2IU0A

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH
publication title Structure-Based Design, Synthesis, Evaluation, and Crystal Structures of Transition State Analogue Inhibitors of Inosine Monophosphate Cyclohydrolase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
total genus 213
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2006-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2iu0A04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2iu0A01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu0A02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu0A03
2X8WA 1PKXA 2IU0A 1OZ0A 1G8MA 2IU3A 1P4RA 1THZA 2B1GA 1BXRA 1T36A 4EHIA 1M9NA 1WO8A 1S8AA 1A9XA 1B93A 2B1IA 1S89A 1CE8A 1JDBB 2XW6A 4A1OA 3ZZMA 1KEEA 2YVQA 1VMDA 5H3LA 1EGHA 1M6VA 1CS0A 1C3OA 1C30A 1PL0A 1IK4A 1ZCZA
chains in the Genus database with same CATH superfamily
1ND5A 2YFKA 2PLAA 2KHZA 3WGNA 1SCUA 1PZXA 2B8TA 1Z6AA 3GJZA 2RDMA 4H3VA 4G5RA 2W2PA 4EUFA 2PUBA 2PGOA 3C39A 7MHTA 4RD3A 4X6XA 1HYQA 4HQFA 5IY5B 3GPCA 2NTEA 1HDJA 1TO6A 3QX8A 2IYZA 2MWMA 3V7UA 1RJGA 2GVNA 1A5ZA 2GHTA 4JYAO 4O2LA 4IHAA 5MN6A 1L7NA 4PO8A 1TD9A 1O95C 3MYRA 4K5QA 3IIKA 1Q21A 1EI9A 4P9OA 3C90A 2EW1A 1JQKA 2J59A 3AFGA 3BF7A 4MV7A 3M83A 1QOZA 4EG5A 4U3JB 1PD1A 3ZK7A 1UWZA 5LL6Y 5ALZA 3ZOKA 2PQMA 1ORQC 2KCQA 1MEEA 3JYLA 4EG7A 4DR7O 4Z9XA 3ZPXA 5JAIA 2RBKA 4TV8A 1SQBH 4TKZA 2PGDA 2PR2A 4I36A 2HP8A 4EG2A 1VYHA 4X88A 5GWXA 4LZZA 4UATA 3ZIAD 4ZEOA 1G4AE 4KKXB 5IT0A 4E31A 1ANKA 3D4NA 4QGPA 3GCGA 2VJOA 3VISA 3E2MA 1UBCA 4DIOA 3S55A 4R6WA 4B87A 5M59B 4XTRA 3RIHA 1ZM9A 4RWEA 4TLBA 4YRBA 4RK5A 2V7XA 1L1RA 4UQOA 2C99A 2GZSA 3B53X 3WXBA 4UCUA 1KI3A 1YL7A 3GGCA 3THOA 3LA8A 4H0CA 3K0KA 1OXMA 4A5OA 2C2HA 2P87A 1E3DA 3P7MA 3ZBPA 3LQFA 4Y2RA 2WA3A 2WHPB 2XHEA 1C1YA 5FLXN 3CPSA 2F3SA 5CXQA 5TMEA 5CT9A 4KQCA 4R2IA 5ALSA 2XNJA 1J25A 3OF2A 2H0QA 1OXBB 5DTMA 2ZT9B 2QN3A 1WEHA 4JVSB 1WPXA 4CUJA 2YFHA 5SYAA 1JG6A 2D1SA 3W2EA 4WHMA 3U37A 4X1YB 1G7RA 5HDQA 2R1TA 4JLKA 1GPJA 1FDUA 4TMVA 3DAFA 1RFLA 2HLHA 3L02A 3WIVA 4E2LA 5FH9A 5F5NA 3WDMA 1O94A 4R50A 2CUGA 3LUPA 1K0FA 1XIVA 1VE6A 3GRAA 2EV9A 5J9FA 3UYKA 5IABA 4BZZA 2GETA 5HHTA 4XVCA 1T9ZA 5LXTB 3EXIB 2YN2A 3G9UA 1GRJA 1IK4A 4Z99A 2FI1A 4M0UA 5F7ZA 3RUHA 3ELDA 2WTNA 3K6SB 3I52A 2H1CA 1FDSA 3G6BA 1MENA 1XTQA 3PD1A 1B6QA 3DAGA 3QG1A 3K4HA 4FX5A 3IT1A 3HJUA 3T9BA 2IZ6A 4RC9A 3H1TA 2OXRA 5K3FA 2SKCA 2QI9F 4DV5O 1I5EA 1OZFA 5A6SB 2FEPA 4XWTA 3BHNA 2I2AA 2TYSB 1REQB 4N0EA 5AHXA 2PV0A 4QEDA 1QORA 4I1SA 3RUEA 5LMNO 3UOWA 2XKAA 2X0EA 1P9WA 2FH5B 3GLGA 2OEPA 4IYRA 4YYEA 5IUKC 3NRCA 2RD2A 2DJIA 3QVOA 1VPWA 1JDJA 5KKNB 2F95B 4IYHA 4JLMA 4M1YA 3T12A 4J3FA 1E9RA 1ZNZA 2I67A 1O57A 1PCXA 1N5MA 2B4TO 1BG6A 3WHLA 2QKSA 1RTKA 4OFWA 2ZUEA 1RD4A 1KFCB 1N6KA 3IEUA 1NKTA 5KHLB 2E85A 5JAPA 2VOEA 521PA 4D5EA 2VP3A 3SNHA 2YHBA 1XWIA 1P7YA 1YGYA 3RWOA 2VC2B 3FB5C 4JJAA 2PIAA 1YIAA 3WNQA 1LPPA 4Y6SA 1D7AA 4JIMA 4M89A 4F7OA 2ZD9A 3T7RA 2FPUA 4JCCA 3SNKA 4LDZA 4PRYA 4XDHA 4D4LA 4LNHA 1TAEA 3AJAA 2JATA 2QGZA 4ZANA 3URKA 4B3SB 1HETA 2YFQA 4Q1DA 5KOHA 3NEJA 2GK4A 2JC3A 2AF4C 3IDOA 2HQBA 4L8YA 4RTNA 1HNNA 1HYGA 2UYQA 3RADC 2OHOA 4O4LF 4KN5A 4PDMA 1N0NA 4HSEA 4R2JA 1I1NA 1JKIA 2NU9B 2P79A 1XZMA 5E7IA 1W0CA 3GT0A 4Y9UA 4CKWA 1GGEA 1KIMA 2GPTA 5GINE 4KAXA 1DAKA 1P4RA 4UTPA 1VI5A 2KWIA 3ANLA 4QVGA 2A5GA 4PEVA 4R5HA 2VWPA 1TF7A 3E83A 4LFBB 3C3BA 6ADHA 3DMYA 5FLYA 4Q6WA 3KSDO 1FVOA 5LLDA 4CG2A 5F4BA 3BAAA 2G8NA 4OP2A 1MOQA 1KORA 1Z8FA 2AXQA 3HN6A 2SCUA 2V4ZA 1RRPA 3PFCA 1T4DA 2UXXA 1S2DA 4MP6A 3G8QA 3AG3B 4MQFA 5CFMA 5GVSA 4Q4DA 4UPVA 1FTQA 1MAHA 1QR6A 4UASA 4C6TA 3DXXA 3DMTA 2DT8A 2NN4A 4MVYA 3PFNA 1PNOA 2C03A 2NYUA 5NLLA 3JYHA 1MB0A 3OPVA 1DKNA 4HAXA 1OZGA 5AVWA 2WM2A 3RSQA 3L6BA 4JI1B 4F3YA 4HNUA 5IH7A 3D2AA 1YAHA 4INAA 3OZEA 3ROMA 2GRAA 3P0FA 4Q7JB 5LN1A 2MOKA 5JZSA 2V7TA 3ZJVA 3IEVA 2PYJA 3E22A 4FLUA 2V54A 4MVXA 1ZC4A 1RM4A 4HR7A 1UWLA 1AZLA 1VLLA 2C0CA 4BGVA 2ODMA 3V8QA 4ZAWA 2PLFA 4BGDC 2X8JB 3GB7C 4LOJA 3ZCUA 2QUJA 3TXSA 4KRYA 3FPJA 3DDCA 3LWBA 1D4ZA 4QSHA 1XZGA 2ZIGA 2F00A 4UULA 4WDQA 1NTMH 1ZO8A 1VQ7V 3WQHA 2A88A 4F3TA 4CM4A 1KU0A 2VPWA 5KOIA 5HS6A 1K6XA 3VC3A 5C93A 4EHFA 3P9RA 3BEHA 1SXJC 3RC9A 1N2CB 3PP8A 5T5QA 4O2AB 3IKLA 5L3BA 5LVAA 2FEXA 4HYOA 4QDXA 3V33A 1XL1A 4UCXA 1OJLA 1OXXK 4X94A 2CJWA 5T8KC 2FHPA 4DLVA 5JV5A 3OIGA 3MGGA 3QLTA 4QOJA 5ETJA 2W58A 4RHFA 4MP8A 2I3BA 4AICA 3IJ5A 4LHZA 4QM6A 1OBCA 4DZTA 4DA9A 4QAQA 1TM1E 3MWEB 4LP8A 4Q9HA 2QSAA 4X92A 4JLBA 1G8KA 4POAA 4OU5A 4NXNO 5L4NA 3PX3A 2VJLA 1H9BA 4X1OA 2IL1A 3COYA 3HA3A 3QNMA 5E7QA 4L4UA 3WHPA 1VHLA 5E3JA 1P0FA 2DT5A 1U11A 1V5GA 3KR9A 1XD2A 3ZE9A 2QMUA 2FUKA 1NJFA 4QHTA 4D42A 2HPAA 1XP5A 2GBLA 2OY0A 3MWKA 3PFBA 3CSDA 2AR0A 2G36A 2OHJA 4G8BA 1RI3A 1T5BA 4N3NA 2GPBA 2ZJOA 1YRBA 2VT2A 2AF3C 4I1VA 2VWKA 3RASA 3TRFA 1JDVA 1AVMA 1DKUA 1N1DA 4ZJZA 1KR2A 3E82A 1M1NB 2WU1A 1U0BB 4AZVA 5JEEA 1RLJA 4QFDA 4G9EA 2V3CC 2Q7OE 2C58A 1XJ5A 1ETHA 4KBFA 1G19A 1UXKA 5LZ8A 2RI0A 1YJWV 2P9BA 4ZEMA 1ZIPA 5LP6F 4KUEA 1RLIA 4AJPA 3ZTWA 4FGWA 2X0FA 2JS3A 2QXUA 2X41A 2FEAA 4QG3A 1XQWA 2FZ5A 2QYOA 1SVIA 3RU2A 3I04M 1E6WA 3WKCA 1H3EA 4PF1A 1ORTA 3MB8A 1XVIA 4CEHB 4RJ2A 1WNTA 3S8YA 2OLJA 2LE0A 1MB4A 4IQFA 1NYRA 2VDPB 3RW0A 4KIUA 3KQOA 2HK8A 1TVCA 1OYWA 4MA4A 2JIPA 1DAFA 4HDNA 3GN1A 1H85A 3T8YA 3E84A 3JYPA 3HBFA 2I33A 2GHRA 2AJDA 3KHTA 3BD6A 5B1BC 3T7EA 2QV0A 4J2OA 4PQTA 4MYRA 2RH9B 1RPRA 2C1XA 3FB4A 3WLPA 2ZPUA 2GDZA 4QYIB 3L75H 2OECA 1E9FA 3E5NA 5GV7A 3Q1KA 2FFRA 4QXQA 1XDUA 3KJHA 4CHTA 3ADKA 2UV8A 3CLHA 1QVRA 1TX4B 4IIJB 2EVWX 1KH3A 4XCVA 1H5QA 2P4KA 5IJZA 5TPWA 4QPCA 3PKZA 4MWBA 3KVOA 4XFDA 1UK6A 5JNUA 3HGMA 5DGCA 3FLBA 1QUEA 3FYCA 1N2XA 4K8OA 2AGVA 3OLVA 3WWZA 2FSUA 3NT2A 3V4FA 3QVTA 3HZRA 1ULZA 1F2TB 4BMDA 3ZHSA 3VZQA 3ZNQA 1N92A 4ND4A 3G9ZA 1M2OA 1EN5A 3L1KA 2BFCB 2ZJZA 3S1SA 1WOMA 2Q9UA 4O0MA 4YT4A 2WSBA 2IJIA 4RV5A 3AL2A 4KPFC 2YMMA 4XWOA 3VAYA 4FS3A 3RS7A 3OZTA 3M6XA 1B8VA 3B8HA 4F9FA 2PUWA 1BH6A 4BMZA 1DELA 1PDVA 3UK6A 2WHEA 5EL0A 3EDRA 4UBLA 3ZDQA 1RAGA 1UX1A 2YRWA 4QUGA 5HKAA 1BE0A 4CQMB 1EHCA 4BQPA 1DEHA 3V1MA 3MQ2A 2ZREA 2QT1A 4PSUA 4Y1RA 1OI7A 4UE6A 5A2QN 1UXHA 4KO8A 3TXXA 3ZS9A 4W7IA 1T9CA 5KNLA 4OLJA 3ZPCA 4FYXA 2FCRA 1E89A 4W5NA 5HCIA 2NUPA 4B4KA 4J0CA 2AZXA 1RT9A 4O29A 4J0QA 2GPWA 4NV3A 4FLMA 1VSUA 3MTEA 2VPIA 5ALKA 5BMOA 1KVTA 1FS4A 1Y6GA 1P91A 721PA 4DMMA 4DA6A 3I2GA 1XCGB 3AHGA 5DCAJ 2JLSA 1WCYA 1EB8A 1M4UA 3G2JA 4BL5A 1VLMA 1R9JA 5EJIA 1E62A 4GZLA 2FMTA 1SUPA 1N5OX 4M0FA 2V4MA 2FF5A 3D81A 2DYRB 4NZPA 1DMSA 2H0AA 1IRIA 3GGPA 4CL8A 3DL0A 2Y4TA 1Z82A 2GESA 3GY0A 1IM8A 1KEZA 2BKEA 4K9QA 2G82A 4JXXA 4KFRA 2YW2A 2CNNA 2EIKC 2CLMB 1GZ6A 1IXMA 4I1OA 3HJRA 4MV3A 2E76B 3ZNOA 1BEZA 2I2XB 3JCZA 1QVVA 2FQXA 4EMUA 3EW7A 3SKYA 2KG7A 1PUIA 2ZNIA 4WH0A 1K5DA 1SK8A 2OB1A 1BU5A 2GYVA 1FYVA 2EZ4A 4K6OA 3E03A 4DBLE 4WCEV 3GLGE 4L8GA 2C94A 2YDYA 1UPAA 2PFSA 2YI8A 1PGJA 1S8NA 1OCOC 4D81A 1X7DA 1U9ZA 1XHZA 1JP7A 2V6MA 3DMGA 4LTMA 3TM5A 1UOPA 3MINA 4RYLA 4DUZB 2Q2WA 4G36A 4BKMA 4DJDC 1FLDA 2X0IA 3LNTA 6Q21A 1AKEA 3MPUA 4NHOA 1SD1A 2WIGA 3GBPA 2JA2A 4CF6A 2R9AA 3DWEX 3EVCA 1NA5A 1YH3A 1DWPA 2ZNVA 4RKEA 1EWQA 1HURA 3WKBA 2BE9A 2C4NA 3U31A 1S0UA 1VLHA 1EUDB 1C30A 4IKEA 3AR6A 1SVOA 2YJTD 1U7PA 4F56A 1XJ0A 4LPSA 3ADDA 3RG2A 2E4YA 2JGNA 2XB2A 4JI4B 1ZUD1 2Y1FA 2JEXA 2ORVA 1H2AS 4EDHA 3HH8A 1T4CB 3KJEA 4B9EA 3K0CC 3ICOA 3UQ8A 4I4TA 4P81A 1TT7A 4EPXA 1UK8A 1RZRA 2O0LA 1LRKA 5AKLA 4LZNA 3LKDA 1GL9B 4IXWA 4IZHA 4HATA 2WJPA 3EXEB 5C34B 5TNXA 3GMSA 4DT1B 1QGUB 1PR9A 1P60A 3IV9A 4MIEA 3IPRA 1JAIA 3PIIA 4JWTA 4NICA 3HVKA 1QS0A 1JSCA 4OHUA 2O8EB 2XCRB 3B7PA 3NI2A 2JJQA 3VO2A 2Q9AA 4CR8A 2P7IA 2BCGY 2B61A 5DGDA 1O5IA 2H7VA 2IH4A 3H11B 2JLZA 1YQGA 5CN0A 4WECA 2ZWOA 1U3CA 2ETNA 2COKA 1Z74A 3CIOA 2C59A 5IJ0B 1Z0FA 2OFXA 4JTDB 1NR5A 3A1EA 3UZUA 4DFDA 1I0IA 4GICA 4KV9A 2OV1A 1OVMA 3HNRA 3IPLA 3OM8A 5H5JA 2FW9A 3FTPA 1DDIA 4EQ6B 3N0TA 2XUHA 2Y9PB 3VH4A 4GZ5A 1P3Y1 3AG1B 3QVGA 3DLBA 1U31A 1P5ZB 4P30A 5E9AA 1MKYA 4BX2A 4A8JA 3U0VA 1OV6A 4IG4A 4YAIA 1TB4A 3U80A 4FFBA 1ZOIA 2OSVA 4OEHA 3N28A 4F38A 3PNYA 4D96A 2FZCA 1DXYA 2Y4OA 2WNIA 3K8YA 1SQFA 1GPBA 1H0SA 4B8YA 3HR0A 1R0YA 3ZJ4A 3B8MA 4IVRA 1IVSA 1WWKA 4URWR 1L7VC 4IIXA 4EYKA 4MW5A 4Q4LA 3RAJA 4D4GA 3KQWA 4HNSA 3IP9A 2RIRA 4Y6RA 3RTGA 1YVUA 1FP4A 1S0VA 4LDPA 1R0RE 3RYIA 2LCIA 2XVXA 1N25A 1D9XA 3MPOA 4BGUA 4A2WA 1PV2A 3GQVA 2I6GA 1EUCA 3FBGA 3AW9A 1S1CA 13PKA 4ZJPA 3P5BA 5CDGA 1UR5A 3IX7A 3HA5A 2VL7A 3RC8A 1K8XB 3ZVMA 2JAOA 1PIWA 3ZHYA 3HXLA 2Z2XA 1Z4OA 3PQ4A 2HCJB 3QO8A 5LDHA 4KL1A 2YVAA 1QRAA 2ZGVA 1QP8A 4ENVA 4S1OA 1QG0A 2EW2A 4IQ8A 1JNYA 2Q1UA 4IWNA 3T9FA 4NCBA 4AG5A 1QDLB 2O1EA 4CLOB 3BMNB 4YCCA 1KOJA 3V80A 4TS1A 1CR0A 1C7IA 3RIGA 2YH2A 1BE6A 4M98A 4CMEC 1A76A 5GZ6A 1IATA 2PU7A 4HX2A 1QVFU 3TQHA 2G1AA 5EJ2A 3BF8A 2Z4SA 4IEEA 4RKFA 4RMJA 3A9WA 3JXEA 4HXGA 2JF0A 3QGMA 1PEDA 4BGEA 1Q74A 2XAJA 5K0CA 5MGBA 1TIKA 5K05A 2J4FA 5TEWA 2O8CB 1XJWA 4ETIA 1E4YA 1E3LA 3URMA 3TL3A 3ZD6A 5IZCA 1SQGA 4LMPA 5KNDD 4Q0MA 4JJGA 3ROTA 1NVPD 2QWPB 3DYIA 4G0NA 3ILVA 2WA4A 5CLFA 3R3SA 4E5VA 1XQYA 2OQ2A 3LPNA 1PFGA 4Q05A 4P53A 1CU1A 1NVTA 1WPGA 3VYUB 3WGIA 4Q3AA 4FM2A 1U6IA 2HWUA 3E18A 2CNLA 3B1FA 4EKGA 2YICA 4WA7A 1GZ7A 1K88A 4ZI3A 2DQKA 4QASA 4EY4A 2ZRHA 2AOWA 4A6EA 4S12A 1OLSA 2BBOA 1E9EA 2P9HA 4JQOA 3Q12A 2JZOA 4B3SO 3WFVA 1PWEA 5K8CA 1W0JD 3HSYA 1E4EA 1V71A 1ZOPA 2XGSA 4P84A 4K26A 3GARA 4OI1A 1HW7A 3WMGA 1PNQA 3N3BC 4AIIA 4IP0A 3VMFA 2G67A 2UXCB 1B6GA 1AGPA 2EXXA 5LJLA 2WFZA 1KY2A 3RC1A 1EK2A 1PDWA 2IX3A 4GM4A 2D5LA 3BK1A 4OQNA 3PDIA 4WK4B 4E5PA 4ZOAA 3G0HA 2PLNA 3BK7A 1FRQA 4OG2A 1FJHA 1X7YB 2VDUE 3UXEA 4UKDA 3UMVA 2KS6A 3EXFA 4XXHA 5AUPB 2ADFA 3WIOA 2HGZA 5B4VA 4LFBO 3BHJA 5AKZA 4MUJA 4JCOA 3H5LA 2GJ8A 1LX6A 1DAPA 4U8GA 3X43A 1JHZA 1ZRHA 1HYEA 3B9PA 1OKKA 2GTAA 4RK1A 1N1MA 4U7JA 1XCMA 4OK5A 4YY3B 2QL6A 4D9JA 2FX3A 2J3IA 2IYOA 5C81A 1Z2GA 1K0UA 3OUSA 2A2ZA 4XRRA 3LXXA 1DC3A 1SRYA 4YVFA 2ZUDA 4DM4A 5EXPA 4EIWA 1TNDA 4KUMA 2ILTA 1MRNA 2ZATA 3ZQ4A 4BRSA 3O8NA 5DI9A 1SA0B 1UIRA 5CJJA 3ORHA 2G5CA 1TFUA 2QAJA 4RY0A 1ZWIC 1HE8B 1ZGBA 4B6QA 4A5SA 2VP2A 2QTRA 1CR1A 1JHMA 1RPJA 1SZPA 4J0IA 3RT1A 5FPRA 3AP2A 5EUQB 2Y4UA 6LDHA 1Q57A 1VHWA 4XD7A 3AYZB 4JI1O 1UPFA 1EFKA 3JQ9C 1M74A 4JA2A 1GRNA 4WZZA 3O83A 3BABA 3H65A 3FH0A 5C5IA 4Z53A 3AB8A 1UKEA 4QTXA 1AKYA 2DC1A 2CMFA 4I9QA 3E8BA 4X0EA 4E5YA 2D1TA 3PTAA 3U9LA 4IGGA 4J80A 2Y69B 2ZT8A 3I9OA 1IEQA 3QUQA 1TXGA 4E3ZA 2ZYWX 4UUBA 1OASA 2B4AA 2WA1A 3S5JA 1RPOA 2O48X 2PSJA 1YJ9V 2CVOA 4TKUB 2VTBA 2AS0A 4ZQGA 1P2FA 1DIAA 5H02A 1GNLA 1E1DA 1E0KA 2UKDA 1GPKA 2I4OA 4OYLA 1YWGO 4GEGA 1K33A 4MQUA 1CVLA 1Q83A 1DJPA 3VR5H 4CKBA 3CLUD 3NEPX 1D6NA 1VHJA 4NNPA 2YS7A 3OY2A 4RMHA 3N2KA 1O4VA 4C7XA 2QRUA 1XLTA 4JOSA 5KZMB 2GEFA 3BH7A 3D0RA 2D5BA 2Q9CA 4HMQA 1K8ZB 2WK1A 4LRTB 4O8YB 4LNUB 3SZUA 2O0JA 1LZKA 1V5WA 2ZJ2A 5EZYA 1XYGA 1U0SY 2CN1A 1B06A 3QX7A 1NXTA 1WIWA 4S0XA 1P1HA 4Q1VA 2D1RA 1YZNA 4TLEA 2C2ZA 3MTIA 4TLMB 1KYWA 4W9RA 4LJRA 2QWXA 1JU3A 2ORYA 5A7HA 1ZD3A 3DV0A 3PXUA 4W5JA 2VP9A 3P9ZA 3CKKA 4F12A 3ML0A 1WAZA 1NM5C 1JEJA 2QZZA 5ILGA 4AMZA 3TL2A 5BXQC 3HRHA 1MQ9A 1TIPA 4UMEA 4UUJC 4BIMA 1Q1ZA 4WPGA 2IXBA 1FXKA 3BG5A 1YSBA 3DVAB 1J70A 1M2EA 2XAUA 4BE9A 3HLYA 1Z12A 3EGDB 2ALJA 4AXXA 1QNLA 4ETNA 1QQ7A 3W6ZA 5BQ5A 3KFVA 4DDTA 3R7WB 4FEYA 4C3VA 3F4BA 1M56C 3F3YA 2E1PA 1SXGA 3SJQC 3QZUA 2VHJA 1NH2B 3H0EA 1OIVA 3CVJA 2D62A 4HNQA 5J4YA 2QI9C 4CTJA 2SKEA 3TLMA 1UFQA 4B45A 3C4JA 3BAZA 4Q7QA 5K0NA 3PJRA 1MG1A 1LBIA 1B6TA 1W47A 2EEZA 2EJUA 1ZUQA 1A8QA 1JHAA 1FOEB 3FVRA 4HDSA 2FZWA 2Y27A 3SIXA 5EOVA 3PTLA 4YRCA 2I6TA 2IY7A 1TTQB 3Q0EA 4L95C 7MDHA 4OPMA 3GJ6A 3OQNA 1Z16A 4RX1A 2FL4A 3EEOA 3ES9A 4Y9RA 1XCOA 2V5VA 1FNMA 3HKCA 2FXVA 2OHFA 1F8XA 1KJJA 2XQKA 4D3SA 5AVJA 1ROPA 1J0DA 1Z4LA 3TGWA 4K3AA 4JBLA 1WSAA 2RGUA 3PHHA 4QREA 4TV9F 3AEIA 3UT6A 2Y3IA 1GLVA 2WZQA 2Z6QA 3C85A 3VBCA 1K6MA 1DAEA 1Y9DA 1PJRA 4AW9A 3TZQA 3NMUF 2O7PA 3SYLA 2H4JA 4C3UA 2WEKA 3INRA 3HKEB 4L15A 2XBLA 2VJMB 3SZLA 3ZHXA 5I7VA 1NN3A 4K1XA 4YWJA 3AM3A 1RWVA 3QUBA 1ZIOA 1T5DX 3DNFA 4ACBA 3H1GA 4HBNA 3WQSB 4C03A 5A9RA 2RGGA 4DPKA 5I9BA 2B3ZA 1RR6A 1TZMA 4FM9A 3BXFA 4XSGA 3SDSA 1KBZA 4A73A 5K7SA 5PNTA 3EBPA 3U62A 4QYMA 1R74A 4BASA 1NTKH 4UTRA 1N4AA 2O23A 2J4DA 2HCFA 1P1JA 2AZMA 4WIGA 2ESRA 3U1VA 1M2GA 5TXGA 3R5XA 1U3TA 4MZXA 1ZCFA 4IJMA 4E5KA 1JSLA 4AS2A 3LUDA 2KLBA 4D97A 4H7PA 3HEMA 3F6CA 4QDOA 3HXQA 5E3IA 3GJ0A 3LF1A 1ZVJA 1MAAA 1NLFA 3NHKA 1ENZA 1Z5VA 3FBTA 2OK7A 1N5KA 3KCYA 3P5SA 3M7MX 2L17A 4KO1S 1MC8A 2OWOA 3B1VA 1C0KA 3S1AA 2NV6A 3EFEA 1T2NA 3SAJA 3AR4A 5IF3A 3N8NA 3FR7A 3FUTA 2WZBA 2AWNA 1VKNA 1U4OA 4MS3A 4NZOA 5SZHB 3K03A 1IHUA 1KKUA 5BORA 3IPCA 2FK7A 3IDQA 4DQKA 5LFAA 3VR3D 2LW7A 2GBFA 4I9FA 4OSEA 1HK7A 4UHBA 4WXEA 4G1CA 4GWKA 3IB6A 2ID8A 3V46A 1EN6A 1KJNA 4YJ2A 1P7PA 4KXRA 1GQ2A 4IDDA 3AO0B 3MW8A 4EHKA 3BZWA 3ZWOA 3AQIA 3EIFA 4D3YA 3LO8A 1TAUA 2KYRA 4IDFA 4ASUA 2VDVE 3H1JH 4FUQA 2J08A 3BHPA 3CB2A 2IX9A 4BNIA 4MWCA 2X6TA 4J6EA 3T0GA 1NQOA 1MMMA 5D3KA 4IYJA 5FBLB 3BXEA 5HRCA 3ZV7A 4Q24A 4DQDA 4ZFNA 3CRCA 2FJPA 4MA0A 4BFCA 4MS2A 4QGSA 3EEIA 3L84A 3S2GA 3L2OB 1YIJV 4RZQA 4ENTA 1FXVA 2FR8A 2IHVA 3AK1A 5FLEX 2ZBFA 1G64A 1TZ2A 3OECA 1TK2A 3ZWDA 3E8FA 4KOAA 1DOAA 1TJ3A 3NNSA 1H65A 2PTMA 3VPCA 5CFZA 4KSBA 3MXOA 2ASEA 1L5SA 4QBGB 1GKIA 4R69A 3QUSA 4JI6B 1NG1A 1B3BA 5K0FA 1L4NA 4H59A 1E2FA 2WMYA 4JB3A 4WESA 3HUFA 4HS4A 1XE3A 4NFLA 4YRQA 1SBCA 2NU6B 2NX8A 1LV7A 4BN5A 4MVWA 5EQJB 3JAKB 1RHQA 1U2GC 2FPRA 4PZ9A 5JYEA 1F9EA 1U8CB 2A5YB 3E9CA 2GUZB 2NMVA 1X1CA 1SHLA 1VKJA 2I2CA 2GA8A 3SHVA 1PD0A 2CJYA 2ZB4A 1BHAA 3TO5A 1HRKA 3VZDA 3H5RA 3KYCB 2VNAA 1QHIA 5FPTA 2XAQA 4U6NA 1HL3A 1RJ9A 4OQQA 2WV7A 2XXAA 4Z4FA 2DWQA 1BE3H 1XCBA 1Z8HA 5FI3A 2EF0A 1S3GA 1KQ3A 2A8YA 1LXCA 3QPWA 1RRGA 2Y1DA 2CHVA 3IXMA 4C2AA 3O90A 4E2WA 4G5HA 4H6WA 4I9HA 4UCQA 3G8DA 3PIDA 2FFJA 3KQUA 4HAUA 2WM3A 2Z5VA 5G41A 3ZN2A 5JJEB 2G76A 4XB6B 4DUZO 2PA0A 4IYIA 2E37A 3U60B 3NBKA 3UTDA 3BA6A 3THYA 2CYCA 5FNZA 1M8JA 4HYEA 1NQXA 1C9MA 3ZXSA 4DEVA 3LPDA 5KYWB 2CYBA 3RNOA 4YREA 3E23A 4PLTA 3JSLA 4K86A 1BHSA 1NMSA 1JDPA 4G4SO 2GX6A 3VDRA 3PHLA 1FU8A 1ZNQO 3I42A 5D8DA 1GXSB 4MMXB 2BIFA 2EQAA 5AUQA 1XMJA 4L08A 3I04A 3VOSA 4B81A 3ASNB 3OZRA 9MHTA 3I73A 5JARA 4BTLA 1QCZA 4MUKA 2GJSA 3WO0A 3ZDBA 4KEAA 1DBIA 2D2IA 2VRCD 3COPA 3OCCA 4KJZA 1MPTA 4AJ2A 3SLRA 4AZTA 2BFWA 1JLSA 3B7GA 2AN3A 5I3CA 5B57C 3EIEA 1T8YA 2BEVB 4ES6A 5LDDC 1JA8A 1LUAA 2QTVB 1DAHA 2HSZA 2QOEA 5FUQA 5LP6C 5K2MA 1P7BA 2QF7A 2VZ8A 3MCTA 4ASUG 1BU8A 2WOJA 1ND6A 5F2KA 1U2SA 3GUCA 4O0LA 1EFLA 4NMHA 3CCRV 2GN4A 4I0XB 3QH4A 3K35A 1QMGA 1JB9A 1E9AA 3ZGZA 2DQ3A 1Y6FA 1VMGA 1JG7A 5C4MA 2ZSFA 4IMRA 3WAGA 3I4CA 3ACCA 5A2GA 1G1XB 4W7SA 3NH6A 1PFKA 4FXPA 1L4FA 3SJ7A 2IYEA 3GZNB 3J7AU 3SIPA 1YDMA 3GJQA 4C87A 1XAJA 1JQLB 3X1DA 1OWMA 3CLVA 1TF5A 4CH4A 2Z58A 3L05A 2RAPA 3AH8A 4I3HA 3W7BA 2DMRA 4CIWA 2WLSA 4QFCA 2YJ3A 1XOIA 3TMKA 4QL3A 2P7TC 4EG0A 4JELA 4BUZA 3A32A 4ZAXA 3HP7A 3HMKA 4EUNA 4ER3A 1ABEA 5KA6A 1WKBA 4G0WA 1GQOA 1NQWA 3OOSA 4I6JA 3DMFA 2OFWA 2IH3C 2QQ0A 3T1YB 1PJ2A 4V24A 3BH0A 5CLJA 3G8CA 3UB3A 4KBYA 4GP9A 5DX8A 4M36A 4PGHA 3GUZA 3U9SA 1UP4A 2ZJ6A 1EEXB 1QK3A 3LYLA 4EW6A 3R44A 4AY5A 3KUCA 2CKDA 1FVXA 1UMKA 2X5KO 3TLGB 3TZLA 1H2SB 3ZDXB 5KNCD 3LRXA 3RVDA 5AW8A 2W2QA 2P6NA 5GJCA 2W2VA 4ZO6A 3GDFA 1WRBA 3OW2U 2CNWD 4TSKA 3ZIUA 1RRFA 2OOSA 4G4GA 5FJJA 2QL5A 3IP7A 5BNZA 1WZNA 1MX5A 3B8NA 5DM2A 3HEBA 2ATXA 4LF9B 4BNDB 4EUKA 4TZKA 2HREA 2P30A 5H3CA 2DH5A 2V4UA 3QYJA 1SCIA 3G5LA 2KX7A 2ZAMA 2O2EA 4WXMA 4XDZA 3WNVA 2NVUA 1VMAA 5K0TA 4JB2A 1I7PA 3JY6A 2E1RA 1E3TA 1YK0A 2RHWA 4Y1EA 3EPKA 3DO5A 1B93A 5JRJA 2A14A 1M1XB 1SBTA 3G71V 2BE3A 2GEBA 3RAFC 4RIHA 4HN4B 2OP1A 4Q1AA 1Q92A 4QGFA 1ODLA 5CHYA 3MOGA 4IR7A 1M3SA 4HEJA 5IEBA 4O1IA 3WKEA 1J2UA 1SNYA 2FMKA 1PR3A 3CU5A 5AHWA 5AVTA 2ISQA 2IC5A 2LVBA 4MGZR 2ZI9A 1Y5LA 3V32A 4G8CA 2N0SA 4HWGA 2IYFA 2FW0A 1FFEA 3KQPA 5JH7F 3R0JA 3HCEA 4BOYA 3KX2A 4I55B 3V1KA 4RIGA 1YDGA 5CFLA 3W2TA 2OZVA 4EJFA 4N3GA 4H15A 4GX2A 6GPBA 2QX7A 5CIWA 3VDMA 3LTNC 3EX7C 3ZW7A 5CAEB 1WDTA 5EPEA 3LWNA 2OKGA 3F7NA 4RJIA 2C88A 4ZPXA 3K1AA 3I9KA 4CT5A 4KR3A 1G5HA 2VKQA 5EWJB 1V3UA 3U3RA 4XM2A 5IW8A 2HU7A 3OWHA 1L5YA 2QJOA 3BXHA 2YXDA 4QPZA 3GD5A 3AG4B 4B9AA 4GCZA 4OX9Y 3BDVA 1WTAA 1GUYA 4PG7A 2V1UA 3VO9A 1KSJA 3SBDA 5KHHA 1E1RA 4HGPA 4DV2B 3N07A 4X6UA 5JXHA 2Q5QA 3G2QA 2W6PA 3H99A 4P4TA 2UXCO 1XTRA 3D7KA 1QE0A 3AESB 3ZHZA 1WLSA 3ZZUA 3ABSB 4YMHA 1ISIA 2H92A 1PI3A 3REOA 3NW9A 4YMTA 3JYNA 2G09A 2OV2A 4IZ6A 3I3SR 3ESYA 1I1OA 3WK4A 4P0TA 2RGYA 3ZCSA 4LMRA 4HUQB 5E9WA 1VJ5A 4C4YA 3RFCA 4YY3O 2FY8A 4IGFA 3QVMA 3DGFC 2H8PC 4DXAA 5AXCA 4N0QA 3CWZA 1JWLA 1Q7YW 3LUGA 3DKIA 2DFLA 2VDWA 1P2SA 1Z28A 3DCNA 7GPBA 2AR9A 2YWJA 3HXTA 5CT5A 4QUHA 3G80A 2FVYA 4B4OA 3EOAI 3HCAA 1QF6A 4DWVA 1HXHA 2BZGA 5JD5A 1RMTA 1YFZA 4KLRA 3AERB 5TC4A 5BV8A 1AGNA 3ZR4B 2DJVA 3CX3A 4IIBA 2B8NA 5EK0A 2XYPA 3Q7IA 3C5WP 1P9RA 2HH9A 4HQNA 4EL0A 2H4FA 5ARDA 5IARA 4B8ZA 4QECA 4YRAA 5LIRA 5EP4A 4BEVA 3V7WA 3IOCA 3F3MA 3W3ZB 2G6BA 3FOZA 2XDWA 1KPHA 3KALA 4PV7A 4LKRA 5KX5F 4UJ5A 3LDHA 3ABIA 4ZIRA 3K9SA 3OPQA 5JFTA 3NWJA 2QW8A 2WWTA 2AMVA 4GS5A 3NHFA 1CUAA 2IZ5A 2WAXA 3IAHA 4FYPA 2FUG1 1Y3CE 2ZBEA 1ZI8A 1MGOA 4ZV4A 2HRBA 1T0PA 1YBHA 5LQMA 1BD3A 1C1DA 1WDKA 4O4JF 2YXBA 2WJGA 4CKYA 3AEXA 3OCUA 2XZLA 3OQIA 1V39A 3PS9A 1R15A 3V8MA 4CR6A 5TB5A 2PUHA 1CIVA 3KAJA 2H54A 2QSUA 3SDBA 1K97A 2UXBB 2ZINA 3EDOA 1EP2B 5JR3A 4J9ZB 5EJGA 2DUWA 4JD5A 5JMPA 1QU7A 1KP9A 2AR7A 1BMFD 4JN6B 3BX1A 2OFOA 3QJ5A 3B5JA 1GTL1 3P9SA 3BMCA 3ER9A 4L6AA 4LYEA 2YWFA 2HNAA 4NAUA 1NVBA 4JL6A 4RFVA 4RV9A 3IRVA 4HVCA 4GDMA 3PCTA 2OAQ1 4P83A 1D5WA 4B3FX 4DSAA 1U2EA 4AKEA 2D3TA 3MDSA 5ALLA 1ZH4A 3I9V1 4UCOA 1ZSNA 3EAFA 3RO7A 5I5GA 3Q9SA 4KYTA 4TPKA 1BCSB 1TO2E 2FP4B 3DEFA 1GUDA 4RF5A 1WMAA 3ESAA 1YS4A 4M22A 5TF4A 5E4JA 3OTIA 1X0XA 1E1RG 1TOAA 1U0LA 3DDZX 3FTEA 4BYGA 2NACA 1FUEA 3G7SA 5T57A 1BNCA 4R0VA 1A9YA 2A92A 3K5PA 2PI4A 3AHDA 4DRZA 2C1ZA 2J3MA 1O6GA 2CBXA 3FJOA 4WJKB 3APQA 4MGIR 5M04A 3ZNNA 2EWWA 1QOPB 4G9GA 1C3OA 2QZSA 4LXTA 4B35A 4TMKA 3N2GB 2IJJA 1OLUB 2ST1A 2FX2A 4BO0A 2PW9A 2H7XA 3DFZA 3RI3A 1D2GA 1PVVA 5FB3A 3A70A 4UDOA 3SD7A 5JATA 4NJOA 1YKFA 3NTVA 1PNLA 2C57A 3KWJA 4FNOA 3X1KA 2MR6A 4CIDA 2A84A 4NYJQ 2X3FA 3ETQA 2C2GA 1TCUA 3EHEA 4OVKA 3SVTA 1X74A 1RBQA 4L5YA 4EEXA 3EXHA 2P9FA 1XRJA 2H1LA 3TW0A 4LWSB 4BW5A 3D8HA 2VQDA 3B2NA 1KJYA 4TTAA 4GXNA 1U9CA 2E82A 4L9AA 1UXIA 4UHFA 4NE2A 2FPXA 2REQB 2ZR8A 1WHTA 3ILXA 3IQEA 2GPYA 4BX0A 3USZA 2KMLA 1G5FA 2R7LA 1X0VA 2YOGA 1WLEA 3Q7TA 4JYYA 2X6RA 1T2VA 3H9VA 1U6KA 3LWZA 4D43A 2DR3A 1J20A 5IN4A 4GRIA 5CDUA 4GBMA 4XLTA 2XTZA 3S5UA 2FR5A 4CF7A 1IPEA 3KJZA 4AFNA 1T1EA 2QLNA 1LSOA 3DC2A 1QZZA 5TR9A 4FOLA 4OHYA 3CLRD 4OXSA 1E4OA 1QFJA 1RC1A 1JEYB 2QKAA 1JYSA 2EJVA 4PFKA 2R6HA 3RYHA 3LYUA 4YP7A 4RZUA 4RSGA 1UZLA 1LPBB 2DFTA 2AI3A 1XUOA 5IKXA 3Q9LA 3CKLA 1JQEA 3BQNB 2D5IA 2OCLA 1V11A 2VJDA 4IDEA 2QD4A 1WUJS 2YHSA 3SC4A 3PV0A 2E5WA 4LF7B 2B30A 4NR0A 4ZN6A 2R4UA 4ADSG 3ZEIA 3BXZA 4MKFA 2YKGA 1XT6A 1QP7A 1JXOA 2PV7A 1W5FA 1QPBA 3GV0A 4DTIA 3ZXYA 3F1KA 3PEVA 4WFFA 3VR5A 2D4AA 4Q3DA 2ZG6A 3PENA 2A9FA 1T2FA 1DO2A 3F5MA 5K6AC 5C37A 1EZJA 4P34A 1X7WA 2BPOA 5EMLA 1I7SB 3DSQA 4WVLA 3QHPA 4HAWA 4DLRA 1V3QE 2ZZMA 4Q9AA 2XZOA 1CUUA 3T4PA 1K8RA 4ALJA 5FOUA 1EA5A 2GK3A 5A71A 4E4TA 3A6EA 4M9CA 4GPAA 3KQNA 4GPIB 1VZ2A 2H2IA 3W5JA 3BXPA 2ORIA 1DWQA 3GFFA 4IIHA 3VFDA 4ZI7A 2V7QD 1QGOA 4KU4A 2CK3D 3VJMA 3U1TA 4YUWA 2PJRA 3L1VA 4DY6A 1Y7IA 3VNQA 1OTYA 1KZ6A 5K1XA 1HP8A 3RYCA 3KXDA 3UKMA 4TV8B 3HY6A 4QOHA 3OCQA 1TUBA 4WY2A 4OJTA 5DTEA 4OB6A 4WASA 1R64A 4QIWF 4L50A 5FLXA 1XYYA 2ZP1A 5C8YB 2L0XA 3HWWA 1P2VA 4G97A 2WG2A 3BDIA 2EBWA 4ZAVA 1OZ0A 3AM5A 4PS1A 5DCWA 2B34A 4ARBA 1KQGA 1NJ5A 2VT3A 2N74A 2FN4A 1GFZA 1SRRA 1G291 1QGED 5BNTA 3L7MA 2VYVA 1ID8A 4IHJB 1RXEA 3AUJB 1NBHA 2RDCA 2H17A 1MABB 4XGRA 4AZ3B 5F5LA 2PX0A 2O14A 4Y6PA 2AE1A 3IR6A 4QFMA 2YS6A 4BO7A 5DT2A 2LFRA 4DLLA 4O8XA 3NUQA 1NMYA 3K53A 1QJCA 2X4DA 2HNKA 1V54B 2QMZA 1OCRB 1YSDA 1DCKA 1E0DA 3UCXA 4CKCB 4JB8A 5ARCA 2WVAA 1PGNA 4Y67A 4ENWA 2O3JA 4E2YA 1YOVB 5CBHA 2IYPA 3ZE8A 2B2NA 3OC0A 5F1KA 1QF7A 3TNYA 4J0EA 3W78A 3K57A 1ACLA 3FTQA 1XOUA 3BAFA 4RZIA 2VZEA 1IURA 5E6RA 3QPCA 4GBED 3BTVA 4UAJA 5CVEA 1YL6A 1C1XB 3M5CA 4RE6A 3GNLA 4JFAA 2VHVA 1US6A 4DMGA 3QOYA 1E58A 5AI9A 3DS8A 3N86A 8AT1A 3PJEA 1Z2CA 5JNTA 2HLDA 3B6ZA 1P5JA 1KMIY 2CH7B 3W7AA 5BN3B 3S8MA 4NENB 1RB7A 4ZXFA 1K4MA 1T43A 2QAGB 3CG0A 1D2DA 4JI6O 4CIYA 5B1AC 5C5EA 3SC2A 4DV3B 4MHTA 1FYEA 4QOFA 4ZKDA 3L43A 5A3RA 1UODA 4KXQA 1KKLA 5FAKA 4JMLA 2TMYA 4QUDA 1G60A 3OOJA 4EUEA 4A2PA 3Q3JB 3SHTA 2WD7A 1A8UA 3AV3A 2QVBA 2PS9A 2VS1A 1KHHA 1GMGA 1E7QA 5AKIA 1G8PA 1OJ7A 1MC1A 1CRZA 2A0KA 2VCEA 3UMFA 1A5BB 4R8LA 2WZCA 2AFRA 4D57A 4NBTA 4BBPA 4XWGA 1YRQA 1UBOS 2B35A 1OLOA 4AG3A 4PGMA 1YE8A 4YV1A 1R0SA 5E9QA 2IOQA 2F93B 3PUKA 3O0DA 3QELA 2O7VA 3KPVA 4P33A 3A04A 1AXEA 1GT91 2PGJA 4DUGA 5HIAA 4I1PA 1WB6A 3DZDA 4X9QA 1XJCA 4RZHA 4OGWA 3BMQB 3P9KA 5JJIA 1Z6GA 4B43A 2PBFA 3T7AA 2VK2A 3ZLJA 3HK2A 4PYQA 3D6VA 1TW2A 2IS1A 2OG2A 3AILA 1JH9A 3VHQA 4TWBA 2P6RA 5CJ2A 1R7RA 1UMDB 3DT6A 2RKBA 3RIYA 2OVBA 2HA3A 1PLKA 2I78A 2YZKA 3I12A 3A2KA 5DBOA 1CZNA 4UBJA 4MYTA 2ZE5A 1PG2A 4GECA 4PNEA 4LOHA 2XLCA 3ETHA 5E2AA 4RULA 2QNIA 4JEIA 4IIGA 4R05A 3S2YA 2QTNA 5CIQA 3CXHF 2WLIA 3SZ3A 5TS3A 4L1KA 4DMLA 1IG3A 5TF0A 1AMNA 2FEWB 4Z7QB 3JASB 2CXPA 1SC9A 3LNMB 4DRXB 3VR4D 4MPRA 1N78A 1Y1TA 3CLSD 5LZ5A 4NJMA 5KOJA 4XX1A 1K86A 3WMEA 4IJ5A 2HDNB 3SXUB 2GZDA 3WL4A 4E08A 4WXPA 4G86A 1YZ3A 1H4SA 3T4UA 1YTFD 4PIMA 4YCMA 4GUNA 4IJQA 4JASA 2HXYA 2R0QC 2PCJA 1CQWA 4ZT5A 4BFUA 1IJEA 4YRGA 3QXCA 1OTXA 3PF8A 3FCOA 1YRHA 2OT5A 1QP0A 1PJZA 1WQ4A 2D6FA 4Q9NA 1HPLA 3NONA 1CP3A 3AHCA 3TLZA 2F3RA 4LV5B 1ZAUA 4RD4A 1HEUA 4UHHA 2AW3A 4AKTA 1VJTA 3LFHA 1FFDA 4X45A 4CBCA 1MX1A 3MJTA 2QJTA 5KJ6A 3VKUA 3PC3A 1C50A 5FNVF 2BHNA 1GZHB 1OPRA 2V59A 2Q6AA 1Y48E 4CI9A 1VF7A 4X63A 2DETA 2HVVA 3CONA 3Q7RA 4DCVA 1PV0A 3D8NA 3W3AD 2J0VA 2GDJA 3D8CA 1UK7A 5IFLA 4FHGA 1M34E 2HLDG 2KW5A 3OE7A 1SU6A 5NULA 1VGRA 2PGXA 1CEEA 3GNSA 1YI0A 1AUQA 3B12A 3WR5A 4LXYA 3VZPA 3GFRA 3NT5A 4AAYA 1N7IA 2UVPB 2QN7A 5JMWA 4W6QA 2EX1A 5EN4A 4HFRA 4E88A 5AKEA 3D54D 3K73O 3ZJZA 5T6BA 2WNHA 3CCSV 4Y30A 3QBJA 3Q3GE 4HWTA 2X58A 3T1YO 3T9EA 1A2QA 2WJVA 2PZJA 2P35A 3BD9A 1KJ9A 2VNSA 3L40A 4MYHA 1QR2A 4EM6A 5HGJA 2LDBA 2WUFA 4O2AF 3NHLA 4XR4A 4B2PA 3UAXA 3UV3A 1WBJB 3FHTA 5GJWC 2J46A 1OILA 3F6YA 4EI9A 3DKVA 3IMGA 4MQFB 3ELBA 1BW9A 1Q6IA 1GSOA 5LZ2A 3OMXA 4TTIA 4C6TB 4FI3C 1JIVA 1HWYA 3EN0A 4RFLA 1K9VF 4G63A 1I0HA 1RNLA 1M1YB 4FDUA 4ZA2A 1YCGA 2OHIA 3IS3A 1KTVA 3AHFA 4BJ3A 3GROA 1I0ZA 2XZTA 4LF9O 3OD5A 4PSAA 2I3AA 1H6DA 5JIBA 4U3FH 2DWEC 1XKTA 1GN9A 1T3SA 3L04A 1DZIA 1GL7A 4M86A 3CHXA 2P0AA 2PGIA 2O4CA 4YHHB 4DSTA 3SEFA 2A58A 3FIUA 1UDBA 3TSZA 4Q3EA 1QBZA 1Z7BA 1XVVA 3TZEA 4K6HA 3LUBA 3KHSA 5K1PA 1CUZA 5EP1A 5JJKA 3F2VA 3RIXA 1LKZA 1D5AA 3B9QA 4NV0A 2NZWA 2QTWB 3MGCA 1RJEA 2VSQA 4ID3A 5FTJA 2R1ZA 2UUOA 4JDPA 1XDSA 3FB7C 2GHIA 3GFGA 2X1LA 1E2GA 1ZSYA 3BMXA 2DYSC 3JQFA 4ZRDA 2FR0A 5HZMA 3IQHX 3STTA 3EIUA 3ZHBA 3RRNA 2UUAB 2V0CA 4DYHA 1XREA 1M6HA 4NL4H 1RZ3A 4BZPA 1F4MA 2OBLA 4BVAA 4IZOA 2ZQYA 2ZETA 1SC4A 2PGNA 1YRAA 4BIUA 4B6SA 2EINC 3T3PB 4G24A 3HNPA 4KQ1A 2IEDA 3BA9A 1GITA 4RL6A 1ZPDA 5CVTA 3G49A 1COZA 3W5SA 4ZVUA 3SWWA 4X00A 3GVPA 4B6RA 3PQ6A 5BT9A 3OZXA 3IE2A 4PCVA 3KOMA 1QTIA 2BT4A 5AW3A 1C0EA 3JARB 1OHHA 2YHIB 3QBVA 5JPDA 3QM1A 1JPJA 2D2CB 1PJQA 1QWSA 2BI8A 4M2LA 2QRQA 3TLBA 4V0NA 2BSKA 1TEXA 3UXYA 4CFZA 2Q0OC 4DV2O 3OE7G 5LGNA 3SGLA 3ZDCA 1Q20A 3IESA 1II8B 5DYTA 5FA8A 2HADA 3FGNA 5HJ7A 3LLUA 1Y37A 2P41A 1MUUA 3B13B 3FOCA 4IIJF 4LZWA 1OX6A 2V55B 4NOMA 5AKYA 1Z2PX 4EGSA 1G55A 4RMIA 4G4SP 2BFFB 3R41A 1C7FA 4F21A 4N03A 1THGA 2WA2A 2JA1A 1KETA 4KUHA 4O02B 2DPGA 3THXB 4YDSA 3T7KA 5HF6A 3TNDA 2Q5CA 1RCUA 1OX4A 2VJYA 3AY7A 1Z6QA 3VNVA 4MDEA 1SIWA 2IH5A 5D6OA 5B7PA 2QLFA 2FUCA 4DA4A 5IYCO 4ZBMA 3IR5A 5M34A 3EODA 1CUHA 1EINA 4OCLA 5AVUA 4EB3A 3E7XA 4CLRA 5L3SA 3W06A 4AMBA 3UGJA 2FUG6 3E8SA 4CV0A 3JVDA 2IEBA 1WDWB 2FQYA 3GNTA 4OAOA 4I5EA 4DR6B 1O95D 1LS6A 2PF4E 2OCYC 4LBYA 3D8BA 4OQFA 1U0GA 3K09A 2BEUA 4MKIA 3KUXA 3UJNA 4PO1A 3B2QA 1HL7A 3MC1A 1UQRA 1VG8A 1H2BA 4R16A 1T8WA 2D0IA 2OFFA 4RCYA 4JC4A 4YAGA 1R5JA 4POOA 3K0BA 2VHZA 3SPGA 3MXTA 1XTJA 5JJNB 3NHZA 3JV7A 2NQTA 1KEKA 1JA9A 4A03A 4TXNA 1Z88A 2M6RA 3GA5A 1PX0A 3RUPA 1MAUA 2CDAA 1BAPA 4X3CA 1L7DA 2C92A 3H2BA 1EWTA 4ENPA 3A1FA 5LP1A 2DFNA 4HLUA 1XC7A 3A4TA 2QTMA 2UXBO 3FOBA 4HQRA 1KJQA 3KQHA 5ALRA 7ADHA 4PLWA 1FB5A 4J7AA 5YASA 4WFGA 4YAKA 1U1FA 1ZCAA 1N9GA 2BRUA 1E3WA 4QFBA 4O33A 3L4BA 3G6WA 4MTGA 4J2HA 1PO7A 4PAGA 1OYVA 2PH7A 3CRMA 1DT5A 4C06A 5DNWA 3PDHA 3K6JA 4RXUA 4K0KB 1L7XA 4Q93A 5A2QA 3GHYA 3EIHA 3YASA 4G9BA 1SO8A 2QM4A 2GERA 1FPMA 4B3DA 3CB4A 1VI6A 1OHHG 2REXB 2DBZA 4NTZA 1VB5A 2AEJA 2CGNA 5KREA 1AKMA 3QE2A 2EIXA 1SOAA 1Y1RA 3U1BA 2IH2A 4COOA 3X2QC 1CX9B 1TYAE 4HYQA 4EHDA 3PPYA 1CTUA 3DOOA 2Z9BA 1AQUA 5IVDA 4RDCA 5F21A 4FLWA 2FV8A 4Y1RB 4DB4A 1UT5A 2Z5UA 2Q3EA 4JAVA 1V5IA 1FNDA 1XN1A 1DQYA 1Y4SA 2F48A 3SGIA 3NKLA 2MDTA 5JCPA 4I19A 3GJXC 5FPQA 2NUPB 4GNKA 1MLDA 1PTJC 3KJFA 1SCJA 1TQ6A 3PXGA 5BQOA 3MMPA 2VQFB 1ULAA 1D2CA 1XZAA 2DFKB 2X5NA 2LW1A 5FI5A 3PYLA 1JJAA 4G26A 4HD8A 2G4CA 2GAAA 1PR5A 2XW6A 2YIAA 1GM5A 4GSYA 2GVZC 2Y67A 2YXEA 5AG2A 3PNKA 2O4UX 1ZJYA 3WOVA 2KI5A 5GADl 1WDLA 1VL8A 2ODNA 4DF3A 1PTKA 2Q6VA 4DDVA 3K0AA 5FOSA 1OFIA 4GQIA 3NLLA 5C3UA 1NXQA 1OA0A 1R8YA 4RZXA 1S1MA 4DABA 4D46A 3VSDA 1YACA 2TRSB 2H65A 2H85A 1J90A 1MFPA 2VJBA 3LQ1A 4NYIR 3V4VB 4EO4A 2PYLA 4TLDA 2BI7A 3RREA 1QYRA 4UD2A 3A6KA 4MGKR 2W6IA 4AP5A 4PA3A 3KEMA 4DLXA 4FBLA 1YJXA 3FB6C 4C7MA 4ZC8A 1EVJA 5CLHA 3IQZA 4L5AA 4KLZA 1XEQA 1NP3A 5FLKA 1E9VA 3EZ9A 3N5KA 5AI0A 4LF7O 2RQ6A 1QMPA 1TE2A 4INJA 4BNJA 3Q15C 1NUSA 2BGNA 3J81A 1E59A 3DDNA 3UHAA 3OT5A 4FFMA 1IVYA 2P9JA 1HLGA 1E6KA 3FTNA 1Y6JA 3SIWA 1LI4A 4TVOA 2O8DA 3QVSA 3OM3B 3UT5B 2IUFA 4FJ1A 1AF4A 3E86A 4MUBA 2AOXA 3R7NA 3G2KA 1J09A 5ADWA 1MZVA 3MSXA 5JVDA 4LG1A 1AHIA 2PMKA 2JCXA 2YIBA 3EFFK 1PJTA 2IELA 5P8WA 4QVIA 5AOCA 1CULC 2AUNA 2C5LA 3WADA 2EFEB 3JYOA 4UNNA 4PC2A 1ODSA 4N8EA 2FPWA 3AGPA 4R5MA 1IEVA 1UJBA 3R0XA 1RQ2A 3RRMA 2E6UX 1DTSA 1PEKE 4KYUA 2N9UA 1LK0A 2PUAA 3KZMA 1L5VA 1UKCA 4PC3A 1L3IA 3QENA 1E6CA 3ECSA 1SCKA 4R8CA 1KAGA 2Q3BA 4CN9A 1ZINA 1WCXA 4J2TA 5KVCA 5IVHA 3F1LA 3HB1A 2DCUA 4JYZA 2Y1CA 1ISRA 1M73E 1VLZA 3E58A 4I4CA 1HDOA 4IOLA 4NATA 2JJ2D 1ENOA 2H51A 5JS1A 1CB7A 2HBQA 3F8WA 2PWPA 3M1IA 5B36A 4X3OA 4O8ZA 3FWKA 5FWXA 4IL6Z 1VYUA 2I29A 2YWBA 4K6CA 1DUIA 4JLDA 3H05A 4BVGA 2AI2A 4KGVA 4G67A 2JVIA 4NOJA 2VTKA 1WMFA 5JNVA 2BCEA 2O96A 2JB9A 3FKSD 4O2BA 3F5FA 4FZJA 3C41J 1VQKV 1RVDA 5L7YA 2V0GA 2BFEA 1WJZA 3VC7A 2B7BA 4GVXA 3NH9A 4QPKA 4ZT7A 4F4UA 3CO0S 1IRXA 3LLSA 3I9FA 1BWRA 5DBGA 1A2KC 1LBTA 4DUYB 3UK0A 1N32B 5AKGA 2LO1A 2VJKA 1XTSA 2G06A 2CJPA 4V1CI 1EHYA 2HTFA 2R7AA 1B0ZA 5ALVA 3GGDA 4JA0A 3H1HH 3QKRB 4A8JB 4AI6A 4D3FA 1OIWA 1ILWA 4LX0A 1PR1A 2ZIFA 4G89A 4LCOA 2A5JA 1OGIA 2VZ9A 1VMKA 4F9EA 4DV3O 2JIOA 1EXMA 3RC2A 4JI2B 4WZBE 2PBRA 1CY4A 1PL6A 3R9KA 4D44A 3B09A 2DWUA 5EHNA 2W6IG 2OGSA 1FYFA 1XX6A 3GQBB 3MQ4A 3NG1A 3A9SA 2IRWA 3FNHA 5E1AC 1W0KD 1M57B 4OMDA 5BV0A 4RZSA 3B6MA 3PKIA 1YV9A 3DM9B 1TM5E 3D3WA 4YQZA 4CG0A 4KMSA 1Z8NA 2R1VB 2WUWE 3P9QA 3KS9A 5JXIA 4ZVPA 3KTAA 4ZEXA 3WL3A 4UVEA 3UO3A 5BR8B 2Q4BA 2QAIA 3K9BA 1VG0B 4JVLA 4ZU3A 1Z0DA 3IBGA 3QMPA 3OPYB 2VSOA 1TMGE 5KDDA 5JISA 5MN5A 1ISFA 1SXJD 2IT1A 1WZCA 3W1VA 1RAFA 5IAAA 2LFSA 1SKVA 1Z17A 3Q3EA 2JHAA 2BOBC 3RVKA 4P5PA 4DYVA 3O4IA 2X8WA 1XDWA 5CDFE 3DOEA 5K8LA 4HYYA 4CC5A 1GFIA 4N21A 3U44B 2CLSA 1FSZA 3GPBA 5KAMA 1JB1A 3W5UA 4BBZA 4QE7A 5IY5C 4YJGA 2VAWA 4YDHB 2ZUSA 1A96A 5DGTA 4W1SA 1AZSC 1UC5B 5TPZD 1DFIA 4KO4S 2HHJA 3CJHB 4KJXA 1KDOA 3A1WA 3B6IA 2FQ1A 3WDLA 1Q3KA 3G79A 2UUPA 2Y1EA 3EE6A 1HOXA 3DULA 3ZRXA 2PUGA 5DSXA 4H3HB 3EUWA 4I50A 1Z35A 1P2BA 2VCHA 2VK8A 3NEAA 4UUNA 3BKXA 4IL5A 2LXNA 1A95A 4WACA 1DWOA 5ALJA 4RDHA 2H4WA 3I6IA 3IQIX 3P32A 3D6MA 1XXHB 2XAAA 1IXZA 4MUFA 4KV7A 1TZJA 4A92A 5ILQA 1K2WA 3L1HA 2JLAA 3DLPX 4P4LA 1GQQA 4J3NA 5TGTA 3QFCA 2BKVA 3LLCA 1OOEA 5HA5A 4PRKA 4O3MA 4HB3A 2WPDD 1NF8A 5CEEA 3LCRA 6NULA 4FM0A 2VK1A 4IINA 2BELA 3AV0B 3T1NA 1KAMA 3FCEA 2PT7A 3S81A 3GEGA 4EL5A 3BB3A 1DARA 2NAFA 4WZ6A 4IO0A 3PEEA 2IE0A 3UB4A 1RVV1 2POQX 3M3PA 4NSNA 5DTIA 3GNQA 5HCNA 2RGNC 4MI6A 2WABA 2O2SA 1XL4A 3AFIA 2YVQA 5I8ZA 5LQAA 1R6TA 3RUCA 2QRVA 3RG8A 3WI7A 1E94E 1COWA 1SG0A 3KZXA 4H27A 4EGQA 3CZMA 2R6JA 4C0XA 3SJCC 5AVOA 2HIMA 4D4MA 4EY6A 2GXSA 4I43B 4V0OA 1HEIA 1VIDA 5E1BA 4RLHA 4H0FA 1YTUA 3UYLA 2CBZA 1F1BA 3O3MB 4RBNA 3VR6D 2Z5FA 3KQQA 3AUXA 4RY8A 1K3UB 4P4NA 1H5NA 1WSDA 4QWWA 4F92B 3CUKA 2QT9A 3C45A 3P96A 1P77A 1EUQA 4L3OA 1BH2A 4G2TA 3ABOB 5A3QA 3ZRWA 2A67A 1GN6A 3NGMA 3G5UA 4XDJA 2I3GA 4JL8A 1KC3A 1EEHA 3RVNA 4D26A 3VR0A 1S2LA 3HYLA 3QOWA 3ABMB 4KOEC 3DBOB 4HVTA 2VNKA 4ER5A 3EMDA 1NXPA 2ZJ0A 4X61A 4AX4A 2W4LA 4M9XA 4W8HA 3IVXA 1P6QA 5CDHA 2Y1OA 2ZTLA 4HV4A 3KEGA 1E2MA 4RELA 1Z5UA 3U7GA 4MR9A 1U80A 2HSGA 4D0SA 2A3QA 4QT0A 3BXXA 4YHHO 3I5YA 3A2NA 5KU1A 3V55A 4UNSA 3DE3X 3R2JA 4Y7DA 4E7PA 4EGFA 1AHHA 3EK2A 1JFSA 2V45A 4YMLA 2EF1A 3K8QA 5JJCA 1HG0A 1GUBA 2AN4A 3OA2A 4R81A 2NW6A 4ZMRA 5JZOA 3NOVA 5EHIA 4CEIA 1UBHS 1KK1A 4ZMBA 3N2NA 1ECBA 4F60A 4PLZA 3RVLA 5J63A 4I5FA 4M0DA 5EP2A 5J2TB 4NCNA 4MVJD 1QP4A 3RVBA 2GMWA 3SJBA 3OU2A 4R68A 3I28A 3OE1A 2R62A 3CR7A 2QUHA 6REQB 3I0ZA 2UUAO 3B1XA 3NHAA 1UWKA 4U7NA 3GP3A 1TIYA 4Y9TA 8LDHA 5CDYA 2PX5A 1RQ7A 4AIRA 1C7QA 2AG0A 1SD5A 2XD4A 5EJ6A 1UBLS 1N5DA 1F51A 3OCVA 4XE5A 1K3FA 4WOPA 4OXXA 3NANA 2X0RA 3LY5A 1WW2A 4QDZA 3M89A 5EZYB 4DANA 2DLNA 3F97A 2HJRA 4H77A 4NCJA 3KQLA 3O4RA 2ZDIA 3MIIA 4X44A 5DE3A 2V8OA 1FXWA 4L2IB 4TUYA 3A9RA 2JLQA 5BSUA 4Q4JA 3CWCA 4LJ6A 5I7SA 4G5FA 5AHKA 2FW7A 3AF0A 3WGQA 4J9VA 3TRDA 4AILC 4U0JA 1OFTA 2P9YA 2G4VA 2IYSA 2QG4A 2GK6A 3F98A 2FMFA 1E6EA 1TLFA 1J9ZA 3JALA 1VPDA 1FXKB 4YAJA 5B58C 1R12A 1A0OA 1COWG 4PO3X 5KPDA 3CPEA 5HFJA 2DXIA 1US8A 5CHEA 3EEYA 4B2YA 3EC2A 5LQNA 3DB1A 4XWKA 2H31A 5CT8A 1JMYA 2Z6VA 3ROZA 5CDTA 4IVPA 1GR0A 2XYVA 2CVFA 2OBBA 4EF4A 2HJWA 1VCMA 1NVUQ 4D9BA 1N2ZA 2ZNJA 2QLTA 4R2XA 4YC7A 5ITWA 1DQRA 3CCBA 3V9AA 1IN5A 3WBFA 2OO7A 3KAKA 5ALPA 2A94A 4BCBA 5D7NA 5GTIZ 1ZM3A 1UM9A 4DSZA 1P0PA 3RDPA 4PG4A 1SZXA 3VVCA 1XR3A 2IBZH 1PQYA 4GZRB 1DPGA 4KIJA 3BVOA 4BAGA 2XA2A 2QUAA 5JDIA 2F3QA 4JBGA 5F2EA 2HT1A 4PPGA 3AG3C 5BSKA 4KK4A 1OW3B 2R6ZA 5M7EA 2YWCA 3HCBA 3NPAA 3R5KA 4DR6O 4K9SA 2HTEA 1YR6A 4U2KA 1ZGGA 3G67A 3Q5GA 1UOEA 1GGMA 3AOEA 2ZTUA 2PZGA 1J49A 1YZLA 5KQMA 3ZRSA 2QJ1A 4AZSA 2VP6A 3TJMA 5IE9A 1JVMA 3CH5A 5C7OO 2WQ7A 1USVA 4PI2A 3DAOA 3N27A 3PYXA 1XSEA 4IXMA 3ABKB 3KB1A 1M34A 2LP4Y 3OM9A 2EATA 3OX1A 1UKAA 4MQMA 2GCEA 4MV9A 4F5EA 4REOA 3Q4HA 5CLIA 4IXTA 2OCCC 1SG9A 1RWNA 2YTZA 3WL8A 1U96A 2ZKOA 1G7TA 1M6VB 1AS0A 3V2HA 1AILA 4CIXA 3KCQA 4FK8A 1ECGA 4MRMB 4EFKA 3OI7A 1Y5RA 2YWHA 5CVDA 1UBJS 3BIXA 3SPXA 2REBA 1Z33A 4GOKA 4LJYA 5ERGB 3ZV4A 3CF4A 1Q1NA 1NDHA 2C9BA 4OJYA 4E2XA 2WKQA 3HKBB 5KIAA 1G21A 3SFVA 1OXKB 3S1AB 4FOSA 5UKDA 3WA7A 5FPSA 1QH8A 3ASVA 2GM4A 1KQFA 2KM1A 3TTWA 4YONB 4K0KO 4MS3B 4MRSA 2OLEA 3VQTA 2GD2A 1S9DA 4V02A 4IHKA 4KZPA 1PNTA 3Q7SA 4V0ME 3GXOA 3PUXA 2XH8A 4MS4A 1KF0A 5KHAA 2UVQA 5HYVA 3SLKA 4TN5A 3PB3A 3DLIA 2DQYA 3FTFA 3TQCA 4OFZA 3CW9A 1CUEA 1P84F 3QMVA 1H93A 2VHEA 3OIYA 3LAWA 4B1FA 4MPPA 3I0NA 2CVZA 4L16A 2VHTA 1CUFA 5EEGA 3R8XA 3UN1A 4OCNB 1X86B 1TIBA 1GTJ1 2WTAA 1WB7A 1NIJA 3H8VA 4CEJA 4GUAA 4CL2A 1C9EA 4EF5A 5LMUB 3N75A 3C3TA 2Z08A 5ALXA 4DR5B 1GKUB 2JJYA 3AVUA 1L9KA 3NFYA 2VQFO 1JDUA 3NOQA 2LGWA 4EFLA 1B2LA 3E48A 4Z1MD 4XPIA 4H33A 5H6RA 4HTFB 4JBIA 4BXOA 5L51A 4D99A 2GDSA 4TYPA 1O58A 1E64A 3LPAA 4QRHA 1KWGA 2QRKA 3ZY6A 3DBHA 4KXXA 3R09A 1HYBA 3L77A 1JH8A 2ZCEA 2K5UA 3A6ZA 1W36C 1TEHA 5DN6D 2C7RA 1FNNA 2D06A 2IHJA 1OH7A 1GSHA 3CZ4A 1M2FA 2QL7A 2C0PA 3T0IA 1EB9A 4ZP1A 1MBZA 4KGXA 5REQB 2ZB3A 3SFTA 5F3DA 2CGOA 5MHTA 5IH3A 4EFDA 4GR9A 2WTBA 1MJNA 2XADA 3OJWA 4ZVQA 5EP3A 4XSHA 4B3IA 5JY1A 1S2GA 4WX2B 5JD4A 5HQTA 1FUYB 4FCTA 1DO8A 3MCVA 2PZEA 3ZUGA 5KHIA 2G6VA 1YJNV 2JGFA 2JGKA 2QRZA 1RJ9B 4TL9A 2XXAB 3TZCA 2SICE 3E1KA 2OBNA 4LRYA 4P82A 4X93A 2GBGA 3LY8A 5CBKA 2Z04A 3NYQA 1VQMV 2NO0A 4U9IS 4L4SA 1P4JA 3KKLA 2VAPA 3WFJA 3PL5A 5F2VO 5EQDA 1X7ZA 2QL9A 1SVMA 3S7TA 4CWAA 1CUIA 1V9SA 5ELLA 3UQYS 4JC8A 1KVSA 4ZV9A 4ZJUA 4CM1A 5EYPB 4JENA 2QMEA 3V4RA 1IBCA 2PH5A 2P22C 2EU8A 3GJ4A 2M2IA 1P18A 2IV7A 4Q3LA 1JHRA 2G04A 1FFBA 1N2BA 3E6AA 3K1ZA 3CF4G 1JRLA 2C84A 1GN8A 3FSGA 1R8SA 3SBGA 5L45A 4MIYA 1RYFA 3O9MA 4WI1A 1ZUNA 4DCJA 3LRPA 1GNVA 4K6GA 3V8NA 1FFAA 1D6SA 3P2YA 4IAOA 1SCUB 1M2VA 1E1CA 5E6UA 1QK5A 1WN6A 2C54A 3FDJA 3U10A 4MI1A 1QLEC 2Z0AA 4FEEA 2HY7A 5DW0A 3L79A 3D02A 4FYIA 4ND5A 4TYQA 1TU4A 5BSMA 4JI8B 5IVKA 2WSIA 1VE5A 1YHQV 1U2QA 4TRNA 2NO1A 2LR0A 3Q2KA 3O8LA 4LRQA 5ILOA 2JLRA 4TSFA 1IU9A 1WXIA 3PC7A 3ERCA 3CZAA 2OHHA 3GLQA 1VQOV 1SXQA 1KYZA 3OM0A 4H1TA 3W7XA 2ZAOA 2L2QA 2RGDA 2DFDA 2BJWA 4BLRA 2FSFA 1N6IA 5DECA 2CVPA 4DY4A 5IMBA 5EXEA 4J10A 3MBIA 2ZROA 2PY6A 2ZCJA 3K2QA 4JUAA 2Q9BA 2F8TA 1LNQA 1FSSA 1N3YA 1TCVA 3G89A 3NDBB 4EHBA 4N0PA 4IH1A 3KYJB 1DIHA 2WKPA 4Y9SA 1RI2A 1V16A 2GH1A 4Q7MB 1ZJ4A 3NDPA 5IS2A 5D5PA 5LXTF 3ZU4A 3RT7A 4DUYO 1RKXA 2OHVA 4M8SA 1N32O 2P65A 1I51A 3AKDA 3KLPX 2Z57A 1H66A 4Y18A 3EVDA 3LP5A 3LQQA 3QP9A 1K6EA 2AQ8A 1JT9A 4PHCA 2R7MA 5HR5A 5EBMC 3PL1A 2HR1A 1PPJH 4YFVA 4WADA 1XWFA 3A58B 3Q3IA 2WKSA 2QS9A 2LWIA 2OUKA 4E14A 4JI2O 3IUQA 3T5CA 3QEJA 2QD5A 4JNKA 5JCOC 3W4KA 1R3IC 4N5NA 2VF4X 4PELA 5IDXA 1ZVMA 2GHQA 3FNQA 4EPWA 1MHTA 2J3KA 3BMOA 3X44A 4FE7A 2I91A 3P19A 4EI2A 1IUOA 2X6CA 3ZCCA 2DULA 2RJOA 3EFHA 3R3ZA 4FNGA 4BLTA 5AVRA 4HX5A 3MGAA 2D1QA 4G84A 4YIKA 1X13A 9ABPA 4QNMA 4CCYA 2IYNA 1MIHA 1N57A 5CFPA 4YK7A 2X9VA 1NDUA 5BR8O 3HJFA 2R1TB 2HWYA 5TVKA 5KYXA 4JT9A 1G3QA 1YQEA 5DM6V 3HXOA 2JAQA 3GLFE 2HU8A 2IDJA 2B6HA 2HZ7A 2PMEA 2AI1A 1KO5A 2VO1A 1HDCA 5KA5A 3PFFA 1M90W 4MGEA 4F1JA 3CSXA 3R7DA 2BFMA 3QA9A 2LTAA 1E3MA 4CE6A 4PSVA 3GA0A 1DNPA 1PE0A 3ZXIA 3DFKA 1WPQA 2NP6A 3BC1A 3QTBA 4YAOA 4BO8A 4WCFA 3C6BA 2AJBA 2PXCA 1EUZA 1F51E 4CFYA 3CZCA 3TXAA 1WE2A 3AUUA 2CLIB 3UA4A 4XW2A 4QJ3A 2Q1TA 1AR5A 3GCXA 4DLNA 1SF9A 1JG1A 3KU1A 4N7JA 4WAUA 1NRXA 4WKOA 1QUFA 2G07A 4EKYA 3U4DA 5JZ9A 1GDDA 4L8FA 1T1JA 1ESEA 5KYYA 4C0LA 1P17A 2QU7A 4FLEA 5K3FB 5JDCA 3J81k 4J41A 1BKYA 2M7WA 4TSFG 2HIAA 5DFAA 1OBVA 2R87A 4QHYA 1GL6A 2XUJA 4PSKA 2EFHB 4KUGA 4UW9A 3SN6A 2XNDA 1F12A 3I6ZA 3GLGB 2P9TA 4ZREA 2A1TR 5JI3E 3IHLA 3BE6A 1Y3FE 1E1QD 3R3HA 4EVRA 5LWHA 1BGXT 3HZOA 4TZ6A 3DCYA 1AC5A 2WF6A 5GGYA 3CX7A 4KHZA 5I7AA 1QG2A 3SC6A 2R7NA 4EW1A 2JLVA 3K9HA 4WV3A 1L8DA 3WJAA 4B8WA 4N5HX 1WD7A 2FRVA 4MGHA 1UWCA 2LD4A 3QY0A 5TIIA 3IVAA 3O1JC 4CS2A 5C1DA 3QE3A 2QEQA 3VPFA 1ADFA 1RYHA 2H07A 3HB0A 4CM9D 2KPOA 3HRKA 4LC1A 2BW0A 3I1IA 1XZQA 421PA 2QUZA 2P3LA 2O8BA 4J3JA 4M83A 4P7GA 3DYBA 1Z8DA 3O4HA 4JBNA 2OFPA 2PGLA 3AG1C 1GQRA 3ZGVA 3FPBA 1BSMA 2HLNA 5L7WA 2R8YA 4L75A 4YX9A 4GXQA 3ORSA 4LCNA 1RHJA 1QLHA 5KOHB 3BJMA 2X14A 4E51A 3K71B 4MDYA 3O4FA 4KIWA 1EFRD 5HGXA 1PUXA 4EG4A 1F7UA 1GEEA 1K34A 4MA5A 1QYVA 3E2PA 4XH9B 1BEEA 1VIAA 3EBLA 3MT7A 1B73A 3K4QA 1WP4A 2WM9B 5T3UA 4TWKA 1JA0A 4P3PA 1X94A 1CRPA 3UHJA 2Q7GA 4CKWB 4BECA 1U3DA 3WNZA 4GQAA 2H0RA 1S4MA 1QTQA 4HMPA 1IDOA 4K9OA 4BO4A 1E0JA 2R00C 4FLFA 1XZIA 4GHWA 2BMAA 1LVUA 1DJOA 2D2XA 2FWBA 4DPMA 3OMNB 4H08A 1I7DA 1TTHA 2ODEA 1FDTA 4M76B 4FMDB 4HGOA 3AFOA 2XKKA 1PFYA 1X1TA 4XFKA 3S7ZA 4L6IA 4PWYA 1TQ8A 2WSMA 4YIHA 4B7KA 1DUVG 2ZDQA 3PKJA 3RWBA 2SCUB 3VKVA 1NN0A 2VI5A 3EG9A 3ZU6A 1YE3A 1HKHA 1G21E 2D4HA 2ZE8A 4P0PB 4B3HA 2R6CA 4N6NA 3U4AA 2HMTA 4Q15A 1F9AA 4Q20A 1EH5A 2VBGA 2EGGA 3OLZA 3K9GA 2DFVA 3OLQA 1G4YB 4QEKA 3SYMA 1KEEA 2QWRB 3DVSX 5IU6A 4ZYWA 4X91A 3DHYA 4JKIA 1F2VA 1LC3A 5FUWA 3OBBA 3P30A 1CJBA 5JSYA 3CF2A 2PMFA 2HV8A 1P1BA 3CURA 4Q00A 3KKMA 4WWHA 4WZBA 1YVPA 1WR8A 2OYCA 4X6YA 1PJBA 2PM8A 1AUOA 5BN4A 3K16A 4ZYUA 2J6IA 1L7RA 2ZTVA 4GMKA 3E3OA 4H35A 3AETA 1N2OA 5HFLA 2A4MA 3E22B 3PXDA 2XNDG 3ZBTA 2O2XA 4Y2GA 2XGMA 2FKNA 3T3GA 4W5QA 2OXTA 3ONWA 2CXSA 3HM2A 2IITA 4QAJA 1KKDA 2HNBA 4IHQA 2CNOA 4AMGA 2XB4A 4NOKA 4JAUA 3FD8A 1V2HE 3H17A 5KHGA 1JQJC 1FFTB 4FYMA 2WJZB 5HXAA 5JFOA 3F7OA 1SEPA 4UM9B 3PD7A 1PDOA 4HGYA 2I3ZA 5L8VA 4TROA 3A8TA 2Q7DA 2OD7A 3K9QO 1TJYA 4CM4B 4RO2A 2XWSA 2JIRA 1RFYA 1RW4A 2DTXA 2GBPA 3EB9A 3IA7A 3CCQV 2A1UA 3ORFA 1TFRA 4QJ5A 4CMJA 4L57A 4FD2A 2CLFB 1R5NA 5CXXA 1C3OB 5CDFA 2ZIMA 4KIGA 3TRJA 4ND1A 4RD1A 4FHZA 1W1IA 2CJWB 1G8GA 4OA8A 1S5LZ 3PRKE 2PJUA 1YCIA 1NUUA 2PNFA 1VSBA 2JGLA 3WMFA 1J56A 3WY9A 1W76A 2ERCA 3WYFA 1OV9A 2W90A 1I5RA 1G9SA 2OO3A 2IYLD 3LY9A 2WZDA 2JFYA 3U56A 1RADA 3LUAA 1IUNA 4MUNA 3DEZA 2GB4A 3EJ6A 4KPUA 2LKCA 3VPDA 5ELMA 1D2NA 3E89A 4CV2A 5EJ5A 1R4NA 3D4PA 4NYMR 3OC6A 1XD2B 2WFAA 5JCXA 3FYUA 2H9IA 2OR3A 1SY7A 3A9TA 4ZCLA 3UWMA 2XPCA 1B6SA 2YS8A 4UB8Z 2IF0A 5C8YF 3V7NA 2IZOA 2IKSA 4UBKA 5A04A 1ES9A 4HG2A 2ZYSA 3ORRA 2DB3A 1E0SA 4CN8A 1EBUA 4IHJF 4M0CA 1DKLA 2XVYA 4Q18A 2WIJA 3RVQA 4UTOA 5AW4A 4RTMA 2F17A 2O2JA 1Y33E 4YLGA 3N8IA 1DB3A 1P5HA 4W6ZA 5J1TB 4JI3B 1HSOA 5FO0A 4MS7A 4GVPA 3QKSA 2KJQA 3EGEA 2QQEA 1ZL8A 4ITRC 1VXRA 2I6QA 4Q66C 2QMHA 3U6BA 4Z51A 5KNDH 4P38A 2WE7A 3P2KA 2JVKA 1SC5B 2Y69C 4DDWA 1ORRA 3R76A 2RJ3A 4R1PA 3G7UA 2GT1A 1XTBA 1QKJA 2PL3A 2RH8A 4N18A 5LHHA 3FPAA 3ADBA 4D6TH 3WLLA 4MHSA 1KMQA 1XEFA 1H2WA 2VDQB 3EVFA 3HNOA 4J7UA 3MJCA 4EKEA 3VRHA 1W29A 1SVSA 1K8QA 2D3WA 4HDNB 1JHQA 4ZWNA 4CQNA 5C8VA 4KBGA 1Z45A 3TFOA 1DQZA 4D9FA 3S68A 4O25A 1TJ5A 4COKA 3B8FA 1H4TA 4PA9A 4DBZA 4ZMSA 2CCGA 1SOVA 1ZXLA 5DRYA 3AVVA 1F0NA 4C07A 3B38A 4WVFA 2EIJB 2G7ZA 3N7AA 2DPYA 4NCKA 1TUBB 4TGLA 4BQIA 5IDWA 3NTXA 1X8KA 5IZ4A 3AC0A 5ITZA 4ZCPA 2Y8EA 1E8MA 2QUKA 5ALOA 4MPTA 1T6BY 5JNWA 4KQ6A 5TPWB 2J5XA 4LQLA 3WTBA 3I9V6 4OQLA 1DBWA 1GU1A 1E60A 5JQGA 4UZFA 3FYEB 3KM0A 4XYBA 1EDDA 2XE7A 1H3NA 4EYEA 3MJEA 4Y1GA 2JLWA 3DYVA 2FEOA 3A1SA 1UDAA 2NQ2C 4UM7A 2BTOA 1UJWB 1Z18A 4M9SA 3BSSA 5F78A 5MN4A 4RHEA 4B48A 16PKA 1M2OB 1S2IA 1E2IA 3C48A 5HPYB 4U6SA 5LMUO 2QR4A 4DR5O 1ONBA 3IALA 2ZYRA 1T2CA 1AGRA 5JE8A 2OA0A 4KHPB 4A0RA 1UCFA 2JGEA 1NMEA 2W0XA 1I4TD 5EWLA 1Y80A 1MC4A 4IIDA 2OO5C 3LT4A 2AHYA 1RACA 3VI4B 3JRWA 4TRJA 1ORWA 2FLWA 2W2LA 4DV6B 2FP3A 1VPLA 1KEWA 4B3GA 2IDZA 4JYCA 1RSZA 4HGNA 5DK4A 2ZUUA 3PX2A 2CVHA 4FOOA 3BRSA 2N42A 2DF8A 1H8ED 1VARA 1U5AA 4OJQA 3ABQB 4R8VA 2ZRKA 1A7KA 1QLNA 4HZIA 5ABPA 4XD2A 1I2MA 4MCAA 2W0FC 3K2EA 2ZDHA 3LS2A 3O4JA 3EPPA 3BREA 1ZUHA 2XCIA 4HSGA 4C4RA 1P8JA 1NF3A 2MMCA 1P80A 3WYEA 4TM8A 1NT2A 5T4EA 3G6EV 2VHCA 4Q3CA 3D9QX 3FMPB 1YVEI 1KVQA 2H18A 2GFIA 5AQEA 1GN3A 1I1HA 3TJRA 3PT9A 5KTSA 1F0KA 2K9PA 1YKSA 4KQ9A 3F8SA 4RFSA 4KYIB 4EFNA 1H1LA 2KSDA 2O8FA 3FHCB 4CBVA 4UE3S 1LDEA 2Z4RA 1P44A 3LK7A 4B82A 1XKXA 2QYHA 3LBAA 4NRDA 1HE3A 1XROA 4F7WA 2PMDA 4F8EA 2RONA 3K2IA 1JEEA 3B9BA 4DJTA 2FR1A 3RVZA 2XMBA 3VR1A 2HPVA 2HZBA 2BUCA 3N53A 1C7EA 4IXDA 3NWPA 4UVGA 2KG7B 4EVQA 1LFDB 4WNYA 4JR1A 4DZRA 2JFQA 4MJ3A 2EZ9A 5JLJA 1NWHA 2BP7A 3PNPA 3ST7A 1AJPA 3ELYA 3VQYA 1LSUA 2R86A 4BNTA 4YCLA 1CQXA 2ZS9A 1EP9A 2C2XA 4QQ8A 1GK9A 4CMIA 5J4VA 3U6KA 2ANBA 5CT4A 1CEZA 4R7ZA 2I6UA 1SXIA 3NDIA 1A7JA 3KZKA 3MCWA 4RVFA 1Z2OX 2NU7A 1Y5MA 4YRMA 3MINB 4EW3A 4N39A 2Q5EA 5LQRA 2IHZA 4DMRA 1L7EA 2WUVA 1DKRA 5E4TA 4RPGA 4ZCIA 1FFHA 4TXJA 1S8FA 4P80A 4C30A 3HCFA 4R1LA 1Q1EA 1XDZA 3VKWA 2R44A 4JI8O 4HWPA 4K2AA 3OICA 3UH1A 1ISHA 4LF5B 2AN9A 3FBWA 2RHCA 2JIQA 4LXQA 1C30B 4HFJA 4B3BA 5CB8A 3FMFA 4OP1A 5FWNA 1ZH2A 3NBQA 8MHTA 2BFDA 1EDEA 2WVJA 5BSEA 4NC9A 4MSWC 1D09A 1PP9H 1X9HA 2XOXA 4PTLA 1HA3A 1I9CA 4V39A 3ZYZA 1YUNA 4UD6A 3I92A 2DVMA 2F7SA 4I4TB 5EZQA 1HSZA 2N04A 1Z4MA 1UJ6A 3LW7A 3DDSA 3TLAA 3GO4A 1LH0A 3TAXA 2JASA 1T6XA 2XSZA 1OROA 1WUKS 2AXNA 1UZMA 2DECA 4DM3A 1IULA 4AYXA 1L5QA 1Y1LA 4RF3A 2G5GX 1CLUA 4EZEA 2RAUA 1IBMB 1QS0B 2NZYA 1EBFA 3GU3A 3O7MA 5CDSA 4OXYA 2BD0A 3D5TA 3M6IA 2KQUA 2D2FA 3ZY2A 3A6DA 4GOLD 2HSWA 3PA6A 3CM0A 3N7TA 3R9WA 1CQIA 3TOZA 5DNCA 1VMDA 4PLGA 3QI2A 2CLLB 1RJFA 4ILKA 2OKCA 5FUBA 2EIMB 4KWTA 1V41E 4V0MA 3T0FA 2G40A 4Z5XA 1J07A 2QLLA 1EESA 4ISCA 4A23A 1PP4A 4L72A 1T6YA 5JJJB 3QVGB 4AY2A 4L22A 2VNHA 1OCCC 3HCNA 4MKZA 1Z7YA 4PNHA 4QVKA 4XB2A 3WVNA 2L42A 2D30A 4PHTA 3ZS8A 3CCCA 2XTMA 4FFBB 3U16A 3K32A 3WB2A 3DL2A 3NWBA 4YB8A 3EZNA 3OEHA 1R3JC 1YQ9A 5LGTA 2ZXEA 3LGAA 2RH5A 1EVIA 2MCFA 2BFAA 4X60A 3LM8A 3RS8A 3OMWA 2RG1A 1ZHFA 3R75A 1Z7GA 3N6RA 1MF7A 2EARA 4IICA 1F0PA 2WFLA 2X0JA 4BC1A 3RSOA 4WBNA 3KETA 4FEAA 3W5DA 1FP4B 3RYIB 3H1IH 5CVCA 5AW6A 4YDQA 3JQBC 4W5TA 2ZB2A 2NUAA 3WHKA 4O4IA 1EUCB 4WEOA 3N59A 4NMMA 2DW4A