2CGOA

Factor inhibiting hif-1 alpha with fumarate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
342
structure length
339
Chain Sequence
b'AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Structural and Mechanistic Studies on the Inhibition of the Hypoxia-Inducible Transcription Factor Hydroxylases by Tricarboxylic Acid Cycle Intermediates.
pubmed doi rcsb
total genus 106
structure length 339
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2cgoA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgoA01
4JAAA 1H2MA 4B7EA 3OD4A 1H2NA 3P3NA 2CGOA 1H2KA 2WA3A 3KCXA 1MZEA 3D8CA 2W0XA 4Z1VA 5JWPA 1IZ3A 2ILMA 4B7KA 4QU2A 2YDEA 4AI8A 2XUMA 4BIOA 1MZFA 4NR1A 3P3PA 2YC0A 1H2LA 4Z2WA 1YCIA 3KCYA 2WA4A 2Y0IA 2CGNA
chains in the Genus database with same CATH superfamily
3ZX7A 4MW3A 4EEQA 5D5QA 1PM9A 3W59A 3ORJA 2PYJA 3IPVB 1AR5A 2DWDC 3ZMVA 5EBLC 4LBMA 2E75B 5IYZB 1WCUA 1C4RA 1DLLA 1Q6IA 5FY1A 4Y1XA 4HLTA 3B5LB 5FZ1A 1VBD2 5FO7B 2XHBA 3WF1A 5FPRA 5FZCA 2FDHA 2YU1A 4X65B 4ZHQA 4UFIA 3ICXA 2NQYA 3I2IA 3AKTA 3SCHA 3AFKA 1L7RA 4N90A 4J6GA 1A6CA 5DDJ2 4DRRA 3Q8BA 3E5XA 3ZSLA 2PHFA 4Y1ZA 3VD4A 4CS2A 4X8AA 1DQ6A 3ZXDA 2DCZA 3SKVA 3GCWA 4NO4A 3SPIA 4N43B 1C28A 2WNOA 4D6SA 1KP3A 1EV11 4QX2A 4DQAA 5L9BA 1K12A 2KSDA 1H9PA 3MF6A 3LOIA 3CJIA 4BLIA 4QKBA 2J1VA 4OCTA 4IV3A 2E51A 2QQUA 4DFSA 1GZ9A 3D3IA 3T1HO 1UIKA 3CEWA 2LROA 3JSNA 5ANQA 1U12A 3FHIB 2L6LA 4C1WA 5DAPA 4JGYA 4DUVA 3DXTA 2D7FA 3JCIA 5FKBA 1Q8OA 2UU9B 5GTHZ 4S2FA 1JHJA 4XJ8A 3OTOB 1KDKA 2WWUA 5HCHA 2MNGA 4B7KA 3ZHQA 3LNMB 1XNQB 3LF7A 5F39A 3U37A 4G3YC 3GZEA 1L8DA 4UFLA 4P9YA 5EZWA 1ENSA 2IUWA 2PLV1 3CJIC 2A9HA 4TZDA 2EULA 4EN6B 2BW8A 4L87A 3B9CA 3EHBB 1GZWA 1B35A 4V1PA 2ZZJA 3CDZB 3DL3A 1H2LA 1AR4A 4R7CA 5DUVA 1DYPA 1DGRA 1Z7S1 4OUMA 4G27B 4TV9B 4YW3A 3ZMNA 5A3NA 1AZDA 4OMCA 5J09A 2P5OA 2WFF2 4X20A 3MIFA 3CHXA 3U10A 2R062 5IYBO 4ATEA 2OW4A 4UBHA 5FZFA 4S2GA 2OIIA 1YTFD 4FI9A 5JR7B 5L3FA 2W6JG 2V09A 2CGOA 1POV1 2BSKB 2FQPA 2LALA 3HOBA 5LGTA 1VRBA 2A0LA 2Q1FA 3I4IA 5IY5B 4EWAA 1FV3A 3H3ZA 1X9TA 2HYXA 5L19A 2DUPA 1T6BX 1PP9H 1JX9A 5C8WA 4S2HA 1CAVA 2VZOA 5A80A 4Z8BA 2ZD9A 4AVVA 1LNQA 1AL21 4GH4B 1JR9A 1QLEC 1MA1A 1FJGO 4N9HA 3DYPA 4I55A 5JPMB 5C70A 2ZGMA 3RJ2X 5ITZA 2DVAA 4B4RA 2XAJA 1KXGA 4I4TB 3JAWB 2PHXA 4QX3A 1QVGU 4JV5B 4CS4A 2PLV2 3SNMA 3E1F1 2K9ZA 5EJ1B 2HEPA 4YW1A 2BJSA 2A6YA 2CUGA 4NIIA 4K8FA 5B4XA 5FPZA 5CBFA 2EIJB 2D2CB 2AREA 2VZPA 2RR12 5LOVA 1EZJA 4JAUA 3BKZA 4X65O 4DV6B 5FZ8A 2PYLA 4QXHA 3ZHVA 4LR3A 2JGDA 2ZGRA 1OD5A 1VQPV 2GN7A 1MS3A 3AB0A 4L8QA 3AP9A 2A06H 3I2GA 3WP6A 4AOCA 4UCRA 4BMEA 4LNUA 5C4WA 2YUEA 2HBUA 2VUAA 4BQ5A 4DV3B 1L3JA 3MPBA 2BU9A 3PDQA 4UFHA 4B3MB 1J3RA 4DUWA 3WX5A 4LORA 1QOTA 5FZOA 4LH7A 5IJ0A 4CSWA 1MOFA 2YSUB 3JARA 5A1LA 3B4SA 1HNZB 5FZ3A 2QSAA 4IIJB 1D0HA 2DBNA 4MH0E 5H5NA 2WSUA 3G6EV 3N27A 1E57A 1E79G 5CADA 4CU8A 2R30A 1ACCA 5BY5A 2VVEA 4XW3A 4Q4Y2 3HT2A 1WNSA 2W87A 1OKQA 4ZU4A 3S57A 3NJVA 2EICA 5GLVA 1KDMA 4FFBB 4F7ZA 3UKNA 3VHNA 5JXJA 3Q9OA 3UKTA 2YB7A 1NCQB 3OG2A 3TBDA 3CU7A 2WR9A 2A3YA 2ZGPA 4OPAA 5BNNC 3EJKA 2W2IA 4X9QA 1WCKA 4JI1O 3I55V 2BNMA 3AVSA 4DR5O 5HFLA 3T1LA 4AG4A 4DB5A 2JIGA 2K9PA 4BE3A 3FKSG 5BXZA 5FL7G 1JI6A 3N35A 3V0BB 1K33A 5A33B 3LAGA 1QDCA 3W7XA 3L74H 3K9AA 3O7OA 4BAYA 4ISRA 1Y9QA 2A6XA 2ERFA 1EPWA 1FMD2 4B3RO 3JD72 3WVJA 4F6RB 2NLJC 4EN7B 4XDJA 5B1BC 3IIAA 4IERA 1HQNA 4MXWB 1XRUA 4RS5B 5KBFA 4Y22B 5KC6A 4PLNA 1W59A 3SLIA 3AKSA 5DXDA 1KFUL 3POGA 1CAXA 1DYOA 4CDWC 4WBNB 4RGGA 2BV4A 1FYJA 3OFNG 1C57A 4PELA 4YG0A 1FJGB 1TUBB 2JG9C 1QJZA 1WW6A 4I0XA 1GICA 2OA2A 2LM3A 1AJNA 1G9DA 3WG4A 1LTEA 4BDVB 4PDRA 2Y6GA 2XOMA 2Z42A 1R1BA 2C26A 1UPSA 2PLV3 2DUOA 3H7JA 5FPVA 3GCXA 3JD2A 1XE8A 1R73A 3H1KH 1CZSA 1LKNA 4TV8B 1VBB2 2ARAA 1J59A 4B3NA 1WA8B 3D82A 3NV3A 3B69A 3DCQA 3K08A 3HR0A 5LRSA 3OD4A 5IDJA 2P3YA 1S0VA 4QQ2A 2CDYA 3M2MA 2P3IA 4UFZA 2UYBA 1NE6A 1JU4A 1NY72 2A75A 2GAUA 4QU2A 3LDCA 3E8FA 3MFAA 3D36C 1V54B 5A7WB 1LCLA 3EO6A 3ZSEA 2QZ3A 5ANNA 2VS0A 3QG5A 4JZRA 2HBTA 4OUSA 3ETQA 1UU6A 4P14A 2CTVA 2FZ1A 5JVDB 4R9DA 1UOFA 1PK6C 3VBHC 1ZRCA 1U5XA 2LUWA 5DAVA 3K5LA 2E31A 4PBPA 1BVVA 1P7BA 2XASA 3RYCA 4DXSA 3B8NA 1OQDA 2ADQB 1PZ9A 2QTOA 4HAMA 3FC0A 4ARXA 2P90A 5CNAA 4GXLA 3NWKA 1Q43A 1GP6A 4IQPA 1QJEA 4GQ7A 1FAFA 2BWCA 4OULA 2YU2A 1K73W 3QTCA 4Q4Y3 2QKAA 2IZWA 4P5HA 5JR2A 1U5IA 3ZO0B 3G80A 4NWVA 4K9SA 5FZAA 1W6OA 2BQPA 3WU2Z 2TEPA 2UXCO 2DV9A 2NYYA 4ZXEA 1WLDA 5CU1A 3POYA 4O2AB 5FWJA 3ON7A 3T3YA 1Q56A 4JTAB 1NZIA 4LP8A 1YHQV 2HHHO 5C5UA 1JVMA 1XILA 4XTMA 4OHWA 3FUQA 2EVXA 3BFRA 1WMXA 1R6KA 1DBNA 5CKNA 3RZMA 1W6MA 1X50A 3OW2U 1DQ4A 2WQ4A 3IDAA 4YW4A 2FDGA 3FLPA 3RVZA 1JUIA 5I0SA 4D8MA 3C7OA 5GLUA 3WHUA 5CG8A 1RUD3 3VD3A 4X6RB 3PVEA 1K3EA 4HSJA 2NP0A 1YLLA 2N74A 5JZGB 1NT0A 1NXMA 4XDOA 3C2UA 3SH4A 4B4QA 1BGYH 4Y20A 1AR61 5LGNA 2D6OX 1MQTA 4RHV1 3N9PA 4I3GA 1N1TA 1HJGA 3RYHA 2HWD3 2QDNA 4BQ2A 2JEXA 1W9SA 4LLOA 4QPWA 3BOPA 2UY8A 4CUAA 2XLFA 3UKMA 2ZHLA 2OCCC 4PQ9A 5I8TA 1V9U3 1J3QA 2C5DA 3CB2A 3CCLV 1LB2A 1P4RA 1XNRO 1JZ3A 1EN4A 3G6BA 3AK0A 3V0AB 4P9XA 4AL9A 1JTZX 2ZINA 2LW8A 1YF2A 1GQPA 1HDKA 1N0JA 3VL8A 5KX5A 1CJPA 3MLKA 2OYZA 1FXKB 3S0MA 1AROP 2JIZG 1PIV2 5T55A 5J2TA 5K8SA 2W52A 2IU3A 1TNFA 1UZ0A 3VKLA 3FB7C 3MIGA 3AK1A 1YC61 4I55B 3CCVV 2ADPA 4EFBA 4Q0PA 1UKRA 3AG2B 3UCSC 1LOBA 4YY3B 1MZ5A 5FRAA 4QGNA 4NE9A 1R093 5KA5A 3AKQA 2AEZA 3OYWB 4YG6A 4BXFA 5FKCA 3GHNA 3X2QC 3LE0A 2E63A 4DW1A 3LEMA 2PQSA 2HWC3 4LF8O 3LFMA 2V73A 2QA4V 1JFFA 3WEZA 3UV9A 1XHZA 3EBRA 1SFPA 1ENVA 1O4ZA 1W28A 2RJKA 1H4HA 3QD6A 1RUD1 1PKXA 1AL0G 3DKQA 4A41A 1GNHA 1CGPA 5F5IA 2HR3A 1ODMA 4A7YA 1GZWB 4NIHA 1BK0A 3LA3A 2UWBA 4LE3A 1C8M3 3T1HB 1WN7A 5E88A 3BU7A 3K57A 1FX5A 2WA3A 2ETNA 4JQTA 2R041 4YXWG 3S7IA 2XHKA 1YEWA 2BOIA 3LWCA 4OLLA 4QIWF 3WFVA 4YW2A 3FBYA 2VW1A 1OF4A 4Q4W3 2R16A 5LHHA 2ZR2A 4GJYA 5FLJA 3VBUC 1L1FA 3P1IA 3RSJA 2Y69C 3ZR5A 3WDXA 4CDXA 3HBZA 5D5PA 1GBGA 1SZBA 3J8F3 5FR3A 4A42A 2ES3A 4XFFA 4K3AA 1VMJA 4TYSA 1AILA 1LJ7A 4YFZA 1PMHX 2ZGUA 1KD1W 2A7WA 3Q4HA 2IXKA 3NQHA 5IHRA 1V6LA 2ZCWA 5LYJB 4UFKA 1QU0A 4P00B 2RJZA 3DUIA 1VQLV 1VIWB 2R49A 2ZA9A 3N9QA 2DYRC 1QXRA 1PL0A 4TQFA 3E8GA 2QEXV 3WNLA 1JH5A 3CCEV 5EK0A 4JZ2A 1SQBH 3VD5A 1SACA 3MHHC 1YIFA 5DUWA 2JIJA 3GNEA 3MD0A 1I1EA 3M3QA 2BGOA 1MS0A 2JE9A 5FYCA 4JHTA 2RMU1 4CEYB 4E27A 2WYFA 5H6RA 4XJAA 3MIBA 5SV8A 2CAUA 2DVDA 2ZAAA 3POJA 4Q4X2 1PGW1 1RC6A 2JG9B 1W2OA 4IEYA 1NR1A 5FOJB 1QHTA 2W1UA 1KFXL 3ZYHA 2CTQA 2JG8C 1VJ2A 2Y48A 3BTZA 1VBC3 5CB7A 2E7QA 4R52A 3MHSC 1OF3A 1RINA 1SHWB 1UYXA 3O0VA 4ZONA 1VAKA 1X59A 1Y66A 3AP6A 1K45A 1RUNA 4JVAA 1V54C 2JD4A 2K2SA 4CUCA 2WAAA 3U11A 4AR2A 3JQXA 1EZVH 1JHNA 1MNGA 5IVBA 2I07B 3W58A 3S5QA 4EN0A 4PD4F 1FOD3 5FZ7A 3POFA 3K48A 4DRVA 4Y1UA 2WSVA 1HR0O 2BTOA 3ZFFA 5FXWA 2WLHA 3AG2C 2YGLA 3NNJA 1KS4A 4LF7O 1O9GA 1NQJA 2D6NA 1CP9A 4QE7A 2A79B 4TUYB 1JQ0A 1HXS2 5A7PA 2JEUA 1TVKB 4CEYC 2AHYA 2GTSA 1TAEA 5B1NA 4LLFA 4COUA 3OEAA 3APBA 4JRAA 1SESA 2GBOA 4MVQA 1MS4A 1I6XA 3D36A 3S5AA 5C3RA 4GAZA 3GVMA 2R6QA 2AXTZ 2XBO3 4PF1A 3ES4A 3OB8A 2UXNA 3GWKC 4YHHB 1LNSA 4PI2A 2VQTA 2IJKA 3NXSA 2JKBA 2IU0A 4FFIA 3ZFFC 3CD6V 4EZ4A 2OWOA 2WJSA 2B45X 1UOGA 4N21A 2GSMB 5DZFA 2VW0A 4PI0A 5C4WC 1K5MB 4LKEA 1W6PB 1S0EA 1LR1A 4MVUA 1YJLA 3IKWA 4JZGA 1LOAA 1COV2 4XF3A 1XB9A 4IESA 1AR63 1NLRA 3NJXA 5FMOS 1W9FA 3CMEV 5L7OB 1XYNA 2X5IC 5D8AC 1QIQA 4O65A 1N47A 4JGYC 4J9YB 2ZIMA 3I56V 4A7KA 1M1KW 2P1BA 2ZE7A 2CSGA 5I0UA 1N8RW 4BM8A 4RGKA 2GC3A 2FDFA 1MPXA 3A0NA 2VW2A 2W94A 4H14A 3CXCU 5LY2A 2V5YA 3IN9A 1YQCA 1YNAA 1N1YA 2QFEA 4LBJA 1HN1A 2PHRA 1JW6A 3AG1C 4CP9A 3E5QA 2YS8A 4QM8A 3SQOA 3RYCB 5FUPA 2A5ZA 1BMV1 3SJBC 4RSUA 4ZKTB 4Y4RA 4AI1A 4XJWA 4FPJA 2LW1A 4JKKA 3OGVA 2R0FA 5DMYA 2UUCO 1M57C 1SF9A 4JTDB 2VZ3A 3USUA 1ENRA 1UPIA 1BMV2 4NHXA 2WNUB 2ITCC 4Q4V1 3WQBA 1SZTA 4N7IA 2FD8A 1OHHG 2XJSA 4IV1B 1EP0A 4O4JA 2ZMLA 2D98A 3M7AA 3AMNA 5A3LA 4JYBA 1Q7YW 2KG7A 2BOJA 3AMPA 1W6MB 4BQ1A 2R042 4DIQA 2DVGA 2EIBA 5EYPA 3ZDSA 5H9CA 1HB2A 3TXQA 1NA1A 3PVNA 1Z78A 3ASOC 3P6BA 2FMDA 4MHRA 3DPRB 3E8HA 4IEPA 4O2AA 3N7KA 1HXS3 4CH6A 1M4UA 2HWC2 3NO8A 4UF0B 3B2EE 3MW2A 1L7LA 2BTVC 1PHMA 5C8YB 4FCAA 2GU9A 4PDWC 5G04L 2ARXA 3RI9A 2GUZA 4UFJA 1GUIA 2NNUA 5BNOB 1SBFA 4TTGA 3Q8AA 1TUBA 5BNNA 4AGGA 3E97A 1EUUA 2D6LX 2JDPA 4OUEA 4X8PA 2EX3A 5BR8B 3ZXAC 3I2JA 5FZ4A 2XBO2 3WG3A 1DF5A 3C3TA 1LEDA 1LGCA 2WS92 3UYJA 4KH9A 4NB5A 4WZCA 1QJX2 1NS1A 2UXCB 4ZKIA 2VQEO 1RUJ2 3ACFA 2B46X 4P9PA 4XIKA 5ABJB 4LITA 3E8BA 3VBOA 3N36A 1ZRIA 4I09A 2V72A 2X6BA 4E8DA 4YZ5A 2BEOA 5B2GB 4IEXA 1GN4A 2DF7A 4WM8C 3CLPA 1OOPB 1PGL1 1PGSA 2O14A 2YROA 1PZ8A 1B09A 2JDZA 4X6QB 4XJZA 1WCQA 3C7EA 4LBNA 1WCDJ 2VPVA 1YI2V 2WRAA 4GMP0 2MK3A 1URXA 1QQP1 4DINB 2VZQA 3RYFB 3LQCA 4DZGA 1G7YA 3GXUA 5L3BA 3N9LA 1IPKA 4XILA 5CKMA 5IJ9A 1EV12 2KR2A 2XUMA 4QB6A 2JG9A 2G19A 1IBLO 2ZS6B 3WNXA 2I2SA 2YZ4A 1N1VA 2OQ6A 4H2AA 2GSYA 2FHRA 4DR1B 2CNAA 4IYHA 4GCZA 4YJ2A 3JARB 1VMHA 4W6WA 4GJZA 5FZOB 1OH4A 2ZT9B 3JD0A 3ACIA 1K3IA 4Y22A 1VMFA 5EC1C 1KC8W 2YEVA 3NRUA 4FJCC 2VUCA 2UUCB 1PNFA 1PMIA 4OVEA 3T08A 1D4M2 4X64O 4G9SB 3NNMA 4BIOA 1GM8A 4M3CA 3KF3A 4H33A 2VMFA 4DPNA 3N2GA 2IJHA 4LWSB 2DYCA 3G6JB 2F4LA 2R7EB 2XLAA 2V1DA 1RM1C 4IT5A 4FM1A 2P06A 5HFMA 1CAUB 5FFOC 1YTFB 2A3XA 2QE7G 4RD7A 4DR4O 3M8LA 1WCSA 1VQ4V 1HB1A 1XQNA 3GDBA 5BV6A 4D7SA 1Y6XA 3N2KA 3VZMA 2F4PA 1PO13 4N53C 1APNA 5IK4A 3PUSA 2DQ3A 4H44B 2UYAA 1S1AA 4YW6A 2YHJA 4KP4A 1WW4A 4QPGC 4X1IB 3A4UA 3FB6C 2F17A 3FB8C 3P5BA 1XXNA 4EWDA 4AFDA 3VBSB 4JI6O 1KKDA 1WBFA 2ZX0A 3AJYA 2CV6A 3IJ4A 2GZWA 2VTXA 4IE6A 3N9NA 5K1PA 2D6MA 4HVOA 2YFUA 5D2AA 1ZBA1 5F7UA 4GKYA 3ETPA 1VEWA 1OCRB 4LFAB 2G9ZA 5GZCA 4GH4A 3OGRA 3TEXA 1IQDC 2VBDA 4LNVA 3ABMC 2GMPA 4F83A 1UFIA 3LEGA 1UQXA 4FOWA 1NLQA 3ZBHA 3WP4A 4NRQA 5JXGA 1U5YA 3O1OA 2QKDA 3BALA 1O9HA 2JS5A 3FLTA 1UY4A 1JZ2A 1AX2A 1F4AA 4YRDA 4GMP3 3D8CA 3ZMOA 2PUSA 1JOBA 4AQYO 3PTRB 1JOJA 4AEJA 2RM22 2VOVA 2PN5A 3HKEB 1LHOA 3ILNA 2W1WA 3Q8FA 1QLEB 3NAPB 1JOYA 3I97A 5AG2A 5CG9A 3ABLB 1HXS1 4IV1A 4YVSC 4AK3A 1ND2A 1J95A 4M3CF 3AM2A 1AR91 3JAKB 3CZJA 4P9JA 2J1UA 1B04A 1IOAA 2AGAA 2RM23 1HWYA 2QQJA 3T0DA 4YLZA 2ARHA 4GKJO 2PXJA 2CE4A 5CA1A 1COWG 3KVAA 4O9EA 1Y7BA 1SETA 2JD9A 1JYCA 4KBZA 2D3RA 1RUE3 1Z7S3 3WF2A 3OEEG 4DRXA 1ST8A 4FLYA 1TME2 1QVFU 1WD3A 4QKNA 3S3WA 4J41A 2FCVA 5FLXN 2AACA 1OFSA 4FM2A 3RFRA 2XKOA 5K0UA 1KJRA 1O3RA 4HETA 5DG2A 2FYUH 4RHV3 3B94A 3K5MA 3JSLA 4FSJA 4LF6O 4TSFG 2LO1A 2WDBA 1QJY2 3HNYM 1AR81 4U3JB 2YXHA 5T3NA 1R091 5BZBA 5JDBA 1EFRG 2DFCA 1HQWA 3A21A 1F51A 1H9WA 2EIKB 3RN4A 4KG8A 4EKWA 1VAVA 1EN6A 2VJXA 4DV7O 1TNRA 5BMVB 2ZE8A 4YPJA 1PX4A 2XL9A 2JDHA 3INAA 4AEKA 4Y5SA 4E4EA 2R072 2Q7HA 2NLRA 4MXVA 1EY2A 4MGKE 5HCAA 2BBVA 5JSRA 3VN4A 1M93A 1HDJA 2W39A 3D4KA 4ZPIA 2QBXA 1HLCA 4HSLA 1CD3G 5HBAA 1RUJ1 5FYSA 1OCZC 5FO9B 3GBWA 2HWF3 3U14A 3E2EA 4CDXC 4IEQA 1AR93 5K1XA 3URFA 4XQWA 2XB6C 4RN5A 2BOBC 3NR7A 2AYHA 3DECA 4DEQA 3MFCA 2P17A 3E5UA 3ROUA 3HPLC 1IKPA 1RJ7A 4JGYB 2CU5A 1NQTA 2NN4A 4MHUA 5A7QA 1D2QA 1EUTA 1QR8A 2HG5C 4Q4V2 2CDOA 1AJPA 2OTLV 2CWMA 4INDA 4FZ0A 3TN92 4AGVA 3L75H 3GZTB 4Z1VA 4NWWA 2ATKC 1PMJX 3UO2A 4DK1A 1A8DA 1K4CC 4KHPO 3WCSA 2G1MA 5FY8A 4I7ZB 1H2NA 5T5PA 3AG1B 2DWRA 5AVAA 4RWUA 4OMDA 5JPNB 4JRLA 1SPPA 5I8SA 5LA2A 5F32A 1RGSA 1XSRA 4UW5A 3QNEA 3VQWA 3VBHB 5FZMA 4BCUA 1ND3C 5A2QN 4H7MA 3R05A 2QQNA 3EQEA 5C7GA 2IXHA 5FK8A 2Q8OA 1W04A 4FFHA 3EVKA 3LSEA 3W7WA 2DFBA 4UXAA 1OC1A 4QXKA 1KS5A 1POV3 1FFXB 1LRHA 5IYZA 3N7LA 5I91A 5LHIA 1RJ8A 1UU4A 5C3OA 4COZA 3K4AA 1LESA 4UXNA 1I7FA 1WPXA 2D5FA 2KM2A 4LO8A 3AP7A 3WUCA 4IGGA 1VF7A 3H1MA 3IMNA 2OX0A 4H55A 4Q0QA 2JG8A 1FV2A 4MVZA 1OLMA 3SDLA 1RHI1 1Q8IA 1NBMG 3J7AU 3B00A 2XJTA 4AEDC 3KV5A 1NUKA 5L3EA 4E4HA 3RWRD 4QPGB 1YXBA 4WBNA 2VECA 2GC1A 1PNKA 3WNKA 1AX0A 3I8TA 3OUIA 5F5CA 5LBCA 5LASA 4JI7O 2W3JA 1ZBE1 2J1EA 3W5NA 4N7UA 2IVIB 2F6BA 4ZOLA 3HNBM 4YZ4A 5LB6A 3RYFA 1W9WA 3WDTA 4FP2A 5DAXA 5LYJA 2HH9A 2JJ2G 1Y74A 3IT8A 4LCUC 4W4ZA 4YJ3A 3ZYPA 2IFRA 1VBD3 4D6QA 1WJZA 1Q86W 2Q73A 3CYOA 1W9YA 2Q4PA 1S0GA 1H6YA 3ZRWA 1OOPA 5EJ3A 3B9IA 3BPZA 4HG6B 3JU9A 1VB4A 1DK1A 5SV5A 2QDOA 3FJSA 1DLCA 2JICA 1LOGA 1BEV2 1IBMB 1UY3A 1P7GA 4GX5A 5A1AA 1I5YA 3R4DB 4XCAA 1SMVA 3UGHA 2HEVF 3K46A 3G71V 2IJJA 2ZE6A 2DDUA 3AG3C 4ZIBA 4AILC 3RZHA 3RVHA 3SPCA 4MS2A 1ZYBA 2MHFA 3KS7A 2WFPA 2EAKA 1MABG 2Q6AA 1IXMA 2NZ9A 2Y6LA 2JEMA 2ZNJA 2ZGLA 4AVCA 4EQVA 2Y4UA 3LB9A 3RPQA 1KBHA 4RQFA 3DTUB 1JPXA 2Y6HA 3ZSKA 5IJ0B 1GP5A 1UZVA 2JDYA 2GUZB 4QB1A 4WM7C 3GBGA 5LBQA 4DO2A 1DZTA 5JOZA 5IJ9B 2ORZA 3WF4A 4Q5OA 2BFUS 4K40A 1CX1A 4QNHB 3WG1A 3VBFA 2C0ZA 4I9QA 4CCJA 2AH2A 3RT3C 5FYBA 3KM5A 1QNWA 5JSPA 3M7MX 4LNUB 5LXTA 3C90A 3ZFGB 4LXLA 2IFWA 3LDRA 1ZRFA 4CEWA 3OOXA 1JYTA 2W5FA 1I94O 2KG7B 4Z82A 3H9AA 5LA6A 4WVVA 5C8CB 1PO22 1X7NA 5J37A 2DN9A 5EZYA 3RWNA 4B3TO 1YSCA 1BT8A 4P02B 2AUYA 2EINC 5F5QA 1AR71 1W2AX 2VWJA 4JI8B 1NZ6A 1RVF1 4LPLA 3VBOB 2VNRA 4DY3A 1OVSA 3C3VA 5KAIZ 4YVWA 1W99A 4N53A 5FMDA 3BTYA 1OLQA 4MVTA 4D94A 2PELA 3NV2A 1GNYA 4W6YA 3V0AA 4AFAA 1WLCA 3T1MA 2G4IA 2XNDG 3AK3A 4WFFA 1UMHA 1QJY3 1RUC2 1PK6B 1BQPA 4Q0VA 1V6IA 1BLZA 5D1IA 3BB6A 3WZ1A 3ZXLA 4CZZA 1IBLB 3C8XA 1PM7A 5LP6B 4DR1O 1W6QB 3THTA 2ZTNA 4FQ4A 4J7KA 4P9WA 2ZQMA 5BNPA 4I30A 4X1YA 1MQTB 4XFCA 3AL6A 5CFDB 2D3OW 3HBKA 5AFEA 1XMOO 1YO8A 2VM9A 1PNLA 2ZM6O 2GNBA 3ZMZA 5DAQA 3T0BA 4MTGA 2YC2A 1DHKB 1NCRC 4GT1A 3RYKA 4LO7A 1S77D 1AB3A 3UT0A 5FY5A 2ZHKA 3BUCA 4PA4A 4YM0A 2BVBA 5JOXA 2Z3YA 3VBSC 3FN9A 1Q8SA 1QJX1 3VLBB 3IC7A 2O1QA 1VE0A 4ZBMA 2CH7B 2RDRA 1GLHA 3ZXEA 1JYVA 1UY1A 4LO6B 5GLTA 1PIV1 1GH6A 3FHQA 5A7SA 4P2ZA 1QJU1 1Z2GA 3T2QA 4BK4A 2HLDG 3TB0A 3X2QB 1B6QA 3POIA 3ZRSA 2VGDA 2WNUC 1SLBA 3NNGA 3Q8EA 4IEZA 2ZEZA 1I08A 3BYWA 3FB5C 5LMUB 5HV0A 1WGPA 1BQ0A 2OIGA 4AFMA 1VRH3 1HNWB 1G8WA 1I5ZA 4FMTA 5IK7A 3AFGA 3FFZA 2D3SA 3A0RA 1TVKA 3OMNB 2JE8A 2JDMA 4TUYA 4GULA 3ILRA 4DXRA 1PL4A 2ODMA 2Z5WA 3VDCA 3K79A 1YJKA 5FZHA 4LKSA 2WUHA 3WT3A 5AFBA 5F6KA 3WG7C 3CZUA 4MGTA 1CONA 3SPHA 3LKJA 4R8HA 2VCAA 1AX1A 3O65A 5LWBA 5A3UA 2EAAA 1LENA 3ATGA 5A7WA 2VCMA 4XUNA 1Q82W 1KITA 3BTAA 2C2AA 1SCRA 3KV9A 3QLQA 5LEJA 3P3PA 4QQPA 2CGNA 5LA6B 3AZZA 1GM7A 1JZ4A 4LFBB 2XJVA 2FDJA 3ABTA 3ASOB 5FP9A 4XF4A 5H9PA 4QX0A 5A3OA 2RHPA 4CXWA 1K5MA 1XJAA 2QR4A 1AVBA 1S0CA 3CPWU 2GP5A 4RUEA 3A0KA 1E5SA 5FYIA 2VULA 5HXMA 3BODA 4XPVA 4DV2O 1H38A 5FLIA 1ZRRA 4WFEA 5GONB 4AVSA 5DM6V 4N23A 2IH3C 3QACA 2N05A 2A70A 2XJQA 3UGFA 4NPMA 1UYPA 5JCOA 2UURA 2B8MA 1QXPA 4I0XB 5CKQA 5TSWA 4YYOA 2Y64A 3DGTA 5GZFA 4EB6B 2JGUA 2OT7A 3I3BA 1RUH3 5JOWA 2Z5UA 3K77A 4NKGB 1DZRA 5FPXA 4UW4A 3KD4A 3POWA 5LL6Y 4CDUA 4GX0A 1JS9A 1REDA 1Q3EA 2BGCA 4AQ6A 4LH6A 3QO8A 1XMOB 3ELNA 4CH4A 5JUVA 4LF6B 1AHSA 4MTFA 2C1FA 2Z2SB 1ULEA 1DF4A 3ZOIA 3ZYIB 1Q8VA 3LIGA 3DXRA 4Q8KA 3WDWA 1RTVA 4CDWB 4LUMA 1ROPA 1X8MA 2WO2A 4FPLA 2DYSC 2TBVA 3AMMA 1ALYA 3W7TA 2TUNA 4XXPA 1ORQC 4JYCA 5HCBA 4FK5C 4LHNA 3BIWE 4FPPA 1UCXA 3CKHA 2FDKA 5J36A 5IAVA 4GMP1 4UCSA 2VTXJ 4IW3A 3TGUH 4QB2A 3O0WA 1UYYA 3IDCB 1Y74B 4E2SA 4YZ2A 1RB8G 2WWSA 4W50A 3CBNA 3WY6A 4A4AA 3CCJV 2D97A 1YIPA 3G4SV 1SQPH 1SBDA 3OBAA 4BYYA 5IFTA 1THZA 1AL23 5FZLA 3ZJZA 2QKSA 4XAEA 4B3SB 2ET1A 2KD7A 1V55C 3WHTA 4JYAB 1DP0A 1ND2C 1O8SA 3OPZA 3RRDA 1R083 1JMKC 1R1ZA 1XDCA 1K5QA 2GHYA 2VAUA 1S0IA 4F6EA 1GWLA 4FPEA 1OLME 3K0DA 5IWAO 4AHYA 4JI5B 2CH7A 1XNAA 1NCRA 2EZPA 2ZXQA 3KGZA 2RS52 4IV1C 3ZYBA 2CTPA 4Z1MG 3N3HA 3T09A 5DQ0A 2EIMB 4WVMB 3JBG1 1WPBA 4LULA 5FXVA 5IY5C 1DQ5A 1MEC2 2XR4A 4Q4W2 1MSDA 1GFF2 4LF5B 4MGZE 4XJUA 5G05L 2A3WA 4J7ZA 2Y38A 4X88A 2H8PC 3WXPA 5FP4A 2ZGTA 5LBEA 3FX7A 3BU0A 3LNNA 1BMFG 2HJFC 3KT7A 3ZMUA 1M06G 3I49A 3GBFA 1V0AA 4R6ZA 5A7OA 2X29A 1AR62 5FP3A 2W95A 5CYYA 1ZL8A 4GZ9A 4QX7A 1TQ5A 3ZXGA 5FQ0A 2F4VB 5GLZA 3V65A 1R3KC 2HKOA 2CY6A 4YGBA 1V55B 3I54A 4B1LA 2V4DA 2JECA 3SISA 1ZL8B 2YY1A 1FPN3 3K4ZA 1QOOA 3FYIB 3P32A 4AWDA 1WUVA 1BHAA 3N9MA 4I02A 2HLEA 2RM21 1W90A 2HWD2 1H2KA 1KQRA 1YUDA 3JAKA 1Z7S2 4IGQA 5JMOA 1MVEA 1UNBA 1UMZA 1H8HG 1FPOA 5A6YA 1H6XA 1QHDA 1ZM1A 4CDQA 4UV9A 1NT2B 2WLKA 1XL6A 1G8MA 3BPSA 3RS6A 5IYYA 1LUWA 2BSKA 2VVFA 2B42B 1SC5B 2H0BA 3C7HA 4E9KA 1VBA1 5LP6C 2R9RB 1P8JA 3DN7A 4LR4A 3ETDA 4Y20B 1Q81W 2C9AA 4FLZA 4JI2O 4BU2A 4OI1A 5JJEB 3WB0A 1VQMV 3M3CA 1PIV3 2YG0A 5T5LA 2BYVE 1X82A 2VTFA 2ZBJA 4KWJA 4XC9A 2ZXWB 4BK5A 4C0BA 1Y76B 2DUQA 5GM0A 4B8EA 2VU9A 1AR83 3S7EA 4X1KB 3ES1A 4MGYE 2AEYA 2EXHA 3AZVA 3IIIA 2QQKA 3O1PA 4W4LA 1Y4MA 2XL7A 4DY5A 2HWB2 4QPIB 5T52A 1FXVA 2E3CA 3MF9A 4AI3A 2ZKOA 2VH9A 1OPOA 4RR3B 2XHNA 1NTKH 1OUSA 1AJKA 2RE9A 2IJIA 1NCQC 5ABJC 1BJQA 2VMEA 1QQP2 4AI2A 3IDBB 2RMKB 4ZU5A 1H8TA 2XLGA 2WWWA 1WMFA 3MZHA 4HZ3A 1KRIA 3BRCA 2J1AA 4UVCA 1QDOA 4BQYA 1J83A 1F4HA 3CSXA 4JGZB 3GJBA 4I50B 4F8AA 3ZXFA 1ULCA 3APOA 1ODNA 2HHHB 2WC2A 2DTWA 1L0NH 5KR7A 4OX9B 2ZIOA 4IV3B 1S0JA 4XBNA 1PPJH 4FT8A 5FZKA 2WINB 4JI4O 1OLRA 1W0JG 3ZFEC 1GU3A 1P84F 4KWLA 2IXCA 1FXKC 5F3EA 4WFGA 4UW6A 4J1XA 3CRAA 3STZC 3KZ4C 2EIKC 1F5FA 3HKCA 3H8XA 3SJQC 1EAH3 2BFUL 3U4SA 1SLIA 5L7OC 3WLUA 3AMHA 4S2DA 4KGGA 2PAMA 3WINE 5J7MA 1Z5WA 2YEVB 5L9RA 3AX4A 3CCSV 4DR7B 3KT4A 4NXNO 5JXHA 1SLTA 4NHMA 5LK7B 2EILC 4HANA 1PO23 4CDQC 3PL0A 2FCUA 2QJ1A 4QGPA 1KGYA 1MMMA 3NAPA 3G7DA 2V7QG 1D2SA 2WN2A 2WLIA 1UIJA 2D44A 3ABUA 1BQZA 3AL5A 1HQLA 3ZN5A 1HRI3 3WCRA 3T2MA 5JIUA 3IPVA 2ZACA 4JGZC 2UUAO 1O3TA 1CXZB 4WFHA 1SBEA 4YW5A 1D5NA 3ZN1A 4BOWA 3CJHB 5JQGA 1JODA 4UWDA 1W03A 1YFYA 4AGRA 1OBNA 1US3A 5LEKA 4DR2B 1J1TA 3N7MA 2WLIB 3O1UA 1J5EO 3ABKB 5JOYA 1RUI3 5GTIZ 3HAGA 2X09A 1TMF3 1YI7A 2AW9A 2EIJC 3UNPA 3FX3A 4D0QA 3ZHSA 1TE1B 2WNVC 4OQ9A 2QQVA 4JCKA 1RITA 3FBMA 1ZX5A 4RAIA 4RS5A 4JI2B 2F66C 3ZIXA 3VZNA 4WM8A 5IE9A 3B09A 3BVOA 2ZM6B 1QNYA 3RZZA 2EJ7A 4FPOB 3LDKA 2ARBA 3RNSA 2WNVA 1UYZA 3LEKA 2CTRA 4O2BB 2Y8KA 2ZZQA 3FD9A 3N2KB 3SR2C 1B35C 4Z2AA 3VQVA 4GKKO 1S72V 3E6BA 5KXDA 1QMJA 4C7UA 4R8CA 3V0BA 3ZKUA 1GV9A 3PU8A 2UXDB 1NG0A 2AR6A 1LEMA 1R1A1 2EIMC 1W2BU 1QCEA 1NR7A 1R6TA 4CPBD 2R1DA 3THCA 2B1GA 4K6BA 4NRPA 4KFMA 1ZA4A 5KXCA 5EWSA 4CUBA 1UOJA 2R9AA 2IVJA 1A3KA 4TV8A 5J2UB 1SQVH 3WD5A 1FNZA 2LFRA 3VDDC 1WMEA 1SDDB 3UGGA 4QDQA 1F15A 1F35A 3MEPA 3ASNB 1BBT1 3WR0A 1GMMA 4YJ2B 4FPFA 5FUNA 5D8AA 2BZDA 2FB5A 1XNBA 1PNMA 2RS53 2P22C 4Q0SA 4ZS3A 5FZ0A 3MIHA 3M3OA 1K5JA 4YIPA 4MGIE 1UZWA 5CBGA 1ZBA3 2KXLA 1NH2B 5FPUA 3OTFA 4PA9A 1GQGA 1HKDA 1Q90D 4E4SA 2P34A 3AXEA 4JI0O 4GWJA 4K7JA 3WW1A 1IZ3A 3JATA 2DE0X 4CCOA 1YIJV 5LMNB 1XL4A 4FOYA 1RYYA 2B5HA 1GM9A 4I2OA 3JXSA 4NROA 4NPRA 1IKQA 5KWRA 3T4HB 1OA3A 4ZZ5A 3OM3B 1BXHA 5A33A 3CRCA 4UB8Z 3FZ3A 1TME1 4JASA 1YJ9V 4BA6A 1XE0A 1DIWA 4JV4A 4U3FH 4GWMA 2P5BA 4CCMA 2LS6A 1RUF3 4LFBO 1T2XA 4DXTA 4XACA 3UO3A 5FCCA 4MADA 5IAXA 1N34O 4Q4W1 1NKDA 3PJQA 3ST7A 1C5HA 2IW5A 3I2HA 1VQ6V 1IBKB 2WLPA 4RQEA 4L8JA 3AK2A 1E1RG 1RUC1 1H2GA 3JD4A 4KUMA 4UAPA 2WFF1 4XIOA 5E1RA 4IEWA 3JAWA 2WBKA 5TISZ 3SPGA 3VBUA 2IM9A 4B08A 2VZRA 1UY2A 5FDBA 1G9CA 2VZVA 1KP2A 2RDNA 3GF6A 2MEV3 3E35A 4A3ZA 1GZCA 5EIBC 2IH1C 3TETA 3OGIB 3LUTB 2R071 4L92A 1Q5OA 1F5JA 3CEIA 1VBB3 2FDIA 3CMGA 3PU3A 3BA9A 2C24A 5FPOA 5C8YA 1R64A 2JS3A 5IVJA 3IAYA 2F93B 2KQXA 4QWNA 3O1SA 5KUKA 1ZWIC 4FLWA 1N32O 1G1XB 5J3UA 5GJ6A 3BA8A 4AAPA 4YWAA 1U5ZA 2JE7A 2GNMA 2WAMA 3UT5A 4Q0UA 1LUVA 1M9NA 2VXJA 2VQAA 1NA1B 2ITDC 3IFXA 4LFCB 3OGGA 1VPHA 4DMIA 2DW4A 3UL2A 2D3PA 2PI4A 3BABA 3H8RA 1HRI1 4PQQA 5HPOA 1AXZA 4CPBA 2K0GA 4LEJA 5FMCA 1LULA 5GKAC 4K0KO 1S2BA 1X8EA 4YZ3A 1R092 4A6OA 4PF5A 1V6NA 1YITV 4AQTA 3JASB 5FO8B 2RJLA 4XYXA 4DUYO 2FBEA 3I3MA 5KUMA 3WF3A 1HP8A 2UU9O 3VQXA 5B1OA 4OFGA 1GAXA 3PN1A 3OTOO 1GSLA 4H0LB 4U7OA 4BHPA 1YQ2A 2ET7A 5ACA1 1JA8A 5IVVA 1ONAA 4YGCA 3ITQA 3OEHG 3CRRA 4ARYA 4IETA 1ZSPA 2ZKNA 3SYQA 3O1TA 4GZRB 3SYPA 3LSQA 5FZ6A 2Q5ZA 5LRRA 1FS0G 3VBFC 5FPBA 2WLNA 3SYOA 1VP6A 2RS13 4Z07A 4Z2WA 1D2DA 3JCZA 3H1WA 4N43A 3OMAB 1F4MA 4XMIA 4HNAB 2YIDA 2XTAA 1BCCH 2VL4A 4X20B 2HYKA 4XVHA 2VQ0A 2DU1A 3NKTA 2QJVA 5CA3A 5IVYA 1K5MC 3K06A 4WVMA 5C5TA 3THPA 3CCQV 4UB6Z 1W05A 4XDLA 2H0VA 4QPKA 1FNYA 2PHDA 1ZZCA 3USSA 5F2WA 2BTQA 3ZXKA 5B4NA 4H13B 1AYN1 4YZ1A 3ILFA 3BY6A 2OZJA 3ZYJB 5EBMC 1LGBA 4O4HA 1MZFA 1N34B 3U75A 1NAEA 3VKFC 2AZ2A 1IBKO 5A9GA 2JWPA 1XI1A 1RUI1 3ZR6A 3VDBA 1PNGA 5FYMA 2Q7GA 1VBD1 2HJDA 2EXKA 3LOBA 3DEMA 3I7DA 4LIVA 3ABKC 4XFIA 5GONA 1VF5B 2H6BA 2ZOEB 4ONUA 4W4KA 1FXZA 4YG3A 3CL1A 1RUI2 5J2UA 4E4DX 1DDLA 3ZN4A 1TVGA 5FY7A 1HB4A 2ZJCA 3E22A 4NR1A 4N43C 1VBE2 4XTPA 5A32A 1B3QA 4JF3A 1A8MA 2XWJB 4YIOA 3PTYA 4MSVA 1LOCA 1LHWA 3SKJE 4YVSA 5LBBA 4CA9A 3J9SA 4UYBA 1FYUA 5A70A 4QMAA 4AEMA 2BERA 2HJIA 1BL8A 1AI7A 2DCYA 4HZFA 3JUUA 1K34A 2XOKG 1OZ0A 3JD3A 4LFCO 2B1IA 3D0JA 1CX4A 4WM8B 1POV0 1K92A 1QBZA 4QX8A 4M3CE 2X05A 4NIGA 2LGQA 4LF4O 3VKOA 3VHRA 3LDBA 4H37A 4R9CA 4K0KB 3E22B 3AG4C 1B06A 2B4KA 4C1XA 1H30A 1Y9MA 4MTXA 3SMHA 3KQRA 3AYEA 4HOOA 1NKGA 4B7EA 1GOFA 1D4VB 1R082 4HPKA 5BNOA 4HONA 3H1IH 5DDJ3 2CHHA 5BR8O 2ZGKA 4WF9V 4Y3OA 1RMU3 4DUYB 1YDXA 3PVBB 3AZWA 3FHAA 1HV1A 2M7WA 4CCLA 2VG9A 5LA0A 4DV5B 4NYKA 3G67A 3EHKA 4IL6Z 4CS3A 1RM1B 5BNPC 1R1A2 4W6XA 2XT9A 4OYUA 3ZYGA 3SJAC 3OJBA 4XHXA 3LIHA 3HB3B 3AG3B 4HKOA 5EYPB 4QQOA 1AI6A 4JI1B 4PBOA 3SCFA 3MDSA 4NAMA 3B8MA 4LO5B 1KB9F 4XQ4A 5A6QA 1GQHA 4I0BA 2X53S 3UESA 4D7YA 5BPXA 4RQPB 4JTCB 5LBFA 4MX3A 4HBNA 1BK1A 1POQA 2WT0A 3BVCA 4LA2A 1H1IA 2AENA 3RYIB 2PAEA 1NZCA 4LT5A 1MZ6A 2XVGA 4XQDA 3PVOA 2VZUA 4L11A 1GANA 3OUSA 3CS5A 5GALA 1P49A 1ZZ6A 4XURA 3MV11 3ABZA 4MGQA 1W39A 1HNZO 1ASJ2 1TGOA 3D0SA 2QM8A 5LP6A 2WFF3 3SH5A 5FYVA 1VR3A 4DK0A 2AGSA 4XFHA 3WB2A 4P30A 3T2PA 4CYDA 5H9QA 2B9ZA 3HD8B 1QJFA 4RUFA 4ATFA 4F3JA 1YJWV 1W8HA 3FLRA 4IE0A 2QE3A 4QD2A 3PUQA 3GALA 2ZAHA 2DQ0A 4K35A 3K5OA 1DGWX 2RG4A 1G9AA 2A6WA 5F3GA 4MV2A 1SLCA 4GB31 4RFRB 4XZUG 1QR9A 5GZGA 4MVMA 3HVDA 2GNDA 4UCTA 1VAMA 3ZM8A 1RMU1 2DVFA 2YPDA 2WO3A 4KL1A 1SLAA 2XJPA 3BAAA 5KXBA 3PURA 1J5EB 2DJVA 5EZYB 5BXXA 4BH9A 4Q29A 3GZUC 3SGIA 5FZEA 1PVXA 4CU7A 4YM1A 4KNCA 4CH3A 4TLGA 3NSTA 2JKXA 4ASUG 5FYUA 2WWJA 5IVCA 4MVOA 1UMIA 5JI9A 2E9QA 3RG0A 3OY8A 4AZZA 3TN91 1JFFB 1S2KA 1O59A 4URAA 5LK5A 1CESA 1XEQA 1E1QG 4UOJA 1LODA 2H94A 3KSCA 2RMU3 3ZHRA 5C9AB 2OVUA 2VQUA 4B4PA 4NVPA 2R043 1OCRC 3GGLA 4LF4B 1HIXA 1XNCA 2D40A 3MUY1 1JZ7A 4DV0B 4MW8A 3LFIA 5FUIA 4XFGA 1W6QA 4P5YA 1G6UA 2RDQA 2HVKC 3I59A 2Q1MA 4LFAO 4FO9A 1H1MA 4XBFA 2WAOA 1F9KA 1QH6A 4X8NA 3FMGA 1SQGA 1YRZA 5C8CC 5CFCA 5E16A 5FK7A 2RJ2A 5FNVA 4KU7A 4DV5O 4QGLA 5L73A 5J96B 3UQ8A 3WDYA 3LPFA 3S30A 3TXSA 5DG1A 4Z92B 1Q8PA 5EBWC 3H3LA 2QQMA 1RUG3 1V9U1 1ZZ7A 3K04A 4A6SA 1FOD1 2IXLA 3PNAA 2GV9A 3IGAC 1S5HC 2KKWA 2R70A 2Y4TA 4Y24A 4J1WA 3SH3A 5F9TA 4UBGA 2IXJA 4GB33 3BIEA 5AC91 3ETEA 2BOCC 3R65A 3CC7V 3CQOA 1F2NA 3RWKX 1GKFA 2QGNA 3J4UH 5KXEA 1RHI2 4Y1VA 1M90W 4CCCA 5CZKA 1G86A 2YYOA 4ZOLB 4GKJB 2YBKA 3AVRA 4DS0A 3IBMA 1OCOB 1XNDA 2BNNA 4KI5M 2GMMA 2V5DA 3NV4A 1AYM3 5A6XA 4ZXKA 4RQPA 4IV3C 4OXSA 3VD9A 1NTMH 4KWKA 1HW7A 1SDWA 1TG7A 1LU2A 1F4NA 2CAVA 4DV4B 1WLEA 5B1AC 4YARA 2P3KA 1IG3A 3ZFEB 1RXFA 1G9FA 1WA4A 1S55A 1RUD2 4PIZA 3SYAA 5GLWA 4CDUC 4BPZA 5IFPA 1D4M1 1EBOA 1W0NA 4Q8LA 2E53A 5FMOL 1DFQA 4A3XA 3S3XA 5CMUA 3HKBA 2JJ6A 1IGOA 4KQ7A 2WPDG 4Q4X1 4R4XA 4XCBA 4CCNA 2WT1A 2XXZA 1SA0B 3A0BZ 2EA7A 3T1YB 1KQSU 1DLBA 1W6OB 5KHHA 4EJRA 1AP5A 1NY71 2NPIA 4UCVA 4HNAA 1UAIA 2ZPXA 4QPYA 2W47A 1W6NB 1IQAA 4P9GA 3S6PA 3KT1A 4NHYA 3GHMA 2B7YA 1A34A 3ZRWB 4XUTA 2X6AA 3I5DA 2Q9LA 5FV3A 2O57A 4D69A 4ORFA 1OH3A 1UZZA 2CL2A 4BZ4A 5CN0A 3UK9A 2M6YA 2KA3A 1DF0A 3QOPA 1BVP1 5CIRA 3H42B 1NVPB 2OCCB 3KKYA 4PT6A 4M4RA 1BHGA 2J1RA 4P9IA 2FCTA 4JI3B 4XOGA 3TJTA 3JD71 1FXHA 4PHZA 4GWNA 5JVDA 4HFSA 5FP7A 1O3QA 3FUOA 3TWIA 1JJ2U 4M00A 4D7TA 3OSDA 2G9GA 2W9XA 1ZZ9A 3U1XA 1UPGA 1UX6A 5JH7B 4DOUA 2E7AA 4DV0O 2LP7A 3POEA 4NPLA 4QAWA 3NJZA 4PDWB 2YBSA 4OGQB 3K3OA 4CDUB 4AVAA 4JAAA 4XF0A 1CZTA 1R3LC 2RS32 1LOEA 2WKKA 1WA8A 5JAXA 3A0HZ 1JYIA 4CE8A 1XNRB 2JG8B 4C91A 2B9UA 1IHMA 4CU6A 4ZS2A 5F5AA 4I9WA 3HIFA 5FYZA 4K3UA 2JB4A 2Y0IA 2LQTA 4FP3A 2RS51 3P3NA 4KHPB 4OHVA 1R1A3 1VQOV 4MO3M 3DPRA 5DUXA 2ZX4A 3E89A 3OR6C 2VZSA 4ICGA 2IWGB 1YQ8A 5EYYA 4E4ZA 5EC2C 3ASIA 4HXCA 1I3HA 3LDEA 1ND3A 2YXLA 1OCZB 2X6CA 1K42A 1RUG2 4LIUA 3AP5A 1BEV3 4RFT0 2WLLB 3APQA 4YY3O 1X9PA 2XQRA 4LTAA 3OMIB 1CPNA 3DYMA 3I2FA 1W2TA 4PV1B 3H50A 1FFTB 5FJKA 1COV1 2ZXWC 1CAXB 5J48A 3KV6A 4RYDA 1NH2D 3VBHA 1URFA 4IHJB 2VR4A 2VMCA 2XUEA 5BMVA 3WW3A 3GB7C 1RUOA 3DC5A 1UKGA 2VCCA 3VBUB 1VF6A 2GH8A 5B3SB 1NE4A 3KB5A 4X66B 3EFFK 4NHKA 1MACA 1N3QA 2ZEWA 1RUJ3 3VZLA 2X8KA 1BZKA 4WM7A 1CJDA 2HWF1 4CH5A 2WQZC 1HX6A 4XDQA 2Y69B 1NLSA 3SITA 3QF7A 3PLQA 1SEFA 3KG2A 3NMBA 4DXZA 2WL1A 3T1YO 2Q5TA 2E32A 1SRYA 2W68A 1RUF1 5FZDA 4L99A 2P37A 3RI8A 4WFAV 4XZPA 1JYXA 4NOTA 3A7QA 3H01A 2C9KA 5CVRA 2P6JA 1O8PA 5FZ9A 1XQ8A 1CN1A 5LZ6A 5LHGA 3D5OA 2DYRB 1QJU2 1VQKV 2R32A 1G6NA 1D7PM 4NIAA 1S5JA 1RUC3 3M70A 2VOTA 4XUQA 2PY5A 5DN6G 2NR5A 3ZRVA 2FMYA 3ETGA 4BQ3A 4PJYA 5DAWA 5FP8A 3N4MA 1W8FA 2QWNB 3ZN0A 1NJIW 4ASKA 1QQCA 2WO7A 2YGMA 1ZREA 1IBMO 4G2KA 3X29B 5B1BB 5C4WB 1AXYA 5K4LA 3QH6A 2LFSA 5FZIA 1KJLA 2GMEA 1OD3A 2R073 4KWUA 5F2SA 1X36A 4LF9O 2F23A 4I5SA 3JZVA 1GWMA 5EHDA 3THOA 4LF7B 2JGDB 2Q0AA 3K0GA 3WUDA 1DGRN 3VB9A 5K7PA 2WZR2 1PV0A 1K9MW 5JJJB 4PA7A 2NM1A 2Y6JA 2G38A 1GO3F 5I0TA 2XH6A 4FTSA 5K0UB 3I2OA 2R1BA 1J84A 5T54A 4BJ0A 5EV7A 5ERLA 3VL9A 4FVVA 4WM7B 3BI3A 4PDWA 3K5NA 2PTMA 1CVNA 4SBVA 2RNBA 2B5UA 1OA4A 3O0XA 4EFEA 5FWEA 4DV1B 2QKCA 3C3SA 3AMQA 4BQ4A 2HKXA 1EPZA 3M8AA 4JTNA 2OTJV 3MIEA 2PI5A 4YM3A 2UWAA 2CYFA 2UXBB 2RN9A 2HWB1 4DUXA 5FPAA 3RQ0A 2ZMNA 4EN8B 3CCMV 5LA9A 2L35A 2IC1A 3JBG3 1EYBA 3CCUV 2WZR1 2VOXA 4BWAA 4K8RB 5IVFA 4LBEC 1NQDA 4OI0A 3DPRC 5C8CA 2MPFA 4ET7A 3RZLA 5ACA3 1CAUA 4J42A 1AL22 3A22A 1EM1A 1W6NA 2ATFA 1OCOC 1PVC1 1NOVA 4Q4V3 3ZFGA 1HR0B 3TK1A 3JATB 3T2TA 3CJHA 5JQGB 4JX0A 4HK8A 4K1YA 2ZGQA 2D6KA 1WB7A 4MVRA 3STLC 2HWE2 3KCXA 4LHLA 1FATA 5FYTA 5ACA2 2XWBB 4P9LA 4CEYA 3HKBB 2HWC1 3KHCA 4UVAA 1GYKA 3U0ZA 2ORXA 1DGLA 5A7NA 2VBBA 2CDPA 3ACGA 5JCTA 1CQ9A 3WG2A 4YM2A 1V6KA 1SS3A 1VBC1 2X5IB 4TOIA 5DN2A 3JAMN 2VZ1A 1OCCB 4OHYA 3VBOC 2ZGSA 3CWBH 4FAGA 2ZGNA 1QXJA 1JXNA 3AG7A 1W8NA 4FZ1A 3RZKA 2QQWA 1A32A 2YC0A 3VBSA 2HEYF 4XFBA 1AYN3 4QDRA 2ZMKA 2Y60A 1H2MA 1Y3TA 4ZU7A 2R063 3OBTA 1COV3 3BOWA 1I9RA 4SLIA 5C33A 2O8QA 2Z4FA 3AP4A 5FY0A 4XHBA 4CCDA 5DDJ1 2HWE1 1WLWA 4Q27A 1IS5A 3J26N 3TOJA 3OBRA 3CJXA 2J22A 2ZR3A 3ZVXA 4Y1YA 2W1QA 5BNQA 1FKAO 5FTTC 1G9BA 1ULDA 3CJIB 2Y0PA 2F95B 3LEIA 1M56C 4AVTA 2CTWA 4FPGA 4XJ9A 1VQ7V 4LMFA 1WWYA 3E6CC 3B93A 4WFBV 4GH4C 3UKVA 2PYTA 5L9VA 4J11A 3POSA 2XVLA 1W9TA 2WNVB 4QU1A 3JB4C 2ZGOA 4CVUA 3UETA 4I50A 4NHLA 2J1TA 2BE3A 2QQLA 4HKWA 1MQTC 1PGL2 4CUGA 1O4TA 5EP9A 4JAVA 4Q1PA 1H8TB 4QX5A 1RSOB 1VBC2 3GJAA 2Q8CA 5KHIA 4PLOA 1NTZH 5JXIA 1YFWA 3ENRA 2PFWA 3I59B 4PLMA 3DV8A 3JCUZ 4PCRA 4ASLA 2DTYA 1V9PA 4O4LA 4UCUA 5T50A 3I3EA 1UX7A 1SQFA 1ASJ1 1DQ1A 2VCBA 4META 3GWOA 3WDVA 1Q8QA 4L9BA 2D43A 2E33A 3ZFGC 2OXBA 4AFBA 4JV5O 2P7TC 1VRH1 4MGSA 4ISQA 3LCPA 4L0PA 3KGLA 3NL1A 2VQEB 1MR5A 3MLJA 3VDDB 1VF6C 1WMDA 2KB1A 5IVEA 1J3PA 2JK5C 2XAHA 3OYWA 2WS93 3MIDA 3VD7A 1FFXA 1S0DA 4CCKA 4W65A 1EAH1 1YZBA 5KHKA 3OGCC 2XKPA 3OGJA 4BISA 4O4JB 2YXSA 3AYCA 4UUJC 4GX2A 3RMXA 4MSWC 4DUZB 1Q6UA 3TRSB 3LSDA 1N3OA 4IDZA 1CPYA 2VXRA 4AI8A 2JB8A 2WNUA 4LJHA 3USUB 3AC0A 3FAVB 1LR5A 3MAQA 2YMZA 2BUKA 3KVBA 5KX5B 3LSSA 4DV3O 3NV1A 4H3WA 1UW8A 2C6SA 3J8F2 3JQWA 1K7DA 4B3MO 4IL7A 1T5EA 5FNVB 3WNMA 2LW7A 3T4DA 3ZDVA 4I4TA 3IB3A 3A2FA 1OOPC 1IDSA 5ITZB 3OPWA 2Y26A 1DQ2A 4CC6A 3WF0A 1U0AA 2XGXA 5CA0B 4DV4O 5BNNB 2XJRA 2YIBA 4B29A 1CAVB 4G28B 3RZJA 1QGLA 4HYOA 3HQRA 1S3JA 3WB1A 4C8DA 3O1RA 1U96A 4XBLA 3K58A 2N7GA 4MLOA 1W06A 3DGEA 3GYDA 3H3UA 3ALQA 1GWKA 3VBRC 5C9AA 2VOKA 3RMYA 3CX5F 4FXKB 3SJCC 5KMGB 3F7YC 1UOBA 1OT5A 5FYYA 4YFWA 4X64B 4PA6A 2MEV2 3K9SA 3BTXA 2VWKA 3O1MA 2AHZA 4LQRA 3PUAA 2WIIB 1ULGA 4I0AA 4JDMA 1S0BA 3BGAA 4FTEA 3ZHUA 3I2DA 3JYCA 1PVC3 4QPIA 2EJRA 3PIJA 5GW7A 2DCJA 5EPAA 4ZY9A 1AXKA 1XU1A 2BRTA 3POBA 3RW0A 3MLLA 1YYNA 2HVJC 2SLIA 5F1RA 4FLUA 3V56A 1Y76A 2RR13 4O9GA 2OZ6A 3H1LH 2EZOA 3E6DA 2QWRB 1ENXA 4WBBA 2ILMA 1D5AA 3W7UA 4DW0A 5A6ZA 4URTA 1O3SA 2JDKA 5J1XA 4B3SO 2F1MA 3NNLA 4BW9A 4A7ZA 3LPGA 4J80A 2Y33A 3QBQA 1PD3A 4TXWA 5I8YA 4TN7A 1XE7A 4GD4A 1JYNA 3MUZ1 4EROA 2QQIA 5F2VO 3L9DA 2R061 1I5XA 1YI9A 3U07A 2A6ZA 4ITCA 5IWAB 1C3HA 5FBJA 4JI5O 4XDKA 1MS9A 4MUVA 3OUJA 4D6RA 1S4CA 5EJZB 3B40A 2P6CA 1FOD2 3RDIA 1NX9A 2Q30A 2Z0AA 5IT9N 3I3QA 4N53B 4FQZA 5LCWL 3ZKYA 1NI8A 3SC7X 2ZX3A 5CA1B 5K9YA 1UD1A 4QM9A 4GX1A 3MYXA 4BXSV 5EFUA 1Z5VA 4LF5O 2SBAA 4YVSB 4PIXA 2P2KA 5FXXA 4IHJA 3OPTA 1DZQA 3H7YA 3OF1A 2OKXA 2WA4A 1STMA 2EIDA 4RR3C 3T30A 5D21A 2FTKA 4DUZO 1ND2B 5LW9A 4YGDA 3VHOA 2VUDA 1LHNA 5H2FZ 4A45A 3TEWA 2Q69A 5IW0A 1S76D 5IUQA 3PHMA 1EN5A 3CNAA 1CAWA 2EXIA 4NTXA 1AJQA 2YI8A 5C93A 1GNZA 4HN0A 3VBFB 4IE5A 1VB2A 2F4VO 2ZNIA 4FAHA 4X89A 1N36O 2O0OA 4JI6B 3NAPC 5E1AC 3WV6A 4DR6B 4Q4Y1 3QO7A 4CC5A 1OXCA 4O4LB 3W7SA 3OUFA 1ASJ3 3TNQA 2EF6A 4DR3O 1X4TA 4RS5C 1XBLA 1O5LA 4O4IA 4P08A 1H4GA 3L71H 3JD73 4O4HB 3O12A 4EZHA 1F23A 3AYDA 3HN1A 2A3QA 2K46A 3VBBA 5AC92 4UI9L 4XBQA 1BBT3 1RSOA 5FYHA 1QWRA 2QM7A 4MXWA 5IYDO 5JWPA 2Y6FA 3H9VA 2WS91 2ARCA 5JSOA 1ZAUA 4IE7A 3M3EA 2W91A 2QNKA 1N33B 4OPHA 4A2UA 4AQYB 3R4SA 2ZEYA 1M4WA 2EBOA 4CXYA 1MS5A 3NJYA 1QLNA 3VUOA 4D3WA 4N8MA 4QHZA 3TCUA 1DU3D 4BB3A 1GTOA 3VBRB 1WW7A 3VHPA 2HP8A 1NYWA 3VQYA 3ZS8C 1KD7A 1FPN1 5DECA 1XYPA 3ACHA 4G4FA 3MI8A 1BEV1 4CDWA 4FFBA 5FIXA 3DXRB 1REFA 1VBE3 2QWOB 3ZSMA 1SZXA 4E2QA 5LGUA 2W46A 5DUUA 4LK6A 2OUJA 4XXAA 1SA0A 1VP7A 2IBZH 4LBQD 2ZABA 4O7XA 4KBBA 4A44A 1VBA3 1OSGA 4BWOA 3DYOA 1SG3A 4K8XA 1XBFA 1IX9A 4WZFA 5CFCC 4LKFA 2YPJA 3F2ZA 3SPJA 3WQ0A 4O4IB 2RS33 2BTQB 1I0HA 3ZFEA 1HRV1 4EB6A 2VNOA 4R9AA 4I01A 2ZHNA 3C7FA 4BQWA 3R0RA 3SYCA 4PDLA 1LECA 4AI9A 5IWFA 3J8F1 5A3PA 4DV1O 3ZMSA 3MGUA 3W5MA 5H9SA 3ML0A 2GH2A 1ULPA 2Q8VA 3JBG2 1A78A 1VBB1 2Q7EA 1I5PA 1AR92 1IXBA 4AE2A 1AR73 3UM7A 4TLFA 3KCCA 4MOAA 1GN2A 4CCEA 3HWJA 2OIEA 2UXBO 1CAWB 1W3VA 1WP8A 1W0PA 1OPMA 3ZLIA 4NXNB 3Q4HB 2WLMA 1EAH2 2I74A 5KHGA 4FOVA 1V00A 1UXZA 3ZCCA 3F5WC 1CPMA 2JDAA 2YICA 5KAFZ 5IATA 4LBLA 4LF8B 4TWKA 1SPPB 5JLVA 2NMNA 3LD8A 1IPSA 1RVF2 1VALA 4CU9A 1RPOA 1FXKA 2UUAB 2Q68A 1MEC3 2I45A 4MZUA 4L97A 1H1AA 4MG2A 4YVWB 1RL3A 2EILB 1H8VA 4XF9A 5I0RA 3O5SA 4LKDA 1ZTEA 1G4YB 4DR3B 1VQ5V 2DCKA 2V4VA 2BNOA 1R6NA 3TEZA 4Q20A 4NRMA 1F31A 3DXUA 1AP6A 1UJWB 5JCOC 1QH7A 1FMD3 1R3IC 2WZPP 3CC2V 4Y5TA 5M0TA 1SERA 4AW7A 5IYCO 2UY9A 3MW3A 4KGQA 4NJ4A 2WLJA 3VZKA 1MVQA 2DU0A 3L2HA 3UT5B 3J7MA 1N33O 2BDRA 5LXTB 3ASNC 3H8OA 1TMF1 3K3WA 1RUE2 5KC5A 1HRV3 3CP1A 2W08A 5A3MA 4TV9A 5F6LB 5FZBA 4OQ8A 2EIEA 2OS2A 2QM4A 4QQLA 1OURA 4HVQA 4E2GA 2W0XA 3VZOA 1C8NA 2FL4A 4RO2A 1HV0A 2NN8A 3R4UA 4COYA 3BEHA 1YCIA 1FAYA 4LO4B 3PUIA 4FLTA 1AVMA 1AI4A 1VARA 4IGPA 2P67A 1LOFA 3NW4A 1YHFA 2LGWA 5JI7A 2FKXA 3T2OA 1PO21 2PA7A 4FM0A 3PUHA 3J80N 5L3GA 4QPIC 2VY0A 3K4DA 2FZ2A 3CF6E 2PHWA 1IG0A 1NU1H 3T4ZA 2Q8EA 3PIGA 3RJRA 3HQUA 1XU2A 3U78A 1HW5A 4COVA 4NAOA 2A7AA 3IMMA 3F5TA 4DNYA 3HKDA 3IC9A 1N0NA 4AYUA 4LC1A 2XVKA 4X1YB 4P9OA 1VBA2 1PO12 4LHSA 4XDPA 5KA6A 1XOUA 3NNFA 3MHZA 2BP6A 3QH7A 5CA0A 1DQ0A 4OZOA 1RUE1 4F4LA 3RYHB 4FIPC 2HWB3 3KCYA 4DRXB 3B02A 3IAPA 4YJ3B 1N3PA 1QJY1 3KWVA 1WKYA 1W8UA 3TYJA 2HFEC 3OCPA 4MVSA 4M01A 2J7MA 5CB4B 5JZGA 2HEWF 2ZDIA 1FMD1 3LGRA 2WNEA 3OGSA 1RMU2 3GM8A 4GLXA 1C8M2 1Z0HA 3FAVA 2MW2B 2XBO1 3K2OA 1SKVA 3JB8A 2WYSA 3H8UA 1HNXO 2NMOA 4AQSA 4C0HA 1US6A 1NXD1 4N9IA 2P4EA 4QGMA 3HJRA 4Y5Z0 1V70A 2WLLA 5D8AB 3DSQA 2ZHMA 2P4VA 4B3TB 4AAXA 3RZGA 3HKEA 1OA2A 2L9LA 4IE4A 3WOGA 1ND3B 1K97A 1BYHA 1RHI3 4AEDB 4AQ2A 4QPJA 4JI8O 1R3JC 2QQOA 1RUH1 3OAAG 2W6IG 3ZXJA 3WQ7A 2WZ8A 2VE1A 4OI4A 4FLVA 3FYEB 4TQDA 2EALA 2J42A 5AC93 3MDPA 2YIBD 3B3QE 3CO2A 1ZRDA 3ZRXA 1ZX3A 1XPWA 3FE5A 5E89A 2CAZC 2UWCA 4XFAA 3O14A 2ZE5A 1JCHA 3ABMB 2EINB 4IYIA 1ZBE2 1BZWA 2VD7A 3J7HA 3KF5A 2VZTA 3RYPA 2OPKA 3UJOA 5L36A 2BPA2 2QVSB 1AYM1 1GP4A 5JH7A 4O2BA 2RVAA 2HWE3 1YVWA 2X0LA 4MT8A 4WVZA 3ZHTA 3WP3A 4YHHO 4FBFA 1MZEA 3WQ1A 2AZ5A 1DTOA 2ETEA 2Y34A 2ZX2A 4AF9A 1UL9A 5A1FA 1MS1A 1O4YA 1MSWD 3DC6A 1PZ7A 1LAJA 1H8EG 1JYWA 5I0DA 1W2UA 2A6VA 2QWQB 2VRZA 1HN0A 2BGPA 1YWKA 4QKDA 4CEWC 1RUH2 1O91A 3B7MA 3O1VA 3QCWA 1XNKA 3M4FA 4RGAA 1KUQA 4LE4A 1SQQH 4UV8A 4K1ZA 1KECA 1R081 2GN3A 4CTEA 2PF4E 2UU8A 5IK5A 5E6HA 4JGZA 2RMU2 2O8OA 2R0HA 1SFYA 3CE2A 2DWEC 1RPRA 4C90A 1DGSA 2VBPA 2Q4SA 3ME2A 1CIYA 2LJ2A 1PGW2 3VKNA 2UUBB 5LMUO 3N7JA 3TEYA 3A8TA 1GKBA 4Q6GA 1SQ4A 5C3PA 1GRJA 4BMBA 5FBZA 1CEZA 5GZEA 1FI2A 2YUAA 2XDVA 4AHZA 5KLVH 3EB7A 1ZLZA 1JZ6A 5CEHA 1HNWO 4ES8A 3T1CA 2E6VA 3OD0A 2C4XA 5L3DA 1XNTA 4TSVA 3L70H 4X1KA 4CXXA 1W0OA 3OUHA 5H9RA 3VV1A 1YXWA 4QHBA 4M4PA 2ID4A 4ZHNA 5B5EZ 2OPWA 4QT6A 4FPKA 4AI0A 5CB4A 1Y4WA 4XUPA 3HKCB 1K4DC 2OYQA 2H3OA 3WNPA 4U3JA 2YV8A 1M57B 2PHLA 5HI0A 1TZOA 1BHBA 5E79Z 1GN6A 1V6JA 2RS11 4Y4YA 3E83A 5CBHA 3MICA 1OQ1A 1OQEA 1S5LZ 4OHXA 5F37A 5BY1A 1BE3H 2R9IA 5LOVB 1Y9GA 4NXMB 3F7VC 1RFYA 4PJ0Z 4UVBA 2RS12 2E76B 2XAFA 5ABJA 3K75B 4CDXB 4CP2A 1YFXA 2DYSB 1WAZA 4DV2B 1H8TC 3K03A 1VRH2 1TUEB 1LGNA 2EIGA 4FFGA 5JMCA 1XSQA 2WSSG 3CIHA 2RCVA 1N36B 1OVPA 1RUF2 3KV4A 4JKMA 1ZBA2 4NIDA 1WBLA 4JQRA 2X10A 1TA8A 4DR6O 2P3JA 4GYCB 4IGOA 1H0BA 3W20A 4RR3A 3JASA 3DF0A 4QDSA 4BW5A 1PX3A 4FPYA 2XQXA 1Y67A 4DYLA 4MYEA 1VLNA 2H6CA 2J1SA 4QXCA 5EIYB 3R6SA 4AHWA 1PM4A 1DG6A 4R50A 1GR3A 1C5IA 3BCCH 2VUJA 5LATA 3ZEDA 1W8WA 4EWEA 1WP7A 4QKFA 3CXHF 4HN1A 3I2KA 2E5LO 3F95A 1N4CA 1J1LA 2N04A 2F43G 1TMF2 4FOQA 3CC4V 4KMQA 1HRI2 2BVVA 4X62B 3Q8CA 5IT6A 1BKZA 2EXJA 2VVDA 2A73B 4LHKA 1JUHA 3WP5A 1XMQO 1AUYA 1QF3A 2VNGA 1PO11 3IAQA 1V6MA 3OT7A 4M0NA 2RR11 3LA2A 1QJU3 3THDA 3L72H 1W8OA 4NTWA 1DCSA 1ZZ8A 1Y43B 4HVRA 4COWA 1E5HA 1B35B 4LBKA 4A5UB 4QJFB 1NA1C 5JVVA 4NTYA 4KU8A 3ZPYA 5DEDA 1GMGA 2Z79A 2VMIA 1GN3A 1UZYA 2XPJA 3LDDA 3E86A 4FLXA 1WW5A 5FXZA 1H2SB 3ABLC 2XAGA 1WD4A 3KQ4B 4HK9A 3VOUA 3VGIA 4TT3G 3N9OA 4L2NA 2CGPA 1OHFA 1JU3A 3BCWA 2BCCH 3IM0A 5GZDA 4LBQB 5FQ0B 2UUBO 3ZPOA 4D6TH 5DZGA 4WV8A 3EYPA 3MW4A 3FFQA 5K0UC 5EYXA 4X1IA 3H1JH 1UY0A 3PMSA 3WSOA 4JC1A 4CP9B 3BN6A 4JYAO 1V6OA 3LA7A 4AXOA 3AG4B 4FTBA 1HJFA 2E26A 2WZEA 2OQ7A 4ABMA 4PA3A 2WQ8A 4EV0A 1KKCA 2X7RB 3J7NA 4ES9A 4EE2A 1JZ5A 1OFNA 4IUGA 1YQ5A 1VIBA 3HKDB 2YDEA 3QO5A 2PHTA 2CWSA 2HWD1 1AR82 1UWWA 3EMRA 4FVMA 4FXGB 4ASMB 4HKLA 2RQ6A 3A23A 3N2GB 1UO9A 4M3CB 4XUOA 4R9BA 5C3SA 1O5UA 2PAKA 3LZZA 2QWPB 1W8ZA 3AKPA 4JDNA 4DEVA 3WW2A 4BLJA 1C1FA 2ENRA 4GUNA 4J9ZB 4NUBA 3JALB 4QXBA 1OCCC 1WZXA 2R72A 4DR4B 4J7JA 5F3IA 4QE9A 1F7YA 1OI6A 5A3WA 5FMBA 1L0LH 1L7QA 2QDRA 3UJQA 5FZGA 2A71A 4NXMO 1M5IA 2OUHA 2BWAA 5IJRA 3CRQA 3IZOA 1QKQA 4O61A 1US2A 3QVNA 5ISLA 1OMIA 3SXWA 1ULOA 4GWIA 1CIWA 2W92A 5DPNA 4CZSA 2YI9A 1QJX3 3WW4A 1SQXH 4BIZA 3ZIAG 5KHJA 4QQHA 4W8JA 1YJNV 3VZJA 1U97A 3SHRA 4K8ZA 4HPKB 3KLSA 2GC0A 2VC9A 2DVBA 1RP3B 1M56B 2WLQA 5A3TA 1JZ8A 4U2AA 4GIQA 2JDIG 5T5JA 4KG0A 3H1HH 1BCXA 5HXVA 3MBWA 3IDEA 5H6QA 2ZKLA 4M0HA 5JIAA 1AYM2 3ACLA 1AR1B 3CCRV 2ZEXA 4PDVA 2JX9A 5C3QA 3K51A 3ZFFB 2VO5A 1TME3 4X62O 1GOHA 1TEIA 3I3DA 3MV01 4OI2A 5FREA 2RV9A 1HRV2 4JDOA 2QTSA 4XAAA 1AYN2 5FOBB 1XMQB 2ADDA 1XYOA 5CBLA 1DGWA 1S0FA 3ZYRA 2AC1A 2XG3A 3SCGA 3DKWA 1QOSA 1QNMA 4V2VA 5A32B 1KMIZ 2DURA 2VQFB 1W2NA 1T6GC 4CP1A 4YSFA 1MG1A 4V2WA 3V64A 4JYYA 2Q0OC 3IWZA 4NMIA 4E8CA 2YIAA 2RDSA 2Q8DA 3KHBA 4BIFA 2IXIA 3SEEA 3VKMA 3HT1A 3MO4A 1IPJA 5J98B 1PVC2 1VQNV 4IXLA 3ZX6A 2OT5A 4LWSA 2Q1ZB 1KYOF 3LSUA 3OE7G 1BSMA 2VOWA 4BR6A 1WA6X 1FT9A 1W3XA 3J7LA 3R66A 1ZUQA 2TNFA 4UF0A 1OKOA 3RYRA 3K59A 1QEXA 1IVSA 3WG7B 1YFUA 5APAA 4YGEA 2QQPA 1C1LA 4AEDA 2V4AA 2PMWB 5F8PA 3B77A 4EYUA 1XOYA 1CWPA 2RDCA 4Q1RA 3J81N 4GALA 4JKLA 1W8TA 5EQUA 4DV6O 4AVBA 1UXXX 1MEC1 4DXWA 3TAYA 3JALA 4EN9B 3ZN6A 1LHUA 5CISA 4FPCA 3WDUA 3AZYA 4Y26A 3PJYA 3KZIZ 2GC2A 1VQ9V 1IS4A 3PMEA 5FY4A 2OCHA 1AR72 4YW7A 4JTOA 4GB32 2WZR3 2QTWB 4F6RA 2VNVA 4RQPC 4DV7B 1XUQA 3OEBA 3H0OA 2G9FA 4J10A 1HNXB 3VBRA 5C9AC 3TN93 4E2LA 4K20A 1QQP3 4IEVA 2JRIA 2UXXA 2QZ2A 2HWF2 4CBCA 2B9VA 3HNMA 2P6HA 3M3IA 3T0AA 5LY1A 4IEOA 5CFDC 4J25A 1QY4A 3MPPG 5AVPA 3RGBA 3T4VA 4DO0A 1UF2C 1JOPA 5JJNB 3CMAV 5CA6A 5FJHA 1PK6A 1FD9A 4AHXA 4QX1A 2JXAA 1GK9A 1AF9A 4UFMA 3H1YA 4LBQA 2CK3G 5I93A 2D93A 1NCQA 3U4XA 2QCSB 2WABA 4LOTA 1UN1A 4LBOA 1CZVA 3L2YA 5BNOC 3OBZA 5JZGC 2DMXA 5B1AB 3AYAA 1REEA 2JDUA 5CFCB 5DZEA 4DR2O 1XC6A 3AKRA 4DR5B 3D3AA 1IS6A 4OX9O 2ZCEA 1O7FA 1ZBE3 4LUKA 5F3CA 3W21A 2PGGA 3L9JT 1J58A 3HR9A 3HEIA 2B39A 4K21A 5BYNA 4JI4B 4NN0A 1BBT2 4IIJA 1RUG1 1ZA7A 1WB8A 2D6PA 4GA9A 2GP3A 1JN2P 4XETA 1W6PA 4CEWB 2QUOA 4ZI7A 4Q2FA 2VMGA 1XHXA 3D6EA 3NVCA 3AEIA 4TWTA 4B3RB 3ZSJA 4OZXA 5FLHA 2GDSA 4JI3O 3D3QA 1E5RA 3FL7A 4LA3A 5KMGA 1IURA 1VMGA 4MTOA 4JPRA 5CFDA 3OY8B 1KU9A 4Y33A 4DR7O 4UW3A 5BNPB 2VQFO 1VQ8V 3RBZA 4ZZ8A 5B66Z 4GKKB 1JBCA 2DOSA 2ADEA 4JHZA 2UXDO 4I0WB 5C71A 1UU5A 4AHCA 2JVDA 5E8AA 4CDQB 4WCEV 4RHV2 1EV13 4Q26A 2VMDA 1K5SA 5J2TB 1V9U2 4U36A 4FFKA 5CAZA 3CRMA 5J9PC 4UCOA 3TNPB 2Y0OA 4YVWC 4CRQA 1ZZBA 1D4M3 5HCFA 1X33A 5FAXA 5C6CA 4Q4X3 3FWEA 4FPHA 2WN3A 3EXUA 4OHZA 2W1SA 4IEUA 1GOGA 4HL0A 1AJOA 2WT2A 3KMHA 5FY9A 2LTNA 3RVYA 3GZAA 5IK8A 2WO1A 1SLLA 4PDMA 2PZSA 2LRPA 4XABA 3C7GA 3HN3A 3L73H 3W9AA 5DABA 1MS8A 4JI7B 3ZMTA 3AXDA 3ZYFA 3M99B 3OR7C 1OUXA 1N1SA 2MEV1 1SFNA 1NVPD 1SCSA 2GDFA 1OV9A 3ECQA 3HPNA 5FPLA 2E74B 4X66O 5HV4A 1E5IA 4FFFA 4ZI7B 4I3PA 3P30A 4XEZA 5L7OA 5LA1A 1JJOA 4YNIA 1ULFA 2YBPA 4GKXA 4QPGA 1OJHA 3ZN6B 4R4ZA 1RVF3 2DCTA 2GALA 1NCRB 5BUVA 4XMAA 3JD1A 1CR7A 3WNOA 1IS3A 4LK7A 2XMLA 4KXRA 2YFZA 3B01A 3K3NA 2PHUA 3SEPA 2AZ0A 1LHVA 5EXOA 1WLTA 4U7NA 1ENQA 2GNTA 1DYKA 3O9OA 5EIBD 3HQXA 1JMUB 2XONA 2P4KA 4JGSA 2Q67A 2ZDIC 1XNQO 3M1HA 1C8M1 2K1EA 2PQQA 1LU1A 4HT1T 1F8VA 2ZX1A 2YC4A 5T5OA 4AFCA 4CP0A 3ZIWA 2XAQA 5L3CA 2E7TA 2BBAA 2YXYA 4BIUA 3PJSK 3NKGA 1LOFC 1VBE1 1RXGA 2VMHA 1BS3A 4RL7A 1QU7A 1W0KG 3AJZA 2Y6KA 1S2EA 1K8AW 2W0FC 1AI5A 2E5LB 1FPN2 4XE9A 2GTAA 4JI0B 1Q6HA 3VDAA 1KEXA 1GZTA 4HMZA 3BHPA 1N32B 3RYIA 3EXAA 4WVWA 2Z69A 5LMNO 2XJUA 4BQXA 4B1MA 1RIRA 2FMLA 2RS31 4LF9B 2JENA 4LOSA 5B3SC 4RA0A 1ZNPA 2A1XA 3HMYA 1I94B 3WNNA 2X5IA 4PIYA 1D0GA 4UT5A 1ZVFA 2DBIA 4QHOA 1XREA 1YQ6A 1HB3A 4ZHQB 2JJ1G 2D5HA 1O6UA 3AZXA 4XF1A 4H7LA 3VDDA 2JDNA
chains in the Genus database with same CATH topology
3ZX7A 1AX2A 1GNZA 4HN0A 3VBFB 3W59A 4YRDA 4GMP3 5J3UA 3D8CA 1VB2A 5GJ6A 3ZMOA 3IPVB 4FAHA 1U5ZA 2JE7A 2GNMA 2O0OA 4Q0UA 3NAPC 4M2IA 1JOJA 4LBMA 2VQAA 1NA1B 3WV6A 2RM22 4AEJA 2VOVA 2PN5A 4Q4Y1 3OGGA 1LHOA 1C4RA 4DMIA 1DLLA 3ILNA 4Y1XA 1ASJ3 4HLTA 3B5LB 3TNQA 3UL2A 2EF6A 3NAPB 1VBD2 2D3PA 1HRI1 5FO7B 4RS5C 1O5LA 5CG9A 1H4GA 3JD73 1AXZA 1HXS1 3O12A 4IV1A 4YVSC 4AK3A 2K0GA 4LEJA 3N6WA 1ND2A 3AYDA 3HN1A 1LULA 5GKAC 2NQYA 1S2BA 3AKTA 4M3CF 3AM2A 3SCHA 3AFKA 1AR91 1X8EA 4N90A 4J6GA 4YZ3A 1R092 5AC92 4P9JA 4XBQA 1A6CA 5DDJ2 4PF5A 1IOAA 1V6NA 1BBT3 4DRRA 2OG5A 1QWRA 4AQTA 2RM23 4MXWA 3E5XA 5JWPA 3ZSLA 2PHFA 4Y1ZA 2WS91 5FO8B 2RJLA 5JSOA 4XYXA 4YLZA 2FBEA 1DQ6A 3M3EA 4OFGA 3ZXDA 4O9EA 2DCZA 2QNKA 4A2UA 1GSLA 1Y7BA 3R4SA 4NO4A 4N43B 1C28A 1JYCA 2D3RA 1RUE3 1Z7S3 1M4WA 4BHPA 1TME2 1EV11 2ET7A 5ACA1 1WD3A 4DQAA 1MS5A 1H9PA 3MF6A 1OIJB 3LOIA 3VUOA 4D3WA 1ONAA 4YGCA 3CJIA 1OFSA 4BLIA 1DU3D 2XKOA 4IV3A 5K0UA 1KJRA 1O3RA 2E51A 3VBRB 4IETA 4HETA 1OIJC 1WW7A 4DFSA 1GZ9A 5DG2A 3VHPA 1NYWA 2ZKNA 1UIKA 3CEWA 1KD7A 4RHV3 3B94A 1FPN1 1U12A 3FHIB 4FSJA 5LRRA 4C1WA 3VBFC 4JGYA 1XYPA 4G4FA 1VP6A 3MI8A 2RS13 4Z07A 4Z2WA 1BEV1 1QJY2 1AR81 2D7FA 3JCIA 4CDWA 3H1WA 1Q8OA 4N43A 4S2FA 4XMIA 1REFA 1R091 1VBE3 5T3NA 4XJ8A 3ZSMA 5JDBA 1KDKA 2HYKA 2VQ0A 2DFCA 1HQWA 4E2QA 2DU1A 3NKTA 2QJVA 5DUUA 1H9WA 4B7KA 2MNGA 1K5MC 2OUJA 4WVMA 3THPA 4KG8A 4XXAA 2H0VA 1VAVA 4G3YC 1TNRA 4LBQD 1FNYA 2PHDA 2ZABA 4KBBA 1ZZCA 2XL9A 4P9YA 3USSA 1VBA3 3INAA 1OSGA 5EZWA 4BWOA 4AEKA 1ENSA 2PLV1 3CJIC 3ZXKA 2R072 1AYN1 4TZDA 2NLRA 4YZ1A 3ILFA 4EN6B 4MXVA 2BW8A 2OZJA 3ZYJB 1EY2A 4MGKE 4WZFA 5CFCC 5HCAA 3B9CA 2YPJA 2BBVA 1GZWA 1LGBA 5JSRA 1MZFA 3WQ0A 1B35A 3VN4A 4V1PA 2ZZJA 3DL3A 2RS33 1H2LA 5DUVA 3ZFEA 1HRV1 2VNOA 2W39A 3VKFC 1DYPA 1DGRA 1Z7S1 3D4KA 4R9AA 4I01A 1HLCA 2ZHNA 4HSLA 4OUMA 3R0RA 4YW3A 3ZMNA 1LECA 1CD3G 1RUI1 5HBAA 1PNGA 1RUJ1 3J8F1 1AZDA 1VBD1 5FO9B 5J09A 3MGUA 2EXKA 2WFF2 3GBWA 5H9SA 2HWF3 2GH2A 3MIFA 3JBG2 4CDXC 3LOBA 2R062 4IEQA 3U10A 3I7DA 4ATEA 1AR93 2OW4A 4UBHA 3URFA 4XFIA 4XQWA 2XB6C 4S2GA 2OIIA 1A78A 1VBB1 2H6BA 2AYHA 2ZOEB 5JR7B 4ONUA 3MFCA 2P17A 1AR92 1OIHA 3E5UA 4AE2A 2V09A 1FXZA 2CGOA 1AR73 1POV1 4YG3A 3ROUA 4TLFA 3CL1A 1IKPA 1RJ7A 1RUI2 4JGYB 3KCCA 2FQPA 2LALA 3HWJA 1CAWB 4E4DX 1DDLA 1W0PA 1OPMA 3I4IA 1D2QA 3ZN4A 4EWAA 1FV3A 1EAH2 3H3ZA 2ZJCA