2DWEC

Crystal structure of kcsa-fab-tba complex in rb+
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords ANTIBODY FAB HEAVY CHAIN
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dweC00
3F7YC 3SPIA 4JTAB 3K03A 3E8FA 4J9YB 2HVJC 4MTGA 3HPLC 2ITDC 2WLLB 5B1AC 3K0DA 3LDEA 3SYPA 2YEVA 3AG3C 4H37A 2WLNA 4GX1A 3F7VC 1JVMA 3E86A 4GX2A 4R7CA 3LDDA 4X88A 3LUTB 3SPJA 4DXWA 4LBEC 4MVZA 1P7BA 2KB1A 2Q68A 3K0GA 4MW3A 2IH1C 1XL6A 4RAIA 5CBHA 3FB6C 3TETA 3OR7C 3OUFA 2W0FC 3E8HA 2EIJC 2X6CA 3ABMC 2WLJA 1V54C 4PA3A 4QE7A 1LNQA 2HVKC 4PA4A 3LDCA 3RW0A 1M56C 3AG4C 4P30A 5KUKA 1R3JC 3ABLC 3FB8C 4GX5A 5IY5C 2ATKC 4P9OA 3T1CA 3E8GA 2ZD9A 4JTDB 2A9HA 4RUFA 4ZBMA 4LCUC 4OXSA 3SPHA 3SPGA 3ABKC 3BEHA 4F4LA 2WLIB 4CBCA 3UKMA 1KKDA 4JTCB 2BOBC 2DWDC 4XDJA 5EBWC 2H8PC 4WFEA 3ASNC 5BZBA 4QE9A 3IGAC 4H33A 4I9WA 2JK5C 2X6AA 4PDRA 3FB7C 3TCUA 2R9RB 3WG7C 2HG5C 4R50A 4HYOA 4R8CA 5EC1C 4LP8A 2Q67A 3K04A 1J95A 3E89A 3E83A 2DWEC 2WLKA 3LNMB 1OCZC 4XDKA 3RVYA 3UM7A 3KG2A 4G27B 3SYCA 1ZWIC 2EIKC 3GB7C 3K08A 3F5WC 4MTFA 1R3IC 4PDVA 4X8AA 3ZRSA 4HZ3A 5B3SC 1ORQC 1S5HC 3AG2C 4PA7A 1V55C 3ASOC 4MVRA 4TWKA 4MVQA 4MVMA 2WLLA 4MTOA 2EIMC 4MVOA 3OGCC 1R3LC 2DYRC 1OCRC 3SYAA 5EC2C 3ZJZA 4WFGA 4BW5A 3T2MA 1OCCC 2DYSC 3PJSK 4MW8A 3SYQA 4EKWA 5KUMA 2OCCC 5E1AC 2AHZA 2A79B 4G28B 4QNHB 4MVSA 1BL8A 4X89A 2Q69A 2NLJC 3T4ZA 3X2QC 4PA6A 2AHYA 1OCOC 4P2ZA 2QTOA 3R65A 5B1BC 5EK0A 3SJQC 3VOUA 4R6ZA 5CBFA 3EFFK 2EINC 4RUEA 3FB5C 2BOCC 4MSWC 4PDLA 3IFXA 4PA9A 2Y69C 4MS2A 3K06A 2HJFC 4XDLA 3T4DA 1R3KC 2ITCC 3RVZA 5EBMC 3JYCA 1G4YB 2HFEC 2WLHA 4GX0A 2QKSA 2Q6AA 5CBGA 2WLMA 3E8BA 1QLEC 2A0LA 2IH3C 4KFMA 4MVUA 3OUSA 4UUJC 4WFFA 4WFHA 3OR6C 3STZC 4J9ZB 4RO2A 2X6BA 5EBLC 2WLIA 4PDMA 3RBZA 3SYOA 1K4CC 3AG1C 1K4DC 3STLC 5J9PC 4P9PA 1M57C 1XL4A 2K1EA 2P7TC 3SPCA 2ZXWC 2EILC
chains in the Genus database with same CATH superfamily
5B66Z 2IU3A 1N4CA 4JAVA 2HVJC 2QE7G 3LDEA 3H9VA 1WPXA 1JVMA 1SZXA 5GTHZ 3MAQA 3CC7V 4LF7B 2Q68A 3K0GA 3U11A 1IBMO 4K8ZA 4TV9B 1PNMA 5A9GA 4GZRB 1PPJH 1VIBA 2UXBO 4DR4O 1P4RA 1NTKH 1BCCH 4FMTA 5LXTA 5BMVB 1GO3F 2ZNIA 3B09A 3OGIB 4LNUB 2JEXA 5CB4B 4AI8A 2DWDC 4J42A 1QVGU 4DV2O 1CXZB 1KU9A 2CAZC 2LP7A 3FYIB 4NTWA 3FAVB 2Q67A 1HNZB 2KG7A 3ZIAG 5H9CA 1MOFA 4O4LB 1JFFA 1M93A 4OPHA 2EIJB 1ORQC 3K5NA 2E5LB 1AR4A 4TWKA 1XI1A 3UCSC 2BE3A 4LWSB 1R6NA 4MTOA 3TJTA 1U97A 1K92A 2FYUH 4RWUA 1WLEA 4MW8A 1EM1A 3D36C 4X1YA 3G6BA 3OMNB 2HJDA 5EIBC 1BQZA 1XEQA 3QO8A 3FB5C 4MSWC 3IFXA 1N36B 1QHTA 2HJFC 2ZDIC 2VQFB 1B6QA 2XT9A 1SRYA 1G4YB 1TUBB 4WFFA 4C7UA 5L3CA 1S77D 3ETEA 5CA3A 1PM9A 1OCOB 1ZUQA 1UPGA 5HFMA 1OCCB 4IGGA 4UCUA 3JAKB 1MG1A 5LXTB 4J9YB 4FZ1A 3K0DA 2F95B 1PD3A 1KECA 1Q6UA 3MD0A 4GX2A 5CA0B 3K5LA 1VQMV 1NH2D 4YHHO 2EIJC 1I94O 3BVOA 1OZ0A 4IIJB 5KHKA 2O57A 1I5XA 5KUKA 1L0LH 1PL0A 4JI3O 4EEQA 1H2LA 2F66C 2ZQMA 3E8GA 4JTDB 1COWG 3P30A 3WG7B 5B1OA 4OX9O 4EB6B 4HAMA 2N04A 2W0XA 2UXBB 1AI5A 4JI6O 1HWYA 4PDRA 2HG5C 1IXBA 1WJZA 4O4IA 5KX5B 3BABA 4CS4A 2B9ZA 4AQYB 4ZI7B 3JD3A 5FNVB 2WPDG 3FKSG 2E75B 1YJWV 2PTMA 4DV2B 3JATB 1IXMA 3OGCC 4JI4O 2A7WA 5IYBO 2PZSA 4H0LB 3FFQA 4DV5B 1M90W 1XILA 3JALB 3QO7A 4DK0A 4DV6B 2FKXA 5DECA 3R65A 3D36A 4RUEA 1KQSU 4PA9A 5IJ9B 3WB0A 3ZHVA 4UCVA 5EBMC 2WLMA 4IHJB 4LFCO 4KFMA 1DF5A 3OR6C 4J9ZB 2DQ0A 4QJFB 5JCOA 1AILA 3SYOA 1KD1W 2YSUB 2YDEA 3AG1C 3VQYA 1MNGA 1I94B 2K1EA 1X59A 3CHXA 2DYSB 3F7YC 2QWQB 1DK1A 1S5JA 5GONB 1NS1A 2YXHA 3SYPA 3AG3C 4DR7B 3E86A 4X1IB 4FZ0A 4MW3A 2IH1C 3J80N 1GAXA 1JFFB 2H3OA 3NR7A 4B3MB 2CH7B 2Z0AA 1YEWA 2KQXA 3P3PA 4LFBB 1MABG 1YDXA 5IY5C 3RYIB 4WCEV 4B3TO 2ATKC 4P9OA 4ZBMA 2ZINA 1J5EO 3OM3B 2UXDB 5IJ9A 2Y0PA 3K9AA 3ASNB 3BEHA 4A5UB 4LF4O 3W7UA 1NR1A 1RSOB 2QKAA 5LGUA 3WFVA 5IE9A 3SDLA 4F6RA 2OTLV 2F4VO 4I9WA 2X6AA 5BXZA 4NR1A 1FXVA 2EBOA 2WLKA 4UCOA 4B7EA 4FM1A 2VQFO 4KUMA 3SGIA 2BCCH 2UUCB 4K0KB 5JJJB 3JATA 4X62B 4LFAO 4O4JA 5IDJA 1VQ4V 1ROPA 3AG7A 1Y76A 2UU9O 5L3BA 2HKOA 1PV0A 2CTQA 5BR8B 3SYQA 3H1HH 5LP6B 1VQ7V 4QNHB 2AHYA 1OCOC 4X1KB 3EFFK 5LMUO 1JMKC 3DXRB 2IJIA 3CWBH 4CS2A 1Z5WA 1O9HA 2QM7A 4TQDA 1NZ6A 1R3KC 2Q8VA 3RVZA 1AI4A 1EBOA 4DR7O 3ABUA 1E1QG 4IYHA 1VF6C 1VQ5V 1LUWA 1KC8W 1HP8A 2Q73A 1YCIA 1XQ8A 1U96A 4B3SO 1FXKA 1MSDA 3SPCA 4JAUA 2B1IA 4D7TA 3E22B 3I55V 3CS5A 1F23A 3O65A 5B1AC 1WB8A 5IYCO 4FLUA 3LDDA 1N32B 4DXWA 1NT2B 5KA6A 2KB1A 1AB3A 4X20B 2B5UA 5IWAO 3K9SA 4ZIBA 1WAZA 2YIAA 3FB8C 4UV8A 2W6IG 3ABKC 2E5LO 2V7QG 2V4DA 3OAAG 5IYZB 2RMKB 2ZIOA 1US6A 3JAMN 3RYFB 4DV6O 3TCUA 1N32O 1ENVA 3I56V 2ZCEA 3AG4B 3J81N 5H6RA 1BQ0A 4I5SA 5F2VO 1NU1H 5LL6Y 2QKCA 3AG2C 2HHHO 1BHBA 4F6EA 5KHJA 1OCRC 1YTFB 1GRJA 1HNWB 1RFYA 2KG7B 4PI2A 4LF8O 4LF5B 5KMGA 4DV1O 2NLJC 2ZE5A 3X2QC 4IHJA 2RJZA 3ZRWA 4DV4B 2EINC 2GV9A 3RYHB 3D3IA 5KHHA 5CBGA 2Q7HA 1QLEC 4MT8A 3STZC 2JGDB 4Z1VA 1Q90D 2FTKA 1HNXO 4WFBV 2JEUA 2M6YA 3STLC 1YI2V 1SF9A 4NB5A 4J7JA 1PKXA 3ETQA 4UV9A 2BTQB 3CRCA 2YIDA 3E22A 3DC6A 4OX9B 3FB6C 2VWJA 3AG2B 1YHQV 3OR7C 1Q86W 2X0LA 3CRAA 1GK9A 2WLJA 2YC0A 1IURA 2HVKC 5KX5A 2AGAA 4NYKA 2XNDG 2MW2B 4HBNA 3QNEA 3SJBC 4DW1A 4AILC 4X64O 4ZOLA 3BFRA 1NVPB 4JTCB 4N23A 3RYFA 1M4UA 2XAFA 3ABKB 1IVSA 4EFEA 3EXAA 3AEIA 2QM8A 2ZE6A 4DV1B 2OYQA 2AW9A 1ZL8A 3AK3A 3CCMV 3Q4HA 4G27B 1Y76B 1KMIZ 5TISZ 1CEZA 4FJCC 5FLXN 4LF5O 1OV9A 4PA7A 3ZBHA 4JF3A 2QWNB 4JI0O 3N2KA 5JH7A 1NVPD 3UQ8A 2OIEA 4YJ2B 5B1AB 1VQPV 4I50B 4DR2B 4GKJB 3KCXA 2WA3A 1H8HG 5FNVA 2YI9A 3C90A 4PA6A 2QA4V 4LF6B 4B3RB 2WA4A 3SJQC 4R6ZA 3CRMA 3W7SA 3RN4A 4DYLA 4O4IB 1CP9A 1Y6XA 4NTYA 4J41A 4BIUA 1DGSA 2A0LA 3ZCCA 4LF9O 3OUSA 5LOVB 2YIBD 5EBLC 4LF7O 1F7YA 2Q5ZA 2ZM6B 4FFBA 1IBLO 1SQBH 5LP6C 4DRXB 1QCEA 5L3EA 3JD0A 4J7ZA 2Y4UA 3OTFA 5K1PA 1SERA 2MK3A 3LSQA 4B3RO 2EIMB 1M9NA 4WF9V 1R1BA 1T5EA 4JI5O 2B1GA 5CBHA 4BR6A 3OUFA 3A2FA 1Q3EA 4O4JB 4JGSA 3L70H 1M56C 3ZN1A 2CUGA 5LMUB 1TVKA 3APQA 2ZD9A 1AJQA 2ZM6O 4JI2O 4KP4A 1QNMA 2V1DA 3THOA 4DR2O 3ASNC 1N33O 1R73A 2Q7GA 3CE2A 1XHZA 3OMIB 4FLTA 3A8TA 3ABLB 3K04A 2P06A 1BSMA 4GKKO 1W2BU 4FLZA 4JI8O 4NXMO 3ABMB 3ZMZA 1S5HC 4MVRA 1N34B 2PYLA 1Y67A 4MVMA 2WLLA 2IM9A 1N36O 3T1YB 3AG3B 4LF4B 4Z2WA 3ZMVA 4TUYA 4LWSA 1K5QA 3ZHUA 2LQTA 1JJOA 2EILB 1JQ0A 3IC9A 5KUMA 5K1XA 5LOVA 3CMAV 2JRIA 1XNRO 3G71V 5KAFZ 4Q20A 5GONA 1W0JG 3AG1B 2JS5A 2Q69A 4U7OA 4DRXA 1F51A 5EK0A 1YIJV 2LW1A 1YJ9V 2BOCC 2EJ7A 2UUAO 2UUCO 3FAVA 1TUEB 4JI8B 2IBZH 3JD1A 5JVDA 1S0VA 3JYCA 5HFLA 2ZIMA 4I4TB 4UCTA 2CTRA 1SETA 5FPOA 4MVUA 2HEPA 4DR3O 1N0JA 4WFHA 4FM0A 4DR5O 4JI5B 4UB8Z 1H38A 2P6JA 1YZBA 1Q5OA 2OCCB 5IT9N 3BHPA 3LSUA 2QWOB 1SZTA 3I5DA 2QR4A 3BPZA 3KKYA 1PL4A 5CA0A 1IX9A 3ZMSA 3J7AU 1IBKO 1P84F 3H1LH 4GX1A 2KKWA 2PI4A 4W4LA 1KP3A 1OHHG 3JAKA 4LBEC 4ZHQB 4DUZB 2N05A 5EZYA 2ZE7A 4DW0A 3RWRD 3DSQA 2W6JG 4UCRA 1NBMG 3L73H 5JQGB 3PN1A 5CMUA 1VQOV 2Y48A 3K79A 2M7WA 1N0NA 4Q6GA 3WG7C 1FXKC 4E4EA 1HNZO 1QVFU 1AI7A 4R8CA 2ZR3A 1R3IC 3RT3C 5LP6A 2XAJA 1MZEA 2LJ2A 4O2BA 1XMQO 1MSWD 2A3QA 1EZJA 1JR9A 2OCHA 1R3LC 5KAIZ 1VQ9V 2GTAA 4O4LA 1AJPA 3H1JH 3JAWA 2YXLA 1FJGO 4BIZA 3MDSA 3P32A 3M8AA 5B1BC 1EN4A 3RYHA 4RQFA 3T4DA 4PD4F 1M1KW 1Y74B 5JCOC 2Y69B 1TUBA 3VBBA 1UJWB 1NTMH 3BRCA 1JA8A 4DR1O 3IAYA 1K4CC 1FFXB 4LFAB 4CZZA 1TGOA 3L75H 3ZRWB 3CRQA 5KLVH 4DR6B 3OEHG 2YEVA 1HR0O 4DV0O 5B1NA 4R7CA 2Z5UA 4DV3O 2R9IA 4RAIA 4ZKIA 5D5PA 1JJ2U 1G8MA 3BAAA 1W0KG 5LA6B 1SESA 2YXYA 2L6LA 1RPRA 1XREA 3CC2V 1XMOO 1RM1B 1F4MA 4J10A 4JZGA 1FD9A 4H33A 4GCZA 1XBLA 5EC1C 3CJHB 1URFA 2XAQA 5J2TA 1J95A 3E89A 4UCSA 1SA0B 3LNMB 2Q4PA 2HHHB 4ZHQA 4NXNO 4O2AB 1AR1B 1THZA 3TGUH 3N2KB 3JALA 4HNAB 5LMNB 1EZVH 1J5EB 4DK1A 4LR3A 2QWPB 3SYAA 5EC2C 3ZJZA 4FLVA 1Q7YW 1K8AW 1SQQH 2ADPA 4JYBA 4K35A 4O2BB 3T2MA 4CC6A 3PJSK 4EKWA 2A79B 1RPOA 1M57B 1Q43A 4FLWA 2XHBA 3ZMTA 3GWKC 5IJ0B 4CH4A 1JPXA 4ZI7A 4DV7O 1I7FA 2NR5A 3G6EV 4X66O 3OW2U 1PP9H 2BSKB 1N33B 4J7KA 3OE7G 1S5LZ 4Z1MG 2Q6AA 2ILMA 2P22C 2WWWA 2HP8A 3GVMA 2PYJA 4LFCB 4DUYO 5C8YA 2ZXWC 3U10A 3ZMUA 1ZTEA 1GN4A 3E8FA 3P3NA 2WLLB 4LF9B 4ICGA 2GBOA 3SPJA 3HKEB 1EFRG 1YVWA 3ASOB 1V55B 1D5NA 5D5QA 3UO3A 1FFXA 2AZ0A 2QTSA 4BWAA 2EIKB 4BW9A 1JOYA 4DR6O 2JGDA 1FXHA 3ABLC 4DR3B 5A2QN 1NJIW 1VQ8V 2OT5A 3CRRA 3T1CA 1IZ3A 3K59A 3HKBB 1DTOA 1VF6A 4KHPO 1KKDA 5LYJB 2C2AA 2XASA 4F6RB 2JK5C 3ZX6A 1I08A 3K58A 3OMAB 3UM7A 3RYCB 1Y4MA 3KG2A 1QR9A 2PUSA 3F5WC 5KA5A 2YS8A 4HZ3A 3L72H 1ZX3A 4AQYO 2YICA 3B8MA 2EIMC 4ABMA 2LGWA 4LH6A 2Y0IA 1H2SB 4JYAO 3ZHRA 1H2MA 4WFGA 5BR8O 2QEXV 2DW4A 4NVPA 2UU9B 4X89A 1P7GA 4X64B 4GLXA 1VMGA 2OIGA 3W7WA 2VQEO 4JYYA 2UUBB 2OWOA 4XDLA 3UO2A 2ITCC 1GKFA 2IW5A 4B3SB 4UUJC 2HLDG 4QGPA 3RBZA 4JI6B 4I50A 3WU2Z 1YTFD 1S72V 4D7SA 4K8XA 4JTAB 3K03A 3QVNA 5JH7B 1S76D 2ITDC 2F23A 1QQCA 2HR3A 3JAWB 2CTWA 1E1RG 4H37A 5ITZB 3RFRA 3F7VC 1XOUA 2F4VB 3QTCA 1BZKA 5JJEB 1G6UA 4KHPB 4YHHB 5LBQA 4P30A 4I4TA 3E35A 2P4KA 4G2KA 3SPGA 3G80A 2H94A 5DN6G 2LO1A 3TXSA 3W7XA 3LSSA 2RCVA 1SC5B 4I9QA 3BA9A 1NKDA 1OJHA 1K7DA 3RVYA 3N2GB 2NNUA 1R6KA 1SS3A 2GHYA 4PDVA 3HKCA 3OTOO 4EFBA 4MVQA 1PNLA 1SKVA 3CCLV 3KCYA 1MA1A 2DYRC 1WP8A 4DV5O 1L8DA 4LF6O 5ITZA 3FD9A 5H6QA 2ZR2A 4JASA 1VF5B 1IBMB 4W4KA 3B4SA 4DV7B 4GUNA 3ABTA 4DR4B 1VARA 3CC4V 2GTSA 1IDSA 3K06A 4JI0B 5FL7G 5DM6V 2WLHA 4FLXA 1TVKB 4E2LA 1XNQO 1JCHA 5IWAB 2EULA 4H44B 2WLIA 1FKAO 1M57C 3VQVA 1XL4A 4JI1O 1S3JA 2F1MA 1F4NA 2DN9A 5GW7A 3D3QA 3HB3B 4I55A 1AI6A 5CA1B 4JV5O 2UXNA 2XTAA 1B04A 4TUYB 2R72A 2UXXA 1BT8A 3TETA 2W0FC 3RYCA 2X6CA 4FFBB 5B3SB 1V54C 2K9PA 3CPWU 3CEIA 2BTOA 2DJVA 3AG4C 1R3JC 1IBLB 3L71H 4GKJO 4YY3B 3CX5F 4FK5C 5CB4A 2YIBA 3L9DA 4UVBA 4KL1A 3WB2A 1RM1C 2JJ2G 3IGAC 2ZDIA 1Q6IA 1R6TA 3T1YO 3ZN0A 3O9OA 3CMEV 4UXNA 1JX9A 4TT3G 2DMXA 4K3AA 4X20A 3AK2A 3OEEG 4TSFG 1XNRB 5BMVA 1YJNV 2EZPA 5LHGA 4X62O 3HKCB 4TV9A 2UUAB 2RNBA 3Q4HB 1M5IA 3N2GA 1SQPH 1KYOF 1WP7A 5LHIA 4QPJA 4NKGB 2R70A 4MVSA 2CGNA 3QG5A 2FB5A 4P2ZA 4GKKB 2XAGA 4B3TB 2UXCB 3CSXA 4ZOLB 4MS2A 2PF4E 3CB2A 1KP2A 3JARA 3UT5B 3CCUV 3EHBB 1AP6A 5IYZA 3K5MA 1KKCA 5H5NA 3CCEV 1Q8IA 2X6BA 5B1BB 5J9PC 5IJ0A 4RUFA 1VF7A 1FAFA 1YSCA 1I5YA 2E76B 1H2KA 1GN2A 2ZE8A 2WLNA 4XBFA 2FL4A 4HNAA 1RP3B 3KZIZ 4CH5A 5EYPA 3S3WA 4PI0A 5LGTA 4YJ2A 1BS3A 3BY6A 1SA0A 4NTXA 1LNQA 4FFKA 4DO2A 4GT1A 1D5AA 2X7RB 1YITV 2WAMA 1K33A 3G67A 1SQXH 2Z3YA 4OGQB 1BHAA 1Q6HA 2P5OA 1FXKB 1VQNV 1LR1A 2RN9A 5J2UA 1HDJA 3UKMA 1P49A 1TAEA 2BOBC 3RYIA 2GSMB 2D3OW 1WA8A 4PJ0Z 3FB7C 1WNSA 3BCCH 1ZSPA 5IY5B 1OCZC 1Z2GA 4B7KA 1ZWIC 2EIKC 1G1XB 3GB7C 4MTFA 3ZRSA 2QGNA 1NTZH 1XNQB 2OTJV 4WBNB 1V55C 3M7MX 2CE4A 2IJKA 2PY5A 3G4SV 3CCVV 5JWPA 1WN7A 1HNWO 3EVKA 4JAAA 4YIPA 1X4TA 1VQ6V 2QWRB 2GUZA 2UXCO 1GM7A 1CPYA 4PHZA 3APOA 3C3SA 3W7TA 1WB7A 2ZKOA 2DYSC 3B2EE 2ZXWB 3A0RA 1A32A 1EN6A 2OCCC 4JZ2A 1SQGA 4U3JA 3T4ZA 3MHSC 2QM4A 1SQFA 1Y74A 2LW7A 4L8JA 1GMGA 1H2GA 4IT5A 3RGBA 3DGEA 4GX0A 1FFTB 1RSOA 5L3GA 3OD4A 3HR0A 4DV3B 5L3DA 1N34O 4IYIA 1HR0B 5LMNO 1IBKB 2P7TC 2Q9LA 4U3JB 3MHHC 1H2NA 1BE3H 2IJJA 3JSLA 5L3FA 4CS3A 4BIOA 1NI8A 2VQEB 4X88A 1ZAUA 2GUZB 1XMOB 4LC1A 1MMMA 3B8NA 3ABMC 3CYOA 4N21A 3K5OA 4QE7A 5E79Z 4PA4A 2VRZA 1WPBA 1K97A 1OCZB 2UXDO 3JASA 4GX5A 4YY3O 4B3MO 3UT5A 4TQFA 4FM2A 3ZHTA 3R66A 4LFBO 3QO5A 4F4LA 3DXRA 4H13B 4XDJA 3JCUZ 1I0HA 5JQGA 5J2UB 4LP8A 1XHXA 4YJ3B 3E83A 2AXTZ 1M56B 4KXRA 2JGUA 4LH7A 4FLYA 4PV1B 4X8AA 1Q82W 1XMQB 2E74B 1B06A 3CCSV 1DF4A 5B5EZ 5EZYB 4O2AA 2F43G 2ARHA 2R9AA 5EYPB 1Q81W 2YUAA 2CDYA 1OCCC 2RDCA 1GN6A 1BL8A 4JI2B 1EN5A 2QTOA 1NR7A 1L0NH 4UB6Z 3BA8A 2LFSA 1K9MW 1FJGB 1MZFA 4PDLA 2XUMA 2Y69C 3JCZA 3DC5A 4OPAA 1K73W 5LGNA 4DUYB 3E8BA 1B3QA 1YXBA 2D2CB 5JVDB 4RO2A 5EIBD 4O4HA 3IJ4A 4PDMA 1HW7A 4X1IA 2JS3A 2PI5A 4IIJA 2YEVB 1FS0G 1TA8A 3LUTB 3JD2A 1XL6A 2Q0OC 2L35A 3E2EA 3B40A 3K3WA 1D2DA 4GYCB 2Q7EA 5BY1A 3RW0A 3IC7A 4DUZO 2EJRA 1AR5A 4J11A 2IU0A 2ADQB 3NXSA 4ASUG 1XUQA 3SPHA 4LNUA 3SJAC 5EBWC 2H8PC 3JSNA 1BGYH 1XDCA 2KSDA 3ZRVA 5BZBA 4JI7O 1SQVH 4X66B 4R50A 4YIOA 4NXNB 3ZEDA 1QU7A 1AJNA 3HKEA 3K08A 1V54B 5B3SC 3CCJV 5KMGB 3CCRV 1W59A 2CH7A 3CP1A 4U3FH 2QSAA 2UUBO 1QLNA 1AVMA 1GH6A 2N74A 2WSSG 4BW5A 2A06H 3DTUB 5IYDO 1VP7A 4O4HB 5CA1A 1FPOA 3CD6V 4RQEA 2AHZA 4IL6Z 1Y66A 4K0KO 3B77A 2JDIG 1V9PA 1VQLV 3VOUA 3ZRXA 2QDOA 2F93B 3ZHQA 4UVAA 1WA8B 2HFEC 1GM9A 2DOSA 2FMLA 3FYEB 4UVCA 4QPKA 4FPPA 3D8CA 2IJHA 3X2QB 2P4VA 3HKBA 2EILC 1K5SA 4MTXA 4DR1B 1BMFG 3S3XA 3HPLC 1OCRB 4TV8A 4TV8B 2DYRB 2CTPA 1P7BA 3OFNG 2Q0AA 2GDSA 4CH6A 3C3TA 3E8HA 4JPRA 4DV0B 4WFAV 4DV4O 4U7NA 3CJHA 3LDCA 2Y4TA 1VEWA 5C8YB 2A9HA 1H8EG 1HNXB 4JI4B 3H01A 4CBCA 3TXQA 3N27A 4WFEA 2ETNA 3JARB 5JJNB 3JASB 1NH2B 2LFRA 1LUVA 2BSKA 4HYOA 1QR8A 2DWEC 4XDKA 4JV5B 1KBHA 3SYCA 3TK1A 2VS0A 3WB1A 2G38A 4D6TH 1KUQA 3K57A 2RQ6A 4MVOA 4JYAB 3M99B 3VQXA 2PGGA 3ICXA 1VQKV 2JVDA 4X65O 2BTQA 4G28B 3SR2C 2DE0X 4CC5A 4PELA 5AG2A 1K3EA 3VQWA 5CBFA 4JI3B 3H1IH 5J2TB 2QJ1A 3T1HO 3CXCU 4L87A 1FYJA 3FX7A 1E79G 3GWOA 1K4DC 4P9PA 1L1FA 5KHIA 3QF7A 4YXWG 4TOIA 4B08A 3SPIA 1DLBA 5GTIZ 1YF2A 4MTGA 4X1YB 1N8RW 4BAYA 1AP5A 2CK3G 4JYCA 3H1KH 2CGOA 3AK1A 4MVZA 4X9QA 4DR5B 5DEDA 2ODMA 4PA3A 3SJCC 4WBNA 4I55B 3JD4A 1PNKA 4LCUC 4OXSA 2JIZG 2ZT9B 5LHHA 2LGQA 2WLIB 3LNNA 1ZLZA 4LF8B 2JJ1G 4QE9A 3HKDB 5LYJA 4QIWF 2R9RB 4FVMA 4I7ZB 3U0ZA 4NXMB 2E3CA 4X65B 3OT7A 5FPRA 5KHGA 1K34A 5H2FZ 3ASOC 4I0XB 4I0XA 4CH3A 1GM8A 2VWKA 3F5TA 3CXHF 5CN0A 3A0HZ 5C93A 1KB9F 1GTOA 2XAHA 3L74H 2EZOA 2YI8A 2AZ2A 3T1HB 1ZL8B 3ML0A 4YJ3A 4J80A 5E1AC 2P90A 3HKDA 4FIPC 2P67A 3CCQV 1Z5VA 1AROP 1QLEB 1NQTA 2XOKG 2ZNJA 1QBZA 4AHCA 4JI7B 4UFZA 2NN4A 2QKSA 3ETGA 5LA6A 2EINB 2IH3C 3ETDA 1O9GA 2DQ3A 3ZHSA 4EB6A 3A0BZ 2EX3A 4JI1B 1UFIA 3OTOB 4X1KA 1GN3A 3ZS8C
chains in the Genus database with same CATH topology
2IU3A 4JAVA 3E8FA 2HVJC 3MHHC 2WLLB 1PKXA 2IJJA 2QE7G 3LDEA 4UV9A 5L3FA 1WPXA 3SPJA 1JVMA 4X88A 3CC7V 4LC1A 1EFRG 2Q68A 3K0GA 3ASOB 1V55B 3FB6C 3AG2B 1YHQV 1PNMA 3OR7C 1Q86W 2X0LA 3B8NA 3ABMC 3CYOA 1GK9A 2WLJA 4N21A 1P4RA 4QE7A 2EIKB 2HVKC 4PA4A 1JOYA 4FMTA 2XNDG 1K97A 1OCZB 1FXHA 3ABLC 4GX5A 1NJIW 1GO3F 3QNEA 1VQ8V 2OT5A 3T1CA 2JEXA 3QO5A 4F4LA 1DTOA 1NVPB 1KKDA 4JTCB 4N23A 2C2AA 2DWDC 4XDJA 2XASA 1QVGU 2XAFA 3ABKB 3AEIA 2JK5C 2QM8A 3FYIB 2LP7A 4LP8A 2Q67A 3OMAB 3ZIAG 3E83A 1MOFA 5H9CA 3UM7A 1M56B 1Y4MA 3KG2A 4G27B 3CCMV 1QR9A 3F5WC 5KA5A 4X8AA 4HZ3A 1CEZA 2EIJB 1ORQC 4FJCC 1Q82W 4PA7A 4JF3A 4TWKA 3B8MA 1R6NA 3CCSV 1DF4A 2EIMC 4MTOA 1NVPD 2F43G 5B1AB 1K92A 1Q81W 4WFGA 2QEXV 1VQPV 2DW4A 1WLEA 1OCCC 4MW8A 1H8HG 1BL8A 4X89A 3OMNB 4PA6A 2QA4V 2QTOA 1NR7A 3W7WA 3SJQC 3QO8A 4R6ZA 3W7SA 2LFSA 1K9MW 3FB5C 4MSWC 4PDLA 3IFXA 2Y69C 4XDLA 2HJFC 2ZDIC 3JCZA 2ITCC 1B6QA 1SRYA 1CP9A 1G4YB 1K73W 4BIUA 1GKFA 5LGNA 3E8BA 2IW5A 2A0LA 3ZCCA 4WFFA 4UUJC 3OUSA 5L3CA 1S77D 2HLDG 3ETEA 4RO2A 5CA3A 5EBLC 4PDMA 1OCOB 3RBZA 5HFMA 1YTFD 1OCCB 1S72V 1QCEA 4JTAB 3JD0A 3K03A 1MG1A 5L3EA 4J9YB 1S76D 2ITDC 2HR3A 3K0DA 2PI5A 1PD3A 1E1RG 1KECA 2YEVB 4H37A 1SERA 2MK3A 1FS0G 3LSQA 3MD0A 3F7VC 2EIMB 1M9NA 4GX2A 4WF9V 3LUTB 3JD2A 2B1GA 1VQMV 5CBHA 1XL6A 1NH2D 3E2EA 3OUFA 2EIJC 3K3WA 1OZ0A 4JGSA 3RW0A 3IC7A 1M56C 1I5XA 2EJRA 3ZN1A 5LBQA 4P30A 2IU0A 1PL0A 5KUKA 2ZQMA 3E8GA 2ZD9A 3NXSA 4JTDB 1AJQA 1COWG 4ASUG 3P30A 3WG7B 3E35A 5B1OA 4G2KA 3SPHA 4KP4A 3SPGA 2V1DA 2H94A 5DN6G 4HAMA 1AI5A 5EBWC 2H8PC 3ASNC 3W7XA 1HWYA 3LSSA 5BZBA 3ZRVA 4PDRA 1R73A 1NKDA 2HG5C 4R50A 3OMIB 1K7DA 3K04A 3ABLB 3RVYA 1W2BU 2NNUA 1AJNA 3K08A 1R6KA 2GHYA 3JD3A 1V54B 4PDVA 5B3SC 3CCJV 3ABMB 3ZMZA 3CCRV 1S5HC 2WPDG 3FKSG 4MVRA 1YJWV 4MVQA 4MVMA 2WLLA 1PNLA 1IXMA 3CP1A 3CCLV 3OGCC 1QLNA 2DYRC 3AG3B 5IYBO 2WSSG 3ZMVA 4BW5A 1K5QA 3DTUB 5IYDO 2EILB 1JQ0A 5H6QA 5KUMA 3CD6V 4RQEA 2AHZA 1M90W 1Y66A 2ZR2A 3CMAV 4JASA 3G71V 3B77A 4Q20A 1W0JG 3AG1B 2Q69A 3QO7A 4U7OA 2JDIG 3R65A 3ABTA 1F51A 5EK0A 3D36A 3VOUA 1VQLV 3CC4V 1YIJV 3ZRXA 1YJ9V 4RUEA 1KQSU 2BOCC 4PA9A 3K06A 1TUEB 3JD1A 5EBMC 3JYCA 4UVAA 5HFLA 2HFEC 5FL7G 1GM9A 2WLHA 5DM6V 1S0VA 4E2LA 2WLMA 1SETA 4MVUA 3FYEB 4KFMA 4WFHA 1JCHA 1DF5A 3OR6C 4UVCA 4J9ZB 2DQ0A 4QPKA 4QJFB 4FPPA 2WLIA 3SYOA 1H38A 1KD1W 2IJHA 3X2QB 2YSUB 3AG1C 2P6JA 1M57C 1XL4A 2K1EA 2OCCB 1S3JA 2EILC 2DYSB 1K5SA 1F4NA 1SZTA 3F7YC 4MTXA 5GW7A 3HB3B 1BMFG 3ZMSA 1AI6A 3HPLC 1OCRB 2UXNA 3SYPA 2DYRB 3AG3C 4GX1A 2PI4A 3E86A 1KP3A 1OHHG 2UXXA 4LBEC 1P7BA 3OFNG 4MW3A 2IH1C 3TETA 2W0FC 3E8HA 2X6CA 4JPRA 5B3SB 1V54C 4WFAV 3CPWU 4U7NA 3LDCA 2W6JG 3AG4C 1MABG 1NBMG 1R3JC 5IY5C 4WCEV 2ATKC 4P9OA 5CMUA 4ZBMA 2A9HA 1VQOV 2Y48A 3OM3B 3K79A 3K9AA 1H8EG 3ASNB 3BEHA 4FK5C 2M7WA 3H01A 4CBCA 3W7UA 4UVBA 1NR1A 4WFEA 3WFVA 5LGUA 1RM1C 2OTLV 2JJ2G 3IGAC 1NH2B 2ZDIA 4I9WA 1FXKC 2X6AA 3WG7C 2LFRA 1QVFU 1AI7A 4HYOA 4R8CA 3ZN0A 1QR8A 3CMEV 4UXNA 1FXVA 2DWEC 2EBOA 2WLKA 4XDKA 1JX9A 4TT3G 3SYCA 4KUMA 2ZR3A 3TK1A 1R3IC 3OEEG 4TSFG 1YJNV 5IDJA 2XAJA 1VQ4V 1ROPA 1MSWD 2EZPA 5LHGA 1EZJA 4MVOA 3M99B 1R3LC 1VQ9V 5L3BA 2HKOA 1VQKV 1AJPA 5LHIA 4QPJA 3SYQA 1VQ7V 4G28B 4QNHB 4MVSA 2AHYA 4BIZA 1OCOC 3P32A 4P2ZA 5B1BC 4PELA 2XAGA 1K3EA 5CBFA 3EFFK 4RQFA 2IJIA 4MS2A 3T4DA 2QM7A 1R3KC 1KP2A 3RVZA 1AI4A 1M1KW 1EBOA 2Y69B 3CXCU 3CCUV 3ABUA 1E1QG 3EHBB 3VBBA 4L87A 1UJWB 1VQ5V 3CCEV 1KC8W 2X6BA 1E79G 5B1BB 3GWOA 1K4CC 5J9PC 1K4DC 4P9PA 1FXKA 1L1FA 4CZZA 4YXWG 3SPCA 4RUFA 3ZRWB 4JAUA 2B1IA 3SPIA 1DLBA 1YSCA 3I55V 1I5YA 4MTGA 1F23A 5B1AC 1N8RW 3OEHG 5IYCO 2YEVA 4BAYA 2WLNA 5B1NA 4XBFA 2CK3G 4JYCA 4R7CA 3LDDA 2Z5UA 4DXWA 5LGTA 4MVZA 5KA6A 2KB1A 2R9IA 2B5UA 4RAIA 4ZKIA 3BY6A 4PA3A 1LNQA 1JJ2U 4DO2A 4GT1A 1G8MA 1W0KG 2X7RB 1YITV 4UV8A 3FB8C 2WAMA 3JD4A 1K33A 2W6IG 1PNKA 2Z3YA 1SESA 1BHAA 1FXKB 4LCUC 4OXSA 1RPRA 2JIZG 5LHHA 3ABKC 1VQNV 3CC2V 2WLIB 2V7QG 1RM1B 3OAAG 3UKMA 1F4MA 2BOBC 2JJ1G 2GSMB 4QE9A 2D3OW 4H33A 3TCUA 3FB7C 4QIWF 2R9RB 4GCZA 5EC1C 2XAQA 5IY5B 1J95A 3E89A 1ENVA 3I56V 3AG4B 1OCZC 3LNMB 1ZWIC 2EIKC 5H6RA 3GB7C 4MTFA 3ZRSA 1AR1B 1THZA 4I5SA 1K34A 2OTJV 3AG2C 1V55C 3ASOC 1BHBA 2IJKA 1GM8A 3G4SV 3CCVV 5CN0A 5C93A 1GTOA 1VQ6V 2XAHA 1OCRC 1YTFB 3SYAA 1GM7A 5EC2C 3ZJZA 1Q7YW 2EZOA 1K8AW 1CPYA 3W7TA 3ML0A 4JYBA 3T2MA 2DYSC 3PJSK 2ZXWB 3A0RA 4EKWA 2OCCC 5E1AC 2A79B 1RPOA 2P90A 1M57B 4FIPC 3T4ZA 3MHSC 2NLJC 2P67A 3X2QC 3ZMTA 3CCQV 3ZRWA 1JPXA 1AROP 1QLEB 1GMGA 1H2GA 2EINC 1NQTA 3G6EV 2XOKG 3OW2U 1QBZA 3DGEA 3D3IA 3OE7G 4Z1MG 4GX0A 2QKSA 2Q6AA 3ETGA 5CBGA 1QLEC 1FFTB 2EINB 2IH3C 3ETDA 4MT8A 3STZC 5L3GA 2WWWA 2FTKA 2DQ3A 4WFBV 2JEUA 5L3DA 3STLC 1YI2V 2P7TC 2ZXWC 3ZMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F7Y C;  3SPI A;  4JTA B;  3K03 A;  3E8F A;  4J9Y B;  2HVJ C;  4MTG A;  3HPL C;  2ITD C;  2WLL B;  5B1A C;  3K0D A;  3LDE A;  3SYP A;  2YEV A;  3AG3 C;  4H37 A;  2WLN A;  4GX1 A;  3F7V C;  1JVM A;  3E86 A;  4GX2 A;  4R7C A;  3LDD A;  4X88 A;  3LUT B;  3SPJ A;  4DXW A;  4LBE C;  4MVZ A;  1P7B A;  2KB1 A;  2Q68 A;  3K0G A;  4MW3 A;  2IH1 C;  1XL6 A;  4RAI A;  5CBH A;  3FB6 C;  3TET A;  3OR7 C;  3OUF A;  2W0F C;  3E8H A;  2EIJ C;  2X6C A;  3ABM C;  2WLJ A;  1V54 C;  4PA3 A;  4QE7 A;  1LNQ A;  2HVK C;  4PA4 A;  3LDC A;  3RW0 A;  1M56 C;  3AG4 C;  4P30 A;  5KUK A;  1R3J C;  3ABL C;  3FB8 C;  4GX5 A;  5IY5 C;  2ATK C;  4P9O A;  3T1C A;  3E8G A;  2ZD9 A;  4JTD B;  2A9H A;  4RUF A;  4ZBM A;  4LCU C;  4OXS A;  3SPH A;  3SPG A;  3ABK C;  3BEH A;  4F4L A;  2WLI B;  4CBC A;  3UKM A;  1KKD A;  4JTC B;  2BOB C;  2DWD C;  4XDJ A;  5EBW C;  2H8P C;  4WFE A;  3ASN C;  5BZB A;  4QE9 A;  3IGA C;  4H33 A;  4I9W A;  2JK5 C;  2X6A A;  4PDR A;  3FB7 C;  3TCU A;  2R9R B;  3WG7 C;  2HG5 C;  4R50 A;  4HYO A;  4R8C A;  5EC1 C;  4LP8 A;  2Q67 A;  3K04 A;  1J95 A;  3E89 A;  3E83 A;  2DWE C;  2WLK A;  3LNM B;  1OCZ C;  4XDK A;  3RVY A;  3UM7 A;  3KG2 A;  4G27 B;  3SYC A;  1ZWI C;  2EIK C;  3GB7 C;  3K08 A;  3F5W C;  4MTF A;  1R3I C;  4PDV A;  4X8A A;  3ZRS A;  4HZ3 A;  5B3S C;  1ORQ C;  1S5H C;  3AG2 C;  4PA7 A;  1V55 C;  3ASO C;  4MVR A;  4TWK A;  4MVQ A;  4MVM A;  2WLL A;  4MTO A;  2EIM C;  4MVO A;  3OGC C;  1R3L C;  2DYR C;  1OCR C;  3SYA A;  5EC2 C;  3ZJZ A;  4WFG A;  4BW5 A;  3T2M A;  1OCC C;  2DYS C;  3PJS K;  4MW8 A;  3SYQ A;  4EKW A;  5KUM A;  2OCC C;  5E1A C;  2AHZ A;  2A79 B;  4G28 B;  4QNH B;  4MVS A;  1BL8 A;  4X89 A;  2Q69 A;  2NLJ C;  3T4Z A;  3X2Q C;  4PA6 A;  2AHY A;  1OCO C;  4P2Z A;  2QTO A;  3R65 A;  5B1B C;  5EK0 A;  3SJQ C;  3VOU A;  4R6Z A;  5CBF A;  3EFF K;  2EIN C;  4RUE A;  3FB5 C;  2BOC C;  4MSW C;  4PDL A;  3IFX A;  4PA9 A;  2Y69 C;  4MS2 A;  3K06 A;  2HJF C;  4XDL A;  3T4D A;  1R3K C;  2ITC C;  3RVZ A;  5EBM C;  3JYC A;  1G4Y B;  2HFE C;  2WLH A;  4GX0 A;  2QKS A;  2Q6A A;  5CBG A;  2WLM A;  3E8B A;  1QLE C;  2A0L A;  2IH3 C;  4KFM A;  4MVU A;  3OUS A;  4UUJ C;  4WFF A;  4WFH A;  3OR6 C;  3STZ C;  4J9Z B;  4RO2 A;  2X6B A;  5EBL C;  2WLI A;  4PDM A;  3RBZ A;  3SYO A;  1K4C C;  3AG1 C;  1K4D C;  3STL C;  5J9P C;  4P9P A;  1M57 C;  1XL4 A;  2K1E A;  2P7T C;  3SPC A;  2ZXW C;  2EIL C; 
#chains in the Genus database with same CATH topology
 5B66 Z;  2IU3 A;  1N4C A;  4JAV A;  2HVJ C;  2QE7 G;  3LDE A;  3H9V A;  1WPX A;  1JVM A;  1SZX A;  5GTH Z;  3MAQ A;  3CC7 V;  4LF7 B;  2Q68 A;  3K0G A;  3U11 A;  1IBM O;  4K8Z A;  4TV9 B;  1PNM A;  5A9G A;  4GZR B;  1PPJ H;  1VIB A;  2UXB O;  4DR4 O;  1P4R A;  1NTK H;  1BCC H;  4FMT A;  5LXT A;  5BMV B;  1GO3 F;  2ZNI A;  3B09 A;  3OGI B;  4LNU B;  2JEX A;  5CB4 B;  4AI8 A;  2DWD C;  4J42 A;  1QVG U;  4DV2 O;  1CXZ B;  1KU9 A;  2CAZ C;  2LP7 A;  3FYI B;  4NTW A;  3FAV B;  2Q67 A;  1HNZ B;  2KG7 A;  3ZIA G;  5H9C A;  1MOF A;  4O4L B;  1JFF A;  1M93 A;  4OPH A;  2EIJ B;  1ORQ C;  3K5N A;  2E5L B;  1AR4 A;  4TWK A;  1XI1 A;  3UCS C;  2BE3 A;  4LWS B;  1R6N A;  4MTO A;  3TJT A;  1U97 A;  1K92 A;  2FYU H;  4RWU A;  1WLE A;  4MW8 A;  1EM1 A;  3D36 C;  4X1Y A;  3G6B A;  3OMN B;  2HJD A;  5EIB C;  1BQZ A;  1XEQ A;  3QO8 A;  3FB5 C;  4MSW C;  3IFX A;  1N36 B;  1QHT A;  2HJF C;  2ZDI C;  2VQF B;  1B6Q A;  2XT9 A;  1SRY A;  1G4Y B;  1TUB B;  4WFF A;  4C7U A;  5L3C A;  1S77 D;  3ETE A;  5CA3 A;  1PM9 A;  1OCO B;  1ZUQ A;  1UPG A;  5HFM A;  1OCC B;  4IGG A;  4UCU A;  3JAK B;  1MG1 A;  5LXT B;  4J9Y B;  4FZ1 A;  3K0D A;  2F95 B;  1PD3 A;  1KEC A;  1Q6U A;  3MD0 A;  4GX2 A;  5CA0 B;  3K5L A;  1VQM V;  1NH2 D;  4YHH O;  2EIJ C;  1I94 O;  3BVO A;  1OZ0 A;  4IIJ B;  5KHK A;  2O57 A;  1I5X A;  5KUK A;  1L0L H;  1PL0 A;  4JI3 O;  4EEQ A;  1H2L A;  2F66 C;  2ZQM A;  3E8G A;  4JTD B;  1COW G;  3P30 A;  3WG7 B;  5B1O A;  4OX9 O;  4EB6 B;  4HAM A;  2N04 A;  2W0X A;  2UXB B;  1AI5 A;  4JI6 O;  1HWY A;  4PDR A;  2HG5 C;  1IXB A;  1WJZ A;  4O4I A;  5KX5 B;  3BAB A;  4CS4 A;  2B9Z A;  4AQY B;  4ZI7 B;  3JD3 A;  5FNV B;  2WPD G;  3FKS G;  2E75 B;  1YJW V;  2PTM A;  4DV2 B;  3JAT B;  1IXM A;  3OGC C;  4JI4 O;  2A7W A;  5IYB O;  2PZS A;  4H0L B;  3FFQ A;  4DV5 B;  1M90 W;  1XIL A;  3JAL B;  3QO7 A;  4DK0 A;  4DV6 B;  2FKX A;  5DEC A;  3R65 A;  3D36 A;  4RUE A;  1KQS U;  4PA9 A;  5IJ9 B;  3WB0 A;  3ZHV A;  4UCV A;  5EBM C;  2WLM A;  4IHJ B;  4LFC O;  4KFM A;  1DF5 A;  3OR6 C;  4J9Z B;  2DQ0 A;  4QJF B;  5JCO A;  1AIL A;  3SYO A;  1KD1 W;  2YSU B;  2YDE A;  3AG1 C;  3VQY A;  1MNG A;  1I94 B;  2K1E A;  1X59 A;  3CHX A;  2DYS B;  3F7Y C;  2QWQ B;  1DK1 A;  1S5J A;  5GON B;  1NS1 A;  2YXH A;  3SYP A;  3AG3 C;  4DR7 B;  3E86 A;  4X1I B;  4FZ0 A;  4MW3 A;  2IH1 C;  3J80 N;  1GAX A;  1JFF B;  2H3O A;  3NR7 A;  4B3M B;  2CH7 B;  2Z0A A;  1YEW A;  2KQX A;  3P3P A;  4LFB B;  1MAB G;  1YDX A;  5IY5 C;  3RYI B;  4WCE V;  4B3T O;  2ATK C;  4P9O A;  4ZBM A;  2ZIN A;  1J5E O;  3OM3 B;  2UXD B;  5IJ9 A;  2Y0P A;  3K9A A;  3ASN B;  3BEH A;  4A5U B;  4LF4 O;  3W7U A;  1NR1 A;  1RSO B;  2QKA A;  5LGU A;  3WFV A;  5IE9 A;  3SDL A;  4F6R A;  2OTL V;  2F4V O;  4I9W A;  2X6A A;  5BXZ A;  4NR1 A;  1FXV A;  2EBO A;  2WLK A;  4UCO A;  4B7E A;  4FM1 A;  2VQF O;  4KUM A;  3SGI A;  2BCC H;  2UUC B;  4K0K B;  5JJJ B;  3JAT A;  4X62 B;  4LFA O;  4O4J A;  5IDJ A;  1VQ4 V;  1ROP A;  3AG7 A;  1Y76 A;  2UU9 O;  5L3B A;  2HKO A;  1PV0 A;  2CTQ A;  5BR8 B;  3SYQ A;  3H1H H;  5LP6 B;  1VQ7 V;  4QNH B;  2AHY A;  1OCO C;  4X1K B;  3EFF K;  5LMU O;  1JMK C;  3DXR B;  2IJI A;  3CWB H;  4CS2 A;  1Z5W A;  1O9H A;  2QM7 A;  4TQD A;  1NZ6 A;  1R3K C;  2Q8V A;  3RVZ A;  1AI4 A;  1EBO A;  4DR7 O;  3ABU A;  1E1Q G;  4IYH A;  1VF6 C;  1VQ5 V;  1LUW A;  1KC8 W;  1HP8 A;  2Q73 A;  1YCI A;  1XQ8 A;  1U96 A;  4B3S O;  1FXK A;  1MSD A;  3SPC A;  4JAU A;  2B1I A;  4D7T A;  3E22 B;  3I55 V;  3CS5 A;  1F23 A;  3O65 A;  5B1A C;  1WB8 A;  5IYC O;  4FLU A;  3LDD A;  1N32 B;  4DXW A;  1NT2 B;  5KA6 A;  2KB1 A;  1AB3 A;  4X20 B;  2B5U A;  5IWA O;  3K9S A;  4ZIB A;  1WAZ A;  2YIA A;  3FB8 C;  4UV8 A;  2W6I G;  3ABK C;  2E5L O;  2V7Q G;  2V4D A;  3OAA G;  5IYZ B;  2RMK B;  2ZIO A;  1US6 A;  3JAM N;  3RYF B;  4DV6 O;  3TCU A;  1N32 O;  1ENV A;  3I56 V;  2ZCE A;  3AG4 B;  3J81 N;  5H6R A;  1BQ0 A;  4I5S A;  5F2V O;  1NU1 H;  5LL6 Y;  2QKC A;  3AG2 C;  2HHH O;  1BHB A;  4F6E A;  5KHJ A;  1OCR C;  1YTF B;  1GRJ A;  1HNW B;  1RFY A;  2KG7 B;  4PI2 A;  4LF8 O;  4LF5 B;  5KMG A;  4DV1 O;  2NLJ C;  2ZE5 A;  3X2Q C;  4IHJ A;  2RJZ A;  3ZRW A;  4DV4 B;  2EIN C;  2GV9 A;  3RYH B;  3D3I A;  5KHH A;  5CBG A;  2Q7H A;  1QLE C;  4MT8 A;  3STZ C;  2JGD B;  4Z1V A;  1Q90 D;  2FTK A;  1HNX O;  4WFB V;  2JEU A;  2M6Y A;  3STL C;  1YI2 V;  1SF9 A;  4NB5 A;  4J7J A;  1PKX A;  3ETQ A;  4UV9 A;  2BTQ B;  3CRC A;  2YID A;  3E22 A;  3DC6 A;  4OX9 B;  3FB6 C;  2VWJ A;  3AG2 B;  1YHQ V;  3OR7 C;  1Q86 W;  2X0L A;  3CRA A;  1GK9 A;  2WLJ A;  2YC0 A;  1IUR A;  2HVK C;  5KX5 A;  2AGA A;  4NYK A;  2XND G;  2MW2 B;  4HBN A;  3QNE A;  3SJB C;  4DW1 A;  4AIL C;  4X64 O;  4ZOL A;  3BFR A;  1NVP B;  4JTC B;  4N23 A;  3RYF A;  1M4U A;  2XAF A;  3ABK B;  1IVS A;  4EFE A;  3EXA A;  3AEI A;  2QM8 A;  2ZE6 A;  4DV1 B;  2OYQ A;  2AW9 A;  1ZL8 A;  3AK3 A;  3CCM V;  3Q4H A;  4G27 B;  1Y76 B;  1KMI Z;  5TIS Z;  1CEZ A;  4FJC C;  5FLX N;  4LF5 O;  1OV9 A;  4PA7 A;  3ZBH A;  4JF3 A;  2QWN B;  4JI0 O;  3N2K A;  5JH7 A;  1NVP D;  3UQ8 A;  2OIE A;  4YJ2 B;  5B1A B;  1VQP V;  4I50 B;  4DR2 B;  4GKJ B;  3KCX A;  2WA3 A;  1H8H G;  5FNV A;  2YI9 A;  3C90 A;  4PA6 A;  2QA4 V;  4LF6 B;  4B3R B;  2WA4 A;  3SJQ C;  4R6Z A;  3CRM A;  3W7S A;  3RN4 A;  4DYL A;  4O4I B;  1CP9 A;  1Y6X A;  4NTY A;  4J41 A;  4BIU A;  1DGS A;  2A0L A;  3ZCC A;  4LF9 O;  3OUS A;  5LOV B;  2YIB D;  5EBL C;  4LF7 O;  1F7Y A;  2Q5Z A;  2ZM6 B;  4FFB A;  1IBL O;  1SQB H;  5LP6 C;  4DRX B;  1QCE A;  5L3E A;  3JD0 A;  4J7Z A;  2Y4U A;  3OTF A;  5K1P A;  1SER A;  2MK3 A;  3LSQ A;  4B3R O;  2EIM B;  1M9N A;  4WF9 V;  1R1B A;  1T5E A;  4JI5 O;  2B1G A;  5CBH A;  4BR6 A;  3OUF A;  3A2F A;  1Q3E A;  4O4J B;  4JGS A;  3L70 H;  1M56 C;  3ZN1 A;  2CUG A;  5LMU B;  1TVK A;  3APQ A;  2ZD9 A;  1AJQ A;  2ZM6 O;  4JI2 O;  4KP4 A;  1QNM A;  2V1D A;  3THO A;  4DR2 O;  3ASN C;  1N33 O;  1R73 A;  2Q7G A;  3CE2 A;  1XHZ A;  3OMI B;  4FLT A;  3A8T A;  3ABL B;  3K04 A;  2P06 A;  1BSM A;  4GKK O;  1W2B U;  4FLZ A;  4JI8 O;  4NXM O;  3ABM B;  3ZMZ A;  1S5H C;  4MVR A;  1N34 B;  2PYL A;  1Y67 A;  4MVM A;  2WLL A;  2IM9 A;  1N36 O;  3T1Y B;  3AG3 B;  4LF4 B;  4Z2W A;  3ZMV A;  4TUY A;  4LWS A;  1K5Q A;  3ZHU A;  2LQT A;  1JJO A;  2EIL B;  1JQ0 A;  3IC9 A;  5KUM A;  5K1X A;  5LOV A;  3CMA V;  2JRI A;  1XNR O;  3G71 V;  5KAF Z;  4Q20 A;  5GON A;  1W0J G;  3AG1 B;  2JS5 A;  2Q69 A;  4U7O A;  4DRX A;  1F51 A;  5EK0 A;  1YIJ V;  2LW1 A;  1YJ9 V;  2BOC C;  2EJ7 A;  2UUA O;  2UUC O;  3FAV A;  1TUE B;  4JI8 B;  2IBZ H;  3JD1 A;  5JVD A;  1S0V A;  3JYC A;  5HFL A;  2ZIM A;  4I4T B;  4UCT A;  2CTR A;  1SET A;  5FPO A;  4MVU A;  2HEP A;  4DR3 O;  1N0J A;  4WFH A;  4FM0 A;  4DR5 O;  4JI5 B;  4UB8 Z;  1H38 A;  2P6J A;  1YZB A;  1Q5O A;  2OCC B;  5IT9 N;  3BHP A;  3LSU A;  2QWO B;  1SZT A;  3I5D A;  2QR4 A;  3BPZ A;  3KKY A;  1PL4 A;  5CA0 A;  1IX9 A;  3ZMS A;  3J7A U;  1IBK O;  1P84 F;  3H1L H;  4GX1 A;  2KKW A;  2PI4 A;  4W4L A;  1KP3 A;  1OHH G;  3JAK A;  4LBE C;  4ZHQ B;  4DUZ B;  2N05 A;  5EZY A;  2ZE7 A;  4DW0 A;  3RWR D;  3DSQ A;  2W6J G;  4UCR A;  1NBM G;  3L73 H;  5JQG B;  3PN1 A;  5CMU A;  1VQO V;  2Y48 A;  3K79 A;  2M7W A;  1N0N A;  4Q6G A;  3WG7 C;  1FXK C;  4E4E A;  1HNZ O;  1QVF U;  1AI7 A;  4R8C A;  2ZR3 A;  1R3I C;  3RT3 C;  5LP6 A;  2XAJ A;  1MZE A;  2LJ2 A;  4O2B A;  1XMQ O;  1MSW D;  2A3Q A;  1EZJ A;  1JR9 A;  2OCH A;  1R3L C;  5KAI Z;  1VQ9 V;  2GTA A;  4O4L A;  1AJP A;  3H1J H;  3JAW A;  2YXL A;  1FJG O;  4BIZ A;  3MDS A;  3P32 A;  3M8A A;  5B1B C;  1EN4 A;  3RYH A;  4RQF A;  3T4D A;  4PD4 F;  1M1K W;  1Y74 B;  5JCO C;  2Y69 B;  1TUB A;  3VBB A;  1UJW B;  1NTM H;  3BRC A;  1JA8 A;  4DR1 O;  3IAY A;  1K4C C;  1FFX B;  4LFA B;  4CZZ A;  1TGO A;  3L75 H;  3ZRW B;  3CRQ A;  5KLV H;  4DR6 B;  3OEH G;  2YEV A;  1HR0 O;  4DV0 O;  5B1N A;  4R7C A;  2Z5U A;  4DV3 O;  2R9I A;  4RAI A;  4ZKI A;  5D5P A;  1JJ2 U;  1G8M A;  3BAA A;  1W0K G;  5LA6 B;  1SES A;  2YXY A;  2L6L A;  1RPR A;  1XRE A;  3CC2 V;  1XMO O;  1RM1 B;  1F4M A;  4J10 A;  4JZG A;  1FD9 A;  4H33 A;  4GCZ A;  1XBL A;  5EC1 C;  3CJH B;  1URF A;  2XAQ A;  5J2T A;  1J95 A;  3E89 A;  4UCS A;  1SA0 B;  3LNM B;  2Q4P A;  2HHH B;  4ZHQ A;  4NXN O;  4O2A B;  1AR1 B;  1THZ A;  3TGU H;  3N2K B;  3JAL A;  4HNA B;  5LMN B;  1EZV H;  1J5E B;  4DK1 A;  4LR3 A;  2QWP B;  3SYA A;  5EC2 C;  3ZJZ A;  4FLV A;  1Q7Y W;  1K8A W;  1SQQ H;  2ADP A;  4JYB A;  4K35 A;  4O2B B;  3T2M A;  4CC6 A;  3PJS K;  4EKW A;  2A79 B;  1RPO A;  1M57 B;  1Q43 A;  4FLW A;  2XHB A;  3ZMT A;  3GWK C;  5IJ0 B;  4CH4 A;  1JPX A;  4ZI7 A;  4DV7 O;  1I7F A;  2NR5 A;  3G6E V;  4X66 O;  3OW2 U;  1PP9 H;  2BSK B;  1N33 B;  4J7K A;  3OE7 G;  1S5L Z;  4Z1M G;  2Q6A A;  2ILM A;  2P22 C;  2WWW A;  2HP8 A;  3GVM A;  2PYJ A;  4LFC B;  4DUY O;  5C8Y A;  2ZXW C;  3U10 A;  3ZMU A;  1ZTE A;  1GN4 A;  3E8F A;  3P3N A;  2WLL B;  4LF9 B;  4ICG A;  2GBO A;  3SPJ A;  3HKE B;  1EFR G;  1YVW A;  3ASO B;  1V55 B;  1D5N A;  5D5Q A;  3UO3 A;  1FFX A;  2AZ0 A;  2QTS A;  4BWA A;  2EIK B;  4BW9 A;  1JOY A;  4DR6 O;  2JGD A;  1FXH A;  3ABL C;  4DR3 B;  5A2Q N;  1NJI W;  1VQ8 V;  2OT5 A;  3CRR A;  3T1C A;  1IZ3 A;  3K59 A;  3HKB B;  1DTO A;  1VF6 A;  4KHP O;  1KKD A;  5LYJ B;  2C2A A;  2XAS A;  4F6R B;  2JK5 C;  3ZX6 A;  1I08 A;  3K58 A;  3OMA B;  3UM7 A;  3RYC B;  1Y4M A;  3KG2 A;  1QR9 A;  2PUS A;  3F5W C;  5KA5 A;  2YS8 A;  4HZ3 A;  3L72 H;  1ZX3 A;  4AQY O;  2YIC A;  3B8M A;  2EIM C;  4ABM A;  2LGW A;  4LH6 A;  2Y0I A;  1H2S B;  4JYA O;  3ZHR A;  1H2M A;  4WFG A;  5BR8 O;  2QEX V;  2DW4 A;  4NVP A;  2UU9 B;  4X89 A;  1P7G A;  4X64 B;  4GLX A;  1VMG A;  2OIG A;  3W7W A;  2VQE O;  4JYY A;  2UUB B;  2OWO A;  4XDL A;  3UO2 A;  2ITC C;  1GKF A;  2IW5 A;  4B3S B;  4UUJ C;  2HLD G;  4QGP A;  3RBZ A;  4JI6 B;  4I50 A;  3WU2 Z;  1YTF D;  1S72 V;  4D7S A;  4K8X A;  4JTA B;  3K03 A;  3QVN A;  5JH7 B;  1S76 D;  2ITD C;  2F23 A;  1QQC A;  2HR3 A;  3JAW B;  2CTW A;  1E1R G;  4H37 A;  5ITZ B;  3RFR A;  3F7V C;  1XOU A;  2F4V B;  3QTC A;  1BZK A;  5JJE B;  1G6U A;  4KHP B;  4YHH B;  5LBQ A;  4P30 A;  4I4T A;  3E35 A;  2P4K A;  4G2K A;  3SPG A;  3G80 A;  2H94 A;  5DN6 G;  2LO1 A;  3TXS A;  3W7X A;  3LSS A;  2RCV A;  1SC5 B;  4I9Q A;  3BA9 A;  1NKD A;  1OJH A;  1K7D A;  3RVY A;  3N2G B;  2NNU A;  1R6K A;  1SS3 A;  2GHY A;  4PDV A;  3HKC A;  3OTO O;  4EFB A;  4MVQ A;  1PNL A;  1SKV A;  3CCL V;  3KCY A;  1MA1 A;  2DYR C;  1WP8 A;  4DV5 O;  1L8D A;  4LF6 O;  5ITZ A;  3FD9 A;  5H6Q A;  2ZR2 A;  4JAS A;  1VF5 B;  1IBM B;  4W4K A;  3B4S A;  4DV7 B;  4GUN A;  3ABT A;  4DR4 B;  1VAR A;  3CC4 V;  2GTS A;  1IDS A;  3K06 A;  4JI0 B;  5FL7 G;  5DM6 V;  2WLH A;  4FLX A;  1TVK B;  4E2L A;  1XNQ O;  1JCH A;  5IWA B;  2EUL A;  4H44 B;  2WLI A;  1FKA O;  1M57 C;  3VQV A;  1XL4 A;  4JI1 O;  1S3J A;  2F1M A;  1F4N A;  2DN9 A;  5GW7 A;  3D3Q A;  3HB3 B;  4I55 A;  1AI6 A;  5CA1 B;  4JV5 O;  2UXN A;  2XTA A;  1B04 A;  4TUY B;  2R72 A;  2UXX A;  1BT8 A;  3TET A;  2W0F C;  3RYC A;  2X6C A;  4FFB B;  5B3S B;  1V54 C;  2K9P A;  3CPW U;  3CEI A;  2BTO A;  2DJV A;  3AG4 C;  1R3J C;  1IBL B;  3L71 H;  4GKJ O;  4YY3 B;  3CX5 F;  4FK5 C;  5CB4 A;  2YIB A;  3L9D A;  4UVB A;  4KL1 A;  3WB2 A;  1RM1 C;  2JJ2 G;  3IGA C;  2ZDI A;  1Q6I A;  1R6T A;  3T1Y O;  3ZN0 A;  3O9O A;  3CME V;  4UXN A;  1JX9 A;  4TT3 G;  2DMX A;  4K3A A;  4X20 A;  3AK2 A;  3OEE G;  4TSF G;  1XNR B;  5BMV A;  1YJN V;  2EZP A;  5LHG A;  4X62 O;  3HKC B;  4TV9 A;  2UUA B;  2RNB A;  3Q4H B;  1M5I A;  3N2G A;  1SQP H;  1KYO F;  1WP7 A;  5LHI A;  4QPJ A;  4NKG B;  2R70 A;  4MVS A;  2CGN A;  3QG5 A;  2FB5 A;  4P2Z A;  4GKK B;  2XAG A;  4B3T B;  2UXC B;  3CSX A;  4ZOL B;  4MS2 A;  2PF4 E;  3CB2 A;  1KP2 A;  3JAR A;  3UT5 B;  3CCU V;  3EHB B;  1AP6 A;  5IYZ A;  3K5M A;  1KKC A;  5H5N A;  3CCE V;  1Q8I A;  2X6B A;  5B1B B;  5J9P C;  5IJ0 A;  4RUF A;  1VF7 A;  1FAF A;  1YSC A;  1I5Y A;  2E76 B;  1H2K A;  1GN2 A;  2ZE8 A;  2WLN A;  4XBF A;  2FL4 A;  4HNA A;  1RP3 B;  3KZI Z;  4CH5 A;  5EYP A;  3S3W A;  4PI0 A;  5LGT A;  4YJ2 A;  1BS3 A;  3BY6 A;  1SA0 A;  4NTX A;  1LNQ A;  4FFK A;  4DO2 A;  4GT1 A;  1D5A A;  2X7R B;  1YIT V;  2WAM A;  1K33 A;  3G67 A;  1SQX H;  2Z3Y A;  4OGQ B;  1BHA A;  1Q6H A;  2P5O A;  1FXK B;  1VQN V;  1LR1 A;  2RN9 A;  5J2U A;  1HDJ A;  3UKM A;  1P49 A;  1TAE A;  2BOB C;  3RYI A;  2GSM B;  2D3O W;  1WA8 A;  4PJ0 Z;  3FB7 C;  1WNS A;  3BCC H;  1ZSP A;  5IY5 B;  1OCZ C;  1Z2G A;  4B7K A;  1ZWI C;  2EIK C;  1G1X B;  3GB7 C;  4MTF A;  3ZRS A;  2QGN A;  1NTZ H;  1XNQ B;  2OTJ V;  4WBN B;  1V55 C;  3M7M X;  2CE4 A;  2IJK A;  2PY5 A;  3G4S V;  3CCV V;  5JWP A;  1WN7 A;  1HNW O;  3EVK A;  4JAA A;  4YIP A;  1X4T A;  1VQ6 V;  2QWR B;  2GUZ A;  2UXC O;  1GM7 A;  1CPY A;  4PHZ A;  3APO A;  3C3S A;  3W7T A;  1WB7 A;  2ZKO A;  2DYS C;  3B2E E;  2ZXW B;  3A0R A;  1A32 A;  1EN6 A;  2OCC C;  4JZ2 A;  1SQG A;  4U3J A;  3T4Z A;  3MHS C;  2QM4 A;  1SQF A;  1Y74 A;  2LW7 A;  4L8J A;  1GMG A;  1H2G A;  4IT5 A;  3RGB A;  3DGE A;  4GX0 A;  1FFT B;  1RSO A;  5L3G A;  3OD4 A;  3HR0 A;  4DV3 B;  5L3D A;  1N34 O;  4IYI A;  1HR0 B;  5LMN O;  1IBK B;  2P7T C;  2Q9L A;  4U3J B;  3MHH C;  1H2N A;  1BE3 H;  2IJJ A;  3JSL A;  5L3F A;  4CS3 A;  4BIO A;  1NI8 A;  2VQE B;  4X88 A;  1ZAU A;  2GUZ B;  1XMO B;  4LC1 A;  1MMM A;  3B8N A;  3ABM C;  3CYO A;  4N21 A;  3K5O A;  4QE7 A;  5E79 Z;  4PA4 A;  2VRZ A;  1WPB A;  1K97 A;  1OCZ B;  2UXD O;  3JAS A;  4GX5 A;  4YY3 O;  4B3M O;  3UT5 A;  4TQF A;  4FM2 A;  3ZHT A;  3R66 A;  4LFB O;  3QO5 A;  4F4L A;  3DXR A;  4H13 B;  4XDJ A;  3JCU Z;  1I0H A;  5JQG A;  5J2U B;  4LP8 A;  1XHX A;  4YJ3 B;  3E83 A;  2AXT Z;  1M56 B;  4KXR A;  2JGU A;  4LH7 A;  4FLY A;  4PV1 B;  4X8A A;  1Q82 W;  1XMQ B;  2E74 B;  1B06 A;  3CCS V;  1DF4 A;  5B5E Z;  5EZY B;  4O2A A;  2F43 G;  2ARH A;  2R9A A;  5EYP B;  1Q81 W;  2YUA A;  2CDY A;  1OCC C;  2RDC A;  1GN6 A;  1BL8 A;  4JI2 B;  1EN5 A;  2QTO A;  1NR7 A;  1L0N H;  4UB6 Z;  3BA8 A;  2LFS A;  1K9M W;  1FJG B;  1MZF A;  4PDL A;  2XUM A;  2Y69 C;  3JCZ A;  3DC5 A;  4OPA A;  1K73 W;  5LGN A;  4DUY B;  3E8B A;  1B3Q A;  1YXB A;  2D2C B;  5JVD B;  4RO2 A;  5EIB D;  4O4H A;  3IJ4 A;  4PDM A;  1HW7 A;  4X1I A;  2JS3 A;  2PI5 A;  4IIJ A;  2YEV B;  1FS0 G;  1TA8 A;  3LUT B;  3JD2 A;  1XL6 A;  2Q0O C;  2L35 A;  3E2E A;  3B40 A;  3K3W A;  1D2D A;  4GYC B;  2Q7E A;  5BY1 A;  3RW0 A;  3IC7 A;  4DUZ O;  2EJR A;  1AR5 A;  4J11 A;  2IU0 A;  2ADQ B;  3NXS A;  4ASU G;  1XUQ A;  3SPH A;  4LNU A;  3SJA C;  5EBW C;  2H8P C;  3JSN A;  1BGY H;  1XDC A;  2KSD A;  3ZRV A;  5BZB A;  4JI7 O;  1SQV H;  4X66 B;  4R50 A;  4YIO A;  4NXN B;  3ZED A;  1QU7 A;  1AJN A;  3HKE A;  3K08 A;  1V54 B;  5B3S C;  3CCJ V;  5KMG B;  3CCR V;  1W59 A;  2CH7 A;  3CP1 A;  4U3F H;  2QSA A;  2UUB O;  1QLN A;  1AVM A;  1GH6 A;  2N74 A;  2WSS G;  4BW5 A;  2A06 H;  3DTU B;  5IYD O;  1VP7 A;  4O4H B;  5CA1 A;  1FPO A;  3CD6 V;  4RQE A;  2AHZ A;  4IL6 Z;  1Y66 A;  4K0K O;  3B77 A;  2JDI G;  1V9P A;  1VQL V;  3VOU A;  3ZRX A;  2QDO A;  2F93 B;  3ZHQ A;  4UVA A;  1WA8 B;  2HFE C;  1GM9 A;  2DOS A;  2FML A;  3FYE B;  4UVC A;  4QPK A;  4FPP A;  3D8C A;  2IJH A;  3X2Q B;  2P4V A;  3HKB A;  2EIL C;  1K5S A;  4MTX A;  4DR1 B;  1BMF G;  3S3X A;  3HPL C;  1OCR B;  4TV8 A;  4TV8 B;  2DYR B;  2CTP A;  1P7B A;  3OFN G;  2Q0A A;  2GDS A;  4CH6 A;  3C3T A;  3E8H A;  4JPR A;  4DV0 B;  4WFA V;  4DV4 O;  4U7N A;  3CJH A;  3LDC A;  2Y4T A;  1VEW A;  5C8Y B;  2A9H A;  1H8E G;  1HNX B;  4JI4 B;  3H01 A;  4CBC A;  3TXQ A;  3N27 A;  4WFE A;  2ETN A;  3JAR B;  5JJN B;  3JAS B;  1NH2 B;  2LFR A;  1LUV A;  2BSK A;  4HYO A;  1QR8 A;  2DWE C;  4XDK A;  4JV5 B;  1KBH A;  3SYC A;  3TK1 A;  2VS0 A;  3WB1 A;  2G38 A;  4D6T H;  1KUQ A;  3K57 A;  2RQ6 A;  4MVO A;  4JYA B;  3M99 B;  3VQX A;  2PGG A;  3ICX A;  1VQK V;  2JVD A;  4X65 O;  2BTQ A;  4G28 B;  3SR2 C;  2DE0 X;  4CC5 A;  4PEL A;  5AG2 A;  1K3E A;  3VQW A;  5CBF A;  4JI3 B;  3H1I H;  5J2T B;  2QJ1 A;  3T1H O;  3CXC U;  4L87 A;  1FYJ A;  3FX7 A;  1E79 G;  3GWO A;  1K4D C;  4P9P A;  1L1F A;  5KHI A;  3QF7 A;  4YXW G;  4TOI A;  4B08 A;  3SPI A;  1DLB A;  5GTI Z;  1YF2 A;  4MTG A;  4X1Y B;  1N8R W;  4BAY A;  1AP5 A;  2CK3 G;  4JYC A;  3H1K H;  2CGO A;  3AK1 A;  4MVZ A;  4X9Q A;  4DR5 B;  5DED A;  2ODM A;  4PA3 A;  3SJC C;  4WBN A;  4I55 B;  3JD4 A;  1PNK A;  4LCU C;  4OXS A;  2JIZ G;  2ZT9 B;  5LHH A;  2LGQ A;  2WLI B;  3LNN A;  1ZLZ A;  4LF8 B;  2JJ1 G;  4QE9 A;  3HKD B;  5LYJ A;  4QIW F;  2R9R B;  4FVM A;  4I7Z B;  3U0Z A;  4NXM B;  2E3C A;  4X65 B;  3OT7 A;  5FPR A;  5KHG A;  1K34 A;  5H2F Z;  3ASO C;  4I0X B;  4I0X A;  4CH3 A;  1GM8 A;  2VWK A;  3F5T A;  3CXH F;  5CN0 A;  3A0H Z;  5C93 A;  1KB9 F;  1GTO A;  2XAH A;  3L74 H;  2EZO A;  2YI8 A;  2AZ2 A;  3T1H B;  1ZL8 B;  3ML0 A;  4YJ3 A;  4J80 A;  5E1A C;  2P90 A;  3HKD A;  4FIP C;  2P67 A;  3CCQ V;  1Z5V A;  1ARO P;  1QLE B;  1NQT A;  2XOK G;  2ZNJ A;  1QBZ A;  4AHC A;  4JI7 B;  4UFZ A;  2NN4 A;  2QKS A;  3ETG A;  5LA6 A;  2EIN B;  2IH3 C;  3ETD A;  1O9G A;  2DQ3 A;  3ZHS A;  4EB6 A;  3A0B Z;  2EX3 A;  4JI1 B;  1UFI A;  3OTO B;  4X1K A;  1GN3 A;  3ZS8 C; 
#chains in the Genus database with same CATH homology
 2IU3 A;  4JAV A;  3E8F A;  2HVJ C;  3MHH C;  2WLL B;  1PKX A;  2IJJ A;  2QE7 G;  3LDE A;  4UV9 A;  5L3F A;  1WPX A;  3SPJ A;  1JVM A;  4X88 A;  3CC7 V;  4LC1 A;  1EFR G;  2Q68 A;  3K0G A;  3ASO B;  1V55 B;  3FB6 C;  3AG2 B;  1YHQ V;  1PNM A;  3OR7 C;  1Q86 W;  2X0L A;  3B8N A;  3ABM C;  3CYO A;  1GK9 A;  2WLJ A;  4N21 A;  1P4R A;  4QE7 A;  2EIK B;  2HVK C;  4PA4 A;  1JOY A;  4FMT A;  2XND G;  1K97 A;  1OCZ B;  1FXH A;  3ABL C;  4GX5 A;  1NJI W;  1GO3 F;  3QNE A;  1VQ8 V;  2OT5 A;  3T1C A;  2JEX A;  3QO5 A;  4F4L A;  1DTO A;  1NVP B;  1KKD A;  4JTC B;  4N23 A;  2C2A A;  2DWD C;  4XDJ A;  2XAS A;  1QVG U;  2XAF A;  3ABK B;  3AEI A;  2JK5 C;  2QM8 A;  3FYI B;  2LP7 A;  4LP8 A;  2Q67 A;  3OMA B;  3ZIA G;  3E83 A;  1MOF A;  5H9C A;  3UM7 A;  1M56 B;  1Y4M A;  3KG2 A;  4G27 B;  3CCM V;  1QR9 A;  3F5W C;  5KA5 A;  4X8A A;  4HZ3 A;  1CEZ A;  2EIJ B;  1ORQ C;  4FJC C;  1Q82 W;  4PA7 A;  4JF3 A;  4TWK A;  3B8M A;  1R6N A;  3CCS V;  1DF4 A;  2EIM C;  4MTO A;  1NVP D;  2F43 G;  5B1A B;  1K92 A;  1Q81 W;  4WFG A;  2QEX V;  1VQP V;  2DW4 A;  1WLE A;  1OCC C;  4MW8 A;  1H8H G;  1BL8 A;  4X89 A;  3OMN B;  4PA6 A;  2QA4 V;  2QTO A;  1NR7 A;  3W7W A;  3SJQ C;  3QO8 A;  4R6Z A;  3W7S A;  2LFS A;  1K9M W;  3FB5 C;  4MSW C;  4PDL A;  3IFX A;  2Y69 C;  4XDL A;  2HJF C;  2ZDI C;  3JCZ A;  2ITC C;  1B6Q A;  1SRY A;  1CP9 A;  1G4Y B;  1K73 W;  4BIU A;  1GKF A;  5LGN A;  3E8B A;  2IW5 A;  2A0L A;  3ZCC A;  4WFF A;  4UUJ C;  3OUS A;  5L3C A;  1S77 D;  2HLD G;  3ETE A;  4RO2 A;  5CA3 A;  5EBL C;  4PDM A;  1OCO B;  3RBZ A;  5HFM A;  1YTF D;  1OCC B;  1S72 V;  1QCE A;  4JTA B;  3JD0 A;  3K03 A;  1MG1 A;  5L3E A;  4J9Y B;  1S76 D;  2ITD C;  2HR3 A;  3K0D A;  2PI5 A;  1PD3 A;  1E1R G;  1KEC A;  2YEV B;  4H37 A;  1SER A;  2MK3 A;  1FS0 G;  3LSQ A;  3MD0 A;  3F7V C;  2EIM B;  1M9N A;  4GX2 A;  4WF9 V;  3LUT B;  3JD2 A;  2B1G A;  1VQM V;  5CBH A;  1XL6 A;  1NH2 D;  3E2E A;  3OUF A;  2EIJ C;  3K3W A;  1OZ0 A;  4JGS A;  3RW0 A;  3IC7 A;  1M56 C;  1I5X A;  2EJR A;  3ZN1 A;  5LBQ A;  4P30 A;  2IU0 A;  1PL0 A;  5KUK A;  2ZQM A;  3E8G A;  2ZD9 A;  3NXS A;  4JTD B;  1AJQ A;  1COW G;  4ASU G;  3P30 A;  3WG7 B;  3E35 A;  5B1O A;  4G2K A;  3SPH A;  4KP4 A;  3SPG A;  2V1D A;  2H94 A;  5DN6 G;  4HAM A;  1AI5 A;  5EBW C;  2H8P C;  3ASN C;  3W7X A;  1HWY A;  3LSS A;  5BZB A;  3ZRV A;  4PDR A;  1R73 A;  1NKD A;  2HG5 C;  4R50 A;  3OMI B;  1K7D A;  3K04 A;  3ABL B;  3RVY A;  1W2B U;  2NNU A;  1AJN A;  3K08 A;  1R6K A;  2GHY A;  3JD3 A;  1V54 B;  4PDV A;  5B3S C;  3CCJ V;  3ABM B;  3ZMZ A;  3CCR V;  1S5H C;  2WPD G;  3FKS G;  4MVR A;  1YJW V;  4MVQ A;  4MVM A;  2WLL A;  1PNL A;  1IXM A;  3CP1 A;  3CCL V;  3OGC C;  1QLN A;  2DYR C;  3AG3 B;  5IYB O;  2WSS G;  3ZMV A;  4BW5 A;  1K5Q A;  3DTU B;  5IYD O;  2EIL B;  1JQ0 A;  5H6Q A;  5KUM A;  3CD6 V;  4RQE A;  2AHZ A;  1M90 W;  1Y66 A;  2ZR2 A;  3CMA V;  4JAS A;  3G71 V;  3B77 A;  4Q20 A;  1W0J G;  3AG1 B;  2Q69 A;  3QO7 A;  4U7O A;  2JDI G;  3R65 A;  3ABT A;  1F51 A;  5EK0 A;  3D36 A;  3VOU A;  1VQL V;  3CC4 V;  1YIJ V;  3ZRX A;  1YJ9 V;  4RUE A;  1KQS U;  2BOC C;  4PA9 A;  3K06 A;  1TUE B;  3JD1 A;  5EBM C;  3JYC A;  4UVA A;  5HFL A;  2HFE C;  5FL7 G;  1GM9 A;  2WLH A;  5DM6 V;  1S0V A;  4E2L A;  2WLM A;  1SET A;  4MVU A;  3FYE B;  4KFM A;  4WFH A;  1JCH A;  1DF5 A;  3OR6 C;  4UVC A;  4J9Z B;  2DQ0 A;  4QPK A;  4QJF B;  4FPP A;  2WLI A;  3SYO A;  1H38 A;  1KD1 W;  2IJH A;  3X2Q B;  2YSU B;  3AG1 C;  2P6J A;  1M57 C;  1XL4 A;  2K1E A;  2OCC B;  1S3J A;  2EIL C;  2DYS B;  1K5S A;  1F4N A;  1SZT A;  3F7Y C;  4MTX A;  5GW7 A;  3HB3 B;  1BMF G;  3ZMS A;  1AI6 A;  3HPL C;  1OCR B;  2UXN A;  3SYP A;  2DYR B;  3AG3 C;  4GX1 A;  2PI4 A;  3E86 A;  1KP3 A;  1OHH G;  2UXX A;  4LBE C;  1P7B A;  3OFN G;  4MW3 A;  2IH1 C;  3TET A;  2W0F C;  3E8H A;  2X6C A;  4JPR A;  5B3S B;  1V54 C;  4WFA V;  3CPW U;  4U7N A;  3LDC A;  2W6J G;  3AG4 C;  1MAB G;  1NBM G;  1R3J C;  5IY5 C;  4WCE V;  2ATK C;  4P9O A;  5CMU A;  4ZBM A;  2A9H A;  1VQO V;  2Y48 A;  3OM3 B;  3K79 A;  3K9A A;  1H8E G;  3ASN B;  3BEH A;  4FK5 C;  2M7W A;  3H01 A;  4CBC A;  3W7U A;  4UVB A;  1NR1 A;  4WFE A;  3WFV A;  5LGU A;  1RM1 C;  2OTL V;  2JJ2 G;  3IGA C;  1NH2 B;  2ZDI A;  4I9W A;  1FXK C;  2X6A A;  3WG7 C;  2LFR A;  1QVF U;  1AI7 A;  4HYO A;  4R8C A;  3ZN0 A;  1QR8 A;  3CME V;  4UXN A;  1FXV A;  2DWE C;  2EBO A;  2WLK A;  4XDK A;  1JX9 A;  4TT3 G;  3SYC A;  4KUM A;  2ZR3 A;  3TK1 A;  1R3I C;  3OEE G;  4TSF G;  1YJN V;  5IDJ A;  2XAJ A;  1VQ4 V;  1ROP A;  1MSW D;  2EZP A;  5LHG A;  1EZJ A;  4MVO A;  3M99 B;  1R3L C;  1VQ9 V;  5L3B A;  2HKO A;  1VQK V;  1AJP A;  5LHI A;  4QPJ A;  3SYQ A;  1VQ7 V;  4G28 B;  4QNH B;  4MVS A;  2AHY A;  4BIZ A;  1OCO C;  3P32 A;  4P2Z A;  5B1B C;  4PEL A;  2XAG A;  1K3E A;  5CBF A;  3EFF K;  4RQF A;  2IJI A;  4MS2 A;  3T4D A;  2QM7 A;  1R3K C;  1KP2 A;  3RVZ A;  1AI4 A;  1M1K W;  1EBO A;  2Y69 B;  3CXC U;  3CCU V;  3ABU A;  1E1Q G;  3EHB B;  3VBB A;  4L87 A;  1UJW B;  1VQ5 V;  3CCE V;  1KC8 W;  2X6B A;  1E79 G;  5B1B B;  3GWO A;  1K4C C;  5J9P C;  1K4D C;  4P9P A;  1FXK A;  1L1F A;  4CZZ A;  4YXW G;  3SPC A;  4RUF A;  3ZRW B;  4JAU A;  2B1I A;  3SPI A;  1DLB A;  1YSC A;  3I55 V;  1I5Y A;  4MTG A;  1F23 A;  5B1A C;  1N8R W;  3OEH G;  5IYC O;  2YEV A;  4BAY A;  2WLN A;  5B1N A;  4XBF A;  2CK3 G;  4JYC A;  4R7C A;  3LDD A;  2Z5U A;  4DXW A;  5LGT A;  4MVZ A;  5KA6 A;  2KB1 A;  2R9I A;  2B5U A;  4RAI A;  4ZKI A;  3BY6 A;  4PA3 A;  1LNQ A;  1JJ2 U;  4DO2 A;  4GT1 A;  1G8M A;  1W0K G;  2X7R B;  1YIT V;  4UV8 A;  3FB8 C;  2WAM A;  3JD4 A;  1K33 A;  2W6I G;  1PNK A;  2Z3Y A;  1SES A;  1BHA A;  1FXK B;  4LCU C;  4OXS A;  1RPR A;  2JIZ G;  5LHH A;  3ABK C;  1VQN V;  3CC2 V;  2WLI B;  2V7Q G;  1RM1 B;  3OAA G;  3UKM A;  1F4M A;  2BOB C;  2JJ1 G;  2GSM B;  4QE9 A;  2D3O W;  4H33 A;  3TCU A;  3FB7 C;  4QIW F;  2R9R B;  4GCZ A;  5EC1 C;  2XAQ A;  5IY5 B;  1J95 A;  3E89 A;  1ENV A;  3I56 V;  3AG4 B;  1OCZ C;  3LNM B;  1ZWI C;  2EIK C;  5H6R A;  3GB7 C;  4MTF A;  3ZRS A;  1AR1 B;  1THZ A;  4I5S A;  1K34 A;  2OTJ V;  3AG2 C;  1V55 C;  3ASO C;  1BHB A;  2IJK A;  1GM8 A;  3G4S V;  3CCV V;  5CN0 A;  5C93 A;  1GTO A;  1VQ6 V;  2XAH A;  1OCR C;  1YTF B;  3SYA A;  1GM7 A;  5EC2 C;  3ZJZ A;  1Q7Y W;  2EZO A;  1K8A W;  1CPY A;  3W7T A;  3ML0 A;  4JYB A;  3T2M A;  2DYS C;  3PJS K;  2ZXW B;  3A0R A;  4EKW A;  2OCC C;  5E1A C;  2A79 B;  1RPO A;  2P90 A;  1M57 B;  4FIP C;  3T4Z A;  3MHS C;  2NLJ C;  2P67 A;  3X2Q C;  3ZMT A;  3CCQ V;  3ZRW A;  1JPX A;  1ARO P;  1QLE B;  1GMG A;  1H2G A;  2EIN C;  1NQT A;  3G6E V;  2XOK G;  3OW2 U;  1QBZ A;  3DGE A;  3D3I A;  3OE7 G;  4Z1M G;  4GX0 A;  2QKS A;  2Q6A A;  3ETG A;  5CBG A;  1QLE C;  1FFT B;  2EIN B;  2IH3 C;  3ETD A;  4MT8 A;  3STZ C;  5L3G A;  2WWW A;  2FTK A;  2DQ3 A;  4WFB V;  2JEU A;  5L3D A;  3STL C;  1YI2 V;  2P7T C;  2ZXW C;  3ZMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...