2DWEC

Crystal structure of kcsa-fab-tba complex in rb+
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords ANTIBODY FAB HEAVY CHAIN
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dweC00
2R9RB 4P9PA 2AHYA 1BL8A 3X2QC 4PDRA 4H33A 3SYPA 4GX0A 1QLEC 4PDVA 1KKDA 2A9HA 1K4CC 5IY5C 1R3LC 1ORQC 4R8CA 2ZXWC 1OCRC 3OUFA 4I9WA 4KFMA 4R6ZA 5KUKA 4RUEA 4H37A 2H8PC 4TWKA 3OR6C 4LBEC 4MVOA 3EFFK 2W0FC 4MVUA 4MVMA 2EIMC 1XL6A 2HFEC 5B1BC 3RBZA 3K03A 4PA4A 2BOCC 3F7YC 4GX2A 3RW0A 3LDCA 2JK5C 3GB7C 3STZC 3IGAC 2EIKC 3FB7C 2ITDC 4MS2A 3LDDA 4MTGA 3ABLC 2QKSA 2DWDC 3HPLC 4QNHB 4X8AA 5KUMA 1R3KC 2ZD9A 2YEVA 3UKMA 2AHZA 3ASNC 4CBCA 4XDLA 2WLKA 2DWEC 3K04A 2WLIA 2WLNA 4G27B 4GX5A 2WLJA 3F7VC 2DYRC 3UM7A 4X89A 3ABKC 3WG7C 3IFXA 2WLMA 3K0DA 3AG3C 4MTOA 3JYCA 3AG2C 3K08A 3AG1C 2P7TC 3E83A 3LUTB 4PA9A 5BZBA 2A79B 2IH3C 4J9ZB 3T2MA 4JTCB 2WLIB 4MW8A 4WFHA 1ZWIC 3TETA 4P2ZA 4PA7A 5E1AC 3KG2A 2HJFC 3OUSA 2WLLA 2DYSC 3F5WC 1M57C 1R3IC 2K1EA 3RVZA 3E8HA 1J95A 3OGCC 3OR7C 5B1AC 4HYOA 3SPGA 4BW5A 1XL4A 3ASOC 2ATKC 4MVSA 4PDMA 2QTOA 1OCZC 4R50A 3T4DA 3PJSK 5EC1C 3ZRSA 1R3JC 4RUFA 2Q67A 3SPJA 2Q69A 3ABMC 3R65A 3K06A 2OCCC 2Q6AA 3SYCA 2BOBC 4ZBMA 3SJQC 5EC2C 2KB1A 4WFEA 4WFFA 2HG5C 1M56C 3SPHA 3SYOA 3T1CA 2Y69C 4LCUC 4WFGA 3VOUA 3E8FA 4RAIA 1OCOC 2Q68A 4J9YB 2IH1C 4MVRA 4MW3A 1G4YB 2X6AA 3LNMB 4JTAB 3TCUA 4X88A 4MVQA 4QE9A 5EBWC 3K0GA 5B3SC 2HVKC 5J9PC 3FB5C 1K4DC 3AG4C 4PDLA 2ITCC 2HVJC 3E89A 3SPCA 3ZJZA 5EBLC 1OCCC 4UUJC 5CBHA 2EIJC 4XDKA 3FB8C 5CBGA 4GX1A 4LP8A 2A0LA 2NLJC 3LDEA 3STLC 4F4LA 5EK0A 1S5HC 2X6CA 4MTFA 4PA3A 3SPIA 4R7CA 4MVZA 3SYAA 3SYQA 1V54C 2X6BA 4DXWA 3E8BA 3RVYA 4JTDB 3T4ZA 2EINC 3FB6C 4P30A 3E86A 4QE7A 3E8GA 2WLLB 3BEHA 1LNQA 1JVMA 5EBMC 4RO2A 4HZ3A 4EKWA 1V55C 4MSWC 4P9OA 2EILC 4XDJA 5CBFA 2WLHA 1P7BA 4OXSA 4G28B 4PA6A
chains in the Genus database with same CATH superfamily
2ZE8A 1BL8A 2ARHA 1XMOB 4R6ZA 5DEDA 2YXYA 5B1BC 4X1YA 5GONA 5KHJA 3K5MA 3CYOA 2NN4A 4GKKO 3ABMB 4XBFA 1AR1B 3HPLC 3OTFA 5KUMA 3L74H 3KCYA 1M56B 3WG7B 3G71V 1M9NA 2EINB 3E83A 5FPRA 2Q7HA 3ABUA 5JH7B 3N2KB 4MW8A 1ZWIC 4I50B 3FD9A 3ZRWB 1PNMA 3OT7A 4O4IB 3OTOB 2HJFC 1SETA 2K1EA 1YIJV 2IJJA 1SKVA 4I0XB 2Q0OC 1ZL8A 3SPJA 2Q67A 2B1GA 2JVDA 2V1DA 3CP1A 3Q4HB 4H44B 2XAFA 4LCUC 1KUQA 2H3OA 4LF7O 1Z2GA 2X6AA 3S3XA 1MA1A 3B2EE 4FPPA 3ZCCA 1WLEA 5B3SC 2B1IA 3G4SV 2UXCO 4IIJA 1OCZB 4FM1A 1X59A 4CC6A 4IT5A 2ODMA 3EHBB 3B8NA 1SQFA 3QO7A 3IJ4A 5TISZ 2A06H 4DV6B 1SQXH 4MVZA 3SYAA 1H2GA 3BABA 4B08A 3FKSG 1IDSA 3FB6C 2K9PA 1YZBA 2Q5ZA 4MSWC 4XDJA 2ZNJA 3ZHUA 1QQCA 2YSUB 4RUFA 2WAMA 1JJ2U 3HKDB 2JS3A 1OCRC 5KUKA 4ZHQB 4LBEC 1OV9A 4B3RB 1GN3A 1HDJA 3RBZA 2VQEO 4PA4A 2BOCC 4U3JB 4X20B 3ZIAG 3RW0A 1B06A 1N0JA 2GUZB 2LFSA 2UUBB 2FKXA 4IIJB 1N32O 2CE4A 1VF6C 4DR4O 1BMFG 4X8AA 3UKMA 3JARB 1NT2B 4JYBA 4AI8A 2Z3YA 4GX5A 1GO3F 1H2NA 1B3QA 3O65A 4J7KA 1BSMA 5L3GA 1KU9A 5C8YB 1Y74B 4PA7A 4KHPO 3CCLV 1MZEA 3ETEA 2L6LA 1PL4A 1ROPA 1IXMA 1JPXA 4KL1A 2Q9LA 1FS0G 3AK3A 4O2BA 3FX7A 4QPJA 3FYEB 1COWG 4CC5A 1RM1B 1AVMA 3TCUA 3RYIA 1YJWV 5C93A 4K8ZA 2DJVA 3NR7A 3SJCC 5CA0A 1BCCH 2ITCC 1VQ7V 3N2GB 1HNWO 2YXLA 3ASNB 1IBKO 4BR6A 4UV8A 2DMXA 4LR3A 1GN2A 5LGTA 3RVYA 1GAXA 1SC5B 3AG2B 1NR1A 4P30A 2ZXWB 1LNQA 1XILA 2EIMB 4BWAA 1V54B 2QA4V 1CP9A 2W6JG 2AHYA 4U3FH 2DN9A 4ZI7B 5J2TA 4BAYA 4B3RO 3WFVA 4R8CA 3EXAA 4GT1A 1SQVH 1N33O 1VF5B 5LMNB 2CH7B 4H37A 1R6TA 1MG1A 1SERA 4MVOA 3EFFK 1I7FA 1NH2B 3IAYA 3K03A 5JVDA 4LFAB 4G2KA 3JAWB 3H1IH 2ZNIA 2BSKB 1GRJA 3NXSA 1TAEA 3H01A 2XAGA 2WLNA 4O4JA 3QF7A 2WLMA 1KYOF 3ETDA 1SS3A 4YY3B 4LF6B 2P7TC 1VQOV 3TETA 3E22A 2GDSA 3KG2A 2DYSC 2NNUA 5K1XA 5LMUB 4RWUA 4YJ3A 1DF5A 4TQFA 1VQKV 1R3JC 3I5DA 5BMVB 3OMNB 2EILB 2EJ7A 5EIBC 3MHSC 4WFFA 3M8AA 2Q7EA 4D6TH 1IURA 2FYUH 1PL0A 5IE9A 1PNLA 2Q68A 1Y67A 3CCUV 3AG3B 1NKDA 5FL7G 2GTSA 4TUYA 4GZRB 5IY5B 1K34A 1YI2V 2Q4PA 1FD9A 3OW2U 1WPXA 2A3QA 3H1JH 4J80A 1L8DA 1MABG 5JCOC 1TUEB 3APQA 5J2UB 3FB8C 1YSCA 1GM9A 1YCIA 1H2SB 3BAAA 2N05A 3JD0A 3AK2A 5B3SB 2WLLB 4BIUA 1VMGA 3AG7A 3RYIB 3CMEV 1KC8W 2HR3A 4JZGA 4G28B 5ITZA 1AB3A 3CEIA 2B5UA 3G67A 4JI4B 2UU9O 4UVAA 5L3FA 4U7OA 4FLVA 1MOFA 4N23A 3ZMZA 4X64B 2HFEC 2BTQB 4JI6O 2D2CB 2JK5C 3MDSA 2CAZC 3ZHSA 1OCCB 3LDDA 2P67A 2YEVA 4EFBA 2ZE7A 2DQ0A 5A9GA 1XNQB 2ZQMA 1NR7A 1JCHA 4DUZB 1KB9F 4B7KA 1X4TA 4J9ZB 3T2MA 4X66B 4DR7B 1HNWB 3CX5F 4WFHA 2IU0A 5E1AC 1BT8A 4AHCA 2Y4TA 2KQXA 4KHPB 4DV1O 3AG4B 4QIWF 2OWOA 3K06A 1QNMA 3SJQC 2XT9A 2KB1A 3RYHB 4WBNB 4NVPA 1K9MW 5IYDO 2VWKA 4JPRA 3ZMVA 1G4YB 4PJ0Z 4ASUG 2ZT9B 1XHXA 4JI8O 3HKEA 3P32A 4FMTA 5CA1B 4FIPC 2QTSA 1R1BA 2OT5A 4UCOA 4NTXA 2ZDIA 5CBHA 3CCMV 1MMMA 1TVKA 2RDCA 4TOIA 2GHYA 1HW7A 1JQ0A 2XNDG 1XMQO 1W59A 5EIBD 1EFRG 2Q0AA 3THOA 1PD3A 2IJHA 1VQLV 1JX9A 5JJEB 4QE7A 1FKAO 2IW5A 1KMIZ 2WPDG 1JVMA 1Z5VA 4AILC 2LP7A 5FNVA 5IJ9A 4DR5O 5IYZA 4F6RB 5H5NA 4H0LB 3CXHF 1BQ0A 1QLEC 3N2GA 2LO1A 1XEQA 4JYYA 3OUFA 5FLXN 4JV5O 2Y0IA 4TWKA 2ZM6O 3OD4A 3P3PA 4CH3A 1NS1A 2CH7A 2Z0AA 1B6QA 1K92A 3AEIA 5B1OA 1N8RW 1ENVA 4FFBB 4FK5C 1N32B 2HJDA 1XHZA 3L75H 2JS5A 4CZZA 2RQ6A 4UCSA 4D7TA 5LP6C 2E5LO 1VARA 1AROP 4J10A 4JTCB 4TUYB 1GMGA 1GN6A 3B8MA 1XREA 1J95A 5B1AC 1M1KW 1V9PA 5KX5B 1PNKA 4TV8B 3ZRSA 2Q69A 2UXDB 5LA6B 2N74A 4JI7O 2RNBA 3SPHA 3RGBA 4RAIA 2YIBD 5H6RA 3R66A 5KA6A 2XOKG 3L73H 2Y69B 4X1IB 4WFAV 5F2VO 2EIJB 4H13B 3ZBHA 4LFBO 1R6KA 3ZX6A 2FMLA 1J5EO 3SPIA 3H1LH 1Q81W 3CRQA 1FXKC 1H38A 3OGIB 2EINC 1LUWA 4DR5B 4I4TA 3WB2A 1NZ6A 2RJZA 3HKEB 3VQVA 5GW7A 4YY3O 3T1HO 1YF2A 3SYPA 1XUQA 3SJBC 4O2AB 1AJNA 2KG7A 4I9WA 1WN7A 5EZYA 5CB4A 4JI2O 2H8PC 3UO2A 2EULA 2YIDA 1K5QA 5H9CA 4DW1A 3ZHTA 1WP7A 1PM9A 4EFEA 1FJGB 1TUBB 3CRMA 2PGGA 3FB7C 2ETNA 4MS2A 5IJ0A 4LFAO 4MTGA 1FXKB 1Q7YW 2WLKA 4ABMA 2XASA 4LF8O 1W0JG 2ADPA 1R6NA 3VQXA 5B5EZ 3AG1C 2M7WA 1LUVA 4X65B 4LF9O 2JEUA 1ZL8B 4DV6O 1F23A 4P2ZA 4ZOLA 4CH5A 4X1IA 1R3IC 1S3JA 1S0VA 4U7NA 3N2KA 4JYAO 2QTOA 2AW9A 4FM2A 3ZRXA 3CSXA 1QVGU 4I5SA 4LH6A 1I94O 3SYOA 4K0KO 3CRRA 3DGEA 2IH1C 3C3TA 1EBOA 1I08A 4JTAB 4UB6Z 4JI3B 1ZUQA 3FB5C 2C2AA 4TSFG 3JALB 3AG4C 2HVJC 4TV8A 4LF5B 4CS4A 1PV0A 2R72A 2VS0A 1NU1H 3TK1A 3ZN1A 4F4LA 2PY5A 3ML0A 3QG5A 3QVNA 3M7MX 4MTFA 2BSKA 1AR4A 1R73A 3U10A 4A5UB 1SQBH 5IYCO 2AGAA 1FFTB 3T4ZA 4YJ2B 1WA8A 1QLNA 3JATB 3ZEDA 1H2MA 1FYJA 1FXKA 3HKCA 1XDCA 4D7SA 3U11A 4UCUA 3SDLA 3X2QC 2ZINA 5E79Z 2A9HA 5IY5C 4IL6Z 4X9QA 5DN6G 3OFNG 2EZPA 1S77D 1O9GA 1SQGA 4GX2A 2CK3G 3W7WA 4FLXA 1NJIW 1A32A 3J80N 2XAHA 1VIBA 3E35A 5L3BA 1PKXA 1YDXA 1QCEA 2WLIA 4GUNA 1SQPH 4X89A 3ABKC 3IFXA 1KP2A 1IBLO 3H1KH 5GTIZ 5CB4B 3JCZA 4LWSA 3JATA 2Y0PA 3F5WC 4DR7O 2FTKA 5FPOA 3CC7V 4O4HB 1XMQB 3PJSK 5EC1C 2Z5UA 5LL6Y 4K0KB 1AI6A 2BOBC 4ZBMA 5EC2C 1KBHA 4DO2A 3QO8A 1KKCA 3IC9A 4DR3O 1JFFA 1L0NH 2QE7G 2QWPB 2W6IG 3K0GA 4I55B 2HVKC 4KUMA 4LF5O 2D3OW 1YVWA 2JGDA 2JJ2G 1VQ4V 3HKBB 5LA6A 1UPGA 1M5IA 5L3EA 3JASA 3BFRA 3E8BA 2XTAA 3JAMN 5KLVH 2YEVB 3Q4HA 4NYKA 4UCVA 3H1HH 2NR5A 3G6EV 1JJOA 4LFCB 4H33A 4GX0A 1T5EA 4JI0O 5BY1A 1N36O 4DYLA 1THZA 2F4VB 5LP6B 4NXNO 2JRIA 2OIEA 4OPAA 2QKAA 4JAVA 3GB7C 3JAKB 4DV0O 3D3QA 4JI1O 1Y76A 5JQGB 1JMKC 2MK3A 5CA0B 5LMNO 2DWEC 3T1YO 3RWRD 2QSAA 2AXTZ 3AG3C 4O2AA 3DTUB 1SA0B 3K08A 2ZKOA 3BRCA 2IH3C 2KSDA 5LXTA 5AG2A 4EB6A 2UXNA 3SJAC 1XI1A 3CJHB 1Q5OA 4JI5B 5BMVA 2UUAB 2VQEB 1IZ3A 2PF4E 4OX9O 2VQFB 2JGDB 3ZMSA 4E4EA 3CC2V 2AZ0A 3J7AU 2LW7A 2JEXA 4DR4B 4O4JB 2KG7B 4NKGB 1HNXB 4LC1A 3H9VA 4JI0B 5EBWC 1FFXB 4DW0A 1EZVH 3APOA 4PHZA 1YTFB 3E89A 3E22B 3ZJZA 4BIZA 4J11A 1K5SA 1O9HA 1OCCC 1QU7A 4B7EA 3ZMUA 2VWJA 2NLJC 1VQPV 1ZX3A 4Z1MG 4DV4O 3OMIB 4JTDB 2WSSG 3JAKA 1OJHA 3A0BZ 3HB3B 2YDEA 1V55C 4O4LB 4PI2A 4K8XA 3UT5A 2YIBA 2ADQB 2QWNB 2CTWA 3G80A 1N0NA 2CGOA 4PA6A 1YTFD 5IYBO 3FYIB 2Q8VA 4B3SB 1OZ0A 4EB6B 1GTOA 5JCOA 2FL4A 1KKDA 1MZFA 4KFMA 2ZE5A 2QJ1A 2EX3A 4DUYO 3AK1A 4LWSB 5CA3A 4HNAA 4UB8Z 1WB7A 4UFZA 2ITDC 1NTMH 1EN4A 2UXBB 2QKSA 2IJKA 3L70H 1HR0B 2AHZA 3ASNC 3JD4A 4UCRA 5KMGA 2P22C 3K0DA 1YITV 3DC5A 1KQSU 1P7GA 1HP8A 3ABKB 4JASA 2LQTA 5FNVB 2OYQA 3CRAA 4LF9B 1QVFU 3OEEG 3KKYA 3C90A 2PTMA 3ABMC 4O4IA 1JA8A 3OE7G 1D5AA 1M56C 1N34B 3JSLA 2UXXA 3RYCA 2RCVA 5BR8B 5CA1A 4J9YB 5CN0A 2HHHO 3ABTA 1WP8A 4JAAA 1ZLZA 3CE2A 3UO3A 2E76B 1QR8A 4Q6GA 4JI3O 3SPCA 4DR2B 4DV0B 4FLWA 5LMUO 3K58A 1SQQH 2EIJC 4LH7A 1GKFA 4FLUA 1VEWA 4LF4B 2X6CA 3RYHA 4WBNA 4DXWA 1Y4MA 2KKWA 3E8GA 3ZRVA 1B04A 4HZ3A 2L35A 2EILC 3RYFA 1AILA 1BGYH 2YICA 1OHHG 3JD2A 2F23A 4K35A 4DV3O 2UUAO 2LW1A 5LHIA 1US6A 4DV7O 4NTWA 5IYZB 1GM8A 2QGNA 4JI4O 3MHHC 1M4UA 2W0FC 5BXZA 1JFFB 3K3WA 3LDCA 3RFRA 3CCJV 5BR8O 2HEPA 3T1HB 1OCOB 4ICGA 4JZ2A 2ZCEA 2RMKB 4CBCA 1XNRO 3RN4A 2ZM6B 3W7SA 2XAQA 4HAMA 4PD4F 1P84F 3RYCB 2B9ZA 4FFKA 5KX5A 2PYLA 1VQNV 1HNZO 2WLLA 5A2QN 3TXQA 3CCQV 1E79G 4I50A 4DR6B 2OCHA 3ASOB 4B3MO 4DV5O 1AP5A 2OIGA 2PYJA 2PI4A 1Q8IA 3T1CA 1K97A 2HKOA 4DK0A 4GLXA 4B3SO 3ICXA 4ZKIA 1VP7A 3K5LA 1DF4A 4DRXA 3ZS8C 1K4DC 2UU9B 4CS3A 2UXDO 5KHKA 1DK1A 1Q6UA 4ZI7A 4XDKA 1KECA 1XOUA 4PA3A 5JH7A 4FM0A 2YI9A 1F4NA 3CB2A 4O2BB 3TGUH 3SYQA 5LOVB 1KD1W 1DTOA 1K3EA 4C7UA 5KAIZ 1Y66A 3GVMA 5CBFA 3WU2Z 1P7BA 4OXSA 3LNNA 4DV7B 3CD6V 4JI8B 4I55A 4YIOA 4HNAB 1SZTA 3SGIA 1K33A 1BE3H 1E1RG 2LJ2A 3HKBA 3STZC 3IGAC 4DV3B 4X62O 2LGWA 1VQ8V 4NXNB 2DWDC 4X20A 1Q82W 2UUCO 1R3KC 2BCCH 4NTYA 1CXZB 3B09A 3K04A 4DV4B 2WLJA 5IJ9B 4Z2WA 4LNUA 3OEHG 3J81N 5KHGA 2X7RB 4NB5A 2A79B 5BZBA 3T1YB 1F4MA 1Q6IA 3ETGA 1EN6A 3OUSA 1M57C 1NBMG 3SPGA 3OGCC 1BQZA 4MVSA 1K8AW 3CHXA 1NTZH 3CRCA 3UQ8A 4FZ0A 4CH6A 4F6RA 1J5EB 3SR2C 3JD3A 5IJ0B 1QBZA 1I0HA 2Y69C 4WF9V 3D36C 4MTXA 4JI7B 2Y4UA 1N34O 2QM7A 2UXBO 2UXCB 3OMAB 3DXRB 1Q90D 3X2QB 4X1KA 1I94B 5IWAO 5EBLC 3VBBA 1KP3A 4UUJC 1G8MA 3A0HZ 2UUCB 2A0LA 4YJ2A 1SA0A 1WNSA 4IGGA 1XNRB 5LXTB 4R7CA 4KP4A 4RO2A 1HR0O 1JR9A 4PI0A 3D8CA 4DRXB 3K59A 4LF8B 2E74B 5H2FZ 4P9PA 1Q43A 4PDRA 3TJTA 4X1YB 4IYHA 3CS5A 5DM6V 1N4CA 2CGNA 1ORQC 2QKCA 2P90A 4AQYO 4MVUA 4LFBB 1IX9A 1YJ9V 2P4KA 2QM4A 3A2FA 4LNUB 2IJIA 2R9AA 1HWYA 5HFLA 2CDYA 5GTHZ 4BIOA 2F4VO 4MTOA 3JASB 3ZHRA 4UXNA 3QNEA 2DW4A 1AR5A 1BS3A 1NTKH 4OGQB 3C3SA 1RPRA 5JJNB 3JD1A 2BE3A 1OCZC 4NXMO 1MSDA 3BVOA 3OM3B 4B3TB 5J2TB 1TUBA 3TXSA 4Q20A 4DR6O 4WFEA 5LYJB 3DXRA 1GK9A 4JI5O 2ZIOA 1Z5WA 4MW3A 4X88A 1Y6XA 1S76D 3KCXA 2F43G 4X65O 3CJHA 3O9OA 1TVKB 3FAVA 3A8TA 2HP8A 4EEQA 3ZN0A 1N33B 4IYIA 5CBGA 1VQMV 2EBOA 2IM9A 5EK0A 1LR1A 4QPKA 2EJRA 3CMAV 3E2EA 4JV5B 4TV9A 2V4DA 3BEHA 1WPBA 4P9OA 2CTPA 5EYPA 3GWOA 3P3NA 3HKDA 2LGQA 3P30A 2OTJV 2UUBO 4YHHO 3FAVB 2ZXWC 5ITZB 4RUEA 2MW2B 2P6JA 1EN5A 1F7YA 1RPOA 2EIMC 1TGOA 1D2DA 5JQGA 1NI8A 3DSQA 2ZR3A 1F51A 1WJZA 3B77A 1IBMO 1WA8B 4DR1B 4XDLA 1UJWB 1MNGA 3WG7C 5IWAB 2YC0A 3JSNA 1IXBA 1PPJH 3CCRV 1DGSA 4O4LA 3QTCA 2QWRB 4U3JA 3MD0A 4J7JA 4IHJA 2EZOA 3UT5B 3RVZA 4FZ1A 1EZJA 2ZE6A 3A0RA 2ATKC 5C8YA 1RSOA 1Q6HA 1DLBA 2OCCC 1QHTA 2E5LB 3PN1A 3EVKA 1M57B 2W0XA 2HG5C 1Y76B 1BHBA 2XUMA 2YIAA 3WB1A 5KHHA 1OCOC 5IDJA 1FXVA 2Q73A 1M93A 2QM8A 2VQFO 2DOSA 1AI7A 5LP6A 2DE0X 2H94A 3D3IA 5LGUA 2AZ2A 2PI5A 2YUAA 3M99B 4NR1A 1ZSPA 4UVCA 2DYRB 2ILMA 5EZYB 3LDEA 5HFMA 1RP3B 2R9IA 2WA4A 1S5JA 1AP6A 4YXWG 4X62B 1P49A 1YEWA 1NQTA 4JI2B 4DR3B 3MAQA 4PV1B 1QLEB 4DR2O 4GKJB 4O4HA 2WLHA 3ZMTA 1XNQO 4LF4O 4I4TB 1L1FA 5KAFZ 2YXHA 3I56V 1G1XB 4PDVA 3S3WA 4X66O 1K4CC 1R3LC 2Y48A 3CPWU 4B3TO 2FB5A 4KXRA 1VQ5V 1EM1A 3BCCH 1SESA 5B1NA 4AQYB 3CCSV 2P06A 1SF9A 5LOVA 2ZDIC 1H2LA 3K9AA 2GV9A 5CMUA 2CTQA 1W2BU 4G27B 5LHGA 1HNXO 1TA8A 3F7VC 1SZXA 3JYCA 4JF3A 3AG2C 1URFA 1GN4A 1D5NA 1BHAA 4N21A 2R70A 3HR0A 1IVSA 1ZAUA 4ZHQA 3JALA 3E8HA 4JI6B 4F6EA 2E75B 5L3DA 2OCCB 2JDIG 1MSWD 1UFIA 3ASOC 2LFRA 1ZTEA 4R50A 3F5TA 5D5QA 3R65A 2M6YA 3N27A 2QR4A 2N04A 1WB8A 1NVPB 4BW9A 4YHHB 2XAJA 5KMGB 1XMOO 3BY6A 4JAUA 3AG1B 4MVRA 4RQFA 3LNMB 2EIKB 4MVQA 4QE9A 1U96A 5H6QA 4ZOLB 4FVMA 2CUGA 4UVBA 4DV2B 2QWQB 1IBMB 1K7DA 3JARA 4GX1A 4LP8A 1YXBA 4GYCB 1S5HC 4FLYA 1S72V 1G6UA 4FLTA 2OTLV 2BTQA 4ZIBA 3ABLB 5J2UA 3IC7A 4QGPA 3CCVV 4FFBA 2QDOA 5EBMC 4TT3G 3I55V 2VRZA 3CXCU 3L71H 1H2KA 3LUTB 5LHHA 1YJNV 3VQWA 1CEZA 5JJJB 2JIZG 4OPHA 1Y74A 2F1MA 5LBQA 4J42A 1W0KG 4DV5B 1Q3EA 3JCUZ 4MVMA 3ZRWA 2G38A 3F7YC 5B66Z 4DK1A 4FLZA 1I5XA 4J41A 1H8EG 4YJ3B 3FFQA 1FFXA 3ABLC 4QNHB 4J7ZA 2Q7GA 2ZD9A 2PZSA 1OCRB 5EYPB 3WB0A 5KHIA 2CTRA 2DYRC 3UM7A 2YS8A 1K73W 4DV2O 3L9DA 3CCEV 3QO5A 4QJFB 2WLIB 4UCTA 2YI8A 2JJ1G 4WCEV 2ZIMA 2P5OA 5GONB 1XQ8A 3BA9A 4JYCA 5L3CA 3W7XA 1PP9H 2F93B 2DQ3A 3RYFB 4PDMA 4I9QA 3T4DA 1FJGO 2PUSA 1VQ9V 3SYCA 4WFBV 1FPOA 4E2LA 3K9SA 4LF7B 3K57A 1HNZB 1QR9A 1RSOB 5B1BB 1CPYA 3BA8A 1GM7A 4FJCC 5LGNA 2GBOA 3K5OA 4JGSA 5J9PC 3K79A 2HHHB 4K3AA 2RN9A 4CH4A 4DUZO 2QEXV 4DUYB 5IT9N 2WWWA 3STLC 4RQEA 3JAWA 1NVPD 4W4KA 2GUZA 2ZR2A 1H8HG 4Z1VA 1VF7A 3K5NA 1M90W 3E86A 4X64O 4EKWA 4YIPA 4DV1B 3B4SA 4IHJB 4DR1O 2R9RB 4GKJO 2JGUA 1AJQA 2IU3A 2DYSB 4L87A 1V55B 3LSUA 3GWKC 4L8JA 3OR6C 2P4VA 1XL6A 5JWPA 3LSQA 2O57A 1S5LZ 1VQ6V 2EIKC 2F66C 5D5PA 2HLDG 2E3CA 4LFCO 4B3MB 3BPZA 2BTOA 4W4LA 5K1PA 1XBLA 3CWBH 4OX9B 4GKKB 3ETQA 2IBZH 1N36B 3BHPA 1AJPA 2A7WA 4PA9A 1U97A 1NH2D 4JI1B 2X0LA 5DECA 4JYAB 1RM1C 4X1KB 1JOYA 3OR7C 1AI5A 4PELA 4HYOA 1AI4A 4BW5A 1XL4A 4CS2A 3VQYA 2Q6AA 4TV9B 4TQDA 5KA5A 1FXHA 2XHBA 4WFGA 3VOUA 1RFYA 1BZKA 3E8FA 3HKCB 2WA3A 1IBLB 2F95B 2GSMB 4LF6O 3UCSC 3W7UA 4NXMB 1I5YA 3KZIZ 3ZHVA 1FAFA 4PDLA 3G6BA 3LSSA 4MT8A 1GH6A 3DC6A 1VF6A 1IBKB 5JVDB 2GTAA 4I0XA 1Q86W 1SRYA 3L72H 5LYJA 3W7TA 3OTOO 1WAZA 1V54C 2X6BA 1P4RA 5B1AB 2V7QG 3D36A 2QWOB 3B40A 3OAAG 3U0ZA 1L0LH 4GCZA 3ZHQA 4UV9A 3RT3C 1E1QG 3CC4V 1YHQV 4HBNA 4I7ZB
chains in the Genus database with same CATH topology
3P30A 2OTJV 5IYBO 1BL8A 3FYIB 1OZ0A 1QLEC 1GTOA 1KKDA 2ZXWC 3OUFA 4KFMA 4R6ZA 4RUEA 2P6JA 4TWKA 1RPOA 5B1BC 2EIMC 5CA3A 3CYOA 2ZR3A 1B6QA 1F51A 1K92A 3AEIA 5B1OA 1N8RW 2ITDC 1ENVA 3B77A 3ABMB 4XBFA 2QKSA 3HPLC 1AR1B 2IJKA 5KUMA 2AHZA 3ASNC 3JD4A 4FK5C 4XDLA 1UJWB 1M56B 3WG7B 3WG7C 4CZZA 3G71V 3K0DA 1M9NA 2EINB 1YITV 3E83A 1AROP 3ABUA 4JTCB 3CCRV 4MW8A 1ZWIC 3ZRWB 1KQSU 1GMGA 1PNMA 3ABKB 3MD0A 4JASA 2HJFC 1SETA 2EZOA 2K1EA 3B8MA 3RVZA 1YIJV 1J95A 5B1AC 1M1KW 1QVFU 2IJJA 1EZJA 1PNKA 3A0RA 3OEEG 2ATKC 3ZRSA 3SPJA 2Q67A 2B1GA 2Q69A 1DLBA 3ABMC 2OCCC 2V1DA 1M57B 3OE7G 3CP1A 2HG5C 1M56C 3SPHA 2XAFA 1BHBA 2UXXA 4LCUC 4RAIA 1OCOC 5IDJA 1FXVA 4J9YB 5CN0A 5H6RA 2QM8A 2X6AA 1AI7A 4FPPA 3ABTA 3ZCCA 5KA6A 1WLEA 5B3SC 2XOKG 2H94A 3D3IA 5LGUA 2PI5A 2B1IA 3G4SV 1QR8A 1OCZB 3SPCA 3M99B 2Y69B 4UVCA 2EIJC 2DYRB 3EHBB 1GKFA 4WFAV 3LDEA 5HFMA 2EIJB 3B8NA 2R9IA 1R6KA 2X6CA 3QO7A 3SPIA 4MVZA 3SYAA 1H2GA 4YXWG 4DXWA 1Q81W 1FXKC 3FKSG 1Y4MA 1H38A 3FB6C 2EINC 1NQTA 3E8GA 3ZRVA 4HZ3A 1QLEB 4MSWC 2EILC 4XDJA 2WLHA 3ZMTA 1OHHG 3JD2A 2YSUB 4RUFA 5GW7A 5LHIA 1L1FA 3I56V 2WAMA 3SYPA 4PDVA 1JJ2U 1K4CC 1R3LC 1AJNA 2Y48A 1OCRC 4I9WA 5KUKA 3CPWU 1GM8A 2H8PC 4LBEC 3MHHC 2W0FC 1VQ5V 3RBZA 1K5QA 5H9CA 4PA4A 3K3WA 2BOCC 3ZIAG 3RW0A 3LDCA 1SESA 5B1NA 3CCJV 2LFSA 3CCSV 3FB7C 4MS2A 4MTGA 1FXKB 1OCOB 2ZDIC 1Q7YW 1BMFG 4X8AA 3UKMA 3K9AA 4CBCA 5CMUA 2WLKA 4JYBA 3W7SA 2Z3YA 4G27B 4GX5A 2XASA 2XAQA 3F7VC 1W0JG 4HAMA 5LHGA 1R6NA 3JYCA 1GO3F 4JF3A 3AG2C 3AG1C 2M7WA 1BHAA 4N21A 1VQNV 2JEUA 5L3GA 1F23A 4P2ZA 4PA7A 2WLLA 1R3IC 1S3JA 3E8HA 3CCLV 4U7NA 5L3DA 1S0VA 2OCCB 2JDIG 1MSWD 3CCQV 1E79G 3ETEA 3ASOC 2LFRA 2QTOA 4R50A 3ASOB 3R65A 1ROPA 3ZRXA 1IXMA 1JPXA 1QVGU 4I5SA 1FS0G 2PI4A 1NVPB 3SYOA 3T1CA 1K97A 2HKOA 3DGEA 4QPJA 3FYEB 2XAJA 1COWG 2IH1C 3BY6A 3AG1B 4JAUA 4MVRA 4ZKIA 1EBOA 4RQFA 3LNMB 1RM1B 4JTAB 2EIKB 3TCUA 4MVQA 4QE9A 1DF4A 1YJWV 5H6QA 5C93A 3FB5C 1K4DC 2C2AA 4TSFG 3AG4C 2HVJC 2ITCC 4UVBA 1VQ7V 4XDKA 1K7DA 4GX1A 4LP8A 3TK1A 1KECA 3ZN1A 4F4LA 3ML0A 1S5HC 3ASNB 4MTFA 4PA3A 1S72V 2OTLV 1R73A 1F4NA 5IYCO 3SYQA 4UV8A 5LGTA 1DTOA 1KD1W 3ABLB 3RVYA 1FFTB 1K3EA 3T4ZA 3IC7A 3AG2B 1NR1A 4P30A 3CCVV 2ZXWB 1LNQA 5EBMC 4TT3G 1QLNA 3I55V 3CXCU 1FXKA 1Y66A 5CBFA 2EIMB 1V54B 1P7BA 3LUTB 4OXSA 3CD6V 2QA4V 1CP9A 2W6JG 5LHHA 2AHYA 1YJNV 3X2QC 1CEZA 4BAYA 3WFVA 2A9HA 5IY5C 4R8CA 2JIZG 4GT1A 1SZTA 5DN6G 4H37A 5LBQA 1MG1A 1K33A 1SERA 1W0KG 3OFNG 2EZPA 4MVOA 3EFFK 1S77D 1NH2B 4MVMA 3ZRWA 1E1RG 3K03A 3F7YC 4G2KA 2CK3G 4GX2A 3W7WA 1NJIW 1I5XA 1H8EG 3STZC 3IGAC 3NXSA 1VQ8V 3ABLC 2DWDC 4QNHB 1Q82W 2XAHA 1R3KC 2ZD9A 3H01A 3E35A 1OCRB 2XAGA 1PKXA 5L3BA 3K04A 1QCEA 2WLNA 2WLIA 2WLJA 2DYRC 3UM7A 4X89A 3ABKC 3IFXA 1KP2A 2WLMA 3ETDA 3OEHG 1K73W 2P7TC 2X7RB 5BZBA 2A79B 3CCEV 1F4MA 3QO5A 4QJFB 2WLIB 1VQOV 3JCZA 2JJ1G 3TETA 4WCEV 3ETGA 4JYCA 5L3CA 3KG2A 3OUSA 3W7XA 2DYSC 3F5WC 1M57C 2NNUA 1NBMG 3SPGA 3OGCC 2FTKA 2DQ3A 3CC7V 4MVSA 4PDMA 1K8AW 1DF5A 3T4DA 1VQKV 3PJSK 5EC1C 2Z5UA 1R3JC 1VQ9V 3SYCA 3OMNB 2EILB 4WFBV 1AI6A 2BOBC 4ZBMA 3JD3A 5EC2C 4E2LA 3MHSC 1QBZA 4WFFA 4DO2A 3QO8A 2Y69C 1QR9A 4WF9V 5B1BB 1PL0A 1PNLA 4MTXA 2Q68A 1CPYA 2QE7G 3CCUV 2QM7A 3AG3B 1NKDA 3OMAB 5FL7G 1GM7A 2W6IG 4FJCC 5IY5B 5LGNA 1K34A 3K0GA 4JGSA 1YI2V 2HVKC 4KUMA 5J9PC 3X2QB 3K79A 2D3OW 3OW2U 1WPXA 5EBLC 1MABG 3VBBA 1KP3A 4UUJC 1G8MA 1TUEB 2QEXV 3FB8C 2A0LA 2WWWA 2JJ2G 3STLC 1YSCA 4RQEA 1GM9A 1VQ4V 1NVPD 3JD0A 2ZR2A 4R7CA 1H8HG 5L3EA 3E8BA 1M90W 1W2BU 3E86A 5B3SB 2WLLB 2YEVB 4KP4A 4BIUA 4RO2A 4EKWA 3CMEV 1KC8W 2HR3A 4G28B 2R9RB 2B5UA 3G6EV 4P9PA 1AJQA 2IU3A 4PDRA 4H33A 2DYSB 4GX0A 1V55B 4L87A 4UVAA 5DM6V 5L3FA 1ORQC 4U7OA 1MOFA 4N23A 3ZMZA 2P90A 3OR6C 1THZA 4MVUA 2HFEC 1XL6A 3LSQA 2JK5C 3GB7C 4JAVA 1VQ6V 2EIKC 1OCCB 3LDDA 2HLDG 1YJ9V 2P67A 2IJIA 2MK3A 2YEVA 1HWYA 5HFLA 2DQ0A 2DWEC 2ZQMA 1NR7A 3AG3C 4MTOA 1AJPA 1JCHA 3DTUB 3K08A 4PA9A 4UXNA 3QNEA 2IH3C 4J9ZB 3T2MA 1NH2D 2DW4A 2UXNA 4WFHA 2X0LA 2IU0A 5E1AC 1RM1C 1JOYA 3OR7C 1AI5A 4PELA 4HYOA 3ZMSA 1AI4A 1RPRA 4BW5A 1XL4A 3JD1A 3CC2V 1OCZC 3AG4B 3OM3B 2JEXA 4QIWF 3K06A 2Q6AA 4Q20A 3SJQC 5KA5A 2KB1A 4WFEA 1FXHA 1K9MW 4WFGA 5IYDO 3VOUA 1GK9A 3E8FA 4JPRA 4LC1A 3ZMVA 4MW3A 1G4YB 2GSMB 4X88A 4ASUG 5EBWC 3W7UA 1S76D 2F43G 1I5YA 3P32A 4FMTA 4FIPC 4PDLA 1YTFD 1YTFB 3E89A 3LSSA 2OT5A 4MT8A 3ZJZA 4BIZA 3ZN0A 1K5SA 1OCCC 2ZDIA 5CBHA 3CCMV 3ZMUA 5CBGA 1VQMV 2GHYA 2NLJC 2XNDG 1JQ0A 2EBOA 1VQPV 5EK0A 1Q86W 1EFRG 1SRYA 4QPKA 2EJRA 4Z1MG 3CMAV 3W7TA 1PD3A 2IJHA 1VQLV 1V54C 2X6BA 3E2EA 3OMIB 1JX9A 4JTDB 2WSSG 1P4RA 2V7QG 4QE7A 5B1AB 2IW5A 3D36A 2WPDG 3HB3B 3BEHA 1JVMA 3OAAG 1V55C 4P9OA 4GCZA 2LP7A 3GWOA 4UV9A 1E1QG 3CC4V 1YHQV 4PA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9R B;  4P9P A;  2AHY A;  1BL8 A;  3X2Q C;  4PDR A;  4H33 A;  3SYP A;  4GX0 A;  1QLE C;  4PDV A;  1KKD A;  2A9H A;  1K4C C;  5IY5 C;  1R3L C;  1ORQ C;  4R8C A;  2ZXW C;  1OCR C;  3OUF A;  4I9W A;  4KFM A;  4R6Z A;  5KUK A;  4RUE A;  4H37 A;  2H8P C;  4TWK A;  3OR6 C;  4LBE C;  4MVO A;  3EFF K;  2W0F C;  4MVU A;  4MVM A;  2EIM C;  1XL6 A;  2HFE C;  5B1B C;  3RBZ A;  3K03 A;  4PA4 A;  2BOC C;  3F7Y C;  4GX2 A;  3RW0 A;  3LDC A;  2JK5 C;  3GB7 C;  3STZ C;  3IGA C;  2EIK C;  3FB7 C;  2ITD C;  4MS2 A;  3LDD A;  4MTG A;  3ABL C;  2QKS A;  2DWD C;  3HPL C;  4QNH B;  4X8A A;  5KUM A;  1R3K C;  2ZD9 A;  2YEV A;  3UKM A;  2AHZ A;  3ASN C;  4CBC A;  4XDL A;  2WLK A;  2DWE C;  3K04 A;  2WLI A;  2WLN A;  4G27 B;  4GX5 A;  2WLJ A;  3F7V C;  2DYR C;  3UM7 A;  4X89 A;  3ABK C;  3WG7 C;  3IFX A;  2WLM A;  3K0D A;  3AG3 C;  4MTO A;  3JYC A;  3AG2 C;  3K08 A;  3AG1 C;  2P7T C;  3E83 A;  3LUT B;  4PA9 A;  5BZB A;  2A79 B;  2IH3 C;  4J9Z B;  3T2M A;  4JTC B;  2WLI B;  4MW8 A;  4WFH A;  1ZWI C;  3TET A;  4P2Z A;  4PA7 A;  5E1A C;  3KG2 A;  2HJF C;  3OUS A;  2WLL A;  2DYS C;  3F5W C;  1M57 C;  1R3I C;  2K1E A;  3RVZ A;  3E8H A;  1J95 A;  3OGC C;  3OR7 C;  5B1A C;  4HYO A;  3SPG A;  4BW5 A;  1XL4 A;  3ASO C;  2ATK C;  4MVS A;  4PDM A;  2QTO A;  1OCZ C;  4R50 A;  3T4D A;  3PJS K;  5EC1 C;  3ZRS A;  1R3J C;  4RUF A;  2Q67 A;  3SPJ A;  2Q69 A;  3ABM C;  3R65 A;  3K06 A;  2OCC C;  2Q6A A;  3SYC A;  2BOB C;  4ZBM A;  3SJQ C;  5EC2 C;  2KB1 A;  4WFE A;  4WFF A;  2HG5 C;  1M56 C;  3SPH A;  3SYO A;  3T1C A;  2Y69 C;  4LCU C;  4WFG A;  3VOU A;  3E8F A;  4RAI A;  1OCO C;  2Q68 A;  4J9Y B;  2IH1 C;  4MVR A;  4MW3 A;  1G4Y B;  2X6A A;  3LNM B;  4JTA B;  3TCU A;  4X88 A;  4MVQ A;  4QE9 A;  5EBW C;  3K0G A;  5B3S C;  2HVK C;  5J9P C;  3FB5 C;  1K4D C;  3AG4 C;  4PDL A;  2ITC C;  2HVJ C;  3E89 A;  3SPC A;  3ZJZ A;  5EBL C;  1OCC C;  4UUJ C;  5CBH A;  2EIJ C;  4XDK A;  3FB8 C;  5CBG A;  4GX1 A;  4LP8 A;  2A0L A;  2NLJ C;  3LDE A;  3STL C;  4F4L A;  5EK0 A;  1S5H C;  2X6C A;  4MTF A;  4PA3 A;  3SPI A;  4R7C A;  4MVZ A;  3SYA A;  3SYQ A;  1V54 C;  2X6B A;  4DXW A;  3E8B A;  3RVY A;  4JTD B;  3T4Z A;  2EIN C;  3FB6 C;  4P30 A;  3E86 A;  4QE7 A;  3E8G A;  2WLL B;  3BEH A;  1LNQ A;  1JVM A;  5EBM C;  4RO2 A;  4HZ3 A;  4EKW A;  1V55 C;  4MSW C;  4P9O A;  2EIL C;  4XDJ A;  5CBF A;  2WLH A;  1P7B A;  4OXS A;  4G28 B;  4PA6 A; 
#chains in the Genus database with same CATH topology
 2ZE8 A;  1BL8 A;  2ARH A;  1XMO B;  4R6Z A;  5DED A;  2YXY A;  5B1B C;  4X1Y A;  5GON A;  5KHJ A;  3K5M A;  3CYO A;  2NN4 A;  4GKK O;  3ABM B;  4XBF A;  1AR1 B;  3HPL C;  3OTF A;  5KUM A;  3L74 H;  3KCY A;  1M56 B;  3WG7 B;  3G71 V;  1M9N A;  2EIN B;  3E83 A;  5FPR A;  2Q7H A;  3ABU A;  5JH7 B;  3N2K B;  4MW8 A;  1ZWI C;  4I50 B;  3FD9 A;  3ZRW B;  1PNM A;  3OT7 A;  4O4I B;  3OTO B;  2HJF C;  1SET A;  2K1E A;  1YIJ V;  2IJJ A;  1SKV A;  4I0X B;  2Q0O C;  1ZL8 A;  3SPJ A;  2Q67 A;  2B1G A;  2JVD A;  2V1D A;  3CP1 A;  3Q4H B;  4H44 B;  2XAF A;  4LCU C;  1KUQ A;  2H3O A;  4LF7 O;  1Z2G A;  2X6A A;  3S3X A;  1MA1 A;  3B2E E;  4FPP A;  3ZCC A;  1WLE A;  5B3S C;  2B1I A;  3G4S V;  2UXC O;  4IIJ A;  1OCZ B;  4FM1 A;  1X59 A;  4CC6 A;  4IT5 A;  2ODM A;  3EHB B;  3B8N A;  1SQF A;  3QO7 A;  3IJ4 A;  5TIS Z;  2A06 H;  4DV6 B;  1SQX H;  4MVZ A;  3SYA A;  1H2G A;  3BAB A;  4B08 A;  3FKS G;  1IDS A;  3FB6 C;  2K9P A;  1YZB A;  2Q5Z A;  4MSW C;  4XDJ A;  2ZNJ A;  3ZHU A;  1QQC A;  2YSU B;  4RUF A;  2WAM A;  1JJ2 U;  3HKD B;  2JS3 A;  1OCR C;  5KUK A;  4ZHQ B;  4LBE C;  1OV9 A;  4B3R B;  1GN3 A;  1HDJ A;  3RBZ A;  2VQE O;  4PA4 A;  2BOC C;  4U3J B;  4X20 B;  3ZIA G;  3RW0 A;  1B06 A;  1N0J A;  2GUZ B;  2LFS A;  2UUB B;  2FKX A;  4IIJ B;  1N32 O;  2CE4 A;  1VF6 C;  4DR4 O;  1BMF G;  4X8A A;  3UKM A;  3JAR B;  1NT2 B;  4JYB A;  4AI8 A;  2Z3Y A;  4GX5 A;  1GO3 F;  1H2N A;  1B3Q A;  3O65 A;  4J7K A;  1BSM A;  5L3G A;  1KU9 A;  5C8Y B;  1Y74 B;  4PA7 A;  4KHP O;  3CCL V;  1MZE A;  3ETE A;  2L6L A;  1PL4 A;  1ROP A;  1IXM A;  1JPX A;  4KL1 A;  2Q9L A;  1FS0 G;  3AK3 A;  4O2B A;  3FX7 A;  4QPJ A;  3FYE B;  1COW G;  4CC5 A;  1RM1 B;  1AVM A;  3TCU A;  3RYI A;  1YJW V;  5C93 A;  4K8Z A;  2DJV A;  3NR7 A;  3SJC C;  5CA0 A;  1BCC H;  2ITC C;  1VQ7 V;  3N2G B;  1HNW O;  2YXL A;  3ASN B;  1IBK O;  4BR6 A;  4UV8 A;  2DMX A;  4LR3 A;  1GN2 A;  5LGT A;  3RVY A;  1GAX A;  1SC5 B;  3AG2 B;  1NR1 A;  4P30 A;  2ZXW B;  1LNQ A;  1XIL A;  2EIM B;  4BWA A;  1V54 B;  2QA4 V;  1CP9 A;  2W6J G;  2AHY A;  4U3F H;  2DN9 A;  4ZI7 B;  5J2T A;  4BAY A;  4B3R O;  3WFV A;  4R8C A;  3EXA A;  4GT1 A;  1SQV H;  1N33 O;  1VF5 B;  5LMN B;  2CH7 B;  4H37 A;  1R6T A;  1MG1 A;  1SER A;  4MVO A;  3EFF K;  1I7F A;  1NH2 B;  3IAY A;  3K03 A;  5JVD A;  4LFA B;  4G2K A;  3JAW B;  3H1I H;  2ZNI A;  2BSK B;  1GRJ A;  3NXS A;  1TAE A;  3H01 A;  2XAG A;  2WLN A;  4O4J A;  3QF7 A;  2WLM A;  1KYO F;  3ETD A;  1SS3 A;  4YY3 B;  4LF6 B;  2P7T C;  1VQO V;  3TET A;  3E22 A;  2GDS A;  3KG2 A;  2DYS C;  2NNU A;  5K1X A;  5LMU B;  4RWU A;  4YJ3 A;  1DF5 A;  4TQF A;  1VQK V;  1R3J C;  3I5D A;  5BMV B;  3OMN B;  2EIL B;  2EJ7 A;  5EIB C;  3MHS C;  4WFF A;  3M8A A;  2Q7E A;  4D6T H;  1IUR A;  2FYU H;  1PL0 A;  5IE9 A;  1PNL A;  2Q68 A;  1Y67 A;  3CCU V;  3AG3 B;  1NKD A;  5FL7 G;  2GTS A;  4TUY A;  4GZR B;  5IY5 B;  1K34 A;  1YI2 V;  2Q4P A;  1FD9 A;  3OW2 U;  1WPX A;  2A3Q A;  3H1J H;  4J80 A;  1L8D A;  1MAB G;  5JCO C;  1TUE B;  3APQ A;  5J2U B;  3FB8 C;  1YSC A;  1GM9 A;  1YCI A;  1H2S B;  3BAA A;  2N05 A;  3JD0 A;  3AK2 A;  5B3S B;  2WLL B;  4BIU A;  1VMG A;  3AG7 A;  3RYI B;  3CME V;  1KC8 W;  2HR3 A;  4JZG A;  4G28 B;  5ITZ A;  1AB3 A;  3CEI A;  2B5U A;  3G67 A;  4JI4 B;  2UU9 O;  4UVA A;  5L3F A;  4U7O A;  4FLV A;  1MOF A;  4N23 A;  3ZMZ A;  4X64 B;  2HFE C;  2BTQ B;  4JI6 O;  2D2C B;  2JK5 C;  3MDS A;  2CAZ C;  3ZHS A;  1OCC B;  3LDD A;  2P67 A;  2YEV A;  4EFB A;  2ZE7 A;  2DQ0 A;  5A9G A;  1XNQ B;  2ZQM A;  1NR7 A;  1JCH A;  4DUZ B;  1KB9 F;  4B7K A;  1X4T A;  4J9Z B;  3T2M A;  4X66 B;  4DR7 B;  1HNW B;  3CX5 F;  4WFH A;  2IU0 A;  5E1A C;  1BT8 A;  4AHC A;  2Y4T A;  2KQX A;  4KHP B;  4DV1 O;  3AG4 B;  4QIW F;  2OWO A;  3K06 A;  1QNM A;  3SJQ C;  2XT9 A;  2KB1 A;  3RYH B;  4WBN B;  4NVP A;  1K9M W;  5IYD O;  2VWK A;  4JPR A;  3ZMV A;  1G4Y B;  4PJ0 Z;  4ASU G;  2ZT9 B;  1XHX A;  4JI8 O;  3HKE A;  3P32 A;  4FMT A;  5CA1 B;  4FIP C;  2QTS A;  1R1B A;  2OT5 A;  4UCO A;  4NTX A;  2ZDI A;  5CBH A;  3CCM V;  1MMM A;  1TVK A;  2RDC A;  4TOI A;  2GHY A;  1HW7 A;  1JQ0 A;  2XND G;  1XMQ O;  1W59 A;  5EIB D;  1EFR G;  2Q0A A;  3THO A;  1PD3 A;  2IJH A;  1VQL V;  1JX9 A;  5JJE B;  4QE7 A;  1FKA O;  2IW5 A;  1KMI Z;  2WPD G;  1JVM A;  1Z5V A;  4AIL C;  2LP7 A;  5FNV A;  5IJ9 A;  4DR5 O;  5IYZ A;  4F6R B;  5H5N A;  4H0L B;  3CXH F;  1BQ0 A;  1QLE C;  3N2G A;  2LO1 A;  1XEQ A;  4JYY A;  3OUF A;  5FLX N;  4JV5 O;  2Y0I A;  4TWK A;  2ZM6 O;  3OD4 A;  3P3P A;  4CH3 A;  1NS1 A;  2CH7 A;  2Z0A A;  1B6Q A;  1K92 A;  3AEI A;  5B1O A;  1N8R W;  1ENV A;  4FFB B;  4FK5 C;  1N32 B;  2HJD A;  1XHZ A;  3L75 H;  2JS5 A;  4CZZ A;  2RQ6 A;  4UCS A;  4D7T A;  5LP6 C;  2E5L O;  1VAR A;  1ARO P;  4J10 A;  4JTC B;  4TUY B;  1GMG A;  1GN6 A;  3B8M A;  1XRE A;  1J95 A;  5B1A C;  1M1K W;  1V9P A;  5KX5 B;  1PNK A;  4TV8 B;  3ZRS A;  2Q69 A;  2UXD B;  5LA6 B;  2N74 A;  4JI7 O;  2RNB A;  3SPH A;  3RGB A;  4RAI A;  2YIB D;  5H6R A;  3R66 A;  5KA6 A;  2XOK G;  3L73 H;  2Y69 B;  4X1I B;  4WFA V;  5F2V O;  2EIJ B;  4H13 B;  3ZBH A;  4LFB O;  1R6K A;  3ZX6 A;  2FML A;  1J5E O;  3SPI A;  3H1L H;  1Q81 W;  3CRQ A;  1FXK C;  1H38 A;  3OGI B;  2EIN C;  1LUW A;  4DR5 B;  4I4T A;  3WB2 A;  1NZ6 A;  2RJZ A;  3HKE B;  3VQV A;  5GW7 A;  4YY3 O;  3T1H O;  1YF2 A;  3SYP A;  1XUQ A;  3SJB C;  4O2A B;  1AJN A;  2KG7 A;  4I9W A;  1WN7 A;  5EZY A;  5CB4 A;  4JI2 O;  2H8P C;  3UO2 A;  2EUL A;  2YID A;  1K5Q A;  5H9C A;  4DW1 A;  3ZHT A;  1WP7 A;  1PM9 A;  4EFE A;  1FJG B;  1TUB B;  3CRM A;  2PGG A;  3FB7 C;  2ETN A;  4MS2 A;  5IJ0 A;  4LFA O;  4MTG A;  1FXK B;  1Q7Y W;  2WLK A;  4ABM A;  2XAS A;  4LF8 O;  1W0J G;  2ADP A;  1R6N A;  3VQX A;  5B5E Z;  3AG1 C;  2M7W A;  1LUV A;  4X65 B;  4LF9 O;  2JEU A;  1ZL8 B;  4DV6 O;  1F23 A;  4P2Z A;  4ZOL A;  4CH5 A;  4X1I A;  1R3I C;  1S3J A;  1S0V A;  4U7N A;  3N2K A;  4JYA O;  2QTO A;  2AW9 A;  4FM2 A;  3ZRX A;  3CSX A;  1QVG U;  4I5S A;  4LH6 A;  1I94 O;  3SYO A;  4K0K O;  3CRR A;  3DGE A;  2IH1 C;  3C3T A;  1EBO A;  1I08 A;  4JTA B;  4UB6 Z;  4JI3 B;  1ZUQ A;  3FB5 C;  2C2A A;  4TSF G;  3JAL B;  3AG4 C;  2HVJ C;  4TV8 A;  4LF5 B;  4CS4 A;  1PV0 A;  2R72 A;  2VS0 A;  1NU1 H;  3TK1 A;  3ZN1 A;  4F4L A;  2PY5 A;  3ML0 A;  3QG5 A;  3QVN A;  3M7M X;  4MTF A;  2BSK A;  1AR4 A;  1R73 A;  3U10 A;  4A5U B;  1SQB H;  5IYC O;  2AGA A;  1FFT B;  3T4Z A;  4YJ2 B;  1WA8 A;  1QLN A;  3JAT B;  3ZED A;  1H2M A;  1FYJ A;  1FXK A;  3HKC A;  1XDC A;  4D7S A;  3U11 A;  4UCU A;  3SDL A;  3X2Q C;  2ZIN A;  5E79 Z;  2A9H A;  5IY5 C;  4IL6 Z;  4X9Q A;  5DN6 G;  3OFN G;  2EZP A;  1S77 D;  1O9G A;  1SQG A;  4GX2 A;  2CK3 G;  3W7W A;  4FLX A;  1NJI W;  1A32 A;  3J80 N;  2XAH A;  1VIB A;  3E35 A;  5L3B A;  1PKX A;  1YDX A;  1QCE A;  2WLI A;  4GUN A;  1SQP H;  4X89 A;  3ABK C;  3IFX A;  1KP2 A;  1IBL O;  3H1K H;  5GTI Z;  5CB4 B;  3JCZ A;  4LWS A;  3JAT A;  2Y0P A;  3F5W C;  4DR7 O;  2FTK A;  5FPO A;  3CC7 V;  4O4H B;  1XMQ B;  3PJS K;  5EC1 C;  2Z5U A;  5LL6 Y;  4K0K B;  1AI6 A;  2BOB C;  4ZBM A;  5EC2 C;  1KBH A;  4DO2 A;  3QO8 A;  1KKC A;  3IC9 A;  4DR3 O;  1JFF A;  1L0N H;  2QE7 G;  2QWP B;  2W6I G;  3K0G A;  4I55 B;  2HVK C;  4KUM A;  4LF5 O;  2D3O W;  1YVW A;  2JGD A;  2JJ2 G;  1VQ4 V;  3HKB B;  5LA6 A;  1UPG A;  1M5I A;  5L3E A;  3JAS A;  3BFR A;  3E8B A;  2XTA A;  3JAM N;  5KLV H;  2YEV B;  3Q4H A;  4NYK A;  4UCV A;  3H1H H;  2NR5 A;  3G6E V;  1JJO A;  4LFC B;  4H33 A;  4GX0 A;  1T5E A;  4JI0 O;  5BY1 A;  1N36 O;  4DYL A;  1THZ A;  2F4V B;  5LP6 B;  4NXN O;  2JRI A;  2OIE A;  4OPA A;  2QKA A;  4JAV A;  3GB7 C;  3JAK B;  4DV0 O;  3D3Q A;  4JI1 O;  1Y76 A;  5JQG B;  1JMK C;  2MK3 A;  5CA0 B;  5LMN O;  2DWE C;  3T1Y O;  3RWR D;  2QSA A;  2AXT Z;  3AG3 C;  4O2A A;  3DTU B;  1SA0 B;  3K08 A;  2ZKO A;  3BRC A;  2IH3 C;  2KSD A;  5LXT A;  5AG2 A;  4EB6 A;  2UXN A;  3SJA C;  1XI1 A;  3CJH B;  1Q5O A;  4JI5 B;  5BMV A;  2UUA B;  2VQE B;  1IZ3 A;  2PF4 E;  4OX9 O;  2VQF B;  2JGD B;  3ZMS A;  4E4E A;  3CC2 V;  2AZ0 A;  3J7A U;  2LW7 A;  2JEX A;  4DR4 B;  4O4J B;  2KG7 B;  4NKG B;  1HNX B;  4LC1 A;  3H9V A;  4JI0 B;  5EBW C;  1FFX B;  4DW0 A;  1EZV H;  3APO A;  4PHZ A;  1YTF B;  3E89 A;  3E22 B;  3ZJZ A;  4BIZ A;  4J11 A;  1K5S A;  1O9H A;  1OCC C;  1QU7 A;  4B7E A;  3ZMU A;  2VWJ A;  2NLJ C;  1VQP V;  1ZX3 A;  4Z1M G;  4DV4 O;  3OMI B;  4JTD B;  2WSS G;  3JAK A;  1OJH A;  3A0B Z;  3HB3 B;  2YDE A;  1V55 C;  4O4L B;  4PI2 A;  4K8X A;  3UT5 A;  2YIB A;  2ADQ B;  2QWN B;  2CTW A;  3G80 A;  1N0N A;  2CGO A;  4PA6 A;  1YTF D;  5IYB O;  3FYI B;  2Q8V A;  4B3S B;  1OZ0 A;  4EB6 B;  1GTO A;  5JCO A;  2FL4 A;  1KKD A;  1MZF A;  4KFM A;  2ZE5 A;  2QJ1 A;  2EX3 A;  4DUY O;  3AK1 A;  4LWS B;  5CA3 A;  4HNA A;  4UB8 Z;  1WB7 A;  4UFZ A;  2ITD C;  1NTM H;  1EN4 A;  2UXB B;  2QKS A;  2IJK A;  3L70 H;  1HR0 B;  2AHZ A;  3ASN C;  3JD4 A;  4UCR A;  5KMG A;  2P22 C;  3K0D A;  1YIT V;  3DC5 A;  1KQS U;  1P7G A;  1HP8 A;  3ABK B;  4JAS A;  2LQT A;  5FNV B;  2OYQ A;  3CRA A;  4LF9 B;  1QVF U;  3OEE G;  3KKY A;  3C90 A;  2PTM A;  3ABM C;  4O4I A;  1JA8 A;  3OE7 G;  1D5A A;  1M56 C;  1N34 B;  3JSL A;  2UXX A;  3RYC A;  2RCV A;  5BR8 B;  5CA1 A;  4J9Y B;  5CN0 A;  2HHH O;  3ABT A;  1WP8 A;  4JAA A;  1ZLZ A;  3CE2 A;  3UO3 A;  2E76 B;  1QR8 A;  4Q6G A;  4JI3 O;  3SPC A;  4DR2 B;  4DV0 B;  4FLW A;  5LMU O;  3K58 A;  1SQQ H;  2EIJ C;  4LH7 A;  1GKF A;  4FLU A;  1VEW A;  4LF4 B;  2X6C A;  3RYH A;  4WBN A;  4DXW A;  1Y4M A;  2KKW A;  3E8G A;  3ZRV A;  1B04 A;  4HZ3 A;  2L35 A;  2EIL C;  3RYF A;  1AIL A;  1BGY H;  2YIC A;  1OHH G;  3JD2 A;  2F23 A;  4K35 A;  4DV3 O;  2UUA O;  2LW1 A;  5LHI A;  1US6 A;  4DV7 O;  4NTW A;  5IYZ B;  1GM8 A;  2QGN A;  4JI4 O;  3MHH C;  1M4U A;  2W0F C;  5BXZ A;  1JFF B;  3K3W A;  3LDC A;  3RFR A;  3CCJ V;  5BR8 O;  2HEP A;  3T1H B;  1OCO B;  4ICG A;  4JZ2 A;  2ZCE A;  2RMK B;  4CBC A;  1XNR O;  3RN4 A;  2ZM6 B;  3W7S A;  2XAQ A;  4HAM A;  4PD4 F;  1P84 F;  3RYC B;  2B9Z A;  4FFK A;  5KX5 A;  2PYL A;  1VQN V;  1HNZ O;  2WLL A;  5A2Q N;  3TXQ A;  3CCQ V;  1E79 G;  4I50 A;  4DR6 B;  2OCH A;  3ASO B;  4B3M O;  4DV5 O;  1AP5 A;  2OIG A;  2PYJ A;  2PI4 A;  1Q8I A;  3T1C A;  1K97 A;  2HKO A;  4DK0 A;  4GLX A;  4B3S O;  3ICX A;  4ZKI A;  1VP7 A;  3K5L A;  1DF4 A;  4DRX A;  3ZS8 C;  1K4D C;  2UU9 B;  4CS3 A;  2UXD O;  5KHK A;  1DK1 A;  1Q6U A;  4ZI7 A;  4XDK A;  1KEC A;  1XOU A;  4PA3 A;  5JH7 A;  4FM0 A;  2YI9 A;  1F4N A;  3CB2 A;  4O2B B;  3TGU H;  3SYQ A;  5LOV B;  1KD1 W;  1DTO A;  1K3E A;  4C7U A;  5KAI Z;  1Y66 A;  3GVM A;  5CBF A;  3WU2 Z;  1P7B A;  4OXS A;  3LNN A;  4DV7 B;  3CD6 V;  4JI8 B;  4I55 A;  4YIO A;  4HNA B;  1SZT A;  3SGI A;  1K33 A;  1BE3 H;  1E1R G;  2LJ2 A;  3HKB A;  3STZ C;  3IGA C;  4DV3 B;  4X62 O;  2LGW A;  1VQ8 V;  4NXN B;  2DWD C;  4X20 A;  1Q82 W;  2UUC O;  1R3K C;  2BCC H;  4NTY A;  1CXZ B;  3B09 A;  3K04 A;  4DV4 B;  2WLJ A;  5IJ9 B;  4Z2W A;  4LNU A;  3OEH G;  3J81 N;  5KHG A;  2X7R B;  4NB5 A;  2A79 B;  5BZB A;  3T1Y B;  1F4M A;  1Q6I A;  3ETG A;  1EN6 A;  3OUS A;  1M57 C;  1NBM G;  3SPG A;  3OGC C;  1BQZ A;  4MVS A;  1K8A W;  3CHX A;  1NTZ H;  3CRC A;  3UQ8 A;  4FZ0 A;  4CH6 A;  4F6R A;  1J5E B;  3SR2 C;  3JD3 A;  5IJ0 B;  1QBZ A;  1I0H A;  2Y69 C;  4WF9 V;  3D36 C;  4MTX A;  4JI7 B;  2Y4U A;  1N34 O;  2QM7 A;  2UXB O;  2UXC B;  3OMA B;  3DXR B;  1Q90 D;  3X2Q B;  4X1K A;  1I94 B;  5IWA O;  5EBL C;  3VBB A;  1KP3 A;  4UUJ C;  1G8M A;  3A0H Z;  2UUC B;  2A0L A;  4YJ2 A;  1SA0 A;  1WNS A;  4IGG A;  1XNR B;  5LXT B;  4R7C A;  4KP4 A;  4RO2 A;  1HR0 O;  1JR9 A;  4PI0 A;  3D8C A;  4DRX B;  3K59 A;  4LF8 B;  2E74 B;  5H2F Z;  4P9P A;  1Q43 A;  4PDR A;  3TJT A;  4X1Y B;  4IYH A;  3CS5 A;  5DM6 V;  1N4C A;  2CGN A;  1ORQ C;  2QKC A;  2P90 A;  4AQY O;  4MVU A;  4LFB B;  1IX9 A;  1YJ9 V;  2P4K A;  2QM4 A;  3A2F A;  4LNU B;  2IJI A;  2R9A A;  1HWY A;  5HFL A;  2CDY A;  5GTH Z;  4BIO A;  2F4V O;  4MTO A;  3JAS B;  3ZHR A;  4UXN A;  3QNE A;  2DW4 A;  1AR5 A;  1BS3 A;  1NTK H;  4OGQ B;  3C3S A;  1RPR A;  5JJN B;  3JD1 A;  2BE3 A;  1OCZ C;  4NXM O;  1MSD A;  3BVO A;  3OM3 B;  4B3T B;  5J2T B;  1TUB A;  3TXS A;  4Q20 A;  4DR6 O;  4WFE A;  5LYJ B;  3DXR A;  1GK9 A;  4JI5 O;  2ZIO A;  1Z5W A;  4MW3 A;  4X88 A;  1Y6X A;  1S76 D;  3KCX A;  2F43 G;  4X65 O;  3CJH A;  3O9O A;  1TVK B;  3FAV A;  3A8T A;  2HP8 A;  4EEQ A;  3ZN0 A;  1N33 B;  4IYI A;  5CBG A;  1VQM V;  2EBO A;  2IM9 A;  5EK0 A;  1LR1 A;  4QPK A;  2EJR A;  3CMA V;  3E2E A;  4JV5 B;  4TV9 A;  2V4D A;  3BEH A;  1WPB A;  4P9O A;  2CTP A;  5EYP A;  3GWO A;  3P3N A;  3HKD A;  2LGQ A;  3P30 A;  2OTJ V;  2UUB O;  4YHH O;  3FAV B;  2ZXW C;  5ITZ B;  4RUE A;  2MW2 B;  2P6J A;  1EN5 A;  1F7Y A;  1RPO A;  2EIM C;  1TGO A;  1D2D A;  5JQG A;  1NI8 A;  3DSQ A;  2ZR3 A;  1F51 A;  1WJZ A;  3B77 A;  1IBM O;  1WA8 B;  4DR1 B;  4XDL A;  1UJW B;  1MNG A;  3WG7 C;  5IWA B;  2YC0 A;  3JSN A;  1IXB A;  1PPJ H;  3CCR V;  1DGS A;  4O4L A;  3QTC A;  2QWR B;  4U3J A;  3MD0 A;  4J7J A;  4IHJ A;  2EZO A;  3UT5 B;  3RVZ A;  4FZ1 A;  1EZJ A;  2ZE6 A;  3A0R A;  2ATK C;  5C8Y A;  1RSO A;  1Q6H A;  1DLB A;  2OCC C;  1QHT A;  2E5L B;  3PN1 A;  3EVK A;  1M57 B;  2W0X A;  2HG5 C;  1Y76 B;  1BHB A;  2XUM A;  2YIA A;  3WB1 A;  5KHH A;  1OCO C;  5IDJ A;  1FXV A;  2Q73 A;  1M93 A;  2QM8 A;  2VQF O;  2DOS A;  1AI7 A;  5LP6 A;  2DE0 X;  2H94 A;  3D3I A;  5LGU A;  2AZ2 A;  2PI5 A;  2YUA A;  3M99 B;  4NR1 A;  1ZSP A;  4UVC A;  2DYR B;  2ILM A;  5EZY B;  3LDE A;  5HFM A;  1RP3 B;  2R9I A;  2WA4 A;  1S5J A;  1AP6 A;  4YXW G;  4X62 B;  1P49 A;  1YEW A;  1NQT A;  4JI2 B;  4DR3 B;  3MAQ A;  4PV1 B;  1QLE B;  4DR2 O;  4GKJ B;  4O4H A;  2WLH A;  3ZMT A;  1XNQ O;  4LF4 O;  4I4T B;  1L1F A;  5KAF Z;  2YXH A;  3I56 V;  1G1X B;  4PDV A;  3S3W A;  4X66 O;  1K4C C;  1R3L C;  2Y48 A;  3CPW U;  4B3T O;  2FB5 A;  4KXR A;  1VQ5 V;  1EM1 A;  3BCC H;  1SES A;  5B1N A;  4AQY B;  3CCS V;  2P06 A;  1SF9 A;  5LOV A;  2ZDI C;  1H2L A;  3K9A A;  2GV9 A;  5CMU A;  2CTQ A;  1W2B U;  4G27 B;  5LHG A;  1HNX O;  1TA8 A;  3F7V C;  1SZX A;  3JYC A;  4JF3 A;  3AG2 C;  1URF A;  1GN4 A;  1D5N A;  1BHA A;  4N21 A;  2R70 A;  3HR0 A;  1IVS A;  1ZAU A;  4ZHQ A;  3JAL A;  3E8H A;  4JI6 B;  4F6E A;  2E75 B;  5L3D A;  2OCC B;  2JDI G;  1MSW D;  1UFI A;  3ASO C;  2LFR A;  1ZTE A;  4R50 A;  3F5T A;  5D5Q A;  3R65 A;  2M6Y A;  3N27 A;  2QR4 A;  2N04 A;  1WB8 A;  1NVP B;  4BW9 A;  4YHH B;  2XAJ A;  5KMG B;  1XMO O;  3BY6 A;  4JAU A;  3AG1 B;  4MVR A;  4RQF A;  3LNM B;  2EIK B;  4MVQ A;  4QE9 A;  1U96 A;  5H6Q A;  4ZOL B;  4FVM A;  2CUG A;  4UVB A;  4DV2 B;  2QWQ B;  1IBM B;  1K7D A;  3JAR A;  4GX1 A;  4LP8 A;  1YXB A;  4GYC B;  1S5H C;  4FLY A;  1S72 V;  1G6U A;  4FLT A;  2OTL V;  2BTQ A;  4ZIB A;  3ABL B;  5J2U A;  3IC7 A;  4QGP A;  3CCV V;  4FFB A;  2QDO A;  5EBM C;  4TT3 G;  3I55 V;  2VRZ A;  3CXC U;  3L71 H;  1H2K A;  3LUT B;  5LHH A;  1YJN V;  3VQW A;  1CEZ A;  5JJJ B;  2JIZ G;  4OPH A;  1Y74 A;  2F1M A;  5LBQ A;  4J42 A;  1W0K G;  4DV5 B;  1Q3E A;  3JCU Z;  4MVM A;  3ZRW A;  2G38 A;  3F7Y C;  5B66 Z;  4DK1 A;  4FLZ A;  1I5X A;  4J41 A;  1H8E G;  4YJ3 B;  3FFQ A;  1FFX A;  3ABL C;  4QNH B;  4J7Z A;  2Q7G A;  2ZD9 A;  2PZS A;  1OCR B;  5EYP B;  3WB0 A;  5KHI A;  2CTR A;  2DYR C;  3UM7 A;  2YS8 A;  1K73 W;  4DV2 O;  3L9D A;  3CCE V;  3QO5 A;  4QJF B;  2WLI B;  4UCT A;  2YI8 A;  2JJ1 G;  4WCE V;  2ZIM A;  2P5O A;  5GON B;  1XQ8 A;  3BA9 A;  4JYC A;  5L3C A;  3W7X A;  1PP9 H;  2F93 B;  2DQ3 A;  3RYF B;  4PDM A;  4I9Q A;  3T4D A;  1FJG O;  2PUS A;  1VQ9 V;  3SYC A;  4WFB V;  1FPO A;  4E2L A;  3K9S A;  4LF7 B;  3K57 A;  1HNZ B;  1QR9 A;  1RSO B;  5B1B B;  1CPY A;  3BA8 A;  1GM7 A;  4FJC C;  5LGN A;  2GBO A;  3K5O A;  4JGS A;  5J9P C;  3K79 A;  2HHH B;  4K3A A;  2RN9 A;  4CH4 A;  4DUZ O;  2QEX V;  4DUY B;  5IT9 N;  2WWW A;  3STL C;  4RQE A;  3JAW A;  1NVP D;  4W4K A;  2GUZ A;  2ZR2 A;  1H8H G;  4Z1V A;  1VF7 A;  3K5N A;  1M90 W;  3E86 A;  4X64 O;  4EKW A;  4YIP A;  4DV1 B;  3B4S A;  4IHJ B;  4DR1 O;  2R9R B;  4GKJ O;  2JGU A;  1AJQ A;  2IU3 A;  2DYS B;  4L87 A;  1V55 B;  3LSU A;  3GWK C;  4L8J A;  3OR6 C;  2P4V A;  1XL6 A;  5JWP A;  3LSQ A;  2O57 A;  1S5L Z;  1VQ6 V;  2EIK C;  2F66 C;  5D5P A;  2HLD G;  2E3C A;  4LFC O;  4B3M B;  3BPZ A;  2BTO A;  4W4L A;  5K1P A;  1XBL A;  3CWB H;  4OX9 B;  4GKK B;  3ETQ A;  2IBZ H;  1N36 B;  3BHP A;  1AJP A;  2A7W A;  4PA9 A;  1U97 A;  1NH2 D;  4JI1 B;  2X0L A;  5DEC A;  4JYA B;  1RM1 C;  4X1K B;  1JOY A;  3OR7 C;  1AI5 A;  4PEL A;  4HYO A;  1AI4 A;  4BW5 A;  1XL4 A;  4CS2 A;  3VQY A;  2Q6A A;  4TV9 B;  4TQD A;  5KA5 A;  1FXH A;  2XHB A;  4WFG A;  3VOU A;  1RFY A;  1BZK A;  3E8F A;  3HKC B;  2WA3 A;  1IBL B;  2F95 B;  2GSM B;  4LF6 O;  3UCS C;  3W7U A;  4NXM B;  1I5Y A;  3KZI Z;  3ZHV A;  1FAF A;  4PDL A;  3G6B A;  3LSS A;  4MT8 A;  1GH6 A;  3DC6 A;  1VF6 A;  1IBK B;  5JVD B;  2GTA A;  4I0X A;  1Q86 W;  1SRY A;  3L72 H;  5LYJ A;  3W7T A;  3OTO O;  1WAZ A;  1V54 C;  2X6B A;  1P4R A;  5B1A B;  2V7Q G;  3D36 A;  2QWO B;  3B40 A;  3OAA G;  3U0Z A;  1L0L H;  4GCZ A;  3ZHQ A;  4UV9 A;  3RT3 C;  1E1Q G;  3CC4 V;  1YHQ V;  4HBN A;  4I7Z B; 
#chains in the Genus database with same CATH homology
 3P30 A;  2OTJ V;  5IYB O;  1BL8 A;  3FYI B;  1OZ0 A;  1QLE C;  1GTO A;  1KKD A;  2ZXW C;  3OUF A;  4KFM A;  4R6Z A;  4RUE A;  2P6J A;  4TWK A;  1RPO A;  5B1B C;  2EIM C;  5CA3 A;  3CYO A;  2ZR3 A;  1B6Q A;  1F51 A;  1K92 A;  3AEI A;  5B1O A;  1N8R W;  2ITD C;  1ENV A;  3B77 A;  3ABM B;  4XBF A;  2QKS A;  3HPL C;  1AR1 B;  2IJK A;  5KUM A;  2AHZ A;  3ASN C;  3JD4 A;  4FK5 C;  4XDL A;  1UJW B;  1M56 B;  3WG7 B;  3WG7 C;  4CZZ A;  3G71 V;  3K0D A;  1M9N A;  2EIN B;  1YIT V;  3E83 A;  1ARO P;  3ABU A;  4JTC B;  3CCR V;  4MW8 A;  1ZWI C;  3ZRW B;  1KQS U;  1GMG A;  1PNM A;  3ABK B;  3MD0 A;  4JAS A;  2HJF C;  1SET A;  2EZO A;  2K1E A;  3B8M A;  3RVZ A;  1YIJ V;  1J95 A;  5B1A C;  1M1K W;  1QVF U;  2IJJ A;  1EZJ A;  1PNK A;  3A0R A;  3OEE G;  2ATK C;  3ZRS A;  3SPJ A;  2Q67 A;  2B1G A;  2Q69 A;  1DLB A;  3ABM C;  2OCC C;  2V1D A;  1M57 B;  3OE7 G;  3CP1 A;  2HG5 C;  1M56 C;  3SPH A;  2XAF A;  1BHB A;  2UXX A;  4LCU C;  4RAI A;  1OCO C;  5IDJ A;  1FXV A;  4J9Y B;  5CN0 A;  5H6R A;  2QM8 A;  2X6A A;  1AI7 A;  4FPP A;  3ABT A;  3ZCC A;  5KA6 A;  1WLE A;  5B3S C;  2XOK G;  2H94 A;  3D3I A;  5LGU A;  2PI5 A;  2B1I A;  3G4S V;  1QR8 A;  1OCZ B;  3SPC A;  3M99 B;  2Y69 B;  4UVC A;  2EIJ C;  2DYR B;  3EHB B;  1GKF A;  4WFA V;  3LDE A;  5HFM A;  2EIJ B;  3B8N A;  2R9I A;  1R6K A;  2X6C A;  3QO7 A;  3SPI A;  4MVZ A;  3SYA A;  1H2G A;  4YXW G;  4DXW A;  1Q81 W;  1FXK C;  3FKS G;  1Y4M A;  1H38 A;  3FB6 C;  2EIN C;  1NQT A;  3E8G A;  3ZRV A;  4HZ3 A;  1QLE B;  4MSW C;  2EIL C;  4XDJ A;  2WLH A;  3ZMT A;  1OHH G;  3JD2 A;  2YSU B;  4RUF A;  5GW7 A;  5LHI A;  1L1F A;  3I56 V;  2WAM A;  3SYP A;  4PDV A;  1JJ2 U;  1K4C C;  1R3L C;  1AJN A;  2Y48 A;  1OCR C;  4I9W A;  5KUK A;  3CPW U;  1GM8 A;  2H8P C;  4LBE C;  3MHH C;  2W0F C;  1VQ5 V;  3RBZ A;  1K5Q A;  5H9C A;  4PA4 A;  3K3W A;  2BOC C;  3ZIA G;  3RW0 A;  3LDC A;  1SES A;  5B1N A;  3CCJ V;  2LFS A;  3CCS V;  3FB7 C;  4MS2 A;  4MTG A;  1FXK B;  1OCO B;  2ZDI C;  1Q7Y W;  1BMF G;  4X8A A;  3UKM A;  3K9A A;  4CBC A;  5CMU A;  2WLK A;  4JYB A;  3W7S A;  2Z3Y A;  4G27 B;  4GX5 A;  2XAS A;  2XAQ A;  3F7V C;  1W0J G;  4HAM A;  5LHG A;  1R6N A;  3JYC A;  1GO3 F;  4JF3 A;  3AG2 C;  3AG1 C;  2M7W A;  1BHA A;  4N21 A;  1VQN V;  2JEU A;  5L3G A;  1F23 A;  4P2Z A;  4PA7 A;  2WLL A;  1R3I C;  1S3J A;  3E8H A;  3CCL V;  4U7N A;  5L3D A;  1S0V A;  2OCC B;  2JDI G;  1MSW D;  3CCQ V;  1E79 G;  3ETE A;  3ASO C;  2LFR A;  2QTO A;  4R50 A;  3ASO B;  3R65 A;  1ROP A;  3ZRX A;  1IXM A;  1JPX A;  1QVG U;  4I5S A;  1FS0 G;  2PI4 A;  1NVP B;  3SYO A;  3T1C A;  1K97 A;  2HKO A;  3DGE A;  4QPJ A;  3FYE B;  2XAJ A;  1COW G;  2IH1 C;  3BY6 A;  3AG1 B;  4JAU A;  4MVR A;  4ZKI A;  1EBO A;  4RQF A;  3LNM B;  1RM1 B;  4JTA B;  2EIK B;  3TCU A;  4MVQ A;  4QE9 A;  1DF4 A;  1YJW V;  5H6Q A;  5C93 A;  3FB5 C;  1K4D C;  2C2A A;  4TSF G;  3AG4 C;  2HVJ C;  2ITC C;  4UVB A;  1VQ7 V;  4XDK A;  1K7D A;  4GX1 A;  4LP8 A;  3TK1 A;  1KEC A;  3ZN1 A;  4F4L A;  3ML0 A;  1S5H C;  3ASN B;  4MTF A;  4PA3 A;  1S72 V;  2OTL V;  1R73 A;  1F4N A;  5IYC O;  3SYQ A;  4UV8 A;  5LGT A;  1DTO A;  1KD1 W;  3ABL B;  3RVY A;  1FFT B;  1K3E A;  3T4Z A;  3IC7 A;  3AG2 B;  1NR1 A;  4P30 A;  3CCV V;  2ZXW B;  1LNQ A;  5EBM C;  4TT3 G;  1QLN A;  3I55 V;  3CXC U;  1FXK A;  1Y66 A;  5CBF A;  2EIM B;  1V54 B;  1P7B A;  3LUT B;  4OXS A;  3CD6 V;  2QA4 V;  1CP9 A;  2W6J G;  5LHH A;  2AHY A;  1YJN V;  3X2Q C;  1CEZ A;  4BAY A;  3WFV A;  2A9H A;  5IY5 C;  4R8C A;  2JIZ G;  4GT1 A;  1SZT A;  5DN6 G;  4H37 A;  5LBQ A;  1MG1 A;  1K33 A;  1SER A;  1W0K G;  3OFN G;  2EZP A;  4MVO A;  3EFF K;  1S77 D;  1NH2 B;  4MVM A;  3ZRW A;  1E1R G;  3K03 A;  3F7Y C;  4G2K A;  2CK3 G;  4GX2 A;  3W7W A;  1NJI W;  1I5X A;  1H8E G;  3STZ C;  3IGA C;  3NXS A;  1VQ8 V;  3ABL C;  2DWD C;  4QNH B;  1Q82 W;  2XAH A;  1R3K C;  2ZD9 A;  3H01 A;  3E35 A;  1OCR B;  2XAG A;  1PKX A;  5L3B A;  3K04 A;  1QCE A;  2WLN A;  2WLI A;  2WLJ A;  2DYR C;  3UM7 A;  4X89 A;  3ABK C;  3IFX A;  1KP2 A;  2WLM A;  3ETD A;  3OEH G;  1K73 W;  2P7T C;  2X7R B;  5BZB A;  2A79 B;  3CCE V;  1F4M A;  3QO5 A;  4QJF B;  2WLI B;  1VQO V;  3JCZ A;  2JJ1 G;  3TET A;  4WCE V;  3ETG A;  4JYC A;  5L3C A;  3KG2 A;  3OUS A;  3W7X A;  2DYS C;  3F5W C;  1M57 C;  2NNU A;  1NBM G;  3SPG A;  3OGC C;  2FTK A;  2DQ3 A;  3CC7 V;  4MVS A;  4PDM A;  1K8A W;  1DF5 A;  3T4D A;  1VQK V;  3PJS K;  5EC1 C;  2Z5U A;  1R3J C;  1VQ9 V;  3SYC A;  3OMN B;  2EIL B;  4WFB V;  1AI6 A;  2BOB C;  4ZBM A;  3JD3 A;  5EC2 C;  4E2L A;  3MHS C;  1QBZ A;  4WFF A;  4DO2 A;  3QO8 A;  2Y69 C;  1QR9 A;  4WF9 V;  5B1B B;  1PL0 A;  1PNL A;  4MTX A;  2Q68 A;  1CPY A;  2QE7 G;  3CCU V;  2QM7 A;  3AG3 B;  1NKD A;  3OMA B;  5FL7 G;  1GM7 A;  2W6I G;  4FJC C;  5IY5 B;  5LGN A;  1K34 A;  3K0G A;  4JGS A;  1YI2 V;  2HVK C;  4KUM A;  5J9P C;  3X2Q B;  3K79 A;  2D3O W;  3OW2 U;  1WPX A;  5EBL C;  1MAB G;  3VBB A;  1KP3 A;  4UUJ C;  1G8M A;  1TUE B;  2QEX V;  3FB8 C;  2A0L A;  2WWW A;  2JJ2 G;  3STL C;  1YSC A;  4RQE A;  1GM9 A;  1VQ4 V;  1NVP D;  3JD0 A;  2ZR2 A;  4R7C A;  1H8H G;  5L3E A;  3E8B A;  1M90 W;  1W2B U;  3E86 A;  5B3S B;  2WLL B;  2YEV B;  4KP4 A;  4BIU A;  4RO2 A;  4EKW A;  3CME V;  1KC8 W;  2HR3 A;  4G28 B;  2R9R B;  2B5U A;  3G6E V;  4P9P A;  1AJQ A;  2IU3 A;  4PDR A;  4H33 A;  2DYS B;  4GX0 A;  1V55 B;  4L87 A;  4UVA A;  5DM6 V;  5L3F A;  1ORQ C;  4U7O A;  1MOF A;  4N23 A;  3ZMZ A;  2P90 A;  3OR6 C;  1THZ A;  4MVU A;  2HFE C;  1XL6 A;  3LSQ A;  2JK5 C;  3GB7 C;  4JAV A;  1VQ6 V;  2EIK C;  1OCC B;  3LDD A;  2HLD G;  1YJ9 V;  2P67 A;  2IJI A;  2MK3 A;  2YEV A;  1HWY A;  5HFL A;  2DQ0 A;  2DWE C;  2ZQM A;  1NR7 A;  3AG3 C;  4MTO A;  1AJP A;  1JCH A;  3DTU B;  3K08 A;  4PA9 A;  4UXN A;  3QNE A;  2IH3 C;  4J9Z B;  3T2M A;  1NH2 D;  2DW4 A;  2UXN A;  4WFH A;  2X0L A;  2IU0 A;  5E1A C;  1RM1 C;  1JOY A;  3OR7 C;  1AI5 A;  4PEL A;  4HYO A;  3ZMS A;  1AI4 A;  1RPR A;  4BW5 A;  1XL4 A;  3JD1 A;  3CC2 V;  1OCZ C;  3AG4 B;  3OM3 B;  2JEX A;  4QIW F;  3K06 A;  2Q6A A;  4Q20 A;  3SJQ C;  5KA5 A;  2KB1 A;  4WFE A;  1FXH A;  1K9M W;  4WFG A;  5IYD O;  3VOU A;  1GK9 A;  3E8F A;  4JPR A;  4LC1 A;  3ZMV A;  4MW3 A;  1G4Y B;  2GSM B;  4X88 A;  4ASU G;  5EBW C;  3W7U A;  1S76 D;  2F43 G;  1I5Y A;  3P32 A;  4FMT A;  4FIP C;  4PDL A;  1YTF D;  1YTF B;  3E89 A;  3LSS A;  2OT5 A;  4MT8 A;  3ZJZ A;  4BIZ A;  3ZN0 A;  1K5S A;  1OCC C;  2ZDI A;  5CBH A;  3CCM V;  3ZMU A;  5CBG A;  1VQM V;  2GHY A;  2NLJ C;  2XND G;  1JQ0 A;  2EBO A;  1VQP V;  5EK0 A;  1Q86 W;  1EFR G;  1SRY A;  4QPK A;  2EJR A;  4Z1M G;  3CMA V;  3W7T A;  1PD3 A;  2IJH A;  1VQL V;  1V54 C;  2X6B A;  3E2E A;  3OMI B;  1JX9 A;  4JTD B;  2WSS G;  1P4R A;  2V7Q G;  4QE7 A;  5B1A B;  2IW5 A;  3D36 A;  2WPD G;  3HB3 B;  3BEH A;  1JVM A;  3OAA G;  1V55 C;  4P9O A;  4GCZ A;  2LP7 A;  3GWO A;  4UV9 A;  1E1Q G;  3CC4 V;  1YHQ V;  4PA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...