2CGOA

Factor inhibiting hif-1 alpha with fumarate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
342
structure length
339
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Studies on the Inhibition of the Hypoxia-Inducible Transcription Factor Hydroxylases by Tricarboxylic Acid Cycle Intermediates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
total genus 106
structure length 339
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2cgoA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgoA01
3D8CA 2CGNA 2ILMA 1H2MA 4Z2WA 1H2NA 2Y0IA 4Z1VA 4B7KA 2W0XA 4BIOA 1H2KA 4QU2A 2YC0A 5JWPA 2XUMA 2WA4A 3P3NA 4B7EA 1H2LA 2WA3A 3KCXA 3KCYA 2YDEA 1MZFA 4NR1A 4JAAA 3OD4A 4AI8A 1IZ3A 1YCIA 3P3PA 2CGOA 1MZEA
chains in the Genus database with same CATH superfamily
1UMZA 4JI7B 1R1A3 2R7EB 3T1YO 2PYJA 3RZGA 4XC9A 3T2OA 4EQVA 3R65A 2E32A 2UUCO 1N33B 3AP4A 1RUD2 5FK8A 3UCSC 5HCFA 2DVDA 4K0KB 2XAGA 3WNXA 2B4KA 3N9MA 1UKGA 3MICA 2UUAO 3E86A 2Q69A 4TOIA 1FFXA 4PA6A 4BU2A 2QKAA 1PK6A 5FLXN 5I0TA 3H1LH 5IAXA 2R32A 5H6QA 1BE3H 3LF7A 4KI5M 3ZYGA 2ZX4A 5A32B 3BTYA 2FKXA 4BQ2A 3VZOA 3JAKB 4XFBA 1CAWA 5CAZA 5H9RA 1B09A 1H2MA 3WXPA 2JB8A 1J84A 2ARHA 1G9AA 4LF9B 2R9IA 2XOMA 5A7OA 5KHHA 2CH7B 3IMNA 3JD3A 4XETA 4NAOA 1PGW2 5C93A 5A7WA 1JZ3A 3VBUA 2PQQA 1AR72 5HFLA 3LB9A 4HNAA 4M3CA 4RS5B 2ADQB 3G67A 3MD0A 4EFEA 3N7LA 1ZBE3 3HR0A 4N53B 2RG4A 1CIWA 1FV3A 1LUVA 1XNTA 2BFUL 1OQDA 1HR0B 1GM7A 3UKTA 3UGHA 4COWA 1VAVA 5BY5A 2Q5ZA 3H1JH 4U3FH 3J80N 3RYKA 2ZEXA 3IB3A 1Q86W 1HKDA 2DVBA 3F5WC 1OD3A 4XOGA 3MPBA 2GNBA 3JARB 3NJZA 3LPGA 3ZMSA 4X65O 3ILNA 5FOBB 2XGXA 4I55B 5FY4A 1W2NA 5BNNA 2DN9A 5LK7B 1H2SB 4MTOA 2PMWB 2VVDA 4RSUA 1VBE3 2Y6KA 5CNAA 3CE2A 3WF4A 2BOJA 3LWCA 2CGPA 1CZTA 2A0LA 1HN1A 2RS32 4HZ3A 3CDZB 1ND3B 3OYWA 5C5TA 1G7YA 2Y6JA 3FWEA 1JUIA 4IL6Z 3ZJZA 5I8SA 3JALA 2HWD3 1LODA 4FVMA 3SEPA 3PVNA 4QXKA 4PA4A 2K1EA 4RA0A 2GMEA 5J37A 4R9DA 3VQYA 4IHJA 3POSA 4IV3B 1DYPA 1ZBE1 3GHMA 3M7AA 3BCWA 2W1UA 3LOBA 3UQ8A 3UJQA 4JF3A 2ZHMA 2IC1A 2LFSA 4XJUA 4YW5A 1AF9A 1XRUA 1GH6A 3DF0A 1S5LZ 2JG8C 1BYHA 2Y60A 3J81N 3WW2A 2DVAA 1IG3A 3WV6A 2PN5A 1NY71 1QKQA 5ANQA 1JI6A 4QIWF 1VQ4V 1LOCA 4L87A 4K20A 2JS5A 4FBFA 4M01A 5FY0A 3W7UA 1OVSA 1QLNA 1MACA 3POJA 2D7FA 5DG2A 5GONB 4QHZA 2BTVC 4E2GA 4XILA 3VD4A 1MZEA 1ENRA 5CB7A 3D0SA 4XPVA 2XNDG 4OMCA 2VUAA 3LA7A 5AVAA 5FYUA 2C5DA 1TUBA 2A7AA 1NI8A 2FCVA 1W05A 1D4M1 2D6PA 3WG7B 2ATKC 4AEDA 4X8NA 4PJ0Z 2Y34A 2G9FA 4UV8A 5F3GA 4WZFA 4XDKA 4KH9A 4Y1YA 2D93A 1VBC2 1YSCA 1GN4A 5K1PA 1H2LA 4OI1A 4LK6A 5A3WA 3BOPA 4PDMA 5LGTA 4GJYA 5GKAC 4FAHA 4CDUB 4YIOA 3FFQA 3S3WA 4RS5C 2QQNA 1KDKA 4QPJA 2D43A 2K2SA 3FLTA 3CNAA 4C0HA 1W6QB 3H3LA 1FKAO 3PTYA 2NYYA 4TSFG 5IYCO 4WM7B 1QVGU 5LHHA 2YROA 2OCCC 3VKFC 1HIXA 2A79B 1VQNV 4Z07A 2GC1A 3LDCA 5JQGB 3I2GA 5A33A 4JTDB 1SFNA 5D8AB 5ANNA 4GZRB 2OCHA 2PYLA 4R52A 3ZYRA 3ZR5A 3LE0A 2W0XA 5DPNA 3P32A 1PVXA 1Y76A 4K6BA 2Y48A 2AZ2A 5B5EZ 2JKBA 3WFVA 1N32O 1ZTEA 3T4HB 5A6XA 5CG8A 1YTFD 5LBBA 4LPLA 5FP3A 1UZVA 2J1UA 1K5SA 1PNFA 1SQ4A 2M7WA 4FTSA 5A80A 5C3OA 1UMHA 4Z8BA 1VP7A 3AP9A 4JAAA 2VO5A 2VGDA 3V0AA 5H6RA 5LHGA 2EIBA 3IDAA 5IWAO 3BGAA 4GALA 5BMVA 4XFAA 2OYQA 3AP5A 3AYAA 3JZVA 4EEQA 5LP6C 4NROA 3MDSA 3KLSA 4Q4V2 1AX2A 1DF0A 2DWDC 1W2UA 4H3WA 4MOAA 2E53A 5FZIA 4UWDA 2WS93 4LF4O 3N7KA 3EXUA 5BY1A 1SLTA 3GF6A 2Y69B 5LA2A 3ZIXA 1VAMA 4IEUA 3BKZA 2RR13 4XUPA 3RVHA 3LDKA 4CE8A 2VRZA 4FPYA 1AL0G 5JZGC 1Y74B 4QX0A 5A1FA 3BPZA 1PM7A 5FZLA 3IC9A 3OGSA 4NHXA 1AR5A 2B39A 1PVC3 4KBBA 1OBNA 5J2UA 1QMJA 3QH6A 2XL9A 1RHI2 3ZHQA 4BWAA 3B00A 4GMP3 1GOFA 4BR6A 4LTAA 1M9NA 3MHSC 4LOSA 4IEWA 3S3XA 3ZKUA 1B35B 1NTZH 4DUYB 1RM1C 2F4PA 5LCWL 5IWFA 2ZGUA 5FZ1A 4Q0PA 3POEA 4XDPA 1O4YA 1QJY1 3P3PA 1U97A 2OA2A 1AR71 2A06H 4I3PA 5ABJA 3T1YB 4FM2A 3WCRA 4GT1A 4DW1A 4AVTA 2ATFA 4XFIA 3DN7A 4Y3OA 5J2TB 3K3NA 4O4HB 4ZKIA 3SGIA 4I50B 1XQ8A 1PGL2 1R6NA 2OXBA 1LOFA 1O59A 1DZTA 3OPTA 1H2KA 4JTAB 1F9KA 2A9HA 3VBSB 4LFBB 2DTWA 2J1EA 3NVCA 1N34B 3RBZA 2R1BA 4GUNA 2EIJB 2ZMLA 3QO7A 3WG7C 2CDOA 2VTFA 3HNYM 4CCCA 1GKBA 4HMZA 2L35A 3OY8B 1JOYA 4JI8O 4AVCA 5J1XA 1W0KG 2IH1C 2W91A 5IYDO 3E35A 2WLKA 2C26A 4XW3A 4HL0A 3B4SA 1N34O 2V4VA 4AQYB 4XCBA 1US6A 4N53C 3I7DA 4Q4X1 3HT2A 1THZA 2P1BA 5KX5B 1GN2A 1SQFA 1DGLA 3CF6E 4V2VA 3CC7V 5FR3A 4G4FA 4A2UA 1RUJ3 2EINB 4O2AB 1XNKA 1JS9A 2RJLA 3DYOA 2L6LA 1NTKH 4JVAA 4WM8C 1E1RG 2F4VB 1W9FA 5DM6V 1GRJA 3VV1A 3G71V 3ETQA 1JYNA 4NTWA 4MX3A 1HRI1 3W9AA 2W68A 4QDRA 5CA1B 1H8TC 1AXYA 1P7GA 1WLTA 3ZRXA 4P9XA 5F37A 5G04L 1SLLA 2GN3A 2XAHA 4XDLA 3X2QC 1TNFA 1CPNA 4UV9A 5IJ9B 4RHV1 5ERLA 1QJU2 5KHIA 1DDLA 1UCXA 4LWSB 4QPKA 4CS2A 5FJHA 4E9KA 1H38A 3AL6A 3X29B 2QKSA 4EJRA 4QB1A 3SJCC 2HWE1 3EYPA 4GX1A 4IUGA 5IY5C 1AVMA 3NSTA 1I0HA 3AG4C 1H6YA 1Q56A 4H2AA 4U3JA 3ME2A 5EZWA 5L7OA 4LKEA 2K9PA 2A7WA 2ES3A 5JXIA 4AR2A 1VBB3 2RS12 4CDXA 1AR81 1TE1B 3VKOA 4BMEA 4QKBA 3L75H 3DXRB 1SDWA 3B8MA 3ASNC 2LQTA 2YI9A 2XL7A 4URTA 4DRXA 4JI4O 1H4GA 4YZ4A 2HYXA 1ASJ2 2PLV3 4RFRB 3RNSA 2BJSA 4I9WA 3OD0A 5C3SA 1F4AA 4EN8B 3TXSA 2XJVA 3GWOA 4XQ4A 1BK0A 1T5EA 4GH4A 3AM2A 3TBDA 2XH6A 3IZOA 3FE5A 4URAA 1REDA 2R073 4L11A 3D82A 5BXZA 5IHRA 4OPAA 2FZ2A 2XHBA 3K5OA 3ZYFA 5CFCB 3OUFA 4ZI7B 2PI4A 1DHKB 3AMPA 3ASOC 1W9WA 5LBQA 2ZCWA 1JUHA 2BWCA 5IE9A 5IATA 3CMGA 4LF9O 4YWAA 2VQFB 1NA1B 1V70A 3IKWA 2VNRA 3OBTA 3LPFA 1SFPA 4DUYO 1AR82 3LIGA 4N43A 4AHXA 5IJ0B 1N1TA 4FFBB 4IV3C 1EYBA 2EIGA 2FHRA 3DV8A 4Q5OA 4RR3A 5IT9N 2Q30A 2IJKA 4BYYA 1ZYBA 1G9BA 2IJJA 4DR7B 3W20A 2BZDA 4MV2A 5H5NA 1PVC1 5FMOS 5DABA 1MEC2 4JGZB 4HFSA 3MV01 4I09A 4N9IA 1F23A 5DAQA 2Y64A 2UU8A 4HOOA 1W8TA 1YUDA 2WSSG 1W8HA 5FLHA 4YVSC 2CGOA 3MFAA 3WNNA 4JGYA 5T55A 4XEZA 3D36A 1JYVA 3B94A 1XNAA 4JYBA 2KA3A 1SA0A 1ZRCA 2HWD2 2ZMKA 4BM8A 4OHYA 2YBKA 2RVAA 4PBPA 4RAIA 3ACHA 5AFBA 3MIBA 1W6OB 1GWMA 5CKMA 2WNVB 4FPJA 5K8SA 4LH6A 4DIQA 2VQAA 4XAAA 5TSWA 1TMF3 1CPMA 2WPDG 1R092 4ASKA 2HKOA 3DECA 4QKDA 4RD7A 4QQPA 3F7VC 2ADEA 4H13B 4QPGC 2YIBD 3UO2A 4FPPA 1LEMA 4IE5A 3U37A 4AQYO 5GZGA 2A71A 1CAVA 2HHHB 1MQTA 4QGLA 2WYFA 3SXWA 3K4DA 2D3PA 2R071 2LW1A 2BGPA 3VDBA 4V1PA 2XJRA 3O1RA 1LGCA 4DS0A 1WP7A 2E5LB 4JTNA 3RGBA 2IZWA 3CIHA 4Q4X2 4ZU7A 2L9LA 1JZ7A 4DUZB 4YM3A 4DQAA 1QJZA 2ZAAA 4YGDA 2F4VO 1L7QA 3E8HA 4FPOB 2XMLA 4HPKB 3ACLA 3SCGA 1E1QG 5A7QA 1D0GA 2W39A 1R73A 1WCQA 1K5MC 5EYYA 2WO2A 1RUI3 1MR5A 2J1RA 1L3JA 1JYCA 4QXCA 1AI4A 4HK8A 4TWKA 2BU9A 1IX9A 1DLCA 4E4EA 2JDIG 1ZBA1 4OXSA 1XNRB 1UOFA 1ZM1A 4WM7C 4IIJA 3D36C 2GMMA 1NQDA 1RUH3 1BHBA 1KC8W 4L8JA 4FLXA 1A8DA 1AHSA 3DYMA 1GN3A 4Y22A 2WYSA 5T52A 2TUNA 1QJX1 1GTOA 2ZGOA 5FLJA 2XWBB 3K58A 4QDSA 4FFIA 3VD7A 4YRDA 4CBCA 3H3ZA 4QKFA 4MVUA 4B29A 1A8MA 3LAGA 3VOUA 3POIA 2CYFA 4CDWC 4CDQB 5CB4A 4RQPB 4B7EA 2IFRA 2KSDA 4ASUG 5L3BA 3NRUA 3MI8A 4E27A 1OH3A 1N36O 1OCOB 1NCQA 2QNKA 1V55B 4I0XB 1LKNA 2C6SA 5H9QA 4QJFB 5DZGA 4X8AA 2QKCA 5L36A 1XMOO 2CHHA 1FXKA 2WJSA 4NTYA 1L0NH 2EIDA 4LBQB 3VKNA 4DK1A 1K5QA 4BDVB 4NHYA 1CP9A 3EFFK 1WLDA 4DR5B 4YW7A 2EIMB 1REEA 5FFOC 5DZEA 3I3BA 4DV5O 4P14A 4AGRA 4CEYC 1S0JA 3WF0A 2AYHA 1EUUA 2O14A 3HQUA 2ETEA 5JI9A 4W6WA 4FPCA 1DLLA 2VNGA 2WKKA 4EROA 1GP4A 5L19A 5LATA 3KV4A 4IEXA 2WO7A 2PHXA 4XBNA 3T2PA 4WFHA 4WFAV 2ZX1A 4CEYB 4YM1A 5DG1A 3AZYA 2FCUA 4YZ2A 4NHKA 4OVEA 3FB8C 5GZEA 1YZBA 2Z79A 3GCXA 4XQWA 3QNEA 3AG2C 1PIV3 4CCEA 2F66C 4IERA 1DU3D 1W0OA 1GNYA 4S2FA 4XF3A 5SV5A 4EN0A 3RSJA 4K7JA 2V1DA 1PO12 3ZXLA 2QA4V 2X6AA 4HONA 2EXJA 5IJRA 4HG6B 5JIAA 2DVFA 5FZ4A 5JOWA 2DYSC 3H8RA 5FLIA 4HZFA 4N21A 3KCXA 2XVLA 3J4UH 1N32B 3PIJA 4PA9A 2YMZA 1E57A 4JGSA 4UT5A 4K1YA 1EV12 2Z5UA 1LHWA 5A7SA 4JTOA 2JGDB 2R063 1A34A 5FBZA 1O3SA 3AMNA 1RYYA 2WZR2 5DAWA 5KUMA 2P37A 3SYOA 3FMGA 1WZXA 2F4LA 1KB9F 4LF6O 4O4IA 4LO4B 2NQYA 1JU4A 5DAPA 2PGGA 4DV1B 4M3CF 4MG2A 4TYSA 2XKOA 3V0BB 4LBNA 4OUEA 4EV0A 3KZIZ 1N33O 1FXHA 1J5EO 1RIRA 3BHPA 2W0FC 1O5LA 1QH7A 1RUJ1 4AXOA 4PJYA 1J58A 4P9IA 4LIVA 4LF4B 2A3QA 1NA1C 5LBCA 2H3OA 2E26A 5HPOA 4P9JA 4K8RB 2DUPA 1UOBA 1NTMH 3WDWA 4XURA 2BW8A 1YHQV 4JI2B 4Q4Y2 1HRV3 4LBJA 1ASJ1 3CSXA 2KG7B 2QE3A 4PQQA 2NR5A 3RWNA 3VBUB 2Z0AA 5AVPA 4CCMA 4RS5A 3JCUZ 2XVKA 1O9GA 2DCKA 1NCRB 1NT2B 1YIPA 2P17A 1JYTA 3ABLB 2ZHLA 1IPSA 3HNMA 4X1KA 2IW5A 5BUVA 1FJGO 2OS2A 4BMBA 5FXVA 2Q4PA 1VBC3 5IFPA 4GX2A 3EO6A 1COV2 1O6UA 1KJLA 2IXLA 4XDJA 1F4HA 5KA6A 2JEMA 4ZS3A 2XUEA 2X5IB 1R64A 4V2WA 4ASMB 2EALA 1IBKO 5JCOC 4IEOA 3MIEA 4PT6A 3SEEA 3QF7A 5FO8B 1N8RW 1GZWB 4H0LB 3N35A 4QHOA 4BCUA 1CESA 5LRSA 1DGSA 5A1LA 1OLRA 5EBMC 1FV2A 4I55A 3STZC 5LK5A 2J1TA 3ZMOA 4R8CA 4FK5C 4XUOA 2VZ1A 3KM5A 5FYHA 5F6LB 5IVVA 5K0UA 1K7DA 1RUD1 3OYWB 3NNMA 3OR7C 1RMU3 3CCLV 3LZZA 4JGZC 5A3MA 4LR3A 3JCIA 2VCBA 1SLBA 1XJAA 3WF1A 4LKFA 4CU8A 4X89A 2BRTA 4W4ZA 1R1BA 1YQ8A 2ZE8A 1VARA 3UKVA 4TQFA 4PDRA 2P6HA 4IHJB 2R0HA 2J1SA 3R4DB 4BZ4A 4DV0O 4CCDA 4LLOA 3T0AA 1RITA 2RMKB 3FJSA 4YY3O 2XR4A 3ZSLA 4J11A 4W4LA 3E5XA 4L92A 2HYKA 1GM8A 4BQ3A 1XI1A 4FPHA 1JHJA 1IPKA 3TB0A 2AH2A 4PCRA 4LNVA 1XL6A 2ZGQA 1R1A1 1TEIA 2TNFA 4UUJC 1D2SA 2ZAHA 4LO7A 1D4M2 4MHRA 1LGBA 4WVMA 4H33A 3G7DA 2R072 1EM1A 3WVJA 1Z2GA 1H8TA 2XWJB 2A75A 2RDNA 3ZXFA 2PTMA 3SQOA 1CIYA 1IS4A 4FZ1A 4JZGA 2WLHA 2V5DA 2R0FA 2V4AA 1N3PA 5C6CA 4FOVA 2RM22 4RWUA 1J3RA 4UF0B 1YFYA 1N47A 4CP9B 4UFHA 3UGFA 2FDJA 1AP5A 3LDDA 4BA6A 1SHWB 3DKWA 4DV6O 5L3EA 3AG3C 1X82A 4ZPIA 4CDXC 3L71H 2B9UA 4ES8A 5JCTA 1YWKA 2RM21 2PHUA 1S2BA 1YFUA 1QCEA 4XHBA 2VL4A 5DDJ1 1NCQC 2JE7A 2VJXA 5CA0A 1DF5A 1TVKA 1CXZB 4RYDA 3OOXA 1W6QA 2GUZA 4F83A 4A5UB 2YZ4A 4WM7A 2FDGA 3OTOB 5F32A 3EHKA 4Y1UA 3R05A 2IXJA 4OULA 1HW5A 4B7KA 2NLJC 4JI2O 5JQGA 3N9PA 5CN0A 3TRSB 3ILFA 4JYYA 4CH3A 2ARXA 2VAUA 1XB9A 1RXGA 2A6XA 1GO3F 1TMF2 4AFDA 4M0HA 1W04A 3AK2A 2K46A 3NV4A 3WEZA 5LMUB 2Y0OA 4N7IA 4N7UA 3J8F2 4R9BA 3J7AU 3WW1A 3VUOA 2EVXA 4OLLA 3ZSMA 1Z78A 1IXBA 1BHAA 3VBOA 1QJEA 1JZ4A 2YIBA 3FD9A 4AGVA 2GSYA 1HRV1 3KCYA 5EJ1B 2HWD1 2ZS6B 2GTAA 2Z5WA 3N2KB 4JDNA 4G9SB 1RUJ2 4AG4A 4B1LA 5D21A 2BBAA 3E8FA 3JBG3 4X8PA 3IFXA 1UYXA 2CWSA 4WFGA 4QPGB 4UW6A 4DRRA 1NVPB 4RGAA 4GJZA 4MVZA 4AEMA 2QTSA 1LNQA 3FBMA 2ITCC 2BBVA 4OHZA 1CEZA 3KV9A 4FJCC 1OF4A 5F2VO 2WAAA 1PNMA 1W2BU 5CISA 1XNCA 1BVP1 1WD4A 2ZR3A 5FWJA 1RUF2 1Z7S1 1RINA 3J7MA 3NKTA 4BIUA 4NIGA 5J2UB 1GZ9A 4FO9A 2JJ6A 4BAYA 1F31A 4LE4A 2FD8A 1V6JA 5ISLA 1K34A 4YW4A 5H9CA 4QDQA 4AE2A 3UESA 1J3PA 3LCPA 2XAFA 4JDOA 1NYWA 1BGYH 4KG8A 1R3IC 2QM7A 2HHHO 2DTYA 5C3RA 4FZ0A 1JMUB 2H94A 3MZHA 4UW4A 2XJUA 1GWKA 1D7PM 3ETGA 4LBKA 4EN9B 4K8ZA 3MHHC 3N9LA 2JB4A 4JZ2A 5ABJB 3B8NA 1FXVA 1DF4A 2VCCA 1X9PA 3NMBA 3OW2U 3HKBB 4O4HA 1S1AA 1XMQO 4OHWA 2DVGA 5LL6Y 4E8CA 3PL0A 5IVBA 3AG1B 3M3CA 4UYBA 3SJAC 1CJDA 3QCWA 4HN0A 1U5YA 3IBMA 4JKLA 5FPUA 2WLIA 4LHSA 1ULFA 1WCSA 3K9AA 1BVVA 1LESA 2ODMA 1BEV1 1OI6A 3WHUA 1NS1A 2HEVF 2OIEA 1JHNA 2D6LX 1YDXA 2WRAA 3T09A 5AG2A 5A3TA 1R6KA 2NLRA 1MMMA 2IVJA 3RZHA 1WGPA 5GM0A 4JC1A 5JMOA 1A3KA 4BE3A 3B3QE 1ZA7A 3DPRB 3ZRWA 3WB1A 4GXLA 4PI0A 1H1MA 4BQXA 1RVF3 4QPIC 1FI2A 4WFBV 2X8KA 3WZ1A 4AZZA 1MEC3 4UFKA 2PZSA 4ATEA 4W4KA 2EULA 1GWLA 4JDMA 2BSKA 2KXLA 4UCOA 2ZEZA 1J1TA 4OI4A 2PUSA 1NQJA 2GZWA 2W87A 1EAH2 4B08A 2WN3A 3I2OA 2WINB 1XNQO 1HV0A 2WQ4A 3RT3C 3RMXA 1QJY2 1RUE2 1W59A 4XVHA 1XSQA 1UU6A 4MT8A 1NY72 5KXDA 3ZBHA 1NH2B 3OGJA 1YEWA 4FP2A 4MGTA 3W5NA 3E83A 2Y38A 3QACA 5FQ0B 5GLUA 2BUKA 2Z3YA 1NLSA 3T4ZA 3UKNA 3Q9OA 1CPYA 3E8BA 3CRCA 5D2AA 3K48A 4N8MA 2CTVA 5T5PA 4SLIA 4KP4A 4LJHA 3KD4A 1QU0A 3SJBC 4OHVA 2YEVA 3DXRA 1OC1A 3U11A 3C8XA 2V09A 1L0LH 2B5UA 1O8SA 1OV9A 2HWB3 2FDIA 3O5SA 3WNPA 2W9XA 1HRV2 2VOKA 5KHGA 3I2HA 1N1YA 2CWMA 3Q4HA 1OOPC 4IV1B 2UXDB 2GU9A 4E8DA 4OQ9A 2B46X 2EIEA 4QXBA 5IW0A 4LNUA 3WU2Z 4GIQA 2VPVA 4J42A 1E5SA 1RUI2 1C1FA 4HK9A 2N74A 1FPN2 4CCLA 5DN2A 4NB5A 4A6SA 4KU7A 5FUNA 1VALA 3ZN5A 5CFCA 1TA8A 5FYZA 4E4DX 3EQEA 1XPWA 4CZSA 1AVBA 4C0BA 4RO2A 2G9GA 4GH4C 3PUQA 1WN7A 1S72V 1RUH2 3RRDA 1GP6A 5LOVB 3JD72 4DO2A 1Y4MA 4ATFA 4NO4A 1I1EA 4Y5Z0 3ACFA 5C3QA 2D5FA 4LA3A 4FLVA 3VHNA 3D3AA 3LDRA 3QOPA 3ATGA 1W6NA 2QDRA 1ULCA 4BQ1A 1YJNV 4AVSA 4AF9A 2WZEA 2VECA 3MW2A 5FZMA 1HDJA 5F6KA 1JZ6A 1YQ5A 3M99B 2BEOA 2OQ7A 3VDDB 5FZDA 3BI3A 1WMXA 3LDEA 3THPA 4LMFA 4XFCA 1V00A 4LITA 1JU3A 4IL7A 4BJ0A 2NN4A 3GXUA 4WBNA 3ROUA 5HCHA 1IQDC 2PAEA 4D6QA 3WSOA 4IQPA 3ZOIA 3B9CA 3CCRV 4Y5SA 1MSWD 2A3WA 4MADA 1DQ2A 1PO23 5F1RA 4XABA 2XXZA 2V4DA 2UUAB 4QU1A 3PNAA 1AL23 3I59A 3MUY1 4FOYA 2ET7A 5C8CB 2CY6A 4C90A 3T2MA 3ZXKA 5T5LA 3MPPG 4XF9A 1MG1A 4UVCA 2VMDA 4RFT0 2H6CA 4UCTA 3S57A 2UWCA 4G27B 3DGTA 3SHRA 2P3YA 4WBBA 2HWB1 1Y9GA 4Z1MG 1KKDA 2EICA 5C5UA 4OUMA 3U4SA 2G9ZA 2DYCA 1J59A 1UIKA 3QD6A 4Y20B 2ZGLA 2ZKLA 4C7UA 1LOAA 4GULA 1V9U1 4WM8B 2FYUH 5EWSA 3AP7A 1H0BA 3ZS8C 4PA7A 4I5SA 3THOA 4TV9B 3E89A 1JODA 4CU7A 1PL0A 1QOTA 3N3HA 5BYNA 3VQXA 4K3AA 1KUQA 2SLIA 2Y4UA 1NE4A 2RM23 3B09A 1RL3A 3CCUV 3A23A 3THTA 1ZL8B 5IYZB 3P1IA 3OJBA 4NRPA 3BPSA 3OMNB 2WFF3 4EWEA 5AC93 2DBIA 2WNUC 2ZKOA 3HPNA 4IIJB 3UNPA 1HNXB 2DCZA 3C7OA 4BIOA 4RL7A 2Q5TA 2ZR2A 1FFXB 4KHPO 2XPJA 3BRCA 1QLEC 3I8TA 1PK6B 3HNBM 1UKRA 1WBFA 1GNZA 2QDOA 3MIDA 1ND3C 1I5ZA 4LF5B 5FPVA 5JMCA 1MZ6A 2O57A 2VNOA 1GZTA 2LGQA 5EP9A 3UV9A 1XOYA 1URFA 4A7ZA 4RUFA 5LBEA 4CRQA 2FMDA 4I0BA 3WY6A 2CH7A 3PUIA 4CDQA 5FPOA 4D6TH 5J96B 4MZUA 3SLIA 3WUCA 1OUXA 1AL21 4UFJA 5GZFA 3PUSA 4N53A 5EPAA 3ZN0A 4L99A 1DQ1A 3VL8A 2E7QA 3CS5A 1PGL1 1X33A 1WW6A 2CE4A 1PZ7A 2PAMA 1XMQB 3VN4A 3WQ0A 1UU4A 5FAXA 2Y26A 4BW9A 3R6SA 1JVMA 4J7KA 2PHLA 1W9YA 3A0BZ 2EX3A 4GB32 4GQ7A 3JBG1 3SH4A 3A7QA 4DEQA 5FY8A 1V9U3 3NAPC 1QQCA 4P00B 2BTQA 2Q8OA 2WNUA 2EIMC 2VZVA 3IIIA 3PJYA 5KUKA 1I5XA 2Q1FA 4EB6B 2XLFA 4D7YA 5GLVA 1GLHA 3S7IA 4YZ5A 1QWRA 2VY0A 4JYCA 4NWVA 5KBFA 4HKLA 4CEYA 4ZZ8A 2ZACA 2AR6A 1HWYA 1MZ5A 1Z0HA 1WMDA 1RM1B 2RNBA 1IBMB 3MO4A 4CYDA 5C33A 1ZBA2 2VOVA 4ZHQA 4CUAA 4I4TB 2Z4FA 4YM2A 3J26N 3U78A 4UVAA 5AC91 5JZGA 1RSOB 2ORZA 3GALA 4FPKA 4PDVA 3MV11 5C70A 2BYVE 4X62B 4Q26A 1OFSA 3MGUA 2ZOEB 3HBKA 4D0QA 4YHHB 4K21A 1SQBH 2YHJA 2P4EA 1G8WA 4BOWA 4DEVA 2RS31 5CKQA 2BPA2 2Q1ZB 2D3RA 1KD1W 1SLAA 1B06A 2YGLA 3X2QB 2GV9A 1S3JA 2JGDA 3A8TA 2WUHA 1RUC2 1VQLV 2EINC 1W6MA 4MH0E 2QQOA 2X10A 2X05A 2ZM6O 3JCZA 2DU0A 3C3TA 4J7ZA 3VBOC 3LNNA 4FTBA 4H7MA 2JIJA 1ENQA 4Y5TA 4BXFA 4QKNA 2EIKC 3H7YA 3WF3A 5GZDA 1SLIA 3ZDVA 4ZHNA 3RMYA 3BY6A 4CH5A 2XAQA 5LA1A 2ORXA 1TUBB 3GZEA 2VNVA 3WW4A 3ZX6A 1AR73 3KB5A 4PDWC 4XYXA 3H42B 5CBFA 4QWNA 1WMFA 5KC5A 5A3NA 1ND2C 4A45A 1GM9A 4N43C 3L9DA 4IGPA 2LO1A 5GZCA 4O7XA 2IFWA 3D4KA 3ETPA 2ZHKA 4GKJB 4IW3A 1VBD3 3AVRA 3PVOA 2UXCB 4CDUA 1VF5B 3MEPA 1OMIA 2MK3A 5GJ6A 4X1KB 1PPJH 4DV2B 5I91A 1KDMA 2DBNA 2UU9O 1HLCA 5FKCA 1HB1A 5FRAA 4UW3A 4X66O 1C8M1 1OOPB 3ZFGA 2P6CA 2QQKA 3K3OA 3FN9A 5ACA3 1D4VB 4IYHA 1XYOA 1BQ0A 5JSRA 1B3QA 2QDNA 4NPMA 5GW7A 1RVF2 4FVVA 4DFSA 1AUYA 2JWPA 3SPJA 5FY1A 1UY4A 3VBHB 4R4ZA 3K9SA 2J42A 1BMV2 1MPXA 5A33B 2UWBA 2JG8B 3ZXJA 3JD2A 2RS33 4NYKA 2TEPA 4CSWA 1PNLA 5LB6A 3M8LA 4OCTA 2HWC3 4W8JA 3BABA 1Y76B 2Z2SB 1XNRO 2QTWB 4YZ3A 5KXBA 4A42A 4UCRA 3NV2A 4FFKA 1OFNA 1OVPA 2ZX0A 3ETDA 5IDJA 1CAXB 5K0UB 4MS2A 1X9TA 5J36A 2QQLA 1BSMA 1IPJA 5EC1C 4MVMA 4IETA 2Q8DA 4X1YA 4D3WA 1TQ5A 2Z42A 1FMD1 3CBNA 3JASB 4HN1A 3BCCH 3O1SA 4DR2B 3H1KH 1K45A 4NPRA 2OTJV 5B4NA 1AXKA 1WB7A 1GUIA 1HNWO 3FAVB 1OJHA 2C9AA 1OCCC 2XHNA 4K9SA 4JKMA 4LO5B 5CBGA 1V6NA 1FXZA 3S30A 4CXXA 5JI7A 3UK9A 5EYPA 5LGUA 3WNMA 3KCCA 5FOJB 5FPZA 1C28A 4TTGA 3CEWA 3KT7A 1WNSA 1ULGA 5FXWA 1RXFA 2YUEA 3RYRA 4WVMB 4GZ9A 3OGRA 3LFMA 3ZFFC 4O9EA 1Y74A 3OGVA 1LECA 3USUA 4LHKA 1WLWA 4CP1A 5T50A 5EHDA 1M06G 3I2JA 4XQDA 1CD3G 4LF7B 2W52A 3J9SA 4FLWA 2X6BA 4Y1XA 3H7JA 5LW9A 2HWC1 1U0AA 1P49A 3E1F1 3T08A 2WSVA 4ZKTB 3VD5A 4CDWA 3AG4B 3A0RA 4LFCB 5LWBA 1W9SA 2RMU1 4CP9A 1UX7A 2A6ZA 4QX7A 2WSUA 5FXZA 1S0BA 3Q8AA 5FYYA 3RZKA 1SZTA 4TLGA 4F6EA 4JASA 3W7TA 2VTXA 3Q8BA 4FQZA 1R1ZA 5T5OA 4S2GA 2IXHA 4NXNO 4MTGA 1IKQA 5L9VA 2YI8A 1I6XA 1PO21 2W94A 4TUYA 3WQ1A 3WR0A 2G4IA 1VBC1 4D69A 2PHWA 2VOXA 5F3IA 4A44A 3LA2A 2GUZB 2OZ6A 3BEHA 4KWKA 4XFGA 4GB31 2IH3C 3ASIA 1AX1A 3BVCA 1K97A 3AK0A 4QB2A 5DDJ2 4FT8A 1LENA 1PO22 2Q8EA 1RUE1 4Q29A 4MGZE 2XTAA 3GNEA 4XCAA 1ZZ9A 4XACA 1MS0A 3K4AA 1PIV1 4CA9A 1AL22 5D1IA 3T0BA 3UT5B 4DUWA 3BU7A 3C3VA 2VZOA 3MF6A 2PY5A 4B3RO 4YSFA 2WFF1 5LMNB 2F17A 2DU1A 1PNKA 2E31A 4MVRA 3SR2C 4O2AA 3W59A 4CPBA 1RMU1 2J1VA 5FZCA 1OCRC 4MUVA 3L70H 3E5UA 3VBOB 3OBZA 3SKVA 1URXA 2YU1A 2YPJA 3WX5A 3APQA 5F7UA 4NIHA 2XLGA 1IS3A 3FLRA 2O8OA 4CU9A 4FPGA 4Q2FA 3VZLA 4DR4O 4Y33A 2FMLA 4MHUA 2OYZA 1U5XA 2DYSB 4X6RB 4Q4Y1 4LC1A 1VLNA 2Y6HA 5L3GA 2H0BA 3SDLA 2P6JA 3GDBA 4FI9A 5FTTC 4CPBD 1NKGA 4JI4B 4IEYA 3F7YC 1PV0A 3G6EV 4CXWA 3I54A 5FP8A 4O4JA 1UN1A 1DIWA 1J5EB 4LH7A 1DGRA 2JD9A 1I08A 2SBAA 1EAH3 4PLOA 2YICA 3PU3A 4QGMA 4TWTA 4CH4A 5IK4A 4UFLA 4AI1A 2ZZJA 5C9AB 4JRAA 5JH7A 1LEDA 4GWMA 1YTFB 3OR6C 1UYYA 4O65A 4ORFA 5BNPB 5B66Z 1YVWA 4LIUA 1FPOA 1EP0A 1W2OA 1YFWA 2VUDA 4MXVA 3B77A 4LF8B 2ARBA 1FX5A 3ZPOA 3CZUA 3ZMVA 5JXHA 1IHMA 1G9FA 1VMJA 5GLWA 2ZDIC 2GP3A 1ZREA 3PURA 1PGW1 2JDHA 1WCDJ 3WDTA 3RYHB 5F8PA 1AROP 2VQFO 4GH4B 2Q68A 3AL5A 2LRPA 2BGCA 1LU2A 1U5IA 2EXKA 4HLTA 4Q1RA 3HKBA 3I2FA 1VMHA 3M4FA 2M6YA 1RP3B 2LM3A 3DYPA 4QX2A 3WP3A 2EIKB 1VQPV 1RUG3 2B7YA 1NKDA 4YYOA 4OUSA 2AACA 4IV1C 1G8MA 3HB3B 1WPXA 4AI9A 1ZZ6A 5DN6G 2ZX2A 5F5AA 4HVQA 5A1AA 2FQPA 4KFMA 1QBZA 4BISA 1F4MA 2WLIB 1OF3A 3R4UA 2JDMA 1GICA 2RDRA 4OGQB 1YXBA 3JQXA 5ITZB 2MPFA 1N1SA 4Q20A 4N43B 5IJ0A 1W8WA 1S2EA 3GWKC 2FDHA 2VQUA 3APOA 5GALA 2EJRA 4AQ6A 2MEV1 1Q81W 1TME3 3JD73 2LS6A 5FZFA 2YPDA 2ZGMA 1ZLZA 1QXRA 4U36A 1ZRDA 1FAYA 1K3EA 3I3QA 2EZOA 4Q8LA 4HKOA 4JGZA 1BEV2 3M1HA 4U7NA 1YFXA 3KS7A 1S2KA 2DWRA 4OHXA 5EQUA 5ABJC 1OA4A 2BERA 3S7EA 2DWEC 3CEIA 4YW1A 3S5AA 1AILA 3CCSV 3A2FA 1Z7S2 4JI5O 3A0KA 4P9GA 2WS91 3D0JA 3H1YA 5EJZB 1ZUQA 2QM4A 1R6TA 1QIQA 1GQHA 3GBWA 1LU1A 2OIIA 4YXWG 2KQXA 2BVVA 2YXYA 3OGIB 5M0TA 2WNVA 2RS51 3QVNA 1L7LA 4BIZA 2JE9A 3ICXA 1IG0A 2B1IA 3OEBA 3AZXA 1H8HG 2XBO3 1VF6C 4C1WA 1TNRA 2XLAA 5L3DA 3NJVA 2Y0IA 3FC0A 4P9OA 4ZBMA 5JOZA 1Y4WA 3GJAA 1CAVB 1MQTB 3VBRA 3ALQA 2GN7A 2BFUS 1NVPD 4H55A 5CADA 2YDEA 2YXHA 2R042 5LA6B 1NZ6A 2YC2A 4CU6A 1YI2V 5FQ0A 5A7PA 5BPXA 2DOSA 3RYFB 4K8FA 1Q6UA 2PLV2 3SITA 1S0FA 2WA4A 4KWLA 4EE2A 2RV9A 1FJGB 1XUQA 1D2QA 1TME1 2QCSB 3GZTB 3VGIA 4XUNA 5BR8O 3IT8A 1ODMA 4TLFA 2IJHA 4NIDA 2VR4A 5GTIZ 5AFEA 2WS92 2VH9A 2Q7HA 4DV5B 1W8ZA 3KMHA 1SQGA 4LR4A 3Q4HB 1QNWA 3CJXA 1UAIA 4H14A 3K08A 2UY8A 3GYDA 1Y9QA 1JZ8A 3TETA 1P8JA 2RR11 3MHZA 4BQ5A 4X88A 4LE3A 3WG1A 2Q9LA 3NNFA 4LO8A 2A6VA 3ABLC 4DV3B 3N7MA 1HB4A 3HKCA 2EILC 2UUCB 4GX0A 1PKXA 1ENSA 3MBWA 1I5PA 1RHI3 2VC9A 5BR8B 3IPVA 3ZSJA 2UYBA 1Z5WA 5BNOB 4LCUC 4JI3O 2QBXA 3NXSA 2W47A 3U75A 1Q8OA 2J1AA 1EN6A 3AX4A 5LOVA 1POV3 4X20A 5C4WB 2LW7A 3FFZA 3BTXA 1S0VA 5CB4B 4RQPA 3ZEDA 3NNGA 2DUQA 1NCQB 5DAVA 3CQOA 2DURA 3N27A 1MS9A 4AFMA 4JI6O 1FXKB 3SYCA 1EAH1 3CD6V 1QGLA 1MS1A 3OMIB 2YUAA 5IFTA 5D5PA 4IDZA 3C7EA 1H4HA 4EKWA 5DXDA 5EIBD 4O4LA 1UU5A 1ZVFA 3T1MA 4LFAB 1RUC1 3WNKA 2RHPA 1HP8A 4Q4W1 3QO5A 1PZ9A 4P08A 3NO8A 1NXMA 3DEMA 4B3MB 3M70A 1HNZO 2WZ8A 1YQ6A 2D44A 1IBLB 2XHKA 4JKKA 2JK5C 4JAVA 1NZIA 2PELA 2GP5A 2NNUA 4Y1VA 1FD9A 3P3NA 3SH3A 2YXLA 4FXGB 1S76D 3VDCA 3IC7A 1XBFA 4Q4X3 2QJ1A 2BVBA 2JS3A 4IGGA 1DQ5A 4KUMA 4HSLA 2DFCA 4Y20A 5LY1A 4P9PA 3H1HH 4J9YB 5I0UA 2JDAA 3ZDSA 1MNGA 1GSLA 5T5JA 2XASA 3H9AA 1SKVA 3U0ZA 2WQZC 3I49A 2WC2A 1JFFB 4TV9A 4AI0A 4DV1O 3HQRA 3SPCA 5F39A 1DYKA 3VBFC 4UBGA 3DC6A 2BNOA 1ORQC 3ABTA 2UUBO 1FXKC 4JI0B 3P5BA 4DUVA 1VR3A 4IE4A 5IYZA 5A3PA 4BIFA 2ZE6A 2VQEB 1ZZ8A 2JEXA 2JDZA 2QQPA 1RUC3 3QLQA 1TG7A 1VAKA 4ET7A 5I0SA 2VZRA 4M00A 5A6ZA 1JJ2U 1XDCA 3PVBB 4DR5O 1JOJA 1D0HA 4YG6A 3V0BA 1OCOC 1VE0A 4YZ1A 1AJQA 1VBB2 2HWF3 2RS13 2V72A 5EYXA 4L97A 3J7LA 4IT5A 2D3OW 4ZOLA 1EN4A 4UVBA 1C57A 3G4SV 4LKDA 3TGUH 1OPOA 4XIKA 1WPBA 1NU1H 4M0NA 4IESA 4QXHA 1NQTA 4MXWB 2JD4A 3KT1A 5JJNB 4AHYA 5KMGA 1TZOA 2QKDA 5C8WA 4PELA 2DUOA 5DDJ3 1Y43B 4FLZA 1AR93 2PLV1 4JQRA 2IVIB 2B5HA 1LOGA 2ZIOA 3AK3A 2FL4A 5FO9B 2RS52 2W2IA 3D5OA 4NXNB 1W90A 3LKJA 2CUGA 4D7SA 3JD4A 1VQMV 1LOFC 1W39A 1HDKA 4U7OA 3ZXAC 1YJ9V 1QQP2 2VZ3A 1UY3A 2JICA 5HFMA 1YJLA 5L3CA 1KEXA 4WCEV 1MEC1 4AI8A 2A6WA 2VMHA 1QDCA 5JPNB 2XJPA 3AFGA 1VBD2 2AHZA 4YVWA 3AYDA 2YU2A 2IUWA 4AHCA 2RDCA 4J80A 5IVFA 3ZSKA 4CCKA 1NT0A 2BTQB 2P22C 2ZGTA 1OHFA 2CTWA 1M90W 1GZWA 4XMIA 1YI7A 1NR7A 2CDYA 3Q8EA 4NE9A 2QWRB 1W8UA 1PGSA 2UXDO 2YIDA 3VB9A 3TN93 4P2ZA 5LMNO 1AJKA 4DB5A 2UXBB 1PO13 1LHNA 1O91A 4E4ZA 1RGSA 2BV4A 5CA6A 3L2HA 1G6NA 1AB3A 1VRH3 5FY7A 1BCXA 3I2IA 1XSRA 3KGZA 4J9ZB 4W6YA 2GDFA 1MS4A 3K79A 4IXLA 4ZHQB 1YO8A 5JZGB 4XIOA 1RSOA 1SLCA 2YC4A 4JX0A 2HWC2 2QWQB 2OVUA 3T2QA 3AMMA 5LA9A 4CC6A 4YVWC 3ZN4A 4LKSA 2A70A 3P6BA 1Q8VA 4DYLA 4K8XA 3OT7A 4LFAO 1AR91 2OT7A 2ET1A 2E76B 5J98B 1UXXX 2GC0A 4J6GA 3M3OA 4I30A 1KQRA 4BPZA 3GVMA 3RN4A 2JG9B 4ZIBA 3BFRA 2BWAA 4BB3A 2R1DA 4XFHA 3ZN6A 2JDYA 2ZINA 4J7JA 4H44B 1UPIA 2Y6FA 3I2DA 3FYEB 2VG9A 1VB2A 1N3QA 3VHPA 2XJTA 4QPIB 3DXUA 1O8PA 3MFCA 3K59A 2NM1A 1AZDA 1ST8A 1IKPA 2P67A 1H8TB 1WCUA 2D5HA 4JV5B 1L7RA 2OX0A 4E2LA 4AQTA 2Y33A 3OSDA 3ZFEA 4A3XA 3EBRA 2VOWA 2ZABA 3KF3A 3JUUA 1KQSU 5LY2A 4AK3A 4JI7O 1T6GC 2WT0A 2NPIA 5D8AC 3BAAA 1KXGA 3IAPA 4XF0A 1EFRG 4I2OA 1OD5A 1A6CA 3RJ2X 1H8VA 1ZZCA 1OCCB 2BOCC 2VWJA 5L9RA 1XNBA 3ZRVA 3OTFA 2ZQMA 1T6BX 2A3YA 3L9JT 5B3SC 4PLNA 3K0GA 2JJ1G 3EB7A 3H8UA 2XDVA 3CB2A 2XBO1 2UURA 1S4CA 2GALA 1LUWA 5JOXA 1M57C 5SV8A 3VBRC 4R4XA 2F93B 1SQQH 1FOD3 5CA0B 1X50A 3ZFGB 3ABZA 1DLBA 5FP4A 1BEV3 5BXXA 3DC5A 3HEIA 2HJIA 1AYN3 2Q0OC 2UXXA 3AC0A 5J9PC 1OURA 2ZTNA 3AVSA 4NXMO 1YF2A 1COV1 2BDRA 4QD2A 4DINB 4M3CE 3OUJA 4GKKO 2WLLA 2TBVA 2JEUA 1RJ8A 4ZONA 3LSQA 4MVSA 2VZPA 2WDBA 3PLQA 3LEIA 1QHTA 4A3ZA 3JU9A 2UWAA 3VHOA 4EN6B 1BMV1 2VBPA 5C7GA 4ZU5A 4UW5A 3D3IA 5FPBA 1E5RA 3OUIA 2R061 4B4PA 5FPAA 1WAZA 1YI9A 3M2MA 3RYCB 3JASA 1FYJA 4CEWA 3EHBB 3BODA 3LSSA 3O0XA 1YHFA 4PD4F 1AI6A 3N2KA 5E8AA 1UMIA 4NIAA 3AYEA 2RJZA 3UT0A 3FAVA 3FL7A 3SYQA 3K77A 5C3PA 4UFZA 2CU5A 4AEJA 5IWAB 4NVPA 3O1MA 2WABA 4QPGA 5EYPB 4K1ZA 3AG7A 2RMU3 3RI8A 1GANA 3H1IH 2WAOA 1KU9A 4XBLA 3K06A 3CXCU 1RHI1 2QQMA 4LUKA 2ZXQA 2QUOA 1SZXA 3OF1A 4DY3A 2JIZG 1UL9A 2WQ8A 5JXGA 3ACGA 4OMDA 1FFTB 2WAMA 4XBQA 4JPRA 2FBEA 2A5ZA 3USUB 3VD3A 3CKHA 3N2GB 2C4XA 4CUGA 3PMSA 2B8MA 3MW4A 4XDOA 3MLJA 4Q0SA 1AYM3 2MW2B 2NZ9A 2VWKA 2IBZH 1S77D 1JTZX 4CDWB 3DPRC 1K9MW 4CDQC 1ZRIA 4LO6B 1ZZ7A 4LF7O 5FZ7A 3M8AA 1Q6HA 3FB7C 2VMFA 3BN6A 2QWOB 3DSQA 4CCOA 4W50A 4UAPA 1LHUA 2GMPA 3E6BA 1KJRA 2P4KA 1M4WA 3VBHC 1F15A 5JVVA 3DXTA 3ES4A 2GSMB 2F43G 2QVSB 1QQP1 4TUYB 4YPJA 4LFBO 4D7TA 4QM8A 4RN5A 2WLMA 3AG2B 1LGNA 5J7MA 4KXRA 3B01A 1K42A 5E79Z 3CMEV 1B04A 3JSLA 4HVOA 1HR0O 2P5OA 4Q4Y3 1CX1A 2HG5C 1US2A 3TYJA 3C3SA 1WA8B 3JB8A 1ENXA 2QE7G 3EXAA 2RJKA 1BQPA 4GLXA 3UT5A 4WVVA 1DFQA 3BTZA 4Q0QA 3ASOB 4A6OA 1DP0A 1JQ0A 4QX1A 1YJWV 4WVWA 2C1FA 1SF9A 2D98A 3ZFFA 1IVSA 4HETA 1SS3A 5DUXA 4M4PA 4NOTA 3CRQA 1VF7A 3AXEA 3SYPA 3DPRA 4PDWB 2EXIA 2HJFC 1NE6A 1TME2 5DZFA 2Z69A 1UJWB 5LEJA 4ICGA 3LSDA 4LT5A 3JBG2 2LUWA 3CC4V 5T3NA 2E33A 2WWJA 5FZHA 2EIJC 4P5YA 1OKOA 1C8NA 3I3DA 5F9TA 1R081 4AI2A 4MSVA 3SMHA 4OX9B 2VMIA 1WBLA 1BQZA 4BLIA 3N9QA 2QQIA 4Q27A 4JYAO 2QGNA 4IEPA 5JWPA 5EIBC 1V6LA 1LR1A 2ZMNA 1KYOF 1FPN1 4FM1A 1OSGA 4LF5O 3T4DA 3O1UA 4YVSB 5BNQA 3K4ZA 5JXJA 5JJJB 1ZRRA 2HBUA 4BXSV 1DYOA 5F2SA 3KZ4C 2DF7A 4K40A 1FATA 1W6PB 4O4JB 1V54C 1PP9H 2UU9B 3TNPB 4B3MO 1RUH1 1RUD3 3T30A 3GM8A 2JXAA 3OCPA 4N9HA 1JYWA 2E63A 5JSOA 5E16A 2FDFA 1UF2C 5C9AA 2CV6A 2D40A 3FHAA 5B3SB 4I01A 2HWF2 5BNPA 2E6VA 3W7XA 3J7HA 2QZ2A 2YEVB 2R043 3POWA 4ASLA 4EWDA 1O3RA 3JATA 4GKJO 3ABMB 3RS6A 1AR63 3WCSA 1K3IA 2QWNB 3NAPA 4AEDC 4IV1A 1CN1A 1D4M3 5EZYA 4LNUB 3VZMA 3TEZA 3PDQA 4X66B 5FMDA 3T4VA 3QH7A 2HBTA 3JD71 3FX3A 3CJIC 5JPMB 3H1WA 4QU2A 4PIYA 1GYKA 2ERFA 4GAZA 1QR9A 4KGGA 4CUCA 3OEEG 1R083 4LXLA 5LP6B 3JAWB 1OKQA 1SZBA 1GV9A 4MYEA 1KFUL 4WVZA 4Y26A 1EUTA 4B3SB 5JR7B 4OFGA 1IOAA 5CFDA 1ND2A 4LBOA 4PDLA 2YS8A 3NJXA 2B9ZA 1T2XA 5IAVA 1LOEA 4MVQA 1MS5A 2GTSA 3RDIA 4EWAA 4OPHA 1WP8A 3OM3B 5FKBA 4CUBA 5EBLC 1JJOA 1K73W 3W21A 1PMJX 2AHYA 3GZUC 2XAJA 2JJ2G 2YBPA 3VDDA 4F3JA 2CAUA 3CJHB 1HB3A 2VMGA 5J09A 3S6PA 1YRZA 4R6ZA 1DQ6A 4WV8A 5CVRA 1IQAA 1NXD1 3H0OA 1VF6A 1ZA4A 1AYM1 1M4UA 3DKQA 4YFZA 5FO7B 2BOIA 4XJ8A 3IAYA 5EK0A 1JZ5A 3FUQA 2PAKA 3BUCA 1OQ1A 1PK6C 4C8DA 2Y6GA 4P9YA 5FJKA 1H1IA 2WT1A 1N3OA 3I59B 4CC5A 3WQBA 5C8CA 1AP6A 1VMFA 3PUHA 3IIAA 3JB4C 1W2TA 1VBA1 4A41A 5JUVA 2K0GA 4X1IA 3ZMTA 3TCUA 4FFHA 4DRVA 2DW4A 2XB6C 5JIUA 2OPWA 3TNQA 3WUDA 2YV8A 1EN5A 1GKFA 2VS0A 5E88A 5I93A 4IE7A 3RPQA 2N7GA 4WM8A 1QOSA 4ISQA 1O9HA 5LA6A 3RYIB 2VCAA 1WA4A 4PLMA 1EZVH 1M1KW 2FZ1A 4XAEA 5EIYB 3B40A 4OYUA 2HWB2 3KV6A 4I3GA 3AKSA 3WDVA 2W6JG 1Y3TA 1B6QA 1X8EA 1KRIA 1D2DA 1NG0A 2VU9A 2D97A 1W8OA 4D94A 5I8YA 1COWG 4UFMA 1ZL8A 3BA8A 4QPYA 1F35A 4GKYA 1QJX2 3BOWA 1ENVA 3C90A 3AZWA 2WLJA 4ISRA 1UPSA 1VQ7V 3POBA 2EAKA 2R30A 1QXPA 4K3UA 4FOQA 4YGEA 1W0JG 3N9OA 5FZ9A 4HAMA 4JAUA 5C8YA 3O12A 3JQWA 2X0LA 2R16A 4NPLA 5DUUA 2HP8A 1SBDA 4QE7A 3BALA 1IDSA 2JDNA 1CR7A 4UOJA 3ZRSA 1GR3A 4X20B 5C4WA 4B8EA 3SPHA 2VXRA 2YYOA 1UZZA 2LFRA 2IXKA 1BZWA 3UGGA 1R3JC 4MGYE 3VBFB 3UO3A 4AEKA 5FY9A 1JN2P 4UXAA 3MDPA 4QNHB 3K5MA 3I97A 2PHRA 4QGPA 3WT3A 2ZE7A 2VW1A 4PIXA 1H8EG 1AR92 1WWYA 3HKEB 3B2EE 1VIWB 1IXMA 5FZGA 1RB8G 5FNVB 2ILMA 2Y0PA 3VD9A 1ZBE2 3AKTA 3HKDB 4RUEA 1W9TA 4NXMB 1C1LA 4LBQD 4NAMA 2XQRA 2Y6LA 3VZNA 4XMAA 3FHQA 1DZRA 3CXHF 1VQKV 1GQGA 2VW2A 2WNUB 3MIFA 1IBKB 2XKPA 3O1OA 2NN8A 4EB6A 3GGLA 1XOUA 3V64A 2VMCA 5DUVA 1RC6A 2W5FA 2GC3A 4QT6A 5LMUO 2ADPA 1YIJV 2X5IC 3WP6A 4O2BB 5HV0A 4TV8A 1HN0A 2JENA 2J22A 4Z1VA 4RQFA 3IWZA 3AG1C 3VDDC 1POV0 4WFFA 1W28A 2D6MA 1DGRN 4I4TA 3SJQC 4RGKA 1S0IA 2X09A 3PIGA 1FS0G 1MSDA 4INDA 1PD3A 4AFCA 1RVF1 5FYMA 1HJFA 2VUCA 2PXJA 5E1AC 2FDKA 5FV3A 1G86A 3IJ4A 1DBNA 1JFFA 1M57B 3ETEA 3P30A 1PVC2 1AJNA 5FZ8A 4H7LA 1IGOA 1K8AW 4EN7B 3ZHTA 1AYM2 3AXDA 1ONAA 3THCA 2VZUA 5E1RA 2ZDIA 5J48A 4DV4O 4FM0A 4DXWA 1W6MB 5F5QA 1TGOA 3RZZA 4QQHA 3H8XA 1W06A 1QJY3 3LGRA 4OQ8A 3MLKA 4X64B 4BLJA 1RUG1 1WLEA 3SH5A 2E5LO 1S5JA 3C7GA 1G1XB 5EBWC 1YLLA 2I2SA 1WB8A 3TEWA 2WT2A 1W0NA 2W95A 1NJIW 1OCZC 5IK5A 1NBMG 4F6RB 1YCIA 2BTOA 4KMQA 3DTUB 5A32A 3E8GA 1NUKA 3JAKA 3KGLA 3WNOA 1UY1A 4AFBA 4ZOLB 2RN9A 1CAWB 2VUJA 5JAXA 5A9GA 4XXPA 2KKWA 5FUPA 3T1HO 4MXWA 5K1XA 3JYCA 1HW7A 1VQ6V 3ZR6A 4DNYA 5CG9A 1UX6A 2MHFA 1U12A 2X53S 3LA3A 3SISA 1HXS1 4M3CB 4QPWA 1XE0A 2HVJC 2GNTA 1Y67A 4GCZA 1LULA 2DCTA 2E51A 1ALYA 2R9AA 3W7WA 1FPN3 4GB33 2WBKA 2F1MA 3CJIB 1UNBA 1SDDB 3AMQA 2WNOA 4KWJA 1Q90D 3A21A 1OOPA 2RE9A 4DR3O 2WL1A 3O14A 4YVWB 3ZXGA 1MQTC 4FXKB 4UCSA 2VXJA 2XT9A 2PQSA 4AGGA 3W7SA 1N36B 1O4TA 2GH2A 1W8NA 3VBHA 3APBA 3KHCA 4P5HA 5C4WC 3OTOO 2VBBA 4JGYC 2VW0A 2JG8A 4JI1O 4DY5A 4YNIA 3ZPYA 1BS3A 2ZT9B 2V5YA 5FZOB 2VVEA 1UQXA 2E9QA 2P34A 1H1AA 3GZAA 5JVDA 5JLVA 2YXSA 3L73H 1XXNA 2WNEA 1X7NA 4ZXEA 4CVUA 1S0EA 2YY1A 1IS5A 1O3TA 3RW0A 3LSUA 3WDXA 1Q3EA 5HXVA 3L2YA 1V54B 3UKMA 3LD8A 5KLVH 1YNAA 5KXEA 1CAXA 3AFKA 5CIRA 3O0WA 2H0VA 1ND3A 4MW8A 3AB0A 4Q4V1 4M4RA 1SBEA 1M93A 4X1YB 2ZGRA 4HSJA 2CTPA 5A3UA 3KVBA 1NOVA 1JCHA 3JALB 3MIHA 4DV0B 4LBEC 2AGAA 1BHGA 2NMNA 1Q5OA 1QXJA 1QHDA 4J10A 4COYA 4YY3B 5CFDC 1V6MA 5I0DA 4N90A 2ZGKA 4FTEA 1A32A 4Q8KA 1FMD2 3AEIA 1R091 2C24A 5CA3A 2RDQA 3BTAA 5FUIA 2KD7A 1ACCA 2D6OX 4PIZA 1GN6A 2UXCO 2YFUA 3OE7G 3N7JA 4TXWA 1CZVA 4O61A 2DQ3A 3ZYJB 2D6KA 3ML0A 2F6BA 4QPIA 4FFGA 4XJZA 2RMU2 3SKJE 5LXTA 5GONA 2C9KA 4QE9A 4DV7O 3WD5A 2UYAA 1R082 3ZFEB 4GMP1 5HV4A 2VQ0A 1HV1A 5HI0A 3OUSA 1QY4A 3LEKA 1XE8A 3KKYA 2Q67A 2B42B 4YIPA 4XHXA 1JZ2A 1I3HA 2XVGA 2IU3A 3THDA 4AEDB 1AYN1 1UZ0A 1US3A 4I0WB 3B9IA 1XBLA 3D6EA 1S0GA 2ARCA 1PM4A 2ITDC 2X7RB 4FAGA 2OPKA 1QF3A 3FZ3A 4NHMA 3INAA 1NLRA 4GKXA 4F8AA 1H9WA 1AR83 5BNPC 4AW7A 1PL4A 2DCYA 2CAZC 4JHZA 4DV6B 1KGYA 2XUMA 1HQWA 1JBCA 4HBNA 1APNA 4Q4W3 4FLYA 1DCSA 4YARA 5L3FA 2PF4E 2EXHA 2EA7A 2VM9A 2E7AA 3A22A 2ZNIA 3M3EA 1CX4A 3OEAA 1Q8SA 2WLPA 4ES9A 1ZSPA 1XYPA 4MO3M 1U5ZA 3OB8A 3LFIA 1BXHA 4BQWA 1SMVA 4N23A 1AJOA 3PHMA 3IM0A 3T1HB 3AJYA 5LZ6A 4OZXA 4JI0O 4G3YC 3PTRB 1ZWIC 4QX8A 3ZIAG 2VULA 3EVKA 1UWWA 1AI5A 2WLLB 2VQEO 1XL4A 3VQWA 3TN91 1RUF1 3WP4A 4P9LA 4K35A 1UD1A 1R093 2H8PC 4W65A 3GHNA 2O0OA 3NV3A 4FFFA 2CTQA 3L72H 1JOPA 1N0NA 1M5IA 3N9NA 1P84F 1Q8QA 1Y7BA 4E2QA 3ZN1A 3O0VA 4I9QA 4QX5A 1XILA 5A3OA 1XNDA 4AVBA 3RYCA 3NWKA 4NJ4A 5FWEA 1O5UA 2YG0A 1NZCA 3H9VA 1OLQA 5BMVB 3JD0A 5H9PA 2OTLV 4IEVA 4UB8Z 1UO9A 4MGKE 1QJFA 1RUI1 4AFAA 4PA3A 2W46A 3ITQA 2PI5A 5JOYA 5A7NA 2EAAA 2DCJA 4RHV3 5IVJA 1FNZA 3HIFA 1ZBA3 1WUVA 2RS11 2OIGA 4XZPA 3NKGA 5FZAA 1G6UA 4MGQA 3C2UA 3SC7X 2JDKA 2PHFA 3IGAC 1GP5A 1W3VA 3WINE 4DMIA 3ZCCA 4NR1A 1TMF1 4NRMA 2QQUA 1EY2A 1H6XA 4LF6B 1Z5VA 4PHZA 1XHZA 1QJU3 4YW6A 5JH7B 5JSPA 1O3QA 2W6IG 5EJ3A 4EZ4A 2YC0A 1VBD1 3R66A 5B2GB 2WO3A 4LOTA 1AR4A 4DXSA 4QM9A 4AI3A 2ZCEA 1KP3A 5A6QA 1JX9A 2X29A 1V6OA 3DCQA 5B4XA 5JR2A 4PF1A 4L8QA 2P3IA 4MSWC 3PUAA 2P4VA 2UXBO 3RYHA 1G4YB 2OT5A 4RQEA 4L2NA 5A70A 4JQTA 4B3TB 4YJ2A 4ARXA 3H3UA 2KM2A 3WB0A 3LSEA 1GU3A 5A6YA 1UY0A 4DOUA 1ASJ3 3B93A 3T2TA 2IWGB 2W1QA 3VKLA 4J1XA 3BIWE 4I50A 2DQ0A 3B7MA 4FPLA 1Y66A 4IEZA 2WN2A 1PMIA 5F2WA 2BQPA 4QGNA 1Q7YW 2Q7EA 2LJ2A 4YJ3A 4I0AA 4BHPA 4C1XA 1EBOA 1SETA 4MW3A 1K4CC 2CAVA 4NTXA 4XTMA 5TISZ 3DUIA 4AYUA 4DXZA 1VRH1 2PFWA 4QB6A 1FT9A 5ITZA 3ZYIB 4QHBA 3I3MA 3H50A 3PN1A 3ZXDA 3CO2A 1PM9A 1PX3A 2GDSA 3POFA 5CMUA 5BNNC 2AENA 1OZ0A 4Q0UA 3VHRA 3UYJA 2RJ2A 3PU8A 4XUQA 3ZMNA 1JYIA 1DQ4A 2BOBC 1C5HA 3HJRA 4XTPA 5KX5A 1UPGA 4QQ2A 3CC2V 4YW3A 5ACA2 3WG3A 3NNJA 3JD1A 1PIV2 4PDWA 1C8M3 1F2NA 5CKNA 1S5HC 3BU0A 4BW5A 4E4HA 1M56C 3RYPA 5LYJB 4EFBA 1CAUA 2ENRA 2LP7A 4MVTA 1SEFA 5B1BB 4LF8O 3H01A 1J83A 3LIHA 1MABG 5DQ0A 1YQ2A 3O9OA 5CA1A 1GK9A 5FZBA 1EV13 4JI1B 3KT4A 1W99A 3E6CC 2AXTZ 3RI9A 2ZGNA 4XJ9A 3TEYA 4Y4YA 2WWUA 4LBLA 3ZFGC 4AQ2A 3LQCA 1ZX5A 3QTCA 3TXQA 5HCAA 3CU7A 1GOGA 5EFUA 1W6PA 4B1MA 4LWSA 3VBRB 1LB2A 4KBZA 3F95A 4YG3A 3K46A 3RZMA 4XUTA 3I3EA 4ARYA 4TSVA 1UY2A 4CTEA 4U3JB 3ZHRA 1K5MA 3RYFA 3ZYPA 1HNXO 1SPPA 2LTNA 1UYPA 2ZM6B 3RZJA 5CZKA 1GZCA 1VIBA 1VPHA 1H30A 1TVGA 2VBDA 3NV1A 4TN7A 4S2HA 4W6XA 4CS4A 5KA5A 3BB6A 3JATB 3ES1A 4DRXB 4DR6O 2IJIA 1V6KA 1CONA 3NAPB 4KNCA 1VP6A 1H2NA 1VJ2A 3OAAG 1RUG2 1GMMA 3M3QA 2HFEC 3LEGA 2BE3A 1HJGA 5EZYB 5FP9A 3PJSK 2I74A 1UOGA 2N05A 3K0DA 2DJVA 1HNZB 3HKCB 3STLC 5L9BA 5A3LA 4J25A 4E4SA 3I2KA 1QJX3 2D3SA 2QM8A 5FZ6A 3R0RA 3IPVB 5LP6A 1COV3 1KMIZ 5BNOA 1VBA3 5G05L 2DE0X 3B5LB 2JVDA 4DUZO 3MAQA 3CCVV 3HWJA 3CPWU 2QQJA 1GOHA 4Q6GA 1JOBA 3E22B 2XQXA 2ADDA 1XREA 1OH4A 5JDBA 1J1LA 3RVZA 4B3SO 3K3WA 4FSJA 3ZHUA 4AWDA 5K7PA 5CEHA 3CRMA 1F5JA 2BGOA 2W08A 1N4CA 4TT3G 1F7YA 2Q6AA 5L7OC 1IBLO 2DFBA 2B1GA 3CCMV 5FL7G 3CJHA 3RWKX 1YC61 4NUBA 3A4UA 3KQ4B 4FPEA 2UUBB 2E3CA 2Y8KA 1RPOA 1WMEA 5IUQA 4O4LB 3U10A 3I55V 1RMU2 4AILC 4JZRA 2EF6A 5FK7A 5DECA 1N1VA 3L74H 1SA0B 4PV1B 1BL8A 1AXZA 4WF9V 2VOTA 5FMBA 1WW4A 4XDQA 4JV5O 3ABKC 2ARAA 4NHLA 4X1IB 3C7FA 1QEXA 3ENRA 5HXMA 2VTXJ 4DR3B 1WD3A 4XZUG 3K57A 1FMD3 3AK1A 2K9ZA 2FMYA 3U1XA 3ZHVA 1RUOA 2Q8CA 5BNOC 3LDBA 2WR9A 2Q73A 3SCHA 2P06A 4DV3O 1DG6A 2Q0AA 1GBGA 1N0JA 4DR2O 2HJDA 4JCKA 4AAXA 1YYNA 4AL9A 3POYA 2WA3A 4AOCA 3UM7A 4UCUA 1Q8IA 1TAEA 2CL2A 2WFPA 1KP2A 3RYIA 4JI8B 3GB7C 1Q8PA 3VBBA 4YGBA 1QU7A 1W3XA 5BV6A 1L8DA 4X62O 2DYRB 1SQVH 5FYIA 4OZOA 2AEYA 3EJKA 3VZJA 4DR7O 2LGWA 1KD7A 5KHKA 2HWE3 1C4RA 5J3UA 2I07B 2CGNA 1W2AX 4Z2WA 5HBAA 4JRLA 1WCKA 4CP0A 4I02A 3HMYA 5CBHA 1GAXA 1CZSA 3ZMUA 3PJQA 3H8OA 5T54A 4FOWA 4DXRA 3WQ7A 4AVVA 3VKMA 1PZ8A 2WNVC 4JV4A 2VD7A 1UW8A 2R062 3I5DA 4B4QA 1SERA 2WZR3 3AJZA 5LEKA 5C8YB 3HOBA 2BNMA 1CQ9A 1B35C 1GNHA 3QG5A 3U07A 2AZ5A 4NMIA 4TQDA 4CXYA 4NKGB 1BK1A 5B1AB 2MEV3 1JPXA 3CP1A 4ZS2A 5FY5A 1KKCA 3UJOA 5KMGB 4TZDA 1IZ3A 3HVDA 4XJAA 5FZ3A 3JXSA 4UXNA 4DK0A 5A7WB 4P02B 4DR6B 3VBFA 4HNAB 1BLZA 2HR3A 5GLTA 4I0XA 1V9PA 3I4IA 4J1WA 2WIIB 1JW6A 4LHLA 4B3TO 5H2FZ 1SCSA 2W92A 5FBJA 2HEWF 4DO0A 2AC1A 5KC6A 2KB1A 3ORJA 5JCOA 5FYSA 4LBQA 2C2AA 2Q8VA 1H9PA 2B9VA 2R49A 4Y4RA 3FX7A 3IDEA 1UZYA 4BH9A 4BWOA 3ZMZA 3BYWA 4F4LA 3HKDA 1QVFU 4OX9O 5FDBA 4X65B 4BQYA 2W1SA 3NW4A 2JIGA 4CS3A 2PA7A 3WF2A 1JMKC 3OBRA 3AZZA 1XU2A 3S5QA 2Q7GA 3JARA 4DXTA 2ZEWA 5F5CA 1SCRA 1S0DA 1XMOB 1RTVA 2ZNJA 2R9RB 4FMTA 5FMCA 3CX5F 3DL3A 3POGA 3CYOA 5BNNB 3U14A 5E89A 1NR1A 1H2GA 3K75B 5I8TA 5LASA 1WA6X 4AVAA 2RDSA 1HNWB 1TUEB 2CK3G 1P4RA 1QLEB 4RHV2 4S2DA 1UIJA 2PHDA 1BBT3 1DK1A 4PQ9A 5LGNA 3D8CA 4GWJA 2A73B 3IDCB 5CU1A 4LEJA 2AUYA 1XNQB 3ZKYA 1LJ7A 1R3LC 2OWOA 1WJZA 1NH2D 5C9AC 4Z92B 5IYBO 1Z7S3 3E5QA 4ONUA 2XJSA 1RPRA 2WZR1 1OPMA 5IT6A 1RJ7A 4FP3A 3WG2A 5IY5B 3ZSEA 3UL2A 1R1A2 1WW7A 5K4LA 2VCMA 4YHHO 3ZX7A 2WWWA 4CZZA 4IV3A 5EV7A 2ZBJA 4RR3C 1K12A 2JG9A 4U2AA 2F23A 2XBO2 1AX0A 1MZFA 3I56V 3HN3A 4HVRA 3N4MA 2A3XA 3WDYA 1CWPA 1AI7A 2CSGA 2O1QA 2G19A 5BZBA 1MVQA 4KU8A 3K5NA 3ZN6B 3G6BA 3RWRD 5FCCA 2KR2A 3WP5A 4DV4B 3ZYBA 4O4IB 3KQRA 1YXWA 3MF9A 5FREA 3MW3A 5FYCA 4R50A 1LTEA 4F6RA 5KR7A 4GWIA 1HX6A 2A6YA 2P5BA 1DZQA 1XC6A 3OUHA 1OHHG 3ASNB 4X6QB 2HWF1 4CCJA 1JR9A 4G28B 1Q43A 4FCAA 5KXCA 1IURA 1XQNA 3BIEA 4COZA 3KWVA 2DV9A 4QQOA 3AYCA 2KG7A 2GH8A 1QQP3 2QFEA 4LFCO 1S55A 1DQ0A 1Q6IA 4KHPB 5FP7A 1ULPA 2OKXA 1UFIA 3J8F1 2YGMA 1I9RA 2V7QG 5FZEA 1I94B 1NCRA 3CJIA 4GKKB 3WHTA 3RJRA 2AEZA 4QAWA 4COVA 1D5NA 1JH5A 1XYNA 1AR1B 3CZJA 4DV2O 2IM9A 2G38A 5FZKA 1SQPH 4AAPA 3G6JB 1HXS2 3KF5A 2BCCH 3FHIB 1LHOA 5CBLA 1GQPA 3MYXA 2P3KA 3ZO0B 1XE7A 2X5IA 1W03A 2OUJA 4FQ4A 3RVYA 2YIAA 3TAYA 3TN92 2G1MA 5B1BC 4Q4W2 5C8CC 3ZHSA 3ON7A 4LLFA 3RG0A 1W8FA 4DR1O 1VRH2 2XONA 3N36A 5B1AC 5D8AA 5APAA 3M3IA 5FZOA 5IVEA 4HXCA 5JVDB 2IXIA 2ZD9A 2LROA 1KFXL 4LP8A 1V55C 4NRQA 3R4SA 2D6NA 3K03A 4JTCB 4PI2A 1GFF2 3VQVA 3AG3B 1BKZA 2NMOA 1RUE3 3QO8A 5EC2C 1ULOA 2WLQA 5L73A 4EYUA 3OFNG 4ZZ5A 2XOKG 4G2KA 3ACIA 1W0PA 1KITA 1FYUA 1MOFA 3V0AB 1STMA 4CEWB 1HRI3 4DW0A 2VZSA 3CCJV 4K0KO 1WKYA 2NP0A 2V73A 1ZZBA 3B69A 3J8F3 3ABUA 1KECA 5E6HA 5GLZA 1IBMO 3S0MA 3KHBA 3HAGA 3GBFA 1JA8A 1VMGA 5IVYA 4FLTA 1OT5A 4AQSA 3LUTB 3SYAA 4QMAA 1WW5A 4A7YA 3C7HA 1LAJA 3M7MX 4NN0A 2AGSA 1OLME 2YB7A 1LCLA 3SCFA 2GHYA 2R041 3NR7A 2P7TC 4WZCA 1MS8A 3OGGA 3N2GA 5LXTB 4MTFA 1Y9MA 1REFA 1AR61 1EZJA 1SC5B 3VZKA 1VBB1 4EZHA 1XHXA 2FB5A 4P9WA 4GA9A 2A1XA 2JRIA 3CWBH 1VBA2 2Q1MA 1NLQA 1R3KC 1CJPA 1VQ8V 4R8HA 2WO1A 1Q82W 1B35A 1RUF3 3IDBB 5FXXA 4UF0A 3RQ0A 4B4RA 3OPWA 1EPZA 3OMAB 2W1WA 2H6BA 2VZQA 4IGQA 1CVNA 3LOIA 3OEHG 3B02A 4FPFA 2VVFA 3DGEA 5DAXA 1BT8A 4LHNA 4YLZA 3T0DA 2QSAA 4YG0A 5J2TA 1AYN2 4IGOA 4HT1T 1BZKA 2OW4A 3HPLC 4JYAB 3NL1A 4YGCA 1TVKB 1MS3A 2JDPA 1K4DC 3VBSA 3MUZ1 1HQNA 2ZGPA 3GBGA 1M56B 1QR8A 3FUOA 2R6QA 1WA8A 4MGSA 4XBFA 3BA9A 3OY8A 1IS6A 3LEMA 4LULA 2RS53 3WG4A 1I5YA 4Z82A 1BMFG 2WLNA 4LQRA 1UYZA 4OI0A 1HB2A 3VLBB 3E2EA 3K51A 2RCVA 1LOBA 3FB5C 1CGPA 1RUNA 3D3QA 1ZAUA 3CRAA 1VRBA 3ZFFB 2EBOA 5HCBA 4QQLA 1NCRC 2WZPP 1I94O 2EJ7A 1X4TA 5F3EA 5A2QN 1J3QA 5FMOL 2P2KA 1G9DA 3RZLA 3VL9A 1S0CA 4ITCA 3IN9A 4L9BA 4Q4V3 2XJQA 4LUMA 4E2SA 2MNGA 3GCWA 2JECA 1QNYA 1X59A 4RQPC 1ODNA 3ABKB 4DR4B 2OCCB 5KAIZ 1C8M2 1OA2A 4JI5B 4MLOA 1LRHA 1BJQA 1QDOA 1I7FA 2VZTA 3IMMA 4KQ7A 3V65A 2RR12 2GNMA 5EXOA 5DUWA 4ZY9A 2HWE2 4Q1PA 3AMHA 3F2ZA 2ZZQA 4MVOA 4P30A 3PVEA 5KAFZ 1VBE2 5IJ9A 4MTXA 4YVSA 3WB2A 3ILRA 3OPZA 5CYYA 5AC92 2ZXWC 4B3NA 5KWRA 2HLDG 3HT1A 5FYBA 2FCTA 1P7BA 4XXAA 2OQ6A 3ELNA 3KG2A 5L7OB 2N04A 2QWPB 5DEDA 3K5LA 5F3CA 1VB4A 2P3JA 1VQOV 5IK7A 1C3HA 1U96A 4CDXB 1OLMA 3MIGA 2IXCA 1POQA 1OCZB 1YQCA 4FIPC 3HR9A 2XG3A 2MEV2 5K9YA 4NIIA 4XE9A 4KGQA 4X9QA 4META 4AHWA 3CHXA 3WLUA 2VMEA 3OGCC 1F5FA 1UZWA 1SQXH 3OD4A 3CCQV 1FOD1 5FYVA 3T3YA 3IAQA 3SPGA 2RQ6A 4CH6A 4YJ2B 2DYRC 2ZGSA 5LBFA 1ULDA 1PMHX 4I7ZB 4LA2A 1C5IA 5FYTA 3LNMB 4ZI7A 1LR5A 4GX5A 4YW2A 1LNSA 2ZPXA 3OBAA 3JAWA 1RFYA 4JI6B 4UB6Z 1KS4A 3OG2A 4RGGA 5B1OA 3GJBA 1EV11 4ZU4A 4IYIA 3A0NA 4YJ3B 3K04A 4CCNA 3VBUC 5CFDB 5F5IA 2ETNA 1KS5A 1ND2B 4JI3B 2R70A 1NA1A 5FZ0A 2Y69C 2C0ZA 1V6IA 3WOGA 4D8MA 3KV5A 1ZX3A 2JE8A 3ZFEC 1G9CA 5ACA1 4F7ZA 1BBT1 1SG3A 2E7TA 4FFBA 5FPRA 4D6SA 2DDUA 1SBFA 4RR3B 3FYIB 3TOJA 3TWIA 1OXCA 2QJVA 4CP2A 2B45X 1DGWX 2YBSA 4BK5A 1POV1 4UCVA 1NAEA 4LORA 1SESA 3FB6C 3AP6A 4R9AA 1FOD2 1ULEA 3NNLA 5FIXA 4XF4A 1BBT2 1FNYA 2O8QA 5JJEB 3ZRWB 3G80A 1X36A 2QQVA 4KG0A 3SNMA 3V56A 4Z2AA 3AKQA 1BCCH 2OZJA 4IE6A 5LYJA 4X64O 4JGYB 1F8VA 3KSCA 4D6RA 2GBOA 1CAUB 4Q0VA 3E6DA 2QR4A 2ZJCA 3CLPA 2QEXV 3CCEV 4HYOA 1SFYA 2CTRA 4QX3A 3ZM8A 2Y4TA 1WLCA 2AZ0A 1UOJA 4OI2A 3O1PA 1MVEA 3AZVA 2FTKA 2BSKB 5LA0A 1W6OA 4DR1B 1XEQA 2OUHA 4ZXKA 3KVAA 3Q8CA 3WNLA 4KWUA 2YSUB 4UI9L 5LRRA 5IK8A 1E5IA 3J7NA 1ZNPA 1VQ9V 4IEQA 2CNAA 5FPLA 1ROPA 4UFIA 3HQXA 4O9GA 1HQLA 1ZRFA 5LHIA 4LK7A 1FAFA 3FBYA 3CRRA 1AR62 1K5MB 3FKSG 3ZIWA 1SPPB 1QJU1 5IVCA 3T1LA 4PF5A 3AKRA 1OA3A 4HPKA 3WW3A 3URFA 4J41A 3O65A 2HVKC 4CDUC 3JAMN 4Y1ZA 4AHZA 3EMRA 1J95A 3TEXA 2I45A 4C91A 4IE0A 5GTHZ 3TJTA 1QOOA 1OUSA 1JXNA 3Q8FA 2W3JA 5D5QA 1LHVA 2VE1A 3O1TA 2P90A 1GMGA 1NX9A 1OCRB 2JDUA 2HH9A 3A0HZ 4A7KA 1QH6A 4HKWA 4PBOA 1SRYA 2HEYF 4GWNA 2UY9A 4L0PA 2ID4A 1OQEA 2WWSA 1D5AA 2WFF2 4Y22B 1SACA 3W5MA 4DUXA 3E97A 4JHTA 4NWWA 4DZGA 1HXS3 3F5TA 1A78A 3H1MA 3WDUA 3K2OA 5I0RA 2ZKNA 1XU1A 4GYCB 1YJKA 2GC2A 3E22A 1X8MA 5H9SA 3NQHA 4A4AA 1F4NA 2DMXA 5DMYA 3O1VA 4Y24A 4MGIE 2EILB 1UXZA 2ZXWB 1W6NB 2R72A 1KBHA 3O7OA 1K92A 3ZLIA 4BQ4A 1V0AA 4YFWA 4R9CA 1PHMA 1VEWA 4YM0A 2D2CB 1PO11 1YITV 3U4XA 2J7MA 3MLLA 5C71A 2ZEYA 1QNMA 1DGWA 4XJWA 2PHTA 3HKEA 1PX4A 1JYXA 4H37A 3JSNA 5FPXA 3VDAA 5FNVA 2IU0A 2AW9A 4WBNB 3ZYHA 2VQTA 2HLEA 1O7FA 2YFZA 2BNNA 2E74B 1K5JA 4B3RB 1DTOA 4FLUA 2GAUA 2QZ3A 2Q4SA 4GD4A 1F51A 3ST7A 3FLPA 2BP6A 4XF1A 2HKXA 1K33A 1HRI2 3ABMC 2AREA 3UETA 4GMP0 4LBMA 2F95B 1EPWA 1Y6XA 2JX9A 4XFFA 4DV7B 3AKPA 3CL1A 5IYYA 4HANA 2UXNA 1V9U2 3VBSC 3W58A 2ZHNA 4UBHA 5CFCC 3ECQA 4O2BA 4TV8B 2EZPA 1VQ5V 1PNGA 2QQWA 2ZX3A 4DPNA 3QBQA 5KHJA 2X6CA 1MA1A 3ZXEA 4CEWC 5B1NA 4BK4A 2ZIMA 2ZE5A 1O4ZA 3TK1A 4COUA 2CDPA 2JGUA 3NJYA 3CMAV 3BVOA 1YIFA 4WFEA 2JG9C 1E5HA 3T1CA 1AJPA 2ZA9A 3HD8B 1E79G 1L1FA 3ZVXA 3RFRA 2JKXA 3PMEA 5K0UC 4SBVA 2LW8A 2QTOA 4ABMA 2HEPA 2GNDA 3HBZA 2LALA 2PYTA 3SPIA 3USSA 4KL1A 2E75B 4R7CA 1VBE1 3HN1A
chains in the Genus database with same CATH topology
4BIFA 1UMZA 1QJU3 1R1A3 1GZ9A 4FO9A 5JSPA 2JJ6A 1O3QA 1F31A 4LE4A 5EJ3A 1ZZ8A 4CVYA 2JDZA 1V6JA 2YC0A 1VBD1 5B2GB 3AP4A 2QQPA 1RUD2 4YW4A 5HCFA 1RUC3 2DVDA 4AE2A 1J3PA 3QLQA 3LCPA 3WNXA 1VAKA 4JDOA 5I0SA 1NYWA 1UKGA 4M00A 3MICA 4QM9A 4KG8A 4AI3A 2X29A 2DTYA 3PVBB 1V6OA 1JOJA 1D0HA 4YG6A 3V0BA 1PK6A 5I0TA 3MZHA 2R32A 4UW4A 4YZ1A 4L8QA 2P3IA 2XJUA 3ZYGA 1VBB2 2HWF3 2RS13 5EYXA 4L97A 2ZX4A 4LBKA 5A32B 4EN9B 3VZOA 4L2NA 5ABJB 4XFBA 1CAWA 5CAZA 1C57A 3H3UA 1OPOA 4XIKA 2KM2A 5H9RA 1B09A 4M0NA 1H2MA 4M25A 4IESA 3LSEA 4MXWB 2JD4A 3KT1A 3WXPA 4DOUA 1ASJ3 3B93A 3T2TA 1S1AA 4AHYA 1G9AA 2IWGB 4OHWA 2QKDA 3VKLA 5C8WA 4J1XA 2DVGA 3BIWE 5KHHA 2DUOA 3IMNA 5DDJ3 1Y43B 3B7MA 4FPLA 4XETA 1AR93 2PLV1 1PGW2 4IEZA 4JQRA 1PMIA 3VBUA 2B5HA 1LOGA 2PQQA 1AR72 2BQPA 3LB9A 5FO9B 4M26A 4M3CA 4QGNA 4RS5B 2RS52 3N7LA 1ZBE3 3M3CA 4I0AA 3D5OA 4N53B 4BHPA 3LKJA 1CIWA 4C1XA 4D7SA 1CJDA 3QCWA 1LOFC 1W39A 4HN0A 1FV3A 1HDKA 3ZXAC 2CAVA 1U5YA 3IBMA 2BFUL 1OQDA 1QQP2 4XTMA 3UKTA 2JICA 3DUIA 1YJLA 4AYUA 4DXZA 4COWA 1MEC1 1ULFA 4AI8A 1VAVA 1VRH1 1WCSA 5BY5A 2A6WA 2PFWA 1FT9A 1BVVA 1LESA 2VMHA 1BEV1 1QDCA 1DS1A 1OI6A 3ZYIB 4QHBA 5JPNB 2XJPA 3H50A 3AFGA 1VBD2 4YVWA 3WHUA 3ZXDA 2HEVF 3AYDA 3CO2A 1JHNA 2D6LX 5BNNC 2AENA 2NLRA 3RYKA 4Q0UA 3VHRA 3ZSKA 3ZMNA 1WGPA 1JYIA 5GM0A 1HKDA 2DVBA 2ZGTA 4JC1A 1DQ4A 1OHFA 1A3KA 1C5HA 4XTPA 1GZWA 4XMIA 4QQ2A 4XOGA 4BE3A 3B3QE 4YW3A 1YI7A 3MPBA 2GNBA 5ACA2 3NJZA 3WG3A 1PIV2 3DPRB 4PDWA 1C8M3 4GXLA 1H1MA 3ILNA 1F2NA 5FOBB 2XGXA 1PGSA 2OG7A 1RVF3 4QPIC 5BNNA 5LK7B 3TN93 1FI2A 3RYPA 1AJKA 4DB5A 1PO13 1LHNA 1O91A 4E4ZA 1CAUA 1RGSA 2VVDA 3L2HA 5CA6A 1G6NA 2X8KA 3WZ1A 2ENRA 4MVTA 4RSUA 1MEC3 1VRH3 1VBE3 1SEFA 5CNAA 4ATEA 1BCXA 3KGZA 4W6YA 3LWCA 2CGPA 2GDFA 1MS4A 2RS32 4IXLA 4JDMA 1YO8A 5JZGB 2KXLA 4XIOA 1ND3B 1SLCA 1OIHA 2HWC2 2OVUA 3OYWA 3AMMA 1J1TA 4OI4A 1EV13 1G7YA 3KT4A 3E6CC 4YVWC 1NQJA 2GZWA 3ZN4A 3FWEA 1JUIA 2A70A 1EAH2 3RI9A 2WINB 1Q8VA 5I8SA 2HWD3 1HV0A 2WQ4A 1LODA 2ZGNA 4XJ9A 4Y4YA 1AR91 3RMXA 2ET1A 3PVNA 4LBLA 4QXKA 1QJY2 3ZFGC 1RUE2 5J98B 4AQ2A 1ZX5A 4RA0A 2GMEA 5HCAA 2GC0A 3CU7A 5J37A 5EFUA 4R9DA 1UU6A 1W6PA 4J6GA 3POSA 1NY72 4IV3B 3VBRB 5KXDA 1ZBE1 1DYPA 3M3OA 3GHMA 3OGJA 1KQRA 4I30A 1LB2A 4FP2A 3M7AA 4BPZA 3BCWA 2JG9B 3LOBA 4YG3A 3UJQA 2Y38A 3QACA 2ZHMA 2BWAA 2IC1A 4XJUA 4TSVA 2R1DA 5FQ0B 5GLUA 4YW5A 4CTEA