2DWEC

Crystal structure of kcsa-fab-tba complex in rb+
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB HEAVY CHAIN
publication title Crystallographic Study of the Tetrabutylammonium Block to the KcsA K(+) Channel
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 41
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2006-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2dweC00
2ZD9A 2HG5C 4MW8A 4HZ3A 4PDRA 3SYOA 5EBWC 1LNQA 3AG3C 4MVSA 2BOBC 2EILC 4GX5A 4X88A 2Q68A 3TETA 3ABMC 1V54C 4PA6A 1OCOC 4GX2A 4PA7A 2AHYA 4MW3A 3F7YC 3AG2C 4MVOA 4P30A 3SYAA 2QTOA 3E8GA 3OR7C 3AG1C 3X2QC 1XL4A 2QKSA 1M56C 1OCZC 4RAIA 3OUSA 4MTOA 5CBFA 5KUKA 1XL6A 3IFXA 3LNMB 3SPIA 2HVJC 4J9YB 3FB7C 5B1BC 3ABKC 3OR6C 4G27B 4P9PA 4PDLA 5EC1C 3ZRSA 4JTDB 4LCUC 5EBMC 1V55C 3K04A 4MS2A 3UM7A 3K08A 3ZJZA 1R3LC 3E83A 3PJSK 3T1CA 2OCCC 2HVKC 3EFFK 5EBLC 2Q6AA 4RO2A 2A79B 4RUFA 2R9RB 4R50A 4G28B 4BW5A 3E8BA 4MVUA 3SPCA 2DYRC 1J95A 5E1AC 5B3SC 3LDEA 3KG2A 2Q67A 3GB7C 4MSWC 3RVZA 5CBGA 1R3KC 2WLLB 4QE9A 2WLLA 4P2ZA 3E8HA 2H8PC 3T2MA 3SPGA 2ITDC 4CBCA 2WLIB 2WLIA 4TWKA 3K0GA 1QLEC 5IY5C 4UUJC 1G4YB 3OGCC 2DYSC 2DWEC 1K4DC 4MTFA 4MVRA 1JVMA 3E8FA 1M57C 2X6BA 2EIJC 4PDMA 4X8AA 2HFEC 2ZXWC 1R3JC 3ASNC 4H37A 4R6ZA 2EIMC 2Y69C 4XDKA 4QNHB 1R3IC 1OCRC 1ORQC 2IH3C 1P7BA 1K4CC 3K0DA 4XDJA 1KKDA 3SJQC 2WLMA 4OXSA 3FB6C 3R65A 3SPHA 2X6AA 3AG4C 3JYCA 4MVQA 4PA3A 4KFMA 4R7CA 4WFEA 2WLNA 3SYPA 4X89A 2IH1C 3T4DA 4MTGA 2Q69A 3WG7C 4F4LA 3F5WC 4RUEA 4HYOA 3TCUA 4GX1A 4PA9A 2WLKA 4JTCB 1ZWIC 3VOUA 3K03A 4WFGA 4GX0A 4LBEC 4DXWA 2NLJC 4EKWA 3E89A 4LP8A 4PA4A 2X6CA 3OUFA 4WFFA 3SYQA 2HJFC 3K06A 2ATKC 4QE7A 3LUTB 3STLC 3UKMA 2KB1A 3RVYA 5CBHA 3BEHA 2BOCC 2ITCC 5J9PC 3E86A 1BL8A 2K1EA 3RW0A 2WLJA 3IGAC 3LDCA 3STZC 2WLHA 2YEVA 3SYCA 2AHZA 4I9WA 3ASOC 4JTAB 4WFHA 2DWDC 4XDLA 2EIKC 3F7VC 2P7TC 4ZBMA 2JK5C 4J9ZB 4MVMA 5EK0A 5B1AC 4PDVA 4MVZA 3HPLC 2W0FC 3T4ZA 3FB5C 1OCCC 2A9HA 3FB8C 3ABLC 4P9OA 5BZBA 5KUMA 3SPJA 1S5HC 2EINC 3LDDA 4H33A 5EC2C 4R8CA 2A0LA 3RBZA
chains in the Genus database with same CATH superfamily
5IT9N 4HZ3A 5IJ0B 5IJ0A 1BSMA 1SQXH 4GX2A 1VQPV 4P30A 4Z1VA 1VQ6V 4FLTA 4JI2B 2UUAB 2CH7B 2CH7A 4RAIA 3JAMN 1JMKC 2VQFB 1IBLB 3JD2A 2ZR2A 2P67A 3K59A 2B1IA 2E5LO 3CB2A 3E35A 4RO2A 1K73W 1J95A 1GN2A 5LGUA 3B40A 3A0RA 3IJ4A 2OWOA 2UUCO 2EZOA 1L8DA 1BCCH 2FL4A 1TAEA 1F7YA 2Z3YA 4QNHB 4GCZA 1N33O 3RYFB 3RYFA 2JJ1G 2AGAA 1XNRB 1Q7YW 3W7XA 3AG3B 3BRCA 1V9PA 1O9GA 2X6CA 1H38A 3CRQA 1S5LZ 1AR4A 1VMGA 2QDOA 3ZMSA 1Y74B 1Y74A 4ZOLB 2DYSB 4ZOLA 4FM2A 4CS4A 3RN4A 3F5TA 1LUVA 1XILA 3STZC 3H1HH 4CH5A 1AP5A 3B8MA 1NR1A 3SJAC 4X1IB 4X1IA 5H5NA 2BCCH 1SQQH 2H94A 3P3NA 2UUBO 2LQTA 1S5HC 1Q81W 4DUZB 4MT8A 4FJCC 1M1KW 2UXBO 1P4RA 4DR5B 1N36O 2QWOB 2V4DA 2EX3A 4MW3A 4IIJB 4IIJA 2QM8A 1N32O 1Y66A 3TK1A 3ZS8C 1XI1A 1GAXA 4DV5O 4UVAA 3ZHRA 1EZVH 4DV4B 2BTOA 3C3SA 3WG7B 1JFFB 1JFFA 5IYZB 4UCOA 1SA0A 5IYZA 4LCUC 4D7SA 1V55C 4HAMA 2QWPB 1QNMA 4AQYO 3PJSK 3T1CA 3EFFK 4YY3O 1OZ0A 5E1AC 3K79A 1QVFU 5LHGA 1S3JA 2YUAA 3E8HA 2GHYA 3BY6A 3JSNA 2CTQA 4JI7B 4TWKA 2DJVA 1GMGA 5LP6C 5K1PA 4L8JA 4JAUA 3S3XA 3OGCC 4MVRA 3CMEV 5B66Z 5KHIA 1VQ5V 1R3JC 3M7MX 1YXBA 1P7BA 4PD4F 2P6JA 4B3SB 4MVQA 3SYPA 4WFEA 1U97A 4LF8B 1OJHA 4FMTA 4UXNA 4X9QA 4CH3A 4GX0A 3DC6A 2NR5A 4X62O 3D36A 1M56B 3BCCH 3OT7A 4UCRA 4DR7B 1QVGU 4E2LA 1NH2D 4DR4O 2QWRB 3OTFA 5B1BB 2JJ2G 2DOSA 3CCUV 3SJBC 5IYBO 2WLJA 5F2VO 2VQEO 2ZXWB 1VQMV 2PTMA 4JTAB 1Q3EA 4XDLA 2PZSA 4QPJA 3CRAA 1GO3F 2LP7A 5B1NA 4NXMO 3OMNB 5BZBA 4LF4B 5KUMA 4JASA 3A0HZ 2Q73A 4PDRA 1O9HA 1Y76B 2VRZA 1Y76A 4IT5A 4DV7O 4FFBB 3N27A 4FFBA 2XTAA 2ZE6A 5CBFA 3JD1A 4JGSA 1I0HA 1MZEA 3ETGA 1Y4MA 1Q86W 1F23A 1PNMA 2V7QG 2WA4A 1AP6A 1IBMO 4PJ0Z 2ZNIA 1XREA 1YI2V 4B3TB 5CMUA 3B09A 1DF4A 3CCSV 2LJ2A 1VF5B 3DGEA 3JAWB 3JAWA 1AI6A 2WLLB 2F95B 2WLLA 4QE9A 4P2ZA 2DN9A 4GZRB 2Z0AA 4FM1A 5KAIZ 2DYSC 2DWEC 4O2BB 4O2BA 2DMXA 2Q7EA 1FYJA 1J5EO 4DUYB 1F51A 4C7UA 4FLWA 4R6ZA 2EIMC 1OCRC 2E3CA 4CH6A 3R65A 1RFYA 2CUGA 1YJWV 4LF5O 4DW0A 1DTOA 3D3IA 3JYCA 2E5LB 4FFKA 2Q69A 4FM0A 3AEIA 3CCJV 4HYOA 1WPBA 2WLKA 1OCOB 4JI0O 1JA8A 3GWOA 1E79G 3CD6V 2E75B 1PD3A 2G38A 5IJ9B 2RNBA 5IJ9A 2UUCB 2XAJA 1IDSA 4IGGA 1RPOA 5LMNO 3WB1A 1N33B 2JK5C 5B1AC 5EK0A 3BVOA 4DV1O 2JVDA 3FB5C 4P9OA 1QBZA 5L3FA 4R8CA 3EVKA 5JQGA 1VQNV 1FPOA 2ZD9A 2HG5C 2UXXA 1YTFD 2CK3G 3J80N 2ZINA 4GX5A 3BAAA 3OW2U 2LFRA 3ABMC 2PI4A 3T1YO 1JPXA 3AG2C 5LGTA 1OCZC 2DQ0A 2NN4A 1HDJA 5B5EZ 1RP3B 1QQCA 3RT3C 3K5LA 3OR6C 4KXRA 2ZKOA 4JTDB 2UUBB 1IXMA 1VQLV 2PI5A 4X66O 2NNUA 1XUQA 4G28B 2YI9A 2UXBB 4NTYA 1Q82W 1N36B 5KHHA 3LSQA 1BQ0A 2QKAA 2P5OA 1N32B 2QWQB 4DV5B 4ZKIA 1AVMA 2JGUA 1TUEB 1SC5B 1PM9A 2ZXWC 5DEDA 5CA1B 2XASA 4TV8B 4TV8A 5CA1A 3K0DA 1CP9A 4R7CA 1PNKA 4AQYB 5AG2A 1FD9A 4YY3B 2YC0A 1I08A 1IZ3A 4JI5B 3CRCA 3ZHVA 3RVYA 4CS3A 2X0LA 5KAFZ 2YS8A 5JJNB 5JJEB 3JALB 3JALA 1GM7A 1X4TA 1Q6UA 3SGIA 3RGBA 2LW1A 3LDDA 5EC2C 1UFIA 3ZHUA 1SZXA 3CXCU 4X62B 1HR0O 2L35A 3D8CA 5JVDB 4DR4B 2KSDA 5JVDA 3KCYA 1QCEA 3SYAA 3OR7C 3X2QC 2CTPA 1R73A 2QKSA 2YXYA 3K9AA 2VQEB 4B08A 4NTXA 3IFXA 3LNMB 2ADPA 1XQ8A 3ABKC 3M99B 1G8MA 5BR8O 3E22A 5EBMC 4NXMB 4XBFA 3K08A 5KHGA 2OCCC 3ETEA 1XMOO 3JD3A 2XNDG 3W7TA 4J7KA 1YZBA 4YJ2B 4YJ2A 4DV7B 2CTRA 2ZE8A 1NR7A 1QLEC 2GUZA 1NZ6A 4LH7A 1K4DC 3APQA 1F4MA 1M57C 2BSKB 1JCHA 2BSKA 1WP7A 2FB5A 1FAFA 4LFCO 4TOIA 5FNVB 1TGOA 4TQFA 5FNVA 1IBMB 4LFAO 1FXVA 4JI1O 1VF6A 1DF5A 1I5YA 4N23A 4RQEA 3QTCA 3CWBH 4QE7A 2A3QA 1MMMA 1U96A 2KB1A 4KP4A 2YI8A 1CEZA 2RMKB 1BQZA 1K92A 1NTZH 4QIWF 1V55B 1KBHA 2AHZA 4KL1A 1VQ4V 3CCQV 3VBBA 1FXKC 4MVMA 5LHIA 3BPZA 4K8ZA 1WLEA 3MHHC 3HB3B 1S76D 2YIBA 3SYOA 4JI0B 5LP6B 5LP6A 1SS3A 4PA7A 2XHBA 3AG1C 3U11A 1H2MA 1Z5WA 4NTWA 1QU7A 2XT9A 3QG5A 5LMNB 1Q6HA 4E4EA 1AJQA 2CGOA 1AROP 3A2FA 4AILC 3K04A 4DV1B 3CS5A 4B3MO 2HVKC 4DK1A 4O4IB 4F6EA 4O4IA 4RUFA 2F43G 3JD0A 4J10A 5EIBD 5B3SC 4JYCA 4MSWC 1GH6A 4PELA 2HHHO 3TXQA 3T2MA 2Q8VA 2DQ3A 3OM3B 3ZHSA 3T1YB 1XNQO 2UXDO 3VQXA 1ZSPA 1JVMA 5B1OA 1MNGA 1BMFG 3OD4A 1EBOA 2GSMB 1PL0A 5CB4B 2Y69C 3UT5B 5CB4A 3UT5A 2IH3C 3AG4C 5LHHA 2RDCA 1YDXA 1ROPA 3B77A 2XAFA 5CN0A 4X66B 3F5WC 4ZHQB 4ZHQA 4JI6O 1N34O 2MK3A 3UCSC 5L3CA 3CRRA 3ZN1A 2ATKC 5JWPA 1VARA 1Z5VA 1BL8A 2P4KA 4ZI7B 4ZI7A 1TVKB 4A5UB 1TVKA 4Z2WA 4WFHA 1JQ0A 2DWDC 1HW7A 5GTHZ 5L3DA 1HNXO 3I56V 4D7TA 2UXCO 1WB7A 4X1YB 3JARB 4X1YA 3JARA 1OCCC 1D2DA 1MSWD 1SQBH 1RPRA 3L73H 4QGPA 1Q5OA 1IXBA 4X88A 1CXZB 2IW5A 3G6EV 1R6NA 1L0LH 4JF3A 1VIBA 4DV2O 2EIMB 5D5QA 1OCRB 2IM9A 1ZX3A 4P9PA 4N21A 1GN6A 5CA3A 2F4VO 4DRXB 4O4HB 4DRXA 4O4HA 4CZZA 1VF6C 1HR0B 1KU9A 3ML0A 2Q67A 2F1MA 2JDIG 2HKOA 2WLIB 4U3JB 2WLIA 4LH6A 4OPAA 4U3JA 4DYLA 1AR5A 3CEIA 1A32A 1MABG 5B1AB 4NYKA 1VQOV 3UQ8A 1SA0B 1H2KA 4FLYA 4GT1A 1ORQC 5BR8B 1JR9A 2X6AA 4DR2O 4RUEA 1H8HG 4GX1A 3ABMB 1PV0A 1GN3A 3FYEB 4JTCB 1L1FA 4EFEA 1XMOB 2OIEA 2F23A 3AG2B 1FFXB 3WB2A 1FFXA 1QHTA 3OGIB 2YICA 3HKBB 5IDJA 3HKBA 1OCZB 2AW9A 2PF4E 3H1IH 3BEHA 1YEWA 2ARHA 2P4VA 3T1HO 1BHBA 4FPPA 5FPOA 1SQVH 3ICXA 3LDCA 1IBKO 3ZRWB 3ZRWA 5LXTB 4LFCB 5LXTA 3FKSG 4WFAV 4LFAB 4DR3B 4JI1B 1SRYA 2JIZG 3CCEV 3JATA 2RCVA 3WB0A 4MVSA 1AI4A 5H6QA 2BOBC 2GV9A 1AB3A 4JAVA 3JD4A 1V54C 2QM7A 1BZKA 4JZ2A 1FFTB 1XL4A 4HNAB 4HNAA 1W0KG 4DR6O 1SQFA 2ADQB 4JZGA 1K5SA 4YIOA 1PP9H 3APOA 3THOA 4J7JA 1WP8A 3I5DA 2EINB 4J7ZA 4LF6O 4YXWG 5DN6G 1YITV 1ZTEA 4MVUA 5GONB 5GONA 1W2BU 2N04A 3ZN0A 4BIOA 1KB9F 3RVZA 2EULA 4I0XB 4I0XA 1LR1A 3SPGA 4GUNA 5IY5C 2A7WA 2Q4PA 4LF9O 3AK2A 2ZE5A 1K33A 3NR7A 5KMGB 5KMGA 1HNZO 4QJFB 4YHHO 2HEPA 4NR1A 1HWYA 4X89A 4B3MB 5JCOC 2YXLA 3CSXA 3CCVV 3TCUA 2KKWA 4JI3O 3S3WA 1G1XB 3OFNG 4PA4A 3X2QB 1BHAA 3OTOO 4FK5C 2HHHB 1UJWB 1AI5A 5CBHA 4X20B 4X20A 1XNQB 3RYCB 3RYCA 3ABKB 2UXDB 1PKXA 5LOVB 5LOVA 1BE3H 1IVSA 4DV3O 1YHQV 3OEEG 5A2QN 4OPHA 2OCCB 1Q6IA 3CC7V 3BFRA 5LL6Y 2IJHA 1M9NA 4B3TO 1YJ9V 1R1BA 4I4TB 4JI6B 4I4TA 2Y0PA 1YJNV 1N34B 3HR0A 5H2FZ 4FZ1A 1LUWA 1QLEB 3CE2A 1JX9A 2Q68A 3KKYA 4K8XA 1M57B 2Y4TA 3NXSA 4TT3G 1X59A 2RJZA 2GBOA 4WCEV 1FJGO 5KHKA 2DW4A 1HNXB 2OTJV 2UXCB 5JQGB 3ABLB 1EN5A 2CTWA 2MW2B 4LC1A 4JI8O 2GTSA 2YIDA 1MZFA 2F93B 3U0ZA 1EM1A 2OYQA 4OX9O 4JAAA 1Q43A 3OAAG 2ITDC 2YIAA 2R72A 3BHPA 3FAVA 3FAVB 2B5UA 1XBLA 3K0GA 4DV2B 5KHJA 3WFVA 1FXKB 1FXKA 4K3AA 4MTFA 4NVPA 1US6A 2QWNB 1R6KA 1YVWA 3IC7A 1P84F 1Q90D 4XDKA 2VQFO 2F4VB 2BTQB 2BTQA 4H44B 4IYIA 2ZIMA 3AG7A 4UVBA 4DXWA 2QSAA 2YXHA 3OUFA 3AG1B 3W7SA 3L71H 3K06A 3STLC 1H2LA 2D3OW 1B3QA 4CC5A 3RW0A 3QNEA 4JYYA 1H2SB 3VQWA 3ASNB 1GM9A 1XHXA 1GRJA 3F7VC 4DR1O 4H0LB 4J41A 3JASB 3JASA 5TISZ 1BS3A 3FB8C 2A9HA 1COWG 5GTIZ 5B3SB 4DR2B 1SQPH 2EINC 4H33A 4ABMA 4RQFA 3RBZA 2ETNA 4ZIBA 5EZYB 2IJIA 5EZYA 1XMQO 1QR8A 2EILC 1UPGA 2IJKA 4I50B 4I50A 1I94O 2QM4A 1FS0G 2AHYA 2YDEA 3F7YC 2Y69B 3W7UA 4K0KO 3OEHG 4X1KB 4X1KA 2ZM6O 3T1HB 1W59A 4JV5O 5HFLA 3KZIZ 4MTOA 4CS2A 1QLNA 2HVJC 3AG4B 2EIKB 2PUSA 1IBKB 5LGNA 5EC1C 1JJOA 4LWSB 4LWSA 3JSLA 4MS2A 1R3LC 5KX5B 5EBLC 5KX5A 3MD0A 2R9RB 3HKEB 3HKEA 1OV9A 2XAQA 1R3KC 5IWAO 3RWRD 2HJDA 3TJTA 1OHHG 2AZ0A 4DR6B 3E22B 2Q5ZA 4PDMA 1OCCB 4G2KA 4F6RB 4F6RA 2D2CB 3B4SA 3H01A 4OXSA 5EYPB 5EYPA 2GDSA 2HR3A 4LF6B 3I55V 4WFGA 3ETQA 1YSCA 1WAZA 2GUZB 3SYQA 3FD9A 4PV1B 3IAYA 3JCUZ 1EN4A 3MHSC 3ZBHA 3E86A 1N4CA 4BIZA 5HFMA 3SJCC 2ZDIC 2AXTZ 1URFA 5ITZB 2ODMA 5ITZA 3CRMA 2QA4V 4LF9B 3AK3A 2XAGA 3BA8A 2HLDG 2OIGA 2B1GA 3LSSA 2P7TC 3H1LH 4J9ZB 2WAMA 3CCLV 1HNZB 3ABLC 1RSOB 1RSOA 4DV0O 4K35A 2JS3A 3ZX6A 2IU0A 4JI3B 5EBWC 4LF8O 4W4LA 5IYCO 3OTOB 4I55B 1NU1H 4I55A 3TETA 3FFQA 1YIJV 4UVCA 1PNLA 1J5EB 3E8GA 2ZE7A 2N05A 1SERA 5H9CA 4DV3B 5H6RA 4LF5B 3QO7A 4J9YB 3FB7C 1K7DA 2CAZC 3M8AA 4QPKA 1ZUQA 3UM7A 2UU9O 2JRIA 1XOUA 3OE7G 4FLUA 1K8AW 1P49A 4LF4O 2DYRC 1ENVA 4PI0A 2A06H 4UUJC 4LF7O 1KQSU 2WSSG 1NQTA 4GLXA 4FLVA 2EIJC 1FJGB 1WPXA 1NH2B 4FIPC 5EIBC 3ASNC 4H37A 4LNUB 4LNUA 1H2NA 5IE9A 4X65O 1E1QG 1XEQA 1SESA 1EZJA 2CDYA 3T4DA 1EN6A 3BA9A 1T5EA 4JI8B 1V54B 2VWJA 4I9QA 1ZWIC 3K03A 2BE3A 3A8TA 3CXHF 1AJNA 2PY5A 2KQXA 4NXNO 4DK0A 4OX9B 3ABUA 3SDLA 3K57A 4LFBO 5DECA 2JEUA 3CCMV 3SR2C 1S0VA 1K97A 3ASOC 4DV6O 3FX7A 4MTXA 2EIKC 2IBZH 1N8RW 2Q9LA 4HBNA 4MVZA 4DUYO 4CH4A 2XAHA 2A0LA 1NKDA 4BIUA 4JI4O 1QR9A 4JYAO 5IY5B 2QEXV 3L72H 3UO3A 4UCTA 4U3FH 1XDCA 4KUMA 4U7OA 4D6TH 4NB5A 2C2AA 4DR1B 5JCOA 3QO8A 4O4JB 1VEWA 4O4JA 3B2EE 3ZRSA 1B06A 4UB8Z 4YJ3B 4YJ3A 3QVNA 1ZLZA 2QTSA 2XUMA 1S5JA 3L70H 4YIPA 2A79B 1WNSA 1XMQB 3ABTA 1TA8A 2B9ZA 2WPDG 1I94B 2UXNA 2H8PC 3ETDA 4J11A 4AI8A 1RM1C 4K0KB 3QO5A 2ZM6B 1CPYA 4JV5B 4UFZA 1MG1A 1MA1A 3ZMTA 2HFEC 4GKKO 4XDJA 1KKDA 2N74A 1AILA 2ZT9B 2WLNA 4PHZA 4MTGA 1MOFA 1KP3A 4IL6Z 1IX9A 3E89A 2V1DA 3A0BZ 4Q20A 5IWAB 1YTFB 3AK1A 1GKFA 5J9PC 2ITCC 5LMUO 2K1EA 1VQ9V 2FYUH 4B3RO 2FKXA 2EZPA 5K1XA 1TUBB 1TUBA 4J42A 1E1RG 2JS5A 3RYHB 3G6BA 3RYHA 3HPLC 3C3TA 2QR4A 2K9PA 1K34A 3CCRV 3ZHQA 2M6YA 3H1KH 3L9DA 1EFRG 2H3OA 1LNQA 1VQ7V 2Q0AA 2IU3A 2ILMA 4TQDA 3JCZA 4JI5O 3GVMA 1NVPD 1YCIA 3SPIA 3ZEDA 3ZRVA 2FTKA 4PDLA 3O9OA 4WFBV 2YIBD 1AR1B 1M90W 2QJ1A 3JATB 3G71V 4L87A 3ZJZA 4DV0B 5CA0B 5CA0A 2QGNA 1JJ2U 3H9VA 4B7EA 2E74B 2R70A 3BABA 2OT5A 1AI7A 2EJRA 1WN7A 1HP8A 3CX5F 3K5MA 5J2UB 3ZHTA 5J2UA 1D5NA 1VQKV 5KA5A 1R3IC 4W4KA 2L6LA 1BGYH 4GKJO 2DE0X 3P32A 2UU9B 4KFMA 3LNNA 3K58A 2EILB 1KECA 3VOUA 1VF7A 2NLJC 4EKWA 1GTOA 2M7WA 5DM6V 3L74H 4LR3A 2BOCC 4LF7B 3ZCCA 1VQ8V 1Q8IA 1JOYA 3SYCA 2Y0IA 3DTUB 4I9WA 5BMVB 2ZNJA 5BMVA 5IYDO 4X65B 1P7GA 5C8YB 5C8YA 4EB6B 4EB6A 3T4ZA 1SQGA 2VS0A 4PI2A 4KHPO 3AG3C 3DC5A 2CGNA 1NTMH 4TUYB 4TUYA 4NXNB 2FMLA 1NTKH 1THZA 3IC9A 2GTAA 1K5QA 4WBNA 4WBNB 4LFBB 2QTOA 3KCXA 4X64O 3O65A 1PL4A 1HNWO 3TGUH 4UCSA 2OTLV 4DW1A 4DV6B 2F66C 4B7KA 4G27B 4BR6A 2ZIOA 3N2KB 3N2KA 3CHXA 4BWAA 3CC2V 3J7AU 1NI8A 3E83A 4UCVA 1M4UA 3JAKB 3JAKA 4R50A 4JI4B 4JYAB 2Z5UA 4DO2A 2ZDIA 3P3PA 3LSUA 1G6UA 1B04A 2JEXA 1I7FA 1W0JG 3WU2Z 3K9SA 2P06A 1N0JA 3E8FA 2X6BA 5FL7G 2RQ6A 4AHCA 5LBQA 2W0XA 3WG7C 4F4LA 3HKCB 3HKCA 2CE4A 1KUQA 1GM8A 1KMIZ 2X7RB 3J81N 3TXSA 2LFSA 3OMIB 4WFFA 5BY1A 2HP8A 3GWKC 4TSFG 1Y67A 3ZMUA 1DLBA 4UCUA 1SZTA 1ZAUA 4U7NA 4JI2O 3MDSA 2UUAO 1Y6XA 3RYIB 3RYIA 2E76B 3IGAC 4BAYA 5A9GA 2YEVB 2WLHA 2YEVA 5E79Z 1IBLO 1KKCA 1DK1A 4NKGB 4GKKB 3P30A 1NT2B 1MSDA 5FPRA 3PN1A 2DYRB 1K9MW 2LGQA 4MW8A 5FLXN 2R9AA 5C93A 1DGSA 4JPRA 3G4SV 5JJJB 2R9IA 3C90A 3VQVA 5BXZA 2EIJB 2P90A 5LMUB 1YF2A 4MVOA 3D36C 1WB8A 2IJJA 2VWKA 1M56C 4B3RB 5KUKA 5L3BA 1AJPA 4OGQB 2WWWA 3DSQA 1IURA 2W6IG 2ZQMA 5B1BC 5L3GA 3R66A 3W7WA 3E2EA 1F4NA 4WF9V 1XNRO 3OMAB 1FKAO 4J80A 4O4LB 4O4LA 2W6JG 2WA3A 2XOKG 2PYJA 1L0NH 3LDEA 3GB7C 5CBGA 5LYJB 5LYJA 1XHZA 3ASOB 3K5OA 3CP1A 1G4YB 1K3EA 2P22C 5KLVH 1M5IA 1NS1A 3CMAV 2OCHA 4X8AA 4O2AB 4O2AA 3MAQA 4EEQA 2ZCEA 5D5PA 2LW7A 1K4CC 2QKCA 4BW9A 3FB6C 3H1JH 3SPHA 4PA3A 4Z1MG 3QF7A 1KP2A 1S72V 4LBEC 1WA8B 1WA8A 4DUZO 2PYLA 3ZRXA 3K3WA 3LUTB 4DR5O 3EHBB 2Q7HA 2JGDB 2JGDA 1NBMG 3N2GB 3N2GA 1KC8W 5J2TB 5J2TA 4I7ZB 1M93A 3CYOA 4UV8A 4I5SA 4DV4O 3K5NA 1NJIW 4GKJB 1BT8A 3ZMVA 4PDVA 1SKVA 1PPJH 3HKDB 2W0FC 3HKDA 4CC6A 3DXRB 3DXRA 1RM1B 3FYIB 2YSUB 2Y4UA 1B6QA 4FZ0A 1ZL8B 2LGWA 1ZL8A 1OCOC 4PA6A 4JI7O 2ZR3A 2AZ2A 1R6TA 3ZMZA 1H2GA 1H8EG 2LO1A 3OUSA 3UO2A 5L3EA 1XL6A 4H13B 3VQYA 4YHHB 1WJZA 2O57A 4IYHA 3EXAA 4B3SO 3D3QA 4TV9B 4TV9A 4UV9A 2Q6AA 4BW5A 3E8BA 4KHPB 3SPCA 1VP7A 4DR3O 4IHJB 4IHJA 3KG2A 4DR7O 4CBCA 4ASUG 4X64B 3CPWU 2RN9A 3ZIAG 1HNWB 5JH7B 5JH7A 2Q0OC 1KD1W 2Q7GA 2EBOA 1I5XA 3Q4HB 3Q4HA 4FLZA 1SETA 1GK9A 3CJHB 1KYOF 3CJHA 5LA6B 5LA6A 4RWUA 3SJQC 2WLMA 4EFBA 2PGGA 3G67A 3G80A 2QE7G 2IH1C 4FLXA 2Y48A 4PA9A 1NVPB 4LP8A 1FXHA 3U10A 4Q6GA 4GYCB 2HJFC 3RFRA 1GN4A 3UKMA 5KA6A 1D5AA 5GW7A 1S77D 1SF9A 4ICGA 2EJ7A 4JYBA 2KG7B 3CC4V 2KG7A 4ZBMA 3B8NA 4FVMA 3SPJA 3L75H 1N0NA 1Z2GA 4UB6Z
chains in the Genus database with same CATH topology
1EFRG 4HZ3A 1LNQA 3CXCU 1QLEB 1VQ7V 1JX9A 2IU3A 2Q68A 4GX2A 1M57B 3NXSA 1QCEA 4TT3G 1VQPV 3JCZA 4P30A 3SYAA 3OR7C 3X2QC 1VQ6V 1R73A 2QKSA 4RAIA 3K9AA 1NVPD 4WCEV 3IFXA 3LNMB 3SPIA 3JD2A 2ZR2A 3ZRVA 2FTKA 3ABKC 2DW4A 2P67A 3M99B 1G8MA 4PDLA 2OTJV 4WFBV 1AR1B 1M90W 2B1IA 5EBMC 3G71V 3ABLB 4L87A 4XBFA 3K08A 3ZJZA 2OCCC 3E35A 3ETEA 4LC1A 4RO2A 1JJ2U 1K73W 3JD3A 2XNDG 1J95A 3W7TA 5LGUA 3A0RA 3OAAG 2ITDC 1NR7A 2OT5A 2B5UA 3K0GA 1AI7A 1QLEC 2EZOA 2EJRA 3WFVA 1FXKB 1FXKA 1K4DC 4MTFA 1F4MA 1M57C 1R6KA 3IC7A 1VQKV 2Z3YA 1JCHA 5KA5A 4QNHB 4GCZA 4XDKA 1R3IC 2JJ1G 3P32A 1Q7YW 3W7XA 3AG3B 4KFMA 2EILB 1FXVA 1KECA 1DF5A 1I5YA 4N23A 3VOUA 4UVBA 4DXWA 2NLJC 4EKWA 1GTOA 2M7WA 2X6CA 3OUFA 5DM6V 3AG1B 3W7SA 1H38A 4RQEA 3K06A 4QE7A 3STLC 3ZMSA 2KB1A 2D3OW 2BOCC 4KP4A 1CEZA 2DYSB 3ZCCA 1VQ8V 1K92A 3RW0A 3QNEA 1JOYA 4QIWF 1V55B 3STZC 3SYCA 3DTUB 3ASNB 2AHZA 4I9WA 1GM9A 3CCJV 1VQ4V 3CCQV 3F7VC 5IYDO 3B8MA 1FXKC 1NR1A 3VBBA 4MVMA 5LHIA 2H94A 3T4ZA 3FB8C 2A9HA 1COWG 5B3SB 1S5HC 2EINC 1WLEA 4H33A 1Q81W 3MHHC 4RQFA 3RBZA 3HB3B 1S76D 3SYOA 2IJIA 4MT8A 4FJCC 3AG3C 1M1KW 1QR8A 2EILC 2IJKA 1P4RA 1THZA 1FS0G 1K5QA 4PA7A 2AHYA 4MW3A 3F7YC 2QTOA 2Y69B 3AG1C 3W7UA 2QM8A 3OEHG 1Y66A 3TK1A 5HFLA 4MTOA 4UVAA 2OTLV 1QLNA 2HVJC 3AG4B 2EIKB 1AJQA 5LGNA 3WG7B 1AROP 4G27B 5EC1C 4LCUC 3CC2V 1V55C 3K04A 4HAMA 4MS2A 1R3LC 3E83A 3PJSK 3T1CA 2HVKC 3EFFK 5EBLC 3MD0A 4RUFA 2R9RB 4R50A 2F43G 2Z5UA 4DO2A 3JD0A 1OZ0A 5E1AC 5B3SC 3K79A 2ZDIA 1QVFU 4JYCA 2XAQA 5LHGA 4MSWC 4PELA 1S3JA 1R3KC 2JEXA 3T2MA 3E8HA 2GHYA 3BY6A 2DQ3A 3OM3B 4TWKA 1GMGA 1W0JG 4JAUA 3OGCC 1OHHG 4MVRA 1JVMA 3E8FA 5B1OA 2X6BA 1BMFG 4PDMA 5FL7G 3CMEV 1OCCB 1EBOA 1VQ5V 4G2KA 2GSMB 1PL0A 1R3JC 2Y69C 2IH3C 1P7BA 3H01A 4OXSA 2P6JA 2HR3A 3AG4C 4MVQA 3SYPA 4WFEA 5LBQA 5LHHA 1ROPA 3B77A 4UXNA 2XAFA 4FMTA 3WG7C 5CN0A 4F4LA 3F5WC 1GM8A 3I55V 4WFGA 4GX0A 2MK3A 2X7RB 2LFSA 3OMIB 5L3CA 4WFFA 1YSCA 3D36A 3SYQA 3ZN1A 1M56B 2ATKC 4TSFG 3ZMUA 1QVGU 3MHSC 1DLBA 4E2LA 1NH2D 3E86A 1BL8A 5B1BB 1SZTA 2JJ2G 4BIZA 2ZDIC 4U7NA 5HFMA 2QA4V 3CCUV 5IYBO 2WLJA 2XAGA 3IGAC 4BAYA 2YEVB 2WLHA 2YEVA 2ZXWB 1VQMV 2HLDG 4JTAB 2B1GA 4WFHA 1JQ0A 2DWDC 4XDLA 3LSSA 5L3DA 2P7TC 3I56V 4J9ZB 3P30A 4QPJA 1GO3F 2WAMA 3CCLV 2LP7A 5B1NA 1OCCC 3ABLC 2DYRB 3OMNB 5BZBA 5KUMA 4JASA 1K9MW 1MSWD 4MW8A 4PDRA 5C93A 1RPRA 4JPRA 2IU0A 3G4SV 5EBWC 5IYCO 2R9IA 4X88A 3TETA 1YIJV 2EIJB 2IW5A 1R6NA 2P90A 1PNLA 4UVCA 3G6EV 4JF3A 4MVOA 3E8GA 2EIMB 1OCRB 2IJJA 1M56C 1SERA 5H9CA 5CBFA 5KUKA 5H6RA 5L3BA 1AJPA 3JD1A 2WWWA 4JGSA 3QO7A 2W6IG 4J9YB 2ZQMA 3ETGA 3FB7C 5B1BC 1K7DA 5L3GA 1Y4MA 3W7WA 4P9PA 1Q86W 1F23A 1PNMA 3E2EA 1F4NA 2V7QG 4WF9V 4QPKA 3UM7A 3OMAB 4N21A 1S72V 5CA3A 1YI2V 4CZZA 3OE7G 5CMUA 2W6JG 2XOKG 1DF4A 1K8AW 3CCSV 2DYRC 1ENVA 3LDEA 3DGEA 3ML0A 2Q67A 3GB7C 5CBGA 1AI6A 2WLLB 2WLLA 4QE9A 2JDIG 4P2ZA 2HKOA 2WLIB 2WLIA 3ASOB 4UUJC 1KQSU 3CP1A 1G4YB 1K3EA 2WSSG 2DYSC 1NQTA 2DWEC 1MABG 5B1AB 1VQOV 2EIJC 3CMAV 1WPXA 4X8AA 4GT1A 4FIPC 1NH2B 1F51A 3ASNC 4H37A 4R6ZA 2EIMC 1OCRC 1ORQC 1K4CC 1E1QG 1SESA 3FB6C 3R65A 1YJWV 3SPHA 1DTOA 2X6AA 3D3IA 3JYCA 1EZJA 4PA3A 4Z1MG 3T4DA 2Q69A 3AEIA 4RUEA 4HYOA 1H8HG 3ABMB 1KP2A 4GX1A 1V54B 2WLKA 1OCOB 1ZWIC 3FYEB 3K03A 4JTCB 4LBEC 1L1FA 3AG2B 3ZRXA 1AJNA 3K3WA 5IDJA 1OCZB 3GWOA 3LUTB 3EHBB 1E79G 3ABUA 3CD6V 3BEHA 1PD3A 1NBMG 1KC8W 2XAJA 2JEUA 1BHBA 4FPPA 3CCMV 1RPOA 3CYOA 3LDCA 1K97A 4UV8A 1S0VA 4I5SA 3ASOC 1NJIW 4MTXA 2EIKC 1N8RW 2JK5C 5B1AC 5EK0A 3ZMVA 4PDVA 4MVZA 3ZRWB 3ZRWA 2W0FC 3FB5C 4P9OA 1QBZA 3FKSG 5L3FA 4WFAV 2XAHA 4R8CA 1VQNV 2JIZG 2A0LA 1SRYA 1NKDA 3CCEV 2ZD9A 2HG5C 2UXXA 1YTFD 2CK3G 4BIUA 1QR9A 5IY5B 1RM1B 2QEXV 4MVSA 3FYIB 1AI4A 5H6QA 2YSUB 2BOBC 4GX5A 3OW2U 1B6QA 4JAVA 2LFRA 3ABMC 3JD4A 1V54C 2QM7A 1OCOC 4PA6A 2PI4A 2ZR3A 1JPXA 4KUMA 3AG2C 1FFTB 5LGTA 3ZMZA 1H2GA 1XL4A 4U7OA 1OCZC 1H8EG 2DQ0A 3OUSA 1W0KG 5L3EA 1XL6A 2C2AA 3OR6C 3QO8A 1K5SA 3ZRSA 4JTDB 1IXMA 1VQLV 2EINB 2PI5A 2NNUA 2Q6AA 4UV9A 2A79B 4YXWG 4G28B 4BW5A 3E8BA 5DN6G 1YITV 4MVUA 3SPCA 1W2BU 3ZN0A 3KG2A 3ABTA 2WPDG 3RVZA 1Q82W 2UXNA 2H8PC 3ETDA 3SPGA 4CBCA 3LSQA 5IY5C 1RM1C 4ASUG 3QO5A 3CPWU 1CPYA 3ZIAG 1MG1A 4ZKIA 1KD1W 2EBOA 3ZMTA 1I5XA 1TUEB 2HFEC 2ZXWC 1SETA 1GK9A 1K33A 2XASA 3K0DA 4XDJA 1KKDA 3SJQC 2WLMA 1CP9A 4QJFB 2QE7G 4R7CA 2WLNA 1PNKA 4X89A 1HWYA 2IH1C 4MTGA 1MOFA 1KP3A 2Y48A 3TCUA 3CCVV 4PA9A 1NVPB 3E89A 3OFNG 4LP8A 1FXHA 2V1DA 4PA4A 3X2QB 1BHAA 2HJFC 4FK5C 4Q20A 1UJWB 1AI5A 3UKMA 1YTFB 3RVYA 1GKFA 5CBHA 5J9PC 5KA6A 2ITCC 2X0LA 2K1EA 3ABKB 1VQ9V 5GW7A 1S77D 1PKXA 2EZPA 4JYBA 1YHQV 1GM7A 3OEEG 1E1RG 2OCCB 4ZBMA 3CC4V 3CC7V 3HPLC 2IJHA 3B8NA 1M9NA 3SPJA 1K34A 3CCRV 3LDDA 5EC2C 1YJ9V 1YJNV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZD9 A;  2HG5 C;  4MW8 A;  4HZ3 A;  4PDR A;  3SYO A;  5EBW C;  1LNQ A;  3AG3 C;  4MVS A;  2BOB C;  2EIL C;  4GX5 A;  4X88 A;  2Q68 A;  3TET A;  3ABM C;  1V54 C;  4PA6 A;  1OCO C;  4GX2 A;  4PA7 A;  2AHY A;  4MW3 A;  3F7Y C;  3AG2 C;  4MVO A;  4P30 A;  3SYA A;  2QTO A;  3E8G A;  3OR7 C;  3AG1 C;  3X2Q C;  1XL4 A;  2QKS A;  1M56 C;  1OCZ C;  4RAI A;  3OUS A;  4MTO A;  5CBF A;  5KUK A;  1XL6 A;  3IFX A;  3LNM B;  3SPI A;  2HVJ C;  4J9Y B;  3FB7 C;  5B1B C;  3ABK C;  3OR6 C;  4G27 B;  4P9P A;  4PDL A;  5EC1 C;  3ZRS A;  4JTD B;  4LCU C;  5EBM C;  1V55 C;  3K04 A;  4MS2 A;  3UM7 A;  3K08 A;  3ZJZ A;  1R3L C;  3E83 A;  3PJS K;  3T1C A;  2OCC C;  2HVK C;  3EFF K;  5EBL C;  2Q6A A;  4RO2 A;  2A79 B;  4RUF A;  2R9R B;  4R50 A;  4G28 B;  4BW5 A;  3E8B A;  4MVU A;  3SPC A;  2DYR C;  1J95 A;  5E1A C;  5B3S C;  3LDE A;  3KG2 A;  2Q67 A;  3GB7 C;  4MSW C;  3RVZ A;  5CBG A;  1R3K C;  2WLL B;  4QE9 A;  2WLL A;  4P2Z A;  3E8H A;  2H8P C;  3T2M A;  3SPG A;  2ITD C;  4CBC A;  2WLI B;  2WLI A;  4TWK A;  3K0G A;  1QLE C;  5IY5 C;  4UUJ C;  1G4Y B;  3OGC C;  2DYS C;  2DWE C;  1K4D C;  4MTF A;  4MVR A;  1JVM A;  3E8F A;  1M57 C;  2X6B A;  2EIJ C;  4PDM A;  4X8A A;  2HFE C;  2ZXW C;  1R3J C;  3ASN C;  4H37 A;  4R6Z A;  2EIM C;  2Y69 C;  4XDK A;  4QNH B;  1R3I C;  1OCR C;  1ORQ C;  2IH3 C;  1P7B A;  1K4C C;  3K0D A;  4XDJ A;  1KKD A;  3SJQ C;  2WLM A;  4OXS A;  3FB6 C;  3R65 A;  3SPH A;  2X6A A;  3AG4 C;  3JYC A;  4MVQ A;  4PA3 A;  4KFM A;  4R7C A;  4WFE A;  2WLN A;  3SYP A;  4X89 A;  2IH1 C;  3T4D A;  4MTG A;  2Q69 A;  3WG7 C;  4F4L A;  3F5W C;  4RUE A;  4HYO A;  3TCU A;  4GX1 A;  4PA9 A;  2WLK A;  4JTC B;  1ZWI C;  3VOU A;  3K03 A;  4WFG A;  4GX0 A;  4LBE C;  4DXW A;  2NLJ C;  4EKW A;  3E89 A;  4LP8 A;  4PA4 A;  2X6C A;  3OUF A;  4WFF A;  3SYQ A;  2HJF C;  3K06 A;  2ATK C;  4QE7 A;  3LUT B;  3STL C;  3UKM A;  2KB1 A;  3RVY A;  5CBH A;  3BEH A;  2BOC C;  2ITC C;  5J9P C;  3E86 A;  1BL8 A;  2K1E A;  3RW0 A;  2WLJ A;  3IGA C;  3LDC A;  3STZ C;  2WLH A;  2YEV A;  3SYC A;  2AHZ A;  4I9W A;  3ASO C;  4JTA B;  4WFH A;  2DWD C;  4XDL A;  2EIK C;  3F7V C;  2P7T C;  4ZBM A;  2JK5 C;  4J9Z B;  4MVM A;  5EK0 A;  5B1A C;  4PDV A;  4MVZ A;  3HPL C;  2W0F C;  3T4Z A;  3FB5 C;  1OCC C;  2A9H A;  3FB8 C;  3ABL C;  4P9O A;  5BZB A;  5KUM A;  3SPJ A;  1S5H C;  2EIN C;  3LDD A;  4H33 A;  5EC2 C;  4R8C A;  2A0L A;  3RBZ A; 
#chains in the Genus database with same CATH topology
 5IT9 N;  4HZ3 A;  5IJ0 B;  5IJ0 A;  1BSM A;  1SQX H;  4GX2 A;  1VQP V;  4P30 A;  4Z1V A;  1VQ6 V;  4FLT A;  4JI2 B;  2UUA B;  2CH7 B;  2CH7 A;  4RAI A;  3JAM N;  1JMK C;  2VQF B;  1IBL B;  3JD2 A;  2ZR2 A;  2P67 A;  3K59 A;  2B1I A;  2E5L O;  3CB2 A;  3E35 A;  4RO2 A;  1K73 W;  1J95 A;  1GN2 A;  5LGU A;  3B40 A;  3A0R A;  3IJ4 A;  2OWO A;  2UUC O;  2EZO A;  1L8D A;  1BCC H;  2FL4 A;  1TAE A;  1F7Y A;  2Z3Y A;  4QNH B;  4GCZ A;  1N33 O;  3RYF B;  3RYF A;  2JJ1 G;  2AGA A;  1XNR B;  1Q7Y W;  3W7X A;  3AG3 B;  3BRC A;  1V9P A;  1O9G A;  2X6C A;  1H38 A;  3CRQ A;  1S5L Z;  1AR4 A;  1VMG A;  2QDO A;  3ZMS A;  1Y74 B;  1Y74 A;  4ZOL B;  2DYS B;  4ZOL A;  4FM2 A;  4CS4 A;  3RN4 A;  3F5T A;  1LUV A;  1XIL A;  3STZ C;  3H1H H;  4CH5 A;  1AP5 A;  3B8M A;  1NR1 A;  3SJA C;  4X1I B;  4X1I A;  5H5N A;  2BCC H;  1SQQ H;  2H94 A;  3P3N A;  2UUB O;  2LQT A;  1S5H C;  1Q81 W;  4DUZ B;  4MT8 A;  4FJC C;  1M1K W;  2UXB O;  1P4R A;  4DR5 B;  1N36 O;  2QWO B;  2V4D A;  2EX3 A;  4MW3 A;  4IIJ B;  4IIJ A;  2QM8 A;  1N32 O;  1Y66 A;  3TK1 A;  3ZS8 C;  1XI1 A;  1GAX A;  4DV5 O;  4UVA A;  3ZHR A;  1EZV H;  4DV4 B;  2BTO A;  3C3S A;  3WG7 B;  1JFF B;  1JFF A;  5IYZ B;  4UCO A;  1SA0 A;  5IYZ A;  4LCU C;  4D7S A;  1V55 C;  4HAM A;  2QWP B;  1QNM A;  4AQY O;  3PJS K;  3T1C A;  3EFF K;  4YY3 O;  1OZ0 A;  5E1A C;  3K79 A;  1QVF U;  5LHG A;  1S3J A;  2YUA A;  3E8H A;  2GHY A;  3BY6 A;  3JSN A;  2CTQ A;  4JI7 B;  4TWK A;  2DJV A;  1GMG A;  5LP6 C;  5K1P A;  4L8J A;  4JAU A;  3S3X A;  3OGC C;  4MVR A;  3CME V;  5B66 Z;  5KHI A;  1VQ5 V;  1R3J C;  3M7M X;  1YXB A;  1P7B A;  4PD4 F;  2P6J A;  4B3S B;  4MVQ A;  3SYP A;  4WFE A;  1U97 A;  4LF8 B;  1OJH A;  4FMT A;  4UXN A;  4X9Q A;  4CH3 A;  4GX0 A;  3DC6 A;  2NR5 A;  4X62 O;  3D36 A;  1M56 B;  3BCC H;  3OT7 A;  4UCR A;  4DR7 B;  1QVG U;  4E2L A;  1NH2 D;  4DR4 O;  2QWR B;  3OTF A;  5B1B B;  2JJ2 G;  2DOS A;  3CCU V;  3SJB C;  5IYB O;  2WLJ A;  5F2V O;  2VQE O;  2ZXW B;  1VQM V;  2PTM A;  4JTA B;  1Q3E A;  4XDL A;  2PZS A;  4QPJ A;  3CRA A;  1GO3 F;  2LP7 A;  5B1N A;  4NXM O;  3OMN B;  5BZB A;  4LF4 B;  5KUM A;  4JAS A;  3A0H Z;  2Q73 A;  4PDR A;  1O9H A;  1Y76 B;  2VRZ A;  1Y76 A;  4IT5 A;  4DV7 O;  4FFB B;  3N27 A;  4FFB A;  2XTA A;  2ZE6 A;  5CBF A;  3JD1 A;  4JGS A;  1I0H A;  1MZE A;  3ETG A;  1Y4M A;  1Q86 W;  1F23 A;  1PNM A;  2V7Q G;  2WA4 A;  1AP6 A;  1IBM O;  4PJ0 Z;  2ZNI A;  1XRE A;  1YI2 V;  4B3T B;  5CMU A;  3B09 A;  1DF4 A;  3CCS V;  2LJ2 A;  1VF5 B;  3DGE A;  3JAW B;  3JAW A;  1AI6 A;  2WLL B;  2F95 B;  2WLL A;  4QE9 A;  4P2Z A;  2DN9 A;  4GZR B;  2Z0A A;  4FM1 A;  5KAI Z;  2DYS C;  2DWE C;  4O2B B;  4O2B A;  2DMX A;  2Q7E A;  1FYJ A;  1J5E O;  4DUY B;  1F51 A;  4C7U A;  4FLW A;  4R6Z A;  2EIM C;  1OCR C;  2E3C A;  4CH6 A;  3R65 A;  1RFY A;  2CUG A;  1YJW V;  4LF5 O;  4DW0 A;  1DTO A;  3D3I A;  3JYC A;  2E5L B;  4FFK A;  2Q69 A;  4FM0 A;  3AEI A;  3CCJ V;  4HYO A;  1WPB A;  2WLK A;  1OCO B;  4JI0 O;  1JA8 A;  3GWO A;  1E79 G;  3CD6 V;  2E75 B;  1PD3 A;  2G38 A;  5IJ9 B;  2RNB A;  5IJ9 A;  2UUC B;  2XAJ A;  1IDS A;  4IGG A;  1RPO A;  5LMN O;  3WB1 A;  1N33 B;  2JK5 C;  5B1A C;  5EK0 A;  3BVO A;  4DV1 O;  2JVD A;  3FB5 C;  4P9O A;  1QBZ A;  5L3F A;  4R8C A;  3EVK A;  5JQG A;  1VQN V;  1FPO A;  2ZD9 A;  2HG5 C;  2UXX A;  1YTF D;  2CK3 G;  3J80 N;  2ZIN A;  4GX5 A;  3BAA A;  3OW2 U;  2LFR A;  3ABM C;  2PI4 A;  3T1Y O;  1JPX A;  3AG2 C;  5LGT A;  1OCZ C;  2DQ0 A;  2NN4 A;  1HDJ A;  5B5E Z;  1RP3 B;  1QQC A;  3RT3 C;  3K5L A;  3OR6 C;  4KXR A;  2ZKO A;  4JTD B;  2UUB B;  1IXM A;  1VQL V;  2PI5 A;  4X66 O;  2NNU A;  1XUQ A;  4G28 B;  2YI9 A;  2UXB B;  4NTY A;  1Q82 W;  1N36 B;  5KHH A;  3LSQ A;  1BQ0 A;  2QKA A;  2P5O A;  1N32 B;  2QWQ B;  4DV5 B;  4ZKI A;  1AVM A;  2JGU A;  1TUE B;  1SC5 B;  1PM9 A;  2ZXW C;  5DED A;  5CA1 B;  2XAS A;  4TV8 B;  4TV8 A;  5CA1 A;  3K0D A;  1CP9 A;  4R7C A;  1PNK A;  4AQY B;  5AG2 A;  1FD9 A;  4YY3 B;  2YC0 A;  1I08 A;  1IZ3 A;  4JI5 B;  3CRC A;  3ZHV A;  3RVY A;  4CS3 A;  2X0L A;  5KAF Z;  2YS8 A;  5JJN B;  5JJE B;  3JAL B;  3JAL A;  1GM7 A;  1X4T A;  1Q6U A;  3SGI A;  3RGB A;  2LW1 A;  3LDD A;  5EC2 C;  1UFI A;  3ZHU A;  1SZX A;  3CXC U;  4X62 B;  1HR0 O;  2L35 A;  3D8C A;  5JVD B;  4DR4 B;  2KSD A;  5JVD A;  3KCY A;  1QCE A;  3SYA A;  3OR7 C;  3X2Q C;  2CTP A;  1R73 A;  2QKS A;  2YXY A;  3K9A A;  2VQE B;  4B08 A;  4NTX A;  3IFX A;  3LNM B;  2ADP A;  1XQ8 A;  3ABK C;  3M99 B;  1G8M A;  5BR8 O;  3E22 A;  5EBM C;  4NXM B;  4XBF A;  3K08 A;  5KHG A;  2OCC C;  3ETE A;  1XMO O;  3JD3 A;  2XND G;  3W7T A;  4J7K A;  1YZB A;  4YJ2 B;  4YJ2 A;  4DV7 B;  2CTR A;  2ZE8 A;  1NR7 A;  1QLE C;  2GUZ A;  1NZ6 A;  4LH7 A;  1K4D C;  3APQ A;  1F4M A;  1M57 C;  2BSK B;  1JCH A;  2BSK A;  1WP7 A;  2FB5 A;  1FAF A;  4LFC O;  4TOI A;  5FNV B;  1TGO A;  4TQF A;  5FNV A;  1IBM B;  4LFA O;  1FXV A;  4JI1 O;  1VF6 A;  1DF5 A;  1I5Y A;  4N23 A;  4RQE A;  3QTC A;  3CWB H;  4QE7 A;  2A3Q A;  1MMM A;  1U96 A;  2KB1 A;  4KP4 A;  2YI8 A;  1CEZ A;  2RMK B;  1BQZ A;  1K92 A;  1NTZ H;  4QIW F;  1V55 B;  1KBH A;  2AHZ A;  4KL1 A;  1VQ4 V;  3CCQ V;  3VBB A;  1FXK C;  4MVM A;  5LHI A;  3BPZ A;  4K8Z A;  1WLE A;  3MHH C;  3HB3 B;  1S76 D;  2YIB A;  3SYO A;  4JI0 B;  5LP6 B;  5LP6 A;  1SS3 A;  4PA7 A;  2XHB A;  3AG1 C;  3U11 A;  1H2M A;  1Z5W A;  4NTW A;  1QU7 A;  2XT9 A;  3QG5 A;  5LMN B;  1Q6H A;  4E4E A;  1AJQ A;  2CGO A;  1ARO P;  3A2F A;  4AIL C;  3K04 A;  4DV1 B;  3CS5 A;  4B3M O;  2HVK C;  4DK1 A;  4O4I B;  4F6E A;  4O4I A;  4RUF A;  2F43 G;  3JD0 A;  4J10 A;  5EIB D;  5B3S C;  4JYC A;  4MSW C;  1GH6 A;  4PEL A;  2HHH O;  3TXQ A;  3T2M A;  2Q8V A;  2DQ3 A;  3OM3 B;  3ZHS A;  3T1Y B;  1XNQ O;  2UXD O;  3VQX A;  1ZSP A;  1JVM A;  5B1O A;  1MNG A;  1BMF G;  3OD4 A;  1EBO A;  2GSM B;  1PL0 A;  5CB4 B;  2Y69 C;  3UT5 B;  5CB4 A;  3UT5 A;  2IH3 C;  3AG4 C;  5LHH A;  2RDC A;  1YDX A;  1ROP A;  3B77 A;  2XAF A;  5CN0 A;  4X66 B;  3F5W C;  4ZHQ B;  4ZHQ A;  4JI6 O;  1N34 O;  2MK3 A;  3UCS C;  5L3C A;  3CRR A;  3ZN1 A;  2ATK C;  5JWP A;  1VAR A;  1Z5V A;  1BL8 A;  2P4K A;  4ZI7 B;  4ZI7 A;  1TVK B;  4A5U B;  1TVK A;  4Z2W A;  4WFH A;  1JQ0 A;  2DWD C;  1HW7 A;  5GTH Z;  5L3D A;  1HNX O;  3I56 V;  4D7T A;  2UXC O;  1WB7 A;  4X1Y B;  3JAR B;  4X1Y A;  3JAR A;  1OCC C;  1D2D A;  1MSW D;  1SQB H;  1RPR A;  3L73 H;  4QGP A;  1Q5O A;  1IXB A;  4X88 A;  1CXZ B;  2IW5 A;  3G6E V;  1R6N A;  1L0L H;  4JF3 A;  1VIB A;  4DV2 O;  2EIM B;  5D5Q A;  1OCR B;  2IM9 A;  1ZX3 A;  4P9P A;  4N21 A;  1GN6 A;  5CA3 A;  2F4V O;  4DRX B;  4O4H B;  4DRX A;  4O4H A;  4CZZ A;  1VF6 C;  1HR0 B;  1KU9 A;  3ML0 A;  2Q67 A;  2F1M A;  2JDI G;  2HKO A;  2WLI B;  4U3J B;  2WLI A;  4LH6 A;  4OPA A;  4U3J A;  4DYL A;  1AR5 A;  3CEI A;  1A32 A;  1MAB G;  5B1A B;  4NYK A;  1VQO V;  3UQ8 A;  1SA0 B;  1H2K A;  4FLY A;  4GT1 A;  1ORQ C;  5BR8 B;  1JR9 A;  2X6A A;  4DR2 O;  4RUE A;  1H8H G;  4GX1 A;  3ABM B;  1PV0 A;  1GN3 A;  3FYE B;  4JTC B;  1L1F A;  4EFE A;  1XMO B;  2OIE A;  2F23 A;  3AG2 B;  1FFX B;  3WB2 A;  1FFX A;  1QHT A;  3OGI B;  2YIC A;  3HKB B;  5IDJ A;  3HKB A;  1OCZ B;  2AW9 A;  2PF4 E;  3H1I H;  3BEH A;  1YEW A;  2ARH A;  2P4V A;  3T1H O;  1BHB A;  4FPP A;  5FPO A;  1SQV H;  3ICX A;  3LDC A;  1IBK O;  3ZRW B;  3ZRW A;  5LXT B;  4LFC B;  5LXT A;  3FKS G;  4WFA V;  4LFA B;  4DR3 B;  4JI1 B;  1SRY A;  2JIZ G;  3CCE V;  3JAT A;  2RCV A;  3WB0 A;  4MVS A;  1AI4 A;  5H6Q A;  2BOB C;  2GV9 A;  1AB3 A;  4JAV A;  3JD4 A;  1V54 C;  2QM7 A;  1BZK A;  4JZ2 A;  1FFT B;  1XL4 A;  4HNA B;  4HNA A;  1W0K G;  4DR6 O;  1SQF A;  2ADQ B;  4JZG A;  1K5S A;  4YIO A;  1PP9 H;  3APO A;  3THO A;  4J7J A;  1WP8 A;  3I5D A;  2EIN B;  4J7Z A;  4LF6 O;  4YXW G;  5DN6 G;  1YIT V;  1ZTE A;  4MVU A;  5GON B;  5GON A;  1W2B U;  2N04 A;  3ZN0 A;  4BIO A;  1KB9 F;  3RVZ A;  2EUL A;  4I0X B;  4I0X A;  1LR1 A;  3SPG A;  4GUN A;  5IY5 C;  2A7W A;  2Q4P A;  4LF9 O;  3AK2 A;  2ZE5 A;  1K33 A;  3NR7 A;  5KMG B;  5KMG A;  1HNZ O;  4QJF B;  4YHH O;  2HEP A;  4NR1 A;  1HWY A;  4X89 A;  4B3M B;  5JCO C;  2YXL A;  3CSX A;  3CCV V;  3TCU A;  2KKW A;  4JI3 O;  3S3W A;  1G1X B;  3OFN G;  4PA4 A;  3X2Q B;  1BHA A;  3OTO O;  4FK5 C;  2HHH B;  1UJW B;  1AI5 A;  5CBH A;  4X20 B;  4X20 A;  1XNQ B;  3RYC B;  3RYC A;  3ABK B;  2UXD B;  1PKX A;  5LOV B;  5LOV A;  1BE3 H;  1IVS A;  4DV3 O;  1YHQ V;  3OEE G;  5A2Q N;  4OPH A;  2OCC B;  1Q6I A;  3CC7 V;  3BFR A;  5LL6 Y;  2IJH A;  1M9N A;  4B3T O;  1YJ9 V;  1R1B A;  4I4T B;  4JI6 B;  4I4T A;  2Y0P A;  1YJN V;  1N34 B;  3HR0 A;  5H2F Z;  4FZ1 A;  1LUW A;  1QLE B;  3CE2 A;  1JX9 A;  2Q68 A;  3KKY A;  4K8X A;  1M57 B;  2Y4T A;  3NXS A;  4TT3 G;  1X59 A;  2RJZ A;  2GBO A;  4WCE V;  1FJG O;  5KHK A;  2DW4 A;  1HNX B;  2OTJ V;  2UXC B;  5JQG B;  3ABL B;  1EN5 A;  2CTW A;  2MW2 B;  4LC1 A;  4JI8 O;  2GTS A;  2YID A;  1MZF A;  2F93 B;  3U0Z A;  1EM1 A;  2OYQ A;  4OX9 O;  4JAA A;  1Q43 A;  3OAA G;  2ITD C;  2YIA A;  2R72 A;  3BHP A;  3FAV A;  3FAV B;  2B5U A;  1XBL A;  3K0G A;  4DV2 B;  5KHJ A;  3WFV A;  1FXK B;  1FXK A;  4K3A A;  4MTF A;  4NVP A;  1US6 A;  2QWN B;  1R6K A;  1YVW A;  3IC7 A;  1P84 F;  1Q90 D;  4XDK A;  2VQF O;  2F4V B;  2BTQ B;  2BTQ A;  4H44 B;  4IYI A;  2ZIM A;  3AG7 A;  4UVB A;  4DXW A;  2QSA A;  2YXH A;  3OUF A;  3AG1 B;  3W7S A;  3L71 H;  3K06 A;  3STL C;  1H2L A;  2D3O W;  1B3Q A;  4CC5 A;  3RW0 A;  3QNE A;  4JYY A;  1H2S B;  3VQW A;  3ASN B;  1GM9 A;  1XHX A;  1GRJ A;  3F7V C;  4DR1 O;  4H0L B;  4J41 A;  3JAS B;  3JAS A;  5TIS Z;  1BS3 A;  3FB8 C;  2A9H A;  1COW G;  5GTI Z;  5B3S B;  4DR2 B;  1SQP H;  2EIN C;  4H33 A;  4ABM A;  4RQF A;  3RBZ A;  2ETN A;  4ZIB A;  5EZY B;  2IJI A;  5EZY A;  1XMQ O;  1QR8 A;  2EIL C;  1UPG A;  2IJK A;  4I50 B;  4I50 A;  1I94 O;  2QM4 A;  1FS0 G;  2AHY A;  2YDE A;  3F7Y C;  2Y69 B;  3W7U A;  4K0K O;  3OEH G;  4X1K B;  4X1K A;  2ZM6 O;  3T1H B;  1W59 A;  4JV5 O;  5HFL A;  3KZI Z;  4MTO A;  4CS2 A;  1QLN A;  2HVJ C;  3AG4 B;  2EIK B;  2PUS A;  1IBK B;  5LGN A;  5EC1 C;  1JJO A;  4LWS B;  4LWS A;  3JSL A;  4MS2 A;  1R3L C;  5KX5 B;  5EBL C;  5KX5 A;  3MD0 A;  2R9R B;  3HKE B;  3HKE A;  1OV9 A;  2XAQ A;  1R3K C;  5IWA O;  3RWR D;  2HJD A;  3TJT A;  1OHH G;  2AZ0 A;  4DR6 B;  3E22 B;  2Q5Z A;  4PDM A;  1OCC B;  4G2K A;  4F6R B;  4F6R A;  2D2C B;  3B4S A;  3H01 A;  4OXS A;  5EYP B;  5EYP A;  2GDS A;  2HR3 A;  4LF6 B;  3I55 V;  4WFG A;  3ETQ A;  1YSC A;  1WAZ A;  2GUZ B;  3SYQ A;  3FD9 A;  4PV1 B;  3IAY A;  3JCU Z;  1EN4 A;  3MHS C;  3ZBH A;  3E86 A;  1N4C A;  4BIZ A;  5HFM A;  3SJC C;  2ZDI C;  2AXT Z;  1URF A;  5ITZ B;  2ODM A;  5ITZ A;  3CRM A;  2QA4 V;  4LF9 B;  3AK3 A;  2XAG A;  3BA8 A;  2HLD G;  2OIG A;  2B1G A;  3LSS A;  2P7T C;  3H1L H;  4J9Z B;  2WAM A;  3CCL V;  1HNZ B;  3ABL C;  1RSO B;  1RSO A;  4DV0 O;  4K35 A;  2JS3 A;  3ZX6 A;  2IU0 A;  4JI3 B;  5EBW C;  4LF8 O;  4W4L A;  5IYC O;  3OTO B;  4I55 B;  1NU1 H;  4I55 A;  3TET A;  3FFQ A;  1YIJ V;  4UVC A;  1PNL A;  1J5E B;  3E8G A;  2ZE7 A;  2N05 A;  1SER A;  5H9C A;  4DV3 B;  5H6R A;  4LF5 B;  3QO7 A;  4J9Y B;  3FB7 C;  1K7D A;  2CAZ C;  3M8A A;  4QPK A;  1ZUQ A;  3UM7 A;  2UU9 O;  2JRI A;  1XOU A;  3OE7 G;  4FLU A;  1K8A W;  1P49 A;  4LF4 O;  2DYR C;  1ENV A;  4PI0 A;  2A06 H;  4UUJ C;  4LF7 O;  1KQS U;  2WSS G;  1NQT A;  4GLX A;  4FLV A;  2EIJ C;  1FJG B;  1WPX A;  1NH2 B;  4FIP C;  5EIB C;  3ASN C;  4H37 A;  4LNU B;  4LNU A;  1H2N A;  5IE9 A;  4X65 O;  1E1Q G;  1XEQ A;  1SES A;  1EZJ A;  2CDY A;  3T4D A;  1EN6 A;  3BA9 A;  1T5E A;  4JI8 B;  1V54 B;  2VWJ A;  4I9Q A;  1ZWI C;  3K03 A;  2BE3 A;  3A8T A;  3CXH F;  1AJN A;  2PY5 A;  2KQX A;  4NXN O;  4DK0 A;  4OX9 B;  3ABU A;  3SDL A;  3K57 A;  4LFB O;  5DEC A;  2JEU A;  3CCM V;  3SR2 C;  1S0V A;  1K97 A;  3ASO C;  4DV6 O;  3FX7 A;  4MTX A;  2EIK C;  2IBZ H;  1N8R W;  2Q9L A;  4HBN A;  4MVZ A;  4DUY O;  4CH4 A;  2XAH A;  2A0L A;  1NKD A;  4BIU A;  4JI4 O;  1QR9 A;  4JYA O;  5IY5 B;  2QEX V;  3L72 H;  3UO3 A;  4UCT A;  4U3F H;  1XDC A;  4KUM A;  4U7O A;  4D6T H;  4NB5 A;  2C2A A;  4DR1 B;  5JCO A;  3QO8 A;  4O4J B;  1VEW A;  4O4J A;  3B2E E;  3ZRS A;  1B06 A;  4UB8 Z;  4YJ3 B;  4YJ3 A;  3QVN A;  1ZLZ A;  2QTS A;  2XUM A;  1S5J A;  3L70 H;  4YIP A;  2A79 B;  1WNS A;  1XMQ B;  3ABT A;  1TA8 A;  2B9Z A;  2WPD G;  1I94 B;  2UXN A;  2H8P C;  3ETD A;  4J11 A;  4AI8 A;  1RM1 C;  4K0K B;  3QO5 A;  2ZM6 B;  1CPY A;  4JV5 B;  4UFZ A;  1MG1 A;  1MA1 A;  3ZMT A;  2HFE C;  4GKK O;  4XDJ A;  1KKD A;  2N74 A;  1AIL A;  2ZT9 B;  2WLN A;  4PHZ A;  4MTG A;  1MOF A;  1KP3 A;  4IL6 Z;  1IX9 A;  3E89 A;  2V1D A;  3A0B Z;  4Q20 A;  5IWA B;  1YTF B;  3AK1 A;  1GKF A;  5J9P C;  2ITC C;  5LMU O;  2K1E A;  1VQ9 V;  2FYU H;  4B3R O;  2FKX A;  2EZP A;  5K1X A;  1TUB B;  1TUB A;  4J42 A;  1E1R G;  2JS5 A;  3RYH B;  3G6B A;  3RYH A;  3HPL C;  3C3T A;  2QR4 A;  2K9P A;  1K34 A;  3CCR V;  3ZHQ A;  2M6Y A;  3H1K H;  3L9D A;  1EFR G;  2H3O A;  1LNQ A;  1VQ7 V;  2Q0A A;  2IU3 A;  2ILM A;  4TQD A;  3JCZ A;  4JI5 O;  3GVM A;  1NVP D;  1YCI A;  3SPI A;  3ZED A;  3ZRV A;  2FTK A;  4PDL A;  3O9O A;  4WFB V;  2YIB D;  1AR1 B;  1M90 W;  2QJ1 A;  3JAT B;  3G71 V;  4L87 A;  3ZJZ A;  4DV0 B;  5CA0 B;  5CA0 A;  2QGN A;  1JJ2 U;  3H9V A;  4B7E A;  2E74 B;  2R70 A;  3BAB A;  2OT5 A;  1AI7 A;  2EJR A;  1WN7 A;  1HP8 A;  3CX5 F;  3K5M A;  5J2U B;  3ZHT A;  5J2U A;  1D5N A;  1VQK V;  5KA5 A;  1R3I C;  4W4K A;  2L6L A;  1BGY H;  4GKJ O;  2DE0 X;  3P32 A;  2UU9 B;  4KFM A;  3LNN A;  3K58 A;  2EIL B;  1KEC A;  3VOU A;  1VF7 A;  2NLJ C;  4EKW A;  1GTO A;  2M7W A;  5DM6 V;  3L74 H;  4LR3 A;  2BOC C;  4LF7 B;  3ZCC A;  1VQ8 V;  1Q8I A;  1JOY A;  3SYC A;  2Y0I A;  3DTU B;  4I9W A;  5BMV B;  2ZNJ A;  5BMV A;  5IYD O;  4X65 B;  1P7G A;  5C8Y B;  5C8Y A;  4EB6 B;  4EB6 A;  3T4Z A;  1SQG A;  2VS0 A;  4PI2 A;  4KHP O;  3AG3 C;  3DC5 A;  2CGN A;  1NTM H;  4TUY B;  4TUY A;  4NXN B;  2FML A;  1NTK H;  1THZ A;  3IC9 A;  2GTA A;  1K5Q A;  4WBN A;  4WBN B;  4LFB B;  2QTO A;  3KCX A;  4X64 O;  3O65 A;  1PL4 A;  1HNW O;  3TGU H;  4UCS A;  2OTL V;  4DW1 A;  4DV6 B;  2F66 C;  4B7K A;  4G27 B;  4BR6 A;  2ZIO A;  3N2K B;  3N2K A;  3CHX A;  4BWA A;  3CC2 V;  3J7A U;  1NI8 A;  3E83 A;  4UCV A;  1M4U A;  3JAK B;  3JAK A;  4R50 A;  4JI4 B;  4JYA B;  2Z5U A;  4DO2 A;  2ZDI A;  3P3P A;  3LSU A;  1G6U A;  1B04 A;  2JEX A;  1I7F A;  1W0J G;  3WU2 Z;  3K9S A;  2P06 A;  1N0J A;  3E8F A;  2X6B A;  5FL7 G;  2RQ6 A;  4AHC A;  5LBQ A;  2W0X A;  3WG7 C;  4F4L A;  3HKC B;  3HKC A;  2CE4 A;  1KUQ A;  1GM8 A;  1KMI Z;  2X7R B;  3J81 N;  3TXS A;  2LFS A;  3OMI B;  4WFF A;  5BY1 A;  2HP8 A;  3GWK C;  4TSF G;  1Y67 A;  3ZMU A;  1DLB A;  4UCU A;  1SZT A;  1ZAU A;  4U7N A;  4JI2 O;  3MDS A;  2UUA O;  1Y6X A;  3RYI B;  3RYI A;  2E76 B;  3IGA C;  4BAY A;  5A9G A;  2YEV B;  2WLH A;  2YEV A;  5E79 Z;  1IBL O;  1KKC A;  1DK1 A;  4NKG B;  4GKK B;  3P30 A;  1NT2 B;  1MSD A;  5FPR A;  3PN1 A;  2DYR B;  1K9M W;  2LGQ A;  4MW8 A;  5FLX N;  2R9A A;  5C93 A;  1DGS A;  4JPR A;  3G4S V;  5JJJ B;  2R9I A;  3C90 A;  3VQV A;  5BXZ A;  2EIJ B;  2P90 A;  5LMU B;  1YF2 A;  4MVO A;  3D36 C;  1WB8 A;  2IJJ A;  2VWK A;  1M56 C;  4B3R B;  5KUK A;  5L3B A;  1AJP A;  4OGQ B;  2WWW A;  3DSQ A;  1IUR A;  2W6I G;  2ZQM A;  5B1B C;  5L3G A;  3R66 A;  3W7W A;  3E2E A;  1F4N A;  4WF9 V;  1XNR O;  3OMA B;  1FKA O;  4J80 A;  4O4L B;  4O4L A;  2W6J G;  2WA3 A;  2XOK G;  2PYJ A;  1L0N H;  3LDE A;  3GB7 C;  5CBG A;  5LYJ B;  5LYJ A;  1XHZ A;  3ASO B;  3K5O A;  3CP1 A;  1G4Y B;  1K3E A;  2P22 C;  5KLV H;  1M5I A;  1NS1 A;  3CMA V;  2OCH A;  4X8A A;  4O2A B;  4O2A A;  3MAQ A;  4EEQ A;  2ZCE A;  5D5P A;  2LW7 A;  1K4C C;  2QKC A;  4BW9 A;  3FB6 C;  3H1J H;  3SPH A;  4PA3 A;  4Z1M G;  3QF7 A;  1KP2 A;  1S72 V;  4LBE C;  1WA8 B;  1WA8 A;  4DUZ O;  2PYL A;  3ZRX A;  3K3W A;  3LUT B;  4DR5 O;  3EHB B;  2Q7H A;  2JGD B;  2JGD A;  1NBM G;  3N2G B;  3N2G A;  1KC8 W;  5J2T B;  5J2T A;  4I7Z B;  1M93 A;  3CYO A;  4UV8 A;  4I5S A;  4DV4 O;  3K5N A;  1NJI W;  4GKJ B;  1BT8 A;  3ZMV A;  4PDV A;  1SKV A;  1PPJ H;  3HKD B;  2W0F C;  3HKD A;  4CC6 A;  3DXR B;  3DXR A;  1RM1 B;  3FYI B;  2YSU B;  2Y4U A;  1B6Q A;  4FZ0 A;  1ZL8 B;  2LGW A;  1ZL8 A;  1OCO C;  4PA6 A;  4JI7 O;  2ZR3 A;  2AZ2 A;  1R6T A;  3ZMZ A;  1H2G A;  1H8E G;  2LO1 A;  3OUS A;  3UO2 A;  5L3E A;  1XL6 A;  4H13 B;  3VQY A;  4YHH B;  1WJZ A;  2O57 A;  4IYH A;  3EXA A;  4B3S O;  3D3Q A;  4TV9 B;  4TV9 A;  4UV9 A;  2Q6A A;  4BW5 A;  3E8B A;  4KHP B;  3SPC A;  1VP7 A;  4DR3 O;  4IHJ B;  4IHJ A;  3KG2 A;  4DR7 O;  4CBC A;  4ASU G;  4X64 B;  3CPW U;  2RN9 A;  3ZIA G;  1HNW B;  5JH7 B;  5JH7 A;  2Q0O C;  1KD1 W;  2Q7G A;  2EBO A;  1I5X A;  3Q4H B;  3Q4H A;  4FLZ A;  1SET A;  1GK9 A;  3CJH B;  1KYO F;  3CJH A;  5LA6 B;  5LA6 A;  4RWU A;  3SJQ C;  2WLM A;  4EFB A;  2PGG A;  3G67 A;  3G80 A;  2QE7 G;  2IH1 C;  4FLX A;  2Y48 A;  4PA9 A;  1NVP B;  4LP8 A;  1FXH A;  3U10 A;  4Q6G A;  4GYC B;  2HJF C;  3RFR A;  1GN4 A;  3UKM A;  5KA6 A;  1D5A A;  5GW7 A;  1S77 D;  1SF9 A;  4ICG A;  2EJ7 A;  4JYB A;  2KG7 B;  3CC4 V;  2KG7 A;  4ZBM A;  3B8N A;  4FVM A;  3SPJ A;  3L75 H;  1N0N A;  1Z2G A;  4UB6 Z; 
#chains in the Genus database with same CATH homology
 1EFR G;  4HZ3 A;  1LNQ A;  3CXC U;  1QLE B;  1VQ7 V;  1JX9 A;  2IU3 A;  2Q68 A;  4GX2 A;  1M57 B;  3NXS A;  1QCE A;  4TT3 G;  1VQP V;  3JCZ A;  4P30 A;  3SYA A;  3OR7 C;  3X2Q C;  1VQ6 V;  1R73 A;  2QKS A;  4RAI A;  3K9A A;  1NVP D;  4WCE V;  3IFX A;  3LNM B;  3SPI A;  3JD2 A;  2ZR2 A;  3ZRV A;  2FTK A;  3ABK C;  2DW4 A;  2P67 A;  3M99 B;  1G8M A;  4PDL A;  2OTJ V;  4WFB V;  1AR1 B;  1M90 W;  2B1I A;  5EBM C;  3G71 V;  3ABL B;  4L87 A;  4XBF A;  3K08 A;  3ZJZ A;  2OCC C;  3E35 A;  3ETE A;  4LC1 A;  4RO2 A;  1JJ2 U;  1K73 W;  3JD3 A;  2XND G;  1J95 A;  3W7T A;  5LGU A;  3A0R A;  3OAA G;  2ITD C;  1NR7 A;  2OT5 A;  2B5U A;  3K0G A;  1AI7 A;  1QLE C;  2EZO A;  2EJR A;  3WFV A;  1FXK B;  1FXK A;  1K4D C;  4MTF A;  1F4M A;  1M57 C;  1R6K A;  3IC7 A;  1VQK V;  2Z3Y A;  1JCH A;  5KA5 A;  4QNH B;  4GCZ A;  4XDK A;  1R3I C;  2JJ1 G;  3P32 A;  1Q7Y W;  3W7X A;  3AG3 B;  4KFM A;  2EIL B;  1FXV A;  1KEC A;  1DF5 A;  1I5Y A;  4N23 A;  3VOU A;  4UVB A;  4DXW A;  2NLJ C;  4EKW A;  1GTO A;  2M7W A;  2X6C A;  3OUF A;  5DM6 V;  3AG1 B;  3W7S A;  1H38 A;  4RQE A;  3K06 A;  4QE7 A;  3STL C;  3ZMS A;  2KB1 A;  2D3O W;  2BOC C;  4KP4 A;  1CEZ A;  2DYS B;  3ZCC A;  1VQ8 V;  1K92 A;  3RW0 A;  3QNE A;  1JOY A;  4QIW F;  1V55 B;  3STZ C;  3SYC A;  3DTU B;  3ASN B;  2AHZ A;  4I9W A;  1GM9 A;  3CCJ V;  1VQ4 V;  3CCQ V;  3F7V C;  5IYD O;  3B8M A;  1FXK C;  1NR1 A;  3VBB A;  4MVM A;  5LHI A;  2H94 A;  3T4Z A;  3FB8 C;  2A9H A;  1COW G;  5B3S B;  1S5H C;  2EIN C;  1WLE A;  4H33 A;  1Q81 W;  3MHH C;  4RQF A;  3RBZ A;  3HB3 B;  1S76 D;  3SYO A;  2IJI A;  4MT8 A;  4FJC C;  3AG3 C;  1M1K W;  1QR8 A;  2EIL C;  2IJK A;  1P4R A;  1THZ A;  1FS0 G;  1K5Q A;  4PA7 A;  2AHY A;  4MW3 A;  3F7Y C;  2QTO A;  2Y69 B;  3AG1 C;  3W7U A;  2QM8 A;  3OEH G;  1Y66 A;  3TK1 A;  5HFL A;  4MTO A;  4UVA A;  2OTL V;  1QLN A;  2HVJ C;  3AG4 B;  2EIK B;  1AJQ A;  5LGN A;  3WG7 B;  1ARO P;  4G27 B;  5EC1 C;  4LCU C;  3CC2 V;  1V55 C;  3K04 A;  4HAM A;  4MS2 A;  1R3L C;  3E83 A;  3PJS K;  3T1C A;  2HVK C;  3EFF K;  5EBL C;  3MD0 A;  4RUF A;  2R9R B;  4R50 A;  2F43 G;  2Z5U A;  4DO2 A;  3JD0 A;  1OZ0 A;  5E1A C;  5B3S C;  3K79 A;  2ZDI A;  1QVF U;  4JYC A;  2XAQ A;  5LHG A;  4MSW C;  4PEL A;  1S3J A;  1R3K C;  2JEX A;  3T2M A;  3E8H A;  2GHY A;  3BY6 A;  2DQ3 A;  3OM3 B;  4TWK A;  1GMG A;  1W0J G;  4JAU A;  3OGC C;  1OHH G;  4MVR A;  1JVM A;  3E8F A;  5B1O A;  2X6B A;  1BMF G;  4PDM A;  5FL7 G;  3CME V;  1OCC B;  1EBO A;  1VQ5 V;  4G2K A;  2GSM B;  1PL0 A;  1R3J C;  2Y69 C;  2IH3 C;  1P7B A;  3H01 A;  4OXS A;  2P6J A;  2HR3 A;  3AG4 C;  4MVQ A;  3SYP A;  4WFE A;  5LBQ A;  5LHH A;  1ROP A;  3B77 A;  4UXN A;  2XAF A;  4FMT A;  3WG7 C;  5CN0 A;  4F4L A;  3F5W C;  1GM8 A;  3I55 V;  4WFG A;  4GX0 A;  2MK3 A;  2X7R B;  2LFS A;  3OMI B;  5L3C A;  4WFF A;  1YSC A;  3D36 A;  3SYQ A;  3ZN1 A;  1M56 B;  2ATK C;  4TSF G;  3ZMU A;  1QVG U;  3MHS C;  1DLB A;  4E2L A;  1NH2 D;  3E86 A;  1BL8 A;  5B1B B;  1SZT A;  2JJ2 G;  4BIZ A;  2ZDI C;  4U7N A;  5HFM A;  2QA4 V;  3CCU V;  5IYB O;  2WLJ A;  2XAG A;  3IGA C;  4BAY A;  2YEV B;  2WLH A;  2YEV A;  2ZXW B;  1VQM V;  2HLD G;  4JTA B;  2B1G A;  4WFH A;  1JQ0 A;  2DWD C;  4XDL A;  3LSS A;  5L3D A;  2P7T C;  3I56 V;  4J9Z B;  3P30 A;  4QPJ A;  1GO3 F;  2WAM A;  3CCL V;  2LP7 A;  5B1N A;  1OCC C;  3ABL C;  2DYR B;  3OMN B;  5BZB A;  5KUM A;  4JAS A;  1K9M W;  1MSW D;  4MW8 A;  4PDR A;  5C93 A;  1RPR A;  4JPR A;  2IU0 A;  3G4S V;  5EBW C;  5IYC O;  2R9I A;  4X88 A;  3TET A;  1YIJ V;  2EIJ B;  2IW5 A;  1R6N A;  2P90 A;  1PNL A;  4UVC A;  3G6E V;  4JF3 A;  4MVO A;  3E8G A;  2EIM B;  1OCR B;  2IJJ A;  1M56 C;  1SER A;  5H9C A;  5CBF A;  5KUK A;  5H6R A;  5L3B A;  1AJP A;  3JD1 A;  2WWW A;  4JGS A;  3QO7 A;  2W6I G;  4J9Y B;  2ZQM A;  3ETG A;  3FB7 C;  5B1B C;  1K7D A;  5L3G A;  1Y4M A;  3W7W A;  4P9P A;  1Q86 W;  1F23 A;  1PNM A;  3E2E A;  1F4N A;  2V7Q G;  4WF9 V;  4QPK A;  3UM7 A;  3OMA B;  4N21 A;  1S72 V;  5CA3 A;  1YI2 V;  4CZZ A;  3OE7 G;  5CMU A;  2W6J G;  2XOK G;  1DF4 A;  1K8A W;  3CCS V;  2DYR C;  1ENV A;  3LDE A;  3DGE A;  3ML0 A;  2Q67 A;  3GB7 C;  5CBG A;  1AI6 A;  2WLL B;  2WLL A;  4QE9 A;  2JDI G;  4P2Z A;  2HKO A;  2WLI B;  2WLI A;  3ASO B;  4UUJ C;  1KQS U;  3CP1 A;  1G4Y B;  1K3E A;  2WSS G;  2DYS C;  1NQT A;  2DWE C;  1MAB G;  5B1A B;  1VQO V;  2EIJ C;  3CMA V;  1WPX A;  4X8A A;  4GT1 A;  4FIP C;  1NH2 B;  1F51 A;  3ASN C;  4H37 A;  4R6Z A;  2EIM C;  1OCR C;  1ORQ C;  1K4C C;  1E1Q G;  1SES A;  3FB6 C;  3R65 A;  1YJW V;  3SPH A;  1DTO A;  2X6A A;  3D3I A;  3JYC A;  1EZJ A;  4PA3 A;  4Z1M G;  3T4D A;  2Q69 A;  3AEI A;  4RUE A;  4HYO A;  1H8H G;  3ABM B;  1KP2 A;  4GX1 A;  1V54 B;  2WLK A;  1OCO B;  1ZWI C;  3FYE B;  3K03 A;  4JTC B;  4LBE C;  1L1F A;  3AG2 B;  3ZRX A;  1AJN A;  3K3W A;  5IDJ A;  1OCZ B;  3GWO A;  3LUT B;  3EHB B;  1E79 G;  3ABU A;  3CD6 V;  3BEH A;  1PD3 A;  1NBM G;  1KC8 W;  2XAJ A;  2JEU A;  1BHB A;  4FPP A;  3CCM V;  1RPO A;  3CYO A;  3LDC A;  1K97 A;  4UV8 A;  1S0V A;  4I5S A;  3ASO C;  1NJI W;  4MTX A;  2EIK C;  1N8R W;  2JK5 C;  5B1A C;  5EK0 A;  3ZMV A;  4PDV A;  4MVZ A;  3ZRW B;  3ZRW A;  2W0F C;  3FB5 C;  4P9O A;  1QBZ A;  3FKS G;  5L3F A;  4WFA V;  2XAH A;  4R8C A;  1VQN V;  2JIZ G;  2A0L A;  1SRY A;  1NKD A;  3CCE V;  2ZD9 A;  2HG5 C;  2UXX A;  1YTF D;  2CK3 G;  4BIU A;  1QR9 A;  5IY5 B;  1RM1 B;  2QEX V;  4MVS A;  3FYI B;  1AI4 A;  5H6Q A;  2YSU B;  2BOB C;  4GX5 A;  3OW2 U;  1B6Q A;  4JAV A;  2LFR A;  3ABM C;  3JD4 A;  1V54 C;  2QM7 A;  1OCO C;  4PA6 A;  2PI4 A;  2ZR3 A;  1JPX A;  4KUM A;  3AG2 C;  1FFT B;  5LGT A;  3ZMZ A;  1H2G A;  1XL4 A;  4U7O A;  1OCZ C;  1H8E G;  2DQ0 A;  3OUS A;  1W0K G;  5L3E A;  1XL6 A;  2C2A A;  3OR6 C;  3QO8 A;  1K5S A;  3ZRS A;  4JTD B;  1IXM A;  1VQL V;  2EIN B;  2PI5 A;  2NNU A;  2Q6A A;  4UV9 A;  2A79 B;  4YXW G;  4G28 B;  4BW5 A;  3E8B A;  5DN6 G;  1YIT V;  4MVU A;  3SPC A;  1W2B U;  3ZN0 A;  3KG2 A;  3ABT A;  2WPD G;  3RVZ A;  1Q82 W;  2UXN A;  2H8P C;  3ETD A;  3SPG A;  4CBC A;  3LSQ A;  5IY5 C;  1RM1 C;  4ASU G;  3QO5 A;  3CPW U;  1CPY A;  3ZIA G;  1MG1 A;  4ZKI A;  1KD1 W;  2EBO A;  3ZMT A;  1I5X A;  1TUE B;  2HFE C;  2ZXW C;  1SET A;  1GK9 A;  1K33 A;  2XAS A;  3K0D A;  4XDJ A;  1KKD A;  3SJQ C;  2WLM A;  1CP9 A;  4QJF B;  2QE7 G;  4R7C A;  2WLN A;  1PNK A;  4X89 A;  1HWY A;  2IH1 C;  4MTG A;  1MOF A;  1KP3 A;  2Y48 A;  3TCU A;  3CCV V;  4PA9 A;  1NVP B;  3E89 A;  3OFN G;  4LP8 A;  1FXH A;  2V1D A;  4PA4 A;  3X2Q B;  1BHA A;  2HJF C;  4FK5 C;  4Q20 A;  1UJW B;  1AI5 A;  3UKM A;  1YTF B;  3RVY A;  1GKF A;  5CBH A;  5J9P C;  5KA6 A;  2ITC C;  2X0L A;  2K1E A;  3ABK B;  1VQ9 V;  5GW7 A;  1S77 D;  1PKX A;  2EZP A;  4JYB A;  1YHQ V;  1GM7 A;  3OEE G;  1E1R G;  2OCC B;  4ZBM A;  3CC4 V;  3CC7 V;  3HPL C;  2IJH A;  3B8N A;  1M9N A;  3SPJ A;  1K34 A;  3CCR V;  3LDD A;  5EC2 C;  1YJ9 V;  1YJN V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...