2CGOA

Factor inhibiting hif-1 alpha with fumarate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
342
structure length
339
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
publication title Structural and Mechanistic Studies on the Inhibition of the Hypoxia-Inducible Transcription Factor Hydroxylases by Tricarboxylic Acid Cycle Intermediates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 106
structure length 339
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2cgoA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgoA01
2YC0A 2CGNA 2W0XA 3KCXA 1MZEA 2XUMA 4BIOA 4Z2WA 1YCIA 2YDEA 2Y0IA 3KCYA 1H2NA 4Z1VA 2WA3A 5JWPA 3P3NA 1H2MA 4JAAA 4AI8A 4B7KA 1IZ3A 4NR1A 3D8CA 1MZFA 4QU2A 2CGOA 3OD4A 4B7EA 1H2LA 1H2KA 3P3PA 2ILMA 2WA4A
chains in the Genus database with same CATH superfamily
1QIQA 1HV0A 5HXVA 4GWNA 4ISQA 5B1AC 5FPBA 4LULA 3THPA 5FNVA 1FNZA 1V9PA 4GX5A 3JD0A 5AC92 2XBO3 4AI3A 3OW2U 3AG7A 5CU1A 1T6BX 2VNGA 3SGIA 2XBO1 1UX7A 4CXWA 2R9AA 1POQA 1CX1A 1JYTA 1JFFB 4C90A 5FBJA 1NZIA 3W7UA 1QH7A 2ADDA 4TT3G 2F43G 2RR13 1XEQA 4MTGA 2WLLA 2NQYA 1Y74A 1V0AA 3OD4A 4MLOA 1ZBE2 4XTPA 4DEVA 3FHAA 1V6JA 3WY6A 1REDA 5LMUO 1GMMA 1L7RA 3DECA 1SZBA 1YI9A 1ZRFA 3JAKB 5HV4A 1C28A 1ST8A 1WLTA 1VPHA 4FOVA 2YHJA 5KR7A 3OMNB 3LSSA 3LNMB 4FCAA 3CZJA 5D5PA 2NR5A 4JV4A 1X59A 2Q1ZB 4R7CA 1DQ6A 4XFGA 4K3AA 2CAVA 1WA8B 3H3UA 1IBMO 3FLRA 5B4NA 5C9AA 1MABG 1K3EA 3T0DA 2HR3A 3BEHA 2EXIA 2N05A 2QQIA 5LY2A 2ZGPA 5IDJA 3M3CA 1M1KW 4XAEA 4Q1RA 5FNVB 1O4YA 5D5QA 3E6BA 3ABLC 4N7UA 2HWB3 2XLFA 5LMNB 1KUQA 4X20B 3UO3A 2WFF1 4OQ8A 3K57A 5HCAA 5IAXA 1KDMA 1ZLZA 1DZQA 4AHYA 2UXCB 5BYNA 5I8SA 1ND3C 1SCSA 4L97A 3GZAA 4P00B 4GX1A 1V6LA 2GMMA 4JX0A 1W2UA 4M3CE 1NUKA 1OD3A 2Y64A 1Y74B 2YIDA 1NE6A 3CCQV 4AQYB 5HFMA 4GKKO 2DDUA 3AJYA 1CVNA 2FMYA 2PQSA 2ZX4A 1ND2C 1LGCA 2RDCA 5FRAA 4AR2A 4FPKA 3SYAA 4DV4O 4CCJA 1CAWA 4ZU4A 2UXDB 5J2UA 3RVYA 4ZXKA 2GC0A 4BIOA 4FFGA 2F93B 3UO2A 1GKFA 5H9SA 3JAWB 4LXLA 2JB8A 3NAPB 1N3QA 1YIFA 1PL4A 1OFNA 4FIPC 2WLPA 2JE8A 3T1CA 2W1SA 3VBUC 2ZCWA 2W91A 3ZHRA 2QJVA 4URTA 1UU6A 1UFIA 4MXWA 4Y22A 3S7IA 4JZGA 3THCA 2G19A 1UY1A 5FYYA 1K9MW 2YV8A 1FV3A 5CVRA 2FMLA 1X36A 4A6SA 5B1AB 2HHHB 3VZJA 2YXYA 5J3UA 4Q26A 1V54B 2ZKOA 3ZXEA 5BMVB 3MW2A 2QJ1A 2W2IA 3E89A 4KUMA 1OQ1A 2BYVE 1XDCA 2H6CA 2JRIA 1QJU2 3RBZA 1J5EO 4FTBA 4WVMA 3LEKA 4CSWA 1TVGA 1OFSA 4LFAB 2D5FA 4CUBA 4M3CF 3T1MA 1SACA 5F5AA 3E5XA 2V7QG 3WW1A 1CAWB 5JCOA 5FJHA 4YVWC 3T2MA 1G8WA 3AMMA 3EXUA 3FAVA 4O65A 3OGSA 4B4RA 2VNRA 4DUYO 1X4TA 3AYDA 2KD7A 2VL4A 3SJQC 4Q4V3 3VZNA 5L36A 3U07A 4CCCA 2VOKA 4TZDA 1BYHA 1RUH2 3UGHA 2RDQA 4CDQA 4RO2A 3ZPOA 3I3MA 3J7NA 1YFWA 1L8DA 3PIGA 3VZLA 3BA9A 3R4DB 1UXZA 1DBNA 3OGIB 3AMHA 5JUVA 4GX2A 2O0OA 5FDBA 3ETPA 3GHNA 3ABLB 1R081 1CAXB 3SPJA 3V0BA 3HMYA 5BUVA 2VGDA 5KHIA 1EBOA 2WWSA 3HT2A 4KU7A 3F5TA 1ND3B 4AF9A 3B7MA 2J22A 4DV1B 3S5AA 3HKDA 2UXBO 2EALA 3K5NA 3KCYA 4HMZA 1EPZA 5KXEA 4GA9A 4YJ3B 4LF4B 2R062 4J11A 3FAVB 1ND2B 2WNUA 3VKLA 1OCZC 2FCVA 4LCUC 4O4LA 1VRH2 4JI8B 1R091 1FATA 1SETA 1SFNA 1WGPA 3ZMSA 4PIYA 5CIRA 1PNLA 2OPWA 3AZYA 1W3XA 1LGBA 5AFEA 3LSEA 4XCAA 1HB3A 4EV0A 5EWSA 3OUSA 1JZ5A 4CDQB 2P4VA 3WB1A 1YF2A 5A3WA 3N9LA 4ZI7B 1MEC3 4AVSA 5J36A 3E5UA 3RN4A 5CA6A 2Y6JA 3VBUB 4DUVA 3SH3A 2ZNJA 3BVOA 3GWKC 3VBHC 4LFBO 3BU7A 3N9NA 5JR7B 5E1RA 1AI7A 2A7AA 4R6ZA 4BQ5A 3JARA 2HKOA 5FTTC 1R6KA 4YGCA 4FVMA 1FAFA 4X8NA 4JTOA 3GB7C 3P3NA 4JI4O 3BIWE 2Q8DA 2WZR1 2GC1A 1ULPA 2P2KA 1VIWB 2W95A 1AR72 1N3PA 4S2HA 4BIUA 3RWRD 5FZ3A 2A0LA 5FLJA 5EJ3A 1PMHX 2BUKA 3VBOC 2VMHA 3JD4A 1GN3A 4LKEA 4LO4B 1VQNV 1L0LH 4YVWB 3MEPA 1NKDA 3C3TA 5TISZ 3HOBA 5IYZA 1VF7A 4TUYB 3J7MA 3AXEA 1ZL8A 2LW8A 3N7KA 2X10A 1SQ4A 3FJSA 5IK4A 2VNVA 2W3JA 4GYCB 3SJBC 1UYZA 4FPPA 4I02A 1VAKA 5FWJA 1TMF2 2RJZA 4O4HB 3PUIA 2P34A 1W6NA 2IXLA 3ZYFA 3JARB 4FLXA 2LJ2A 3BAAA 2WC2A 5LHHA 5IVBA 4PHZA 3CU7A 2Z69A 2HWD2 1FD9A 5DZFA 1MMMA 3JXSA 2R1BA 1F9KA 3L73H 4FFHA 4IGQA 1M57B 3JCIA 1RHI2 2H0VA 4FFBB 5IT6A 1DG6A 2BOJA 2Q5TA 1H38A 2HEVF 2ZGRA 1F15A 2E5LB 3J81N 3RQ0A 4FLWA 2H94A 1MZ6A 2ZBJA 4Z07A 4IEUA 2RV9A 4S2FA 2WWJA 1N32O 2BTQB 1K12A 1BCCH 2XWJB 3G80A 2IFWA 1HNWB 3H1KH 2FL4A 4HVOA 5LBCA 1Q6HA 4KH9A 1GZ9A 2AYHA 4OI4A 5T5JA 4FOYA 2JICA 3CF6E 5LRSA 1X82A 2BVBA 3VN4A 3K0GA 4FFIA 1URFA 4LIUA 3PNAA 1XNAA 5E88A 2IVIB 3WB2A 3I7DA 1PNMA 2E74B 3WOGA 4FLZA 4Q4X2 3WD5A 5K0UA 3BFRA 3ZLIA 4K20A 5LEKA 3VBHB 2JDZA 3JAMN 2EVXA 2OQ6A 3ZBHA 2VG9A 1ULCA 4UT5A 3MIFA 3K3OA 4MV2A 1XNTA 2BU9A 3NJXA 4X1IA 4B3MO 4L9BA 3ZM8A 2NZ9A 3ZMTA 2VZ3A 1TVKB 3OJBA 4XFFA 3HIFA 4N9HA 1FXHA 3STLC 5EYXA 4KBBA 5A3MA 4X6QB 1HJFA 4N8MA 3O1MA 4PA6A 1GTOA 1RMU3 1N4CA 1FXKC 3AYAA 4XXAA 5B1OA 5JI9A 4RHV2 4E2GA 1W8HA 4IEPA 1IZ3A 4YW2A 3VBOB 1SDDB 3ATGA 1MZFA 1PGL1 4GWJA 2KA3A 3AC0A 5FZGA 3HNYM 4IDZA 2D93A 1JZ3A 3HR0A 4A7ZA 1PVC2 3M3IA 3QNEA 3AP4A 1JZ7A 3C2UA 5D1IA 3OB8A 5T5PA 1XJAA 1COV2 5JSOA 1XNDA 3OY8A 4W50A 3KLSA 3LEMA 2XVLA 4FMTA 4IHJB 5IYDO 1GYKA 4HXCA 4NPRA 3WUCA 1W28A 1GM9A 4JTAB 4A45A 2HH9A 4IUGA 3P3PA 2Q0AA 3I3DA 3DGEA 5CFCC 4CDXC 3SITA 1S5JA 1BBT3 1QMJA 4R4XA 1JMUB 2MEV2 2QE7G 1QR9A 4GWMA 2JX9A 3SKJE 3WX5A 3NO8A 1YQ5A 1XMQO 4E2SA 1OHFA 3D36A 5A3NA 1W39A 2WFPA 2YBSA 3MV11 4HNAA 2ZM6O 3N35A 1UAIA 1SF9A 1H6YA 1KP3A 4MTXA 1QOOA 2VQTA 1EN5A 2UYBA 1IPSA 2DU0A 2GDSA 1JYWA 2QQVA 1ZBA3 2QTOA 4LF7B 1QXPA 1HRI2 2CL2A 1QNYA 3OY8B 1WMEA 2V09A 2ZABA 4IXLA 2WPDG 1ZBA1 4LC1A 5GONB 3AK2A 4AHWA 3JD72 3T3YA 3BOWA 3ZFGA 1L3JA 4QPGA 1E1QG 1YJKA 2BFUS 5IYYA 5GZGA 3BABA 4MGSA 1VMGA 1MOFA 4WVZA 4CUAA 5A80A 4CUGA 1ZRDA 1IXBA 4Q0SA 1TE1B 2EILC 5APAA 5LYJA 2ZMLA 3CJIA 1VQ5V 5I8TA 4I0BA 5ACA1 2VVFA 1Q6IA 2ZGSA 2EIGA 4DV0O 2LW1A 4JI7B 5HCFA 3UCSC 5JWPA 3JBG3 5FYHA 2BWAA 3K03A 1RUI2 4Q4Y3 3T0BA 2HYXA 3TN93 3U10A 4PT6A 4QKNA 3DN7A 1VE0A 1YI7A 2AEYA 2X6BA 4DXTA 1FXKB 1WB8A 3HT1A 1AL0G 3EHBB 4ASLA 4DR1O 3CCJV 3DXRA 3ZMNA 4DXZA 1SQPH 2R043 3U37A 3IT8A 2FDIA 4KWJA 5C7GA 1XPWA 4EN8B 1YI2V 2W5FA 2HVJC 1VQPV 2A5ZA 4UFJA 2I07B 5FY0A 1DFQA 3ZFGB 4BM8A 3AG3B 3MD0A 5LHGA 1ULFA 2R073 3IC7A 4LNVA 2E7TA 5KHGA 3OG2A 3ABZA 1EV13 2ZA9A 3D3IA 2PHRA 4AVVA 3OPZA 4MGKE 4CA9A 5C3PA 3K5MA 2R071 4INDA 3KM5A 4AGVA 1EV11 3TK1A 1LOBA 3WQ0A 3OFNG 5FZBA 2HG5C 3AFKA 4IE6A 1EY2A 4DUXA 1QQCA 2PLV1 5DM6V 4PI2A 2W0XA 5FZ9A 4QB2A 4O9GA 5CFCB 4CDXB 3SLIA 3BOPA 2Q67A 2G4IA 4I55B 2QKCA 3SNMA 4QKFA 1RUF2 3PVOA 4QD2A 5JVDB 2Y6GA 4DV7O 3I49A 2YEVA 1HWYA 4G27B 3WVJA 2DUPA 4BXSV 2DMXA 2DYCA 2ZIOA 1HNZO 2ZPXA 5CB4A 3T4HB 4UV9A 3ZRWB 1NXMA 4LR4A 1I1EA 3LA3A 4RS5A 1S55A 3WNLA 2V4VA 4I0WB 5LXTA 2CDPA 1SG3A 1E57A 4AFDA 1TUBA 1MS0A 1NCQA 5K1PA 1WLDA 1SLTA 4E2LA 5BNPA 4CEWA 3ACGA 3DUIA 3W5NA 1OA4A 3OUHA 4JTCB 4HANA 4GH4C 4LLOA 5CKNA 2ZZJA 4Q0QA 3BTXA 4DXRA 5IJ0A 1UZZA 4FPFA 4FTEA 1W6OA 2V5DA 2GUZB 2VBDA 2Q73A 4MTOA 3VZMA 3AG4C 1AI5A 3LSDA 1IBKB 2EILB 4ASUG 1LODA 3GXUA 5FP7A 1IVSA 2HJFC 3QH7A 3MW3A 4PA3A 1YQ2A 1GOFA 2XJPA 2VPVA 2GAUA 2X05A 2ZEYA 1R3IC 3W58A 3ZHSA 2XOMA 4Z92B 4YGDA 1QLEB 2UYAA 2EIBA 2RDSA 4JHZA 2BBAA 3WNOA 1AJPA 4J7JA 4Q0VA 1Q8OA 4I9WA 4C91A 5E6HA 2KG7A 3KMHA 4J9ZB 1JODA 4F4LA 4CS3A 4X65B 2DFCA 5K1XA 4YZ4A 2Y69C 3E22A 2LRPA 3KVAA 3ZYIB 1AR62 4F3JA 5A2QN 2AUYA 3J4UH 1W0JG 2ZEZA 2OCCC 4O2BA 3JYCA 2YYOA 1CZVA 2ZMNA 3U4SA 3KF3A 3ZXAC 1QDOA 2QNKA 4LE4A 1DZTA 5HXMA 1KYOF 3H01A 5IJ0B 1W6OB 1SLLA 5C3RA 5FY4A 2DU1A 4JDOA 2JDPA 1MSDA 2EJRA 3AX4A 3H50A 2P06A 1UY2A 1B06A 4N23A 4P9GA 4NHYA 2YUAA 2V72A 1X7NA 2VM9A 1GNHA 4XUTA 5DZGA 3FD9A 2D6LX 1SQXH 2JGDA 2XMLA 1W6PA 1OUXA 1BMV2 4OVEA 3P32A 1PVXA 3U75A 1K5MC 3A0RA 4DRXB 3RSJA 2RDRA 3K06A 4M0NA 3B4SA 4IEWA 2JEMA 5J37A 1KRIA 2X6AA 4LK7A 1DYOA 4GKJO 3ZSEA 3MICA 4Y26A 1UY4A 1LJ7A 3ZPYA 1VBB3 2ZINA 2WLQA 5KXCA 1NZ6A 4UWDA 3WDXA 1XNCA 1VBB1 2WSVA 3RYFA 4O2BB 2EZPA 3HKEA 2RQ6A 5L7OC 1VAVA 3VD4A 1YIJV 1JYXA 3GALA 4RR3C 3S57A 4WBNA 5EIBD 4LNUA 1NOVA 5FZ4A 4GH4B 4NO4A 5A32A 3VKFC 3CS5A 4XYXA 4IEOA 4PA4A 3AG4B 4CZZA 2CGNA 2DVDA 1JMKC 3INAA 1V9U1 1UY3A 5JPNB 3OBRA 2ADPA 1FNYA 4PBOA 4I09A 2QBXA 3H8RA 1UPIA 2Z2SB 3FHIB 1AROP 1RUC1 3WV6A 1WLCA 1GZTA 4S2DA 1XSRA 4KG0A 2PHFA 1ROPA 3OGCC 3E97A 4E4ZA 1ASJ3 1AP6A 3DF0A 2DBNA 1DTOA 2D3OW 1W8TA 3RYIA 3JATA 4JGZC 1O9HA 4KL1A 2ATFA 2WZ8A 2DWDC 3AP6A 3NL1A 2RN9A 4LA2A 2Y69B 2F4VO 2W1UA 4JI0B 4BQ1A 3D8CA 2PY5A 4LBEC 3OGRA 1JH5A 3SMHA 2OCCB 2DWRA 2ZZQA 3CDZB 4FK5C 1QJY1 3GJAA 4KWKA 4HK9A 4M00A 4IIJB 1Q90D 3IAQA 2Y38A 3MF6A 2FDGA 3UGFA 1AVMA 4MHUA 5L7OA 3BPSA 3DTUB 4YG6A 2JDUA 3VBRC 2WRAA 4IV1C 3CCSV 1H4HA 1LOFA 2HBTA 3T2OA 3TGUH 5L3DA 3C90A 2WFF2 4D7YA 4B4PA 2GMEA 2VUDA 1ENVA 5JZGA 3DKQA 4NIHA 1RUD3 1PGW2 4E4HA 1J3PA 2MW2B 1AL21 2E6VA 3WR0A 3T1HO 3ZX7A 3RNSA 2ITCC 1LNQA 3RYHB 4CPBD 5JCTA 1JYVA 3ZKYA 4QGMA 4F8AA 4CP9A 1I6XA 1W9FA 1HQLA 1PNKA 3WLUA 2Q7HA 1K5MB 5JH7A 1SFPA 1ZA4A 4JKLA 4FI9A 3PVNA 3WCRA 1NA1A 2ARAA 1UKGA 3UYJA 1XBFA 3S6PA 4E8CA 4LH7A 5LA2A 4LHKA 3K9SA 3IDEA 2ZHMA 4YHHO 2KR2A 1WNSA 3MDPA 2FDHA 3WP4A 4AEMA 3RW0A 1W9SA 5FY9A 4RUFA 3WFVA 1J3RA 3HN1A 3CPWU 5FK8A 3MFCA 5L7OB 1G1XB 4CPBA 5FO8B 4WFFA 1F31A 2YGMA 2JE9A 4OUSA 1Y66A 1OV9A 2H3OA 3NR7A 3JUUA 4RR3B 2VQEO 4WF9V 5KA6A 4D6SA 4ZS2A 4YZ1A 5CBFA 4RQPC 3ZFFC 1KBHA 2WKKA 5GJ6A 1NH2B 2RNBA 1SFYA 2BNOA 4W8JA 3RG0A 4HLTA 4X66O 5FYCA 2QSAA 5F37A 1XOUA 3J7AU 3LE0A 2FQPA 3I3EA 3W9AA 3NNJA 5I0DA 4D3WA 4LA3A 1SBFA 2KKWA 4OHWA 5LEJA 1SEFA 1CGPA 2ZEXA 1OZ0A 4AFMA 1WWYA 3LUTB 4JGZB 2UWAA 5FBZA 3BN6A 4PLNA 2KSDA 3FBYA 2E7QA 2EIKC 4ZIBA 2G9GA 1LOCA 1W99A 1GN4A 3PUQA 3LPGA 4WBBA 4P30A 5BNNA 1ZVFA 3WNNA 1JZ2A 1O4ZA 3SCGA 3H8XA 4WFGA 4KXRA 1YFUA 3A23A 2GN3A 1SC5B 4Q5OA 1WLWA 4YG3A 3PURA 3POJA 3ON7A 4GB31 3VBRB 1YRZA 4PD4F 1KD7A 4IV1B 5FZCA 1ULOA 5AC93 5L9RA 4Y1XA 1YNAA 3ZXGA 1EUTA 3NNFA 3Q8BA 1R082 1HNXO 5FXVA 3LDEA 2JDMA 1PZ7A 1PGSA 5IJ9B 2W1QA 1XNQO 2X6CA 2GNDA 1H1IA 3JCUZ 1K34A 4KG8A 5FYIA 1S76D 1RUJ1 4YJ2A 4COYA 2ITDC 4W6YA 3Q8FA 3A2FA 1O4TA 2WINB 1RM1C 1JA8A 3AMQA 1ULGA 4DEQA 2B45X 3QACA 3FBMA 1IKQA 4JI6O 2Z5WA 2W39A 4P5HA 3HN3A 2RM21 3N7MA 1R092 2CK3G 3APQA 1LRHA 1VB4A 1V6NA 2PAEA 3CXCU 3BPZA 1TME1 2R9RB 4DR5B 1GNYA 2CAUA 2J1VA 4BCUA 2X0LA 4LF8O 1JHJA 3KZ4C 1NQDA 2GSYA 4KNCA 3NNMA 1U96A 3ZYHA 4ZHQB 4Q4W1 2BQPA 3THTA 1XMOB 4YYOA 1Z78A 2CAZC 4HKOA 1BE3H 1N36O 4DO0A 3MAQA 2P90A 5FPVA 4Z82A 5IWAO 4RQPB 4Q1PA 4L87A 1RL3A 1JJOA 4CCOA 2DFBA 1POV0 5A1AA 2WZR2 2VU9A 4FQ4A 4PIZA 4YJ2B 3VDDC 1HP8A 3OGJA 5F3IA 1JW6A 1LUWA 2VQUA 2QM4A 2AGSA 3UKMA 4DK0A 1OCRC 1S0JA 2YFZA 2P22C 1NI8A 4DO2A 2QTWB 2QQJA 2A3YA 4Y4YA 2NMNA 3H1YA 1WN7A 1R3LC 4YZ2A 1DF4A 3M3OA 4LITA 5K8SA 4UFMA 4OYUA 1QDCA 1J58A 3T4VA 1ZWIC 5KC6A 1WA4A 1STMA 1G8MA 2GU9A 3SXWA 5FPLA 1C57A 1S0VA 4LF6B 1JZ6A 3UJOA 2EIKB 4HN1A 1SPPA 2P6JA 4UXAA 1WW4A 3NMBA 1QLNA 3LDCA 1WCQA 2J1EA 4YM3A 1J1LA 3BTAA 3WNXA 1QVGU 4GCZA 5A3PA 4JYAB 3T09A 4MVUA 3CLPA 4Z8BA 1JOYA 4S2GA 1JPXA 4META 2QWRB 4YHHB 3BRCA 3OBTA 2ZOEB 1VF6A 2IH3C 3ME2A 4IL6Z 4EB6A 5JXHA 3AYCA 3N2GA 1QJU3 3HKCA 2GHYA 2D3PA 2ZR3A 4QQOA 1AHSA 4AYUA 1F4MA 1MS4A 4NRQA 1US2A 1QJU1 1XHXA 2ZKNA 4NTYA 4CXXA 1PMJX 5FMCA 3R6SA 2FHRA 1EPWA 1RM1B 3K04A 2D44A 4MGZE 5BNOA 1PMIA 4AWDA 2KM2A 4YVSC 5KBFA 5DN6G 4FZ0A 4NUBA 1UCXA 5FZIA 5C93A 4O2AA 2FCUA 1FOD1 5L3FA 1SPPB 1RUH3 4I01A 1UD1A 1V55C 4RAIA 4CU9A 3RVHA 1SLBA 5JOWA 2IXIA 1GR3A 3UT5B 4KHPO 1SLCA 2X8KA 2D6KA 2VZQA 5ERLA 3VGIA 4UAPA 1FV2A 4AEDA 4IGOA 3K58A 2TNFA 1Z5WA 3I54A 1DYKA 1GP4A 2ZGOA 3A0HZ 1G6NA 5ITZB 2SBAA 5BXZA 4BE3A 4XJ9A 1F7YA 2K9ZA 4ZZ5A 4JAAA 3K9AA 2VBBA 2VQFO 3URFA 2VTXA 1NYWA 2BOIA 4QXCA 4YFWA 1W3VA 5E1AC 1CXZB 4RL7A 5FXZA 1ZZBA 2A73B 3JALA 3K48A 3IM0A 1NLQA 1M5IA 3CRAA 3H1JH 3VDDB 4Q8KA 2I45A 2C1FA 2B5UA 2GTAA 4X1YB 2BV4A 2VZUA 2R063 3WUDA 4Y20A 1F8VA 4OZOA 3HPLC 2ZDIA 1PKXA 1QCEA 3BHPA 4CE8A 4CC5A 5D8AC 1VRH3 3AVSA 4QJFB 3FZ3A 3PL0A 1PGL2 3OE7G 2WR9A 3K3NA 4XF3A 1QHDA 3OD0A 1Q3EA 4UCOA 4O2AB 2WT0A 1XUQA 1VRH1 3KHBA 2DCKA 5F6LB 4CDWA 5LGTA 4RWUA 3NNGA 1W0OA 3H1IH 3OYWB 5FAXA 2VMFA 3CC7V 5ANNA 3I8TA 3JD3A 4Y5SA 3VHRA 4HT1T 4G9SB 1LENA 4CRQA 2N7GA 5ABJA 1XNRO 4I0XA 4RQFA 2F4PA 3OR7C 3NKGA 3C3VA 5DG1A 1UOGA 2F17A 4IEXA 1R64A 4H44B 3OCPA 2KB1A 3ZS8C 4ONUA 3ETQA 2X29A 4ZS3A 3H8OA 1J83A 3WCSA 4IE7A 5IVFA 2EXKA 4QQ2A 3WW2A 2Z42A 4PLOA 1ZRIA 1RJ8A 4MW8A 5L3CA 2W0FC 3A7QA 3C7EA 3B69A 3AL6A 2X5IC 3WF1A 1AR73 4CC6A 4XJAA 5EK0A 3M1HA 5LZ6A 2MK3A 1YJWV 1NAEA 3USSA 1JHNA 3JD1A 1W59A 3AKTA 5C8CC 2DVBA 3AXDA 1MG1A 1O3RA 3BI3A 2CDOA 4CP0A 5JVVA 2V1DA 3RZGA 2K2SA 4CDWB 2HYKA 4EQVA 3O7OA 3JSLA 4I5SA 1LKNA 5BY1A 4EWEA 1CPYA 3VBSC 1AR91 1BSMA 1ZBA2 1TMF3 1EZJA 2JEUA 2F1MA 4CU6A 1V55B 5DPNA 4WM7A 1K33A 3I2DA 1EAH1 3O1SA 1Y76A 2VCBA 3F7YC 2DUQA 5J2TA 5FQ0A 4TXWA 3ZIAG 4I50A 5DAXA 2WL1A 2BTVC 3FE5A 2OA2A 3MO4A 2HWD3 4FPJA 4OX9O 4FOWA 5F9TA 4YM2A 4JI5O 3LGRA 4IEQA 4Q20A 2JG8C 1CR7A 3RYCB 1RHI3 2QUOA 5ACA2 2B4KA 1LUVA 1GSLA 4FP2A 2HLEA 4BWOA 3TNPB 2EINC 4D7TA 4Z1MG 1SCRA 2W92A 4NHLA 3OTOO 3ZSJA 5FIXA 5FZ0A 3LSUA 1WW7A 4XFBA 4AVTA 3ASNC 3AK3A 1D4VB 2ZD9A 2EIJC 4FO9A 5DUWA 5F3GA 1Q6UA 4OMCA 1XOYA 5E8AA 4IGPA 1K7DA 2VMGA 1VBC1 4PELA 4UF0A 2VTXJ 5D8AB 2YC2A 4N90A 3WG1A 2IU0A 4DV5B 1J84A 2WNVC 1HRV1 2JJ2G 5FYMA 1HR0O 2W47A 2QQNA 2YG0A 4WM7B 1HV1A 5C3OA 2BWCA 4I50B 3HKBB 1JZ8A 4YIPA 4LUKA 2HWC1 3RMXA 3ILFA 4NYKA 3VQXA 3OBZA 2JB4A 2PA7A 4XFHA 2QCSB 2WO1A 1BT8A 4WVWA 2PLV2 1WBFA 3V0AA 4CEYA 4CTEA 4O4IA 1H8TA 1PM4A 3IC9A 2R72A 4YGBA 5FUPA 3KQRA 1CZSA 5CAZA 4UFIA 1IQDC 2X5IB 5C8WA 4E4SA 5F2SA 1BK0A 5GLVA 3KT1A 2PAKA 2E33A 4LE3A 4UI9L 3UL2A 1JN2P 3AG2B 1YUDA 5LA6B 4OPAA 2CH7B 5C8CB 2K46A 2QWPB 2G38A 4CUCA 5C70A 3VQWA 1NE4A 3Q4HA 3PJYA 3CMGA 5IVCA 1RUOA 1PVC3 4UUJC 1S2EA 4CCEA 1VBE2 4A41A 1COV3 4XE9A 3O5SA 1UU4A 3I3BA 2ARHA 2B1IA 3B40A 2IM9A 4J41A 4YSFA 3VQYA 2PHLA 4V2WA 4LWSA 4UCRA 5T54A 1Q8QA 1G4YB 1K5SA 4XIOA 3SCHA 2BGOA 3IN9A 4O4JA 4TQDA 2O14A 3FX3A 4QDRA 2D97A 3A0KA 3QBQA 4N7IA 4NOTA 5IWFA 4CH6A 3V0AB 4QWNA 1WKYA 1TA8A 4O4IB 2SLIA 2CU5A 4NXNB 3U11A 4NMIA 4WFEA 3ES4A 3V64A 2JG8B 2MEV3 3VZKA 1MVEA 1RGSA 1PPJH 3WT3A 1AXZA 2EINB 2YFUA 3ZRVA 2P6HA 2WIIB 3SQOA 1KU9A 2VWJA 4JPRA 4R8CA 3VKMA 2ZGMA 3ZMZA 2UUCB 2WN3A 2ZNIA 4MO3M 1W03A 1W2OA 4XPVA 2DTYA 5T50A 4CP1A 2WZEA 1GQGA 2EIJB 4MGTA 2WQ4A 3A4UA 4P02B 4LFCO 1UXXX 2IW5A 4UW3A 1RXGA 2HKXA 3OEBA 4Y24A 2VECA 1HRI3 3C7FA 3ZX6A 1B35C 1Y9GA 4ZOLB 1AJQA 1Z5VA 2HFEC 4GZ9A 3IB3A 5EZWA 5FZFA 1YHFA 2FYUH 4LH6A 2LTNA 4DRRA 2YIBD 2XJSA 2ILMA 5A7OA 5H9CA 2V4DA 3ZN6A 1PL0A 4GWIA 4AAXA 4B3TO 5T55A 2Z5UA 3K5OA 3JB4C 3S7EA 1RJ7A 4UFKA 4IETA 2P37A 2D40A 1HB4A 2RS31 5DZEA 2HP8A 2QWNB 1HJGA 3ZYBA 3K79A 2Y48A 1RUI3 2OT7A 1NU1H 3HWJA 2YIBA 4NKGB 1S1AA 1NT2B 4P2ZA 4NIAA 3VBFC 2ADEA 1RUI1 1XU1A 2UUBB 2WT2A 5HFLA 4AI9A 1UOBA 4TSVA 1BCXA 4PCRA 1OH4A 1LCLA 3E35A 3OUJA 2J1SA 4E2QA 4BAYA 1U5YA 2VVDA 1C5HA 3PTRB 3BTYA 5BZBA 3IZOA 2JG9A 5KXBA 4JI2O 2E31A 4YW6A 3T2TA 2NN8A 4ZHNA 4ZU7A 3N7JA 1VBB2 4FP3A 1K5QA 5L9BA 3DYPA 1G9AA 1MS5A 3M8AA 1MR5A 5EZYA 5CA1A 1YJ9V 1QNWA 4FT8A 3E6DA 1TAEA 3OEHG 2DVFA 4LHLA 1TNFA 3ZR6A 2RMU1 1UN1A 1NKGA 3AK1A 3USUA 2XTAA 1GU3A 2A6WA 5DN2A 3C7OA 4R8HA 4J42A 5EFUA 4JGYC 5F1RA 1RUF3 1R6NA 1I5XA 1NCRC 4XDOA 1IS4A 1V9U2 2KQXA 4X89A 2P67A 4K8RB 4MGQA 4Q0UA 3ZHQA 2A3WA 1GQHA 1YHQV 5EQUA 4IE5A 2VCAA 3OPTA 1XYPA 4DMIA 3JASB 4F83A 3ABKC 1RUC2 3LZZA 5KMGA 2WQZC 2GTSA 4IV3C 5F3CA 1UO9A 4LTAA 2QE3A 1XL4A 2JG9B 2O8OA 3CEIA 4HG6B 3M7AA 4YARA 1B35B 1E1RG 4KWLA 2P3YA 4FTSA 5CA1B 3K51A 5LMNO 1POV3 4H14A 4MGIE 1W6MB 3RZLA 2UXCO 1QJY2 1POV1 1XREA 1ODNA 3LB9A 3DL3A 2K0GA 4X62B 3T4DA 2W68A 3IIIA 3FFQA 1VQ7V 1RPRA 2WABA 4A3XA 4AQYO 1MQTA 3AEIA 4NXMB 1VARA 3STZC 4QPIA 2WLJA 2HEWF 2VMDA 1DU3D 1URXA 2LALA 2XJRA 2DCTA 2UXDO 4BXFA 4QX5A 3U4XA 1AL22 4H0LB 5LP6C 1JU3A 4WM8C 3UNPA 1Q8SA 3RWKX 1JS9A 2BE3A 3VBFB 4Q6GA 2GMPA 1LHVA 2ZGKA 1ZZ7A 1NQJA 4U3JB 2CWSA 1K97A 1JOBA 1Y4MA 4IE0A 3MHSC 3MHHC 1XYNA 1MS3A 3KHCA 1SQFA 2DYRC 3NVCA 3ZYRA 2BSKB 4D7SA 2VS0A 3UJQA 1D4M1 1AR63 3ACHA 1JOPA 1C8M2 3M4FA 3HPNA 2DVAA 3WB0A 5KX5B 2D2CB 3EFFK 3GCXA 3RDIA 3AZXA 3ML0A 1A8MA 3CIHA 3NQHA 4MUVA 4UW6A 3POWA 2B7YA 4EKWA 1Q43A 4X64B 1LU2A 2B8MA 4ES8A 2JECA 4BDVB 4LFAO 4DR6O 1FT9A 2BP6A 2R70A 4NPMA 3IPVA 1GZWA 1YCIA 4D94A 1CZTA 1KQRA 1BHGA 4P9OA 4JGYB 4PQ9A 1NCRB 3T2PA 1ENRA 1D0HA 3TETA 3UESA 3TAYA 2JEXA 1RYYA 2XLAA 1SQGA 5F6KA 2OWOA 2KXLA 4PIXA 3E86A 3HVDA 4J1WA 1NY71 1GH6A 3M3QA 5M0TA 3ABKB 1H9PA 1ZTEA 2J7MA 2XDVA 4IV3B 2H6BA 4XMIA 4YPJA 1C5IA 5LASA 4CDUC 4DK1A 4DV3B 3SPIA 4AVCA 1NTMH 3W59A 3NV4A 3V65A 3F7VC 3WF3A 1BGYH 4DR7B 2QQPA 1UZ0A 4NHMA 3H1HH 4DYLA 5CKQA 1IG0A 3MIDA 3AP9A 4Z2AA 3BY6A 2HWE1 3CC2V 3W7SA 1GWMA 1IX9A 1OJHA 2UXNA 5FY5A 3AP5A 2A3XA 4BMBA 2YC4A 1NBMG 1OLQA 1WA8A 1WMFA 4BU2A 4DV1O 4JI2B 2B9UA 3GVMA 3AVRA 1EFRG 4BLJA 3ES1A 4QAWA 2D6MA 4GB32 3JU9A 5F2WA 4BMEA 3KCXA 5LK5A 4ASMB 4LF4O 4JHTA 4UBHA 5GLUA 1N34B 4XACA 4IYIA 4X20A 4DR3B 4EYUA 1FI2A 4B3NA 2BGCA 3CD6V 4LOTA 5EC2C 4JI8O 3E1F1 4MH0E 4JI1B 3ACIA 3AFGA 1PHMA 3PDQA 5LP6B 3N7LA 1RUJ2 4WM8B 3QVNA 5ANQA 2JDNA 4N43A 1SESA 1KFUL 5IHRA 3Q8AA 1YFXA 4HKLA 3MIGA 1GN2A 5LCWL 1GLHA 2J1UA 2QWOB 1KS5A 3TEYA 4XQWA 2C9AA 1BZKA 2DYRB 4B1MA 2ADQB 1FX5A 2DURA 2RM22 1XILA 1US3A 4J1XA 1COWG 3TXSA 1QBZA 2YB7A 1Q8VA 5FYZA 1YTFB 1VBD1 3LD8A 1Q56A 2A6XA 1BHAA 1TME2 3AZWA 5FZKA 3JAWA 1NVPB 1P7GA 3NAPA 1C1LA 1R1A3 4XUOA 4XIKA 1MNGA 4XZUG 1Z0HA 5GLTA 1SMVA 3ZFEC 4A42A 4Q4W2 1R1A1 5FXXA 4PJ0Z 2VZOA 4JDMA 3LFIA 5A7WB 2XH6A 3HQUA 4JASA 2WFF3 4YLZA 1PK6C 3VL9A 3UKTA 2DW4A 1N1YA 1XB9A 1W05A 4O9EA 1AR83 4TV8B 1W0NA 1XNKA 1Z2GA 3N4MA 1PGW1 2YS8A 3ZO0B 4C0BA 3O9OA 2Y8KA 4N43B 5DXDA 1AR81 1CX4A 1X8EA 5LL6Y 2ZAHA 5FKBA 5BMVA 3AJZA 4XFIA 4PJYA 4YZ3A 3FL7A 3JQWA 2RHPA 3PU3A 1HLCA 3IAYA 1PV0A 2AREA 1QGLA 2WWUA 3O0XA 5KHHA 4MADA 5L73A 4FXKB 1RC6A 4FOQA 5F3EA 2ZGUA 1R1ZA 4CDUB 3PU8A 3TBDA 1NG0A 1MVQA 3J8F2 3O12A 5GKAC 4YW7A 3JQXA 3IWZA 2PYJA 1FPN1 2OIGA 1V6IA 4XMAA 5FK7A 2OKXA 2LGWA 1N8RW 1CN1A 4QPWA 2E5LO 3H3ZA 3RZZA 2F6BA 4MT8A 3TEXA 1M06G 4N53C 4DUZB 4DR2B 4LK6A 3EHKA 3CEWA 4UV8A 1THZA 5GZCA 3E2EA 4LUMA 1HNWO 2MNGA 2OQ7A 2HWF1 2YROA 2UU8A 1CAXA 4DB5A 2YY1A 2PN5A 2Y4UA 2D98A 1IG3A 1REEA 5IVJA 2IFRA 2RJLA 4EZHA 4TWKA 1ND3A 2A7WA 4DR6B 1PZ9A 2AR6A 2LROA 1QXJA 2WO3A 4OXSA 4LBQD 3WZ1A 4P9YA 3RRDA 4QPKA 4YJ3A 1K42A 4MTFA 3VL8A 1RXFA 1ND2A 4HN0A 3N2KB 5FREA 2JDIG 1CJPA 1FOD2 3RPQA 3MUZ1 1G9DA 3PUSA 1UMZA 3K59A 1ONAA 4FPCA 3BCCH 1AI6A 4OQ9A 4PI0A 5JMOA 4ZI7A 1X9TA 3GWOA 4FPEA 3VBUA 4A4AA 3ZFEB 4AGRA 4LBQA 1R083 3J26N 3M2MA 1R3KC 3AYEA 5IW0A 1BK1A 3HQRA 5LATA 2A06H 2F23A 3LIHA 4XZPA 3ZDVA 2ZGTA 1FPOA 2FMDA 1VMJA 4TV9B 3OF1A 3ELNA 5IYCO 2Y6LA 4L8JA 2D6PA 3VUOA 1AX2A 2R16A 5A33B 1EM1A 2WAOA 5F2VO 3LCPA 4GT1A 5FMOS 4OI0A 1DK1A 2BBVA 1OUSA 1R093 2BERA 3ACFA 3CE2A 1DYPA 2PHTA 2PF4E 1S5LZ 2BNNA 2FDFA 4IT5A 4YVWA 4E4EA 4YRDA 3K0DA 1A78A 4XJ8A 4Y1YA 4TUYA 3LKJA 2VULA 3WDVA 3IDAA 3ZYPA 4O61A 5I0UA 1WW6A 4ISRA 3T08A 2OW4A 1SRYA 1I08A 3KG2A 3C8XA 4O4HA 4LBQB 2EIMC 2RMKB 4GULA 1L1FA 1PX4A 4NIGA 2DBIA 4MVSA 5GTIZ 3N9MA 3DPRC 4QM8A 2WZR3 1JTZX 1JU4A 4N53B 4QHOA 2YI9A 5B3SC 1KMIZ 2A71A 3H42B 3FMGA 1WAZA 5JQGB 5CADA 1XE8A 2GV9A 4PV1B 1OVSA 4LF7O 4FFBA 2BPA2 3CWBH 3UQ8A 4R50A 1UL9A 1N3OA 5CKMA 4H13B 4CZSA 3BKZA 2TUNA 5EC1C 1XSQA 2RS11 4DFSA 2P3IA 3LDBA 4Q29A 3RS6A 3PVEA 2M7WA 5JR2A 2BTQA 5H6RA 5KXDA 3CCUV 3W7TA 5A1FA 1N1SA 1AR92 1APNA 4ZONA 2IJIA 5I8YA 5KAFZ 1A34A 5DEDA 1WUVA 2JE7A 2PQQA 4JI7O 2Z3YA 1EAH2 4XUQA 1S77D 2CTQA 2XKPA 3IJ4A 4XDJA 2JGUA 4KU8A 3ZXDA 2VNOA 1E5RA 4DV2B 4WFAV 4QNHB 1UF2C 3CJXA 4P9LA 4DPNA 5T5OA 2VCCA 1JVMA 3HNMA 1C4RA 2A9HA 2Y60A 4CYDA 4FFFA 3NW4A 1AVBA 3L74H 2XJVA 3VBHA 2E75B 3K75B 2JIZG 5F5IA 3MBWA 5C33A 3CCEV 2WO2A 3CC4V 4DXWA 4UVCA 4ZKIA 1WJZA 5C8YA 2C2AA 1B6QA 4DV6B 4HZFA 1TVKA 4HETA 3ZOIA 4OI1A 2CV6A 2ZAAA 4ITCA 3SCFA 1S4CA 3VBBA 5CYYA 1NS1A 2IC1A 2IJKA 4NHXA 5A9GA 1HX6A 3B94A 3KSCA 4R9AA 1VBC2 4QKBA 4IYHA 2LS6A 4XAAA 2W52A 3WNPA 4EN6B 1YFYA 3RVZA 3VBOA 2R1DA 1UY0A 1OCZB 4M01A 1HRV2 4NJ4A 4NB5A 2UWCA 4C1XA 4LF9B 3GM8A 4XBFA 4I4TB 3KVBA 3ZR5A 1NTKH 3LWCA 3DC6A 3L70H 5KLVH 2HWC2 3X29B 1PIV2 1W2BU 1W0PA 2P17A 1HB1A 1WPBA 4DW1A 4IHJA 2EIMB 1E5SA 4BW9A 3JZVA 4H37A 2ZE8A 4K35A 4CCKA 2E9QA 1SDWA 2YBPA 5C8YB 1GOHA 2YDEA 4JAVA 2ZX2A 4I0AA 2XL7A 4W65A 5B3SB 3N9PA 4PDWC 1F4HA 3VDCA 2FKXA 5FPAA 3MIHA 5HCHA 3ZN1A 1Y43B 1GZCA 4ZY9A 3R66A 1NQTA 3I2JA 1YQ8A 2IXKA 3IDBB 5C4WC 1W8FA 4Z1VA 4B8EA 4QGNA 3HEIA 2W08A 4QQHA 3DXTA 2QGNA 2CHHA 2B46X 5IFPA 3O1UA 1IBLB 2WUHA 2UURA 1AX0A 3O1TA 1OCCC 1VQ4V 5H9RA 5DQ0A 1EN6A 2FDJA 1IBKO 2DQ3A 4BIZA 4XOGA 1H8HG 4MVOA 4UW5A 1AJKA 1GM7A 5GONA 1SKVA 5KUMA 5LOVB 5FZOB 2R32A 3NJZA 2DWEC 2E7AA 1CPNA 1U97A 1GAXA 3LIGA 2PI5A 3B00A 5FPZA 1LOEA 5K7PA 1OOPC 3D4KA 3WEZA 5CFDC 1I5YA 5I91A 4YWAA 3VDBA 5JMCA 4LKSA 2QM7A 5FO7B 1QQP1 3KV4A 3PHMA 4X65O 4LBJA 1I94O 5FY8A 2BRTA 4XJZA 1DLBA 3J9SA 3B02A 3EB7A 3TEZA 5IAVA 3K3WA 2P1BA 2VZTA 2QFEA 4YGEA 4Q27A 5FZ7A 1RUE1 5IUQA 1GICA 4BHPA 2RG4A 2AHZA 4YZ5A 5IE9A 2BFUL 2GSMB 4KGQA 2GC2A 2FD8A 3CX5F 3OT7A 4OHZA 2I2SA 1FXKA 4ARYA 2B5HA 1AYM1 1HN1A 3E8HA 1OQDA 2OUHA 3K5LA 2IVJA 3BA8A 3KF5A 4AI0A 1DQ5A 1KKCA 1YVWA 4YIOA 3TNQA 1H2GA 1TGOA 4L2NA 2PTMA 4TWTA 3WQ1A 2VAUA 4RGGA 1N33B 1VBA1 4OUMA 4HSLA 3OPWA 2ZS6B 1O59A 5H6QA 5A6YA 1IS6A 2R9IA 3SEPA 2RS32 1CJDA 2Q68A 5ACA3 3I3QA 2UUAB 1Y7BA 2JIGA 4UW4A 4C0HA 3P6BA 3OM3B 4MHRA 1ZX3A 1BEV2 2Y0IA 2YZ4A 2BGPA 1W9WA 5CFCA 4CDXA 3I2KA 4PDWB 4I55A 1JX9A 1FMD1 1H2LA 5JVDA 4RFRB 2VUAA 2WSUA 3AP7A 2B1GA 1XBLA 3CCRV 3PIJA 1YQ6A 3ZCCA 2VVEA 2JWPA 2QZ3A 5B66Z 2WZPP 1PM7A 3POEA 5E89A 5LBQA 4M3CB 2XONA 1BMFG 1Q7YW 4UFZA 1WD4A 3ZRWA 1DLCA 4H7LA 4A7YA 1AILA 4X6RB 4QT6A 4DY3A 1FJGB 4BJ0A 3L9DA 1BXHA 1YEWA 3D0SA 3GYDA 4K1YA 2DN9A 4JRAA 2QR4A 1N1VA 5JIAA 5DDJ1 1SLIA 2Q8OA 5CG9A 3UV9A 2VTFA 2A6VA 5DAPA 4M4RA 4Z2WA 5BR8B 2RMU2 3B93A 4IESA 3LA2A 3ASOC 2PLV3 1KB9F 3PJQA 1SS3A 4UXNA 1MS8A 3PUHA 1VP6A 1OOPB 3BGAA 5GLWA 1VP7A 5CFDB 4MVTA 2GUZA 4B3SB 1YXWA 3P5BA 5LBBA 1HXS1 3GBFA 4LEJA 3APOA 3ASIA 4MXVA 4U7OA 1PO11 1DHKB 4CS4A 5A6ZA 1BVP1 5A3OA 5GZFA 4QIWF 1REFA 4HSJA 4JI0O 4LF5B 5DUVA 2WLIB 3SPCA 5FLIA 5FO9B 3VHOA 4QU1A 3VKNA 5I0SA 3A21A 5CN0A 1JOJA 2J1TA 2ZX3A 4M4PA 1VBE3 4XDPA 4BISA 3I56V 1QNMA 4DOUA 5K9YA 1C1FA 2Y6HA 1VBE1 1T2XA 1W06A 3D6EA 4FM1A 4XDLA 5JAXA 4B3RB 3WDYA 4HVRA 2E53A 1W0KG 3G71V 1BJQA 2CTRA 3K08A 3VD9A 4YW3A 4X8PA 2JDHA 4QXKA 2BOCC 1IPJA 4HPKB 4COVA 1IHMA 1UYXA 4LBKA 1UW8A 1QR8A 3B77A 4GLXA 3MFAA 5GW7A 1O7FA 4UB8Z 4PDLA 3D3QA 1GKBA 1DQ2A 1XE0A 1GRJA 5A3UA 3EJKA 4ZPIA 3G6JB 5FLHA 2OUJA 4OHXA 3FYEB 5EYPB 1W8UA 3BUCA 2PMWB 5BY5A 1KXGA 4MVRA 4B4QA 5IVYA 1YJNV 2VW1A 3KT4A 4XUPA 4UVBA 2PZSA 5CBHA 5C9AC 2LP7A 3SEEA 4E8DA 5CA0B 4BK5A 2YMZA 2PUSA 4DRXA 1F2NA 3HR9A 2OTLV 2YSUB 4QM9A 4Y4RA 1D4M2 5FP3A 1I94B 4J9YB 4AOCA 5FOJB 4JI3B 1QU0A 3BODA 2Y34A 1QXRA 3L71H 5IJRA 4QMAA 1H6XA 1V54C 3VHNA 3ORJA 4F6EA 4PDMA 5JOYA 3ZSKA 1N0JA 1N47A 1P8JA 5KC5A 2IWGB 2VO5A 4QB1A 2ETNA 3CNAA 4XDKA 2BW8A 3ASOB 1ZZ8A 4GH4A 1UPSA 3I2HA 1F23A 2RR11 2JKXA 1Y4WA 1CQ9A 3RJRA 4QQPA 4OCTA 4AVBA 4C7UA 3ETGA 1JYIA 4QPJA 2CNAA 3SC7X 1H2MA 1XYOA 2ZE7A 5IK8A 2QVSB 1U12A 2XL9A 1NY72 3WSOA 1Z7S3 4PDVA 2ZJCA 1D2DA 5IFTA 2OS2A 4H55A 3CMEV 5E16A 2JJ1G 1Z7S1 3T4ZA 4DRVA 3W5MA 5EXOA 4TN7A 5CA3A 1QOSA 1UX6A 1O9GA 1GV9A 4P9PA 5FMDA 2H0BA 2VWKA 3I55V 3FLTA 2LGQA 4EWAA 1WBLA 2MPFA 2HWE2 3ZJZA 4XCBA 4ZZ8A 2QZ2A 3J7LA 1H1MA 2HWB1 3FUQA 1B04A 2PI4A 1W2TA 3EO6A 3SR2C 1OH3A 5JCOC 2WLLB 2XJUA 4IIJA 4P9XA 2GN7A 4QPYA 4K0KB 4BA6A 4LBMA 1VQOV 1IQAA 1V9U3 1SBEA 4D6RA 2BDRA 4BQ2A 2ZEWA 5FOBB 5CEHA 2F95B 2WWWA 4UCTA 1D0GA 1YJLA 5D2AA 1RUC3 3VOUA 5JJJB 1CPMA 2WJSA 1N1TA 5LA9A 4CDQC 2QM8A 5C9AB 3RYHA 4DR5O 2F4LA 4NIDA 2WLNA 4B08A 4AFCA 2ZACA 2PFWA 2VQ0A 2CE4A 3B2EE 4L99A 5CBGA 5EHDA 2DV9A 5JI7A 1K5MA 4EJRA 5JJEB 4JYYA 2QKDA 1XMOO 4MSVA 1RB8G 2XAHA 2QTSA 3ILNA 3FB8C 2DTWA 1CP9A 1VBD2 4ZBMA 5B1BC 1NH2D 4DNYA 4QXBA 1VJ2A 1QJY3 5HV0A 3N9QA 5EPAA 4LP8A 2EZOA 5CISA 3VLBB 4CXYA 5FV3A 2LQTA 2CGPA 4HONA 4LT5A 3AMNA 3SJAC 1R1A2 1E79G 3BVCA 1QJX2 5A6QA 4MVMA 3ZN5A 2WNUC 4JDNA 1J3QA 3WNKA 2CSGA 4RR3A 2DOSA 4G3YC 3S3WA 2ZE6A 4AI1A 5J2UB 1AL23 1KKDA 4F7ZA 4TQFA 2Q5ZA 1MPXA 1PO23 3POGA 3ZSLA 2EULA 3IGAC 2ZXQA 1K8AW 3W20A 2XG3A 1AR82 1H2NA 2R30A 3PN1A 1PO21 2I74A 2W87A 4LF6O 1CIYA 1LOAA 1WMDA 1DCSA 3I2OA 1C8M3 4Q4V1 4KGGA 4MXWB 4Y22B 1OLMA 3B3QE 4QX7A 2QEXV 3O1RA 5C3QA 3FUOA 2O1QA 1C8M1 4JYAO 2ZTNA 3RZHA 1RINA 1OLRA 1W9TA 3E5QA 4G2KA 5CZKA 1H8EG 1JJ2U 4JGZA 1OA3A 2V5YA 4LORA 1M57C 3PTYA 2P4KA 2DCJA 2CYFA 4YNIA 1NJIW 4MGYE 4HK8A 1FPN2 2ZCEA 3NSTA 4JF3A 4HAMA 2YBKA 2UU9B 4WVMB 5LWBA 4PLMA 3ETDA 2A6YA 1S3JA 4D6TH 1AI4A 1LHUA 5GTHZ 3R0RA 2C4XA 3ZMVA 2CGOA 3JB8A 2Y0PA 3VBRA 1Q8IA 1S72V 4IV1A 2XR4A 3BB6A 1XQNA 1FYUA 4G4FA 3MPPG 1U0AA 3DYMA 2HWF2 3CRQA 4TTGA 1YDXA 2QDRA 2VW2A 2O8QA 4AEJA 1VMHA 5IJ9A 4BWAA 4K7JA 2JENA 2NLJC 1X9PA 1K4DC 3WQ7A 2XNDG 2WA4A 3KV9A 1VB2A 2C9KA 3CSXA 3H0OA 1S5HC 4K8FA 1ORQC 1T5EA 2VQAA 1XL6A 2E3CA 4Y33A 5LMUB 1MEC1 3CCMV 4OHYA 4KFMA 4CS2A 5TSWA 1ZNPA 4FBFA 1YZBA 3ZRSA 4DQAA 3V0BB 3JD2A 3OGVA 4AXOA 2IJHA 5B1BB 4XBNA 4NROA 4UCSA 3APBA 1IBMB 3HKDB 2ID4A 3D3AA 4BOWA 5IK7A 4JZ2A 4GB33 1XE7A 3SYCA 4ZHQA 1SZTA 2IXCA 3TXQA 1LULA 4J10A 2WNUB 2EA7A 4O4LB 2A79B 4OUEA 5BPXA 3ILRA 1GP6A 5FJKA 4MYEA 4XJWA 1RUJ3 4RQPA 3ZFFA 2W46A 5GZDA 1YXBA 1ZZ9A 1K45A 2Y6FA 5KWRA 4BZ4A 4QXHA 4AQTA 5CBLA 1A6CA 1M90W 4FAHA 4GKXA 5K0UC 3CXHF 4GKKB 4D8MA 4U2AA 4HOOA 1ZSPA 2TEPA 3C3SA 2QQWA 2RM23 5DUUA 5G04L 4YG0A 1AXYA 4DV4B 1F4NA 1OHHG 2LO1A 1RUG2 1VR3A 3GZTB 5C3SA 3BYWA 3PUAA 4YM0A 4UOJA 4AZZA 4LO6B 3VKOA 3AK0A 1TME3 4NAMA 3G7DA 3GBWA 5T52A 1JZ4A 4LOSA 4ASKA 4EFBA 4H7MA 4Q4W3 3CP1A 4Q0PA 3RYPA 2ZHNA 5IK5A 1OKQA 4MVQA 5CG8A 1VF5B 5CB7A 4NAOA 3UETA 3MLLA 4DUWA 1B3QA 1H30A 5IYZB 3ZFFB 1LAJA 1G7YA 2OX0A 2C26A 1W6QA 1ZL8B 2YXHA 5HBAA 3T30A 1J5EB 1R6TA 2RJKA 4U36A 1O91A 2J1RA 4AW7A 2PHWA 4P9JA 1Y3TA 1GO3F 5I0RA 3F5WC 2RS12 4XC9A 3E6CC 5J7MA 1W6NB 2XHKA 3LEGA 1AJOA 1OT5A 2D3SA 3J8F3 1I0HA 5FFOC 1YQCA 3MPBA 3BTZA 4DUYB 5AFBA 1WW5A 3J8F1 3CBNA 3R05A 2LUWA 1HKDA 3H9AA 2ZR2A 3T1YO 1J95A 3FYIB 1DGWA 2ETEA 4KBZA 2IXJA 2E63A 5FP8A 3GDBA 1QU7A 1LHOA 2EIEA 4WZFA 5FZLA 3D36C 1NT0A 3ZIWA 4DINB 3UT5A 3CL1A 4LBLA 3LOBA 1RVF2 3IKWA 5A70A 3MGUA 3CCLV 1XXNA 3ECQA 4LIVA 1IPKA 1ZZ6A 3WF2A 2P5BA 1RMU1 1W6QB 4XBQA 4V1PA 5ITZA 4AHXA 4EEQA 3WINE 2R0HA 5I0TA 3ZDSA 4DV5O 4XBLA 3WQBA 2VZRA 3B9IA 1XNBA 4R4ZA 1XC6A 1OPMA 3ZFGC 3AG3C 4QPGC 3POBA 2UXBB 2OIIA 2VY0A 2N04A 4JYCA 4JKKA 4IW3A 3VDDA 3UT0A 5K0UB 4X1YA 1ULDA 4GX0A 3LA7A 5FPUA 2XUMA 3CJIC 1FOD3 2FZ2A 4WFBV 3DYOA 2A70A 4X1IB 3TOJA 5F5QA 2Y33A 1HB2A 3OYWA 2C0ZA 2DCZA 1JUHA 5J1XA 4J80A 2YPJA 4L8QA 1LU1A 2X7RB 3P1IA 2YU2A 3OMAB 1KC8W 1D5NA 3WHTA 1BBT1 4A6OA 4LFBB 1OLME 4OLLA 3CZUA 1GM8A 2NN4A 3B9CA 3G67A 4K1ZA 2P5OA 3I5DA 4UB6Z 2ZHLA 3ABUA 1GMGA 4AHZA 3RGBA 2C6SA 3ZHUA 3IMMA 5A3LA 4JI4B 5FZHA 1SA0A 1JQ0A 3LFMA 1OPOA 3M7MX 4X8AA 3G4SV 5FMBA 4B1LA 3PLQA 4UVAA 1GQPA 2UY8A 1CONA 2CTWA 3ETEA 1DGSA 4NIIA 1OD5A 1SQVH 2F66C 2ZX0A 1OCRB 5FL7G 1GUIA 3AM2A 1AF9A 1OVPA 1V6OA 3GNEA 2JXAA 3UGGA 1BQ0A 4B7KA 2GH2A 2DJVA 3S3XA 1Y6XA 4WCEV 4YVSA 4HBNA 5A1LA 1UIKA 1EP0A 4JTNA 2NLRA 4NXNO 1CESA 1DQ0A 4BB3A 1F35A 2YU1A 3H7JA 2OT5A 1QLEC 1OCOC 3MYXA 2G1MA 1VQMV 1DQ1A 3MLJA 4BW5A 4J7KA 2YICA 1BZWA 1QY4A 2P4EA 2TBVA 3JBG1 1RTVA 4FPHA 4HNAB 2UUCO 2RS53 4Q4Y1 4RS5C 1OC1A 2K1EA 3TN91 4UCVA 1C8NA 3M70A 3KV6A 1BKZA 3FN9A 4AGGA 3J7HA 1SA0B 3OUFA 4AI8A 4HL0A 2B42B 2RS51 1O5LA 5C5UA 4XF9A 1IGOA 5EBMC 1EZVH 1QQP2 3RYCA 3SJCC 1NCQC 1KFXL 1SERA 2G9ZA 3ZVXA 5BNPC 2R041 4CEWC 3DC5A 2NYYA 1RUE2 1QJEA 2L6LA 1MSWD 3N27A 5J96B 4H3WA 4QPGB 4Y1ZA 4DW0A 4D6QA 1ZX5A 1QVFU 5A3TA 5EV7A 3LQCA 1N32B 3HB3B 4OPHA 5L3GA 1AYM2 4Y3OA 4YVSB 5JXJA 3UM7A 1AR93 3VHPA 5LYJB 1BQPA 1WCDJ 5D8AA 4TOIA 3CJIB 4QX2A 4LO7A 4MW3A 1F4AA 1JCHA 2ZT9B 2CUGA 1VQLV 4TLFA 2N74A 1EAH3 4XFAA 2DE0X 4AEKA 4MG2A 1M9NA 1H2SB 1O8PA 3I4IA 2VBPA 4A44A 4UFLA 3O0WA 3B09A 1O3QA 1VBA2 2LW7A 3NV1A 2GC3A 4AHCA 3HKBA 2VMCA 1NR1A 2FTKA 3J80N 3AKRA 2UUBO 4UCUA 2ORXA 2P3KA 1MZ5A 1PP9H 2E26A 4QDSA 3FKSG 1S0CA 3DXRB 3T1YB 4ATEA 1Q82W 4B3MB 4WZCA 4LKDA 1UMIA 1BVVA 4FXGB 2X53S 2Q1MA 3T1LA 3ZRXA 5LGNA 1L0NH 4WV8A 1W8NA 1FMD2 2X5IA 5JPMB 2ERFA 2IZWA 5FZMA 1DGRA 1QH6A 1VBC3 2VZVA 3K2OA 2HJIA 1Q86W 5FZ8A 5A7QA 5LA6A 1KP2A 2CH7A 1HRV3 5C8CA 4QQLA 3AG1C 2M6YA 4KI5M 4XW3A 2AW9A 3U14A 1W2AX 5JXIA 2AHYA 1DGRN 3F95A 2A6ZA 1D2QA 4EN9B 4KMQA 1A8DA 2WBKA 3POIA 3VBSA 2HWC3 3I2FA 5K4LA 4ARXA 1PIV3 2YEVB 5DDJ2 1OCOB 1A32A 3FHQA 1OKOA 1PIV1 3MF9A 1FYJA 2R6QA 2V4AA 4QX3A 2GNBA 1QHTA 4MS2A 5CB4B 2XHNA 2NM1A 1OSGA 4LBOA 4RS5B 3ABTA 5H5NA 5LB6A 5LXTB 2QQUA 2XB6C 4JCKA 3WU2Z 4EN0A 1HXS2 1VQ6V 2XWBB 1H2KA 2JG8A 3RZJA 1TUBB 1P84F 3POFA 1NCQB 2CDYA 3BU0A 4NN0A 1PO12 1MZEA 1NTZH 3BCWA 1CD3G 2OVUA 3QF7A 3R4SA 5BNPB 1JR9A 2D6NA 4CEWB 5FZAA 3NV2A 3LEIA 1XMQB 3TB0A 4RGAA 4XHBA 3T2QA 3S30A 3NJYA 2ZM6B 1WD3A 1RFYA 3PMSA 2VXRA 5DMYA 2QDOA 4CVUA 4P14A 4X62O 4CP2A 4I9QA 3F2ZA 2GDFA 4XABA 4K9SA 1K4CC 4W6WA 3O0VA 4ZOLA 1GNZA 4NXMO 4HZ3A 3VBSB 1AR4A 1I9RA 1J59A 1Y9QA 2WNVA 3ZN0A 4LR3A 5GLZA 1PNGA 1KD1W 3KGLA 1TZOA 2P6CA 1I3HA 5LA0A 5C71A 1C3HA 1LHNA 5T5LA 3ZXLA 5A6XA 5E79Z 5D21A 4QGLA 4B7EA 5EIBC 5FUNA 5KAIZ 2PHUA 4R52A 5FYSA 2KG7B 4CCNA 1S0GA 2ES3A 1ENXA 4P5YA 2ZHKA 3CMAV 3RWNA 3A0NA 1LECA 5FY7A 1P4RA 3D82A 5IVEA 1OF4A 5IY5C 4K21A 1E5IA 4DV0B 3E22B 1UPGA 5KUKA 1MS9A 2PAMA 3O65A 4J6GA 3QH6A 4URAA 4FPLA 1BL8A 1M4WA 3C7GA 4HKWA 1RPOA 4XFCA 4QE9A 4I2OA 1S0BA 2WNEA 3ASNB 2PELA 2Q9LA 4DR1B 1CWPA 2XQXA 1KQSU 1LOFC 3FWEA 2QKSA 2WS92 2XAFA 2YIAA 4X64O 2LFRA 3AG1B 3ROUA 2YPDA 5JZGC 4RYDA 1D7PM 2WNVB 1UMHA 3ICXA 3A0BZ 2P3JA 3IDCB 5LA1A 2LFSA 4PA9A 2WO7A 4EFEA 4RUEA 3AKQA 2JGDB 1YC61 2NMOA 2XXZA 3SHRA 5FR3A 4AK3A 1U5ZA 5FWEA 1W6PB 3HBZA 5I93A 2RS33 2XBO2 4OMDA 5EBWC 4LHSA 4ATFA 3JCZA 3O1PA 3E8BA 1NA1C 3QG5A 1AJNA 3K77A 2R49A 4MVZA 3BIEA 3WG7C 1RP3B 3B8MA 1BEV3 2RJ2A 1I5PA 2RR12 1WZXA 2O57A 1YYNA 4LO5B 4PF5A 1D2SA 4SBVA 1BEV1 4DV3O 1ASJ1 4JGSA 2JDAA 2VUJA 3RYFB 4DV7B 4DR7O 2DVGA 4RSUA 3HKEB 3QOPA 2RVAA 4D69A 1HNZB 3T0AA 3KB5A 3JASA 1KEXA 5SV8A 5IT9N 1Z7S2 4WBNB 4LNUB 2Q8VA 4I30A 5L3EA 5A32B 2IH1C 3AMPA 3WNMA 3NRUA 3MW4A 5FYUA 5G05L 4NVPA 2XQRA 3I2IA 4ICGA 2JK5C 2HVKC 1B35A 2C24A 2QA4V 3GF6A 3TWIA 5HCBA 3V56A 3VD7A 1N34O 4W4KA 2HWB2 4DR3O 2RMU3 3AKPA 1VQ9V 3RZKA 4CU8A 4FLTA 1W6MA 4JI1O 1RUD1 5A7SA 2ENRA 4YW4A 2GP5A 4DS0A 2IXHA 4JQRA 1R73A 3JSNA 1KGYA 3POSA 3RYIB 2UXXA 3JATB 2A3QA 3OOXA 1RIRA 1UZYA 4TYSA 4XJUA 2RCVA 1RSOA 5IY5B 4LKFA 3R4UA 1YSCA 2JVDA 3EMRA 2L35A 3E83A 4MSWC 1ENSA 1O6UA 1Y67A 2E32A 4IGGA 5FLXN 1UZWA 2Y26A 4QGPA 5BNNC 3B5LB 2IU3A 1ACCA 1AUYA 2Y0OA 5F39A 2QDNA 2QQMA 3NKTA 4QKDA 1H4GA 2VE1A 3DXUA 5FCCA 3VBFA 4LQRA 4NR1A 2ZQMA 1UOJA 4U3JA 3LOIA 4UBGA 4YW5A 2B9VA 4EWDA 1UWWA 2YXSA 5FYTA 1XRUA 2H8PC 2PHDA 1WCUA 4DZGA 2EXHA 1O8SA 2BSKA 4EN7B 2QKAA 4GMP0 2DQ0A 2NNUA 4AFBA 2Q0OC 3KD4A 5JZGB 5KX5A 4K8ZA 4I3GA 2FZ1A 1UJWB 3OBAA 2RE9A 2B9ZA 4XQ4A 4CP9B 2VOWA 4LPLA 3VZOA 4RA0A 1F5JA 5C6CA 5JH7B 3ZXKA 1I7FA 1VIBA 3MV01 5J9PC 2VZSA 1NA1B 4LBNA 3EQEA 1AYN3 1RSOB 2K9PA 3WG7B 3ZHVA 2XAJA 4JV5O 1AYN1 4W6XA 2HJDA 4JGYA 2GBOA 1NCRA 1PO22 1N0NA 3RYRA 3LF7A 4BQWA 3KCCA 2Q30A 2EX3A 4WVVA 2HLDG 3RI9A 1D4M3 1NX9A 2VD7A 1UU5A 4Q4V2 4GKJB 1BLZA 2XUEA 2A75A 4IV3A 2BJSA 2XVKA 3CRMA 4FSJA 2VR4A 2JS3A 3I59A 1NLSA 1AXKA 4E9KA 1DIWA 1KITA 4JVAA 3ST7A 2VOVA 3GCWA 2VZ1A 4DUZO 4LO8A 4DR2O 5L9VA 1FS0G 3FC0A 5GZEA 3H1LH 4FFKA 3WF0A 5AC91 2DYSC 1H8VA 4TLGA 4Y5Z0 1JXNA 3MHZA 5BV6A 1UNBA 5FP4A 4BQYA 5HI0A 2Y6KA 3S5QA 4COWA 2BTOA 3ZIXA 1ZREA 4PBPA 1ZBE3 2ZGLA 5IATA 2BOBC 5LHIA 1CAVA 1ZBE1 2WLMA 1MACA 5L19A 1W9YA 5J09A 3RMYA 4A7KA 3HJRA 4JQTA 1LOGA 4Y1VA 5CMUA 3FFZA 4AQSA 3NXSA 1YTFD 3LNNA 1ZAUA 5IVVA 4YFZA 3U1XA 2JD9A 1F5FA 4GJZA 5BNNB 3NWKA 1NVPD 3UK9A 5LW9A 4U3FH 3TJTA 5LP6A 5BNQA 4WM8A 4GJYA 2OIEA 3I59B 1SLAA 3OAAG 4GD4A 1VQKV 4AAPA 3WG2A 3QO7A 4FPOB 4K6BA 4GZRB 4L11A 1MEC2 2AH2A 5FZEA 1VF6C 1GN6A 1GP5A 1GBGA 4KWUA 2HWE3 3B8NA 2F4VB 4I7ZB 1YLLA 3KKYA 2Q4SA 3MDSA 1LEDA 3SYQA 3CJHA 3DV8A 2ZGNA 2XKOA 2OTJV 4P08A 4FZ1A 3ZXJA 5GM0A 3HNBM 5BNOC 3D5OA 1U5XA 5EYYA 1XU2A 2D3RA 4JYBA 1CAVB 3IBMA 2OYQA 4RGKA 1NXD1 5BXXA 3A22A 5A7WA 4AI2A 2Q69A 2NP0A 3QLQA 2FB5A 4GQ7A 3NNLA 2JD4A 1G6UA 3L9JT 4GIQA 3T1HB 2XJQA 3KS7A 4TV8A 5FXWA 3ENRA 1RUNA 2VMEA 3KWVA 2FCTA 2E51A 4Y5TA 1R3JC 4FAGA 4FM0A 2ZMKA 3DEMA 1DP0A 4NTWA 5FY1A 1SZXA 4YY3O 2CTVA 5A7NA 4AEDC 3H1MA 5ISLA 1AP5A 5DABA 2ARXA 1VBD3 4PF1A 1EN4A 3CCVV 1JI6A 1LEMA 3FLPA 2V73A 4XF1A 4CDUA 1OXCA 4CCMA 4RQEA 3CJHB 3QCWA 5AVPA 4C8DA 2DYSB 1VAMA 1IXMA 1QJX3 3HD8B 1W04A 3FB6C 3TRSB 2ZDIC 5FYVA 3ITQA 1QJX1 3OGGA 2VQEB 3K4AA 2OZ6A 4PDRA 2QWQB 3AZVA 3H7YA 2ZIMA 2OXBA 4CDWC 2BEOA 3K46A 3EXAA 1YWKA 1OQEA 4X66B 2WYSA 1GANA 5ABJC 2YGLA 4OFGA 5DAVA 3M8LA 3WW3A 1ZYBA 2VH9A 4MZUA 2GH8A 3CRRA 3ZKUA 4AE2A 1RUH1 1T6GC 4ET7A 1UQXA 1DF5A 1GWLA 5A7PA 1KS4A 1UOFA 1VLNA 2XVGA 4BPZA 1L7LA 4JV5B 4DV2O 4EZ4A 2GZWA 5KHKA 1IKPA 2UY9A 4EB6B 3N2KA 4F6RA 1FPN3 2J42A 3WG4A 3N2GB 4L0PA 3LAGA 3HKCB 2ATKC 2VJXA 1ENQA 1H9WA 1HW5A 1EUUA 3QO8A 3C7HA 2PYLA 4OZXA 4YM1A 2AZ0A 2PYTA 3SPHA 1X50A 2C5DA 4DV6O 3VV1A 2CWMA 1XHZA 5F8PA 3SYOA 3LSQA 1NLRA 5BNOB 3ZFEA 1GFF2 1XQ8A 1RMU2 1ZRRA 1LNSA 4YW1A 2HWF3 2R061 1HNXB 1UYYA 3E8GA 1PZ8A 1WLEA 1PK6A 3LDKA 2Z4FA 3GZUC 2WAAA 4XVHA 4ZU5A 4N21A 1XNQB 2ZX1A 2EAKA 2JDKA 5EIYB 4QDQA 4WM7C 4NRPA 4TV9A 3DSQA 2BCCH 2RDNA 4H33A 1VEWA 5F7UA 3L72H 2DUOA 4LF9O 4I3PA 1HQNA 1U5IA 5A33A 2EIDA 4JI6B 4AEDB 1K73W 4BLIA 3RFRA 1K5JA 1VRBA 2VUCA 3EYPA 3MZHA 4F6RB 4AG4A 4XQDA 3FB7C 4MX3A 2BZDA 3O1OA 3ABMC 5B4XA 4UFHA 2WN2A 2ET7A 1SQBH 3RI8A 4LF8B 3JALB 1H0BA 3MLKA 2EICA 4AL9A 3B01A 1G9BA 1BBT2 2QQKA 1TUEB 1AR71 5FMOL 2WDBA 3AG2C 4Y20B 4M0HA 1K3IA 1S0DA 3MI8A 1FAYA 1JYCA 3EBRA 1N36B 4LMFA 5FZ6A 2VMIA 4FJCC 1YO8A 3TCUA 1PK6B 5IWAB 1HIXA 1X8MA 1FKAO 1DF0A 4XDQA 4LLFA 1KJRA 4E4DX 1IBLO 4N53A 3P30A 3CKHA 2Q4PA 3O14A 3IAPA 4R9CA 5JQGA 4RFT0 1IOAA 5ABJB 3LDDA 4QHZA 4I0XB 2AEZA 4YXWG 1S0EA 3DKWA 5LRRA 1RUG3 1TMF1 3WW4A 5JOZA 3SISA 2IUWA 2Q7EA 1Q81W 2Q7GA 4FLYA 5H9QA 3X2QC 3VB9A 1RUG1 1H1AA 3SDLA 2FDKA 4KP4A 4NHKA 4CEYC 1H8TC 1IS5A 1IDSA 2HEPA 3IFXA 5EBLC 5B1NA 4BH9A 2JIJA 2HWD1 2Z79A 4NTXA 1Q5OA 4AVAA 1TEIA 1QF3A 3I2GA 1RHI1 4YY3B 3ZMUA 4IERA 1UZVA 1WCKA 4E27A 1AZDA 5JSPA 4QB6A 5FUIA 2W1WA 3JBG2 3CO2A 2XOKG 3ZMOA 4OHVA 1GWKA 1MS1A 5L3BA 4Q4Y2 2UWBA 3RJ2X 3TN92 3OEAA 5J48A 3HAGA 1S0IA 3KZIZ 2RS52 3Q8CA 4FPYA 3PJSK 2XAQA 2D43A 4PA7A 2EJ7A 1DGWX 4H2AA 1P49A 3Q8EA 2VCMA 1LGNA 5LBEA 2QQOA 2R042 4Y1UA 1DZRA 1F51A 2WAMA 3K4ZA 2RS13 1Y76B 2WSSG 4Q4X3 5J2TB 5FQ0B 4BQXA 3IIAA 1JYNA 2G9FA 4TSFG 3HQXA 3KV5A 1HN0A 5FPRA 1N33O 4ABMA 1ZZCA 2R072 4Q4X1 1W2NA 4O7XA 2Q8CA 5LY1A 3OUIA 1EV12 3N9OA 4DR4O 4GXLA 1KECA 1Y9MA 2XT9A 4HFSA 4XHXA 2UUAO 4ZXEA 5T3NA 4BIFA 2GNTA 3SPGA 2PHXA 5FP9A 2W94A 1LHWA 1FFXA 4AQ2A 5B2GB 2PXJA 3ABMB 4CH4A 1ZUQA 4KHPB 2HEYF 2JS5A 4CCLA 1RVF3 4I4TA 3THOA 5FZDA 1RITA 4RHV3 3MUY1 1AR5A 1RVF1 2XASA 1P7BA 2WT1A 1YIPA 5H9PA 4K8XA 4OI2A 4UF0B 4RHV1 3WP6A 3WF4A 4FLUA 2W9XA 2VQFB 4W4ZA 1WCSA 1YITV 5CNAA 3QD6A 5EJ1B 5F32A 1QKQA 4HVQA 4X9QA 3DPRA 2OPKA 1PD3A 1PVC1 3GZEA 3GHMA 5H2FZ 1PX3A 2R0FA 1WP7A 1FJGO 2WQ8A 1COV1 2ARCA 3SYPA 3TEWA 3OTFA 1M93A 2PGGA 3UKNA 2L9LA 1V6MA 4RN5A 2GP3A 3X2QB 1QWRA 5BR8O 2VOTA 1M56C 1W90A 4CEYB 1FFXB 2ZXWC 1H8TB 1ALYA 4V2VA 2AZ2A 3KT7A 3Q9OA 3CHXA 1CEZA 2EAAA 4LJHA 1S0FA 3W21A 3ZXFA 4B3SO 3WP3A 1XNRB 2DCYA 5FKCA 5JSRA 3O1VA 4HYOA 4DXSA 3BALA 3IMNA 2MEV1 3A8TA 2W6JG 2VXJA 4IEZA 3I97A 5LOVA 4JAUA 5FZOA 4BQ3A 2XGXA 4LF5O 4OULA 3NV3A 3Q4HB 2B39A 2JG9C 4EE2A 4DY5A 4W4LA 3L2YA 4MOAA 4XETA 1UKRA 5JXGA 3DPRB 4GMP3 2JJ6A 2AZ5A 1ZA7A 2WA3A 4CBCA 4JKMA 1OA2A 2WNOA 2FBEA 4A2UA 4GMP1 2Q8EA 4B3RO 3JD73 1HRI1 3GJBA 2ZGQA 3KQ4B 4P9WA 4QHBA 5DAWA 1TQ5A 4BQ4A 4LWSB 1BQZA 2YC0A 4C1WA 3H9VA 4JZRA 3JD71 1XI1A 2A1XA 3NJVA 1LTEA 2HBUA 4O4JB 3VD3A 4B29A 4FPGA 5C5TA 1M4UA 2W6IG 2CY6A 3AB0A 4XEZA 1G9CA 3ZHTA 3ZSMA 1VQ8V 3LDRA 2OZJA 5DECA 1KDKA 1LR1A 5JJNB 3CRCA 4Q8LA 5SV5A 4FLVA 3AZZA 4JC1A 2JDYA 5LBFA 4GUNA 4CCDA 3VQVA 3L75H 1FXVA 1QJZA 4FQZA 4AQ6A 1FXZA 4QX0A 3DGTA 1QOTA 5AVAA 5F5CA 1K92A 2ORZA 1KJLA 4N9IA 4Q2FA 4CH5A 2R7EB 4X88A 1L7QA 1R1BA 2CTPA 4OX9B 4JI5B 3DCQA 1QQP3 1UIJA 1HDJA 2MHFA 1GK9A 4XURA 1DGLA 2XLGA 4XF4A 4NE9A 1SBDA 2DF7A 3ACLA 3W7XA 3OSDA 3OTOB 1RUE3 4R9DA 2OYZA 3WP5A 3RZMA 4JI3O 1W8WA 4K3UA 3ZN6B 4BK4A 1W8ZA 1TNRA 4PDWA 1BS3A 2IJJA 4NWWA 5FPXA 1CAUA 5GALA 4ZKTB 1AYM3 1O3TA 2GALA 2YUEA 3VD5A 1MQTC 1ULEA 3M3EA 4M3CA 5C4WA 2ZE5A 4QPIC 3G6EV 4CH3A 2AC1A 1WMXA 4NRMA 5J98B 1HR0B 1M56B 1A3KA 2ARBA 3SH5A 1B09A 4NWVA 5IYBO 2VRZA 2ZXWB 5EJZB 1VBA3 4AFAA 1AR1B 3SH4A 5DUXA 4QE7A 3HBKA 4KQ7A 4XXPA 4FM2A 1RUF1 3ZYJB 2BVVA 1LESA 1ODMA 4BYYA 5LGUA 3OR6C 1V00A 3CQOA 1DDLA 4DR4B 4FVVA 3MIEA 3GGLA 3KGZA 3W7WA 1QEXA 3U0ZA 1DQ4A 1AX1A 3H8UA 4P9IA 1O5UA 2LM3A 4L92A 3FB5C 4CU7A 3N3HA 1OOPA 1ASJ2 5CFDA 2IBZH 4DIQA 1FMD3 5LK7B 2AGAA 5DG2A 1WPXA 3MIBA 1W8OA 1ZRCA 4GAZA 1OBNA 1CIWA 2AENA 1NZCA 3ALQA 2VW0A 3THDA 5EZYB 4ORFA 1CAUB 3E8FA 1GOGA 4XTMA 2EXJA 2EF6A 2BNMA 2ZKLA 2P7TC 1ZM1A 1OMIA 2WLIA 2XHBA 4NPLA 5C4WB 1PNFA 3USUB 4ES9A 1WB7A 3FX7A 1LR5A 2YXLA 5DAQA 4QX8A 2VZPA 4IE4A 2YI8A 4JTDB 5JDBA 4BR6A 1WP8A 4K0KO 2D6OX 1OCCB 5HPOA 4R9BA 5DDJ3 1HQWA 2E76B 3L2HA 4X1KA 3WDUA 1G86A 3AL5A 2AXTZ 1S2KA 1E5HA 1JUIA 2XAGA 2D7FA 5AG2A 5KA5A 2OCHA 1RUD2 5KMGB 4HPKA 1D5AA 3ZEDA 5JIUA 4IL7A 3H1WA 4J7ZA 4WFHA 2VOXA 3OEEG 1VMFA 1HXS3 4RD7A 4COUA 3POYA 2QQLA 3PVBB 1FFTB 1MA1A 1G9FA 2ET1A 4XUNA 1AB3A 1PM9A 1VALA 1PO13 4K40A 3S0MA 1X33A 1OURA 4A3ZA 4IQPA 4JRLA 5EYPA 4U7NA 2XJTA 1AR61 4LHNA 1BHBA 3LPFA 5JOXA 1NR7A 3U78A 4IEVA 2HHHO 3WG3A 3G6BA 3VDAA 5CA0A 3GBGA 4PQQA 2WYFA 3QTCA 4A5UB 1SHWB 3UKVA 4LFCB 3M99B 1V70A 1S2BA 2WLKA 1HW7A 1QJFA 2NPIA 3WDWA 1MQTB 1OI6A 2Q1FA 3K4DA 3RT3C 4OGQB 5B5EZ 4AILC 4QPIB 1IS3A 4SLIA 4COZA 4X1KB 3R65A 1I5ZA 1HDKA 2AACA 3AKSA 3PMEA 4B3TB 4N43C 2EBOA 1O3SA 3WHUA 1LB2A 5EP9A 2XPJA 1JBCA 5FPOA 2ODMA 3RYKA 4J25A 1J1TA 1US6A 3ZYGA 4D0QA 1BMV1 2X09A 2Z0AA 1WA6X 3SKVA 4IEYA 2Q6AA 1JFFA 5KHJA 4QX1A 3OMIB 1OF3A 4GALA 1IURA 1AYN2 4GKYA 1DLLA 4UYBA 4EROA 1UYPA 3NAPC 2WLHA 2GNMA 4G28B 4QU2A 3JAKA 3WDTA 3TYJA 3CB2A 3N36A 4XILA 5JLVA 4XF0A 3WXPA 2WS93 1TG7A 5FZ1A 3EVKA 1Q8PA 3ZN4A 1SQQH 2UU9O 2D5HA 2J1AA 2WS91 1EYBA 1V6KA 3H3LA 3CYOA 2JKBA 5FYBA 2Y4TA 3QO5A 3D0JA 3IPVB 1GZWB 2VC9A
chains in the Genus database with same CATH topology
3PMSA 2VXRA 2ZAAA 4ITCA 1HV0A 2DFBA 3SCFA 1POV0 5HXVA 4P14A 2WZR2 2VU9A 4FQ4A 4GWNA 4ISQA 4PIZA 2IC1A 4LULA 3VDDC 3THPA 4CP2A 3OGJA 1HX6A 1FNZA 3B94A 2GDFA 3KSCA 4R9AA 5AC92 4K9SA 1VBC2 2XBO3 4W6WA 1JW6A 3O0VA 4AI3A 2W52A 1GNZA 5CU1A 4EN6B 2AGSA 3SWTA 1S0JA 2VNGA 3VBSB 1YFYA 1I9RA 3VBOA 2R1DA 1J59A 1Y9QA 2XBO1 2WNVA 4M01A 5GLZA 1PNGA 1HRV2 3KGLA 4C90A 1I3HA 2A3YA 1OIJB 1C3HA 1LHNA 4Y4YA 1QH7A 2NMNA 2UWCA 3H1YA 5T5LA 2RR13 3ZXLA 4YZ2A 4C1XA 2NQYA 3M3OA 4QGLA 5K8SA 3OD4A 4B7EA 4MLOA 1ZBE2 4XTPA 1QDCA 2PHUA 1OIHA 1J58A 1V6JA 4R52A 3LWCA 5KC6A 3WY6A 1WA4A 1S0GA 2ES3A 1ENXA 1REDA 2GU9A 2ZHKA 3SXWA 3RWNA 4Y0EA 3A0NA 1LECA 1C57A 2HWC2 3X29B 3D82A 1YI9A 3UJOA 4HN1A 1PIV2 1ZRFA 4UXAA 1W0PA 1WW4A 4K21A 1C28A 2P17A 1WLTA 4FOVA 2YHJA 1MS9A 3JZVA 2PAMA 4FCAA 4J6GA 4YM3A 1J1LA 3QH6A 3BTAA 4JV4A 3WNXA 2E9QA 4FPLA 2Q1ZB 1M4WA 1DQ6A 3CLPA 1SDWA 4XFGA 4Z8BA 2CAVA 3H3UA 4HKWA 4XFCA 3FLRA 4S2GA 5C9AA 2YDEA 4I0AA 2ZX2A 4I2OA 4META 2XL7A 4W65A 1S0BA 4PDWC 2WNEA 2EXIA 3OBTA 2ZOEB 2ZGPA 3ME2A 3MIHA 3M3CA 2PELA 1Y43B 4Q1RA 1GZCA 3AYCA 1O4YA 1QJU3 1LOFC 3FWEA 3E6BA 2D3PA 2IXKA 4QQOA 1AHSA 2WS92 4N7UA 2HWB3 2XLFA 4AYUA 4BGMA 3IDBB 2WFF1 1MS4A 5C4WC 4Z1VA 5HCAA 1QJU1 3ROUA 4B8EA 1KDMA 2ZKNA 1DZQA 4AHYA 4QGNA 5JZGC 5BYNA 2WNVB 2W08A 4QQHA 5I8SA 1ND3C 1SCSA 4L97A 3GZAA 2B46X 3R6SA 2FHRA 2P3JA 1EPWA 1V6LA 3IDCB 2D44A 2UURA 2GMMA 4MGZE 3AKQA 1AX0A 5BNOA 1PMIA 1W2UA 4AWDA 2NMOA 2KM2A 1VZ4A 4YVSC 3SHRA 4AK3A 1U5ZA 5KBFA 4M3CE 5H9RA 1NE6A 1W6PB 3HBZA 5I93A 1UCXA 3AJYA 2RS33 4XOGA 1CVNA 2FMYA 2XBO2 2ZX4A 4UW5A 1ND2C 1LGCA 1AJKA 5FRAA 4ATFA 4FPKA 1FOD1 2R32A 3NJZA 1RUH3 1NA1C 4I01A 1CAWA 4ZU4A 1UD1A 2R49A 2E7AA 1CPNA 4ZXKA 1BEV3 2GC0A 4BIOA 3B00A 5FPZA 1SLBA 5JOWA 2RR12 3EATX 2IXIA 1LOEA 1GR3A 5K7PA 5H9SA 1YYNA 4LO5B 2R6SA 1D2SA 1OOPC 1SLCA 3PVJA 1BEV1 2X8KA 1ASJ1 1N3QA 3D4KA 3NAPB 4SBVA 2D6KA 5CFDC 1YIFA 1OFNA 5I91A 2VUJA 2WLPA 5JMCA 3VGIA 1FV2A 2DVGA 3VBUC 4RSUA 2ZCWA 2TNFA 4AEDA 5FO7B 3I54A 1QQP1 3PHMA 3QOPA 1DYKA 2ZGOA 1G6NA 2QJVA 2SBAA 4LBJA 4BE3A 4XJ9A 2K9ZA 4D69A 4URTA 4JAAA 3J9SA 4XJZA 3B02A 1UU6A 3KB5A 5SV8A 4MXWA 4Y22A 2QFEA 3S7IA 3URFA 1NYWA 4YFWA 4YGEA 4Q27A 1VZ5A 1Z7S2 1RUE1 5IUQA 4RL7A 1GICA 4BHPA 1OTJA 1ZZBA 2YV8A 4I30A 4YZ5A 5A32B 1FV3A 2A73B 2BFUL 5CVRA 1X36A 3AMPA 3K48A 3IM0A 4KGQA 2GC2A 3VZJA 3MW4A 3VDDB 4Q8KA 2I45A 5J3UA