2QWPB

Crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi form #2
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
92
structure length
92
Chain Sequence
DPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Heat shock cognate 71 kDa protein
publication title Structural basis of J cochaperone binding and regulation of Hsp70.
pubmed doi rcsb
source organism Bos taurus
total genus 30
structure length 92
sequence length 92
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2007-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2qwpB00
2Y4TA 3AG7A 4J7ZA 2KQXA 1GH6A 2QWQB 4J80A 2QWOB 2CTQA 3BVOA 2CTPA 3UCSC 2GUZB 1N4CA 1IURA 2CTRA 4IT5A 3APQA 1BQ0A 2Y4UA 3APOA 1FAFA 1WJZA 2PF4E 4RWUA 2CTWA 3UO2A 2DMXA 2YUAA 1NZ6A 2QSAA 2CUGA 2L6LA 2N05A 2QWPB 2QWRB 2LGWA 1HDJA 1BQZA 1XBLA 1FPOA 2YS8A 2LO1A 2EJ7A 2M6YA 3UO3A 2OCHA 2DN9A 2N04A 2QWNB 2GUZA
chains in the Genus database with same CATH superfamily
4QE7A 1MABG 1WP8A 4JI5O 2K1EA 4Z1VA 3T4ZA 1OCZB 4U3JB 2WA3A 4F6RA 1NT2B 2ZQMA 1CP9A 3OTOO 1O9GA 4B3SB 2KG7B 3PJSK 1VARA 2NR5A 1VP7A 3CCVV 1SC5B 4D7SA 1SZXA 4JAVA 3ZRVA 1AI5A 1H2LA 1VQ8V 3BVOA 3T4DA 3MHHC 3DTUB 1IBMB 4DUYB 4D6TH 3GVMA 3B77A 2GDSA 4TV9A 3BA9A 4I4TA 2K9PA 4TQDA 4LFCB 1VQ5V 3ZJZA 1VQ4V 4PD4F 2R72A 1MG1A 4PA4A 4DR6O 5LMUB 4DR3O 3R65A 5JQGB 1GRJA 4X64O 3K5OA 3CXHF 1XL6A 3CRAA 3FAVA 4H37A 1GO3F 4DV5B 3IAYA 2UXDB 5C93A 2A0LA 3K79A 4AI8A 2VQFO 4JI2O 3RYCA 3UQ8A 1IBKO 2CTPA 2PYJA 2XAHA 2ITCC 1XMQB 2HG5C 4RUEA 2VWKA 4J7KA 3RFRA 3UKMA 1Q6UA 3T1HO 1EN6A 3LSSA 3K9SA 2OIEA 5IDJA 2AXTZ 5CBGA 4OXSA 3TCUA 2UUBB 4J10A 4R50A 4NKGB 4IHJA 1XMOB 1VF6C 2WA4A 1JJ2U 2Q73A 4P9PA 4LF8B 5EC2C 4DW0A 1AI7A 2CH7A 3S3XA 2RQ6A 3SPCA 1RSOA 4IIJB 1FFXB 3BAAA 2LQTA 1VIBA 2OCHA 4MVUA 4GUNA 3FKSG 2RJZA 4DR7B 5BXZA 2AGAA 4R7CA 2DYSC 3ETDA 5DM6V 3CYOA 3QTCA 4I55A 2UUAO 3BA8A 1BQ0A 2XAFA 1IDSA 1N33B 3DC6A 4FVMA 4I9WA 4GX0A 3FAVB 1NS1A 4X62O 4FZ1A 5LOVA 1OCRC 4WFFA 3RGBA 4PA3A 1AB3A 1Z2GA 4LF5O 1AR5A 3AG4C 2HEPA 2Z5UA 3CPWU 3B09A 4AQYB 1S76D 3CCQV 3E2EA 3JATB 3E83A 3OTFA 2E5LO 4UCUA 2KKWA 3N27A 3CCEV 1FYJA 4RQFA 1KUQA 4LF9O 3ZHTA 5FNVA 1ZWIC 1WA8A 4W4KA 2AW9A 3MAQA 1N34O 1Y66A 1OCCB 1I7FA 4H13B 2WLJA 4DR1B 3K03A 1XHZA 1YI2V 1WJZA 1YJ9V 5EZYA 1COWG 3CMAV 1DF5A 2YSUB 1K73W 1BQZA 2LGQA 5LMNB 2DN9A 1WP7A 2CH7B 1XDCA 3H1LH 1RSOB 2QTSA 5ITZA 3W7TA 3ASNB 2P4KA 3ZHQA 1E79G 3U11A 2EILB 4LF7B 1EM1A 4JI7B 3C90A 3HKBA 1JA8A 1G4YB 1M5IA 3CEIA 4DV3B 4JTDB 4DK1A 4NTXA 4O4HA 1JPXA 2BOBC 1L1FA 4K8ZA 1DTOA 3IFXA 5IJ9A 3K0GA 2FKXA 5CA0A 1VQPV 2V7QG 3HKDB 3WB0A 4B7EA 2DJVA 1N36B 4FFBB 2HJDA 2EINC 5LXTB 2FMLA 3CC2V 5IYDO 4NR1A 5KAIZ 4DW1A 3LDCA 3A2FA 3ML0A 4IYIA 5EIBC 4B3MB 3KCXA 1E1QG 4DR2O 4NXMO 3SYPA 2X7RB 5FNVB 1WA8B 3H1IH 4CC6A 3OGIB 2JJ1G 3KCYA 3AK2A 1FJGO 3AG3B 1VQKV 4FM0A 3SJQC 2RCVA 4FLVA 3RYIB 5J2TB 2YXHA 5EZYB 1HDJA 1KD1W 2XAQA 4Q20A 1NU1H 4OX9B 3UO3A 2Z3YA 3RWRD 4CS3A 4DUZO 2Y69B 4CS4A 1ZX3A 4DYLA 2CK3G 4JI3O 2YIBA 1R6KA 4DR5O 3A8TA 2QGNA 3D36A 1JFFB 4LNUA 1HR0B 2N74A 1AILA 4X88A 3HKBB 3JAWA 3AG2B 1V54B 2YICA 4NXNO 4DV1B 4ASUG 5KHIA 3B4SA 3OT7A 1BL8A 2P90A 4AHCA 4O4HB 2V4DA 2IM9A 5LP6C 3LUTB 3G71V 2QWQB 1S3JA 5LHHA 3L74H 4B3RO 2VQEO 4B3TB 1N4CA 4ZHQA 4WFAV 2OCCC 1I5XA 3LNNA 2Q5ZA 4LCUC 2P5OA 3A0RA 4HBNA 3O9OA 1PV0A 4X65B 1IZ3A 2HVKC 5L3GA 3OR7C 5TISZ 4LBEC 4XBFA 4O4LB 1M93A 4Z2WA 3N2KA 3W7XA 3FB8C 4YXWG 4MVZA 4LFAB 1Q6HA 1IURA 3K9AA 2ETNA 4QE9A 4JI1O 4UV9A 1CXZB 1P49A 3HB3B 2JEXA 2E3CA 1TGOA 3ABMC 3ZHUA 2YI9A 2ADPA 3FB6C 2E74B 2QKCA 1I94B 5FPOA 2HP8A 4G28B 3ZX6A 2PGGA 1MSDA 2LJ2A 3BABA 1F7YA 3MD0A 1YITV 3Q4HB 1NH2D 1Q6IA 3SYQA 3L75H 1D5NA 4JV5B 1R3IC 4JI8B 1JVMA 5FPRA 4DR4B 1WN7A 4B08A 3JALA 5J2UA 3JAWB 2B1IA 4I0XA 3K57A 4BAYA 4OPAA 5KHGA 2F23A 3L72H 3STLC 2JRIA 1WB8A 4EFBA 2B5UA 1MZFA 1NR7A 3THOA 1HP8A 3LSUA 2ZXWB 4JTCB 4P2ZA 1M4UA 2PI5A 3JCUZ 2M6YA 1H2MA 2ILMA 3JD2A 3ZHSA 1YHQV 5KHJA 2PY5A 1FXKB 3LDEA 1SESA 1QLEC 5B1NA 1AR1B 3OFNG 1R6NA 3G4SV 1KU9A 4TV8B 1XQ8A 1IBLO 2ODMA 1BHBA 4JI0B 4Q6GA 5H6QA 5GONA 5KUKA 1GMGA 1N0JA 4JYBA 4DV7B 2Q69A 2M7WA 4MW3A 3CCJV 2EIJC 1E1RG 4G2KA 2LW1A 3LNMB 4U7OA 4WFEA 1ZUQA 1YJWV 3UT5A 3FD9A 2D2CB 3KKYA 4TUYA 1DK1A 4O4JB 4FM1A 1U96A 5K1XA 3I56V 4F6EA 5JCOA 1H8EG 2WLHA 4QPJA 3SPIA 2B1GA 2W0FC 3ABKB 2ZDIC 1S72V 4ZIBA 1B6QA 2DW4A 5J2UB 1YEWA 5H5NA 2A3QA 2ZIMA 5GTHZ 3SYAA 1NQTA 2CUGA 1NTKH 1M56B 3TXQA 1EBOA 1R6TA 4LR3A 4YHHB 2Q7EA 5LGUA 4KFMA 5JH7B 2DYRC 4GYCB 4LFBO 2BSKB 2R70A 2WWWA 1VEWA 3E8BA 4X89A 3GWOA 4K0KO 2XT9A 2EZPA 3DGEA 1THZA 3T1YB 2DMXA 2WLNA 3DSQA 5B1AC 5B1BC 3OUFA 4DV0O 4J11A 1R73A 4DV2O 1URFA 1GK9A 4DUYO 1KYOF 4GKJO 1ZAUA 4UFZA 2QTOA 1NH2B 2IBZH 1GN6A 1F23A 2QR4A 3OEHG 1GM9A 2QKSA 5LHIA 3UT5B 4O4IB 1RM1B 3GB7C 1L0NH 4J42A 3VQYA 5JVDB 1N32B 3SPHA 3K08A 1F51A 2P06A 3HKEA 4DV5O 3SYCA 1V55B 2NNUA 5BR8B 1GN4A 3JARA 3JD0A 1Z5VA 1AJPA 3ABTA 1N0NA 2CGNA 2OWOA 1VQ6V 2OIGA 1YVWA 3E22B 4DRXB 1Q43A 4JGSA 1UFIA 1XNRB 1VF6A 1R3LC 4HAMA 4JI4O 2YEVA 2BTQA 3NR7A 1EFRG 5CBFA 3RYHA 2ZD9A 1Y4MA 4YIOA 4PI0A 1YSCA 1JMKC 3E89A 2XASA 2UXBB 2CTQA 2ZM6O 2YXYA 4WF9V 1EZVH 2JGUA 5JJNB 1SQQH 5KAFZ 3BPZA 2CTWA 4KHPO 2JEUA 3CJHB 4NB5A 3CXCU 4EFEA 1XBLA 5L3FA 1Y76B 2IJHA 1OCZC 2WAMA 1SKVA 1P7GA 1MMMA 2PUSA 4N21A 5LGTA 4J9YB 2E75B 3LSQA 2AZ2A 1ENVA 1M9NA 3H01A 4WFGA 3OD4A 5F2VO 3B40A 1I0HA 5BY1A 5FLXN 4X20A 4C7UA 2ATKC 1KKDA 4MTGA 1PNMA 1I08A 1YZBA 3CRMA 1HNWB 4R6ZA 5EC1C 4O2AA 1VQOV 1SQXH 3JCZA 4ZOLB 3NXSA 1F4NA 4UB6Z 4YJ3A 2DWEC 3HKEB 1BSMA 1CEZA 1XUQA 4OPHA 3APOA 3E8HA 3M7MX 1XEQA 2DWDC 4JI5B 3ICXA 3JASA 3JYCA 4DV4O 5EIBD 4TSFG 2R9IA 1XNQO 4PV1B 4F6RB 2GBOA 2IJKA 2NLJC 5LHGA 2BTQB 1I5YA 1JX9A 1IXMA 5LGNA 1KECA 1NVPD 5K1PA 4X66O 2KSDA 1EZJA 3A0BZ 1GN2A 3I5DA 2ADQB 4KL1A 2WLLA 3TJTA 1K9MW 2F4VO 1QCEA 2H3OA 4TV9B 3E8FA 4UUJC 4I4TB 1MNGA 2JDIG 1JOYA 4I50A 1WB7A 5KMGA 1Y67A 1YTFD 3CMEV 1GH6A 3J7AU 5D5PA 1FXHA 4YY3O 2JS5A 3ABLB 3F5WC 2EJRA 2CGOA 4DR3B 4KP4A 5KX5A 4QNHB 2HJFC 1SQPH 3ETQA 4CH3A 1BHAA 4X20B 1SERA 2BE3A 4O2BA 2OTJV 3CCUV 1M1KW 2AZ0A 4O2AB 3QNEA 4BIOA 1GKFA 1K5SA 4UCTA 2VQFB 5BMVA 4JI2B 3RYCB 4FK5C 1RPOA 1IBKB 1DLBA 1QVGU 4MS2A 5LA6A 3JASB 2A06H 4YJ2A 1OJHA 1L8DA 2ZE8A 3ZS8C 3X2QB 4XDKA 2Q0OC 4JYAO 2WPDG 3JSLA 1S5JA 4CC5A 3J81N 3T1HB 2ZCEA 5E79Z 1JCHA 1K92A 3K58A 1TUEB 3JAKA 5LYJA 3EXAA 5EYPA 2ZE6A 4IHJB 2W0XA 1DF4A 2ZINA 3G6BA 4HNAA 2QKAA 3SPJA 1QR9A 3BY6A 1QVFU 1KP2A 2CAZC 4X1KA 1UJWB 1BE3H 4FLWA 4IGGA 2RDCA 4H44B 1OCOB 1OCCC 5C8YA 4I55B 1WLEA 2UUAB 1H2KA 2Q6AA 5IYZA 5KX5B 2JK5C 2YIBD 4BWAA 3G80A 1QU7A 5H9CA 5L3DA 2L35A 5E1AC 2UXNA 4X62B 3RT3C 5LOVB 1MSWD 3FX7A 1HR0O 3U10A 4ZKIA 1XREA 4PDRA 1KB9F 4LF5B 1WPBA 3ZN0A 4PA7A 4I5SA 1FXVA 3ZMTA 5BMVB 3ASNC 4UVCA 4WCEV 1K4DC 3ABUA 1NVPB 2E5LB 4BR6A 5IYBO 1H2GA 2ZT9B 3E8GA 3H1JH 5LA6B 4FJCC 4YJ2B 1HNZO 4LF9B 5IE9A 2UU9B 1IX9A 3UCSC 1M57C 4L8JA 3ZRWA 1YJNV 1N34B 2XNDG 2ZIOA 4GT1A 5CN0A 1XL4A 1GTOA 2LW7A 4RO2A 2Q68A 2EIKB 1SZTA 1PNKA 2EIMC 1QBZA 2GHYA 1KC8W 2NN4A 1HWYA 3JAKB 1YTFB 5LYJB 5EYPB 4LH7A 4HYOA 2AHYA 2VRZA 2GV9A 4GZRB 3JSNA 4HNAB 3QO7A 4FZ0A 5ITZB 5FL7G 2BTOA 2P4VA 5GW7A 4LF4O 1NZ6A 3K0DA 1AI6A 2EBOA 2ITDC 3CHXA 3AG3C 5IYZB 3VQXA 2LP7A 3CCLV 1X4TA 4J80A 3ZMVA 4FLYA 4JI8O 4BW5A 5A9GA 2QDOA 5IJ9B 4GX5A 4IT5A 4CH4A 4JASA 3RW0A 5CA1A 4X1IA 2HFEC 2PF4E 5CA0B 1Y74A 2QWPB 3CC4V 3ASOB 3OMNB 1KKCA 4ZI7A 1QQCA 1OZ0A 2ZKOA 1IXBA 2ZNJA 3ABMB 4FIPC 4GKKO 1KMIZ 2YC0A 3SPGA 3WG7B 3QG5A 2X6CA 3AG2C 3W7UA 3IJ4A 1HW7A 1V54C 2H8PC 3OM3B 4DR2B 4NXMB 1SA0A 2F1MA 3GWKC 3K59A 1QNMA 1H2SB 4WBNA 1VF7A 2Y48A 1YDXA 4FLTA 2ZDIA 4BIZA 1PP9H 4FM2A 1D2DA 3WU2Z 3HR0A 3ZRSA 3W7WA 1ZL8A 1H8HG 3ZN1A 2Y0PA 2Q4PA 4DUZB 4LF6O 1R3JC 4PJ0Z 4JI3B 5DECA 2HR3A 2DOSA 4DR5B 4WFBV 4Z1MG 3IC7A 4UCSA 4LNUB 1EN4A 2PI4A 4H33A 1XOUA 2UUCO 1Q81W 3SGIA 4CBCA 4JI6O 1XI1A 4NXNB 1YCIA 4PELA 3G67A 3P3PA 1ORQC 4B3RB 4ZHQB 1HNXO 2VQEB 2WLIA 4MW8A 1BCCH 2QWRB 5IYCO 4CH5A 4EB6A 4MVOA 5B3SC 2YIDA 3BCCH 2X6AA 3AG1C 3E35A 4IL6Z 3DXRA 4DXWA 4IYHA 4J7ZA 1MOFA 3CRRA 3F7VC 1WPXA 5IY5B 3N2KB 4JZ2A 2DE0X 4TWKA 2H94A 2IH3C 4LP8A 4DV6O 1Q90D 1SQGA 2DQ0A 1S5LZ 2UXCO 1J5EO 1VF5B 4LC1A 2R9AA 1SA0B 1D5AA 1K97A 1T5EA 4WBNB 4FLZA 2HHHO 3CCRV 5IWAB 2ZXWC 5EBLC 1JQ0A 2F93B 5JJJB 5L3BA 5L3CA 3TGUH 2QEXV 1FXKC 3U0ZA 4U7NA 4X1YA 1Q5OA 4WFHA 4B7KA 1LR1A 4PA6A 5IJ0A 3RVYA 1TUBA 1BMFG 1W2BU 3JALB 3BRCA 2RNBA 1KP3A 3BEHA 4AILC 2DYRB 4I0XB 3D8CA 3K5LA 1FKAO 4JTAB 2QM8A 2GSMB 3CX5F 2ZR3A 1M90W 2IJJA 1VQ7V 5CBHA 3CP1A 2E76B 3ETEA 4EB6B 5AG2A 3B8NA 4MVQA 3RN4A 1LUWA 4B3SO 4X9QA 3ABKC 4TT3G 4MT8A 1Q86W 1LNQA 5B66Z 3HKCA 2QE7G 4JF3A 1IBMO 1IBLB 2EZOA 3RYFA 3K06A 2CE4A 5GONB 5CMUA 1M56C 1X59A 1PL0A 1WAZA 1K5QA 5A2QN 5KLVH 4JYCA 4LFCO 1SQBH 4P9OA 1N8RW 1XHXA 2LGWA 4TUYB 5LMUO 5B5EZ 1LUVA 2D3OW 4GCZA 3AK3A 4JPRA 2UXDO 4PA9A 1YXBA 4LH6A 1K4CC 1TUBB 1HNWO 3JAMN 3WFVA 4LWSA 2V1DA 2ZR2A 3A0HZ 4D7TA 3P3NA 2IH1C 1XMQO 1NKDA 2LFSA 3CCSV 2MK3A 1RM1C 4LFBB 1B06A 3ZEDA 5JCOC 1Y6XA 1SQVH 3QVNA 4JAAA 1V55C 2P22C 3OE7G 3F5TA 3ETGA 3ZRXA 1QR8A 4K0KB 1FPOA 1AJQA 2UUBO 1Q8IA 4K3AA 1XMOO 1U97A 3HKCB 2LFRA 4LF8O 4DV0B 5IT9N 3RYFB 5CA3A 4DV2B 4GKJB 2CTRA 3F7YC 3L9DA 4K8XA 4IIJA 3FB5C 1FFXA 3EVKA 1SETA 2A7WA 1BGYH 2RN9A 4DR7O 2XUMA 3C3TA 2QM4A 3L70H 2GUZA 5KHKA 2WLKA 4PDVA 1N33O 1W0KG 1ROPA 3OUSA 3P32A 5LBQA 1P7BA 3QO8A 4RQEA 3JARB 1V9PA 2HLDG 3T2MA 2QSAA 5CB4A 2QA4V 3MDSA 4OGQB 1OHHG 3K5NA 1VQMV 3OTOB 3N2GA 2YEVB 2C2AA 4LWSB 4MVMA 4AQYO 4JI4B 1NR1A 3AG7A 3VBBA 4PDMA 3RYHB 5H6RA 3JATA 1RP3B 3QO5A 3CD6V 4PI2A 4UCOA 5BZBA 3T1CA 4NYKA 4A5UB 1PKXA 2ZM6B 2DYSB 4DR1O 4KHPB 3ZCCA 1IVSA 2ZE5A 3K3WA 4GX2A 3EHBB 3CSXA 5KUMA 2OTLV 1OCRB 2VWJA 1PNLA 5LMNO 1AJNA 4DR6B 4XDLA 1KQSU 1J95A 3AG4B 2Y0IA 1Q3EA 4X64B 2XOKG 4GLXA 1NI8A 1K33A 5H2FZ 1G8MA 3KZIZ 2IW5A 4LF7O 3VQWA 4JI7O 1FFTB 4UB8Z 1B3QA 4DV3O 1NBMG 2GUZB 3TK1A 1R1BA 4YJ3B 3UO2A 2N05A 5EK0A 4KXRA 5JWPA 1YIJV 2GTSA 4J7JA 1QLNA 3OMAB 3ABLC 1NTZH 5CB4B 3VOUA 4DV4B 1H2NA 3RBZA 2AHZA 3HKDA 4ICGA 1XNQB 3RVZA 4JZGA 1N36O 1MA1A 1P84F 3R66A 4FFBA 3N2GB 5KA6A 1H38A 5LXTA 3CE2A 5KHHA 1G6UA 4FFKA 3AK1A 3FFQA 1OV9A 4X66B 4B3MO 2L6LA 2Q0AA 3CS5A 2IJIA 4HZ3A 1A32A 2UU9O 2WLLB 1JJOA 3FB7C 4MTOA 2OT5A 2N04A 4H0LB 2F4VB 3E86A 1K34A 4UCRA 2MW2B 4I50B 4G27B 5LP6A 5KMGB 3RYIA 1O9HA 5J2TA 1ZLZA 2UXXA 2JVDA 4OX9O 3X2QC 1AVMA 3CB2A 4YY3B 2PZSA 1GM7A 2IU0A 1KBHA 2F43G 1GN3A 4MSWC 1AR4A 2EINB 5LL6Y 1P4RA 1Z5WA 4CS2A 2KQXA 5HFMA 3DC5A 4O2BB 1JFFA 2XHBA 2Q8VA 2OYQA 2XAGA 1RPRA 3OW2U 3SYOA 4DV1O 1VMGA 3O65A 4BIUA 1M57B 3UM7A 2EILC 4B3TO 2JGDA 2QWNB 1OCOC 2EIMB 3KG2A 4U3FH 2QWOB 2Q7GA 4X65O 3L71H 2FTKA 2P67A 4JYAB 4O4LA 1TVKA 3FYEB 2YIAA 2IU3A 2WSSG 5D5QA 4LFAO 3FYIB 3CRQA 1S77D 2BOCC 1AROP 3CCMV 3CRCA 3L73H 4FPPA 3OAAG 1I94O 4X1KB 1GAXA 5LP6B 2HVJC 4MVRA 3P30A 3QF7A 1K7DA 4ABMA 5C8YB 4QGPA 2OCCB 3ZBHA 2PTMA 1SQFA 5L3EA 3Q4HA 3CC7V 2EIKC 2FB5A 4CZZA 1MZEA 2FYUH 4JV5O 2F95B 4UXNA 2ZE7A 3EFFK 4DR4O 1WNSA 4NVPA 1FAFA 3K04A 4J41A 2X6BA 4FLUA 2Y69C 2JJ2G 2CDYA 1BZKA 4MTFA 2XTAA 1F4MA 1CPYA 2Y4TA 2JGDB 3J80N 3CWBH 4ZBMA 4PDLA 2PYLA 3ZIAG 3WB2A 5DN6G 2KB1A 1HNZB 4DO2A 3D3IA 3ZRWB 5EBWC 1SRYA 1YF2A 1FXKA 2VS0A 4NTWA 4KUMA 1S5HC 1TVKB 1FJGB 2FL4A 1PM9A 4RWUA 3ZMSA 4L87A 4EKWA 4TV8A 3LDDA 3ASOC 4JI0O 3M99B 5EBMC 3C3SA 1VQNV 1XILA 1R3KC 3SR2C 4I9QA 4DV7O 1BT8A 1TAEA 3S3WA 3JD4A 3PN1A 3TETA 3WG7C 2ARHA 4TOIA 5IWAO 3OGCC 4LF4B 3ZHRA 2WLMA 3JD1A 1NJIW 1Q82W 4X8AA 4I7ZB 4J9ZB 4O4JA 4EEQA 5B3SB 1K8AW 1W0JG 2HKOA 2YDEA 3APQA 3AG1B 2Y4UA 2Q9LA 3IGAC 4JAUA 3I55V 1B04A 2Q67A 2DQ3A 1DGSA 1PD3A 2RMKB 1AI4A 4F4LA 2EULA 3JD3A 5CA1B 4X1IB 2LO1A 1QLEB 2R9RB 1L0LH 2G38A 1Y74B 1PPJH 4MTXA 2BCCH 1RFYA 4QPKA 5DEDA 4ZI7B 1BS3A 3MHSC 5HFLA 1UPGA 4N23A 3SDLA 1AP5A 3H9VA 3D36C 4FMTA 4GKKB 2Q7HA 2EIJB 4YHHO 3B8MA 3K5MA 2YI8A 5JH7A 1EN5A 4E4EA 4E2LA 2BSKA 3IC9A 4JI1B 3ZMUA 2EJ7A 4TQFA 5J9PC 3STZC 4FLXA 1VQLV 3T1YO 3D3QA 2GTAA 4UVAA 4BW9A 1SF9A 3G6EV 4W4LA 1S0VA 3TXSA 1ZL8B 2YXLA 2O57A 5IY5C 2A79B 4LF6B 3BHPA 4RAIA 4GX1A 2F66C 1NTMH 3SJCC 1AP6A 3BFRA 3M8AA 4JYYA 2UUCB 3W7SA 4UV8A 1ZSPA 4O4IA 2A9HA 2W6IG 1VQ9V 3OEEG 4MVSA 1GM8A 4JI6B 1US6A 5JVDA 1N32O 2YS8A 5BR8O 2P7TC 2WLIB 1HNXB 2QJ1A 5KA5A 4P30A 4YIPA 2ZNIA 1TA8A 3E22A 4DRXA 1XNRO 4U3JA 3B2EE 5B1AB 5B1BB 1SS3A 1W59A 3DXRB 1QHTA 2KG7A 2JS3A 2B9ZA 3VQVA 3WB1A 4QIWF 2P6JA 4XDJA 2UXBO 4NTYA 4RUFA 4DV6B 5B1OA 2W6JG 2UXCB 1PL4A 1J5EB 4CH6A 2XAJA 3SJBC 4DK0A 3CJHA 4QJFB 2HHHB 4UVBA 1Y76A 3OMIB 1ZTEA 1Q7YW 2X0LA 1JR9A 1FS0G 3HPLC 2EX3A 5JQGA 3ZHVA 1K3EA 4X1YB 3H1KH 3H1HH 3ZMZA 5IJ0B 4UCVA 1G1XB 3SJAC 3OR6C 2YUAA 2JIZG 5GTIZ 4ZOLA 4K35A 5JJEB 3AEIA 1FD9A 2Z0AA 4PHZA 4R8CA 2QM7A
chains in the Genus database with same CATH topology
2Y4TA 3AG7A 4J7ZA 2KQXA 1GH6A 2QWQB 4J80A 2QWOB 2CTQA 3BVOA 2CTPA 3UCSC 2GUZB 1N4CA 1IURA 2CTRA 4IT5A 3APQA 1BQ0A 2Y4UA 3APOA 1FAFA 1WJZA 2PF4E 4RWUA 2CTWA 3UO2A 2DMXA 2YUAA 1NZ6A 2QSAA 2CUGA 2L6LA 2N05A 2QWPB 2QWRB 2LGWA 1HDJA 1BQZA 1XBLA 1FPOA 2YS8A 2LO1A 2EJ7A 2M6YA 3UO3A 2OCHA 2DN9A 2N04A 2QWNB 2GUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4T A;  3AG7 A;  4J7Z A;  2KQX A;  1GH6 A;  2QWQ B;  4J80 A;  2QWO B;  2CTQ A;  3BVO A;  2CTP A;  3UCS C;  2GUZ B;  1N4C A;  1IUR A;  2CTR A;  4IT5 A;  3APQ A;  1BQ0 A;  2Y4U A;  3APO A;  1FAF A;  1WJZ A;  2PF4 E;  4RWU A;  2CTW A;  3UO2 A;  2DMX A;  2YUA A;  1NZ6 A;  2QSA A;  2CUG A;  2L6L A;  2N05 A;  2QWP B;  2QWR B;  2LGW A;  1HDJ A;  1BQZ A;  1XBL A;  1FPO A;  2YS8 A;  2LO1 A;  2EJ7 A;  2M6Y A;  3UO3 A;  2OCH A;  2DN9 A;  2N04 A;  2QWN B;  2GUZ A; 
#chains in the Genus database with same CATH topology
 4QE7 A;  1MAB G;  1WP8 A;  4JI5 O;  2K1E A;  4Z1V A;  3T4Z A;  1OCZ B;  4U3J B;  2WA3 A;  4F6R A;  1NT2 B;  2ZQM A;  1CP9 A;  3OTO O;  1O9G A;  4B3S B;  2KG7 B;  3PJS K;  1VAR A;  2NR5 A;  1VP7 A;  3CCV V;  1SC5 B;  4D7S A;  1SZX A;  4JAV A;  3ZRV A;  1AI5 A;  1H2L A;  1VQ8 V;  3BVO A;  3T4D A;  3MHH C;  3DTU B;  1IBM B;  4DUY B;  4D6T H;  3GVM A;  3B77 A;  2GDS A;  4TV9 A;  3BA9 A;  4I4T A;  2K9P A;  4TQD A;  4LFC B;  1VQ5 V;  3ZJZ A;  1VQ4 V;  4PD4 F;  2R72 A;  1MG1 A;  4PA4 A;  4DR6 O;  5LMU B;  4DR3 O;  3R65 A;  5JQG B;  1GRJ A;  4X64 O;  3K5O A;  3CXH F;  1XL6 A;  3CRA A;  3FAV A;  4H37 A;  1GO3 F;  4DV5 B;  3IAY A;  2UXD B;  5C93 A;  2A0L A;  3K79 A;  4AI8 A;  2VQF O;  4JI2 O;  3RYC A;  3UQ8 A;  1IBK O;  2CTP A;  2PYJ A;  2XAH A;  2ITC C;  1XMQ B;  2HG5 C;  4RUE A;  2VWK A;  4J7K A;  3RFR A;  3UKM A;  1Q6U A;  3T1H O;  1EN6 A;  3LSS A;  3K9S A;  2OIE A;  5IDJ A;  2AXT Z;  5CBG A;  4OXS A;  3TCU A;  2UUB B;  4J10 A;  4R50 A;  4NKG B;  4IHJ A;  1XMO B;  1VF6 C;  2WA4 A;  1JJ2 U;  2Q73 A;  4P9P A;  4LF8 B;  5EC2 C;  4DW0 A;  1AI7 A;  2CH7 A;  3S3X A;  2RQ6 A;  3SPC A;  1RSO A;  4IIJ B;  1FFX B;  3BAA A;  2LQT A;  1VIB A;  2OCH A;  4MVU A;  4GUN A;  3FKS G;  2RJZ A;  4DR7 B;  5BXZ A;  2AGA A;  4R7C A;  2DYS C;  3ETD A;  5DM6 V;  3CYO A;  3QTC A;  4I55 A;  2UUA O;  3BA8 A;  1BQ0 A;  2XAF A;  1IDS A;  1N33 B;  3DC6 A;  4FVM A;  4I9W A;  4GX0 A;  3FAV B;  1NS1 A;  4X62 O;  4FZ1 A;  5LOV A;  1OCR C;  4WFF A;  3RGB A;  4PA3 A;  1AB3 A;  1Z2G A;  4LF5 O;  1AR5 A;  3AG4 C;  2HEP A;  2Z5U A;  3CPW U;  3B09 A;  4AQY B;  1S76 D;  3CCQ V;  3E2E A;  3JAT B;  3E83 A;  3OTF A;  2E5L O;  4UCU A;  2KKW A;  3N27 A;  3CCE V;  1FYJ A;  4RQF A;  1KUQ A;  4LF9 O;  3ZHT A;  5FNV A;  1ZWI C;  1WA8 A;  4W4K A;  2AW9 A;  3MAQ A;  1N34 O;  1Y66 A;  1OCC B;  1I7F A;  4H13 B;  2WLJ A;  4DR1 B;  3K03 A;  1XHZ A;  1YI2 V;  1WJZ A;  1YJ9 V;  5EZY A;  1COW G;  3CMA V;  1DF5 A;  2YSU B;  1K73 W;  1BQZ A;  2LGQ A;  5LMN B;  2DN9 A;  1WP7 A;  2CH7 B;  1XDC A;  3H1L H;  1RSO B;  2QTS A;  5ITZ A;  3W7T A;  3ASN B;  2P4K A;  3ZHQ A;  1E79 G;  3U11 A;  2EIL B;  4LF7 B;  1EM1 A;  4JI7 B;  3C90 A;  3HKB A;  1JA8 A;  1G4Y B;  1M5I A;  3CEI A;  4DV3 B;  4JTD B;  4DK1 A;  4NTX A;  4O4H A;  1JPX A;  2BOB C;  1L1F A;  4K8Z A;  1DTO A;  3IFX A;  5IJ9 A;  3K0G A;  2FKX A;  5CA0 A;  1VQP V;  2V7Q G;  3HKD B;  3WB0 A;  4B7E A;  2DJV A;  1N36 B;  4FFB B;  2HJD A;  2EIN C;  5LXT B;  2FML A;  3CC2 V;  5IYD O;  4NR1 A;  5KAI Z;  4DW1 A;  3LDC A;  3A2F A;  3ML0 A;  4IYI A;  5EIB C;  4B3M B;  3KCX A;  1E1Q G;  4DR2 O;  4NXM O;  3SYP A;  2X7R B;  5FNV B;  1WA8 B;  3H1I H;  4CC6 A;  3OGI B;  2JJ1 G;  3KCY A;  3AK2 A;  1FJG O;  3AG3 B;  1VQK V;  4FM0 A;  3SJQ C;  2RCV A;  4FLV A;  3RYI B;  5J2T B;  2YXH A;  5EZY B;  1HDJ A;  1KD1 W;  2XAQ A;  4Q20 A;  1NU1 H;  4OX9 B;  3UO3 A;  2Z3Y A;  3RWR D;  4CS3 A;  4DUZ O;  2Y69 B;  4CS4 A;  1ZX3 A;  4DYL A;  2CK3 G;  4JI3 O;  2YIB A;  1R6K A;  4DR5 O;  3A8T A;  2QGN A;  3D36 A;  1JFF B;  4LNU A;  1HR0 B;  2N74 A;  1AIL A;  4X88 A;  3HKB B;  3JAW A;  3AG2 B;  1V54 B;  2YIC A;  4NXN O;  4DV1 B;  4ASU G;  5KHI A;  3B4S A;  3OT7 A;  1BL8 A;  2P90 A;  4AHC A;  4O4H B;  2V4D A;  2IM9 A;  5LP6 C;  3LUT B;  3G71 V;  2QWQ B;  1S3J A;  5LHH A;  3L74 H;  4B3R O;  2VQE O;  4B3T B;  1N4C A;  4ZHQ A;  4WFA V;  2OCC C;  1I5X A;  3LNN A;  2Q5Z A;  4LCU C;  2P5O A;  3A0R A;  4HBN A;  3O9O A;  1PV0 A;  4X65 B;  1IZ3 A;  2HVK C;  5L3G A;  3OR7 C;  5TIS Z;  4LBE C;  4XBF A;  4O4L B;  1M93 A;  4Z2W A;  3N2K A;  3W7X A;  3FB8 C;  4YXW G;  4MVZ A;  4LFA B;  1Q6H A;  1IUR A;  3K9A A;  2ETN A;  4QE9 A;  4JI1 O;  4UV9 A;  1CXZ B;  1P49 A;  3HB3 B;  2JEX A;  2E3C A;  1TGO A;  3ABM C;  3ZHU A;  2YI9 A;  2ADP A;  3FB6 C;  2E74 B;  2QKC A;  1I94 B;  5FPO A;  2HP8 A;  4G28 B;  3ZX6 A;  2PGG A;  1MSD A;  2LJ2 A;  3BAB A;  1F7Y A;  3MD0 A;  1YIT V;  3Q4H B;  1NH2 D;  1Q6I A;  3SYQ A;  3L75 H;  1D5N A;  4JV5 B;  1R3I C;  4JI8 B;  1JVM A;  5FPR A;  4DR4 B;  1WN7 A;  4B08 A;  3JAL A;  5J2U A;  3JAW B;  2B1I A;  4I0X A;  3K57 A;  4BAY A;  4OPA A;  5KHG A;  2F23 A;  3L72 H;  3STL C;  2JRI A;  1WB8 A;  4EFB A;  2B5U A;  1MZF A;  1NR7 A;  3THO A;  1HP8 A;  3LSU A;  2ZXW B;  4JTC B;  4P2Z A;  1M4U A;  2PI5 A;  3JCU Z;  2M6Y A;  1H2M A;  2ILM A;  3JD2 A;  3ZHS A;  1YHQ V;  5KHJ A;  2PY5 A;  1FXK B;  3LDE A;  1SES A;  1QLE C;  5B1N A;  1AR1 B;  3OFN G;  1R6N A;  3G4S V;  1KU9 A;  4TV8 B;  1XQ8 A;  1IBL O;  2ODM A;  1BHB A;  4JI0 B;  4Q6G A;  5H6Q A;  5GON A;  5KUK A;  1GMG A;  1N0J A;  4JYB A;  4DV7 B;  2Q69 A;  2M7W A;  4MW3 A;  3CCJ V;  2EIJ C;  1E1R G;  4G2K A;  2LW1 A;  3LNM B;  4U7O A;  4WFE A;  1ZUQ A;  1YJW V;  3UT5 A;  3FD9 A;  2D2C B;  3KKY A;  4TUY A;  1DK1 A;  4O4J B;  4FM1 A;  1U96 A;  5K1X A;  3I56 V;  4F6E A;  5JCO A;  1H8E G;  2WLH A;  4QPJ A;  3SPI A;  2B1G A;  2W0F C;  3ABK B;  2ZDI C;  1S72 V;  4ZIB A;  1B6Q A;  2DW4 A;  5J2U B;  1YEW A;  5H5N A;  2A3Q A;  2ZIM A;  5GTH Z;  3SYA A;  1NQT A;  2CUG A;  1NTK H;  1M56 B;  3TXQ A;  1EBO A;  1R6T A;  4LR3 A;  4YHH B;  2Q7E A;  5LGU A;  4KFM A;  5JH7 B;  2DYR C;  4GYC B;  4LFB O;  2BSK B;  2R70 A;  2WWW A;  1VEW A;  3E8B A;  4X89 A;  3GWO A;  4K0K O;  2XT9 A;  2EZP A;  3DGE A;  1THZ A;  3T1Y B;  2DMX A;  2WLN A;  3DSQ A;  5B1A C;  5B1B C;  3OUF A;  4DV0 O;  4J11 A;  1R73 A;  4DV2 O;  1URF A;  1GK9 A;  4DUY O;  1KYO F;  4GKJ O;  1ZAU A;  4UFZ A;  2QTO A;  1NH2 B;  2IBZ H;  1GN6 A;  1F23 A;  2QR4 A;  3OEH G;  1GM9 A;  2QKS A;  5LHI A;  3UT5 B;  4O4I B;  1RM1 B;  3GB7 C;  1L0N H;  4J42 A;  3VQY A;  5JVD B;  1N32 B;  3SPH A;  3K08 A;  1F51 A;  2P06 A;  3HKE A;  4DV5 O;  3SYC A;  1V55 B;  2NNU A;  5BR8 B;  1GN4 A;  3JAR A;  3JD0 A;  1Z5V A;  1AJP A;  3ABT A;  1N0N A;  2CGN A;  2OWO A;  1VQ6 V;  2OIG A;  1YVW A;  3E22 B;  4DRX B;  1Q43 A;  4JGS A;  1UFI A;  1XNR B;  1VF6 A;  1R3L C;  4HAM A;  4JI4 O;  2YEV A;  2BTQ A;  3NR7 A;  1EFR G;  5CBF A;  3RYH A;  2ZD9 A;  1Y4M A;  4YIO A;  4PI0 A;  1YSC A;  1JMK C;  3E89 A;  2XAS A;  2UXB B;  2CTQ A;  2ZM6 O;  2YXY A;  4WF9 V;  1EZV H;  2JGU A;  5JJN B;  1SQQ H;  5KAF Z;  3BPZ A;  2CTW A;  4KHP O;  2JEU A;  3CJH B;  4NB5 A;  3CXC U;  4EFE A;  1XBL A;  5L3F A;  1Y76 B;  2IJH A;  1OCZ C;  2WAM A;  1SKV A;  1P7G A;  1MMM A;  2PUS A;  4N21 A;  5LGT A;  4J9Y B;  2E75 B;  3LSQ A;  2AZ2 A;  1ENV A;  1M9N A;  3H01 A;  4WFG A;  3OD4 A;  5F2V O;  3B40 A;  1I0H A;  5BY1 A;  5FLX N;  4X20 A;  4C7U A;  2ATK C;  1KKD A;  4MTG A;  1PNM A;  1I08 A;  1YZB A;  3CRM A;  1HNW B;  4R6Z A;  5EC1 C;  4O2A A;  1VQO V;  1SQX H;  3JCZ A;  4ZOL B;  3NXS A;  1F4N A;  4UB6 Z;  4YJ3 A;  2DWE C;  3HKE B;  1BSM A;  1CEZ A;  1XUQ A;  4OPH A;  3APO A;  3E8H A;  3M7M X;  1XEQ A;  2DWD C;  4JI5 B;  3ICX A;  3JAS A;  3JYC A;  4DV4 O;  5EIB D;  4TSF G;  2R9I A;  1XNQ O;  4PV1 B;  4F6R B;  2GBO A;  2IJK A;  2NLJ C;  5LHG A;  2BTQ B;  1I5Y A;  1JX9 A;  1IXM A;  5LGN A;  1KEC A;  1NVP D;  5K1P A;  4X66 O;  2KSD A;  1EZJ A;  3A0B Z;  1GN2 A;  3I5D A;  2ADQ B;  4KL1 A;  2WLL A;  3TJT A;  1K9M W;  2F4V O;  1QCE A;  2H3O A;  4TV9 B;  3E8F A;  4UUJ C;  4I4T B;  1MNG A;  2JDI G;  1JOY A;  4I50 A;  1WB7 A;  5KMG A;  1Y67 A;  1YTF D;  3CME V;  1GH6 A;  3J7A U;  5D5P A;  1FXH A;  4YY3 O;  2JS5 A;  3ABL B;  3F5W C;  2EJR A;  2CGO A;  4DR3 B;  4KP4 A;  5KX5 A;  4QNH B;  2HJF C;  1SQP H;  3ETQ A;  4CH3 A;  1BHA A;  4X20 B;  1SER A;  2BE3 A;  4O2B A;  2OTJ V;  3CCU V;  1M1K W;  2AZ0 A;  4O2A B;  3QNE A;  4BIO A;  1GKF A;  1K5S A;  4UCT A;  2VQF B;  5BMV A;  4JI2 B;  3RYC B;  4FK5 C;  1RPO A;  1IBK B;  1DLB A;  1QVG U;  4MS2 A;  5LA6 A;  3JAS B;  2A06 H;  4YJ2 A;  1OJH A;  1L8D A;  2ZE8 A;  3ZS8 C;  3X2Q B;  4XDK A;  2Q0O C;  4JYA O;  2WPD G;  3JSL A;  1S5J A;  4CC5 A;  3J81 N;  3T1H B;  2ZCE A;  5E79 Z;  1JCH A;  1K92 A;  3K58 A;  1TUE B;  3JAK A;  5LYJ A;  3EXA A;  5EYP A;  2ZE6 A;  4IHJ B;  2W0X A;  1DF4 A;  2ZIN A;  3G6B A;  4HNA A;  2QKA A;  3SPJ A;  1QR9 A;  3BY6 A;  1QVF U;  1KP2 A;  2CAZ C;  4X1K A;  1UJW B;  1BE3 H;  4FLW A;  4IGG A;  2RDC A;  4H44 B;  1OCO B;  1OCC C;  5C8Y A;  4I55 B;  1WLE A;  2UUA B;  1H2K A;  2Q6A A;  5IYZ A;  5KX5 B;  2JK5 C;  2YIB D;  4BWA A;  3G80 A;  1QU7 A;  5H9C A;  5L3D A;  2L35 A;  5E1A C;  2UXN A;  4X62 B;  3RT3 C;  5LOV B;  1MSW D;  3FX7 A;  1HR0 O;  3U10 A;  4ZKI A;  1XRE A;  4PDR A;  1KB9 F;  4LF5 B;  1WPB A;  3ZN0 A;  4PA7 A;  4I5S A;  1FXV A;  3ZMT A;  5BMV B;  3ASN C;  4UVC A;  4WCE V;  1K4D C;  3ABU A;  1NVP B;  2E5L B;  4BR6 A;  5IYB O;  1H2G A;  2ZT9 B;  3E8G A;  3H1J H;  5LA6 B;  4FJC C;  4YJ2 B;  1HNZ O;  4LF9 B;  5IE9 A;  2UU9 B;  1IX9 A;  3UCS C;  1M57 C;  4L8J A;  3ZRW A;  1YJN V;  1N34 B;  2XND G;  2ZIO A;  4GT1 A;  5CN0 A;  1XL4 A;  1GTO A;  2LW7 A;  4RO2 A;  2Q68 A;  2EIK B;  1SZT A;  1PNK A;  2EIM C;  1QBZ A;  2GHY A;  1KC8 W;  2NN4 A;  1HWY A;  3JAK B;  1YTF B;  5LYJ B;  5EYP B;  4LH7 A;  4HYO A;  2AHY A;  2VRZ A;  2GV9 A;  4GZR B;  3JSN A;  4HNA B;  3QO7 A;  4FZ0 A;  5ITZ B;  5FL7 G;  2BTO A;  2P4V A;  5GW7 A;  4LF4 O;  1NZ6 A;  3K0D A;  1AI6 A;  2EBO A;  2ITD C;  3CHX A;  3AG3 C;  5IYZ B;  3VQX A;  2LP7 A;  3CCL V;  1X4T A;  4J80 A;  3ZMV A;  4FLY A;  4JI8 O;  4BW5 A;  5A9G A;  2QDO A;  5IJ9 B;  4GX5 A;  4IT5 A;  4CH4 A;  4JAS A;  3RW0 A;  5CA1 A;  4X1I A;  2HFE C;  2PF4 E;  5CA0 B;  1Y74 A;  2QWP B;  3CC4 V;  3ASO B;  3OMN B;  1KKC A;  4ZI7 A;  1QQC A;  1OZ0 A;  2ZKO A;  1IXB A;  2ZNJ A;  3ABM B;  4FIP C;  4GKK O;  1KMI Z;  2YC0 A;  3SPG A;  3WG7 B;  3QG5 A;  2X6C A;  3AG2 C;  3W7U A;  3IJ4 A;  1HW7 A;  1V54 C;  2H8P C;  3OM3 B;  4DR2 B;  4NXM B;  1SA0 A;  2F1M A;  3GWK C;  3K59 A;  1QNM A;  1H2S B;  4WBN A;  1VF7 A;  2Y48 A;  1YDX A;  4FLT A;  2ZDI A;  4BIZ A;  1PP9 H;  4FM2 A;  1D2D A;  3WU2 Z;  3HR0 A;  3ZRS A;  3W7W A;  1ZL8 A;  1H8H G;  3ZN1 A;  2Y0P A;  2Q4P A;  4DUZ B;  4LF6 O;  1R3J C;  4PJ0 Z;  4JI3 B;  5DEC A;  2HR3 A;  2DOS A;  4DR5 B;  4WFB V;  4Z1M G;  3IC7 A;  4UCS A;  4LNU B;  1EN4 A;  2PI4 A;  4H33 A;  1XOU A;  2UUC O;  1Q81 W;  3SGI A;  4CBC A;  4JI6 O;  1XI1 A;  4NXN B;  1YCI A;  4PEL A;  3G67 A;  3P3P A;  1ORQ C;  4B3R B;  4ZHQ B;  1HNX O;  2VQE B;  2WLI A;  4MW8 A;  1BCC H;  2QWR B;  5IYC O;  4CH5 A;  4EB6 A;  4MVO A;  5B3S C;  2YID A;  3BCC H;  2X6A A;  3AG1 C;  3E35 A;  4IL6 Z;  3DXR A;  4DXW A;  4IYH A;  4J7Z A;  1MOF A;  3CRR A;  3F7V C;  1WPX A;  5IY5 B;  3N2K B;  4JZ2 A;  2DE0 X;  4TWK A;  2H94 A;  2IH3 C;  4LP8 A;  4DV6 O;  1Q90 D;  1SQG A;  2DQ0 A;  1S5L Z;  2UXC O;  1J5E O;  1VF5 B;  4LC1 A;  2R9A A;  1SA0 B;  1D5A A;  1K97 A;  1T5E A;  4WBN B;  4FLZ A;  2HHH O;  3CCR V;  5IWA B;  2ZXW C;  5EBL C;  1JQ0 A;  2F93 B;  5JJJ B;  5L3B A;  5L3C A;  3TGU H;  2QEX V;  1FXK C;  3U0Z A;  4U7N A;  4X1Y A;  1Q5O A;  4WFH A;  4B7K A;  1LR1 A;  4PA6 A;  5IJ0 A;  3RVY A;  1TUB A;  1BMF G;  1W2B U;  3JAL B;  3BRC A;  2RNB A;  1KP3 A;  3BEH A;  4AIL C;  2DYR B;  4I0X B;  3D8C A;  3K5L A;  1FKA O;  4JTA B;  2QM8 A;  2GSM B;  3CX5 F;  2ZR3 A;  1M90 W;  2IJJ A;  1VQ7 V;  5CBH A;  3CP1 A;  2E76 B;  3ETE A;  4EB6 B;  5AG2 A;  3B8N A;  4MVQ A;  3RN4 A;  1LUW A;  4B3S O;  4X9Q A;  3ABK C;  4TT3 G;  4MT8 A;  1Q86 W;  1LNQ A;  5B66 Z;  3HKC A;  2QE7 G;  4JF3 A;  1IBM O;  1IBL B;  2EZO A;  3RYF A;  3K06 A;  2CE4 A;  5GON B;  5CMU A;  1M56 C;  1X59 A;  1PL0 A;  1WAZ A;  1K5Q A;  5A2Q N;  5KLV H;  4JYC A;  4LFC O;  1SQB H;  4P9O A;  1N8R W;  1XHX A;  2LGW A;  4TUY B;  5LMU O;  5B5E Z;  1LUV A;  2D3O W;  4GCZ A;  3AK3 A;  4JPR A;  2UXD O;  4PA9 A;  1YXB A;  4LH6 A;  1K4C C;  1TUB B;  1HNW O;  3JAM N;  3WFV A;  4LWS A;  2V1D A;  2ZR2 A;  3A0H Z;  4D7T A;  3P3N A;  2IH1 C;  1XMQ O;  1NKD A;  2LFS A;  3CCS V;  2MK3 A;  1RM1 C;  4LFB B;  1B06 A;  3ZED A;  5JCO C;  1Y6X A;  1SQV H;  3QVN A;  4JAA A;  1V55 C;  2P22 C;  3OE7 G;  3F5T A;  3ETG A;  3ZRX A;  1QR8 A;  4K0K B;  1FPO A;  1AJQ A;  2UUB O;  1Q8I A;  4K3A A;  1XMO O;  1U97 A;  3HKC B;  2LFR A;  4LF8 O;  4DV0 B;  5IT9 N;  3RYF B;  5CA3 A;  4DV2 B;  4GKJ B;  2CTR A;  3F7Y C;  3L9D A;  4K8X A;  4IIJ A;  3FB5 C;  1FFX A;  3EVK A;  1SET A;  2A7W A;  1BGY H;  2RN9 A;  4DR7 O;  2XUM A;  3C3T A;  2QM4 A;  3L70 H;  2GUZ A;  5KHK A;  2WLK A;  4PDV A;  1N33 O;  1W0K G;  1ROP A;  3OUS A;  3P32 A;  5LBQ A;  1P7B A;  3QO8 A;  4RQE A;  3JAR B;  1V9P A;  2HLD G;  3T2M A;  2QSA A;  5CB4 A;  2QA4 V;  3MDS A;  4OGQ B;  1OHH G;  3K5N A;  1VQM V;  3OTO B;  3N2G A;  2YEV B;  2C2A A;  4LWS B;  4MVM A;  4AQY O;  4JI4 B;  1NR1 A;  3AG7 A;  3VBB A;  4PDM A;  3RYH B;  5H6R A;  3JAT A;  1RP3 B;  3QO5 A;  3CD6 V;  4PI2 A;  4UCO A;  5BZB A;  3T1C A;  4NYK A;  4A5U B;  1PKX A;  2ZM6 B;  2DYS B;  4DR1 O;  4KHP B;  3ZCC A;  1IVS A;  2ZE5 A;  3K3W A;  4GX2 A;  3EHB B;  3CSX A;  5KUM A;  2OTL V;  1OCR B;  2VWJ A;  1PNL A;  5LMN O;  1AJN A;  4DR6 B;  4XDL A;  1KQS U;  1J95 A;  3AG4 B;  2Y0I A;  1Q3E A;  4X64 B;  2XOK G;  4GLX A;  1NI8 A;  1K33 A;  5H2F Z;  1G8M A;  3KZI Z;  2IW5 A;  4LF7 O;  3VQW A;  4JI7 O;  1FFT B;  4UB8 Z;  1B3Q A;  4DV3 O;  1NBM G;  2GUZ B;  3TK1 A;  1R1B A;  4YJ3 B;  3UO2 A;  2N05 A;  5EK0 A;  4KXR A;  5JWP A;  1YIJ V;  2GTS A;  4J7J A;  1QLN A;  3OMA B;  3ABL C;  1NTZ H;  5CB4 B;  3VOU A;  4DV4 B;  1H2N A;  3RBZ A;  2AHZ A;  3HKD A;  4ICG A;  1XNQ B;  3RVZ A;  4JZG A;  1N36 O;  1MA1 A;  1P84 F;  3R66 A;  4FFB A;  3N2G B;  5KA6 A;  1H38 A;  5LXT A;  3CE2 A;  5KHH A;  1G6U A;  4FFK A;  3AK1 A;  3FFQ A;  1OV9 A;  4X66 B;  4B3M O;  2L6L A;  2Q0A A;  3CS5 A;  2IJI A;  4HZ3 A;  1A32 A;  2UU9 O;  2WLL B;  1JJO A;  3FB7 C;  4MTO A;  2OT5 A;  2N04 A;  4H0L B;  2F4V B;  3E86 A;  1K34 A;  4UCR A;  2MW2 B;  4I50 B;  4G27 B;  5LP6 A;  5KMG B;  3RYI A;  1O9H A;  5J2T A;  1ZLZ A;  2UXX A;  2JVD A;  4OX9 O;  3X2Q C;  1AVM A;  3CB2 A;  4YY3 B;  2PZS A;  1GM7 A;  2IU0 A;  1KBH A;  2F43 G;  1GN3 A;  4MSW C;  1AR4 A;  2EIN B;  5LL6 Y;  1P4R A;  1Z5W A;  4CS2 A;  2KQX A;  5HFM A;  3DC5 A;  4O2B B;  1JFF A;  2XHB A;  2Q8V A;  2OYQ A;  2XAG A;  1RPR A;  3OW2 U;  3SYO A;  4DV1 O;  1VMG A;  3O65 A;  4BIU A;  1M57 B;  3UM7 A;  2EIL C;  4B3T O;  2JGD A;  2QWN B;  1OCO C;  2EIM B;  3KG2 A;  4U3F H;  2QWO B;  2Q7G A;  4X65 O;  3L71 H;  2FTK A;  2P67 A;  4JYA B;  4O4L A;  1TVK A;  3FYE B;  2YIA A;  2IU3 A;  2WSS G;  5D5Q A;  4LFA O;  3FYI B;  3CRQ A;  1S77 D;  2BOC C;  1ARO P;  3CCM V;  3CRC A;  3L73 H;  4FPP A;  3OAA G;  1I94 O;  4X1K B;  1GAX A;  5LP6 B;  2HVJ C;  4MVR A;  3P30 A;  3QF7 A;  1K7D A;  4ABM A;  5C8Y B;  4QGP A;  2OCC B;  3ZBH A;  2PTM A;  1SQF A;  5L3E A;  3Q4H A;  3CC7 V;  2EIK C;  2FB5 A;  4CZZ A;  1MZE A;  2FYU H;  4JV5 O;  2F95 B;  4UXN A;  2ZE7 A;  3EFF K;  4DR4 O;  1WNS A;  4NVP A;  1FAF A;  3K04 A;  4J41 A;  2X6B A;  4FLU A;  2Y69 C;  2JJ2 G;  2CDY A;  1BZK A;  4MTF A;  2XTA A;  1F4M A;  1CPY A;  2Y4T A;  2JGD B;  3J80 N;  3CWB H;  4ZBM A;  4PDL A;  2PYL A;  3ZIA G;  3WB2 A;  5DN6 G;  2KB1 A;  1HNZ B;  4DO2 A;  3D3I A;  3ZRW B;  5EBW C;  1SRY A;  1YF2 A;  1FXK A;  2VS0 A;  4NTW A;  4KUM A;  1S5H C;  1TVK B;  1FJG B;  2FL4 A;  1PM9 A;  4RWU A;  3ZMS A;  4L87 A;  4EKW A;  4TV8 A;  3LDD A;  3ASO C;  4JI0 O;  3M99 B;  5EBM C;  3C3S A;  1VQN V;  1XIL A;  1R3K C;  3SR2 C;  4I9Q A;  4DV7 O;  1BT8 A;  1TAE A;  3S3W A;  3JD4 A;  3PN1 A;  3TET A;  3WG7 C;  2ARH A;  4TOI A;  5IWA O;  3OGC C;  4LF4 B;  3ZHR A;  2WLM A;  3JD1 A;  1NJI W;  1Q82 W;  4X8A A;  4I7Z B;  4J9Z B;  4O4J A;  4EEQ A;  5B3S B;  1K8A W;  1W0J G;  2HKO A;  2YDE A;  3APQ A;  3AG1 B;  2Y4U A;  2Q9L A;  3IGA C;  4JAU A;  3I55 V;  1B04 A;  2Q67 A;  2DQ3 A;  1DGS A;  1PD3 A;  2RMK B;  1AI4 A;  4F4L A;  2EUL A;  3JD3 A;  5CA1 B;  4X1I B;  2LO1 A;  1QLE B;  2R9R B;  1L0L H;  2G38 A;  1Y74 B;  1PPJ H;  4MTX A;  2BCC H;  1RFY A;  4QPK A;  5DED A;  4ZI7 B;  1BS3 A;  3MHS C;  5HFL A;  1UPG A;  4N23 A;  3SDL A;  1AP5 A;  3H9V A;  3D36 C;  4FMT A;  4GKK B;  2Q7H A;  2EIJ B;  4YHH O;  3B8M A;  3K5M A;  2YI8 A;  5JH7 A;  1EN5 A;  4E4E A;  4E2L A;  2BSK A;  3IC9 A;  4JI1 B;  3ZMU A;  2EJ7 A;  4TQF A;  5J9P C;  3STZ C;  4FLX A;  1VQL V;  3T1Y O;  3D3Q A;  2GTA A;  4UVA A;  4BW9 A;  1SF9 A;  3G6E V;  4W4L A;  1S0V A;  3TXS A;  1ZL8 B;  2YXL A;  2O57 A;  5IY5 C;  2A79 B;  4LF6 B;  3BHP A;  4RAI A;  4GX1 A;  2F66 C;  1NTM H;  3SJC C;  1AP6 A;  3BFR A;  3M8A A;  4JYY A;  2UUC B;  3W7S A;  4UV8 A;  1ZSP A;  4O4I A;  2A9H A;  2W6I G;  1VQ9 V;  3OEE G;  4MVS A;  1GM8 A;  4JI6 B;  1US6 A;  5JVD A;  1N32 O;  2YS8 A;  5BR8 O;  2P7T C;  2WLI B;  1HNX B;  2QJ1 A;  5KA5 A;  4P30 A;  4YIP A;  2ZNI A;  1TA8 A;  3E22 A;  4DRX A;  1XNR O;  4U3J A;  3B2E E;  5B1A B;  5B1B B;  1SS3 A;  1W59 A;  3DXR B;  1QHT A;  2KG7 A;  2JS3 A;  2B9Z A;  3VQV A;  3WB1 A;  4QIW F;  2P6J A;  4XDJ A;  2UXB O;  4NTY A;  4RUF A;  4DV6 B;  5B1O A;  2W6J G;  2UXC B;  1PL4 A;  1J5E B;  4CH6 A;  2XAJ A;  3SJB C;  4DK0 A;  3CJH A;  4QJF B;  2HHH B;  4UVB A;  1Y76 A;  3OMI B;  1ZTE A;  1Q7Y W;  2X0L A;  1JR9 A;  1FS0 G;  3HPL C;  2EX3 A;  5JQG A;  3ZHV A;  1K3E A;  4X1Y B;  3H1K H;  3H1H H;  3ZMZ A;  5IJ0 B;  4UCV A;  1G1X B;  3SJA C;  3OR6 C;  2YUA A;  2JIZ G;  5GTI Z;  4ZOL A;  4K35 A;  5JJE B;  3AEI A;  1FD9 A;  2Z0A A;  4PHZ A;  4R8C A;  2QM7 A; 
#chains in the Genus database with same CATH homology
 2Y4T A;  3AG7 A;  4J7Z A;  2KQX A;  1GH6 A;  2QWQ B;  4J80 A;  2QWO B;  2CTQ A;  3BVO A;  2CTP A;  3UCS C;  2GUZ B;  1N4C A;  1IUR A;  2CTR A;  4IT5 A;  3APQ A;  1BQ0 A;  2Y4U A;  3APO A;  1FAF A;  1WJZ A;  2PF4 E;  4RWU A;  2CTW A;  3UO2 A;  2DMX A;  2YUA A;  1NZ6 A;  2QSA A;  2CUG A;  2L6L A;  2N05 A;  2QWP B;  2QWR B;  2LGW A;  1HDJ A;  1BQZ A;  1XBL A;  1FPO A;  2YS8 A;  2LO1 A;  2EJ7 A;  2M6Y A;  3UO3 A;  2OCH A;  2DN9 A;  2N04 A;  2QWN B;  2GUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...