2CGOA

Factor inhibiting hif-1 alpha with fumarate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
342
structure length
339
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
publication title Structural and Mechanistic Studies on the Inhibition of the Hypoxia-Inducible Transcription Factor Hydroxylases by Tricarboxylic Acid Cycle Intermediates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 106
structure length 339
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2cgoA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgoA01
4B7KA 2W0XA 5JWPA 3P3NA 2XUMA 1H2MA 4Z2WA 3OD4A 4BIOA 1H2LA 3D8CA 1H2KA 4NR1A 1MZEA 3KCYA 2ILMA 2CGOA 2WA3A 3P3PA 1YCIA 4Z1VA 1H2NA 4JAAA 2CGNA 2YDEA 4QU2A 4B7EA 2WA4A 1MZFA 1IZ3A 4AI8A 2Y0IA 2YC0A 3KCXA
chains in the Genus database with same CATH superfamily
4JI5B 2FCUA 2VQTA 1VP6A 4FT8A 1Y74A 4R9CA 3O0VA 2Y48A 5C7GA 4P5YA 2P3IA 2YUAA 5LASA 4WVVA 5DN6G 1VQKV 1QJEA 4BIFA 5A70A 3Q8BA 3PVOA 5KC6A 1UL9A 1RUE2 3N2GA 3LE0A 3ILFA 4URAA 3RFRA 2V7QG 1OMIA 4XQ4A 1SQXH 1KD1W 4BCUA 2QFEA 3Q8AA 1UZYA 4LKDA 2VUDA 4NKGB 2HJIA 2QUOA 1PNLA 3LSEA 3DKQA 4QB6A 4MVOA 2A7WA 4FOYA 2D2CB 2CH7A 4H37A 4Y20A 1SLIA 2RS31 1OOPC 3O1UA 1OBNA 1JYWA 4GZRB 4CUAA 2R9RB 1GH6A 5A7WB 1HNWO 2DQ0A 3KM5A 4CDXA 4KBBA 1VQ5V 2UWBA 1MQTB 3VBRA 5HCHA 1P7BA 4CCEA 2YYOA 5FZ6A 1OA3A 2BRTA 3WQBA 5KX5A 3L2HA 5DZGA 3ZSJA 3OR6C 2LW7A 5DG2A 1VQPV 1XNQO 2RDSA 5KBFA 2DE0X 3RYCB 1K73W 1LGBA 4J9YB 5CBHA 1KS5A 4WVMB 4CH4A 4AZZA 1HB4A 3TWIA 1X50A 3GM8A 4PA3A 1COV2 4LNVA 4X89A 1WLCA 3C3SA 5GTIZ 4Q4X2 3I56V 3JB8A 4N9HA 3CD6V 2Z5WA 2QKAA 3STLC 1YUDA 4O61A 1VF5B 4C8DA 2X5IB 1N34O 3J8F1 2C5DA 4BYYA 4EWAA 1K12A 5FO9B 2E63A 1R1BA 4JI0O 4D7SA 5FP8A 2VBPA 3PU8A 2QJ1A 2N74A 3HNBM 4Z8BA 5HFLA 4DR3O 1UZZA 1AR61 2QZ2A 1W6NB 4D6QA 2EILC 5IJ0B 1S0JA 2BBAA 3ON7A 4AHWA 2IJIA 2ZEWA 1V9PA 1ZL8B 2MEV3 2HJFC 2WSUA 5DM6V 5K0UA 3O0XA 4NHYA 4DV2O 1N36B 1DQ2A 4DXSA 5LMUB 1GBGA 4Y22B 4EN9B 2VQ0A 2VR4A 4XTMA 3TEZA 2JIJA 1Q8IA 5IY5C 1JU4A 2D7FA 4JGYC 5FY0A 5DUXA 1YI2V 2IXLA 5FYZA 1SLBA 2I74A 3T4DA 3HKBB 5C9AA 2WLLA 3GJBA 2UYAA 3T0DA 4RQEA 4AQYB 1RUH3 4PQ9A 4A42A 1XJAA 5TSWA 2HWC3 4PDMA 2Y69B 4NHKA 1UO9A 3IAYA 1REDA 1W05A 1HN0A 1HQNA 4CPBD 4NAMA 1TNFA 4S2DA 3NV4A 4XFGA 3ES4A 4KQ7A 1PL4A 1UMZA 4WM8C 3HB3B 3JAKB 2AH2A 2R073 1JZ4A 3SPCA 2Z0AA 4FZ1A 1SLTA 1H8VA 1TME3 2PYTA 2UWCA 5LA2A 3O7OA 4MHRA 1XI1A 3AG7A 3VD4A 3MLJA 2JXAA 4J1XA 3AZVA 3FUQA 1EM1A 5KMGA 3CCRV 4YARA 1GP6A 3W58A 3G80A 4GYCB 4Y26A 3ZLIA 2D40A 5A32A 3JCUZ 2G9FA 4XQDA 4EV0A 4H14A 1CP9A 3ZFEC 5FYSA 2D6MA 3AX4A 4UCUA 4NJ4A 2B45X 5FPZA 3SLIA 5EPAA 1HX6A 5J2UA 4O4JB 4TUYB 4N7IA 1TME2 1W2OA 3LOBA 4XDPA 2E9QA 3DGTA 3E22A 3ELNA 1KFUL 2DVAA 4META 4G27B 2E7QA 2JDYA 3RMXA 3GBGA 2FDGA 5CMUA 1EAH3 1XB9A 1TUBB 3RZMA 1PMHX 4UVCA 5A33A 2QM8A 4GUNA 2IBZH 2Q6AA 2A6WA 2YY1A 3HWJA 2UUCO 1QR8A 3UJQA 1WLEA 2NMOA 5EBWC 2BTVC 4N9IA 4X8AA 1SZTA 2LW8A 5IFTA 4JF3A 3CJIB 3ALQA 1IQDC 1VBA3 5DMYA 2YU2A 2WL1A 4FXKB 5C3SA 1ZVFA 5CYYA 1VP7A 4BQ2A 5LA9A 2QQOA 3OFNG 2UXDB 1YZBA 4HMZA 4MGTA 1DF5A 4LKSA 3FLTA 3KV4A 4G9SB 2VZSA 2SBAA 3JAWB 3UO2A 4NXNO 5FUIA 2GP3A 1O59A 3FZ3A 1WMDA 3UGGA 3OUIA 3JATA 2UU8A 2A75A 4LOSA 3VDDB 2WLPA 3KF3A 4CDQA 4QB1A 3M99B 4DR6O 3D3AA 5J2TA 4B3RO 4AVBA 2R32A 5C70A 1GQPA 1LUVA 1H6XA 1MSWD 4JQTA 1VBA2 5I0TA 1UN1A 2FKXA 2VZRA 1QGLA 1PD3A 4MLOA 3ZPYA 4S2GA 3AXDA 4JYAO 3PVNA 2I45A 5EYXA 1PNKA 2VCCA 3K5MA 3LD8A 4R9AA 2XLFA 1NZCA 1PMJX 4YM2A 2XQXA 4N53C 3TN93 3RRDA 4YGDA 1JCHA 1Q3EA 2XR4A 1W6QA 3MEPA 3CRCA 2RJLA 1JOBA 3AZWA 2RCVA 1GMGA 1JFFB 2YG0A 5AFEA 1PGW2 4UI9L 5FY4A 1W8UA 3H1MA 5A3UA 5JLVA 2DMXA 4B29A 1W8FA 1O3SA 2QQKA 4YLZA 1T2XA 5KA5A 1SA0B 2R7EB 1E1RG 3D4KA 5LXTB 5JMCA 3RYIB 1YQ2A 3Q4HB 3H1IH 3MHSC 1FD9A 1FJGO 1I94B 3BVOA 1SS3A 1HB2A 4IIJB 2IU0A 1H2GA 1M56B 4M0NA 1K5MB 3C7HA 1F5JA 2QEXV 4L8QA 5LK5A 3AXEA 3THOA 1COWG 3ZSMA 1NKGA 3LAGA 5A7OA 4LBNA 1H2LA 5EJZB 5DDJ1 1GNZA 1UY4A 5F7UA 3F95A 5L3DA 1W99A 2WO2A 2GN7A 3Q8EA 3U14A 3STZC 2EIKB 4GT1A 4BQ1A 1N32B 4XUPA 4RAIA 5A7WA 3ZIXA 3OEBA 3IDAA 4FLZA 4QHZA 2W1UA 1XU2A 2Z42A 3D36A 4BIUA 3SYPA 3RYHB 1MQTA 4AEMA 2M7WA 2WWJA 4RUEA 1LUWA 4XIOA 5BR8O 4XHBA 4NVPA 3J26N 3T1MA 4CEWC 1H8TC 3BODA 5FOBB 4X65B 3VL8A 3HNMA 5JSPA 1WBLA 3E2EA 4JZRA 3RYCA 3PTYA 2W1SA 2QE7G 4MW8A 3P3PA 3DECA 1LR5A 3W5MA 3ZHSA 2ZKNA 4Q4V1 4FLVA 1YHFA 2PHWA 2JJ2G 4JI3B 1GZWB 2D93A 1YYNA 3RT3C 3LPFA 2W2IA 2DQ3A 3PNAA 3FD9A 3H1KH 1VQ9V 3SYCA 1RUI3 4D7TA 3ZEDA 2JDNA 1SDDB 2Z79A 5C4WC 4AVAA 5KHIA 3QACA 5FP7A 3ZMOA 4XDKA 2XGXA 4GKJB 2VZ1A 2QA4V 1GMMA 4TQDA 4RGGA 4COVA 3SJQC 4X1YB 3W7SA 1N33B 2ORXA 1BLZA 4OULA 3BTXA 4W65A 3H8XA 4OPHA 1WLWA 5GALA 3MV11 2JD4A 1UF2C 1S5JA 4JI1O 4Y1XA 1MS4A 1W6NA 1VQLV 2E6VA 4W6WA 4TSVA 3S0MA 4Q4Y1 1ZL8A 4XZPA 2ZKOA 1XOUA 4J41A 2ADPA 2LTNA 2AENA 1NS1A 3FYEB 2ET7A 3AYCA 3T1LA 4Y22A 5IK4A 5ACA3 3BU0A 3HR0A 1JBCA 1GICA 2J1SA 2WO1A 2JGUA 1HNXO 1LR1A 4OLLA 4DV4B 4RA0A 3HKBA 3PHMA 1JH5A 3MV01 4PI0A 4H55A 3JD0A 1CN1A 3VL9A 4DOUA 2WAAA 4EFEA 1KMIZ 3PU3A 3JALB 2JX9A 1ZBA2 4X66O 1BZKA 2ZD9A 1RJ7A 1N3PA 1HRV1 4EWDA 1OFSA 2RS52 4LFAO 5B2GB 3IBMA 2CTRA 3JAKA 4XJ9A 4DV7O 4FIPC 1JZ5A 2DYRB 4XF1A 3ZSLA 3A7QA 1UY2A 2WNVC 3RMYA 4FFIA 4I01A 4AFDA 2WWUA 1RMU3 3E97A 2PY5A 4FLWA 2VH9A 2ZJCA 4IEZA 3DPRA 2IWGB 4ZHQB 1Y4MA 3QO8A 2W1WA 1ZRFA 1C3HA 2CHHA 1VF6A 3QH6A 3H9AA 1SQVH 4YG3A 4YJ3B 1HNZB 1QQP3 4JTNA 3PVBB 1IBMO 4AI2A 4AGRA 2W39A 1XNBA 4NTXA 4W50A 3ZKYA 1OQEA 5GKAC 1KFXL 2HKOA 1FI2A 2VRZA 3PUQA 4GH4B 4LBJA 4O4JA 4TUYA 3RWKX 4HKWA 3EFFK 4JTCB 4XE9A 2FD8A 3VBUB 3I3BA 5JXHA 2DU1A 1RUJ2 5F6LB 4EROA 1RUC2 1DF4A 1MEC2 5L9RA 1LULA 4JAUA 5CEHA 1GZCA 2P4VA 1TUBA 4UF0B 3OBRA 3OR7C 2XAQA 1HJFA 3WP6A 1VMFA 1J95A 1RSOB 4IEWA 1R1ZA 4B3TB 4LCUC 1DQ0A 3UESA 5JQGB 3O1TA 3TBDA 3AG4B 4Z1MG 3CJIA 3OEAA 1POV1 1RPRA 4IE7A 4LF7O 5FYTA 2L35A 4PF1A 3AMNA 2A0LA 4DV3O 2K2SA 2VUCA 2IFRA 4N8MA 3D0SA 5DAWA 2GAUA 3DXTA 4XIKA 1X8MA 3JAWA 5KXCA 2X6AA 1M57C 3C8XA 3QBQA 4TQFA 5L3FA 2TBVA 4IV1C 4P5HA 3VD3A 2UY9A 3SPJA 3WZ1A 2VC9A 2JEXA 2WNUB 3VDDA 1LHUA 1S0DA 5FMOS 2H0VA 4PDLA 1B6QA 1P7GA 5FZ1A 3RVYA 5DN2A 1F4AA 1HW7A 5ISLA 5EWSA 3DEMA 2HHHB 1QOOA 3OGCC 1HB1A 4LULA 2VQFO 3O1PA 5IVYA 5J09A 2IZWA 5DXDA 3DL3A 3RG0A 5FLHA 1JYCA 3K06A 3CRQA 1TE1B 1AJNA 1JX9A 3J7AU 2ZABA 1VLNA 3H50A 1W3XA 1VPHA 1JFFA 1Z5WA 1Q8OA 3C7GA 3ABUA 3EVKA 5BXZA 4M00A 2XLAA 2DDUA 1HQWA 2EX3A 3ZXLA 3AM2A 3VB9A 2R0HA 1UKGA 2HEPA 1HN1A 1NCQC 2HYKA 4CVUA 3MICA 3R4UA 4ARYA 5FPAA 4KMQA 4NE9A 3AZXA 1GM9A 3D3IA 5KXEA 3FB8C 1B35B 2RJKA 5BUVA 1OKQA 1SA0A 5LXTA 3RYIA 3Q4HA 3SDLA 4K1YA 1H1AA 1OI6A 4J9ZB 1H4HA 2ARXA 4GIQA 1GOHA 5IATA 1VIWB 5FPUA 2OUHA 2QKDA 4IQPA 2H0BA 1K5MA 2BFUL 3ZMNA 1BK1A 2YXSA 3VQWA 3H1YA 4MGKE 1JI6A 4LORA 3SHRA 2YROA 1QLEC 4JQRA 4HYOA 1O3RA 4WVZA 1A3KA 1HW5A 3TB0A 2A5ZA 2HWE1 4JTDB 4C91A 3ES1A 5B1AC 1STMA 2ILMA 1YJNV 1VBC3 3K57A 5JUVA 1XYPA 1TZOA 1APNA 3NKTA 1TNRA 2F1MA 3K4DA 1JOYA 2RR13 4PHZA 1L0NH 3ETGA 1V0AA 1XE8A 3G67A 4YGBA 1JA8A 3MDPA 4DV5B 1SEFA 2VS0A 4F8AA 1SBFA 3RYHA 1ASJ3 1G9AA 1W9SA 4IEPA 4MGYE 1AR83 2JDIG 2B1GA 1XQNA 3BU7A 4UFZA 3WX5A 4XJAA 1FMD3 4Y24A 1ZREA 3WP4A 5B66Z 1QXJA 1OPOA 1RL3A 4Q0PA 2YXLA 2RE9A 5FMCA 2XL7A 2JRIA 3Q8FA 1PIV2 2Y0PA 3U07A 2RR12 4YHHB 4CCLA 2G4IA 3LOIA 4ZY9A 1GZWA 3WDVA 1AR72 4AHYA 3ZMZA 4LA3A 4KH9A 1POQA 1J59A 1BKZA 4DZGA 1VRH3 1MVQA 3BABA 4FK5C 3F5TA 2FDFA 4D6TH 2BDRA 1TG7A 1R093 2AEYA 1K97A 3TNQA 3EQEA 4WBNB 5AVAA 5IK5A 4LO7A 5FY8A 3ETQA 1H1MA 4X1YA 3OJBA 1GOGA 3LF7A 5FY7A 3LDKA 5C8WA 1BHGA 3WUDA 2EIJC 3HT1A 4Z2WA 4MV2A 2ZX2A 4XEZA 3RI9A 1DQ5A 4KWLA 4HSJA 3O5SA 3ATGA 2XBO2 3OBZA 2UXBO 3A4UA 3MW4A 4QB2A 2UXXA 1AL0G 4PDWC 2HG5C 3NNLA 2XAFA 5FV3A 1W0NA 2NM1A 4KGGA 4FFKA 2DJVA 2ZXQA 2O8OA 3HQRA 1OOPB 4YPJA 1IPJA 2R043 2VZTA 1V9U1 5FK8A 3BYWA 2W08A 1EUTA 3VKFC 5LA6B 2Y6HA 5FYCA 5G05L 2WT2A 1BQZA 1K42A 1ZZBA 1RUD3 5KR7A 1HP8A 1K5JA 5F1RA 3N9QA 1UXZA 5DQ0A 4NHXA 1JZ2A 4TSFG 2NLRA 1G6NA 2XAGA 1ULGA 3DSQA 4IGGA 4B3NA 3W7UA 1V6NA 1J3PA 5A6YA 3M7AA 3N27A 1R082 2F4PA 1S55A 3WNOA 4Q20A 1O4TA 3E8HA 4GB32 4N43C 2D6PA 3J7MA 4XBLA 4LEJA 5L9BA 4DR3B 2YXYA 3H3UA 4P9WA 1XNDA 3E35A 5FBJA 1JZ6A 3HQXA 1EPZA 2QWOB 4AEDA 1EZJA 4Q29A 1RUD2 2ZS6B 3ABLB 4OUMA 4DV2B 1N47A 2JEUA 1YSCA 4ZU4A 2CU5A 2JE8A 3KWVA 3CDZB 4ZHQA 2B46X 4QU2A 3PJQA 1OC1A 2MNGA 1A8DA 1Z7S2 5A3MA 4YJ3A 5F3CA 3I2DA 3OD4A 4IHJB 3ZRXA 1QEXA 4OPAA 4YZ3A 3BCWA 4IEUA 2ZZJA 1UYYA 4F4LA 3CZJA 2OCCB 4BW5A 3IJ4A 3R66A 1NX9A 4DY5A 2VAUA 4GH4A 2WO3A 5CKMA 2EILB 2VGDA 2CWSA 1RC6A 1PVXA 2VCBA 2NLJC 3VBUA 2Q73A 3H01A 4Y1ZA 1A32A 4DR4O 3M70A 1PVC3 3I2OA 3IT8A 3ZX6A 5H9CA 1IQAA 4UF0A 1XRUA 4KWKA 5IY5B 3PIJA 5K8SA 3MIHA 2DURA 2E3CA 4CP2A 2B8MA 5M0TA 4QXKA 1RSOA 5GLVA 3WDWA 3F7YC 3Q8CA 2CDOA 2GC1A 2ZGRA 3VZLA 1AR91 2ZGSA 4QKNA 4A3XA 2A6VA 4CCMA 5GONB 1YDXA 1CIWA 1XE0A 4HLTA 3UKNA 4BLJA 4QM8A 2PHTA 5LEKA 3LWCA 3SPIA 2E31A 2V4VA 4GLXA 1QJY1 3ZXKA 1JJOA 2F6BA 4NRMA 2BPA2 1Y43B 1YC61 3VZKA 3FLRA 3L9JT 2WNUA 4XJUA 5CB7A 3U0ZA 1XNTA 2CYFA 2QQPA 4YNIA 2HWF1 1GYKA 4WM7C 3AK3A 4L92A 4CXWA 1Q7YW 2YEVB 1QMJA 3HN1A 2GMEA 4FFFA 1UXXX 4K20A 2ARHA 1FV2A 5IYBO 1KD7A 1WD3A 4QX7A 2WWWA 4R52A 5LA0A 1FPOA 2DVDA 2JB4A 2UUCB 3ZDVA 1R1A3 1VARA 2RS13 3K4ZA 1ZSPA 3VOUA 5CB4B 3ZFEB 5JJEB 4Q5OA 2AHZA 3LEGA 3WG1A 1OCOC 1CR7A 2WZR2 3VBOC 5EHDA 1BS3A 4LF9B 1QH7A 2PHLA 1BEV1 4L0PA 3JBG1 3S5QA 3R6SA 4NXNB 4I02A 2DCYA 3D5OA 5LHGA 4P9LA 5FYUA 4QQLA 1QU0A 1NAEA 1O3TA 2R0FA 1B35A 4PDRA 3N36A 2R061 3O0WA 3NQHA 2MPFA 2F4LA 2ZX4A 3LSUA 3W9AA 1UYPA 1VBE3 1PZ8A 1HQLA 4ZOLB 3PLQA 2Y6KA 1PX3A 4HZ3A 1G9FA 3CCJV 5J9PC 1WAZA 3I3MA 4BIZA 5B5EZ 4JYAB 1POV0 5EFUA 5J36A 5AC92 2VD7A 3C7FA 1AYM1 2P6HA 2Q0OC 1P84F 2PGGA 3ASOC 4CPBA 1PK6C 4Y5SA 1H2NA 3AMMA 4A45A 4Q4Y3 2W92A 2IXKA 4LTAA 1B06A 4IYHA 1K8AW 2HYXA 3D6EA 4B8EA 5D8AB 2BEOA 4LFBB 4NIAA 4DR5B 5IAVA 3LFIA 3OTOO 5CZKA 1IPSA 4LF6O 1XSRA 3NNJA 4CCNA 1DLLA 1V6JA 1QJZA 1UX7A 4JAVA 1UU6A 2Q68A 2B5HA 3JARB 3DV8A 1JHJA 1RHI3 5FZ3A 3SH4A 4XBQA 1IKPA 2VUAA 2HWD2 4PLOA 4XVHA 2HJDA 2W87A 1FJGB 1RUF3 2ZGOA 5F37A 5JDBA 3A2FA 3PDQA 1DF0A 2BWAA 2P4KA 1VQMV 2OTLV 3LIGA 4XJZA 1VALA 1WA4A 3BI3A 1V55B 1IHMA 3CHXA 1XE7A 2ZE6A 4DUYO 5DAQA 1OJHA 4GJZA 2PN5A 3CZUA 3CPWU 3T4HB 5FBZA 2J1RA 2EIGA 4RS5C 5SV5A 5T3NA 1N3OA 2F4VO 1RHI2 1EN4A 2A3QA 3V65A 5L7OC 2ZDIC 2YB7A 1DYPA 5F5CA 4COWA 1W59A 4FOVA 1Q81W 3W20A 5FWEA 3CO2A 1XUQA 3MD0A 2X0LA 5FZ8A 3SMHA 4JI6B 5IWAB 2PTMA 1O7FA 2QSAA 3BALA 4XJWA 4LWSB 2B9UA 5FY9A 3HJRA 2BOCC 5BMVB 2GSMB 2VXJA 5AG2A 1S0EA 4YFWA 4XF9A 1JHNA 3ZSKA 4S2HA 2QWRB 3JD1A 2Q7HA 4CXXA 2X6CA 2GH2A 1AL21 4CEYC 5C8CC 4JX0A 3ZO0B 1OOPA 1OH3A 3PJYA 3K75B 4B4QA 3SPGA 2XHNA 4C90A 4RN5A 1G1XB 5LA6A 1TMF1 4XUNA 4IERA 4JI5O 3SCHA 1D4M1 5EJ1B 4YXWG 5BNPC 1BBT2 3MFCA 1Y76B 1ODNA 1YXBA 1Q5OA 5KHGA 4LF4B 3BIEA 4MYEA 1JVMA 4OX9B 3H1LH 1GR3A 1N1YA 4PI2A 3S57A 3FB5C 4CEWB 2WAMA 4DEVA 4LBKA 2BQPA 1OLQA 2WUHA 1NLQA 2EAAA 2ZGPA 3RZGA 1GANA 1GOFA 1PV0A 1SRYA 1S0BA 3ZXDA 1WZXA 1DIWA 3AVRA 2PHDA 3B93A 4E4ZA 1Y66A 1URXA 4JI1B 4N7UA 5H9QA 3ZYJB 3BIWE 4E4DX 4MS2A 5FL7G 1JZ8A 2B4KA 2XAHA 1MS0A 1GU3A 1SZXA 2XWBB 5JXJA 3SJCC 4NROA 3ZYBA 2YUEA 2GUZB 3IIAA 1SQBH 1FNYA 3WXPA 3PIGA 5C4WB 1EFRG 2VZ3A 4DV0B 2FZ1A 3ICXA 3ZN4A 4FAHA 4XHXA 2JJ1G 4IHJA 2PUSA 3DN7A 3OMAB 3U78A 4ZBMA 3KVAA 1HXS2 3BN6A 4QGMA 1VQ8V 1RUOA 4U3FH 1NTKH 1WA6X 1NVPB 4JYYA 2ZM6B 4Z2AA 1S76D 3NNMA 5FLXN 5L3GA 1D5NA 5FLIA 2ARCA 3PMSA 3QD6A 1ULDA 3WNMA 1PO22 1WCSA 1X7NA 2GU9A 2XVKA 1Q8QA 4EE2A 3E89A 4M3CA 2PQSA 3IM0A 4QKBA 2BTQB 3ORJA 2JG9C 3OBAA 4MOAA 5J37A 1DGSA 2DCZA 4WFBV 1UMIA 2WT1A 1VBD1 3OM3B 3SXWA 1OUXA 1YIFA 1SCSA 1YIJV 4EWEA 1KKCA 5GONA 4LJHA 2CAZC 2VBDA 3MZHA 4P9JA 2N7GA 1PGSA 3CP1A 1IBMB 1EV11 2VVFA 2YU1A 2ZCEA 3OGVA 3RBZA 1ZZ8A 2DWDC 3B9IA 1XNAA 5KLVH 3OUHA 4WM8A 3H1WA 2E32A 1CAUB 3NAPC 4HFSA 2A06H 1U5ZA 2TUNA 4Q2FA 3QCWA 2E7AA 2WNVB 4QGLA 4F6RB 2YEVA 3NRUA 2QGNA 5LMUO 1I7FA 2PYJA 1CAWB 1NY71 4V2WA 2OT5A 4P9GA 2YGMA 5FZDA 3KMHA 5FZ7A 4AHCA 4YWAA 2Q30A 3EMRA 4PT6A 2FMLA 2CWMA 4U7OA 5FFOC 1QVFU 5ERLA 4XTPA 5CB4A 3ZFEA 4AQYO 4MTXA 3JD73 5FYMA 5IYZB 3FFZA 3GNEA 3CRMA 4OCTA 3NR7A 4K3UA 3AC0A 4BZ4A 1VBB3 1AX2A 5K9YA 1FATA 3AEIA 2OIGA 1AJKA 4M3CF 2ZQMA 3ZXAC 4CDWC 1O91A 1CPYA 1VR3A 3MIDA 2AGAA 4DUZB 2CAUA 1XYOA 2PLV3 3KZIZ 3POEA 1DLBA 5ITZB 3OGSA 3T2MA 1JUHA 4DO2A 2Z2SB 1ZRCA 3R4SA 3M7MX 3JD72 4JDOA 4ZOLA 2YPJA 4J7ZA 5A1AA 4MGZE 2OKXA 1CZTA 4R9BA 1NYWA 4GULA 4Q4X1 4PDVA 4UFKA 2JDMA 4OFGA 2EALA 3POJA 1YFUA 2OT7A 2Q69A 1W04A 4Q0UA 4QXHA 4H33A 4QPIC 2AZ5A 3NV3A 4B3SO 2CSGA 2WQ8A 4KXRA 2AEZA 3MW2A 5ABJB 3S3WA 3ZN1A 3AZYA 2JS5A 2WLJA 4IV1B 1J1TA 3WP5A 1QJX3 3VGIA 3IMMA 2ZA9A 4ZU7A 4OZXA 4J42A 4X64B 3K51A 2H8PC 2Y8KA 2ZZQA 3BY6A 4UCTA 3T4VA 3IAQA 5EV7A 1MZEA 2HR3A 4PQQA 1QNYA 4Z1VA 1CZVA 3QVNA 2P5OA 1OLME 2RS32 1GZ9A 3JARA 1W8TA 2PXJA 2VXRA 1NLRA 2AYHA 1U5XA 1OA2A 4NR1A 4HPKB 3K59A 4LBMA 4N53A 4FOQA 3A0BZ 2GNBA 3I2FA 3K2OA 1QJX2 3AKPA 5FP9A 1VB2A 3OY8B 2V4DA 4Y3OA 2UXDO 4QPGC 2OYZA 3KKYA 4IEXA 2WN2A 3UQ8A 4A2UA 2P2KA 2ZGUA 3NKGA 2Q5TA 2XUEA 1NCQB 1FS0G 2H3OA 1IZ3A 1Y7BA 2W0XA 1BVP1 3W7TA 1AI5A 1LU2A 1SPPB 1K92A 2GC3A 2FZ2A 3NJZA 1P49A 4AYUA 2UY8A 3A23A 4HT1T 4IV3B 3HR9A 5FZ9A 1EBOA 2WFF3 1NQJA 3R65A 1FXKC 4GMP3 2NNUA 5H9PA 4GALA 5H6QA 4YVSC 3ASNC 3E5QA 2BOIA 5BMVA 1UNBA 4LXLA 3C3TA 2HWC1 4QAWA 1DK1A 3UJOA 3GGLA 2P3JA 1YTFD 3HEIA 3M3IA 5T5LA 1AB3A 1SLAA 2C9AA 1FFXB 4BW9A 4E9KA 2F95B 3L74H 1GKFA 1GNYA 1AR62 2R071 1Y9MA 3UGFA 1AXKA 2DYCA 3N9MA 5FPBA 1IS6A 1S2BA 2WFF2 4ASKA 5F2WA 2CY6A 4RYDA 3OGJA 4B4PA 1TME1 2ARBA 1Y76A 3VHRA 3WCSA 1H2MA 2ET1A 4TWKA 4LF5B 5LYJB 3LEKA 4COUA 1G4YB 1WW6A 4CEWA 4UCOA 1H8TA 4ORFA 3PUAA 1N0NA 1MACA 1AR93 4E2SA 2V5YA 1I94O 3POFA 2W94A 3SCFA 1E57A 3OGIB 3L71H 1X59A 5C3RA 1KECA 4IXLA 3JUUA 5BPXA 1GQHA 2DUPA 1QJY3 4QQ2A 3SR2C 3KD4A 4DQAA 1AP6A 4IETA 5JOXA 3WF2A 3K3WA 2DBNA 1QHTA 2J42A 2GUZA 1HLCA 1T5EA 3AKSA 5EBLC 3G71V 3BCCH 2AR6A 5C4WA 1EAH1 4L9BA 1N32O 2OPWA 1OKOA 4CP9A 4AI8A 4XUTA 3CMAV 2AACA 1JU3A 4N21A 4B4RA 5JPNB 5F3EA 1YFWA 1KP2A 1C5IA 2MW2B 3DXRB 4OHZA 5B1NA 4DR2B 3E8GA 2V72A 3LZZA 1VBA1 4LO5B 3HBKA 1OZ0A 4QQHA 4X65O 5CFCC 5J1XA 4FPCA 5LL6Y 3ACIA 5LBBA 3K08A 1BVVA 1ULFA 2GDSA 3OT7A 1YFYA 1NH2D 4DFSA 3VBHC 4YJ2B 4PDWB 4WV8A 3IFXA 5LATA 4FO9A 4JI3O 2CV6A 4CU7A 3HMYA 4TV9B 1BEV3 3D3QA 1CJDA 4I2OA 3BA8A 4HANA 4FZ0A 2WS92 3AMHA 2BTQA 2ZX3A 1Z5VA 2KA3A 4GQ7A 2Y6FA 3LPGA 1XL4A 1M4WA 4WCEV 3ZXGA 1L7QA 3J81N 3MPBA 4LKEA 3BPZA 4GKJO 3USUB 4AE2A 3WQ1A 5IDJA 1HRI3 3POIA 5F6KA 4HL0A 4NHLA 3JASA 3RWNA 1RVF3 4Y33A 3UK9A 2X09A 3TN91 3LEMA 2QKCA 5CVRA 1NBMG 5KX5B 3M4FA 2Y33A 4S2FA 1AYM3 2EA7A 5DAXA 1QLNA 3WHTA 1GP5A 3ACGA 1CAUA 3HPLC 3LA7A 1W8ZA 5IWFA 2HLEA 3MLLA 2WNVA 4F6RA 4IE0A 2BVBA 4P14A 1LOAA 4X8PA 4AL9A 1HRI2 1CAWA 1DGRA 2HKXA 2XUMA 2JD9A 4BMEA 4UW4A 1AJOA 2Y38A 1FKAO 3VZJA 2K1EA 1PHMA 2FYUH 4XUOA 4IESA 4J7KA 2P5BA 2ZGNA 2WINB 5L73A 3OG2A 1L8DA 5IYZA 2RVAA 4YW6A 4IEVA 3K3NA 1UY3A 1MS1A 4Y5Z0 3E83A 2BNMA 1LOFC 2Q8CA 5A80A 3WDTA 2ZR2A 1M90W 1ZZ7A 2ZGLA 3PUSA 4KBZA 1YCIA 3T30A 2Y6LA 1ZA4A 4HETA 5ITZA 2WSVA 2EBOA 3WT3A 5FP3A 5CU1A 4QX5A 4LQRA 1ZLZA 3UO3A 1LGNA 5C5TA 1GLHA 3G7DA 1OF3A 1FXVA 3ZMUA 1QJU3 3WNXA 1W9TA 2QDRA 1KITA 1HNZO 4E4HA 4DXZA 4UUJC 4INDA 4JRAA 5C9AB 5JPMB 2Q8DA 1W2AX 1JXNA 3NV2A 4K8RB 4AEJA 3K9AA 2BTOA 4MVSA 2FDKA 5FP4A 5F32A 4IV1A 1UOGA 1NR7A 4MVZA 1R6NA 1OCCC 3KT7A 2Q1MA 1OT5A 5IUQA 1R3LC 2FDJA 3M3CA 5EBMC 3A0KA 3HQUA 4WM7B 2OS2A 1XHXA 1IG3A 2E53A 4R6ZA 1VAKA 2ZAHA 3MGUA 3MF9A 5DDJ2 1E5HA 5GZEA 2PQQA 1RUI1 1AYN2 1QJU2 5LY2A 2VNOA 3I54A 4LIVA 2ZGMA 3J7LA 1BQ0A 5LGTA 4WFEA 3RWRD 3SEEA 5FJHA 4XMAA 2VWJA 4LFCO 4CCCA 3SGIA 2BSKB 2ZXWC 4HPKA 1LOGA 4LR3A 1YQ5A 1ZUQA 3NO8A 2AUYA 3AK0A 4AHZA 3OY8A 3BUCA 1JR9A 2WAOA 3QO5A 3KCXA 1OCOB 1FXHA 3VBOB 1SBDA 1OCZC 2EIEA 4GJYA 4MG2A 2QE3A 3WF1A 4CZZA 3K79A 1VMHA 1FX5A 1NCQA 3NMBA 1QBZA 4XF4A 5J2UB 2ZMNA 3WG7C 4TN7A 1YI9A 1HV1A 2DYSC 4ZKIA 4UCSA 1LHVA 3PN1A 2VQEB 4JKLA 3CSXA 4LF6B 4IV3A 4UCVA 5BV6A 2HHHO 1W8HA 2LP7A 4CE8A 2QZ3A 3USSA 4M0HA 3ML0A 1OUSA 1AUYA 4PD4F 2BGPA 3RJ2X 4YGCA 2JDHA 5BNNB 3WHUA 2JB8A 1JYIA 2XJVA 3ASOB 2QQUA 2EXKA 1FFXA 1XBLA 2D3OW 3LDBA 1N3QA 1XNRB 2JG8C 4DXRA 2EXJA 4JYCA 2HVKC 2EIMC 3CC2V 4D6RA 3K46A 3BTAA 1W3VA 5TISZ 3AMQA 4W4KA 1LENA 3OW2U 1D0GA 2F4VB 5IVEA 4NPLA 5JZGB 2IJJA 1RMU1 2Y6JA 1WW7A 1UZVA 2NP0A 2KG7B 3AB0A 3POSA 1VBD3 4PCRA 3WG4A 3U4SA 3NSTA 2O0OA 4BM8A 1LOEA 1G9CA 2XWJB 4ZIBA 5HCAA 1QQP1 3D82A 3M3QA 5D5QA 4IUGA 2RMKB 5CKQA 3VKLA 5LHIA 4NOTA 3FFQA 1UPSA 3VDCA 2BP6A 2Y0OA 1OURA 2PAKA 1P8JA 3CMEV 1C5HA 2PAEA 1I5ZA 1C8M3 3I2GA 1RUE3 2TNFA 3WCRA 4WFAV 1UY0A 4I30A 1DGWX 4RS5B 3IPVB 4TXWA 3CE2A 1F8VA 1XMOB 3WVJA 4KWJA 1U5IA 3OF1A 3SJBC 4DV5O 3AFKA 4BQYA 4AOCA 2VPVA 1WJZA 3DXRA 1FAFA 1FV3A 1IS4A 3UT0A 4MGIE 1XHZA 4A7ZA 4LHKA 2EINC 1C8M2 5FZEA 5I0SA 2G9GA 2PAMA 3GBWA 1CQ9A 2HLDG 2Z5UA 2UXNA 1L1FA 2WLHA 1UOJA 1UMHA 2UU9B 1JYTA 4YJ2A 2W0FC 4YHHO 2ZBJA 4PDWA 4ATEA 5CNAA 4LR4A 2ARAA 4FPOB 4P2ZA 5K1PA 4TV9A 5T50A 1LJ7A 3MDSA 1PGL2 3TAYA 1MQTC 2BYVE 3H8UA 1QQCA 3JD2A 4MTGA 2Y4UA 4MO3M 5GZCA 5EJ3A 1F7YA 1XU1A 3T2PA 2HFEC 4HK8A 1SG3A 2D44A 1DBNA 4EYUA 1AI4A 3PJSK 3ZN6B 4RUFA 4EN0A 1CX4A 4UFIA 3AP6A 3ME2A 3USUA 1J83A 3GCXA 1COV3 2FHRA 4ZPIA 2GSYA 5FAXA 2X29A 3PTRB 2KSDA 4RL7A 4CXYA 4Q4X3 1ZTEA 3N7JA 2G1MA 1YJKA 1RP3B 2XT9A 4JDMA 5H6RA 5FPVA 4AQTA 1O9HA 4CZSA 3SITA 4AGVA 4FPGA 1IXMA 2W3JA 3CRAA 1UPGA 2BOJA 3OSDA 4PIZA 1XREA 3TRSB 2WA3A 2OW4A 2P3YA 4BLIA 2ITDC 2X5IC 2DCKA 4QDSA 1RUG3 2A7AA 2L9LA 3CMGA 5FY1A 2NN4A 1W03A 2QVSB 1AF9A 1BJQA 2DVFA 3QH7A 2D6LX 1CZSA 1ENQA 3CEIA 1SQPH 2CTWA 1EZVH 4KNCA 5B3SC 1CVNA 4X9QA 3NJXA 1JN2P 4BQ3A 1Q8PA 4UV9A 1S1AA 2E5LB 1OHFA 1G9BA 4YW3A 2W91A 1BCXA 3FLPA 1MS5A 1AZDA 3RYRA 2D3RA 4IT5A 2A79B 4E2LA 3P32A 3H42B 1RUG2 3ZHQA 3WFVA 2PA7A 4DV1B 4FFHA 1YTFB 4UW5A 2QJVA 2V1DA 3B8MA 1BYHA 1VBC1 1V6LA 4FAGA 1G8MA 5CFDC 1DQ4A 3I4IA 1QF3A 4PLMA 2IXJA 2RR11 2VQUA 2IM9A 5GZGA 2DOSA 2HEYF 5FYYA 2JG9B 3WNLA 4XAEA 5FO7B 4MSWC 1M5IA 1ASJ1 3MBWA 1AR81 1GN3A 2ENRA 1C1FA 4LBLA 2NMNA 2DFCA 2XNDG 1FMD1 1ULEA 4ZONA 4CS3A 2WT0A 5A7NA 1YI7A 2DV9A 4NUBA 4W4LA 4PF5A 3AK2A 2W5FA 2KXLA 1E5SA 3IDCB 4X62B 1SLLA 1AX1A 5IVBA 1ULPA 2A3WA 4K9SA 4QHBA 3NAPB 4ES9A 1PM9A 4WM7A 4AI1A 1BQPA 1Q90D 1I9RA 2HWE2 3EO6A 1VRH1 3RGBA 4MVQA 3VN4A 4LUMA 1BK0A 2XVLA 5GTHZ 1R091 3GF6A 2I2SA 2RDRA 2EJ7A 4QE9A 5KHHA 4O4IB 4AGGA 2IXHA 4BQ4A 3WF0A 3IN9A 3CCUV 2BSKA 4I0BA 5E1RA 5JXIA 1J84A 3DPRB 1WCQA 1SDWA 4PA4A 2W6JG 1MS8A 1N0JA 2R6QA 4J10A 1E5RA 3VBOA 2WQ4A 4E2GA 4NO4A 3VKOA 4DK1A 3J80N 3W59A 4A6OA 4HVRA 4MGSA 4B3SB 4NIHA 5EYYA 3OMNB 2XXZA 5LA1A 5DG1A 4CDWB 4FP2A 2D98A 2RQ6A 5GLUA 1VE0A 1FT9A 1M9NA 2Q67A 5DPNA 2GZWA 2ZTNA 5GW7A 1IG0A 2R041 2RMU2 4GB31 4UV8A 5IVVA 4GX0A 3PVEA 4DR7B 1QNWA 1YQCA 4H0LB 3VQXA 4HN0A 1R64A 2WQZC 4CUGA 1RUD1 5L9VA 4FPFA 3WU2Z 4MVRA 3RVHA 3CC7V 3PUIA 3AKRA 1BGYH 4BDVB 4RSUA 1CD3G 4AQ6A 1UD1A 4WVWA 5BNNA 4QPIB 5CA1B 1ZZ9A 3B94A 1PK6A 2QBXA 4X88A 3N7MA 1SESA 1GZTA 4P9PA 4LF9O 4E8CA 1QXRA 5FPOA 5F5IA 4ARXA 1DP0A 4Y4YA 5B4NA 2XDVA 3RZZA 3E6CC 3QNEA 4EFBA 1DGLA 4UVAA 4RQFA 3AYDA 5EP9A 5JWPA 1ND2B 4EZHA 5JZGA 4AVVA 2KG7A 4Q4W3 3T2QA 4DUXA 4W6YA 5BZBA 3ETDA 5JOZA 1V9U2 1AJPA 1L7RA 1LODA 2A6YA 3ZFFC 1GRJA 1ULCA 5EXOA 3W5NA 5IJ9B 1AR1B 2DFBA 4H13B 2XTAA 3C3VA 4CS2A 2BWCA 1X33A 4H7MA 4RQPC 3POWA 2EULA 3A0RA 4I0XA 5KHJA 1NJIW 4CTEA 4KU8A 1NU1H 2ZGTA 3FJSA 2DUOA 4Q4W2 3CCMV 4RS5A 3IPVA 1PVC1 5DZFA 5FO8B 3CCEV 2QQMA 1OHHG 5L7OA 2VULA 2ZDIA 1HIXA 3ZYIB 2XJSA 3WEZA 5I0DA 5JCTA 5FR3A 3ZXEA 4LFBO 1UZWA 4UCRA 1M56C 4DR5O 5T52A 2PHXA 4URTA 4NTWA 3ECQA 3L75H 2X10A 2JGDB 4R7CA 4E4EA 3LSSA 1FXKB 1ODMA 4I0WB 2Y6GA 2GBOA 5JIAA 4YVSB 4CS4A 3ASNB 1FPN3 4GAZA 1BMFG 2C2AA 5LB6A 1XMQB 4Q8KA 1O5LA 5DABA 3G4SV 1CPNA 1UU4A 2LROA 3N2KB 1HDKA 1IPKA 3AL6A 1OA4A 4CEYA 1HKDA 2JE9A 1BMV1 3AG1C 2OXBA 5LK7B 3LQCA 1VB4A 4NN0A 3O1VA 2OIIA 1V6IA 4AQSA 2O1QA 3ETPA 1IKQA 2Q9LA 4CU8A 1QKQA 4A3ZA 1FPN2 4GX2A 5KUMA 3ZN6A 1LNSA 1VAMA 2HWB3 4FPKA 5FNVA 5FZKA 2HH9A 5IE9A 2V4AA 3BEHA 5L3CA 1FYJA 2FB5A 5A3TA 4ISQA 1L0LH 5D5PA 2R70A 4JI6O 1R1A1 5IWAO 3ENRA 4J80A 4SLIA 3K0DA 4UFJA 2RS11 4TOIA 2ZGKA 3TEXA 1ZRRA 4LNUB 5L19A 5FQ0A 3UL2A 3N9LA 2UXCO 2JDAA 2HWB2 3LKJA 3NJYA 3FC0A 5J98B 2Q7EA 3OPTA 4XXAA 1QXPA 2ID4A 1A8MA 1GQGA 5LCWL 4JAAA 5LGUA 4BK5A 5KUKA 3CS5A 1PZ7A 5KAFZ 1VBE1 2OA2A 3DF0A 4LF4O 3BOWA 2FCVA 2C24A 5FUNA 4OX9O 1UAIA 2WBKA 4OI4A 1ZBE2 1AXZA 2W52A 2WN3A 1YFXA 4K8FA 1NXD1 5DEDA 5CFCB 2PI4A 3KS7A 2VO5A 2ZE5A 4JV5B 2WO7A 5B4XA 1JQ0A 1Q6HA 4R8CA 3EHKA 2Y64A 1S72V 4PBOA 1CX1A 4HK9A 2CTPA 5JJJB 3VBSC 1EY2A 2LFSA 3I2IA 5CA6A 1ZBA3 2JG9A 3JBG2 3LEIA 4YW5A 2AC1A 2O14A 3CCVV 2WNOA 2RS53 4FP3A 3KT4A 4Y1VA 4DV0O 1JTZX 4YY3B 2XKPA 4TLGA 4GCZA 1XPWA 1Q56A 3B9CA 3RZKA 4F6EA 1RHI1 5J96B 2R062 4UB8Z 1F2NA 1W2UA 4YM0A 2XJRA 4KG8A 4UWDA 2DYRC 1RUF1 4DK0A 5FKCA 2OCHA 3EBRA 4AVSA 1RINA 1WW5A 3F5WC 1REEA 4UXNA 1UZ0A 5BNQA 1X36A 1DZTA 1J3QA 5CA3A 2ZM6O 3H8RA 3CC4V 2VTXA 4CCJA 5C3PA 1WB8A 1E1QG 5EZYB 5LBQA 3NAPA 5F2SA 1OD3A 3E5XA 1F9KA 2EZOA 1P4RA 5FRAA 4A5UB 3K77A 3CX5F 5K4LA 4LHSA 4AEDB 3KGLA 3OAAG 4O4IA 1W8OA 1IBKB 3ZRSA 2J1AA 3KT1A 1U96A 4KG0A 1SQ4A 2VU9A 1RUJ3 1RUC3 1MEC3 2YBPA 4PBPA 1DG6A 4XC9A 3J9SA 1D2SA 4PIXA 1W6PA 3T4ZA 1B09A 4OUSA 1BBT1 2HP8A 3B69A 4BQWA 1V70A 5JMOA 2K0GA 3WDXA 3J7NA 1S5HC 2D6OX 5DUVA 3I2KA 1NXMA 1IS3A 4CDWA 4DV6O 3OUSA 2VW1A 1K5QA 3T1YO 2YFUA 4P08A 4MTOA 2J1UA 2XHKA 4EQVA 4ZI7B 2YFZA 3OMIB 3DYMA 3AZZA 1U12A 3IGAC 2CTQA 1PM7A 3E8BA 4QXBA 4CCOA 3ZOIA 1GM7A 4AFMA 2AW9A 4XXPA 2JE7A 2TEPA 3DCQA 4OVEA 1GP4A 4LFCB 2L6LA 1GKBA 1PL0A 1W2BU 3WQ0A 4QPIA 5CA1A 4TV8B 2WNUC 4ITCA 2A73B 1LECA 2B9ZA 4DEQA 1QOSA 3WOGA 1OCCB 2J1TA 4BK4A 5JCOC 3CXHF 1DQ1A 4MXVA 2P4EA 1QJFA 4BU2A 4DRXB 1LHWA 3JSNA 3LNNA 5LRRA 3X2QC 4QGNA 1ND2A 3P1IA 1AL22 1VQ4V 1YNAA 4DUZO 3ZYPA 5AFBA 3UGHA 4FSJA 2IJHA 1H0BA 4NIDA 4FOWA 1GWMA 2R72A 3VQVA 5A6ZA 3AYEA 3FAVB 1T6GC 2ZXWB 1Z2GA 1PO12 1D4M2 2WZ8A 3HBZA 5IJ9A 1XEQA 1OXCA 1I1EA 5A7SA 1H2KA 4LT5A 4XUQA 4N23A 2GTSA 4L8JA 4DYLA 4AW7A 1R73A 2H6BA 2VUJA 4LUKA 5LY1A 4BXFA 1OCZB 3ACFA 3DYPA 4X1KB 4QJFB 3N9PA 1CJPA 5IVJA 2WYFA 3OD0A 3IB3A 4DW1A 4OQ9A 3WG7B 5KA6A 3JCIA 4M4RA 1HWYA 4X64O 3WW3A 5BNOB 3FBMA 4L97A 1G8WA 2DYSB 3M1HA 3ABMB 2JGDA 1IURA 4LO4B 1FXKA 3SYOA 2XONA 4FVMA 3T0AA 4YVSA 4F7ZA 5EZWA 4UOJA 5C93A 3HKCB 3ZMSA 3UKVA 1YQ8A 4DIQA 3N2KA 3K48A 1D7PM 4IW3A 1RJ8A 3SH3A 2VNRA 4JI8B 4Y4RA 4JGZC 2JG8B 2D6NA 4RGAA 3K5LA 1JOJA 1JOPA 2N04A 4O7XA 4XURA 4FPEA 5C3QA 2Y4TA 3TJTA 3BPSA 3L70H 1PIV3 2YGLA 2GC0A 4MHUA 2NR5A 4EZ4A 3VBBA 1AR5A 3P3NA 1VQ7V 3MIGA 4QD2A 1AR73 1F23A 1AR4A 1JW6A 4QXCA 1I3HA 1X9TA 4D0QA 3A21A 4ZHNA 1CAVA 4XCBA 4Z92B 3W7WA 3VBFC 3JD71 3TEYA 4J1WA 4XYXA 1KJLA 3P6BA 2DN9A 4AR2A 1ZX3A 4LNUA 4XCAA 4MTFA 1VBB1 4HNAB 4RFRB 1EV12 2R1DA 2LRPA 3GYDA 1NA1C 1F51A 1HV0A 4J25A 2KQXA 5EYPA 3CEWA 1JJ2U 1GFF2 3OYWB 1RIRA 1DZRA 1RITA 4FM1A 1JZ7A 4OGQB 3THCA 2A9HA 2PLV1 3HT2A 4FLUA 3BVCA 5LW9A 2CDYA 3IAPA 1HR0O 3Q9OA 4LA2A 2XBO3 4P9IA 2VCMA 5KXDA 4FCAA 3B3QE 2WLNA 2P3KA 5DZEA 4LF5O 3JSLA 4MADA 3GBFA 3G6EV 4NWVA 3G6BA 3JQXA 1NY72 2YIBD 4B08A 2XPJA 1MR5A 4JTAB 2EINB 3WP3A 5CFCA 2VY0A 3SKVA 3FWEA 5J48A 1QR9A 2QQLA 1C1LA 2IJKA 1PP9H 3L72H 1W9YA 3ZN0A 3VBHA 1K45A 1WKYA 5A1LA 5D2AA 2GNTA 3BFRA 1YLLA 3FX3A 1FFTB 5CADA 3E8FA 1QJX1 3EHBB 2C6SA 2BCCH 3I97A 3ZXFA 3HNYM 4ZXKA 2FCTA 4QX8A 3JD3A 4HXCA 5E1AC 1R083 2MHFA 2ITCC 1F15A 1DGWA 2OPKA 4GB33 4K0KO 2AGSA 2OYQA 3O1SA 5LMNO 4UBHA 4PELA 3V0BB 3V0AB 1Q8SA 4L87A 2W1QA 5HV0A 4LO6B 4KU7A 2JVDA 3SYQA 1GN2A 3ETEA 3OBTA 2GP5A 4DR2O 3ABLC 1GWKA 4OMCA 3FB7C 2KR2A 1A78A 1S77D 2XJUA 2GNMA 1FXZA 1VQOV 5E6HA 4QX3A 5EZYA 3QLQA 1Z7S3 2UWAA 1XC6A 4BISA 3BA9A 5IT9N 3VZMA 2LW1A 4I4TB 3SPHA 5FPLA 1ALYA 3ZYHA 4A4AA 3MUY1 5B3SB 2OIEA 2OCCC 5FY5A 3B09A 3KCYA 3T1HB 4YZ5A 1S2EA 3GHMA 5KC5A 1LCLA 1VF7A 2WFF1 4LKFA 1Q43A 5LP6C 5HPOA 2Q4SA 4GMP1 2QQNA 1VQNV 4ASMB 4ZKTB 4DXWA 3C7OA 1NZIA 3VKNA 1W06A 1LOFA 1WNSA 4JKKA 4NHMA 3RYFB 5IYCO 1QNMA 2EAKA 1URFA 2W47A 1NQTA 5BXXA 1ND3C 4NTYA 2WABA 5APAA 1WCDJ 5CFDB 1LRHA 5FZCA 1L3JA 4RR3C 1K9MW 2HBUA 5T55A 2Y34A 4ZI7A 2MEV2 5FYIA 1OCRC 4O4LB 3V64A 3VHPA 2VZUA 4M01A 1C8NA 4JGYB 4M3CB 1B3QA 3T08A 2RM23 3ZMTA 4TV8A 1ULOA 1DLCA 2VNVA 2J22A 1PNMA 2IW5A 1XSQA 4CDUC 2ADEA 4YIPA 1LESA 2IFWA 4AG4A 5LWBA 5A3NA 1SCRA 1SQQH 2R16A 4BIOA 2RJZA 1ORQC 1RUH2 1RXFA 1HDJA 2HWC2 1O4ZA 4X8NA 2YBSA 3ZHVA 2EIBA 4DRXA 4LITA 1LOCA 4WM8B 3THDA 2P90A 4BOWA 3KV5A 3ZYGA 1ENRA 4Q27A 1PNFA 2RM22 2D97A 2R072 2WZR3 3HN3A 1ZM1A 2ZPXA 5JVVA 1VIBA 3FAVA 5LGNA 4BPZA 4OI0A 4UW6A 1TA8A 1CONA 2WS91 3E6BA 4W4ZA 4LC1A 2GHYA 3FHIB 4TWTA 3U37A 1D5AA 3AG2C 4X1KA 3ZJZA 2IH3C 1NT0A 3ZRVA 1PM4A 3ZFGC 4BWAA 3LA3A 5I8TA 5B1BC 4Q1RA 1OF4A 1Q82W 1NI8A 4JI2O 1EPWA 4OHYA 5AC93 3OEHG 5BNOA 3MHZA 1OPMA 1C28A 4DPNA 1Z0HA 5F3IA 3CLPA 1J58A 3WQ7A 3KQ4B 4MUVA 2Q5ZA 4EB6B 5AVPA 4NAOA 1R3KC 2JICA 3S6PA 2MK3A 5JVDB 2VZQA 5FZGA 4A7YA 2AXTZ 5FZHA 3OEEG 1EAH2 2BU9A 2LS6A 2W95A 4B7EA 2DTWA 4B1MA 2FTKA 2J7MA 2BFUS 2ES3A 1HRI1 5T5PA 4I3GA 4JZ2A 5FZBA 3K03A 3OOXA 4A44A 5C8YA 3HKCA 3NVCA 2ZOEB 5I93A 4FLXA 5JAXA 2LUWA 4I55B 5JH7A 1RVF1 4H7LA 2LM3A 3SJAC 4G3YC 5D8AC 1Q6IA 5FZLA 4RWUA 2WLIB 2P06A 3P30A 2JG8A 1UW8A 1DCSA 1OSGA 1WLTA 4QE7A 1LHOA 1WWYA 2HWD3 3GDBA 5FMOL 5HCFA 5E16A 4Y1YA 4EJRA 2Q8VA 1UKRA 4LHLA 1WA8B 4DR1B 1SC5B 4MVUA 4P02B 1OQDA 1J1LA 4OZOA 3QO7A 3HPNA 1YJLA 1W6OB 4BA6A 2PZSA 5C3OA 3HKEB 5L36A 3AP9A 1MVEA 4Y5TA 2W9XA 2VQEO 5FZ4A 4XFHA 2XJPA 4DRVA 1OV9A 3ZKUA 4L2NA 3ZFFB 1TVKB 4DB5A 1QWRA 2LFRA 3RVZA 4OI1A 1V55C 3W21A 4GKXA 2ZACA 3WW1A 3PUHA 3RZHA 4E8DA 3IDBB 3KF5A 4FQ4A 3WDYA 1CAXA 1O3QA 2WLKA 1UIJA 1W0JG 3CB2A 4RQPB 4J7JA 2WLQA 4DO0A 3KHBA 1O8PA 4BAYA 4N53B 2EVXA 3M8LA 1YEWA 4HNAA 3APQA 2E26A 1LNQA 3UETA 4K8XA 3TN92 4YW4A 5F5QA 5A1FA 1XNRO 5JR7B 1I0HA 2PHFA 3OYWA 2RN9A 2EIDA 2XG3A 3MAQA 5FYHA 1ZZ6A 3NXSA 4LLFA 1AROP 1KEXA 3J7HA 1NQDA 4AI0A 3I49A 4MZUA 1DTOA 1AYN1 1QJU1 3RI8A 3BKZA 1I6XA 2A6ZA 2HEWF 5GM0A 3ZIAG 4W8JA 3EXAA 1BBT3 2VVDA 2P22C 4LH7A 3WG3A 1F4HA 5T54A 3KLSA 4MVMA 2VTXJ 3LDDA 1ST8A 3AG1B 2ADQB 4UW3A 4AI3A 4QM9A 2YDEA 2QWNB 2UXCB 1BHAA 1QDOA 1S2KA 4RHV3 4J11A 2R9AA 3KQRA 1V54C 2Z3YA 1OD5A 1F5FA 2RNBA 4X6QB 3WDUA 3TYJA 5C6CA 1XMOO 2X53S 5FCCA 4FM0A 4Z07A 2R1BA 4WVMA 4AK3A 1HB3A 3V0BA 3EYPA 1SMVA 3FN9A 5CA0B 3V0AA 1X8EA 2P17A 4XFBA 1BXHA 2LO1A 1Q86W 5IW0A 3TGUH 3FKSG 1GNHA 1WCKA 1H8TB 4LBOA 4PA7A 1IDSA 3CWBH 4NIGA 1TQ5A 4RHV2 4NB5A 5B1OA 1K3EA 4GKYA 2X5IA 2UU9O 1AI6A 4I4TA 3N9OA 1UPIA 3ROUA 3CF6E 1HXS3 2CGPA 1G86A 3IWZA 4YW1A 3GZUC 1XQ8A 1JPXA 5GZFA 2Z4FA 1H9PA 3WV6A 5F5AA 1JS9A 1H8HG 2XAJA 4CBCA 4DW0A 2QQIA 5IJ0A 2FQPA 1PO23 4JHTA 3BTYA 3CIHA 1RUI2 4ONUA 4CP9B 1JZ3A 4JI4B 4B3MB 4I5SA 3G6JB 4CC6A 2A3YA 4NXMB 3RYFA 4Q26A 1QU7A 4JPRA 2XHBA 1LKNA 3WW2A 4O2AB 1W28A 3LDRA 3ST7A 4LOTA 1ENSA 5CFDA 3VBSB 1WN7A 3IC9A 5A3OA 1U0AA 2VTFA 3VDAA 3HVDA 5H5NA 5JJNB 4CUCA 2QM4A 4K40A 1VAVA 1A6CA 4O4LA 3MFAA 5ACA2 5FUPA 4JGYA 2YIAA 3WB2A 2D6KA 3SNMA 3IDEA 3S7EA 4CH3A 2E5LO 1CPMA 1K5SA 1DHKB 1FOD3 4LK7A 1WMFA 3AFGA 4I50B 3LNMB 1KUQA 1N1SA 3D0JA 3JXSA 4R9DA 4IGOA 1UCXA 3K0GA 4QHOA 3JASB 4EN6B 3AP4A 3W7XA 5HI0A 5IVCA 3I55V 2WR9A 5E89A 4DV1O 1C8M1 1RUE1 3T09A 2QWPB 2VMEA 3L73H 1KBHA 4DV6B 3GWOA 3ZYRA 5IYYA 4WBBA 3T1YB 3I2HA 1UWWA 1JMUB 4AHXA 4OI2A 1AVBA 2VZOA 3KV9A 5HXMA 5JXGA 4XBFA 3ZSEA 1FOD2 2XJTA 1YXWA 3MF6A 1PGL1 3ITQA 4BXSV 3FMGA 1JUIA 1J5EO 2WWSA 5FDBA 5JR2A 2WC2A 1RMU2 3SKJE 1CXZB 4TYSA 5EK0A 4GMP0 5LEJA 1F35A 3H8OA 3RZJA 4YM1A 3U11A 2ZEYA 3R05A 5KXBA 4B7KA 1GSLA 3WF4A 2EICA 1U5YA 1QQP2 1WBFA 3D8CA 4X62O 4LF8B 1YWKA 4QPJA 4W6XA 4IEQA 2CDPA 3DKWA 4XFIA 1A34A 2GH8A 5FZFA 2ZIOA 1KS4A 4LE3A 2CAVA 3MW3A 4QKDA 4FBFA 4XF3A 4EB6A 4BB3A 5D21A 1DDLA 5JVDA 2YSUB 4F3JA 3WNNA 4GD4A 3U1XA 4I0AA 2FMDA 3K9SA 1LEDA 4U7NA 4IE4A 4HKOA 2VW2A 3VD7A 2RDQA 5ABJC 1COV1 4E4SA 4ATFA 2VNGA 5LHHA 1O4YA 3UKMA 1OLMA 1PMIA 4NWWA 4QPKA 3WNKA 1RUNA 2ORZA 2LGWA 4I55A 3AP5A 4I09A 4OQ8A 4O9EA 1QCEA 2WLIA 5FZOB 2RS33 3OCPA 3RYKA 3CU7A 1J3RA 1MSDA 3HIFA 4HVOA 2YMZA 1QHDA 2B39A 1RGSA 3AKQA 2BUKA 1M57B 1WA8A 3AJYA 5DAVA 3X2QB 3I3EA 2VJXA 1RUG1 2WJSA 2E74B 2YI8A 5I0UA 1K3IA 5LBFA 1ZYBA 1W6OA 1IOAA 3HKEA 2LJ2A 4AAXA 4DR7O 3VUOA 4O2BB 4OHVA 4UYBA 1IX9A 3MIFA 1GUIA 3ZFFA 1TVKA 2UUBO 4C0HA 2ETEA 2Z69A 3AG3C 3T0BA 3MHHC 2O57A 5GJ6A 3WY6A 4D6SA 3LUTB 5BY5A 4PJ0Z 4RQPA 4FVVA 2V5DA 1ZZCA 2CE4A 3OUJA 2ZHNA 5FREA 3ZHRA 4AILC 4Q6GA 1DU3D 1VMJA 5FZMA 3ZRWB 1H4GA 3VZOA 4IYIA 3H3ZA 2BW8A 2VL4A 4IV3C 1E79G 1UY1A 2P67A 4IIJA 3J8F3 4L11A 5FJKA 1F4MA 3KCCA 4D69A 2CGNA 1SACA 3I8TA 1NVPD 2UURA 1IBLO 4WZCA 2JECA 5CBFA 3LSQA 2UUAO 4ICGA 1BSMA 1T6BX 1KQSU 1K4CC 3CBNA 4DS0A 2VOKA 4NMIA 1MOFA 1NLSA 1S3JA 1AR63 4KHPB 3EB7A 4V1PA 4UFLA 2V09A 1YIPA 2YI9A 2GTAA 5FYBA 5FMBA 4EN7B 4JGZB 1XNCA 3J8F2 4GKKO 4QQOA 1NCRC 2WNEA 1QLEB 4YW2A 2Y60A 3JB4C 4UB6Z 1W9FA 5FZ0A 5CBGA 1H30A 1AI7A 2QWQB 3ZMVA 5B1AB 4ES8A 1KXGA 4IE6A 1VBC2 4YVWC 3HAGA 2J1EA 2WZEA 4K35A 1AP5A 1EYBA 3URFA 1HR0B 4NRPA 1SQGA 3WD5A 2P6CA 1SFPA 4K1ZA 5CA0A 4AF9A 3RYPA 2R9IA 2RMU1 5A3LA 3WB1A 4QIWF 1RTVA 2CGOA 4J6GA 1GV9A 1ASJ2 5EQUA 1CESA 3VBFB 1S5LZ 1XMQO 2CTVA 3FUOA 4QGPA 1AR82 3QF7A 3O1MA 1Y67A 4P00B 2ADDA 1FMD2 1NTZH 4NPRA 3I3DA 1HNWB 1NA1B 4QWNA 2CUGA 3NNGA 2FMYA 3WR0A 4CUBA 3ZDSA 4ABMA 1CWPA 2YC0A 1QY4A 2SLIA 4XF0A 2B1IA 3A0HZ 2NYYA 4KP4A 1QH6A 2YC4A 3EJKA 4COYA 3N3HA 4OMDA 4K0KB 1XNQB 1VRH2 1WB7A 3THPA 5GLTA 3LCPA 4R4XA 3B00A 1XBFA 4A6SA 3MUZ1 5LMNB 4Q0QA 2ZMLA 2Q0AA 1R092 5A7QA 4U36A 3GVMA 2WS93 4ZZ5A 2EIJB 1CEZA 4R4ZA 4O2AA 4JV4A 1NOVA 5LBCA 4TT3G 4D8MA 1NZ6A 3UYJA 1R3JC 3VBSA 3MI8A 4AQ2A 1M06G 3M3OA 2QQWA 4XETA 4C1XA 2F17A 1N34B 3FHAA 5K7PA 3O1OA 1CIYA 4CDXC 3JALA 4LP8A 3ZYFA 3B77A 1WD4A 4K3AA 2ATKC 4LK6A 4TZDA 4JI0B 2OWOA 3VBRC 5A9GA 1BE3H 3B40A 1KDKA 4FFGA 4Q4W1 3UT5B 1NUKA 1PGW1 2R042 4YZ2A 1RYYA 3SISA 1IGOA 2DWEC 3GCWA 3GALA 3E6DA 3O14A 2VOTA 4K6BA 1JODA 4UBGA 4I50A 3GB7C 3ZR6A 3JAMN 4FPPA 4YG0A 4FLYA 1YJWV 3UCSC 5F39A 2C4XA 4JV5O 4JI7O 1DGRN 2NZ9A 4N43B 2GNDA 3CYOA 3BHPA 2VMIA 1D4VB 2EXHA 1G9DA 3AKTA 2PELA 3E5UA 2XB6C 3APOA 4UXAA 3ZR5A 5IJRA 1MS3A 3I59B 2DVGA 1EN5A 2Y0IA 4E2QA 4UT5A 1RM1C 1UU5A 4CCDA 3WINE 4YY3O 5LP6B 1WMXA 1B04A 2VZPA 4E27A 3AP7A 1FPN1 2YIBA 3OPZA 5IK7A 2NQYA 2ZE8A 2XMLA 2A70A 2VOXA 2BV4A 1VMGA 1SFYA 2IXIA 4BH9A 4JTOA 2C0ZA 5K0UC 2VMCA 4RO2A 4JC1A 2B7YA 1ND3B 5A6QA 4P9XA 5JQGA 5BYNA 2F66C 4LBEC 2VVEA 4RR3B 5KWRA 1LOBA 3FYIB 2EZPA 4Q0SA 2C26A 4MW3A 1OCRB 1YO8A 3CQOA 1DQ6A 1PVC2 2VMDA 5C9AC 4PA9A 2HWB1 5I8YA 2BOBC 4OUEA 1IBKO 1DYKA 1US3A 2CK3G 2QQVA 2ZNJA 1W6MB 2XJQA 3KVBA 2P6JA 2O8QA 2ZAAA 4U3JB 3L2YA 2ODMA 5FYVA 4QDRA 5DDJ3 3NV1A 4CDUB 1AYN3 4LBQD 2WFPA 1N8RW 5FZOA 3JCZA 3ACLA 1ZAUA 4LLOA 1SBEA 5JCOA 2DU0A 4AFCA 2ZNIA 1GTOA 3BTZA 1ZBE1 4MGQA 3BB6A 1FAYA 1I5YA 1YF2A 4XQWA 1G6UA 1UIKA 4JI2B 1BMV2 1ENVA 2BNNA 2GN3A 4O2BA 2E76B 2QTWB 2ZHKA 4JDNA 4U2AA 3OGGA 2GMMA 1W9WA 3ZN5A 3H0OA 2ZR3A 2IU3A 1S4CA 3K5OA 4Q4V3 2D5FA 4FQZA 5GZDA 2VM9A 4A7KA 1NE6A 4DINB 3AG2B 3VV1A 1R6KA 2PF4E 5CISA 3PMEA 4DR6B 3ZRWA 1R1A2 4XACA 4B3RB 3H7JA 3ZFGB 2RS12 3H1JH 4RFT0 3VKMA 1YRZA 5B1BB 1MPXA 1XNKA 2KD7A 3LSDA 2QKSA 3ABKC 2K9PA 2JEMA 3KB5A 5FIXA 2XQRA 3HOBA 3AL5A 4GWNA 3A0NA 1ZBA1 3M3EA 3GJAA 1I08A 2CNAA 4NPMA 3ILNA 4WFGA 2W68A 4Q4V2 2BE3A 5BNNC 1Z78A 2RS51 4XAAA 1UYZA 5JOYA 4CU9A 2AREA 2G19A 3ZCCA 4LMFA 5DECA 4UFHA 2D3PA 4WZFA 1YITV 2E33A 1D0HA 1LHNA 2VOWA 2QR4A 1VBE2 4YZ1A 4FI9A 2H94A 3AJZA 1W8WA 2E7TA 4JGZA 3ACHA 2YV8A 1YJ9V 1H2SB 4Z82A 5JZGC 3E86A 4XOGA 3CJHB 4YM3A 1AX0A 1FYUA 3VDBA 1WP7A 1IXBA 4CDQC 4AVCA 1PK6B 2E75B 4ZU5A 5FWJA 2JDPA 5ANNA 3H7YA 2ZX1A 3N7LA 5I8SA 2P1BA 4Q4Y2 3C7EA 2PHRA 4YW7A 1R3IC 5FPRA 2QTSA 5BY1A 1MS9A 1OVSA 4IEYA 3T2TA 1RUJ1 1RUC1 1MEC1 4HZFA 1HRV3 4A41A 3VBFA 1KGYA 3ZHUA 4HSLA 3RDIA 1D2DA 5LOVB 2ZHLA 1ZWIC 2CL2A 3RQ0A 5DUWA 2X8KA 5IFPA 4BMBA 5J3UA 4WBNA 4M4PA 4HAMA 1RUF2 4JZGA 4JI8O 1NA1A 3OPWA 4H44B 2X05A 2HEVF 4QDQA 4I0XB 4OXSA 1NR1A 4XFAA 3R0RA 5BR8B 3S3XA 1HRV2 5LBEA 4FFBB 5L7OB 2IXCA 2HBTA 3GXUA 2VE1A 3JYCA 3BAAA 2ZEXA 1SHWB 4FPJA 1R6TA 4QNHB 2PMWB 3B4SA 4XFCA 1XL6A 1V00A 2Q8OA 4QQPA 2VZVA 5E8AA 2N05A 4ZS3A 1W8NA 4YFZA 1KJRA 1AILA 3WUCA 3UKTA 1G7YA 3IZOA 3B8NA 1PO11 5FXWA 5K1XA 4C1WA 4N90A 2WZPP 4KGQA 3IIIA 1H8EG 2I07B 2QQJA 4GWJA 2XOKG 1X82A 3DYOA 4DXTA 1QDCA 3O12A 3FHQA 4IL7A 4CEYB 2WSSG 5C8CB 3D36C 4D94A 1V54B 2DVBA 3LDCA 1HJGA 5F8PA 1KB9F 4CCKA 1POV3 2Q4PA 1GWLA 3CJXA 1LAJA 3CKHA 4X6RB 4FTSA 3UT5A 1C57A 1ZRIA 4IGQA 2IVJA 4MVTA 5BNPB 4EEQA 2JDZA 4YGEA 1O8SA 4PA6A 1US2A 5FNVB 2RDNA 4XDOA 2X7RB 2DWRA 2DF7A 3NNFA 1TEIA 3PL0A 4CYDA 2ZE7A 3B02A 3DGEA 4L99A 3OE7G 5T5JA 2YICA 3OGRA 4N43A 5HBAA 4BJ0A 1H38A 1JYVA 3IC7A 3N4MA 2IVIB 5HV4A 1HNXB 2GMPA 3LB9A 3MIBA 4GWMA 5FQ0B 2IUWA 1LU1A 4XPVA 1V6MA 1SQFA 2QDNA 2P37A 1NKDA 4WF9V 5EC1C 4I7ZB 2XH6A 3I59A 4P9OA 3CNAA 4NYKA 4X66B 3B01A 3A22A 4FTEA 2WDBA 1Y9QA 2GDFA 3H3LA 3KHCA 3INAA 5LP6A 2WIIB 2JDKA 3T1CA 5JIUA 4FJCC 3ZM8A 5FLJA 2VW0A 4LFAB 5FXVA 4PIYA 3POBA 3UM7A 3ZVXA 1EP0A 1XYNA 4DV7B 5A2QN 5HCBA 2BVVA 4R8HA 1OFNA 4AI9A 1H1IA 3WB0A 4FXGB 1ND3A 4ZS2A 3RZLA 4O9GA 3GZEA 1OQ1A 2GALA 1REFA 3V56A 4RR3A 4CH6A 1X4TA 4CSWA 3GZTB 1VRBA 3BOPA 1K7DA 2Q8EA 4HVQA 2BGCA 1PIV1 4JHZA 1GN4A 3VD5A 2WPDG 3NWKA 3RPQA 1AR71 4HBNA 4CH5A 1W6MA 2Y69C 3T1HO 5I91A 1M93A 2YZ4A 2JENA 1J5EB 5FOJB 5GLWA 1KQRA 4GZ9A 4C0BA 4U3JA 2HWE3 3I3QA 4LPLA 4CDUA 2EXIA 5CAZA 4QPWA 4AWDA 1N36O 2RHPA 2LQTA 4PLNA 5CG8A 4M3CE 1H9WA 4LIUA 2VQAA 5JI7A 1FNZA 1Q6UA 3SYAA 2YXHA 1VQ6V 5CBLA 3T3YA 1Y4WA 4Q8LA 1KP3A 1KC8W 4X1IB 4R50A 4O65A 2OQ7A 3TEWA 4BE3A 5FPXA 3DPRC 5HFMA 1KKDA 4BQXA 2YIDA 3VHNA 4TLFA 2G38A 5CN0A 2JKXA 1XILA 4LF7B 4DUWA 5FTTC 1W2NA 1VF6C 4MSVA 4JRLA 4RD7A 4DV3B 5I0RA 2XBO1 2GV9A 3X29B 4OHXA 2B42B 1C4RA 1F4NA 2NPIA 4K7JA 4XMIA 4X20B 4YSFA 4CRQA 5EC2C 1O6UA 3H9VA 2RMU3 5FXXA 3CXCU 4QPYA 1JMKC 1YHQV 1W6PB 3KV6A 5A3PA 3ZFGA 3WLUA 2XASA 4I3PA 4BWOA 4JYBA 2B5UA 3ZIWA 2ZMKA 2RV9A 3C90A 1WW4A 2QM7A 4UAPA 1N1TA 1VBB2 5EIBC 1EN6A 1NH2B 3S30A 2VQFB 1R081 3LIHA 3GHNA 1KU9A 3K5NA 3NW4A 3CJIC 4ET7A 1BCCH 2DTYA 5H9RA 4O4HB 2PLV2 2KB1A 2UUBB 3FL7A 3U4XA 3SQOA 1KRIA 2LGQA 1BHBA 4FM2A 1BL8A 2YBKA 1K4DC 2FDIA 2F43G 5D8AA 1WLDA 4H3WA 3ZS8C 5SV8A 3SEPA 1ND2C 5HXVA 3CJHA 1V9U3 1GAXA 4BQ5A 5IK8A 3WSOA 3VDDC 4SBVA 3RN4A 2F23A 2KKWA 1Z7S1 1NTMH 4BHPA 1PPJH 1S0FA 4YRDA 2AZ0A 3IMNA 4WFHA 4FPYA 5C71A 3HD8B 4HN1A 4XILA 1SLCA 1GN6A 2EF6A 2B9VA 1S0IA 2OUJA 1IBLB 5GLZA 3AG3B 2UUAB 5H2FZ 3C2UA 4MXWB 2MEV1 3S7IA 3FE5A 1KYOF 5LOVA 2WYSA 3N35A 4HG6B 2QDOA 4CA9A 1ROPA 1W90A 2W6IG 1UQXA 1DFQA 4ZXEA 1OH4A 5F3GA 3GZAA 4PV1B 1V6OA 5IT6A 3S5AA 4GKKB 5D1IA 1UJWB 4QPGB 2AZ2A 2ERFA 1YVWA 4PJYA 3N7KA 5DAPA 3THTA 4LWSA 2V73A 4Y1UA 3TK1A 1ZA7A 1UFIA 3O1RA 3MO4A 4DR1O 2VCAA 3OB8A 1RUH1 2C1FA 4FFBA 1GK9A 1AXYA 2G9ZA 4QU1A 3SCGA 3LGRA 2VG9A 4JGSA 1IVSA 3ZPOA 3HKDB 3QOPA 3RS6A 1QVGU 2OVUA 1K5MC 2IH1C 5L3EA 2ZEZA 4QMAA 1I5PA 2RM21 1H6YA 2Q1ZB 2F93B 2K9ZA 4K21A 2D3SA 3TXSA 4HKLA 4RGKA 3U10A 5A6XA 2YHJA 4XABA 1M4UA 3LA2A 1NCRB 4LBQB 2H6CA 2GC2A 2ZHMA 2EIKC 2RJ2A 2P34A 4B1LA 4IL6Z 3U75A 4Q0VA 1LB2A 2XL9A 5JI9A 5C8CA 2BJSA 2OZ6A 2R49A 3K04A 5L3BA 1TUEB 4AEKA 1SERA 3N9NA 3B2EE 2JKBA 4YVWB 4XZUG 2JIGA 3K3OA 2ZGQA 4DUVA 5F9TA 2A71A 1MNGA 2WZR1 3AMPA 1RPOA 5BNPA 3POGA 4MH0E 3MYXA 4GA9A 5DUUA 3ABTA 2UXBB 4JVAA 2A1XA 1UOBA 2DUQA 4XJ8A 4ASUG 2UYBA 4DMIA 4AVTA 4GWIA 2HWF3 2Q7GA 3KSCA 1AR92 2VBBA 2D5HA 3CCSV 1CAVB 4DRRA 1DZQA 2DBIA 3TXQA 1Y74B 5IHRA 5J7MA 1MA1A 2ZX0A 3JQWA 1ZBE3 4CU6A 2ZT9B 1I5XA 5AC91 4FTBA 4NIIA 1QJY2 2JS3A 1QOTA 3JU9A 3ZX7A 2FDHA 3RJRA 4YYOA 1SZBA 5EYPB 3N2GB 1PZ9A 3CCLV 4QX1A 1XDCA 2HWF2 5H9SA 3TOJA 2ZCWA 2DCTA 1MZ5A 3POYA 2WRAA 2JJ6A 1NE4A 1GO3F 1WUVA 3JBG3 3LFMA 1IS5A 1WPXA 1MABG 5JSOA 1LGCA 1JYNA 4XDLA 3H1HH 2CH7B 2QTOA 4Y20B 2Q1FA 4JI7B 1MG1A 2R063 1OVPA 1SETA 2HWD1 4GX1A 5EIBD 3O9OA 3VBHB 5ANQA 4QX2A 2RDCA 4CDXB 2FL4A 1XOYA 1O5UA 1N33O 1VJ2A 4NRQA 2Y26A 5FZAA 1PKXA 5F2VO 3VBRB 1BT8A 3KZ4C 1BEV2 2JDUA 1Y6XA 4ASLA 3VD9A 3WF3A 2FBEA 4YIOA 2K46A 1BZWA 2LALA 1ENXA 1W39A 2PYLA 3RNSA 4DR4B 3APBA 1W0KG 4XW3A 2WA4A 4JI4O 1CGPA 4B3MO 1ZNPA 4V2VA 2YPDA 2ETNA 4NXMO 4AAPA 1Y9GA 2RG4A 4AEDC 2HVJC 1SF9A 2A3XA 3VZNA 4GXLA 3VLBB 1TVGA 2IC1A 3B7MA 5FKBA 1N4CA 1WPBA 1WCUA 3UV9A 4I9QA 3AYAA 3VHOA 1K34A 1RVF2 4JKMA 3ZXJA 4DV4O 3LDEA 2QNKA 4ISRA 3QTCA 3ZHTA 4HONA 4X1IA 2M6YA 4KUMA 3TCUA 4LH6A 3I5DA 3JZVA 1AYM2 3KGZA 3KG2A 3DUIA 1ONAA 5G04L 3VQYA 4ZZ8A 2WKKA 3GWKC 2VMFA 3O65A 1OLRA 1RM1B 4KWUA 5CG9A 4X20A 4P30A 2E51A 3WG2A 1UX6A 4IDZA 2EJRA 4GH4C 1E5IA 2W46A 2BBVA 2OX0A 2ZKLA 4IEOA 2XVGA 5E88A 4F83A 3VBUC 1WMEA 2ZINA 1NT2B 4BR6A 1PNGA 4QT6A 4DNYA 1S0GA 5K0UB 1MZ6A 4GX5A 3F7VC 2JWPA 4YZ4A 3UNPA 4C7UA 3RW0A 1X9PA 2PFWA 2DCJA 2BZDA 1AVMA 3NJVA 3TETA 1W2TA 4G4FA 3CRRA 2JK5C 1SFNA 4RHV1 3QG5A 5FK7A 4FPLA 2VMGA 4HOOA 3AK1A 1ZRDA 3AG4C 4XBNA 2WLLB 4COZA 4EKWA 4O4HA 2PI5A 5ABJA 1EUUA 3IKWA 3PURA 3MIEA 1F31A 5IAXA 2ATFA 1AL23 1JYXA 2DW4A 5LZ6A 4UFMA 3ABZA 2XLGA 1WGPA 3F2ZA 3WNPA 1ACCA 3CCQV 4YG6A 1AJQA 1UOFA 2OQ6A 3TNPB 4LO8A 2ZIMA 1RXGA 1TMF3 4XDQA 2WLMA 3T2OA 1U97A 3DTUB 5IVFA 1PO13 1D4M3 2J1VA 1GM8A 2BERA 1WP8A 3K58A 4CP0A 2XOMA 3I2JA 4B3TO 4LF8O 1TAEA 3DXUA 3BGAA 4K8ZA 1S0CA 3CL1A 5KMGB 1HXS1 5A7PA 1XXNA 1KDMA 4I9WA 4AFAA 5C33A 5E79Z 3OUFA 3JD4A 5A32B 2OTJV 2VECA 3SH5A 5T5OA 2PHUA 2R30A 4MXWA 1PO21 2VMHA 1THZA 1TMF2 4XFFA 1YQ6A 1TGOA 4G28B 3B5LB 3K4AA 2YS8A 3MPPG 5ACA1 1M1KW 1DYOA 5A3WA 3DC5A 3E22B 1SPPA 5BNOC 3OTOB 5KAIZ 4QPGA 3EXUA 3ABMC 4FPHA 5LRSA 3M8AA 5CKNA 3ABKB 3L9DA 4EN8B 4AXOA 5A33B 1B35C 1UYXA 1N1VA 4KFMA 1Y3TA 4MT8A 1S0VA 4CP1A 1L7LA 4D3WA 3FX7A 3M2MA 4LE4A 1W0PA 3ZBHA 1Q8VA 2OZJA 3P5BA 2X6BA 4KI5M 3HKDA 4CC5A 1QIQA 4OHWA 1US6A 5FZIA 5JSRA 4TTGA 4D7YA 4WFFA 3R4DB 3ASIA 3FBYA 4QKFA 2NN8A 2KM2A 1O9GA 3DC6A 4KL1A 4JCKA 4FMTA 4DUYB 1NG0A 1LTEA 3ILRA 5IYDO 1FOD1 3FB6C 3E1F1 4OYUA 2VWKA 1NCRA 5FMDA 2JIZG 4LBQA 1RB8G 5FXZA 2XKOA 2QCSB 5C8YB 3JATB 5LYJA 4QX0A 5KHKA 4CDQB 5JH7B 5CIRA 2C9KA 5J2TB 5EIYB 4IGPA 4UVBA 4IE5A 3A8TA 1SKVA 1AHSA 2YC2A 2EIMB 1V6KA 2BGOA 4YVWA 2D43A 4Q1PA 3J4UH 4AFBA 4DY3A 3WW4A 3OTFA 1D2QA 2AHYA 1LEMA 4XDJA 1EV13 3I7DA 4H2AA 1VEWA 3MLKA 4FLTA 1K33A 2P7TC 4G2KA 1W6QB 1W0OA 5C5UA 3RSJA 2VOVA 4KHPO 3AVSA 3BRCA 1PX4A 4MX3A 1RFYA 5JOWA 3SC7X 1MMMA 4P9YA 1VBD2 4JASA 2A6XA 1ZX5A 4LHNA 3NL1A 2BNOA 1MZFA 1CAXB
chains in the Genus database with same CATH topology
3BALA 4XJWA 1VB4A 4NN0A 2B9UA 3RYPA 4AF9A 1VP6A 4FT8A 2RMU1 2OIIA 1V6IA 4R9CA 3O0VA 4AQSA 2O1QA 5A3LA 1RTVA 1IKQA 2P3IA 2CGOA 4WVVA 4J6GA 1GV9A 1ASJ2 1S0EA 1CESA 3VBFB 4YFWA 4XF9A 4BIFA 1QKQA 1FPN2 2CTVA 1JHNA 3FUOA 3V17A 3ZN6A 1AR82 3ZSKA 4S2HA 1VAMA 3PVOA 2HWB3 5KC6A 4FPKA 2GH2A 1UL9A 1AL21 1RUE2 4CEYC 1FMD2 4NPRA 5C8CC 3ILFA 3ZO0B 1OOPA 3PJYA 4B4QA 1NA1B 1OMIA 4C90A 4ISQA 4M27A 4XQ4A 1R1A1 2FMYA 3ENRA 3WR0A 1TMF1 4SLIA 4IERA 2RS11 3ZDSA 2QFEA 3SCHA 1D4M1 4BCUA 2ZGKA 1UZYA 2YC0A 5BNPC 1BBT2 3MFCA 1QY4A 2SLIA 4XF0A 2OG6A 1Q5OA 5KHGA 2NYYA 1ZRRA 2HJIA 2QUOA 1QH6A 3LSEA 3EJKA 5L19A 4MYEA 5FQ0A 1GR3A 3UL2A 4FOYA 1N1YA 4COYA 3N3HA 1VRH2 3THPA 4Y20A 5GLTA 4CEWB 3LCPA 2WBOA 1SLIA 4R4XA 2RS31 4LBKA 1OOPC 2BQPA 2HWB2 3B00A 1OLQA 3LKJA 2EAAA 2ZGPA 1GANA 3FC0A 4Q0QA 2ZMLA 1R092 2Q0AA 5J98B 1S0BA 3ZXDA 1DIWA 2PHDA 3B93A 4U36A 4XXAA 4E4ZA 1QXPA 3KM5A 2WS93 4CDXA 1A8MA 1URXA 1GQGA 4N7UA 4KBBA 5H9QA 2UWBA 3ZYJB 3BIWE 4E4DX 1MQTB 4JAAA 4R4ZA 4JV4A 1NOVA 3VBRA 1MS0A 1PZ7A 2XWBB 1Y0ZA 2YYOA 1VBE1 2OA2A 3DF0A 1OA3A 3VBSA 3MI8A 3L2HA 5DZGA 4AQ2A 1M06G 2YUEA 3ZSJA 3BOWA 3M3OA 3IIAA 1UAIA 4XETA 5DG2A 4C1XA 5KBFA 4OI4A 1LGBA 1FNYA 1ZBE2 3WXPA 1KS5A 1AXZA 2W52A 1YFXA 4K8FA 5C4WB 1VZ4A 1NXD1 5CFCB 5K7PA 3KS7A 4WVMB 2FZ1A 4CDXC 3TWIA 1WD4A 3ZN4A 4FAHA 1X50A 4XHXA 4TZDA 1COV2 4LNVA 3EHKA 3VBRC 1KDKA 4PBOA 4Q4W1 1WLCA 3DN7A 1PGW1 2R042 4YZ2A 4HK9A 3SISA 4Q4X2 1IGOA 3VBSC 1EY2A 1HXS2 3JB8A 3GALA 3E6DA 3O14A 4QGMA 4N9HA 4K6BA 1RUOA 5CA6A 1ZBA3 2Z5WA 2JG9A 3JBG2 4UBGA 1YUDA 4YW5A 2X5IB 3J8F1 5FLIA 3PMSA 2C5DA 4BYYA 3SWTA 2RS53 4FP3A 3KT4A 3QD6A 1ULDA 4Y1VA 4YG0A 4EWAA 2WBQA 1PO22 1JTZX 1WCSA 2XKPA 3B9CA 1Q56A 1DGRN 1X7NA 5FO9B 2E63A 2NZ9A 1RHI1 4D7SA 4N43B 5J96B 2R062 2GU9A 1GQWA 2GNDA 1F2NA 2XVKA 1W2UA 2VMIA 1Q8QA 4YM0A 2XJRA 4KG8A 4Z8BA 1UZZA 1D4VB 2EXHA 4M3CA 1RUF1 1G9DA 1AR61 3AKTA 2PELA 3E5UA 3EBRA 3IM0A 2QZ2A 4AVSA 1RINA 1WW5A 2XB6C 1W6NB 2JG9C 5J37A 1REEA 2DCZA 1S0JA 2WT1A 1VBD1 4AHWA 3SXWA 2MEV3 1YIFA 4UXAA 1X36A 5BNQA 2WSUA 1OIJA 1DZTA 1SCSA 1J3QA 1MS3A 4EWEA 3I59B 5K0UA 2DVGA 3O0XA 3NAPA 2Y0IA 4E2QA 1DQ2A 3E5XA 1GBGA 1F9KA 4Y22B 4EN9B 2VQ0A 1UU5A 3MZHA 4XTMA 4P9JA 3WINE 2N7GA 1PGSA 5FRAA 4E27A 3AP7A 1EV11 2D7FA 2VVFA 1FPN1 3OPZA 4JGYC 4AEDB 5IK7A 2NQYA 3KGLA 1ZZ8A 5DUXA 2IXLA 2A70A 2VOXA 3B9IA 1SLBA 2I74A 1SFYA 4WM8A 2IXIA