2IU0A

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
590
structure length
590
Chain Sequence
b'RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH
publication title Structure-Based Design, Synthesis, Evaluation, and Crystal Structures of Transition State Analogue Inhibitors of Inosine Monophosphate Cyclohydrolase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
total genus 213
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2006-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2iu0A04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2iu0A01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu0A02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu0A03
4EHIA 1JDBB 2XW6A 1EGHA 1S89A 3ZZMA 1KEEA 1WO8A 1C30A 2X8WA 1T36A 1ZCZA 1M6VA 5H3LA 4A1OA 1B93A 1P4RA 1PL0A 1PKXA 1VMDA 1M9NA 2B1IA 1BXRA 1CS0A 2IU0A 2YVQA 1G8MA 1CE8A 1OZ0A 1IK4A 1S8AA 1THZA 2B1GA 1A9XA 2IU3A 1C3OA
chains in the Genus database with same CATH superfamily
4HNHA 3ESCA 1VE1A 5THQA 5CPBA 2YXPX 4DB2A 1R4NB 1HT2E 3LKDA 1O6BA 3HR8A 3OEWA 4XAQA 4R2LA 1UPBA 1DKRA 5LYJA 1ZRHA 3EVBA 1ANKA 2BGWA 4S05A 5FEUA 1NI4A 2X4DA 4HDAA 1R6AA 3MMSA 2HCRA 5KYYA 3QBVA 2I2BA 5IHXA 4CEJB 3ADDA 1DBPA 3NKFA 4ZZ3A 2RBGA 3M5PA 3M4JA 3KXIA 5K2MA 1J1ZA 2GM3A 4F4CA 3IURA 3IP8A 4US1R 3H17A 1EZ1A 5C7OO 3D3WA 3QENA 2E5FA 1VQ8V 5BQXA 1RPZA 2XWJI 2ZE8A 3HCDA 2DGDA 3BIJA 4X9QA 4TQAA 4QOEA 2I9KA 1Q0RA 1PVOA 2XY4A 3LA8A 4G9BA 1FDTA 4K5QA 3OMIB 4YIPA 2Y05A 2QX8A 2WTMA 1MRSA 4B3RB 3LQYA 3TO5A 1F8YA 2QP3A 1W46A 3AY3A 4RHUA 4X84A 1II8A 3LF1A 2ILTA 2JGAA 5EJ6A 4QAJA 1Z6XA 3K35A 3O2JA 2DUWA 1IWBB 2WG1A 3ADBA 1I6LA 4J4HA 4KRYA 4OGGA 2B1IA 4W5OA 4C78A 1J56A 2HTFA 3QSYA 1G18A 1XXLA 4B2PA 4L7QA 4H3SA 1Y7HA 3UMYA 4PVDA 1I4LD 4Q7MB 2IOQA 2NSHA 4XJTA 3Q10A 3TEFA 4GS5A 1EDOA 2C20A 3S4YA 3JAWB 1R10A 2GBOA 2A3RA 4FYWA 3ICCA 3BHNA 3RFCA 2EYUA 2H5EA 2JIOA 3BMNA 1H2WA 4CIVA 5BV8A 4CLDA 1U31A 4OXNA 5BWNA 3CP1A 1MJFA 4B6PA 2VWQA 4O6VA 1D04A 3EVDA 1RZ3A 5FPHA 3EY4A 1HDEA 3E89A 3DFFA 3KU4A 4DC0A 3LQ4A 2XBUA 4GR9A 4AB1A 3O8CA 3GJYA 1R4NA 1G4AE 3S2YA 1XCGB 4F85A 4KU4A 4LYFA 1U3WA 1B41A 5LLSA 3WI7A 4JI7B 4Q20A 4YIHA 3ZY4A 2GEBA 4IZOA 5BUCA 2G9VA 3PPWA 3TW4A 4K2AA 5AIAA 2AFVA 2JGJA 5L6LB 3OT4A 1C1XA 5D2CA 3GJTA 4JB2A 4FYKA 2PXAA 4CEJA 1GR0A 4AAYA 2W2TA 4A0QA 3IBGA 1PZMA 2YY5A 1SBZA 1NBEA 4S0XA 2VSQA 4M8NE 2IZZA 3HN7A 4BJ5A 2CE7A 2PBFA 1MBZA 2ZB3A 1IXSB 5ER9A 4PX3A 1B76A 2OPBA 4MQ6A 4ESVA 1QIFA 3CA8A 4JJIA 3TLMA 3WU2Z 1N3YA 4ZBMA 1LVHA 5A4DA 1EWQA 2V0CA 2FQYA 2G3YA 3D02A 2AUNA 3MK31 3CLUC 4WIGA 3L5KA 3LCVB 5AW7A 3OJ0A 3VQYA 3W3AH 2A4KA 2Y0BA 4AWAA 4O33A 4HCJA 4M87A 1S1MA 3ZWXA 1KIFA 1ZICA 4CODB 4WL0A 5L3FA 2VTDA 3RS4A 3C87A 3LX5A 2HFKA 1ZBQA 2ZTSA 5CW1A 3REOA 5CNMA 5LLTA 1CK4A 3W5DA 3PIDA 2N75A 4J4BA 3FD8A 3KDPA 1NULA 2PZAA 1GILA 1CWUA 1WQ3A 5AWFC 1QYIA 1INLA 4JSYA 1YDXA 2YN4A 4AP9A 2R7MA 3JR3A 3DOFA 1Y0BA 5ABPA 1AO3A 1KPIA 3IPXA 2NX8A 2UYQA 1DXOA 2PX4A 2YC0A 3E9EA 4JV5B 3LDFA 5JUWA 1N75A 4YR9A 3MERA 2O8BB 3KZ1E 2O14A 3ZEDA 2WJ4A 4FI3C 1RJEA 4PR3A 5E2AA 4YAWA 2B78A 4YXFA 3OOHA 2BE3A 2XBMA 4LH7A 3L0BA 3UXMA 1OA0A 1DG3A 2FKXA 4BLPA 1MHTA 1OWPA 1EFRA 2Q07A 1Y5IA 3MB8A 3P32A 1JWBB 4YAFA 4U9HS 2GILA 5CJJA 1VF6A 1W2HA 2ZUSA 4DDKA 3K6JA 4ETMA 1GN8A 1FF9A 4MW9A 1PIWA 1D2HA 3A28A 1KQ3A 2FGJA 4D3DA 2ES4A 2O0KA 4EB0A 3IMFA 3KTOA 4XFDA 3RTCA 5ETJA 3BFKA 4QU8A 2ZJYA 5TEWA 3FRJA 1JR6A 2XRFA 5ALIA 3BBLA 4YAEA 1B43A 5DSXA 4PX9A 1E89A 2NZUG 3LIIA 1YB2A 5KLVH 2XMPA 2UZ0A 4UU0A 4OI2A 4E2WA 2OWOA 4HS9A 2ZRBA 1J97A 1Z75A 5IT9A 2G9NA 1YB6A 1Q90D 5ALLA 1XMSA 3O2SB 3F3KA 5FPRA 1QPBA 4J49A 4PYIA 5JJCA 5B1BC 3O38A 3BTOA 3VO2A 4EO9A 1YASA 4KVAA 3RR2A 3F71A 1NXQA 3GBSA 5JNWA 2FZWA 3NWJA 1X74A 3H5TA 3C6KA 3G59A 4U0JA 2G1AA 3KQVA 4CEHB 3WNVA 1ZI6A 4I99A 5BYAA 5DYYA 5E9JA 4RS4A 3PGXA 5B1IA 1QKKA 2HXYA 2K2WA 5LUBA 1OWNA 2BFDB 4UUBA 1N6PA 3SBEA 4E46A 3BKWA 3CX4A 2ZT9B 3CR3C 3I72A 5DP1A 3OJEA 1XLVA 2ODAA 3RS5A 1T0IA 3JQAD 1T4MA 4EG1A 4DMUB 2JI8A 3FKJA 4EI8A 2NMVA 3P2OA 1CU1A 1HLFA 4K9LA 5TGTA 3LUBA 4ZHQB 2AVDA 4JKIA 4Q05A 4RZQA 1GH6A 2O8BA 3CPEA 3B8FA 1P45A 2IYNA 2H7XA 4QBIA 3M5WA 3TSZA 3TBKA 2VNJA 4EP1A 3HBFA 3R7NA 1M5IA 3W2TA 1ORHA 4QDJA 1DPFA 3RN4A 4K05A 5LR6A 4XB2A 2IHZA 3K32A 4B4VA 3UWOA 4BB6A 1ZH4A 2DY1A 4JJ8A 4D46A 2CVHA 3HXQA 4UDYX 2VDUE 4ZV7A 1XZFA 1Z36A 3RC1A 1KC1A 3IQZA 4HOYA 4KR0A 1W9MA 3ABKC 1L9XA 3WGYA 1LBEA 2VPZA 1WUIS 4IKOA 1G5TA 4Q6WA 3DG9A 3FSRA 2DH5A 3C2QA 3Q8XB 5BR7A 4TYYA 1ZIYA 3BGIA 2EBWA 3ZNPA 5F5NA 3VQWA 2DOKA 3ITNA 2JGNA 1S9DA 5CW2A 1FEZA 5AQ1A 4BP9A 4BAGA 3UT5B 3ZCTA 3F74A 2POQX 3QEMB 3CF0A 1UKVY 3MMNA 2Q4PA 1PJCA 4XM1A 4ZAXA 2QJOA 2RCVA 3AO0B 4BP3A 5M2QA 4Y0VA 4OJMX 1OWOA 1G6KA 5B5SA 3B7GA 2UKDA 2IY9A 1F8FA 4YMWA 3L4BA 1N5MA 2WLNA 3LYLA 5CH3A 2FSFA 3EEBA 2ZDIC 1G1MA 3EGWA 1SZJG 1GPH1 3VJLA 4G2TA 3CPWU 3FZEA 4DV0B 2O0MA 2ZUTA 4IJVA 3QFRA 3TJRA 3ELWA 4GI5A 2CTPA 1EH5A 2VHWA 2QW0X 4RKRA 4EUSA 3E9RA 5EUQB 2X5OA 3GPIA 3QH4A 1SCKA 4LBWA 1KBHA 2WHXA 3QMVA 1YCDA 2L6LA 3NP7A 4XYBA 4G0MA 1XVTA 3DE1X 2Y1FA 3OMWA 1JVMA 4ZAFA 3I9NA 2FWRA 3Q8LA 3D8BA 4ZVMA 5EFZA 1L1FA 3WGNA 4QHYA 4ZHQA 1WP9A 4HXYA 3MJ4A 3SNHA 1A95A 5IYZA 4N6GA 3VVBA 4Q0MA 2RGRA 2REQB 1BVUA 5F9FA 5CYGA 1IL0A 5KMGB 2YXDA 1K3UB 4Q66C 3UKDA 2FSHA 2IOHA 2XWSA 1SU8A 1KO5A 1QRUA 1AV7A 3CRNA 5KB3A 2Q4DA 1TK2A 4KFMA 2JEOA 3WYDA 4EG6A 4OPHA 2AG6A 5BPFA 4N65A 3VPGA 4ZGGA 3EUFA 3PA6A 2OYQA 2GRAA 1V96A 1IHXA 2HJGA 1R6DA 3L75H 1YKSA 4NYMQ 3KQNA 1RQNA 3A0BZ 2HBRA 4ZDIA 1TYEB 1RPTA 4L6AA 4CS2A 3MCTA 2JCVA 1TPYA 1OBVA 3LXMA 1QYRA 3BHIA 2NTEA 2JEUA 1Q7TA 2Z3GA 1EAYA 2QN6A 3RCBA 3OAAD 2WA1A 4F3YA 2PKWA 4YMGA 3S2ZA 4G37A 1L4BA 4PIVA 1N0WA 3OZRA 5JDCA 3QEMA 3QGMA 4E5DA 3PQ4A 3E1GA 3EWSA 2EZTA 1M8JA 3T06B 2JLWA 4GI3A 1IFXA 3Q3GE 4DLKA 1X70A 4NVPA 2FJUA 3I76A 3MTIA 1QTNA 4D6TH 2Z58A 2AI1A 4RVSA 1GGJA 3O4JA 3IEKA 5HTOA 3AM4A 3ICPA 5A7HA 2I65A 2JIZG 4Z2AA 1U8EA 1D5WA 3G0GA 1FUYB 4L9RA 4IDDA 4YQFA 4B6JA 4C04A 2WLLA 1Z26A 2A33A 4Y2HA 5FI3A 4PV1B 2QSUA 2P1RA 3WXMA 1YBMA 5KWSA 4BUJA 4LY3A 3EGVA 1BQ4A 4FQ5A 4M83A 1D8AA 3ZI0A 3P3NA 5H70A 1TC2A 1PK9A 3FMOB 1Y6RA 4UTZA 4MCIA 1TGOA 3GZNB 1OX5A 3CCUV 1WKVA 2VQDA 4TMVA 4ALIA 5EC2C 1PX0A 2JAWA 3PQEA 1JU4A 4PYLA 2REXB 5DM70 4Z7OB 2IU0A 3NO4A 5GJBA 2B8NA 3OE4A 1GPAA 2H11A 3FOWA 2REQA 3IHTA 3A2MA 1T2EA 2OV6A 3G8YA 1QDUA 3EYAA 5HRUA 2QA4V 3V1TC 4WH0A 4L9AA 1JKFA 4UCVA 3KCNA 2HVVA 3DHYA 4NCHA 3MCUA 4C7OB 1LNSA 1NW7A 3NHBA 4BWVA 1IXKA 2GNPA 4AJJA 3RAGA 3S1SA 1QCYA 1IY1A 1QR6A 1J2RA 2HHLA 4TYWA 2X9LA 1FS6A 5HPYB 1Z06A 2F43G 3ECAA 4DYLA 2D8AA 2HO5A 1GZ3A 3OSUA 2ZRKA 5FXMA 4WMLA 1OH7A 1TVEA 1GTVA 3DVAB 2P9CA 4I0WB 4L87A 1KQNA 4NICA 2YN2A 5CA1B 2IBTA 5LU9A 2A9PA 4HH0A 4RPJA 4ZTUB 3STLC 3IJPA 3PD7A 2I29A 1T9GR 2FWMX 5KNDA 3GLHE 4BIOA 2X1LA 2OFPA 3QEAZ 1HDIA 1FBNA 4LJAA 2CJFA 2X58A 3L06A 1OU0A 1N33O 2XZPA 2MR5A 3C3TA 3AJAA 3PG5A 1EM8A 2PD6A 1SCIA 3NHAA 2DULA 2ZZMA 3FWYA 2G07A 3SPGA 1LDNA 2OV8A 3I5DA 4ZD5A 1X1AA 1X0XA 5AKGA 4X44A 2CB9A 1NA5A 3CLRD 1NV8A 4N7JA 1YZYA 1DIBA 5COBA 3C8ZA 3AB3A 3WL5A 4IX1A 5CVDA 1BEUB 2AA3A 3NDJA 4MTCA 3AK4A 4UM7A 3ZWWA 3CW8X 3GEGA 1QCCA 1E6UA 1HNZO 2FN3A 3ET4A 1R00A 2DHRA 1ZJJA 4RX1A 5J4LA 1R0KA 1V9SA 1KMIY 1VTKA 3EHBB 3FB5C 2SHKA 2BM0A 3EDQA 4IWNA 4H6PA 2PD4A 3SQNA 3X3HA 3ZHOA 1WY5A 4BNIA 3K1JA 4P92A 3UM7A 1A7UA 3RW0A 2C2XA 3EFBA 5DEDA 3BJMA 3O8LA 4V0OA 4JKOA 5IT4A 1G3QA 2H6EA 3NASA 2ORYA 3C3EA 1W5SA 1OB5A 4P80A 2H9AA 3CYFA 4F7WA 3D8TA 4MUFA 3C6XA 3B1KA 2YYSA 2VYVD 1TX4B 3AESB 2YMQA 4AF8A 1SCJA 4QRHA 1VYTA 3UY4A 4E03A 5BNTA 4C7OA 1DO0A 4OCMA 3R7AA 1JX9A 4O4HF 3IDZA 3RH0A 1NW4A 1O0CA 3IPLA 1SQ6A 3OLVA 3KLNA 4LW8A 4ZEWA 5L4LA 1HYEA 1ZW1A 4FB5A 3CS5A 3EWIA 4GSKA 4DSOA 2QQ0A 1FUIA 1HOXA 3KE8A 4ZQCB 3MFQA 2CBXA 4QHSA 4P4UA 4F4LA 3DVAA 2DG2A 1LK7A 4UASA 2R00C 2UZ3A 1ENPA 3PXGA 5LQJA 2VJNA 5AJYA 5CA1A 1I4EB 1PUXA 1ZCBA 2QVYX 2J09A 2XMDA 3JQ7B 4MKFA 4CR7A 3L0YA 5EMKA 5SY9A 3PRHA 4FU0A 4IT5A 3T1VA 1YKGA 4FM2A 4K28A 3D1LA 2ZITA 1CZUA 3S8MA 2DKFA 4UEWA 4A10A 3SHTA 4DUPA 1YS6A 4BLSA 4GOLD 4V0LA 3CN7A 3QG5A 3FAVB 2Q6VA 4P2GA 4DLTA 1HC7A 3OZDA 3SBOA 4BNWA 4HATA 4MV1A 4EI9A 2A94A 1J8DA 5EP1A 5KTTA 1IZ9A 1FQJA 2B4KA 4KB5A 1GDTA 1VK9A 1CD5A 3SM3A 2Q4RA 5AOAA 2C2ZA 2Q3HA 1C30B 3UWDA 3K04A 5CYOA 5J47A 2X7XA 2BGLA 5EJIA 3K0AB 4GVXA 1QANA 1N6IA 4RPHA 3KUKA 4R8VA 3EH2A 4BWYA 2X14A 3HCNA 4YJHB 1KTIA 1FU8A 4D80A 4JAUA 2KJQA 1NIPA 1NXOA 4MS7A 4CCWA 4TZ0A 1G0NA 4O5AA 1KEPA 3HL4A 5B1HA 4NV3A 5D01A 5AKZA 3SYPA 2V0GA 2ZYVX 3WSWA 3K7EA 4I50A 4UCOA 2PMCA 3FLMA 1CUZA 5I7SA 2L82A 3VPFA 4Y9UA 1TCAA 1IHDA 2A5YB 1NMSA 2FUCA 3M8AA 2P06A 3KL2A 3V4LA 2D06A 4QQFA 4EPVA 2PTHA 1VXRA 3BMQA 4TROA 5EJAA 4G4IA 4OFWA 3QQPA 5K45A 2ZDHA 2VDWB 1I1QB 5ARBA 4JC8A 1ECGA 2R70A 4W5WA 3UPUA 2GZDA 1R8XA 4YRTA 1XLUA 1ORVA 4H0NA 1T2FA 1GPBA 4JI3B 4KFCA 1RWVA 2WIFA 4ZV4A 4FNOA 1RQLA 3N2IA 4B4DA 1GLNA 1CNFA 3JQ7A 5A3VA 4ZYTA 2XDQB 2CYAA 3BFRA 3G2NA 4XCVA 4JEMA 4WQMA 1ZH0A 2QQ5A 4PW0A 1RHUA 4KYTA 4OUDB 5BW6B 3C85A 4ND7A 3R1IA 3FCCA 2OGUA 4CKCB 4EG3A 1O9GA 3FAVA 1A0OA 1ROPA 4IOKA 2DEUA 4GVPA 3GRCA 4B3RO 2JHAA 1ISMA 1SXJD 1SBTA 4Y2PA 5KS2A 4IHQA 2PF4E 2IYAA 2RHLA 4PC6A 3QTBA 3FZGA 4G1FA 3MUOA 1L4FA 1KIMA 2LCFA 3O0DA 2ATEA 3BXHA 3NWOA 1MO5A 3K0AA 1YOVB 5L53A 1JH8A 2ANCA 5C3UA 3DE5X 1B14A 1OH6A 1ONOA 4U8GA 3PUXA 4YJHA 1SEVA 4BHTA 4KLRA 3P20A 1T5LA 1BD4A 2WLIB 4EY5A 1GP2A 5LMZA 1PG2A 1KOFA 1PWEA 1L5FA 1YDEA 2EIKB 4W63A 5J43A 3I73A 2CLEB 1GUZA 4UPDA 2I7VA 2NYUA 1G3RA 2O95A 3DLBA 1R3LC 4TZTA 4RTNA 2I1LA 2ORED 3HJUA 1N77A 3LBNA 1UBHS 3ESBA 1L4MA 1BYIA 3EVKA 4YHHB 2P2SA 2B5WA 1PN3A 1QR9A 2XXAB 2UZ4A 3AR8A 3P8ZA 2C7OA 4W6QA 1I1OA 4C2AA 3FGPA 1XU9A 5ICSA 4HGZA 3E48A 4JI7O 3B70A 4M1KA 2C78A 4H1TA 2VDWA 2F8SA 1ZG3A 2O8FB 3U1TA 1TW3A 3SMQA 1UXHA 1X3LA 3ULKA 1IATA 4PHHA 3LM8A 1ULBA 2CCJA 3TB4A 3ZVKA 3QIAA 4UVGA 4GOXA 1PI3A 2V7QD 1W36C 2MSNA 4BO9A 1HYGA 2VRBA 3RBZA 1T34A 3CHYA 3KKPA 2LGWA 1MJNA 2OA0A 2RCYA 1VQOV 4ERNA 1WA8B 4Z0PA 5FRDA 4UTXA 3OZTA 4L16A 2XDQA 2ZINA 4KMSA 1VKNA 1VYVA 4GUDA 1LK5A 4QGFA 4MQFB 1CCWA 1NONA 3VYSB 2FYTA 2EOAA 3WFIA 3CG0A 1JTKA 3I1JA 2VZEA 1P0CA 4KP7A 3SMVA 4ZCRA 3HBMA 1QIEA 1E18A 4E1BA 3Q8KA 2AW3A 3OEED 4Q21A 2HG5C 2LFRA 3I8SA 2ZAYA 4J0GA 2QE6A 4D57A 3QZUA 4AJLA 3NYRA 1E1NA 2NU7B 1PZFA 4O1HA 1GCUA 3PIIA 5ESRA 1SWVA 5AK0A 4I6JA 4J75A 5CD9A 5EN4A 4COKA 5JADA 3U4HA 3SF0A 1ODLA 5D3ZA 3DBRA 1Q1EA 1GZSA 1KEWA 3QPDA 1KMMA 4V1CI 2UYCA 3TD6A 2Q27A 4MICA 3LQKA 1E7WA 2XSZA 4MS2A 2CDNA 4I1YA 4NCXA 3M70A 3OQMA 1E3TA 4PQEA 4NNJA 1Y8QA 5JRDS 1T0UA 1XRPA 2QZPA 3ZU2A 5FL3A 3WLHA 4X7MA 4JV5O 2YJ5A 5EPUA 4BKRA 2R7AA 1QM5A 2BISA 1CJTC 2PH5A 3AF3A 2OUKA 3BRSA 1HG0A 2W2PA 4GKBA 4CMEA 2D5NA 2CKDA 1HDCA 5A4IS 3G2QA 3AFIA 1L5NA 2I6GA 4KK4A 2C8VA 4M86A 3QV1A 1N7JA 1YOBA 1X8XA 3OX2A 3OT7A 4LHEA 5AW1A 4UB8Z 1T9HA 2CNOA 3RG2A 4C6TB 4X6YA 3K20A 1B93A 2XXAA 2RGEA 3I5AA 1H38A 2HIAA 4GKVA 2GDZA 2XMQA 3HLKA 2G0AA 2HLHA 1X1TA 4IOLA 3CZQA 2NO4A 2QTOA 2JS3A 2O8FA 2PH1A 2QTCA 2VWHA 4I4CA 1XEWX 5LZ8A 2R66A 1Q0HA 5DOVA 5HX7A 2AYYA 4GMDA 3GFBA 5IUKC 4RK4A 1PE0A 3H6GA 1W85B 3T7RA 5KYGA 4OA8A 1E3DA 4BNNA 1BC5A 3WADA 1VE6A 2JAQA 2WE7A 4S1VA 4GX1A 2AW5A 5GADl 1JLRA 4Y2YA 4YRAA 3GUZA 4NJEA 2HD4A 1P6OA 3KEOA 2ICAA 1EWYA 4MQFA 3HKEB 4F3NA 4XKJA 3FZYA 2ISSD 1XO1A 4F1WA 1KY4A 1YZLA 2VCEA 4KN8A 2K4MA 5C8ZA 1KQFA 2QRUA 3ZRXA 4AN0A 1K7FB 4CQMD 2K6GA 4TV8F 4P36A 1BX0A 5FPQA 3HXTA 4BLWA 1Y8ZA 2WF7A 1MFPA 4WFJA 2C5BA 2AOWA 1XWFA 3HDYA 5LP6C 3AJ9A 4YACA 4YALA 2NU7A 1AZSC 3BQMB 1HMPA 1BDJA 2GBLA 4FGWA 1ZXLA 1L4HA 1M1YE 1JIIA 4L8FA 1JFRA 3H87A 3QELB 5EKTA 3DWFA 1MW8X 4EGAA 3RVNA 4BFZA 2GH1A 5CUQA 1VBFA 4UQPA 3R8XA 1MOPA 4QOJA 1GV0A 1PYOA 3GB9A 2Q2NA 1ZLYA 4G0UA 4DA0A 4OGWA 4BX9A 3A1SA 2CHQA 1NXVA 1BDIA 4RAQA 4C6SA 4HGOA 3C7DB 3ITDA 4ZEXA 5LOVB 1NBWB 1PGJA 1LZLA 2ZR0A 1NT4A 3G9XA 2OE2A 4FI3F 3ET5A 4MW8A 3I42A 2A59A 1NE7A 1R1BA 1IPEA 4F3KA 3LNNA 3I0ZA 2D4HA 3FHJA 5BOVA 2C9MA 4C6TA 1QHEA 3EIEA 3ZQ6A 3ROZA 4NK5A 4IIVA 3CH6A 4UM9D 3MIZA 2C97A 3P4UA 4UNNA 1XYYA 2J5QA 1WD5A 2EZ9A 1KYXA 1NJ2A 4BXOA 2G9ZA 5IEBA 5CDTA 1EVLA 1DGSA 4DAOA 4W8OA 1E98A 4I55F 3IJEB 3K6KA 4HPWA 1M1KW 3L43A 5FFFA 5EC1C 4N3NA 4KAXA 2BR4A 4AUMA 1B06A 3TM5A 2DW4A 4ZIRA 3MLAA 4BFLA 4PO1A 1Q1QA 1ZKDA 4UFOA 1QQAA 1LPMA 4CUJA 1MTOA 4UVCA 1N7IA 3HKEA 2ZIMA 4X91A 5KOJB 1JBQA 3PLRA 1YB5A 3KT0A 3TSOA 3EIUA 3CNQS 1K27A 4S2UA 3KLBA 2BZSA 4NMWA 4HR7A 3L4JA 3WWCA 3EIWA 3CEHA 2D00A 4ER6A 3IC7A 3M6VA 4JC5A 5ALUA 2JFUA 4INAA 2AWNA 2X8WA 1PJQA 1HK7A 1UBCA 1TW2A 1YUNA 4LDPA 4F12A 4MW1A 2XAUA 4EHFA 4NBVA 2ZSBA 1TVCA 4HSGA 3UA4A 1NZFA 2FZVA 2NZ2A 3DBOB 1G41A 5CIYA 1U7WA 1JP7A 2G09A 1ST2A 4YQEA 5JSFA 4BMNA 1Q21A 1PBNA 1KE2A 1R9MA 3AQIA 3TZQA 1WVIA 5AM3A 1I7PA 1G3UA 2PMBA 1L3CA 3OG9A 1VMEA 1J07A 4KX5A 3EZNA 3K6RA 3EQ6A 1ZD4A 2X1HA 4PBTA 3R9KA 1UBUS 2IF0A 3A05A 4JBYA 2M6SA 3DMTC 1NWHA 4GI2A 3SFTA 4R1SA 1WSBA 2GCGA 1KNXA 2QTRA 4OMUA 3N2ZB 1YZHA 1Z12A 3H65A 4EPWA 4I4TF 1NHGA 3BIXA 1PDWA 1KVRA 1CRPA 3FYUB 3DL2A 2AQHA 3CUEF 1WN6A 2HADA 4TT3D 4W82A 3Q15C 1JVNA 4IYRA 2OKCA 3HY3A 3HVHA 3SG0A 2QRGA 5LQSA 1C7JA 3TIFA 2QRJA 2J0EA 2CH7A 4P9NA 1DXYA 1RT9A 1T3TA 3N2LA 3OCZA 4JEUA 2P0YA 4C7BA 4C22A 4O8CA 3SN6A 2WFAA 2XADA 1KYYA 3TCKA 1VHWA 3EZ9A 3T12A 5AI6A 4QOHA 1MMMA 2EV9A 3IS3A 3LUHA 4BQOA 5JD6A 3EFOB 1PU2A 2JGKA 4B3BA 3PVCA 2LDXA 3OO0A 5EIOA 1QRSA 3CZAA 3PF8A 2QD5A 2I4OA 3ZNQA 4MGZR 5LQRA 1O94C 5JXJA 4ZOCA 3UQYS 1LRLA 4HAYA 3EAGA 1QS0B 4M0MA 4J1SA 1J0EA 4BX8A 3W5JA 3WHPA 4CDMA 4DA9A 3HBAA 1VJRA 4YFVA 2QWQB 3K2EA 2XTAA 1CY1A 5IULC 4GWGA 4CL3A 4EUHA 2CMDA 3T9DA 1JSCA 1RACA 2YJTD 3ILYA 4Q3LA 3THWB 1N2CE 2Q4EA 3W9SA 3AL3A 3N59A 4OX9B 4RK5A 4ZYLA 4KTTE 5CX4A 4Z49A 4TYNA 2MT9A 2VHYA 2C82A 3EDOA 1F8UA 4OLBA 3GWKC 4YI5A 1I1NA 1H9BA 1EE9A 3L0PA 4RFSB 2IYXA 3WK7A 4ZGBA 3BRQA 1J9GA 3EQZA 3AILA 4CKZA 1IN6A 2QSJA 3RTGA 1YQXA 2H3OA 1XEXB 1LLCA 4QPJA 1J20A 1S5PA 5HF8A 3FYUA 4AYWA 1KE1A 4AC9A 5ENVA 4PV7A 3ND5A 4GC5A 1DHTA 2FZGA 2AKYA 3A1WA 4UDXX 2WJPA 5F52A 2KSDA 3FOAA 2FZLA 3STHA 4LCUC 5FYQA 4X1OA 4OQPA 3OETA 2HHHB 1C7QA 4MV4A 3K79A 4QXQA 1QGYA 1U3TA 3WYCA 1IY2A 3SYMA 3O47A 3PEFA 3KEGA 2Z6QA 4M9ZA 2CHUA 4ZMRA 3VU9B 5DPMA 3V8RA 3TJTA 2GK7A 3L4KA 3Q5DA 2C77A 3BREA 1FJXA 4RSHA 3CO0S 3K9FC 1UBMS 4ZAYA 4W1SA 2CLIB 2I6QA 4N49A 1N92A 5ICFA 3BS4A 4ITUA 4AI6A 3FX2A 2XV1A 5ADVA 4YRZA 3GO4A 5K4HA 3STXA 4ZFNA 5C5EA 1P5HA 4UNIA 3U4IA 5KYYB 1QS0A 3TNFA 2IM9A 1QHTA 3RVBA 4RA9A 1TIKA 5FORA 4JVSB 3I28A 1B0PA 2F9MA 4KL1A 1VF5B 5JMOA 1BZKA 3WLQA 3STTA 3PNYA 2VDNB 3PHBE 3THWA 1DKLA 5B1DA 4UCUA 3D3WB 1ZH8A 3TOZA 1NE2A 1NBMG 4JLAA 1XLTA 3NKVA 1NQAO 4D43A 2QDXA 3SJUA 1B7GO 3GQBB 4QRDA 4MSMA 3PX3A 2GCEA 3FHLA 4GMGA 1R0SA 3H5NA 1XMPA 2IK8A 3C70A 3M2TA 4RFSA 3L7LA 5JCJD 2WKRA 5AW4A 4Y2UA 3TH5A 5TF0A 2YVQA 2IXAA 1XEXA 1TUBB 3OHMA 2E4WA 3DZDA 4MYTA 1VSQA 5EMJA 4NENB 5EXSA 4RDCA 2O3JA 4HADA 2AN9A 4PRYA 2X2FA 3QLTA 4R3WA 1T1RA 3W5IA 1NKSA 3KZMA 2OB2A 4UDNA 3UWMA 6ADHA 3A0UA 2RFLA 4MW6A 3H83A 2ZAMA 4WCDA 1U7PA 2HMYB 1S96A 1TFRA 2D59A 3DXYA 2V7TA 3SBXA 4QGGA 5AUQA 1UH5A 3RUEA 4MI9A 5BQ3A 2V7XA 1ZM9A 3VU9A 2OOKA 4Z53A 5FL7A 2B7BA 3F8WA 4E5PA 1ZEMA 4V0RA 3OBBA 3T3PB 5FR1A 1ESNA 2WZQA 4J1QA 4MV5A 2ZREA 3THRA 1RAEA 3RBAA 1UPAA 3OF5A 4M88A 2I67A 1HZZC 2Y0IA 1Z45A 1NU6A 2QQGA 3B3GA 1D07A 2AS0A 5ER6A 3TQOA 4DEVA 3KXDA 1Y1PA 5B64A 1LUWA 3K08A 4KXNA 2O50A 4XW2A 4EY7A 2ZYGA 5LL6Y 1AN9A 4QRIA 1C1XB 4A2QA 3I53A 2I80A 2J0QA 1VG8A 4QDOA 2AJLI 5DM1A 2O0JA 1N5OX 1KWKA 3U80A 1OROA 2Q5LA 4QUHA 3F7OA 1BU8A 2BONA 3VR3D 4UXNA 5AJZA 1VI6A 1I8TA 4ZC1A 4PXAA 1P6XA 3CX5F 3CF4G 1AUVA 1VQ2A 3G5UA 1YJXA 1DIHA 2E6UX 3IQIX 3GMTA 4IILA 3GQBA 3NTUA 3HKBB 4H7IA 3FYCA 1M33A 3BXEA 3HSKA 2EP8A 1KYOF 3P97A 3LPCA 5KUKA 2NUBA 2OQRA 4P3NA 1PKEA 3HU1A 4UTNA 1N3BA 3PI6A 2ZYRA 4ACAA 3JQ6A 3LWBA 1PJZA 5DCUA 4P9OA 2ZWMA 3OLXA 4KMOA 1XVAA 2OC9A 1MA1A 5ENDA 3CFYA 1TUBA 5TARA 2JA1A 2V6IA 1SQVH 3KZIZ 5KHAA 1LU9A 1G2PA 4I1PA 2J4DA 4NENA 2CK3D 3Q7TA 1F5NA 5K3SA 4F72A 2M6YA 3TDMA 4AG3A 5DJ5A 2I2FA 2RK4A 2C4HA 2HSGA 2GEJA 4FBLA 4L9SA 4QKQA 4LRTB 5DK6A 4G63A 3H13A 4LRSB 2IYFA 1HEYA 5CA0B 4ZOBA 4Z4IA 3PC3A 4QDXA 5JI3E 3K9SA 1VLMA 5I7AA 5J4VA 1VMKA 3KKMA 3GX1A 4F9EA 4DMCA 4PA9A 8AT1A 4L15A 5ALXA 3TZCA 5IANA 1JU9A 3FDJA 2QUBA 5T4EA 2J59A 3WLNA 3MPZA 4RQBA 1YRHA 3K94A 2B2CA 4MW5A 2W6JG 3W5HA 3H1FA 3JYPA 2C92A 4NV1A 3QXXA 3ILXA 3R74A 1PL6A 1PL4A 3OIWA 1SC1A 2ZFUA 4EFBA 1NF2A 5FOSA 4MW7A 4EMTA 1DT5A 2OHVA 5AW5A 2PT5A 4UJ3A 1KRWA 4PYNA 3RQIA 1W5AA 2EIHA 5AM4A 1V41E 1GQSA 4FONA 3OZCA 4IM7A 2NX2A 1NBOA 4Q9LA 2ZSKA 2W6NA 1M9NA 1K9SA 3OURA 1XQVA 4RD4A 3A1FA 3JQCA 3ID6C 4EHIA 4AJ9A 2ZSUA 4A1FA 1KMIZ 3HKBA 3RWOA 2VQ6A 4IIEA 3PFHA 4HDMB 3CCRV 3L01A 5HTKA 5BURA 4L5IA 3B2EE 3ZE1B 4QVKA 3HJTA 2TMKA 1ZNXA 2PH3A 3NNSA 2ZYDA 1J33A 1V8OA 1QVZA 5EE5B 1JHAA 1NNUA 3OCWA 2JHFA 3NT2A 1QK3A 4QYXA 2Q9BA 1PJSA 2C5EA 3EIFA 3LY5A 5JMPA 1PT6A 3WWZA 4Z7QB 4YHHO 1P5ZB 3DS8A 3NEYA 3MCAA 1M7HA 4TZ6A 4JCCA 4QL3A 4AS1A 4DDVA 4UCTA 3WB1A 1FP7A 4WTOA 4XSVA 2EZUA 2H65A 2FB5A 4DMHA 4H17A 2GN2A 3U9LA 5ESXA 3H9EO 2VF4X 2FWNA 2E9SA 5ENZA 2L17A 4Z4HA 3AF2A 3NUGA 2C4NA 1F2TB 5CA0A 1D2RA 5LHIA 3J80N 1F8GA 1DK1A 5SYMA 1XTSA 2V58A 4IEFB 5L3BA 4AJPA 4UATA 5TPZA 3BDVA 3TRKA 3PE3A 4OHFA 1Q3TA 3OUFA 2OHJA 5F2VO 4I46A 3GU3A 1KJYA 4MVJI 5DZSA 1HOTA 1RFYA 4HQNA 4NE7A 3I0NA 1Q3HA 1DAPA 3HI4A 3O1HB 4TT8A 4TM7A 5BO5A 3AF1A 2JGRA 2R79A 1ZJWA 2Q7OE 4BV3A 2ETNA 3E35A 1AKUA 4XUGB 3K9WA 1JHOA 4QM6A 1W0KA 2CWDA 4XWWA 4WOPA 1KZ4A 3B85A 3NYWA 3LZ6A 1DVRA 4LCEA 3BK2A 1PV4A 4PYQA 3PXXA 2UXBB 5IFKA 5B3SC 2P9FA 2FR6A 1N7HA 4W4TA 3AHDA 1MC1A 4RVHA 3EMBA 1J8VA 3QU4A 3HVIA 3EXEB 4K81B 1NI5A 1NN0A 3KK0A 2QIOA 2PA3A 1BS1A 3P9PA 4HDMA 1W0JA 2ZNJA 1N34B 2GPSA 1H65A 3N8HA 2VWKA 3T4DA 3SQOA 4RF3A 2O2EA 4JEIA 3PTZA 2YR0A 2ZB7A 3RIYA 1UOQA 1TTPB 1U2RA 3IELA 3P45A 5HCIA 3KKEA 1WNFA 5HUQA 1H2ZA 2VNHA 2ZTUA 2PY5A 1I33A 1LPBB 2ZE6A 1UM9B 4WFBV 3USZA 4DLLA 3U3XA 2LO1A 4FMCF 2G9QA 1SIUA 4IUYA 1NTMH 2YUIA 1LF0A 3NGXA 1EHYA 1AO0A 3ZY6A 3W06A 5EIEA 4PINA 1VDMA 3E83A 1M2KA 3N6VA 1F2TA 5IYZB 5IJZA 3CXRA 3B13B 1YNOA 4QFBA 4NBNA 4JSRA 4B71A 3UWPA 3IUSA 3ZGOA 3UMBA 2N3ZA 1ENOA 5IHPA 2QXUA 4ROTA 3LC1O 5I9TA 1CHDA 4NESA 1DMRA 4QQRA 3I04M 1LBIA 4D9GA 4G0YA 5IBCA 2AKEA 4B4UA 121PA 2Q9AA 4NU0A 1QYDA 2W6IA 2OP1A 1YTLA 3EZ2A 5H80A 5JBQA 3BORA 3ASUA 1JQJC 4HWSA 2C4UA 4FPPA 3RFFA 3TQTA 5CM9C 1T8PA 1TCVA 2IPXA 4WNCA 4WVLA 2P9ZA 3O31A 3OA2A 2PANA 1UKBA 4OMCA 3PJRA 3D36C 1EK5A 2HRZA 1M56B 3G2HA 4BZQA 5EJ9A 5C8YB 2GVNA 1XHLA 4Z2WA 1UMDA 2QN2A 4ILKA 3AHEA 1T3SA 4QUBA 4CLHA 3F7YC 2BF4A 5DASA 5J4HA 2Q2QA 3EXEA 4RE5A 1P3JA 5J2TF 4QWMA 2E82A 2XUMA 3NJRA 4UMVA 5G0UA 1L7MA 3I45A 1T6YA 1OTXA 3RUFA 3GNQA 1BCSB 2NTYC 1I5EA 1V55B 1R64A 2ACWA 1GSIA 1Z73A 3JD0A 1KBZA 2J6BA 5LPNA 4NCKA 1QV9A 4L8WB 2WLLB 2V55B 1T0HB 1EK6A 4OHMA 4JWKA 1VL8A 4MUIA 5I9BA 1Q7CA 4I43B 1I2DA 1UM9A 3PDHA 3SPJA 2FUNB 3GLIE 5BSHA 2XPCA 3D6VA 1MB3A 4EL0A 4MDYA 2YXBA 2Z3HA 4R9NA 3J81A 4LXUA 2ONKA 4YRCA 1Z7YA 3BVOA 1TT5B 4EITA 4KO4S 1ZWKA 2YVKA 3QBTA 1D9XA 2I4IA 3DEZA 3GCWA 3BPSA 3V1LA 4NAVA 4C20A 5AK5A 4ZT4A 3GRKA 1E0KA 4KXRA 3GDWA 3T0IA 2GZ3A 5I9SA 3BWYA 4YGXB 2ZR2A 4CG2A 1T0JB 4O0LA 2VRNA 3RS8A 3UH1A 2YVLA 2FMIA 1U9IC 1N8KA 3NDRA 2NNUA 4BOYA 4QG3A 2I2CA 1MB4A 1WMEA 3QVNA 2E5WA 4HHEA 4JLOA 5AIBA 4P32A 3AYZB 4FDTA 2R62A 3OPYB 5AJUA 1BHAA 4MVRA 5ESWA 4H18A 3KSRA 1EIWA 4ISBA 1UUFA 2HGZA 1BU5A 2VZ8A 1Z0KA 4H7EA 3H1PA 3GMSA 5LP6F 2BEVA 3TPFA 5C8YA 1LB1B 5DSZA 1QJCA 2WAMA 3M9LA 2PYIA 2MSEB 4JP8A 2VXCA 3VR5H 1N9KA 2B61A 2PRYA 1UFVA 1P4HA 3E22A 3B7WA 1R4MB 4W8GA 2ID7A 3QBJA 3WKAA 2D2EA 5E9AA 2ASVA 5FA8A 4OVKA 3DCIA 2HMWA 4HGRA 1GXSA 1PJ8A 3CLRC 3MS2A 1GG8A 1EM8B 4ADSG 2BN4A 4D0SA 2BR5A 2NZYA 4RY8A 3WRWA 4PA4A 3FDFA 3HSYA 3CISA 2PR2A 1BCSA 3KD2A 1HI9A 4TL8A 3GP8A 4J2HA 2IT1A 4PLPA 1L5WA 3GF4A 5TPWB 1QV6A 3B8NA 4DCPA 2AQ8A 1X19A 2ZJ4A 4MJXA 3FKSG 2Y4UA 1US8B 1UWLA 4J0HA 4KSYA 3A6DA 1E6MA 2EFDB 1FU4A 1Q86W 3R3VA 5H16A 4CU5A 2IJJA 1Z82A 1VSBA 2GVDC 1E5VA 4FMPA 3M9XA 1NN3A 4AL4A 4Y2QA 2IITA 3SPIA 3VH1A 2IXFA 1YONA 4PS1A 1GJRA 1R3UA 1FTQA 4Q02A 1TT5A 2AUMA 2CW5A 3IUNA 1M10A 1GU0A 4F5YA 5B1EA 4MVJG 1FY2A 1U04A 5DM2A 3MTJA 3AG4B 3HCCA 2PRZA 3VGJA 2ZT8A 3AETB 3ROTA 1CXZA 4WD3A 4XPIA 5JXIA 1XZLA 3JZDA 3X2FA 1JHQA 1JS1X 1SF9A 1TVKB 1LNZA 4UUAA 1EFPB 1XTRA 1OCCB 4EB6B 3EVCA 3QX7A 2Z3WA 3UMSA 1XI2A 2OO3A 1ZIXA 2VA9A 3ZY5A 4OCMB 4CKXA 2R44A 3OPYA 2I2AA 2G83A 1O5OA 1X38A 4AF7A 2XCTB 3IULA 4N3BA 2YWEA 1CDOA 3BE4A 3CT6A 4IDPA 1KGSA 4ALNA 5ECWA 3NVDA 1A98A 3QA3E 2C0CA 5D7BA 3EX8A 1TGVA 4GZ3A 3WJ1A 5IM5A 1J21A 2A0LA 4D10F 3B9RA 1PV2A 1C9MA 1V8BA 1DWOA 2QUHA 4CPDA 1R4MA 2G06A 3RS0A 3FJ1A 5DBHX 3LD9A 1L8LA 3ZBPA 1DAOA 1NQ5A 5GW7A 4EL5A 1UPCA 2HL6A 3M3HA 3GIWA 4OX9O 3FTEA 4CKEB 1WF3A 1PGPA 5BMVF 4TX1A 2WYIA 2Q7GA 1L5LA 3WE7A 1XZHA 3GLVA 1A5AB 1AE1A 1X1BA 4ALMA 5E6SA 2AFIB 4AJEA 2CN1A 2KQXA 4TS9A 3CVOA 1MAHA 3ZWCA 2RK6A 2AD5A 4L5AA 5TPWA 4X95A 1I80A 1ZESA 2NYVA 3HTXA 3TIVA 4QXOA 2NADA 2VHQA 1JJ2U 3U60B 1YSCA 1PCXA 1US8A 3NORA 1I5RA 5B4VA 4N5HX 2AL7A 1GPYA 1SQ0A 3DZGA 1H5NA 2XUPA 1G20B 3C3KA 3UJCA 3LBIA 4Z51A 1TTTA 2GAFA 2B7LA 2CNNA 1I30A 1TU3A 5HDQA 2HU7A 1ZI8A 3CCLV 3WJ7A 2RKBA 2RH8A 4M6WA 3VKWA 1OQAA 2HV9A 3BXXA 4IJQA 3NU1A 2GTAA 1VRCA 3T99A 3IIEA 2HHHO 4I9NA 1P0QA 3CNHA 1AB6A 1E0SA 3WNDA 2GAOA 4NI5A 3O7MA 4I50B 1AK9A 3WMRA 3RT7A 3DMNA 1PT5A 1UAAA 1XKQA 1NW9B 4L3VA 4MROA 2BCEA 3AETA 2JD2A 1WBBA 3H1IH 1HE1C 2QX7A 2VUSA 1P31A 3WRVA 3FCYA 4YJ2F 1WZ2A 1YZFA 1TVKA 2CLHB 4TMWA 1K2VN 1FLVA 1EFPA 3WK6A 5IDYA 3TE7A 3MUEA 5CVUA 4EYQA 4EB6A 3BMQB 1E92A 3PKIA 2R6JA 5A9GA 1Q83A 3IYLW 4A6DA 4BNFA 1J8QA 3WNQA 4FNAA 2YMMA 3HY6A 4ZC8A 1LDYA 4DYHA 3HRIA 3HDHA 4W9RA 1KGDA 3ZHCA 3DZBA 2UUAB 5CXSA 4LX0A 3IUEA 1NUSA 4L22A 4JP1A 1MG0A 3SS8A 1WTAA 3X0DA 4EUNA 2JBWA 3VA7A 1T1IA 3I52A 2Y4TA 1QH9A 4KJXA 4CKBB 4B7KA 3C3BA 5KHJA 2FSVA 4KYUA 3KETA 3SXJA 1JEYA 4CKEA 1RPRA 5D6OA 3BTUA 1SXJC 3VYUB 4OHCA 2XODA 2BFPA 3KU1A 2WKSA 3RKSA 3LDHA 4JHLA 1V54C 2AFIA 4LYDA 4E1VA 2FH5B 2V1UA 5IE9A 2YIDA 1ECFA 1JHUA 5FI0B 4DHWA 3L3BA 2A9VA 4NZOA 1EVYA 3BHMA 3MTEA 1WEKA 1AI6A 5SYNA 4B3FX 1PNKA 4LSZA 1G20A 1P44A 3MLBA 5JJNB 4L8YA 1SC6A 1Z5GA 5K0JA 1W1WA 4MCJA 3RIHA 1IY8A 2VPTA 4ZCLA 4EJMA 3HB0A 4FP9A 3OMAB 3K2IA 4ZVRA 3GROA 3R20A 4CV1A 1NPDA 4IEEA 1ZX1A 4Y9DA 5AW0A 4Q9HA 5GPBA 4N01A 1RM4A 1DI0A 5IW8A 2D2FA 3AUXA 5F12A 1TQDA 4HAVA 1HKHA 1D0VA 5FPTA 1FJHA 3FF1A 1B8OA 2GYWA 4YH1A 2FW9A 4J94A 1X2BA 3VDMA 4A9AA 3CO5A 3W2IA 2EJVA 5L3GA 3DMRA 1A5BB 2YXEA 1QRTA 3PR2B 3FWPA 1YD7A 3ZZMA 2R5WA 4B6SA 3I5XA 1VP7A 4HFMA 1GL9B 3EOAI 5HCUA 3LVQE 2C0PA 5BVGB 2C9BA 3G2OA 3NYQA 2PI5A 4HN2A 5HKKA 4XUEA 4KN6A 2ZPUA 2EIXA 4BRUA 4PR0A 5FLXA 2OXCA 1TEXA 2HKIA 5KNBA 4R2HA 4QG7A 3HFRA 3BCUA 5EKDA 4M3NA 3ZUGA 1CHNA 1AURA 5DHTA 4ZO8A 1QJ4A 1P2BA 3TM4A 3S8EA 1JW9B 4CKBA 4O4LF 4Z1MA 3GUYA 2MU1A 4HEQA 3D0RA 3AR2A 2HWWA 1PAUA 3THOA 3ZBHA 1IRXA 4UHCA 3NALA 1C7FA 3O95A 4TLCA 5ILOA 1Q74A 5J4YA 4ZI3A 3RHZA 5HMLA 2IELA 1XNRB 2QN1A 3BDAA 2EULA 2BM9A 2ZS9A 5DXFA 3CHXA 3GFSA 4XX1A 4H6VA 4ZVKA 4B3SB 4V24A 1V7ZA 2X7HA 4O2AF 1XNQB 3MGGA 1SXJE 2WDZA 1LI4A 3DBRB 3GLGA 3HZHA 3SKVA 2G1JA 3C6MA 3G88A 3ZJVA 3ASZA 4WT7A 2W4QA 5DRYA 3SYCA 5DDIP 3OE5A 2V74B 2YWCA 5IDXA 2IOFA 1QFSA 1VL6A 3KPWA 1IUOA 3FNIA 1J2TA 4FLEA 1YJ8A 4WXEA 1SHLA 2QJFA 3C45A 1VE5A 1Y8QB 1DKMA 5EFOA 3CG4A 1M2HA 4J0KA 3TRJA 3OLQA 3LPLA 1H4VB 3HB3B 2L19A 3BD6A 3JZIA 4N5MA 3GVCA 4V2IA 4QEKA 1XZCA 3X2EA 1FP6A 1UBJS 4NCAA 1A5TA 2VS1A 3KQHA 1VHJA 2R7KA 2H07A 1Q3KA 1HQDA 1ZR4A 5BSFA 4HTAA 3F78A 4HWRA 2HR3A 2QK4A 5C8VA 4NOJA 5JNLA 5EJMA 4GZMA 2OG1A 2RJOA 5BVGA 4EWLA 1WJZA 1QX4A 4LZNA 1YBHA 1B1AA 1TKCA 3WXBA 3Q41A 4NZZA 3X1ZA 1IJKA 1MIOA 4G5XA 3KOUA 2RB4A 3HS3A 2G77B 1F51A 2JRLA 3GJXC 1N7GA 1RFGE 4XEHA 1VQ4V 3QSGA 2H2FA 3IB3A 4IHJA 2ZBUA 4NJEB 5JPCA 1L7PA 1I08A 3QY0A 1BFDA 3LOPA 2WQ6A 2DFLA 4W1QA 1GN3A 2I4TA 1PNOA 1N1DA 2WSBA 5DHFA 1OHHG 2CLCX 1RCTE 5CLLA 2GCPA 3M4ZA 4IJWA 1GUDA 4GP6A 1JHMA 3FWZA 1THZA 3GMIA 4BQPA 5FUVA 1QOZA 3LY9A 3O8BA 1GFIA 3B6JA 2XZDA 4O4JB 4ZD4A 4G1VA 3UM9A 1ND5A 3MZ0A 3HY4A 2IVZA 4KV9A 2FLWA 3ILHA 4HNQA 1OYYA 1ILEA 5I7FA 2PN1A 3OJ6A 5CK5A 1Y76B 2OIEA 3QEJA 4IJ5A 5LQUA 4DQUA 5AICA 1DQZA 1PS9A 3AI3A 5EKXA 3ZPXA 5EA2A 1GNRA 4MK4A 3QHPA 1VB3A 5DULA 2Y68A 3LC2O 2CHVA 1MEOA 2C8JA 2NTJA 4Z9AA 4JI1B 2XE6A 5E1OA 1COWG 3R6DA 2V5VA 4YXWA 4II7A 2R8YA 2JRCA 4OM7A 3L6OO 4J6EA 2NU9A 4NV0A 3SX4A 4FTWA 3PPYA 2II6A 1T2UA 2EGGA 3I3SR 4HVLA 1I3CA 4Y1RA 3PHHA 5H9WA 2XGMA 4IJUA 2GYUA 1QRAA 4GXQA 1VBMA 2AHYA 1JG6A 4CM9D 3VI4B 2NACA 4R05A 1U8CB 1V8FA 2EF0A 3W3AA 4UM5A 1M2WA 3W9YA 4WSOA 4DS3A 3VU3A 2HCFA 1R50A 1QRRA 1USUA 5EZ6B 5IYBO 1RQGA 4YCLA 3IP5A 2BBWA 3Q2KA 3T61A 3UJHA 3F6YA 4E22A 3D54D 1SC4A 2UVQA 2YOGA 4L0CA 3ZEAA 1I2ZA 4YJ3F 3AOEC 4BXOB 3O9ZA 1Z5VA 5EXXA 2WSSA 1XQ8A 1GU7A 1PEAA 1BMQA 1QP4A 421PA 5B55A 4QUAA 1SXQA 1BKYA 4HS4A 1DB3A 4U2KA 1V1RB 4G4JA 4E94A 2WZCA 4IAOA 2Q6AA 3IUBA 3WX0A 1F0KA 4NE2A 4I1VA 4MTXA 2UXBO 2ZJAA 4ZMBA 1K34A 1UINA 2IXBA 1YR1A 4ZIRB 1TTHA 5KJCA 3TXAA 3M81A 4IF6A 4KLZA 5EHXA 5GMOA 3OGIB 2ACEA 3OQHA 5AHKA 4Y6GB 1Z07A 4BMXA 1HL7A 4FWTA 3DUFA 3K96A 5CB8A 1I36A 4CMJA 1NNLA 4FEAA 1N34O 1T6ZA 1CUWA 5LA6F 5HXAA 4F2HA 1XAGA 2JARA 1ULSA 2JFWA 2PLRA 4CM1A 4EA8A 2D1TA 3LT4A 4O4JA 4G85A 5JY6A 1NUAA 3LT5A 5EBLC 2PO5A 1QOQB 3RSGA 1QWSA 2K87A 1Y76A 2FDCA 1KJ9A 1A7KA 2I2WA 3MWGA 3RVOA 3ZDQA 4BKPA 4H3VA 1DKQA 4CI0B 2LQTA 4I08A 3PC7A 2A8YA 2GZMA 4HUQB 4JPRA 4I5SA 2R4UA 3VR2D 1TYZA 4GEGA 4HN4B 2OXIA 5AMXA 4R9SA 3MA0A 3NPMA 3ZH2A 3QFCA 3NEPX 2JZNA 4G5YA 4B7AA 2J9RA 2ONCA 4UHKA 1H8EA 5DWQA 2ZSDA 3TCNA 1HFWA 3NP9A 1L9KA 1UOOA 4J16C 3SYNA 2WM3A 2H3EA 4D82A 1L5GB 1UF9A 5LHGA 4WKOA 1KAOA 1UFIA 4HLUC 2HJ9A 2ORIA 2JH8A 1ZK1A 2C42A 1MNAA 4G8CA 3W8EA 1WQ4A 3NM5A 4JA0A 4Z1OA 1NFQA 3PGJA 5HBRA 4U4AA 1FS5A 3GL9A 5BT8A 2HMSA 2CH7B 3F9IA 4HN9A 4LTDA 3TSWA 4DFDA 3ZS8C 2CMGA 1WXFA 1LBSA 1V1RA 1RLUA 3EIXA 1RI3A 1AB3A 3WJAA 5K4GA 4LXGA 1R6TA 1ZGZA 1ZR2A 1RYZA 1OFUX 1GAJA 1ACMA 1MLDA 4LNHA 1BE6A 3MFYA 1WO8A 2WJ3A 4RMNA 4CL0A 1AKYA 2FTKA 1H94A 2JH3A 3RUIA 3UTDA 2XIQA 4FFOA 3LTNC 2CJPA 2HW8A 5KWIA 1QX3A 1ZU4A 1JDJA 3DDCA 2IS2A 3U3RA 1IXZA 2IP2A 1EEHA 1K7YA 2BJWA 1UDWA 2F17A 4CTNA 1B42A 1P2VA 2A84A 4C7MA 3IAM1 2XOKD 3HCPA 3Q5EA 2DPXA 2WIJA 2RKWA 2GD6A 5E6UA 4DV0O 1KD1W 3D2AA 3E9YA 1MORA 3JWPA 2Q3FA 3JS5A 1QHHB 2ZUBA 4DZZA 4D7AA 4HUQA 3R3ZA 2AUTA 3D3KA 3I1YA 1OSNA 4HNRA 1XUOA 2VDPB 2GO1A 1OI2A 3HHEA 4AJOA 3H2IA 2CDBA 4G89A 4DOMA 4Q03A 2GO7A 1ZAYA 1E8DA 2WU8A 2Y2UA 1ZUIA 5FQOA 2K1EA 1YFJA 3GPBA 4BO7A 4C03A 2DFDA 1UXOA 4AKGA 2PUTA 4UCWA 3KD3A 1TK9A 3DZJA 4F4DA 5E4FA 3SJQC 4XUCA 4PE5B 2B25A 4TS4A 3F5SA 1TO2E 2A14A 3TAXA 5ALJA 4CV2A 4TUYB 1GVNB 1NH2B 4XJSA 4U2BA 2W2NA 1K8YB 3ZGYA 3L7MA 3OPXA 1KDOA 1Q1BA 2G70A 5JAPA 1SCUB 4EF4A 4OXQA 3O73A 1GKLA 4TSRA 5T67A 3F2VA 3I2KA 3SS9X 2XGGA 1Z5UA 3Q7EA 1A27A 4J9VA 3W79A 3NTXA 3G2LA 3WWOA 3AXTA 1M74A 1UKYA 5JCPA 1K5DA 3FFWA 4FGUA 4Q18A 4M98A 1URFA 4P4LA 2QE7G 2ECKA 2GERA 3KB1A 3CH5A 4NRDA 1RI5A 3QYPA 5KU1A 5JNVA 5IVHA 2AEEA 3FHTA 3RRBA 2XUZA 4B33A 4RV4A 5K6AA 3G67A 3D5EA 3SP1A 1KO7A 4DQDA 1SCAA 1GFWA 2XD4A 3IKTA 1H2XA 4AUEA 3ORHA 4FHFA 4FDMA 4V0MA 3F0TA 5EE9A 5ERXA 2DAPA 4W9MC 1XTPA 2VNAA 5B1NA 4FLWA 4ZOLF 3IERA 5ARDA 4RA9B 2QWPB 2RDMA 3L0DA 1VHTA 5K6RA 1B8VA 3RU9A 2O2XA 2JGMA 3D6AA 3CNNA 2DOSA 1QHHA 4JYCA 1RXCA 3BL6A 1EK2A 4LRYA 3JPYA 2JJ8A 5EP2A 3RS9A 1MTZA 1K63A 4ITRC 1VYHA 1ZJ6A 3M1YA 2WB2A 4DLWA 3NCHA 4QPZA 1R6KA 1SD1A 3L0IB 5BWBA 1NJIW 3VR5A 1VQ5V 1VXOA 2X6QA 5BXQC 2GZ2A 4B32A 3SYQA 1IK6A 4JQSA 4L27A 1JYSA 5BSMA 5GONA 3QY9A 2PE5A 4C2TA 2Q1SA 1D0IA 4EZEA 3D7NA 4TTPA 2F23A 2VSNA 1WX1A 1KJNA 5H0IA 2AE1A 3VUFA 4TUYA 1RHMA 4ODIA 4B5KA 4OAPA 2XDAA 3VO1A 3AG1C 1UJ5A 4X71A 5BSVA 3OPNA 1LW6E 1SCUA 3FKQA 2HXVA 2ZQZA 4FFVA 4M55A 4AY2A 4JOCA 2IHKA 1M0TA 1KKCA 3ZE0B 5KYNA 4TQUS 4M99A 2D0IA 1K7DA 1E6CA 2D5LA 4X9XA 3QWHA 4IX9A 1W5EA 4EHHA 1COZA 3FMIA 2IA5A 1OMOA 1D6JA 4X6LA 1FXKB 4YJDA 1AB5A 1EZZA 1HXHA 3N70A 4PC7A 3ZMSA 4M9UA 3T35A 3EK2A 5CFOA 1CYDA 4DLNA 1YVWA 3H8VA 4OGQB 1U65A 1CTUA 1KJJA 3DT8A 3TW8A 3CUTA 1KP9A 2EL9A 3E4CA 3GG9A 3B9BA 2ZETA 4A4DA 4ZGWA 5TGDA 4BQEA 1QBKC 1ZH6A 4UREA 1S2MA 1WG8A 1OA1A 2KKWA 1J7KA 2EF1A 3REQB 1EWTA 3JWIA 2QSYA 3B38A 1EB8A 2QKAA 3L84A 2P90A 2ERXA 1A9YA 3RVSA 1X86B 3LPDA 4WV3A 4WBNF 1AGNA 4LP8A 3SICE 2OV4A 1WDTA 3ZBTA 5TV2A 2QQEA 3EULA 3VQVA 3KVVA 4GF5A 2XE8A 2ZRLA 3AEUB 3E7XA 1J8FA 2HFJA 2ETXA 4M7RA 2JD0A 4RWEA 2HQBA 1JIVA 4B35A 1ALNA 3LO5A 4JI5B 4B81A 1ZK2A 4I4LA 4GLFA 3ETHA 1WW8A 3D0KA 1ZN2A 3CSDA 1SU6A 3JVDA 2ZSEA 5D1NA 1P4RA 1W1IA 2JAHA 2I54A 2QTLA 5NULA 1I3KA 3D3EA 3OLYA 2X0EA 3VSBA 1CLEA 1WP4A 1ZVKA 1PX2A 1N2SA 3H0EA 4M7WA 3A36A 5B3JA 4NDNE 1LJUA 1BVHA 2C9YA 4Q9KA 3VISA 5HA5A 2A1IA 3SGLA 1SUPA 2GQ0A 3EVZA 4H44B 2Q4BA 5KBYA 3SYKA 2X0LA 4IJMA 4YP6A 4M7OA 1L7QA 1M73E 3NHMA 1FXKA 4KWIA 4OBBA 1W94A 1J8MF 1SXGA 2WPDA 1EQUA 3WFZA 3H2JA 1A72A 4HDSB 4YUZA 1QG6A 1CT9A 2ZRCA 2V0NA 1RWMA 2Y48A 1L5YA 4L5BA 3NIBA 1NM5A 2FGKA 4YK7A 3WGZA 2HSZA 4ZAZA 4IO0A 3UAZA 3RYTC 3OMLA 3HO8A 3WK9A 4YUYA 5GVRA 2H3HA 2L2QA 3FOBA 1XTKA 3KKKA 3REQA 4WNIA 2NUPB 5EXDA 1TNDA 1E2GA 5FKJA 4HFNA 3E0XA 2XITA 1Q0PA 3UO8B 3COVA 3V7WA 3A3PA 2WA3A 3E1UA 4F8YA 1YVPA 4JT4A 4FLUA 1WN7A 4EKYA 3TD9A 4S3MA 1ILWA 3Q4GA 3OCQA 1C3JA 3AEUA 3P26A 1T3ZA 3IDFA 2A0XA 4JQYA 4JJEA 4A0RA 2GPYA 2Q2OA 1U28C 4ZCMA 3ACCA 2WLTA 1JDZA 4E30A 9ABPA 3KTAB 4M89A 2C4KA 4H31A 3FDZB 4II3A 1EEXB 1CC1S 3KKOA 2ARHA 4B45A 1CZRA 2X4LA 1QH0A 1RE1A 2CXUA 4RCYA 3MS7A 5IX8A 3OW2U 1QO7A 3DB2A 3NHPA 3OZFA 1OZGA 4DC1A 2HF7A 3L4SO 1AXGA 2Q5HA 3DYBA 4KUGA 4BECA 4HYEA 4QT4A 4GLLA 2PKYX 2PLFA 3LQRA 2R84A 2RHOA 4KIGA 2X6BA 5AOVA 1GADO 2ZJOA 2G63A 1XREA 1U0TA 4TS1A 4WK4B 2X1VA 4EW2A 1PHRA 4PLWA 4JI3O 1ZKMA 1YC5A 2QRVB 4PGMA 2XNKA 1OC4A 2R11A 3RI3A 2AE2A 1CJKC 1RKXA 5DM4A 1MZVA 1I5XA 2HSJA 1QP7A 4HDSA 1RW4A 4P38A 4E88A 3LI2A 1L5MA 2H59A 5CHYA 3X1YA 3IPAA 1P3DA 5K0ZA 3KOWA 2WD7B 2YYYA 1IZZA 4CF4A 3G2IA 1DC8A 1XNRO 2HTEA 4BTEA 3FD9A 3GPDG 1QHYA 1UBFA 3OFJA 3A37A 2Q8QA 1N0UA 4NJMA 5LLDA 3T3OA 3VNUA 4B3SO 1U7TA 2XNJA 4D7SA 2ZRMA 3L79A 4RXUA 3R65A 3ABMB 3ZZ1A 3MRVA 2NUPA 1KRXA 1XNQO 2PXCA 2OCGA 4YIKA 4MDHA 3QKIA 4OHKA 2FWPA 3SC6A 1SVKA 2I87A 2EL7A 3QW4B 4ZAVA 2JLRA 3HVRA 4CC6A 4D3XA 2D8MA 2X0FA 4CV0A 3ICXA 2LD4A 5AT1A 2VNSA 1HO3A 2AN4A 2WSLA 3M34A 1V8ZA 4E14A 1ECPA 1NQUA 3IHKA 3LQ2A 4LRQA 1C7RA 3KTAA 1QQ6A 2Z8ZA 5EAIA 4PRKA 3ZWQA 2JATA 3FDZA 3CF2A 4L57A 5JT1A 2VSXA 4ZVNA 4UUQA 5CXXA 1G66A 3H7IA 3MWYW 4LBEC 2O1EA 2IIPA 1CEYA 1OAKA 4DSZA 5MN4A 1RZUA 2FEAA 2FDRA 1Y6FA 4IUCS 1H2FA 5T8KC 3PWSA 4WRRA 3K9BA 2CLDX 2AV6A 4MWSA 1B3RA 5KUMA 3B77A 3KALA 1XYGA 2RHRA 4MW0A 1S2OA 4QXRA 4S0ZA 3GT0A 2B8JA 2V59A 1LS6A 2P3SA 3WLIA 2GN4A 1TM3E 2QRVA 4WECA 2AI2A 4FLMA 2J3KA 2QN8A 3CMCO 4RTRA 5CM8B 4X64B 3EJ6A 1TMGE 1E3JA 3PUIA 2XMBA 1DRVA 2R8EA 1Y7LA 4KVFA 3BFVA 2YJZA 3RJ5A 5KAIZ 2WD7A 5EK0A 5T4BA 1IMOA 4MGHA 2Q62A 2VRCA 4MVJH 3IR7A 1ZMRA 2OB1A 1QVAA 3II6X 4JLBA 1DOAA 4PYOA 4HAOA 3V5NA 5KAFZ 1NUQA 4X1YA 4F6EA 1A96A 5KPDA 2C31A 4BO4A 1UMDB 5EVCA 1XMJA 4K9PA 2QF7A 3DEKA 3BH1A 5J9FA 3GRZA 4RKYA 3OPVA 3WGLA 1SKYE 2A5GA 2JLAA 5FHRA 2WI8A 1PNMA 4JLJA 4MA4A 2OLEA 3RBVA 4LVCA 1YNSA 2XLCA 2RG7A 3WK5A 3W7XA 4JI1O 4OSEA 3VGPA 3LECA 4MV7A 3GD7A 4NEHB 3FNRA 1CSEE 1NXSA 5K3OA 3V4OA 3T5DA 2P6OA 3FNHA 1Y3AA 4QGBA 2QU7A 3SQXA 2WMYA 1UPXA 3MBIA 2GEKA 2O23A 3AG2B 1NXTA 3J81k 3UQ8A 1IAQA 2C58A 3IEUA 2EDAA 2M2IA 1O58A 3HB4X 1VQMV 4WFEA 3K9GA 1ZOOA 4D9EA 1EB9A 4G9EA 2VF8A 1I6MA 1KU9A 3I0MA 2P6RA 2QWNB 1H0HA 3L6EA 4R6XA 1DBQA 2Z5FA 2QVLA 4MYUA 4DA8A 3IE1A 3IH5A 2IE8A 1XA3A 1SKUA 3A6FA 1H22A 4BS9A 4WZBE 1PFKA 1WUHS 1CNEA 2R9VA 4A2WA 3EUWA 1WXHA 1LSSA 2NVOA 3MWFA 4ZJYA 3VTAA 1FFYA 2I7TA 1QYVA 1RRKA 4PPNA 5L7TA 4KAAA 2XWQA 1JMYA 1Q7YW 3KVOA 1NAIA 4M0LA 1VYUA 4V1CA 3DV9A 2PAFA 1DSSG 1ZSNA 1QAMA 2Q0AA 3CSSA 4FXPA 5JALA 1L4GA 5GAOA 4EJSC 1SQSA 3EPJA 3ZCVA 4NR0A 4C0SA 4KOAA 4MI3A 4PLTA 3J7TA 3K9LA 3OX3A 2GBIA 2B2XA 3FBGA 2XHEA 5I9IA 2JLCA 3W5CA 2ZNRA 3B9QA 4LCJA 4MR9B 2AMLA 1AKWA 4LXXA 1B6QA 1TAEA 1MA0A 2BEVB 1PLJA 4PEVA 4BQNA 3C24A 3GAMA 4M22A 5TEVA 2GGSA 2YZMA 4CGZA 1CNMA 1GQFA 2ZXUA 3E22B 1UZNA 3G23A 1R27A 4YRQA 3PUHA 3QG1A 3JVIA 3SLGA 4YPOA 4C6HA 4MR7B 4U00A 2OCKA 1MT3A 4HQOA 1GXSB 1WUYA 1Z4OA 2O52A 4LGMA 1BKDR 2C98A 4GOOD 4B3GA 9GPBA 2ADFA 4F2PA 1CPYA 3W2GA 4BRSA 4YV2A 3QLVC 3CLSD 2QZSA 3WMGA 3JAKB 3MRTA 1JDBB 5MFZA 4LS3A 4DM4A 4O1IA 3ZE6A 4IICA 3ME5A 1TCUA 2JCSA 2CL5A 1RQXA 4WASA 4QLAA 2BHNA 2QRKA 2Q3CA 3K03A 4EG4A 2XZOA 5F5XA 2M9MA 4CFYA 4BFUA 2FFHA 2CFSA 3T0FA 3I9KA 4KBFA 1KVTA 1NXXA 3ETGA 3FWNA 1GTRA 3IOEA 4YCBA 1WXGA 1A2OA 4NZMA 1KYTA 4NDZA 2J3LA 3HUDA 1EM6A 1JQ5A 4M49A 1T1JA 1ID8A 1TU0A 4Y3UA 4IFIA 1RPAA 2XVMA 2NAFA 4JMLA 1C81A 1YVUA 4P5PA 3WNZA 3BAZA 3K8OE 3JD3A 3MOIA 1LF5A 2Y1XA 3IKLA 1CXZB 4XPIB 1T5OA 5IJXA 2R7LA 1ADFA 1IZYA 4ZQIA 5D85A 5LWHA 3FSGA 3GCDA 1OCOC 3QKUA 1QZXA 3T94A 2VP5A 2P3OA 2OV1A 4JYBA 2ZB2A 2IOFK 3FFXA 3AY0A 4NS1A 2BHSA 2R6DA 1EVJA 2Z6VA 3JQPA 3PFKA 5HRCA 1HTTA 1G6Q1 4AICA 2AG1A 4IXMA 3LT2A 4FZJA 3ZWDA 4JYPA 3IQWA 3N0XA 1P7PA 4OPAA 3DR5A 3EXAA 3FPBA 4RVOA 4MR9A 3WA7A 3RROA 4F4HA 4LQCA 2B4QA 4D42A 1S2LA 4PAOA 3T7EA 2H0AA 2SECE 4EKNB 1NW8A 1DWUA 3RFUA 2GBFA 1R5TA 4JLNA 3ZDXB 5CBPA 2Z5GA 1BA3A 1OWLA 1T8SA 2Q8PA 2W83A 1DV2A 1EX7A 2XRYA 1WULS 3TSAA 1PQWA 2AC2A 3OQVA 2EBOA 4K6CA 3EASA 4ENPA 4IDAA 4YS6A 2CUNA 1XRMA 4MR7A 1KO1A 1JR3D 4JLSA 5EIAA 2JI9A 2ZSJA 1ZN8A 3DE6X 2GM4A 1S8FA 3JAMA 4DF3A 4KXYA 4BGIA 2QM0A 2X0IA 4I4NA 5DWDA 5HHTA 5KNDD 5CNIA 5E6SB 3JAKA 2I5PO 4DW8A 4NFLA 1YRQA 2WV7A 1DG9A 2NXEA 2X15A 3DFUA 1G7RA 3FI0A 3W1EA 1YZQA 1SKQA 3IJ5A 3F6PA 3DBLB 3VOBA 2K5UA 1OH5A 1X4TA 4HGYA 1ZD8A 3W8NA 1A8PA 2ZLBA 4RUEA 3G2JA 1G5FA 2XE7A 2DC1A 3A6KA 3D7MA 3ABRB 1HFKA 3A4IA 3RYFA 4P08A 1IEQA 4M6WB 4QPPA 3SDZA 3CC4V 3ZJ4A 2QLCA 1H4TA 3K09A 2H92A 1PSDA 3UT6A 2GVZC 4ED9A 3DVQX 3AEQA 2G40A 1MC4A 2AXQA 3EC1A 2P27A 2O6LA 2JS7A 4M9RA 1TZCA 4PYJA 4JENA 1QTIA 4DUGA 1GPMA 1J0XO 3GA0A 3BK1A 4E4RA 3E8BA 3ZLJA 5C1DA 2RAVA 5CVTA 4P81A 1Y8RA 2FEKA 4J7AA 2GHTA 1OIWA 3IQDB 2XNDD 2RIPA 4TXMA 3PFIA 1TQ8A 1JR4A 1VCMA 2WD8A 1TM5E 5LP1A 2NPIA 5GOZA 4HX5A 3B6KA 3VBBA 4KE9A 4UCFA 1VIBA 4ZEOA 3H9VA 4G26A 3FFTA 4GC9A 4PN3A 3MEQA 3S5JA 1MABG 3IUYA 1OI0A 2YYAA 4UUPA 4A8JA 2O5VA 2D1YA 4E5UA 2WG0A 1QHIA 5AR1A 2DN9A 2YS6A 5ADWA 1JCHA 1FDIA 2XZLA 2PIAA 4G07A 1QLWA 2IPLA 1JEYB 3V8MA 4C2BA 4YQYA 1OAOA 3NBZC 4FM9A 2QP9X 3HUUA 5FNVF 3WLLA 5K8LA 3P0RA 1AH2A 5M3BA 5DM6V 2CEAA 5AI4A 3ZGXA 1DFGA 5CLGA 4L0MA 2XX3A 3B1WA 3ZE2B 4EF6A 4PPGA 4ND4A 1ISPA 2O3SA 4TPKA 3DBLA 3ZD8A 4X62B 2OUIA 2H57A 3A27A 3U3ZA 3ZPCA 1QBGA 3L71H 1W73A 2AGAA 3SZRA 5CDFE 2YV2A 4FK5C 3CB2A 4GOKA 4CZ2A 1RLIA 3GRPA 1BXRA 3D3QA 1JHYA 1NX9A 3D0OA 1CY8A 2FMKA 4BZPA 2RGGA 3A4NA 3E82A 3G6BA 2IWHA 5BXYA 4EZIA 1ZHOA 1UEIA 4RLQA 3Q9LA 1HWYA 4BMSA 5CCXA 3ESRA 1OLUA 1U4NA 2J87A 2ZYSA 6NULA 1XNJA 1KK3A 4YAJA 3EUEA 2WW8A 3VAZA 1ECBA 3T54A 3KQTA 3AINA 2BLNA 2C7PA 1H23A 1U3FA 5JJJB 3CMMA 1ODKA 5JG7A 4CM7A 4TLEA 1JRLA 1UDBA 3AR9A 2P67A 2IZ1A 4W4KA 5BQFA 2CF6A 1XELA 4MVOA 4FDUA 4I7ZB 1D7AA 3SK0A 1G291 2LJ2A 2PJRA 3ZOKA 3T4UA 2CL6X 4O3MA 3DHVA 2YI9A 3GWOA 4OXIA 4AS2A 1H9CA 3L6UA 1DIAA 4C05A 1KI1A 4DCSA 3ZZNA 1S6YA 3CVUA 4QNNA 1J39A 4ML3A 4G0NA 2Q29A 2E7ZA 4CLRB 1JLMA 2PWBA 4BCBA 2EQBA 2BI4A 3OH8A 3PP8A 2V96A 2IE0A 4OI1A 3F8TA 4LYHA 4G1MB 3E3MA 1L7DA 1E99A 4KV7A 3MD0A 2D7CA 2Q0OC 1SRYA 5LBUA 2C5GA 2ZCJA 2I6SA 1IQRA 4I2VA 3WG9A 1AVTA 1EFUA 5TX7A 4YB8A 5C7LO 5IASA 2A0KA 5JVDF 2OORC 2FA9A 5F23A 3A3KA 4CMCA 1B1CA 5AM1A 4B40A 3GJ4A 2PYZA 2GZSA 1KU0A 3SYLA 1H2BA 1XUQA 1BHQ1 2YN0A 3PF9A 4JI5O 3O2NA 4JMPA 3PC4A 3GLGB 1UJBA 1LTKA 5EUCA 1HH4A 3L8CA 2AGVA 2VA8A 5A02A 1U4OA 2RCNA 2BFOA 5C5IA 1EGHA 1JPUA 2JAUA 3PRYA 5AHWA 4E5VA 1X1QA 4R40A 1I2AA 5D84A 2PKQO 1WR8A 1I7DA 1VB5A 4J0FA 3E27A 2QHXA 1BN6A 4CGYA 3IX7A 3BWVA 3OWOA 2I66A 4QUJA 4RGVA 2IYWA 1YQGA 2XUJA 4HEA6 2AMFA 4J1TA 3TJMA 2H4FA 5K99A 5BORA 1M6YA 4LN1A 4GPBA 1F0NA 3GFQA 1HKUA 3K5IA 4RM3A 3VZSA 2VJCA 1SHKA 3VDXA 4V0NA 1W76A 4PANA 4DM3A 4HNUA 2Q46A 4KVZA 3QNMA 2OOSA 1PWYE 3EPKA 2ZWIA 1FYDA 5JWRA 1L4LA 5IK2A 3WOVA 3O21A 2FN4A 1OJHA 3CMAV 2X2EA 4LMPA 1P7BA 1H05A 5IM4A 4CI9A 2FUKA 1MIOB 4DJFC 2EZ8A 3B5IA 1KSJA 4G2KA 1K73W 4BFTA 2X8JB 2DLDA 5C1BA 4BMPB 4CLRA 3UKJA 2O5CA 1EIZA 3LCRA 3QYJA 1O1YA 1Q50A 4IHJB 4KWEA 3U4CA 4YRFA 4BLRA 1JXQA 5E7MA 3GY0A 1DC5A 2QTAA 1Z6GA 4JT8A 3GGSA 5IAGA 4KXLA 4IW3B 1WPQA 2Q0QA 1AZWA 3PGKA 1FQOA 1YZBA 4YRRA 2DBVO 4FFNA 3MQ2A 3FPCA 3HA2A 3F7VC 3K16A 3ER9A 3QF7A 3DC2A 1EFDN 2B1QA 5I4CA 4FB4A 3RRZA 5MN5A 1N5IA 2GWHA 2OY0A 2NVWA 4KE7A 1Q16A 3H1JH 1ZIPA 4XWYA 3HO1A 1ZA1A 3EGXB 1OREA 4XVQA 3I64A 2L42A 4U02A 2ZXFA 3E2IA 3GCGA 2WJIA 3O3MB 2NU9B 1YDHA 3SEFA 5DX8A 1ZHHA 1KI6B 3HVJA 3KKQA 2VT7A 3FCEA 1M2GA 1NG9A 4Y1RB 2Y99A 4JZGA 1Z25A 1UAQA 1BGVA 4R54A 2OBCA 3RVPA 4ATNA 1IQUA 2HLDD 3SDBA 2OK7A 1UWCA 2PUJA 4HFJA 5DBEX 1WMFA 4DLPA 1Y81A 3CXCU 3AKEA 4FOSA 3JYCA 1IXMA 5A62A 5EBMC 5GQSA 4LISA 3SFZA 1VJDA 3T7TA 2I4MA 4AO6A 4E0BA 5H5NA 5IRCD 5LZ7A 3NEJA 3JSNA 3WC4A 2E4YA 2IY7A 4NPAA 1JPXA 3OU6A 2NN3C 4X1IA 4KGVA 4B44A 2OLJA 2X8JA 5DGIA 5TQVA 3OOSA 1T1SA 1V5WA 4MITA 3FB8C 3HH8A 1DP4A 3OBIA 1SQ5A 1KH2A 3MJSA 3BEHA 4Y1FA 4Y2SA 4FLFA 5AKEA 3WQBA 2SKDA 1P1FA 3CINA 2Z9DA 2Y69C 3VVMA 4PGFA 4CNBA 3DUFB 1L5RA 1KK0A 2NO1A 4Y2GA 2EU8A 1E1YA 2ZM6B 4QWWA 1AZLA 4E15A 3I83A 4TGLA 2F3QA 1ZCAA 4DG9A 4JR1A 4QSHA 2XA9A 3AI2A 2O2HA 4DMKA 2O06A 3QXSA 4K03A 2QMZA 5DHAA 5B4UA 4DW1A 1N6NA 2V5UA 4IWYA 4KSCA 1E1CB 5EJ8A 3V46A 4DXHA 2J46A 1AGPA 3GT3A 2ODEA 4ZTBA 1GUAA 3D7RA 3H2YA 1ZD9A 2C7VA 3WP1B 4Y2JA 3EGXA 3W3ZB 5JQGB 3RSZA 2WF6A 3FMPB 4QXPA 4TWZA 3TTWA 1F06A 4ZALA 3NUZA 2QLMA 4ZVTA 2R6R1 3MWKA 5FV4A 2HRCA 1PGQA 2J30A 1D1QA 4JLKA 4EUKA 3W2EA 1KI6A 2FF7A 1EDBA 3EF1A 5D3KA 4ARUA 3RW9A 4GDMA 4QIWF 3N28A 2ZD9A 1W2WB 4IUBS 2OC4A 2F43B 4TVBA 6Q21A 1GNLA 3TRIA 3UN1A 1JQAA 4X64O 1DEXA 1BX1A 3MJDA 3B6IA 1U2SA 4XYLA 2TSYB 4N03A 3NBFA 1T5IA 3O1IC 2H9IA 3COJA 2O3QA 2ZI5A 4DVJA 4Q4HB 1UAGA 4Y2XA 4TYPA 2HIGA 3MMZA 2G76A 4G97A 4G25A 1AILA 3R3UA 1HW7A 1RWQA 1EXDA 3U11A 4KDRA 4Q16A 2OV3A 1LW7A 3HU5A 5ISMA 4EB3A 3OO1A 1U1DA 4XTCS 4OI0A 1Z6AA 1XTBA 3RAJA 1JXOA 4RAOA 2JJMA 1U9YA 3AU8A 2JIZA 1XAHA 4PFQA 3OM8A 4B8YA 4EG0A 3CWZA 4C06A 5KVQA 1J25A 4R2MA 2IUEA 3GJRA 1WB5A 3UAXA 4JD5A 3QBEA 4AKIA 4QNRA 2QP4A 2OCCB 3KUCA 4G24A 2YTZA 1AKRA 1C7IA 1N9ZA 1GPLA 2JJYA 1MZPA 2V54A 4M1TA 2AZXA 4DIBA 1LPPA 4ZJUA 3SWWA 4Y2RA 3TK1A 4P86A 1JFTA 4LDJA 4PG8A 4MQEA 5B7NA 3IFSA 3PGA1 4OQDA 1PK7A 3U31A 1E9BA 4GRAA 3COSA 1WB6A 2WUGA 5E6UB 2PRJA 1ZWIC 2J3DA 1W9HA 3VZDA 2DRIA 3G7UA 4LGVA 1E1CA 4J07A 4DADA 1Y6ZA 3CCEV 3ZJYA 4EM6A 2YWBA 4F5WA 3KJIA 3ASOC 2IKSA 1XPRA 1MF7A 4URXR 1CR1A 1TI7A 5JQGA 2BFMA 1OTHA 2EIMC 4FEYA 4X88A 4MTOA 5K7SA 4PSAA 3IMGA 3CZ9A 4Y9RA 1YHNA 1MPXA 4FE3A 4HWPA 1PWHA 4CBVA 1CQIB 4CW7A 3H1AA 3TNDA 4NOMA 5ALYA 1D0SA 2WUVA 4FC6A 3B53X 5A5FA 4IRXA 2RGXA 1V4BA 3B3FA 2F43A 3NAGA 2VH1A 5AVWA 4XQGA 2G28A 1CULC 4RJ2A 3LLVA 3CD6V 3R8CA 3LK6A 3I62A 4WJKB 1YR7A 2AFHB 4F9GA 2NPOA 3ZY2A 2Z2KA 4BV8A 2X9NA 5JAOA 3MPUA 1JALA 3PSAA 1OKKA 2ZYTX 3BE8A 4Q4HA 5F35A 3RVLA 1K4DC 4ZOQI 2BM1A 2YY6A 2B1GA 5LBQA 5A05A 3OI7A 1NZJA 2D1SA 1K0FA 2G08A 5HSGA 2JCBA 1Z6PA 4YYZA 3OZBA 2QJRA 4D3SA 2BKEA 3DWGA 1NVVR 6ABPA 1SQQH 1KYIA 1WKBA 4NB5A 1FDOA 4N1AA 4F91B 2HWKA 1NNEA 3RIMA 2IIQA 2WZDA 721PA 1R8JA 2W37A 1FTWA 4X6UA 1KR5A 4D56A 4DV6B 1X14A 2VJLA 3TQHA 3BRWA 4Y98A 4MUNA 1J5PA 4PAQA 2PTGA 4GZLA 3U9SA 2D7DA 4MUHA 2XVZA 7ADHA 1U0FA 3EVEA 1EBUA 2FMTA 4R71A 3ZYCA 5DGTA 4WKNA 4KACA 2M1ZA 1TKAA 3BGVA 1UZLA 3VQXA 2QUZA 2X6RA 3UWKA 5IAAA 2W5UA 2FI1A 4ER3A 2VUTA 3UG6A 5BT9A 3QX9A 3U09A 2O8DA 3DAGA 1Q0TA 1T25A 2D4AA 3W5VA 2OFXA 1FSPA 2ONYA 3QU9A 7MHTA 4HMQA 4RORA 4CS4A 3QE0A 3A7DA 2XVAA 3RPEA 4OQEA 5HQ3B 4H7KA 3T7SA 5IAKA 5F2EA 3QTTA 5GTDA 1PR2A 3AVTA 5H5JA 4ZDWA 4X45A 3NT4A 1A4IA 4UBLA 1H42A 3VOUA 4WBXC 5IKXA 1E2EA 2P2NA 3OGCC 1P81A 1CQIA 2ZQYA 3HXPA 3IESA 3WMWA 4RIHA 4JN6B 3VU0A 5GONB 2V98A 1VPWA 2A1UA 1UJ6A 2Q9LA 2AW9A 2HF9A 4NAUA 5F7JA 2PO7A 3WVNA 3D6TB 1CV2A 1PT9A 4YYEA 2B36A 3B3AA 2WUDA 3MMPA 2AFHA 2P9BA 4REQA 4F7OA 3BPZA 4CLEA 5ALRA 1XTZA 3KQLA 5IKMA 2OCLA 1EUQA 3MHSC 4LMRA 5LFAA 1KP2A 3A1CA 4BVBA 1IULA 3NAMA 1P6QA 2PUFA 1WLYA 4BMOB 2C3UA 2HX1A 1DJPA 4KQMA 4PDRA 3OKCA 5ICMA 4CMKA 3C5HA 3T9EA 2QTBA 4CM5A 4BFCA 4JGBA 3AJEA 3BXPA 1GGMA 1PWZA 1E9AA 5LNK6 2NLOA 4P0QB 2BYTA 4ZYVA 1C3VA 4C5AA 3SQDA 5BNZA 5J1SB 4E1AA 4WI1A 3TW8B 3IA7A 4GRIA 1RYHA 3TTYA 2DPMA 2WC1A 2DYRC 2PEYA 4OXRA 3ZJZA 4UD2A 3RG8A 2IV3A 4GM1A 4QVIA 3ZIAG 3L6RA 1EK0A 4UB6Z 4QREA 7GPBA 1EXVA 4PGAA 1G7TA 4MVUA 1YB1A 1RDFA 4D4IA 4JA2A 1K89A 3IUJA 2R97A 2VG8A 3H11A 3KV1A 1MX3A 3ZDRA 3KLPX 5LB2A 4BWFB 4D8UA 4IIDA 4Q7KA 1F48A 2R2GA 4ZO7A 3L41A 2CBZA 2BY4A 1P19A 3B78A 4YGYA 5K3AA 5BUZA 2YJ6A 2QZ9A 5HQ3A 3OLZA 4C76A 1JFFB 1DAFA 2UZAA 1AKEA 3NLLA 5HEKA 2FCAA