5H5NA

The crystal structure of the ns1 (h17n10) rna-binding domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
71
structure length
71
Chain Sequence
EPNPTTIAFQVDCYLWHLKKTLSMMGEVDAPFEDRLRREQKALKGRSMTLGIDIQSATQEGYYKIKSITEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NS1 gene from bat-derived influenza-like virus H17N10 can be rescued in influenza A PR8 backbone
pubmed doi rcsb
source organism Influenza a virus (a/little yellow-shouldered bat/guatemala/060/2010(h17n10))
molecule tags Rna binding protein
molecule keywords Non-structural protein 1
total genus 30
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5h5nA00
4LF8O 4JYAO 2N74A 1HNZO 2UUCO 4JI5O 3T1YO 1NS1A 1XNQO 4DR5O 1YZBA 1FKAO 5BY1A 4LF7O 4LFAO 5A2QN 4YY3O 1XMOO 1HR0O 2DOSA 2VQFO 4DUYO 1J5EO 2ZM6O 2DJVA 4DR6O 4DR1O 4DR4O 2UUAO 4DV7O 4GKJO 1AILA 4DV0O 4DV2O 3J7AU 1FYJA 4X62O 2UXBO 4DR7O 5LL6Y 1A32A 2HHHO 1N34O 4DV3O 1HNWO 4JI8O 4LF6O 2Z0AA 3JAMN 2E5LO 2ZKOA 4DUZO 4OX9O 1N36O 1R1BA 1X59A 4JI3O 2UXCO 1AB3A 3OTOO 4LF5O 1IBMO 4DV5O 2VQEO 3SDLA 5BR8O 4X65O 1KUQA 4DR2O 1HNXO 4B3MO 1I94O 1F7YA 4LF4O 4NXNO 4A5UB 3J80N 4DV6O 1XNRO 4X64O 3RT3C 3O65A 4YHHO 2UUBO 4KHPO 3M8AA 4JI2O 4B3TO 4B3RO 4LFCO 2AGAA 3J81N 1N33O 2UU9O 1R6TA 3F5TA 4DV1O 4LFBO 1IBKO 4JI0O 5FLXN 5H5NA 2JRIA 4JV5O 1FJGO 4K0KO 4AQYO 4JI4O 4LF9O 5BXZA 1DK1A 2F4VO 4GKKO 4B3SO 5IT9N 4X66O 2UXDO 4JI7O 5IWAO 4DV4O 4NXMO 4OPAA 4JI1O 2FKXA 4DR3O 2LW7A 1N32O 1D2DA 3R66A 4OPHA 4JI6O 5LMUO 1XEQA 1XMQO 1G1XB 5LMNO 3T1HO 1IBLO
chains in the Genus database with same CATH superfamily
4QJFB 3CXHF 1I7FA 2XAHA 2B9ZA 3AG2B 3ZEDA 5BY1A 1NBMG 1YTFD 4B3TB 3D8CA 4WFFA 3CCUV 4JF3A 2ZNJA 4XBFA 3TJTA 2V4DA 3ZRXA 4X89A 1PD3A 2QTSA 1Q6UA 1WAZA 3S3WA 3E8HA 1SETA 5CMUA 1Q81W 3W7UA 4DR7O 2PGGA 3C3SA 4TV8B 3E22B 4X9QA 4DV3O 4J7KA 5JWPA 1BS3A 4JAAA 4PDRA 3ZX6A 3AEIA 3ETQA 4JYBA 1AVMA 1AB3A 3KCXA 2Q73A 4Z2WA 2GV9A 2VQEO 4O4JA 2RQ6A 2ZNIA 4B3MO 2XUMA 4J80A 1VF6A 4ZHQB 4FFBA 5JVDA 1IVSA 2P4VA 2A0LA 1VQ7V 2QWNB 5JJNB 3ZMUA 3UO3A 3H1IH 5CBGA 4QE7A 3JCUZ 2ADPA 3M99B 4JV5B 2E5LB 4X88A 4TT3G 3CCEV 3K9AA 2EULA 2EIKC 2RMKB 1B06A 4K0KO 3CRCA 5KUKA 3I55V 4PDVA 2QWQB 4FLXA 2WLLA 1CXZB 3U11A 3MHSC 3ZCCA 3K06A 3HPLC 2AZ0A 4BIOA 2P22C 5LMUO 2R72A 2K9PA 5L3DA 3CCJV 1EM1A 2XAFA 4GCZA 2EILB 2NR5A 3T1YO 1VQ8V 4O4IB 1AR1B 1SQFA 4TUYB 4U3FH 4B3RB 2CTQA 4JYCA 2VQFO 1JX9A 2KQXA 1J5EO 3EHBB 3LDCA 1W0KG 1N33B 3WB2A 3ASNB 3CX5F 2OTLV 2WAMA 4YY3B 3JAKB 1PNLA 1S5JA 1QR9A 4JGSA 4UCUA 3L72H 1FD9A 2QE7G 2XOKG 1G6UA 1NU1H 1GM7A 4JASA 2P06A 3LSSA 2Q69A 3FB8C 4LF4B 4WBNA 2GTSA 4B7EA 1J95A 2HP8A 4X65O 1R3JC 3SPCA 3RVZA 3ZRWB 5J9PC 4FLYA 1EBOA 2YXLA 4I50B 2KKWA 4DUYB 1AI6A 5BMVA 4YHHO 3FFQA 4KHPO 3B77A 3QO7A 4JAUA 1QHTA 1CPYA 1XI1A 1DGSA 5KMGB 1L1FA 3CEIA 2JK5C 3AG1B 5KAIZ 5LP6C 1JMKC 3HKEB 4F4LA 1TUBA 4F6RB 4U7OA 1NH2B 2CTRA 2ZE6A 2YI9A 4LF7B 5EC1C 1U97A 3T1CA 1UPGA 3SJAC 3JASA 1YJWV 3OMAB 2ARHA 1QR8A 4DR3O 2LW7A 2V1DA 2XASA 1XHZA 2IU3A 4X1YB 1N4CA 5LHHA 5B5EZ 3RYHA 1XMQO 1YVWA 3MAQA 3K5NA 4TV9A 5FNVA 2Y0IA 2N74A 3JD2A 4MS2A 2UU9B 2X0LA 3SPJA 2CUGA 4PDMA 4CS4A 3G67A 2BOCC 1EN6A 1YTFB 4CS2A 2W0FC 4HZ3A 2XAGA 5KHHA 2YEVB 3L71H 2UUAO 1S0VA 2LFRA 4GKJO 4H33A 1BL8A 1AILA 4GZRB 5IJ9A 1GKFA 4OX9B 1GN3A 4O2AB 1KKDA 1CP9A 3HKEA 4WFHA 1Q8IA 5EC2C 4IHJA 4ZBMA 3JAWA 4UVAA 3OD4A 4X66B 3GWOA 1JVMA 2CE4A 1R73A 1OCRC 4YXWG 2ZE8A 4CH5A 3JAKA 1URFA 5GONB 4NB5A 3UO2A 2XHBA 2WLKA 1SC5B 4YJ2B 1VF5B 2QTOA 4L8JA 1BHAA 1TGOA 3A0RA 2JGDA 4F6EA 3CXCU 4LFAB 3O65A 2YICA 1BMFG 2ZR3A 4EFBA 1V55B 4EB6A 5ITZA 1VF6C 5B66Z 5IDJA 3ICXA 1H2LA 1R6TA 3AG1C 3K0GA 4DV1B 2A7WA 3H1KH 3K58A 4J7JA 1AJNA 5L3GA 4JI4O 2YUAA 4UV8A 1DK1A 1VQ9V 5IT9N 4JPRA 3SYPA 1RM1B 4R7CA 4FFKA 3ZRWA 4KP4A 2ZDIC 3ETEA 2OYQA 2BOBC 3BAAA 2KG7A 3QTCA 3ETGA 4O4HB 4UCRA 1PM9A 2JGDB 4Q6GA 4WFGA 4X64B 1YZBA 3SYCA 3BEHA 4H37A 4DR1B 2KB1A 4YY3O 4JZGA 5LGNA 4I5SA 2LGWA 3TETA 5CB4A 3CJHA 5IWAB 2GTAA 3E2EA 1RSOB 4BWAA 1BT8A 3TXSA 4UCVA 5L3FA 3K79A 4DV7O 1AROP 4O4LA 1FFTB 3CCMV 4WBNB 1XL4A 2UXBO 4RAIA 2WLIA 2H94A 3HKBA 2Z0AA 1IXBA 1XNQB 3THOA 3ZHQA 5LP6B 4DR7B 1IXMA 2YEVA 2A06H 1NR1A 3ABMC 4KHPB 4DV3B 3MDSA 2OIGA 4DYLA 3LDEA 5LA6B 4AILC 4Z1VA 2IH3C 2UXCB 3BA8A 3AK1A 3QVNA 1L8DA 5GTIZ 1JPXA 1AI7A 4DW0A 4DR5B 2M7WA 3SJCC 3LSUA 2JIZG 1W0JG 2WLHA 4ZOLA 2EILC 4JI2B 1XILA 2DMXA 4LFBO 2F23A 1YEWA 2QJ1A 3SPGA 4JV5O 3WU2Z 3HR0A 4NKGB 2UXNA 2EINB 3H1HH 3CRQA 3N2KA 1QVFU 3FYIB 1FXKA 5LXTB 2LGQA 3E8GA 1D2DA 2WPDG 1IURA 1WA8A 4PI0A 5BZBA 2OIEA 1G4YB 4O2BA 2C2AA 1R3KC 3U0ZA 4O2BB 1K4CC 2X7RB 3QG5A 4UCTA 2PTMA 3E83A 3ABTA 3ZRVA 2PF4E 1IBLB 2GHYA 4U3JB 4CH6A 1XMOO 1SZTA 4RWUA 4PDLA 2XNDG 3B8MA 4MW3A 3TK1A 1BZKA 1AJQA 1SERA 1B04A 3LSQA 2K1EA 1TA8A 5E1AC 1NVPD 1NZ6A 2NN4A 4JYYA 3H01A 5H6QA 1FXHA 2IJJA 3O9OA 4JI8O 4LNUB 2B5UA 4XDJA 4FM1A 1W59A 4HYOA 3ASNC 2FTKA 4MTFA 3AG4C 1MG1A 1R1BA 1VARA 4ZOLB 4I0XB 4PHZA 4I9QA 3BCCH 2D3OW 3NR7A 3ABLB 5KHGA 3D36A 4P2ZA 2JS3A 4LWSB 4IGGA 4DV6O 1RM1C 1JA8A 3RT3C 4X64O 5DN6G 1S77D 4FLVA 1VQ5V 3K9SA 2ZD9A 4GX1A 3DXRA 4MVMA 4TWKA 3G80A 3LNMB 2ILMA 1IBKO 3WB0A 5H5NA 1H2SB 1OHHG 2JRIA 5CA0A 1NTZH 3PN1A 5KUMA 2UXBB 4FFBB 4BIZA 2GDSA 4ZI7B 5E79Z 2V7QG 1SF9A 1NKDA 4N21A 1Q82W 3CC2V 2EIKB 3K08A 3HKDB 3TXQA 3ZIAG 4LF6B 2JGUA 3ASOB 4MVSA 4CBCA 4LNUA 5FPOA 1MOFA 5LGUA 1HNZO 5LOVB 1US6A 3ETDA 3H1LH 4LF7O 3GB7C 1DF5A 1E1QG 4G2KA 4Z1MG 1I08A 4O4LB 2RNBA 1SQBH 1HW7A 3QF7A 3RGBA 3OFNG 1OZ0A 5KX5A 4FLTA 3UQ8A 4X62B 4WFEA 2BTOA 1A32A 1VQ6V 2AZ2A 4G28B 4LF5B 2WSSG 2KSDA 1WB7A 1WA8B 4LP8A 2FMLA 2QKSA 3JALA 1XMQB 5GTHZ 5JCOA 4OX9O 1H2NA 3T1HB 1SESA 1N32B 2Y69C 1LUVA 4UB8Z 1ZLZA 3CMEV 4J9YB 4I0XA 4TSFG 5LOVA 1WJZA 5CBFA 1EN5A 4YJ2A 3SGIA 5LMUB 2OCCC 4UVBA 1F23A 3ZMZA 4JI2O 3KG2A 1KD1W 3J81N 3HKDA 3B4SA 3H1JH 2ZE5A 3D36C 1NTKH 2YS8A 3BA9A 2EIJC 2BTQA 1Q43A 1R6KA 1N0NA 1QCEA 1SQXH 1PNKA 1S5LZ 3FX7A 2UXDO 1K5QA 3OAAG 2YSUB 4J42A 1N36B 1CEZA 5LYJB 4JI1O 2Q6AA 4UUJC 2AHZA 4J11A 1UFIA 5GW7A 3OEEG 4OGQB 2CTWA 4HNAA 3CCRV 4ZI7A 1IBLO 5AG2A 1XDCA 3W7TA 1KC8W 1IZ3A 2QSAA 1ZUQA 1M56C 4UFZA 1GM8A 1XOUA 3AG4B 2ZM6B 3OTOB 3P3NA 1FS0G 5IJ0A 4YHHB 3BY6A 5EYPA 4X65B 4MT8A 1M57C 4D7TA 2DJVA 3MD0A 4DR1O 3APOA 3CWBH 4MVUA 3UKMA 1XHXA 5LL6Y 2BTQB 4ZIBA 1K97A 4FLWA 4K3AA 2LFSA 2QWOB 4MVRA 5BR8B 2EZPA 2H3OA 5JQGA 2QM7A 3LDDA 3NXSA 4DK1A 2Y4TA 4XDLA 5BR8O 5IY5B 3WG7C 1KUQA 4FZ0A 4H13B 2ZQMA 1AR5A 4QIWF 2ZIMA 2L6LA 2UUBO 1RFYA 2GUZA 4CH4A 1V54C 4CZZA 1G8MA 1BQZA 3E8BA 1TUBB 2LO1A 4F6RA 4DO2A 4LF9B 5JJEB 1EZVH 4YJ3B 3S3XA 1ZAUA 2DN9A 3CCVV 4X1YA 3CJHB 1OCCB 1Q90D 1NJIW 1YJ9V 4J7ZA 1WB8A 2P4KA 5KX5B 2QWRB 4DV5B 2YI8A 3W7SA 1MABG 3R65A 5EIBC 1AP5A 1E1RG 4O4HA 5EZYA 1OCOC 4ASUG 3KCYA 4GT1A 5B1BB 4GX2A 3Q4HB 4NXMB 1YHQV 1F4MA 2XT9A 5LHGA 1OCOB 2LW1A 1JJ2U 1KMIZ 3CRRA 3CB2A 5A2QN 2YIAA 1T5EA 2ADQB 3P30A 1JR9A 2E75B 4I55A 5L3BA 4RUEA 1P4RA 1H38A 2EBOA 4JAVA 4TQDA 2P67A 5JH7A 2HR3A 4D6TH 2WLLB 5B3SC 1QLEC 3SJQC 3UT5B 3UM7A 2HHHO 1HNWO 3K5MA 2Z5UA 1J5EB 1N36O 3ZHTA 3BVOA 1YCIA 1M90W 3RN4A 5LP6A 1IBMO 2DYRC 2E3CA 3CD6V 3ZHUA 1GO3F 2FB5A 1AR4A 3CCSV 3K03A 3VBBA 3D3QA 1XMOB 3DC6A 1SRYA 3BABA 3ZHRA 3M8AA 2PUSA 5CA1A 1M4UA 3IC9A 2AGAA 5IJ9B 3K0DA 3F5TA 3F7YC 3LUTB 1XL6A 4DV1O 4XDKA 3UCSC 5FLXN 3T4DA 2ETNA 1N0JA 3T4ZA 3JATB 3WFVA 2AHYA 4B3SO 2LJ2A 3IFXA 2CGOA 4DV4O 3L75H 4TQFA 2ZINA 3FB6C 1RP3B 5CN0A 4OPHA 3TCUA 4NTXA 2Y4UA 3M7MX 1SQGA 1HNXB 2OT5A 2DQ3A 2JDIG 2FYUH 2Q8VA 4YJ3A 1PV0A 1V9PA 4R6ZA 1O9HA 3I5DA 1E79G 1ROPA 2QM8A 4WFAV 5LXTA 2Q7EA 1SKVA 4LH6A 4TV9B 2IJHA 3N2KB 1WP8A 1V54B 4PA9A 4FPPA 3OUSA 2OTJV 4MW8A 5JH7B 4O2AA 2E74B 3ZRSA 1W2BU 3FB5C 2YIBD 5LBQA 2Q7GA 1PNMA 1WLEA 4LF6O 3RYIA 2JEUA 5KHKA 3RWRD 3AG7A 3OT7A 4LF5O 1H8HG 1Y76A 4DV5O 2ZXWB 3WB1A 4GX0A 1JCHA 1F7YA 1QU7A 3J80N 2ZCEA 3K5LA 2WA3A 2EZOA 4I7ZB 3SJBC 4DXWA 4QPKA 4QE9A 3JCZA 3DSQA 2HVJC 2HLDG 1WP7A 5KA6A 2WWWA 3LNNA 4J10A 1N34B 1K73W 4GKKO 1KKCA 4MSWC 4WFBV 2DWDC 4KFMA 4CH3A 5J2TB 4X66O 4JI7O 3AK2A 2R70A 1Q7YW 3KKYA 4JI8B 5J2UB 2YIDA 4I55B 3ZN1A 1LUWA 4B3SB 1VQPV 3E86A 5K1XA 2X6CA 3IC7A 4LFAO 3SR2C 2HHHB 4H0LB 2DOSA 5D5PA 3FAVA 1SS3A 4R50A 1XREA 5KMGA 2ZM6O 4DR6O 1Q6HA 1VQNV 2Q9LA 4L87A 3OGIB 4E4EA 2HJDA 2L35A 4FM0A 2X6AA 2VWJA 1WPBA 3IGAC 2PI4A 4I4TA 3SYAA 2HJFC 1S3JA 5IY5C 3JD3A 2NNUA 1XUQA 2HG5C 3T1YB 3AK3A 2ZKOA 4DUZO 3HKBB 1QNMA 4FK5C 1YIJV 3JALB 4X1IB 1NR7A 3SDLA 2D2CB 3F5WC 2FL4A 1COWG 2Q68A 3C3TA 5LA6A 1Y67A 4LF4O 1MSWD 4NXNO 3RBZA 3L70H 1BHBA 1KQSU 1SQVH 3KZIZ 1VEWA 5LHIA 2WLMA 1I94B 1GM9A 4B3TO 3EXAA 4TV8A 1IX9A 4EEQA 1MSDA 4CC5A 4IT5A 4NVPA 5IYDO 1XBLA 5KHIA 2M6YA 1GN2A 1JFFA 1FFXB 2XTAA 4LF9O 4KUMA 3FKSG 3VQXA 1SQQH 1LR1A 4DR3B 2DWEC 1K4DC 3E8FA 2CH7A 2BE3A 1M9NA 3AG2C 1HDJA 2A79B 1GAXA 2VQEB 5DM6V 5IYCO 4X8AA 2JEXA 4B3MB 4NTWA 1JJOA 5EBMC 2YC0A 1Q3EA 4EB6B 3ZBHA 2QWPB 4LCUC 1THZA 4DR5O 5H9CA 2CDYA 3CP1A 5FL7G 4P30A 1D5AA 1K8AW 3CRAA 1AP6A 1OJHA 3ABMB 1I5XA 5HFLA 4WCEV 4PI2A 4DV0B 4DV0O 3ABKB 4DRXB 1K33A 1GN4A 1KB9F 3AG3B 1QLEB 4LFCB 3ABUA 2W6JG 2KG7B 3JAMN 1JFFB 3B09A 2E76B 4UXNA 1ZWIC 1YI2V 1WN7A 1MZFA 1K92A 5LGTA 2ZE7A 3CSXA 1O9GA 4I4TB 3SYQA 2MK3A 5IJ0B 1M57B 1P7GA 3K3WA 3IAYA 1FXVA 1L0LH 4CS3A 3JAWB 5KA5A 3STLC 3Q4HA 4LWSA 2PY5A 4B3RO 1UJWB 4LFCO 1YF2A 5ITZB 1M56B 4U7NA 5EZYB 1L0NH 2EJ7A 2GUZB 1P49A 4FLZA 1RPOA 3RYHB 1YDXA 3VQWA 3G6BA 1Q6IA 3FB7C 1Q86W 1YITV 5C8YA 4UVCA 1R6NA 1MNGA 3DXRB 3ZHSA 1OV9A 2JS5A 2ITDC 4N23A 3JSLA 3X2QB 3E22A 5HFMA 5IWAO 4AQYB 1GN6A 2Q67A 3OUFA 2PYJA 1R3IC 3QO8A 1K7DA 1FFXA 2VQFB 5JVDB 3D3IA 4ZHQA 1I5YA 2ZIOA 1AI5A 3APQA 4B7KA 4BW9A 4HNAB 3A2FA 1VQLV 5B1AB 4AHCA 4PA3A 3CCLV 1XNQO 2RDCA 3WG7B 3CS5A 4K8ZA 2LP7A 1Y74A 1B6QA 1Y74B 1KP2A 3BHPA 3N27A 1OCRB 1TAEA 3CPWU 4LR3A 2UUBB 3ASOC 3TGUH 1NTMH 1PKXA 5F2VO 3H9VA 1WPXA 4PA6A 2BCCH 3J7AU 2HEPA 1FXKB 5LMNB 4E2LA 4JTAB 2DQ0A 1FJGB 4NXNB 2RN9A 2DYSB 3ZS8C 3MHHC 1AI4A 1ZTEA 5BMVB 1X59A 2UXCO 1F51A 5C8YB 4MTGA 3OE7G 4GKJB 2IU0A 1YSCA 2IW5A 3RVYA 1HNZB 4UB6Z 2UUCB 5L3EA 3CHXA 2Q0OC 1Y6XA 1H2MA 4DR2O 1JOYA 3U10A 1M1KW 1PPJH 4GX5A 1GTOA 1XNRB 4AI8A 2XAJA 5IYZB 2F93B 1RSOA 4BR6A 1Y76B 5D5QA 4IYHA 1VQKV 2UU9O 4U3JA 1K9MW 3CMAV 2BSKA 3RYFB 2QM4A 4IYIA 1IDSA 4H44B 2HVKC 3BFRA 4K35A 4X1IA 1HP8A 1XQ8A 3ZMVA 4NXMO 1GH6A 2AXTZ 2WLIB 2FKXA 1N32O 4ZKIA 4JI6O 4LFBB 4PJ0Z 4PD4F 1HNWB 2A9HA 4JYAO 1FAFA 3RYCA 2LQTA 5EK0A 4BW5A 2IM9A 3OR6C 3HKCA 4NYKA 1OCZB 3SPIA 2CGNA 2IH1C 2O57A 3GVMA 4FMTA 1S72V 4MVQA 3ABLC 4QPJA 4CC6A 4O4JB 2IBZH 3ZMSA 4EFEA 2GSMB 3EFFK 4I9WA 4DR4B 1KYOF 5GONA 2HKOA 2EIMB 2WA4A 5H2FZ 1VP7A 5CB4B 1M93A 5A9GA 5CBHA 3CYOA 4BAYA 2N05A 2YXHA 3F7VC 1S76D 2F4VB 1B3QA 2IJKA 2JJ2G 1EFRG 1P84F 5DEDA 2N04A 3X2QC 2QDOA 4PA4A 4X20A 1KP3A 3RYCB 3DGEA 5K1PA 1U96A 3ML0A 1Q5OA 4KL1A 1RPRA 3A0HZ 4AQYO 2DYSC 3OEHG 4JTCB 5IYZA 2F4VO 1VQMV 3FYEB 1KECA 3FD9A 1VMGA 4OPAA 3STZC 2OCCB 1GMGA 2ATKC 2PZSA 3B8NA 3DTUB 4HBNA 4MVOA 1OCCC 3QO5A 2CK3G 1ZL8B 1K34A 4JZ2A 1H2KA 2CAZC 3K04A 1IBKB 4LBEC 3RW0A 4JI5B 2UUCO 4JI5O 3OMIB 1VQ4V 1FKAO 1WNSA 2DW4A 2P7TC 3VQYA 3PJSK 4DW1A 1HR0O 3JD4A 3VOUA 2ZXWC 1KBHA 1TVKA 4GUNA 3N2GA 1NQTA 4P9PA 1F4NA 1Z5WA 3OW2U 1BGYH 1M5IA 2ODMA 3HKCB 1BE3H 4FZ1A 4DV2O 4X62O 1BCCH 1SQPH 5EIBD 2ZT9B 4RO2A 3E35A 4R8CA 1ENVA 2E5LO 2ITCC 1H8EG 2F1MA 2P6JA 4JI3O 1NH2D 5EBLC 1GK9A 4YIOA 4GLXA 5B3SB 3CRMA 1DF4A 1Z5VA 3L73H 1P7BA 4JI3B 1OCZC 4MTXA 4RUFA 3E89A 2UUAB 4B08A 1K5SA 2QR4A 4QGPA 2H8PC 1EN4A 1VIBA 4JYAB 5EYPB 1TVKB 1PP9H 3BRCA 2WLNA 4W4KA 3L74H 2QA4V 2Q4PA 1I0HA 2Q7HA 4JI0O 1SA0A 2Q0AA 4X1KB 3OR7C 4DR6B 3A0BZ 3K5OA 3B40A 2OWOA 5EBWC 4KXRA 4IIJA 2UXDB 3ZHVA 5CA3A 3HB3B 1VQOV 4JTDB 2QKCA 2QEXV 2OCHA 3JASB 4PA7A 4TOIA 3R66A 1NVPB 1KU9A 4NR1A 3CC7V 5CA1B 2F43G 2W0XA 4PELA 1AJPA 2F66C 3UT5A 3CE2A 1GRJA 1EZJA 4FM2A 3JD1A 2YXYA 1Z2GA 3JARB 1ZX3A 4TUYA 3BPZA 4O4IA 2DE0X 4UCSA 2YIBA 1QVGU 1S5HC 1TUEB 2F95B 2Q5ZA 4DUYO 2X6BA 4JI4B 1ZL8A 4DR4O 2RJZA 5B1OA 2AW9A 5B1AC 3W7XA 2EJRA 3JD0A 3RFRA 1FYJA 4DUZB 3N2GB 3ZMTA 1DLBA 4OXSA 4X1KA 1NI8A 1SA0B 3AG3C 3OM3B 4J9ZB 3SYOA 1PL0A 3JATA 3ABKC 3OTOO 5B1NA 1X4TA 4ICGA 3P3PA 3C90A 2DYRB 1D5NA 1HNXO 3L9DA 2Y0PA 1I94O 4DV7B 1VF7A 4DK0A 2HFEC 1QBZA 1XNRO 1QLNA 3K57A 1MZEA 2EIJB 4ABMA 4DR2B 1V55C 1QQCA 3JARA 4Q20A 5KAFZ 4G27B 4UCOA 2VWKA 4FLUA 2IJIA 4FJCC 1YXBA 5H6RA 4LF8B 4BIUA 3JYCA 1FJGO 4C7UA 5L3CA 5IE9A 5BXZA 3OGCC 2XAQA 4PV1B 4YIPA 2W6IG 4DV2B 2EX3A 2CH7B 4X20B 2YDEA 3W7WA 2PI5A 3FAVB 2CTPA 4GKKB 1BQ0A 1DTOA 1K3EA 2PYLA 2ZDIA 4NTYA 5FNVB 1HR0B 1XEQA 4K0KB 3T1HO 4K8XA 5KHJA 1H2GA 5C93A 4LF8O 4JI6B 3VQVA 4EKWA 1JQ0A 5IYBO 4W4LA 1NS1A 4DRXA 2A3QA 3G6EV 3EVKA 4JI1B 4QNHB 5J2UA 4FVMA 1YJNV 2NLJC 3B2EE 2ZR2A 3GWKC 4IHJB 4LC1A 1MA1A 5J2TA 1ZSPA 2Y69B 2QKAA 2G38A 4MVZA 4JI7B 2QGNA 4J41A 3JSNA 1N34O 3K59A 3T2MA 4GYCB 4UV9A 3I56V 5FPRA 2R9RB 2Z3YA 1MMMA 2EIMC 2VS0A 3P32A 4HAMA 2GBOA 4IIJB 3OTFA 1N8RW 1SZXA 5B1BC 4IL6Z 4FIPC 1PL4A 1IBMB 2JVDA 4A5UB 5JJJB 1Y4MA 4WF9V 2JJ1G 5DECA 5JCOC 2P5OA 4P9OA 4JI0B 1FXKC 2R9AA 2EINC 1N33O 5KLVH 2VRZA 4RQFA 5LYJA 2MW2B 3RYIB 1NT2B 4I50A 3ZN0A 1R3LC 2BSKB 3RYFA 3G4SV 3CCQV 5JQGB 3CC4V 1LNQA 4DV4B 2Y48A 4MTOA 1ORQC 1FPOA 3G71V 1Y66A 2B1GA 3QNEA 3IJ4A 2RCVA 3OMNB 3SPHA 1HWYA 5TISZ 4D7SA 4RQEA 2P90A 3ZJZA 4LH7A 2R9IA 5CA0B 4DV6B 2B1IA 3A8TA 1G1XB 3DC5A 1BSMA 2UXXA 2WLJA 5LMNO
chains in the Genus database with same CATH topology
4LF8O 4JYAO 2N74A 1HNZO 2UUCO 4JI5O 3T1YO 1NS1A 1XNQO 4DR5O 1YZBA 1FKAO 5BY1A 4LF7O 4LFAO 5A2QN 4YY3O 1XMOO 1HR0O 2DOSA 2VQFO 4DUYO 1J5EO 2ZM6O 2DJVA 4DR6O 4DR1O 4DR4O 2UUAO 4DV7O 4GKJO 1AILA 4DV0O 4DV2O 3J7AU 1FYJA 4X62O 2UXBO 4DR7O 5LL6Y 1A32A 2HHHO 1N34O 4DV3O 1HNWO 4JI8O 4LF6O 2Z0AA 3JAMN 2E5LO 2ZKOA 4DUZO 4OX9O 1N36O 1R1BA 1X59A 4JI3O 2UXCO 1AB3A 3OTOO 4LF5O 1IBMO 4DV5O 2VQEO 3SDLA 5BR8O 4X65O 1KUQA 4DR2O 1HNXO 4B3MO 1I94O 1F7YA 4LF4O 4NXNO 4A5UB 3J80N 4DV6O 1XNRO 4X64O 3RT3C 3O65A 4YHHO 2UUBO 4KHPO 3M8AA 4JI2O 4B3TO 4B3RO 4LFCO 2AGAA 3J81N 1N33O 2UU9O 1R6TA 3F5TA 4DV1O 4LFBO 1IBKO 4JI0O 5FLXN 5H5NA 2JRIA 4JV5O 1FJGO 4K0KO 4AQYO 4JI4O 4LF9O 5BXZA 1DK1A 2F4VO 4GKKO 4B3SO 5IT9N 4X66O 2UXDO 4JI7O 5IWAO 4DV4O 4NXMO 4OPAA 4JI1O 2FKXA 4DR3O 2LW7A 1N32O 1D2DA 3R66A 4OPHA 4JI6O 5LMUO 1XEQA 1XMQO 1G1XB 5LMNO 3T1HO 1IBLO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 O;  4JYA O;  2N74 A;  1HNZ O;  2UUC O;  4JI5 O;  3T1Y O;  1NS1 A;  1XNQ O;  4DR5 O;  1YZB A;  1FKA O;  5BY1 A;  4LF7 O;  4LFA O;  5A2Q N;  4YY3 O;  1XMO O;  1HR0 O;  2DOS A;  2VQF O;  4DUY O;  1J5E O;  2ZM6 O;  2DJV A;  4DR6 O;  4DR1 O;  4DR4 O;  2UUA O;  4DV7 O;  4GKJ O;  1AIL A;  4DV0 O;  4DV2 O;  3J7A U;  1FYJ A;  4X62 O;  2UXB O;  4DR7 O;  5LL6 Y;  1A32 A;  2HHH O;  1N34 O;  4DV3 O;  1HNW O;  4JI8 O;  4LF6 O;  2Z0A A;  3JAM N;  2E5L O;  2ZKO A;  4DUZ O;  4OX9 O;  1N36 O;  1R1B A;  1X59 A;  4JI3 O;  2UXC O;  1AB3 A;  3OTO O;  4LF5 O;  1IBM O;  4DV5 O;  2VQE O;  3SDL A;  5BR8 O;  4X65 O;  1KUQ A;  4DR2 O;  1HNX O;  4B3M O;  1I94 O;  1F7Y A;  4LF4 O;  4NXN O;  4A5U B;  3J80 N;  4DV6 O;  1XNR O;  4X64 O;  3RT3 C;  3O65 A;  4YHH O;  2UUB O;  4KHP O;  3M8A A;  4JI2 O;  4B3T O;  4B3R O;  4LFC O;  2AGA A;  3J81 N;  1N33 O;  2UU9 O;  1R6T A;  3F5T A;  4DV1 O;  4LFB O;  1IBK O;  4JI0 O;  5FLX N;  5H5N A;  2JRI A;  4JV5 O;  1FJG O;  4K0K O;  4AQY O;  4JI4 O;  4LF9 O;  5BXZ A;  1DK1 A;  2F4V O;  4GKK O;  4B3S O;  5IT9 N;  4X66 O;  2UXD O;  4JI7 O;  5IWA O;  4DV4 O;  4NXM O;  4OPA A;  4JI1 O;  2FKX A;  4DR3 O;  2LW7 A;  1N32 O;  1D2D A;  3R66 A;  4OPH A;  4JI6 O;  5LMU O;  1XEQ A;  1XMQ O;  1G1X B;  5LMN O;  3T1H O;  1IBL O; 
#chains in the Genus database with same CATH topology
 4QJF B;  3CXH F;  1I7F A;  2XAH A;  2B9Z A;  3AG2 B;  3ZED A;  5BY1 A;  1NBM G;  1YTF D;  4B3T B;  3D8C A;  4WFF A;  3CCU V;  4JF3 A;  2ZNJ A;  4XBF A;  3TJT A;  2V4D A;  3ZRX A;  4X89 A;  1PD3 A;  2QTS A;  1Q6U A;  1WAZ A;  3S3W A;  3E8H A;  1SET A;  5CMU A;  1Q81 W;  3W7U A;  4DR7 O;  2PGG A;  3C3S A;  4TV8 B;  3E22 B;  4X9Q A;  4DV3 O;  4J7K A;  5JWP A;  1BS3 A;  4JAA A;  4PDR A;  3ZX6 A;  3AEI A;  3ETQ A;  4JYB A;  1AVM A;  1AB3 A;  3KCX A;  2Q73 A;  4Z2W A;  2GV9 A;  2VQE O;  4O4J A;  2RQ6 A;  2ZNI A;  4B3M O;  2XUM A;  4J80 A;  1VF6 A;  4ZHQ B;  4FFB A;  5JVD A;  1IVS A;  2P4V A;  2A0L A;  1VQ7 V;  2QWN B;  5JJN B;  3ZMU A;  3UO3 A;  3H1I H;  5CBG A;  4QE7 A;  3JCU Z;  2ADP A;  3M99 B;  4JV5 B;  2E5L B;  4X88 A;  4TT3 G;  3CCE V;  3K9A A;  2EUL A;  2EIK C;  2RMK B;  1B06 A;  4K0K O;  3CRC A;  5KUK A;  3I55 V;  4PDV A;  2QWQ B;  4FLX A;  2WLL A;  1CXZ B;  3U11 A;  3MHS C;  3ZCC A;  3K06 A;  3HPL C;  2AZ0 A;  4BIO A;  2P22 C;  5LMU O;  2R72 A;  2K9P A;  5L3D A;  3CCJ V;  1EM1 A;  2XAF A;  4GCZ A;  2EIL B;  2NR5 A;  3T1Y O;  1VQ8 V;  4O4I B;  1AR1 B;  1SQF A;  4TUY B;  4U3F H;  4B3R B;  2CTQ A;  4JYC A;  2VQF O;  1JX9 A;  2KQX A;  1J5E O;  3EHB B;  3LDC A;  1W0K G;  1N33 B;  3WB2 A;  3ASN B;  3CX5 F;  2OTL V;  2WAM A;  4YY3 B;  3JAK B;  1PNL A;  1S5J A;  1QR9 A;  4JGS A;  4UCU A;  3L72 H;  1FD9 A;  2QE7 G;  2XOK G;  1G6U A;  1NU1 H;  1GM7 A;  4JAS A;  2P06 A;  3LSS A;  2Q69 A;  3FB8 C;  4LF4 B;  4WBN A;  2GTS A;  4B7E A;  1J95 A;  2HP8 A;  4X65 O;  1R3J C;  3SPC A;  3RVZ A;  3ZRW B;  5J9P C;  4FLY A;  1EBO A;  2YXL A;  4I50 B;  2KKW A;  4DUY B;  1AI6 A;  5BMV A;  4YHH O;  3FFQ A;  4KHP O;  3B77 A;  3QO7 A;  4JAU A;  1QHT A;  1CPY A;  1XI1 A;  1DGS A;  5KMG B;  1L1F A;  3CEI A;  2JK5 C;  3AG1 B;  5KAI Z;  5LP6 C;  1JMK C;  3HKE B;  4F4L A;  1TUB A;  4F6R B;  4U7O A;  1NH2 B;  2CTR A;  2ZE6 A;  2YI9 A;  4LF7 B;  5EC1 C;  1U97 A;  3T1C A;  1UPG A;  3SJA C;  3JAS A;  1YJW V;  3OMA B;  2ARH A;  1QR8 A;  4DR3 O;  2LW7 A;  2V1D A;  2XAS A;  1XHZ A;  2IU3 A;  4X1Y B;  1N4C A;  5LHH A;  5B5E Z;  3RYH A;  1XMQ O;  1YVW A;  3MAQ A;  3K5N A;  4TV9 A;  5FNV A;  2Y0I A;  2N74 A;  3JD2 A;  4MS2 A;  2UU9 B;  2X0L A;  3SPJ A;  2CUG A;  4PDM A;  4CS4 A;  3G67 A;  2BOC C;  1EN6 A;  1YTF B;  4CS2 A;  2W0F C;  4HZ3 A;  2XAG A;  5KHH A;  2YEV B;  3L71 H;  2UUA O;  1S0V A;  2LFR A;  4GKJ O;  4H33 A;  1BL8 A;  1AIL A;  4GZR B;  5IJ9 A;  1GKF A;  4OX9 B;  1GN3 A;  4O2A B;  1KKD A;  1CP9 A;  3HKE A;  4WFH A;  1Q8I A;  5EC2 C;  4IHJ A;  4ZBM A;  3JAW A;  4UVA A;  3OD4 A;  4X66 B;  3GWO A;  1JVM A;  2CE4 A;  1R73 A;  1OCR C;  4YXW G;  2ZE8 A;  4CH5 A;  3JAK A;  1URF A;  5GON B;  4NB5 A;  3UO2 A;  2XHB A;  2WLK A;  1SC5 B;  4YJ2 B;  1VF5 B;  2QTO A;  4L8J A;  1BHA A;  1TGO A;  3A0R A;  2JGD A;  4F6E A;  3CXC U;  4LFA B;  3O65 A;  2YIC A;  1BMF G;  2ZR3 A;  4EFB A;  1V55 B;  4EB6 A;  5ITZ A;  1VF6 C;  5B66 Z;  5IDJ A;  3ICX A;  1H2L A;  1R6T A;  3AG1 C;  3K0G A;  4DV1 B;  2A7W A;  3H1K H;  3K58 A;  4J7J A;  1AJN A;  5L3G A;  4JI4 O;  2YUA A;  4UV8 A;  1DK1 A;  1VQ9 V;  5IT9 N;  4JPR A;  3SYP A;  1RM1 B;  4R7C A;  4FFK A;  3ZRW A;  4KP4 A;  2ZDI C;  3ETE A;  2OYQ A;  2BOB C;  3BAA A;  2KG7 A;  3QTC A;  3ETG A;  4O4H B;  4UCR A;  1PM9 A;  2JGD B;  4Q6G A;  4WFG A;  4X64 B;  1YZB A;  3SYC A;  3BEH A;  4H37 A;  4DR1 B;  2KB1 A;  4YY3 O;  4JZG A;  5LGN A;  4I5S A;  2LGW A;  3TET A;  5CB4 A;  3CJH A;  5IWA B;  2GTA A;  3E2E A;  1RSO B;  4BWA A;  1BT8 A;  3TXS A;  4UCV A;  5L3F A;  3K79 A;  4DV7 O;  1ARO P;  4O4L A;  1FFT B;  3CCM V;  4WBN B;  1XL4 A;  2UXB O;  4RAI A;  2WLI A;  2H94 A;  3HKB A;  2Z0A A;  1IXB A;  1XNQ B;  3THO A;  3ZHQ A;  5LP6 B;  4DR7 B;  1IXM A;  2YEV A;  2A06 H;  1NR1 A;  3ABM C;  4KHP B;  4DV3 B;  3MDS A;  2OIG A;  4DYL A;  3LDE A;  5LA6 B;  4AIL C;  4Z1V A;  2IH3 C;  2UXC B;  3BA8 A;  3AK1 A;  3QVN A;  1L8D A;  5GTI Z;  1JPX A;  1AI7 A;  4DW0 A;  4DR5 B;  2M7W A;  3SJC C;  3LSU A;  2JIZ G;  1W0J G;  2WLH A;  4ZOL A;  2EIL C;  4JI2 B;  1XIL A;  2DMX A;  4LFB O;  2F23 A;  1YEW A;  2QJ1 A;  3SPG A;  4JV5 O;  3WU2 Z;  3HR0 A;  4NKG B;  2UXN A;  2EIN B;  3H1H H;  3CRQ A;  3N2K A;  1QVF U;  3FYI B;  1FXK A;  5LXT B;  2LGQ A;  3E8G A;  1D2D A;  2WPD G;  1IUR A;  1WA8 A;  4PI0 A;  5BZB A;  2OIE A;  1G4Y B;  4O2B A;  2C2A A;  1R3K C;  3U0Z A;  4O2B B;  1K4C C;  2X7R B;  3QG5 A;  4UCT A;  2PTM A;  3E83 A;  3ABT A;  3ZRV A;  2PF4 E;  1IBL B;  2GHY A;  4U3J B;  4CH6 A;  1XMO O;  1SZT A;  4RWU A;  4PDL A;  2XND G;  3B8M A;  4MW3 A;  3TK1 A;  1BZK A;  1AJQ A;  1SER A;  1B04 A;  3LSQ A;  2K1E A;  1TA8 A;  5E1A C;  1NVP D;  1NZ6 A;  2NN4 A;  4JYY A;  3H01 A;  5H6Q A;  1FXH A;  2IJJ A;  3O9O A;  4JI8 O;  4LNU B;  2B5U A;  4XDJ A;  4FM1 A;  1W59 A;  4HYO A;  3ASN C;  2FTK A;  4MTF A;  3AG4 C;  1MG1 A;  1R1B A;  1VAR A;  4ZOL B;  4I0X B;  4PHZ A;  4I9Q A;  3BCC H;  2D3O W;  3NR7 A;  3ABL B;  5KHG A;  3D36 A;  4P2Z A;  2JS3 A;  4LWS B;  4IGG A;  4DV6 O;  1RM1 C;  1JA8 A;  3RT3 C;  4X64 O;  5DN6 G;  1S77 D;  4FLV A;  1VQ5 V;  3K9S A;  2ZD9 A;  4GX1 A;  3DXR A;  4MVM A;  4TWK A;  3G80 A;  3LNM B;  2ILM A;  1IBK O;  3WB0 A;  5H5N A;  1H2S B;  1OHH G;  2JRI A;  5CA0 A;  1NTZ H;  3PN1 A;  5KUM A;  2UXB B;  4FFB B;  4BIZ A;  2GDS A;  4ZI7 B;  5E79 Z;  2V7Q G;  1SF9 A;  1NKD A;  4N21 A;  1Q82 W;  3CC2 V;  2EIK B;  3K08 A;  3HKD B;  3TXQ A;  3ZIA G;  4LF6 B;  2JGU A;  3ASO B;  4MVS A;  4CBC A;  4LNU A;  5FPO A;  1MOF A;  5LGU A;  1HNZ O;  5LOV B;  1US6 A;  3ETD A;  3H1L H;  4LF7 O;  3GB7 C;  1DF5 A;  1E1Q G;  4G2K A;  4Z1M G;  1I08 A;  4O4L B;  2RNB A;  1SQB H;  1HW7 A;  3QF7 A;  3RGB A;  3OFN G;  1OZ0 A;  5KX5 A;  4FLT A;  3UQ8 A;  4X62 B;  4WFE A;  2BTO A;  1A32 A;  1VQ6 V;  2AZ2 A;  4G28 B;  4LF5 B;  2WSS G;  2KSD A;  1WB7 A;  1WA8 B;  4LP8 A;  2FML A;  2QKS A;  3JAL A;  1XMQ B;  5GTH Z;  5JCO A;  4OX9 O;  1H2N A;  3T1H B;  1SES A;  1N32 B;  2Y69 C;  1LUV A;  4UB8 Z;  1ZLZ A;  3CME V;  4J9Y B;  4I0X A;  4TSF G;  5LOV A;  1WJZ A;  5CBF A;  1EN5 A;  4YJ2 A;  3SGI A;  5LMU B;  2OCC C;  4UVB A;  1F23 A;  3ZMZ A;  4JI2 O;  3KG2 A;  1KD1 W;  3J81 N;  3HKD A;  3B4S A;  3H1J H;  2ZE5 A;  3D36 C;  1NTK H;  2YS8 A;  3BA9 A;  2EIJ C;  2BTQ A;  1Q43 A;  1R6K A;  1N0N A;  1QCE A;  1SQX H;  1PNK A;  1S5L Z;  3FX7 A;  2UXD O;  1K5Q A;  3OAA G;  2YSU B;  4J42 A;  1N36 B;  1CEZ A;  5LYJ B;  4JI1 O;  2Q6A A;  4UUJ C;  2AHZ A;  4J11 A;  1UFI A;  5GW7 A;  3OEE G;  4OGQ B;  2CTW A;  4HNA A;  3CCR V;  4ZI7 A;  1IBL O;  5AG2 A;  1XDC A;  3W7T A;  1KC8 W;  1IZ3 A;  2QSA A;  1ZUQ A;  1M56 C;  4UFZ A;  1GM8 A;  1XOU A;  3AG4 B;  2ZM6 B;  3OTO B;  3P3N A;  1FS0 G;  5IJ0 A;  4YHH B;  3BY6 A;  5EYP A;  4X65 B;  4MT8 A;  1M57 C;  4D7T A;  2DJV A;  3MD0 A;  4DR1 O;  3APO A;  3CWB H;  4MVU A;  3UKM A;  1XHX A;  5LL6 Y;  2BTQ B;  4ZIB A;  1K97 A;  4FLW A;  4K3A A;  2LFS A;  2QWO B;  4MVR A;  5BR8 B;  2EZP A;  2H3O A;  5JQG A;  2QM7 A;  3LDD A;  3NXS A;  4DK1 A;  2Y4T A;  4XDL A;  5BR8 O;  5IY5 B;  3WG7 C;  1KUQ A;  4FZ0 A;  4H13 B;  2ZQM A;  1AR5 A;  4QIW F;  2ZIM A;  2L6L A;  2UUB O;  1RFY A;  2GUZ A;  4CH4 A;  1V54 C;  4CZZ A;  1G8M A;  1BQZ A;  3E8B A;  1TUB B;  2LO1 A;  4F6R A;  4DO2 A;  4LF9 B;  5JJE B;  1EZV H;  4YJ3 B;  3S3X A;  1ZAU A;  2DN9 A;  3CCV V;  4X1Y A;  3CJH B;  1OCC B;  1Q90 D;  1NJI W;  1YJ9 V;  4J7Z A;  1WB8 A;  2P4K A;  5KX5 B;  2QWR B;  4DV5 B;  2YI8 A;  3W7S A;  1MAB G;  3R65 A;  5EIB C;  1AP5 A;  1E1R G;  4O4H A;  5EZY A;  1OCO C;  4ASU G;  3KCY A;  4GT1 A;  5B1B B;  4GX2 A;  3Q4H B;  4NXM B;  1YHQ V;  1F4M A;  2XT9 A;  5LHG A;  1OCO B;  2LW1 A;  1JJ2 U;  1KMI Z;  3CRR A;  3CB2 A;  5A2Q N;  2YIA A;  1T5E A;  2ADQ B;  3P30 A;  1JR9 A;  2E75 B;  4I55 A;  5L3B A;  4RUE A;  1P4R A;  1H38 A;  2EBO A;  4JAV A;  4TQD A;  2P67 A;  5JH7 A;  2HR3 A;  4D6T H;  2WLL B;  5B3S C;  1QLE C;  3SJQ C;  3UT5 B;  3UM7 A;  2HHH O;  1HNW O;  3K5M A;  2Z5U A;  1J5E B;  1N36 O;  3ZHT A;  3BVO A;  1YCI A;  1M90 W;  3RN4 A;  5LP6 A;  1IBM O;  2DYR C;  2E3C A;  3CD6 V;  3ZHU A;  1GO3 F;  2FB5 A;  1AR4 A;  3CCS V;  3K03 A;  3VBB A;  3D3Q A;  1XMO B;  3DC6 A;  1SRY A;  3BAB A;  3ZHR A;  3M8A A;  2PUS A;  5CA1 A;  1M4U A;  3IC9 A;  2AGA A;  5IJ9 B;  3K0D A;  3F5T A;  3F7Y C;  3LUT B;  1XL6 A;  4DV1 O;  4XDK A;  3UCS C;  5FLX N;  3T4D A;  2ETN A;  1N0J A;  3T4Z A;  3JAT B;  3WFV A;  2AHY A;  4B3S O;  2LJ2 A;  3IFX A;  2CGO A;  4DV4 O;  3L75 H;  4TQF A;  2ZIN A;  3FB6 C;  1RP3 B;  5CN0 A;  4OPH A;  3TCU A;  4NTX A;  2Y4U A;  3M7M X;  1SQG A;  1HNX B;  2OT5 A;  2DQ3 A;  2JDI G;  2FYU H;  2Q8V A;  4YJ3 A;  1PV0 A;  1V9P A;  4R6Z A;  1O9H A;  3I5D A;  1E79 G;  1ROP A;  2QM8 A;  4WFA V;  5LXT A;  2Q7E A;  1SKV A;  4LH6 A;  4TV9 B;  2IJH A;  3N2K B;  1WP8 A;  1V54 B;  4PA9 A;  4FPP A;  3OUS A;  2OTJ V;  4MW8 A;  5JH7 B;  4O2A A;  2E74 B;  3ZRS A;  1W2B U;  3FB5 C;  2YIB D;  5LBQ A;  2Q7G A;  1PNM A;  1WLE A;  4LF6 O;  3RYI A;  2JEU A;  5KHK A;  3RWR D;  3AG7 A;  3OT7 A;  4LF5 O;  1H8H G;  1Y76 A;  4DV5 O;  2ZXW B;  3WB1 A;  4GX0 A;  1JCH A;  1F7Y A;  1QU7 A;  3J80 N;  2ZCE A;  3K5L A;  2WA3 A;  2EZO A;  4I7Z B;  3SJB C;  4DXW A;  4QPK A;  4QE9 A;  3JCZ A;  3DSQ A;  2HVJ C;  2HLD G;  1WP7 A;  5KA6 A;  2WWW A;  3LNN A;  4J10 A;  1N34 B;  1K73 W;  4GKK O;  1KKC A;  4MSW C;  4WFB V;  2DWD C;  4KFM A;  4CH3 A;  5J2T B;  4X66 O;  4JI7 O;  3AK2 A;  2R70 A;  1Q7Y W;  3KKY A;  4JI8 B;  5J2U B;  2YID A;  4I55 B;  3ZN1 A;  1LUW A;  4B3S B;  1VQP V;  3E86 A;  5K1X A;  2X6C A;  3IC7 A;  4LFA O;  3SR2 C;  2HHH B;  4H0L B;  2DOS A;  5D5P A;  3FAV A;  1SS3 A;  4R50 A;  1XRE A;  5KMG A;  2ZM6 O;  4DR6 O;  1Q6H A;  1VQN V;  2Q9L A;  4L87 A;  3OGI B;  4E4E A;  2HJD A;  2L35 A;  4FM0 A;  2X6A A;  2VWJ A;  1WPB A;  3IGA C;  2PI4 A;  4I4T A;  3SYA A;  2HJF C;  1S3J A;  5IY5 C;  3JD3 A;  2NNU A;  1XUQ A;  2HG5 C;  3T1Y B;  3AK3 A;  2ZKO A;  4DUZ O;  3HKB B;  1QNM A;  4FK5 C;  1YIJ V;  3JAL B;  4X1I B;  1NR7 A;  3SDL A;  2D2C B;  3F5W C;  2FL4 A;  1COW G;  2Q68 A;  3C3T A;  5LA6 A;  1Y67 A;  4LF4 O;  1MSW D;  4NXN O;  3RBZ A;  3L70 H;  1BHB A;  1KQS U;  1SQV H;  3KZI Z;  1VEW A;  5LHI A;  2WLM A;  1I94 B;  1GM9 A;  4B3T O;  3EXA A;  4TV8 A;  1IX9 A;  4EEQ A;  1MSD A;  4CC5 A;  4IT5 A;  4NVP A;  5IYD O;  1XBL A;  5KHI A;  2M6Y A;  1GN2 A;  1JFF A;  1FFX B;  2XTA A;  4LF9 O;  4KUM A;  3FKS G;  3VQX A;  1SQQ H;  1LR1 A;  4DR3 B;  2DWE C;  1K4D C;  3E8F A;  2CH7 A;  2BE3 A;  1M9N A;  3AG2 C;  1HDJ A;  2A79 B;  1GAX A;  2VQE B;  5DM6 V;  5IYC O;  4X8A A;  2JEX A;  4B3M B;  4NTW A;  1JJO A;  5EBM C;  2YC0 A;  1Q3E A;  4EB6 B;  3ZBH A;  2QWP B;  4LCU C;  1THZ A;  4DR5 O;  5H9C A;  2CDY A;  3CP1 A;  5FL7 G;  4P30 A;  1D5A A;  1K8A W;  3CRA A;  1AP6 A;  1OJH A;  3ABM B;  1I5X A;  5HFL A;  4WCE V;  4PI2 A;  4DV0 B;  4DV0 O;  3ABK B;  4DRX B;  1K33 A;  1GN4 A;  1KB9 F;  3AG3 B;  1QLE B;  4LFC B;  3ABU A;  2W6J G;  2KG7 B;  3JAM N;  1JFF B;  3B09 A;  2E76 B;  4UXN A;  1ZWI C;  1YI2 V;  1WN7 A;  1MZF A;  1K92 A;  5LGT A;  2ZE7 A;  3CSX A;  1O9G A;  4I4T B;  3SYQ A;  2MK3 A;  5IJ0 B;  1M57 B;  1P7G A;  3K3W A;  3IAY A;  1FXV A;  1L0L H;  4CS3 A;  3JAW B;  5KA5 A;  3STL C;  3Q4H A;  4LWS A;  2PY5 A;  4B3R O;  1UJW B;  4LFC O;  1YF2 A;  5ITZ B;  1M56 B;  4U7N A;  5EZY B;  1L0N H;  2EJ7 A;  2GUZ B;  1P49 A;  4FLZ A;  1RPO A;  3RYH B;  1YDX A;  3VQW A;  3G6B A;  1Q6I A;  3FB7 C;  1Q86 W;  1YIT V;  5C8Y A;  4UVC A;  1R6N A;  1MNG A;  3DXR B;  3ZHS A;  1OV9 A;  2JS5 A;  2ITD C;  4N23 A;  3JSL A;  3X2Q B;  3E22 A;  5HFM A;  5IWA O;  4AQY B;  1GN6 A;  2Q67 A;  3OUF A;  2PYJ A;  1R3I C;  3QO8 A;  1K7D A;  1FFX A;  2VQF B;  5JVD B;  3D3I A;  4ZHQ A;  1I5Y A;  2ZIO A;  1AI5 A;  3APQ A;  4B7K A;  4BW9 A;  4HNA B;  3A2F A;  1VQL V;  5B1A B;  4AHC A;  4PA3 A;  3CCL V;  1XNQ O;  2RDC A;  3WG7 B;  3CS5 A;  4K8Z A;  2LP7 A;  1Y74 A;  1B6Q A;  1Y74 B;  1KP2 A;  3BHP A;  3N27 A;  1OCR B;  1TAE A;  3CPW U;  4LR3 A;  2UUB B;  3ASO C;  3TGU H;  1NTM H;  1PKX A;  5F2V O;  3H9V A;  1WPX A;  4PA6 A;  2BCC H;  3J7A U;  2HEP A;  1FXK B;  5LMN B;  4E2L A;  4JTA B;  2DQ0 A;  1FJG B;  4NXN B;  2RN9 A;  2DYS B;  3ZS8 C;  3MHH C;  1AI4 A;  1ZTE A;  5BMV B;  1X59 A;  2UXC O;  1F51 A;  5C8Y B;  4MTG A;  3OE7 G;  4GKJ B;  2IU0 A;  1YSC A;  2IW5 A;  3RVY A;  1HNZ B;  4UB6 Z;  2UUC B;  5L3E A;  3CHX A;  2Q0O C;  1Y6X A;  1H2M A;  4DR2 O;  1JOY A;  3U10 A;  1M1K W;  1PPJ H;  4GX5 A;  1GTO A;  1XNR B;  4AI8 A;  2XAJ A;  5IYZ B;  2F93 B;  1RSO A;  4BR6 A;  1Y76 B;  5D5Q A;  4IYH A;  1VQK V;  2UU9 O;  4U3J A;  1K9M W;  3CMA V;  2BSK A;  3RYF B;  2QM4 A;  4IYI A;  1IDS A;  4H44 B;  2HVK C;  3BFR A;  4K35 A;  4X1I A;  1HP8 A;  1XQ8 A;  3ZMV A;  4NXM O;  1GH6 A;  2AXT Z;  2WLI B;  2FKX A;  1N32 O;  4ZKI A;  4JI6 O;  4LFB B;  4PJ0 Z;  4PD4 F;  1HNW B;  2A9H A;  4JYA O;  1FAF A;  3RYC A;  2LQT A;  5EK0 A;  4BW5 A;  2IM9 A;  3OR6 C;  3HKC A;  4NYK A;  1OCZ B;  3SPI A;  2CGN A;  2IH1 C;  2O57 A;  3GVM A;  4FMT A;  1S72 V;  4MVQ A;  3ABL C;  4QPJ A;  4CC6 A;  4O4J B;  2IBZ H;  3ZMS A;  4EFE A;  2GSM B;  3EFF K;  4I9W A;  4DR4 B;  1KYO F;  5GON A;  2HKO A;  2EIM B;  2WA4 A;  5H2F Z;  1VP7 A;  5CB4 B;  1M93 A;  5A9G A;  5CBH A;  3CYO A;  4BAY A;  2N05 A;  2YXH A;  3F7V C;  1S76 D;  2F4V B;  1B3Q A;  2IJK A;  2JJ2 G;  1EFR G;  1P84 F;  5DED A;  2N04 A;  3X2Q C;  2QDO A;  4PA4 A;  4X20 A;  1KP3 A;  3RYC B;  3DGE A;  5K1P A;  1U96 A;  3ML0 A;  1Q5O A;  4KL1 A;  1RPR A;  3A0H Z;  4AQY O;  2DYS C;  3OEH G;  4JTC B;  5IYZ A;  2F4V O;  1VQM V;  3FYE B;  1KEC A;  3FD9 A;  1VMG A;  4OPA A;  3STZ C;  2OCC B;  1GMG A;  2ATK C;  2PZS A;  3B8N A;  3DTU B;  4HBN A;  4MVO A;  1OCC C;  3QO5 A;  2CK3 G;  1ZL8 B;  1K34 A;  4JZ2 A;  1H2K A;  2CAZ C;  3K04 A;  1IBK B;  4LBE C;  3RW0 A;  4JI5 B;  2UUC O;  4JI5 O;  3OMI B;  1VQ4 V;  1FKA O;  1WNS A;  2DW4 A;  2P7T C;  3VQY A;  3PJS K;  4DW1 A;  1HR0 O;  3JD4 A;  3VOU A;  2ZXW C;  1KBH A;  1TVK A;  4GUN A;  3N2G A;  1NQT A;  4P9P A;  1F4N A;  1Z5W A;  3OW2 U;  1BGY H;  1M5I A;  2ODM A;  3HKC B;  1BE3 H;  4FZ1 A;  4DV2 O;  4X62 O;  1BCC H;  1SQP H;  5EIB D;  2ZT9 B;  4RO2 A;  3E35 A;  4R8C A;  1ENV A;  2E5L O;  2ITC C;  1H8E G;  2F1M A;  2P6J A;  4JI3 O;  1NH2 D;  5EBL C;  1GK9 A;  4YIO A;  4GLX A;  5B3S B;  3CRM A;  1DF4 A;  1Z5V A;  3L73 H;  1P7B A;  4JI3 B;  1OCZ C;  4MTX A;  4RUF A;  3E89 A;  2UUA B;  4B08 A;  1K5S A;  2QR4 A;  4QGP A;  2H8P C;  1EN4 A;  1VIB A;  4JYA B;  5EYP B;  1TVK B;  1PP9 H;  3BRC A;  2WLN A;  4W4K A;  3L74 H;  2QA4 V;  2Q4P A;  1I0H A;  2Q7H A;  4JI0 O;  1SA0 A;  2Q0A A;  4X1K B;  3OR7 C;  4DR6 B;  3A0B Z;  3K5O A;  3B40 A;  2OWO A;  5EBW C;  4KXR A;  4IIJ A;  2UXD B;  3ZHV A;  5CA3 A;  3HB3 B;  1VQO V;  4JTD B;  2QKC A;  2QEX V;  2OCH A;  3JAS B;  4PA7 A;  4TOI A;  3R66 A;  1NVP B;  1KU9 A;  4NR1 A;  3CC7 V;  5CA1 B;  2F43 G;  2W0X A;  4PEL A;  1AJP A;  2F66 C;  3UT5 A;  3CE2 A;  1GRJ A;  1EZJ A;  4FM2 A;  3JD1 A;  2YXY A;  1Z2G A;  3JAR B;  1ZX3 A;  4TUY A;  3BPZ A;  4O4I A;  2DE0 X;  4UCS A;  2YIB A;  1QVG U;  1S5H C;  1TUE B;  2F95 B;  2Q5Z A;  4DUY O;  2X6B A;  4JI4 B;  1ZL8 A;  4DR4 O;  2RJZ A;  5B1O A;  2AW9 A;  5B1A C;  3W7X A;  2EJR A;  3JD0 A;  3RFR A;  1FYJ A;  4DUZ B;  3N2G B;  3ZMT A;  1DLB A;  4OXS A;  4X1K A;  1NI8 A;  1SA0 B;  3AG3 C;  3OM3 B;  4J9Z B;  3SYO A;  1PL0 A;  3JAT A;  3ABK C;  3OTO O;  5B1N A;  1X4T A;  4ICG A;  3P3P A;  3C90 A;  2DYR B;  1D5N A;  1HNX O;  3L9D A;  2Y0P A;  1I94 O;  4DV7 B;  1VF7 A;  4DK0 A;  2HFE C;  1QBZ A;  1XNR O;  1QLN A;  3K57 A;  1MZE A;  2EIJ B;  4ABM A;  4DR2 B;  1V55 C;  1QQC A;  3JAR A;  4Q20 A;  5KAF Z;  4G27 B;  4UCO A;  2VWK A;  4FLU A;  2IJI A;  4FJC C;  1YXB A;  5H6R A;  4LF8 B;  4BIU A;  3JYC A;  1FJG O;  4C7U A;  5L3C A;  5IE9 A;  5BXZ A;  3OGC C;  2XAQ A;  4PV1 B;  4YIP A;  2W6I G;  4DV2 B;  2EX3 A;  2CH7 B;  4X20 B;  2YDE A;  3W7W A;  2PI5 A;  3FAV B;  2CTP A;  4GKK B;  1BQ0 A;  1DTO A;  1K3E A;  2PYL A;  2ZDI A;  4NTY A;  5FNV B;  1HR0 B;  1XEQ A;  4K0K B;  3T1H O;  4K8X A;  5KHJ A;  1H2G A;  5C93 A;  4LF8 O;  4JI6 B;  3VQV A;  4EKW A;  1JQ0 A;  5IYB O;  4W4L A;  1NS1 A;  4DRX A;  2A3Q A;  3G6E V;  3EVK A;  4JI1 B;  4QNH B;  5J2U A;  4FVM A;  1YJN V;  2NLJ C;  3B2E E;  2ZR2 A;  3GWK C;  4IHJ B;  4LC1 A;  1MA1 A;  5J2T A;  1ZSP A;  2Y69 B;  2QKA A;  2G38 A;  4MVZ A;  4JI7 B;  2QGN A;  4J41 A;  3JSN A;  1N34 O;  3K59 A;  3T2M A;  4GYC B;  4UV9 A;  3I56 V;  5FPR A;  2R9R B;  2Z3Y A;  1MMM A;  2EIM C;  2VS0 A;  3P32 A;  4HAM A;  2GBO A;  4IIJ B;  3OTF A;  1N8R W;  1SZX A;  5B1B C;  4IL6 Z;  4FIP C;  1PL4 A;  1IBM B;  2JVD A;  4A5U B;  5JJJ B;  1Y4M A;  4WF9 V;  2JJ1 G;  5DEC A;  5JCO C;  2P5O A;  4P9O A;  4JI0 B;  1FXK C;  2R9A A;  2EIN C;  1N33 O;  5KLV H;  2VRZ A;  4RQF A;  5LYJ A;  2MW2 B;  3RYI B;  1NT2 B;  4I50 A;  3ZN0 A;  1R3L C;  2BSK B;  3RYF A;  3G4S V;  3CCQ V;  5JQG B;  3CC4 V;  1LNQ A;  4DV4 B;  2Y48 A;  4MTO A;  1ORQ C;  1FPO A;  3G71 V;  1Y66 A;  2B1G A;  3QNE A;  3IJ4 A;  2RCV A;  3OMN B;  3SPH A;  1HWY A;  5TIS Z;  4D7S A;  4RQE A;  2P90 A;  3ZJZ A;  4LH7 A;  2R9I A;  5CA0 B;  4DV6 B;  2B1I A;  3A8T A;  1G1X B;  3DC5 A;  1BSM A;  2UXX A;  2WLJ A;  5LMN O; 
#chains in the Genus database with same CATH homology
 4LF8 O;  4JYA O;  2N74 A;  1HNZ O;  2UUC O;  4JI5 O;  3T1Y O;  1NS1 A;  1XNQ O;  4DR5 O;  1YZB A;  1FKA O;  5BY1 A;  4LF7 O;  4LFA O;  5A2Q N;  4YY3 O;  1XMO O;  1HR0 O;  2DOS A;  2VQF O;  4DUY O;  1J5E O;  2ZM6 O;  2DJV A;  4DR6 O;  4DR1 O;  4DR4 O;  2UUA O;  4DV7 O;  4GKJ O;  1AIL A;  4DV0 O;  4DV2 O;  3J7A U;  1FYJ A;  4X62 O;  2UXB O;  4DR7 O;  5LL6 Y;  1A32 A;  2HHH O;  1N34 O;  4DV3 O;  1HNW O;  4JI8 O;  4LF6 O;  2Z0A A;  3JAM N;  2E5L O;  2ZKO A;  4DUZ O;  4OX9 O;  1N36 O;  1R1B A;  1X59 A;  4JI3 O;  2UXC O;  1AB3 A;  3OTO O;  4LF5 O;  1IBM O;  4DV5 O;  2VQE O;  3SDL A;  5BR8 O;  4X65 O;  1KUQ A;  4DR2 O;  1HNX O;  4B3M O;  1I94 O;  1F7Y A;  4LF4 O;  4NXN O;  4A5U B;  3J80 N;  4DV6 O;  1XNR O;  4X64 O;  3RT3 C;  3O65 A;  4YHH O;  2UUB O;  4KHP O;  3M8A A;  4JI2 O;  4B3T O;  4B3R O;  4LFC O;  2AGA A;  3J81 N;  1N33 O;  2UU9 O;  1R6T A;  3F5T A;  4DV1 O;  4LFB O;  1IBK O;  4JI0 O;  5FLX N;  5H5N A;  2JRI A;  4JV5 O;  1FJG O;  4K0K O;  4AQY O;  4JI4 O;  4LF9 O;  5BXZ A;  1DK1 A;  2F4V O;  4GKK O;  4B3S O;  5IT9 N;  4X66 O;  2UXD O;  4JI7 O;  5IWA O;  4DV4 O;  4NXM O;  4OPA A;  4JI1 O;  2FKX A;  4DR3 O;  2LW7 A;  1N32 O;  1D2D A;  3R66 A;  4OPH A;  4JI6 O;  5LMU O;  1XEQ A;  1XMQ O;  1G1X B;  5LMN O;  3T1H O;  1IBL O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...