2CGOA

Factor inhibiting hif-1 alpha with fumarate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
342
structure length
339
Chain Sequence
b'AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Studies on the Inhibition of the Hypoxia-Inducible Transcription Factor Hydroxylases by Tricarboxylic Acid Cycle Intermediates.
pubmed doi rcsb
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 106
structure length 339
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2cgoA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgoA01
2YC0A 1H2MA 4NR1A 4BIOA 1H2KA 2XUMA 1IZ3A 3KCYA 1H2LA 2YDEA 3P3NA 2W0XA 3KCXA 3OD4A 2WA4A 1YCIA 4B7EA 4Z2WA 1H2NA 4AI8A 1MZEA 4JAAA 5JWPA 4B7KA 2Y0IA 3D8CA 2WA3A 1MZFA 2CGOA 2ILMA 4QU2A 3P3PA 4Z1VA 2CGNA
chains in the Genus database with same CATH superfamily
1KECA 2W2IA 1JZ2A 3CJIC 1A78A 4TZDA 4ZXKA 2HWB3 4JI2B 2VVEA 1AR83 5CYYA 3JB4C 4GLXA 3K3WA 4JYAO 3ASNC 1PGW1 2PI4A 4CCJA 3AJZA 4QB6A 3FJSA 2EX3A 3VKNA 2R6QA 5HCBA 1QJX3 2R49A 4JTAB 3BRCA 2J42A 3OGSA 2DWDC 3DL3A 1SPPA 1C4RA 4XFAA 1YJNV 2VU9A 2ZE5A 4YYOA 1MS4A 3GZEA 2BEOA 2VBDA 2A6YA 3J7HA 1VRH3 1WA8B 4LF4O 4LO6B 1JX9A 3KWVA 3NAPB 3W59A 3QH6A 2VY0A 4R6ZA 2JB8A 4XJ8A 4OX9O 3APBA 1FD9A 5FMDA 5K1PA 5FREA 3PUHA 1I0HA 2HBTA 1IS5A 3IC9A 1OD3A 1JYNA 3W5MA 1MSWD 2DV9A 1W6MA 1Y74B 2B1IA 2OIGA 4X1IA 2JDUA 5A7PA 4EEQA 2XL9A 1VR3A 4QU2A 4XCAA 1V54B 2JDIG 4MSVA 3POIA 4GJZA 3ZMSA 1QJZA 2E6VA 4XHBA 1HRV2 4LP8A 1E5SA 2HVJC 1PMIA 1QJU2 5LHIA 2EIKC 4AI9A 4Q4Y3 3BKZA 1M4UA 5F8PA 1RUH2 3OG2A 1OFSA 5A32B 3JCUZ 2R042 4IEYA 1Z0HA 2ZX2A 4OUSA 1PO22 2R063 1OH4A 3ZN5A 3E83A 3ZXGA 3VQWA 5JJJB 4BQ1A 3SHRA 4E8DA 1P84F 4FM0A 2FDJA 1VAVA 4YHHO 1LHNA 2GALA 1G9FA 1CWPA 5FPBA 5FZOA 4K3UA 1PZ7A 3WG1A 3OM3B 1BHGA 3LDRA 1JA8A 1RHI2 3PDQA 4O4LA 3VBSC 2WKKA 2VRZA 5T5OA 2Q4SA 1TUEB 3M1HA 3BVOA 1L7LA 3HBZA 1WMDA 4UF0A 1Y43B 4FXKB 1PVC2 1AI7A 1FATA 5LBBA 1SERA 5F6KA 1RP3B 1W9SA 1DQ1A 3PVBB 2RDNA 2N04A 4ZONA 4LF9O 3LA3A 1WW6A 3ABLB 4QB2A 5JCOC 5A3LA 4EZ4A 2ZMKA 4O2BA 3ZRSA 2DN9A 1OOPA 3KQRA 4FQ4A 4NRMA 4QKNA 4LLFA 5FLJA 4CDWC 2R0HA 4RFT0 2VXJA 2KG7A 3CJIB 5K9YA 5LB6A 4DY3A 3CXCU 3E6BA 3RMXA 5EIYB 1XQNA 1PK6A 4N9HA 3ZBHA 4DR2B 3ASNB 4WZCA 4Z8BA 1HNZB 2ZIOA 3RVYA 3EO6A 2AC1A 3N4MA 1IG3A 1ZX3A 2DTYA 2IUWA 1D2SA 4LF7O 5C3OA 1XOYA 3LSQA 4JI6O 3MUY1 3I2HA 4AI3A 1H8VA 3ZHQA 5LK5A 2VCMA 2HLDG 5KX5B 2UXCO 2GTAA 4K1ZA 3GXUA 5A2QN 1ZL8A 5C33A 2AW9A 1FKAO 4TXWA 2E5LB 5C5UA 5J2UB 3LFMA 3J7MA 4YSFA 3RFRA 1RUI2 1WB7A 2PHWA 5K8SA 3HKBB 3GDBA 1XYPA 1DGSA 1US6A 5FZ3A 3BUCA 1VB2A 1DHKB 4P30A 3WX5A 1WP8A 3MICA 5LXTA 2Q8OA 1WBFA 1W2OA 3L9JT 1BHBA 5F5CA 1W8HA 2H0BA 2X10A 4WVMB 3H50A 1UU4A 5A70A 4V2VA 4X1YB 1XOUA 1Q81W 5LW9A 3RZHA 4Q8LA 5F5IA 4LO7A 3OBRA 1L7RA 1D4M3 2RM22 4D6SA 5IDJA 2ADDA 3OTFA 3C3VA 1S0BA 1UIKA 3ACLA 4XZPA 2WT1A 2ZNJA 1IQAA 1ZBE1 2WNVC 5J48A 1POV3 1QHDA 2EIKB 3H7JA 3NNLA 1JTZX 2EIMC 4I2OA 2DQ0A 3MUZ1 2WQ8A 2Q8CA 4P9JA 3ZFFA 1VQ4V 4EWEA 3N2KA 3FBYA 4PDRA 4XUPA 5F3IA 4OXSA 3VBUC 3ZJZA 4HAMA 1IDSA 1KS5A 2DFBA 1HWYA 4FFHA 1GQPA 4QPIC 1QDCA 4CCEA 5JDBA 3PUSA 4Q27A 4MSWC 2LTNA 1SLIA 3A21A 1AR63 4BM8A 4ISRA 5CMUA 3QO7A 2WBKA 4XURA 4EQVA 2JG9A 3VBOA 2WLQA 4QM9A 5L73A 3E86A 2Q8DA 2VZ1A 1HQWA 4RFRB 5FZBA 1FXHA 2CE4A 4D69A 2PXJA 4UXNA 3VBSB 2X29A 1LU1A 3V0BB 2ZGSA 1XNDA 4HKWA 2WABA 3EJKA 5HCHA 2LUWA 1FPN2 3HAGA 2A7WA 4HMZA 2Y0OA 3VDCA 2FDKA 1OPOA 3K5NA 5FAXA 2SBAA 1SESA 3ZYFA 4JGZC 5ABJC 2CNAA 1UCXA 1WLEA 1MS5A 5C8YB 3R4DB 4EB6B 4WVVA 3ZHRA 4GT1A 1DQ0A 2VS0A 4BQ2A 5LA6A 2NLJC 1UMIA 1JH5A 4CDWB 1VBB2 1VBD1 3CZUA 5CFCA 3U11A 3EHKA 1MABG 1LOAA 1STMA 2QKDA 3ACHA 2EIDA 4DB5A 2C6SA 3VBRC 2ZGKA 1N32O 5IVBA 1MEC1 1KD1W 3Q4HA 4Y20B 2P34A 3AFKA 4PJYA 5DUXA 4QGLA 4GMP1 4CS3A 4QGMA 3O1UA 3RVZA 4WBNB 5JVDA 1YI7A 4B3RO 3ZKUA 1QJU1 2QDNA 5FPVA 1F5FA 1RUH1 2EXIA 3T08A 2LGWA 4DW1A 4LTAA 1J5EO 4MVRA 2VG9A 4W6WA 4MS2A 1R1A2 4YW6A 4WFHA 3WY6A 4IEXA 3WB2A 1OI6A 2F4PA 3FL7A 2M6YA 1N34B 2F4VO 2FCUA 4BIOA 2RR13 1Q8VA 1QIQA 1AX2A 2BTVC 1Y67A 4AFAA 4CUBA 4N7IA 1EAH1 3JCZA 1RUD3 3TEXA 1BCXA 2E31A 4ZI7B 4LCUC 4AI0A 3CMAV 2Q0AA 4Z92B 4KQ7A 4DRXA 1RHI1 4AFMA 1UYZA 3NNGA 1DQ6A 5IK7A 1ODNA 1S2KA 3SITA 2CK3G 1H4HA 3UGFA 4DUXA 4O4HB 4RN5A 5JAXA 3JBG1 1K12A 2LJ2A 4DXTA 2HWE2 2CY6A 2PQSA 1ZBE3 5KAIZ 4XFHA 4CDXC 1PVC1 2VMIA 3CF6E 1V6NA 3KV9A 2VUDA 2FYUH 3AG1C 2WC2A 2B5HA 3GHNA 2RNBA 2WNVB 5T52A 1Q82W 4QM8A 4K7JA 5IK5A 5FYZA 2CAZC 2EIMB 4CDUC 3LSUA 1IKPA 4IDZA 3WF4A 3UKTA 1LHWA 1RUF2 5DZGA 4WV8A 3FYEB 5L3GA 3A23A 4ITCA 3SCFA 3VBUB 2Y0PA 3WP6A 3RWKX 1S0FA 4QPIB 4XFBA 4LBMA 2BRTA 1OMIA 2XJUA 1B35A 3S0MA 1WCDJ 4TV9B 3ZHVA 1MG1A 1WW7A 3DTUB 1LEDA 3O0XA 2VOVA 3STLC 3KT7A 4ICGA 5FXWA 4A7YA 4H13B 2GMEA 2GDSA 5A80A 1AXYA 1DZQA 1XU1A 2CWMA 4K1YA 3KVBA 1RINA 4GXLA 3WZ1A 3HBKA 4O2AB 2Y0IA 4DV0O 5I8SA 3ES4A 1NQJA 4Q4V1 2UXNA 4AFCA 4MTXA 1W2UA 1A8DA 4BQXA 5E8AA 4XF3A 2ZE6A 3T3YA 4JGZB 5ABJB 1M90W 1PKXA 2YYOA 1BS3A 2XJSA 2JX9A 3LEGA 3IIIA 2HWD2 1GM9A 3ZYPA 3AP5A 2W6IG 2Z5UA 4JI8B 4IGOA 3E6CC 2VNOA 2Y6LA 4HL0A 1O4YA 4LF6B 1MEC3 4Y1ZA 4OGQB 1NVPD 3ZMZA 4IV1A 3OYWA 4IEOA 2QE7G 1YJLA 1IS3A 2VMDA 4N53A 3VBRB 1B3QA 4GMP3 4XJZA 4C7UA 4AR2A 3U78A 1HRV3 2X5IC 1WJZA 1QJU3 1DDLA 2QM8A 4E4EA 3FN9A 3JD3A 1VBC2 1RUH3 5F2WA 5CFDC 5IJ9B 1VE0A 3B09A 5I0DA 1BZWA 4QHOA 3F95A 4OHZA 2ZGNA 3CRMA 1W2NA 3KF3A 1Q90D 4WF9V 5FYSA 4B3SB 1Q7YW 5A3NA 4KFMA 1PO23 3JAMN 2XOMA 4X66B 3ZHTA 3SH5A 4LF5B 2ZX3A 1EAH3 4QX5A 3BTXA 4KBZA 2ET1A 3SGIA 3T0DA 2HYKA 4Z1VA 1P4RA 3V65A 2EJRA 3U75A 3CRQA 1SBFA 1RHI3 2YC2A 2VZQA 1DZRA 3PNAA 3ILFA 3VZKA 2A06H 5L9BA 3WB1A 3DV8A 1P7BA 3JBG3 3POJA 4FPFA 1GRJA 4XOGA 5CB4A 3AKPA 4XYXA 5GLTA 3MHZA 2W5FA 1ZRFA 4DV3O 2VQAA 2WO3A 5D8AA 3HKDA 3SPGA 3UV9A 1W6NA 1PVC3 1OUXA 4OI4A 1Y9MA 2DF7A 3S7IA 1R3JC 4CA9A 5L36A 2L9LA 4O61A 3KB5A 1MR5A 4CDXB 2LO1A 3W7TA 2WNOA 3RPQA 3FMGA 3AG1B 4LLOA 2Z69A 2HG5C 3JQXA 3ZFEA 2R071 3ACGA 4HZFA 4CDUB 1GLHA 5KMGA 2ZD9A 3AMNA 2C26A 3SPHA 4Y1VA 3AB0A 4DK0A 3BCCH 1PL4A 2A0LA 4QQHA 2JENA 4AZZA 1WW4A 2OZJA 2XVGA 5IVEA 5JCTA 3ZEDA 3B69A 1G6NA 2ARCA 4GQ7A 1QH6A 1KGYA 3SKVA 5DZEA 2E26A 1FJGB 3I7DA 1H2KA 2DCZA 2AR6A 1S5JA 2IW5A 1OFNA 4N9IA 1N3PA 3I8TA 3JQWA 2GSYA 4FMTA 2DE0X 1H0BA 2YBPA 2UUBB 1SZXA 4OZOA 3TNPB 1X50A 5H5NA 4TWTA 1HRI2 3WHUA 5IYDO 5ITZB 2AZ5A 3PJYA 1UJWB 1DGLA 1F4NA 4LKEA 1RUI3 3GB7C 4BIFA 1GM8A 1OD5A 5FZCA 5GALA 2XHKA 2R9AA 3ZN6B 1GR3A 5F3GA 2JS5A 2YUEA 4BIUA 1P7GA 4GX2A 1VAKA 4LKSA 3ZM8A 4JX0A 5LYJA 4EN7B 1UOJA 2V5DA 5EK0A 2RM23 5A7WA 3KHCA 5BMVB 5JVVA 4PI2A 3AG4C 4PA4A 1FXZA 2Q5TA 3DF0A 3MO4A 5FNVB 4J41A 4QX0A 5EBMC 2X5IB 4QDRA 1W59A 4RA0A 1CN1A 3CL1A 3HR0A 2PELA 5EBLC 3FB8C 3T0AA 1R6NA 4DRRA 1QXRA 4AGGA 1O3TA 3Q8AA 5FR3A 4Z1MG 4NTYA 3CC2V 1OF3A 2A3XA 4CU6A 1H1AA 5A33A 1OCOB 5JUVA 1GOGA 2BVBA 3GGLA 1LOFA 4GAZA 2IVJA 2VMCA 3RDIA 4JKKA 2YIBA 3JAWA 2VZUA 2YDEA 4CCLA 1PIV1 4DUZB 4P9WA 1E57A 3QVNA 1VBE1 1K5SA 4OI2A 1I5YA 1NZ6A 2VW0A 4PJ0Z 4LBQB 2UYBA 1GSLA 2EXJA 3OY8A 3M8LA 1LENA 2ZT9B 2OX0A 2WN3A 4J9YB 1EN6A 4OI0A 3ZPYA 4I3PA 3VD9A 2WN2A 4RR3B 1CAUB 5KXCA 5A1LA 4CZZA 3A4UA 4CUCA 1DG6A 5E79Z 2UU8A 1F9KA 1MS1A 1OA2A 2Q8VA 3OTOB 4YW3A 4I55B 2H94A 4OUEA 3OEEG 1AVBA 1HQNA 1IZ3A 1JUHA 1J3QA 2WA4A 3RYHB 4F83A 3KVAA 1UY1A 3RYIA 3JCIA 4I0AA 3CCJV 1U96A 4PQ9A 3E5XA 4UCSA 1AX0A 5GONB 4FTEA 1US3A 1ULPA 1UYYA 3K77A 2B1GA 4HANA 4NXNO 4KUMA 2FQPA 4IQPA 1VBB3 4MTGA 2QQWA 2KSDA 1JYXA 2DUPA 4OFGA 3RZGA 3JSNA 2Y4TA 1S0VA 3D8CA 4I0XB 4TV8A 3S5QA 4FLTA 2XLFA 2ZM6B 5FPAA 1V70A 2WZR2 5A3OA 4CU8A 2ZE8A 5EZYB 1SMVA 2ZGLA 4JTNA 4JI0B 2RJZA 1BEV2 3THPA 1M9NA 5K4LA 3I3BA 1ZREA 1XHZA 2V72A 4PHZA 1CEZA 5IVJA 1O9HA 1UIJA 3OPWA 1R1A3 1WPXA 4BWAA 1KQSU 3IFXA 5A9GA 2Y38A 5FZHA 1N1SA 4CP9B 4JDMA 3GWKC 1GUIA 5DPNA 1JYIA 1EY2A 2QQOA 1GN4A 4A4AA 4JRAA 1B6QA 3AM2A 3I2FA 3WNLA 3USUB 4RUEA 1MVEA 4FI9A 4X6RB 5CG8A 5IYCO 2ET7A 2LALA 3TRSB 2J1EA 1CD3G 3VBBA 1K5QA 3L70H 5FYTA 4PIYA 1Y9QA 1AJNA 2QE3A 3K2OA 2NMNA 1WKYA 3PU8A 1ZM1A 2HWE3 1HW5A 4NYKA 1ZAUA 1OVPA 4PIZA 2DVBA 4K8FA 4GB32 4BCUA 4HVOA 2LP7A 4EN9B 3GZUC 3AG4B 4XUTA 2RV9A 5FZ7A 2MEV1 2FCTA 2ZGQA 3S3WA 1OOPC 4OUMA 2YI8A 5JZGA 2XVLA 1V9U1 5BR8B 4IGPA 2YU2A 4EN0A 3DEMA 4RS5A 1UOGA 2FDHA 2RG4A 4P14A 3I4IA 2WS92 3WF0A 2J22A 4GWIA 1PK6C 2IZWA 1TA8A 4LT5A 3WUCA 2ETEA 2OS2A 4LR4A 1F4MA 2DDUA 4FLWA 1D4VB 5TSWA 2JE9A 4AF9A 2UXDO 1BQZA 4BYYA 2KA3A 1ASJ1 1VQ7V 5HV4A 1NYWA 2PGGA 2IFRA 4O9GA 4ZU5A 3DXUA 2R1BA 1OXCA 4EZHA 3ZSMA 3GCXA 1TG7A 3HJRA 4B1MA 4JI5O 1IS4A 5FQ0B 1NBMG 1HP8A 4NXMO 3KT1A 1HRI1 3ZN4A 3R4SA 4JI3O 3CU7A 5JOYA 4R52A 2EALA 3MLJA 4XBFA 3IDEA 1GWKA 1VPHA 2FL4A 3J7LA 4IV3A 2R9RB 2B9ZA 2RMU2 3NNMA 2DVGA 1W6MB 4K35A 2WINB 3TCUA 1XMOB 5JXHA 5IATA 4K8RB 1S0CA 2G19A 1GOHA 4HKLA 2X7RB 4PDLA 2CAVA 3VQYA 2GDFA 2YMZA 3FUOA 2R0FA 5A3MA 2OIIA 1LGNA 3IN9A 4NVPA 3HQUA 3THDA 1NKDA 1HXS2 2FZ1A 2L6LA 3IBMA 3EYPA 2P6CA 3ZFFC 1V6IA 3K0DA 5FZEA 1BT8A 5FPXA 1JZ5A 4BW5A 3FB7C 4KL1A 4DV4O 2WAAA 4FFFA 1YYNA 3O65A 4Y33A 4BDVB 4F8AA 1W3XA 4I01A 3F7VC 1RSOA 3VLBB 1F4AA 5LBEA 1MS3A 3RYCB 4IGGA 3SYPA 5FZOB 4NOTA 4XF0A 1H2MA 4DINB 5KHKA 2BQPA 5L3BA 4HETA 4KG0A 5DUWA 4O4LB 5G04L 5LP6A 3B02A 2QQUA 4HLTA 5LA9A 2O8QA 3AVRA 2BOJA 3FWEA 2XAGA 5KBFA 1V6MA 2BVVA 5F5QA 1X4TA 2ARBA 4EWAA 4YW2A 4IYHA 2XOKG 2OW4A 1BQPA 4UF0B 4HVRA 2W46A 1SFYA 1LKNA 1JOYA 5EYPA 2MEV3 3H1MA 5IJ0A 5E1RA 5ANNA 5IJRA 1NR1A 4COZA 5FWEA 3IJ4A 1GZTA 4LNVA 4O2BB 4FXGB 3OFNG 5JH7A 1OOPB 3ZXDA 5E6HA 5HV0A 4DUWA 2RDSA 1NR7A 4LKFA 1EZJA 5FUIA 2KG7B 5CFCC 4NMIA 1RUG1 3PVEA 1JVMA 4XDQA 2XAQA 5DAQA 1PK6B 4BWOA 1GP4A 1QF3A 4GX0A 1GQHA 2JG8C 4MGKE 5LATA 4JTCB 2OVUA 1F4HA 3MEPA 5HI0A 2WIIB 4U3FH 3G7DA 4NIIA 4ASLA 3ZN1A 2EJ7A 1NJIW 5KA6A 1S0EA 2VQUA 1LODA 5BNPA 3OAAG 3ZS8C 2WFPA 1AB3A 5EQUA 2NP0A 2XKOA 4U2AA 4AFDA 4DQAA 3WDUA 1HRI3 1VMJA 3ZRWA 1QJY2 4FOQA 1S3JA 1ENXA 1FOD1 1ZL8B 4C90A 2VMGA 5J2TB 4LUKA 4YLZA 4MXVA 2A3WA 1FPOA 1GWLA 4XBLA 4OYUA 2XWBB 4C91A 1SLAA 2RS52 4B3NA 2WFF2 4H33A 3T1LA 1VF6A 1QLEC 4PV1B 2EINC 4FAHA 5LMNB 4FM2A 2BGCA 4FZ1A 2AHYA 1MA1A 3NKGA 1COWG 2JJ6A 3S5AA 3P30A 4MTOA 1MS8A 3NO8A 3RQ0A 5EBWC 4AG4A 4QPGA 4FPLA 4CE8A 5LXTB 4JQRA 2QTSA 3OJBA 4NO4A 3OMAB 3TN92 1YIPA 2A9HA 3TXQA 1TMF2 5FP7A 3KLSA 5LA1A 1QU0A 4UFJA 4LOTA 2FBEA 1QH7A 3HNMA 3MIGA 2ZHNA 4UFHA 4DW0A 4GB31 5D21A 4J1XA 3CCLV 2X6BA 5LZ6A 3NJYA 4QWNA 4FPJA 4QT6A 3FZ3A 4BLJA 3N7LA 3FX3A 3ABUA 2VNVA 2JD9A 3BTYA 3ZFFB 3N2KB 5LBFA 1WA6X 4I7ZB 1QR9A 3HKEA 3IIAA 1UPIA 3M2MA 1YHFA 4DR4B 2WS91 1ZRDA 4DR7B 4EFEA 2YIDA 1YIFA 3CCRV 1MVQA 1V6OA 1I9RA 2A6ZA 4QMAA 4BR6A 3QOPA 4P9YA 3PJSK 4DV5O 2Q30A 1B35C 4FIPC 4IEVA 4JTDB 3FB5C 4YZ2A 2FZ2A 5ACA1 1URXA 4MV2A 2BSKA 5C5TA 3TK1A 4GKJO 1J1LA 4ATFA 3C3SA 1H6YA 4QXKA 3LIGA 3RRDA 4N90A 4QXCA 1CJPA 4YGEA 3I2KA 3MI8A 3J80N 2WAMA 4AVBA 2PHLA 4A3XA 3WVJA 3WNPA 1UNBA 1SF9A 4D3WA 4MVTA 2LM3A 4YVWA 3M7AA 4CCNA 4KGQA 3OD4A 3OT7A 1TQ5A 1ULOA 1X9TA 1H6XA 4HG6B 5LMUO 4XJAA 4JRLA 3W20A 1JYVA 2E74B 3JARA 1HB2A 1RUG3 4K0KO 1NZIA 3ALQA 1W9YA 4JDNA 1KJRA 2JDPA 1X9PA 2DVAA 5LA6B 3QTCA 1AYN2 2LS6A 2YBSA 4I5SA 1MACA 5CFCB 3CWBH 4H44B 3ACIA 2EF6A 3T1YB 2YXHA 5FDBA 2WZR3 3KZIZ 4N53C 1L7QA 4JI2O 1LUWA 4CCDA 1K5MA 1UZZA 2JG8B 3Q4HB 4XDOA 4LE3A 1IBLB 2UUAB 3FBMA 1BEV3 1L8DA 3DXTA 3BTZA 5JVDB 3E35A 3RZJA 5GW7A 3MV11 3L2HA 4LITA 4FPEA 3FHIB 2VUAA 1OURA 2UWAA 1DBNA 3ETPA 2GN7A 2C9KA 2ZTNA 5EJ1B 3C8XA 5FMBA 4YFWA 4L8QA 2JICA 2EAAA 3N7MA 5FP9A 3IC7A 4YARA 5I8YA 2PN5A 1I7FA 3OUHA 4L87A 3DYPA 3KHBA 5KLVH 2V73A 3E89A 3M8AA 5CVRA 3HOBA 4H7MA 1YZBA 2CH7B 2XB6C 4PI0A 1NQTA 1BK1A 4EV0A 1L0NH 1QLEB 4W8JA 2EINB 3CQOA 2LRPA 5FLXN 1O8SA 3JD0A 2E75B 3OGGA 4DRXB 2VMFA 2JIGA 5CZKA 1OCRC 3WV6A 3G4SV 1OLME 5H9QA 5D8AC 3UL2A 2HJDA 2E53A 3VKMA 3MAQA 4YG3A 3C7EA 1QHTA 4FPPA 1DQ2A 4GB33 2EA7A 4UCTA 4HFSA 5JOWA 4M4PA 1YJKA 3HQXA 3F2ZA 2TUNA 3OGCC 4DEVA 5F2SA 5KUMA 4R7CA 3GNEA 2QQVA 1Z78A 2TNFA 4IT5A 2D7FA 3ZFEC 2XWJB 2B4KA 4COYA 5JMOA 4COWA 1LHOA 3U37A 2Q4PA 2WS93 2NM1A 4LK7A 2VE1A 1HB1A 2LW8A 4UW3A 3UT5A 1GZCA 5T5LA 4Q29A 2VBBA 1SLLA 4B08A 1B06A 5FPUA 5CA0A 4ARXA 1VARA 1IURA 1D5AA 5ACA3 2CSGA 2Y64A 2JKXA 2VOWA 1B35B 1BGYH 1R091 4NKGB 4AYUA 1POQA 2H6CA 5EFUA 2WUHA 3IDCB 2GP5A 4I9WA 3C7FA 3I5DA 4AHYA 5FZMA 1N33B 3THCA 1S2BA 2VUCA 2Z42A 4UCRA 4AHCA 1UU6A 5C71A 4LULA 3VUOA 1WD4A 4LBJA 1IPJA 5I8TA 5B5EZ 1FMD1 1JZ4A 3L2YA 4KXRA 2ATFA 2WFF1 1HB3A 3VGIA 1WA4A 4XPVA 3A8TA 2PHDA 4IESA 4CEYA 5LBCA 4WFBV 1ND3A 4UXAA 2D2CB 4LWSA 2B42B 2BNMA 2QKSA 1EYBA 1G8WA 3OYWB 4JZRA 4DV2B 4LHKA 1UOBA 3TN91 4XEZA 5FCCA 2O14A 1GBGA 4N53B 1NE6A 2AH2A 1N3OA 3ZYRA 4Y5SA 4DR2O 1LJ7A 1QXJA 2E3CA 3RZMA 3CYOA 1XJAA 1HXS3 4UV9A 4OULA 1HNZO 3JALB 2Y6FA 3AK0A 2W6JG 2JDMA 4LMFA 1K8AW 1DGRN 1FI2A 3W7XA 2ZNIA 3SCHA 4UW4A 1OQEA 4MUVA 2RCVA 3PHMA 1LOFC 5D1IA 1NLSA 4QX1A 4CC5A 4XW3A 3W7UA 2Q6AA 2Y4UA 1QQP2 2GC3A 2VNRA 3DPRA 2K1EA 1WGPA 4YM0A 2E5LO 2K9PA 2XUEA 3ZHUA 3RZKA 1RUE2 2WYFA 3JB8A 1IX9A 2VZOA 3MFCA 1N36B 5EP9A 2ID4A 2WAOA 3A0KA 5ERLA 1AR5A 4UVBA 4RGKA 3A0BZ 1W8WA 2HWB2 2CTVA 4BAYA 2BZDA 4RSUA 1GK9A 3OW2U 5CB4B 1HN0A 1OCRB 2HP8A 5D8AB 3HKDB 4GIQA 1AR4A 1JW6A 3H1JH 3O1PA 3QD6A 2G9FA 4JCKA 5D5PA 5A7OA 5I0UA 4HK9A 3SXWA 4N21A 3H9AA 2ZGRA 2W1UA 4KG8A 3SNMA 3AKSA 4LFAB 1PPJH 1BMFG 1RXFA 3R65A 2DVDA 1BXHA 3TAYA 3ZFEB 5DUVA 2N05A 2WLLA 3GBGA 4WFEA 5KMGB 2WQZC 5BXZA 3CO2A 1G9BA 1NXD1 1CAWA 4O4JA 2W3JA 3RW0A 2JDAA 5FY8A 4W6YA 3T1HB 4I09A 3H01A 1A32A 4R9CA 2GHYA 4J1WA 1R093 1VQ5V 3M4FA 1UWWA 4GYCB 2XASA 4IERA 1DYPA 4PF1A 4HNAB 5C3QA 4Y4YA 4C0BA 5C3SA 1XI1A 1DYKA 1YF2A 2W0FC 4AHXA 2BW8A 1AUYA 3OEAA 4O9EA 5LASA 1MNGA 3BU0A 3RBZA 4D6RA 2HEPA 3E5UA 1DLLA 3K08A 1F2NA 3BVCA 1GKBA 4YJ2A 3ABTA 3M3OA 4R9AA 3RI9A 2HWC1 2AXTZ 1YJ9V 3G6JB 1FX5A 3LOBA 2RS53 3N9MA 2MK3A 2WFF3 3K46A 5I0TA 4IHJA 2W95A 1BZKA 1IHMA 1PGL2 3I2OA 4HOOA 4P9XA 3O12A 4YM2A 2BTQA 2VZPA 3I2IA 4B8EA 3TN93 2BPA2 2R062 2ZCWA 4LO5B 4CH5A 2KD7A 2ZDIA 2ZEYA 5LYJB 1KEXA 3QG5A 1AL0G 3W58A 2X53S 3GBFA 5A7WB 1W6QA 5JOXA 2F1MA 3MDPA 5A6XA 4A41A 1LOBA 1UQXA 5JZGC 3AP9A 3NQHA 4TWKA 1U5IA 1MPXA 1DLBA 2BWAA 4RS5C 2DU1A 3ZFGA 3I56V 2B46X 3VD7A 5A33B 5FZIA 2WWJA 5B4XA 4G27B 5FXZA 1URFA 1U5YA 3GHMA 3SEEA 2M7WA 2IJKA 3JAWB 2AZ2A 4AQ2A 2JEXA 1FYJA 2E63A 1XHXA 3CHXA 1N34O 4OHYA 4C1XA 4GUNA 2RS11 3OY8B 1YUDA 4CH4A 2MHFA 4PBOA 3GJBA 1D2DA 3H1HH 1Q8PA 2WZEA 3O7OA 3K0GA 4MOAA 5IFTA 1PZ8A 2JDYA 2VO5A 1UYXA 1SG3A 1PGW2 1LR1A 2BDRA 1YDXA 4XHXA 2AEYA 2J7MA 2HHHB 2EXKA 2WWSA 4XACA 3SH3A 3M7MX 3CRCA 2XONA 3CP1A 3RYIB 3SKJE 2J1RA 4KWUA 2Y26A 4IV3C 3X29B 1H38A 1W9FA 4M3CA 2VPVA 1AROP 3VV1A 1KP2A 4DR1B 2BV4A 1XBLA 1S72V 3BIWE 4AXOA 3OUFA 2WWUA 2OUHA 3OEHG 2QCSB 2ZJCA 4TV8B 2I74A 1A3KA 2OWOA 1IBMB 4DV1B 3ST7A 4BLIA 3JATA 4JGSA 1PZ9A 2TEPA 4YW4A 4BU2A 2UU9B 5KUKA 4CXYA 4F4LA 1R1BA 1F7YA 4CCCA 3J7NA 3UO2A 3PLQA 2ETNA 2D43A 5LRRA 5B2GB 2NR5A 3UJOA 3BEHA 1KD7A 5DM6V 5JJNB 1NE4A 1X8EA 2JKBA 5FV3A 4NHMA 1W8ZA 4JPRA 1AXZA 2OYZA 3EFFK 3ME2A 2BUKA 4LF8B 5EC2C 1XE8A 2UURA 3GZTB 4QQ2A 1GN2A 1LU2A 2W1SA 4KU7A 3B94A 3DYOA 3WW2A 2FMLA 2RVAA 5LP6C 2XG3A 2PAMA 4MVOA 5JPNB 3ZIAG 3K3NA 4XTPA 4Q26A 4XUQA 3FB6C 4XETA 1W2BU 4A3ZA 1LTEA 3EB7A 4JI8O 2ARXA 3G6BA 1RIRA 2DMXA 3WNNA 3WF2A 5FPZA 3NKTA 1QQCA 4LF6O 2ORZA 4XUNA 5DN6G 3H1YA 3O1SA 4BZ4A 2QKCA 4H3WA 4AI2A 2AHZA 4MGYE 5JSRA 5JZGB 4DR3B 2A1XA 2Z0AA 2OYQA 2X6AA 4Q0QA 3RZLA 5FYHA 4Q6GA 5FO9B 2VOTA 3N3HA 2GBOA 4RS5B 3WQBA 4KI5M 2FB5A 3OBZA 4B3SO 4ASMB 3CC4V 3SCGA 3HD8B 3SYOA 2JWPA 2R72A 1IXBA 4X66O 1GANA 2RS13 2BJSA 4LF5O 3AP6A 3DKWA 3RYKA 2CGNA 2FKXA 3K3OA 2D6KA 1SQXH 3OGVA 1OBNA 2VMEA 5LBQA 2HVKC 4SBVA 1SQBH 3TBDA 1NTKH 3IZOA 4LFCB 4I50A 1JJ2U 3DKQA 4WVZA 4XABA 2YV8A 5K0UA 1FXKC 1H8HG 2VCAA 2J1TA 1ROPA 5FZAA 4X9QA 4RQFA 2QVSB 1S0JA 3AX4A 3ITQA 1GO3F 4NB5A 1N8RW 2IXLA 3OCPA 4UB6Z 2HJIA 1O5LA 4D6QA 4JHTA 1YLLA 1VF6C 1WNSA 4TLGA 4ARYA 4CUAA 4IV3B 2L35A 4IEUA 4F6EA 3BFRA 4D7SA 1PNGA 3B01A 1EV11 2VQEB 2PYLA 4B7KA 4QPGC 3KCCA 4AVSA 2VVFA 2AGAA 1Y76B 5F7UA 3T2TA 3O1VA 1RUNA 1UZYA 1SHWB 2GZWA 1S77D 2QM4A 4KGGA 4D7TA 3K5MA 1XDCA 2R9IA 5ANQA 1WLTA 1JZ7A 3CMEV 1R6TA 1H4GA 3FD9A 5BNNA 2BNOA 3MIHA 2QWOB 2NN8A 3K4ZA 4L11A 3AK3A 4X64B 3IDAA 1Y66A 3BU7A 1XREA 1HNWB 1FJGO 1I5XA 3THTA 5KXDA 5F5AA 2WSSG 1NA1C 1S0IA 3S6PA 1BSMA 2UUBO 1ALYA 1JODA 4E2GA 2BBAA 4AQYB 2P3JA 1R3IC 4E2LA 1QQP3 3SH4A 1SFPA 1ZBE2 1VBA1 4FTBA 1S5LZ 1KFXL 5DAPA 5FZ9A 2WNEA 1RITA 2ZX1A 2XKPA 3LSDA 5FY9A 1RUE3 1PX3A 3SC7X 1JPXA 4A5UB 2B9VA 2YB7A 1G9CA 3D5OA 2PHTA 1T6GC 4MVSA 4YFZA 2HR3A 3DUIA 2PZSA 5LP6B 2BOIA 2ZR3A 2GNTA 1PNKA 4COVA 1OCZC 1KU9A 4X1KB 1GQGA 3VHRA 3K51A 1WW5A 4ZBMA 2ZA9A 1OQ1A 4CEWA 3KCYA 3UGGA 5EYPB 2ZGTA 2B7YA 1VP7A 2W91A 4Q4X1 2MW2B 5IJ0B 4A7KA 5F2VO 5LHGA 1YITV 5AC91 1C5HA 3J8F2 4JV5B 5A6YA 3D0SA 2PHRA 4L8JA 1JR9A 3NSTA 1A8MA 1O9GA 5FY4A 3W21A 3N9OA 1VQ6V 1R081 3VZNA 3WD5A 1KYOF 1JFFA 3MLLA 5FBZA 1ZA4A 3ETDA 2RJ2A 4PF5A 2JGDA 4XF1A 2B5UA 4B3MB 4AEJA 1WMXA 3SQOA 2ZEXA 4MGZE 1ZBA1 4CP1A 1K5MC 1UOFA 5B66Z 2FMDA 3GJAA 1C1LA 1W6PA 5LY2A 4XF4A 1XE7A 3CCVV 1S0GA 4N7UA 2HLEA 1SLCA 1I3HA 4EWDA 4DUZO 4IGQA 4TN7A 3PTYA 1W90A 3JUUA 3BODA 3CE2A 4YXWG 1D7PM 1VBD2 3ILRA 5FWJA 1EPWA 3K75B 5CKNA 5JIAA 3IT8A 4BMBA 3HVDA 4E2SA 1TVGA 3T2MA 3T2PA 1E1QG 2AZ0A 3WG7C 1TUBA 3ZRWB 1MEC2 4HK8A 4UCOA 3LE0A 1FXKB 4MH0E 3O1TA 2UY9A 3LD8A 1SQQH 1XL6A 3Q8EA 1WB8A 3OTOO 2YU1A 3IMNA 1F5JA 2Q1ZB 3H1KH 4ZHQA 1PL0A 4RD7A 3E22A 4PDWA 3LDBA 3C7OA 3KMHA 3LB9A 1ZZ7A 4NHLA 1UU5A 4EYUA 3LEMA 1ZSPA 4P9IA 5T55A 3WW3A 4QPGB 4X1YA 5FTTC 4H14A 4L0PA 1KFUL 1JHNA 1AL21 1QBZA 1EAH2 4HKOA 4DUVA 1OSGA 5FP3A 1XRUA 4LO4B 2ZM6O 2PHFA 3LKJA 2VECA 5FZFA 2OT7A 4EROA 2YI9A 1VF7A 4JI0O 1VMHA 1V6KA 1TE1B 2YXYA 1KDKA 2QWPB 5FY5A 3JBG2 2DBIA 4CYDA 5FZLA 2XAJA 4AQTA 1G4YB 1NA1B 3HKEB 3ZIXA 2LFRA 1VBA3 3T1CA 1GYKA 3D82A 3MZHA 1KQRA 2BCCH 4DO0A 1N0NA 4URAA 3ABKC 4GKKB 1CXZB 5B3SC 1E5RA 1XNTA 2W0XA 4Y26A 5DABA 2Y33A 1DU3D 2HJFC 1GOFA 3V0BA 1W39A 3ETQA 2BSKB 3VQVA 1I5PA 5EYXA 4Q0SA 5A3PA 1SLBA 3J7AU 1OCZB 1X36A 3ROUA 5A1AA 4IUGA 3H7YA 2HKOA 1K9MW 1DQ5A 4N43A 4NPRA 4I9QA 5I0SA 4Q4X3 1TNFA 4GKXA 5JLVA 1HX6A 3MW4A 4JI1B 4J7ZA 4W6XA 5GLWA 1Q5OA 1UPGA 3UETA 4ATEA 1ZLZA 4AI8A 1RMU1 3PU3A 3GF6A 1IPKA 1O59A 2VGDA 3AXDA 3JASA 4CDWA 3JARB 5CKMA 1TNRA 1RUOA 3MPPG 1QMJA 3CCEV 4CEYC 4FLXA 3AZVA 5BR8O 5A7SA 1ND3C 4Q4V2 2R1DA 4LHSA 5HFMA 4CRQA 3AP4A 4KP4A 4WBBA 3PVOA 4X8AA 4LNUA 4B4RA 1K5MB 4U3JA 3P6BA 5T54A 1H8EG 2ZAAA 1CIWA 3WDWA 2YICA 3NV4A 1HIXA 4AVAA 2XDVA 1ZTEA 2VQTA 3FC0A 5BNOA 1Y4WA 2FMYA 3WDVA 4Z82A 3OR6C 2VWJA 4B4PA 5JPMB 1T2XA 1AVMA 1FFXA 1CR7A 3LCPA 2BFUL 2JXAA 3BYWA 3WU2Z 2P1BA 3B9IA 3N9LA 1FFTB 3WG7B 4GH4C 3ZXKA 1PD3A 4YJ3B 3MIBA 5FOJB 3U0ZA 4MGTA 4XC9A 3POBA 3DPRC 1ZVFA 1LHUA 3WF1A 1OKOA 1CP9A 3M70A 3K9AA 2WSVA 1O4TA 2GC1A 3CCSV 4QQPA 4FOYA 2XAFA 1WWYA 5CG9A 4QQOA 3M3CA 5LWBA 1NY72 2A75A 5FJHA 3WCSA 2PFWA 1I08A 4KWKA 1G9AA 2OA2A 4QDSA 3HKCB 1WN7A 1UY0A 1JCHA 1K42A 3CCQV 4A7ZA 1LOEA 2PLV1 3VKFC 1XMOO 3VHNA 4GX1A 2ADPA 2A70A 3BAAA 3AKRA 5SV5A 3ZO0B 1K97A 2E9QA 3J8F1 3OMNB 1C5IA 4FQZA 3RNSA 3OEBA 5C70A 2KXLA 4AI1A 1CESA 1PO12 4B3TB 1VQ8V 4J9ZB 5LOVA 4XJUA 1J59A 2QKAA 4QKDA 3WHTA 3VL9A 1HDKA 2XXZA 1SQVH 3H1IH 1SRYA 2F95B 3JAKB 4GKYA 3UT5B 2R7EB 5FZ6A 1OZ0A 2CWSA 3ABKB 5CA0B 1MS0A 4QD2A 2R072 5B3SB 2YSUB 2YG0A 1CPMA 1K4CC 5IUQA 3D3IA 3I59B 1W6OB 3RSJA 1OJHA 5LGUA 4Y1UA 3D6EA 5LGNA 3LQCA 1EZVH 2F43G 1K5JA 3ORJA 4R4XA 2N7GA 1QDOA 2IU3A 4CXXA 5IT6A 1WCKA 1AYM1 2BE3A 4FLVA 5EHDA 1BKZA 1FV2A 4LIUA 1NOVA 1QVFU 1HNXB 2I2SA 4CTEA 4XJWA 1AP6A 1QEXA 4O4IA 4QPJA 3HNYM 4DNYA 4XDPA 3A0RA 2VZRA 4DY5A 2D6NA 1RMU3 4XIOA 3IMMA 3H9VA 2ZXWC 3ACFA 3ZSLA 4H37A 1UYPA 1NLRA 5FJKA 3RVHA 4AHZA 2QGNA 4JTOA 2QWQB 3TNQA 3EXAA 3B3QE 5BY1A 4CCOA 2HFEC 3WF3A 3I55V 1M1KW 1DTOA 3HMYA 2WLHA 3QO5A 2P4KA 2ZDIC 1XNBA 2HEYF 5KHIA 2DWRA 2GC0A 1ND3B 1WCSA 3KQ4B 1KMIZ 1PVXA 4XDKA 2V4AA 2SLIA 2BGPA 4XFFA 3UK9A 3UQ8A 4PIXA 4XDJA 5CKQA 1XE0A 1ZZBA 1YQCA 4MTFA 5DDJ1 1K3EA 2WO1A 4YY3B 2H8PC 3J4UH 3ZFGC 3ZLIA 1W05A 3B40A 5KHHA 3F7YC 4NTXA 2ZR2A 2J1SA 4GH4B 3MLKA 1GAXA 4YZ4A 1GFF2 2ZCEA 4YM1A 2IXJA 2E32A 2GTSA 3DPRB 1RJ8A 5LRSA 1R3KC 1OT5A 1RUJ1 4RUFA 2GMMA 5CA1A 1HV0A 3GCWA 1IKQA 4YPJA 2W52A 3OGJA 3T0BA 4MGIE 4AILC 3T1MA 5C9AC 3SPCA 3N2GA 5LMNO 3NL1A 4XCBA 4FOWA 4AEDA 3AKQA 5JMCA 3FHQA 3AYAA 1PIV2 4OQ8A 1YNAA 3T2QA 1VBE2 1C3HA 2VXRA 4WCEV 1E1RG 1BMV2 3QNEA 2W68A 2P5BA 1UKRA 2IWGB 2QFEA 1EUUA 3LDKA 3H8XA 3J8F3 3WR0A 2RE9A 3NR7A 4KHPB 2Y69C 4ZOLA 2XJTA 2WSUA 4IXLA 3TWIA 3FX7A 4YZ5A 1M93A 5FOBB 2XBO1 4A6OA 1SFNA 3LA7A 2WLLB 4LOSA 4ZY9A 5ISLA 2XQXA 1QOTA 2NQYA 1CAWB 4O4JB 2IH1C 4J10A 2W47A 4LBQD 3HN1A 5H6QA 2QJ1A 2UXBB 4DR4O 1JHJA 1I94B 4DR7O 3QO8A 2OQ6A 4U36A 1XNKA 1RUC1 3VD3A 4NIGA 1AI6A 3G6EV 4BB3A 3SDLA 5C8CA 2WYSA 3L73H 3OMIB 4GWMA 3TB0A 1VBD3 1G1XB 3PUQA 3AVSA 3ZYGA 3PIGA 4M01A 1IBKB 4D8MA 4MVQA 5JR2A 1JYWA 4R4ZA 1SA0A 3AYDA 4M0NA 1J95A 2LW7A 4YJ2B 3B7MA 3ZX7A 2AREA 2XAHA 3WQ7A 1PP9H 5GZCA 2ZXWB 2P6JA 1U12A 4U7OA 1SS3A 2ZGPA 4IHJB 3HT1A 2V5YA 5C4WA 4D94A 4Y3OA 1NY71 2GV9A 1W28A 1KC8W 4A6SA 3ZXLA 4UT5A 2BTQB 1AXKA 3HQRA 4ZPIA 3NNJA 4D7YA 2BTOA 1X33A 1Q6UA 2ERFA 2WA3A 5FNVA 3T1YO 1W6QB 1OLQA 2X5IA 5EWSA 4HBNA 2DOSA 4MX3A 4KNCA 5APAA 3CRRA 4RQEA 3CPWU 1IBLO 2UUAO 4R9DA 1WMFA 2EULA 5IVVA 3K48A 4K20A 4Y1YA 2D6LX 2QSAA 1UZVA 1HR0B 1PO11 2V4DA 5KHJA 2ZGMA 3ZFGB 2OZ6A 4TQDA 5A6ZA 1XNRB 2GN3A 2PYTA 3VHPA 1RXGA 3AEIA 5F32A 3C7HA 1AR81 1RUJ3 3JYCA 2MEV2 1ZRIA 2AEZA 1PM4A 1V9U2 1AR91 2IVIB 3LZZA 5CAZA 2ADEA 1GP5A 4DRVA 1RVF1 5H6RA 1MQTA 4RR3A 1CAUA 2NN4A 4AWDA 2CTWA 3AG3C 2IBZH 5C9AB 2CTRA 1SQ4A 4AEKA 2YC0A 5K0UC 3QCWA 4KBBA 3LGRA 3VL8A 3FHAA 4YZ1A 3DCQA 2YXSA 3WUDA 1ASJ2 2ZHMA 3G71V 1VRH1 3FUQA 1VQLV 3IGAC 4P08A 3FE5A 3SMHA 2XH6A 2Y69B 2QQKA 3HPNA 2H6BA 5FBJA 4M3CB 4QIWF 1D0GA 2WJSA 4XMIA 5IVFA 2E76B 3LEIA 4LHLA 4Q4V3 1XMQB 3THOA 4WFFA 3L74H 4BK4A 2VOKA 2JB4A 4XFGA 5IYZB 2VWKA 3PIJA 4PA3A 4FVMA 3IPVB 4IIJA 2A6XA 4UW5A 3L75H 5BNNC 5K7PA 2QR4A 1QOSA 4Y22A 5FZ1A 4O7XA 1SQPH 4NIHA 5T3NA 2DVFA 2D3SA 5JQGB 4NUBA 4Q4Y1 2V7QG 3VDBA 3JU9A 2WDBA 4XZUG 2VOXA 4K3AA 4HVQA 2OTJV 4P9GA 3ZXEA 3CC7V 4Y5Z0 3LWCA 3MIFA 2Q1MA 4WM7A 4XF9A 2Q8EA 1R6KA 4NPLA 1N33O 4NWVA 1WLWA 2AUYA 5F3EA 4BPZA 1BK0A 4DV7B 5CFDB 1DF5A 5GZDA 3HIFA 4URTA 3B9CA 2X09A 4UOJA 1U97A 2KM2A 5FMCA 3RJRA 3ZXJA 2Y6GA 1ZRCA 3OR7C 4FO9A 1W8OA 1C8M2 5H9CA 4XXAA 3RZZA 1Y4MA 2E7AA 2ZACA 3MIEA 4BE3A 1H8TA 3UNPA 4CEWC 2YXLA 2CDYA 1AHSA 3W7SA 2ZAHA 3TXSA 4G2KA 3H8UA 3LPGA 3O1OA 1BMV1 4DV2O 4PA9A 4S2GA 4A2UA 2WZ8A 1HB4A 1VEWA 3K04A 2JK5C 3WQ0A 2Z5WA 4W4LA 2VJXA 4FOVA 5GZEA 4M0HA 1PO13 3SLIA 2IXCA 4UW6A 2D6MA 3WSOA 2QQNA 2B8MA 5DG2A 2BGOA 3DN7A 4RQPA 2DTWA 1U5XA 1CAXA 1G8MA 3ZYBA 5SV8A 1J83A 2QM7A 1AR93 3ZXFA 4XBNA 4QXBA 5FP4A 4AVVA 4HXCA 4X89A 1DGWX 2R073 3BN6A 3IDBB 1RVF3 4TYSA 5FMOL 1I1EA 2QTOA 5JXGA 4NAOA 5C93A 4UFZA 4EN6B 3KG2A 1XPWA 2YY1A 5LA2A 2JEUA 1RUG2 5T5JA 4GCZA 1GU3A 5GLZA 4QQLA 4MYEA 2VM9A 4OMCA 1REFA 1N36O 3AG3B 4I50B 5FQ0A 1NT2B 3VDDA 2IFWA 2YBKA 2BNNA 5K0UB 2P37A 1OF4A 1W8NA 1UY3A 1CZSA 4ZXEA 1JUIA 3ZOIA 1BHAA 2RHPA 1W8FA 1WCUA 4ZS2A 3Q8CA 4LR3A 3KGLA 3BIEA 2PAKA 4PDWC 2IM9A 4QPWA 3T09A 3HR9A 3WP5A 3FKSG 1BQ0A 2FDIA 3ES1A 4LFAO 3J9SA 4G9SB 1FOD2 3GZAA 1OHFA 5A7QA 1ZYBA 2GUZA 3A0NA 4GWJA 2RJLA 2ILMA 5FY0A 1UKGA 1RJ7A 3J81N 1ZX5A 4XQDA 4TUYA 3T1HO 5BZBA 3NJZA 5AG2A 1S4CA 1D4M1 3KGZA 4O65A 3QACA 1POV0 4IETA 5BNNB 4RHV2 2FDFA 1SZTA 1POV1 2PF4E 1HLCA 4XMAA 2ZS6B 1LUVA 1IPSA 4WFAV 1V55C 1BYHA 3T4ZA 1U5ZA 2PA7A 5A3UA 5FYVA 3ICXA 2CYFA 3WP3A 2DU0A 4ET7A 4CU7A 3RYCA 3A2FA 2YIAA 4X65B 2F6BA 4ASKA 1EP0A 3UKNA 1UMZA 1AR61 1CVNA 4MT8A 2H3OA 4QJFB 4INDA 2LW1A 3RS6A 2E7TA 2WLKA 2YUAA 2V1DA 2ZHKA 3P1IA 2VAUA 5EJZB 4JGYA 4MADA 1F23A 3ZXAC 1YCIA 1Q8QA 1PIV3 4N43C 4QKFA 4COUA 1CGPA 3KM5A 3LSSA 4TQFA 1VBE3 3ZPOA 1RFYA 4WM8A 1RYYA 4CEWB 2EZOA 2Z79A 4L9BA 5JR7B 1PNMA 5F6LB 4X62B 3SR2C 5ACA2 2VQFB 4JZ2A 4X8PA 3BOPA 1OUSA 3ETGA 1UFIA 2IJHA 3AMHA 3CX5F 5F9TA 4K6BA 2B9UA 4IE6A 1TME2 3K9SA 1SPPB 1CPYA 1JFFB 1N1TA 2BFUS 2Y6HA 1OPMA 2JVDA 2JGDB 1D2QA 5FYIA 3N36A 3E8GA 5HXMA 3VZOA 5T5PA 1QU7A 1ULEA 1QNWA 1W6PB 2C4XA 5IAXA 4TTGA 2F17A 2KKWA 3CSXA 1V6LA 2AACA 1OLRA 1SEFA 5BNOC 2XLGA 1FXVA 4GZ9A 2R30A 3DC5A 2VTXA 3PL0A 5HBAA 5FFOC 5C3RA 3AL5A 2N74A 3PVNA 5IHRA 1QWRA 1K34A 1GN3A 1TUBB 4X1IB 4AE2A 5J2TA 5LY1A 1KJLA 2P7TC 1FT9A 3WDTA 4FFBA 4CPBA 3JD71 4OMDA 2ZGOA 3APQA 4ISQA 2HHHO 1BBT1 2DJVA 2RR11 1ENQA 1QY4A 3RJ2X 4CDQA 3I2JA 4ZHQB 1N47A 2ZKLA 4UFLA 3E22B 4PDWB 4Q4W1 5IWAB 1NH2D 1XSQA 1RUD1 4E8CA 3IKWA 2QNKA 2R70A 1VLNA 2VC9A 2YPJA 1WCQA 1ULCA 2VZTA 1JOPA 5DN2A 4QKBA 5JOZA 4DR1O 4IL6Z 5CA3A 1NS1A 3GALA 3N9NA 5C6CA 1O3RA 1C8M1 4GALA 4LFBB 4PCRA 5CEHA 2JG9C 3VBOC 3EMRA 4HYOA 2ODMA 2OPWA 1IBMO 4DV1O 2DUQA 5CU1A 4FPYA 4NHXA 5EZWA 2UYAA 5A7NA 3HPLC 5DMYA 1J1TA 4PLOA 1XXNA 3IWZA 2BU9A 5KWRA 2A5ZA 2W1QA 4YW7A 2UU9O 3JXSA 2RMKB 1ND2A 3WINE 1VB4A 4K9SA 4J7JA 3A22A 4P9PA 4UAPA 1VF5B 1V55B 3ELNA 3O14A 5B1OA 2O8OA 3POFA 2ZINA 2UUCO 4Y24A 3I54A 4IE7A 2ZKNA 2EICA 1V9U3 4ABMA 3PTRB 3LSEA 4JDOA 2Q69A 1KXGA 4JYCA 1JN2P 3RWRD 2ITDC 1AR72 3DYMA 2Y60A 5GZFA 4LF8O 5JWPA 4DR6B 2PAEA 4ES8A 2A3YA 1AZDA 1G86A 1ZRRA 4I30A 3H0OA 1Y3TA 1LRHA 4E27A 5L7OA 1WUVA 4XFCA 3C3TA 4LBOA 2VUJA 4N43B 1ENRA 4UVCA 2ARHA 1ASJ3 4CZSA 3BOWA 1DQ4A 5LA0A 3SYAA 1R092 1VP6A 3E97A 4BQ3A 4XAAA 4B29A 3A0HZ 2JDHA 5E1AC 2YS8A 1SETA 3JASB 3HEIA 3ZVXA 4DR3O 4TSVA 3LEKA 3WQ1A 1AILA 2HH9A 4FPGA 2EVXA 2PI5A 3JSLA 4OVEA 2GNBA 3VD4A 2MPFA 5HXVA 2JG8A 1BVVA 4LNUB 3WNKA 4GMP0 4BK5A 1JZ8A 1ZWIC 4U3JB 4K8XA 3CEWA 4QU1A 1FMD2 2CDPA 2NNUA 1YHQV 3N35A 1HRV1 1CX1A 4RAIA 3JD1A 2ZGUA 4QX3A 3VZLA 4F7ZA 5BNOB 5FY1A 1UX6A 4LK6A 3ZKYA 3AMQA 1UW8A 1YEWA 2VTXJ 1FFXB 4JAVA 1YFWA 4RHV1 4BW9A 2R041 2DCYA 3JD4A 1N3QA 3X2QC 3NMBA 3NV1A 3JD73 1PO21 3M3IA 4LFCO 1BBT3 3NRUA 5F37A 1H2GA 1SZBA 3DXRA 1K4DC 1O4ZA 1P49A 3H3LA 5A1FA 4Q4W3 4TLFA 2CH7A 4NIAA 3ILNA 4AAPA 1CAVA 3HNBM 3LUTB 4RWUA 3GVMA 4OHWA 4GD4A 5FYUA 4NRQA 4K21A 3LFIA 3WB0A 3OBAA 4ZKIA 3LPFA 3QH7A 4JI4B 1MZ5A 1C8M3 4AEDC 3WXPA 3CLPA 1T5EA 2VQEO 4GJYA 4S2FA 1YO8A 3WEZA 1XB9A 1DYOA 5FZDA 2VW2A 3ZCCA 3FLRA 2XJPA 2QQIA 4JI7B 1CONA 1W8TA 4JAAA 2HWF2 3K57A 4K40A 2V4VA 2C24A 2JG9B 3VBOB 1US2A 3VKLA 1ULDA 4Q1RA 4XBQA 5J96B 5BY5A 2O0OA 3K79A 5B1NA 3WFVA 1YQ2A 2CUGA 3VBFA 4X64O 4A45A 3FAVA 4CUGA 5IW0A 1TME1 5LOVB 1WZXA 5K1XA 1HNWO 1GICA 5KXBA 5A3TA 4Z2AA 3VBHA 4AFBA 4R8HA 3DSQA 1NXMA 1LESA 5FKBA 3ZSKA 3BGAA 4AQYO 1FAFA 4P9OA 3PJQA 3B4SA 1H1MA 4XILA 5C8CC 1F8VA 1NQDA 4MGQA 1KRIA 4CVUA 1NH2B 4LO8A 1SQGA 4DUYB 1COV2 4YG6A 5D2AA 1VQPV 3WNMA 3JZVA 4IV1C 3SPJA 4RL7A 3MF6A 4BIZA 1OH3A 3CIHA 3T2OA 5IE9A 3UYJA 4XXPA 5FIXA 2D40A 1YFYA 5C7GA 3W7WA 1B04A 4CS4A 3ML0A 4O4IB 1WLCA 2ZX4A 3V0AA 3O1MA 4YVSA 2WLMA 4KU8A 4FP3A 4DV6B 3QLQA 3EVKA 4HONA 4FPKA 1VQKV 4J25A 3CBNA 3TETA 1PMJX 5LHHA 4FFGA 5CA6A 1RUI1 3PMEA 4CP0A 4Q0PA 3M3QA 1ZA7A 4OQ9A 1UY4A 1PNLA 3ZR5A 1W3VA 4JV5O 1XYOA 5C4WC 1FOD3 1CJDA 3B2EE 4ONUA 1EBOA 5J09A 3RI8A 2EBOA 4ASUG 2X8KA 2NZ9A 4OCTA 4BHPA 2JE8A 4MZUA 5GLUA 2HWC2 4UBHA 2YEVA 3NJVA 5F39A 3IB3A 4UBGA 4XIKA 1NLQA 2WL1A 2ZMLA 3UKMA 4FBFA 4B3MO 1MZ6A 4JV4A 2XQRA 2RM21 1C8NA 2WNUA 3LNMB 3JALA 4FK5C 3GM8A 2OCCC 4D0QA 3KV5A 4RHV3 3TYJA 3AK2A 3U4XA 5EV7A 2R043 1YQ8A 3R0RA 2VR4A 2ES3A 5H2FZ 1UF2C 1LNQA 4DZGA 4NPMA 2B45X 1XNQB 1OCOC 2DURA 4AGRA 4DYLA 2KR2A 3D0JA 2X0LA 2ZQMA 5C8WA 3KZ4C 4FLYA 3X2QB 4JAUA 1AI4A 1A6CA 2GU9A 3I49A 1M57C 4DR5B 5JXIA 1TZOA 5M0TA 3S3XA 2CGPA 1PM7A 4LIVA 4BXFA 5CA1B 3UESA 1JBCA 2PHXA 4UYBA 2WT2A 1MQTC 3I3QA 1NZCA 4RR3C 1PX4A 4C1WA 1AR71 4QPKA 4J42A 1HQLA 1H9PA 3UCSC 3N2GB 4XJ9A 3S57A 2Q7EA 4AEDB 5T50A 3U4SA 3USSA 4QX7A 2BWCA 2RDCA 3K4DA 1FPN1 4CC6A 1R3LC 1YFXA 3STZC 2ZOEB 4YIPA 2RS12 4JHZA 1NAEA 3O5SA 2OT5A 1S76D 4E4ZA 1ONAA 2ADQB 4DOUA 1DGRA 4ZOLB 1TME3 3RN4A 5L3FA 1DCSA 1VQ9V 5AFBA 2Q73A 3ETEA 5CBLA 5IT9N 1VBB1 2YIBD 2YFZA 3EXUA 3LAGA 3H1LH 5BNQA 1KDMA 4Y4RA 1W0OA 2ZABA 1AR1B 3EHBB 5J1XA 3ZR6A 3OGRA 1Q8SA 1N0JA 1DIWA 3C90A 4TSFG 4CBCA 4GKKO 2P67A 1LNSA 1GZ9A 3AJYA 4HNAA 5C8CB 3E8FA 3G80A 4DXRA 3ZRVA 5JJEB 3S7EA 5FYBA 2J1UA 3SJBC 2Q9LA 2NMOA 4SLIA 3SISA 3IAPA 1DFQA 2D3PA 1LR5A 1ACCA 1R1A1 2EIGA 1K33A 4IV1B 2YZ4A 3IAYA 1N4CA 1SA0B 1UPSA 4PQQA 1WD3A 4WM7C 1E5IA 4IEQA 2NLRA 4CSWA 3NW4A 1MZFA 5LEKA 4YG0A 5IY5C 4GZRB 5EPAA 4JI1O 4XAEA 2YHJA 1EN4A 4BQWA 5LCWL 5L19A 4A42A 3SYCA 4JYAB 3PUIA 1UN1A 4UFIA 2ITCC 5GKAC 3AZZA 5C4WB 1UXZA 1SKVA 5FYMA 2Q5ZA 3KCXA 1XSRA 3IM0A 1H8TC 4Q5OA 3E8HA 1S55A 2HWE1 3CDZB 1LHVA 3RYFA 4DS0A 1JMKC 2PMWB 5FPRA 1WP7A 4E4HA 5FK7A 2HWF1 3GWOA 1JJOA 4ZS3A 3N7JA 1XEQA 2OCCB 5FMOS 4YIOA 1H2NA 3WNXA 1BCCH 3POSA 1GZWA 3TOJA 4LF4B 2YC4A 4EKWA 5FXXA 2IJIA 1VQOV 1JXNA 4RQPC 1RUF1 5FUPA 2O57A 1W6NB 4OX9B 3ECQA 2J1AA 2CHHA 1KUQA 5IYYA 4R50A 3UKVA 4QNHB 4Q0UA 1WLDA 4YWAA 1M57B 3VN4A 5CISA 4DXSA 3BABA 4QX8A 2XVKA 3H1WA 1AR73 4JYBA 5IYBO 2OQ7A 5KAFZ 1ULFA 5JIUA 1J3PA 1MQTB 2UXXA 3WCRA 2OPKA 1FPN3 2ZBJA 2E51A 2P6HA 3VDDC 5LGTA 4QAWA 3ZMOA 1QNMA 2VVDA 1COV1 3DC6A 1L3JA 3BHPA 1THZA 1NVPB 2YFUA 3FYIB 1OA4A 2A7AA 1HW7A 2RQ6A 2DYCA 4G28B 4P02B 4UCUA 1EN5A 1J3RA 2RS32 3AFGA 4JC1A 2HWD1 4JF3A 2QQPA 5FUNA 5DUUA 1ZZCA 4YHHB 1NCRA 3KF5A 4JASA 4B3TO 1FNZA 4HN1A 3ZHSA 5EC1C 4XE9A 3B8NA 1LAJA 1FMD3 2GNDA 1TVKA 3HB3B 2OCHA 4OZXA 3VD5A 4IIJB 4MXWA 5FZ8A 5CBGA 1PNFA 4FFKA 3ABMC 1EV12 4Y22B 3U07A 1VBC1 4TOIA 4FPCA 1LGBA 3GYDA 4QPYA 5IAVA 1JYTA 3AMMA 1MZEA 4IE4A 3AP7A 4I4TA 1UZWA 1KP3A 5IFPA 2P5OA 2WLJA 3K58A 3I3DA 4ZIBA 4LF9B 3KV6A 4XVHA 3EBRA 1ENVA 2D5HA 4JQTA 1OC1A 1HNXO 4WM7B 1NCQA 4C8DA 4XFIA 1GKFA 1BVP1 3NV3A 1RPOA 5IY5B 1OKQA 5JI7A 2D3RA 4DIQA 4I0WB 2I45A 3ABZA 4OHXA 5I0RA 2A73B 5IVCA 1ZZ8A 3OF1A 4JGYC 2DQ3A 3HT2A 4MW3A 4NWWA 1ENSA 2JECA 2G4IA 1AJQA 3FFQA 3INAA 1VBA2 4CPBD 2Q68A 4WM8C 4LF7B 3TEWA 1H8TB 4PD4F 2DFCA 4G4FA 3VDAA 2HWF3 3RG0A 4JI6B 3P3NA 4DMIA 4AQ6A 5J7MA 1CPNA 1RTVA 5JI9A 2UXCB 1QR8A 4DXWA 5KHGA 2WLIA 1VALA 1Q56A 4QDQA 3H3ZA 2DCTA 1EM1A 1RUF3 1LOCA 2QQMA 4X8NA 5H9RA 4RQPB 4YY3O 1CAXB 4N23A 3SJAC 3T4DA 4EE2A 4Q4X2 1LECA 4YGCA 1YXBA 5AC92 4OHVA 1XC6A 4JYYA 3NVCA 4X20A 1RL3A 1H9WA 2G1MA 4YW5A 3U1XA 4QGNA 2ZHLA 1R082 1UL9A 3W5NA 1M4WA 2IXKA 1D0HA 3NNFA 3WLUA 4GX5A 3WP4A 3P3PA 5B1BC 1COV3 5CN0A 1VAMA 2IU0A 3K59A 4NRPA 1ZBA2 3VDDB 4W65A 2X05A 4QE7A 2D3OW 4LC1A 4AW7A 4F6RA 5L9RA 3L72H 4P9LA 4RYDA 1S1AA 4LPLA 2Z2SB 4ZZ8A 4BQYA 3OGIB 3AXEA 4NR1A 1OCCC 5KA5A 3ENRA 4CDQC 4PA7A 2P3YA 4OPHA 2P22C 2HWD3 1H30A 5HFLA 1KKDA 2CDOA 2DWEC 2WR9A 5AFEA 1FAYA 2ZZQA 4KHPO 4NN0A 4PBPA 2KB1A 1Y76A 3OUSA 1ZNPA 3MW3A 4PDVA 3I3EA 2HWC3 1ST8A 1C57A 4XQWA 2GUZB 5GZGA 2ZEWA 2UWBA 1GN6A 4LKDA 3KD4A 1O8PA 1W0JG 5AVPA 3P32A 4V2WA 4TUYB 1VBC3 3V56A 4E9KA 1S2EA 1NTZH 4BH9A 1HV1A 2WZPP 2UXBO 3LOIA 3BA9A 1I94O 5BUVA 3ABMB 4IEZA 2K2SA 2HEVF 1VIBA 4AGVA 1P8JA 1REEA 4HPKA 2XJRA 4H0LB 4FZ0A 5B1AC 2GP3A 1ND2C 1Z7S2 2OTLV 1AL22 1GTOA 2QQJA 3N9PA 3Q8FA 5FP8A 5LEJA 4K8ZA 3CJHA 2GC2A 1IBKO 3H3UA 5CBFA 1JYCA 3PN1A 1YI9A 3B00A 4IYIA 1H2LA 5DG1A 1Z5WA 4NIDA 5HCAA 2VH9A 2Y34A 1PM9A 1XL4A 1VJ2A 1N32B 4PLNA 4X1KA 3SJQC 4BQ4A 3B8MA 4JGYB 5L7OC 1G9DA 3I2GA 1W9WA 2CTPA 1LEMA 3B93A 4KMQA 3O1RA 3RGBA 5DAWA 1FYUA 3WDXA 4J80A 2W08A 5FLIA 4ES9A 3T4VA 4XTMA 4WM8B 4B3RB 2CU5A 2V09A 3WT3A 1K7DA 5EYYA 3POGA 2JIJA 5BNPC 2RN9A 1G6UA 3C2UA 3MIDA 3SEPA 2EIEA 1J5EB 2C9AA 3M3EA 3CCMV 4DFSA 1EFRG 4JVAA 1YWKA 3VB9A 4FPOB 4AHWA 4P5HA 2RS31 2LQTA 3MDSA 4OPAA 2F4VB 3N27A 2P4VA 1X59A 1TAEA 1WA8A 2YGMA 1RGSA 4CCMA 1SCRA 1FS0G 4Z2WA 1HR0O 5FO8B 3NAPA 4JKMA 1M06G 2C5DA 4DXZA 1XNRO 2WZR1 3ZSEA 3E6DA 1YI2V 1K73W 1RMU2 4M3CE 4DPNA 2F93B 3O9OA 4B4QA 1JS9A 3ASOC 5JSOA 1BEV1 3L9DA 4MG2A 2C1FA 4KWJA 4CU9A 3D36A 1SLTA 5L9VA 4H7LA 1Y74A 5LL6Y 5B1BB 3CXHF 1M56C 3AZWA 5I91A 4UV8A 2XHBA 4MW8A 1FXKA 4I0BA 5CADA 3CRAA 3ZDVA 1V6JA 1Q86W 3WNOA 4CXWA 1YQ6A 1WBLA 4HSLA 1YVWA 4G3YC 4FFBB 4LEJA 3WG4A 4J7KA 2OXBA 4ORFA 1ULGA 2JE7A 1OCCB 4RGAA 5HCFA 3UGHA 5A32A 4CDQB 2IC1A 4V1PA 1VRBA 2DCKA 1SBDA 2ORXA 2PY5A 3SPIA 5GJ6A 3Q8BA 2HEWF 4RO2A 3WW1A 4RGGA 1Q8OA 4BXSV 3DECA 1VQNV 4X6QB 4W50A 1Q3EA 2P90A 3T4HB 1C1FA 1IS6A 1OLMA 4YRDA 1XMQO 2H0VA 2QDOA 1RSOB 1JU3A 2VCCA 2R32A 4UVAA 2IXHA 2VQ0A 1IGOA 3WG3A 1XQ8A 4QB1A 3RT3C 4C0HA 5JXJA 4QGPA 4ZKTB 2PYJA 3VBFC 1WPBA 4DV0B 2WLPA 3MBWA 2WO2A 5B1AB 1NA1A 1ND2B 2W94A 1MOFA 2I07B 4OLLA 2PLV2 1E5HA 1U0AA 3L71H 4E2QA 5FXVA 4XDLA 3VBHC 4LORA 4LE4A 4MVMA 2QDRA 4YVWC 5CB7A 4FJCC 2ATKC 2K9ZA 4Q1PA 4NJ4A 1ODMA 5F1RA 2LFSA 1LCLA 5JH7B 3QBQA 2ZZJA 1GH6A 4TT3G 3TJTA 3CJIA 4MHUA 2YGLA 4DK1A 1SC5B 1IG0A 1YC61 4DV7O 2JD4A 2JDNA 2WPDG 1O3SA 4LA2A 5A3WA 3OUIA 5L7OB 2AENA 4UFMA 2EZPA 3SJCC 2G9GA 1HJFA 2BOCC 4YVSC 2Z3YA 3W9AA 1REDA 1KB9F 3PUAA 2RDQA 3LDEA 5BNPB 2XNDG 2Y6JA 3VZJA 5DEDA 2RS33 5DECA 4N8MA 1S5HC 4FP2A 1W03A 5KX5A 2ENRA 5KXEA 1AYM2 4CH3A 1GP6A 4LXLA 2RMU1 3MYXA 3OD0A 3ZIWA 5FO7B 5CIRA 3F5TA 2OUJA 3POYA 2K46A 1V00A 3KT4A 2XJQA 2ZKOA 3BA8A 5J2UA 3TGUH 5I93A 1KITA 1EPZA 3CCUV 4NHYA 3ASIA 1PHMA 2P17A 4M3CF 1SCSA 2A6WA 2WNUC 3HKBA 3HN3A 2PHUA 1E79G 1EV13 1W99A 3ASOB 2Z4FA 2LROA 5E89A 4FSJA 3K03A 3Q9OA 4DV3B 3NV2A 2DBNA 2VL4A 1HXS1 4EN8B 3IAQA 3VOUA 4PDMA 4IL7A 4LH7A 1KBHA 1NG0A 3CNAA 4WVMA 5L3EA 5JSPA 5FYYA 2FTKA 4PLMA 3OBTA 1N1VA 1M56B 1Z7S1 3C7GA 2BBVA 2EILC 4YJ3A 3BPZA 5DAVA 1AJOA 2PQQA 4EJRA 4E4DX 1W06A 3JD2A 3DXRB 3U14A 3AL6A 2HYXA 1GWMA 5FYCA 1HN1A 5AVAA 1HKDA 3V64A 4F3JA 3TEZA 3E2EA 2OIEA 4JZGA 5DDJ2 2FDGA 1A34A 3ZN0A 5CBHA 1FNYA 5DZFA 4QHBA 1CAVB 4AOCA 2Y8KA 2Y48A 1G7YA 5A6QA 3FFZA 1VMFA 1TGOA 3NJXA 4Y5TA 2VZVA 1CZTA 3P5BA 4I02A 3WG2A 3PURA 3AG7A 3DGTA 2G9ZA 4YZ3A 3HWJA 3D3AA 5BV6A 3HKCA 3H42B 2EAKA 3WW4A 3OUJA 3UT0A 2QQLA 3D3QA 3RYRA 4HT1T 5BYNA 3ON7A 1RUJ2 2LGQA 3MFAA 4L97A 4YW1A 4QX2A 2VZ3A 2EIJC 1K92A 3BI3A 3VBSA 4BOWA 3WOGA 2E7QA 4P00B 5FKCA 1W2AX 4IE0A 2GSMB 5J9PC 3H8OA 3AYEA 3VBFB 2OKXA 3FAVB 3E8BA 1I6XA 1UZ0A 3VZMA 1X7NA 3JAKA 3ZYJB 4LQRA 2PUSA 5AC93 3ZMUA 4UUJC 3J26N 3VBHB 4YVWB 3CZJA 4QHZA 1K3IA 4W4ZA 5C8YA 5JCOA 1X8MA 5G05L 3ZSJA 4EB6A 1R083 4IW3A 2XBO2 3NWKA 3I59A 1W6OA 4X65O 1RB8G 1GNYA 3AK1A 3T30A 2BOBC 4PT6A 2VW1A 2Y6KA 1ZBA3 2WQ4A 3OE7G 2XLAA 5B4NA 3R6SA 2CAUA 3APOA 4MGSA 3K4AA 1QJY1 2D6OX 4LUMA 4Y20A 2FCVA 1M5IA 4AVCA 1RUC2 4WVWA 1FV3A 3V0AB 4YVSB 4WBNA 2DUOA 3B5LB 1HDJA 3KSCA 2HBUA 5FL7G 4L99A 3URFA 2RS51 1NI8A 5E16A 4X62O 1SACA 2RMU3 2D98A 1PGSA 2VQFO 5FLHA 4J6GA 1XILA 1VIWB 4CH6A 4YGDA 2A71A 2Q7GA 3CS5A 4MLOA 2QZ3A 4FCAA 4P5YA 1UXXX 1IXMA 1W9TA 2YEVB 3AMPA 2QWNB 3LA2A 1WAZA 1V9PA 4B1LA 1TMF1 4YNIA 3SYQA 1W0KG 1BJQA 3ZYIB 2P4EA 1JMUB 2WT0A 2JJ2G 1UO9A 4R9BA 2WNUB 5H9SA 4KWLA 4ZI7A 5GM0A 4LBEC 4UI9L 4NTWA 5IWFA 3KV4A 3MGUA 2A79B 1L0LH 1SBEA 3OPTA 2P3IA 1VMGA 3GBWA 5J3UA 2Q7HA 3BTAA 1Z7S3 1Q6HA 3KS7A 1AL23 4L92A 2WRAA 4O4HA 2NYYA 4Q0VA 3O0VA 4GH4A 2XMLA 2WWWA 2EILB 2ZIMA 4AL9A 2ZEZA 1YRZA 5DAXA 2PTMA 3EQEA 1Y7BA 1GMMA 3CD6V 3S30A 2WNVA 4NXNB 2Q0OC 2XT9A 4HN0A 4Q8KA 1W04A 2XUMA 1QNYA 4E4SA 2D97A 1Q8IA 4FTSA 2XHNA 1D5NA 4KH9A 1SDWA 1F35A 2F4LA 3TEYA 1LB2A 5IWAO 3VBUA 3N7KA 3A7QA 1AR82 2GMPA 2DYSC 4QPIA 3MHSC 1YQ5A 2QEXV 1AR92 1NX9A 2ZPXA 1SDDB 3OPZA 2VNGA 1DF0A 4TV9A 1V0AA 1RVF2 4XQ4A 4LFBO 1Z2GA 2VULA 2JDKA 1QJX2 3BCWA 4AK3A 2EIJB 2QA4V 2QTWB 5F3CA 3MV01 4LA3A 4S2DA 1LOGA 2IJJA 2JJ1G 4X88A 5GTHZ 2XJVA 2JDZA 1O6UA 1NCRC 4BISA 4R8CA 3BALA 2MNGA 4O2AA 1DGWA 2F23A 1AI5A 1AYN1 1W2TA 4IEPA 4I3GA 1UY2A 3UM7A 2QZ2A 2XGXA 1VRH2 3MHHC 1JOBA 1PMHX 4DO2A 1XU2A 3LIHA 4JGZA 5ABJA 2YPDA 4UWDA 4LJHA 5LK7B 5GLVA 4HZ3A 3ZX6A 1LULA 1QKQA 3N9QA 5J36A 3I2DA 1LGCA 2EIBA 5IK4A 4FLZA 1CQ9A 1QJY3 3BY6A 4CEYB 2ZX0A 2BP6A 1MSDA 2FD8A 5IK8A 4DR6O 1RM1C 4LWSB 5FZKA 3VBRA 3LDCA 4AQSA 1AF9A 2RDRA 1EUTA 2JIZG 4BMEA 3CEIA 1X82A 1NT0A 4NAMA 2Q1FA 2G38A 4Q2FA 1NCQC 3RWNA 5IJ9A 4CS2A 3LNNA 4LH6A 4Q4Y2 2DYRC 3PMSA 3OOXA 5FK8A 1JOJA 1XNCA 4HSJA 5EJ3A 2Q67A 1S0DA 4AAXA 1PV0A 2XR4A 1IOAA 3NXSA 1TMF3 4OI1A 2UXDB 3RMYA 4MVZA 4BJ0A 1Q43A 4ZU4A 3LDDA 4CP2A 5H9PA 2GH2A 3RYFB 1R73A 5FZ4A 5DQ0A 2J1VA 2VD7A 3BPSA 5GTIZ 4A44A 4FPHA 5L3CA 5FPLA 5BPXA 4FLUA 4PA6A 4JI5B 2X6CA 5EIBD 1YSCA 4UFKA 4NXMB 4B7EA 1J58A 2XTAA 1XNAA 3AZYA 1GZWB 1KKCA 2PLV3 5J37A 4JI3B 5L3DA 1OHHG 1AJPA 2GAUA 3VKOA 2GH8A 1UAIA 4CDXA 2QJVA 4YGBA 1QJFA 1MMMA 2B39A 1BL8A 4MVUA 4EFBA 1AX1A 1YTFD 2K0GA 3CB2A 4UB8Z 2C0ZA 2C2AA 2E33A 4CDUA 1I5ZA 5FZGA 3RYPA 2WO7A 1JZ6A 4JKLA 5C9AA 1QLNA 3QF7A 2IXIA 4GWNA 3AKTA 4JI4O 2DYSB 1XBFA 3K5LA 4IEWA 3F5WC 2XL7A 5FRAA 4PELA 3BB6A 1GNHA 4META 1GMGA 2JEMA 1UD1A 4DEQA 5FZ0A 4JI7O 1Y6XA 4IE5A 1Q6IA 1AYM3 5EXOA 4DV4B 4Y1XA 5C3PA 2O1QA 2F66C 1AYN3 5EIBC 1H2SB 3I97A 1DK1A 4LBNA 3AZXA 1SQFA 1Z5VA 1NCRB 1JI6A 5TISZ 5ITZA 1CIYA 5KC6A 3AG2C 1O5UA 2CTQA 3G67A 1VQMV 3MPBA 5HPOA 1DP0A 1K45A 2IH3C 5IYZA 3IPVA 4H55A 1DZTA 1QXPA 1TVKB 1WMEA 2R16A 1F31A 1ZZ9A 3ZN6A 2RJKA 4MXWB 3CJXA 3FLPA 2W39A 3U10A 2KQXA 1APNA 5JQGA 3O0WA 2JRIA 1HJGA 2NPIA 2YROA 3H8RA 4UCVA 1W0NA 1O91A 1GV9A 3ZMTA 2UUCB 5DXDA 4I4TB 1BLZA 3KKYA 3AC0A 2UWCA 1W8UA 4DUYO 1T6BX 1RM1B 5BMVA 4AVTA 4LBKA 4AEMA 4QE9A 1D4M2 3ZYHA 2D44A 3MD0A 1KS4A 4W4KA 5FY7A 4GULA 1H1IA 1OV9A 5DDJ3 1QQP1 4Q20A 1NCQB 5E88A 1QJEA 5CFDA 1O7FA 4DV6O 2DYRB 3K5OA 1C28A 1RUE1 1AP5A 3R4UA 5J98B 1Y9GA 1QGLA 4L2NA 2GNMA 2UY8A 4CCKA 2ZE7A 1RC6A 3B77A 1ZZ6A 2HWB1 3VHOA 3UJQA 2P06A 4NE9A 1DF4A 1AJKA 2ZXQA 2DCJA 1NTMH 1AR62 4FT8A 4LBQA 5D5QA 1JQ0A 1ZUQA 4MHRA 3ZRXA 1CZVA 2W1WA 3WDYA 3MW2A 1XYNA 3ATGA 3E5QA 4WZFA 2JGUA 4YM3A 1QJX1 2WLIB 1JU4A 1R1ZA 2ZMNA 1ORQC 3R66A 4LBLA 3R05A 4S2HA 4FM1A 4I55A 3ZMNA 1XNQO 4GA9A 4ZHNA 3AYCA 3ZDSA 4ZZ5A 3NAPC 4FVVA 3RYHA 1NKGA 3OSDA 1YFUA 4H2AA 5FPOA 4MO3M 4X20B 2VTFA 1TEIA 4P2ZA 4QXHA 2XBO3 4NROA 5GONA 1OVSA 2ARAA 4DR5O 2AGSA 2VBPA 2W92A 2A3QA 3D36C 2W9XA 4NHKA 2WLNA 2BYVE 2AYHA 2HKXA 2CL2A 4M4RA 1YIJV 3FLTA 4I0XA 2W87A 3CMGA 3UO3A 1IVSA 1V54C 2FHRA 1R64A 1RUC3 2VZSA 3POEA 4F6RB 1QCEA 5EZYA 2QBXA 3MF9A 4ZU7A 4LHNA 3JATB 2XPJA 1L1FA 1QVGU 3DGEA 5CNAA 1NUKA 1N1YA 2D93A 1JZ3A 5KC5A 1UMHA 2QWRB 1YJWV 1PGL1 4CP9A 2CGOA 3OB8A 2P3KA 1O3QA 1W0PA 2P2KA 3M99B 3K06A 3JD72 4DV5B 2R061 4M00A 3AG2B 3CKHA 3USUA 1BBT2 2DW4A 2JS3A 2RR12 1NU1H 1OQDA 1YXWA 1F15A 2A6VA 1GNZA 1QOOA 4Q4W2 4GKJB 1IQDC 1OA3A 4D6TH 1B09A 3VQXA 1RUD2 2QUOA 1J84A 1BE3H 5BXXA 2BERA 1YTFB 5KR7A 2D5FA 2D6PA 2VMHA 3ZMVA 4HPKB 3POWA 4J11A 4U7NA 1RPRA 3D4KA 4FFIA 1GM7A 2TBVA 4XUOA 2CV6A 3I3MA 5IVYA 4BQ5A 3CJHB 1MS9A 5LMUB 3ABLC 3E1F1 1DLCA 2VCBA 1XUQA 4K0KB 4WFGA 4FAGA 1F51A 1UX7A 4BA6A 3LF7A 1CX4A 2EXHA 4Z07A
chains in the Genus database with same CATH topology
4AHZA 4JTOA 3TNQA 2OG5A 3B3QE 3CJIC 2FBEA 1OA4A 1QH7A 2A7AA 1A78A 4TZDA 3MIGA 4ZXKA 2HWB3 2ZHNA 3HMYA 2VVEA 4GB31 4J1XA 1AR83 1XNBA 2HEYF 3JB4C 2GC0A 2DWRA 5KHIA 1ND3B 2DYCA 1WCSA 2WBQA 4FPJA 1PGW1 1J3RA 1PVXA 2RS32 3AFGA 4QT6A 3FZ3A 4BLJA 3N7LA 3FX3A 2SLIA 3AJZA 4JC1A 2HWD1 4XFFA 3FJSA 3UK9A 2QQPA 5DUUA 1ZZCA 3ZFFB 3VKNA 2R6QA 5HCBA 1NCRA 4PIXA 5HSXA 3IIAA 1UPIA 1QJX3 3M2MA 1ZZBA 1YHFA 2R49A 2WS91 1ZRDA 1FNZA 4HN1A 4M2GA 1YIFA 5DDJ1 1MVQA 1V6OA 1I9RA 2A6ZA 3DL3A 4QMAA 4XE9A 3QOPA 1C4RA 1FMD3 2GNDA 4P9YA 4XFAA 2VU9A 3J4UH 3ZFGC 2Q30A 4YYOA 1B35C 4OZXA 1MS4A 4IEVA 4MXWA 2BEOA 4YZ2A 2A6YA 1PNFA 2FZ2A 5KHHA 5ACA1 1URXA 1EV12 1VRH3 4GH4B 4Y22B 3U07A 3MLKA 1VBC1 4MV2A 4YZ4A 1GFF2 4FPCA 4LO6B 4YM1A 1LGBA 3GYDA 1J1LA 4QPYA 2IXJA 4ATFA 3W59A 3NAPB 4QXKA 3QH6A 3AMMA 1MZEA 2VY0A 3DPRB 1RJ8A 4XJ8A 5LRSA 3APBA 3AP7A 4N90A 3RRDA 1RUJ1 1CJPA 4YGEA 2GMMA 3SWTA 3MI8A 1HV0A 5FREA 4AVBA 1IKQA 2PHLA 4A3XA 2W52A 3EBRA 3WVJA 3OGJA 2D5HA 1IS5A 4D3WA 4MGIE 4MVTA 2DV9A 1W6MA 2LM3A 4YVWA 3M7AA 3T1MA 5C9AC 4KGQA 3OD4A 4WM7B 1TQ5A 3NL1A 1NCQA 4FOWA 4AEDA 3AKQA 5JMCA 3AYAA 2XL9A 4XFIA 4XJAA 4JRLA 1BVP1 1VR3A 1PIV2 3NV3A 1YNAA 4QU2A 1OKQA 1VBE2 2D3RA 5JI7A 4MSVA 1C3HA 2VXRA 4I0WB 3ALQA 2I45A 1RUG3 4JDNA 1BMV2 2W68A 1KJRA 1QJZA 1UKRA 4OHXA 2DVAA 2E6VA 2IWGB 2QFEA 5I0RA 4XHBA 2A73B 1HRV2 1ZZ8A 3OF1A 1PMIA 4JGYC 3HT2A 1AYN2 1QJU2 3J8F3 4NWWA 3WR0A 1ENSA 4Q4Y3 2JECA 2RE9A 1MACA 2G4IA 5CFCB 3FFQA 2EF6A 3INAA 1VBA2 2XJTA 1RUH2 5FDBA 2WZR3 2WSUA 4IXLA 3TWIA 1OFSA 4N53C 5A32B 4YZ5A 1K5MA 4WM8C 1UZZA 2R042 2JG8B 5FOBB 2XBO1 1H8TB 2DFCA 4G4FA 4IEYA 1Z0HA 1SFNA 1GY9A 3LA7A 2HWF3 4LE3A 2ZX2A 3RG0A 3FBMA 4OUSA 3P3NA 1BEV3 4DMIA 1PO22 2R063 3ZN5A 1QOTA 3ZXGA 4AQ6A 5J7MA 2NQYA 1CPNA 4BQ1A 1RTVA 1CAWB 3SHRA 5JI9A 4Y0EA 1VAVA 5KHGA 1VALA 1Q56A 4LBQD 3H3ZA 3HN1A 3L2HA 2DCTA 4FPEA 1LHNA 3FHIB 2GALA 1RUF3 1G9FA 2VUAA 1LOCA 4U36A 2UWAA 1DBNA 1XNKA 4K3UA 2GN7A 1PZ7A 1RUC1 2ZTNA 3WG1A 4X8NA 5H9RA 4YFWA 4L8QA 2JICA 2EAAA 3N7MA 4RQPB 5C8CA 1RHI2 1CAXB 3VBSC 4GWMA 3TB0A 1VBD3 2WKKA 4Q4X2 1LECA 4YARA 5I8YA 4YGCA 2PN5A 5AC92 5T5OA 2Q4SA 4OHVA 3ZYGA 2V73A 3NVCA 1RL3A 4J5IA 1H9WA 3M1HA 5CVRA 3HBZA 1WMDA 4H7MA 4YW5A 2XB6C 4M01A 4QGNA 1Y43B 2ZHLA 4FXKB 1R082 1BK1A 4R4ZA 1PVC2 1UL9A 4EV0A 1M4WA 2IXKA 1FATA 1D0HA 3AYDA 3WLUA 4M0NA 5F6KA 3WP4A 1DQ1A 3B7MA 3ZX7A 3P3PA