2CGOA

Factor inhibiting hif-1 alpha with fumarate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
342
structure length
339
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Studies on the Inhibition of the Hypoxia-Inducible Transcription Factor Hydroxylases by Tricarboxylic Acid Cycle Intermediates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
total genus 106
structure length 339
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2cgoA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgoA01
4Z2WA 4BIOA 1IZ3A 2YDEA 3KCYA 4AI8A 4QU2A 4B7KA 3KCXA 2CGOA 5JWPA 2Y0IA 3P3NA 4Z1VA 1H2NA 2CGNA 3P3PA 3D8CA 3OD4A 1MZFA 2ILMA 4B7EA 1YCIA 2XUMA 4NR1A 2YC0A 4JAAA 1H2MA 1H2LA 2WA4A 1H2KA 2WA3A 1MZEA 2W0XA
chains in the Genus database with same CATH superfamily
5SV5A 2L35A 1N33B 3CCEV 4YXWG 4I4TB 1H1MA 3BABA 4COUA 3LFMA 3SR2C 5C9AB 1RB8G 4XJAA 4IEQA 4YHHB 4G2KA 1TNRA 4DR3B 3BPSA 4GCZA 3A0KA 1RUF3 5T5LA 4LBQA 1LU2A 2GU9A 3WINE 1GR3A 2CWMA 3RVZA 5K7PA 3FFQA 1GZWA 4XFIA 3OEEG 1PO11 3MFAA 1R3LC 1DQ5A 1W28A 3K0DA 1GKFA 3B8MA 4DR2B 2DU1A 2XL9A 2D7FA 3SISA 2YDEA 1G9DA 5F1RA 3EXUA 1W9FA 1SC5B 4DV7O 3AK1A 3WEZA 4GB31 4CCJA 2YC2A 4GWMA 1COV2 5A80A 3PJSK 3AXEA 2W0XA 4RGKA 4NIIA 1X9PA 4O2AA 2EZOA 4OMDA 4QKFA 1AB3A 1M5IA 1QJU1 5DAPA 4IV1B 1P8JA 2OIGA 4LF8B 3LEGA 5KAIZ 1LUWA 4AEJA 1JVMA 4BM8A 3ETGA 2C24A 2ZGSA 1CVNA 1XNKA 1VF6A 4I50B 5HI0A 1S0IA 3ZPOA 3AP6A 3OTFA 3K4AA 3POBA 3JATA 4LOTA 3ZR6A 1OBNA 3LPFA 3PU3A 2PI4A 2V4AA 2DCTA 5DUWA 4RHV1 1OCOC 3M3CA 4LBNA 3DGEA 3CSXA 2D6OX 2LALA 3CWBH 3RBZA 3SH5A 3QACA 2ZKNA 4ZHQA 1K42A 3P3PA 3JAKA 3FUQA 5FUPA 3ASOC 5IDJA 3PU8A 4JYBA 5FXXA 1QVGU 2MPFA 4W6XA 1W3XA 4FFKA 5LK7B 3AG1C 2QDRA 4LF9O 1ZUQA 4IE0A 4AI3A 2Q4PA 2Q1ZB 5KAFZ 2YICA 3SJAC 4BIFA 4LO6B 3ABLC 1IBKO 3Q4HB 4FLXA 3TNQA 2HWC3 2XG3A 5IK7A 1DQ6A 1H8VA 1G8MA 3WQ1A 1BMV2 2GN7A 3KZIZ 1RHI2 5FMOS 2NR5A 1X9TA 3H50A 2ZM6O 3W59A 1AXYA 4YY3B 3WOGA 4Y5Z0 5B1AC 1LHOA 3NJYA 1H8TB 4Q0SA 1WNSA 4DR5O 5F5AA 1GM9A 4LNUB 2Q4SA 5I8YA 1WCQA 5JR2A 2BQPA 3ORJA 3BUCA 4X20B 3BTXA 4UW5A 1QJX3 2IZWA 1V9U1 5EC2C 4WF9V 4YHHO 3G4SV 3B9CA 2RQ6A 5IK5A 1CAXB 1MQTA 1QQP1 1K34A 3VKOA 4QM8A 5FZHA 3U0ZA 4GKJB 4RAIA 5E88A 3HKCB 5F2SA 2R32A 4YRDA 4K40A 1VB2A 3LGRA 4FLUA 1D4M1 2BTOA 2Y4TA 3PUSA 2ZA9A 3N9QA 4UVBA 1RUH1 5JXIA 3USUA 1HKDA 1LODA 4FFIA 5J96B 4HNAB 3RW0A 1RUG2 2QR4A 2W47A 2Z69A 1QGLA 2JG8A 1SHWB 4YZ4A 2EXJA 2HWF1 3ZO0B 1CX1A 3DPRA 1PZ8A 1TME2 4UB8Z 1D0HA 5FBZA 5JXJA 3T4VA 4KBZA 1FT9A 4Q0UA 3FAVA 4QMAA 1VMHA 4QD2A 5KXBA 3IDEA 2XT9A 2O8OA 3KQRA 5K8SA 5BNNB 1Q86W 3ES4A 2V09A 1RM1C 4FM1A 1A8DA 5L3GA 2P22C 5A7NA 4QHZA 4IEYA 2FKXA 2PAKA 4IW3A 1H38A 3MF6A 4TUYB 2RMKB 1GH6A 5BR8O 1QIQA 1HRV3 1IXMA 4COYA 3BY6A 4FP2A 4XXAA 1N34B 3J7HA 5CNAA 2UXNA 3F5WC 2RS32 4BYYA 4GWJA 4QKDA 5IVCA 2WNUC 3B5LB 1LRHA 5D5PA 4PQ9A 1S1AA 4W4KA 1ENXA 2PUSA 4HVQA 4PV1B 2IXKA 4AEDC 1UYXA 5DDJ1 3UETA 2JIJA 4S2GA 3ALQA 4N53A 4YZ3A 1YJNV 4LFCO 1UKRA 5EZYA 3WW1A 1NCQB 3M8LA 2V4VA 4A4AA 2E33A 1IGOA 2BE3A 1BGYH 4PJYA 5H6QA 2VOWA 4NVPA 4GMP1 2I45A 5FZBA 3VUOA 1ZBE2 2BOIA 3CB2A 2W91A 4MX3A 2R16A 3ZXDA 1UJWB 4DY3A 1YSCA 1BEV2 3ZXKA 4QU1A 5KXDA 3DKWA 1GQPA 3C90A 2BSKA 2G1MA 3ACFA 3NNLA 3LF7A 3JXSA 4A5UB 1S0CA 1PO22 5KHKA 3HQXA 2NNUA 4J9YB 2DJVA 4QU2A 1ZA7A 1NKDA 4BIUA 2H0VA 1EM1A 4QGNA 5A3PA 1OH3A 5EK0A 2B39A 1G9CA 3OGVA 4Y5TA 2W1QA 1MS9A 1J3QA 4IGPA 2XQRA 2PELA 1FXKB 4Q4W1 2QTWB 4KWLA 5I0TA 2YI9A 4LA2A 4Q4V3 3EQEA 1N1SA 1SLIA 2ZE7A 2CY6A 1Q7YW 2QA4V 1DK1A 4CP0A 4DRVA 3OM3B 4CYDA 5HXVA 1IS4A 2KKWA 4TT3G 2YBKA 3J8F3 1UOJA 4JV4A 1BQZA 3D8CA 3WZ1A 4AFAA 4DUWA 1O9GA 4CUAA 1XNQO 4LKDA 1W03A 3I3EA 2UY8A 5JOYA 4RR3C 3OMNB 3NVCA 1NBMG 2JGDB 1SLBA 3T1YB 1B06A 1CXZB 5GZFA 1I1EA 3E6CC 4Y1YA 1LOEA 5AVAA 3ZKUA 4NIAA 4MG2A 3O1OA 1AYM3 2E5LB 1OJHA 2Q8VA 3VBHB 2YC0A 1KBHA 4M0HA 2WWJA 3IMNA 4AQ2A 5FOBB 1V6NA 3ASIA 1OA3A 3SPHA 5FFOC 3K08A 4J7ZA 2UUBO 4XDKA 2EIGA 4PF5A 3WDUA 3RYCB 3PVBB 3VQYA 3O1VA 4IIJB 1SLTA 4BA6A 3R05A 1RM1B 4ONUA 1QOOA 4UBHA 3FHIB 5GLTA 4KP4A 2WYSA 3MHHC 1WMXA 2DVFA 1HJGA 2RR11 4Z92B 4LBMA 5IJRA 4XQDA 1N1TA 1W59A 4HK8A 2QWOB 1LKNA 1Q81W 1VQNV 3AYCA 1ZVFA 4LTAA 4OXSA 3W7XA 4MVQA 1XOUA 5FYIA 3HKDA 4ISQA 4J9ZB 5A7OA 3HKEA 1QXPA 4LFAO 1H2SB 4XILA 1TMF2 3D0SA 3R6SA 2ZDIC 1FOD1 3GB7C 2BTVC 4TLGA 5FMBA 1XYPA 4P9GA 1DDLA 5GZCA 3AZZA 5ACA2 2ZGKA 4EV0A 1B35B 1FX5A 1CX4A 1QKQA 2ZHNA 3G80A 4LNUA 1XNDA 3CRQA 3ZIWA 1G9FA 5FO8B 1F7YA 1HDKA 1ONAA 1SPPA 4MLOA 1DGRN 2V7QG 3APBA 5LRSA 1UKGA 4M4PA 2NM1A 2EAAA 4WM8C 4COZA 1M93A 1ZL8B 2OKXA 5KX5B 2D3SA 2L9LA 4N53B 4XZPA 5F6LB 4D6QA 4LF5O 1MEC2 5L19A 2JEMA 2DYSB 2H3OA 3LOIA 3T1YO 2JDNA 2BFUS 3CCMV 4PCRA 4AGGA 5BNOB 1GNHA 3NV2A 3JD3A 2VD7A 1IZ3A 4FTEA 2DMXA 2ZXWB 4LPLA 4FXGB 5E1RA 2QTOA 1W9SA 3T4DA 2WQ4A 4QHOA 1DGWA 1QJU2 3OAAG 4XVHA 4QXBA 1LHVA 2KG7B 3EO6A 2JGUA 4FLYA 1K97A 2HEVF 2ILMA 1DIWA 3THCA 2VOKA 2BNOA 5LP6C 3RDIA 1H8TA 5FMDA 2BTQB 5CFDC 3ASOB 5KHJA 1M56B 1X8EA 3VBRC 2LGQA 2ZAHA 2QQPA 3CMEV 4IEXA 4FPEA 4IUGA 1NLSA 3BB6A 4PIZA 3E86A 1SFYA 2AHZA 1K5SA 1BHBA 2GNBA 4EN0A 2IM9A 1WCUA 4XUTA 1MS0A 4JGYB 1VRBA 4OI0A 1FXKA 4QPGB 4LIVA 4Z8BA 3PJYA 3L74H 1E1RG 4B08A 2WBKA 4N7IA 2UUAO 3MUY1 5JDBA 4RR3A 3B3QE 1JOBA 3H1MA 4ZHQB 5LOVA 4UOJA 5LMNB 3BA8A 1NS1A 4QXKA 1KS5A 5L3FA 4D7TA 2D97A 1KQRA 3ZYJB 3N2KA 3IC7A 3ZFGC 2EF6A 4AL9A 1Y7BA 4ES9A 5HV4A 1DQ0A 2AC1A 3NAPA 2ZD9A 4PDWB 3M70A 2P37A 4PA7A 2XKPA 2JDAA 1POV0 1PL4A 4Q4Y1 5J3UA 2YS8A 4BHPA 2CDPA 1W06A 2VOVA 2RDQA 1OA4A 1WMDA 2WLPA 1UU6A 1PVC1 2V72A 5GLZA 2YEVB 1GU3A 1MVQA 1AR92 3DCQA 4NHLA 2OYQA 5FPAA 3JAWA 2YBSA 2DVBA 1IBMB 2YEVA 4IV1A 3CX5F 1PO21 4HAMA 4LBEC 1UPSA 4QQOA 1AX1A 2IU3A 1DZQA 4YY3O 1LENA 3H0OA 2ZX2A 3S6PA 3SLIA 5B1BB 3AYAA 1D5NA 1GQHA 4HSLA 3NAPB 2JDIG 1NU1H 3K06A 1H1AA 5H9SA 5ERLA 2V4DA 1K4DC 4DR3O 3WP5A 3JD73 4OUSA 1X50A 1EV13 2FB5A 4KGGA 3AC0A 1T5EA 4MGIE 1NLRA 2P4EA 5EIBC 1N3PA 3D36A 1LCLA 1UW8A 1Q90D 2BZDA 1JYVA 4QB2A 3MICA 2CL2A 4PI0A 3C8XA 2R0FA 4PA6A 1O6UA 4DR7B 5A6ZA 1PPJH 4MGKE 2UXCO 3PUIA 1KD1W 2VZUA 3ABTA 4K9SA 1O91A 3I56V 5FZ7A 3TEZA 2HWD2 2VOXA 4LF9B 3WQ0A 2WAMA 1R73A 4FFBA 4AILC 2BUKA 1R3IC 5A3WA 2PYJA 1OXCA 4JQRA 5L9RA 3N9PA 2GV9A 3CRMA 3H8XA 1XJAA 3FHAA 4Q4W3 2D43A 2Q68A 2YIDA 1SZXA 1O8PA 3DPRB 2JXAA 4B8EA 5K1XA 1N0NA 2CE4A 1AZDA 2UXXA 1JI6A 3RS6A 2RS51 1GNZA 4A7ZA 2VZ1A 3I55V 1L8DA 4AQSA 5CA0B 4GJYA 1XUQA 3L2HA 5CU1A 4UFHA 5CMUA 4JGYC 1SESA 4I0BA 3POEA 3CXHF 1NA1C 5GLUA 5FZOB 1N3QA 3WNMA 3EB7A 1TVKA 4YG6A 4DINB 1WD3A 5JSRA 4NAMA 1RUJ2 2JB4A 1VQ8V 1ND3C 3HR9A 1DLBA 1CAVA 1OPMA 1X36A 2X7RB 4B3SO 2YROA 5KXCA 2JD9A 1XMOB 2GMMA 5JI9A 3DXRB 3SYAA 4WV8A 1N8RW 3CCLV 3O1SA 3WQ7A 1UY2A 5C8WA 4BQ3A 2Y8KA 2R0HA 4XBNA 1GP5A 3SPGA 2C2AA 4X1IA 3AG2B 1JYCA 1OCRC 1C8M2 1RUF1 3OYWA 4MT8A 1UOGA 3QNEA 5M0TA 1HB1A 2H8PC 2E51A 1MA1A 4AVCA 2ZKLA 2QWPB 2FZ2A 1SEFA 2IXIA 1SZBA 1KITA 1IBMO 1W04A 4WVVA 3UGGA 1W8WA 5EHDA 1UZYA 4IESA 4JI4B 2J1AA 2Y0PA 2XVKA 4Q2FA 1MEC1 3QO5A 3I4IA 1J3PA 3TXSA 1AHSA 1XPWA 4FFFA 2PAEA 1UOBA 5CA3A 2I2SA 2PZSA 3DL3A 3I2HA 1M4UA 1EN4A 5CAZA 3RVYA 3CEIA 1YIPA 2WS93 5JXHA 3HT1A 1WLTA 4W8JA 3BOPA 3PUQA 1MS5A 3GHMA 5CB4B 3MIBA 2OPKA 2GALA 5FJKA 3PL0A 1MS4A 2QFEA 2VGDA 1OI6A 4Q20A 3QH6A 4LQRA 2LROA 3SQOA 4E4EA 2WO7A 1YXBA 5G05L 1JZ5A 3WW2A 5DMYA 3D3IA 1M1KW 2ZIOA 1IS5A 5FZMA 1N33O 1WP7A 4DO2A 5ANQA 3ZRSA 2LM3A 1FV3A 2EULA 4H55A 4DR4O 2WNVC 2EIJC 4YM2A 3C7GA 3THOA 4DV2O 1X4TA 2MEV2 2D93A 2YG0A 1XBFA 4MW8A 1RXGA 1RUC3 3H3ZA 3WT3A 2ADDA 4HETA 1XNBA 5F37A 1WPXA 1HW7A 4B1LA 4K3UA 3T0DA 4R50A 3N9NA 1VJ2A 4CH6A 4ZOLA 1R083 4R8CA 2JS3A 1CIYA 4XEZA 3THPA 1GKBA 1GLHA 3IAQA 2D6NA 2Y6HA 3UCSC 3NSTA 1G9BA 2ARBA 5DAXA 1V6JA 3HKDB 3JCZA 5IK4A 2BVBA 1HRI1 1U5IA 4AK3A 2VCMA 5CBFA 1K3EA 2DU0A 5IE9A 2FBEA 5FPXA 2J1EA 1W8NA 1A78A 1JJOA 4AWDA 5EYPB 4IXLA 1K33A 1Z5VA 4OHZA 2XHNA 2XGXA 1Z78A 1RINA 3AVSA 3UT0A 2DN9A 2X29A 3PJQA 2E53A 5CA0A 5IWFA 3WXPA 2AEZA 1F4NA 3ILRA 3RT3C 2QVSB 4UCTA 4RGGA 5C8CB 3U37A 3TN92 1S72V 4K7JA 1RUI1 1YTFB 1OD3A 4FQ4A 3BI3A 3ZN1A 4XUOA 5KHGA 5KHIA 3RYCA 4YM1A 3BPZA 1PGL1 5F2WA 4E8CA 2JGDA 2YB7A 1KEXA 3NJVA 2CSGA 1C1LA 1PD3A 4MV2A 3V56A 1R1A2 3SJCC 2WLIB 1GM8A 3PUHA 2AREA 3FB6C 2H94A 3E89A 3KF5A 4LFBO 2DFCA 3KGZA 1HNXB 3LOBA 5LEJA 2YFUA 1HP8A 1AVMA 1IOAA 3ABKB 1IQDC 3R4DB 5IJ9A 2C26A 4RUFA 5JJEB 1VB4A 3WF3A 2ATKC 1CONA 1MSWD 3B7MA 1MMMA 3HEIA 4RSUA 4GQ7A 4E2QA 2RS13 4NWVA 3LEKA 2JG8C 5A7PA 4K0KB 4HPKA 2GDFA 1UIKA 4LF6O 1KD7A 5BNPC 4E8DA 1BLZA 4B1MA 1PL0A 4QKBA 4Y1VA 3AG3C 4XURA 2Y6FA 3LD8A 4FP3A 3ZHVA 3EVKA 4UF0B 3SMHA 5AFBA 3OBRA 5L9BA 4XFAA 3I7DA 3GZAA 3QF7A 3GBWA 2XJUA 3O5SA 4A41A 1G4YB 3RGBA 4DR1B 4GKJO 1YRZA 3MLKA 3D0JA 1US6A 4AVVA 1U12A 4DRRA 4R9CA 1EUTA 5EIYB 1NY71 3JD0A 5A32A 4XBQA 5K4LA 4NAOA 2GNDA 4CC5A 2XJVA 1SA0A 1NR7A 1BJQA 1ULPA 3DYPA 3GCWA 2H0BA 1ZZ7A 4HZFA 2CNAA 5IVJA 5E16A 1KKDA 4DRXB 1UQXA 1XHZA 4OHXA 3ACGA 1P7BA 2VUDA 4UF0A 5J2UA 4I0WB 1LOFA 1GN6A 2DWEC 4QT6A 2N05A 1SQ4A 5B4XA 4I9QA 2I74A 2VW2A 4B3RB 3T2OA 2UURA 1Y74A 4QIWF 4CEYA 2P06A 2ZX1A 1W3VA 1YHFA 5H9QA 1WA8B 3ZRWA 5CFDB 4LFBB 2W68A 1RVF1 5IJ0B 4DW1A 3NW4A 3WG3A 5F32A 1VBD3 2AHYA 5A7SA 1IKQA 4UFZA 1ND3B 3KHCA 1F4MA 2J1UA 1OOPB 4DV0O 1DGLA 4N90A 4WVZA 1A8MA 4LOSA 3SKJE 5DDJ3 5FZ6A 2JE7A 1STMA 2ZGUA 4S2DA 2ZXWC 4M3CF 1AR4A 3VZJA 4KH9A 2HWE2 4HFSA 3OEAA 3T1LA 1WAZA 1WMFA 3N7KA 3JYCA 3HVDA 4BK5A 1VIBA 1M9NA 4DR6B 1S0FA 2WZR1 2RV9A 4FT8A 4GX0A 2R30A 3ZOIA 5C8CC 1AYM1 1S2KA 1S3JA 3ZEDA 3RZGA 1H9WA 4BLIA 4Q4X1 3OGCC 2MHFA 1ZLZA 2IXJA 2AZ5A 2EAKA 1ZZ9A 4OQ9A 3LA2A 3CIHA 2XJSA 4AFMA 5L3EA 1ENSA 3AMMA 4HXCA 3LFIA 1T6BX 3LDEA 1ZWIC 1EY2A 4JCKA 4NROA 3FHQA 3N27A 4FLVA 1H4HA 3ZRVA 3CJIC 1JOYA 3HOBA 3I49A 3WG1A 4DK0A 1H8HG 1M4WA 1X59A 1RUJ3 2J42A 2FDIA 1FPN3 4L0PA 1ZL8A 3TBDA 4DOUA 1S0JA 3HKCA 3ZX7A 1CAWA 4LBKA 4U36A 5IVBA 2RHPA 1KUQA 4URTA 1YDXA 3K5OA 1BBT1 2DFBA 4GXLA 4A6OA 3BCWA 4I0XB 4X89A 3PLQA 2J7MA 4Q4V2 1QY4A 4XIKA 2X0LA 2HWE3 3BU0A 1KP2A 5LBCA 4XFBA 2F1MA 4LR4A 1LOCA 4N8MA 4R4XA 4AEMA 4O2BA 1RUNA 1I7FA 1YQCA 5GALA 1HR0O 4O4LA 1HN0A 4CCOA 3WF4A 4PELA 2X6AA 4L8QA 1N1YA 1HV1A 4P9LA 4MVUA 1M57B 1W6MB 4JAVA 1PIV3 1QU0A 3CC4V 3ZYIB 2OS2A 3ZYPA 1R1A3 2BCCH 1BS3A 4ZZ8A 4AAXA 4MTOA 1BCCH 4YJ3A 1R081 5FPZA 2ZZJA 3Q8FA 1WA4A 5D1IA 5I0SA 5D2AA 2WSVA 3WUCA 4N43A 3N36A 1URFA 3MIEA 3WDVA 1VEWA 3JATB 2VZVA 5F5QA 1I9RA 1DHKB 2CYFA 4ET7A 4MXWB 5ITZB 3W58A 1U97A 2RVAA 3FBYA 3RZKA 2VTFA 3TK1A 3UKMA 2K2SA 3VD7A 2EIBA 3J7MA 4U7OA 4NIDA 2HBUA 4AVTA 1AX2A 1PZ7A 1K12A 4LEJA 1XMOO 5EYPA 4UXAA 3E8GA 3HJRA 1PK6A 3H8UA 4CDUC 4IYHA 3X2QC 4OLLA 3G71V 3IB3A 3DC6A 2CDOA 2Z2SB 2YYOA 4UFJA 1NXD1 4J1XA 2WT2A 4Q26A 1YQ5A 2F4LA 4UW3A 2RDCA 2G9FA 3LSQA 5FY5A 2M7WA 1C8M3 4DUXA 2YXLA 2OQ6A 3NKTA 2P3KA 2OCCC 1H2GA 1DLLA 2OCHA 5IYZA 4D94A 5LY2A 2VC9A 4CPBA 1OOPC 4QWNA 1GOHA 4OZXA 1K5MB 1OSGA 3UKTA 4ISRA 3VDAA 3UL2A 4FM2A 5LHIA 1BL8A 1VQ7V 1BHGA 4X1YA 1DYPA 1TMF3 2R042 2IH1C 3DXRA 1R1BA 4IQPA 2I07B 2P3JA 5CVRA 2M6YA 2UUCB 2XMLA 5LA6A 4HKWA 2BPA2 1XXNA 3VQWA 3B9IA 1IDSA 4W4LA 3IT8A 1AJKA 3AKSA 1NA1B 3WP3A 5IY5C 2XJRA 5JQGB 3AM2A 1YI2V 5FWJA 2Y6LA 4PBOA 2EXKA 2ZHKA 3M3EA 1HXS2 3N3HA 3C2UA 4XW3A 4K1YA 2SLIA 1RUOA 4YLZA 2QTSA 4R9BA 3P32A 1JZ7A 5I0RA 4LK7A 3I2IA 4HVRA 2BW8A 1GZTA 5T3NA 3ZXGA 4XF0A 4BQ5A 1V9U3 1GYKA 2GUZB 4U2AA 2K9ZA 3CLPA 1ENRA 1MS1A 2JS5A 2HEWF 3ZJZA 5FZCA 1GOGA 1HQWA 4E4DX 2CU5A 4IV1C 3AZVA 5IFPA 1JYXA 4LF5B 4EWAA 1VRH2 3J7NA 4LKFA 3P6BA 5JJJB 5FCCA 4TQFA 1LR1A 4CZSA 1UO9A 1DG6A 3DF0A 1MVEA 3FAVB 4CDXA 3I2JA 4UCRA 3MPBA 1NZCA 3LSDA 2VQAA 4FPYA 3ZMSA 3R4SA 4QX5A 1RVF3 2A6ZA 1BXHA 5HBAA 1XRUA 1DP0A 3OCPA 2ZR3A 1OC1A 1PNKA 3WU2Z 4P9WA 4X64O 2YXYA 2VTXA 1DZTA 3C7HA 4F8AA 2WO1A 4I02A 2LUWA 3F2ZA 3TOJA 4YG3A 4A2UA 1W6QA 4K6BA 5B1NA 1VIWB 3L2YA 4JRLA 4QPJA 2JENA 5DPNA 4FPFA 1PKXA 1YUDA 3WF0A 1O4TA 2W46A 3SPCA 1LEDA 3CZJA 5A33A 5C3QA 2PY5A 1XDCA 1SF9A 2RDRA 4CDWB 3VBRB 4F6RB 5A3UA 1VQ4V 1EV11 4AAPA 2F4PA 2WKKA 3G67A 3GNEA 3BGAA 1V55C 4QQLA 3JCUZ 4XUNA 3U14A 4X88A 4CP1A 1RJ8A 3B94A 3VV1A 4UBGA 4JI3O 5L3BA 3AG1B 1XSRA 3ZFEC 2EJRA 3WG2A 4BMEA 1XSQA 4QPIC 1AI6A 4EEQA 3L71H 3WB2A 3B69A 4J42A 1YQ8A 3JBG3 1EPZA 3OTOO 1B35A 2A06H 4X62O 1OOPA 5T50A 5FZ1A 1R3JC 5BR8B 5CBLA 5SV8A 3I2GA 4ZS2A 5DQ0A 4QGLA 2DUQA 1AR72 1K92A 3ZN6B 2VUAA 2QWNB 4K35A 2ZPXA 2HWE1 1QR9A 2JICA 2W3JA 2VVDA 2D2CB 1DZRA 2HYKA 1OA2A 2VNVA 3MUZ1 1AP5A 5HCBA 1RP3B 4AXOA 1B35C 4OZOA 3ZBHA 2IJIA 2ZX4A 1U5ZA 3TYJA 3NNMA 2A6YA 1POQA 3RZJA 1XNQB 1LULA 4GYCB 1QDOA 2B5HA 2LW8A 3IDBB 3K58A 3OPWA 2JJ1G 3FLTA 5B3SC 3F7VC 1D2QA 4JI2O 2RJ2A 4OFGA 2G19A 2YIAA 3WNLA 4HT1T 2ARAA 1GM7A 1XC6A 5H9RA 4INDA 1GWMA 1S2BA 5CA1B 2EICA 3K04A 3ZMVA 4W65A 5FNVB 4HANA 5JSOA 5KHHA 4QX7A 2WNOA 4XJUA 5EIBD 2FCVA 3W5MA 4X64B 3ZFGB 4GJZA 2XLGA 1XI1A 2NN4A 2ZE5A 2B5UA 4X1YB 2DUPA 2RJZA 3BA9A 1U0AA 4DR1O 1BMV1 2OUHA 2XAFA 5BNNC 4JI6O 1LHUA 4FAGA 5A3MA 2BGPA 2VBDA 1HV0A 2EXHA 4FO9A 5FZLA 3B02A 3WP4A 3E8BA 4DEQA 2XJPA 3ABZA 3VBUA 4GMP3 4CP9B 4D69A 5JOWA 2QM7A 5FXWA 2DW4A 1CESA 5IYDO 5FY4A 5JVDA 3T2QA 5FPUA 2Q9LA 2X8KA 1GP6A 4RYDA 4B4QA 3IAPA 2WLJA 3R4UA 5A1LA 3TCUA 1HQLA 5LWBA 5CN0A 4HN1A 3SGIA 4BQWA 5EJZB 1JHJA 1V6IA 2XUMA 4YIOA 1YJLA 5FYCA 1S5JA 3CC2V 4A6SA 1EV12 1UNBA 1W2NA 4BK4A 3LPGA 5LBFA 1HXS1 3DXTA 4E2GA 3DUIA 2QQMA 4WFFA 3RWRD 1K5QA 5A7QA 2XNDG 3FLRA 1W2BU 1REFA 2VXJA 1PX3A 3I2DA 4YVWA 5H5NA 3E83A 4BW5A 5KMGA 3KT4A 3PTRB 3CJHA 2CTQA 4QE7A 2QSAA 4I2OA 3SYOA 1TZOA 5CEHA 1YIFA 3AP4A 1XNTA 5IATA 3ITQA 2P67A 4PA3A 5FR3A 4JGZC 3CD6V 1SQPH 2CAZC 4AFCA 4UV9A 1QWRA 3ICXA 4C90A 4OI1A 5FYSA 4LF8O 4JYAO 1N32O 5LOVB 2YHJA 2X53S 4JI4O 3MW3A 2PYLA 3JD1A 1FI2A 2XOMA 2KXLA 3K77A 4JZRA 5LBBA 1TUBB 3OGJA 1J1TA 1Y3TA 1ZRIA 1VMJA 4YGBA 2BOCC 1WP8A 2JG9A 1QOTA 2RS12 4NTYA 5A3TA 1A3KA 3MZHA 1QMJA 4H2AA 2UWAA 5D8AA 5FZ0A 1PX4A 3GWKC 2A79B 4HL0A 4MZUA 1QU7A 3HD8B 5KC6A 3ZFFB 2WT0A 3OMAB 4UCOA 3FE5A 3CZUA 3E22A 4CU8A 4JAAA 3U75A 4LE3A 2K0GA 2HJFC 3DYMA 2GC2A 3I2FA 2GC1A 3S57A 1N0JA 3BIEA 4YW4A 4X6RB 1PGW2 2A6XA 4YVSB 1COV1 1JZ8A 3USUB 1CJPA 4EFBA 4MVRA 2JVDA 2A3QA 5IWAO 3Q8CA 4QAWA 1O7FA 2D6KA 3SEPA 4DMIA 2WR9A 1U5YA 1L1FA 1VE0A 2N7GA 5TSWA 3R0RA 1S2EA 4DV1B 1FATA 4NB5A 1FOD3 1DGWX 4N9IA 4W50A 5KUKA 3CCSV 1UF2C 3IAYA 4OI4A 3M99B 2Q8OA 4GH4C 3RJ2X 4JTOA 1AYN3 2TUNA 3T1CA 2ZNIA 4XQ4A 4UUJC 3WCSA 1F35A 2HKXA 3K5LA 1U5XA 3UK9A 1SLAA 2ZM6B 3WD5A 5KX5A 3FC0A 2VCCA 1TGOA 4M00A 1W0JG 2MNGA 4BH9A 4UXNA 4X66B 4PQQA 4O4LB 2YXSA 4RHV3 3A2FA 1MPXA 1OURA 3T1HO 1WA8A 4DUYO 2DOSA 1JA8A 4PBPA 4YIPA 2DCYA 3NJZA 2UWBA 5JOXA 2WUHA 3KCXA 1G1XB 3AG7A 1H2NA 4B3TB 2Y26A 4CA9A 4DR4B 4WZCA 4ZU5A 4XHBA 4F3JA 4WVWA 1ZZCA 1CAWB 5ABJC 4YPJA 3E5QA 3FJSA 2JECA 4JDMA 3CCRV 2Y33A 2DYCA 1Z7S2 3WDWA 1H8TC 5AFEA 1AUYA 4MOAA 2EBOA 4H14A 1J3RA 1QF3A 5IY5B 3POYA 3O7OA 5I0UA 4GB33 4XJZA 5DN2A 2HWD3 2ADPA 3KS7A 3AVRA 3OGGA 3BODA 4YW7A 2A71A 3W7UA 1REDA 3WUDA 4Q4X3 4NPMA 3ZYFA 1D0GA 4AQ6A 5EJ1B 1QJU3 3JD4A 5F2VO 4GALA 3OUSA 5DDJ2 3I3BA 5E6HA 4WFEA 2FQPA 5KMGB 4DY5A 1K5MC 2QZ3A 3RI8A 3CE2A 2ATFA 4GWIA 1VALA 2VL4A 1O3QA 1JFFB 2YGLA 1KGYA 4CDQC 4HPKB 3WVJA 1CZVA 4CEWC 3S3WA 3EJKA 5CFCC 1R1ZA 2BGCA 4Q1PA 5DEDA 2OZJA 1L0LH 1TUBA 3VBUC 5L36A 1BK1A 3WR0A 1UZZA 4OPHA 1HWYA 4QNHB 3WG7C 4LO8A 1Z2GA 1KU9A 4FPKA 4M0NA 4A7YA 4LP8A 2ZBJA 4HVOA 4ZONA 3RPQA 2ZDIA 4RWUA 2XAJA 4Q6GA 1DF4A 5ABJB 2B1IA 2XL7A 1J84A 3ST7A 1EPWA 1VQLV 4Y3OA 3QTCA 4Q4Y3 5JMOA 3VBFA 4RQFA 2RMU1 3CCVV 1YTFD 5A9GA 3WW3A 2KQXA 2VZOA 5LBQA 3LA7A 5B4NA 3TAYA 2YMZA 5C4WA 3MIFA 5CFCA 3D3QA 1ACCA 3RYKA 2VW1A 1GAXA 4Y1XA 2OPWA 4KG8A 3BAAA 4DXWA 2GN3A 4P9YA 3L73H 3V64A 4QPYA 3N4MA 3TN93 2DBNA 3ME2A 1NCRA 1RUD2 2K9PA 2JG8B 2D6PA 3WNKA 3LSSA 5FPBA 3CP1A 1SA0B 4P9JA 1OFSA 5A2QN 5DUVA 1TME3 5LA2A 4DXSA 4COWA 1J59A 1TNFA 4QDRA 3AEIA 1LGBA 4X1KA 1HNWB 3BTZA 4O4IA 2LFSA 1HB2A 5KA5A 5C3PA 1ZBE1 3AMPA 1LR5A 2GP3A 2C1FA 1GO3F 1KC8W 1LB2A 5JXGA 1CAXA 4JI1B 4XCAA 4IE6A 2HEPA 1UPIA 1RUG3 1V70A 5C33A 4DIQA 4UW4A 1OCCB 1KDMA 3OR6C 1XE7A 3WDYA 5J9PC 2PQQA 3ROUA 3CRCA 3I8TA 2CH7B 4J6GA 3AG2C 4FPGA 1PNMA 2ARCA 4Q0PA 2OT5A 4NXMB 5EBMC 3UQ8A 4CSWA 4GH4A 2GTSA 4JASA 1GZCA 4BDVB 1ST8A 1O3TA 3V0AA 4DR6O 2Y38A 4TTGA 2WN3A 1L3JA 1PMJX 2HWB2 3MGUA 3RYPA 2E5LO 1YJ9V 4Q4W2 5FDBA 4MUVA 1JPXA 4DV2B 1VR3A 1J95A 4P02B 3NL1A 4WM7B 4GX1A 2FDFA 1FOD2 4DEVA 2VOTA 4I4TA 1PGW1 1PVC2 1LNSA 2QDOA 3WY6A 1ZRRA 2GH2A 3O9OA 1GWKA 2A6VA 4XTMA 3K75B 3CCUV 1AI5A 3H9VA 1GP4A 3IN9A 2KD7A 1XB9A 4LK6A 3ENRA 4MSWC 3D82A 1JW6A 5ANNA 3V65A 2KG7A 3VDDA 1JZ6A 4CC6A 3VBSB 2WABA 3J8F1 5BY5A 4R7CA 5GZDA 1UYZA 1OMIA 3BU7A 4AVBA 1FNZA 3APQA 4CU6A 2DWRA 1ALYA 2VNGA 1LNQA 5DUXA 2W1WA 3R66A 2ZMKA 1I08A 1B3QA 1VBC2 4YGCA 3W7TA 1JZ4A 1W8UA 1QLNA 3AYEA 3M3OA 1IX9A 3VD4A 5JWPA 2QKDA 2ZEXA 1BT8A 5DAWA 4O4JA 5E1AC 4BISA 3VZNA 5C7GA 4FOYA 1V00A 3O14A 4AQYO 5CKQA 5LHGA 2AZ2A 5FMCA 3NR7A 4EN9B 5K0UC 2F43G 4OQ8A 1IS3A 4I55A 2CGNA 5FZ9A 2VQ0A 1UU5A 1NUKA 1V6OA 4LFAB 2VUCA 1KYOF 4NR1A 2IJHA 2BRTA 1UXZA 1ZZ8A 2VE1A 2QQIA 1TMF1 2YUAA 2B9ZA 2Q6AA 4OHYA 2JEXA 4BIOA 3I2KA 2WSSG 4A42A 4Q4V1 2ET7A 1AYN2 3GXUA 1RSOB 1KQSU 3HQUA 4F6RA 4UCSA 4QGMA 5KUMA 2WJSA 3E5XA 3ZIAG 2D3PA 1JZ2A 3CNAA 1GN2A 4ZBMA 3JAKB 4LO5B 5FYZA 4ZXEA 1NZ6A 3DECA 4CPBD 3STZC 1AVBA 5ACA1 1DLCA 2LW1A 4CS4A 1YYNA 3IIIA 1F2NA 2J22A 5F6KA 2BU9A 1UFIA 4HONA 1S0BA 4DZGA 5FP7A 3FYIB 4XDOA 1DQ2A 4YW6A 1NT0A 2ZACA 3T09A 4WM8A 4DXZA 4U7NA 2VS0A 2D5HA 4PIXA 2WIIB 3HNBM 1L7LA 1FPN2 3I3DA 2VMGA 3D3AA 1EAH1 1VBA1 2C5DA 1NTMH 2DUOA 4CDXB 4F83A 4TV9B 4FFBB 4BQ1A 2AUYA 5J1XA 4ARXA 1NQDA 4LR3A 1IHMA 2HYXA 2P2KA 4NIGA 1VBE2 4NXNB 3PURA 3PNAA 3CHXA 1HRI3 4IEVA 3OGSA 1S0DA 1UMZA 3FUOA 1TEIA 2QWRB 4CEWA 3IZOA 2QQLA 1HJFA 2W1SA 2GHYA 1RUE2 2IJJA 3VZMA 3BFRA 4C0HA 2EIKB 1DBNA 1N34O 1SACA 3ZCCA 2NMNA 4F6EA 2VNRA 1E5HA 3OUIA 2W39A 5IYZB 2VR4A 3NNGA 5FYVA 3R65A 4P9XA 5FY7A 3WF1A 4F4LA 4TOIA 1RVF2 1O5LA 1W8ZA 2DYRB 2CH7A 4YJ2B 3THDA 3JQXA 1HB3A 4UFLA 2LFRA 1PZ9A 5FWEA 1N3OA 1RUI3 3BN6A 4GMP0 3ZYBA 1VQ9V 4JDOA 1QJY1 5C9AA 4AHWA 2Y6KA 4DNYA 1WW5A 1XILA 3IIAA 4NXMO 1MS8A 3WQBA 1JYNA 1NR1A 4JF3A 2Z4FA 1VBC1 2UXCB 1J5EB 1NOVA 1PV0A 2FTKA 1SLLA 4ZIBA 1N1VA 2NLJC 5FZGA 5F8PA 5L7OA 3VGIA 2FDGA 3CBNA 1AL23 4NOTA 5F39A 3N7MA 2VWKA 1F31A 3KCYA 2VVEA 2B46X 3X2QB 5HV0A 3O1TA 4QGPA 4TYSA 4CCKA 5H6RA 2RS33 4G9SB 1DQ1A 3HN3A 3LNNA 4Y22B 4DR2O 3JUUA 4JGYA 1OQDA 4Y26A 4DV1O 3WX5A 4PT6A 2X5IB 4L97A 5LA9A 4AQYB 4QHBA 5J7MA 2JJ6A 2HWC1 3W21A 1RC6A 4WM7C 3IJ4A 3K3NA 2MEV1 3RYHA 4XFFA 3ASNC 4OUMA 5LA1A 3A0HZ 2QZ2A 5F7UA 2J1SA 3QLQA 3IBMA 2ZEYA 5F3GA 4AHZA 1FMD1 5LGUA 2ZS6B 1JODA 3T30A 1Q56A 4WBBA 5A1FA 1BBT2 1R6KA 1QJX1 2DWDC 4EJRA 1FKAO 4IV3B 4CH3A 1ULCA 1F5JA 4Q29A 2YFZA 2B42B 4XDLA 1AI4A 1M57C 3OB8A 1BCXA 4EN6B 2QKSA 2WL1A 2VQUA 3CJIA 2BTQA 2BNMA 4JV5O 3FD9A 2CHHA 2GMEA 2Z0AA 1OPOA 4ZI7B 1V54B 1YEWA 2E9QA 4BXFA 3MFCA 4OULA 2W0FC 2LTNA 2CTVA 3OTOB 5BXXA 1AR61 5C8CA 4RQPB 1VARA 2XHKA 4MVZA 5BYNA 4BWOA 5E89A 3AZXA 4PJ0Z 2HBTA 5CZKA 1HRV2 3K5NA 2QM8A 5IT9N 4MADA 3TGUH 3EFFK 3RJRA 2E31A 1W6OB 3RI9A 2VPVA 1JZ3A 3E22B 4GX5A 1AROP 1Y74B 4EN8B 3AL6A 1AI7A 3P30A 1FAYA 1AR73 4UVAA 2YXHA 3ZN5A 2E76B 5FO9B 3SEEA 5J2UB 2PHWA 5A6XA 4NTWA 2D98A 2GNMA 2X6BA 2D6LX 1YNAA 3ASNB 3A7QA 2X5IC 1RFYA 3VKMA 3JD71 5IHRA 4JYYA 3RYRA 3USSA 4PA4A 4BOWA 5T5OA 2IC1A 3VB9A 4A44A 4JKLA 1J83A 3CXCU 3LQCA 1RUF2 5A3LA 1OT5A 1W0OA 3PN1A 1W9TA 1KJRA 1VAKA 4RQEA 1RXFA 1O3SA 5H2FZ 3Q4HA 1W0PA 2EIMC 2WINB 1I3HA 4XC9A 1XEQA 3K79A 3WG7B 4LCUC 3STLC 1QLEC 2PHXA 2RM23 2UYBA 2WO2A 4IIJA 4J11A 1DGRA 1HXS3 2Q1MA 4FIPC 3MEPA 1VBE3 3AKTA 1YFYA 5FZEA 4IE5A 2UWCA 4TV8A 1SERA 2QBXA 5LMUB 4JI2B 1W0KG 4LKEA 5C4WC 3ZFEB 1SRYA 3ELNA 2HVJC 1JU4A 4UAPA 3LDCA 5JQGA 3G6EV 2R072 3VBFB 5I8TA 5FKCA 3VZLA 4CH4A 1XU1A 2OXBA 2A3WA 5EV7A 4FZ1A 1NCRC 1BBT3 5C3SA 5KXEA 2R043 4AI9A 4GB32 1UXXX 5CB4A 3AXDA 2RS53 2UYAA 4JI7B 1HN1A 4IDZA 3WDXA 2WNEA 3EYPA 3VL8A 1TE1B 1ZZ6A 3OR7C 3OG2A 1NE6A 4U3JB 3KGLA 4DV4B 1B04A 1JJ2U 5EFUA 1W99A 1APNA 2PLV2 4XAAA 3ZYRA 3LSUA 3V0AB 3FB5C 1RUI2 1RYYA 5DUUA 2Y4UA 2HH9A 4JGSA 1BZWA 3O1MA 4YVWB 1URXA 4NHYA 2Q67A 3VKNA 2B9VA 3IKWA 4WBNA 4JDNA 2VU9A 3V0BA 5CKMA 3A23A 3KV6A 5FYTA 1WBLA 3S7IA 5C9AC 2XDVA 4F7ZA 2WNVA 5FAXA 2FCUA 3ZYHA 3ACIA 2ZTNA 5L73A 1LEMA 2WQZC 1MG1A 4BWAA 4DRXA 1PGSA 4KMQA 3IDAA 3CCQV 3KZ4C 4X1IB 1DCSA 4BZ4A 4DPNA 1IS6A 2HEYF 4FM0A 4Y1ZA 3HN1A 3SJBC 2VBBA 1XBLA 2Y0OA 3WG4A 3ZIXA 1Z7S3 1OLME 2WT1A 2WZR2 5FPVA 2WLIA 4IV3C 2K46A 4MXWA 3JALA 3ZXJA 4XXPA 1AP6A 4MGYE 4R9DA 1NCRB 4L8JA 4HKLA 3UJOA 3AFKA 2JD4A 2DURA 3KV9A 1UAIA 2A3XA 4HYOA 2AEYA 1FXHA 1X82A 3RG0A 2LJ2A 2RR13 2R061 1QNYA 2GDSA 4Y4RA 5C4WB 5LGNA 4CDQA 3MAQA 3H7YA 4TLFA 3G7DA 1D7PM 2XJQA 3SNMA 1S4CA 3GBFA 4FPHA 3ZSEA 1OLMA 5IAXA 2UXDO 1A34A 1DGSA 4LO7A 1H2LA 2W08A 4JPRA 5CKNA 4N9HA 2PTMA 2UU9O 2F4VO 3ZFFC 4DR7O 5EP9A 2F95B 2VAUA 2Q8DA 1BE3H 1KFUL 2W94A 2VG9A 2XR4A 2WYFA 2RMU2 1HNZB 1L7QA 1AJPA 4ZU7A 4XIOA 1WB7A 1ULEA 4NO4A 1XE8A 2HR3A 3FFZA 4XJ9A 1RUC1 4UCUA 2XLAA 3FL7A 2UXBB 3LWCA 1D2SA 4KFMA 4TV8B 2MEV3 2VMCA 1R6NA 2QEXV 1I94B 3B77A 4DV4O 3TEYA 2VBPA 1YITV 3CC7V 4JI3B 2VTXJ 2NP0A 4YG0A 4Y33A 4DO0A 4IEWA 5JLVA 5FNVA 3B09A 1H1IA 2E26A 1FMD3 1Y76A 1W6PB 3RYFB 4CDUB 4DUZO 2ETNA 3VBSC 1OV9A 3VKLA 2DDUA 4H7MA 4XQWA 5D8AC 1ZNPA 1Q3EA 2PYTA 4XABA 4FPPA 1FNYA 4LNVA 1UZ0A 4LF7B 1X33A 4GZRB 2ERFA 1I5XA 2XLFA 1VQOV 1QJY2 1A6CA 1JUIA 2IJKA 1US2A 3JAMN 5EWSA 4RS5C 1GZ9A 3ETQA 1V55B 3E5UA 1IBLO 1AR63 2WAAA 5FLJA 3SCFA 3HKBA 3CS5A 1NH2B 3ZLIA 4X20A 2XQXA 1RIRA 3F5TA 2WO3A 3IM0A 4JKMA 1Y9MA 4P14A 3SDLA 1Y66A 3T3YA 4FZ0A 5C3RA 1IPSA 4X1KB 5K9YA 3WHTA 5B66Z 5F3EA 2Q0OC 1ULFA 4QX8A 2AW9A 4CXWA 3AB0A 1P7GA 1UX6A 3VDDC 3OE7G 5IK8A 1RHI1 4CDUA 4AW7A 2IW5A 3L75H 3OJBA 2X5IA 4I7ZB 3T2MA 2B7YA 1W8TA 1JMUB 5FYUA 3M8AA 2JX9A 3SPJA 3OGIB 1UZWA 2JDUA 1MZ5A 1RUE1 3AP7A 1XL6A 3ZHRA 4FBFA 5LCWL 3K48A 4JI6B 5KWRA 4TWKA 1MABG 4LBJA 2GSYA 3SPIA 1W9YA 3I54A 1WCSA 1RMU2 2GMPA 1V9U2 4LA3A 2OW4A 2JDHA 2R071 2HLEA 4YYOA 4IT5A 5GTIZ 1FMD2 4DR5B 4HNAA 4O7XA 5C71A 3VBUB 3M1HA 4CP9A 3C3SA 3APOA 5FIXA 2PFWA 1HNZO 4YW5A 2J1VA 3OPTA 2RN9A 3TEWA 5H9PA 3ZM8A 3OEHG 3N9LA 4OHVA 4TSVA 1E5RA 2ZXQA 4JTNA 3JBG1 1PMIA 3ZSMA 4Q5OA 1NKGA 4KNCA 3C7OA 4Z1MG 3T0AA 2VJXA 5D8AB 3CF6E 3MV01 4XFCA 1E79G 3A0NA 4CZZA 2CUGA 3ZRXA 1IBLB 4OMCA 3W9AA 5CA1A 5I0DA 2HHHB 5HCFA 2R6QA 5A3NA 1ZRFA 1ZYBA 5F3CA 3D5OA 2C9AA 2VZTA 5C5UA 4YARA 2CWSA 1DTOA 2XAGA 4C1XA 3QBQA 2QE7G 4J25A 2SBAA 3DC5A 1ASJ1 5IVVA 5LHHA 4HMZA 2VMFA 4CEWB 4PDMA 1YJWV 2AYHA 3CDZB 1AR93 4Q0VA 3WP6A 2RG4A 4B3MO 3GJAA 1LECA 5EYXA 4GUNA 3S3XA 3RRDA 4P5HA 2Q30A 1MNGA 4I55B 4GULA 1E5IA 1QJX2 1NG0A 3K5MA 4QPGA 1OQ1A 2P6HA 1S77D 2DYRC 2WNVB 1Q82W 2HWB3 4YGEA 3KLSA 2NLRA 4O4JB 4NPLA 3OMIB 3THTA 1O8SA 4AHXA 3Q8BA 1C57A 3HIFA 2OA2A 4RFRB 3JZVA 5I91A 3VZOA 3OPZA 1G8WA 2ZE8A 2P3IA 3AL5A 1DYKA 4WFHA 1IQAA 1FXZA 4BR6A 2KSDA 3CYOA 2A70A 1Q8PA 1ZBA1 1SDDB 5FK7A 4ASKA 1XU2A 4FPLA 1C8NA 2JK5C 1X8MA 4H3WA 1KDKA 1I5YA 2ZR2A 2HWF2 4BQ2A 5T5PA 3VDDB 3E8HA 1AJOA 1ODMA 5FZKA 2GSMB 3JASA 3UYJA 4BQ4A 5A3OA 2ZEWA 4R6ZA 5IYCO 5CBGA 3H01A 2AZ0A 1B09A 1NI8A 3D4KA 3PVEA 3FWEA 2P6JA 3GWOA 2GC0A 2Y0IA 5FZ3A 1KP3A 2AENA 4JI5B 5F5IA 2XH6A 1NQTA 5FLIA 4YJ3B 2Q0AA 5JCTA 3RYIA 4UI9L 4NRPA 5GZEA 5J36A 1AXKA 3P5BA 2BBAA 1ZA4A 3BVOA 2VVFA 3GM8A 2Q1FA 5AG2A 1YFUA 3SXWA 3AK0A 4YW2A 1VAVA 5FPRA 2VECA 2D3OW 1KMIZ 4AI2A 3K51A 3JBG2 5GLVA 4C7UA 1BK0A 2QQOA 3SHRA 4A3ZA 5FZFA 4BXSV 2ZGRA 1WA6X 2EINB 1SQVH 5BUVA 1NE4A 4KG0A 1S0EA 5CISA 4AEKA 2OVUA 4LIUA 4L11A 1ULDA 1SG3A 5LA0A 4GWNA 1YZBA 4DV3O 3CMGA 4L2NA 2LRPA 3SCGA 4DV5O 4PDVA 2E63A 2H6CA 4UYBA 2JKBA 4N43C 1QHTA 3FB7C 1UU4A 3VBOC 2Z42A 5JIAA 3PMEA 2B1GA 1GSLA 2VZSA 3CEWA 5HPOA 3GJBA 1O9HA 2VH9A 2ET1A 3IDCB 3ZYGA 3LDRA 2YUEA 2XKOA 3H3LA 3RYFA 1ND3A 1V6LA 4X66O 4Z82A 1XQ8A 1I0HA 1F4AA 1VBB1 4YFZA 3CRAA 2RDNA 2FDHA 4WFGA 4MVMA 4KHPB 4K1ZA 1TA8A 1DFQA 5DXDA 3U4XA 3MLJA 4IEZA 5J09A 4BIZA 1AR81 2DQ0A 4AF9A 1RUH3 1F8VA 1ZRCA 4CE8A 4RQPA 1BYHA 4UV8A 4BAYA 5FZ4A 3ZHQA 1C8M1 1UX7A 1KXGA 5CG8A 3FN9A 5IWAB 1YI7A 4Y20A 1DU3D 1OUSA 3OD0A 5FQ0A 4AEDA 4R8HA 2EINC 1LHNA 2WLKA 1JOPA 2VQFO 2Y60A 1RPRA 5GONB 4P00B 5CBHA 2N04A 2A75A 1G7YA 3E2EA 5GJ6A 1NQJA 2E7AA 2IXLA 5ABJA 4O4HA 3GALA 1SETA 4O4IB 1AYN1 5L3DA 2E3CA 5GKAC 1VPHA 1ULGA 4LKSA 4KU8A 4B3RO 3N2GB 2ZGMA 3UGHA 4JC1A 2OIEA 3HNMA 5KR7A 4P08A 3RFRA 1PVXA 1IXBA 5IJ0A 3NAPC 1Y4MA 2RS31 4B4RA 2PGGA 1IURA 4DFSA 3FKSG 4GH4B 5BV6A 1D5AA 3WFVA 1UOFA 4H13B 2YU2A 3I59A 1EN6A 3OY8A 5IAVA 2R073 4V2VA 1BZKA 5BNPB 1GN4A 1OZ0A 1MQTB 3LEIA 2AXTZ 4BCUA 4RS5B 1YLLA 3OEBA 3VBHA 3HR0A 3UJQA 1H9PA 2ZGOA 1T6GC 1VBA2 4MVSA 1PK6B 3CJXA 1CP9A 5E8AA 1H2MA 4D3WA 1UMHA 1SQBH 1YO8A 2RS11 5EBLC 1R093 3MPPG 4S2HA 3WW4A 4YVWC 5JPMB 2YSUB 3H1YA 5JH7A 4M4RA 4MTGA 1YFWA 5K0UA 4XF4A 5HCAA 1QH7A 4QPGC 4UCVA 4E4HA 4YW3A 5GONA 4H37A 4ITCA 1VP6A 2WLLA 4IE4A 1UY3A 2DTYA 2BJSA 2RM22 3FBMA 2ZMNA 4AG4A 1F51A 5LL6Y 2XWBB 5FZ8A 3LB9A 4RFT0 3VN4A 1WZXA 3HPNA 2KM2A 2VY0A 4IGGA 3ILNA 3RQ0A 3W5NA 1VBD2 4B7EA 4HK9A 5JVVA 3AKRA 2JG9C 4EKWA 1YHQV 3HAGA 1UD1A 2PMWB 2B9UA 4KGQA 4X6QB 1H30A 2WQ8A 5IJ9B 1AR71 2XUEA 3M2MA 1VMFA 1N36B 5FJHA 2HFEC 3PDQA 1G9AA 4CUCA 4LJHA 1WMEA 3CCJV 4CU9A 4CXYA 5T55A 1RITA 1HR0B 4ZU4A 2R70A 4XJ8A 2DV9A 1UPGA 4O2AB 1LOAA 1YQ2A 4AZZA 2BVVA 1JCHA 5FYBA 3KT1A 4BW9A 1Y4WA 5FKBA 1D4VB 3J4UH 3OSDA 1EYBA 4LF6B 1RGSA 3T4ZA 3KKYA 3VOUA 3KM5A 4FK5C 4CDWA 1NLQA 3CKHA 2VRZA 3KG2A 3JB8A 4CTEA 1POV3 1VRH3 1W2UA 4BQXA 3UNPA 4TQDA 1YJKA 1QXRA 4AYUA 3QG5A 3UKNA 4TUYA 2JIGA 3AMNA 3MV11 4C8DA 3GGLA 2ZIMA 1JN2P 3HMYA 1IPJA 2ID4A 4Y20B 4P30A 2JG9B 2WZR3 3TRSB 4MHUA 3BTAA 5IFTA 3SH3A 2DCZA 4UVCA 3NV4A 2KA3A 3FMGA 2CAUA 2RCVA 1Z7S1 1HX6A 2YZ4A 1LAJA 4RO2A 1BVP1 2W87A 4WFBV 3AZWA 1OCOB 4FSJA 4JI1O 2WWSA 2R1DA 3K3WA 4XFHA 4RQPC 2DTWA 3POSA 5C8YB 4GKXA 3S30A 4AHCA 5BNOA 2QKCA 5T52A 4KI5M 3O0XA 3CQOA 1SQQH 4DUVA 4BLJA 4CCEA 1GICA 1JQ0A 2VMEA 1RUJ1 1V0AA 1A32A 1WLDA 1OHFA 4B7KA 3J7AU 2JKXA 4UWDA 1TQ5A 5DABA 2CV6A 5CFDA 3LNMB 1UY0A 3W7WA 5IW0A 3ZN6A 1LOBA 1EN5A 3BTYA 4JYCA 3FYEB 5FZIA 5G04L 3WDTA 5B3SB 4AGRA 1VBB2 1YQ6A 4LBLA 5CA6A 2FDKA 1AR1B 4LFCB 1ZBA2 3SCHA 3ZSLA 2IXHA 1EBOA 4OUEA 4DV0B 2J1TA 1JTZX 1ZAUA 3AZYA 4JQTA 4D7YA 2DCKA 4PIYA 4W6YA 3DV8A 1Q43A 5DAQA 4JZGA 4O61A 4DXTA 3ABKC 4HG6B 1JOJA 3PUAA 3O1PA 4H0LB 2ARHA 2ZJCA 5F3IA 2CGOA 4ZKIA 5JIUA 3VBSA 4IHJB 3E97A 3DXUA 2W6JG 2R49A 3VD9A 2QWQB 3H1HH 3C7FA 5LRRA 1Q8IA 3B8NA 2BNNA 4TSFG 1F4HA 5FPOA 1AL0G 4Q8KA 5FZAA 2PAMA 2WSUA 1QNMA 3ABMB 4X65O 5E79Z 1M56C 1R082 3LDKA 2GC3A 5A33B 3OBTA 4WBNB 1J1LA 5DAVA 5EJ3A 4DV7B 2F23A 4AE2A 4YJ2A 1G6UA 4XMAA 1K5MA 4XUQA 2R063 2OT7A 5LGTA 2WLMA 1W2TA 1VF7A 2WFF1 4Q8LA 4GA9A 1FFTB 1Y6XA 1OVPA 2PHLA 2EX3A 4ZI7A 3GCXA 2A0LA 2NMOA 2NZ9A 3KCCA 1N36O 1U96A 3KV4A 5LBEA 1GBGA 4JAUA 1IPKA 4FLWA 1FJGB 4JI8O 2YGMA 1FV2A 2WZPP 1WLWA 3AP5A 3ZXLA 1K45A 4NHKA 2ZE6A 3VDBA 1P4RA 3M7AA 4O65A 3D36C 3LDBA 4RHV2 2VQEO 3U10A 2PI5A 2XB6C 2Q5TA 4MXVA 2FCTA 4OHWA 2XTAA 3H1LH 4AFDA 4MGQA 4XFGA 3S5AA 5FZOA 1OCCC 2GBOA 2DF7A 3WCRA 3ZXAC 4X62B 5FP9A 4DW0A 1TG7A 4TV9A 1XL4A 4B29A 5BPXA 1S5HC 1AR5A 2FL4A 1ENVA 2IWGB 2ZGPA 1SLCA 5JI7A 5ITZA 2VWJA 3ABMC 1PHMA 1PO23 3GDBA 1PO12 3OUHA 3U1XA 2YIBD 2B4KA 1PM7A 4DK1A 3UGFA 2WLHA 2WLLB 2PQSA 1RMU1 4XETA 4NMIA 1CD3G 3ZMOA 1QXJA 1BKZA 1EAH3 1VBA3 2HJDA 3ZMTA 3PHMA 1VQ5V 3QD6A 5JH7B 5JUVA 2WLQA 3VHPA 3ACLA 5A32B 3JCIA 1TUEB 1MS3A 4PI2A 1QQP3 2XJTA 3NRUA 4AI0A 2OQ7A 5H9CA 5BY1A 1J5EO 2V73A 1BSMA 3NMBA 1US3A 3B4SA 1NA1A 3OUJA 2ITCC 1H8EG 2BV4A 3A0RA 4ZOLB 2OTLV 4Y24A 5LA6B 1UCXA 3ZR5A 2WWWA 1XYNA 2QQNA 3WB0A 2UXBO 4LLOA 2A5ZA 1V6KA 4FQZA 2E6VA 2GZWA 4EFEA 3NO8A 2IH3C 2Y69B 1MACA 1RUD1 1KKCA 1DF0A 4MGZE 4CH5A 1W6OA 3O12A 1SQGA 3KQ4B 1M06G 3WNXA 1K7DA 2RS52 3RVHA 1IKPA 2WNUA 3A8TA 4JVAA 5FPLA 5AVPA 4KWJA 2WRAA 2MW2B 5C6CA 5IVEA 2ZMLA 3J9SA 3W7SA 1X7NA 5LYJB 2PHUA 4YM3A 2XBO3 1QJY3 3OT7A 1QVFU 3JSLA 4CBCA 1WBFA 3JQWA 1W2OA 1UY4A 1ASJ3 3GVMA 1NTKH 4A45A 3F95A 2QM4A 1NZIA 2P7TC 4EN7B 3N35A 1PM4A 3LEMA 2XOKG 1UWWA 4D6TH 4KHPO 1LOFC 3NNFA 4Z2AA 2ORXA 5A1AA 2X05A 4NHMA 4IHJA 1HNWO 4NKGB 5JJNB 3NWKA 3OUFA 3VDCA 2IU0A 1HDJA 2EIEA 5GTHZ 4RD7A 2ZEZA 2D6MA 2HLDG 2GUZA 3C3VA 5DM6V 3WLUA 2VQTA 2P17A 3IPVB 1WKYA 4N43B 4E27A 2YPDA 5B1OA 1N32B 1NY72 5FOJB 2DCJA 3QCWA 4G27B 5T5JA 1WUVA 4OI2A 3HBZA 5B1AB 3ZMNA 4Y22A 4HBNA 4IEPA 1GNYA 3IGAC 1NAEA 2LW7A 3AG4C 3K03A 1Q6HA 3ZRWB 2CGPA 3KVBA 3TN91 4IETA 1XNRO 4K8ZA 3S5QA 3U4SA 4K0KO 1VBE1 2Q73A 4KL1A 4BQYA 3PIGA 5DZFA 3H7JA 1TME1 2F93B 2HHHO 3P3NA 1NH2D 5BZBA 3OBZA 3A4UA 1PNLA 3DKQA 4QX1A 1GOFA 2DE0X 2A6WA 4META 2XASA 2KB1A 1ZBE3 2XAQA 4XHXA 4BB3A 3WB1A 1QQCA 1N47A 4OX9B 4UFKA 5DECA 3ZX6A 1LOGA 4JI8B 1CPYA 4O9EA 2ORZA 4FVVA 4XMIA 4PF1A 2JDMA 2IFRA 3T2TA 5B2GB 4LITA 4YVSA 2BDRA 3J7LA 1OCZC 1W6PA 2C0ZA 5I8SA 4ASMB 1XMQO 1JUHA 2MK3A 5FBJA 5FXZA 4XAEA 4ES8A 4D8MA 4JGZA 1V54C 2HWB1 4ZKTB 2O57A 4I3PA 3H42B 3KF3A 2LO1A 2DVDA 5FXVA 2P34A 2EIJB 3KVAA 1JR9A 4MGTA 1B6QA 3POGA 2ZAAA 2VMIA 5LW9A 5FY0A 2AH2A 4RN5A 2ODMA 4Z2WA 2PXJA 4I50A 4XZUG 3H1WA 4LUMA 2HVKC 1W6NA 4N7UA 1H4GA 3ZVXA 1FFXB 1SZTA 1UMIA 5BXZA 1UIJA 4AQTA 2DVGA 5FP3A 4LH7A 5B5EZ 2OUJA 4JKKA 4QQHA 3E35A 3LDDA 4JI7O 4LF4B 2CAVA 2QJ1A 3LIGA 4ARYA 2JDKA 4PLMA 2VO5A 2WFPA 3KHBA 3KD4A 1VAMA 3RZLA 1MQTC 1PO13 2BGOA 5EPAA 1UYPA 1UZVA 3VHRA 3BKZA 2Z5WA 2NQYA 4FPCA 4HN0A 1T2XA 4LE4A 3M3IA 3OFNG 3AMHA 3WNPA 3J81N 3BEHA 2RR12 3UKVA 1AR82 1FXKC 4JTAB 4DUYB 2YU1A 3CJHB 1RUG1 1SCRA 1I5ZA 4M3CE 2A9HA 4URAA 1C4RA 1YF2A 3JSNA 4QX0A 5HXMA 4XYXA 4CCDA 3EXAA 1ZREA 3O0WA 1AR83 3JD2A 2ITDC 3PVOA 4EWDA 4V2WA 2V5DA 3HNYM 3B2EE 4GKKB 2LS6A 1FPOA 3MHSC 3H8RA 1OHHG 3MIHA 3RZHA 3DN7A 4LT5A 4MH0E 1VF5B 4R9AA 4L9BA 1F23A 1XYOA 5C93A 1CAVB 2VMHA 4KUMA 1SDWA 1C1FA 5K0UB 4LH6A 2JDPA 4EROA 2JE8A 4EB6A 4FOQA 3L72H 4WZFA 3FB8C 4LMFA 2F6BA 4GLXA 2YY1A 2YBPA 3VBOB 4QPIB 4I0XA 3RWKX 1SMVA 2V1DA 4NXNO 2FMYA 1CZSA 4K8FA 3S7EA 3M7MX 3BALA 2W2IA 2HP8A 1CN1A 1JXNA 4GZ9A 4RL7A 2D3RA 5IVYA 1W0NA 4SLIA 1CAUB 5C5TA 3TNPB 1AILA 2EIKC 2Q5ZA 4FPOB 2PLV3 1V9PA 2CTRA 2ZZQA 3H1IH 5IYYA 2YI8A 4TXWA 1XMQB 4I30A 4CXXA 1Y9QA 4LHLA 1SBDA 3I59B 3CO2A 1H6YA 1NJIW 1AF9A 4CCLA 4WCEV 3JD72 5EQUA 1GV9A 2ZINA 2EXIA 2FDJA 4NJ4A 4CRQA 4U3JA 1QOSA 1ORQC 2LGWA 1OF3A 3SYPA 4KWUA 4FI9A 2PF4E 3ATGA 3VLBB 1O4ZA 4AHYA 1OCZB 3K59A 5IT6A 4DV3B 1KS4A 4MVTA 2UU9B 4Q0QA 5FP8A 3SYCA 4LF4O 4K8XA 4ICGA 3UO2A 2QQKA 5F5CA 3CRRA 2WAOA 3KB5A 4PDWC 1XNRB 5FQ0B 4XACA 4WM7A 2QQWA 2P5OA 4L87A 1YXWA 1ND2B 1JYTA 1Q6UA 1COV3 1W6MA 3IC9A 1UN1A 4MTFA 2GP5A 1QJZA 3B00A 3NKGA 5FV3A 1OFNA 4LHSA 2BOBC 1SPPB 3ZDSA 3ILFA 5LXTA 4XTPA 5L3CA 3MD0A 4QQ2A 4O2BB 5J98B 3K9SA 1S0GA 4LF7O 3LIHA 2F4VB 3B93A 4Y1UA 1AJNA 4JYAB 3OD4A 1WCKA 1R64A 3KWVA 2AGSA 4J10A 1JU3A 4RA0A 1XOYA 2VZPA 1Q8QA 2VCAA 1KECA 2FZ1A 4DUZB 2DVAA 1JYIA 3HKEB 5LATA 2CTPA 2VZ3A 3OY8B 2EILC 4CUBA 4LUKA 4DYLA 3RWNA 5AC91 4W6WA 1RUE3 2A73B 4P9OA 2QJVA 1JMKC 1R091 5I93A 1REEA 3J26N 2VCBA 3ML0A 2Y48A 2IVIB 1S5LZ 3ZN0A 4D7SA 1FXVA 2FHRA 2FYUH 1K8AW 2NPIA 4I3GA 2XAHA 4E2LA 3AK3A 5JCOC 1BQ0A 2CTWA 1HLCA 2JRIA 1FYUA 3H9AA 1XNCA 4AI1A 4LWSA 4O4HB 2BOJA 1POV1 1VRH1 1SCSA 2ZCWA 2VNOA 3LSEA 1EUUA 4QKNA 4DXRA 5J48A 4Z07A 1Z0HA 5A7WA 3NJXA 3AMQA 3GBGA 2EJ7A 1DYOA 3AJYA 3CL1A 4XOGA 3E6DA 4D6SA 1W6QB 1C28A 1W8OA 1OKQA 1EZVH 4GD4A 4PLOA 4QB1A 2X10A 5DG1A 4ORFA 2HWD1 2VUJA 3URFA 4DS0A 4ZY9A 5A7WB 5GLWA 2PHRA 3T0BA 1VMGA 1Y67A 4UB6Z 4M01A 4DV6B 2EA7A 4G3YC 4COVA 2BFUL 2RJKA 4FOVA 3VZKA 2BYVE 1OLQA 2BERA 5LYJA 3BIWE 1LU1A 3QO8A 3RMYA 3GZTB 1D2DA 2IFWA 1VBC3 2NN8A 1YWKA 1QNWA 2IXCA 2WNUB 2EILB 1NCQC 1V6MA 4B4PA 2VQEB 3PIJA 1P84F 1LHWA 2TBVA 5KC5A 2AACA 5C70A 4N21A 4XBFA 1AL21 4B3NA 2DYSC 4XDPA 3ZKYA 5GZGA 4CU7A 2JEUA 4XDJA 5FREA 3LUTB 4KWKA 3RNSA 2O8QA 1UL9A 3VKFC 4G28B 3EMRA 1HRV1 4MS2A 5FUIA 3JALB 1RUC2 4XF3A 2ADQB 3TB0A 2RMU3 3KMHA 4TZDA 1WN7A 2Y69C 4PDRA 4QX3A 1H0BA 1Q8OA 3K4DA 3BYWA 1GFF2 5JVDB 2LP7A 4CS2A 3RSJA 4NE9A 3VBHC 1ND2C 3MIGA 1ND2A 2L6LA 3HWJA 2QNKA 1ENQA 4GX2A 3A21A 3BCCH 1JHNA 2V5YA 4CVUA 3KSCA 2FD8A 4YZ2A 3TEXA 3N2KB 1WPBA 4AGVA 2GH8A 3ZMUA 1RTVA 4BU2A 4C91A 4R52A 4IERA 2JDYA 4RR3B 5LK5A 1KJLA 1THZA 4J7KA 2EZPA 2ETEA 3N9MA 1H6XA 3K4ZA 1QHDA 3CU7A 1AX0A 1K73W 4FVMA 2WFF3 1MSDA 5CB7A 3HQRA 3RZMA 1ZM1A 1R092 2A3YA 4IL6Z 3BHPA 2QDNA 3ZHUA 4EE2A 1AJQA 3H1KH 5BNNA 2WN2A 4JI5O 1BEV3 2PA7A 2QGNA 2WWUA 1RJ7A 4RS5A 2OCCB 3T1MA 2W92A 1OLRA 4QM9A 4JHZA 4R4ZA 4E9KA 5A6QA 1AR91 4YVSC 1KB9F 1HB4A 1CEZA 2YPJA 4WFAV 2NYYA 4Q4Y2 1E5SA 4J7JA 2O14A 2YV8A 1QJEA 3POJA 2PLV1 4AFBA 5JOZA 3EHBB 4Z1VA 1IVSA 4KQ7A 1W90A 3LKJA 3KV5A 4ATEA 4WM8B 3CMAV 1OF4A 5ISLA 2WDBA 3MBWA 4IEUA 1MOFA 3ZFFA 1GZWB 3MIDA 4D6RA 1RSOA 4V1PA 2UXDB 2E7TA 3I3MA 4LBQB 1ZRDA 4AEDB 3SKVA 1BHAA 4LORA 4OX9O 5FZDA 2WPDG 4HOOA 4AVAA 4AOCA 1PP9H 4CUGA 2QQVA 1WGPA 2P4KA 1QH6A 2Y34A 3IFXA 4KXRA 4HSJA 4OGQB 3OYWB 4WVMB 1VBB3 3WNOA 1NT2B 2ENRA 3AK2A 2BWCA 2G4IA 2O1QA 1VQKV 4ZZ5A 1AL22 4DQAA 5FYMA 1C5IA 4CP2A 1SQFA 5DZGA 3ETDA 2C6SA 5CADA 4IYIA 2WZEA 2XVLA 4UFMA 1FS0G 3C7EA 1RUD3 1D4M2 3VBRA 2IUWA 1MZEA 4O9GA 2TEPA 4QPKA 1I5PA 2YC4A 2E75B 4JZ2A 2OX0A 3ETEA 1HW5A 1W2AX 2Q69A 3GF6A 4A3XA 1ZSPA 2Y6GA 4JX0A 2WA3A 1WCDJ 1EZJA 2Q7EA 3QH7A 1PGL2 3MHZA 1ASJ2 3K3OA 2W1UA 2A7WA 4QB6A 4YFWA 3UESA 1YC61 4LULA 3T08A 3I5DA 5LZ6A 1ZX5A 3K0GA 2VULA 3CJIB 4X65B 3I97A 1QCEA 3B01A 3CPWU 1ULOA 3TETA 2ZNJA 4XJWA 1GWLA 3IWZA 3VHOA 4IV3A 1PVC3 1UYYA 5EYYA 3JARA 1MZ6A 3EBRA 4M3CA 1WJZA 2WA4A 1IG3A 3I3QA 2XPJA 1W39A 4K8RB 5ACA3 2O0OA 3RYIB 2VZRA 2EALA 2JB8A 5BMVB 2UUAB 4FFHA 3VD5A 3LZZA 2ZABA 1FJGO 2YIBA 4TN7A 1VP7A 2D40A 3MDPA 3MYXA 1BQPA 1AXZA 2Y64A 1RPOA 3ZDVA 2LQTA 4XE9A 1CJDA 4PDLA 4JV5B 3FLPA 5FTTC 1O4YA 4D0QA 2KR2A 3ZXFA 1SFPA 3AP9A 1SS3A 2D44A 5FRAA 2K1EA 4CDQB 3J8F2 2UUCO 1S55A 4WVMA 3ZSKA 2XBO1 4QQPA 1NX9A 4FJCC 1M90W 4RUEA 1P49A 1UY1A 3L70H 4JI0O 1HQNA 1VF6C 4UW6A 2ZX3A 4FMTA 1O59A 3JB4C 4PA9A 1VQMV 1Y76B 3M3QA 3K46A 2XWJB 3SC7X 3AX4A 3ABUA 2OTJV 1D4M3 1NYWA 5AC92 4ABMA 2ZHMA 5D21A 4H44B 2PHTA 2JE9A 2RJLA 1WLEA 2VQFB 2RE9A 4BJ0A 3GZUC 5CFCB 5GM0A 5L9VA 4CCMA 5GW7A 3E1F1 3WV6A 4LC1A 2OYZA 3DPRC 3TJTA 5K1PA 2VXRA 2HWF3 1JYWA 3D6EA 5JZGA 2RDSA 4I09A 3RZZA 2OZ6A 1TVGA 3NQHA 4LBOA 5J2TA 2P4VA 4MVOA 2B45X 5CYYA 2C4XA 3O0VA 3U07A 1FYJA 3MW2A 3LA3A 3WNNA 1PIV1 4NTXA 5FYYA 3Q8EA 3F7YC 3RN4A 2ZX0A 1QJFA 3ZN4A 4YWAA 3DTUB 5JSPA 4E4ZA 1CGPA 2VZQA 4KBBA 4C0BA 5LASA 1ODNA 2HJIA 4MO3M 4H7LA 4PDWA 3ZHSA 2AGAA 3G6JB 3DSQA 5LEKA 1JFFA 3BOWA 1HRI2 3NNJA 3TXQA 1GTOA 1FPN1 4ZPIA 4AI8A 4ZS3A 4YSFA 4I5SA 4B3SB 1EAH2 3AJZA 2HKOA 1C3HA 3ZS8C 4E2SA 2IVJA 1WW7A 1PK6C 2A1XA 3L9DA 1G86A 5FL7G 3UV9A 5EBWC 4JTDB 1KRIA 4L92A 5EC1C 5LMUO 3JAWB 1CPNA 3ZFEA 3N2GA 2PN5A 2WS91 5LY1A 3JARB 2F66C 4G4FA 5DN6G 3HB3B 1GN3A 3UT5B 1QR8A 3LE0A 2CDYA 2OIIA 3SYQA 2E7QA 5CG9A 2ADEA 4Q1RA 3EHKA 4DB5A 3T4HB 3MI8A 1SBFA 2ZKOA 2ZT9B 2VM9A 1RHI3 3K2OA 4S2FA 1R1A1 5LP6A 1VQPV 3POWA 1PNGA 1GUIA 2P1BA 1EP0A 5JCOA 3GHNA 1IG0A 2UUBB 3OW2U 4NHXA 1IBKB 3POIA 3WSOA 1DQ4A 2VW0A 3RMXA 4H33A 3ACHA 4QPWA 4ATFA 1JBCA 3N9OA 4EWEA 1QLEB 3HPLC 2C9KA 2XBO2 3DEMA 3PTYA 4Q4X2 1PM9A 3E6BA 1VQ6V 1RL3A 4I9WA 5TISZ 3OGRA 4SBVA 5DG2A 2XVGA 1K3IA 3O65A 4YGDA 4BPZA 4PD4F 5HFLA 5EZWA 1HIXA 3Q8AA 3E8FA 4IGQA 1OD5A 3FZ3A 4XF9A 1YVWA 2ZQMA 2P3YA 3VL9A 1CIWA 1N4CA 3U11A 2QE3A 1YCIA 3ABLB 3TWIA 4JTCB 4GIQA 1LESA 1G6NA 3O1UA 1JH5A 3FX3A 3HT2A 4NN0A 1OUXA 3M4FA 1F5FA 5J37A 4CCCA 2JIZG 1MEC3 2E32A 2XHBA 4OCTA 1BMFG 2WLNA 2D5FA 2RM21 3L9JT 4LO4B 2HWC2 4Y4YA 4LXLA 1W9WA 1ZX3A 4LWSB 4JGZB 3ON7A 2EIMB 2A7AA 2ZHLA 1GMMA 4X8NA 1QDCA 3J80N 3ZMZA 4UFIA 4JRAA 4X8PA 2R72A 1OQEA 3AFGA 2ZGTA 2R7EB 3POFA 3ZHTA 4P2ZA 2Q8EA 2P90A 5CIRA 4GAZA 2R041 2DBIA 4XCBA 2Z79A 4XDQA 5FY9A 3ZSJA 1OVSA 3IMMA 3INAA 1LUVA 2W95A 1TAEA 3NXSA 1KFXL 4OVEA 1HNXO 2ZCEA 1S0VA 3A0BZ 3C3TA 2P6CA 4MSVA 4BMBA 1JS9A 1LGCA 4IE7A 3JU9A 5LB6A 4AVSA 4EQVA 5EXOA 2BSKB 5FP4A 3UT5A 1AR62 4FTSA 4BE3A 3AG3B 5IUQA 4DV5B 1NVPD 1E1QG 4YW1A 3W20A 3O1RA 1NXMA 4PLNA 3U78A 4E4SA 4CCNA 2R9IA 4MTXA 4TWTA 4HZ3A 4HKOA 1GK9A 1WW6A 4NRMA 5FYHA 1I94O 3QO7A 1AYM2 2ES3A 3AG4B 1ZBA3 2JJ2G 4N23A 4OYUA 5J2TB 1CAUA 1TVKB 3VQXA 4J1WA 4FFGA 3UO3A 2Y6JA 3PVNA 1GMGA 1XQNA 4FAHA 4YZ1A 4LHNA 2GTAA 5KA6A 4PHZA 4LHKA 2VMDA 2CK3G 3T2PA 4NYKA 2H6BA 4QPIA 1BVVA 3H8OA 2HG5C 5FY1A 3MO4A 4P9PA 5LP6B 4K3AA 1LGNA 3UM7A 2ZGLA 3MLLA 3OOXA 1SKVA 3OBAA 3GYDA 3ZXEA 5FY8A 4U3FH 2JWPA 1R6TA 2WC2A 4MGSA 1QEXA 5APAA 2B8MA 1OCRB 2OWOA 2P5BA 1K9MW 4EZ4A 3V0BB 1QBZA 2RNBA 4W4ZA 5F9TA 5JZGC 1WLCA 4X9QA 4GKKO 5DZEA 1L7RA 3I2OA 4I01A 5JZGB 3AKQA 5LMNO 4Y5SA 2BWAA 5AC93 3ECQA 4EYUA 4P5YA 5EZYB 2FMDA 1FD9A 3K9AA 1F15A 4K20A 4ASUG 4N53C 5FUNA 3AYDA 2PHFA 5L7OC 3H1JH 2Q7HA 3HBKA 1S76D 5BNPA 2W9XA 3VBOA 5L7OB 4GT1A 4IEOA 3ZFGA 4XBLA 4CDWC 1RMU3 4YM0A 2X6CA 1MR5A 3OF1A 5IYBO 4X8AA 2E74B 2UU8A 1Y9GA 5HCHA 4B3TO 2ZGNA 4L99A 3VHNA 5JR7B 4MW3A 4MYEA 3KT7A 1Q8SA 2WZ8A 3S0MA 4FOWA 3SH4A 2ZOEB 1GANA 2EVXA 1VLNA 3QVNA 1FFXA 1SBEA 3BVCA 4YZ5A 3DGTA 1W6NB 4QJFB 2W6IG 5HFMA 1NCQA 3T1HB 4C1WA 2ZGQA 1ZTEA 1YIJV 4FLTA 1YI9A 2ARXA 3N7LA 5FK8A 2EIDA 4JHTA 1WD4A 5BNQA 4AR2A 1W8HA 1O3RA 2QQJA 1K4CC 1WW4A 1H2KA 3Q9OA 2WFF2 1FAFA 3A22A 2DQ3A 3PMSA 4MHRA 1JX9A 3WF2A 1NTZH 3MW4A 5FLHA 3K57A 4J80A 1CZTA 4FTBA 4OPAA 4YNIA 3MDSA 5BMVA 3RYHB 3BRCA 5B1BC 2W52A 2GNTA 4CEYB 1GQGA 2G9ZA 3H3UA 1O5UA 1SFNA 4Q27A 1BEV1 1DF5A 3HKBB 4CDXC 3VBBA 2TNFA 2Q7GA 1PIV2 3LAGA 1CR7A 1COWG 4IL7A 1Q5OA 2GAUA 1VBD1 2F17A 1XE0A 2JDZA 2QUOA 5LXTB 4B3MB 2R062 1QQP2 2W5FA 1PMHX 3DYOA 5T54A 4QDSA 4QDQA 1OKOA 4EZHA 3FX7A 1E57A 4FXKB 3VBFC 1F9KA 4NPRA 5JMCA 3NV1A 1LJ7A 4ZXKA 1RUH2 3IPVA 3WHUA 1YFXA 4FPJA 3AKPA 4I0AA 3B40A 3ZPYA 3X29B 5FLXN 2J1RA 1K5JA 2WS92 1XNAA 4CS3A 4NWWA 3QOPA 4QXHA 4XPVA 4ASLA 1WWYA 1Y43B 2R1BA 1MZFA 1PNFA 5JPNB 4FCAA 3JASB 2Z5UA 2Q8CA 4RGAA 4M3CB 5C3OA 1EFRG 1XHXA 1OH4A 1Q8VA 4FLZA 3SITA 2N74A 1NVPB 2QQUA 3VQVA 4GKYA 2QCSB 2FMLA 1Z5WA 1J58A 4J41A 1C5HA 1R3KC 3LCPA 1GRJA 4NUBA 4LBQD 1W05A 1SQXH 2BBVA 2X09A 2QKAA 4XUPA 3NV3A 4NRQA 3VD3A 5A70A 5KBFA 4ZHNA 5KLVH 1L0NH 4QXCA 3ETPA 1CWPA 3N7JA 2R9RB 4QE9A 5JAXA 4HLTA 4XF1A 1LTEA 1W8FA 4UT5A 1ZZBA 2XONA 2IBZH 4P9IA 2XXZA 4NIHA 3ES1A 4QX2A 1XREA 5FMOL 4KU7A 4JI0B 3SJQC 1WB8A 4IGOA 3GZEA 5A6YA 1Q6IA 2AR6A 5BNOC 3P1IA 2Z3YA 4DV6O 1I6XA 2G9GA 1CQ9A 5IVFA 2R9AA 2G38A 2BP6A 2UY9A 4K21A 4LLFA 4EB6B 5D5QA 2PHDA 5C8YA 3G6BA 1CPMA 5FO7B 1ROPA 4A7KA 3MF9A 2BEOA 4CEYC
chains in the Genus database with same CATH topology
4OLLA 5SV5A 5DUUA 1H1MA 2Z2SB 2YYOA 4XYXA 4COUA 1NXD1 1ZREA 1BZWA 4J1XA 5C9AB 1RB8G 2WT2A 3O0WA 4Q26A 4YVWB 1AR83 1URXA 4CVYA 4XJAA 4IEQA 4UW3A 3VKNA 3PVOA 4EWDA 2G9FA 3IKWA 1C8M3 4JDNA 2VU9A 1TNRA 3V0BA 3A0KA 1Y0ZA 3MIHA 1RUF3 3DN7A 4LT5A 5T5LA 4LBQA 1WBLA 4MH0E 1LU2A 2GU9A 4R9AA 3S7IA 5C9AC 3NKTA 3WINE 1GR3A 4L9BA 2P3KA 1DLLA 3V15A 2CWMA 4F7ZA 2WNVA 5FAXA 5K7PA 1XYOA 1CAVB 3FFQA 1GZWA 4XFIA 2VMHA 4D94A 2ZTNA 5L73A 1PO11 1SDWA 1LEMA 2WQZC 1C1FA 3MFAA 5K0UB 1DQ5A 1OOPC 1PGSA 4EROA 4OZXA 3KZ4C 1K5MB 1OSGA 4FOQA 4WZFA 4BZ4A 2DU1A 4DPNA 3UKTA 2XL9A 4ISRA 3UL2A 1IS6A 2D7FA 2HEYF 3SISA 4Y1ZA 2F6BA 2YY1A 2YDEA 1G9DA 3HN1A 3VBOB 1OTJA 4QPIB 5F1RA 1DYPA 1TMF3 2R042 2Y0OA 3EXUA 3WG4A 1Z7S3 3ZIXA 4IQPA 1SMVA 2I07B 2P3JA 5CVRA 2WT1A 2WZR2 4GB31 4IV3C 2FMYA 4MXWA 4K8FA 4GWMA 1COV2 3ZXJA 4XXPA 3AXEA 3S7EA 4HKWA 2W0XA 3BALA 2BPA2 1CN1A 1XXNA 1JXNA 4MGYE 4RL7A 2D3RA 4R9DA 3B9IA 1NCRB 4HKLA 3IT8A 4SLIA 1CAUB 1AJKA 3UJOA 3AFKA 2JD4A 3AKSA 1NA1B 1QJU1 2DURA 3WP3A 4IV1B 1UAIA 2A3XA 2XJRA 3TNPB 1X82A 3AM2A 3RG0A 4AEJA 4FPOB 4BM8A 2PLV3 2RR13 2ZZQA 4PBOA 2R061 2EXKA 2ZHKA 1QNYA 3M3EA 1HXS2 2ZGSA 3N3HA 4I30A 1Y9QA 3C2UA 5C4WB 4LHLA 1CVNA 1SBDA 1XNKA 3I59B 4CDQA 3CO2A 3H7YA 4XW3A 4TLFA 4K1YA 3G7DA 5HI0A 2XJQA 1AF9A 1S0IA 3SNMA 3AP6A 2SLIA 3OTFA 3JD72 1RUOA 4YLZA 4R9BA 1GV9A 3GBFA 4FPHA 3ZSEA 2EXIA 4CRQA 4LO7A 2DCTA 5DUWA 4RHV1 1H2LA 3M3CA 2W08A 1QOSA 4LBNA 5I0RA 2D6OX 2LALA 4N9HA 3SH5A 4HVRA 2BW8A 2PTMA 3QACA 2ZKNA 5T3NA 3ZFFC 3ZXGA 3P3PA 3ATGA 4XF0A 3FUQA 3VLBB 1O4ZA 1V9U3 4AHYA 1KFUL 1GYKA 2VG9A 4U2AA 2K9ZA 4Y0EA 2RMU2 5IT6A 3CLPA 1ENRA 1MS1A 2HEWF 1KS4A 4MVTA 2MPFA 4W6XA 4Q0QA 1HQWA 5LK7B 4E4DX 4ZU7A 2QDRA 4XIOA 1ULEA 4NO4A 4IV1C 3AZVA 1XE8A 4AI3A 2Q1ZB 3KB5A 4PDWC 4EWAA 1VRH2 5FQ0B 4BIFA 3FFZA 4XJ9A 4WM7A 1RUC1 4LO6B 2XLAA 3LWCA 1YXWA 5FCCA 1D2SA 1ND2B 3TNQA 4CZSA 2HWC3 1COV3 1DG6A 1W6MA 2XG3A 5IK7A 1DQ6A 3DF0A 1H8VA 1MVEA 4CDXA 2MEV3 1UN1A 3WQ1A 1BMV2 1QJZA 3B00A 2GN7A 1RHI2 3MPBA 5FMOS 3H50A 1NZCA 3LSDA 3NKGA 2VQAA 4FPYA 3W59A 1OFNA 1AXYA 3R4SA 4QX5A 1RVF3 3WOGA 2NP0A 4Y5Z0 1LHOA 4YG0A 2A6ZA 1BXHA 3ILFA 3ZDSA 5HBAA 1XRUA 4IEWA 1H8TB 4Q0SA 4XTPA 5JLVA 3OCPA 4QQ2A 1H1IA 1FMD3 4P9WA 2Q4SA 5J98B 4F8AA 1DZTA 1W6PB 5I8YA 4I02A 1S0GA 2BQPA 2LUWA 4CDUB 4UW5A 1QJX3 3TOJA 4H7MA 4XQWA 2IZWA 4YG3A 3B93A 4Y1UA 5D8AC 1W6QA 3VKLA 4A2UA