  3CE2 A;  4HAM A;  1D5N A;  2E3C A;  4ZBM A;  2ETN A;  3BHP A; 
#chains in the Genus database with same CATH homology
 2CTQ A;  2DMX A;  1WJZ A;  2GUZ B;  2N04 A;  2PF4 E;  2Y4U A;  2Y4T A;  2CTP A;  2N05 A;  3UO2 A;  3UCS C;  1IUR A;  3APQ A;  1BQ0 A;  1BQZ A;  2QWQ B;  2KQX A;  1XBL A;  2QWP B;  2GUZ A;  2QWR B;  2CUG A;  1GH6 A;  3BVO A;  2CTR A;  2CTW A;  2QWN B;  4IT5 A;  1NZ6 A;  2LGW A;  2YUA A;  3APO A;  3AG7 A;  3UO3 A;  2QWO B;  1N4C A;  2YS8 A;  1FPO A;  1HDJ A;  2EJ7 A;  2LO1 A;  4J80 A;  4J7Z A;  2L6L A;  2M6Y A;  2OCH A;  1FAF A;  2DN9 A;  4RWU A;  2QSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...