2IU0A

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Based Design, Synthesis, Evaluation, and Crystal Structures of Transition State Analogue Inhibitors of Inosine Monophosphate Cyclohydrolase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
molecule keywords BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH
total genus 213
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2006-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2iu0A04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2iu0A01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu0A02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu0A03
1M9NA 2IU3A 2IU0A 1ZCZA 2X8WA 1VMDA 1C3OA 1CE8A 3ZZMA 1IK4A 1OZ0A 1THZA 1EGHA 1M6VA 4A1OA 1B93A 1PKXA 1KEEA 1BXRA 1S89A 1P4RA 1WO8A 1A9XA 5H3LA 1S8AA 1CS0A 2B1IA 2B1GA 1G8MA 2YVQA 1T36A 1JDBB 1C30A 2XW6A 1PL0A 4EHIA
chains in the Genus database with same CATH superfamily
3NX4A 2H2GA 2Z8XA 3R74A 4U9HS 1XB2A 3U3DA 1P74A 2C4WA 4H7PA 5LYYA 1RYZA 2P62A 3K8QA 1RZRD 3KQNA 4ZOAA 4BFLA 4O8XA 4BLOA 4O4IF 1U81A 1A32A 1OX4B 2BFCA 3EAQA 2OHXA 5CW1A 1T34A 2AVNA 2B8WA 2BBOA 3R5FA 4NOMA 3W8DA 1V3TA 1I2ZA 1RAHA 1RKQA 3APOA 3IAS6 3VH4A 3KXPA 2CXOA 3QQ5A 5G3ZA 2L42A 2B82A 3KCXA 3PD1A 2EULA 5E9WA 1B0AA 1GZVA 3DFZA 2JZNA 1JZQA 2ZD9A 3U44B 4ZC1A 3OGIB 5KTKA 3HM2A 4AD8A 3SC6A 1QZZA 3TAXA 6REQB 1YFZA 1AB5A 3GHHA 1T6YA 3HKEB 4WBXC 4U7NA 2QE7G 3V1YA 5T4BA 2OAEA 5E6RB 3QWHA 4MW6A 4K9QA 5IKPA 3MPZA 3S3XA 4D4HA 4LDAA 5E7IA 2D1QA 4V38A 3AUAA 4L51A 3FF4A 2FG6C 1SEPA 2HA3A 1YTLA 4BEBA 1BFDA 1X7XB 3Q5GA 5HRUA 4DLRA 3RAEC 3HB7A 1PGQA 3VGJA 4L7QA 1GPH1 1A97A 2EKPA 2P3LA 3A2MA 4LZAA 4QULA 1QF7A 4UW9A 3KPJA 1W34A 4H7KA 4QA9A 4F3YA 4JYAO 1ZK3A 4NDZA 4XQGA 1OX5A 4PG4A 5D3ZA 2FPUA 1Z08A 3UT5B 3ZRXA 3ANLA 4GGMX 2E4ZA 3BQ9A 4BY9E 4MUIA 3A9RA 4JGIA 1XQYA 5KVVA 1G64A 1KQGA 3ETEA 1QQAA 2I91A 4Q4LA 3KOUA 3L0DA 4JITA 1DT3A 4CW7A 1U1DA 5LMNO 3BJRA 3O7MA 5G0WA 1CY2A 4C7OB 1GPDG 2O2HA 4KN6A 1ZAKA 2Z3VA 1EDOA 4UVHA 2K4MA 4P3PA 5ANRB 2QMOA 2OCIA 1CDZA 5C8ZA 1N8TA 4HMQA 1P18A 3HBLA 5HQ3A 3VISA 3DCYA 1CTTA 1RB7A 1K8QA 3QIAA 3RABA 2JAUA 2ZRAA 3SXJA 4WFJA 1P49A 2CAZC 1G5QA 1YJXA 2LNDA 3LVFO 4S35A 3BMOA 1WCIB 1W75A 2OCPA 3J81A 2I03A 2YS7A 3R7LA 5EHZA 1JR6A 4BW5A 4Y1GA 4UU0A 3CUWA 1VXRA 2C92A 2PXHA 3BFKA 4GEKA 4PPFA 3FOWA 3CCJV 3RT1A 4DUGA 2ZTVA 3I2GA 3CYFA 2QN9A 1DRJA 3R23A 4DR5O 1MSWD 3FF1A 3GPCA 2JIZG 1KE2A 5C8XA 1J09A 2D2CB 3VDNB 2QT0A 1YXBA 4GEGA 4X60A 4MS1B 4LV8B 5E2IA 3ABTA 1Z2PX 4QBHA 3O2NA 5A62A 5AUOB 1D09A 2O2JA 1BOFA 4MUGA 4KK3A 4HDMA 1GTG1 1KAQA 1IEQA 3KC2A 1B93A 5DHSA 3VKWA 2PTGA 4C6HA 2E76B 1GLNA 2WAYA 4CL3A 3HBMA 5I4IA 3G7NA 5FPKA 3ROFA 3RT9A 3FYCA 1LUAA 2WTAA 2ZI5A 1F5SA 1FCJA 4FTWA 4E2YA 1JKJB 5IYDO 1Y6QA 4WRRA 1T8WA 4NYKA 1X77A 4LZPA 4X6XA 2M6LA 4ZV7A 4AECA 4ETNA 2H06A 4L02A 1VTKA 2IJGX 4XM2A 3ZWCA 4UDXX 2GF2A 2ZNIA 3RD5A 4B6SA 2VHQA 4YMLA 3D2LA 4K6MA 1QVZA 4MWEA 2HU2A 5C34B 2B4RO 5TC4A 3VKHA 4ZFRA 2ZRPA 1HNZB 2G07A 5I47A 1FRZA 1YZNA 2I4OA 5DKFA 1HE3A 2NZUG 3B8FA 1AUXA 2RGAA 5I9LA 3NM4A 1NXXA 3C74A 1FU7A 4QPKA 4IHKA 4UEJA 1GAQA 1Y7TA 2HLPA 2YOHA 1WETA 3MAAC 1XEXA 2GM3A 3HBNA 4DDVA 3LHKA 2FPMA 4KN9S 4JI2B 4ARVA 1FXKB 1PGJA 2HQRA 2FKNA 1U9CA 4WBNB 3C85A 4RLQA 2HRCA 4WFIA 1FNBA 3RYHB 3K72B 4JHXA 2W2KA 4NQZA 5FEUA 2J9GA 1VMIA 2GCNA 2WU1A 3WB9A 5LQDA 3DMOA 3QV1A 2PF4E 4F46A 5H1YA 1THTA 2YIMA 4MCJA 1U3FA 3GLFE 3BD8A 1NTKH 1WZIA 1Y63A 4MSDA 2EQAA 3TLYA 5H82A 1E63A 4LOLA 4MRSA 3TNDA 4G6ZA 4EHJA 1M83A 3TLZA 3EUFA 1ECCA 3OUFA 3FY4A 3T7EA 3FYUA 2O2CA 3THOA 3CX4A 4INJA 3MCWA 2FEXA 2YN0A 3EQ2A 3L5KA 1C1YA 4BBPA 4NABA 2WKSA 4H3KB 1V5EA 2BRUC 4IUCS 2BV3A 2AG1A 2FW1A 2AZXA 3R9XB 2NGRA 2YOGA 1PK7A 3PK0A 4LOAA 3HDGA 3SG0A 4DLAA 2IE8A 5I7OA 4WOJA 1YF3A 4JVNA 1CT9A 3VV3A 2RAVA 3O8CA 2I34A 5JWRA 5CNMA 4FJCC 1QK4A 1D1QA 1GSIA 1KY2A 2A8YA 3OHMA 2WM2A 5KNCA 5T4FA 5BSEA 2WPDG 4IHJF 4DIDA 3A14A 3QVWA 4V24A 2CGEA 2P6RA 3TOZA 1WKBA 3G3EA 1NYTA 4I4TA 3IVMA 4GPAA 1OC2A 2C5FA 3LIPA 3N3BC 4CN8A 5F1YA 4KN8A 3D36A 2NSHA 5KPJA 1M6HA 2BKXA 2P9GA 2XOKD 3OI7A 3N5KA 5IJXA 4BKPA 5ESXA 4S1TA 3EZGA 3PB3A 4TVOA 5B3LA 1ONSA 2ICAA 4ARCA 4GR4A 1NSTA 3KKEA 1TEXA 3OCWA 3UUWA 3T1CA 3G23A 3GOQA 2IYYA 4D1YA 5JANA 5H3CA 3NG1A 3L84A 1SC9A 4F04A 2G63A 3TVDA 4ZIRB 2Q9LA 2HU5A 2QDKA 4ZTBA 1Z2GA 2JCXA 5FULA 3CVJA 5I7HA 2W6JD 1Z2CA 2WJPA 3PDJA 2O2DA 1E1CB 1NKVA 2G67A 2IIVA 2WU3A 1H0RA 4HH1A 4YQYA 4AS2A 4RELA 1E18A 4GPTA 3PI6A 3MGBA 2IHJA 2W2PA 3FUWA 2VYVA 4IXWA 5K0BA 1RJWA 1V41E 4IIFA 4RQUA 3FGOA 4WK2B 4DBLE 1XMJA 1PDOA 3FUTA 4FM0A 4OEHA 5BT9A 2IH5A 1IXYA 3WWZA 1P8AA 3RVKA 5AI6A 4R2KA 1OXVA 1BE6A 2R6JA 2UYQA 1Z6XA 4GICA 5BXYA 4PTZA 1V43A 3K09A 2XY4A 5KQRA 3V00A 3QXHA 4GYKA 1Q0LA 4RIFA 5K3DA 2Y4TA 3LKVA 4LNHA 4MTXA 3JWGA 4P4GA 5CG1A 4JBYA 5LJLA 3QLVC 4MAMA 3TF5A 4WJZA 1DJPA 1Y76B 1X15A 3BSFA 5CU7A 2XCRB 3NJ8A 3KB1A 2N3ZA 4JI1B 2EBOA 2ADQB 3B85A 4F7WA 4A15A 1R15A 4LKOA 1EJBA 2RHRA 3F6CA 3VR4D 4WH0A 1YRYE 3TDNA 4QVIA 2VTBB 2HWKA 1YV9A 4RF3A 3TD9A 1RT9A 2HZ7A 4NNOA 1ISIA 4BV3A 4F3RA 5IEJA 5FNVA 3ZY3A 3GGJA 2QA5A 1DO0A 4N5IX 3H1HH 2JJQA 2PG3A 1Q14A 3H9EO 3ML0A 1H0HA 1P9NA 3DDSA 4UTOA 4URFA 5DDIP 4ENQA 4OX9B 1L7NA 2WF7A 2GPJA 3P2YA 4XM1A 2IBSA 4I55F 3X2FA 3VRHA 1YS7A 3CA8A 1D03A 1CZLA 3L07A 4LEIA 4GS5A 3QXCA 5DTRA 4ZVUA 3CMEV 3R8CA 2FPIA 4M8LA 2NU9A 3LXRA 4NG5A 4Z9AA 3M7IA 1LNQA 3OMNB 1R0YA 4ZO7A 4JUBA 2HVVA 5DM60 3Q41A 4IEIA 3IKJA 3EBLA 1TKRA 3AFHA 3F1KA 3O8QA 3ZVRA 4L85A 4AMVA 3IKMB 2NAPA 4ETMA 4Z49A 3K31A 4US1R 1AP6A 1BA3A 1WVIA 4QUKA 3GFPA 1C2YA 3I92A 2UDPA 3WLOA 2Y1EA 3CV3A 2AN5A 3X3HA 2N47A 3EE6A 2VF2A 1NKTA 1JLKA 4MINA 1CUHA 4TVBA 3QVVA 4S2UA 4DQVA 1R37A 1HDGO 2R2GA 1XAIA 3F7NA 3QPVA 5F5XA 3STWA 1UBOS 3UFXB 1JG1A 3H84A 2VQFB 3ZI0A 5FOQA 2P5YA 4O4HA 2FRVA 3PA8A 4H1HA 4INAA 3DGEA 2I65A 1QQ6A 2UZ1B 3MUNA 5F1PA 1P45A 4JIMA 3B51X 3ECAA 4QTTB 4FNMA 4XRRA 4B3MB 1AH2A 4NQLA 2DULA 5E6UB 3WK7A 2FPLA 1MLDA 3CX5F 3E48A 3L7CA 4AKHA 2J9FA 3OEHD 4RIGA 3ZVKA 4KCGA 1TC1A 2G77B 5F23A 4J0CA 1RWQA 2CLDX 2ZIGA 5KUKA 2I5PO 4FFMA 1YD7A 3RV3A 2WLIA 2HRZA 1EWQA 4XYGA 3K79A 4TYWA 16PKA 4B3RO 1KU6A 3DD1A 3GBSA 3FVRA 4RL4A 5DFAA 4E5PA 2WFZA 1X1DA 1TJYA 2XUFA 3IDOA 5GGXA 4G0VA 3H18A 1R27A 2ZQZA 3PQ3A 1MIOA 1DI0A 4N7RA 2JJ8A 3W7WA 4M7WA 4NICA 4OG2A 3V7UA 1J5EO 2Z43A 1PJ3A 3AWIA 1II8A 5LB2A 1O95D 2KLBA 3U4AA 4A0HA 3RYFB 4KO4S 5K0NA 2QVYX 2QKCA 4ID9A 1AF2A 2AKYA 1BX3A 4YREA 4KODA 4FM1A 1KK3A 2IYUA 2ZWAA 2D2VA 4FCTA 2R6R1 3RU7A 1HTBA 1CUVA 1I9GA 3BDAA 3DDOA 1W7AA 1VP7A 1XQ9A 2FK7A 2HCFA 3I5AA 2A33A 3ZGZA 2HVKC 1V1RB 2VDLB 1OVMA 1Y7LA 3NV7A 4XBFA 1XXHA 1USKA 1EQUA 1C8BA 2BFPA 1MMFB 3B3AA 3MD9A 3NHLA 1JPXA 4DBLC 1UPXA 3PIDA 3IJFX 1JG7A 1RCFA 2J3EA 1CJTC 2Q3JA 1PL0A 1QGYA 4X7MA 5DYGA 4BIOA 2GYYA 1OZHA 2QS9A 3HKBB 1RCUA 1WQ3A 4J1NA 4UREA 4Y9SA 3DE5X 4QTZA 2Z30A 2R7LA 1NP3A 1EB8A 3GA0A 1YIOA 4BFTA 1I7SB 1OC4A 1VCOA 1T3GA 4DLXA 3IRVA 2D1SA 2IPOA 2DYRC 3C5HA 1S01A 2O0JA 4W7HA 2FW6A 1SBYA 1TZJA 4ZVOA 3N0XA 3VOBA 5KNCH 1X74A 2CUTA 5LR6A 3O7WA 4I5DA 1YL7A 4P4UA 3LKDA 1SVKA 1OAAA 4D3FA 1B6SA 1TW2A 3L8HA 2AMFA 2VUSA 4IIYA 4D8WA 3TW8A 5DOZA 1W0CA 4P0QB 1IEWA 3I2IA 4G0NA 4TROA 1MA0A 5AKKA 5T3YA 1E69A 4NEHB 1SZXA 1XZLA 2WABA 4Q18A 4B09A 3H97A 2AD1A 5IVIA 1UBTS 4LC5A 4M0MA 4LCOA 1SQ6A 1CF9A 4FGSA 3B48A 1DKLA 1M5IA 4JEIA 4QTXA 2Y76A 2CL0X 3DOJA 4K40A 4FR5A 5JC8A 2HJVA 1L5YA 1E2GA 1W0KA 2BMAA 2G4VA 1Q17A 4TQUS 1Y67A 3ECCA 4DDWA 4KL1A 1JHAA 4I4IA 3R7FA 3ZX5A 6Q21A 3CZMA 4TS1A 4ZOCA 4C01A 4E08A 2DTXA 1Z0IA 2CDBA 3JALB 1RTKA 2Q6AA 1UBEA 1Z18A 1HF3A 3NIBA 4D26A 4PSDA 3E5HA 3HA7A 2TECE 3UXMA 5BRJA 1DV1A 3JYCA 4JI8B 3PFIA 4L50A 3ER6A 4JJFA 1SXJD 4NMMA 1U8AA 4OYYA 1U6JA 3FVTA 2DFNA 3NM6B 4BUZA 5TT1A 4BVKA 9ABPA 1E1NA 4IKEA 3V2HA 1MSDA 1RYYA 2WLLB 1GTJ1 2AHOA 5K3FB 4KVGA 2BYTA 2X8LA 4BATA 4BQEA 3GGOA 1HM5A 4JC5A 3UO8B 1TUGA 4HNTA 1JAIA 3OE4A 3VH1A 1ZWIC 1G1XB 4OOEA 3DOFA 2QPOA 3ZWBA 1S2NA 4YFVA 4KR9A 3UO3A 2WIDA 1I3CA 2WVJA 3HUFA 5FF9A 1PV0A 1Q50A 4UMVA 3GELA 3HPQA 3NBMA 4B33A 3PP8A 3T7AA 4EB6B 3AETB 1XVUA 4ZVNA 3B1KA 4M88A 4QVKA 3PF8A 1JDJA 2CLHB 2IOFK 3OE1A 2OXRA 4Q19A 3REQA 5K6RA 2DBQA 4UFNA 2GO1A 4R6XA 4UD2A 2ZTHA 3JZFA 3M1YA 3IH5A 3W5AA 4P4LA 2ERCA 2JA2A 3CNNA 3A0HZ 4ZANA 2WWTA 1M34B 4AZVA 3GLFA 1YJCA 2WHXA 1M2EA 4MLPA 5K09A 4GUNA 4C7JA 1ZMXA 1YS4A 2ID9A 2WKQA 4E2FA 4RLFA 1ENZA 3RHSA 1FXKC 1U2SA 2OSBA 2WP0A 3IMFA 5GTHZ 2GO7A 4NMLA 4IJ5A 5BSGA 4RK1A 3P9YA 4NF2A 5IAGA 1N34B 1P62B 1TMKA 3F3MA 3GLRA 3OTIA 5FI5A 4EA9A 1YH3A 4FYWA 4LE2A 2PL5A 4EFNA 3S1AB 2B9VA 2CBZA 4EEKA 1NTRA 3ETGA 5D5PA 1TDJA 5HKAA 1QQBA 4OCMB 1XI2A 2H4WA 1KXZA 2PBFA 3GJ4A 1XTUA 3I52A 1FPMA 1Q6UA 3ANNA 3I61A 4IMRA 2DQ3A 4HC4A 5F9MA 5C7YA 3CJRA 4I6EA 2F48A 1L0NH 1GV1A 3O0TA 2EFEB 5JXHA 4TYYA 1VBNA 2P2GA 5E9AA 1HT2E 5KPDA 2JK5C 1JYEA 3GJQA 1OZGA 1I94B 1WSWA 4WOCA 2X6BA 1AHHA 4FYXA 4GMDA 5D00A 2F59A 2Y2UA 3IBSA 3CJHA 4J0DA 5DGHA 4MDYA 2ZKLA 1JTFA 3RSCA 1TTTA 3LGAA 4C6TB 2B4KA 4ENPA 4EVQA 3QX8A 3ODGA 1YDMA 3LNCA 5ALWA 1HP8A 3DSQA 4AN0A 3U0VA 1Y3CE 5FPPA 1PWHA 2Q50A 2ZSUA 3OSZA 5C7OO 1EXMA 2WLKA 2J85A 3NOOA 4GZMA 1A3CA 4W4TA 4QOIA 5SZJA 1EJ6A 3QTTA 3LHFA 1NH2B 1P1CA 4GWGA 1G19A 3LC1O 1UL1X 2HHCA 4CKEB 4AMGA 1WABA 5KSWB 4HUJA 2GRJA 5C8DA 4B3SB 5KYYB 1HDXA 4AKIA 4FOTA 4Y0NA 1RYBA 4E3ZA 5K4HA 1E0JA 1LTKA 2GZ2A 3DP9A 3QPUA 4FFNA 4G1BA 2QSUA 1JHOA 4KQGA 2P3QA 4A6PA 3VKFA 3HDYA 2IBTA 4K26A 3MMXA 5K3AA 3CW2A 2P6NA 5J2TA 1HURA 3EIWA 3UMMA 1GYRA 3OCQA 2Z04A 4YXWA 1GNRA 1N2CE 2PGJA 3QEOA 4J3NA 2J41A 2GN0A 4O4JB 5CFNA 1L6IA 2WM8A 3TVYA 2PGLA 3QTCA 1WN6A 3K0GA 5B1EA 3DS8A 3GVCA 4DW8A 2LZ0A 2P0AA 1X7ZB 2X22A 1FQKA 4GYCB 5EMHA 4XARA 2C5HA 3N7UA 3HLTA 3IVCA 4DA8A 1AG9A 3MQFA 1OTXA 4LUCA 2B78A 3AKYA 2BJVA 4UCSA 2RBKA 1UT8A 2P4HX 2AF4C 4UUBA 4XQEA 5LBTA 5LZ8A 2WD8A 3WMEA 2VQEB 4H17A 2C7RA 1YR9A 4Y2VA 4LNUB 2IV3A 1QV6A 1KKCA 5C37A 3KXKA 4RGBA 4X90A 3AP3A 4YMHA 1KI6B 4FBLA 3GXBA 4FHEA 2OXIA 4QFMA 1Y6JA 3W1VA 4Q4HB 3TOSA 1ZN7A 1UMKA 2BCGY 1QFYA 3CLTD 3I6MA 1BQ4A 4GM1A 3FPAA 4WXRA 3RS4A 4C4RA 4P6VF 1M1XB 1ESNA 3RC2A 2BFEA 2OHJA 2CMFA 3QLTA 1K75A 4EDHA 5FV7A 3AW9A 4EI7A 2FTKA 1PEKE 3BGVA 4P9CA 4RIEA 1QGOA 3SU8A 4CM7A 2CXHA 5IXJA 5J4KA 2ZNVA 4JNCA 1XQWA 3QMWA 5G40A 3K53A 5JXIA 1NVKA 3QEAZ 4JVSB 4X61A 4Q9DA 4LC9A 5EQDA 2GRAA 4YP1A 4E2XA 4ZCIA 4MUYA 3S7ZA 3WKCA 2O57A 421PA 4MI3A 4DPLA 2ZGVA 1AT1A 4IIJF 4R1NA 3X1WA 1SKAA 5C5EA 2C2KA 5K3SA 1VPDA 1SXJE 3M1IA 3CXRA 2OC4A 4L3VA 1Y9EA 4PSVA 1RYMA 4P81A 5DCYA 3E3OA 3QEKA 2ZAMA 2M6KA 1HV8A 1UAYA 2OM2A 3TJRA 2GZHA 2KQUA 2RHBA 3OE7A 4FSDA 3X2EA 4B2PA 3JX9A 1YZGA 5C32A 1DEHA 3OJ0A 4RCVA 1L7XA 4ZCPA 1O97D 3G6WA 1I2BA 4QUEA 1QZ3A 3COJA 2GFIA 4ZGWA 4LV6A 1W36B 4IIJB 1LVGA 1X1CA 4LYGA 1U2QA 1JLHA 4H7JA 4BFCA 1DC6A 4AX8A 1XG5A 3N2KB 1U8ZA 3HKEA 1QH0A 1YS6A 3BJZA 3ZCUA 5T5QA 4FFLA 2NPFA 2XQFA 1I3LA 4D9BA 3DXZA 1VPVA 3RJ5A 1KK2A 4F2HA 4LK2A 2A9VA 1YC2A 3AM4A 5G1PA 1YZFA 4FCWA 4D97A 4A82A 4EHNA 1J1ZA 3B8NA 4V1CI 3L0IB 3EVGA 5IAAA 3FPSA 3KZNA 3BD9A 3W78A 1OXBB 2A0WA 3SJZA 4MV7A 5JJJB 3SXUB 2QTZA 1VI5A 1JKFA 3GDFA 1YJNV 4GMFA 4NYIQ 4AKGA 5B6PA 5KTTA 3M2TA 1XVIA 2IS1A 1IIBA 3UMVA 1NNLA 5C5CA 3PXUA 2NZYA 1VKNA 5G4KA 3JWHA 4XE5A 1Q7RA 3KE8A 3ZNPA 3AEIA 1E9VA 1ZH2A 1KI8A 1IEVA 4MGIR 4RQAA 1KC1A 1DQPA 3DPSA 5DN6G 3T1HB 1SC4A 4ATNA 8LDHA 3SEZA 1FE8A 2HIHA 1Z2AA 3GN2A 1SG6A 4YXFA 3GJTA 3VTKA 5CFQA 1IZ7A 1ODIA 4CKWA 3Q3EA 2IXDA 1L5HB 3DMYA 2F8MA 2QLJA 2ODBA 1V5IA 2H5JA 3C6MA 5AI4A 4UHEA 1G9XA 2HSZA 3GPBA 3E6AA 1KMIZ 1HEUA 1KECA 1AO3A 1XPJA 1REQB 1E58A 2C0CA 2E9SA 2GLTA 2G72A 5DU2A 1INLA 1EK6A 1ZD4A 2CVZA 2N1MA 2DUWA 3AIIA 4I6JA 4A8TA 4DG9A 4YMUA 1Z0ZA 1P0IA 1RHRA 1GN2A 1YZTA 2MINB 1QOPB 2XYVA 3IEKA 3PF9A 3WFIA 4X85A 1NQUA 4C7KA 1RP3B 1XEAA 2Q0QA 4H2DA 5BVGA 1QM5A 4ZOLB 4NPCA 5ICEA 1G6HA 2A1UB 2BTOA 2Q4DA 4KKXB 1PYOA 3E7PA 4QELA 4UMFA 3L72H 1AGXA 3F49S 5A03A 4YASA 1MA3A 3GD5A 3NRCA 3D7MA 1G6OA 1YHZA 3EVNA 1FDOA 1YIDA 3L0SA 1USIA 1UZAA 3IJRA 5HILA 3UFBA 1JIUA 1CJMA 3WHLA 1A7KA 5I01A 4YP0A 3ONDA 5J59A 3II6X 4MKRA 2FP3A 4Q3BA 4DM3A 4C05A 4BU1A 1CERA 4ZTUB 2H1SA 2A58A 1SQ5A 2Y4OA 3H5WA 2FR1A 5IHXA 2XKBA 2Q0OC 4YMIA 1V7PC 1ESZA 1QGUA 4XJTA 4CMGA 1U1GA 4JQCA 1HI9A 4LOIA 1DS6A 4O8ZA 2AOTA 4C78A 2Q9CA 2W2OA 4S12A 4YONB 1C7FA 2JFBA 1M66A 3G7SA 1LRLA 2DFLA 1E0KA 5HE9A 1SESA 3V1TC 3G5TA 2A8NA 2R9RB 1R6VA 1ZGZA 2PD6A 3VOTA 4UM8B 2X0NA 3KQTA 4ARIA 2WYWA 1ODCA 3TCUA 2XWJI 4Y0VA 5BV1A 5M2QA 4KE8A 2WDPA 3KVVA 1ZX3A 4NZMA 2VNKA 2GDZA 2Q3MA 2UUAB 2QN8A 3EGWA 3K0CC 4IRXA 5B36A 2WSBA 3E81A 2EG5A 5CA1F 2Z58A 5BUCA 1L7BA 3GFFA 3HDVA 5F1KA 1FSGA 3TMKA 3VKGA 1PJAA 4PYKA 1JX9A 2RJZA 4RM2A 3TIXB 2ADFA 1B8UA 3OF2A 4RYLA 1QE0A 1C0PA 4B3IA 4IG4A 3SP1A 1E6EA 4WESA 1A72A 3JXEA 1R2QA 4X0EA 5IX8A 1HLDA 1OY1A 1JYSA 5KUTA 5JSKA 1MB9A 2WHPB 1K8RA 2AN9A 1H2WA 3EAFA 3MTDA 2Y6VA 2BR5A 4KGDA 4U9IS 5KTSA 2OYQA 4LJ9A 4RA9A 1HLPA 5M29A 2IZ5A 1W4CA 2ZVPX 1ACMA 3I37X 2O0LA 2WIBA 3CJTA 3IJ4A 3L8CA 3DE7X 1P7YA 4GI7A 5IUKC 4F84A 4MUKA 1RBQA 3AR8A 1PFYA 2PGDA 2ZVQX 3LP8A 1G20A 3EZXA 3NOQA 3RTDA 4HX9A 3LXMA 4PICA 4HLQB 5BW4A 3KIPA 4L4XA 3P32A 4UCUA 3VAZA 1JZSA 3ZUPA 4QIWF 7MDHA 3RWOA 1KU9A 5K7SA 5EKUA 3F71A 2DJIA 1A4UA 1AA6A 1VG1A 3G8DA 5CITA 3TKAA 1TO1E 4CCWA 4KLZA 1G4HA 4A1FA 3OESA 4HS9A 4IRMA 3QKRB 2D06A 2VKQA 4L5AA 1CP3A 1QTRA 4HGNA 3B7WA 4DY4A 2BEKA 3I04M 3RYTC 1U7OA 2F3QA 4U2EA 4I9WA 2V0NA 4UAUA 3BTOA 5G0SA 3RODA 2A1TR 2K6GA 4S1VA 1T1IA 1NULA 4TWJA 3C24A 2EIKB 1L3BA 4M0EA 2DE0X 2KE5A 4WDRA 4XYLA 1TUBB 1O6BA 2PZ8A 4HDSB 1KAEA 4ZGBA 5CDFE 3ILYA 3U4CA 1N2BA 4RTLA 1ORDA 1GNTA 4K9DA 1O03A 1PL7A 1XDDA 3S0JA 4JBNA 1UXJA 1W4ZA 3QUBA 5ERXA 4QGSA 2Z1NA 2YWDA 1P6OA 4L2IA 4REQB 3SBXA 4A03A 5GONA 2POQX 2AE1A 2H5EA 3DZHA 4C3VA 4EA6A 4Y6PA 3ZE8A 2ZJ2A 4NXNO 1IHOA 4ZJZA 4B7CA 3WRYA 3ZLJA 4WWHA 1W0JA 2Q6IA 3N8IA 2NXJA 4JQSA 5LD2B 3INNA 2BDUA 1OVGA 3D5TA 3DFUA 1X39A 4WFBV 3ZE6A 4GE3A 4WFHA 1JJFA 3BERA 3HXTA 3T1OA 5L7YA 5DO9A 1SH7A 4KRXA 5C81A 3DL0A 2NTYC 4ID3A 5T4HA 3OD5A 1GCOA 3OBIA 4YUWA 2WIAA 1T8SA 3BVPA 4NBKA 1TQHA 2FMTA 4ZQBA 1D2CA 4EABA 3BJEA 3FBGA 5I7AA 1LLUA 1MEJA 1KYQA 2HK7A 4XB1A 4UTNA 4UUPA 2FH5B 2C96A 4ZPXA 3ZIAA 2QW8A 3U6KA 4P9EA 1YUBA 3AF3A 5KHIA 4WJLA 5DTMA 3HB0A 5AM1A 3TGWA 1K9VF 3EFEA 3E3NA 1XC7A 2PPLA 2OP1A 1VHJA 2ZRNA 3D3WB 5FHRA 2WU8A 1TLFA 4MRAA 3BM5A 3KQMA 4WAUA 4P3XA 5C0OE 1XD9A 4DPMA 1E6CA 4LYEA 5J47A 3QMMA 1NOJA 4FYYA 4L5CA 4U8HA 4C3OB 2LD4A 1K7SN 3EPLA 2OCDA 4BTLA 2AEMA 1JB9A 4EHDA 5B4TA 2UYYA 2M2IA 3PNKA 5BW5A 3CC7V 4RUKA 3AHGA 1VECA 3I3OA 4QYXA 4CU5A 2FWMX 5EZ5A 2QTHA 1MO5A 2Q3CA 2QVXX 4NJMA 3W5IA 3H9UA 1XA0A 5AFSA 5DTIA 2BOBC 1S8FA 2AZ4A 1PM9A 2HQSA 2FXIA 3H2HA 1AR1B 1WXQA 2VCEA 2C94A 2YXEA 5JNSA 1AJEA 1SXJB 3A4VA 1CC1S 3N8HA 4EGSA 4I81A 5HR5A 1C1DB 3TXSA 2FW0A 2IYVA 3HJHA 1P8JA 4RSMA 1XQVA 1ZA1A 2B20A 4XFKA 3RRJA 3UNXA 1M5TA 3AK4A 2ZSIA 1W8IA 3NOXA 5EKXA 2CT8A 1T9GR 4N8EA 4Z1MA 4RD3A 3QIVA 2LW7A 2XD9A 1P60A 4HMOA 2FPSA 2V7QA 4O25A 1PKEA 5DHQA 5LBUA 3THSA 4WOKA 2ZRHA 4NQRA 4DMUB 3RF6A 4ZQEA 3A1VA 4RJLA 4D02A 3WMRA 1VLJA 3OBBA 3ZPGA 3DEFA 4A27A 1GXSB 1CY6A 5EI5A 1B06A 1IZ0A 3TK1A 1R4AA 1TU4A 1IDOA 2EP8A 4WTOA 1US8A 1YWGO 4Y1EA 5AYVA 4YMSA 3A6LA 3K94A 4DSOA 5HUHA 5JAHA 5K3EA 1KPHA 1IDN1 1FAFA 2CLSA 3A32A 5BNZA 2A5JA 3H1GA 4EGJA 3DVAA 3D7SA 2PH1A 3IMKA 1I3MA 2D54A 3TFWA 4AHCA 1MQ0A 2OG1A 4U6QA 2AMLA 1W29A 3KSUA 4E5NA 3A7DA 3OCCA 4RD1A 4B6PA 1S4MA 4KQWA 5FADA 3EGIA 4M8IA 5CEJA 3QPAA 1AKEA 2KSDA 1JTEA 2R4QA 4MW0A 2EQBA 3JR7A 3VO2A 3QA9A 3ZWMA 5ELLA 2QHXA 5IJWA 1P2SA 1Y5RA 2AZTA 4PFKA 2Y4UA 4ZKEA 1BMQA 3CLVA 2DFVA 4F6RB 2F17A 2VXOA 2XECA 5KMGB 3A3PA 3CH4B 1KIMA 4MVUA 5L3ZA 1E2JA 3R40A 4XX0B 4QKQA 4WIAA 3GHYA 3GMTA 1ZU4A 1W47A 4DK1A 3KDAA 3FCCA 4N6NA 1K98A 3SVZA 4KITB 2JKZA 2C5LA 1C4OA 1NS1A 4B7UA 4BMSA 3F3KA 1AMNA 3AHIA 4OK6A 3CTMA 3QH4A 2CXQA 4D4GA 4ASUG 1YBVA 4NZOA 2IIBA 2WHYA 3C2QA 1XXHB 1CULC 1SUPA 4FEEA 4LDZA 2WJHA 3K20A 1XDZA 4TUYA 3EMBA 3OUUA 1VYVA 4NATA 4QOGA 5DM4A 4P9PA 4XUCA 5TGZA 1LA2A 1MQAA 3DNPA 4J0EA 5EMJA 4N21A 5DTQA 2P8RA 2IJIA 2OPBA 4YCBA 2PYDA 3L1HA 1A9PA 1KEEB 2GHIA 3CZ4A 3D2BA 1B0PA 5DASA 1U3CA 1JFSA 4Z54A 3I56V 3VU8A 1EFLA 2B3ZA 3EGXA 3W6NA 3M49A 1NLUA 2BGWA 3SR2C 2VEDA 3W7AA 4EYQA 1M93A 2WG0A 4KAFA 2HG5C 1FVFA 4IMJB 1GGMA 1ZK2A 4Q6BA 3TJMA 1E99A 3W5HA 5GAOA 4UMEA 4G1EB 3LUTB 4YRPA 1GZSA 3TTSA 4D80A 3AINA 3EPKA 4CR6A 3PN1A 3F97A 1NXWA 3MERA 3K59A 3QEJA 4RIHA 4WGGA 4AN4A 3RBXA 3RFRA 1QYVA 2QB5A 2QMQA 4P38A 1OBOA 1NM5C 1B2LA 2ZRGA 4AMZA 3WOHA 121PA 4ZQFA 3T9CA 2JGUA 4RULA 3LWBA 5KC8A 1MABA 2F3SA 4L8YA 5AG2A 4O5AA 2QF7A 3DEAA 4NFYA 4NI5A 4NKRA 4MJ3A 4WPGA 4XIIA 4NCJA 5KYNA 1UWZA 4OIFA 5FOVA 2XCOA 4EY5A 1KEKA 4EG0A 1W5EA 2I3ZA 5EGNA 3TE6A 3FH0A 2A4MA 3I72A 4ZOLF 1XAHA 3OWHA 3Q0TA 3ZWYA 1FKAO 3TPFA 3QKTA 2CVPA 4FZJA 2O8NA 1X7YB 2IYPA 2H1IA 4MKXA 4MW5A 4IGIA 4ZO8A 4HUQB 4QLAA 5JIBA 1T5IA 1SZDA 4P84A 3OQHA 4X65O 1GZ4A 3I4CA 4KQXA 4O0LA 5K4AA 5SY6A 3Q2KA 4QVGA 4M1QA 1G8SA 3G13A 1WV0A 2CUZA 3HWSA 4G24A 3WFVA 1HE4A 2YIJA 1MRSA 4D4JA 2EL7A 2ZNRA 3GQVA 5FBQB 3WYBA 2WFAA 1EVIA 3SFTA 1H2MA 5JXWA 3RT3C 1F17A 5ECGC 5LQCA 2AMJA 1ABFA 3MTEA 1V3QE 1TYCA 5CMLA 4D44A 2GN2A 4NOKA 4EENA 3BD6A 3EWAA 3J81k 5F3WB 4R1MA 3W7UA 1BWSA 4EQZA 1U98A 1Q0QA 1R4NA 3E5MA 3CP1A 3G59A 4HEA6 2MMCA 4MGEA 5I8ZA 4WLVA 3TO5A 1KAMA 3UT0A 5KSOA 5JNVA 4O63O 2JC3A 1UT6A 4UKDA 5B1OA 3BWDD 3PHCA 1YASA 2CVOA 2QTTA 4COOA 2KM1A 2W0MA 4AJJA 4WDQA 3SBOA 4N3CA 2IPXA 5BQFA 3KTOA 3AFIA 3RBAA 2CDYA 2C83A 1VA5A 2YXDA 3H1TA 4B74A 4RKWA 4TKUB 2J87A 2QZJA 5AW3A 5BOSB 4ZOBA 3KQPA 1QU7A 3D59A 5K0LA 3IFXA 2QP3A 4HLNA 3WK8A 4UHKA 1KO5A 3PXXA 5JPCA 2CNWA 4BGDA 2D4AA 4MTLA 1T13A 2B3TA 1DBPA 1XHXA 4IQ8A 3QO7A 3P9CA 2EV9A 2WHRA 2J3KA 2F1IA 4LCEA 4DC1A 2Q1XA 3KKKA 3O2JA 4NBRA 4DDMA 4DNPA 5DNYB 4QE3A 3AR2A 1PJCA 2SNIE 2YFQA 3M4NA 3IODA 1S4QA 3G6EV 2AQ8A 2JAWA 4LF4O 4NPAA 4TWKA 1EXDA 5BW6B 3HYTA 2B5OA 2PO7A 3J80A 2HHHO 1WCXA 1MJGA 3U56A 1R9NA 3D8HA 2VH1A 4MMZB 3ORFA 1PLKA 5SZIA 2BSKB 1H2FA 2RG1A 4X88A 4Q16A 4OBBA 2O7SA 2FYUH 2OVBA 5F2NA 5I9NA 1YGYA 2ZIFA 4M36A 3SD7A 1D1TA 1Q95A 4RGQA 5JPDA 5ARDA 3DMDA 4I9NA 1EPUA 2IYAA 4CKWB 4ETIA 3M6VA 1RQRA 3FCXA 4CF3A 2D5NA 3IEMA 3RHTA 1XLWA 3ABLB 3HFRA 1FFSA 1OT3A 1BJKA 5JAIA 3VVMA 5LPNA 3ZHQA 2HKIA 5HF5A 3SY8A 2PV7A 3DSRA 2AI1A 2EKLA 4ZI7B 2JFUA 1K7YA 2ZJ0A 3AFMA 3AONB 4RK4A 1IOLA 4EG4A 3IT3A 4B84A 2NNWB 4PYQA 2A78A 4FDAA 2E5WA 1MX9A 3KD3A 3KT3A 4EYGA 4YJ2F 1CUZA 1E7MA 1OWNA 4WLOA 1ITZA 4JV5B 5DRTA 5E4YA 1R3KC 2RBGA 1VE9A 1B6RA 3AP1A 4KGZA 4R1LA 5CA0A 5CEEA 2FZEA 1QHTA 5FBKA 4E14A 1JFVA 3N0WA 1US6A 1NI5A 3LLSA 5A06A 3A3OA 4DK0A 4FZ3A 3EGDA 3PWZA 4OJTA 4UUOA 4Y6SA 3RQSA 2G0AA 5FB3A 4EFBA 3MT8A 2AR9A 1I5YA 3JD0A 4BQSA 4WL0A 3D0QA 4YRQA 4OF4A 3RFCA 4BUJA 3CWBH 1IBLB 4FUQA 4D6XA 4XDJA 1ISHA 3G2LA 4Y0AA 2NT4A 3L82B 3BF7A 4MRPA 2FG5A 4CLXA 4DSNA 1HG1A 2EIMC 1I4EB 5EHIA 3SEQA 3C98A 3U3KA 1KEPA 1L5ZA 1T9ZA 3BRQA 4HWKA 3ZWPA 4AY3A 5FWXB 1V2GA 5I9BA 2Z2ZA 3C5EA 1A1VA 1KE1A 3AHFA 4G97A 4DMKA 5LXTA 4TQAA 1DJQA 3TXXA 4FLYA 1EVLA 1GFSA 4RCZA 1K4YA 4K8ZA 1Z0UA 2BGRA 4XDGA 4KYIB 3STVA 4MGKR 4I3HA 1EZ1A 4QNHB 1JQLB 1Y5IA 3HB3B 1BH6A 1EQ2A 2XB9A 3G85A 4HAVA 4FGKA 3GZTB 2VTDA 4OQXA 4UTXA 4NBLA 4V0SA 2GNOA 1RSZA 1ZMOA 4TYNA 1LWNA 3ZDAA 2ZYTX 3KQKA 5M59B 2ATVA 3O93A 2AA3A 4CKEA 1ABEA 2JH9A 3WL5A 3O8RA 3R20A 3BXOA 4RY9A 3STHA 2GTHA 1FSZA 3IRUA 3NGMA 4KH1A 5EBLC 1ZFNA 3GRRA 4K8OA 1XU7A 2FSSA 2VTEA 4FBMA 4B8YA 3PNVA 4RD0A 4CJXA 4UVCA 4H6WA 3UMCA 2VHUA 4EPTA 3HY6A 1Z4KA 5EZYA 2BEUA 1GQRA 1NVAA 3QYJA 3SM3A 5IK2D 3M1LA 2DYSC 3ANXA 3L8EA 3AKZA 4N0MA 4M55A 3DLIA 1WMBA 2F9LA 4KXRA 1Z73A 4XR9A 5DNWA 4ED9A 4MSMA 3L7AA 4N0EA 3ZK7A 4M53A 2YHSA 2YN2A 3DONA 3LQ4A 3T7IA 1ULUA 3EC7A 5DWVA 1RJDA 2LGQA 3U0ZA 1OGYA 3M9XA 2PWAA 3OFVA 4LJLA 3MWDA 5DM1A 3S2IA 5DMXA 4EUSA 4QZVA 1O0SA 2P5SA 4K88A 1R1DA 3R65A 4YJ3A 1KEUA 1ZC3A 1KDVA 2WJAA 3RQIA 2LP4Y 4LNUA 4HWSA 2YWGA 2HVJC 1XNRO 4NU8X 2RAPA 4J76A 2JEZA 4OHXA 4RPHA 4MQEA 1UMCA 1K3FA 4EVIA 4ZZIA 4J0FA 1M2HA 5L3QB 4K3VA 2FLWA 2NO9A 1Y6XA 4X3CA 5BURA 5IF9A 2VZEA 2D2XA 3WYAA 1EK5A 2DQZA 4P0PB 1G8YA 1RWVA 3QLUA 1PU2A 4MTGA 5TGTA 1P2VA 3A1TA 4Z8YA 2B8TA 1P6XA 4KPYA 1N3YA 1DB3A 3WDLA 4YAUA 2A7WA 1AKMA 2WA1A 4HQFA 5DN6D 1SKBA 2M6RA 2HR3A 3C4VA 1LCIA 1QO0D 3IPCA 4IO0A 4TN1A 2X1LA 3L49A 5DRYA 3TBFA 4G9EA 1XTJA 3GT7A 3ZGYA 5SYNA 4UVIA 4Y30A 1UPTA 1Y34E 3ZE0B 3ABLC 1JDVA 2R8EA 2Q69A 1ZO8A 5LMCA 1K5DA 3NQ41 3EVEA 3U5ZB 4HAWA 4MI6A 4IWYA 4MVZA 1L7QA 2Q4EA 3ZV5A 3ZHVA 1FDUA 1KF0A 3HKCA 1V4VA 2D0DA 4XLZA 4HQRA 1DRVA 4J2TA 3HI6A 1J56A 4HXFB 4GLJA 1F2VA 3E7WA 3ND5A 1YAHA 4XM0A 4BFSA 2FSHA 2PCJA 4MHOA 2ZJOA 5AVTA 4HZUA 2PR2A 1XMIA 4EYSA 3X2QB 1B1CA 3E1KA 1JFTA 4TLMB 4CIVA 2I8AA 5MN6A 4Q05A 2QN3A 1VHQA 1WX1A 3M70A 3QX7A 4KG7A 3VR3A 2W2LA 4JUFA 2XYRA 1V37A 2FB5A 3U1TA 3N2KA 4OK3A 1OZFA 4UUMA 3QO8A 2YVLA 3TDKA 4F11A 3L71H 1M2JA 1N75A 1PHRA 2R5WA 2X5KO 5EZYF 5I9SA 2DETA 2GCPA 3GO4A 4C87A 2GFHA 4IQGA 3EY9A 1D2MA 2ZR2A 3R77A 1VYTA 4MVJP 4NBTA 4AZ3B 2O05A 3MYYA 3H99A 5GVSA 3LDDA 2BCEA 4IYIA 3O92A 4PA7A 2GBPA 4AJEA 2YASA 4KB5A 1DXYA 3OUTA 3PLNA 4EGQA 4HR7A 3FTDA 3BGOS 3QF4A 1AO0A 1NXPA 2P4VA 2W6IG 1VQ8V 3DMTC 3VMFA 3IIMA 1CQZA 4ESEA 5IJ0A 1GUFA 3DBRA 5AK0A 5ECWA 3MHHC 1T2FA 3RFUA 4I9QA 4OQNA 2G5CA 1KI3A 2SKDA 3G71V 1SQPH 5EP4A 4C89A 4DDTA 2DBVO 2PHZA 2WIFA 1QH1A 4NHOA 3BXXA 3B20A 4AZ3A 3J7AU 1DG9A 2XUJA 3N74A 4LN1A 3OEHA 3GCDA 3WU2Z 1SUBA 3PQCA 3ZHYA 1KC3A 5ILQA 3EHEA 4XB2A 4A7PA 4CL0A 3WKEA 2BOCC 2UUCB 3G79A 4NCHA 5HIJA 1IG3A 1SQBH 5E0OA 3PQ4A 5EP2A 4BNHA 3IFSA 3KLBA 5CYOA 2PWBA 3OA0A 2FTKE 2Z2XA 3MJTA 4FI3C 2KBFA 3EXHA 3ZJYA 5HCNA 4DMCA 3KSZO 3SC3A 1YU6A 2RHHA 3BHNA 2AC7A 1ZOLA 1YRBA 5FT9A 4YRGA 2CTRA 2GDSA 3LT4A 1VE3A 3QYPA 1EGMB 1FS5A 3EXG1 1F0KA 3GGCA 3BTSA 3ME5A 3FPBA 2RN9A 3JW8A 4TSFG 5BVGB 2FW9A 1CUXA 2M32A 4CMEC 1W73A 1QG4A 1J22A 3BS4A 3H0CA 5KYUB 1V9PA 4NCXA 1Q81W 3VO1A 4DY6A 1Y33E 3I6ZA 3HE3A 4HG2A 2PKEA 1DZ3A 1U7DA 1C1XB 2PEYA 2VATA 5GZ6A 4MIOA 2HV8A 2YZ7A 3FZEA 3GCGA 1FMLA 2OMKA 3K9CA 5LBIA 4B31A 1JFFA 1SK9A 3JWJA 1HZZA 2O20A 3AHHA 1NY5A 3OJCA 1J39A 1W44A 4J41A 4EF5A 2LIVA 2XUAA 7YASA 1KEWA 3IEUA 1IN4A 4DIUA 3CX6A 5K0FA 3L6OO 1IPHA 3AI2A 4XW2A 3O8NA 2HK9A 2HRQA 4AZTA 3CRQA 1AI4A 3A70A 1XT6A 1XZKA 3T9FA 2YUTA 3AG6A 1TAUA 4ZIBA 3HCFA 4PFSA 3MDSA 3DPUA 1C8KA 2F1KA 4N5LA 4IGGA 1GO3F 1OLSA 1C1XA 1W5AA 1XDGA 2V4DA 1A2KC 1QGUB 4LGYA 3SFVA 3WGQA 5AVVA 2HRDA 1J25A 4GPBA 4BFZA 1R4MA 4BQOA 1T2CA 4HP8A 5K99A 2JFZA 3R76A 1ONBA 2P4KA 2VQFO 2KMLA 4FD3A 5FD8A 4EW2A 1RJGA 5GZ1A 3MAQA 1Z0FA 4JLAA 1JEEA 2OBLA 4Y6RA 6CHYA 4YLYA 2H08A 4EUEA 1T2EA 3VZQA 2YJ4A 3DOIA 2OILA 2WKRA 3OLXA 4QREA 1LTHR 4O8CA 3UF0A 3EVFA 1G0NA 1UM8A 1D2DA 1FNDA 4CT4B 3D4PA 5LQAA 1HQKA 1V8BA 3EUEA 1FXVA 1PYGA 2FZWA 2WTNA 3ORRA 2YJZA 3RFTA 2MTBA 4C1BA 5ALVA 4HEJA 1U0BB 4E0QA 3RUCA 3OT7A 3A11A 3D0KA 4KN5A 3UJCA 3WJ2A 1XNQO 1L3IA 2HPAA 3WI7A 4AQDA 5JY1A 4JXZA 4TZ0A 4BFWA 3T94A 5IM4A 3BIWA 2MCFA 1OI0A 3T1NA 3SZOA 3R2NA 3JSNA 4HXGA 4YUAA 2PWPA 4A6XA 4BX9A 3DAFA 4IDPA 3NNSA 3RC9A 4I4TB 4TWRA 3SS7X 3V33A 1KOGA 1NXSA 3VOUA 1OFVA 3CTPA 5FOTA 1FMFA 4LYHA 1OZ0A 1LU9A 1E1RG 1XRRA 2DH6A 2Y4NA 4MQBA 2EWMA 3P27A 2IJKA 2HREA 2LTAA 2ZU0C 4D56A 5ADWA 3PEEA 1E1QG 3R3YA 3VR6A 4AFNA 3E22B 1SN7A 2ZT5A 3WLQA 1UKAA 1R6NA 1VKZA 1WPQA 1ZM4A 3HKDA 4D9FA 3MBKA 1DC8A 1Y3BE 4RVHA 3RS2A 2XKAA 1Y6ZA 4MW3A 3APQA 4A5SA 5L4LA 3A04A 2IDZA 2LUOA 1VHWA 4DJ5X 2ATKC 4PWYA 2FN7A 4YDQA 3OPYA 2PS1A 2ZQ5A 3KJHA 4G5XA 3VOAA 4CZ2A 4D41A 4DSUA 5A5DA 1TM3E 5B55A 2DB3A 3OC6A 3OZSA 1QFJA 4W5QA 1X2BA 3ST7A 3EVZA 3AVQA 2MJLA 4KDEA 4RD6A 2JVDA 1U99A 1AGRA 1G63A 1Q11A 1DIOB 2QTGA 1VJ0A 1WKCA 3KU4A 2CVFA 3B60A 3GROA 4KBFA 4MI9A 1A88A 1S02A 3LOPA 5BOVA 4JT2A 2DBRA 2QRVB 4P7JA 3SSAA 3UMGA 1LSSA 3OCJA 2I87A 3CCSV 3C5CA 2X3FA 2WYIA 4G4SO 3HCDA 3SS9X 3DB2A 1KDTA 2FUG1 3PDIA 1UXOA 5LGNA 3ETHA 2X41A 2GPWA 2LGJA 4TYPA 3WK5A 3WK4A 3ZI7A 1SUCA 2YDEA 1RXVA 3IMCA 4OCLA 4CM8B 2F4VB 5AKHA 4MPTA 1EUDA 2HV9A 2QT9A 5IZ4A 3A26A 1YI2V 1KMNA 3OIYA 1SIWA 4JD5A 4TTSA 4D8YA 2HLHA 2OQRA 1P6UA 1AKQA 5AMXA 4GDFA 1Q77A 1IZ8A 2H7YA 1RFLA 3RTAA 3U31A 3W8NA 3VO9A 4NENB 2CK3D 1CUJA 3FFBA 4EPYA 4OXKA 1XCLA 4MQ5A 5JG7A 5H2FZ 3HI4A 2H8PC 1KBZA 3THWA 2X6CA 3U61B 4ISCA 1N6HA 2AEEA 4N7JA 4CQMA 2MWMA 5LUAA 2I33A 2XMGA 5ESDA 1JIQA 1X7WA 2AN1A 1X94A 1SQQH 3K2QA 3MN1A 4G8BA 4O02B 2NYUA 3V7NA 3DDZX 3IQXA 5YASA 1Y9JA 3LWNA 5I7RA 1QVRA 1VOTA 4OB8A 1HL7A 4Z9BA 2NZVG 5FTNA 2X2OA 4C07A 1MH1A 2IUYA 4IEFB 5ENVA 2LCIA 5AM3A 1WB7A 1GCGA 2I1VB 5LUBA 3CFYA 3BGIA 1SVNA 4PIVA 4ZWNA 1DFIA 4E21A 4C0JA 4I66A 4IJUA 1W9MA 4EITA 1N77A 4DQUA 2FHPA 3PTAA 2OHHA 5HGJA 1LVUA 5C46F 1Y80A 4QBKA 4CETA 3AZOA 3MD0A 2GK4A 5HZKA 2VDPB 1T8RA 1NLMA 5EG5A 3COWA 1SVOA 1RI5A 3DOCA 1FXWF 3U13A 4FFPA 5FA8A 1H8HA 2VDOB 2YJ6A 1UC4B 4BNZA 4IINA 4BJHB 3LKZA 4CYMA 2DM6A 3BVOA 3AIOA 1Q74A 2P2YA 4H4DA 4ZQIA 1EFPB 3KUDA 3P9PA 4O6VA 4CLDA 4DMGA 5K6AA 3AWDA 2JFXA 3DE6X 4MS3B 1QB7A 5FR2A 4X94A 5AJHA 1GN6A 4LH7A 1OJLA 4D6PA 2O8FB 4GI2A 4R01A 1DOAA 2XUKA 4TTTS 1ZD9A 1ESEA 3LECA 4FQ7A 4WN3A 1SXJA 4BMCA 1LLDA 4UVEA 3IGFA 4EHAA 4J7UA 2EJWA 2YXBA 3BDIA 3GWOA 2EIXA 3OP4A 5E0KB 3TTYA 3OQ6A 1Q1ZA 3LF2A 2OCHA 2WYHA 2BHSA 4K3UA 3LO8A 1CIVA 2O3QA 4OUDB 4ICGA 1UJNA 5D5QA 4Y2HA 4M60A 1PS8A 3S55A 1OB5A 4F12A 2ZT8A 2A0YA 1MC8A 2GRUA 2E3CA 4YIKA 2Y77A 2HKOA 1USGA 3I2HA 3CH5A 4HYYA 1IN7A 1ZVQA 3FNFA 4WX2B 1V54B 1JV2B 4V3CA 3R7NA 2YVAA 1G2IA 3LJKA 4K9RA 1YMUA 3HCRA 3TQCA 4F06A 4ZGGA 1E2BA 1X80A 2FPGB 4BVHA 4DRZA 3RK0A 3U3OA 1DQNA 3O4JA 4OUDA 3LBAA 1GAXA 1OYWA 2GDJA 3UBTA 3CS3A 3IT0A 4NFHA 2WMOB 5EOVA 4C7UA 3ZOZA 2C2ZA 1AK2A 2JGNA 5J23A 5HIAA 4GL2A 2W8BA 3BSWA 4UM5A 4FHFA 5CW2A 1Y9ZA 4CKZA 1CRZA 3A9UA 2VAPA 5AHRA 3A2NA 2XCLA 2WF5A 5EHNA 3ZKAA 2H2AA 1YA8A 4Q5IA 2G9RA 5AM0A 1RACA 4N6OA 3GJZA 4TRJA 5AICA 4WLFA 3LLMA 1ZD5A 3M6FA 1X19A 4DWOA 3PPXA 5G0TA 4X64O 2ECFA 2JI8A 4L9RA 4S1OA 1BRTA 4FYIA 4E22A 4V3BA 3ADCA 1XA3A 1Y37A 1FW8A 3IXQA 1IHDA 1GM8A 4F4UA 1XHZA 1WLYA 3JQ8A 2G36A 3QVLA 3W90A 3L1KA 4IYHA 5IYCO 2O0KA 3R0QA 5JISA 3ABMB 3M6UA 5IJZA 2GF9A 5KEIA 2P87A 3RGBA 3E5RA 4ZVMA 1LJ8A 1QPGA 4KE6A 1J00A 1QQ7A 2FSIA 2J6BA 3BL6A 2E74B 5JLJA 3HO1A 3IR5A 2VWHA 4EPWA 1ZMRA 3HU1A 1U0GA 3HCCA 1RYFA 4F5DA 2PDAA 3ZRWB 4PZUA 4LWSA 3O4FA 4MCAA 3VVBA 3PL1A 1WXDA 4RANA 3T3NA 3O73A 4BLTA 4RW0A 2O06A 3UWKA 3P0JA 3FZGA 3GAMA 4IG9A 1QYCA 1A8SA 3CG0A 2UV8A 3FR7A 5AH0A 2O96A 4GC9A 1DLIA 5EUCA 2YUAA 3ASZA 3TZQA 4KLRA 4TLEA 1QRTA 4A8JC 4RKYA 2QWPB 1PBNA 5KUMA 2HIMA 4ZCSA 2BFWA 5FTLA 3JATB 2QNRA 1SURA 4G84A 1ZNXA 4JGBA 2VRCA 1S5LZ 1XCBA 3P9SA 5CHYA 1AKNA 2A9HA 3DV0B 4FHDA 2AXEA 4PAGA 3ZXYA 3DL7A 2GXUA 4DR4B 2V7XA 4FDVA 4Y2RA 2JGKA 4LRWA 4PZCA 3VJLA 4YCNA 5M04A 3C3TA 1A04A 5LP6B 1E2EA 5GVRA 1AXRA 4OP1A 1W76A 1KY3A 4ND4A 1QLHA 1H2AS 2QTWB 4YP9A 3FRJA 4DTCA 2IEAA 3UANA 1MGOA 4DLLA 3QEBZ 2JFFA 3F2VA 4Y67A 1UBLS 1XCJA 5JEDA 1Z06A 4HSEA 2FG7C 3FRIA 2EHDA 1ZJ4A 2QG4A 5CBPB 1NI3A 1WUKS 4IJKA 1LB1B 4AUKA 2BY4A 1PJSA 3ITKA 3FMFA 4GZ3A 4WE3A 4B3GA 1DX4A 2C8LA 1K8YB 1WCYA 4CVNA 2YL2A 5KA6A 1AS0A 1UKZA 2W70A 1H93A 1Y82A 3DW1X 3KSRA 3PC6A 5IKXA 2EGGA 3KPUA 1X86B 2VRWA 5TPZD 1RM1C 3DJYA 3DTVA 2PFSA 4IDNA 3SX0A 4K87A 2Y1GA 3AR6A 3GT0A 3OLQA 2ZBQA 4NDNE 2IV2X 4CMAA 1PVOA 4DV7O 2CE2X 2VPYA 4LOKA 2O2GA 2ZPAA 5TVGA 1Z5OA 2JCYA 3I5UA 1YVRA 3ZLVA 4H31A 4UFZA 3EXFB 4CT5A 4QECA 3DULA 3FPJA 2O6LA 2JH3A 2DERA 3JY6A 3UHPA 1V26A 1U1CA 5HWSA 4JR0A 1EFUA 1R6AA 3CQ9A 4QX6A 2W5UA 4N39A 2R6AA 5JT1A 3AG3C 4OX9Y 3DTVB 4RK7A 4CKXA 1ZESA 1A96A 3KOOA 2Q1UA 4CFZA 1UOOA 3MWEB 1EA5A 1MVLA 4CHTA 1A9TA 2XWQA 2ZJBA 1KZ1A 5JAZA 3F73A 5H3HA 1JEJA 4R54A 4BNDB 2J6IA 3F96A 3ZCQA 1QQTA 4EUKA 5KJFA 2XRZA 4WIGA 3EXFA 1CHDA 2OTLV 1FJ2A 1OPRA 2ISCA 4M83A 1U90A 1VKHA 2VJLA 2Q67A 2Z95A 3RASA 1GADO 4P82A 1PFVA 4IIVA 4UAVA 5EMLA 3T7RA 1B3QA 2HIAA 2XNDG 1VLHA 3CJHB 3E27A 1G5HA 4UNRA 1T5SA 5IS2A 4L3WA 5F3RA 1NBOA 1SU8A 1ZN2A 3VOSA 1LK5A 4PZLA 3UWPA 1FP6A 2Q8QA 3SPJA 3EC1A 3O8QB 4JYMA 3ESYA 4R4JA 4TN5A 4X00A 4Q48A 4EL5A 3ODPA 1GTRA 4KR6A 2H4YA 3L7OA 5HIMA 3CRAA 5EE3A 1A2BA 1Y7IA 3GGPA 4IV8A 4MJLA 3V1UA 1DAEA 1YKSA 4C3UA 1FBTA 3IQWA 3JAMN 3FSGA 5FOSA 4D4KA 1PRYA 1GT91 3LUDA 4E09A 5CXUA 3WL3A 1FXHA 5DYNA 4JH0A 4TM7A 4D3XA 2G6TA 4BBJA 1UANA 2Q2NA 1N0NA 1WHSB 2WJ3A 2EF0A 5A0TA 4EW3A 2EKZA 1E1QA 2H4HA 3ABRB 4OWPA 4JOSA 4ZO9A 3GF4A 5EMKA 4AB1A 2XUQA 2H7VA 4N5MA 3L8DA 2H1VA 1E3MA 3G6BA 2P35A 3NW9A 2I22A 2RCYA 4DIOA 2GAFA 5LMNB 1T25A 4DZRA 1CU1A 3P96A 3TLMA 5KDDA 2JKYA 4LXHA 1G38A 2GSWA 1OILA 2XWBF 2VPQA 3E0XA 3EGDB 4BNKA 1PJZA 3H5VA 4BB6A 4J4TA 3MMNA 1T2AA 2H4FA 1HK7A 2HSJA 5FLXA 1N57A 2IKQA 3CMMA 1VPTA 1PAUA 1P7PA 1K0FA 2A9KA 1A9SA 3NIWA 4FONA 3ID6C 4CF5A 3CN7A 4W6QA 4WZBA 3U44A 5CIQA 2VJAA 4UZFA 2QVCA 2B3DA 1HT0A 3I12A 2I1QA 3DEHA 3Q8MA 2O5CA 2DY1A 5DSXA 3ZR4B 1L1RA 4RO0A 1XLTC 4EFDA 4I55A 1ENOA 2IOQA 1OAOA 4B73A 1DTWB 1MTOA 3K9SA 3PC4A 4KLNA 4LS3A 3VJMA 4CF6A 4ERNA 3ZMVA 1ZVMA 4RKRA 3KEGA 1MHTA 3WGVA 2ZQYA 2XF8A 2Y69B 3EC2A 1ZP6A 1Z7EA 1JCHA 2GEKA 2ID7A 4JQOA 4LZLA 4HHEA 4X45A 1R0LA 1GFWA 1XL4A 2ECPA 2V9PA 4R69A 1E2DA 3HDQA 4GBGA 2AK3A 5BN4A 1KMHB 1I36A 2FWPA 3CEMA 3LP5A 3WYCA 4ZYTA 4URYR 2QLCA 3S1LA 3AL0C 2BM1A 3LPMA 4GYJA 4G1MB 3SHWA 3COPA 1T0BA 4P30A 3ACCA 3IDAA 1ZI8A 1ZWKA 3JQ7A 2XTJA 2L17A 3SPHA 4M7PA 3VZPA 1ENYA 5L3CA 3WP1B 2PQMA 5JJLA 1HNZO 2ZPUA 3AUKA 2MSEB 1Z34A 1N2ZA 1ZH0A 2QJRA 4G0PA 2X14A 4RTSA 1QHHA 2PKQO 4YO7A 1LK7A 5EJ7A 4BXOA 5K8VA 2W37A 2H6EA 2OGTA 2AZ2A 3ZDZB 2MU1A 1JH9A 4CMBA 3G2PA 4OQ4A 2W98A 1IWOA 2IYNA 3NCHA 3H1JH 2H57A 1IUPA 3PFNA 4RVGA 2YZMA 1TZ2A 3AR7A 1A2OA 1EK1A 3HVHA 1HDJA 3NOVA 2EHJA 2Q28A 3QWAA 4P0TA 2YICA 2LXNA 5G0UA 4DABA 3T61A 3BGWA 1VSVA 3CVVA 4G0ZA 3KPYA 3A1NA 3L01A 4BNDA 5KTYA 5JU6A 3LU1A 1D9XA 3HYNA 1YE8A 3ZDRA 2J9ZB 5FI1B 3QY9A 5GOZA 4FFVA 3IAFA 3U19A 2BKEA 5ALLA 5JJIA 4MR7A 4QU5A 1H8EA 5LQRA 4D0LB 5KTPA 1OLOA 2WDZA 1AK9A 4CBVA 4F86A 3CWCA 2OM6A 3ESQA 1PJQA 2D2IA 2ZR0A 4P7GA 2F8LA 4AP5A 1SO8A 1U5BA 2X0LA 1UJCA 2G4CA 3B8EA 4QPNA 1E79D 2HGSA 3BRCA 2CFIA 1MOPA 2B0CA 3RPEA 3GG9A 3B6MA 4AUEA 2XD4A 3LY5A 3ERCA 4P08A 1BW9B 4R81A 5EJGA 4CH3A 3U17A 3K57A 2XVYA 2OXFA 2R25B 5CGZA 1IJKA 3CNOA 3C6YA 2WLNA 2PZLA 3KWJA 2REQA 4L5BA 4ZT4A 1YHQV 2XMCA 1P7WA 2YWEA 4K6HA 4TTPA 1R6XA 2J8ZA 3AU8A 4DF3A 2OAP1 1UZUA 2HT1A 4J9YB 5EMMA 4LSZA 1WAMA 4H7IA 2OP0A 2PJUA 2FFQA 1RPTA 1OBCA 2BBSA 2R6ZA 3LXXA 4L0QA 1JJOA 4A0RA 2Q2WA 3PHGA 2H2IA 4F4DA 1U3WA 4LMAA 3WLFA 4X65B 1GLVA 2UXCO 2CL7X 3PPYA 4DXHA 4Y1RA 4J7CA 5T8KC 2H48A 2DWDC 4EHLA 1WW2A 1DC4A 3LVBA 4AQ7A 1XRSB 1NZDA 1IN1A 1HA3A 1PJ2A 1WE2A 2FETA 1MKYA 1OCOC 4GLOA 4WKCA 3TLGA 3TNLA 5JJBA 5FJIA 1F23A 4K05A 5A3VA 1UMBA 3PE4A 1NVEA 5CDGA 5JD4A 4Q1AA 1E1KA 5GIOE 3UW1A 2EFCB 4DLUA 3EX8A 4IM7A 2PH7A 3JD2A 4MV6A 5JSZA 2ES4A 4XWTA 1W2HA 5CB8A 3ZUGA 4ZMSA 3OTOO 2VK4A 4XFJA 1Z8HA 2A57A 1U9JA 4MA4A 2AUTA 4H16A 5CCDA 4YUXA 3GU3A 3MFYA 1M8PA 3CYOA 1EVKA 2R8XA 3N76A 1T6NA 4GF5A 4PX3A 3ZBUA 4EECA 3R6LA 3KYIB 3STZC 4ZCMA 3FSRA 2WD7B 4NECA 4Y6LA 3E84A 4C03A 1G9TA 1JGTA 1UMBB 4DCOA 4EJFA 2B1RA 4DA6A 1JFFB 1M56C 1ORVA 4P4SB 2PFKA 3LSQA 1AIPA 4HPJB 2X9VA 4TWAA 4JAAA 2RAUA 4Q20A 3ABQB 3KVNA 4V03A 3T7DA 2AFRA 4KI0A 4D9NA 5HTOA 3AG2C 2J7PD 3QX9A 5IM5A 4GOOD 1R0SA 3ASNB 4UBOA 4XQ0A 5TPZA 4UHHA 1S2OA 2CMKA 4JLOA 4U2KA 2F8SA 3JZMA 3F67A 1R8QA 5JCOC 2BFFA 1BHBA 4DV5O 2VLIA 5AW5A 1U5CA 1VMKA 1X1TA 4YAWA 3TX6A 4FZVA 3IR6A 2R7MA 1UDWA 1JNXX 1P75A 3D0RA 2P7TC 1E3JA 3O6VA 1LLCA 3T4EA 4ENWA 3EXHB 5KNDA 1DJOA 1O95C 1P3Y1 2C2HA 1WF6A 3EIXA 3FE2A 3K9HA 4HRYA 2X76A 3H0EA 2HXGA 2ZBPA 4JP5A 1QHGA 2XTAA 2JVJA 1SD5A 1S3SA 2UVPB 3I64A 4DJTA 1RPZA 3R5XA 3V1KA 4O8YB 4HGYA 3W3AA 1XZIA 1F7UA 5A4KA 2B4QA 2NPOA 4XUDA 1Z07A 2NVUB 3DC6A 3DBIA 1NUTA 5FIUA 1GSAA 4Q1EA 4R6ZA 1KDRA 5L3BA 4IGEA 4NNPA 4DA4A 4I50A 3AVYA 3EBPA 3LNNA 1RLOA 5BRAA 2D8MA 2HQOA 2OGWA 4G4SP 4AG5A 3PTLA 4N54A 4KIWA 2QXTA 2CH7A 5I3ZA 4BQPA 2VHJA 2RG7A 1TF7A 4RH3A 1RLJA 4MCHA 3QV2A 1YIAA 1C0KA 2FQYA 4G01B 5LMUO 4IS2A 2C1ZA 3SZ3A 1QCEA 1RDFA 4JT8A 3UG6A 3CN9A 4NG4A 4FS3A 3QW4B 5MN5A 4MYCA 3FKQA 3SI7A 2WSSD 4ZHQF 3LTEA 5HJ7A 1KK1A 2FCRA 2E49A 2H9YA 1NJIW 4X20B 1T9CA 1Z0KA 2LQTA 1XE3A 4C4TA 2F95B 2BJWA 4LVUA 3KVRA 1NG9A 2E37A 3FTFA 2PL3A 3GAZA 2B8EA 1BE0A 1JSLA 2P75A 6ABPA 1UFQA 1XOIA 2MHCA 3EH1A 1SZCA 3L8FA 3NBYC 3PWKA 4LWZA 4ZK2A 1E98A 2VT3A 2VP3A 2BE3A 1SVLA 3OTFA 1N2EA 2COKA 2N46A 2Q5FA 2V55B 3F90A 4OP3A 5AR1A 4DXWA 1Y4ZA 3VYSB 4HRAA 3TW6A 4PELA 2AR7A 3AM5A 3QUAA 4C5BA 2UZ4A 2C7PA 1TCVA 2A4KA 3P9XA 4MZXA 3ETLA 4NV0A 4P3YA 1HR0O 4IMIB 5HP4A 1PI3A 2J3JA 5I4CA 1VMAA 1FXKA 3GW8A 2IT1A 3OZIA 5B7PA 1GA4A 4GNRA 1TJNA 2VUHB 4ZQCB 4XWKA 1EBFA 1W25A 2ZIMA 1WUIS 5IZCA 3LX4A 1TFRA 1TAQA 4LC1A 3GJYA 4I5EA 3RZUA 4KTVE 4MWSA 4ENVA 2AN3A 4DEVA 3IXMA 3GQBA 5DYWA 1CVRA 2WLJA 1FLAA 4OYLA 5F1OA 3H4TA 3CO5A 4ZA2A 4KMMA 2GCGA 4ND5A 3RYCA 3BKXA 2R5NA 4J11A 1M2FA 2EINC 3IKTA 1GG8A 2IWRA 3PNYA 4Q0MA 1WXFA 3FSEA 3WYGA 4LIPD 3R9XA 3V2UA 4GUDA 2DF8A 1BYUA 4ZZ3A 1QFZA 4B6OA 2WMNB 4OXXA 4FNGA 4ISBA 5CD9A 4J0GA 1JU4A 4MNTA 4ZYZA 4RDCA 2VZ8A 3ZQKA 4G1UC 1M6NA 1I6MA 1TIBA 2ZYVX 2UXDO 4JUIA 2IP4A 4XVHA 3GUYA 5CNKA 2DKFA 4EUHA 1FTWA 4BRZA 4CF4A 2JAXA 4BO9A 3IPYA 4MKGA 1PZHA 3G49A 2FA9A 4HGQA 2NNLD 1RXSA 5AKIA 1ADCA 4G0YA 1U0LA 4WASA 4J42A 1ZIOA 4QDJA 4Y7DA 1FLVA 1JHDA 4RWUA 1Z4LA 1QVFU 1ZIXA 4MP6A 2NV0A 2ZSKA 4V0QA 3RSZA 1RHKA 6REQA 1ILEA 1QU3A 4B79A 2XGMA 2OBCA 1K7FB 1QJCA 1HNXO 2XAAA 1JLMA 3FJYA 2PYLA 4AKEA 5F4ZA 4ZIRA 3UJHA 3GFTA 4QRDA 2WTMA 1W0JG 3K92A 4WN9A 4D9CA 2A5GA 4HYQA 4Z3OA 4OCLB 1E4EA 2D5AA 1OV4A 2P4SA 5ALOA 2AFIE 5JH7B 2HJFC 3I09A 3QE4A 3PPWA 1S9HA 2QLMA 1R88A 3AKCA 3E9RA 4UEOA 4UPVA 2X1HA 5EWLB 5AVXA 2YNMD 1TAEA 1NATA 2O3SA 3DDHA 5CVUA 1XKXA 3K2EA 1W49A 3PQ8A 2HPVA 3TM5A 4ZKDA 4CIYA 3TL3A 3GNTA 5IT0A 3RVRA 1Z13A 3IE0A 5KYGA 4MS3A 3N05A 4WOPA 3H5TA 3D1JA 4MVOA 1M6VB 5K1PA 8AT1A 2O8CB 4RQBA 1YACA 3QFFA 2J1LA 1QUFA 4UEQA 2QTMA 1TEHA 3D7NA 2YCBA 2WWVD 1C9KA 3F3SA 3VAAA 3FR8A 1YSBA 5LQUA 5CCXA 1BDIA 3KVOA 3TQIA 3OM0A 1KO8A 3CR3C 1WIWA 2OWDA 2PQ6A 4HTFA 5B5SA 4NAUA 1J8FA 4B2IA 4TT3D 1QKKA 3RCBA 3EZYA 1LF0A 4CDMA 2CDCA 1Y76A 4RHYA 3I2JA 2JCGA 4JMPA 2JLAA 1PG2A 2WT8A 4O33A 1ZABA 1CNFA 1D07A 4TQGA 2QRJA 4INZA 2PRZA 4KZPA 3ABUA 1II0A 1K7EB 5DWDA 1X3SA 4EQ6B 1VCHA 2JEXA 4ER3A 4DIEA 4E6EA 2J31A 5J9PC 1M56B 2AJLI 2CLMB 1NP7A 1J8VA 3QVSA 2ORWA 4N4AA 4R0VA 1E1DA 4YGYA 2FPKA 5AJYA 2VDJA 3EEOA 3KR1A 5TPWA 2Z4SA 3QE3A 2R87A 5LC1A 4UXIA 2J9FB 2PH3A 2RKBA 1OXTA 2IODA 3NAGA 2K7FA 4YACA 1K3EA 4F4LA 5JJEB 1RWWA 4PAQA 4X3PA 3V4ZA 1ECPA 1RJ9B 1RVDA 2P0YA 4AWXA 4EPRA 2OY0A 3VTAA 3GPLA 4JXXA 3NEPX 1DNPA 3CY6A 1H3NA 3HB4X 4MKZA 2IC5A 2O9JA 2NU9B 3KK0A 1GL7A 2GM5A 5EE9A 1QMPA 4BNMA 2V0GA 5GM2A 1E3QA 1D4FA 3EZNA 1GG2A 5ALXA 1AX9A 4Y1FA 4N03A 3RRFA 2GEFA 5TPWB 1TE2A 1ATZA 3S3WA 3Q72A 3VUEA 4BQQA 1VGQA 2PSSA 4RTNA 4XIYA 3Q2OA 3CCQV 5E3IA 4W5RA 4F4CA 5JJNB 4LFCO 1PN3A 5SZHB 2BRUA 2I4RA 5A4AA 5BNFA 3OT1A 1HY3A 1U3GA 1UQRA 1ZY2A 3IAEA 5IDVA 621PA 3CLRD 1ZW1A 1JU3A 3BFRA 1K6JA 1SOUA 2GILA 5DYYA 3VPGA 1LXCA 2ZAYA 2ZR9A 1LI4A 1QDUA 4JVMA 3GEGA 4OA8A 5EPOA 3CT6A 1GDTA 1U2GC 4WKOA 1WA5A 1T8TA 2TYSB 1RM0A 3BILA 3H5OA 4JX8A 2ZJAA 5I3CA 3V8VA 4UEKA 2VDWB 3AVOA 3EYAA 2JLSA 4ONEA 2B1IA 1K06A 4BKQA 2K2QB 1DCFA 1R1BA 4JF3A 1E7YA 1NU6A 1XDSA 3C4QA 5JWPA 1MGPA 5EUBA 2XIQA 3LUPA 4Z3DA 1M2GA 2QR5A 2F66C 2B2XA 3SC4A 3NC1C 4JLKA 3UMFA 7AT1A 4HAOA 1SHZA 1EM1A 3DHWC 1EI9A 4HLUA 2I55A 4HXEB 4JR2A 3OKCA 5B2ZA 1MEOA 2TMKA 1F1BA 1JDPA 3D5EA 3GGGA 4R5MA 4AK9A 2HYDA 2JA1A 9GPBA 1VJ5A 2GCEA 1XIVA 3KR0A 2AFIA 2NUAA 4M6WB 5KJEA 3NUZA 5L51A 3Q9LA 3Q10A 4RF5A 2E89A 1HE2A 3NTRA 4DMHA 3KJQA 3VH3A 3LYUA 1Y5MA 1N8RW 2DMRA 3OQ1A 2B2CA 2V9CA 1NI4B 1Z5VA 2AZMA 3JTMA 2HBYA 4FQ8A 1COZA 4HGRA 2FSUA 1Q0SA 4P83A 1G5FA 2GUZB 4IJ6A 1IZZA 2H5LA 2WM9B 4UUNA 4JASA 1R7RA 2VSOA 1JQJC 4MVRA 3AFOA 3GCXA 3IVAA 3Q7IA 4C5AA 3QM1A 2NZJA 3AR4A 5D85A 4BMNA 1Q7YW 1CR4A 1RZ3A 3CVOA 5D6OA 2P2LA 2IEIA 2XDYA 2PVSA 4M6WA 2YIBA 4AQYO 1OE0A 1T1GA 3ISTA 1RRPA 2WR8A 2XB6A 1M10A 4O1IA 2GSMB 4O2BA 1KZYC 2PUFA 2VNSA 1NI4A 1LI5A 1GUDA 2E4WA 3R3HA 3DQPA 1EZZA 3AG1B 1ZL8A 2PI4A 2G9ZA 5JZ9A 4M9UA 2R70A 2XYHA 1QYDA 3IIIA 1U2DA 3JVUA 1JQDA 1VJTA 2B30A 1XTQA 3OQBA 4A16A 3GLGE 1HMYA 1OCZB 3ZU4A 2QE6A 3GVHA 3MRSA 3L0OA 4CUJA 3LX5A 3W4JA 4RMJA 1QAOA 3SSNA 3AJAA 2NSJA 3L0ZA 3H11B 1QQCA 3C3PA 3M0EA 3OLWA 2QRNA 4Y2UA 1NRJB 2P68A 3UZUA 4J0KA 4XEHA 3F6EX 3GYBA 7REQB 2CV1A 2JHGA 2O52A 2P2NA 1EFVA 1K0UA 2PA0A 1N1GA 3QXSA 2X40A 4H0NA 3CSXA 5CVTA 2F43A 1XDWA 3JQAA 1WP9A 2PK3A 1J24A 4FE7A 5EN4A 4DG8A 1O9GA 5H8WA 1Z7WA 3LDHA 2C3OA 4FSHA 4O4HF 1JFLA 2R0QC 2NU7B 4DLZA 3BMCB 3H4MA 1PNKA 5AVJA 3S29A 4JOCA 3T34A 3K6KA 2MDTA 1NU1H 2CE4A 1SWVA 1ZZEA 4PPYA 4CDRA 4Z4EA 6PFKA 2XTNA 3JD3A 1NC1A 2VRNA 2AW9A 3PFCA 1Q82W 1S7CA 4V39A 2XEDA 4BP1A 4BX3A 1TAGA 2QX8A 2QJFA 5AK5A 7REQA 8ABPA 3I9FA 3EIOA 4QJ3A 2ZR3A 2QRMA 3W6ZA 1LDMA 4AKSA 5KWSA 3RAFC 4DCVA 1YA6A 2C5EA 2VLBA 5K0SA 4LG1A 4OH7A 3UIEA 1IEXA 3DHVA 3K0BA 2A0KA 1UDAA 1NVXQ 2EATA 3R5TA 1Y89A 5BSFA 2J0SA 5FL7D 2YY6A 3I9KA 4JBIA 3JVVA 4BNWA 1I7PA 5JNRA 3OZEA 1QYRA 4YYZA 5CBGA 3IA7A 3X2SA 3P3PA 4PLCA 1N9GB 4M1SA 5HZGA 4A9AA 3CF4G 3N8KA 4ZI7A 4QBGB 4ZVPA 2QTFA 4B4WA 1N3BA 3E0QA 3JWPA 3BTVA 3PC8A 2OVFA 4E94A 1QORA 5CRIA 3B1JA 3FSJX 2P1RA 2WBLC 4TKVA 3U7EB 1WA8B 2Y48A 3OGCC 2O7QA 3AILA 3G8CA 3GX1A 1YB6A 3NORA 1XXLA 4DQKA 1Y4SA 1BQZA 2XVXA 3OX1A 1HLFA 4JENA 2BONA 1L1FA 4EB3A 5EAIA 4ER0A 1R6DA 1P5JA 2YWCA 4MR9A 1RRMA 4YX9A 4FWIB 3TSOA 1UXHA 1XNQB 1Z9BA 5JCOA 1IPEA 3AY0A 3TLXA 4QD3A 3OKPA 3K9FC 1VHLA 1F4MA 1AGNA 2MSWA 4E32A 4I1PA 2QLFA 4MVJG 5ALDA 1V8DA 4YRSA 3M5PA 2YC4C 4TXHA 2OIGA 1OKKA 3FMVA 5CX4A 2JI4A 4M46A 4HQ6A 3VDQA 5A9RA 2WPNA 3PCTA 2XB2A 2X0DA 4IHJB 3G67A 3FHTA 2V1XA 2QVZX 4UM9B 3VNSA 1EE1A 2ERYA 2R1UA 3QHPA 5D3MB 2PKRA 3B1VA 1UFRA 1XZFA 3MGKA 1RW4A 3BE8A 3IAHA 2AVDA 2QV7A 3BCUA 3P2OA 1MN6A 1JWAB 3KKOA 4YO8A 2ZETA 3H6KA 5TMPA 5IVHA 2XXAB 1YBFA 3GLVA 1AI5A 1Z82A 4P53A 1T91A 4LHWA 1XRJA 4IOLA 2O7NA 4QUJA 1N0HA 3UAXA 1IUKA 2H0AA 3LIIA 3TRKA 3ABMC 5ITZA 1VRVA 4QYIA 4U9UA 4DMFA 2H1HA 3ZZTA 5HM6A 4PNPA 2GK6A 3ICOA 3L8GA 1QSGA 1TM4E 4PHCA 5D3MA 2WZDA 5FUMA 2HU7A 3P9IA 4RPLA 3VAYA 2G9NA 2W90A 4WLEA 4FIDA 5EQTA 4D82A 4QAQA 4XWAA 1IM8A 2ISQA 3AB7A 4MRRA 2HVWA 1ST2A 3HVKA 4REMA 1JVSA 2JCSA 2EFJA 3KL2A 1AY0A 2OOSA 3M5CA 4U2CA 5D7BA 4DQLA 1HQDA 1MPTA 2XZTA 2O3KA 3ZJUA 2R00C 4BKRA 2B9EA 1HOXA 1BVYF 1NUSA 1EFTA 4GX0A 1MVNA 3GPIA 3LLCA 5ALRA 1SMKA 2IWHA 5FWXA 4EKIA 3PXDA 2H2HA 4JZKA 2G7MC 2HTEA 3TLKA 5ISMA 2BFEB 1KO4A 2BLNA 4Z9FA 2H0RA 2OORA 3MMZA 2HB6A 2RGCA 4BMVA 2YQ5A 4HZIA 1J2JA 4FCCA 3G89A 2GPYA 2DVMA 1U0SY 1Q16A 3JARB 1Y98A 2WJWA 2X86A 1CHNA 3Q3GE 1UOPA 4AC9A 2RHJA 2ZDIA 2ZIVB 1UJMA 4L0MA 4ABYA 2DY0A 4KFUA 3UV7A 1NJ2A 1RIFA 2HWXA 3RRZA 1NMYA 1MFZA 5B1SA 5L3QA 1W36D 2FPXA 4JDUA 1QP0A 3KYCB 3SPXA 1YZLA 1V71A 1XRLA 4TL9A 2DLNA 1DQRA 2XAGA 3BRSA 4LJAA 5IT5A 4I55B 1F8GA 1CDDA 2OKCA 5CFOA 2OENG 1PFUA 2F6RA 4XWGA 4EEZA 4HWOA 5IJAA 2DKNA 1NR1A 3MJEA 4KRYA 2IU0A 4RGVA 1HFEL 2CLKB 1K89A 1FFDA 2XAHA 1W48A 2AEJA 4HUQA 2H85A 1K2WA 3E2EA 3K15A 1C4XA 3D8CA 2PX3A 3N2YA 4J80A 2P8JA 3DBOB 3B5EA 4OM7A 3ZXUB 1VIAA 1K3TA 4KFMA 1AGPA 1XVTA 5B66Z 4PN7A 3MCZA 1FEZA 1UH5A 3JQGA 4RDHA 1ZH4A 4UVAA 2V7PA 1PP9H 3TW0A 4I7ZB 2I1WA 3QUTA 3VZSA 4LJRA 1V96A 3COSA 3NANA 3MUEA 2HBZA 4C5CA 3JQ7B 4OCNA 2I99A 2O5VA 4R84A 4JI4O 1CUGA 3CSDA 3NBXX 5AQ1A 1S5JA 2PGAA 8OHMA 4BYMA 4BWFB 3EY4A 2XDWA 2RH8A 4TV8A 4QPJC 1A8IA 1K5PA 3ZZ1A 4EB0A 5A4IS 1JU9A 5FUXA 4RVCA 3OM3B 4IXDA 2ZR8A 4DXAA 2N04A 1EA7A 2QD3A 2QY9A 2WUVA 3OJFA 4GWLA 4LSGA 1FW6A 3WAKA 3LUAA 3O26A 3P52A 2BLLA 3PUVA 3FOAA 3WB1A 3QU7A 1JSRA 4M22A 4Y1RB 3JASB 1U8XX 3OU7A 3AXTA 4XYBA 1CY0A 5TXGA 4B4VA 4DR6O 4Y18A 4BO5A 2RH5A 4CM3A 4RVOA 1MOQA 4P4NA 2NXCA 3IP6A 1UMDA 3DWFA 3PYXA 4BKUA 4LCUC 2Q9UA 1TF2A 4S24A 1RAGA 4TTVA 2HJHA 3RTBA 5CNJA 3UMBA 1XQ6A 3H2BA 3VU3A 3AZPA 2ZSHA 4RFVA 3B40A 5HIKA 4YRMA 4E5YA 1P72A 4I3GA 4XWYA 2JGJA 1Y1QA 1WBBA 3DBVO 2EFDB 3FWHA 2CNDA 3AETA 3NAQA 1DWUA 1XEQA 1R3IC 2PUSA 4JPRA 2CLOB 1NX6A 1NW3A 2Z5GA 1L5VA 1NVWQ 3QNUA 5FEMA 1H4TA 1VDMA 2WJZB 3JVEA 1VGVA 5T64A 3HMQA 4FFDA 4JXJA 3V4VB 1YGPA 4FGZA 2MK3A 2YIBD 4DWWA 2J46A 2DFKB 3DC5A 3K5IA 4TPKA 1T29A 1KI9A 3DFIA 2QY6A 3CRZA 2VDQB 3GT4A 2YWHA 1NYQA 1BFUA 5CVDA 3X43A 1QGZA 2D0IA 1WDMA 4NZNA 2DWPA 1F3OA 2W8ZA 4PVDA 1B0UA 2Z56A 3FBWA 5EUMA 3PNSA 2XUZA 4BQIA 3EF0A 4FEAA 2RBEA 2ONYA 4B8WA 1OGJA 2WVAA 4I1YA 2EYQA 1K5SA 4JC4A 2C03A 4O4LA 1MNQA 1F51E 2ZSAA 4WACA 3T8YA 1J90A 4FW8A 3VBEA 1L7DA 1C30A 2ZDHA 3DHYA 5D1HA 1L5HA 2WM3A 1TU3A 2GD2A 2CMHA 5BXQC 3A0UA 1CZRA 4RVNA 5FI3A 3TL2A 2BP7A 2XMPA 4BCBA 4LDPA 4XQCA 2PR7A 3CH6A 4OPAA 3DBRB 1JSCA 3FCSB 3KHUA 3KOMA 3TCKA 2XNKA 3DWIA 4S05A 4MVSA 4N47A 4OB7A 1G8FA 5FA5A 4OLAA 1TRKA 1QP7A 2Y1OA 1T0UA 2VDMB 4MVJE 5M7EA 4BHTA 3H1AA 4CFSA 5KYXA 4OJKA 1XU4A 4CV1A 3L7YA 2XWPA 3GJ0A 3JTEA 5AI9A 2CNBA 1E5QA 1NUHA 1EEXB 3LZCA 3HCPA