2IU0A

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Based Design, Synthesis, Evaluation, and Crystal Structures of Transition State Analogue Inhibitors of Inosine Monophosphate Cyclohydrolase
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
molecule keywords BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH
total genus 213
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2006-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2iu0A04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2iu0A01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu0A02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu0A03
1C30A 2YVQA 1EGHA 1OZ0A 1M9NA 1S8AA 2X8WA 4EHIA 5H3LA 2IU0A 2B1IA 1THZA 2B1GA 1IK4A 1VMDA 1KEEA 1JDBB 1CE8A 3ZZMA 2XW6A 1A9XA 1BXRA 1B93A 1PL0A 1S89A 1T36A 1M6VA 1CS0A 2IU3A 1C3OA 1G8MA 4A1OA 1ZCZA 1PKXA 1WO8A 1P4RA
chains in the Genus database with same CATH superfamily
5E2AA 1XQXA 2F67A 1ODLA 1VMAA 4YAEA 3AJDA 3SS9X 3PE4A 1R6VA 2JFFA 2O8EB 4LF7O 4LZJA 1JXQA 3U19A 5HP4A 3R1IA 2GAAA 3GVHA 5CPBA 1EUYA 2P79A 1Z7BA 1ZVJA 4Y0VA 1N8RW 2BR3A 2JJQA 3KUCA 3AY6A 3NWPA 4PLZA 1PUIA 4X9XA 3GXOA 2Q50A 2I29A 3AR3A 3DCNA 5DM1A 4C0AC 4F8JA 2F62A 3FXAA 4G5RA 3CO5A 1WSWA 3LUGA 2GAOA 2RHBA 4BKUA 1Y4DE 1Z4OA 4UB6Z 3FYCA 3G2KA 4IINA 1U04A 1FXUA 1J2RA 3B9PA 5FQOA 5FWDA 3TOCA 3TQFA 1WKQA 2GO1A 4LC5A 1ZX1A 2CJYA 4HG2A 5K0LA 3QTLA 1I2DA 2XTNA 4DM3A 4PBTA 3ZCTA 3ZJTA 4DO2A 4BBZA 4ZAZA 1C7JA 5K2OA 3EY9A 2Y4TA 3DZ8A 4WIFA 1ZZGA 2M6LA 2A35A 2FPPA 4NAHA 1X1SA 2Y0DA 4QPNA 5IY5B 1IY2A 2PFSA 3OE4A 1ULBA 3VUFA 3BCUA 4J9YB 3KQMA 1F8XA 4YLEA 4B3CA 4MKFA 1PQWA 1WCXA 3ZGNA 1E5TA 5TIIA 1ND5A 1LEHA 3EC1A 2MINA 4YAGA 3WISA 2GH1A 3U4DA 4Q4DA 1KRWA 1S5HC 1OYYA 3MAGA 4PZDA 2XUFA 3ZHTA 2OGWA 5HKKA 3W5AA 4RY8A 1LC0A 3EIHA 3JYCA 3C3SA 5LP6B 1H2AS 4Z2WA 1TTHA 1K5PA 2RH9B 4HGRA 1NBMA 4Z3KA 2ZU0C 3FY4A 3D0KA 1J0CA 1G4UR 3T12A 1L4UA 1R0SA 3AF1A 4YJ3A 1P1BA 1YTUA 1ZS9A 1K6EA 1EK2A 2D1TA 3ND8A 2Z30A 1HG0A 1T4CA 4UDNA 2BI8A 5ALEA 1ISMA 2ZYVX 2ONKA 2V7GA 3BX1A 1J5PA 4LTMA 4CH4A 5DT9A 2R62A 2XTJA 2Q6AA 1AXGA 2ORYA 1GFIA 3FLEA 4KO1S 4MO9A 4R1TA 4F92B 1I2BA 2I6SA 3PJFA 4RTRA 2IYAA 2FJUA 4K6FA 1XEQA 2WWHA 1M5RA 1SEVA 3DLIA 2PG3A 2PWZA 2BOBC 4YRPA 3B8FA 1J09A 1E2DA 2CVOA 3DDUA 3EHBB 3G8QA 4EY8A 4BJ5A 4ZEWA 3D3QA 2Q5EA 1RBMA 2GZMA 3L8CA 5CYFA 5AI4A 2WLIB 1OCCB 2Q4RA 3PVCA 2AOWA 3M49A 4TWZA 5DB4A 1L6IA 2GYUA 4HSGA 3IODA 1UOEA 1W0JA 2AE1A 5EWJB 1YS6A 1VB3A 3IJEB 4CLOB 3UQ8A 1QAQA 1QKJA 2X8WA 3M2PA 1JOYA 4L5YA 3F5WC 3JALA 2Q8QA 1EWVA 2G5PA 3NKVA 4FJ2A 5AJYA 1VIVA 1UKVY 3TZQA 2AW9A 3KKMA 3ZHSA 4B3MO 1QNFA 1FDWA 1BYIA 2GCOB 2V6GA 4NCBA 2Z3HA 4NLLA 1XZNA 4Y9SA 2W2LD 2F1IA 1KERA 4R8VA 5JAQA 5ADWA 2W2XA 1RPOA 1NJ6A 1O95C 5AVSA 3C6YA 4J9ZB 1RWPA 3IMEA 1FVFA 3N59A 2QD3A 4N49A 4TROA 4DMCA 3HXOA 5E3JA 2N04A 4G27B 2YXBA 3JQ8A 4PFSA 1VQ7V 1HE2A 2LCQA 4FR5A 3SR3A 3T7DA 2VCHA 7ADHA 4Z4EA 2O3RA 4QLAA 1ZU4A 5JXGA 5D2CA 1U3DA 3GFOA 1ZNYA 3HXTA 1YDWA 3IEUA 3ZHBA 4C87A 2X0DA 1IBCA 4A0QA 3K2IA 3USES 4BIIA 1K92A 1SAYA 3QP9A 4TRNA 1BL8A 4E7OA 1MHTA 2I71A 1M56C 4O2AB 5EKTA 3E61A 1RJGA 4JXJA 4BMDA 4PZPA 1OU4A 3LDGA 4L27A 3WV5A 4DCCA 1PL8A 3LKZA 6ADHA 1R6DA 2QY6A 4MPJA 4B84A 3HKBA 4DBVO 4EJ6A 2M6SA 2X6QA 3ASUA 4B2YA 5TLSA 5DFAA 1R12A 2X6BA 5HMLA 3EDQA 5MN4A 4C7KA 2F95B 3PKIA 3W3ZB 4P33A 1P49A 4O4IB 5KUTA 1EA5A 1GHTA 3OC6A 5LGUA 2Q45A 4G1CA 2DZDA 1U9IA 4JK3A 4ZP1A 4YAUA 4I6GA 2YEVB 1PW5A 3DMPA 2XCLA 1VG0B 5KHIA 1P33A 3W8NA 1TUBB 2ZUCA 5KU1A 5EJ6A 3IKMB 3AZOA 4LNUB 4L4UA 4MJ7A 2G06A 3TOZA 4K46A 3HQ4O 2D2FA 2AX4A 3M7IA 4X8HA 1BGWA 4KRYA 3QVJA 3ZJZA 2BBOA 2PT6A 5H7XA 1T5LA 1V71A 1EVQA 1C9EA 2RG7A 3QFCA 4A9AA 4CMCA 4RBNA 4LZOA 3F7NA 2EJBA 1WUKS 1NIPA 3KM0A 3K7EA 4HVTA 1TEHA 1XV5A 4MUNA 4N8DA 1U97A 1UBKS 5IVIA 1SF9A 2QBYA 3PR3A 4CG3A 2OSVA 2FHSA 2HHCA 1ADJA 2X0JA 3KR0A 2Z57A 4ENPA 3NTLA 3D1VA 4NFSA 3V1TC 3DLAA 2UZ4A 2PMFA 3GEGA 4QDUA 3NKLA 5CFLA 5DXJA 5IDQA 4AP9A 2PGOA 4TTIA 4KE8A 4LWPA 5IS2A 5J3JA 1QGOA 2FNAA 3TLAA 5EK0A 3BIJA 3FNIA 3OQ6A 2YVUA 1B76A 4P9CA 1I14A 1X7WB 1Y1QA 4HSEA 3GCZA 2EDAA 3EC2A 1K3EA 1SCDA 3TRDA 1PV0A 1FLAA 5CA3A 1W4CA 3DJYA 4LNUA 1W0KG 3G2NA 3IT0A 4XIFA 5DNWA 1DT3A 5BV8A 3WMFA 4X41A 1GFWA 2HW8A 2F55A 3QQ5A 3B1ZA 4BUCA 5L45A 3SF8B 3KUUA 5IZCA 1ZAYA 1EN4A 4GD3Q 2X7JA 4BGUA 1M8FA 3E2EA 4AG3A 3H2ZA 3O65A 1NQ5A 5P21A 4CLOA 5LJLA 4LV6A 2XUPA 2HNBA 3EQ2A 1CUDA 4EVSA 3CH5A 1SCUA 3VHRA 4OHYA 1HORA 1M5IA 1V26A 1NZ6A 1L9KA 2IUTA 1O7JA 2P8SA 3MD0A 1TNDA 1U81A 1XJCA 3GCDA 3G4SV 1FTYA 4M87A 4MQ5A 4TWAA 4UARA 3W3AD 1JR4A 5FPQA 3A2LA 2C1EA 2XNCA 4CEHB 1NP3A 4ZO6A 1WDWB 4EA7A 2ODMA 2PGIA 5CDSA 1MJFA 4G1FA 1KAMA 5B3SB 2HRRA 2HRBA 2PUJA 2R8YA 3U4IA 4UBMA 2HCFA 3NAMA 1OWPA 2G1PA 2HF7A 3IP8A 3LUJA 4NAUA 3IXLA 3BE4A 1EX6A 5SY6A 3K92A 3C14C 2WICA 3DNFA 4UHJA 2QV7A 3W6NA 1OMOA 1W8IA 1QHHB 2RHWA 4OCZA 1MOQA 1KJWA 1M2KA 2BI7A 3TINA 3VQVA 1N5LA 3PUYA 4DKXA 2UV8A 1IHOA 1R6NA 2CVFA 1MP0A 4D7TA 2ORED 1OAAA 2FSSA 4JHLA 4YRTA 5ANRB 3S2UA 2J9ZB 4WA8A 1DRKA 2BEUA 3EH1A 4H1WA 5U9CA 1DTWB 1JPXA 3IIIA 2YIMA 2WA1A 3IR7A 1XMQO 1ZBDA 3ETGA 4LVOA 3AEZA 2EW1A 1NSTA 4KOEC 3COPA 1P7WA 4KXNA 5IMBA 3UCXA 1US8B 5JRDS 3FKSG 5H6RA 2GXAA 1GGMA 5DNDA 3L1HA 5LQAA 1X3LA 2JH3A 5HVNA 5KTNA 3ADDA 5AJXA 4YMIA 2M9MA 3LD9A 2P9ZA 5EP2A 4MITA 3U49A 2ZS8A 4BO2A 3IHWA 4ND7A 2JW5A 2XA9A 3QMWA 4RHFA 4A03A 3RNLA 5D7NA 1Y8CA 4YRJA 1RKXA 2CNDA 4ZAVA 5LA6F 3B09A 3NKFA 5CVJA 2O8BB 2CXUA 2I62A 1JQBA 5B1AC 2B35A 1X19A 3OD1A 2GA9A 4EB0A 3IV6A 2IDZA 1G5HA 1S1CA 4GPBA 4K7JA 5KTSA 4LBEC 1JBKA 1M8KA 3C1UA 3DE6X 4KSBA 2YOFA 4ZTBA 4QEZA 1S2LA 4GMXA 3TK1A 2JCXA 3CZAA 2AFIE 4MGHA 4UHFA 3ZBHA 2KM1A 4PC1A 3VU9A 3PGJA 2CKDA 1WU8A 3F6YA 3IE2A 4GWLA 1UFIA 4DLSA 3KETA 4B5KA 4YRIA 4HNAA 4C0BA 2A9PA 4WINA 4ZBMA 4BKMA 3VAAA 5B1OA 2RBGA 3UCEA 4BMYA 3ZRVA 4QYSA 1XJ5A 4RK1A 1KQ3A 1HT0A 1N2EA 1Y1PA 3E9QA 4LMBA 1XZLA 4J3FA 4QDJA 4I1OA 4C4TA 4HV4A 4M0CA 3H4MA 4WASA 3CBQA 5CMLA 3EJWA 4BZWA 1MG1A 3QMPA 2QAGB 4EUNA 1SZTA 4UUQA 4YQZA 3JWEA 2H8PC 1IMJA 5EWLA 4O8YA 2WKRA 2ZANA 1NF2A 1PLKA 2M6RA 3NV9A 1E3SA 1XT6A 3E03A 3E8GA 1E79G 2FPKA 1C0KA 1V9PA 3I1JA 1YMQA 1DUVG 3PE3A 3ENWA 3RYHB 3B2EA 3R9XB 1A8QA 3TSZA 5TMBA 4C7OA 4G0NA 3WYGA 1U8UA 2RGGA 5EZ5A 2PMEA 3PXAA 3TW8A 2EEZA 4L51A 4DCOA 3GLIA 3GEDA 5FFNA 2R2GA 4I9FA 3K1JA 3QG1A 4KEAA 2FGKA 3V8PA 2GPJA 4X3PA 3DC5A 1N7JA 4QC2A 2HM7A 4K8RB 3LPAA 1YZFA 3IERA 1OC4A 2A3QA 1NJSA 4JI7O 2HBYA 3EZ9A 1XTRA 4I46A 1P1CA 4MHOA 1AVTA 2VO1A 3Q5EA 4HDAA 4KQKA 4S3MA 3KJQA 1XKXA 4LWSA 3HH8A 2O3QA 2XDQB 2O95A 4S1OA 1HG1A 1XL0A 4FLFA 1BJRE 2BH9A 4YJHB 3B5IA 5LXTF 1MZFA 2LQTA 1DEAA 2QL5A 1I0HA 1TQ8A 3HKCB 1Y42X 1CDDA 3D7LA 4G0XA 4DILA 3TNJA 3DEAA 1SHLA 3GU3A 4OD0A 4YTEA 2JH9A 2V7UA 3D3EA 1S3JA 3KLOA 4PX2A 2H1RA 3BKXA 1T6YA 1IWOA 4MYCA 5SZJA 5BMVA 3R0XA 3KQNA 1ZLZA 3DE7X 1MEOA 2VDWA 1NVVQ 3RHFA 3IEXA 4ZDKA 2X3YA 4KLAA 4UBNA 4CM3A 4JI2B 5EQFA 3QEJA 4AWAA 2XW6A 2Z6VA 4PLWA 3W78A 4DOMA 5ICGA 5CXXA 3HKEB 2B3DA 1JBEA 4URUR 1NKDA 3ZI4A 1HNZB 1H69A 1Z56C 3M0EA 3LT2A 2EARA 2PCLA 3VVCA 5IJ0B 3VVLA 4BNZA 4P30A 4DREA 1A3CA 7YASA 2DULA 1LK7A 4RVGA 4DR7B 4I4IA 3AL2A 3DYBA 3IR5A 4KQ1A 4ARVA 2R6JA 4DJFC 4EJ0A 2GFIA 2PX0A 4RMIA 1N5RA 3WIUA 3RKSA 4R7ZA 2OXEA 3RGWS 1NBWB 1RZ3A 3UTDA 4IXTA 1KXJA 1MG5A 3U17A 7MDHA 1H23A 2R2AA 2XAAA 4M3NA 4OQFA 1M2WA 4M8KA 3ZHCA 5BT9A 4GWKA 4Y2UA 4TL7A 1WZ2A 3ORRA 5HBRA 2IF2A 2XZLA 1VCHA 2UU9O 3ZG6A 4UFZA 2BZSA 5FUYA 5IULC 4Q01A 2Q3EA 4LDAA 3HMQA 4TZKA 4XQCA 5GVSA 1K7EB 3RBXA 1NF3A 4FFNA 4Y1GA 4IOKA 5I9IA 2O7QA 4N7BA 3SBOA 1IN4A 1AHNA 1QFMA 1SEPA 3A9RA 4DR4B 1N9KA 3GAAA 1G6HA 5EP1A 5HILA 2JVJA 3KPWA 3HB4X 2G77B 3WGYA 1AF7A 1YJ8A 1A8PA 1P0IA 5AFSA 1R0LA 2UKDA 1E6EA 3EGIA 4OHOA 4TM8A 1SRRA 1XHXA 1AGXA 1YS4A 3K1AA 5ECGC 2FSVC 4EG6A 5K3AA 2Q6TA 3KOMA 3LE8A 5AG2A 1WTAA 2O8DB 1WP9A 2E4ZA 1AO0A 1I6MA 4FT4A 5JVDB 4HD8A 3O73A 3NPMA 4O5AA 2Z83A 3LVFO 5IYZF 5HK9A 4OHVA 4BNNA 1ONBA 1PR9A 3E7XA 2WY2D 4PV7A 4Z7NB 2W6IA 2HJHA 2AW5A 4HDNA 3EC7A 3D4BA 4LYFA 1G6UA 4XD2A 1JHQA 3PNYA 1UFKA 2OEPA 4RQTA 5DHRA 2CHVA 3VHLB 4ZT4A 1V45E 1OIWA 1Y6GA 2ZYTX 2UYGA 5AM3A 2NU8B 1QTQA 2HLDG 2Y9PB 3ZCRA 5JWPA 5JH7B 5IC6A 5LBTA 3K20A 5CDYA 2B94A 4TMFA 1PR4A 4UQOA 3T1YO 2HF8A 3N2KB 2ZYWX 3O8NA 1PNRA 2E2WA 4LOKA 1PNVA 4JJGA 1MH9A 2XTZA 4NDNE 3OEHD 4S2EA 4P98A 1G8FA 3EXHC 4B40A 3DCIA 3LP8A 5LYJA 3N76A 4ZDJA 2X3UA 3BFPA 3E0QA 3MWEA 4M1KA 3CZ9A 5ITWA 1TVCA 3V1MA 2X40A 3WLOA 1DXHA 2WA2A 3ZUGA 3N0WA 4XRGA 1A96A 5D5QA 3VOTA 2YXNA 1H2HA 2IPXA 4I5SA 1QGDA 3IDAA 3QFRA 4RD2A 4YA6A 1YDHA 3H75A 1I5XA 3VU3A 2P62A 3QVMA 3OT4A 4FTWA 4K28A 3OX2A 3T4UA 3KG2A 3CN9A 1QR6A 1A9QA 4XSGA 4F38A 1NQOA 1I1NA 3FBWA 3CM0A 4IDNA 3BAAA 3WLJA 3ZJ5A 3PPXA 1MT0A 2AG0A 3VNRA 2QMHA 2XMRA 1B43A 5TF0A 1C9JA 4MKRA 3U4GA 2Q7HA 1I80A 1UWKA 2X8LA 4K9KA 4X1OA 4UUPA 1D0VA 4G8CA 3QW2A 2VQEO 4IHAA 4PG6A 4BEWA 4JJ7A 2Z3GA 1FLDA 4IFBA 2FWRA 3T3NA 2JFOA 3HPQA 3L7CA 2PPLA 2GZ1A 4QYIB 1K6MA 2YIVX 3AEUA 4PRLA 1O97C 1J0AA 1RQ2A 1FUKA 3K8ZA 4KRXA 2WFLA 4ZWNA 5TARA 4QPKA 1Y6RA 2YHBA 4EF6A 3PEWA 2ROQA 1EI9A 3LXUX 4KR9A 1Y3AA 2CD7A 1I6LA 2RCVA 3FOBA 2CDYA 2CJWB 1HTTA 2DFDA 4JYZA 4LX0A 1MORA 1V4VA 5B1EA 2OT3B 4WFAV 3GA7A 3TTUA 4OHKA 1BMDA 1CJMA 3GHHA 3TFWA 2YW9A 5BUSA 2BI4A 3MW8A 4MVJH 4CDNA 2HLNA 5JWHA 1IVNA 4HNGA 5JR3A 5ECYA 3ZV3A 5KEIA 1OJ7A 4GKVA 1N1MA 1N32B 2XE4A 4GZ3A 1N2HA 4WZBA 5T6MA 2PS1A 3EEYA 4CM6A 2PXXA 4EKNB 1DP4A 1XZIA 1GKIA 2XMCA 1CP2A 1RFYA 1SXJD 2VNAA 2Z0MA 1ISRA 4QT0A 2DH6A 2VZ9A 4UE6A 5LC1A 3WDKA 3PXCX 5AVVA 2VDJA 2VF5X 3RASA 5IE9A 5EBWC 4RNCA 2EILB 2GN2A 5ESXA 4C01A 4EGQA 3S2YA 5E7JA 4ALLA 4PYOA 4GI5A 1G19A 4XX0A 1I30A 1T34A 2HCTA 4TTJA 3NHSA 5EOVA 3TPZA 1UAGA 3ZWDA 3BK1A 1JR9A 3BXPA 3PUHA 1Z8DA 4G5GA 4A8JC 3H6HA 4DE5A 3TTXA 3AHIA 2NTJA 3DWEX 3ASZA 4NENB 3NI2A 3ANNA 1GZ5A 4PSCA 4RJJA 3BORA 3ZPXA 1FFTB 4G4IA 4D3FA 1JFVA 4ACAA 2OAQ1 2VJBA 2DECA 2BBTA 3S8YA 4BO5A 3CX4A 1EE2A 1E2QA 1F60A 2NYAA 4Q16A 1M73E 1GTMA 3R8XA 2WTAA 1ODKA 4KQFA 1MQ9A 2QKYA 1E1RG 2B8TA 4NMHA 4FFPA 4EB8A 1JSCA 4Z2AA 2YXDA 1WXQA 4KACA 4MKXA 1Q3HA 1FSPA 1XMXA 2ZIOA 5B1DA 4CTOA 3CE6A 3UG7A 2VF4X 1RKQA 3WGKA 4Q39A 4AXXA 1NL3A 5KJCA 2Y1WA 1K1EA 4S35A 1MT3A 1OGYA 1ZN7A 4CYMA 3WAJA 3A1FA 1GA4A 1UBEA 1V48A 1MDBA 1DF4A 3IILA 3L04A 4I3GA 5D6NA 1VA5A 3S68A 1S0VA 3QO7A 1EAMA 2XAGA 1PJ8A 3PD0A 1S7GA 3QYPA 2C2GA 4ZOAA 1PV2A 3LUBA 1O6GA 3BD8A 4ZKDA 2PSSA 2FDRA 3NWBA 4W8OA 1UQTA 4D82A 2NP7A 4GLOA 2MWMA 2XDQA 3T34A 3N0XA 4OVKA 1M2JA 4DR2O 3BWVA 1P4GA 4B7KA 3I2FA 3H1FA 2QT1A 1VMGA 1JDNA 4TS9A 2E3JA 2ZCJA 4HYOA 5LJIA 4B4OA 4CPDA 4R40A 5DM2A 4CCAA 2EATA 2XAUA 4K8OA 4LRQA 4P1ZA 3JWJA 4S0XA 5HF9A 4UEQA 5BNFA 3RVKA 3WFIA 4RUFA 4GSLA 2XD4A 1XWWA 2BN4A 3BA8A 3NANA 4IR7A 4LCJA 4Q9IA 4P3YA 1KHHA 3K9GA 2VIIA 3P45A 1H4VB 4C6RA 3LDCA 3Q41A 1DXOA 3S3TA 3ES9A 5A4MS 1Y7LA 5AXAA 1P0PA 3GUVA 3OOYA 3TCNA 1J00A 2V3VA 4R1LA 5ALWA 4E2ZA 1QAOA 1R8YA 2MSKA 2N46A 2KPOA 2FE1A 4PYRA 4WN9A 1WLSA 2HLHA 2V9CA 2WOJA 3VR0A 3X44A 3KO8A 2VF8A 4V1CI 1UL1X 4YLYA 3I6QA 5AJUA 1HKHA 3MT8A 1KK1A 4KXWA 1ZIYA 1V8ZA 1HFJA 2G82A 2CYBA 3BDIA 4M0LA 3TLZA 4FB5A 3OZAA 4JUAA 2VAXA 4L2IB 1VLQA 1IBSA 1JLHA 4UC0A 1NHGA 5B7PA 4PLTA 5JADA 3U0ZA 1E1KA 3DLBA 2XHBA 1Z0KA 2HJDA 1XZBA 1NVPB 1ZJ5A 2YMLA 3FF1A 1KZYC 3L0ZA 5A5FA 1CLUA 3OZSA 4MINA 1V8BA 4EGSA 3E5MA 3OP4A 2YHSA 2LRHA 2B3TA 1JQKA 1X1QA 2CL0X 4Y6OA 3ABLB 2XWQA 3C8UA 3O3OB 1GU7A 4KLZA 3ZD9A 4PYQA 3HFRA 2YXPX 1X1DA 2QRKA 3K16A 4EWLA 1DB3A 5HRAA 5FPPA 3IC7A 4J11A 2PD6A 2VP6A 3VGPA 2A9JA 1C30A 3WOVA 1BU5A 3E9EA 721PA 4W4KA 1F2UB 3LX4A 3OH8A 3PNOA 4Q7JB 1M9NA 1C3JA 5HTKA 1LW7A 3KPYA 1O54A 2JS3A 1XQ1A 1PF7E 1Z6AA 2ZQZA 4IG4A 3UC9A 1BHQ1 2I1WA 1U5BB 4X1YA 1RI1A 2RGAA 2H7YA 3X1DA 1FP4A 1RVV1 1CDOA 1NKTA 2HF2A 2RHGB 1N33O 1BRTA 5F7OA 1DAOA 4C05A 3SPXA 1GUDA 1DBWA 1UJNA 4WXRA 1VKOA 2ADOA 1D5CA 4NCXA 2QRLA 3CBGA 3LYHA 2XCRB 3W5BA 1WVIA 4HN4B 1G59A 1S0UA 4GT1A 2BGKA 4CHTA 4MVZA 3GC6A 5HCNA 1XWIA 3ND7A 5AVWA 2QX9A 4GR5A 2QT0A 1Q17A 4IHJB 3RC1A 4UB8Z 1FC0A 2J45A 3AZPA 2C5AA 3BVPA 3RKUA 4CKYA 1MX5A 3D7KA 5EE9A 2ZXWC 5AQEA 5AVKA 3TJTA 1K7XB 1UQRA 5IWCA 2IPMA 3EXHA 5LHGA 4D97A 3VZBA 1GADO 3AKZA 1D1TA 1WF3A 2Y4OA 2YZKA 1GG8A 1Z7EA 1H93A 4ZVQA 3R5HA 4KZPA 3OHSX 3RAGA 2ZJ7A 3RRYA 1GV0A 3PC2A 3Q5GA 4K86A 1TTQB 1ULTA 2NUAB 4MH0R 2GAFA 4N18A 2R7KA 2F66C 3SSAA 4CKEA 3VTAA 4YT2A 4JXZA 4RAIA 1M1ZA 4Y9DA 3UJ9A 5U4XA 2B4RO 2D00A 1LI7A 1EGHA 2IJIA 1FNMA 3LHDA 2C2WA 2PYJA 1S8FA 1GD1O 1NT2B 1SM4A 1RQRA 2YRXA 5BR4A 3Q0TA 3UMMA 5CM9C 5JCPA 1XVVA 2XMBA 2Y6VA 1YB1A 4Z49A 3RW0A 2YI8A 4TVSA 2ZITA 3Q7IA 3BTSA 4MHSA 1SIUA 1DLBA 4RHYA 3DFKA 1E3IA 4G5OA 3GRVA 5DIFA 1E0KA 4D3YA 1ISSA 4X6YA 1UP4A 2J67A 2SICE 2WW8A 3PDJA 2BE3A 3M6AA 5GV8A 4MWTA 4AS3A 5LSAA 3AJ8A 3H5WA 5HKAA 2PX4A 2G4CA 3ZDBA 1XFAA 1WBBA 2IE0A 4LDJA 4F04A 4AROA 4MYHA 3KJFA 3U1VA 3LQFA 1M5UA 1T8SA 4I9UA 5HDQA 4XD7D 4EPXA 4B5LA 5JFOA 3E18A 2CUKA 2E87A 2W71A 1K89A 1OV6A 1VQKV 1ULUA 4ARCA 2TS1A 2FHPA 4CDMA 2F9LA 5BNWA 4P32A 3L75H 4JAVA 2ABWA 3ZH2A 3KNZA 4B3XA 1OYVA 2ODAA 4UJ3A 3RSCA 5FDFA 2D7DA 4PHHA 4R6ZA 3L07A 2JVKA 2YYYA 1H2SB 4DXWA 1GUFA 2HV9A 4JI8O 4KI0A 1RBYA 1GY8A 2I5PO 3KCXA 3H11A 3TXYA 4CN8A 2HIMA 3R7WA 2XUJA 5HS4A 5L40A 1VL2A 2UYQA 2YNMC 2JZOA 2H1SA 3P30A 3LDDA 1GPUA 1TVEA 4DV0B 2P5YA 3WC4A 2RSLA 4KTVE 3BFVA 1UK6A 5F2OA 1YFKA 2LCFA 1VLJA 3DE3X 3HCOA 4JYAB 1GRNA 3KT0A 1U1DA 1YVUA 4D81A 3B1KA 2H4JA 2F1KA 3R7AA 5HIJA 3A2FA 4IILA 1KFEB 4Y6PA 1QC5A 2QTHA 3N6VA 4YJDA 1QRSA 1R0WA 4BWGA 1MGOA 3IVCA 1G3UA 1P6UA 5KHGA 1NZDA 2PU7A 1BOFA 1PRYA 5TQ2B 4OI1A 3QRWA 1NR7A 2IYYA 1V7PC 5TGDA 2CNNA 3EA5A 3K2EA 4KFSA 4Q1CA 2XYQA 4EARA 3V97A 2FUG6 1TYCA 3DTUB 1O0SA 4MCAA 3U5TA 1GAWA 1VE6A 4KAAA 3T5BA 3OTHA 1N5DA 2JHAA 2P9TA 3BREA 3M6LA 3T3GA 4BVAA 4C3ZA 1OC2A 3B1WA 4HZGA 4ESOA 4MVJG 1IQRA 3GJTA 3IP5A 2WBLC 1Y9ZA 3OAAG 1Q82W 1MF7A 2AJDA 3GF4A 4KAXA 4D0RA 4XOUA 1ATZA 3B3GA 2A9HA 1W88B 1WLEA 2X4DA 4M89A 2P9JA 4C04A 1VYVA 3DVAB 1I4TD 3AJRA 2B4TO 3GLTA 3KLMX 4TUYF 1UPAA 1YA4A 4WVFA 3HYTA 4MVYA 3SC6A 5C5IA 1H4SA 4CTNA 4J2HA 4QU5A 3Q7PA 1UPUA 4KL1A 3MA0A 3U6BA 1QFZA 3HR0A 3VO9A 5FKJA 5K05A 4N76A 1IZ8A 2B30A 3A1TA 3W2GA 4CV0A 4LF4B 3EVKA 4DR6O 4WBXC 1H0HA 3N2ZB 3T0FA 3CUVA 3FPFA 5L3QA 1H2ZA 3PQDA 1Q86W 4FYWA 5K1PA 3R5SA 1CNEA 3DBVO 3I0NA 3U3MA 1R3JC 3DULA 2R6AA 3M1IA 4MVQA 1LDMA 4RVDA 1Z88A 1SC4A 1ROPA 1E0JA 4X6UA 2IYEA 1QU7A 1QF6A 1I32A 2KKWA 1XZCA 3I2GA 3V34A 1ZGHA 1CIVA 1RYMA 3PXDA 3DF9A 3R6DA 1XMIA 2QUBA 1Y76B 2WLIA 3RYCB 1MMMA 1QGUB 1QO7A 3B1VA 5HNKA 1CS0B 2QVBA 2ZTSA 3BKWA 3EW9A 1D5NA 2VRCA 1GITA 2NSJA 5K0EA 1KB9F 1P9RA 2PYZA 4LK3A 2VRZA 1Z4IA 1AV7A 1JLMA 2H5JA 3PJGA 4ND6A 3WIVA 4OYLA 4ALIA 3NFYA 1EH5A 2J87A 5CLQA 2MCFA 1YZKA 1TC1A 4KH0A 5BN3B 4G0VA 1N0NA 1GU0A 1SQPH 3S3WA 1KDTA 1LQ2A 1U1EA 3CNLA 4G81A 5D85A 3RVNA 3VR6D 2X23A 3AJ9A 2E37A 1UX0A 2WYIA 1R9NA 5LXTB 4FHZA 2XGJA 5AI0A 3LFUA 1NW8A 4LHZA 5THKA 5DOZA 4U9HS 3FCUB 4DR7O 4GC5A 4BQSA 2BH2A 4LCPA 4H7KA 1S3SA 2VT2A 1RI2A 4B3BA 3LKBA 1BMTA 1RRVA 2Y66A 1G63A 3DMYA 5JMPA 3W7AA 2V7BA 4FLUA 3MWGA 2QXYA 3VSAA 1QIFA 3MYRA 2OY0A 3BJZA 3PUXA 3RC8A 4GLXA 2DKNA 4RULA 3SXUA 1LDEA 4KFUA 4QJIA 1RVDA 4ND3A 4QXPA 5KQSA 1QBKC 1TZMA 2IIPA 1KMCA 4L08A 2J4FA 5EZYB 4G23A 4QXRA 2VZ0A 5AW5A 1FVXA 2XOEA 3B3QA 5AVOA 5CDTA 4DADA 3OE7G 3DXRA 5CG2A 5DYTA 4TT3D 5KNDA 1BNCA 3AVVA 4PLVA 1BDJA 4L4YA 3KWMA 1R1DA 3O21A 1Q1QA 1HDEA 3NQ41 3ZE8A 3OHPA 3V7YA 2WWGA 2YJ3A 4EMBA 5CA0B 1KYOF 2P2LA 2AV6A 4RA9A 1L5KA 2HX1A 2QSJA 3V8EA 3P3PA 1UODA 3RVMA 4BC0A 1R0XA 3EF1A 5EC1C 1WZNA 3CH4B 3WJAA 3HDTA 1L4BA 2FR8A 3T94A 4G85A 4YCDA 2GUZA 5DW0A 1U8XX 4ZYZA 1EUDB 4PX5A 1DQZA 3GLIE 3DSQA 4Q9DA 4V3BA 3FKSD 1DMSA 1VGRA 3ORHA 4UM7A 1OPXA 3RHTA 1T25A 5FBHA 5MGNA 4X71A 4GOLD 1JXAA 5LCXA 1S77D 3UAXA 3WWZA 3BICA 4W8HA 1QVVA 4J0CA 1MAAA 2HP8A 1GPJA 2ZSUA 2X2PA 1RJFA 4PS0A 4CIBA 3ZH9B 1WETA 1T2NA 3ZN0A 3EFEA 4L75A 4MVJM 3UHOA 1QRUA 1WAMA 3ENKA 5JVDA 3M9LA 4WOPA 3BQMB 5HIAA 1IOZA 4EI9A 2YHIA 5SYAA 4IGKA 5BVHA 1N77A 2I6GA 4KR3A 1X42A 5GZ3A 3ISJA 3BQNB 4HGNA 3KOOA 3MUFA 4HRXA 4TQAA 3DA8A 3ZV4A 1SPXA 5H16A 3SFZA 1EHCA 2X8JA 2QYHA 4LY3A 2FQ1A 3IQDB 4AKTA 2XRFA 4TWRA 3GLFE 2HIHA 3U1BA 4DG8A 5TE9A 4EPRA 3R44A 3SZRA 4M38A 1FUUA 1UDRA 2JJ1A 1L7MA 3HDVA 1YTFD 4UCSA 4KLNA 3C1TA 1OXXK 3H19A 3IUEA 3H3JA 3FX7A 2P4HX 3EUEA 1SR8A 3DE1X 3D54D 2RDMA 1O4VA 3HN6A 5CVUA 4CDRA 1S76D 3M5CA 3OT1B 4C3VA 1DWOA 3HDGA 2WJYA 2GDZA 3GOHA 3OZBA 1ZITA 3INRA 3A6HA 4A3SA 4F5WA 5K8TA 2VRNA 1MOZA 4RTOA 5I51A 1WWRA 2LP4Y 1SXGA 1OFTA 2VJYA 1E79D 2A9OA 1EAYA 2ZI9A 4EQ6B 1PZHA 4GEGA 1QFYA 4EYGA 5ALNA 2VTVA 4L9WA 4Y6LA 1NNEA 2HDNB 2XJ9A 5DGDA 5B1BB 4Z9BA 1F14A 3OE7D 4NBTA 2FMFA 4JQSA 4KWTA 5C8YA 4KK4A 4EUEA 3ORQA 2AZXA 1VEWA 2OXRA 2ZB4A 4HAIA 4R9NA 3QIAA 3MPZA 1U7HA 2CVQA 3LUFA 1QPGA 4YH1A 3QX3A 3ZKAA 3QU4A 4HK4A 3CLVA 4L5IA 3C98A 1NF8A 3PXEA 4O4HA 1HL7A 2BFMA 2QPOA 1QDLB 2ZRBA 1EFVA 1BD4A 2VPQA 1QR9A 5DM0A 3MXOA 3IP7A 5BWNA 5ETJA 1TIPA 5JJ5A 1L8LA 2FQXA 1LLDA 3IOMA 5H81A 5B57C 1LPBB 1U8EA 4DJ5X 5KKNB 2B69A 2QP4A 2QZSA 4M49A 5D3ZA 4FOTA 5AXDA 3SC4A 1ORHA 1VKJA 1Z0IA 4H18A 4UOZA 4QGFA 1NTRA 2A8NA 5B3LA 2P4QA 2ZWVA 1PEKE 3R0IA 4YJHA 2IHBA 1W581 1V7CA 4IIEA 4IZHA 2ASEA 3RVZA 2J3HA 5ALFA 1PGOA 1DZ3A 1CRQA 2EFEB 1M2GA 2GUZB 3LSUA 1Y5MA 4G26A 4UVBA 1DO0A 4M7OA 2NLOA 1N9GA 1R4ZA 2VL7A 3O2SB 4LZZA 2GVNA 5CRIA 1YHQV 3QTCA 2BEKA 1ZRNA 2HWKA 3PFNA 1UMDA 3NZEA 2Q0XA 5L3VA 1TZKA 2W2KB 4R8LA 1ADBA 1VF7A 4ESEA 3TLYA 4KWHA 3QBVA 3ZRWB 3DZJA 3DUWA 4HNQA 5DIZA 4QGHA 2BC9A 2LWIA 3VVBA 4YUXA 2UZ1B 2J5BA 4X6LA 1JZTA 4BQEA 1QG4A 4Q47A 3LVBA 1TW3A 2NVOA 1PVVA 1L4HA 2P9EA 3LLSA 4GI3A 4ZREA 5EVCA 4UW9A 3VDRA 2GCGA 1N8NA 2BFDA 3W34A 3WXMA 4QGAA 3E7WA 3SDLA 5K51A 5LMNO 2QAGA 3CPWU 4I5GA 5DEOA 2XQVA 3UPUA 2IBMA 1T1IA 1TLTA 1A9XA 1WKVA 3UYKA 3HCAA 5EWMA 4NE7A 2EJ7A 5DH9A 2V98A 4RLFA 3ZS8C 3KYIB 1ECJA 3AW8A 4IDQA 4PPGA 4AUEA 5C5DA 1Z2AA 4P3PA 1JFSA 3HBFA 3TLGB 4UAUA 4AURA 3TUZC 1RHKA 3EGDB 3T7EA 1O1YA 2Z0AA 1C1DB 1E1RA 4NYJR 3INYA 4RHCA 4Y30A 5AHXA 3U31A 3W6ZA 3H0CA 3MJSA 3OP1A 4IJKA 1XCPA 4TLEA 4QHSA 3UIEA 1Y5IA 4E51A 3Q3IA 1AM4D 5DK6A 5BSRA 1G64A 5AKZA 3KQQA 4C88A 2PRJA 1N1EA 2ZSEA 5H4GA 2FP4B 3GG9A 5J23A 2ZTUA 1H42A 1U2RA 1GCIA 4MR9A 5BWMA 1B3BA 1NBOA 3COVA 1BXZA 3OSZA 4ZDWA 4OSOA 5KQGA 3CVJA 3GUYA 1GKKA 1M6VA 3WQRA 4LOAA 5IY5C 3EVBA 4Q7QA 4AS1A 1N2JA 1UWCA 1VECA 1XAIA 3BOSA 3FB8C 2AJBA 2X7HA 3F5FA 4QPJA 4KBGA 4TZTA 5AKXA 4BTEA 2L19A 4M53A 4I55A 1XDWA 2XV1A 4Q20A 3H2YA 2AHYA 1L9XA 1UJ4A 4L9SA 1VQ4V 1Y1KE 7ABPA 4ZTZB 1D2AA 2E9SA 5DSZA 1P4SA 1AH2A 4U00A 1EP1B 4TXNA 2PMBA 2ZG6A 1WB5A 2ZWAA 4NMWA 1RYFA 2FKAA 3CH7A 3HCRA 3K35A 1V8DA 1TUEA 3D43A 4I1IA 4CL8A 2QSUA 1MIOB 2R86A 1CE8A 1DKUA 2Q1WA 3OJCA 3N8NA 3SJBC 5EIFA 5EJGA 3MRVA 3DZDA 5LUBA 4X3CA 2AUTA 1QRDA 1AS3A 2NP6A 4TWJA 1YJ5A 4LQLA 4FM0A 2MIIA 2AFHE 2XTAA 3F9CA 1WDMA 1QHHA 1ZHFA 4EF5A 1W36B 3AR2A 5I7UA 3RRXA 2MOKA 5DM60 5I9BA 4WK4B 1W8DA 1PGQA 2C95A 1DKOA 2VJNA 3WIOA 3COZA 3EZYA 3NEAA 1IJBA 5FPKA 3UKMA 3UUFA 1V1MB 4Y2XA 2J3DA 1PD1A 4IGIA 1RP3B 2AN9A 3A6PC 5IUKC 3MWKA 1P29A 3S29A 4D7SA 3PC3A 2HHLA 4CLRB 6GPBA 3CVYA 2CZCA 2P75A 5CIYA 3P19A 3GPLA 1K33A 1DGQA 4DV4O 2B83A 2ISCA 3CNOA 3O8QA 3H4IA 4FHFA 4ENWA 1T3LA 2QSAA 1QC5B 5A05A 5DTMA 5J4LA 3I45A 1CY8A 5TPWA 2P35A 4OXIA 4WNAA 1V1JA 3KDSE 3H1GA 4MKZA 2PL3A 2DHQA 2QJWA 1SA0A 2V45A 2YDYA 4OCNB 3PGMA 4YMTA 4BOYA 3CHYA 2J4CA 3L7IA 4R1MA 3OEEG 4X8MA 3GVPA 5L7TA 1O8CA 4DDVA 4WBNB 2CLSA 1UJWB 4F6CA 4LXYA 4EA8A 2B6NA 2H0QA 2H59A 1KNQA 3CLRC 1BX3A 5CBFA 1WB6A 3E3LA 3JR7A 1JSXA 1E6KA 2B3ZA 1LA2A 3DHWC 3PC4A 4HWPA 1MAHA 4JT9A 4INOA 4AICA 1S89A 2AEEA 2GMWA 3DAYA 2R6GA 5COQA 4PIMA 3KCYA 5CMUA 1KOJA 3HU1A 4JBXA 4ECAA 2Q5ZA 4AI8A 4FFWA 2FTKA 1T8PA 1QZZA 2JD2A 2D13A 4LXIA 1AILA 1CD5A 3AI1A 4MO2A 3CZ5A 5E6SB 4E09A 3I4LA 2O05A 4RAOA 3G0GA 4L8GA 1PW7A 1D1QA 5FADA 4W5QA 4JZ2A 1GT6A 3ZVRA 2X6CA 3CX3A 3FWPA 3O3MB 1KEPA 1S9DA 1WHTB 5ENVA 3CCQV 4EYSA 4PNZA 4L73A 1FNNA 1E0DA 4UTOA 1EGAA 4P0PB 2F43A 3EARA 3FLAA 1OU0A 4X60A 5D00A 5BR7A 2AJTA 1O94D 1NUUA 3G5UA 4X45A 5EERA 1OCCC 4KIFA 4TTPA 1PK8A 4PO9A 3JAWB 1LBTA 1NW6A 2VHXA 3KELA 4HEA6 4IV8A 3RJ9A 3WGLA 3K5LA 4CV3A 4HH4A 4DUGA 3CPJB 1PSZA 5KSZA 1YD7A 1KO1A 1XJQA 3JSLA 2W6ID 1UM9B 3RK0A 4NJOA 4ER0A 2OCAA 1JU9A 1X94A 3MRXA 1DJOA 4ETNA 5EHQA 3PC6A 5HOQA 3MMNA 3VZRA 4UD6A 2ECFA 2PX5A 3K72B 4I6EA 5M52C 4V0NA 1HBJA 1JGTA 5A2QA 4JLJA 4KYVA 2FQYA 3IQZA 3REFA 5ALXA 1E2FA 2NV6A 3PT9A 5AOBA 2FR6A 1G8GA 1PWEA 1FRFS 3E7FA 3TIFA 5JEDA 1P39A 3TFOA 3THXA 2F3RA 3WP1B 1PE0A 3OBIA 3RRMA 2ZUFA 4EO4A 3K79A 4HFMA 4HZIA 1W36C 2H54A 3AUAA 5TISZ 2FAXA 2JA2A 3ESZA 4MTXA 3FOCA 4TQFA 2NM0A 3QOXA 3G88A 2NQ8A 3N75A 4OMUA 4CKZA 1ODIA 4NL4H 3A2KA 1HE8B 1CR6A 3OPYI 1V5GA 4DNFA 1NRXA 1YI8A 2P4KA 3C7TA 3NCTA 1W30A 1Y3CE 2WABA 2FZ4A 4M8SA 5IX8A 5B3SC 5G0SA 4B74A 5HIKA 3WRXC 4YUAA 2JEOA 1JPNA 2EX4A 4NYMR 2VJCA 3TTWA 3TEJA 5HKOA 1E99A 3GW8A 1ZL0A 4FBMA 1VDZA 4QSHA 2P6PA 3GH3A 4EMUA 3UB2A 2P06A 3J80N 4I50B 2IEBA 2OENG 3KYCB 3GLHE 4QTTB 4X1YB 4D80A 2WU0A 1FA9A 2P6MA 2DGDA 4F97A 3BH7A 4YDQA 3SR0A 3OM0A 2BAGA 4AN0A 5IDWA 5ADUS 2BFFA 3C6BA 1Q1GA 5K8IA 2R0QC 3OD4A 1ZMRA 5TVGA 2W48A 2WI8A 5IG2A 1IB6A 4B73A 3AP3A 1XCGB 1JX9A 2YZ7A 1FQOA 3OZXA 3RUPA 4D5EA 4TVBA 4BNHA 1LLCA 2PX2A 2Q3CA 3ET5A 4V2UA 5PNTA 3RUDA 3UBMA 1OX7A 2P9YA 3LUKA 2KBEA 2FRXA 4RHTA 3JQCA 4UUMA 3X2FA 3IH5A 1NAIA 5JS7A 1VP3A 2ZVQX 4HDMA 5DP1A 4CS4A 1AS2A 1HLDA 3SG0A 1NN3A 3TL3A 4C03A 2I76A 1OFUA 1YOBA 4K6HA 5F5XA 3ZNQA 1ENYA 3FIUA 3R76A 1OLSA 1DBRA 1FNDA 1HEIA 2ATIA 1CT9A 2HU8A 2YOGA 3A3NA 1FYFA 3GIWA 3IALA 3NIBA 4L3VA 4YLGA 3W8EA 3FZEA 5JSUA 3WRXA 4NCJA 5P8WA 3SF0A 2J3LA 4Q4HB 4GL2A 1D6NA 3ZU2A 4RTLA 2ADMA 1KKLA 3PC8A 1Y5LA 1FIUA 2RB5A 1W4RA 4ZHQA 4L8FA 2A2ZA 1FYXA 1WPBA 1WV0A 3GJ5A 5E6UB 3VU1A 4DLRA 4PC7A 4LWQA 3OCVA 1U7UA 5HUQA 2J0QA 1NRJB 1M74A 2PL9A 4GRDA 3KL4A 2FN7A 2Q4DA 4A0SA 2G3YA 4HH0A 5AIAA 4RKFA 2BY4A 4A36A 2J5QA 4D6PA 3VAZA 1GN4A 4KSYA 4PZCA 4R2LA 4ZOLA 1GA6A 4RXTA 1EINA 4GYWA 4G0MA 1SOWA 1U4OA 2IQ5A 3L9DA 2YNMD 2B9EA 5HYVA 1Z8NA 2BMVA 3U1TA 5AP9A 4FDAA 1YQ9A 2XPCA 4IFTA 2B5OA 4JLNA 3SJCA 2A0LA 4D44A 2IWHA 4BX8A 5BSKA 1BE8A 4H7HA 4ZZIA 3FRIA 3GFFA 4ZMSA 5IYDO 4LSWA 4C14A 3DM5A 4LNHA 4EM6A 3MTQA 5AW8A 3KK0A 3I23A 5EFZA 5BPHA 2HMVA 1EJ0A 3HSKA 5KSOA 4YQYA 2DH5A 1WS6A 4JASA 1CF2O 5A9SA 3G49A 1S01A 3IHTA 4QSMA 1CDZA 3VQXA 1DTSA 2VR1A 3JVEA 4XH9B 2ZXWB 1X7XA 1R27A 4RETA 5ADHA 4R1UA 3CURA 2OV1A 4GMDA 3DNPA 3BFRA 4RJ2A 4OL0A 4K8ZA 3V00A 2JBHA 4W9NC 2P5OA 1VPTA 1WA5A 2QKAA 1EKXA 2HF9A 5GIPE 1CZRA 2GGSA 4GKAA 3UKOA 2G67A 1P6OA 3VO2A 2ZB2A 3OEWA 4RMGA 1PIWA 5DM6V 1W1IA 2CZQA 2FEPA 2PI5A 1M72A 2ZRGA 1FPQA 2X0IA 4RAQA 2XHZA 5FHRA 1FPOA 2FMIA 2O48X 2CFRA 1XROA 2P69A 2PR2A 3UMRA 1QP0A 1TA4A 1QVWA 1Q7CA 4Z2YA 3WLAA 4ES6A 2WQ6A 3W4KA 1ZJJA 2ZCUA 3HRKA 4ZI7B 3N0RA 1VOTA 3PQ7A 2CXOA 1D2CA 3U61B 2Z09A 1ZUD1 3A6DA 2VP0A 4IRMA 2SHKA 3VPCA 4JI6O 3ZV7A 1CPYA 2W90A 4Y2VA 5G0UA 4FS3A 2BDTA 4FQ8A 3DYVA 3ZHRA 1XRNA 4WZAB 2VQSA 3VVMA 3F2IA 2X0LA 2WINI 4REMA 4NENA 1M66A 1RXCA 2X14A 3TZCA 2WJ6A 3LI2A 4BLRA 3FNHA 4LHEA 5C53B 2GD1O 2FGJA 2VHEA 3GDHA 3OJOA 4WLFA 4AB1A 3KB6A 3OZFA 1S4QA 4FCCA 2OMKA 1SVKA 4MSWC 3P96A 1Q92A 1IHXA 1ZIDA 1QOZA 3ECCA 2X58A 1KEWA 2NXCA 4MCHA 1WBDA 4QFTA 3WYDA 2WIKA 4YRKA 2XT6A 2G6TA 3ESRA 3NHPA 1TA8A 1F5SA 4B3TO 1J1ZA 2WT4A 3CR8A 2C2YA 1QTIA 3O8OA 3SNHA 2GSWA 3WYBA 4ARZB 3ZDXB 3QVOA 1ZH8A 2DQ0A 1G8KA 3T4XA 4ER3A 1EVIA 4ND8A 3CLRD 3DB1A 1EUCA 4UFPA 3SHTA 2YCBA 4JJAA 3IS3A 1VCMA 4OX9B 4P4LA 1GZ7A 4LCOA 2VDOB 3DEYX 4GOMD 4D2IA 3C7DB 2DWDC 3GRRA 3ILVA 1E3JA 3OW2U 2ZNRA 2N75A 4M9RA 1G0OA 4NE2A 4DSAA 1G66A 1F6DA 1HYEA 3G2JA 5BOSB 4U3JA 5LDDC 1RYZA 4LRYA 4Q4HA 5JNVA 1JS1X 1YZYA 2AFIA 1BS1A 3I2IA 4LK2A 4ZQEA 1F12A 2Q0AA 3WYCA 1PT7A 5IJWA 1BT8A 2P6UA 1JR3E 2DSNA 4HX5A 2FW1A 2WFLB 1E4EA 1AUOA 4DR2B 3NU1A 5B55A 3J7TA 4H13B 3L8MA 2HNKA 1TZCA 3AP2A 3GFVA 2RHTA 1FSSA 3LK7A 2AZ0A 3JQBC 3UJNA 2QG6A 4MQEB 1DUSA 3AVOA 1HV8A 1PWHA 3WRYC 4FU0A 4X6XA 2FX2A 4F11A 4F12A 3SVLA 5KO2A 1ETUA 3A6JA 1MABG 1DQSA 3BJMA 2ZJ3A 4FGSA 4QQFA 1CTTA 1KZHA 3N05A 3AM1A 5GP1A 2IPOA 1WB4A 3GFQA 3GH1A 4GVXA 4Q3NA 3SMQA 3W6PA 4AMBA 1B2LA 4D8WA 7GPBA 2GESA 3AKDA 1RYHA 3RVJA 1DPFA 2PL5A 3OZCA 1KK0A 2ES4A 2V6IA 4ZZ2A 4WT7A 4JS0A 3KOXA 2GKGA 2RJ3A 3KOYA 4ZAWA 1GJRA 2HJGA 4E6PA 2KQUA 5JHGB 4Q4AA 1A8UA 3OZDA 2OC4A 2VUHB 5KHOC 2BYTA 2JJ1G 2ALJA 3ZGLA 2H3HA 3KXIA 5K7SA 1U28A 2VZEA 1QVZA 4OMCA 5EG5A 1TGVA 3MS2A 1Y3HA 2Q5OA 3LHIA 3R3VA 2LCIA 2M1ZA 1QK5A 1UOQA 2HMAA 2O4UX 3MOSA 3P1JA 1UPCA 3SZMA 3K03A 1NVUQ 2CGNA 1TJPB 2VJPA 2ZRAA 1YBFA 1GRCA 3OR6C 4G25A 1RYDA 4RJIA 1KFKB 1AHIA 1VMEA 4HMPA 1NY5A 3LK6A 4JGSA 1WNSA 4ZFNA 4YRMA 5A2QN 4RPGA 5KVCA 1SXQA 1DBQA 3W0LB 2A1TS 3BK7A 2Q5IA 4PA3A 4WIGA 4BXOB 1N6LA 1SZCA 4IG9A 3K8QA 4NBVA 5L3SA 3BH6A 1R9JA 1SQGA 1WUYA 4KHZA 2FPIA 4JP3A 3M83A 4LF4O 5EL0A 2YS7A 3ROPA 4ZHSA 1EWKA 3OZUA 4OCLA 3JQFA 3EMKA 3F90A 4HXGA 4RF3A 2I6FA 2SKCA 3DEZA 4ZVOA 1Y1TA 2UUBO 3LQ4A 1AMOA 1NVPD 3GPCA 4WESB 4H9GA 2HSZA 4DXDA 4XVQA 1JAZA 2IEZA 4PA6A 1HE3A 1DARA 4B76A 3W7SA 5EJ2A 1K0UA 1P72A 5IM5A 1AXEA 1L7AA 2IBZH 1P2SA 5FF9A 1PU2A 4J2TA 4DWWA 1R9MA 3TOVA 1LNSA 3K1AB 1GLGA 3N1UA 1JA1A 3IAEA 1IUKA 4X1KB 1X74A 3OM3B 3IEKA 4Q9LA 1SK9A 4B4DA 2BPOA 3H86A 4IIDA 4P4UA 4A2CA 1U8CB 1XCBA 4BQIA 4H7DA 5KYKA 4R2HA 1JDSA 1QH1B 2CHFA 3BMQB 1W0KA 5BNIA 3HCCA 5ILOA 2WLLA 3K5OA 4YECA 1JHYA 5DXAA 3OKPA 4YV7A 2JGDB 1JEDA 1QO0D 1JMKC 4GUNA 2Q3HA 2YFQA 1E3MA 4EHIA 4MW1A 3G9QA 3DP7A 1IXRC 4DMKA 4DYDA 5EQTA 1V55C 1JYSA 1DBIA 2JFXA 1Z26A 2Z4SA 3T1HO 1ND6A 3HBLA 3IAFA 1JHPA 1E6WA 3R3ZA 2IZZA 4J9VA 4YO7A 5DCAJ 2R5FA 1XEAA 2FLVA 3W5SA 1XNQB 5DHQA 4AC9A 4Z4QA 4FD2A 2PRKA 3IMKA 3REQA 1JYFA 4MNTA 4JV5O 4KPUB 5T3UA 4EK9A 4V1CA 3IKLA 4MW7A 2HC9A 2AF4C 2QQFA 2R7NA 2XUGA 1GZSA 2VXYA 3FPHA 3O91A 2DU8A 3W9SA 4X9QA 1LX7A 4FJ0A 2C00A 3AP1A 5CHEA 3WLPA 4DCUA 1TTTA 3I73A 1XG5A 5E1BA 1DVRA 3ORYA 4WCFC 1H2MA 4DHEA 3RIYA 3Q3JB 4QIHA 4BL5A 4HRQA 3DM9B 4JD5A 2DT5A 4RFLA 2XNKA 3BRWA 3DMTA 3ETJA 3IQFA 3IRUA 4Y7DA 1Y5RA 5FUVA 3DTVA 4I2VA 4BMPB 1PWYE 2IKQA 2O2CA 3JRWA 5LZ7A 2ZE7A 3RG8A 4JSTA 3JQQA 3HKEA 4RGYA 3ZDQA 1RZRA 5J9FA 5IKXA 1F20A 1AT1A 4V0MA 4BFCA 1R6KA 2VTKA 5FTNA 1H8HA 1XEWY 3UT0A 1WZEA 2RH8A 3CJHA 3T9EA 3VMFA 4LF8B 3E8FA 3BGVA 1CNFA 4B7AA 3DPIA 5E4FA 3VOAA 4DTCA 4GYCB 2NNUA 2JAUA 2WM2A 3TH5A 1XU7A 1L7OA 3PGXA 5DLYA 3ZHUA 4WKCA 2QLNA 4A0HA 1VHTA 4FI3F 4OB6A 2F3PA 3RJTA 3EZNA 1UKYA 2C2KA 4DQUA 1ZL8B 2KWIA 3DMGA 1YUMA 2JZNA 3DS8A 4GHWA 2QRVA 4MR8B 3UWDA 4DC9A 1VZ2A 2IEAA 3IAM1 3W3AA 1KMNA 1JR2A 2QUJA 3ED1A 2M32A 3KB1A 4FM1A 1ORDA 2R8PA 3HJBA 4UM5A 5CH3A 2K2WA 3B4SA 1TB4A 4YC7A 4WXHA 4M36A 2VUIB 1DFGA 2QX6A 2VN8A 5EHIA 3OOJA 3U6KA 1K3UB 4NCAA 1N36B 4B3FX 3BEOA 3BTOA 2PN1A 4B33A 3RYIA 1BTOA 1VIDA 2OO5C 3KZNA 1HT2E 2BGGA 4WKPA 3LDUA 4K9NA 3ZCUA 1SXJB 3X1KA 3QE4A 1U94A 1DX6A 2JFHA 2OM6A 1JIJA 4FXOA 4KVFA 3RIHA 4X66B 3K1TA 3KYJB 4CTJA 4CU2A 3FMFA 1RM0A 4O3FA 2YY7A 1SXHA 5EHNA 2PY6A 1XLTA 1L2TA 1EDOA 3OIVA 4DR4O 4RQBA 3ZW7A 4B2PA 4B75A 3A06A 2B37A 2ZM6B 1OCOC 1OLUB 1Y4AE 2PGDA 3P0FA 4LJSA 1G38A 1X2EA 3W5VA 3D6VA 1KO5A 3PNLA 5ES3A 1V9SA 2EIJC 2P4SA 4LZAA 4A6DA 4B4VA 3PLAE 2YZ2A 1GO2A 2UU9B 2WHRA 3GCWA 1WJZA 1U1FA 3VR3A 1CF4A 3U3RA 1Q19A 2AXPA 1T8UA 3GMIA 3K6JA 4L76A 2V1UA 4A92A 2XBLA 4H17A 3PC7A 1WA8A 4X90A 2AFRA 4RK7A 1TECE 5IKMA 2H1VA 5AYVA 1AGRA 2YNMA 4R84A 4BKQA 2GD2A 1M6VB 1ISIA 3DAHA 4FN5A 4FPPA 3AIMA 1LX6A 1Z0UA 2Q0HA 3LGSA 4PFJA 4OQMA 4ZPJA 5T4BA 5JS6A 2OG4A 4YX9A 3FTQA 3NHRA 3C87A 3Q2IA 4I4TB 4GI7A 3PB3A 3RARA 3BTUA 2AUNA 1HURA 3BGOS 1X14A 4DM7A 2JLQA 3KTDA 2FFAA 2YWDA 5KOHA 3I52A 2HR1A 2Z58A 2HI0A 4OXNA 1ADGA 2JBAA 2EV9A 4FFVA 5J5VA 3WJ2A 5TQ0A 2JS7A 1R5TA 3ZLTA 3SYOA 2GF9A 4B32A 2INGX 3EGDA 3V4ZA 3UHFA 4ZKEA 5L3DA 4E2LA 4JAAA 1H3FA 2J09A 2GCPA 3O95A 4M4SA 4MS4A 3T38A 4XFJA 4BO6A 2NU6A 3QBDA 4CUZA 1ZXLA 2ZATA 2NU7A 3GFPA 4CN9A 2P5SA 3T3HA 3CGGA 1HDXA 5H5JA 1ZFNA 1L8XA 4I08A 1GNRA 2NU7B 3H3XA 4RQEA 2VC2B 3D6TB 5ELLA 4HHEA 2XCSB 1JU3A 5TGTA 2YYSA 1BVUA 1X7ZA 3D2BA 3RG2A 2RK3A 1SHJA 1HETA 1JZSA 2GM3A 2EIMC 3IELA 3LXXA 3O2QB 4HMQA 4LWZA 4WERA 1Z0JA 5D8DA 1R4MB 2ZIFA 1JEAA 4MS1A 3V7UA 1R4AA 1WCWA 3GK3A 1QYCA 1SXJA 1UEJA 2JBAB 2DBYA 4O6VA 5J2TA 4JI7B 4RY0A 5ITVA 5HQJA 5KYWA 4Z9AA 4X20A 4A15A 1D2HA 4WKOA 3GEPA 4P08A 4UEJA 4WFKA 3FMGA 1IPHA 1S6YA 2QLBA 3IPRA 2FPMA 1VQ1A 3H2GA 1JJIA 4GMFA 3EA4A 2FJPA 1J06A 5C4IA 1I7LA 1NY6A 2CL6X 5BYKA 3FOFC 1W25A 4PI0A 1WPRA 2J9GA 1Z0SA 3UC5A 4GC9A 1WW3A 5LD2C 4C5CA 5M2QA 2QWRB 1UF9A 3PNSA 4LVCA 3VQWA 2P4VA 1VZ3A 4V24A 2UUAB 1GVHA 2D0DA 5I3CA 1M6YA 2BFBB 3JVUA 3I9NA 1DKNA 1EK5A 3ASNC 3H1KH 1QYVA 2C97A 5L3EA 2CUTA 3OMLA 1D2NA 4JVLA 4KI7A 821PA 5MF6A 2J3MA 4QM6A 1N3BA 1KPIA 2RGNA 2IU6A 3SQLA 1JV2B 2QN2A 3DFZA 3FVWA 3GPDG 2C8LA 5K0NA 4ZJPA 2PJZA 1HT3A 2XUIA 4ISCA 1OD6A 4K2AA 4MSDA 2X5KO 4R5MA 1WDTA 2PGXA 3KZ1E 3RVLA 4EFEA 2PTHA 2PA0A 3FB1A 2NO4A 1XIVA 2BHRA 3BXHA 1W5AA 2FG5A 3V2UA 4RABA 1K6JA 1EM6A 4IL6Z 3KRTA 4KK3A 4B6SA 4V03A 3C2QA 1S4MA 2G4LA 3ITDA 3F73A 4HS9A 3QVVA 3AUYA 2HT1A 3NYRA 1M6NA 5FA6A 1JBQA 1I4DD 3MILA 4HYQA 1FX1A 1RJ9B 2YV5A 4X7RA 5EPOA 1Z7GA 1IDOA 3HHEA 3LLCA 5SYNA 3X43A 3K1YA 4C4PA 1PBTA 4Q3EA 1XKQA 2E6KA 1RM5A 4ZO4A 3W6OA 3DYIA 2Y0PA 1KP9A 1QQCA 2F1RA 1W36D 5HGXA 3DC6A 3G1TA 4J7AA 4LQDA 5I8PA 5KTKA 1Z83A 1ZOOA 1DC8A 1L1EA 3FCYA 3I9FA 3F6SA 1KUQA 4B31A 1JHMA 3U4HA 5BWOA 3M5DA 5EMNA 5BSWA 4DV2B 4JKOA 1OZGA 2ZWOA 4IICA 2OQIA 2WWTA 2PLFA 3A25A 3HNOA 3IAS6 3KVRA 3WBKA 4F5EA 5ES4B 2Z2ZA 4RK6A 4KDFA 1NWCA 1UZAA 3MTEA 3ZLUA 3HVHA 3GN1A 1P2TA 4Q7MB 4KW7A 2PO5A 1ZD1A 1CUZA 3KYBA 1D6MA 1E89A 4RMHA 3P9ZA 4MTFA 2V3WA 2I34A 3AL3A 4DNOA 3TDNA 1DKPA 4I99A 4DLWA 1N78A 5GAOA 3PENA 3VISA 1FNBA 1YZQA 1L5NA 4BUJA 2WSMA 3GT7A 3OM8A 2Y69C 4TLDA 1DRWA 3AESA 3KD2A 2V4ZA 1I3KA 5TDHA 4GPZA 2H2FA 1OBHA 2W83A 2PSEA 2H85A 4RPJA 2ZJOA 1SUCA 3TI7A 3L0YA 1WQ1R 5LB4A 4RTJA 1IK6A 1A7AA 1VE7A 2XT0A 1M10A 3EGXA 4QPJC 5KHJA 3T3IA 3TSWA 1IQ0A 1V37A 1EBFA 5LA6B 1O9HA 1NXQA 2BSQA 2JG3A 3T1CA 1A9TA 1KDOA 4CBCA 2FMXA 4PGHA 4Q3LA 1QZ3A 2JEZA 1G3RA 3FN4A 4BLSA 2R7MA 4YMLA 5JHHB 2P9GA 4DIBA 2AOVA 1FK8A 1IL0A 2ATCA 3EMBA 3HLTA 4WWHA 1CY0A 3PGKA 1OQAA 4QQNA 3BRQA 2Y1GA 3AR6A 5H5NA 4J3JA 4MRSA 1V5FA 2CNBA 3L0DA 4DLZA 4D8VA 2I6XA 3AR5A 2VYND 3INTA 3GAFA 2AZDA 3OQIB 3TRKA 3TAXA 1KWGA 2RGCA 5KVAA 3K58A 3D59A 3FLBA 4XD7A 4BGIA 3IQIX 4Z5XA 1J8QA 1Y98A 3OO1A 5HRCA 4FK8A 2TMGA 3CXRA 3H6GA 4BWAA 1EQ2A 1YR9A 5GM2A 4CQMA 2H29A 4YXWD 4XFDA 3AHCA 3ULKA 4R41A 2I3AA 1KJNA 1VXOA 5ENDA 2BGJA 4XSHA 2HEGA 3UB3A 3L72H 4J4HA 3VX8A 2CMGA 4TS3A 3EX8A 2CC2A 1ZEMA 4I1YA 1M2OA 3L4BA 1G5RA 4MVJI 1B0PA 1GRQA 3UJHA 2YZNA 1Y34E 4DVGA 1TLFA 2W2PA 4JMLA 1D5AA 1PX0A 2GOYA 5H9WA 2DMXA 5K0JA 4AUMA 3FGPA 1THGA 4YCCA 4KXRA 5KUKA 3O83A 3STVA 3P9QA 3MJFA 3BHIA 4P9DA 3JZIA 1CZLA 5CB6A 4PSDA 1KK2A 1NXSA 5F7ZA 2JFUA 1JKJB 5FB3A 4P2ZA 1ETHA 1NA5A 1DFHA 2I4RA 1WB8A 1VL5A 2X41A 2VWPA 3CF4A 2C7OA 3LWBA 4MR7A 5AQ1A 1B6RA 1WHSB 2FWPA 5CX1A 3L7NA 4QFMA 1KE1A 2OR3A 4JITA 4EPYA 1HPLA 3W2FA 1G42A 1A8HA 5HF5A 4MWZA 5JS1A 2FYUH 2XIJA 3A9CA 1PD0A 1T4CB 2C8VA 4HDRB 4NFYA 4D4IA 5A4FS 2Q1UA 3RF6A 3HA5A 3LVRE 5A4KA 2ZBRA 1CERA 1OWLA 3O31A 1CJVC 2QR3A 2RHLA 3ABKB 1UIRA 3L79A 4N7RA 2OB1A 3H8JA 4G9BA 3ER6A 1TGOA 1D4OA 2PQ0A 4LRXA 3QKSA 4RKWA 5F9FA 4NZNA 3V7WA 3IDQA 4H2DA 3AG1B 1QZTA 4TMWA 2ZRPA 3RQIA 1I3CA 3MT0A 4R1QA 2D1QA 2PEZA 2ZLBA 3M2TA 2YFYA 4RSMA 3TLXA 4LE2A 4D9HA 2UYCA 1I5YA 4ZJZA 5B1HA 4A7PA 1EGVB 1GUZA 2YBDA 4YUVA 1U1IA 2QN7A 4PEVA 2J59A 4REQB 1X1RA 3H8SA 4MSMA 3ZK7A 3HEBA 3PLRA 2ZJBA 2CWWA 2ZRIA 3EISA 3NS7A 1J97A 4I3FA 2Q62A 4JU9A 5DYNA 2RAPA 4Z7OB 1XREA 5LDGA 2KB0A 4TN1A 2EERA 2CEKA 3JYHA 4BGVA 4KQEA 2EBFX 1O5IA 1P6XA 2VUUA 3DHVA 4CE6A 3A1VA 1JQLB 3V1YA 3L8DA 3CNNA 3PHBE 1LJLA 2WSIA 4ESHA 4HNUA 5HS6A 1UAYA 3GRUA 5CB4A 1IAQA 1X6VA 3RNOA 4TTVA 1GPAA 4CNQA 3D36A 4FM2A 1KAQA 3P5BA 4QT4A 1SQQH 3W1EA 1JFTA 2WIDA 1PZFA 4LSZA 2BMEA 1XZGA 3ODGA 1QVAA 2XECA 4P4SB 3SIWA 3JAMA 5AJHA 2QTOA 1LPSA 3KCQA 3LOQA 2VSNA 2G70A 3GZJA 2XSZA 3KAPA 3ONNA 5IVHA 1M56B 3GAZA 4ML3A 4MOWA 4QZVA 3I72A 1PQUA 3OPYB 3ZTYA 1GK9A 1G6OA 1OF1A 1UDBA 2JGMA 2QTVA 2WKWA 1E69A 1OXSC 1XFDA 2F3TA 1PGPA 1ZCZA 4RPKA 4FC7A 2X5NA 1B8PA 1VPLA 1VQ9V 1H2WA 2ZTHA 3LL4A 2NXEA 2V9PA 3DO8A 1ZOPA 3DD1A 3QVGB 4NARA 2IA5A 3APOA 1JG3A 1ZC3A 2WUFA 3LW8A 3EEQA 3I2JA 3QJYA 1XCJA 3HA7A 1UWLA 3DGFC 3P9XA 1SFRA 2CE2X 2CH7B 3L7KA 3WKCA 3N53A 4OXSA 1SWVA 2WU4A 1IM8A 4EI7A 3X2SA 5IDXA 1XZPA 3CCEV 3PFWO 2LW1A 3TMYA 2OGSA 3SJ7A 2N1MA 3D3IA 2HL6A 2O2YA 4YP6A 1OI0A 4ITRC 2BFPA 5H1YA 1SKMA 3SR2C 2HWYA 3K05A 1WVMA 2HR3A 4EB6A 4NMMA 4O2LA 4M7WA 4BMOB 2P6OA 2DP4E 1D2EA 3E1KA 3OURA 2RPZA 1JAIA 2Q3MA 3QHPA 5CG1A 3GEHA 3KEMA 5KQRA 4NTWA 3IAYA 4RDHA 1PL6A 2P3QA 4LFBO 3FTPA 1VQ6V 2NACA 1JHUA 1E5VA 2Q7XA 3PNQA 3SC2B 3M89A 3U40A 5A2GA 3KFXA 4U02A 2I66A 1U3UA 5FTWA 1RM1B 3BE5A 3LJKA 2WPDA 3V33A 4PQTA 4IOJA 1HO3A 1T3GA 3J81A 2YWFA 3TXXA 2FPOA 3EXG2 3O8BA 1K2WA 4OHMA 4EGAA 1WPXA 1YQWA 2H5IA 2YV1A 3CC4V 3AWDA 1I5OA 3H04A 1EDBA 3TPCA 5F1OA 4CIWA 3PFFA 2R1TB 1GYPA 3WG7C 4UHCA 5EIEA 2WDPA 3NHJA 4H37A 4MA4A 5BO5A 3DWGA 4ZCMA 3B89A 4CLHA 2VATA 5LKRA 1XAHA 4U7JA 2Z6AA 1S2MA 4QGPA 2GZ2A 4M1QA 2B0JA 3U7GA 4KFCA 1E5XA 1U0OC 1WV1A 2ZJ8A 1JXOA 1JDBC 1IC6A 4I5DA 4KXQA 4G0OA 4ZHQB 4I1UA 5AMXA 1G1AA 3IPAA 1ZM9A 5CAEB 2BCGY 1CQZA 1KKUA 4D8XA 2DFNA 4GU5A 5G1NA 2G8NA 2HBQA 3C3AA 4QFBA 5IT5A 4ZTUB 5EXDA 4DPLA 2J0EA 3O74A 4UREA 4WFIA 5JLAA 1U96A 1EDDA 1UT5A 1U0HC 1P2BA 2QF7A 3DXXA 4MYSA 2QI9F 5A9GA 4J0GA 2CE7A 1I4EB 4P4SA 4PYKA 5H0IA 2ZJAA 3SKVA 1GZUA 1LKZA 2X19A 2OYSA 3UGQA 3DZIA 4DAEA 2D6FA 1DI0A 1KYQA 2W58A 4FW9A 4Q9AA 4ZMRA 4HWOA 4UBJA 3TKAA 1WN7A 1XA4A 1Z4MA 3NLLA 3ABMB 4QVIA 3IBGA 5C7IO 3ZV6A 2ATXA 4CL3A 4LF7B 2OGZA 2QQEA 4GYJA 1QS0B 4UMDA 1KS2A 3OTWA 1XZHA 1I4OA 3HI6A 3NDIA 4MB6A 5AXCA 2OIGA 2QAJA 4RH3A 2AQIA 4E5UA 1NVDA 3KT8A 3NMUF 4MQFA 2HN9A 4YRLA 1L4MA 5DXFA 3UJ3X 2Q3DA 4Y2QA 1GM9A 4YP7A 2GCNA 5H3LA 3EXFA 3TKLA 5KWSA 1MNGA 2QWNB 2I6UA 4LXQA 2QP9X 3KXLA 3SX0A 5BW4A 2EWVA 3ELWA 4M0DA 3V42A 1L3IA 5COBA 2QD5A 2VWHA 1NNI1 1V4NA 3C1OA 1YB7A 1X1TA 2XDAA 3HB7A 3LC1O 3U4CA 4DV3O 4BR6A 1J8MF 3H84A 4GPAA 4YY3O 1HYBA 1RWVA 2Q8VA 4DIOA 3S2IA 1TCCA 1KIMA 3FMPB 4E5NA 3ZE6A 4MGYR 3ROZA 2PXAA 4XM1A 3IXQA 1UBRS 3V6MA 3PTAA 1R5OA 3C8HA 5AHOA 4D4KA 3GUZA 1X8KA 1C41A 4PICA 5C51B 3VDQA 5IF3A 3DBIA 2EIKC 1Z5OA 1CUGA 4GI1A 3VU8A 1WOMA 1KRHA 1ZESA 2GEDA 1FP2A 2XGGA 4G1VA 4BASA 4OI2A 3O8CA 1KQOA 3DKVA 3PL1A 3PUVA 1E2KA 3OAAA 5AW4A 1Y80A 1NYQA 3NHAA 1YRAA 1MTOA 5AK0A 1CB0A 2YRFA 2H57A 4OQPA 4N9QA 3SMVA 5J2TF 4J1TA 2IH2A 3RWOA 4UNNA 1QHFA 2EINC 1M1NA 1P1RA 3QFHA 4CMEC 3HN7A 1HNXB 1H05A 2AI1A 2Z1MA 3PGVA 4P8RA 5FUWA 3PDHA 4YJKA 1YQXA 1LSSA 3U4QA 1JFRA 1DSSG 4PJ0Z 2JCYA 1WMSA 1VCOA 2ONYA 2C2BA 3EY4A 2PHZA 3KYCA 4IZIA 1AQYA 3A9VA 4CBVA 4E0BA 1LSOA 2FPUA 2JJ8A 2XY4A 3HGMA 3T7RA 1YBAA 4KZKA 4LHSA 3ASOB 2OO5A 2X1VA 3SGLA 4D96A 3WGOA 4KITC 2DTEA 4K05A 4YYZA 4EA9A 4YDHB 4H0NA 2PUBA 2XWPA 4XM0A 4ECEA 1XD8A 1R15A 1VCNA 1ZCBA 2AG6A 2F6RA 3TGLA 3C6MA 4MS3B 2NX8A 2GBGA 1A8IA 1VL8A 2RAFA 3KR2A 1GGVA 3HZZA 5DCWA 4DDWA 2WF6A 4M0KA 1Q7EA 1NQUA 4CIDA 5GM1A 2AYXA 2WQZA 4IMRA 2VJOA 1Z06A 2JI6A 1FFGA 2OCIA 1DKQA 2V0NA 1QFJA 3KKOA 3LKDA 4ZVKA 5EPUA 2MU1A 4BZPA 3DLHA 2IX3A 5BV2P 3REOA 1KSFX 4JWKA 4G4GA 3BWYA 1F7UA 1E59A 4UUOA 2YS6A 5FUQA 2FXIA 5BUZA 2QRJA 4LY0A 5LHIA 5K8UA 1Y8QB 2QVZX 4R8MA 5FFMA 4P92A 1OV9A 4KGVA 2QRHA 3W8FA 1KL7A 1DAEA 3IIKA 2ODNA 1FP7A 4PCLA 5HJEA 4M9SA 3LECA 3WVNA 4X64O 1F1BA 3ABRB 1MPXA 3HA3A 1EEHA 1Y4UA 1JIIA 3QWIA 4IEEA 1MRSA 1HT1E 1ICEA 1N5IA 4R2JA 4DZRA 1Z35A 4ZVTA 4F9FA 3CNEA 4UTNA 5JO9A 4GBED 3SEFA 2EKBA 5IFLA 1VP9A 4LS3A 1I7QB 1NX9A 2WHYA 1PJSA 3FFBA 3JAWA 1VJRA 1EE9A 3LBNA 4DJDC 1P7PA 1B3RA 2ZGVA 5IHXA 2XCQA 5M29A 2BEVA 1FCJA 4D7AA 2PUAA 4DLBA 3HXLA 4CRWB 5F33A 2XWBF 4K9MA 4C20A 2KCQA 3CWCA 3OIUA 4EL0A 4WI1A 3FFTA 1X1CA 2NWQA 1U0BB 1QUFA 3PQ4A 4TSFD 4LF6B 1YULA 2BRUA 2IW1A 4WLOA 5BV7A 2CLKB 2OD2A 2JAQA 2SECE 1VK9A 4XDHA 4HAMA 2QN3A 1XNGA 4JI0O 2KG7A 3W9YA 3H97A 2C61A 5E6SA 4BAYA 1YDFA 2PKWA 3LZDA 5FLXA 1E1QG 5LP6C 4I8DA 5IANA 5A9RA 2HRCA 2W43A 1OA0A 1PFYA 1O95D 4W1SA 1EM8B 2I4OA 4KO3S 3VOSA 1PSDA 1VF6C 4OQZA 2WD7B 1JKMA 4BQNA 5JNTA 3RT9A 2FFBA 4MTCA 4J1NA 4KXLA 5EIWA 1NOKA 4PDRA 2V1DA 4I36A 5ERGB 2AOTA 1VKNA 1KJ8A 2WHPA 3OZWA 4LOHA 2FVXA 5DMXA 4D4MA 4E94A 4YRDA 3R3YA 2VTDA 1VFPA 2CNOA 3AI7A 4WBNA 3CEPB 1IUPA 1I33A 4XWAA 3T1TA 1YJ9V 2QUIA 4BDSA 1K7CA 4N23A 2WD9A 4MROA 1FMFA 1GQSA 3E3OA 1NMSA 1SQ6A 4QUKA 5E9JA 5GOTA 3V4SA 4DM4A 5CDUA 5HZGA 1H3EA 3EA0A 4HADA 2P8RA 1M75A 4X64B 1GNLA 1OW3B 1PJTA 1SQVH 1B26A 1KY4A 2B78A 2DR0A 4JPRA 1IY1A 1ZR2A 2EVWX 2Q7OE 2NYUA 1S7CA 3H5NA 1A0OA 3CRQA 5JAOA 4JJ4A 4WZBB 5DGTA 4NB5A 4N9WA 2YIJA 1CY2A 1Y9AA 3QU2A 3F3MA 3K5PA 3X1JA 2BE7A 2HDHA 2PWAA 4Q7LA 2IP2A 2OD9A 3RVOA 2EZ4A 3GRZA 3SFVA 1FVHA 2X86A 5AW2A 1DDOA 5JCXA 1JJVA 1G291 2Y0CA 1N4DA 3Q3CA 1U5AA 5KC8A 2X1LA 2UXCO 3GJRA 2HMYB 3NR7A 1M1UA 3TQOA 3DGEC 3Q11A 4LTNA 4D9EA 1Y8ZA 3PNMA 1DKLA 2PM8A 3HJRA 2ZZKA 3HFJA 2C31A 4RTPA 2V7QG 3KHKA 3AUXA 2BLNA 2F9FA 2H31A 1PGNA 1IVSA 3H3FA 3OCXA 3A31A 2ZSBA 2FP4A 1P8JA 4FGWA 1VJDA 5CW2A 4N6OA 4YJ2F 3HCFA 1QJCA 5ICFA 3UJ8A 2HWUA 3E35A 1RHQA 4MDYA 4P3OA 5KSWB 1QKIA 1E8NA 5KX5B 1L7DA 1CY1A 3NNNA 4FEYA 4KTTE 4XQEA 4F4DA 4DK1A 1H4TA 3TG8A 1VJ1A 3L0BA 5BQPA 2A9FA 3ROFA 3THWB 2NSHA 3GJSA 1GN8A 2W6QA 3RS3A 1UJBA 4PA9A 2J7PD 3HR7A 1MIOA 2NZVG 3K30A 3L73H 4FKMA 4BYMA 9LDTA 3LWNA 4BFWA 1JE1A 2ZKIA 3NNDA 2OCHA 1XF1A 4IJVA 4RU1A 1C9MA 1K0FA 4X8OA 3UM7A 1WXGA 5EZ6B 5K3SA 5IAOA 3G0BA 1TX4B 5JXWA 1HNXO 3EJ6A 3OZEA 3AVQA 4ZQHA 4YXFA 2HZ7A 3JYPA 4L8VA 3PUKA 4TRRA 2AF3C 4QX6A 2BWJA 5CH5A 1AKMA 1E64A 1JI0A 1C2TA 1BXGB 3IULA 1SKBA 1KPGA 1JAHA 2BFDB 2G0NA 2P91A 2CUGA 4OLHA 2VTBB 4ALJA 2F3SA 3DDOA 4O33A 2GSMB 5LN1A 2IX9A 5HTOA 1SUSA 3M70A 1WWKA 3D8RA 4HB4A 2NTEA 3RANA 2YC2C 3EVCA 4CS2A 1K27A 5JAHA 5ALHA 2HIAA 2XB6A 1AB3A 3OE5A 2OLKA 3RJ5A 3ZCCA 3F6CA 1NI3A 3HWX1 5REQB 2PAAA 2QLCA 1MVLA 1P18A 4JBIA 2WMYA 5AHWA 1FZTA 3N2KA 3FSEA 2Z5UA 4COKA 3SXJA 1AS0A 1HOTA 4YY3B 1NAHA 2Y0BA 3A6KA 3EXIB 3GT0A 3HL0A 4M9XA 3KUKA 3EVFA 3HWSA 3F9IA 4O2AF 4ZVRA 4YIOA 4MRMB 3DV0A 1Z0DA 3R0VA 4ICIA 4INZA 3SX2A 1C1DA 1GNSA 2V9ZA 4DMRA 1YJAA 3NOQA 1E9VA 4TZ0A 2VRCD 5E1AC 1KJQA 1WN5A 3SYQA 4HF7A 4XTCS 5GTHZ 3WICA 5KU7A 3LMKA 4NNPA 2HTFA 4UQLA 1MBZA 1OH6A 3PQ3A 1N0HA 3GXBA 3OETA 3ZQ4A 2VSQA 3A2NA 2GS9A 3MCVA 5IXSA 3OWOA 4DR3B 1E9EA 4NECA 1DRJA 4QOSA 1OXTA 4YWHA 3ZZUA 1TT7A 3WK4A 1H8EA 4ZICA 1NULA 4PZUA 2ZSHA 5DP2A 3BMNB 4NYJQ 1I7DA 3BZWA 2WUGA 4BP3A 2DPYA 1MB9A 2R6ZA 1FRNA 1C0PA 1P80A 4KVAA 4WTOA 2I3DA 1LQUA 1SZPA 1NZJA 2VDKB 4QO8A 1JWBB 1WXFA 1H8ED 1F7YA 2VK2A 2Y1EA 3DT6A 3NASA 4TRMA 3UK1A 2WU8A 1CVLA 1LFDB 5I3ZA 1SU4A 3GJ4A 4EPWA 5K99A 4U0JA 4BO0A 2J32A 5C8DA 3UXHA 4GVPA 2PQ6A 2PUDA 2ODTX 4YBZA 3ICWA 2BEJA 1E7SA 3HB5X 4UU7A 2O2SA 4M6WA 4HWTA 4UJ5A 2CDAA 2ID7A 4I81A 1YQGA 4DUPA 4MUAA 2Q4EA 1W49A 3CYOA 2QJFA 3UAYA 3ZY6A 4HZUB 1SOVA 2YUIA 2HEIA 2ETVA 1SULA 1RJEA 1JRLA 4F1JA 4DWVA 2VP3A 2PSHA 4DMUB 4BCCA 4JYBA 2PV0A 3TRFA 3GQVA 4C6SA 4D57A 3F8TA 4NBLA 1YB2A 1E18A 1GNPA 2AL7A 2OV4A 3FUXA 4LXGA 3RAPR 4XTRA 4EJSA 4CF4A 1FS0G 2PKQO 4QUIA 5JEEA 1YVRA 3PBKA 1EEXB 1KBZA 1PFKA 5I4CA 1BKYA 1NJ2A 2Y2UA 2IXAA 3TAUA 3ZKWA 3NEJA 4MWGA 3BWBA 4YIPA 5E3IA 5IKEA 4J1SA 5CVCA 4J0KA 4NESA 3MJHA 4KFMA 4OKNA 2JCSA 1Z2NX 3V8RA 3DNMA 4R3UC 3OLWA 2BHLA 2HA7A 2GI4A 4J0QA 1Z2EA 3LA6A 3O4IA 3U26A 1NBIA 4EENA 3IAAA 1YGPA 1C3EA 2F64A 2JAWA 4LFBB 1FMLA 3S4YA 1M34E 3AIOA 3MCZA 4L15A 4QBKA 4QKQA 2QWOB 3NHLA 1NVWQ 3CO0S 5J1SB 4UM9B 1TD9A 2OESA 5KNBH 2OP0A 4B3HA 4EQ6A 4I66A 3MTAA 4YP9A 4EFKA 4EJSB 4O8XB 4K1RA 1J20A 4DLTA 1SBTA 1DU4A 5FL3A 5KHAA 2GF2A 4I0XB 2F90A 2ZCVA 3PR2B 4MV6A 5KI6A 4BNWA 4WK6A 1AKYA 1VJ0A 5JJLA 3NALA 4C06A 2UXXA 2ZW9A 2QMEA 1E4YA 2NO6A 5AK5A 3U9SA 3M4XA 3I05A 4YPFA 1Z3CA 2YV2A 2EKPA 1WCIB 1WF6A 3A1DA 3BYZA 3BZBA 3CS3A 4KITB 4HH1A 4RPIA 4EHDA 4PZLA 1OI7A 5F1PA 2Q3LA 4DA8A 1I4WA 1H5UA 3QO5A 2N74A 2QP3A 2E74B 2J0UB 4LH6A 5JPIA 1YCHA 4KYUA 1Q0RA 3BWDD 1QIGA 1XN4A 2IZ6A 1NP6A 1G1MA 4I5IA 3VH1A 4E70A 3QEBZ 4FD3A 4MVMA 4H6VA 3VR4D 3P32A 3G0HA 1Q6HA 3P94A 4X1KA 1OV4A 5FORA 3RHSA 3R9XA 2HK9A 5BP7A 2WLTA 4L0DA 1FMTA 1QHTA 4MV3A 3AR9A 4Y6QA 2MW2B 1ZDMA 4W7IA 4OXRA 3LIPA 4V0LA 1P0QA 4H08A 5C0OE 1KS9A 2B3JA 5L3GA 3GJ3A 3ZK8A 4H6PA 1R3UA 3DONA 1PQ4A 3KKQA 1ZH2A 4U6NA 2C94A 3SQOA 4BN4A 3S6JA 2JLZA 1IJFA 2JEUA 1U6JA 5LMUB 4MYRA 4ZV9A 3UK6A 4GZMA 4AJJA 3RT7A 1AA6A 3ECSA 4D4GA 3ZEFB 3WTCA 2P30A 3PUJA 2OORA 4HLNA 4GAEA 4C3OB 4YI5A 2HU7A 4P5DA 5HDBB 1MOFA 3JCZA 1KEZA 3H7AA 2KW5A 3JQGB 4R2KA 1T5HX 1E9CA 3V3TA 4A8JB 4BMNA 2NNLD 5HKLA 4M0FA 1M2VA 1RFGE 2NGRA 2P3SA 3BXEA 3KLNA 4LPSA 3R7FA 1YZHA 4R2MA 5JUWA 4B3DA 4J80A 1PNQA 1ZM2A 4JAVC 1E1CA 3AUFA 3G5MA 5DLDA 5FWNA 3K6SB 2XB8A 1Y63A 2NQ2C 2YUTA 4PLPA 3G9ZA 1LZKA 3DL0A 4XVUA 5CA0A 3VNBA 3D5EA