2IU0A

Crystal structures of transition state analogue inhibitors of inosine monophosphate cyclohydrolase
Total Genus 213
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
213
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURH
publication title Structure-Based Design, Synthesis, Evaluation, and Crystal Structures of Transition State Analogue Inhibitors of Inosine Monophosphate Cyclohydrolase
pubmed doi rcsb
source organism Gallus gallus
total genus 213
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2006-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2iu0A04
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 2iu0A01
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu0A02
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 2iu0A03
1THZA 1CE8A 2X8WA 2IU3A 2IU0A 1P4RA 1VMDA 2YVQA 1OZ0A 1PL0A 4EHIA 1CS0A 2XW6A 4A1OA 1C3OA 1B93A 1M9NA 1BXRA 1T36A 1C30A 2B1GA 1G8MA 1EGHA 1JDBB 1S89A 1WO8A 2B1IA 1ZCZA 5H3LA 1PKXA 1A9XA 1M6VA 1KEEA 1IK4A 3ZZMA 1S8AA
chains in the Genus database with same CATH superfamily
2ZI3A 3UWSA 2NYTA 3LG2A 3TDNA 5T57A 2EWMA 4IKOA 3WYDA 4LFAB 3GJXC 2YWEA 3RTDA 1B6TA 3Q9UA 5FBRB 4OB8A 4WCEV 4IH4A 1K4DC 3Q8LA 3WYGA 5BXQC 3FNHA 2Y0EA 2OHIA 3K0GA 3BXHA 2G06A 3B9RA 1SRQA 2ODNA 3V1NA 3A25A 3DMTC 3SDZA 4P86A 2ZUVA 2I76A 3MG9A 5HRUA 3QIAA 2C1ZA 5AXDA 1Z4KA 4BN0A 3WDMA 4EUHA 2FW9A 4I9GA 2YXDA 4PCLA 2BKXA 1PT9A 2Q2WA 3E4DA 3J7AU 3OPYA 3BMCB 3L73H 1QHTA 3PDJA 2HN9A 5CT8A 3CX8A 5TT0A 1KDVA 4A8JB 1YR9A 4ARUA 4D98A 1EZ4A 1ZU5A 4CYMA 3R4VA 1PR9A 1WAMA 3M5CA 3ZHCA 2XB8A 4TMXA 2ZJ3A 1AG9A 1HE3A 1P44A 4BHTA 4F2PA 4Z3DA 2QZ9A 4AO6A 1K5HA 3VR2A 1JI3A 5DNCA 3VYVA 2PZBA 1J5EB 1LJUA 3BTUA 4ER6A 4GI5A 5J1TB 5ALVA 3EWNA 2POQX 1WMBA 4UZFA 2YIMA 1T8WA 2ID9A 1OY1A 2JFZA 2AB0A 3K03A 5ALPA 1TAQA 4FMCB 3LL4A 2E18A 4K9OA 3AJ9A 2X1MA 2IHZA 2JKZA 5L3VA 4P4LA 2IYAA 5IT5A 4I4CA 4ZN6A 3FSGA 1JQEA 1UWCA 1EK2A 2EJCA 3NOQA 1W2GA 4H4DA 3SXPA 1OXMA 4QM6A 3WGZA 2D0DA 2IUTA 2XA2A 1C81A 1JLRA 1DQPA 1YV9A 4K2AA 3JAWB 3M5PA 2QM4A 1QVZA 3AHHA 1GDTA 3WWPA 3ITKA 1Z07A 1W1WA 2RHHA 2QIOA 1XZHA 2TYSB 2OM6A 4FLTA 1Y3HA 2EC5A 4JT4A 4AX8A 5DI3A 5D7BA 5DPMA 5JZOA 3V4SA 4S24A 3EFOA 3ZHOA 3OCUA 4EPXA 3QI7A 1F6DA 1N8SA 4MW7A 2B8NA 4RK5A 3EW7A 2DGDA 1WMDA 4JYPA 2RE8A 3JQFA 2W4IA 3UAGA 4FYXA 3MJRA 2QTGA 1IEWA 1ID8A 3FCCA 1E5VA 1XPRA 4C5CA 4TWKA 5GV8A 2V7EA 1QGYA 3ASVA 4E2ZA 4OU4A 1EFVA 1M6VB 1T1SA 5TXGA 5FI0B 1O4WA 2VATA 6ABPA 5IDJA 1E4YA 4B3JA 3QLVC 1K68A 1OJ7A 3W05A 4G36A 2FF5A 3FPJA 2GASA 5LP6A 4ETWA 4BJ6A 4RTRA 3PX3A 4B47A 4WN9A 2ODTX 3UAOA 6AT1A 3NOVA 2Y68A 1LLQA 1XMQO 1IJBA 1L3CA 3BCSA 1JLHA 2I7VA 3BGWA 3R09A 4L50A 1RAAA 4LRTB 4BXOB 1U9JA 4PLYA 1CW2B 3ZR4B 4E1AA 4HI0E 3GDOA 4ZVUA 1CY1A 4QPJC 1Y9EA 5BN4B 5CA3A 4F1JA 1CUWA 2HMAA 2I9PA 4DB2A 3TRJA 4D79A 1T29A 1X77A 5AQEA 3UN1A 4U8GA 3EQ9A 3AHJA 1RW4A 1SUIA 1MVLA 3EXIB 1CS4C 3CX6A 1SCUB 3FJ1A 4ISBA 3EPLA 3ABLC 1QIIA 3R5JA 3EC1A 2XCTB 4B3CA 3WGQA 4M9CA 1FTWA 3IIIA 2J3KA 4J1QA 1A9QA 2ACWA 2OGZA 4NV0A 3T38A 1ICIA 3OD4A 4DAEA 1TD9A 1HNZB 4ZK2A 3SEFA 3PGKA 4B4VA 3R65A 1OXKB 3C6QA 1U8TA 1XO1A 4R7GA 3TNLA 2R48A 2R84A 3Q3EA 5U1PA 4OBEA 3SOPA 4CCWA 5CYOA 3H2JA 3QEMA 2EDAA 1B6GA 1CLUA 4JXZA 4WLUA 1QF9A 1K7DA 1XTTA 3I30X 2HUPA 1OMOA 4PHHA 4BDTA 4F5ZA 2VWGA 3TZ6A 2C2WA 1Z13A 1V25A 3FD8A 3W8RA 3TEJA 1WB4A 4GOKA 1K08A 4YA6A 3IXLA 3LXXA 4AZ3A 1PL8A 1YJ5A 3LUKA 3RFRA 5BSUA 3G5TA 2IW5A 1GAQA 2VRCD 2R2GA 3Q85A 4LOIA 1Z2DA 1QCCA 5FWXA 1Z0AA 3VNBA 1XG5A 4B0OA 4AJPA 5JE8A 3IJEB 4U7WA 2ICAA 3BD6A 5JBQA 5A3QA 1FYDA 3ICQB 2IE8A 2PX6A 4C7VA 3ZUPA 3QRWA 4UCXA 1FRVA 3LQKA 3AUUA 4DTIA 3WY9A 2A30A 1W87A 4R2XA 4B09A 4KXNA 3OR7C 1RAEA 2L6LA 3DZFA 1OLOA 2GETA 5IUNC 4ZOLA 2K5UA 5EQFA 1XT6A 2QL5A 1DRVA 1GZ3A 3ZLVA 4Q20A 5B58T 5IKOA 4X90A 1QPZA 1WEHA 4TTPA 3PLAE 1RZRD 2C03A 4MQFA 2NU8B 5CA1F 4IRXA 2IYOA 2KQXA 3GC6A 4ASUD 2Q8NA 1J6UA 4EEXA 4YMVA 3NM6B 1UBLS 3CLRC 1UBSB 4OQMA 2GILA 2CH7B 1FBTA 2OG2A 4IL6Z 1P74A 3N59A 3FRHA 2C9OA 521PA 3LKVA 3AF1A 1JL3A 2G1PA 2DFVA 3PHJA 1R0KA 3GOQA 3H3FA 1SBZA 4FDUA 2VJPA 4DA9A 3ASNC 1FXWA 4YONB 3JSAA 1P6OA 3LP6A 4UCOA 4EG1A 4BPRA 3C98A 4H7KA 3ONVA 2YJZA 1L4UA 4ZKEA 1G9XA 3V4RA 1T4CB 3L7LA 4ALLA 4PYJA 4R7TA 5EJ6A 1U9IA 3LBAA 3N2YA 3SMVA 5F9FA 2AN9A 1Z63A 3U7QB 3H8WA 4JYZA 3T7JA 4CODB 1P7YA 5BUCA 4FNOA 2O2XA 3TD6A 4Z9AA 1AS3A 2CFRA 5EHIA 2B1JA 4BUCA 3UFBA 1MV5A 2ZI6A 3QVSA 5CB0A 4PAQA 1XQXA 3N7AA 5DP1A 4G89A 2QQGA 2ETVA 1NWCA 1TYCA 1QAOA 4YFYA 3B60A 3O0TA 1FSZA 2VG8A 2A9VA 2GEUA 1H2AS 5DW3A 2X4LA 3PVZA 2DKOA 3WIDA 2V3WA 2GJAA 2Z2YA 1XTKA 3AW9A 1R7RA 4G1VA 1QANA 3WL4A 1TU4A 2J9FB 3ZDXB 4FLEA 4DCNA 5TRTA 1EKXA 1R8SA 2BEWB 3RANA 5K0FA 1ZNQO 4PLWA 1X1RA 4F96A 4AZ0B 2QRVA 5HIMA 1C8VB 4XPIB 1FU8A 4PTZA 3N2KA 1XJCA 4L27A 4X8LA 3KC2A 2G4VA 2JAWA 2JCXA 1I0IA 2CNLA 1FW8A 1RI2A 3LA8A 3MTEA 1AS0A 1PWYE 3AVPA 4NMMA 5K3BA 3DLAA 4MWGA 5CA0B 1L7QA 4HZ3A 3V8EA 3I73A 3Q5DA 4IVPA 3NDBB 3A04A 3KEGA 2A3NA 1JF8A 2ZRAA 1TCAA 3GLHB 4XWOA 1E96A 1TLTA 3HXMA 1BWQA 2WZDA 4CLOB 1OIVA 2LUOA 4NE7A 4RL6A 3AF3A 2VAWA 3BH0A 1C7FA 1R0ZA 3B89A 2H5LA 3RD5A 1NFQA 1LR1A 1JKJB 3I2IA 4BP1A 1L4BA 1PSWA 4JQOA 1EM8A 1P17A 1XEXB 4OQNA 2B2CA 1D5WA 3ZMTA 3LYUA 3DM9B 4CIAA 3NAMA 3JQGA 2F9MA 1ZDMA 3WISA 2QVGA 4L6CA 3AJRA 1JA1A 4W1SA 1P61B 4HB2A 3HKCA 4K35A 5DN6D 4UPEA 4JBNA 5KUKA 3KEOA 4P38A 3I04A 3JAKA 3D4LA 4G97A 4L6IA 4LECA 3UC5A 3HJBA 4OQLA 2G6BA 3ORRA 2I1QA 2V03A 4NWIA 5EMLA 3WL5A 4PSVA 4WFIA 3OZCA 1IPEA 1FXKC 4OHRA 5EXPA 3VGPA 4FM9A 1VIAA 2O2EA 2PPVA 3MBIA 1TGOA 3GD7A 3WGIA 3IOCA 3UMCA 1DV2A 4OIMA 4XJSA 4RY9A 4AILC 2GD2A 4EYKA 4OGQB 3NM5A 2OZLA 3TD9A 2JLCA 4BN4A 4BASA 5BT9A 2JJ8A 4HRYA 4KR7A 2PGXA 1QVWA 1URPA 1KAQA 2ZRIA 1PTJC 4QPKA 3CKLA 5EHXA 5BSKA 3O2NA 1VMKA 4JASB 1JIJA 3Q7QA 4MHSA 4ZKIA 5T3YA 1B41A 4CF5A 2O8FA 2C29D 4A10A 4XDHA 4B17A 1SIBE 3OO1A 2Z83A 2IOFA 1U5CA 1YZGA 2C92A 2O1EA 5HPYB 2EL9A 3LDDA 3ZCRA 3B13B 5E0OA 4B3SO 3DE5X 2PFGA 2WPDA 1ULZA 2VBGA 4C1NA 4DMKA 5DWQA 3AP3A 2OOSA 4KN8A 4QKQA 3NV7A 3PT9A 3QE4A 3KOYA 3DJYA 1YIDA 4CMBA 5TVGA 4EVIA 3MTIA 1CZNA 3IBSA 4NPHA 3RSCA 1OX7A 2Q7XA 1SERA 1ZL8B 1CPYA 1P0CA 5DSXA 1Q20A 4P4SA 4TL9A 4FWIB 1BKYA 4MWOA 3CLSC 5H7XA 4UNNA 5C4IA 4ZIRB 4ZYUA 2FFAA 4D8UA 3LC1O 2BFBA 4CG3A 3DZBA 3IBYA 4YH1A 5IZCC 4HY3A 3EIFA 1L7BA 3CZ9A 3Q0EA 3V3TA 3QOWA 2PRJA 3QX7A 1E3TA 3KVOA 3RT9A 4OKIA 4YV1A 3B8EA 2OFPA 1FVHA 4UBLA 3PDWA 5CBPB 4PG7A 4HLDA 3L4JA 3PGJA 3BF7A 2YJ4A 3FFXA 3OI7A 3CG4A 1G8GA 4EZIA 4P7BA 2FCAA 4C2UA 3V33A 4JVSB 2D7JA 3PC7A 4YPOA 1U2TA 3GJ5A 1KMIY 2C94A 2QG9A 1CR6A 4F4HA 2X1HA 1YH3A 3KBOA 2H1OA 1GUYA 3IAM1 2BJVA 1EM6A 2WC1A 4RPHA 1REQB 1ZM3A 4WFKA 2ZM6B 2JIPA 1SCJA 3K1JA 1AH2A 3AG7A 2CGNA 1LBIA 5A0TA 2EIXA 1OIWA 2YHUA 3O8RA 1Z36A 1JE0A 1ML3A 4EP1A 3VOUA 3OEED 4DV5B 3HDTA 1ESZA 4MVRA 5KYYB 4ZAYA 2C4HA 4C7BA 2VP3A 3ETQA 3ZV3A 1UF9A 3UQYS 3REQA 1ZN9A 3R76A 1LH0A 1ZUQA 3ROMA 3SHVA 3ZX6A 3K9QO 1TVKB 1JJAA 1YMVA 4Z4GA 4K6OA 5C1OA 3GLRA 4NPCA 1IQPA 1MPXA 4ZVMA 2OLJA 1WULS 4A23A 1Q0SA 1V5IA 4RVFA 4CN8A 3C3SA 1QVAA 1HEYA 3IIKA 1Z5VA 4DCOA 3KELA 4MK4A 1MQ8B 5CDSA 1FMJA 4H15A 1GA4A 4KTVE 2IZOA 4F91B 1Y4DE 4CKCB 1M8FA 1M10A 1RKUA 2F8SA 1NQVA 4MGEA 2WQ6A 1VXRA 4JP1A 3A1UA 4ZGGA 4IIDA 1GADO 2LCQA 3O4GA 4RKFA 4AECA 4C0LA 1AOXA 1YULA 3CE9A 3PXEA 5K03A 3HE3A 5LP1A 1AO0A 1YXMA 2FN9A 1K1EA 2BFDA 1TRKA 4XDKA 4BIMA 4TTTS 5C1BA 2XDQB 4C4OA 5B6PA 3EBLA 3L1VA 4QQRA 5EXXA 3ANNA 3AL0C 3LU1A 3E9EA 4IDQA 1OA1A 4IIVA 2BD0A 3RV3A 3CLTC 1VL8A 4UV9A 3OPXA 5EFZA 3FI9A 4FZJA 1HKHA 4NBRA 2IYFA 2M1ZA 3JQ9C 1L7AA 4G8CA 2YIBD 1R6XA 1R4MA 3GWZA 4M6WA 1Y6XA 2XNKA 4RJKA 3LP5A 2ILVA 1E6LA 3ZC3A 5KYXA 4LF4O 4LXGA 1HEIA 2W6ID 2H63A 5HMLA 2VF4X 1UKEA 2F9FA 2Y1LA 3C3AA 2ADOA 3WVNA 3N5CA 1RRFA 1JSXA 1OCZC 4Q3CA 1QH8A 1FUEA 3AGQA 2BFNA 1U02A 4KPUA 2G08A 3ROGA 1AKWA 4D1YA 4UM8B 2YN2A 5AHRA 5JS2A 3GUVA 2E37A 4KBGA 1D2GA 3D3QA 1XU4A 4FFWA 1S8AA 1BTOA 4F3CA 4EVSA 1YDXA 3I28A 3KZNA 1UPAA 3M6XA 5B1AB 3NFRA 3F5MA 4D3FA 1M2KA 3G2JA 2W93A 2IV2X 2BVNA 3F49S 1L4MA 1XAJA 3THOA 4FMPA 2YOHA 1WMAA 2QIPA 3VMMA 2VSQA 3IQGX 4JT8A 3A36A 1SWVA 4TLEA 4YJ3A 3RVYA 5FUMA 2O2IA 4RD1A 4BJ5A 3DL0A 4YAEA 2GAJA 1Z08A 4ZV7A 2RGEA 4ARZA 1YFZA 4CKZA 1EK1A 4QOHA 5E3HA 4MWSA 2WLNA 1V9LA 2G88A 4OLBA 4KAAA 2WTEA 3MJVA 1ENZA 2FWPA 3HS3A 1HLGA 5D85A 2VTVA 3I8SA 2XB4A 2OL4A 1V7QA 3FHTA 3A9TA 1RI3A 1O94C 3CW2A 1EQAA 2AHYA 4Z1MG 3Q7SA 2QAIA 2XUPA 4ER0A 1E60A 4B81A 3I04M 4MUFA 3LIPA 2DCUA 4RPGA 4XQGA 5ITVA 1Y3AA 1I3CA 1T8UA 4PM4A 4YBZA 2P62A 4J16C 4JI7O 4QWWA 2A5LA 4TMZA 5G0SA 3AUAA 2VWKA 3PDIB 5LVAA 4CQJA 3OVMA 5BYKA 2W42A 2GPNA 5DM6V 5LL6P 3LQ1A 3S7ZA 1QZUA 3GPDG 5L3BA 4RWZA 3UWMA 3GV0A 3FKSG 4IIBA 2G36A 4OP1A 4WCVA 2C54A 5KKNB 2UXBO 2IUFA 3ESQA 3G17A 4XCXA 2VBIA 1N7HA 4DNPA 2VTBB 1SGWA 4UXIA 1JP7A 2VT7A 3UV3A 1C8LA 1POXA 2Q3MA 3S2SA 2D5AA 2H48A 5TPZA 3LCRA 1IHPA 5E6UA 2YH2A 5AO9A 5L3SA 5HUJA 4NCXA 1KVTA 2HPHA 1TT5A 2D0PB 1QO9A 3H2KA 2QX4A 2B8TA 3L7IA 1FRZA 5GONF 1PIWA 4KO4S 4RJ2A 4KO2S 2FEMA 5IAKA 4OFBA 4FGSA 2D5LA 2K2QB 1VIMA 1KFJB 3HWWA 2QL7A 2QBYB 1PJRA 3E81A 4RA9A 3TGPA 4LVUA 3SOZA 1I2DA 3V8NA 1F51E 2RHWA 2RMKB 2VXCA 1JQ3A 2ZQMA 4LF7B 4CHGA 5JAZA 3CRAA 2JC3A 3TXAA 1AUOA 1TLFA 2IDZA 4YAIA 3UICA 3Q7TA 1C0IA 3W1EA 2EZ4A 1ZM9A 1NIJA 3AVWA 1D4ZA 3CMMA 2WYIA 3QKSA 2FWJA 4CC5A 1AK9A 3CLRD 2QVXX 4J41A 1KJWA 2R60A 1J49A 3AR7A 4K9RA 3FPLA 3WWDA 1VKHA 3DQPA 4Q3BA 2CCJA 1U1IA 1ZKDA 3EVAA 4PXSA 4LISA 3MMSA 4DR3B 4LY0A 1E61A 3EPHA 2HBQA 3SQDA 4EKGA 2C4MA 4RMGA 2BSAA 1M6EX 3SYKA 3LZ6A 1K89A 3OOJA 2ZBPA 2Y1OA 4P32A 4R81A 3R4CA 2B5UA 3F71A 1U97A 4RPIA 5DCYA 1X38A 4J9ZB 3CE6A 1RYEA 3VU9B 2CMKA 3NWBA 3OEYA 5FWDA 2PS3A 4DXAA 1MQSA 1MRNA 2CDNA 2FSUA 3LDGA 4QYIA 4AU1A 5L9AA 4KPYA 1EE1A 4KIUA 4MAFA 3TZHA 3KQSA 3BWEA 3URKA 3EZ2A 4OHXA 2ATKC 3CPHA 2Q4PA 4UAGA 4ZC1A 3VR6H 2ZTMA 4HWGA 1QRUA 4EUKA 4Y2SA 4AQ7A 3B48A 2B1GA 4JU9A 1KYWA 3DKRA 3RIHA 3KL4A 3UW1A 5JXWA 3PRKE 3OKCA 1GVHA 1CS0A 1I24A 2JGJA 2P3SA 4OP3A 2MIIA 4IILA 1EB8A 2V7BA 3VHXB 5LGTA 3MCZA 2F1OA 2H2IA 2P6UA 2JLAA 1TAHA 2QLNA 4B08A 2JARA 1VQ2A 1DBWA 1SBHA 4BYMA 2WV9A 1RKQA 2R8BA 1E1RD 1MD9A 2LW7A 3C3BA 3AJ8A 3S6JA 3FYUB 1H4TA 2XX3A 4RZSA 1PE0A 3PHIA 3ZD9A 4B48A 4DANA 4AFNA 1B2LA 3DE1X 1XL4A 4A6XA 1MO2A 4B2LA 4NIMA 1MB3A 3WGLA 4H1VA 5A2QN 2CXSA 1YQEA 1U3DA 3U09A 4BW5A 4D4MA 1N92A 3BB4A 2EZOA 1IN8A 2VS1A 3DTTA 4DIDA 1RRVA 4ESOA 4F8JA 4G0XA 4HNVA 4BV3A 4EB3A 1M7BA 1EWYA 2ORED 4WA7A 3ZQKA 3RT3C 3V4LA 1QU3A 4UFNA 3UXEA 2P2ZA 1NVFA 4RD2A 4L6AA 2RKOA 4ZCQA 3EHEA 3OM8A 1ZAUA 5C8YF 2GZ3A 1RJWA 1CRLA 5AKLA 1RBZA 1OWMA 2WJJA 1E20A 2P8RA 3TLZA 5CDHA 2ZAMA 4TL7A 1QYRA 2ZYHA 2GHQA 2O19A 3ZV7A 2C7GA 3F6EX 5T8KA 1NMZA 2P5SA 3I1IA 3Q9LA 3DTVB 5BSTA 3T0IA 1QIKA 1H8ED 1P7WA 1T35A 4CKEA 4HAUA 3K05A 4ZANA 2FMTA 1ATIA 4FB5A 1BHBA 1ZGGA 1JOYA 1XWFA 1JHVA 4PYMA 3CR3C 2B4RO 5FNZA 1W29A 4TSFD 5BW5A 3WGJA 3I34X 3B5JA 4F45A 3MGKA 4LZAA 4GGPA 2XAUA 4ZI7F 1M0WA 1AGRA 1X7HA 3EULA 2ZRGA 3KT6A 4JUFA 1O2DA 5B1YA 4BGIA 2GFQA 1XD2A 4LTDA 4L5JA 5K3EA 4BP9A 1I8TA 2IPAB 3OGIB 3E1UA 3DE3X 2PUWA 4ZU1X 2WP8J 2XODA 4DMGA 1OFVA 3GVHA 3D3WB 4EUFA 4JKIA 4I50A 4FBLA 3NBMA 3W4JA 2A2ZA 3Q11A 2A92A 3CKYA 3RC8A 2Z98A 4NZMA 2LR0A 2E21A 2E0IA 1H23A 3MZ0A 4HEJA 2O3QA 3AR8A 1W76A 2FWNA 1NW8A 1R6UA 2Z9DA 5GV7A 1N9GA 3OZRA 1KJZA 4PVCA 3O47A 1JR3E 1ZEJA 1N75A 2V6IA 1PGNA 5K01A 2P35A 3PC4A 3RVZA 3NVDA 3WI7A 1M6HA 4DV4O 1AM4D 1BC5A 1S8FA 2Y4OA 3DMDA 5KVCA 5C35A 3EFEA 4GOMD 5DKFA 1SG6A 3ZDFA 1YU6A 1HH4A 3OJ6A 3PQ6A 4L4YA 2ERYA 1Z4IA 3RRJA 3KKLA 4LXIA 4NEHB 1O4VA 4RESA 1GV1A 5B2FA 3L0SA 1E3WA 4OLHA 2R9IA 4JSYA 2CJWA 1RIIA 2V1XA 3FWKA 3L6BA 4LX0A 3CLSD 4RQTA 1YL6A 5K5EA 4ZAZA 2IHUA 1EK6A 1XQ1A 1BMDA 3A3KA 1MKYA 3AU9A 4WY8A 3K9AA 3G0BA 2IC5A 4HQ0A 4D81A 4MVUA 1O6CA 1BRTA 1QQAA 1P72A 1J70A 1RWXA 1NU1H 2FEXA 2Q5QA 4LHSA 2BOVA 2QQ0A 2WE7A 3L8EA 3PNBA 3EVNA 3OPYI 4BX0A 4D0LB 2BE3A 2OKCA 3B2QA 2OR3A 1FDUA 2IXGA 4P92A 1N25A 2F1MA 5G02A 2JZNA 2PUCA 4LFBB 2OT3B 4DV6B 3OKAA 1ZN2A 2GYUA 1ZMOA 3O8QB 3J81k 5GJBA 4ENVA 3UKOA 3P9SA 2PCJA 4DJTA 1MB4A 3OJCA 4Q7MB 5KC8A 1Z17A 4UEOA 1HE4A 5HRCA 3ZHSA 2YFQA 2J6HA 2R25B 4FVTA 3I42A 4LX8A 4BQFA 2QT9A 1OZGA 2QKSA 3L7NA 3EXFB 1TM7E 4Z1MA 3A10A 3AFGA 3HWRA 3MINB 9LDTA 2JJ1G 4X92A 3LHSA 3MLBA 1HFEL 2JJ2G 4W4TA 1LK5A 3FLEA 2FMHA 3SR4A 1HW7A 2JGDA 4G0PA 5FAKA 1NM5A 3FDJA 2WZQA 1AUQA 4IS2A 1USGA 4NENA 5EPUA 4GMKA 2KX7A 2DULA 4UBIA 3BK7A 4AI8A 1P8JA 4MS1B 4EJSB 2WJ6A 3DAYA 2X7XA 3RLFA 1E92A 4R1PA 4C7JA 1OCCB 5LA6A 3W90A 1U9YA 4IICA 1X59A 1K4YA 2ZBEA 3E3AA 1ULSA 1EUQA 1PZEA 4RDHA 3HJRA 2O5VA 3RVJA 4P53A 2NSLA 4GNKA 5BSGA 3W3AH 1DDOA 3HMQA 5ERXA 3O4VA 2UUBO 4OBWA 2GCEA 1GM7A 3KP1A 4JJIA 2PSFA 4W82A 5K05A 3RF7A 3ON5A 4Z3OA 1QGED 1QQ7A 3GG2A 3FD9A 2H2WA 4YYZA 4KG7A 2AFRA 4IO1A 5B53A 3CZ4A 1OQAA 5E7JA 3FNBA 3B1JA 3HA5A 3AG3B 3HHEA 4FBMA 5I3ZA 4B7CA 4XGIA 1NXVA 1U6KA 4S1VA 1KZ4A 4XIJA 5JOQA 1DCMA 4E03A 5ALRA 1RYFA 5ALZA 3DAOA 2PIAA 3A2NA 4JOSA 5EWLA 5AP9A 1FU7A 4BBZA 3B09A 2ZPTX 4R2HA 3PYLA 4R0MA 1MT0A 5IHPA 1ZAYA 2Z4SA 4BZWA 2W4MA 1N36O 3D6JA 3C70A 3CLTD 3HQ4O 1K2WA 4PPGA 3A1DA 1EWRA 3L7JA 1YZVA 1XELA 5K1PA 1PKEA 1A5ZA 1CBUA 3PNOA 5CXXA 1VMDA 2H0QA 3AB8A 4DV3B 4OVKA 4E4YA 1C3OA 5G3YA 4XYMA 5D3ZA 4RVCA 5BOSB 4AP9A 5A3VA 4PF1A 3ILVA 1H5QA 1JDBB 2V0GA 2JRCA 2H5JA 2REXB 2ZIVB 3GLFE 2P2LA 3A4LA 4QSMA 1KZ7B 3EVEA 1KP9A 1SIUA 4FFLA 3TVDA 1K86A 3OOHA 3GXBA 3UO2A 2G1AA 5THXA 4UREA 4A8PA 5IH3A 2AMYA 2WTAA 1E32A 4ZT3A 3K1YA 1E2BA 3LUFA 3RJ5A 1SULA 3ZLJA 3KBBA 2H4JA 1Q0PA 2P65A 5KOHA 2JPDA 1UPCA 5IYZB 3NCTA 3Q15C 2QJOA 4G6ZA 4IIUA 1KOJA 4ZD6A 3SC2B 1XQ8A 4B31A 4HAOA 1JH9A 5ER6A 3U7RA 2G83A 1MFPA 3LHFA 2YVQA 4QG7A 4LDNA 2OCHA 2XUDA 2PKCA 2ZI5A 3QMVA 3K20A 4GKKO 5CFNA 4J0CA 2ZJZA 1U28C 2EU8A 3C3DA 1J8FA 2VHVA 2RBEA 5T67A 3NEPX 1YSCA 1QNFA 3MW8A 3ZU4A 4FHZA 4QUDA 2PKEA 5E4JA 4HWPA 4OCZA 2R62A 3Q40A 3NU1A 2WVAA 4PSKA 4CTMA 3ILHA 2IBTA 4KLCA 3K1TA 4CFZA 5ES4B 2BFFA 4GKJB 4MKZA 4OIFA 3SYNA 5T3UA 4TYNA 1ZO8A 5K2MA 3WRXC 5KNBH 4S2EA 3W2EA 3JYPA 3Q2IA 3TXXA 4D9EA 1LDNA 4A82A 1T1JA 1ZSPA 5DVZA 2ZQ5A 1F51A 3GA0A 1X80A 4DQLA 4NP6A 1SESA 4BO5A 4PA7A 4LRSB 4D44A 1YKFA 1UWZA 3GUUA 2PJUA 5LZ4A 1RR6A 4QVGA 3CGWA 3P0FA 2O3SA 1I5EA 4WESB 3WU2Z 3AM3A 4II3A 4TYQA 1RM0A 2QTHA 2VHEA 3E8GA 5PGMA 4RORA 3DC7A 3RW0A 3PR2B 1EXMA 4MR9B 2ZDGA 2VEDA 4DE5A 2C4UA 2GM5A 3HI6A 2BOBC 4EFBA 3LZCA 3ZWKA 1BXZA 2PKXA 4TMKA 1RXSA 1TKAA 5H8WA 1ZK0A 2RN9A 4X1YB 4MGIR 1QHIA 4AC9A 3QA9A 3U5ZB 1H5UA 1OXVA 1ZZGA 4WZAB 3DD1A 3W7XA 3KNZA 4EFLA 2JVIA 1R0XA 3VPAA 2FPRA 1EEHA 4KQHA 3CB4A 2DM6A 4R84A 3AG4C 1JHAA 4FDTA 4AJKA 5BV2P 3DH1A 5AM0A 5F2NA 1N5LA 3T99A 4OQYA 4MRPA 3PNPA 3CO0S 2X19A 1TYAE 2DBZA 1A7KA 1W4AA 4BO4A 2IS4A 4DMCA 3G1TA 2OCAA 5BWMA 3GDHA 1R3UA 3E2PA 2JCVA 4HMOA 2OBFA 5DXAA 3IVRA 2WU0A 1JQ5A 2D8AA 1E2DA 2HLHA 3OJXA 1EDBA 3L8GA 1LRJA 2Q9LA 2I8CA 5L3QA 5SY9A 3SNKA 1XVLA 4GBED 1Z5OA 2QY9A 1WKVA 4C2AA 3E8HA 4BNNA 5CFRA 3G6BA 1HZJA 4A7PA 1OYYA 1GG9A 4Z7JA 1X87A 1LB1B 1RYZA 1KERA 4D9GA 3FB5C 2ZYDA 1QIHA 5H59A 5ECDA 4K0KO 3REOA 2JFWA 4AJ9A 3MAGA 4A5SA 3BWCA 4CTOA 5IK2D 3UUFA 4EUSA 2VYFA 3P96A 2XQJA 1AV7A 2XLBA 2AQ8A 2ZT9B 3GO4A 3GMDA 4FZRA 4M1YA 1MOQA 1FYWA 4V3BA 2Q9UA 1P1KA 3OJWA 4K3AA 4PIVA 3TOSA 5B3SC 3SS9X 1ZGJA 3KT3A 3G2QA 1Y1QA 1OLUA 2ZTHA 2GJKA 4XM1A 2ZDIA 3OQBA 4NY1A 2BCJQ 3R7AA 4JT9A 1T9GS 1SXJC 2ISQA 4N54A 2KJQA 5ALWA 1X1TA 4AL4A 1V3TA 1PJ4A 1FDTA 5BSMA 1PK9A 5LGUA 5KI6A 5B37A 4DSNA 1FK8A 3ZJTA 1M7HA 5F5XA 3EGWA 2YEVA 1Q77A 2OHHA 2PEYA 5CYGA 2QVBA 3PJDA 1RWNA 4HAWA 2DWPA 4Q3LA 2DPXA 4BKMA 4B74A 2DKFA 3PPXA 2VYVD 3WTBA 1OFHA 4J0DA 3Q8WA 2YZ7A 4PX3A 2ZEJA 1NZJA 4IO0A 3ICOA 5CT5A 2HJFC 3OIUA 1X8KA 3RFUA 2GCGA 4U9HS 2B98A 4UEJA 4Q19A 3LM8A 4WIFA 2NO5A 3OZXA 4R2KA 4B44A 1N5KA 3LFHA 4DLPA 3UXYA 3FNEA 3PQEA 2G9RA 2Q1XA 2P9HA 4LOHA 2XMZA 3PC8A 5BQ3A 3EXEA 2DERA 3A37A 3VO9A 1LI7A 1M5UA 3EA0A 3W9YA 1E7RA 1AO3A 1MC4A 4NG4A 5BVHA 4D4GA 3HLYA 3B77A 4H08A 2VBCA 4DQ0A 2CN1A 1QBZA 5HXAA 2ZANA 4TPKA 1QVRA 1BS9A 3AVYA 1GQYA 2I2BA 5ABPA 4ZTZB 1G3UA 3UQ8A 1Z28A 1WUHS 4Q9LA 2I4MA 4D42A 2JJ1A 5TMBA 4PNZA 1NY5A 5KOJA 3OTWA 1B04A 5LQRA 1MHTA 2JJ2A 1WPXA 1XU9A 1TYZA 3QSYA 2R5NA 3AINA 4XQEA 1XVAA 1KY4A 3OAAG 1J0XO 2V58A 3CZRA 2WNIA 4JR1A 5CVTA 2C07A 1YU9A 2AJ8A 3TRIA 1O9GA 4R3WA 2GCOA 1OZAA 2VQDA 2HJRA 2I54A 2XAFA 1E0KA 3O0DA 4O8YA 4OHKA 3GFBA 1N3IA 3K94A 4IIGA 4KI7A 1FDSA 4C01A 4YRJA 3CCBA 1VPWA 1WVGA 3RKUA 4DYLA 4L3VA 1RZUA 1RS0A 2WM2A 4X0EA 4M0DA 3O26A 3NZEA 3H2GA 4Y30A 2ZSHA 3EEIA 3CUKA 3LDHA 4JP3A 3U4AA 3KZXA 3L82B 3L6CA 1H9CA 3RUIA 1RRGA 5JG7A 5JHGB 1WZEA 3NONA 2D2IA 3E3MA 2OO5A 2JBAB 3F8TA 5AK5A 1EZJA 4BO7A 4J9UE 3S1LA 2ECPA 3OOSA 2K7FA 2J3EA 5H70A 3THYB 2V65A 1L7DA 2IXAA 1XZ8A 5G1NA 4Y2TA 1GGMA 3LCUA 1KQOA 1JR9A 2FPGA 4LG1A 2EIKC 4G8JA 5I45A 1T13A 4M53A 5BMOA 4N7RA 2H08A 1PJBA 3AG1B 2C0PA 1ZI8A 3NRCA 2YMLA 4TS4A 3VBCA 4FLVA 5DNAA 4WKPA 2PMFA 2ECOA 2HCJB 5D3MA 3INRA 3B8FA 1Q7GA 3ZHBA 4DEVA 4Z4CA 3F97A 3CX3A 4N4AA 1SBTA 2WRZA 1YCDA 4RHTA 1GG8A 4CH3A 2PUSA 4C6RA 4DLWA 3HVJA 3BE8A 1TAEA 3KT0A 4PAOA 1SA0B 1ULUA 3BXZA 2NUPB 4XJXA 1XNRB 3ZXYA 3FPEA 3ZHYA 2XYHA 1KO4A 2UXDO 1Q7EA 3FY4A 4MV6A 4M0PA 4CLXA 1FEZA 3FUUA 1LZKA 3I8XA 5JSFA 4GX0A 4ZVRA 3N8KA 4PPYA 2P3QA 4DA6A 4MLZA 1ISPA 5BWBA 2BT4A 1M5IA 4PAGA 4X00A 2DOSA 3FX2A 3BWYA 2JGFA 5LQAA 3BULA 1V1MA 3RSHA 1LI5A 4F2WA 2VT3A 2ZREA 5JAQA 4Q00A 3ANSA 1SK9A 4J6EA 4F12A 1C3LA 4QIWF 3JRWA 2EAUA 4RGBA 1ITZA 3UB4A 2G6TA 1KKLA 3C15C 1C30B 3W0LB 4TWAA 1X39A 1DBRA 2QD4A 3LHIA 3OPVA 4KIFA 2XMDA 1E1QD 4ZXPA 1X1CA 5C51B 4GQIA 5B30A 3EMKA 2YSUB 3M3HA 2I2DA 2VZ9A 1WXQA 4XX0B 3H1TA 3UATA 3AR3A 4JZKA 3WR5A 5BY1A 3CCCA 1X7XA 4D25A 3LUTB 2G6VA 1FLDA 5IT4A 3H5IA 4Z9FA 1GFWA 3U10A 3PNLA 5JCXA 3CGGA 1N5MA 5U4QA 5I4CA 4PGAA 1ZOPA 1I2CA 4CMEC 3TFWA 2UZ3A 2YYAA 3X43A 3MCWA 3VH1A 1AHPA 1L1FA 1CX9B 1DFGA 2OHJA 3ZDQA 1DP4A 2OMEA 4JYAB 1XLWA 1C3EA 4WFEA 2EP7A 4PVDA 1KETA 1GKIA 3HB9A 4CMGA 4HEHA 3QTCA 3WJ7A 2WK1A 1OF1A 1O6FA 4ZYTA 1WB9A 2NSHA 3VO8A 3P2OA 4BECA 4YDSA 4G4JA 4L2IB 2GESA 3K6SA 1XMXA 3T1CA 3ELUA 2PW9A 1Y8CA 3UHPA 4R1SA 5FH9A 1B0ZA 3ZCSA 3CVJA 3THWA 4D80A 1N5DA 2GLTA 1NNI1 3FA2A 4DLZA 1MIHA 3SQNA 3GLFA 1W4CA 1JPUA 1FMCA 5EXSA 4BLWA 1Q6ZA 3P2KA 4BBJA 5AKZA 2FPPB 5FX2A 4KHPO 3ZCXA 1CDOA 4DF3A 2RDMA 1A76A 5TJ9A 5EC1C 3U31A 4DSOA 4CKWA 1YGYA 4KZPA 4WNYA 2R6HA 2ERXA 4KMRA 5H5NA 1IOVA 1F4PA 4K8RB 4E4TA 1KAEA 2IYEA 1XCJA 3VR4D 5JSUA 3WKCA 2DZDA 1P0MA 3EGIA 3A4TA 4R8SA 1VCOA 1RM1B 3OPNA 3T9EA 1KBHA 4WCFB 4Z54A 3E9MA 2WLLA 4KSBA 1Q0RA 3H2IA 5A02A 2QLMA 1ZUNB 2Y0BA 1PV4A 2CLEB 1G3MA 3UHOA 4LMBA 1TA4A 5D5QA 3HCFA 2ZCJA 3NTOA 1F5NA 4XCQA 4P0PB 5KNCD 3SJCC 1YQUA 2IK8A 1KSGA 4EBBA 1Y5LA 2BCGY 3JQ8A 3LRPA 2FX3A 5F51A 4LOJA 3KSBC 4E6PA 2EQAA 3OU6A 2BM8A 4MI6A 3HJAA 1Z6TA 3KUXA 4D7AA 2CXXA 3Q7EA 4O4JF 3CH4B 3RR2A 4DR7B 5CYPA 3WG9A 2FPMA 3G6WA 5DNDA 1XTPA 4N3BA 2JIOA 3H4VA 3QYPA 4LYFA 4GMFA 3IR7A 1KMQA 3PNQA 1KOLA 4RS3A 5AKKA 2WMOB 3BD8A 3DH0A 2FGJA 1F12A 1GU7A 3FWNA 5IF3A 3LX5A 1ZR4A 4X1IB 4GYWA 1W96A 1W5SA 2HSEA 3H6GA 4ZARA 5IT9N 3GJZA 3W7SA 5CT6A 4CF4A 4D99A 1W0JD 1RPNA 2XB6A 4NYIR 2EF1A 1WM1A 1RMTA 5TEWA 4K7JA 4AICA 4AXXA 3GEHA 5DOVA 1DLBA 4M36A 1NF3A 3RYIA 5LHHA 4C88A 3DV0A 1HTWA 4RKRA 4JI5B 4BRSA 1J97A 3B9PA 4PCUA 3CTMA 5HUHA 3D36A 1M6YA 1NW3A 2QJRA 1A8UA 4C5BA 3RG2A 3KSDO 2REQA 4U6QA 1QIFA 3F9RA 1NVKA 1N0HA 4OSEA 1I32A 4U0KA 2R1VA 4AN4A 1MG5A 1VLHA 1JEAA 2JHGA 4AWBA 1HDJA 5COAA 3G5AA 2FF7A 4YDQA 1A9TA 1EINA 3T5PA 2VK2A 3RAJA 2NZVG 2QRKA 1VF6A 2AN1A 2AR0A 1Z0ZA 1MXFA 3QBTA 3OQ1A 6REQB 4M46A 4I6JA 5KJ6A 4KXLA 4KIGA 3D6VA 3VNUA 4KLNA 3RUCA 1JG7A 2WUWE 4AY6A 3QXCA 4TV8F 4RY0A 2DBVO 4H9GA 3IBCA 3I0ZA 5LB4A 3UFXB 2I3GA 1R15A 1KQPA 1V1JA 5CT9A 1CNMA 1U2DA 4AMZA 2OA0A 4ZCMA 1NOJA 2JBHA 1Q6YA 5HZMA 4J4BA 2P0AA 3QE2A 3NTUA 4PZUA 2ZYVX 2AZXA 4JI4B 1NC3A 3ICVA 3IC9A 3SS7X 3G2NA 2P06A 2I66A 2RAPA 2VWPA 3CNQS 1D3AA 2WYOA 1U4OA 2X42A 3JVUA 5KYVA 1PWXA 5DHUA 3KFLA 1Z4LA 3SZ3A 1W5EA 1S2NA 3OAAA 3H5LA 1FW6A 4EKEA 2F90A 4ZYLA 1IBMO 3LLVA 5A2QA 2HWYA 4EELA 3CX7A 3HNPA 2F48A 4OHMA 3L46A 4GSKA 1KJYA 1Y8RB 4M9SA 2FL4A 4Y2HA 2PL5A 3NUZA 2CTQA 1FU4A 4BO1A 1NQWA 3UJ8A 3DOCA 4IJ5A 1RQXA 5JJIA 3ZZUA 5KTTA 1BE0A 3KWFA 2YINC 3TSCA 5EIFA 2JFBA 3H16A 2YCBA 1NXSA 2WYVA 4GRDA 3PNYA 2HHHB 1YS9A 2ZJ1A 2Y05A 1Z6ZA 2O8NA 4Q4AB 5EAIA 3URMA 3TBHA 4UQLA 1G21E 5B12A 4JYBA 3HFGA 4X91A 3PEUA 1AKEA 3WE7A 2XHZA 5H0IA 2QW8A 5K4HA 3A9CA 5TX7A 3OT1A 3VKVA 2VP2A 2EVWX 3EX7C 3KM0A 2ZWVA 4PC6A 1ZESA 3LS2A 3R0VA 4TGLA 4NVPA 1ZCFA 2I55A 3ASOC 2AF4C 1GGFA 5EEHA 2OZVA 3U80A 2VPIA 1HYGA 4LV5B 4L9RA 3AK4A 3VV3A 1BS2A 3W3AA 1W0KD 1N6OA 2AA3A 2Q73A 1YZLA 4QU5A 1GITA 4NKGB 2BRUC 4L0MA 2ZU6A 1L7EA 2PY6A 1QCYA 1BHAA 4TRMA 2DYRB 3FPKA 2VYQA 1UODA 3TLEA 2WABA 1ZUHA 1AZLA 3J7AC 3R5KA 1Y48E 1F8YA 2C2HA 2WMNB 1SXJD 1BQZA 3BILA 2CW5A 3WMRA 1YJBA 5F2KA 1Z0DA 3DUFA 1XZPA 1FDVA 3PFHA 1BGVA 2HFKA 2BMVA 1L5LA 5EC2C 2FUKA 2C61A 4B73A 3NETA 4RXTA 2UVPB 2YXEA 4ER7A 5CNKA 1WZCA 1DSSG 1E58A 4WLFA 5CIYA 3NWOA 2Q8QA 1ZBQA 2ZXUA 3PNVA 1KEUA 3UUWA 1T2FA 1IATA 3GIDA 4A6EA 2FCRA 3ORFA 4DYHA 2ZYGA 2PH7A 4EQZA 1M8PA 2DT8A 3TVTA 4C6TA 3TLGA 2ISCA 4RD6A 1YTFD 1IK6A 3E9RA 5TQ0B 1EFUA 5HFJA 4RENA 2PZKA 4QVKA 1XLTC 5KPDA 3CPSA 2OBXA 4ZYVA 3QLUA 2CFCA 1TF7A 4POOA 2VR1A 1HG1A 3TPFA 5CB6A 5ARDA 3D7NA 1MJNA 1FVXA 4LZZA 3K0AB 4OQDA 2QQEA 1BQ3A 4OFWA 4B8YA 1UM9A 4AHCA 1HTBA 3EHDA 3U40A 3LT1A 1V8DA 4Z8XA 1BKDR 4ZD5A 1QG2A 1ZXLA 2GPTA 4FMTA 2I87A 4F56A 2VNAA 2R11A 1E9FA 3A4IA 3V42A 4WFQA 5EJ5A 1CYEA 1ABEA 3RHZA 2YS6A 3IAAA 4NBVA 1C9DB 1JEQA 4X65B 4DJEC 4LF5O 3WIUA 2CXNA 4WIAA 3LGSA 4GPTA 2O5EA 1RI5A 1AB5A 2H18A 3FUCA 2X6RA 2XF8A 1QQBA 3TO5A 2IH2A 3T35A 1HM5A 4II2A 2I8AA 2B5WA 3O5AA 4DMHA 3RASA 3E61A 4IUYA 4IDBA 2KW5A 5JCJD 1JQJC 1R6BX 3RADC 1Q19A 5DX1A 1BHJA 2KSDA 3K35A 3HRIA 2MINA 4G01B 4C2TA 4JIGA 3FLMA 3ICWA 1GTSA 2WU1A 2ZZNA 4N48A 5H02A 2YL2A 4EKYA 1V16A 5EXTA 5KNBA 2GB4A 4F3WA 1HQDA 2QX9A 3C3YA 5F5NA 2GEVA 1I3KA 4IIJB 1GPH1 4D0GA 4CBVA 1I3OA 5KINB 2V7WA 3GROA 1Z4JA 5FAXA 4OKSA 1OH8A 5KTMA 5LZ2A 2Q2OA 1C9KA 5KCMA 2KM1A 5DYIA 3M6MD 4QTYA 3VMFA 4JQCA 2GO1A 3D7MA 5F1OA 5E1MA 3DV9A 1B0AA 1E9SA 1YQWA 1TVCA 1OIXA 5LMCA 3ZY3A 1NN0A 2XBUA 1SQ5A 1OH7A 2CEKA 4F5WA 2P4KA 3Q3VA 1YZQA 1OT3A 3F6CA 3ISJA 1P7BA 2OGUA 1JA9A 2W48A 2IYYA 1P0FA 3CO5A 1OXSC 4TYWA 4FE3A 3X1YA 2OD2A 1JFLA 1FLAA 1GZHB 3TR0A 4MQ6A 3ZKWA 1RWOA 4S04A 4Z9YA 1PGPA 1YRHA 5A3SA 2A1UA 3GYBA 2Z5GA 3JTMA 4Q4HB 4M2LA 2C9DA 3L77A 5JRJA 1WJGA 2NU6A 4PRKA 2FR6A 1Z68A 3G5LA 3FXAA 2ESRA 1MX5A 5ALSA 2QTRA 2A0KA 1KC1A 3SVTA 4LF9B 3M5WA 4GH5A 2RHOA 4BFSA 1THGA 5J47A 2I29A 2A9HA 2XGOA 3ABQB 3HNRA 2R6CA 5LGNA 3D8SA 4BZZA 2QX8A 1V41E 3WZLA 2JLSA 1Z37A 1P6XA 4GYJA 4MV0A 2QHXA 3HXTA 4RAOA 3BZBA 2JVJA 3DVLA 1BX0A 1T4BA 4X9QA 1USUA 1W4RA 4PR0A 3GB7C 5YASA 1R6DA 2MW2B 3V1KA 3HB7A 1XTSA 1VI2A 4LWOA 1JHYA 4MIYA 1G17A 3DMFA 1PQ4A 3FUTA 3X44A 1IN6A 2PZ8A 4ZT7A 4WBNF 1KMHA 5BN3B 2R6AA 2D4AA 2R68A 3C48A 3MRTA 4BU0A 4IDHA 1HO3A 2M7WA 2N47A 3USZA 4HNUA 4FXOA 2AEJA 3KPUA 3CWQA 5FNVB 4MDHA 1QP8A 1TT7A 2VHYA 1SG9A 1GSOA 4WFHA 4FZ0A 1ZU4A 1DC8A 4QGGA 1L0NH 3HVRA 4JVLA 3LJKA 2Q50A 1K98A 4Q15A 2EX4A 4I55B 3UWOA 2CGEA 4MARA 5FWAA 3N76A 2WIBA 1C50A 1QF6A 1RM5A 3AK2A 1KJ9A 3CVOA 3C14C 2CL0X 3V4OA 1Q1GA 1RLMA 5D3KA 3AWIA 4PLFA 4LJ9A 721PA 1N1DA 1T15A 4X61A 3RS5A 2E48A 2EDCA 3Q3JB 1WV1A 4L5YA 5A9RA 4W9NC 1V54C 5JECA 4ZDKA 2XQGA 4RYLA 3BE6A 1OKKD 3L8YA 1HT3A 4IDOA 2JI8A 1TC2A 3L1HA 3SZLA 3I37X 1VYTA 2ZJ6A 1FCJA 5A5DA 1ECPA 5ELMA 4EITA 2GSMB 4MO2A 5GAJA 4FUTA 4DV0O 4KITC 4AZTA 2Q29A 2HEGA 4H37A 4GI1A 2QJ1A 2A67A 2Q6IA 2CXTA 2VHUA 4HYYA 3VNRA 2R5FA 4DC0A 3FPGA 3GHYA 5T41A 2X5XA 2D8MA 1VHLA 2HOQA 4WVFA 4EB0A 2EX3A 2VDUE 4NFYA 1VPDA 2YY7A 3MJHA 3C1OA 5IVKA 1FS4A 3HVUA 2R72A 2NWQA 3L0BA 4ZALA 5ALIA 3TFOA 3IJFX 2XUQA 4DLLA 4FX2A 4LI3X 4KIJA 3CPEA 1UC9A 4IZIA 1Y1LA 4OXYA 2HH9A 1FFCA 3IYLW 4EM6A 4F3RA 4L15A 3AEQA 1OBHA 4IVNA 3NJRA 3W2FA 1EGVB 3P52A 5IXSA 4O2BA 4LFCO 2YXNA 4W1QA 4BMNA 2OCYC 3EUFA 1LC0A 2Y77A 1LF0A 3WLIA 1Z26A 4Q48A 4X6UA 5FPOA 4Y7DA 2IY7A 5CNIA 1A8PA 3R5TA 3LP8A 1R3LC 1WP9A 2EKQA 3AL3A 1ADGA 2Z4TA 2YWXA 1QRDA 1C9MA 2AUMA 2HJSA 4YRNA 3BMQA 3R23A 4OP2A 4RK1A 3TZQA 4IOLA 4W63A 1NI8A 2HDWA 4A5UB 1SQGA 2P27A 4UPDA 1F3OA 2OPBA 5JH7F 4ZJYA 4G1BA 2Z04A 4IMPA 1JDNA 2M6YA 3ZD6A 4KQEA 1XV5A 2YUTA 3EWAA 3ZY5A 1A5BB 1U98A 3LC7O 3AFHA 3CT6A 1AKQA 1FZQA 2MHCA 2HQ1A 4J6FA 1IJEA 1C1XB 3UQZA 4TUYF 4WLNA 2XAHA 3ADPA 1WPQA 4LIPD 4U00A 1EFHA 5DHSA 4Q12A 3U7GA 1ZCJA 2XAJA 2GSWA 4WASA 2EG9A 1TKCA 3KPYA 5MFZA 4JLJA 5AHKA 1GQ2A 4R7CA 3F96A 5ISMA 4C0HA 3V00A 1NVVQ 1DI0A 3T4DA 1BW9B 5FUYA 4P54A 4BKPA 4DA7A 2X58A 3SR3A 1WCV1 3AIIA 1WNFA 1TIYA 3B1KA 4DLXA 3E70C 2WEKA 1V8ZA 1E3QA 1R00A 3T9DA 1ORWA 4E30A 5KHAA 1WQ3A 3CEHA 1QJCA 2GK7A 2OG1A 5BRJA 1AKMA 4MS2A 3DPUA 5DBHX 4JI6B 3EHBB 5JVDB 1QTQA 1BE6A 4UHBA 1XEFA 2XTMA 1E8NA 4LWSA 3R6WA 4O59O 1SVUA 2A78A 4I5DA 5C7IO 2EFDB 1WCYA 1R6VA 3QFCA 2OD7A 4PLCA 3NT2A 2PDAA 2XE4A 2QJWA 4Z2YA 3I52A 1AN9A 2E89A 4GQBA 2X2FA 5IVDA 3Q3IA 1V37A 2WG0A 3AHIA 2WIJA 2VAMA 3M70A 5TT1A 1YDFA 3T4PA 1G21A 3AHDA 3SAJA 2BKUA 4UU7A 5AI8A 2IL1A 2PZAA 1RLIA 3TQFA 2C5SA 3DXXA 4DLTA 5AM3A 3K57A 3G3EA 2G7ZA 3NOXA 3KKPA 5ALQA 2H1FA 3HR0A 3G2HA 3BRQA 3CCQV 4HDKA 3LV8A 2Q28A 2P0EA 2YTZA 2PGAA 2HA3A 4RZ3A 1KYTA 1J5PA 2V4DA 1L5WA 4TV9B 2ZJFA 5IAOA 1IDSA 3BA1A 3EVBA 4A2PA 4PG8A 3AI7A 1P9WA 4YY3O 2GEKA 3OQHA 1I3LA 1XCPA 3KZ1E 4RIFA 5FXMA 3U44B 3FWYA 3FB8C 2B99A 2BI4A 2HQBA 5I51A 3DDSA 2XSZD 5EMKA 1EDZA 1XJWA 3EARA 1Q82W 3VUFA 2Y8EA 4RUFA 4U02A 3BCRA 3WK4A 5KMGA 2AC2A 5H5JA 3PUHA 1NP6A 2CNWD 3E22B 2AEFA 3AEKB 2VRWA 4UFOA 3IAM6 1AIPA 4B6FA 1JIVA 1HE1C 3LBYA 3ODPA 4BY9E 1PV2A 2ZRMA 1ZOIA 1X74A 2OQRA 4O8ZA 2M98A 2D2FA 5ALFA 1AF7A 1PW7A 3AOEA 3PQ5A 2Z57A 2IJHA 3SR2C 3I2HA 3OO0A 3Q3GE 2ZI4A 3I1FA 4DIEA 4FS8A 2MCFA 2FI1A 3CWZA 4NOKA 1MO3A 1SCDA 3M6IA 2CLFB 4AWAA 3SEAA 1AZWA 1KIFA 4WAUA 5GAOA 3KG2A 2EF0A 4FLWA 4NC9A 3EIHA 1CXZA 1A72A 5CK5A 2G80A 5JSZA 3U4QB 4B45A 4E88A 3FHOA 9LDBA 1W19A 1BOFA 3HDQA 5E2IA 1XXHB 1SBNE 2AL7A 2PUDA 4K9KA 1QR9A 4NNOA 1N2XA 3CZPA 4CM9D 2CDRA 4BEWA 2R9RB 1M8JA 4JHXA 4I9QA 1ZUD1 3H84A 4BO6A 4JROA 3IDQA 1D2AA 3O83A 3KQMA 3KYIB 2KLBA 1T8RA 3HSYA 5EBWC 2IV7A 3WV5A 3SPGA 3AB3A 3IPRA 4ZVQA 3KL2A 4JIMA 4M98A 1A4UA 4MDYA 1LSOA 4ZCTA 1RNLA 2I6GA 2OHGA 2WFLB 2LQTA 1P4HA 4E51A 1KQFA 2FP4A 4YJGB 1Y63A 1AN0A 3OHSX 1FMFA 1WCIA 4OJNA 1QNMA 2GRJA 4Y1GA 2RAUA 4EQ6B 3IOEA 2CUTA 5ICMA 3KU1A 4Q3OA 2FLVA 2VAPA 2BHRA 3QMPA 3UGKA 3HKEB 2H1IA 1XZJA 4ND8B 1MZPA 2GF9A 3GDGA 5HTKA 3FKSA 4IV8A 3DHEA 4C3UA 2HVJC 2Y93A 1QFJA 5AUPB 2HT6A 3V7UA 4M9UA 4E94A 5FLXN 2IOYA 3KYCB 2GAOA 1DG9A 3ZWYA 2ONCA 3HM2A 4YMIA 4K6CA 4KEAA 4WFFA 4RUKA 2W6JG 4MYUA 1GRVA 4PO1A 3F9IA 4RM2A 1ZRMA 2Y9MB 4BC1A 2BISA 3AP1A 2CUKA 2O8CB 3DW1X 1GZ6A 4RVHA 4IFIA 2FX5A 2Z58A 3TTUA 1ODCA 1GUDA 1NF9A 4DL9A 3RVSA 2ID7A 3F6RA 4D0SA 4R16A 4WXPA 1FP4B 2P9GA 1JEYB 5AMXA 3NX4A 1DARA 4W4LA 2RSLA 4JJKA 5J4KA 4ZQBA 4CEJA 1YC5A 4PBTA 5AR1A 2LE0A 3T15A 1NSYA 1V1RA 3ZEAA 3JALB 3NBKA 3ENNA 4GPAA 4XOIA 2ZT6A 4L9WA 1M1NB 1CRPA 1YAHA 4CV0A 3OCZA 3NP7A 5KA6A 2VDMB 5AW8A 3CSDA 3FTCA 4CQMA 3P3NA 1U2GA 1Z5PA 4OQFA 4EB6B 4BVJA 3MDSA 2B6HA 3BPZA 1E63A 3TOVA 3V6MA 5KHKA 1ZH0A 4KFUA 5IF9A 5HS4A 3VX8A 4BFXA 3I6ZA 1BMFD 4X71A 3ZQ4A 1A27A 3HKBB 4KRGA 1QFMA 5GGXA 2GI4A 4TWIA 1T1EA 3SD7A 1ORVA 1TUIA 1JQBA 4TWZA 3ETDA 3L71H 4O4HB 4YWHA 4YJFA 5EIBC 3IT1A 3RARA 3IUQA 1J8VA 3KB6A 3E0QA 3HYLA 4UBJA 2II6A 2F93B 2P9JA 4KDFA 4KLZA 3RIMA 3KYDB 5LMNO 2AYXA 5JXGA 2ZT5A 3JV7A 5LJLA 4B7UA 4S1OA 3TUIC 1I33A 1S8NA 1QVVA 2BBSA 3CYFA 2CLMB 4LZNA 3IR6A 2GUGA 3TWOA 1IM5A 1LTHR 3F6SA 3H86A 2DAPA 2CTPA 2CCKA 4TS1A 4KAFA 4KWEA 3VSCA 2NZYA 4ILEA 3C87A 1YTUA 3FOEC 4Q9AA 3CURA 1NMXA 4D9JA 5J2UF 4LA4A 1NW9B 1FE8A 1E2UA 1J23A 4BVBA 4KUGA 5EP4A 3EISA 3GAFA 1LBHA 1Z0SA 1AB6A 4KQWA 1GT6A 4QUIA 4OL9A 1I3NA 2V7VA 2G9UA 4EMSA 3K5HA 5FQNA 2B3JA 2A79B 2IIPA 1RWPA 4ANFA 4HF7A 3K3WA 2OAP1 1YJ8A 3PP8A 1A9PA 2HNKA 3OA2A 5ECYA 3W5AA 4P5EA 1X94A 1H2XA 3AVVA 2WHRA 5EMMA 4B6EA 2J4FA 5EQTA 1MPTA 5MGBA 4UUPA 3S2FA 5HKLA 1SC3A 2YRWA 3FZYA 2QMQA 4YRSA 4ACAA 3BMNB 3CJRA 1JG1A 2VDWB 5IBCA 1OH5A 4D8YA 1AS2A 5JJCA 2QA4V 2H3EA 5EZYB 4W8OA 3MIIA 3R7DA 2Z5LA 3A9WA 1DEKA 1F17A 2EKBA 4D5EA 3SC4A 1SOWA 2DRIA 1W9MA 3IHTA 5JCPA 1CR2A 4Q6WA 2XXAA 4OSPA 3P26A 3L0OA 4H1WA 1B6SA 4RH0A 4WZZA 1J1IA 4Z7NB 3PRYA 1UQUA 1SIWA 4ZVSA 3M7MX 1MC1A 2PSHA 5IFLA 1ZP6A 3ZI0A 4I4TA 4WV3A 2OT5A 4YRPA 1S3FA 3LX8A 1PBTA 3VYTB 4U2EA 2ZR0A 5E6SB 3DCYA 1BEUB 3W2TA 4MR7A 1KVSA 4PG4A 4Q0MA 5IKMA 4HVAA 1K63A 4U7GA 2PUBA 1SVKA 5A4JA 1LLDA 2PYIA 4UM5A 4C7XA 3E9NA 1Z56C 5M59B 1N7IA 2BKAA 4DWWA 4MW2A 5I9LA 1Y6GA 4NCIA 2JAXA 4J7AA 4NCBA 2C0QA 3ITEA 4DIBA 3RROA 5KNDD 1OXUA 3PUYA 3O91A 5D5HA 5E6RB 3PRJA 2HK9A 3U3MA 3RUFA 2JATA 1AGNA 5EZSA 3EVKA 1E3SA 4QQNA 4GUAA 2FR8C 1EIZA 1NBIA 2NU7B 1ESNA 1NVTA 2GXAA 3HUDA 5E2BA 1Y66A 4MUGA 1RPZA 3QO8A 5ECWA 3P32A 1UXGA 4JKOA 4WFJA 3N2IA 3FX7A 1JZQA 1MDBA 2YIAA 5JALA 2O20A 5IT9A 4NMLA 3FMIA 3QVGA 4OHBA 1KI1A 3QLJA 3RFVA 4I7ZB 1G38A 2RHGB 2X9QA 1JT9A 2HJVA 4QUHA 2LVBA 1SBCA 1QE5A 3K1AA 4JTCB 2SKDA 5BPHA 1G0NA 4ND4A 1K7CA 4F9TA 1R4NA 3AVXA 2J5BA 1Z0KA 1H2RS 2HPVA 2GBGA 1Z82A 5FOUA 2QRJA 4UB6Z 3GCGA 2O95A 3R3SA 2RCVA 3OMLA 3BN3A 5DM60 4R2IA 4MUKA 2RPZA 4LJ6A 3L05A 3AXTA 4UE2A 2D1QA 3LPDA 1Q0LA 3H2ZA 4RKEA 1WHTA 1US8B 3K8ZA 1ZVKA 2QU7A 4EI8A 2ACKA 3GEMA 1Y7PA 2QR2A 3S40A 3L18A 1Y34E 3QFSA 3BH1A 3K9CA 2NVBA 2JI9A 5AXCA 1JHUA 4MQLA 2HYIC 3R6GA 4ZFNA 2B4KA 4QBGB 2B30A 1JZTA 4LQCA 9ATCA 3OJOA 4IDCA 4BWAA 1RPOA 2Q8VA 1SEPA 4I19A 2QA5A 4ERXA 1J1ZA 2C2BA 3FYHA 4Q6BA 2XYVA 1OOEA 2VBFA 3N2GA 2MSLA 2K6GA 1F4NA 5SZJA 4IUBS 1OFIA 3Q8MA 4WJLA 1UBGA 2L69A 4HDSA 4PCAA 5J2TA 4X6LA 1P9OA 1JVBA 1ZVMA 3WIBA 3M7IA 4YEDA 4RVUA 2DBRA 1B14A 2B1IA 1QLEC 2F59A 3L8DA 3H5AA 2N3ZA 2WWTA 1WETA 2LPMA 4EG7A 3NC0C 3AI3A 1GN8A 2VL7A 4UM9B 4UVEA 3S27A 5ARBA 2KB0A 2RGXA 1EVJA 5SYMA 5MFPA 4O2AA 1D1QA 3L4SO 4ARSA 4RULA 5BYBA 1E7QA 3ZHRA 4ZCIA 4WZBB 1AQJA 2P6MA 3MOIA 3WHKA 1W59A 3FGOA 1N78A 4KRXA 1L1QA 1USWA 4OBBA 2B7CA 3ONWA 5KBYA 1U7TA 4QNNA 1SU4A 5A9GA 5FOQA 5EQDA 4I3HA 3K0DA 2G9QA 1N0VC 5AD1A 3NS7A 4P80A 3JAMA 1ZRHA 4FN4A 1JR3A 1VL0A 1Q6UA 1D03A 1MH1A 4NZPA 2ZW9A 5MN6A 3OTQA 3MN1A 1I6WA 5K8CA 4B3IA 2JGNA 2V7QD 4KFCA 4L08A 3QG1A 2B37A 4LE1A 2YMPA 1GR1A 5DM1A 5CUQA 1U96A 2AEMA 3V8BA 4XGNA 1GNPA 2GWHA 4QEDA 1UMCA 3MWEA 1V8PA 1TIKA 4EPWA 3SDLA 3YASA 2DWOA 1V55C 3GLHE 3U61B 1XPJA 2QM7A 3KRTA 4FGUA 1FTGA 1MP0A 2BF4A 1V7PC 3G0CA 3LGAA 5K8VA 2CF6A 5EN4A 4N9WA 1ZITA 5JJEB 1NH2B 3SE7A 2YX1A 1Y3IA 4R54A 3NC4A 1OI7A 3I9FA 4G28B 2QMYA 3AKEA 2ZUCA 3CFYA 4GPIB 3WLPA 5AJYA 3ND8A 1JV2B 2CJYA 2DHRA 1JH8A 5BV8A 1H3FA 2EQ5A 1AUVA 1FTQA 3HXPA 1MSDA 4PNHA 5KLVH 1M1XB 2ZNVA 4IOJA 5KKAA 3H1LH 2GRAA 5FUXA 1WQ1R 4JC0A 4X8MA 5IVHA 1U0BB 2J1LA 1P9NA 1L7OA 3DO8A 4MZDA 2AS0A 2C1XA 1E3IA 2P7HA 3P9KA 5BMVF 3M6UA 3OFND 4YXWG 2E82A 5EPOA 5JT1A 1WKBA 4DUGD 2FUCA 1R4AA 1I4DD 2I6FA 3MFQA 1I7QB 4RTNA 5A1TA 3A06A 5L3DA 5DN9A 1S4MA 3O1LA 1Y33E 3C6BA 5B3KA 1L5VA 2OVFA 1B8NA 2A0XA 2PL9A 4FDLA 4L4UA 1G55A 3O65A 5C3UA 4GG1A 4S1TA 1O96B 3ESAA 4MV5A 4GDFA 1TJ4A 4HZUB 5HKBA 1A4RA 1DCFA 5IKEA 4YQYA 1BO6A 5EGNA 1X1DA 1TUBB 4FNMA 3NTRA 4NFLA 1BVUA 4RK0A 4ZP1A 4DC1A 3JD3A 3LWZA 1QTRA 4PU0A 3SBOA 3HJFA 4YK7A 4GS5A 4MUXA 4KQ2A 1VF5B 2HP8A 3EVGA 1QCEA 1S3JA 3K6RA 4K8ZA 4P35A 3CVVA 3X1WA 2E75B 4FD3A 2Z9CA 4Q02A 3G49A 2BGKA 5IBRA 4YYEA 4IJWA 2YOFA 5EVJA 4C07A 2J3JA 4HGNA 4X3CA 5ESDA 4OM7A 5L3EA 2YKGA 1OYVA 3KUDA 3L6DA 5LP6C 4P5DA 3TOCA 1SU6A 1PQYA 3GLIB 1M56C 5JZBA 1ACMA 1V9PA 4B6RA 2CVZA 3P2IA 3R44A 4KV7A 4M8NE 2OBYA 2REBA 3SQOA 5JY1A 4HMPA 1JPVA 1Z7EA 1SY7A 4LZLA 3GRVA 5INTA 2QD1A 4MAMA 1RYHA 3AWDA 4YRMA 3O75A 4NS4A 4F86A 1E77A 4YHHB 3H83A 3HJTA 4OYYA 4CQNA 5JROA 1IZ8A 1E9VA 5FPPA 3SYCA 4O4LB 2IQIA 2Z2KA 4OH7A 4B84A 3ELWA 1UBTS 3GRCA 4EJ0A 1C80A 4P98A 1ATZA 4FR5A 1P18A 5IAEA 3LSYA 2GYWA 3TNFA 2Q9CA 1XHXA 4YALA 3TOXA 3BMCA 1SQQH 2VZLA 3E7PA 3A1CA 3VR6A 3W5DA 1PJCA 4A8JA 1R5NA 2EINC 2IITA 3TCUA 1FFTB 1G5IA 1RWKA 1Y9DA 2C8KA 4TTRA 2EWVA 3T1TA 3HYRA 1WY7A 1RKBA 4A2QA 1IUKA 4GR4A 4ZOLF 2NW6A 4YMGA 1K6JA 5AM4A 3R8XA 1NF2A 2FFQA 3DEYX 4EECA 3W06A 1M2FA 4AI6A 1MZEA 3EEFA 4XLTA 2UYOA 2GR9A 3OMAB 3P1JA 2QAGB 4OGLA 1PR1A 2QVCA 4Z49A 3TX6A 1KR5A 1EG2A 4P0TA 1YZBA 3CLUC 1M0TA 2HFJA 2DVMA 4MQ5A 1NYRA 3A7EA 3BGDA 2QR3A 2JLVA 3WGMA 3TB6A 3I9JA 1CQZA 4UVIA 2JHPA 4MYSA 4G23A 4UHEA 4YQEA 4BRZA 5JPDA 1UFVA 1XRMA 3EZ6A 1DZ3A 3JAWA 1Y4ZA 3P5BA 3GRKA 4CT0A 4U7DA 1XAGA 4MWCA 4U6SA 5IM4A 2IH1C 4FCTA 3NR2A 13PKA 2BF7A 4DCGA 1A5TA 1FRFS 2P9BA 1JQLB 1UXIA 1Y3BE 2H4YA 3PX2A 4F3YA 1EPUA 3WMFA 5LQMA 4YP9A 4RIIA 4D96A 3VR3A 3DOIA 3WBKA 2RG7A 5JWPA 1IN5A 2PYLA 4PY2A 2FZEA 3MBOA 3K96A 1NOKA 2APJA 1XCGB 5D51S 5H6RA 3M9WA 2A1IA 4AKSA 3NIWA 4OCLB 1T8SA 4O5OA 1UPTA 1YQGA 3JZIA 5EIBD 1M6VA 3E15A 3OX1A 4LS3A 2RAVA 4H1UA 4TL6A 2B9EA 1PUJA 2I6QA 5F7JA 3T9FA 1PF7E 4FUQA 3WLNA 1PAUA 4UW9A 1NVDA 3DE4X 4KWTA 3VYUB 4BCDA 1SB8A 5ED4A 5T6MA 1E79G 3THSA 5BXZA 1J22A 1C7ZA 4BXOA 1U9IC 2YDEA 2OP1A 2K1EA 3SGIA 5AVYA 2A0FA 3BQMB 5FEUA 4P3OA 5BN4A 3SC3A 3K15A 3CF6R 3H1JH 5LYYA 3A8TA 4MQEB 3ZHUA 4CFSA 5KA5A 2JNWA 4TZ0A 5FJIA 3NTQA 3RBAA 3WWZA 2A3RA 2CXOA 4UEKA 2VI5A 3GRAA 1L6RA 3KAKA 1I7PA 3NTLA 3O1JC 2R6GA 1Q86W 3EXIA 4QO8A 1JILA 5GTDA 1SCUA 4NCKA 1DCKA 3SEQA 3BGVA 2H51A 2X6TA 1K8XB 2V1DA 1LD3A 5IVPA 1OC4A 5IJ9B 3NR7A 4LF8O 2P9CA 421PA 3VX4A 3RU9A 1LQUA 3T06B 2JIBA 3QEOA 3K4QA 3TSWA 1QH1B 1KQNA 3N05A 1YBVA 3C39A 3EJWA 2VSFA 3BB3A 1OV9A 2B35A 4DLSA 3QE0A 1OAOA 1IOLA 2AG8A 4HNAB 1P9RA 3MAAC 4GLOA 4DV2O 5C1PA 4Y6QA 4B3BA 3JQAB 4G9GA 4ZDJA 3RTAA 2B7BA 5KX5F 1YIAA 1Z15A 1F6BA 3DO6A 3W8FA 3KFVA 5GINE 5IJXA 1XRSB 2AKYA 5BPFA 3ZIAD 3FNRA 2BZ0A 4TKVB 1HRDA 4YAUA 5KPJA 4XWWA 4WEQA 4IRUB 3M4JA 1ZSYA 3A3NA 3B82A 5JBIA 3QJYA 5ICGA 3E83A 1X1AA 2VA8A 2P1RA 4FJ0A 2A4KA 1QHGA 1XTIA 4R51A 4KVZA 3F2IA 2E1PA 2IU6A 2P79A 2X6AA 4P0QB 1W5AA 3ZWOA 2ATXA 7REQB 1R5TA 1S1CA 1B43A 2AW9A 1I0HA 1C4KA 3TZLA 2XXJA 4GZ3A 4LQLA 1ST2A 1HMYA 2FR0A 1ESCA 3SJAA 1LU9A 2ES4A 2WLIB 3UC9A 1CEQA 2P9ZA 4MWTA 4OLJA 3MQ2A 1L5HB 4K3VA 4C0QC 4U0JA 2ONKA 3D8CA 5EJ8A 4J1NA 5D7NA 4YWJA 5ICCA 2MMGA 3DONA 2NU8A 3B1XA 2XUJA 3HN6A 3EH1A 4GFDA 3TI7A 4QZVA 3A1FA 1LDEA 1YXBA 4J11A 4DBLC 2CH7A 3C6XA 2I3DA 2OEPA 3SJQC 3AT1A 1L5NA 3KIPA 4RA6B 2NYAA 3MS7A 1G66A 3UZUA 2XASA 4TMWA 1XEAA 3JAMN 5JR3A 4YMLA 3AK3A 1XX6A 4KVGA 3UKMA 3RQSA 4B4OA 3VYWA 2JFVA 3P4UA 1FFGA 3AQ4A 3OMWA 4B3XA 2JH9A 1CUDA 3AB7A 1HE2A 4I7EA 1Y89A 1WUJS 2NO0A 2PKQP 2IJJA 2A9JA 2MT9A 3TBFA 4FQ5A 3VTKA 1T4CA 1D6NA 1N34B 3DVRX 4RX1A 4EZEA 3T61A 1EHCA 3UUEA 5LBQA 3OZSA 3C85A 4QRIA 4AN1A 4BB0A 4XVCA 2A5GA 3PWTA 4RHXA 3U7QA 5DLEA 4YXWA 2QMZA 5LBIA 4PIPA 4UDYX 2WF7A 1Z2GA 4EO4A 1D6MA 1W581 3QWBA 1VMEA 1JMVA 1MN6A 3G9TA 2G63A 5GJWC 3ABTA 1C14A 4GOLD 3IDZA 2W43A 3HO1A 1P62B 1O03A 1UAGA 4Q9NA 4YRZA 1MVNA 4FSHA 2YUIA 4K6FA 3SKVA 2JFHA 5B5EZ 5KTYA 2M6SA 3IR5A 1QZTA 1JYSA 3ND5A 1PL4A 2J9FA 3QFFA 4CU2A 1NJ6A 4U9IS 2BEWA 3R3VA 5BWNA 1I9GA 4AZ0A 2ZT7A 3O4FA 3GJYA 4YJKA 2LGQA 4XPIA 3NIDB 3DFZA 3BIJA 2O0JA 4OEHA 2XRMA 3TZKA 1YR1A 2XCLA 2FLKA 3HP1A 1YJ9V 1TMKA 3D31A 3S2UA 2EZ8A 5LC1A 1E1LA 4OQ4A 4MOWA 2PUJA 2ZE5A 4RY8A 3KEQA 2ZTSA 5CA0A 3FTPA 4JLWA 3UH1A 2Z5VA 1JJIA 1A04A 2ECFA 3E23A 4QDKA 1JFTA 2ZK7A 3GLHA 2BR5A 2O8EB 1O77A 3QO5A 3I23A 4CLOA 3A6EA 1ZBDA 2LFRA 2VNIA 1JKJA 4OQZA 4LWQA 4GMHA 5B5SA 1TJPB 1XEXA 2R9AA 2HJHA 4QUJA 2A84A 2XAQA 1QKIA 2W2QA 3RBXA 4OPMA 2D3OW 1W5FA 1VYUA 1MB9A 1QR2A 3B8HA 1H0RA 4BMCA 4YP5A 4F72A 2OO3A 4WJZA 4YJ2F 2OXEA 4J0IA 3UF0A 4URYR 4WDRA 4DDVA 3T4ZA 4JI0O 5EA2A 1FDWA 4C7MA 2HGSA 3I2YX 1KI6B 1MEEA 4I4LA 3RABA 3UXMA 2RGNA 4AMUA 5BWLA 2G4LA 3BM5A 2BDTA 4PXAA 3GFSA 3H9VA 3W6UA 1OX5A 1EVEA 2IPOA 5IABA 1RQNA 1MORA 1U7OA 1UK9A 2F66C 1UBFA 3SHTA 4AJ4A 5CURA 4B3TB 1YE3A 4FYYA 2CDBA 3KWLA 1MOFA 3OGCC 3NHWA 4HH0A 2IH4A 3GZNB 1GJRA 2QN7A 1Z2CA 2IVZA 5LXTB 3GJ7A 4M1SA 1DPFA 5LSAA 3WRYA 4IWXA 5DBOA 5DTMA 3ESBA 1ZAKA 3KJHA 4MCJA 2B5VA 4PQTA 1DMSA 3CG0A 1UPBA 4MQBA 1FXUA 4JP2A 4R8KA 4TL8A 1ZZEA 1GPLA 2QMOA 5CMLA 1PNLA 4JASA 1HF3A 1N32O 1GLNA 2J3HA 2VQSA 5D1HA 4UHCA 2O7VA 3IAHA 2ADFA 3VR2D 2XH8A 3SZMA 1CJTC 3ROPA 2J32A 5CVUA 2WJ3A 4ZVPA 1NQ5A 4DG9A 3KO8A 3D7RA 3OZVA 1VPEA 5DTIA 3T1HO 4M76B 1ETUA 4TYPA 1D4FA 1FSFA 4B7EA 2RJ3A 2VNJA 4KOAA 2VJOA 3PF8A 3P9CA 2A0WA 3FSGD 5JYDA 5J5AA 4AG5A 2EP8A 1IIBA 1SXPA 3PITA 3M3DA 2ID8A 3ZDYB 5FLXA 1YJAA 1GTJ1 3UJBA 3V1LA 3LECA 1IJKA 1XZDA 1T0BA 1S5LZ 2JEXA 2YNMA 1ZL8A 2I6SA 2F62A 1PU2A 4PFJA 3U49A 1VQ6V 3BSYA 2CFSA 3ABMC 1LNQA 2OKGA 1Q1EA 4LOKA 3ZVNA 4FFSA 3NNSA 4R9RA 4ZIRA 2RHBA 3NO4A 1XMJA 2CHGA 5EI5A 1KJIA 3CC2V 1TUGA 2ODEA 3BZWA 4L3OA 1QR8A 5FOSA 1D9ZA 5CCEA 3U17A 3U39A 1VL1A 6Q21A 2PQ0A 1SVNA 4HQOA 5LBUA 4ZJUA 2AT1A 5CBPA 4OJTA 3P45A 4ZCPA 2GN8A 2VPZA 3U60B 5K4GA 4RZIA 3OEWA 4E22A 5JNWA 4M8IA 4IKEA 2BWJA 1PK7A 1ZH8A 1UWVA 3FHCB 3SQWA 4KPGA 3QNMA 4YS6A 5HIJA 4E11A 2GVDC 2OIGA 2NPOA 2H4ZA 2E4ZA 4PHZA 1VGVA 1FFAA 2CNBA 3VNAA 4OI2A 2AE1A 3DFMA 1D5NA 4URHA 2WSMA 3VR1A 2YFYA 5HIKA 4B9AA 1H2SB 4ZZIA 3BWDD 3TCKA 1REQA 2QTWB 3MTJA 3IAEA 3MC1A 4IJQA 3PJFA 3NLLA 2QN2A 2XUKA 3QYJA 4EH1A 4RZUA 5BR8O 2EYUA 2PUFA 5KYYA 4HX2A 3L8ZA 3EZLA 5ED0A 4C4TA 2XWBF 3LX4A 2GT1A 5BR1A 3EZ9A 1SUCA 2JCBA 4OPAA 3ZDRA 2ZB2A 1TVKA 1BD4A 4I8IA 1NRJB 5F2OA 3T4XA 1HL3A 2HWWA 1ZJ4A 4A1OA 5GIOE 2D4HA 2VOEA 1NVMB 5EE5B 2GPAA 3QF7A 2UZ1B 5AHWA 5IJAA 2I4NA 2R97A 3K4HA 2HHCA 1X7ZB 3WIOA 5JD4A 3NI2A 2QEQA 3C43A 4FYMA 1I7DA 1JXQA 1NONA 3INGA 2HDNB 4RHEA 2P5UA 5LOVB 3GL9A 4LTNA 1QRAA 4IFTA 2OAEA 1RI1A 4CKCA 2HO4A 2ZYRA 1YB5A 1LV8A 4QBKA 1WA8B 3H5WA 3C3PA 3PB3A 1N2EA 2ZNIA 1XXHE 2WJYA 4BMZA 4G07A 3DVAB 3TDKA 4DOMA 3TXYA 3CLUD 1XCBA 3RO7A 3UMGA 3K6KA 2AR7A 2VH2A 2W00A 2EZPA 2XDQA 4DR1O 1VL5A 3TMKA 1QFZA 4EY8A 1O95A 2PBZA 3OT4A 4Y1RB 5FFNA 2COEA 1CTTA 1N9ZA 1BWPA 1EFLA 2WWIA 1RP1A 1KZ9A 3OCCA 1KK3A 4KXYA 4EABA 4BJHB 5EIAA 5HFAA 5B1BB 1VSQA 2CYBA 2XRFA 3DHWC 3KKQA 2JVKA 2A5YB 5FP0A 2HIHA 4IHJB 3BJIC 1T6YA 2FSIA 4KE9A 3H0EA 5DX0A 4O1IA 1G59A 1D9XA 3AUFA 4FZ1A 3TM5A 3D81A 1W7AA 1DL5A 4RF4A 3VZPA 3GJSA 4NYMQ 4F0JA 3TTXA 4NU8X 4AY2A 4KR6A 3KCNA 1V9CA 4E0QA 4HDMB 3PEVA 5K8TA 3R0JA 1EQUA 3V34A 4NBTA 2J9RA 4Q4CA 2Y76A 3LUBA 5GVRA 3X2QB 1RHRA 3OIDA 3IUBA 2ZXFA 1RP7A 1SMKA 4KOEC 1R8YA 2PGLA 3ABOB 1L9XA 3BJEA 2QUIA 1SUBA 4G0OA 4E4EA 2MSWA 2E4AA 1I4TD 1TFRA 1W88B 5BSVA 4WVLA 1YZNA 1RBYA 2FG6C 3MS4A 4J07A 2HXVA 4K9LA 1S3SA 3OY2A 1TK3A 1PS8A 4LTMA 4A2CA 1E18A 2AN4A 4CUJA 3H97A 2BLNA 2PVSA 3WWCA 4MEAA 2FHPA 1T2NA 5DBIA 1JX6A 4MCAA 4BO2A 5T4EA 5IRCD 2EULA 4XB6B 4XIYA 4G5SA 3H9UA 5A5EA 16PKA 4P3PA 4UCVA 2IP1A 3ZBTA 4X62O 3SLKA 1ODKA 4TMYA 3IVCA 2GXUA 1H0HA 2VHTA 1G20B 3N5KA 1YI2V 1QYDA 1Y1SA 2FR5A 1JKXA 10MHA 4L0DA 1KNQA 2FWBA 1QK5A 5JBNA 1NMQA 4JC5A 3UGTA 1K9VF 1X7GA 2CJXA 3TIIA 1M72A 1VKRA 4BR6A 2FSFA 2L82A 2D6FA 4KSYA 1UJWB 1AA9A 1CWUA 2GDSA 4QAJA 1FSSA 4JSTA 4EFKA 1WVIA 1J5XA 1CV2A 3PDIA 2FVYA 3JSNA 5DJ5A 1R6KA 3MTQA 3WNBA 3OJ0A 4LXHA 3DT8A 4YDRA 2FSVC 5KYTA 2PH5A 2CNOA 3MHTA 5LMZA 2Y0DA 5A6VA 4KVFA 3ND7A 1GKYA 1PG5A 5HJEA 4TQDA 4EDFA 4JK3A 3TLMA 4XYLA 3FAKA 4XRGA 2OBLA 2Q0SA 4G9BA 4GECA 1MA3A 5FPYA 4MSQA 3TB4A 5TQVA 1SRYA 3A9VA 2QWPB 3AKZA 3D6NB 2FPUA 2GEBA 2ZI9A 1RJ9B 2EV9A 1JQ0A 5BNIA 4TM8A 1J8YF 3FM9A 2GNPA 2Y1GA 4DQKA 2R96A 2VTBA 4PNPA 1SKQA 1P4JA 2X3YA 4Y8VA 4PGMA 4C0XA 4NYJR 1UBUS 4EWLA 1J8QA 1NVWQ 2NUTB 4P81A 3EBOA 1YUNA 1YI1A 2V7GA 4R5HA 1IZ3A 1R27A 4WHMA 1VL6A 1DDGA 3M1AA 3DO5A 4O29A 2EIJC 1P6QA 1TTQB 4QUAA 4X7RA 5DSTA 3QBDA 3DLBA 1BQ0A 1UK8A 1DWQA 1E7YA 2QBYA 4GOXA 1W94A 3K32A 2NN3C 4D8VA 5T8KC 1R9GA 3RWOA 1EZZA 4K1LA 3ESCA 2I2CA 4PXYA 3UK7A 4E5KA 4WUTA 2RMKA 4M22A 4OXXA 4RAIA 1Y5MA 1RAFA 1Z8DA 4D92A 3NHRA 1ILWA 1N8TA 2XUGA 5FA8A 3NEJA 2IZ0A 2YCLA 3IDFA 3ILXA 4DRYA 1OFUA 2XZOA 2I65A 2G70A 1CUUA 3D0OA 3AL2A 1S9DA 2BHLA 2WF6A 1WB5A 1RQ2A 3FTNA 3IDOA 4RQFA 2OENG 2I7DA 3JPYA 2DFKB 3LY5A 4RLSA 4ON9A 4Q37A 3A2KA 4DV7O 3TNYA 5LQCA 4HBNA 3CEAA 5AW2A 4WZAE 3VU9A 3TXSA 1IRIA 4MVZA 4I1PA 3KU4A 5LD2B 5JQGB 2SKCA 1FVFA 3BKWA 4RZXA 3JATB 4XYBA 3AESB 4DK1A 1SS3A 4ZD4A 1C3VA 2UUCB 1FQJA 4Q01A 1COWG 3PKIA 1THMA 2ADPA 1HYHA 1V47A 4YRAA 1K6IA 3IB3A 1H5NA 1IBLB 1TTPB 1YL7A 2WPDD 7ADHA 3N6VA 4QVIA 1GNVA 5KQRA 5FYDA 1OLXB 1LF5A 3OTOO 5IHXA 2XNSA 4QULA 2QUZA 1HI9A 1TADA 2JIZD 2L0XA 3UM9A 1SELA 2HR1A 4CM6A 2PH1A 3Q6NA 2QD2A 1UOOA 4CM5A 1XILA 3GDFA 1ABBA 1PJAA 3VHXA 1XKLA 3CCFA 3ZJYA 5FPSA 5DYNA 1V96A 1FDRA 3TE7A 3UOGA 3GFVA 4LWPA 2X3FA 3Q8XB 4DZZA 2Z2JA 3EIQA 1U8XX 1VRWA 1Y1KE 1DV1A 1QIEA 3FYUA 3L06A 5DI9A 4X95A 2A8NA 4IUDS 1O58A 1CY8A 2ONYA 3E03A 3CRRA 5CPBA 2PRIA 3IUJA 1YKGA 5GGYA 4F4FA 1FIUA 1MHPA 4J7JA 5AW4A 3MD0A 3TJZA 4DBVO 2VWQA 3PFWO 4JB3A 3TI9A 4B8WA 3OH8A 1XN4A 2HNBA 3EZNA 3RJ9A 2C2YA 5LA6F 3KZIZ 1XRRA 1ONBA 5AKJA 4Y6SA 4HQFA 3FLAA 1OI3A 1NBHA 1NA5A 2PR2A 3IERA 4JLSA 5DXJA 1S5JA 1CF2O 1VIVA 1UBOS 3L43A 4N41A 1DG3A 3K09A 4YUWA 1KPGA 1KZ1A 5EE3A 1PD1A 1N0JA 1WPRA 4M3NA 3VOBA 5KKCA 4D9NA 1HQYE 3NBZC 1XHEA 3NXSA