2DWEC

Crystal structure of kcsa-fab-tba complex in rb+
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords ANTIBODY FAB HEAVY CHAIN
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel
pubmed doi rcsb
source organism Streptomyces lividans
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dweC00
2H8PC 3FB8C 5CBFA 4X89A 2IH1C 4MS2A 4HYOA 2NLJC 1V54C 3SYOA 1QLEC 3LDEA 2A79B 5E1AC 2X6BA 4G27B 4DXWA 4TWKA 2WLIA 3VOUA 4LBEC 4MVUA 3K08A 4PDVA 4PA4A 5J9PC 2Q69A 2WLJA 4GX1A 3T2MA 3STLC 2EIMC 3OGCC 4JTDB 4MTFA 3ZJZA 5EK0A 1JVMA 2W0FC 3R65A 2WLNA 3E8GA 2R9RB 2X6AA 3RVYA 3STZC 3ABMC 4MW8A 3LDCA 2EIKC 2Y69C 4H37A 3IGAC 4PA9A 4PA3A 2HVJC 2AHYA 1R3KC 3K04A 4P30A 2DWEC 3K0GA 4R7CA 3F5WC 4KFMA 3SPGA 2HJFC 1P7BA 3ZRSA 2ZD9A 5EC1C 4RO2A 4MVMA 2EIJC 4LP8A 3GB7C 2Q68A 4MSWC 5B1AC 2IH3C 4WFGA 3SPIA 4LCUC 4QE7A 4WFFA 3SJQC 3OR7C 1K4DC 4MVOA 4QE9A 5CBGA 3T4ZA 2DWDC 5EBMC 3FB6C 5IY5C 4RAIA 4OXSA 2HG5C 3F7VC 2ITDC 3T1CA 4PDLA 4MTOA 4MVZA 3SPHA 2KB1A 1XL4A 3OUFA 4MW3A 2WLLA 3OR6C 3F7YC 4MVQA 3FB5C 5BZBA 4GX2A 4P9PA 1J95A 3KG2A 2Q67A 4HZ3A 2OCCC 3E83A 4GX0A 3E8BA 4MVSA 1M57C 4XDLA 3BEHA 4XDJA 5KUMA 3SYPA 3HPLC 2JK5C 2AHZA 4RUFA 1G4YB 3ASOC 2ZXWC 2ATKC 3UM7A 2EINC 4P2ZA 1LNQA 4J9YB 4X8AA 2A0LA 4JTCB 3LNMB 3SPJA 3LUTB 3JYCA 3WG7C 3X2QC 2HFEC 1K4CC 1OCZC 4MVRA 2BOCC 3IFXA 4WFHA 4CBCA 3SYQA 4PDMA 5KUKA 4EKWA 3RW0A 4ZBMA 3AG4C 3T4DA 3AG1C 4X88A 2WLIB 3ABLC 3AG3C 1XL6A 4PDRA 3E86A 2HVKC 3SPCA 2A9HA 2DYSC 4I9WA 1OCOC 1ZWIC 5EBWC 4G28B 2ITCC 2YEVA 4R6ZA 3UKMA 1OCCC 1ORQC 3PJSK 1R3LC 4BW5A 2X6CA 2WLLB 2WLHA 3K03A 3K06A 3OUSA 4F4LA 3E89A 5EBLC 2BOBC 3RBZA 3RVZA 3ABKC 1OCRC 5B1BC 1R3IC 4H33A 3AG2C 4RUEA 1M56C 2DYRC 4QNHB 2Q6AA 1KKDA 1R3JC 3E8HA 4J9ZB 3TETA 2EILC 4PA7A 5EC2C 1V55C 2K1EA 3K0DA 3FB7C 4MTGA 3SYAA 2P7TC 4JTAB 4XDKA 4PA6A 3SYCA 1S5HC 3EFFK 4R50A 3ASNC 4R8CA 4P9OA 1BL8A 2WLMA 5CBHA 4UUJC 3TCUA 3LDDA 2QTOA 2WLKA 4GX5A 5B3SC 3E8FA 2QKSA 4WFEA
chains in the Genus database with same CATH superfamily
3G6EV 4JI6O 3SYOA 2A79B 2DJVA 1I0HA 3ML0A 1GK9A 1BT8A 4MVUA 4PA4A 4DRXB 4TT3G 3OGCC 2V1DA 3X2QB 4DV6B 1R73A 4MW8A 2BSKA 4DR3B 4TV9A 5LGUA 2QKAA 5FLXN 2YSUB 1FS0G 4RO2A 4U7OA 4RQEA 2UXBB 2N04A 1T5EA 3FB6C 1KB9F 3J81N 5KAIZ 4MTOA 1XL4A 1W0JG 2WA4A 3FAVB 2YIBD 3T1YO 5KHIA 2ZNIA 2EILB 3UO2A 3CX5F 2BCCH 4LC1A 1PM9A 3BEHA 1VMGA 2AHZA 4JF3A 1RFYA 2Z3YA 3EXAA 1WLEA 2JEXA 4P2ZA 3CCRV 2Y4UA 4CH5A 3B2EE 4ZI7A 3BA8A 1MNGA 2YDEA 1AROP 4X88A 3AG3C 3N27A 4X65O 3E86A 1TVKB 1O9GA 1QVFU 1KUQA 2FL4A 2R9AA 2Y48A 3AK1A 2Q9LA 2KKWA 1JQ0A 2DYRC 2YXLA 2BTQA 3E8HA 4PA7A 2VQFB 1MMMA 2K1EA 1K73W 5IWAB 2VS0A 3ASNC 1SQBH 4IIJB 4O2BB 1SA0B 1L0NH 2X0LA 1I94B 3Q4HA 3FB8C 5L3BA 5EYPB 2UXDO 1NTMH 1Q5OA 2EIKB 2EULA 3OD4A 4KHPB 3VOUA 1XHZA 1HWYA 3C3TA 4JI5B 4NXNO 5B1OA 1GTOA 5EK0A 1N0JA 3G67A 5ITZA 3RYHA 3QG5A 1KD1W 3LSSA 3UT5A 2HKOA 2YI8A 3CS5A 3F5WC 1P7BA 3P30A 3CXCU 4LWSB 3HKEB 4MSWC 1VQLV 3SPIA 1JJ2U 4O4JB 5IE9A 1SQQH 4J42A 4DR5B 4NVPA 3JD0A 4YY3B 3HKDA 4JYCA 2UU9O 4F6EA 4GX2A 3KG2A 4TUYA 3ZRWA 4TV8B 3RT3C 5KUMA 4XDJA 2Q8VA 4O4HA 1P7GA 1H2NA 4DR4B 1U96A 1N32B 2DYSB 2PTMA 3LNMB 3X2QC 1HR0O 1WPBA 3ABUA 1SKVA 1CP9A 5EIBC 3ZRVA 1K4CC 2CAZC 4JI8B 3IFXA 4CBCA 1VQPV 3SYQA 1SS3A 2X7RB 1OZ0A 1N0NA 3P3PA 3OE7G 4UB6Z 2OT5A 3G6BA 2A9HA 3OMIB 2HJDA 3GWKC 1WAZA 1M1KW 4DV4O 1N34B 1BSMA 3ZS8C 2YEVA 3OW2U 4DK0A 1TGOA 3FYEB 5KHGA 1PNLA 2BSKB 4DV0B 5LL6Y 4K8XA 4ZHQA 3CB2A 2QGNA 1PD3A 3K58A 3AG2C 3QTCA 4TV9B 2JGDB 2EILC 3G80A 4K3AA 2GTSA 3U0ZA 1AJQA 1NZ6A 1NBMG 5CA3A 2Q0AA 1VP7A 4FLYA 3E8FA 4BAYA 1U97A 4WFAV 2WSSG 3LDEA 3D8CA 2B5UA 2OCCB 4DUZB 1TAEA 3M8AA 2JGUA 4KUMA 2YS8A 3OTFA 2MK3A 3K57A 2AGAA 2P67A 3ETDA 4D7SA 1Q8IA 2JIZG 4DV7O 1PNKA 4UXNA 3H01A 3AG4B 2HHHO 4J11A 3U11A 1XNQB 3CXHF 2EIJC 1HNWO 1H2KA 4UFZA 4QE7A 3AG7A 3QO5A 3OR7C 4B3RB 5IY5C 2FKXA 3N2KB 4RAIA 1EZVH 3K9SA 3A8TA 3SJCC 4C7UA 1S72V 1B06A 2BTQB 3SYPA 4X1KA 3KZIZ 4X9QA 3ASOC 4NR1A 3ZMTA 3UM7A 2NNUA 3SPJA 1DF4A 3DXRA 4OGQB 4LF8B 2JEUA 4OPAA 1OCZC 3Q4HB 4H13B 1YXBA 3RYCA 1M9NA 5KUKA 4DYLA 3ABKB 1NI8A 4X66O 1RSOB 2XAFA 1OCOC 1NS1A 1MSDA 4FFBA 3SR2C 1HW7A 3CMEV 5IDJA 5ITZB 5CA1A 1AJPA 4LF9O 3RYHB 2UUAB 4JI4O 4H33A 1GAXA 1KKDA 2P5OA 2GDSA 5IJ0A 3B09A 1CXZB 3TETA 2UXCB 2KG7A 1N36B 1G6UA 1I08A 1MZEA 4R50A 1IBLO 3G4SV 2UXXA 1PP9H 4JV5O 5CB4A 2VRZA 1VQ7V 2IH1C 1V54C 4YHHO 2FYUH 2IU3A 3CEIA 3HR0A 1XEQA 3BPZA 4TUYB 4BIZA 4LBEC 2E3CA 1K3EA 4O4HB 3CCJV 5IT9N 2IBZH 3K5MA 4JAVA 4D7TA 4LF4B 3E8GA 2X6AA 1IURA 3OTOB 5LA6A 3R66A 1R3KC 4EB6A 3K0GA 3JD1A 1KU9A 2HJFC 5FPRA 1IXBA 1XMQO 2R72A 4MVMA 1YI2V 4LP8A 1XNRB 3B8NA 5IYZA 1BE3H 1Y6XA 2YEVB 2ZM6O 4TOIA 4X1YA 3I55V 1E1RG 3SPHA 1IBKB 3E22A 4O2AB 3RWRD 1V9PA 1KQSU 2OCCC 4WF9V 1FFTB 4JI2B 4YIOA 2JVDA 2WAMA 1X4TA 4F6RA 3ABLB 5FL7G 2UUCB 4U3FH 3CE2A 1M93A 1GM9A 3W7UA 3AG4C 1VQ5V 3S3WA 5GONA 1NH2D 2NR5A 1SZTA 4ZIBA 1R3LC 2IM9A 3OUSA 4DRXA 3LSQA 5LYJA 4IGGA 1QLNA 2IJKA 1JFFA 4I7ZB 1R3JC 4CS3A 4PA6A 3JAMN 1UPGA 3DTUB 3W7WA 3K59A 3ZN0A 5J2UA 4DV3O 1AILA 5LP6C 3SGIA 1Q81W 1QLEC 1LR1A 3O65A 4DXWA 3OAAG 2ARHA 2FB5A 2WLIA 4K0KO 3FYIB 3FAVA 1K8AW 2Q69A 2B9ZA 2WWWA 4GKJB 1BMFG 4JTDB 1K7DA 4DV5B 3DXRB 5LMNB 1DF5A 3RYCB 1SF9A 3K04A 2E75B 4KFMA 4OPHA 5L3CA 4X20B 2DMXA 4FM0A 1BQ0A 4X62B 3KCYA 1JA8A 1OCCB 3N2GA 2JJ1G 4FFBB 4B08A 5D5QA 2F23A 1TUBA 4IHJA 2HG5C 4OXSA 1XI1A 2QWQB 4N21A 1FD9A 4DW0A 4DR1O 1EFRG 1G8MA 1RPOA 2FTKA 5IJ0B 3E83A 1M90W 4TQDA 1WN7A 3K5NA 1AB3A 4XDLA 3WB2A 4ZOLA 3AG3B 2CTRA 3WB1A 1L1FA 1R6TA 1WP7A 3E2EA 3FFQA 5CB4B 4IYHA 1GH6A 3ZIAG 3GWOA 4O2BA 2D3OW 2HR3A 2DN9A 1J5EB 1AR4A 4WCEV 3QNEA 5EYPA 4AHCA 2DYRB 1L8DA 4FLVA 1SQGA 4E4EA 2WLLB 2YICA 3ASNB 3B40A 4B3SB 5LA6B 4HAMA 1YJNV 1AR1B 1VQ8V 3ZHSA 4DR2B 4FJCC 4QNHB 2RN9A 3IC9A 4LFCO 3WG7C 4J7JA 4WFBV 5IYZB 3EFFK 5AG2A 5K1XA 1EZJA 4AI8A 1SERA 1Q6IA 3D36A 4X1YB 5CBHA 3RYIB 2Y0IA 3C90A 4FVMA 5E1AC 2ADPA 4XBFA 4G27B 5CA0A 2Q7HA 1AI4A 2Q5ZA 3JSNA 4GX1A 2EIMC 4TV8A 1YSCA 4QPKA 2L35A 2Z5UA 4YJ3A 3BA9A 4H37A 4I4TB 1H8HG 2DWEC 2EX3A 3BABA 4BW9A 1OJHA 2RJZA 5GONB 4JI0B 3RGBA 1JX9A 4WFFA 1KC8W 4QE9A 5BR8B 4JI1O 5LYJB 2RNBA 3C3SA 3EHBB 1A32A 1BZKA 1PV0A 3OUFA 1YTFB 4NXMB 4YIPA 1JFFB 2RMKB 4CC5A 2Q67A 4Q6GA 1IVSA 4FLTA 1R6KA 2CGOA 2P22C 4KL1A 1TA8A 2JGDA 4NTYA 2ATKC 1Z2GA 4J9YB 4JTCB 2O57A 1HNXB 5J2UB 4FM2A 2ZDIA 5H5NA 4JZ2A 1IBMB 2ILMA 2LQTA 4LR3A 2WLIB 2AZ2A 3JCZA 3AG2B 2CE4A 4MTXA 1B3QA 1OCCC 4UB8Z 2LO1A 3J80N 1YIJV 3CCEV 2BOBC 3I5DA 1H2GA 4CS4A 1GMGA 2Q6AA 2AZ0A 4DUYB 5EC2C 2GUZA 4PHZA 1Q6UA 3JAWB 4LF5B 4JGSA 4P9OA 3N2GB 1BL8A 2WLMA 1TUBB 3LDDA 4IHJB 4PV1B 2Q7EA 3KCXA 1FKAO 3L71H 4O4IA 1NR1A 4HYOA 4B3MO 3N2KA 2EBOA 2MW2B 3J7AU 1AI6A 4JI3O 1YJ9V 4B7KA 2E5LO 4NTWA 4DW1A 5J9PC 5DM6V 4ZOLB 1GM7A 4LFBO 2EIJB 1KP2A 1FPOA 4UVCA 3BVOA 4DO2A 3ABMC 2DOSA 5JWPA 2YXYA 5IY5B 2G38A 1FJGO 5LP6A 1H2SB 2QWRB 4UCUA 1FFXA 4QIWF 1AP5A 2Y4TA 4WFGA 2A06H 5FNVA 1W59A 4LF7O 5JCOC 1K4DC 1RSOA 1NU1H 2DE0X 3ABTA 3ASOB 4JYAO 1S0VA 2QTSA 5LBQA 2KB1A 1NT2B 3OM3B 4GKKB 1QR8A 2L6LA 1OCZB 2OCHA 4GUNA 3JALA 3HPLC 3ZMZA 1G4YB 1VQOV 4LF6B 1OCOB 1BHBA 4AQYO 3CYOA 4I50B 5KHHA 5GW7A 2Y0PA 1JR9A 2ZE7A 2VQEB 2CUGA 2GTAA 5CA0B 3BCCH 2F4VB 4IL6Z 1R6NA 4JZGA 3MAQA 2EJRA 2XT9A 5IYDO 4ABMA 1NR7A 2YUAA 3RBZA 4YJ3B 3P3NA 5B1BC 4GLXA 3GVMA 5KLVH 5GTIZ 1W2BU 1MSWD 1SC5B 1V54B 2F93B 2ZKOA 2GV9A 1VQ6V 2QWPB 4KP4A 5LGNA 1F23A 3UO3A 1N4CA 5JJJB 3JCUZ 4DV1O 3FKSG 1VARA 4JI6B 1VIBA 1UFIA 1AP6A 1I5XA 4O2AA 2WLJA 1WB8A 3T2MA 2XAHA 2ZCEA 2PZSA 1IX9A 1AI7A 2XASA 1N33O 2ZT9B 4JI7O 4FM1A 3RVYA 2P6JA 3OEEG 5L3DA 4LFAO 4BR6A 2Y69C 5EIBD 3IGAC 4PA3A 5L3GA 3W7SA 1I7FA 3IJ4A 3OFNG 4WBNB 4B3TO 1JMKC 1BQZA 2CK3G 5H9CA 4DV2O 1BGYH 1KKCA 5IJ9A 2QDOA 2CTPA 3T1CA 3JSLA 2GBOA 4P9PA 3MHHC 3T1YB 1SZXA 5D5PA 2GUZB 1LNQA 4X8AA 4Z2WA 1HNZO 2W6IG 4OX9O 4O4IB 3K9AA 1SESA 1Y76B 2H94A 1QBZA 2E74B 2M7WA 4X65B 2QWOB 2WLHA 3K06A 3JARB 3T1HO 4I9QA 5LP6B 3TXSA 1H2LA 3A2FA 1QLEB 5B66Z 1ZTEA 1FFXB 2XOKG 4R8CA 4X20A 5FNVB 1QVGU 4J10A 1M4UA 3DGEA 5DN6G 2M6YA 1XMOO 2UUBO 4DR7O 2H8PC 5KAFZ 4RQFA 2BE3A 3H1KH 4BIOA 1MG1A 2UXDB 4J7KA 1S5LZ 5CN0A 3JALB 5LHGA 3STLC 1F7YA 4FFKA 1GM8A 2PI5A 4NXNB 2JRIA 3DC6A 5LMUO 2E76B 3LNNA 4FZ1A 5B1AC 2YI9A 2PUSA 1HDJA 2ETNA 2D2CB 4MVOA 1KMIZ 2LGWA 4B7EA 2IU0A 5GTHZ 3MHSC 2WLLA 4MVQA 2QWNB 2V4DA 5BMVA 2UU9B 4GX0A 2JJ2G 2R9IA 2XHBA 3VBBA 3SDLA 5KHJA 1Q7YW 5JCOA 1HR0B 3A0BZ 2P4VA 3RYIA 4KXRA 5H6QA 4IT5A 4UCTA 1YHQV 4PDRA 3QF7A 2P90A 1JPXA 4X64O 4IYIA 4O4LA 3WG7B 3ZHUA 4D6TH 1XHXA 2X6CA 4DV4B 3CCMV 4DR6O 1VQ4V 1TUEB 4JPRA 2LP7A 4UCSA 1XBLA 2GHYA 1VQMV 1FXKC 1QHTA 3K0DA 4UCVA 2P7TC 2VWKA 4DK1A 4I4TA 1RM1C 4CH3A 3SJAC 1P4RA 4GKKO 5IJ9B 1FYJA 1DLBA 1XILA 3BRCA 3M99B 2EIMB 1ZLZA 5DEDA 2BTOA 5CBFA 4GT1A 1K5QA 3CD6V 3QVNA 4PDVA 1H38A 4DV6O 4N23A 4DR3O 1US6A 1WNSA 1FXHA 3BFRA 2HVJC 2JDIG 4DV7B 2UXBO 2HHHB 4I0XA 2JS3A 4LCUC 3D3IA 1HNWB 5LXTB 1XOUA 3O9OA 2OYQA 5IYCO 4UCOA 4YJ2B 3ETGA 3F7YC 2QSAA 3K3WA 2JS5A 1M57C 4LH7A 5H6RA 1K34A 2JK5C 4RUFA 1Q82W 3JAWA 4H44B 3AG1C 2C2AA 4GZRB 1QNMA 2HVKC 3ZHVA 1L0LH 1ZWIC 4X66B 1KP3A 1PPJH 2ITCC 2EJ7A 1ORQC 3PJSK 4LNUA 4RUEA 2VQFO 4LF9B 1Z5VA 4UV8A 4JI4B 3SYAA 5E79Z 5IWAO 1SQFA 4XDKA 2K9PA 3SYCA 2IW5A 2LW1A 1I94O 4CC6A 3IAYA 2ZE5A 1IBLB 2B1GA 1MA1A 1YVWA 1VQ9V 1Y66A 4JV5B 4KHPO 5BMVB 3ABMB 1Y74A 4JI5O 4YHHB 2P4KA 4PJ0Z 1P84F 1Y67A 3L75H 2PGGA 1CPYA 2NN4A 3ZHRA 1Q86W 1ZAUA 2CDYA 5J2TB 3K5OA 4PA9A 1K9MW 1K97A 4I50A 2ODMA 4FMTA 4EEQA 2KSDA 1JCHA 2Q68A 1XMQB 4X1IA 1F4NA 4DR5O 4O4LB 3SJQC 4YY3O 1URFA 3AEIA 5EBMC 2ZM6B 3AK3A 3F5TA 1B04A 1O9HA 4FPPA 4QGPA 3OGIB 3FB5C 2OTLV 2YIDA 4L8JA 5A2QN 4DR4O 1OHHG 1N32O 2EINC 4U3JA 3TK1A 4JI8O 1PKXA 2WPDG 3CC7V 4MVRA 2BOCC 3U10A 1IDSA 4EKWA 5KA5A 3T4DA 5B1BB 4EFBA 2IJJA 1MABG 2QJ1A 1N34O 2Q7GA 4I9WA 1SQVH 4DV0O 3HKBB 4JYBA 1JOYA 2R70A 2XAGA 3L72H 2ZE6A 2DQ3A 2LFSA 3ZMUA 2HLDG 1AVMA 4GYCB 1V55C 3B8MA 4JAUA 4I0XB 4GCZA 3WFVA 4WBNA 2Q4PA 2B1IA 2F66C 3CC2V 3CPWU 4W4LA 3ZHTA 4FLZA 4X89A 4DV3B 2OWOA 4U7NA 4DUZO 1YZBA 4FZ0A 2Y69B 3K08A 4K0KB 1YDXA 3ETEA 1FXKA 3ZCCA 2QM8A 4AILC 5LHHA 3PN1A 2YIAA 3P32A 1XNQO 2ZE8A 3SPGA 3CCLV 1EBOA 5IYBO 1BS3A 2W0XA 3VQVA 1Y76A 4MT8A 1VQNV 4B3RO 3S3XA 1R1BA 1WPXA 5HFMA 1H2MA 4PI2A 4E2LA 2ITDC 4LNUB 3RYFB 4JYYA 1WP8A 2FMLA 3JATB 3JARA 3W7XA 4DR1B 3APOA 3CRQA 4HZ3A 1NVPB 3E8BA 5FPOA 3CC4V 2QR4A 3ZMSA 3HKCB 4CS2A 4LF8O 5TISZ 1KYOF 4FK5C 3OMNB 4WFHA 1XDCA 2P06A 3JAKA 5DECA 3RW0A 1Y74B 3CCUV 4JAAA 1XL6A 1ROPA 1CEZA 1WA8A 1MZFA 4CH6A 1GRJA 4TSFG 1YJWV 1SETA 4R6ZA 1S77D 3CJHA 2UUAO 5H2FZ 3H1JH 5EBLC 3G71V 2CTWA 3SJBC 3VQXA 1FAFA 4HNAA 3TXQA 2UXCO 1M56C 1N36O 1DGSA 4UVBA 4LH6A 2RCVA 2CTQA 4X1IB 4LFCB 2LGQA 1SQPH 1M5IA 1NKDA 3H1IH 3MD0A 2PYLA 1X59A 1Q3EA 1D5AA 3CHXA 1VF6C 3QO7A 2ZXWB 4ICGA 4LF4O 4Q20A 3OTOO 4U3JB 5B1AB 4HBNA 1JVMA 3BY6A 3R65A 4FIPC 1GN4A 3NR7A 1HP8A 3E35A 3ZHQA 1QCEA 2F43G 3JASB 1KECA 1XNRO 5BXZA 5EC1C 1PL4A 5JH7B 4H0LB 3GB7C 4PI0A 3JD3A 1Z5WA 3APQA 3T4ZA 5JQGA 3F7VC 1IBKO 3CMAV 4MVZA 1VF7A 4JI1B 1ZUQA 4JI2O 2LFRA 1THZA 1K5SA 3ZBHA 1YTFD 2UUCO 4J7ZA 5C8YA 3D3QA 2XAQA 3WU2Z 1UJWB 3B77A 2HEPA 2QM7A 3LUTB 3JYCA 2DW4A 1E1QG 1S5JA 3THOA 2PY5A 3M7MX 4ZBMA 1EN5A 1NH2B 4W4KA 4BIUA 1W0KG 4I5SA 2XTAA 3OMAB 2OTJV 2PF4E 4G28B 1ENVA 1FXKB 2ZR2A 2CGNA 1RM1B 3KKYA 1GN3A 3E89A 5EZYA 1YITV 3TGUH 2AXTZ 2Q73A 1S76D 1QR9A 1ZL8A 1D5NA 2A3QA 3FX7A 2QE7G 1QU7A 1NTKH 4A5UB 1H8EG 2HP8A 1K33A 1AJNA 3ZRXA 4ZI7B 1COWG 3CP1A 1NTZH 1XREA 4UUJC 2WLKA 2Q0OC 5LXTA 2CH7A 5B5EZ 4MS2A 1P49A 4K35A 3K79A 3A0HZ 2YIBA 4YJ2A 4B3MB 5JJEB 4GKJO 4PD4F 3CCVV 1YCIA 4UCRA 2F95B 4YXWG 4DV5O 2H3OA 4JI3B 5LMNO 2E5LB 4LFBB 3LDCA 5LHIA 2EIKC 3JD4A 3CSXA 3JAKB 4R7CA 1NVPD 2ZD9A 4X62O 1FJGB 3L9DA 3OEHG 1N8RW 1WA8B 3LSUA 1VEWA 2IH3C 2Z0AA 3W7TA 4NYKA 1M57B 3MDSA 3BHPA 3CJHB 2ZNJA 4LF7B 1OCRB 3CWBH 4I55A 3UQ8A 3I56V 4JYAB 4NTXA 3D36C 4HNAB 1BHAA 5C93A 1ZX3A 3AG1B 2ZXWC 3H9VA 3UT5B 3WB0A 1D2DA 1J5EO 4AQYB 4PELA 1IXMA 1IZ3A 2ZIMA 4CH4A 2KQXA 4Z1VA 3SPCA 5L3EA 2DYSC 4UV9A 1SQXH 2YC0A 5EBWC 5LGTA 2RDCA 3HKDB 5A9GA 2UXNA 3UKMA 1S3JA 4B3SO 1F4MA 1VF5B 4F4LA 2VWJA 1Q90D 5KX5A 4DR2O 3ZRWB 3RVZA 1WJZA 1R3IC 5J2TA 2XUMA 3ZEDA 1GN6A 1QQCA 3FB7C 5LOVA 3BAAA 1DTOA 1B6QA 1XQ8A 3L70H 2A7WA 3TCUA 5JQGB 4GX5A 1F51A 1RP3B 2RQ6A 2LW7A 3RFRA 2NLJC 3B4SA 4TWKA 3L74H 5K1PA 5KMGA 2ZDIC 4DV1B 1LUWA 5C8YB 1LUVA 2IJHA 4ZHQB 4ZKIA 2W0FC 2WLNA 2R9RB 1RPRA 1N33B 4JI7B 2ZINA 4FLUA 2W6JG 4LFAB 2PI4A 4JI0O 1NQTA 5JVDA 3CRMA 2GSMB 5BR8O 2N74A 4B3TB 1VF6A 5JJNB 2DWDC 3EVKA 4DV2B 4FLWA 4NXMO 2EINB 4PDLA 5EZYB 3RN4A 5BY1A 3ICXA 1ZL8B 3OR6C 4UVAA 3HKBA 5BZBA 5KA6A 3OT7A 1WB7A 1EN6A 1HNXO 1MOFA 2A0LA 5B3SB 4NB5A 1IBMO 2CH7B 1HNZB 1GKFA 2ADQB 1K92A 4OX9B 1DK1A 5HFLA 1AR5A 1BCCH 5L3FA 3ZN1A 5F2VO 1I5YA 3CCSV 2OIGA 2OIEA 2V7QG 2ZQMA 4EFEA 1V55B 1XUQA 2YXHA 3ETQA 3ABKC 1OCRC 4DUYO 3T1HB 3VQWA 4X1KB 4J9ZB 4LF5O 4TQFA 1S5HC 4CZZA 2LJ2A 4I55B 1XMOB 3JD2A 2UUBB 4DR7B 1NJIW 3RYFA 2X6BA 1Y4MA 4J80A 3H1LH 4QJFB 3FD9A 2QA4V 1TVKA 3JATA 2QEXV 3ZMVA 5CA1B 5CMUA 1PL0A 4MTFA 3ZJZA 3ZX6A 2EZPA 2DQ0A 3HKCA 2PYJA 4K8ZA 3STZC 3UCSC 2F1MA 5LMUB 1SRYA 1Q6HA 3CCQV 2KG7B 2AHYA 4P30A 1G1XB 3ZRSA 2WA3A 2ZIOA 1PNMA 3CRCA 4Z1MG 1EM1A 1YF2A 1GN2A 2XNDG 1ZSPA 5CBGA 1E79G 4IIJA 4ASUG 1SA0A 3VQYA 2EZOA 4JASA 5KX5B 4BWAA 3L73H 2IJIA 4MW3A 1J95A 3AK2A 2AW9A 3CRRA 4MVSA 3QO8A 4LF6O 1Q43A 3DSQA 5LOVB 2ZR3A 4RWUA 3A0RA 3H1HH 4EB6B 3K5LA 1KBHA 2HFEC 1OV9A 2VQEO 4NKGB 4L87A 4PDMA 2QM4A 5KHKA 2F4VO 3DC5A 3ABLC 5KMGB 1VQKV 4LWSA 1GO3F 3HKEA 1M56B 1AI5A 1YEWA 4O4JA 2N05A 3CRAA 2QKCA 4BW5A 4G2KA 3K03A 4X64B 3E22B 4FLXA 4DR6B 4J41A 4F6RB 3IC7A 3HB3B 4MTGA 5JVDB 4JTAB 4QPJA 3JASA 3NXSA 1FXVA 3TJTA 5JH7A 1JJOA 2QTOA 5B3SC 1EN4A 2QKSA 5B1NA 4WFEA 2XAJA
chains in the Genus database with same CATH topology
2H8PC 1Q81W 3G6EV 3SYOA 4RQFA 1QLEC 2A79B 3ML0A 1MG1A 3OAAG 4DXWA 2WLIA 1GK9A 3FYIB 4MVUA 5CN0A 4PA4A 1K8AW 3QO7A 2Q69A 5LHGA 2ZXWB 2WWWA 4TT3G 3STLC 1BMFG 3OGCC 4JTDB 1K7DA 1GM8A 4Q20A 2V1DA 2PI5A 5B1AB 3X2QB 1JVMA 1R73A 3BY6A 1DF5A 3R65A 4FIPC 4MW8A 3E35A 1QCEA 3K04A 2F43G 1KECA 4KFMA 5L3CA 5EC1C 5LGUA 2YSUB 1FS0G 4RO2A 4U7OA 3GB7C 5B1AC 4RQEA 1OCCB 3JD3A 2JJ1G 4MVOA 3T4ZA 3FB6C 4OXSA 2HG5C 3F7VC 2IU0A 4N21A 3CMAV 4MTOA 4MVZA 3MHSC 1XL4A 1EFRG 1W0JG 2WLLA 1G8MA 4MVQA 1RPOA 2FTKA 2LFRA 1THZA 1K5SA 1YTFD 2EILB 3E83A 4GX0A 1M90W 2JJ2G 4LC1A 4XDLA 3BEHA 2R9IA 2AHZA 4JF3A 2Z3YA 2XAQA 3AG3B 3VBBA 1WLEA 1L1FA 1UJWB 2JEXA 4P2ZA 3CCRV 3E2EA 3B77A 1Q7YW 2QM7A 3LUTB 3JYCA 2DW4A 3ZIAG 1E1QG 3GWOA 2D3OW 1AROP 2HR3A 4ZBMA 5H6QA 4X88A 1YHQV 3AG3C 1NH2B 4PDRA 3E86A 4WCEV 4BIUA 1W0KG 3QNEA 4I5SA 3OMAB 2P90A 1JPXA 2OTJV 2DYRB 1QVFU 4G28B 1ENVA 3WG7B 1FXKB 2ZR2A 1RM1B 2X6CA 2WLLB 3CCMV 3ASNB 3E89A 2Y48A 1YITV 4HAMA 1QR9A 1YJNV 1VQ4V 1S76D 1TUEB 4JPRA 2LP7A 1AR1B 1VQ8V 2QE7G 1JQ0A 2DYRC 4FJCC 4QNHB 3E8HA 1H8EG 2GHYA 4PA7A 3WG7C 2K1EA 1FXKC 3K0DA 4WFBV 1VQMV 2P7TC 1RM1C 1K33A 1K73W 1AJNA 3EFFK 3ZRXA 1EZJA 3ASNC 1SERA 1COWG 1P4RA 3D36A 3CP1A 5CBHA 4UUJC 1DLBA 2WLKA 3M99B 2EIMB 2X0LA 3FB8C 5CBFA 4MS2A 5L3BA 3K79A 4GT1A 5E1AC 4XBFA 4G27B 2EIKB 1K5QA 3VOUA 3CD6V 1HWYA 3CCVV 4PDVA 1H38A 4YXWG 1AI4A 4GX1A 5B1OA 4N23A 2EIMC 1GTOA 5EK0A 1YSCA 4QPKA 2Z5UA 3LDCA 5LHIA 2EIKC 3JD4A 1FXHA 4H37A 1KD1W 3LSSA 2HVJC 2HKOA 2JDIG 1H8HG 2DWEC 4R7CA 3F5WC 1NVPD 1P7BA 2ZD9A 3OEHG 1N8RW 3P30A 3CXCU 4MSWC 1JX9A 2IH3C 1VQLV 3SPIA 1JJ2U 4LCUC 4WFFA 3W7TA 3D3IA 1M57B 1KC8W 4QE9A 5IYCO 3EHBB 3JD0A 3ETGA 4JYCA 1OCRB 3OUFA 3I56V 3F7YC 1YTFB 4GX2A 3KG2A 3K3WA 1BHAA 2Q67A 3ZRWA 5C93A 1M57C 5H6RA 5KUMA 4XDJA 1R6KA 1K34A 2JK5C 3AG1B 4RUFA 2ZXWC 2ATKC 4J9YB 2DYSB 4JTCB 3LNMB 1Q82W 3X2QC 3ABUA 1CP9A 3ZRVA 1K4CC 2ZDIA 3IFXA 4CBCA 1VQPV 3SYQA 4PELA 1IXMA 2X7RB 1OZ0A 3AG1C 2C2AA 2WLIB 3OE7G 2HVKC 2OT5A 3JCZA 3SPCA 3AG2B 2A9HA 2DYSC 3OMIB 4UV9A 5L3EA 1ZWIC 5EBWC 5LGTA 1M1KW 1KP3A 4MTXA 2YEVA 2ITCC 3OW2U 2UXNA 3UKMA 1OCCC 1ORQC 1S3JA 3PJSK 1F4MA 3FYEB 1PNLA 4F4LA 1YIJV 3CCEV 3ZRWB 2BOBC 3RVZA 1PD3A 1R3IC 3AG2C 4RUEA 1H2GA 1GMGA 2Q6AA 4UV8A 2EILC 5EC2C 3SYAA 3FB7C 4XDKA 3SYCA 1AJQA 2IW5A 1DTOA 5CA3A 4JGSA 1B6QA 4P9OA 1BL8A 2WLMA 3TCUA 3LDDA 4GX5A 3E8FA 1F51A 2B1GA 4BAYA 1VQ9V 1NR1A 1Y66A 2NLJC 4HYOA 2WSSG 3LDEA 4WFAV 2EBOA 3ABMB 1AI6A 2B5UA 4TWKA 2OCCB 2ZDIC 1YJ9V 5J9PC 4KUMA 5DM6V 1CPYA 1GM7A 2MK3A 1Q86W 2IJHA 2EIJB 2P67A 1KP2A 4ZKIA 3ETDA 2W0FC 4UVCA 2WLNA 2R9RB 4DO2A 3ABMC 1RPRA 5IY5B 4PA9A 2JIZG 1PNKA 4UXNA 2W6JG 3H01A 3AG4B 1K9MW 1K97A 2PI4A 4FMTA 1NQTA 1JCHA 2EIJC 4QIWF 2GSMB 2Q68A 4WFGA 1F4NA 4QE7A 3QO5A 3SJQC 3OR7C 1K4DC 3AEIA 2DWDC 5EBMC 5IY5C 4RAIA 3ABTA 3ASOB 1S0VA 2EINB 4PDLA 5LBQA 4FPPA 2KB1A 3OR6C 4UVAA 3OM3B 1QR8A 3FB5C 5BZBA 2OTLV 1S72V 1OCZB 5KA6A 1OHHG 3SYPA 3HPLC 3ZMZA 1G4YB 1VQOV 3ASOC 3ZMTA 3UM7A 2EINC 1MOFA 2NNUA 2A0LA 3SPJA 1DF4A 3TK1A 1OCOB 5B3SB 1BHBA 2JEUA 1PKXA 2WPDG 3CC7V 3CYOA 1OCZC 4MVRA 1GKFA 2BOCC 5GW7A 1K92A 1M9NA 5KUKA 4EKWA 5HFLA 5KA5A 3T4DA 3ABKB 5L3FA 3ZN1A 5B1BB 1I5YA 2IJJA 1MABG 2XAFA 4I9WA 3CCSV 1R6NA 1OCOC 2V7QG 2ZQMA 1V55B 2EJRA 5IYDO 3CMEV 4JYBA 5IDJA 1JOYA 1NR7A 1AJPA 2XAGA 3RBZA 3ABKC 1OCRC 2DQ3A 2LFSA 5B1BC 4H33A 3ZMUA 2HLDG 1W2BU 1MSWD 1KKDA 4J9ZB 3TETA 1V54B 1V55C 3B8MA 4JAUA 1S5HC 4R50A 4GCZA 3WFVA 3G4SV 2UXXA 2B1IA 3CC2V 3CPWU 1VQ6V 4CZZA 4X89A 2IH1C 4KP4A 5LGNA 4U7NA 1V54C 3JD2A 1F23A 1VQ7V 2IU3A 1NJIW 2X6BA 1Y4MA 3FKSG 2Y69B 4BIZA 4QJFB 2QA4V 4LBEC 3K08A 1I5XA 1K3EA 2QEXV 3CCJV 2WLJA 3ZMVA 3T2MA 2XAHA 3ETEA 1PL0A 4JAVA 5CMUA 1FXKA 4MTFA 3ZCCA 1AI7A 2XASA 3ZJZA 2QM8A 2EZPA 2DQ0A 5LHHA 3E8GA 2X6AA 2P6JA 3RVYA 3STZC 3OEEG 5L3DA 2Y69C 3P32A 1SRYA 3CCQV 3IGAC 4PA3A 5L3GA 2AHYA 1R3KC 3W7SA 4P30A 3K0GA 3JD1A 3SPGA 3ZRSA 2HJFC 1EBOA 5IYBO 1PNMA 3CCLV 3OFNG 4Z1MG 4MT8A 4MVMA 1YI2V 1VQNV 4LP8A 3B8NA 2XNDG 2CK3G 5H9CA 1WPXA 2YEVB 5HFMA 5CBGA 1E79G 4ASUG 3I55V 4E2LA 2ITDC 3T1CA 2EZOA 1E1RG 4JASA 3SPHA 2IJIA 4MW3A 3W7XA 4P9PA 1J95A 4HZ3A 1KQSU 2OCCC 3MHHC 1FFTB 4WF9V 3E8BA 4MVSA 1NVPB 3QO8A 3CC4V 3ZMSA 2WAMA 2ZR3A 3ABLB 5FL7G 1LNQA 4X8AA 3A0RA 2W6IG 2HFEC 4FK5C 3OMNB 3K9AA 4L87A 4WFHA 1SESA 1GM9A 4PDMA 3W7UA 3RW0A 3CCUV 3AG4C 2H94A 1QBZA 3ABLC 1XL6A 1ROPA 1VQKV 1VQ5V 2M7WA 1CEZA 1GO3F 1M56B 1NH2D 1AI5A 4TSFG 1YJWV 1SETA 1SZTA 4R6ZA 1S77D 4BW5A 1R3LC 4G2KA 3K03A 2WLHA 3K06A 3OUSA 3LSQA 1QLNA 5EBLC 3G71V 2IJKA 1M56C 1R3JC 4UVBA 3IC7A 3HB3B 1QLEB 4MTGA 4JTAB 4QPJA 4PA6A 3NXSA 2XOKG 4R8CA 1QVGU 1NKDA 1FXVA 3DTUB 3W7WA 3MD0A 3DGEA 3ZN0A 5DN6G 2QTOA 5B3SC 1NBMG 2QKSA 5B1NA 4WFEA 2XAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H8P C;  3FB8 C;  5CBF A;  4X89 A;  2IH1 C;  4MS2 A;  4HYO A;  2NLJ C;  1V54 C;  3SYO A;  1QLE C;  3LDE A;  2A79 B;  5E1A C;  2X6B A;  4G27 B;  4DXW A;  4TWK A;  2WLI A;  3VOU A;  4LBE C;  4MVU A;  3K08 A;  4PDV A;  4PA4 A;  5J9P C;  2Q69 A;  2WLJ A;  4GX1 A;  3T2M A;  3STL C;  2EIM C;  3OGC C;  4JTD B;  4MTF A;  3ZJZ A;  5EK0 A;  1JVM A;  2W0F C;  3R65 A;  2WLN A;  3E8G A;  2R9R B;  2X6A A;  3RVY A;  3STZ C;  3ABM C;  4MW8 A;  3LDC A;  2EIK C;  2Y69 C;  4H37 A;  3IGA C;  4PA9 A;  4PA3 A;  2HVJ C;  2AHY A;  1R3K C;  3K04 A;  4P30 A;  2DWE C;  3K0G A;  4R7C A;  3F5W C;  4KFM A;  3SPG A;  2HJF C;  1P7B A;  3ZRS A;  2ZD9 A;  5EC1 C;  4RO2 A;  4MVM A;  2EIJ C;  4LP8 A;  3GB7 C;  2Q68 A;  4MSW C;  5B1A C;  2IH3 C;  4WFG A;  3SPI A;  4LCU C;  4QE7 A;  4WFF A;  3SJQ C;  3OR7 C;  1K4D C;  4MVO A;  4QE9 A;  5CBG A;  3T4Z A;  2DWD C;  5EBM C;  3FB6 C;  5IY5 C;  4RAI A;  4OXS A;  2HG5 C;  3F7V C;  2ITD C;  3T1C A;  4PDL A;  4MTO A;  4MVZ A;  3SPH A;  2KB1 A;  1XL4 A;  3OUF A;  4MW3 A;  2WLL A;  3OR6 C;  3F7Y C;  4MVQ A;  3FB5 C;  5BZB A;  4GX2 A;  4P9P A;  1J95 A;  3KG2 A;  2Q67 A;  4HZ3 A;  2OCC C;  3E83 A;  4GX0 A;  3E8B A;  4MVS A;  1M57 C;  4XDL A;  3BEH A;  4XDJ A;  5KUM A;  3SYP A;  3HPL C;  2JK5 C;  2AHZ A;  4RUF A;  1G4Y B;  3ASO C;  2ZXW C;  2ATK C;  3UM7 A;  2EIN C;  4P2Z A;  1LNQ A;  4J9Y B;  4X8A A;  2A0L A;  4JTC B;  3LNM B;  3SPJ A;  3LUT B;  3JYC A;  3WG7 C;  3X2Q C;  2HFE C;  1K4C C;  1OCZ C;  4MVR A;  2BOC C;  3IFX A;  4WFH A;  4CBC A;  3SYQ A;  4PDM A;  5KUK A;  4EKW A;  3RW0 A;  4ZBM A;  3AG4 C;  3T4D A;  3AG1 C;  4X88 A;  2WLI B;  3ABL C;  3AG3 C;  1XL6 A;  4PDR A;  3E86 A;  2HVK C;  3SPC A;  2A9H A;  2DYS C;  4I9W A;  1OCO C;  1ZWI C;  5EBW C;  4G28 B;  2ITC C;  2YEV A;  4R6Z A;  3UKM A;  1OCC C;  1ORQ C;  3PJS K;  1R3L C;  4BW5 A;  2X6C A;  2WLL B;  2WLH A;  3K03 A;  3K06 A;  3OUS A;  4F4L A;  3E89 A;  5EBL C;  2BOB C;  3RBZ A;  3RVZ A;  3ABK C;  1OCR C;  5B1B C;  1R3I C;  4H33 A;  3AG2 C;  4RUE A;  1M56 C;  2DYR C;  4QNH B;  2Q6A A;  1KKD A;  1R3J C;  3E8H A;  4J9Z B;  3TET A;  2EIL C;  4PA7 A;  5EC2 C;  1V55 C;  2K1E A;  3K0D A;  3FB7 C;  4MTG A;  3SYA A;  2P7T C;  4JTA B;  4XDK A;  4PA6 A;  3SYC A;  1S5H C;  3EFF K;  4R50 A;  3ASN C;  4R8C A;  4P9O A;  1BL8 A;  2WLM A;  5CBH A;  4UUJ C;  3TCU A;  3LDD A;  2QTO A;  2WLK A;  4GX5 A;  5B3S C;  3E8F A;  2QKS A;  4WFE A; 
#chains in the Genus database with same CATH topology
 3G6E V;  4JI6 O;  3SYO A;  2A79 B;  2DJV A;  1I0H A;  3ML0 A;  1GK9 A;  1BT8 A;  4MVU A;  4PA4 A;  4DRX B;  4TT3 G;  3OGC C;  2V1D A;  3X2Q B;  4DV6 B;  1R73 A;  4MW8 A;  2BSK A;  4DR3 B;  4TV9 A;  5LGU A;  2QKA A;  5FLX N;  2YSU B;  1FS0 G;  4RO2 A;  4U7O A;  4RQE A;  2UXB B;  2N04 A;  1T5E A;  3FB6 C;  1KB9 F;  3J81 N;  5KAI Z;  4MTO A;  1XL4 A;  1W0J G;  2WA4 A;  3FAV B;  2YIB D;  3T1Y O;  5KHI A;  2ZNI A;  2EIL B;  3UO2 A;  3CX5 F;  2BCC H;  4LC1 A;  1PM9 A;  3BEH A;  1VMG A;  2AHZ A;  4JF3 A;  1RFY A;  2Z3Y A;  3EXA A;  1WLE A;  2JEX A;  4P2Z A;  3CCR V;  2Y4U A;  4CH5 A;  3B2E E;  4ZI7 A;  3BA8 A;  1MNG A;  2YDE A;  1ARO P;  4X88 A;  3AG3 C;  3N27 A;  4X65 O;  3E86 A;  1TVK B;  1O9G A;  1QVF U;  1KUQ A;  2FL4 A;  2R9A A;  2Y48 A;  3AK1 A;  2Q9L A;  2KKW A;  1JQ0 A;  2DYR C;  2YXL A;  2BTQ A;  3E8H A;  4PA7 A;  2VQF B;  1MMM A;  2K1E A;  1K73 W;  5IWA B;  2VS0 A;  3ASN C;  1SQB H;  4IIJ B;  4O2B B;  1SA0 B;  1L0N H;  2X0L A;  1I94 B;  3Q4H A;  3FB8 C;  5L3B A;  5EYP B;  2UXD O;  1NTM H;  1Q5O A;  2EIK B;  2EUL A;  3OD4 A;  4KHP B;  3VOU A;  1XHZ A;  1HWY A;  3C3T A;  4JI5 B;  4NXN O;  5B1O A;  1GTO A;  5EK0 A;  1N0J A;  3G67 A;  5ITZ A;  3RYH A;  3QG5 A;  1KD1 W;  3LSS A;  3UT5 A;  2HKO A;  2YI8 A;  3CS5 A;  3F5W C;  1P7B A;  3P30 A;  3CXC U;  4LWS B;  3HKE B;  4MSW C;  1VQL V;  3SPI A;  1JJ2 U;  4O4J B;  5IE9 A;  1SQQ H;  4J42 A;  4DR5 B;  4NVP A;  3JD0 A;  4YY3 B;  3HKD A;  4JYC A;  2UU9 O;  4F6E A;  4GX2 A;  3KG2 A;  4TUY A;  3ZRW A;  4TV8 B;  3RT3 C;  5KUM A;  4XDJ A;  2Q8V A;  4O4H A;  1P7G A;  1H2N A;  4DR4 B;  1U96 A;  1N32 B;  2DYS B;  2PTM A;  3LNM B;  3X2Q C;  1HR0 O;  1WPB A;  3ABU A;  1SKV A;  1CP9 A;  5EIB C;  3ZRV A;  1K4C C;  2CAZ C;  4JI8 B;  3IFX A;  4CBC A;  1VQP V;  3SYQ A;  1SS3 A;  2X7R B;  1OZ0 A;  1N0N A;  3P3P A;  3OE7 G;  4UB6 Z;  2OT5 A;  3G6B A;  2A9H A;  3OMI B;  2HJD A;  3GWK C;  1WAZ A;  1M1K W;  4DV4 O;  1N34 B;  1BSM A;  3ZS8 C;  2YEV A;  3OW2 U;  4DK0 A;  1TGO A;  3FYE B;  5KHG A;  1PNL A;  2BSK B;  4DV0 B;  5LL6 Y;  4K8X A;  4ZHQ A;  3CB2 A;  2QGN A;  1PD3 A;  3K58 A;  3AG2 C;  3QTC A;  4TV9 B;  2JGD B;  2EIL C;  3G80 A;  4K3A A;  2GTS A;  3U0Z A;  1AJQ A;  1NZ6 A;  1NBM G;  5CA3 A;  2Q0A A;  1VP7 A;  4FLY A;  3E8F A;  4BAY A;  1U97 A;  4WFA V;  2WSS G;  3LDE A;  3D8C A;  2B5U A;  2OCC B;  4DUZ B;  1TAE A;  3M8A A;  2JGU A;  4KUM A;  2YS8 A;  3OTF A;  2MK3 A;  3K57 A;  2AGA A;  2P67 A;  3ETD A;  4D7S A;  1Q8I A;  2JIZ G;  4DV7 O;  1PNK A;  4UXN A;  3H01 A;  3AG4 B;  2HHH O;  4J11 A;  3U11 A;  1XNQ B;  3CXH F;  2EIJ C;  1HNW O;  1H2K A;  4UFZ A;  4QE7 A;  3AG7 A;  3QO5 A;  3OR7 C;  4B3R B;  5IY5 C;  2FKX A;  3N2K B;  4RAI A;  1EZV H;  3K9S A;  3A8T A;  3SJC C;  4C7U A;  1S72 V;  1B06 A;  2BTQ B;  3SYP A;  4X1K A;  3KZI Z;  4X9Q A;  3ASO C;  4NR1 A;  3ZMT A;  3UM7 A;  2NNU A;  3SPJ A;  1DF4 A;  3DXR A;  4OGQ B;  4LF8 B;  2JEU A;  4OPA A;  1OCZ C;  3Q4H B;  4H13 B;  1YXB A;  3RYC A;  1M9N A;  5KUK A;  4DYL A;  3ABK B;  1NI8 A;  4X66 O;  1RSO B;  2XAF A;  1OCO C;  1NS1 A;  1MSD A;  4FFB A;  3SR2 C;  1HW7 A;  3CME V;  5IDJ A;  5ITZ B;  5CA1 A;  1AJP A;  4LF9 O;  3RYH B;  2UUA B;  4JI4 O;  4H33 A;  1GAX A;  1KKD A;  2P5O A;  2GDS A;  5IJ0 A;  3B09 A;  1CXZ B;  3TET A;  2UXC B;  2KG7 A;  1N36 B;  1G6U A;  1I08 A;  1MZE A;  4R50 A;  1IBL O;  3G4S V;  2UXX A;  1PP9 H;  4JV5 O;  5CB4 A;  2VRZ A;  1VQ7 V;  2IH1 C;  1V54 C;  4YHH O;  2FYU H;  2IU3 A;  3CEI A;  3HR0 A;  1XEQ A;  3BPZ A;  4TUY B;  4BIZ A;  4LBE C;  2E3C A;  1K3E A;  4O4H B;  3CCJ V;  5IT9 N;  2IBZ H;  3K5M A;  4JAV A;  4D7T A;  4LF4 B;  3E8G A;  2X6A A;  1IUR A;  3OTO B;  5LA6 A;  3R66 A;  1R3K C;  4EB6 A;  3K0G A;  3JD1 A;  1KU9 A;  2HJF C;  5FPR A;  1IXB A;  1XMQ O;  2R72 A;  4MVM A;  1YI2 V;  4LP8 A;  1XNR B;  3B8N A;  5IYZ A;  1BE3 H;  1Y6X A;  2YEV B;  2ZM6 O;  4TOI A;  4X1Y A;  3I55 V;  1E1R G;  3SPH A;  1IBK B;  3E22 A;  4O2A B;  3RWR D;  1V9P A;  1KQS U;  2OCC C;  4WF9 V;  1FFT B;  4JI2 B;  4YIO A;  2JVD A;  2WAM A;  1X4T A;  4F6R A;  3ABL B;  5FL7 G;  2UUC B;  4U3F H;  3CE2 A;  1M93 A;  1GM9 A;  3W7U A;  3AG4 C;  1VQ5 V;  3S3W A;  5GON A;  1NH2 D;  2NR5 A;  1SZT A;  4ZIB A;  1R3L C;  2IM9 A;  3OUS A;  4DRX A;  3LSQ A;  5LYJ A;  4IGG A;  1QLN A;  2IJK A;  1JFF A;  4I7Z B;  1R3J C;  4CS3 A;  4PA6 A;  3JAM N;  1UPG A;  3DTU B;  3W7W A;  3K59 A;  3ZN0 A;  5J2U A;  4DV3 O;  1AIL A;  5LP6 C;  3SGI A;  1Q81 W;  1QLE C;  1LR1 A;  3O65 A;  4DXW A;  3OAA G;  2ARH A;  2FB5 A;  2WLI A;  4K0K O;  3FYI B;  3FAV A;  1K8A W;  2Q69 A;  2B9Z A;  2WWW A;  4GKJ B;  1BMF G;  4JTD B;  1K7D A;  4DV5 B;  3DXR B;  5LMN B;  1DF5 A;  3RYC B;  1SF9 A;  3K04 A;  2E75 B;  4KFM A;  4OPH A;  5L3C A;  4X20 B;  2DMX A;  4FM0 A;  1BQ0 A;  4X62 B;  3KCY A;  1JA8 A;  1OCC B;  3N2G A;  2JJ1 G;  4FFB B;  4B08 A;  5D5Q A;  2F23 A;  1TUB A;  4IHJ A;  2HG5 C;  4OXS A;  1XI1 A;  2QWQ B;  4N21 A;  1FD9 A;  4DW0 A;  4DR1 O;  1EFR G;  1G8M A;  1RPO A;  2FTK A;  5IJ0 B;  3E83 A;  1M90 W;  4TQD A;  1WN7 A;  3K5N A;  1AB3 A;  4XDL A;  3WB2 A;  4ZOL A;  3AG3 B;  2CTR A;  3WB1 A;  1L1F A;  1R6T A;  1WP7 A;  3E2E A;  3FFQ A;  5CB4 B;  4IYH A;  1GH6 A;  3ZIA G;  3GWO A;  4O2B A;  2D3O W;  2HR3 A;  2DN9 A;  1J5E B;  1AR4 A;  4WCE V;  3QNE A;  5EYP A;  4AHC A;  2DYR B;  1L8D A;  4FLV A;  1SQG A;  4E4E A;  2WLL B;  2YIC A;  3ASN B;  3B40 A;  4B3S B;  5LA6 B;  4HAM A;  1YJN V;  1AR1 B;  1VQ8 V;  3ZHS A;  4DR2 B;  4FJC C;  4QNH B;  2RN9 A;  3IC9 A;  4LFC O;  3WG7 C;  4J7J A;  4WFB V;  5IYZ B;  3EFF K;  5AG2 A;  5K1X A;  1EZJ A;  4AI8 A;  1SER A;  1Q6I A;  3D36 A;  4X1Y B;  5CBH A;  3RYI B;  2Y0I A;  3C90 A;  4FVM A;  5E1A C;  2ADP A;  4XBF A;  4G27 B;  5CA0 A;  2Q7H A;  1AI4 A;  2Q5Z A;  3JSN A;  4GX1 A;  2EIM C;  4TV8 A;  1YSC A;  4QPK A;  2L35 A;  2Z5U A;  4YJ3 A;  3BA9 A;  4H37 A;  4I4T B;  1H8H G;  2DWE C;  2EX3 A;  3BAB A;  4BW9 A;  1OJH A;  2RJZ A;  5GON B;  4JI0 B;  3RGB A;  1JX9 A;  4WFF A;  1KC8 W;  4QE9 A;  5BR8 B;  4JI1 O;  5LYJ B;  2RNB A;  3C3S A;  3EHB B;  1A32 A;  1BZK A;  1PV0 A;  3OUF A;  1YTF B;  4NXM B;  4YIP A;  1JFF B;  2RMK B;  4CC5 A;  2Q67 A;  4Q6G A;  1IVS A;  4FLT A;  1R6K A;  2CGO A;  2P22 C;  4KL1 A;  1TA8 A;  2JGD A;  4NTY A;  2ATK C;  1Z2G A;  4J9Y B;  4JTC B;  2O57 A;  1HNX B;  5J2U B;  4FM2 A;  2ZDI A;  5H5N A;  4JZ2 A;  1IBM B;  2ILM A;  2LQT A;  4LR3 A;  2WLI B;  2AZ2 A;  3JCZ A;  3AG2 B;  2CE4 A;  4MTX A;  1B3Q A;  1OCC C;  4UB8 Z;  2LO1 A;  3J80 N;  1YIJ V;  3CCE V;  2BOB C;  3I5D A;  1H2G A;  4CS4 A;  1GMG A;  2Q6A A;  2AZ0 A;  4DUY B;  5EC2 C;  2GUZ A;  4PHZ A;  1Q6U A;  3JAW B;  4LF5 B;  4JGS A;  4P9O A;  3N2G B;  1BL8 A;  2WLM A;  1TUB B;  3LDD A;  4IHJ B;  4PV1 B;  2Q7E A;  3KCX A;  1FKA O;  3L71 H;  4O4I A;  1NR1 A;  4HYO A;  4B3M O;  3N2K A;  2EBO A;  2MW2 B;  3J7A U;  1AI6 A;  4JI3 O;  1YJ9 V;  4B7K A;  2E5L O;  4NTW A;  4DW1 A;  5J9P C;  5DM6 V;  4ZOL B;  1GM7 A;  4LFB O;  2EIJ B;  1KP2 A;  1FPO A;  4UVC A;  3BVO A;  4DO2 A;  3ABM C;  2DOS A;  5JWP A;  2YXY A;  5IY5 B;  2G38 A;  1FJG O;  5LP6 A;  1H2S B;  2QWR B;  4UCU A;  1FFX A;  4QIW F;  1AP5 A;  2Y4T A;  4WFG A;  2A06 H;  5FNV A;  1W59 A;  4LF7 O;  5JCO C;  1K4D C;  1RSO A;  1NU1 H;  2DE0 X;  3ABT A;  3ASO B;  4JYA O;  1S0V A;  2QTS A;  5LBQ A;  2KB1 A;  1NT2 B;  3OM3 B;  4GKK B;  1QR8 A;  2L6L A;  1OCZ B;  2OCH A;  4GUN A;  3JAL A;  3HPL C;  3ZMZ A;  1G4Y B;  1VQO V;  4LF6 B;  1OCO B;  1BHB A;  4AQY O;  3CYO A;  4I50 B;  5KHH A;  5GW7 A;  2Y0P A;  1JR9 A;  2ZE7 A;  2VQE B;  2CUG A;  2GTA A;  5CA0 B;  3BCC H;  2F4V B;  4IL6 Z;  1R6N A;  4JZG A;  3MAQ A;  2EJR A;  2XT9 A;  5IYD O;  4ABM A;  1NR7 A;  2YUA A;  3RBZ A;  4YJ3 B;  3P3N A;  5B1B C;  4GLX A;  3GVM A;  5KLV H;  5GTI Z;  1W2B U;  1MSW D;  1SC5 B;  1V54 B;  2F93 B;  2ZKO A;  2GV9 A;  1VQ6 V;  2QWP B;  4KP4 A;  5LGN A;  1F23 A;  3UO3 A;  1N4C A;  5JJJ B;  3JCU Z;  4DV1 O;  3FKS G;  1VAR A;  4JI6 B;  1VIB A;  1UFI A;  1AP6 A;  1I5X A;  4O2A A;  2WLJ A;  1WB8 A;  3T2M A;  2XAH A;  2ZCE A;  2PZS A;  1IX9 A;  1AI7 A;  2XAS A;  1N33 O;  2ZT9 B;  4JI7 O;  4FM1 A;  3RVY A;  2P6J A;  3OEE G;  5L3D A;  4LFA O;  4BR6 A;  2Y69 C;  5EIB D;  3IGA C;  4PA3 A;  5L3G A;  3W7S A;  1I7F A;  3IJ4 A;  3OFN G;  4WBN B;  4B3T O;  1JMK C;  1BQZ A;  2CK3 G;  5H9C A;  4DV2 O;  1BGY H;  1KKC A;  5IJ9 A;  2QDO A;  2CTP A;  3T1C A;  3JSL A;  2GBO A;  4P9P A;  3MHH C;  3T1Y B;  1SZX A;  5D5P A;  2GUZ B;  1LNQ A;  4X8A A;  4Z2W A;  1HNZ O;  2W6I G;  4OX9 O;  4O4I B;  3K9A A;  1SES A;  1Y76 B;  2H94 A;  1QBZ A;  2E74 B;  2M7W A;  4X65 B;  2QWO B;  2WLH A;  3K06 A;  3JAR B;  3T1H O;  4I9Q A;  5LP6 B;  3TXS A;  1H2L A;  3A2F A;  1QLE B;  5B66 Z;  1ZTE A;  1FFX B;  2XOK G;  4R8C A;  4X20 A;  5FNV B;  1QVG U;  4J10 A;  1M4U A;  3DGE A;  5DN6 G;  2M6Y A;  1XMO O;  2UUB O;  4DR7 O;  2H8P C;  5KAF Z;  4RQF A;  2BE3 A;  3H1K H;  4BIO A;  1MG1 A;  2UXD B;  4J7K A;  1S5L Z;  5CN0 A;  3JAL B;  5LHG A;  3STL C;  1F7Y A;  4FFK A;  1GM8 A;  2PI5 A;  4NXN B;  2JRI A;  3DC6 A;  5LMU O;  2E76 B;  3LNN A;  4FZ1 A;  5B1A C;  2YI9 A;  2PUS A;  1HDJ A;  2ETN A;  2D2C B;  4MVO A;  1KMI Z;  2LGW A;  4B7E A;  2IU0 A;  5GTH Z;  3MHS C;  2WLL A;  4MVQ A;  2QWN B;  2V4D A;  5BMV A;  2UU9 B;  4GX0 A;  2JJ2 G;  2R9I A;  2XHB A;  3VBB A;  3SDL A;  5KHJ A;  1Q7Y W;  5JCO A;  1HR0 B;  3A0B Z;  2P4V A;  3RYI A;  4KXR A;  5H6Q A;  4IT5 A;  4UCT A;  1YHQ V;  4PDR A;  3QF7 A;  2P90 A;  1JPX A;  4X64 O;  4IYI A;  4O4L A;  3WG7 B;  3ZHU A;  4D6T H;  1XHX A;  2X6C A;  4DV4 B;  3CCM V;  4DR6 O;  1VQ4 V;  1TUE B;  4JPR A;  2LP7 A;  4UCS A;  1XBL A;  2GHY A;  1VQM V;  1FXK C;  1QHT A;  3K0D A;  4UCV A;  2P7T C;  2VWK A;  4DK1 A;  4I4T A;  1RM1 C;  4CH3 A;  3SJA C;  1P4R A;  4GKK O;  5IJ9 B;  1FYJ A;  1DLB A;  1XIL A;  3BRC A;  3M99 B;  2EIM B;  1ZLZ A;  5DED A;  2BTO A;  5CBF A;  4GT1 A;  1K5Q A;  3CD6 V;  3QVN A;  4PDV A;  1H38 A;  4DV6 O;  4N23 A;  4DR3 O;  1US6 A;  1WNS A;  1FXH A;  3BFR A;  2HVJ C;  2JDI G;  4DV7 B;  2UXB O;  2HHH B;  4I0X A;  2JS3 A;  4LCU C;  3D3I A;  1HNW B;  5LXT B;  1XOU A;  3O9O A;  2OYQ A;  5IYC O;  4UCO A;  4YJ2 B;  3ETG A;  3F7Y C;  2QSA A;  3K3W A;  2JS5 A;  1M57 C;  4LH7 A;  5H6R A;  1K34 A;  2JK5 C;  4RUF A;  1Q82 W;  3JAW A;  4H44 B;  3AG1 C;  2C2A A;  4GZR B;  1QNM A;  2HVK C;  3ZHV A;  1L0L H;  1ZWI C;  4X66 B;  1KP3 A;  1PPJ H;  2ITC C;  2EJ7 A;  1ORQ C;  3PJS K;  4LNU A;  4RUE A;  2VQF O;  4LF9 B;  1Z5V A;  4UV8 A;  4JI4 B;  3SYA A;  5E79 Z;  5IWA O;  1SQF A;  4XDK A;  2K9P A;  3SYC A;  2IW5 A;  2LW1 A;  1I94 O;  4CC6 A;  3IAY A;  2ZE5 A;  1IBL B;  2B1G A;  1MA1 A;  1YVW A;  1VQ9 V;  1Y66 A;  4JV5 B;  4KHP O;  5BMV B;  3ABM B;  1Y74 A;  4JI5 O;  4YHH B;  2P4K A;  4PJ0 Z;  1P84 F;  1Y67 A;  3L75 H;  2PGG A;  1CPY A;  2NN4 A;  3ZHR A;  1Q86 W;  1ZAU A;  2CDY A;  5J2T B;  3K5O A;  4PA9 A;  1K9M W;  1K97 A;  4I50 A;  2ODM A;  4FMT A;  4EEQ A;  2KSD A;  1JCH A;  2Q68 A;  1XMQ B;  4X1I A;  1F4N A;  4DR5 O;  4O4L B;  3SJQ C;  4YY3 O;  1URF A;  3AEI A;  5EBM C;  2ZM6 B;  3AK3 A;  3F5T A;  1B04 A;  1O9H A;  4FPP A;  4QGP A;  3OGI B;  3FB5 C;  2OTL V;  2YID A;  4L8J A;  5A2Q N;  4DR4 O;  1OHH G;  1N32 O;  2EIN C;  4U3J A;  3TK1 A;  4JI8 O;  1PKX A;  2WPD G;  3CC7 V;  4MVR A;  2BOC C;  3U10 A;  1IDS A;  4EKW A;  5KA5 A;  3T4D A;  5B1B B;  4EFB A;  2IJJ A;  1MAB G;  2QJ1 A;  1N34 O;  2Q7G A;  4I9W A;  1SQV H;  4DV0 O;  3HKB B;  4JYB A;  1JOY A;  2R70 A;  2XAG A;  3L72 H;  2ZE6 A;  2DQ3 A;  2LFS A;  3ZMU A;  2HLD G;  1AVM A;  4GYC B;  1V55 C;  3B8M A;  4JAU A;  4I0X B;  4GCZ A;  3WFV A;  4WBN A;  2Q4P A;  2B1I A;  2F66 C;  3CC2 V;  3CPW U;  4W4L A;  3ZHT A;  4FLZ A;  4X89 A;  4DV3 B;  2OWO A;  4U7N A;  4DUZ O;  1YZB A;  4FZ0 A;  2Y69 B;  3K08 A;  4K0K B;  1YDX A;  3ETE A;  1FXK A;  3ZCC A;  2QM8 A;  4AIL C;  5LHH A;  3PN1 A;  2YIA A;  3P32 A;  1XNQ O;  2ZE8 A;  3SPG A;  3CCL V;  1EBO A;  5IYB O;  1BS3 A;  2W0X A;  3VQV A;  1Y76 A;  4MT8 A;  1VQN V;  4B3R O;  3S3X A;  1R1B A;  1WPX A;  5HFM A;  1H2M A;  4PI2 A;  4E2L A;  2ITD C;  4LNU B;  3RYF B;  4JYY A;  1WP8 A;  2FML A;  3JAT B;  3JAR A;  3W7X A;  4DR1 B;  3APO A;  3CRQ A;  4HZ3 A;  1NVP B;  3E8B A;  5FPO A;  3CC4 V;  2QR4 A;  3ZMS A;  3HKC B;  4CS2 A;  4LF8 O;  5TIS Z;  1KYO F;  4FK5 C;  3OMN B;  4WFH A;  1XDC A;  2P06 A;  3JAK A;  5DEC A;  3RW0 A;  1Y74 B;  3CCU V;  4JAA A;  1XL6 A;  1ROP A;  1CEZ A;  1WA8 A;  1MZF A;  4CH6 A;  1GRJ A;  4TSF G;  1YJW V;  1SET A;  4R6Z A;  1S77 D;  3CJH A;  2UUA O;  5H2F Z;  3H1J H;  5EBL C;  3G71 V;  2CTW A;  3SJB C;  3VQX A;  1FAF A;  4HNA A;  3TXQ A;  2UXC O;  1M56 C;  1N36 O;  1DGS A;  4UVB A;  4LH6 A;  2RCV A;  2CTQ A;  4X1I B;  4LFC B;  2LGQ A;  1SQP H;  1M5I A;  1NKD A;  3H1I H;  3MD0 A;  2PYL A;  1X59 A;  1Q3E A;  1D5A A;  3CHX A;  1VF6 C;  3QO7 A;  2ZXW B;  4ICG A;  4LF4 O;  4Q20 A;  3OTO O;  4U3J B;  5B1A B;  4HBN A;  1JVM A;  3BY6 A;  3R65 A;  4FIP C;  1GN4 A;  3NR7 A;  1HP8 A;  3E35 A;  3ZHQ A;  1QCE A;  2F43 G;  3JAS B;  1KEC A;  1XNR O;  5BXZ A;  5EC1 C;  1PL4 A;  5JH7 B;  4H0L B;  3GB7 C;  4PI0 A;  3JD3 A;  1Z5W A;  3APQ A;  3T4Z A;  5JQG A;  3F7V C;  1IBK O;  3CMA V;  4MVZ A;  1VF7 A;  4JI1 B;  1ZUQ A;  4JI2 O;  2LFR A;  1THZ A;  1K5S A;  3ZBH A;  1YTF D;  2UUC O;  4J7Z A;  5C8Y A;  3D3Q A;  2XAQ A;  3WU2 Z;  1UJW B;  3B77 A;  2HEP A;  2QM7 A;  3LUT B;  3JYC A;  2DW4 A;  1E1Q G;  1S5J A;  3THO A;  2PY5 A;  3M7M X;  4ZBM A;  1EN5 A;  1NH2 B;  4W4K A;  4BIU A;  1W0K G;  4I5S A;  2XTA A;  3OMA B;  2OTJ V;  2PF4 E;  4G28 B;  1ENV A;  1FXK B;  2ZR2 A;  2CGN A;  1RM1 B;  3KKY A;  1GN3 A;  3E89 A;  5EZY A;  1YIT V;  3TGU H;  2AXT Z;  2Q73 A;  1S76 D;  1QR9 A;  1ZL8 A;  1D5N A;  2A3Q A;  3FX7 A;  2QE7 G;  1QU7 A;  1NTK H;  4A5U B;  1H8E G;  2HP8 A;  1K33 A;  1AJN A;  3ZRX A;  4ZI7 B;  1COW G;  3CP1 A;  1NTZ H;  1XRE A;  4UUJ C;  2WLK A;  2Q0O C;  5LXT A;  2CH7 A;  5B5E Z;  4MS2 A;  1P49 A;  4K35 A;  3K79 A;  3A0H Z;  2YIB A;  4YJ2 A;  4B3M B;  5JJE B;  4GKJ O;  4PD4 F;  3CCV V;  1YCI A;  4UCR A;  2F95 B;  4YXW G;  4DV5 O;  2H3O A;  4JI3 B;  5LMN O;  2E5L B;  4LFB B;  3LDC A;  5LHI A;  2EIK C;  3JD4 A;  3CSX A;  3JAK B;  4R7C A;  1NVP D;  2ZD9 A;  4X62 O;  1FJG B;  3L9D A;  3OEH G;  1N8R W;  1WA8 B;  3LSU A;  1VEW A;  2IH3 C;  2Z0A A;  3W7T A;  4NYK A;  1M57 B;  3MDS A;  3BHP A;  3CJH B;  2ZNJ A;  4LF7 B;  1OCR B;  3CWB H;  4I55 A;  3UQ8 A;  3I56 V;  4JYA B;  4NTX A;  3D36 C;  4HNA B;  1BHA A;  5C93 A;  1ZX3 A;  3AG1 B;  2ZXW C;  3H9V A;  3UT5 B;  3WB0 A;  1D2D A;  1J5E O;  4AQY B;  4PEL A;  1IXM A;  1IZ3 A;  2ZIM A;  4CH4 A;  2KQX A;  4Z1V A;  3SPC A;  5L3E A;  2DYS C;  4UV9 A;  1SQX H;  2YC0 A;  5EBW C;  5LGT A;  2RDC A;  3HKD B;  5A9G A;  2UXN A;  3UKM A;  1S3J A;  4B3S O;  1F4M A;  1VF5 B;  4F4L A;  2VWJ A;  1Q90 D;  5KX5 A;  4DR2 O;  3ZRW B;  3RVZ A;  1WJZ A;  1R3I C;  5J2T A;  2XUM A;  3ZED A;  1GN6 A;  1QQC A;  3FB7 C;  5LOV A;  3BAA A;  1DTO A;  1B6Q A;  1XQ8 A;  3L70 H;  2A7W A;  3TCU A;  5JQG B;  4GX5 A;  1F51 A;  1RP3 B;  2RQ6 A;  2LW7 A;  3RFR A;  2NLJ C;  3B4S A;  4TWK A;  3L74 H;  5K1P A;  5KMG A;  2ZDI C;  4DV1 B;  1LUW A;  5C8Y B;  1LUV A;  2IJH A;  4ZHQ B;  4ZKI A;  2W0F C;  2WLN A;  2R9R B;  1RPR A;  1N33 B;  4JI7 B;  2ZIN A;  4FLU A;  2W6J G;  4LFA B;  2PI4 A;  4JI0 O;  1NQT A;  5JVD A;  3CRM A;  2GSM B;  5BR8 O;  2N74 A;  4B3T B;  1VF6 A;  5JJN B;  2DWD C;  3EVK A;  4DV2 B;  4FLW A;  4NXM O;  2EIN B;  4PDL A;  5EZY B;  3RN4 A;  5BY1 A;  3ICX A;  1ZL8 B;  3OR6 C;  4UVA A;  3HKB A;  5BZB A;  5KA6 A;  3OT7 A;  1WB7 A;  1EN6 A;  1HNX O;  1MOF A;  2A0L A;  5B3S B;  4NB5 A;  1IBM O;  2CH7 B;  1HNZ B;  1GKF A;  2ADQ B;  1K92 A;  4OX9 B;  1DK1 A;  5HFL A;  1AR5 A;  1BCC H;  5L3F A;  3ZN1 A;  5F2V O;  1I5Y A;  3CCS V;  2OIG A;  2OIE A;  2V7Q G;  2ZQM A;  4EFE A;  1V55 B;  1XUQ A;  2YXH A;  3ETQ A;  3ABK C;  1OCR C;  4DUY O;  3T1H B;  3VQW A;  4X1K B;  4J9Z B;  4LF5 O;  4TQF A;  1S5H C;  4CZZ A;  2LJ2 A;  4I55 B;  1XMO B;  3JD2 A;  2UUB B;  4DR7 B;  1NJI W;  3RYF A;  2X6B A;  1Y4M A;  4J80 A;  3H1L H;  4QJF B;  3FD9 A;  2QA4 V;  1TVK A;  3JAT A;  2QEX V;  3ZMV A;  5CA1 B;  5CMU A;  1PL0 A;  4MTF A;  3ZJZ A;  3ZX6 A;  2EZP A;  2DQ0 A;  3HKC A;  2PYJ A;  4K8Z A;  3STZ C;  3UCS C;  2F1M A;  5LMU B;  1SRY A;  1Q6H A;  3CCQ V;  2KG7 B;  2AHY A;  4P30 A;  1G1X B;  3ZRS A;  2WA3 A;  2ZIO A;  1PNM A;  3CRC A;  4Z1M G;  1EM1 A;  1YF2 A;  1GN2 A;  2XND G;  1ZSP A;  5CBG A;  1E79 G;  4IIJ A;  4ASU G;  1SA0 A;  3VQY A;  2EZO A;  4JAS A;  5KX5 B;  4BWA A;  3L73 H;  2IJI A;  4MW3 A;  1J95 A;  3AK2 A;  2AW9 A;  3CRR A;  4MVS A;  3QO8 A;  4LF6 O;  1Q43 A;  3DSQ A;  5LOV B;  2ZR3 A;  4RWU A;  3A0R A;  3H1H H;  4EB6 B;  3K5L A;  1KBH A;  2HFE C;  1OV9 A;  2VQE O;  4NKG B;  4L87 A;  4PDM A;  2QM4 A;  5KHK A;  2F4V O;  3DC5 A;  3ABL C;  5KMG B;  1VQK V;  4LWS A;  1GO3 F;  3HKE A;  1M56 B;  1AI5 A;  1YEW A;  4O4J A;  2N05 A;  3CRA A;  2QKC A;  4BW5 A;  4G2K A;  3K03 A;  4X64 B;  3E22 B;  4FLX A;  4DR6 B;  4J41 A;  4F6R B;  3IC7 A;  3HB3 B;  4MTG A;  5JVD B;  4JTA B;  4QPJ A;  3JAS A;  3NXS A;  1FXV A;  3TJT A;  5JH7 A;  1JJO A;  2QTO A;  5B3S C;  1EN4 A;  2QKS A;  5B1N A;  4WFE A;  2XAJ A; 
#chains in the Genus database with same CATH homology
 2H8P C;  1Q81 W;  3G6E V;  3SYO A;  4RQF A;  1QLE C;  2A79 B;  3ML0 A;  1MG1 A;  3OAA G;  4DXW A;  2WLI A;  1GK9 A;  3FYI B;  4MVU A;  5CN0 A;  4PA4 A;  1K8A W;  3QO7 A;  2Q69 A;  5LHG A;  2ZXW B;  2WWW A;  4TT3 G;  3STL C;  1BMF G;  3OGC C;  4JTD B;  1K7D A;  1GM8 A;  4Q20 A;  2V1D A;  2PI5 A;  5B1A B;  3X2Q B;  1JVM A;  1R73 A;  3BY6 A;  1DF5 A;  3R65 A;  4FIP C;  4MW8 A;  3E35 A;  1QCE A;  3K04 A;  2F43 G;  1KEC A;  4KFM A;  5L3C A;  5EC1 C;  5LGU A;  2YSU B;  1FS0 G;  4RO2 A;  4U7O A;  3GB7 C;  5B1A C;  4RQE A;  1OCC B;  3JD3 A;  2JJ1 G;  4MVO A;  3T4Z A;  3FB6 C;  4OXS A;  2HG5 C;  3F7V C;  2IU0 A;  4N21 A;  3CMA V;  4MTO A;  4MVZ A;  3MHS C;  1XL4 A;  1EFR G;  1W0J G;  2WLL A;  1G8M A;  4MVQ A;  1RPO A;  2FTK A;  2LFR A;  1THZ A;  1K5S A;  1YTF D;  2EIL B;  3E83 A;  4GX0 A;  1M90 W;  2JJ2 G;  4LC1 A;  4XDL A;  3BEH A;  2R9I A;  2AHZ A;  4JF3 A;  2Z3Y A;  2XAQ A;  3AG3 B;  3VBB A;  1WLE A;  1L1F A;  1UJW B;  2JEX A;  4P2Z A;  3CCR V;  3E2E A;  3B77 A;  1Q7Y W;  2QM7 A;  3LUT B;  3JYC A;  2DW4 A;  3ZIA G;  1E1Q G;  3GWO A;  2D3O W;  1ARO P;  2HR3 A;  4ZBM A;  5H6Q A;  4X88 A;  1YHQ V;  3AG3 C;  1NH2 B;  4PDR A;  3E86 A;  4WCE V;  4BIU A;  1W0K G;  3QNE A;  4I5S A;  3OMA B;  2P90 A;  1JPX A;  2OTJ V;  2DYR B;  1QVF U;  4G28 B;  1ENV A;  3WG7 B;  1FXK B;  2ZR2 A;  1RM1 B;  2X6C A;  2WLL B;  3CCM V;  3ASN B;  3E89 A;  2Y48 A;  1YIT V;  4HAM A;  1QR9 A;  1YJN V;  1VQ4 V;  1S76 D;  1TUE B;  4JPR A;  2LP7 A;  1AR1 B;  1VQ8 V;  2QE7 G;  1JQ0 A;  2DYR C;  4FJC C;  4QNH B;  3E8H A;  1H8E G;  2GHY A;  4PA7 A;  3WG7 C;  2K1E A;  1FXK C;  3K0D A;  4WFB V;  1VQM V;  2P7T C;  1RM1 C;  1K33 A;  1K73 W;  1AJN A;  3EFF K;  3ZRX A;  1EZJ A;  3ASN C;  1SER A;  1COW G;  1P4R A;  3D36 A;  3CP1 A;  5CBH A;  4UUJ C;  1DLB A;  2WLK A;  3M99 B;  2EIM B;  2X0L A;  3FB8 C;  5CBF A;  4MS2 A;  5L3B A;  3K79 A;  4GT1 A;  5E1A C;  4XBF A;  4G27 B;  2EIK B;  1K5Q A;  3VOU A;  3CD6 V;  1HWY A;  3CCV V;  4PDV A;  1H38 A;  4YXW G;  1AI4 A;  4GX1 A;  5B1O A;  4N23 A;  2EIM C;  1GTO A;  5EK0 A;  1YSC A;  4QPK A;  2Z5U A;  3LDC A;  5LHI A;  2EIK C;  3JD4 A;  1FXH A;  4H37 A;  1KD1 W;  3LSS A;  2HVJ C;  2HKO A;  2JDI G;  1H8H G;  2DWE C;  4R7C A;  3F5W C;  1NVP D;  1P7B A;  2ZD9 A;  3OEH G;  1N8R W;  3P30 A;  3CXC U;  4MSW C;  1JX9 A;  2IH3 C;  1VQL V;  3SPI A;  1JJ2 U;  4LCU C;  4WFF A;  3W7T A;  3D3I A;  1M57 B;  1KC8 W;  4QE9 A;  5IYC O;  3EHB B;  3JD0 A;  3ETG A;  4JYC A;  1OCR B;  3OUF A;  3I56 V;  3F7Y C;  1YTF B;  4GX2 A;  3KG2 A;  3K3W A;  1BHA A;  2Q67 A;  3ZRW A;  5C93 A;  1M57 C;  5H6R A;  5KUM A;  4XDJ A;  1R6K A;  1K34 A;  2JK5 C;  3AG1 B;  4RUF A;  2ZXW C;  2ATK C;  4J9Y B;  2DYS B;  4JTC B;  3LNM B;  1Q82 W;  3X2Q C;  3ABU A;  1CP9 A;  3ZRV A;  1K4C C;  2ZDI A;  3IFX A;  4CBC A;  1VQP V;  3SYQ A;  4PEL A;  1IXM A;  2X7R B;  1OZ0 A;  3AG1 C;  2C2A A;  2WLI B;  3OE7 G;  2HVK C;  2OT5 A;  3JCZ A;  3SPC A;  3AG2 B;  2A9H A;  2DYS C;  3OMI B;  4UV9 A;  5L3E A;  1ZWI C;  5EBW C;  5LGT A;  1M1K W;  1KP3 A;  4MTX A;  2YEV A;  2ITC C;  3OW2 U;  2UXN A;  3UKM A;  1OCC C;  1ORQ C;  1S3J A;  3PJS K;  1F4M A;  3FYE B;  1PNL A;  4F4L A;  1YIJ V;  3CCE V;  3ZRW B;  2BOB C;  3RVZ A;  1PD3 A;  1R3I C;  3AG2 C;  4RUE A;  1H2G A;  1GMG A;  2Q6A A;  4UV8 A;  2EIL C;  5EC2 C;  3SYA A;  3FB7 C;  4XDK A;  3SYC A;  1AJQ A;  2IW5 A;  1DTO A;  5CA3 A;  4JGS A;  1B6Q A;  4P9O A;  1BL8 A;  2WLM A;  3TCU A;  3LDD A;  4GX5 A;  3E8F A;  1F51 A;  2B1G A;  4BAY A;  1VQ9 V;  1NR1 A;  1Y66 A;  2NLJ C;  4HYO A;  2WSS G;  3LDE A;  4WFA V;  2EBO A;  3ABM B;  1AI6 A;  2B5U A;  4TWK A;  2OCC B;  2ZDI C;  1YJ9 V;  5J9P C;  4KUM A;  5DM6 V;  1CPY A;  1GM7 A;  2MK3 A;  1Q86 W;  2IJH A;  2EIJ B;  2P67 A;  1KP2 A;  4ZKI A;  3ETD A;  2W0F C;  4UVC A;  2WLN A;  2R9R B;  4DO2 A;  3ABM C;  1RPR A;  5IY5 B;  4PA9 A;  2JIZ G;  1PNK A;  4UXN A;  2W6J G;  3H01 A;  3AG4 B;  1K9M W;  1K97 A;  2PI4 A;  4FMT A;  1NQT A;  1JCH A;  2EIJ C;  4QIW F;  2GSM B;  2Q68 A;  4WFG A;  1F4N A;  4QE7 A;  3QO5 A;  3SJQ C;  3OR7 C;  1K4D C;  3AEI A;  2DWD C;  5EBM C;  5IY5 C;  4RAI A;  3ABT A;  3ASO B;  1S0V A;  2EIN B;  4PDL A;  5LBQ A;  4FPP A;  2KB1 A;  3OR6 C;  4UVA A;  3OM3 B;  1QR8 A;  3FB5 C;  5BZB A;  2OTL V;  1S72 V;  1OCZ B;  5KA6 A;  1OHH G;  3SYP A;  3HPL C;  3ZMZ A;  1G4Y B;  1VQO V;  3ASO C;  3ZMT A;  3UM7 A;  2EIN C;  1MOF A;  2NNU A;  2A0L A;  3SPJ A;  1DF4 A;  3TK1 A;  1OCO B;  5B3S B;  1BHB A;  2JEU A;  1PKX A;  2WPD G;  3CC7 V;  3CYO A;  1OCZ C;  4MVR A;  1GKF A;  2BOC C;  5GW7 A;  1K92 A;  1M9N A;  5KUK A;  4EKW A;  5HFL A;  5KA5 A;  3T4D A;  3ABK B;  5L3F A;  3ZN1 A;  5B1B B;  1I5Y A;  2IJJ A;  1MAB G;  2XAF A;  4I9W A;  3CCS V;  1R6N A;  1OCO C;  2V7Q G;  2ZQM A;  1V55 B;  2EJR A;  5IYD O;  3CME V;  4JYB A;  5IDJ A;  1JOY A;  1NR7 A;  1AJP A;  2XAG A;  3RBZ A;  3ABK C;  1OCR C;  2DQ3 A;  2LFS A;  5B1B C;  4H33 A;  3ZMU A;  2HLD G;  1W2B U;  1MSW D;  1KKD A;  4J9Z B;  3TET A;  1V54 B;  1V55 C;  3B8M A;  4JAU A;  1S5H C;  4R50 A;  4GCZ A;  3WFV A;  3G4S V;  2UXX A;  2B1I A;  3CC2 V;  3CPW U;  1VQ6 V;  4CZZ A;  4X89 A;  2IH1 C;  4KP4 A;  5LGN A;  4U7N A;  1V54 C;  3JD2 A;  1F23 A;  1VQ7 V;  2IU3 A;  1NJI W;  2X6B A;  1Y4M A;  3FKS G;  2Y69 B;  4BIZ A;  4QJF B;  2QA4 V;  4LBE C;  3K08 A;  1I5X A;  1K3E A;  2QEX V;  3CCJ V;  2WLJ A;  3ZMV A;  3T2M A;  2XAH A;  3ETE A;  1PL0 A;  4JAV A;  5CMU A;  1FXK A;  4MTF A;  3ZCC A;  1AI7 A;  2XAS A;  3ZJZ A;  2QM8 A;  2EZP A;  2DQ0 A;  5LHH A;  3E8G A;  2X6A A;  2P6J A;  3RVY A;  3STZ C;  3OEE G;  5L3D A;  2Y69 C;  3P32 A;  1SRY A;  3CCQ V;  3IGA C;  4PA3 A;  5L3G A;  2AHY A;  1R3K C;  3W7S A;  4P30 A;  3K0G A;  3JD1 A;  3SPG A;  3ZRS A;  2HJF C;  1EBO A;  5IYB O;  1PNM A;  3CCL V;  3OFN G;  4Z1M G;  4MT8 A;  4MVM A;  1YI2 V;  1VQN V;  4LP8 A;  3B8N A;  2XND G;  2CK3 G;  5H9C A;  1WPX A;  2YEV B;  5HFM A;  5CBG A;  1E79 G;  4ASU G;  3I55 V;  4E2L A;  2ITD C;  3T1C A;  2EZO A;  1E1R G;  4JAS A;  3SPH A;  2IJI A;  4MW3 A;  3W7X A;  4P9P A;  1J95 A;  4HZ3 A;  1KQS U;  2OCC C;  3MHH C;  1FFT B;  4WF9 V;  3E8B A;  4MVS A;  1NVP B;  3QO8 A;  3CC4 V;  3ZMS A;  2WAM A;  2ZR3 A;  3ABL B;  5FL7 G;  1LNQ A;  4X8A A;  3A0R A;  2W6I G;  2HFE C;  4FK5 C;  3OMN B;  3K9A A;  4L87 A;  4WFH A;  1SES A;  1GM9 A;  4PDM A;  3W7U A;  3RW0 A;  3CCU V;  3AG4 C;  2H94 A;  1QBZ A;  3ABL C;  1XL6 A;  1ROP A;  1VQK V;  1VQ5 V;  2M7W A;  1CEZ A;  1GO3 F;  1M56 B;  1NH2 D;  1AI5 A;  4TSF G;  1YJW V;  1SET A;  1SZT A;  4R6Z A;  1S77 D;  4BW5 A;  1R3L C;  4G2K A;  3K03 A;  2WLH A;  3K06 A;  3OUS A;  3LSQ A;  1QLN A;  5EBL C;  3G71 V;  2IJK A;  1M56 C;  1R3J C;  4UVB A;  3IC7 A;  3HB3 B;  1QLE B;  4MTG A;  4JTA B;  4QPJ A;  4PA6 A;  3NXS A;  2XOK G;  4R8C A;  1QVG U;  1NKD A;  1FXV A;  3DTU B;  3W7W A;  3MD0 A;  3DGE A;  3ZN0 A;  5DN6 G;  2QTO A;  5B3S C;  1NBM G;  2QKS A;  5B1N A;  4WFE A;  2XAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...