2IU0A

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH
publication title Structure-Based Design, Synthesis, Evaluation, and Crystal Structures of Transition State Analogue Inhibitors of Inosine Monophosphate Cyclohydrolase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
total genus 213
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2006-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2iu0A04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2iu0A01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu0A02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu0A03
1C30A 2XW6A 1OZ0A 1VMDA 1A9XA 1B93A 4A1OA 1PKXA 2IU3A 1ZCZA 1G8MA 2B1GA 3ZZMA 1WO8A 2X8WA 5H3LA 1P4RA 1PL0A 1BXRA 2IU0A 1M9NA 1C3OA 1JDBB 2B1IA 1S89A 1CS0A 4EHIA 1T36A 1M6VA 1THZA 1IK4A 1S8AA 2YVQA 1CE8A 1KEEA 1EGHA
chains in the Genus database with same CATH superfamily
1FDSA 1I36A 2I71A 1N1MA 1SXQA 3HDQA 4IKEA 4NYMQ 1E9EA 1M90W 5K6AC 1KWGA 4RY2A 3W7TA 5CB0A 3BXXA 1NFFA 1JR9A 2C57A 4I6EA 3ODPA 5HCNA 3ZEDA 1D6MA 1WMBA 2BGJA 4LF9O 3FYUA 4F4JA 2ODMA 4F1JA 4DQUA 1JKJA 3ANNA 3K9HA 4UCRA 3V34A 4AECA 4HDMA 1LX7A 4HL6A 5LOVF 1NV8A 3DOJA 5GIPE 2W9XA 3BH1A 2O8DB 5LN1A 1Z22A 1GZ3A 4IVRA 4J07A 2Q3BA 1QMGA 1A8SA 1XOUA 4YIHA 3DLIA 3G88A 4J9YB 2JFYA 3ZMTA 1JIKA 1WZNA 3K1YA 4AZ0A 3SJAA 3VO9A 4BNJA 3ET4A 3GWOA 4JB0A 1FP1D 4QHTA 2JIDA 3IKMB 1YITV 2EKDA 3PF9A 1A7KA 2KI5A 2HMTA 1GA4A 1TQHA 4OQXA 2HCJB 4ZPXA 3RYFB 3DR5A 1Q1GA 4GKKO 1N1GA 4DMKA 5DNYB 3S6JA 3J81A 2C2MA 1GM5A 1OCCB 1N2CE 3Q72A 3EK2A 4R1MA 1ABFA 4CNBA 2DW4A 5TMEA 4E6EA 1EWRA 3ZPGA 1XNRO 1J70A 4XX0A 3DC5A 3MOSA 5LWQA 1E6WA 4IX1A 3GA5A 5CMLA 5KC9A 3R5XA 2DB3A 1ZLXA 4JA2A 2C9DA 1MABG 3AEUA 1R9JA 4ISCA 4XLLA 2JJ2A 4P4UA 1KDVA 3FYSA 4PIPA 4LOJA 4TKMA 4N0MA 1FBNA 1ZN7A 3FFQA 3BD8A 1NJ1A 4B3MB 4B3FX 2O7VA 2IKQA 2GKGA 4OMUA 5G2OA 5B53A 4C3UA 2VK2A 1TEVA 2DT5A 2WHPB 3ZZ1A 3OIWA 1SVUA 4GUAA 2Q3JA 5KA6A 1YBAA 4RKRA 2B78A 5L3QA 2H29A 3WNQA 4MI9A 3PEFA 1QRDA 4CR8A 1VHLA 1YJ8A 2M1ZA 5BYAA 3C24A 3BMCB 2HLHA 1SUCA 4NXMO 4M38A 1CUDA 2WILA 5LMNO 2N75A 2N3ZA 4EPTA 4LAFA 3EVEA 3W5CA 1DFHA 4NKRA 1A4UA 4OX9Y 1L5OA 1TMKA 5E6RB 5HJ5A 4H4CA 1BE6A 3ZOZA 2F55A 5A05A 3INGA 5DB4A 3QXGA 4GX2A 3GUUA 3O9OA 3HL0A 1F7YA 3GMDA 3A1CA 1JQ3A 4ZPJA 3N2NA 1WXQA 1JNYA 2QRKA 2L82A 5LUBA 2C54A 1CWUA 4ZOLA 3IVGA 2PX8A 5LM3A 4PO8A 5IFLA 3AJEA 4Q4HB 3IMKA 1EJ6A 4HAUA 1K33A 2QYTA 3T1YO 3EVFA 2Z30A 3QKUA 5LDHA 5K3FB 4WFIA 2NO9A 3C70A 4EA6A 1QHFA 1PBNA 5BVHA 1KYYA 4PHGA 2BFFA 4RIEA 4H59A 1P9RA 2B6NA 3CH7A 2JBAA 5F51A 2VWGA 2X1HA 2D8MA 5EJ8A 5E3HA 2WKPA 2VAMA 3DL0A 4EPVA 1X2EA 4BMXA 3A6ZA 1RQ7A 3IP1A 1KETA 3RREA 3APQA 4RF3A 1F8FA 2RHDA 4ZQGA 4ZRDA 3RVKA 5HFLA 1OVGA 2GZMA 1GPLA 2QORA 3WK9A 1TMYA 1TLFA 1V16B 2VYCA 2ORED 4MRVA 2IP1A 1PNKA 1TYDE 4DLZA 4PNEA 3SBGA 1VZ3A 1VPDA 4KQ6A 1QG4A 1W4CA 1UJCA 2O8CB 1VBKA 1NW4A 1KIFA 3QLUA 4FHGA 4UBJA 4F56A 1T5EA 3E15A 3STXA 5DX1A 2AE1A 1SNYA 2HIAA 5JZ9A 4Z7QB 3CE9A 1Y3BE 3CRW1 4LG1A 1OXUA 3OX1A 4KPFC 5CB4F 3P9CA 1FF9A 1SQPH 1A95A 1IZZA 2CBGA 2FFQA 2JCVA 2X9LA 4J76A 5LBUA 3R66A 2J1LA 2I6XA 1NQOA 2ZATA 3LWBA 4TTIA 2ZTVA 4W4LA 1V3TA 3THXA 1DBSA 3LBHA 4QFBA 1ECFA 4U2EA 2V97A 4L5IA 4UDOA 5A2QN 1DAFA 3SQOA 2WWFA 1D2MA 4FCVA 2XPCA 2ADPA 2CHFA 1ZMXA 2LZ0A 4EGFA 4HRYA 1M5TA 4M0UA 2ZYTX 2A3NA 3OQPA 3TQCA 1G1AA 4KQ2A 1W88B 3L7OA 4EIWA 1MAHA 5DCUA 3MGGA 5AYVA 3TJMA 4CM9D 1FFAA 5I8PA 1PDWA 3AR5A 1RWOA 3HACA 2FEWB 4J8PA 3AU9A 3B6KA 1ZONA 3U7EB 2CZCA 4NEGA 3WMRA 3VXKA 2R1VB 4I1UA 1G41A 1M6EX 4BTLA 4TV8F 4PLVA 4P92A 2OYRA 2R3SA 1HDJA 3S28A 4XGQA 4ITRC 2VDMB 4KTTE 2EFYA 5FFMA 3RRZA 4YPVA 4R69A 1GRJA 4ZTZB 2WJ6A 4HNAB 1PI3A 3UEOA 3DBHB 4LXIA 2XWBF 3A4NA 5IRCD 2H2AA 1KR5A 2WJ3A 4LXUA 5FPQA 3FRJA 4X85A 1E1LA 3P3NA 3U3MA 2PTHA 3SX0A 2BSKB 3PYXA 3E9QA 2Y92A 3TI7A 3EEBA 5MN4A 2J7PA 1TZMA 2X40A 3T3IA 4CF7A 7MDHA 1GUZA 1TMGE 1Z5UA 3K03A 3ZGXA 2JIQA 2QDKA 3K0GA 5ALTA 4JNKA 1ZITA 1R16A 4H3SA 2NOAA 2ZJ3A 3WC4A 4X84A 3EVZA 3PQ8A 4J11A 1OBVA 1JHZA 3ZX5A 2J85A 2BONA 4KXVA 2ZJ4A 2VYNA 3W0LB 4G0VA 4TRRA 4G5XA 2H00A 2EEPA 3GYBA 4F1WA 7REQB 5CXXA 4MTXA 2VNSA 2UXCO 2VPTA 1MLDA 2XDAA 5BNFA 4DWVA 5AXDA 2O59A 3RJ9A 4L4UA 4R40A 4L6AA 4YMHA 4GMKA 1YT5A 3G2KA 1KL7A 1AZLA 4R9SA 3CX6A 4LFBB 2ZSHA 5L4LA 3IC7A 4M1MA 4ZEXA 1EK6A 1LWOA 3ROQA 2ZI9A 4MR8A 4G2KA 4F86A 2H48A 4U0KA 5DO9A 4JJEA 2GM9A 4O25A 5LU8A 2HVKC 2JFVA 1XZNA 2IBSA 3RWOA 2ZCVA 1UBKS 4HAIA 2MYNA 3FTPA 4PHCA 1AH2A 1P29A 4F38A 3HDJA 2F59A 1JDSA 5HBRA 1CY6A 4QQ8A 2FZKA 3V1TC 4G1BA 1KO7A 4EVSA 4JI1B 4ML3A 1ZCJA 2RHRA 1B7GO 5J1SB 4KFSA 1TEZA 4U7DA 4MRMA 3YASA 1Z2AA 3SFVA 3SN6A 4UUJC 1JTKA 2L0XA 3OZEA 1WTAA 2FOLA 2JIMA 1G6KA 2IIQA 5JCOA 4NZYA 3JRNA 3L5OA 3G5LA 2AZXA 2QKCA 4I9QA 3QWFA 5AVVA 5K0LA 1URFA 3LHSA 4CQNA 4MGKR 4FM9A 4DR3O 2VR1A 3UB4A 5FIUA 4CLHA 3EPRA 1CS0B 2AG6A 4FLFA 4LC1A 4EG2A 4B7AA 1X7WA 2BI4A 1NMYA 4WJKB 1JFFB 1G7RA 3M5PA 4NBRA 3THYA 5SYMA 3A31A 3AEKA 3GBSA 1W94A 1HXHA 2GILA 1OAOC 4JAVC 4AJHA 4WNIA 3ZKWA 1U7PA 2HAEA 1P5HA 1QIGA 2C1EA 4L6CA 4LCEA 5CVCA 2OAGA 5B1EA 1I94O 3ZWAA 2CV0A 4H27A 3LO8A 4BMDA 3EZLA 5TMBA 4K0KO 5JO0A 4JJAA 4RKEA 2YN4A 5KI6A 2J31A 3PFGA 5FNVA 4BS9A 4PCUA 2EX4A 5EWMB 5CXSA 3DYIA 3HUFA 4KVGA 1U65A 3DDHA 2VLIA 3FKSG 3QLJA 1DHTA 4YREA 3PR2B 4R1UA 1CTTA 3SYMA 1RVV1 3ZEFB 5TPWA 1GN8A 3ZDZB 2W0XA 2JIZG 1U9YA 3C0KA 3GLFA 2GDZA 4BEJA 1OQAA 3IRUA 3TNDA 5LQCA 4RTNA 5CT8A 1T9HA 2P78A 2PGXA 1OFVA 4XSGA 3G1WA 3DGFC 4AJ9A 3VPXA 4UMEA 3BVPA 4EMUA 5CURA 3BWDD 3GK3A 1IULA 1U1GA 3ND8A 2HG5C 4I5FA 1Z7GA 4O2AB 4EJ6A 1Z33A 2ZVDA 5HIKA 4UHBA 2EFJA 1I24A 3FPKA 9ATCA 3WLIA 1QIIA 3A1UA 1Z18A 4QUBA 5H9WA 1JG2A 4OI1A 4ICGA 3GA0A 1H6AA 1ML3A 2RSLA 2V0GA 3KR2A 1J1UA 1BN6A 3FB4A 4TT3D 1HRKA 3GI1A 3ZNQA 1YR8A 3PT5A 1WULS 1RXIA 2XZOA 1JHPA 4EM6A 3FB1A 3QKRA 5BUSA 2C9YA 1PUIA 4M1WA 1NQAO 4JT2A 2AFIB 3IODA 2XHZA 1JLRA 1GNSA 5E1DA 5A4FS 1S76D 1FNCA 1Q3TA 3FCOA 4WFKA 3E7PA 2CKDA 1IPEA 3L0SA 3GFSA 1LS1A 2Z3GA 2B1JA 1DIGA 4DIUA 3TLGB 3CG0A 3IDQA 3OKFA 5A5GA 5IY5B 3GJ7A 3DKPA 1FKAO 5I7RA 1ZJ6A 5AW7A 2GCOB 2NN4A 4MS2A 1FTGA 1DC4A 5H0IA 2ZZKA 5GM1A 1F17A 1YDWA 2FPOA 3CZAA 3FHTA 4WN9A 4Z2YA 4WCFA 4X3CA 2ODEA 1ST2A 3FLEA 1VQLV 1MQ9A 1XXHE 4KMRA 2VOJA 4E0QA 2WMOB 5BSEA 4R0NA 4ZOCA 5DISB 2G83A 1QVGU 1B6SA 1AQ6A 4P4GA 2ACVA 3ASOC 3F8WA 3K9AA 4RHEA 3DZBA 3MAAC 4HWGA 3ZQUA 4IJVA 3CP1A 3BA6A 1BCRA 3A9VA 4BRUA 3Q4HB 2PW9A 1ZA1A 1UBCA 3WGKA 2UXXA 3IHTA 2ZU6A 4ZRMA 2G08A 2IYRA 4BFVA 1DTOA 4Q1CA 1L5HB 1MH9A 1JBQA 2PUAA 5KVSA 5I7VA 4RSRA 4JI4O 2JLZA 3OD1A 3IKVA 4GUDA 1I2AA 2VDOB 2VWQA 4QUDA 1U96A 1E2DA 1N5LA 3DDUA 5SY4A 3SYCA 1L0NH 4JI5B 2Y1DA 1NI5A 2QRJA 3K79A 1GSIA 2Y6UA 1NVVR 3R75A 3H6GA 1DADA 3ICQB 4Y2HA 1HLFA 4UE2A 4TKVB 4N0QA 4MICA 1ST3A 3ZCPA 1SD5A 3MWYW 5DHQA 1V54B 4W7IA 5HKOA 2RI6A 4LF7O 3Q88A 3CD6V 4EHHA 3RNOA 2NG1A 5TNXA 2HMSA 3CCMV 2BM8A 2X4LA 3WJAA 3UPTA 1JEJA 4TKZA 1P7CA 2WJWA 3LECA 3MFQA 5TEWA 2Y2VA 2VLBA 3TSWA 1QHYA 4AJLA 4DLWA 4X7RA 1J9GA 4XD2A 1C81A 3ZV5A 4GOOD 1ROPA 1SU6A 2YZ7A 3TLKA 3C97A 1A98A 1FQOA 4KX5A 1Y8ZA 1DRUA 4OFWA 1MO4A 5LZ4A 4RF2A 3LC0A 1D2DA 4M8LA 4MB0A 1Y6FA 4YLGA 3AUJB 1ZMBA 1T4MA 3S2GA 4N8SA 1NUHA 1KU6A 3T4UA 3MCAA 3SF8B 4L16A 1R9NA 3JAKA 5SV2A 4B2YA 1K6IA 4JLJA 5F23A 2WMDA 4GL4A 1KAOA 1OLSA 1O95A 1Z4IA 2X3YA 3WWEA 1PSWA 5DGIA 2HH9A 1R9GA 5EP4A 3TIVA 5CNMA 2D4AA 5A4DA 3USES 1CUGA 3H2BA 4BQIA 1IPHA 5JHGB 3GA7A 1Z5OA 4IOKA 1ODCA 2X0RA 3QU2A 4D4LA 4D57A 4ARUA 2X5XA 4F71A 5L3SB 4C14A 4RTKA 4D25A 1X1AA 3AR2A 5AOVA 3CHYA 4JHXA 3ZI4A 4L4RA 1NMZA 4QAQA 2O05A 3K9FC 4O8XB 1G63A 2C94A 1UR5A 3DD5A 1FMFA 4GE0A 3TPCA 1NONA 2FK8A 4UM9B 4OCNA 3R41A 1QP0A 1HR0B 1EESA 2XKBA 1GPH1 2ZRLA 3VSAA 3EVNA 1ZI6A 4LYDA 5J1TB 3EX7C 3BB1A 4S1OA 4WCEV 3D4PA 4PC2A 2WD7B 3PPYA 221PA 1LDEA 1RW4A 3T7EA 1HDYA 2Y1GA 2H4HA 4ZHQB 2WVHA 1UMCA 4XQ0A 2IOYA 1KDOA 1R00A 2I7VA 3GJ0A 4PCVA 4LJSA 1KYOF 5AK6A 3L9DA 4N5DA 1GNVA 3UATA 2O8FA 1EFPB 5KJFA 3VU0A 2XAJA 4D41A 3KL2A 2C9OA 4HB0A 4QT0A 4JASB 2UXBO 5ANRB 3T34A 1FFYA 1CEEA 4QASA 4RO2A 2QLJA 1FRZA 4U7PB 1S9HA 4OQZA 3AP2A 2A8NA 3M6FA 2I76A 1M2HA 3E82A 3ADOA 3AQ4A 2EV9A 3H87A 5DLYA 1V55B 4NZNA 1T2EA 3E9RA 1T91A 2A7QA 4ZT7A 1SAYA 4IFTA 4UTRA 1E32A 3D5QA 2YN0A 4NENB 5DEOA 2YNMA 2GO7A 4FCCA 1JQDA 1PR6A 3L0BA 1JFTA 5CK5A 4Q4DA 4W9NA 1AJQA 3H9VA 4YS6A 3M49A 2XUKA 3A05A 1E62A 4CDMA 1GG8A 5BV2P 2I87A 2F62A 1WXFA 5BXYA 2DPLA 4GXTA 4NNPA 3HRKA 4AZ3B 1MB9A 3T3EA 2GRAA 3KYDB 4N3BA 4LVNA 5EIXA 5FPKA 4A26A 2B4RO 3OJEA 3DBLB 3AUAA 3WS7A 1YHNA 1HTBA 4MSQA 1CQWA 2XRYA 4C0JA 3NKFA 2HDHA 4QGAA 4U8GA 5KTOA 2WTXA 3GLIA 2IIPA 4BIIA 2V7VA 1IN4A 3LKVA 1M3SA 2PY6A 3VBCA 1GAQA 1GKYA 2FE1A 2J6BA 4U7OA 3BCCH 4ZGBA 1CXZB 3ROZA 1TA9A 1ORDA 4DDHA 1PR2A 3USCS 5JS6A 2B8TA 4CETA 1RI2A 3G80A 1OILA 3W7VA 4FGUA 4WCVA 3G4SV 1UM9B 3TUIC 4QM7A 3ADCA 1B8OA 3NEPX 2X0JA 1LPOA 4RM3A 1Q74A 1WCWA 1QTQA 3OX2A 3Q9SA 1ZPDA 3NRJA 3ES9A 3B1FA 2M1XA 1X7ZB 2WF6A 3OE7D 1L4LA 1JR4A 3T3DA 1ZM4A 4KWHA 3SZGA 5LP6A 1KVRA 4EG1A 4Z9BA 1JEEA 4GZRB 3DMRA 1VE9A 1X15A 2L69A 1PP4A 2BDEA 3UFXB 5CA1F 1J2RA 1YJCA 1W76A 5I47A 3C45A 3PK0A 4O3FA 1S2DA 5SYNA 2EG5A 1JLHA 1XDZA 1FFCA 3WZ2A 3TCNA 3MLBA 3OPVA 2BFDB 4EG4A 4C0KA 1WB4A 5KDDA 3DCJA 1FMLA 2AZ4A 3AR9A 1JDNA 2Q0QA 4F3YA 1MO2A 3MA0A 4XOIA 3OVMA 2PEYA 5DBEX 4JH0A 4ZO4A 5FWYB 3M1IA 1UMDA 4RULA 4PG5A 1TB4A 1Q11A 1P4SA 2IS2A 3CWQA 4DV0B 1RSOB 3B89A 4ALLA 2N1MA 1J0AA 3PCTA 3I0MA 4NV0A 3M4YA 3A11A 1GN4A 3AONB 1CF9A 3P2JA 3ILXA 4RCZA 3HNRA 2FZLA 3GJYA 4GLBA 2AHRA 3LPNA 2N47A 4JVMA 2ZPAA 3DS8A 4ND4A 5EQFA 3GZTB 2GD0A 5HS4A 4UXHA 5I51A 1MQ0A 1OFIA 5BNWA 3WOHA 3ZGYA 4LRQA 3B2EA 1E92A 2PWPA 1Z82A 2GVDC 1UZNA 1WW3A 3MF4A 5EXSA 3G2OA 5EC1C 2CLMB 4CU5A 5BSTA 1PGNA 4P3KA 2V7XA 4UJ3A 3ZDBA 5JALA 2P6JA 4RXUA 2LP7A 1XCOA 3K4PA 1Q6YA 3H99A 3N28A 4HY3A 3Q9NA 4OBWA 1TUGA 3U1BA 2WLIB 1PQYA 2NVUA 2XUGA 2OTJV 1AXGA 2EKBA 5B3AA 4FNMA 1CDZA 6NULA 4P7JA 3EYWA 1X9IA 2OTCA 3IX7A 2CMHA 5JZBA 5FA8A 1JH8A 1JB9A 3D1JA 2DOKA 4K6MA 5K2OA 2JA1A 2G0AA 1D5WA 3X2QC 1CQZA 1XRPA 4R2XA 2XQKA 1Y5RA 1Z6PA 3MHTA 1XR3A 1CEQA 1GUYA 3G49A 3A2MA 1A82A 1UBGA 3V6LA 2PGGA 3M7MX 3G79A 4O8CA 3FI0A 3QXXA 3HGQA 5HRUA 5HTKA 4FLUA 5REQB 2JB9A 2LDBA 3T15A 4PYQA 4JXJA 1P49A 2DSTA 4KSCA 3VH4A 2OQ2A 1MCZA 3FZGA 1I6WA 3EVCA 4JYMA 5CX1A 4AC9A 4TYPA 2OFFA 3RHSA 4M9SA 3IJEB 1F0YA 4PCAA 4R8KA 3M1AA 4GICA 5D87A 1C3JA 4BLRA 4YACA 1PJCA 3F5FA 5L4NA 5JD5A 5EGSA 3AOGA 3ZN2A 3JYCA 3CTMA 5DHPA 1XEXB 4JWTA 4ZI7A 5ESWA 1EWVA 3WNCA 1KYTA 1Y5MA 3THWB 2G07A 1JWBB 4CM8B 3HO6A 621PA 1VIVA 3NPAA 1NJIW 3WYBA 4PFSA 4NCIA 4KXQA 3OBBA 3OP1A 2JJ1A 4I50B 2B4KA 4ARZA 4DGSA 1RS0A 1KU0A 1E4YA 3SD7A 4GO1A 3FNHA 1UPGA 1NHWA 5KHLB 4JELA 5KUKA 4DWOA 1NJSA 1ZNQO 3P7MA 4F11A 1MRNA 1UPTA 1TKCA 2QWOB 3FB5C 1HNXO 2FR5A 4YCDA 1VARA 2YV2A 4XWTA 5I7FA 4LCNA 1RR6A 3WLHA 3S4YA 3W7WA 2OSVA 3KLBA 2AB0A 4DCCA 2UYYA 4XTCS 4NZPA 3D8CA 3MMPA 3I5MA 4D4HA 4RK0A 1I2MA 4MRAA 4PXAA 5F4BA 5DN9A 3WK5A 2FEOA 2F48A 4HLUC 3RANA 2C96A 4TYYA 3H65A 2BFCA 4P82A 4Q03A 1AVMA 2WSMA 1BSMA 2QVLA 4I3FA 5LCXA 2DYSC 4B6JA 3EIUA 1S2GA 2JEYA 2OKCA 1RQRA 2ON6A 4NBTA 3M6XA 3CLRC 3BJMA 2Y48A 2XY4A 1U5CA 1V5WA 2FYTA 2BGGA 1A7UA 4TTJA 4O59O 2FSVC 2XNCA 3FMGA 2VWPA 5KOJB 3T6KA 4QATA 2DFTA 2KHZA 1Q6UA 1DRJA 3ELBA 2DBYA 4JJFA 1U0SY 2V6MA 4BVAA 4D7TA 1WN7A 3QEMA 1U3GA 1C80A 1FJXA 3PLNA 1E0KA 5FFNA 2GT1A 1NZFA 4RCVA 1DNPA 3ABTA 5KYWA 3B1ZA 4RENA 3AFIA 5EUCA 2W93A 5KWJA 1SCIA 3HBLA 5AHKA 5EY5B 1TRHA 1W0CA 3IBFA 4DMMA 3QE2A 4MQMA 1EP1B 1XYYA 4KIWA 1GA1A 5IK2A 3EVBA 2CUKA 2AQ8A 1LQUA 1PWXA 1XDGA 3BYZA 1XNQB 4Z8YA 1U2GC 4BNLA 3IURA 5E4TA 4F8JA 1KNQA 5TX7A 2QV0A 4H44B 3M99B 1EEXB 1TEHA 2FWIA 4HDNB 2ZJ5A 1GTOA 1JHMA 1Z16A 1OTYA 4EKNB 2KS6A 1XD2A 4PLFA 2OMKA 1EVYA 2CXRA 1T5IA 5E8JA 1IZ0A 3GCDA 1NTMH 3ZKAA 2Z3YA 3TL3A 4ZV9A 1SU4A 1GILA 2CW5A 3P4UA 2OWEA 3LFUA 3AR4A 4HYQA 2OFPA 2AI2A 1ONSA 1ZM9A 3WGOA 1U0JA 2XCTB 3EMDA 5D5QA 1LF0A 5DIFA 4BTVA 2YOFA 3SVZA 4CDGA 2PANA 3D59A 5EIOA 5EXXA 4J7KA 2W2LA 3F7VC 1SBIA 4XSVA 4QZVA 3UAGA 4HFJA 4OX9B 4M7OA 3TXSA 5LZ7A 2PRZA 4MYCA 3AFHA 3JALA 2KG7A 2O1XA 3AR8A 2Z6QA 1MABA 1Q7CA 1HDGO 2XQIA 5K03A 2IL1A 1ZSPA 2DBVO 4P8RA 2HJ9A 3HKCA 3CEJA 1MW9X 2X8BA 1MMFB 3E8GA 4YQFA 1YBFA 1J2EA 1QF6A 1AN9A 4GFDA 2IOFA 4OB8A 1FTQA 3HI4A 3AG5A 1JA1A 3AVVA 1AKVA 2R1TA 1C0EA 4IWXA 2GCPA 1KZ6A 3G6WA 4DILA 3C4JA 1E5QA 3AF6A 4HLQB 3MW8A 3Q87B 4MVRA 3RU7A 4GI3A 5DMXA 3BMOA 4ZGWA 3OCXA 4X8HA 5JWHA 3Q41A 2NU6A 4BNZA 4H0FA 1QZUA 3DZGA 2ZUEA 5B3LA 4KN8A 3FJOA 1ZIOA 3O4RA 1D1QA 4YDQA 1XZFA 5LB2A 1RYMA 2ZKOA 4DYLA 5EBWC 2DHEA 3PDIB 2ZAGA 5DRTA 1VBFA 4PLWA 1OLOA 4PYJA 3GUCA 4YA6A 4EG8A 3G0CA 1Z5WA 1FP7A 2CNBA 1TM3E 2XITA 3RABA 4G26A 3IB3A 1DL5A 1QR9A 4KV9A 4AYTA 4EHDA 3K8ZA 1S8AA 2VHZA 2WU3A 1TCCA 3KTAA 4LJKA 1JEOA 5EMKA 3ZOKA 2CK3A 3TEMA 1PJ2A 3F7TA 1GXSA 1WB6A 3P9QA 5JO9A 2QVXX 4GDFA 4B74A 1WZUA 4RACA 5G1NA 2ZLBA 3LK6A 1B6GA 1BHJA 2I3BA 2C97A 1SVSA 4IOLA 4HNGA 3GFFA 3BRSA 1VLHA 4QU0A 3IUMA 5K1ZA 4LE0A 1A2BA 1T25A 1IHXA 5JMPA 1PVVA 3L4SO 4RLQA 5DHUA 5HKLA 3L49A 3HADA 4XKJA 1JSRA 4TRMA 2O8NA 3A26A 3ZDFA 1NDHA 2J46A 3LW8A 4HX2A 5JMWA 1UJ4A 3FPHA 3L4BC 2ZUTA 3OX4A 2JGAA 4FDVA 3D3QA 2O3UA 2EZTA 2DMXA 2DWDC 4CCAA 2VUTA 4MVOA 3PDCA 3CMMA 2B2XA 3DPUA 4ZMRA 5FDFA 1UEXC 5KIAA 2YIDA 4HAZA 3QVVA 1J0EA 1KC3A 2CMKA 3AFOA 4MV9A 1XPJA 2RH9B 1SVNA 3TSYA 3LXRA 4KDEA 1ZVKA 4B4OA 1AF2A 2B21A 4DDVA 3O3MB 4PAMA 3RIHA 1HQCA 5ECYA 1TF7A 3R77A 3B85A 3SR4A 3H6KA 3WI7A 5CJJA 3OZVA 2E74B 4FGSA 4EQ6A 3VPAA 4R41A 4HPJB 5AW2A 3L07A 4LDPA 1Z6AA 1VGRA 3BBPA 4BNTA 4CKEA 5DW3A 2IY9A 4KWCA 4QQNA 2F9LA 1U1CA 4TV9B 5FO0A 4DWJA 4HTFA 3U11A 4OSPA 4PAWA 1AKWA 2QLTA 2BGRA 1CD5A 2C3PA 3QEBZ 3CW8X 1T5TA 2NGRA 2QT1A 2ZDIC 2AEFA 1ZI9A 4UOZA 1T6XA 1GZDA 4GR9A 4IWNA 4ZMBA 3IC9A 3O4VA 1MT0A 4E4RA 4DYHA 1NBOA 4TQFA 3WISA 3JQ7B 1QHGA 1CTQA 3QVGA 2SECE 5B1HA 5JNVA 2W00A 4JBLA 1O94D 3WK6A 3WGIA 5THKA 3W3AA 2OOSA 4EY4A 5BUZA 3U4IA 1GGFA 1PT5A 1TKAA 1LF5A 4DV5O 4KOAA 2HVVA 1SXPA 4P38A 2UU9O 1A71A 4LWPA 5IM5A 1K5GA 5KX5A 1K66A 3UJNA 1QS0B 2P06A 2DJ5A 2A4KA 1LPSA 3A3OA 3PWKA 1KJ9A 1Y7TA 1RWMA 4I4CA 4ZYXA 4EEZA 3F8TA 3BCHA 1ZAKA 2X0KA 5HF6A 4MV4A 4LF4B 1R3IC 1YCHA 1IVNA 4ILKA 1E1CA 4IGKA 4FLVA 3DO8A 3PCXA 3AKEA 4WCDA 2B1IA 1BDBA 1T9ZA 4MJLA 2NUAA 4WERA 3X1XA 1KJNA 1TECE 1YZFA 5KCMA 1SELA 2CYBA 1IBCA 2ZRKA 1R3DA 4ANFA 4UE6A 3KVOA 3I5AA 4UCXA 3EC7A 1DO0A 2XGOA 3IAM1 4DBVO 1VL2A 2YWJA 4KFRA 4D0NA 5MDHA 1YI0A 4B7CA 3X1JA 1WUKS 4MPTA 1UWZA 3QWHA 5ENDA 1U0GA 2JDIG 1Q15A 1N1EA 5CXQA 1NULA 3IS3A 1FTSA 1P1JA 2OP1A 4ZVRA 3A9SA 5DM6V 3L1KA 3AR3A 4L76A 1KTIA 4YX9A 4HQ6A 2QM0A 3QJGA 1DGQA 2EYQA 3GGGA 3B82A 4MIYA 5JTTA 4EZIA 1L2TA 3GWKC 2XUDA 4BB5A 4PU0A 4L8FA 2EZUA 1EFRD 4PF1A 4JCCA 1NU1H 2B2CA 2OAQ1 1MP0A 5KZMB 2G40A 2O57A 3GGCA 4DR6B 5HK9A 2Y69B 3T7JA 4PYRA 3MUOA 3NC1C 3LWDA 4HX9A 3TOXA 1QQCA 1KYWA 3UB2A 2OUIA 5AO9A 4J16C 4RC9A 2F43G 2ZRHA 1ZC3A 4PRYA 4YYZA 4U5XA 4WY5A 1GSOA 3IA2A 5GMOA 3T94A 5KYGA 1PQWA 3FSRA 3IELA 4ESHA 1KOGA 2D2VA 4K88A 2ODWA 4BRSA 4X1YA 1FUEA 5EP2A 1XZEA 3GRPA 4ARAA 2B8JA 2DR3A 3D0QA 4Q4CA 2O3JA 2O54A 2COKA 3VR5A 4P0PB 3UOWA 2YOHA 2WWGA 4X7PA 4AD8A 1KS9A 1KARA 5FOXA 1QVWA 4UBMA 3ZJUA 4Q4JA 3H7IA 1EB9A 3S3WA 3ACCA 3I8XA 3KFLA 3UENA 3Q0EA 1CJBA 4BATA 2NZVG 1SB8A 4OFBA 1JW9B 3IOYA 4V0KA 3W9SA 4Z0NA 1N0WA 5IFKA 4BJ5A 3LYUA 4DVJA 4JR0A 1OH8A 1SBZA 1Q77A 4H18A 4XIFA 1O9HA 3ZDXB 1MG1A 3Q8XB 1R4NA 4DB4A 5DSXA 1ZGBA 2ZSAA 1XA4A 4HQKA 3B48A 4KXYA 1B0AA 3W6OA 3ML1A 1LPPA 2ZAIA 5J5VA 3NEJA 3CRMA 2WSIA 2L2QA 4LA4A 4RH0A 5LBIA 2IK8A 4NICA 2FR8C 3OMWA 4N82A 4II3A 2GZRA 1BN7A 3HYRA 2FFBA 4G67A 2ZB2A 3SJBC 2C1XA 1YACA 3EEQA 4P93A 1QVVA 3M9XA 4PQFA 4OFXA 1I4EB 1HW7A 4Y6PA 2WSSG 4B71A 3G8QA 1KECA 3VYSB 3FKSA 1ETHA 4IP0A 4YJ2A 3A37A 3D6NB 3QBJA 1ZGZA 4DNOA 1P91A 1K4MA 1CP2A 2CJXA 2JIZA 4IIFA 2ZVPX 2VHTA 1BXRA 3DEKA 3RJMA 4MCJA 4WN3A 2H0AA 3PWTA 4PZUA 1DKMA 2BW0A 3JQAA 2PO5A 2PUWA 3F1KA 2G70A 3BHNA 3R7DA 1ZM3A 3JYNA 2YXNA 4J0HA 3MVEA 4ZT4A 1NA5A 1OBOA 3D9QX 4P0QB 4UXJA 3WFVA 4A5UB 2JJYA 3DDZX 4ZFRA 3V3KA 1N8TA 1P9OA 5TGDA 1GITA 3HR7A 4L1KA 3QMPA 3SYOA 1OROA 1TVKA 4XA8A 1RP7A 3LSSA 4NBKA 5JOQA 5IXJA 2FAXA 3N2IA 1MAAA 1E1RD 3S0JA 1GA6A 3IKLA 3PFNA 1XILA 3S2FA 1AB6A 2ZSJA 3AL0C 2ZZNA 2CK3G 1QPGA 4EGCB 4MWOA 1ORWA 5JBQA 1GN6A 1C1DA 4NG5A 3WLFA 4TXHA 4KNYA 2OGZA 1RM1B 4I9HA 2HMYB 2B92A 2HXVA 2DN9A 1VQMV 4L8WB 4JJ7A 1AUOA 1I1QB 1O57A 4WXMA 3PIDA 4E5KA 1T0HB 1CUXA 3RVYA 2G1KA 1WXXA 3WIDA 4K6OA 1SOUA 2GXUA 3K30A 4QEDA 1XLTC 2QW0X 1UBHS 3MBKA 2EQBA 1AA9A 4IUBS 3VSEA 4EAQA 3BPZA 1XHEA 3MUEA 4KR2A 2WRZA 3TJTA 2WAAA 3NETA 3D7MA 2QKSA 4HUQA 1O97D 3G0IA 2DHRA 4LOAA 4NK4A 1UC8A 4UUOA 2RAPA 2ODNA 4JP5A 1LLCA 1FXKB 3W5SA 3HY4A 4ECAA 1RQPA 4DJJA 1P60A 2Z2IA 4HEQA 4JAAA 1KF0A 5ARDA 1YASA 4IDDA 3LPAA 3LVFO 1LW6E 3CZ4A 4GPTA 4YMVA 3HU1A 1FJGO 4OU4A 2QRLA 4F9EA 5M3BA 4HC4A 1NATA 2CHUA 1U7XA 4H6VA 3C5VA 3WV5A 1HNWB 4FZ0A 1Z4QA 4CTKA 3CCQV 4UM9D 2GJSA 1WUTA 3T3GA 1X3LA 1WWKA 3NJRA 2CNKA 4GQIA 4F04A 2O5CA 1WETA 2VPPA 4GG1A 3C3CA 4ON9A 4J43A 3CRCA 4JITA 5ITZA 1VHTA 1MA1A 5M5BA 1M6VB 5TQ0B 2QY9A 4LDQA 8LDHA 5HNKA 4B0PA 4MW7A 3T1NA 3UMRA 5JEDA 1NYQA 4DUGD 3DE2X 4AXXA 2PS9A 4LNAA 1S5JA 3D36A 2XYRA 3ZDCA 4BCBA 4J3FA 3O8BA 4OQEA 3P2OA 1L8XA 2C7VA 3F3YA 3NYWA 1OJHA 1Z3AA 3LYHA 3OTWA 3W05A 2RG7A 1E96A 4G1UC 3U3XA 1P73A 1Q1NA 4GGPA 4NDAA 3ZWKA 2OCCB 4LJ8A 3O91A 2QWXA 4KDCA 4WACA 3CVJA 1I6LA 3W8NA 1NQ5A 4MCIA 3FTFA 1G2QA 2WU8A 1U7UA 2IGBA 1OOEA 2QR5A 4ZVMA 4B44A 3SI7A 3HZZA 1WAZA 1F3OA 6CHYA 3QIAA 4QJBA 4YMGA 3MB8A 1JP7A 5IYZB 3JARB 1E2IA 3L0YA 1RZUA 5A0VA 3FUUA 2Q6OA 2X5KO 1KEVA 5EZ5A 5JE8A 4WNCA 5DOVA 4B40A 1Y8CA 3HRIA 4CL8A 3VR1A 4JKOA 3RUHA 1ECLA 4BECA 3DMDA 2EILB 3K1ZA 1IUOA 3ICWA 3QBTA 2FPUA 3ZXXA 1UK7A 1ZX3A 2XUMA 2IXEA 1XHZA 3DB2A 1JN0A 1KE2A 1GY8A 5CPBA 2SCUA 4LDNA 1KK3A 4HCJA 2XRMA 2PNJA 4D9GA 4ZCMA 3M6WA 2O9JA 1KEUA 1UPAA 4L5YA 1GKUB 2RBGA 1RLTA 1ODFA 3FWPA 1ESZA 3T7KA 4DJEC 2J45A 3DCNA 5KQRA 1A27A 4F3CA 3P0IA 4LCOA 5TQVA 2PZ8A 1A77A 1P7ZA 3M5DA 4JEMA 1G8PA 1LZKA 2I66A 2ZRCA 4YBRA 2ORWA 2HDOA 3B77A 4Z1MD 1MKYA 4HLDA 2OC9A 1RWQA 4KUMA 4Q1BA 1CK4A 1UJMA 4FMCF 3H9BA 3OZRA 4ALNA 3VNRA 2AN4A 3VBEA 3L9XA 1GTVA 3JZIA 1QR2A 4LHXA 4YUWA 4AP9A 4CIWA 4WNYA 1I8TA 1YE5A 1XZBA 2IYTA 1I1OA 3RKSA 2WIJA 3VPBA 3HSKA 3OR6C 4JEIA 4N4AA 3U61B 1WNSA 4CH4A 4WW0A 1E2UA 1SEVA 3NR2A 1UBOS 3EHEA 4NMWA 3CRRA 3IEIA 1SBTA 4YP0A 4CMIB 3BL5A 3O8QA 2OQVA 2YWHA 3GG2A 3SQNA 3QYJA 4LP8A 4AU1A 1XDWA 4NEQA 2VKQA 2VRCA 4F5EA 5FLXN 3QK7A 1R0RE 4IPTA 4Q3DA 1NJ6A 4FTWA 5JVDF 4I1OA 1KXZA 2EIXA 3ZN1A 4DCOA 2D8AA 2E5FA 2FR0A 1CUEA 5FTWA 3VR6A 3GJ4A 3AUSA 3M1LA 4XGNA 1GZSA 2JFPA 3KCQA 2PA3A 1ZRSA 3FSGD 2JHCA 5F2NA 1ZD8A 1E9BA 4GZ5A 1XKTA 5E0KB 1KPGA 3MCUA 4L85A 1W0JG 4L08A 4DEXA 1PV1A 1M2VB 2AWOA 4CT0A 4I5GA 4Z7NB 3KD3A 2J9YB 5EKXA 3KJZA 3OM1A 2W48A 2DULA 3NLLA 3UMCA 4H7FA 4CMHA 2I6UA 2QPOA 4KW7A 4W8GA 2A1UB 2XDYA 3NIFB 3LDAA 4OQFA 4HWSA 3CLHA 2ASVA 3IUEA 4X20A 1SBYA 1P5RA 4ZOBA 1E9CA 3MWDB 1KFBB 2GAFA 2BBTA 1NRXA 3P9XA 3PXXA 2OCKA 5D6NA 3QFFA 3B3JA 4K0RA 5HGXA 5J23A 1RZ3A 2VO1A 1P7GA 3WMWA 5U1PA 4EYGA 3L7YA 3PJGA 5FOVA 2W6IG 1Q6ZA 4S1VA 1U7TA 2HF8A 2ST1A 5BPFA 2R66A 5CG1A 2VQEB 4HAYA 9LDBA 6REQB 1FFDA 2ZJZA 2V1UA 3UMFA 2GFIA 1XD9A 4OIMA 1VIDA 1I30A 4UNPA 2P6RA 3MMNA 5AMXA 2ZSDA 2IGTA 2FP4B 3B8NA 3D6MA 1ZY2A 3BJEA 2XKAA 5DX0A 2ECFA 3HLYA 4J0GA 3A1EA 4YP1A 3EE6A 2IEIA 1X87A 2XAFA 1UKYA 1KKDA 2YZKA 1S0UA 1XZDA 3F71A 1J0BA 3QITA 4C20A 2C8LA 3X1DA 3LHKA 3ONFA 1JHRA 4JXKA 4F6LA 1Q19A 2CAZC 1Q3KA 4LQDA 1N2EA 1O6ZA 4YP9A 2GFQA 3RYCA 3FROA 4YYEA 2JGDB 5I7AA 3MCZA 1Z7BA 2UYHA 4NCHA 2ZDQA 4XUDA 2K9PA 2XMDA 3JATA 3PC3A 2W4QA 3ANXA 1R0KA 3DOCA 4D7SA 2RGAA 2YQ4A 3G1UA 1D2HA 4MULA 3MC1A 2FN3A 4E08A 4JR1A 1QDUA 5KQPA 5L53A 3OEHG 4MRPA 3CLSD 2CL7X 3T5BA 4TL7A 2P30A 4WVLA 4KDRA 4WADA 1XTUA 1YD7A 2ZIEA 2J6CA 1GP2A 3WLJA 2YVLA 1KH2A 4CLXA 1OZ0A 2WDZA 4E09A 1WE2A 1P18A 1ZAYA 1COWD 2LD4A 1P4RA 2POCA 3RYIA 2AF4C 2O95A 4JT8A 4LTMA 2LIPA 2YYYA 5C53B 5C93A 4DPKA 4JGIA 1QRRA 5EC2C 3IBCA 5GAJA 1HE2A 2ZIGA 2D3WA 3RM3A 4X64B 1RHRA 3CCBA 5I7SA 1XDBA 1TQ4A 3BRWD 2IZ1A 2JIBA 1J5EO 1YZQA 4Q5IA 1WNFA 5HRCA 1ZC4A 5H7XA 3HB7A 5AW5A 2Z6AA 2I3DA 4D5GA 2G80A 3M8KA 4FDAA 5AHRA 1GZ6A 3VR4A 4RNDB 4FEGA 1DDGA 4AKSA 1TCAA 2HEIA 4NONA 2C5HA 5JASA 4FE7A 1A69A 1ONBA 3ZMVA 1H9CA 4S0XA 5HQTA 1YDEA 2Y0DA 2O20A 4MW3A 2PT7A 4AWAA 2XMRA 5L3CA 2PD6A 1ZQ1A 1KFKB 1GZHB 1K2WA 4C6SA 2J3DA 1KIAA 4XWKA 2QNRA 2ZTHA 4LSZA 2X8JB 4EI7A 5J4HA 4PZAA 2WAYA 2EJRA 1DELA 4WBNA 1VL1A 1H3NA 4UTVA 4LE2A 5LD2B 2J3KA 2HA2A 2IXTA 2YWEA 3SJCA 1O6CA 4MSWC 1BDJA 2XOKG 4LC5A 3PVSA 1N33O 1ZOPA 1ULHA 3ZZUA 1ULAA 2H1IA 4RVFA 4BFYA 3SEQA 3EBLA 2RMKA 1EJ0A 2QJFA 2NSHA 3ZXYA 2IOHA 5P8WA 4MLCA 2MJLA 4DB2A 3WLPA 1JJ2U 2Q6KA 4WXYB 1NPYA 1NSFA 2AOUA 4IFEA 5EJ4A 4WK4B 2H07A 4LXTA 2X5OA 3WHIA 1KKCA 1XP8A 3KALA 3KS9A 2QVZX 1FB5A 3FNBA 1GGMA 4GOMD 2JZCA 5JJLA 3DB1A 4B35A 2GTPA 2ZS7A 5C4MA 3Q6IA 1WSBA 1F6DA 4LX8A 2Y4TA 1LQ2A 3AR7A 3JQGB 5DGHA 1OZFA 2O1SA 1TCUA 4ZKDA 3ECAA 1G5QA 4J0IA 2RHOA 5J4VA 5LQKA 4OTZA 1OLXA 3TTXA 4OPMA 1QV6A 1SESA 1NF2A 2HHHB 2EBWA 2HTFA 1HT2E 5EE0A 2I3AA 3ELWA 1XVIA 2GZAA 5KCZA 2WTBA 1THGA 4ZIBA 3GF4A 2NXCA 2A78A 1G9XA 4PFJA 3T7RA 3HY6A 5EK0A 3LBAA 5M52C 3DAYA 2FPGB 2V3WA 2CHEA 2FB9A 3OTHA 2AFIE 5HF8A 4KODA 3KCYA 5FUMA 4EMBA 5IDWA 5BN1A 1VQ7V 4KFTA 1PZMA 4IIJA 3QPBA 4FOOA 3FN4A 1HT1E 1RAIA 1UBJS 2FXVA 3OZSA 1LBIA 1FLNA 4PVCA 3ICCA 4NSNA 5IN4A 3MYRA 3QQ5A 3W7XA 4MUNA 2NV0A 1FUIA 3C7DB 4WUTA 3IV9A 3QYFA 2DZDA 1ADCA 4PYMA 2SNIE 4FGJA 2XB8A 3PHJA 1WBBA 4WZBA 3RUPA 1EXVA 3KP1A 1M83A 2MSEB 3L77A 1QH9A 2D2EA 1YCDA 4UTNA 2QGFA 2Q4EA 3L93A 4C5AA 2BOCC 3LNNA 4GYJA 1W4AA 3O4GA 4BVKA 3L8YA 4E33A 2EBOA 5AJYA 3RVQA 1WXWA 2HJRA 1G2IA 2XUAA 3S1LA 5BSUA 2QTRA 1T6YA 2FTKA 3ZWCA 4NDNE 1WBDA 4QU5A 3V1KA 4LW8A 1ZNZA 3ZWWA 2JGRA 4J91A 4M6WA 3K59A 2JRIA 3H4TA 1QX3A 2HZBA 1MAWA 3O7MA 1GCAA 4QDJA 3EXEA 2P9BA 2ZIUB 1YSBA 2IZ5A 3OT4A 2K2WA 3BEDA 5IAEA 3GLGA 1SVWA 5L51A 4G3MA 5HP4A 4K9QA 4CV0A 4MT8A 1P4JA 1KR2A 3FNRA 3EQ7A 4B45A 2Y1KA 4Z99A 2IW5A 1M66A 1ZNYA 3K5LA 1MX1A 2Q2WA 3EZNA 3CWZA 1UXKA 4CKCA 4QM6A 1GEGA 5I9IA 2ATVA 3A8TA 5EE5B 5ED0A 5AM2A 5I7UA 4NOMA 1ZGCA 3QWBA 3NTQA 1CE8A 5A5FA 3DTVD 3QHAA 5EMMA 1GYRA 3WP1B 4UPDA 3U09A 3RV4A 4J0JA 3WGQA 4OBXA 1GUFA 3A6EA 5JARA 3CEIA 2EERA 3P9KA 2FLKA 3KUDA 3IT2A 1VXOA 4FUQA 3W4KA 5A3QA 1NX6A 2AI3A 5KNLA 4S0ZA 4M1SA 5ICEA 3OQ6A 4B3RB 5IUKC 4HYTA 3T4ZA 3VJRA 1JHVA 3G9TA 3NQ41 1EGHA 2NZUG 2NVWA 3KYJB 5BQ5A 4ZMSA 2KE5A 4M1ZA 1LRKA 5UKDA 3OQIB 2A0YA 4C01A 1SVLA 4EW6A 3PGMA 2IT1A 1CY7A 2QRQA 2W6CX 4YP6A 3LDUA 1CQIA 1RXVA 1VRWA 4HRAA 1PV0A 3H2ZA 2C0PA 2QN6A 1E4VA 1XZGA 1CR4A 2CCJA 2C99A 3WB9A 1JHQA 4M83A 5H5JA 1HMYA 3I37X 1KY3A 1CNEA 2E1PA 2V65A 4MWDA 5AK5A 2TECE 1CX9B 4MXDA 3EFBA 2OB2A 3TF5A 1P7BA 4N6OA 2PSSA 5LMUO 1GQ2A 2EZPA 3GRRA 1F4NA 4LWQA 5ALOA 1EK5A 3TAHA 1YGPA 5AK0A 2JA2A 1EFVB 2ZI4A 3R6WA 1ZJZA 3SYAA 3OFNG 2B37A 3ZX6A 3KL4A 4KBFA 1CUSA 3C3EA 1KMCA 4LS3A 5A4MS 1P75A 5ALKA 1SQQH 2WLMA 3CRAA 2WV9A 1RQ2A 4S2EA 1T5HX 3BZUA 1VYTA 1Q90D 5LQJA 1V0JA 4V0QA 2FI1A 2A8YA 1KKMA 3HA3A 2ZRMA 4M60A 5M34A 4DIMA 6PFKA 1KDYA 2X0NA 5AJHA 4QECA 2J3MA 3K6JA 4X1KA 2NU9B 1O54A 5LLTA 4QVKA 2W22A 4R1NA 3KAQA 4TTRA 4HAVA 2WPNA 4YRIA 3G6BA 3K9WA 2BMVA 3GDOA 3DCIA 3NYIA 3K9BA 2AC2A 1XEFA 4YMWA 3OIGA 2IX3A 3WL8A 4K1LA 1BYUA 4K6HA 4OM7A 2BISA 1NP7A 3KAPA 4GQAA 4BVFA 3AG7A 1KY4A 2QUKA 4Q3EA 5K0EA 3STYA 1RPTA 1J0DA 2DFLA 2G25A 2PHZA 1TIPA 3A9WA 4NYMR 3GEMA 1H8HG 1KZGB 2YCLA 2Q7XA 1XQVA 2Z9CA 4XD7D 2I7XA 3DQQA 3LSTA 5EIFA 2VKTA 4DUZO 2G9QA 3FCSB 4ER0A 5HGJA 3NBZC 1GRNA 3O4JA 3WQRA 3SR0A 3TIIA 1DE0A 3K70C 3ZWDA 5HCIA 2ANBA 2FG6C 4DLLA 1D6JA 1SCUA 2F8MA 4QXOA 4TVOA 3R0XA 5EZ6B 1H94A 2XA9A 1T0UA 4BWVA 3O9VA 2WM3A 2AMYA 3KVYA 3WL6A 2C2GA 3IQWA 1TQ6A 1ZM7A 1RBZA 4JQSA 3N8DA 3AG4C 1A04A 4P2GA 3MT7A 1Y1SA 5B1OA 5BW6B 1X9HA 3VZSA 1V4VA 3BUSA 2OLJA 5FYQA 5GM2A 2W11A 3I1JA 3DAFA 3DHEA 1OX7A 3WTCA 4EUSA 2ISQA 5IH7A 1GGEA 4EDFA 5BMVB 3ZY5A 1P0PA 5DM0A 3H5VA 4Q3BA 3U44B 3SHOA 4QX6A 1YOBA 1NI4B 2IZ7A 3OFJA 2GNPA 3A1FA 1I14A 3LT2A 3TAUA 2VDUE 2J7KA 3AP3A 1EK1A 1QIDA 4GHWA 3OG9A 2A30A 2O07A 2QVBA 1E1YA 4U3JB 1XWWA 1LSJA 4E3ZA 3NT5A 1O7JA 5LBTA 2N46A 1Y5NA 1CJCA 4V0NA 1T0PA 4HDSB 4YQZA 5F2EA 3BF8A 4U7WA 4K86A 5DSZA 3P2KA 3A9CA 3Q3JB 1AI4A 3ZGVA 2O2IA 6Q21A 1IJEA 4UVEA 3NTUA 4Z3KA 3RFFA 3RSSA 3U48A 4DABA 4PLCA 3JVDA 5I4BA 1Y6RA 2FRDC 4GI7A 2QSZA 3N2GB 4Q93A 3VNUA 3NUGA 5E1BA 5TQ2B 3JSNA 1EUDB 2GTAA 2QQ5A 4OPAA 2M2IA 2IXAA 4D0GA 5LKRA 2JDIA 3SBEA 1Q82W 4PYIA 1DX9A 4TMYA 3L7IA 1KXJA 2SKCA 4N5NA 3SC2A 1EH5A 1FDWA 4JMLA 1AZTA 3ZHTA 1I3LA 5AW9A 1U3UA 3RS5A 1ZRNA 4YRBA 4P08A 4ZQCB 4B08A 4RUKA 4RVDA 4CU2A 3NHBA 5CT4A 2FU5C 1KMHA 1G8FA 3W4IA 2C61A 2BEWA 4O4LA 3K5MA 1ZEJA 1TJYA 4EI8A 5C35A 4HADA 3WBJA 1QGZA 2QTVA 2ZDGA 4JODA 5CIQA 3REQA 3TXQA 4L02A 3ZH2A 4DLVA 4JVLA 4R1QA 4JEUA 1GUAA 4CS2A 2F43A 3LQKA 1Z08A 1DWQA 2MDTA 1T9GR 1E3TA 3L6BA 2WY2D 1VE6A 4E4YA 1ZD1A 5CBKA 1W5EA 4M53A 1RJ9A 1ZWIC 1P7PA 1Y76B 4LDJA 1TTPB 1VKHA 1INLA 3PSHA 4HMPA 4N1AA 1JA9A 4WF9V 1LI7A 5IXSA 4HGZA 4QPJC 5ALFA 5BWMA 3GFPA 1SBQA 4KE6A 5IJ0B 2Z0AA 2JI4A 3DEJA 1CRWG 1NXWA 3G2PA 4RF4A 1H6CA 4XCQA 4NXMB 2AKYA 4RNCA 2E49A 3H2JA 4ZC8A 2VN8A 3DPSA 2X1MA 1XU9A 3SLGA 3LQ1A 1L4FA 1WN5A 3PKZA 3U40A 1N32O 2JLSA 2OIEA 2P68A 1C30A 2QRNA 3TL6A 3F9CA 4Y7DA 5KU7A 4FBLA 4RY9A 4AMZA 1YR3A 1J49A 4OYHA 1T43A 3EQ9A 2X7XA 2JFFA 1XMQB 5A2QA 1SA0A 4ID3A 1L7BA 4FD3A 4CKWA 1V4NA 2XOEA 4AROA 4R98A 1FNSA 4JYPA 3D8TA 1NIPA 4RFVA 2H9YA 3N86A 1QIMA 2PK3A 4FLEA 3CS3A 4Q47A 4LFAB 3EPHA 1GLGA 2DWOA 2ISCA 1SQ0A 5KMGA 3FNFA 4FOSA 3AIIA 4RZIA 3OTOO 3UGJA 2QMOA 3PFKA 5EHGA 4O0MA 3NC4A 2GAIA 4FXOA 3WRWA 4QBFA 4NEHB 5K5EA 4Z4GA 1DBVO 2WSSA 2QRVB 1E9AA 1PTKA 4QDTA 3UPUA 3KZIZ 4AN0A 1EYZA 4XFDA 5GONB 1NP3A 2JLBA 2IHKA 4FYPA 2COEA 3PGXA 3OPXA 3OM3B 3OOSA 2P8JA 2DR2A 4TQGA 3U16A 1CNMA 4OAQA 4B09A 1ZX1A 2I99A 3QOYA 3HM2A 1QFXA 2HK9A 2C7PA 1V5IA 5LIPA 3K5IA 3R8FA 5AW0A 4XPIA 4F7WA 4IHJA 2EYUA 5DX8A 3C16C 3FAVB 4DJFC 4RK6A 3KSRA 5EEHA 1N2BA 1H2EA 1GJRA 4YJ3A 2ZUDA 4PZPA 2FSFA 5LB4A 3LKBA 4W5RA 3HY3A 2ZR3A 2W2QA 3SXPA 4OAPA 4JLPA 3KAJA 3SF0A 4NBSA 1NZJA 4D43A 1WSDA 2HQBA 2YJ3A 2Q46A 4RADA 4RAOA 2P35A 4P54A 4IO0A 4I6JA 4LHZA 2QS9A 3OM0A 1KRWA 5EIBC 5JJ5A 1QBKC 2A5GA 1YHQV 2YFKA 3VVMA 3WYCA 2QWRB 1HL3A 2X4DA 2YFQA 2Y0CA 2BAGA 1X1TA 3UGTA 5CFNA 3L73H 4YPFA 1JWLA 5HZMA 5T5QA 1JKIA 1O87A 2FW9A 2YDEA 5JWRA 3EFOB 2CDRA 1JYSA 3QYPA 3PPWA 2QA4V 3F7NA 3H17A 3AW8A 1WQ4A 3LRXA 3UYLA 4YFVA 2LNDA 3JW8A 3U10A 1VG9B 1M1XB 4KIUA 3TM5A 2YMQA 1QHTA 2ARKA 1M4UA 5L4SA 4OYRA 4DMLA 2VTKA 1EX9A 1MF7A 2CLIB 3DCYA 3CBGA 1LW7A 2OBNA 1ZGAA 4HQOA 4NF2A 3W2GA 1VB5A 1S1MA 1FYXA 1KEEA 3EXHC 5IC4A 1CQJB 2ZJ6A 3RVZA 4Q6WA 4Q7EA 3SQMA 5ALZA 3WNBA 2Q73A 4GQBA 3I9JA 4JUIA 2EINB 2RCNA 3KYCA 2A9FA 4KUGA 2Q4TA 4BGUA 2BH2A 5K0CA 2RGXA 3QKTA 1X8XA 5AKLA 4O2AF 3I58A 3TX2A 5DM4A 3LU1A 1JT2A 3KWLA 4LBVA 3ZCSA 5B57C 3G2HA 3PYMA 1LD3A 4YGXB 5M2QA 3Q0IA 2EDAA 1E2GA 3DTVB 3LK7A 5K9ZA 3JWJA 4ZZ2A 4D0LB 1VM6A 3ABZA 3JX9A 5F4ZA 1FVOA 4V39A 4DIDA 1YBMA 4MVQA 4IICA 2PUSA 1EI9A 1NPTO 1QGUB 1IN5A 2Q5ZA 4YCCA 1LTQA 1YNOA 5H8WA 3OCCA 4KE9A 1SQGA 1TUEB 5E4FA 1P4AA 5JNSA 3LUAA 1EP3B 3ABKB 1PJTA 1GDHA 1IDOA 5ER9A 5B64A 4TXNA 1JQBA 1E9RA 2PO7A 3NDJA 4LUCA 1JQ5A 3JU3A 1MEJA 4K5QA 5IY5C 5C8YB 2FYUH 1DXOA 3C3TA 1DINA 4JKIA 1F2TA 4CIYA 4R71A 2QTFA 1X80B 2FN9A 2DQKA 3JS5A 2X9GA 4EQZA 1RRPA 2AFVA 3SXUA 3REFA 3O2QB 1SBHA 1FRFS 1V1RA 4LFCO 2I8LA 5INTA 1UDRA 4TTPA 4ODIA 2XAGA 4BFLA 2VYVD 2HVJC 3GD7A 2QEQA 4G1MB 2GUZB 4V24A 1P2UA 2ORIA 1MEEA 4DT1B 1BWQA 3IEPA 5IEJA 1XT6A 4ESEA 2ONJA 4I4LA 5AW6A 3CCJV 4HYYA 5CBHA 2A92A 2VT7A 1F7VA 4NHOA 2WFLB 1WCIA 3LIIA 1AHPA 4LCPA 1BZYA 3VQTA 4PELA 1YQUA 1YS6A 4EB6B 3FR8A 1KUQA 2OC4A 2WWTA 4P5EA 4KQMA 1S0VA 1XTRA 1B41A 3BRQA 3I62A 3HKBB 4G23A 1P4GA 3EARA 4J03A 2Y6VA 3KOWA 1REQB 3TBFA 3MS4A 3GEDA 5IJ9B 1SZXA 4DUYO 1ZU5A 4JDPA 4BB9A 1U7WA 3LUHA 3NTRA 4F3RA 3EGDA 1VYHA 1KI6A 2NQTA 2GSWA 2AS0A 1IB6A 4RH1A 3ABQB 3K09C 1K4KA 5HKKD 3NB0A 2YC4C 5ILQA 3E23A 5DN6G 2ZI6A 4PDVA 3WQQA 3M5WA 1CDEA 1JHYA 4H1HA 4FSDA 5J63A 1W581 2JI6A 1BSVA 2VPXA 1OGYA 2RGYA 1YB4A 3RD5A 3BULA 3UV6A 1S5LZ 1JPUA 2HJFC 1JYFA 2VT2A 5HZHA 3HFJA 5T8KA 3H8VA 1T8YA 5EAIA 3TX6A 2AN3A 4QD3A 1XJCA 1TPZA 4BGDA 3MGBA 4AQ7A 4G0PA 4A0FA 3F46A 5AKYA 3LFTA 1Z88A 3PEEA 4B3BA 3GPCA 3EA4A 5C81A 2LR0A 2H63A 5J2TB 4L8LA 4G0OA 3KHTA 1NJ2A 4UV8A 4N3AA 3BCUA 4XSHA 1TIYA 3OQ1A 3S40A 1K3UB 2CTWA 1OC2A 3LIPA 4LIPD 3RK4A 4JI3O 3AK3A 2RJZA 2YXEA 3WLOA 1VLZA 3GJSA 1L7EA 3NBFA 2IHBA 2HHAA 4UZFA 1L4HA 2PGDA 4EO7A 1J5XA 2IZOA 5E9JA 2VHVA 4QGPA 3QU5A 4KYVA 1CR0A 3HJNA 1Z9BA 2GNOA 1V2HE 1VIAA 2ERYA 2R79A 2EFGA 2IEZA 4F60A 4M1EA 2X6TA 1BFUA 5A4AA 3G82C 1RHMA 2ZWAA 1AO3A 3ZVNA 1WA8B 4EELA 4WV3A 3D8HA 1W4LA 3I05A 1XMOB 2R9AA 2Z04A 4U2GA 1W0JA 3JAWB 5C4IA 4JWKA 1RI3A 1WVMA 3MSCA 5KDLA 2AOXA 2Z3JA 4OAOA 3FDZB 3MS7A 3T38A 2WA2A 3TCUA 1U2DC 2X2PA 4Y1FA 1ULBA 1UT5A 4B47A 3EULA 5FORA 1GR1A 1I51A 1Y1RA 4ZHQF 1TPYA 5AW1A 3KXKA 1NYTA 3UMSA 1F4LA 5JH7A 1I0IA 4CYMA 4PRKA 4G07A 4B84A 3I92A 5ETJA 1E6EA 1V6SA 2WMYA 3T5AA 3Q85A 5E6UB 4UTPA 2HWYA 2DMRA 4UHHA 4Z7JA 1UODA 3ZRWA 3OOYA 4LYGA 4R8LA 2PH3A 3FHLA 2W6IA 4DC9A 1TJ4A 3GLHB 1FZTA 2NYRA 4ME6A 4ZDWA 1YVPA 3OIUA 3RTEA 1OCOB 5GZ1A 1QGED 1MJHA 2NTEA 3KQOA 3WFJA 3H5OA 3LNMB 2VDKB 5KHIA 4G86A 1U3VA 3RZVA 4A1FA 5EEGA 3Q7IA 1YDMA 4DLRA 3Q4GA 1JALA 3BHJA 2B8WA 2XRZA 3IDZA 3UKJA 1KI1A 3TDMA 2IPLA 1VF5B 2YQZA 4EEXA 5K3DA 5DW0A 4IKOA 4AF7A 3G68A 3UWPA 3N8NA 4JP2A 4IINA 1U02A 4MQEA 3QX9A 4QNMA 1QCDA 4NJEA 1V37A 2PKQP 3DFMA 1E18A 1JDBB 2F95B 3BIFA 1YVWA 1P2GA 1OXBB 4INOA 1ABEA 1MBZA 1XOIA 3D7NA 4MJ7A 3CJQA 1R74A 5CK4A 1SKQA 3EEYA 1LI4A 1M73E 1DQYA 2EFCB 4W5TA 1QH1A 3G7NA 3OEHA 1YS2X 5SICE 2QSAA 4GOXA 2IUUA 4LYFA 1PE0A 2R5FA 2WP8J 3QSYA 3RAFC 2JK0A 3E86A 1KQSU 3ER6A 4JV5O 4FFLA 1Q50A 4ZI3A 1W34A 4PNPA 3RFRA 1YH3A 2PMWB 3CNLA 2MW2B 4CFZA 2YWGA 3UAYA 3LS2A 4F6RA 3K1AB 2NW6A 1AJPA 2D1FA 1SR8A 2Q9AA 4INJA 3CR3C 2XADA 1L3CA 4IBOA 3CVUA 1JU9A 1U3CA 2QMUA 1Z38A 4B8YA 2CDCA 3UFBA 5ER6A 1AJNA 4JX8A 3L05A 1GRVA 2P3SA 3UKDA 4DJ5X 2P2SA 1U8CB 4EHNA 2R6JA 2JGNA 5KYKA 1GCGA 3A2KA 4RA6B 1RLMA 3B52X 5ALNA 1ONPA 5I9SA 4UCVA 1IN1A 1YSCA 2QRMA 4JJ6A 1NVUQ 1GCIA 1RXWA 4NTXA 3OE1A 4WZZA 3BWMA 4WIFA 3UQZA 1I01A 4UAJA 1GQQA 1JG7A 3MERA 1YHZA 2G9VA 1Y8AA 3HB4X 3TQFA 1CKEA 4M22A 1VQOV 1SETA 4K28A 3CUSA 2UZ1B 1H05A 5EE1A 1N5OX 4FIPC 2EGUA 1L5ZA 1ISPA 2WNSA 4BZWA 2WINI 4PLZA 2CTRA 3JQBA 3VMMA 2QPLA 4BRZA 2IOFK 1ZL0A 2HXSA 4HEA1 1N78A 2A79B 2ID9A 1CTUA 1C4WA 3DG9A 3IVMA 3S2EA 3V46A 2XOKA 3LA6A 2FL4A 1VMKA 4E2FA 2VK4A 1AV7A 1F8GA 3DT9A 1R2QA 4HNSA 4FPXA 2RB4A 4RS4A 3JRWA 4WZAB 4TWJA 4JQYA 2HHLA 1E1QD 1IAQA 1ILWA 1IVSA 2F9FA 2Y0IA 2GZ3A 2QV7A 3CRQA 3IYLW 1D5NA 3RVNA 1PEKE 5BQPA 1WPRA 4MVMA 2FW0A 3MJHA 4G09A 1D5CA 3DEIA 5EI5A 3V3TA 2YWFA 3M33A 1X1SA 4NU0A 1ODTC 2W71A 2FPWA 3PJEA 3FTCA 1RB7A 3ROEA 4GGMX 1X86B 4IIGA 5JS7A 4FZ5A 4IZIA 5EQTA 4J75A 1Y74B 2RHLA 3Q8LA 1E6KA 3ACBA 4RWZA 1SKYB 3WGLA 1OWNA 1WWRA 2AZ2A 1MC4A 5IDXA 5L9AA 1MGOA 3FB8C 1DO8A 2PVSA 2QTMA 3TFQA 5AVJA 2RHHA 3IQFA 5LNK1 3RSQA 4A16A 2ZIOA 1E5DA 3A4YA 2ONKA 3TZBA 2CSUA 4XDHA 4PY2A 4Q9LA 3PX2A 4B2LA 4WY8A 5LDGA 4ZK2A 2AJLI 5DULA 4I50F 3EZ2A 4CKBB 1AJEA 1JQKA 1F2UA 1T9AA 3F6YA 4PM4A 4EKYA 4OHBA 3SBDA 4F45A 2I2DA 1QO9A 4CUJA 2QXYA 4M8KA 4UVDA 3U3RA 3BMXA 5C1BA 4WUVA 3KWJA 4MV0A 3RHTA 4YJFA 1N5JA 1BW9A 3UHFA 4FM2A 1J39A 1QO0A 1N7JA 4CM4B 4L51A 3HBFA 4PA6A 2ONZA 3TXXA 1DKUA 1U2ZA 3KSUA 1IBSA 3FCUB 4XYLA 1AGPA 1K8QA 1JYEA 4S2UA 5EFZA 4CV1A 2XUOA 5LXTA 3KE8A 1DCTA 1OFUA 3RIEA 4UQLA 2FLVA 4D8TA 1T2FA 3CV3A 1SVMA 4LDZA 3OAAD 4AW9A 3OA2A 3QXCA 3QF4B 3EB9A 1ZUWA 4G27B 3DE6X 2I34A 4CH3A 1ZRHA 3C6YA 3RB8A 3M6LA 1R3LC 1DAEA 4F6CA 3V9PA 3RLFA 2XRFA 1SOVA 4Q1VA 2P2ZA 1XA3A 5KQMA 1XNHA 5JSFA 1KAMA 3MCTA 1NV9A 5DV9A 5E1AC 3RJTA 1Z3IX 2Q67A 2BEUA 4W5JA 1V96A 4B1FA 2MMCA 3UUEA 4R9NA 4QXRA 4WFAV 2TMGA 3ROGA 1BTOA 2EGHA 4D8XA 4NU5A 4YAKA 3H1JH 3AXTA 2VDNB 5ILOA 5JXGA 1ISFA 4AQYO 3C3JA 4YECA 3HDGA 3B8EA 5AI8A 2UUPA 3R9XB 1CP3A 4ND1A 4O1MA 4Q24A 2M6LA 1WA5A 2Y1XA 3E1KA 1S3IA 3KKQA 1PHPA 2O5RA 1DKOA 3HZOA 1YA6A 4H7IA 3VGJA 1J8VA 5TPZA 3I6YA 4DLYA 2IBZH 4BFUA 2F9MA 4B4DA 3X43A 1JTEA 5IDVA 4TYNA 4Z9AA 5B1DA 3DQZA 1CZRA 1DIOB 4MH0R 1I4LD 3H04A 2PX5A 1KYZA 1XZIA 2HVWA 2A9HA 1O2DA 2QKAA 4EFEA 3K9LA 3VTZA 4C03A 4C7JA 3QA9A 4X8LA 4X63A 3RUDA 4TUYB 2DQ4A 4PLGA 4QNHB 3MUFA 2BD0A 5MGNA 2J0QA 3LXUX 3AVYA 3DF9A 3AJ9A 2EJVA 1XL1A 4M1QA 2A57A 5H1YA 3VR2D 3FD9A 3WG7B 5G4KB 1PZXA 3JQPA 4PGFA 3FGZA 3K9NA 3UAWA 2G7ZA 4N6GA 1Z17A 2JFXA 1PFQA 4WZAE 6YASA 1JXQA 4R2IA 3F4LA 2OILA 4WA8A 5K8LA 4Q7QA 821PA 1RWBA 2N05A 4M54A 4D96A 3AY0A 3V4SA 1H4QA 2WUGA 3OM8A 3QELB 1Q7EA 2MSWA 3AEQA 1J7JA 2QROA 2BOVA 4MUIA 1CFZA 3KXDA 2DEUA 1W4BA 4I9GA 3WWPA 1Y3IA 2Z5GA 4UB8Z 3G7SA 4HUJA 2P4SA 2NZ8A 1Z62A 3NM6B 3M81A 4LWOA 4ARSA 3HCBA 1YA4A 2F17A 1FNNA 1K4DC 4DFDA 3U7HB 3WX0A 1KHTA 1EA7A 1NBMD 4LZAA 4HEHA 3PNQA 1JSLA 2AQIA 1S3SA 4U8HA 2FFAA 1YSDA 4M55A 1AM4D 1TL7C 4UAUA 1ZTEA 1WO8A 1V1JA 2P3OA 3BMNB 3SBXA 4WFHA 1ZN9A 2RFLA 4BEBA 5IVHA 2SICE 1VLLA 5DASA 4D92A 1ZDMA 1SXJB 1E3WB 3OFNA 1PYGA 4BLSA 3NXSA 2ZJAA 4H16A 5BQXA 2ZUWA 2NLJC 2P41A 2FFHA 2MR5A 3CRZA 5JFTA 1J42A 3MAQA 3TKLA 4JAUA 1VDMA 2CUZA 4AS2A 4FONA 4YMSA 4O4HA 3OPYB 3LY5A 1C3EA 1JDPA 4B81A 4RJIA 1GZ4A 4QDZA 2Y1OA 4ENSA 3RC1A 2NV2B 4BMNA 4GEGA 3WE7A 3IOCA 1W85B 3MPZA 4TVKA 1VOTA 1L7OA 2I1LA 4MEBA 1P2DA 3PQDA 4RPKA 1HYQA 3KSMA 4NPCA 1VBMA 4TLDA 5ECWA 2JFBA 3QM1A 3KQPA 3C3SA 3X1WA 2BGWA 1MIOB 1KI7A 2ETXA 1KOFA 3R8XA 5BOSB 1QQTA 1XHXA 5J2UA 3VUFA 1QF9A 4O3MA 5F52A 2FA9A 1EFTA 2CLHB 1PR3A 1Q43A 4NLLA 2IYEA 4OATA 1CULC 2ZQ5A 3SNHA 4BO5A 2F1OA 2ZXFA 4C88A 4Q7LA 1H8HA 4YN3A 3VI3B 5IT0A 1HYGA 4MP8A 1LK0A 3B1VA 1HT0A 1M75A 3EZ7A 4NFLA 1G19A 2AN1A 1EFLA 4KJZA 5D86A 1WLYA 2C84A 1NVDA 4FXPA 4G3XA 1KYIA 3CNHA 2VJQA 2O2YA 4XGRA 3K15A 3DOHA 1Y3CE 3K0EA 4OQQA 3C3WA 3PPIA 3CXUA 1D6NA 3KZ1E 2C5EA 3DF7A 2QG4A 3QWAA 3QNMA 4P81A 3K9QO 4BNDA 5CW6A 2ZYDA 3O92A 2I33A 3HV0A 1BH2A 4N12A 2B36A 5K20A 1ZGGA 1GNTA 2V7TA 4KMSA 4OQNA 2IBMA 1NN1A 1N2OA 3AUKA 2YC0A 4MUMA 3Q40A 1ODSA 3LTNC 2HYIC 4OWPB 3VV2A 3RPEA 5JAHA 1F14A 3UWKA 2QT9A 3H1HH 3PJDA 4NK5A 4DIBA 2VSXA 1IJKA 4DSOA 3A28A 2OESA 1R64A 3PV0A 3DMTA 1PDVA 3ZK7A 1E7WA 1YL7A 4C4SA 1E3LA 3HPRA 3EIFA 4L9AA 2GHYA 4G0XA 3VQWA 4R5HA 1S8FA 4TXLA 1TVCA 3LQQA 3RUAA 1GSAA 2WHRA 1J56A 1CZOA 3KKYA 4HAMA 1IRIA 4FYYA 4MDHA 1IURA 4DLUA 2I5PO 1QH0A 1R6XA 3VAZA 2YYAA 2FPIA 4B33A 1U8YA 3FWHA 3CX7A 4BWFB 1V5EA 3P2EA 2YSUB 4KPYA 5IAGA 1F0KA 2AXQA 4YJGA 2H9AA 1K7CA 1VPVA 4TV9F 2PYZA 421PA 5AUOB 1JIXA 5BVGB 1ZABA 4UB6Z 1EIZA 3REOA 5C51B 2YEVA 3IFSA 3ZR4B 4B7KA 4LXYA 4FC6A 1DDIA 4FLZA 2HRDA 3FKQA 4K2HA 4HQFA 5BMOA 2PT6A 1XRJA 1VQ1A 3DMOA 2QX6A 2BHLA 4WFEA 2E4UA 1N4CA 3CISA 3UPDA 2IYXA 2WT4A 3RSOA 4CN9A 5DNUA 1CZNA 1NPDA 3MWJA 4IYJA 1U9IC 3RR2A 4EFNA 2WQ7A 3EGXB 2JFNA 2J32A 4UHJA 3VZQA 2D5BA 1DBQA 4YMTA 4ZQEA 2CF6A 3PA8A 4DIKA 5JQGB 4L7VA 4JJ4A 3KKKA 1M0EA 2AFHA 4PLHA 2PIAA 3CKLA 2WIBA 3BMQA 3NEAA 3AF5A 2IHZA 3R8CA 4LJ9A 2ZIXB 3IDSA 1CUZA 2BFAA 2Q27A 2NMVA 1U0LA 3Q10A 4G8DA 1KU9A 1DUIA 3HCDA 2WU4A 4HVLA 1OFGA 3VDNB 3I30X 3IMEA 2XGSA 2OZEA 1NXOA 1NVMB 3O47A 5AQ1A 5EKUA 1P6QA 3ON5A 2IWHA 3UJ6A 2JLVA 3ZS8C 3LQFA 3BCRA 1B14A 3NHMA 2WLLB 1QRTA 3GP8A 2AG1A 4ZVQA 3EFHA 1ZVVA 521PA 2RGRA 4IDQA 2CXOA 4ASUA 1DGSA 1CZHA 1T1SA 1TU0A 4Z0HO 3LC7O 2XB9A 4BQFA 3HHPA 3BKWA 2JAUA 3WMXA 1TK9A 4G63A 4BLVA 1FIUA 3WR5A 1M1YA 5FBKA 4LF6O 4Q00A 2GN4A 5F21A 1M5RA 4UOQA 1R6VA 3R6DA 3GLQA 1Z8DA 2FHPA 1G60A 1RABA 3WDLA 2PMDA 3U5TA 1ZXXA 5A2GA 3JTMA 2YY7A 1OF1A 3I8SA 1FDRA 1YS1X 4TL8A 4LVCA 3DWEX 2O8EA 2BFEA 3FRIA 2UUAB 4HI0E 3U81A 2GPJA 3ZI0A 2AXTZ 1M1NA 2BSQA 1URPA 2OBBA 2J0EA 4WK6A 2C5BA 5J2TF 3UUFA 2HREA 4A5SA 4P2ZA 4TS3A 3QBDA 4NMHA 3V8EA 3ONEA 1TJNA 4URUR 4MZXA 2Y69C 3U37A 4U39A 3P97A 4Q4AB 3EVKA 2O0MA 4S1NA 5D84A 3JQDA 4RLHA 4DLXA 4GX1A 1E7RA 1JJAA 2E55A 1SQ5A 1M6NA 4F93B 2NSYA 1ISGA 6AT1A 4DR2O 3HCAA 1E3DA 2BLNA 2Z2XA 3H0CA 4PG4A 1XHFA 1D7OA 4UTXA 3GWGA 3NOOA 4D81A 5LA6B 2CBZA 4GKJO 4JUFA 3H9GA 4V0ME 4OXIA 1TTQB 4ZYZA 5LQMA 3OF3A 3V8NA 1M74A 1M10A 4GRDA 4UMFA 4D9MA 4Q15A 3H8JA 3NORA 2HHJA 3EG9B 3PB3A 2CXPA 1J8MF 4IIDA 4E22A 1ZS9A 1RC8A 2V4ZA 2JVDA 3ITNA 1G98A 1BEEA 4JL8A 3ESZA 1T9CA 3BIXA 3N2YA 3OJLA 2ZNVA 1PIWA 1M67A 4KMMA 4BVGA 1OCCC 3IKJA 5KSPA 2LPMA 4FIDA 5C1OA 3I55V 2PBFA 5BN5A 1X74A 5EL0A 2AXEA 5F9FA 4ALIA 4EUNA 1T1JA 4PVDA 2V96A 4L5CA 4FDLA 2Z8YM 2XDQA 2YJNA 2Y3IA 2ZRNA 4LF5O 2QDXA 3AZOA 2I2CA 2X76A 2HK7A 5TSDA 2BL4A 3L75H 4Q6GA 1G2PA 4C07A 5JG7A 1QH8A 1HUQA 3GRZA 3M89A 2YVUA 1SS3A 2O3QA 2YS7A 4E21A 2GAOA 1XZMA 2IU4A 3C5WP 1V8ZA 1ECCA 3NGLA 1Z83A 5IYBO 2XODA 1Q7BA 4R2KA 3EXIA 1AURA 1LDNA 4ZZ0A 4CMEA 2JLCA 1JKMA 1OUMA 4NG4A 4YRQA 3HMKA 5GJVC 1VKNA 1JMYA 3Q3IA 4DV3B 3QVXA 5K01A 5D3KA 4PX3A 3L71H 4UVBA 2X7HA 4EX7A 3SYKA 1BX0A 4HP8A 3F6EX 1K06A 4ZQBA 2UU9B 2BY4A 1PVDA 4N18A 2XA1A 1FMJA 5ICFA 1J8DA 2FUKA 4LXGA 4W8HA 4ZV7A 1C7EA 4ND2A 2IVZA 4G89A 3H9EO 4MK4A 5JJIA 4IIYA 2F90A 4CLRB 3DMYA 4GSYA 4XLTA 3SJUA 1K08A 3D43A 1Q3EA 3AK4A 3KHKA 1XDSA 2FN7A 4O8ZA 3SK0A 2OZKA 3CKYA 2NSJA 4R3UC 2VXOA 3OUFA 2V7BA 2EP5A 3BOSA 2QD4A 3G0HA 1M2EA 4AFNA 3PITA 1NFRA 4UKDA 1ZZEA 2XYQA 2XXAA 2HSWA 2X8LA 4C5BA 1QHEA 2AC4A 3A0RA 4G85A 1XUQA 3CZQA 3BA8A 1M1UA 3VGPA 1RM1C 1EDOA 5GADl 4W5OA 4JBXA 4R84A 3RI3A 3ILYA 5IVIA 1OX4A 1L3IA 4MRNA 3CC2V 4OK3A 4DCJA 3WRYA 4OGFA 4EO9A 1W59A 3I9OA 2WB4A 3HB1A 4JHLA 5IPFA 3R23A 3EFEA 1JX6A 4FQ8A 4HJRA 3T7AA 2WV7A 2B5UA 1UK6A 2AOTB 4I55B 1FXKC 4LZWA 3WLNA 4WKOA 4IIXA 4YI5A 4EA7A 3CJHB 3ZTWA 2P2DA 1Y63A 1UX1A 4J9UE 3LDFA 5FR1A 2XVMA 4LF9B 3D2AA 5KKAA 4RE6A 1JEQA 4N9QA 5A9TA 3DAHA 3TW8A 2WG0A 3ICXA 4EI9A 1AR4A 2KSQA 2PWBA 1RLOA 2R1ZA 3GIWA 1ZSNA 2VTEA 3U7GA 1DSSG 4Z2AA 1IG0A 3QVWA 4RD1A 1BIFA 5KOHB 4MKZA 1Z63A 4PIMA 3NVKI 3E2IA 1EE1A 3QY0A 2Z8YA 1QV9A 3TKAA 3V1MA 5IBRA 1OHHG 4M0EA 4L07A 1EZVH 1EM1A 4D9NA 1FFTB 3BBLA 2PRJA 4TLLB 3EA5A 3EIOA 3SLRA 3U9TA 3AETB 3GT3A 3RK1A 4EUFA 4BKMA 5DN6A 3PHBE 2C2BA 1HFEL 4QOGA 3P5SA 1OYOA 5IU6A 1BJRE 2G4LA 3IP8A 1DF4A 4KQKA 2CL0X 2ODQA 1JQEA 5KHJA 4DW0A 2QN8A 3IL2A 4BMVA 4Z3DA 3LY7A 4P5DA 2ADFA 1Y8QB 1RP1A 1P3JA 3SE0A 4GKKB 3DMNA 3I6MA 4HSGA 1SB9A 3HDVA 4K81B 2RI0A 1HE1C 1VCIA 2P9HA 1OLUA 2JFGA 3OQOA 4GYWA 5G0VA 2H2DA 2Q4RA 4PYKA 1Q0SA 1UJ2A 3W1WA 1XNRB 1DAMA 2QX9A 2VUSA 1K86A 3DC7A 1GD1O 1PR1A 3Q8KA 2IJGX 4DMGA 1E2NA 5LR6A 2FF7A 4JVSB 1R4MB 5FI0B 3CRNA 1GUDA 2UUBO 1NQWA 4HO1X 5F33A 5IYZF 3VZCA 4KPUB 3K0CA 1AKUA 5D3MB 1P0QA 1D2GA 3EXFA 1VK9A 3SYTA 3U0VA 2GTSA 2B98A 2VHJA 2AN5A 4MB6A 4BXOA 3D4NA 3Q5GA 1L8LA 4DQXA 5DKFA 1WR8A 2EILC 1LTKA 2GYYA 4H1VA 5AESA 2Q0AA 2YICA 5ITSA 2NUPA 4PFKA 1Z8NA 5B1NA 1TKRA 4FOLA 4J2OA 1FVXA 5TGTA 4BO2A 4DANA 4WXPA 5ALRA 3QV1A 2YFHA 1C9NA 3I2GA 4PG8A 2VPZA 3BXFA 2Z3ZA 4JS0A 4Q0MA 1KJYA 5G0SA 2AR0A 2JJQA 5ADUS 2UUOA 3EUAA 1VLJA 3PUJA 5KWIA 1X38A 2O3RA 4ASUG 5EMJA 1ENVA 4OJKA 5TV2A 4G4SO 3AVWA 4QUAA 1B93A 3ZY2A 5LMNB 3OSUA 1GEEA 5TF0A 3QI7A 5FPOA 1QP8A 1CB0A 1T3GA 4I9NA 4ILEA 1WP7A 2ZB4A 1XBLA 2XHEA 1BMQA 1Q22A 2GUWA 4HBNA 4EENA 4CN8A 3WGMA 1GG9A 2R9VA 1H0RA 1E20A 1TZJA 1GTRA 1N34O 3Q12A 4JB8A 3MYYA 3NBYC 2G17A 1WOYA 2BFMA 2EATA 3O03A 5B3KA 4EEKA 3TTYA 1CIVA 5CDUA 5DEIA 2VQFO 3M6AA 4E5NA 2PWYA 1XMVA 2PT5A 3QRWA 3UT0A 1SK8A 5JMTA 5E2AA 3JQ8A 4FGZA 2YHAA 4P7BA 4DQKA 5A1TA 2AEJA 2C83A 2VDPB 3T1YB 3NDRA 3ICOA 4BFTA 2CT8A 2WOJA 1O77A 5FPPA 4DV7O 2WSLA 3CINA 1GN9A 5ECGC 3RHFA 1O94C 4YRFA 3S2UA 1GLVA 2OCPA 1K75A 1ZH6A 2PZGA 2WG2A 3ENWA 1UP6A 2Z5VA 3BPSA 2VZLA 4EBFA 2A94A 3A7EA 2UZ4A 2HRRA 1NVPB 1B3BA 1JU4A 2V55B 2XSZD 2V4UA 4EGAA 5CNIA 1VFPA 3T3NA 1LFAA 3KC2A 4OPHA 4RL4A 4Y7CA 1I7QB 2IPNA 3K6RA 3P4YA 2FE4A 3PIRA 1A88A 4ZP1A 3ZCQA 2XCQA 1PLKA 1F06A 4UHKA 4ZD4A 1PAUA 4GRIA 2FSSA 4JTAB 4PXYA 2AJDA 4IYRA 4QHYA 4DL9A 3SYLA 2X6BA 3EQZA 4BLWA 2VZ0A 1J25A 1SHKA 2BFOA 3TOZA 4YUVA 5ES4B 1EBFA 2CGOA 3IUSA 2YN2A 3GD5A 4BNNA 5FOQA 3CEMA 5K2MA 4OQMA 4MHTA 2ZRIA 5ALXA 1Z0UA 3O8OA 1FQKA 2P22C 1XQWA 2I0FA 3R3ZA 2RH5A 1Z26A 1U4NA 4L9RA 3S2ZA 3U1VA 1NJ5A 2EWMA 4GPEA 4ERNA 5LZ8A 3LUBA 4BYMA 3EPKA 1K7YA 4BE7B 1ID1A 4FGWA 3BTUA 3W5JA 4MV3A 3VI4B 2AG8A 3DAPA 4UDXX 1NXVA 2HMVA 5AKZA 2X8AA 4M0MA 1Q0QA 2RARA 3N0WA 4IDNA 2Z8XA 3R5SA 2PUBA 3FOFC 2GUGA 1QAMA 1QK5A 1F5SA 1W5FA 4RMJA 3CO0S 3TRHA 1HFKA 1UPFA 2DWPA 2XBUA 1FSPA 3DXYA 1W4RA 2WF9A 1LC0A 2QZPA 5FLXA 3I9V1 4DNPA 1AVTA 1QLNA 2YY5A 2JLAA 3CH4B 1KI4A 2HA7A 1V11B 4BGVA 4CKYA 3GCGA 1UDCA 2YZ2A 4ISBA 1JBEA 3R1IA 1XAGA 3NNSA 1JNXX 4HDCA 4P4SB 3PUZA 1T2CA 2NO1A 4CUZA 5IBCA 5CLQA 5AFSA 1A9YA 3Q7TA 1YZVA 3D6AA 1H2KA 4K3AA 1P61B 3DNFA 3K2QA 1QWSA 2JASA 4GP7A 2IYUA 2R87A 1OV6A 3BB4A 2RIRA 4L27A 1PNRA 2QG6A 4I1IA 5FFFA 5IANA 3F9IA 3DULA 3B4SA 4F4IA 3HI6A 1I80A 2JD1A 2HBZA