5H5NA

The crystal structure of the ns1 (h17n10) rna-binding domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
71
structure length
71
Chain Sequence
EPNPTTIAFQVDCYLWHLKKTLSMMGEVDAPFEDRLRREQKALKGRSMTLGIDIQSATQEGYYKIKSITEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NS1 gene from bat-derived influenza-like virus H17N10 can be rescued in influenza A PR8 backbone
pubmed doi rcsb
source organism Influenza a virus (a/little yellow-shouldered bat/guatemala/060/2010(h17n10))
molecule tags Rna binding protein
molecule keywords Non-structural protein 1
total genus 30
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5h5nA00
4DR6O 3F5TA 4B3MO 4X65O 4K0KO 3RT3C 5LMUO 4DR2O 2UUCO 2FKXA 3T1HO 4LF9O 1IBLO 1IBMO 1G1XB 4A5UB 1FYJA 4LF7O 4JI6O 4GKKO 2LW7A 2ZM6O 2UUAO 4DR4O 4OPHA 1AB3A 2UXDO 4JI5O 4DR1O 4LFAO 1DK1A 5BR8O 1FJGO 5IWAO 4LF6O 4B3TO 4KHPO 5IT9N 1XMQO 1J5EO 4DR3O 4X62O 2DJVA 4JV5O 2UXCO 2E5LO 3M8AA 1R1BA 1HNXO 4DR7O 3T1YO 4JI7O 4DUYO 4DV4O 2JRIA 3JAMN 5BY1A 4LF8O 3J81N 3J7AU 4DV2O 4JI3O 1HR0O 3J80N 2F4VO 4X66O 2VQFO 4DV1O 1I94O 2AGAA 4DV5O 4LF5O 4JI1O 4JYAO 4AQYO 5H5NA 4X64O 3OTOO 5FLXN 1KUQA 1XNQO 5BXZA 4B3RO 4LFCO 1N33O 4DR5O 4DUZO 1R6TA 1HNZO 1N34O 4JI2O 1XNRO 1A32A 1N36O 1XEQA 2ZKOA 2HHHO 4DV0O 3SDLA 1HNWO 4GKJO 4NXNO 4JI4O 1F7YA 4OX9O 4DV6O 4YY3O 4OPAA 2VQEO 4YHHO 1N32O 2UU9O 1NS1A 4JI8O 2DOSA 1D2DA 5LMNO 2UXBO 2N74A 4DV3O 1X59A 1YZBA 5LL6Y 2Z0AA 3R66A 4JI0O 4DV7O 1IBKO 3O65A 4LFBO 1XMOO 4B3SO 5A2QN 4NXMO 1AILA 1FKAO 4LF4O 2UUBO
chains in the Genus database with same CATH superfamily
3CHXA 1BMFG 4GCZA 4YJ2A 4D7SA 2EILC 4NB5A 4NXNB 1M56B 3CE2A 3E22A 3B8NA 4WFAV 1DGSA 2DE0X 4UCSA 5EBLC 5IE9A 4YXWG 4B3TB 3K57A 4RO2A 4X65B 3HB3B 2QWRB 5J2UB 2UXCO 1SA0B 1VQNV 1M5IA 4PJ0Z 3AEIA 1WA8A 3ABMB 1QVGU 1H38A 5KAFZ 1YF2A 4DYLA 3SYOA 2Y0PA 4DV5B 4B3MB 3TJTA 4UCOA 1VQ4V 3L70H 1SF9A 4ASUG 3E35A 1CEZA 1IX9A 5BXZA 4FM0A 1K7DA 5GTHZ 1N4CA 2Q67A 3CMEV 3FYIB 1HNZO 3M7MX 5LP6C 2QWPB 2AZ0A 3ZX6A 4QPJA 4MVUA 1SERA 3AG2C 4MTXA 2K9PA 3STZC 2QA4V 2P22C 1N32B 3FAVA 4O4LA 1FJGB 1I5XA 1MOFA 1YJNV 3W7UA 4FPPA 2N04A 3T2MA 4DUZB 1SS3A 4X1IA 3APOA 1VQ5V 3CXCU 4B3SO 4IIJA 3JAKB 4ZHQA 3F5TA 3HKBB 3OTFA 3CWBH 5LGTA 5IWAB 1V54B 3G67A 3EVKA 4Z2WA 3U11A 4P9OA 4K8XA 3AG7A 1YVWA 2ZD9A 1DF5A 3IAYA 3T4DA 1VQLV 2QGNA 3NR7A 1DTOA 3TK1A 1SZTA 1SQQH 3BAAA 4LH7A 4KHPO 2K1EA 2OIEA 3U10A 3CB2A 2B9ZA 3M8AA 1SKVA 4HNAA 4GX5A 4I5SA 4JZ2A 1ZUQA 3F5WC 1VF7A 4LFCB 1PPJH 4JYAB 3ZHVA 2UXBB 3H1LH 5JVDB 4X64O 2QJ1A 3C90A 4DV6B 3ABMC 4F6EA 3G4SV 4FIPC 4J41A 2HKOA 1XQ8A 3L72H 3QG5A 2BTOA 2RJZA 1A32A 3BHPA 5L3GA 2E76B 4X1IB 2WWWA 1YTFB 2EULA 2ADPA 1G8MA 3L73H 4FM1A 2WSSG 3HPLC 1VQMV 2BTQA 3RW0A 4MTGA 1XOUA 2ZR3A 3RYFA 1QLNA 2Q7EA 4ZOLA 2RN9A 1FPOA 4FFBA 3JARA 2O57A 3ZRVA 2H94A 1W0KG 1BHBA 1AR5A 4J7JA 2IBZH 2ADQB 3K5OA 4Z1MG 2NR5A 3OGCC 3CP1A 1J5EB 2Q0AA 3N2KB 4IT5A 5B3SB 3OMIB 1GH6A 1IZ3A 3F7YC 3CCUV 1SESA 4IYHA 5LBQA 4PI2A 1Q7YW 4L87A 1WLEA 1DF4A 2ZM6B 4DV7B 2RCVA 2JS3A 2QSAA 2JK5C 3A0RA 1MNGA 2R70A 1YCIA 1DK1A 4LNUA 1TUBA 3CD6V 1HW7A 3CSXA 2F43G 3OM3B 2M6YA 4YJ2B 3B4SA 2R9AA 1VQ6V 3S3XA 1URFA 2YDEA 3ETDA 4ICGA 1XNRB 4DUYO 3FFQA 5EBWC 3JAMN 3H1KH 1GK9A 1EZJA 2LGQA 5CB4A 4JI0B 4CBCA 4I9QA 3I55V 4R7CA 1VQPV 1LUWA 1FS0G 3TCUA 3J7AU 1YEWA 3JALB 1VQKV 5EK0A 1JVMA 4LF5O 1K92A 1L1FA 1L8DA 1XREA 5J2UA 2XAJA 3FB6C 1JCHA 2JGDB 4DR5O 4AHCA 1V55B 1R6TA 4DR4B 1TVKB 1XNRO 1S5LZ 2F93B 1XEQA 3P3NA 1ORQC 5EYPB 2ARHA 3VQYA 2EIKB 3UT5B 4EFBA 1NS1A 5CBFA 2WAMA 2FB5A 3I5DA 1HR0B 4LF4B 1X59A 4RWUA 1YZBA 1JPXA 1YTFD 1VF6C 4FFKA 4JI6B 3ABKB 1BS3A 2NN4A 2XAGA 1KU9A 2KKWA 5IYZB 4TSFG 2PYJA 1AILA 5FNVA 3ASOC 4DR6O 5KHKA 4IL6Z 2ZINA 1Q6UA 4YHHB 5GONB 5FL7G 3THOA 2W0FC 1ZLZA 1NH2D 3K03A 2PUSA 4QE7A 3WB0A 1JX9A 1VIBA 3LDDA 4J7ZA 2UUAO 1S5HC 3D8CA 4OPHA 5CB4B 2HVKC 3KZIZ 1NVPB 1FFXB 4X62B 2JJ1G 5KLVH 1BCCH 5KHIA 5J2TB 4DW0A 2ZE8A 1IVSA 1EN6A 4B3TO 1XHZA 3CRRA 2WPDG 1ZWIC 3HKBA 4I50A 4P2ZA 1Q6IA 4X62O 1BT8A 1XILA 4DV2B 3NXSA 1HNXO 5IYDO 2D2CB 2JGDA 5KA6A 5BY1A 2WA4A 1G6UA 4UCTA 4JI3O 2ZXWC 1ZTEA 3RFRA 1RP3B 4GZRB 3UM7A 4JYAO 5B3SC 4X89A 4O2AA 2RNBA 1H2NA 1Y76B 3VQVA 4LFCO 5IYCO 3O9OA 1QHTA 4HNAB 4B08A 2F66C 4KXRA 1G4YB 3K06A 1PKXA 4JI2B 4LF7B 1AROP 1S0VA 3K0GA 2ZIOA 4DR3B 2XAQA 5FNVB 2Y4UA 1ZL8A 3L74H 3QVNA 1WNSA 4I4TA 1MA1A 2DWDC 4RUFA 5JVDA 2NLJC 4JASA 2XOKG 5GONA 2N74A 3ZHQA 1NR1A 3CCJV 3AK3A 1K34A 5JJNB 5LHGA 2CUGA 2YUAA 3O65A 4DV4B 3G80A 5IJ0A 5H6RA 2YXHA 4O2BA 4QGPA 2OYQA 3HKDA 1LNQA 2DQ3A 1L0NH 1HWYA 3IFXA 1TGOA 3BFRA 1OCOC 2A0LA 4J10A 1M1KW 2GBOA 4B3SB 1Q6HA 4FZ1A 3AG4B 3AK2A 3BPZA 3E8HA 2EBOA 1SZXA 3CX5F 1FYJA 1K8AW 3ABUA 3H9VA 2XNDG 2XAHA 1KC8W 4GKKB 1NJIW 3K79A 4N23A 2HJDA 2Y0IA 1BQZA 3N2GA 1EBOA 1FJGO 1AI5A 3IC9A 3ZBHA 2L35A 2F1MA 1EFRG 2PTMA 4H37A 3ETGA 2YEVA 3CCLV 1R1BA 4JAUA 3LUTB 3LSSA 1M4UA 1FXKC 3QO5A 1NZ6A 2WLIA 2HFEC 3B40A 2CTQA 4NVPA 2W0XA 2VS0A 3L71H 3ZMUA 5LYJA 3JCUZ 4DW1A 4MVSA 1TUBB 1GO3F 4K35A 4DV5O 2UU9B 2LP7A 4U3JB 4FLWA 3BVOA 1KUQA 3OT7A 5C93A 2V4DA 5LXTB 1WP8A 5HFLA 3B09A 5EBMC 1N34B 3ABLC 2IM9A 1IURA 2HLDG 1HNWO 1N33B 2UXCB 4O4IA 3VBBA 4YY3O 1I7FA 2VQEO 5EZYB 1K5QA 4PA9A 3CMAV 2Q5ZA 2LW1A 1RPOA 2IJKA 4HAMA 1T5EA 2NNUA 2XHBA 1RM1B 2PI4A 1P7GA 1I5YA 4Q6GA 4JV5B 1OCCC 3JD0A 3JYCA 2A3QA 4RQFA 2VWKA 4TV9B 4CC6A 1LR1A 1M9NA 1Q86W 3RYIA 4QNHB 4JI4B 4BW5A 3JD2A 1E1QG 3CC4V 4O4HA 2BSKA 1AI6A 4CZZA 1NH2B 1PNLA 4QIWF 3ABLB 2WLIB 3E89A 5CA1A 2MK3A 2Y4TA 2EIMC 3CRMA 1YIJV 4XDKA 5IJ9B 4WBNB 2DJVA 3JAWA 1WAZA 3N27A 1KKCA 1TAEA 5C8YB 5DN6G 2IH1C 1VQOV 2V1DA 2LFRA 5LXTA 4GUNA 4XDLA 4KFMA 3QO8A 3T1CA 4MS2A 4PA6A 2X6AA 2OCCC 2Z5UA 4EFEA 4OXSA 4I9WA 3J80N 3W7XA 5LMNB 2GV9A 2A9HA 1JQ0A 2EINC 3CC2V 4GX1A 1FXHA 1Y74A 2AXTZ 4MVMA 3VQWA 4YY3B 1I08A 2L6LA 4X1KB 1U97A 1Q8IA 2QWOB 4DUYB 1Y67A 5AG2A 3W7TA 4DV0O 3B77A 3DTUB 5DEDA 2GUZB 3RVYA 2VRZA 2WLNA 4LC1A 5B1BC 4E2LA 3SJBC 2KG7B 3AG3C 2KSDA 4LH6A 4U7NA 3HKEA 1K3EA 2DYSB 4DRXA 3K9SA 2DQ0A 1KBHA 5H6QA 3PJSK 2ATKC 4K3AA 4CH6A 5ITZB 1WN7A 1Q81W 5KHGA 4J9YB 3ZRWB 1L0LH 2CH7A 4ZI7B 2CAZC 3DXRA 2FKXA 3TETA 1QNMA 5H9CA 1IBMO 3S3WA 1E79G 1OCRC 1QVFU 1AR4A 4FK5C 3CS5A 2FYUH 2P90A 2YXLA 3ZIAG 2IW5A 4X1YA 1SQBH 4PDVA 3HKDB 3OD4A 5LMUB 3ZHTA 4LWSB 4CH4A 1JJOA 1S72V 3RWRD 1HNWB 2CTPA 1JA8A 3MHHC 4DK0A 4XBFA 3AG1C 4X1KA 4DV4O 1VP7A 4PI0A 3HKCB 4PDMA 3A8TA 1Y6XA 1VQ8V 3FB8C 3QO7A 4B3RB 3AK1A 3JATA 2F4VO 3Q4HB 1OCCB 3CYOA 4DV1O 1R3LC 4F6RA 1BQ0A 1KD1W 3QTCA 4AILC 4W4KA 5KX5B 2X6CA 2ZNIA 2A79B 2W6IG 5KAIZ 4BW9A 4GKJB 4JI2O 4TQDA 3ZMZA 3TXQA 2HVJC 5CMUA 3P32A 1UPGA 3ZHRA 1OCZC 2CGNA 4JAVA 4GKJO 1K5SA 2QM7A 4OPAA 1S77D 2PF4E 1OCOB 4KHPB 1GN2A 1VARA 1PL4A 1I94B 2EILB 3CCEV 4J42A 4RUEA 2QWQB 4JI3B 4BIOA 2A06H 2LO1A 1N36B 1GM8A 2Y69C 4IYIA 3R66A 4FZ0A 3D3IA 4MVRA 1IBKB 3SPCA 1IBLB 1GN3A 4EEQA 1JOYA 1MG1A 3ABTA 5LMUO 2F23A 1W59A 1K33A 1FXKB 4LFBB 1KQSU 2YSUB 3TXSA 3OFNG 1IXBA 2C2AA 4N21A 4DV3B 1H2KA 1R3IC 2LQTA 4JI5O 2PYLA 5GTIZ 5D5QA 2YICA 1J95A 2R9RB 4H33A 3Q4HA 2HEPA 4B7EA 4IHJA 4MSWC 2ZDIA 2ZE6A 4F6RB 2VQFB 3QNEA 4TV9A 2PGGA 3DSQA 3E83A 5K1XA 1MMMA 3B2EE 3H1JH 4O4HB 2CE4A 2Q9LA 2WLLA 3KCXA 1HR0O 1GKFA 4K0KB 1QU7A 3UKMA 1FAFA 4UUJC 1THZA 5IY5C 3WG7C 2WLKA 5IY5B 3JSNA 3JAWB 4J9ZB 3BA8A 1XNQO 1PD3A 2ZE5A 5C8YA 1N8RW 3ZMVA 4JI7B 1KECA 3T1YB 1AJPA 4PELA 5L3BA 2EIJC 3SJCC 4UCVA 3E22B 1FXVA 2Q6AA 2EIKC 4JAAA 5HFMA 1W2BU 1MABG 5LA6A 3GWOA 5LMNO 5D5PA 1Q90D 2EX3A 2GDSA 3ZHUA 1IBKO 3JCZA 4R50A 2ZT9B 1YITV 2ZNJA 3D3QA 2Y48A 3LNMB 3DC5A 4XDJA 2GTSA 1S3JA 2YIBD 5LGUA 4DR6B 1WJZA 4DR2O 2KG7A 5BMVA 5EC2C 2VWJA 1YHQV 1G1XB 4A5UB 1CXZB 4DRXB 2RMKB 2H3OA 2P4VA 4NTWA 4MVQA 1SQVH 2ZE7A 4TUYA 1TUEB 5KMGA 2LGWA 4CS2A 1QQCA 2MW2B 1XMQO 3RYHB 2IJHA 1O9GA 2IU3A 2UXXA 3AG3B 4O4LB 2X0LA 2E5LO 1D5NA 1GMGA 4K8ZA 3CEIA 2LFSA 3IGAC 2B5UA 1GM7A 2XUMA 4DR5B 5LP6A 1Q82W 2QEXV 2PI5A 2P67A 1D5AA 3K3WA 4X66O 4U7OA 4IIJB 3GWKC 3ZS8C 1WB8A 4AQYO 1EZVH 5LA6B 1XL6A 2GTAA 1YI2V 4C7UA 1XBLA 1S5JA 1OCRB 1KP2A 3RVZA 1SRYA 5GW7A 2CDYA 1NVPD 3HKCA 5LHIA 2ZKOA 3L9DA 1F51A 3SDLA 1LUVA 4ZBMA 2E3CA 1GM9A 3FD9A 1R6NA 4Q20A 4YHHO 3MAQA 1WB7A 2YIDA 2EJRA 2UU9O 1SA0A 2BTQB 1NKDA 1QBZA 2DN9A 3BA9A 4OX9B 3K9AA 2YI8A 1EN4A 2UXDB 4FFBB 2Z0AA 1KMIZ 5DECA 4QJFB 4DV7O 1NU1H 3WB1A 3ICXA 1M57C 5CBGA 3RBZA 2Z3YA 3HR0A 3CPWU 2Q73A 2QWNB 1FKAO 1EM1A 5KMGB 1MSWD 3JD4A 3F7VC 5JWPA 2ZDIC 3RYHA 4NXMB 3GB7C 4JPRA 3SR2C 4LR3A 2IH3C 3MHSC 4UV8A 1K9MW 2WLHA 2RDCA 1BSMA 3ZRSA 4MTFA 2ZCEA 4NR1A 1M90W 1HNXB 5LP6B 2UXDO 2DWEC 3BRCA 5L3DA 4UCUA 2HJFC 5JQGB 1H2SB 1NI8A 3FX7A 1R6KA 4LF6O 1SC5B 2QM4A 4LF5B 1AP5A 4PDRA 1MZFA 4EB6A 4FVMA 5EIBD 2P7TC 2XASA 4L8JA 1JFFA 3C3TA 1AJNA 3RYFB 3CRCA 3P30A 5J9PC 1PNMA 2QR4A 1OHHG 4WFFA 4ZHQB 2BOCC 2ZQMA 3A0BZ 1DLBA 3EFFK 3C3SA 1XL4A 2Q7HA 5LGNA 2P6JA 2HP8A 3BY6A 5E1AC 3SPGA 2G38A 3OEEG 4TT3G 4JI4O 4I55B 2EIJB 3E8FA 1F4MA 5BR8B 1S76D 1R3KC 1CPYA 4WFEA 1EN5A 1D2DA 1KYOF 1VF5B 2F4VB 1IXMA 1MZEA 2WLMA 4DO2A 3M99B 1BGYH 1CP9A 2BCCH 4JZGA 3P3PA 4FM2A 5A2QN 2XT9A 2DMXA 4JI1B 3SPIA 4X65O 3JALA 2E74B 1BZKA 1V54C 2UUCO 3T4ZA 3T1HO 1GTOA 4LF9O 2OCHA 2N05A 1JFFB 4FLVA 4NTYA 1FFXA 2CGOA 3RYCA 3FB5C 2YXYA 2EZOA 1HDJA 2JEUA 2OCCB 5KHJA 4GLXA 2D3OW 4G27B 5B66Z 4LFAB 2BE3A 4UB8Z 4DR7O 5BZBA 4JI7O 1H8HG 1KB9F 2JRIA 3ETEA 1OJHA 4MTOA 2IJIA 3ZEDA 1MSDA 2VQFO 2OIGA 4P9PA 3I56V 4UCRA 1Y76A 3CC7V 4HZ3A 4JYCA 3JSLA 4YJ3A 4TOIA 3TGUH 1NTKH 4JF3A 3X2QB 4DV0B 3BABA 2P5OA 4ZKIA 4X9QA 2IU0A 1QCEA 2AHZA 3OW2U 4OX9O 4ABMA 4AQYB 5H2FZ 3APQA 2OTJV 2ZR2A 1SETA 2DOSA 3ZN0A 1OZ0A 3OUSA 4DV3O 2BOBC 1O9HA 3OAAG 1N0NA 5IJ0B 4FLXA 3ZMSA 4TV8A 5A9GA 3JARB 2DYRC 4NKGB 3K58A 3RYCB 1XUQA 3K5NA 2FMLA 1F4NA 4AI8A 3DC6A 4X66B 2JGUA 3LDCA 1R3JC 3UO3A 4DR1B 2GSMB 3ZHSA 1VF6A 1TA8A 4LF7O 4X20B 3G71V 4DXWA 5EYPA 1N0JA 1NR7A 4PA4A 5B1OA 3SYQA 5K1PA 1AB3A 5L3CA 3UT5A 2Q7GA 1US6A 1B04A 5BR8O 4DR2B 5IT9N 5KUMA 3E8BA 2B1IA 1J5EO 1UFIA 4FMTA 2CTWA 4RQEA 1ZL8B 4JV5O 2KQXA 3CCVV 5CBHA 4FLTA 4KL1A 5EIBC 2F95B 3AG1B 5FPRA 2Q8VA 1F23A 5IYZA 4R8CA 3SJQC 3J81N 4DV2O 1SQPH 5IDJA 4BR6A 2JDIG 5JQGA 3OUFA 2OWOA 4U3JA 1FFTB 1U96A 1KP3A 3OTOO 4U3FH 5FLXN 1B3QA 1RPRA 4PA3A 4EB6B 4B3RO 1IDSA 1B06A 3X2QC 3E86A 4DUZO 4JGSA 2YS8A 1N34O 2EZPA 1RFYA 3D36C 1YDXA 2HHHO 1TVKA 1E1RG 2DW4A 4NXNO 4X64B 1N32O 2R72A 3MD0A 4GX2A 2YIBA 1ROPA 2UXBO 4LBEC 4O4JB 1W0JG 2Y69B 3CXHF 3IJ4A 1NTMH 2DYSC 1HNZB 4CH5A 4PV1B 2AW9A 4X20A 3UCSC 5JJEB 2QTOA 4NTXA 1VQ7V 1PL0A 4LF4O 3ASOB 3U0ZA 1H2MA 4JYBA 4I55A 4B3MO 4O2AB 3CRAA 5IYBO 3QF7A 4PDLA 4K0KO 3K59A 3RT3C 4J11A 1PV0A 3GVMA 1HP8A 3FYEB 4JI5B 3FB7C 2LJ2A 1VMGA 1X4TA 4GKKO 3JD3A 2LW7A 4MT8A 2AZ2A 4DR7B 4MVZA 3E2EA 3SYCA 4UVBA 4JTCB 4LFAO 2EIMB 3OE7G 2JIZG 2PZSA 5IWAO 3E8GA 4O4IB 4JYYA 5J2TA 3ML0A 2IJJA 1B6QA 2JEXA 4I50B 1Q5OA 4J7KA 2KB1A 5CA3A 4LCUC 4HBNA 1H8EG 2B1GA 4O2BB 1BHAA 4LF9B 3G6EV 1P84F 1P4RA 3OTOB 2OTLV 2YIAA 1GRJA 4JI8B 1I94O 2QE7G 3LNNA 4UVAA 3CJHB 2UUBB 4JI1O 5H5NA 4O4JA 2QKCA 5L3EA 1P7BA 2JJ2G 3FKSG 2W6JG 3BCCH 3N2GB 4QE9A 2BSKB 1ZSPA 4JTDB 2CTRA 4B7KA 5CA1B 3ETQA 2ZIMA 4MW8A 5TISZ 1JR9A 4GT1A 4YIPA 1QR8A 4UFZA 2E75B 3ZCCA 4I4TB 4YJ3B 4TQFA 4NYKA 3OR7C 2AHYA 1PM9A 4UXNA 4P30A 3CCSV 1SQXH 3SYPA 5B1BB 1K4CC 1OV9A 3K0DA 1ZAUA 3SGIA 1BE3H 4ZI7A 5F2VO 5KUKA 3SPJA 2P4KA 2Q68A 2QTSA 2QDOA 5LOVB 2HHHB 1K4DC 3BEHA 5L3FA 4D6TH 2CK3G 4I0XB 4X1YB 4TV8B 2ILMA 3STLC 2Q0OC 1GAXA 4F4LA 4LWSA 3W7WA 3WU2Z 1VEWA 2GUZA 2ITCC 1XDCA 1RSOB 2WLJA 4H0LB 1YSCA 3OGIB 4WFGA 1JMKC 2YEVB 1XMOB 3T1YO 1Q3EA 4X88A 1WPBA 2OT5A 4LF8O 1YJ9V 5ITZA 3K5MA 5LYJB 1KKDA 1QR9A 4YIOA 2AGAA 2Q4PA 3RYIB 4J80A 5B1AB 4UB6Z 3R65A 1NT2B 3LSUA 3JD1A 2JVDA 1VQ9V 1AJQA 1GN6A 3JASA 1M57B 2UXNA 3ZRXA 4BIUA 2ITDC 4I7ZB 1Z2GA 4WBNA 5JJJB 1BL8A 5JCOA 4JI8O 3ZN1A 5EZYA 5B1NA 1PNKA 1AI4A 1JJ2U 3K08A 4ZIBA 4FLUA 5LOVA 4JI0O 4PHZA 3D36A 1SQFA 4FLZA 3OMNB 3L75H 4CH3A 1M93A 4LFBO 1YXBA 1XHXA 2UUCB 3JATB 1AP6A 4MVOA 3KG2A 4WFBV 4WF9V 4H13B 3OEHG 3WG7B 4FLYA 1RSOA 1AI7A 1Y66A 1IBLO 4TWKA 1WA8B 3K04A 2ZM6O 3EHBB 2YC0A 1AR1B 2A7WA 3EXAA 4UV9A 3AG2B 2ZXWB 3VOUA 1Q43A 4DR3O 5IJ9A 2EINB 1FD9A 3KCYA 4IGGA 4LF8B 3OMAB 3G6BA 4RAIA 2QKSA 3RN4A 2FTKA 4KP4A 4CC5A 3JASB 2WLLB 2WA3A 4G28B 3LSQA 1Y4MA 2P06A 2ETNA 3FAVB 1ENVA 4E4EA 1NTZH 4D7TA 4DV1B 3DXRB 3OR6C 2VQEB 4HYOA 5DM6V 2X6BA 4GX0A 1Y74B 3SPHA 1N33O 5FPOA 1FXKA 2UUAB 3ASNC 4JTAB 5E79Z 5LHHA 3K5LA 1GN4A 3VQXA 4CS3A 2H8PC 3ZMTA 3UO2A 3JAKA 3T1HB 4DV6O 3WFVA 3B8MA 4PA7A 4LF6B 3CJHA 3A0HZ 3CCQV 2QM8A 4EKWA 2PY5A 3ABKC 1PP9H 5JH7B 3HKEB 1I0HA 1ZX3A 2HR3A 2DYRB 1IBMB 2M7WA 4LP8A 4R6ZA 2EJ7A 1WP7A 1XNQB 3KKYA 1RM1C 4FJCC 1M56C 4NXMO 4WFHA 3SYAA 4DK1A 5KX5A 2GHYA 1XI1A 5EC1C 5B5EZ 3W7SA 3ZRWA 3SJAC 2XTAA 2CH7B 3MDSA 5CA0A 1V55C 4JI6O 3CCRV 3H01A 3CRQA 5KHHA 1H2LA 4DR4O 3WB2A 4DR1O 3IC7A 3CCMV 1K97A 2XAFA 1Z5VA 3AG4C 4W4LA 3UQ8A 5B1AC 4KUMA 2HG5C 1Z5WA 2QKAA 4G2KA 1P49A 3RGBA 3LDEA 4OGQB 4I0XA 3PN1A 2FL4A 3A2FA 2V7QG 4Z1VA 3H1HH 1QLEB 4BWAA 1V9PA 5JCOC 1H2GA 1QLEC 4ZOLB 2Q69A 2RQ6A 4BIZA 5CN0A 1COWG 4MW3A 4GYCB 3H1IH 5BMVB 5JH7A 1N36O 1WPXA 3DGEA 4BAYA 2R9IA 2E5LB 3ZJZA 1F7YA 4IHJB 4PD4F 1NQTA 2X7RB 2ODMA 1XMQB 4TUYB 1AVMA 3N2KA 1K73W 4H44B 4CS4A 4UVCA 3ASNB 5KA5A 5LL6Y 4QPKA 5CA0B 1OCZB 1R73A 1YJWV 4X8AA 4WCEV 2JS5A 1NBMG 1SQGA 1XMOO 4LNUB 2YI9A 1UJWB 2UUBO
chains in the Genus database with same CATH topology
4DR6O 3F5TA 4B3MO 4X65O 4K0KO 3RT3C 5LMUO 4DR2O 2UUCO 2FKXA 3T1HO 4LF9O 1IBLO 1IBMO 1G1XB 4A5UB 1FYJA 4LF7O 4JI6O 4GKKO 2LW7A 2ZM6O 2UUAO 4DR4O 4OPHA 1AB3A 2UXDO 4JI5O 4DR1O 4LFAO 1DK1A 5BR8O 1FJGO 5IWAO 4LF6O 4B3TO 4KHPO 5IT9N 1XMQO 1J5EO 4DR3O 4X62O 2DJVA 4JV5O 2UXCO 2E5LO 3M8AA 1R1BA 1HNXO 4DR7O 3T1YO 4JI7O 4DUYO 4DV4O 2JRIA 3JAMN 5BY1A 4LF8O 3J81N 3J7AU 4DV2O 4JI3O 1HR0O 3J80N 2F4VO 4X66O 2VQFO 4DV1O 1I94O 2AGAA 4DV5O 4LF5O 4JI1O 4JYAO 4AQYO 5H5NA 4X64O 3OTOO 5FLXN 1KUQA 1XNQO 5BXZA 4B3RO 4LFCO 1N33O 4DR5O 4DUZO 1R6TA 1HNZO 1N34O 4JI2O 1XNRO 1A32A 1N36O 1XEQA 2ZKOA 2HHHO 4DV0O 3SDLA 1HNWO 4GKJO 4NXNO 4JI4O 1F7YA 4OX9O 4DV6O 4YY3O 4OPAA 2VQEO 4YHHO 1N32O 2UU9O 1NS1A 4JI8O 2DOSA 1D2DA 5LMNO 2UXBO 2N74A 4DV3O 1X59A 1YZBA 5LL6Y 2Z0AA 3R66A 4JI0O 4DV7O 1IBKO 3O65A 4LFBO 1XMOO 4B3SO 5A2QN 4NXMO 1AILA 1FKAO 4LF4O 2UUBO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 O;  3F5T A;  4B3M O;  4X65 O;  4K0K O;  3RT3 C;  5LMU O;  4DR2 O;  2UUC O;  2FKX A;  3T1H O;  4LF9 O;  1IBL O;  1IBM O;  1G1X B;  4A5U B;  1FYJ A;  4LF7 O;  4JI6 O;  4GKK O;  2LW7 A;  2ZM6 O;  2UUA O;  4DR4 O;  4OPH A;  1AB3 A;  2UXD O;  4JI5 O;  4DR1 O;  4LFA O;  1DK1 A;  5BR8 O;  1FJG O;  5IWA O;  4LF6 O;  4B3T O;  4KHP O;  5IT9 N;  1XMQ O;  1J5E O;  4DR3 O;  4X62 O;  2DJV A;  4JV5 O;  2UXC O;  2E5L O;  3M8A A;  1R1B A;  1HNX O;  4DR7 O;  3T1Y O;  4JI7 O;  4DUY O;  4DV4 O;  2JRI A;  3JAM N;  5BY1 A;  4LF8 O;  3J81 N;  3J7A U;  4DV2 O;  4JI3 O;  1HR0 O;  3J80 N;  2F4V O;  4X66 O;  2VQF O;  4DV1 O;  1I94 O;  2AGA A;  4DV5 O;  4LF5 O;  4JI1 O;  4JYA O;  4AQY O;  5H5N A;  4X64 O;  3OTO O;  5FLX N;  1KUQ A;  1XNQ O;  5BXZ A;  4B3R O;  4LFC O;  1N33 O;  4DR5 O;  4DUZ O;  1R6T A;  1HNZ O;  1N34 O;  4JI2 O;  1XNR O;  1A32 A;  1N36 O;  1XEQ A;  2ZKO A;  2HHH O;  4DV0 O;  3SDL A;  1HNW O;  4GKJ O;  4NXN O;  4JI4 O;  1F7Y A;  4OX9 O;  4DV6 O;  4YY3 O;  4OPA A;  2VQE O;  4YHH O;  1N32 O;  2UU9 O;  1NS1 A;  4JI8 O;  2DOS A;  1D2D A;  5LMN O;  2UXB O;  2N74 A;  4DV3 O;  1X59 A;  1YZB A;  5LL6 Y;  2Z0A A;  3R66 A;  4JI0 O;  4DV7 O;  1IBK O;  3O65 A;  4LFB O;  1XMO O;  4B3S O;  5A2Q N;  4NXM O;  1AIL A;  1FKA O;  4LF4 O;  2UUB O; 
#chains in the Genus database with same CATH topology
 3CHX A;  1BMF G;  4GCZ A;  4YJ2 A;  4D7S A;  2EIL C;  4NB5 A;  4NXN B;  1M56 B;  3CE2 A;  3E22 A;  3B8N A;  4WFA V;  1DGS A;  2DE0 X;  4UCS A;  5EBL C;  5IE9 A;  4YXW G;  4B3T B;  3K57 A;  4RO2 A;  4X65 B;  3HB3 B;  2QWR B;  5J2U B;  2UXC O;  1SA0 B;  1VQN V;  1M5I A;  4PJ0 Z;  3AEI A;  1WA8 A;  3ABM B;  1QVG U;  1H38 A;  5KAF Z;  1YF2 A;  4DYL A;  3SYO A;  2Y0P A;  4DV5 B;  4B3M B;  3TJT A;  4UCO A;  1VQ4 V;  3L70 H;  1SF9 A;  4ASU G;  3E35 A;  1CEZ A;  1IX9 A;  5BXZ A;  4FM0 A;  1K7D A;  5GTH Z;  1N4C A;  2Q67 A;  3CME V;  3FYI B;  1HNZ O;  3M7M X;  5LP6 C;  2QWP B;  2AZ0 A;  3ZX6 A;  4QPJ A;  4MVU A;  1SER A;  3AG2 C;  4MTX A;  2K9P A;  3STZ C;  2QA4 V;  2P22 C;  1N32 B;  3FAV A;  4O4L A;  1FJG B;  1I5X A;  1MOF A;  1YJN V;  3W7U A;  4FPP A;  2N04 A;  3T2M A;  4DUZ B;  1SS3 A;  4X1I A;  3APO A;  1VQ5 V;  3CXC U;  4B3S O;  4IIJ A;  3JAK B;  4ZHQ A;  3F5T A;  3HKB B;  3OTF A;  3CWB H;  5LGT A;  5IWA B;  1V54 B;  3G67 A;  3EVK A;  4Z2W A;  3U11 A;  4P9O A;  4K8X A;  3AG7 A;  1YVW A;  2ZD9 A;  1DF5 A;  3IAY A;  3T4D A;  1VQL V;  2QGN A;  3NR7 A;  1DTO A;  3TK1 A;  1SZT A;  1SQQ H;  3BAA A;  4LH7 A;  4KHP O;  2K1E A;  2OIE A;  3U10 A;  3CB2 A;  2B9Z A;  3M8A A;  1SKV A;  4HNA A;  4GX5 A;  4I5S A;  4JZ2 A;  1ZUQ A;  3F5W C;  1VF7 A;  4LFC B;  1PPJ H;  4JYA B;  3ZHV A;  2UXB B;  3H1L H;  5JVD B;  4X64 O;  2QJ1 A;  3C90 A;  4DV6 B;  3ABM C;  4F6E A;  3G4S V;  4FIP C;  4J41 A;  2HKO A;  1XQ8 A;  3L72 H;  3QG5 A;  2BTO A;  2RJZ A;  1A32 A;  3BHP A;  5L3G A;  2E76 B;  4X1I B;  2WWW A;  1YTF B;  2EUL A;  2ADP A;  1G8M A;  3L73 H;  4FM1 A;  2WSS G;  3HPL C;  1VQM V;  2BTQ A;  3RW0 A;  4MTG A;  1XOU A;  2ZR3 A;  3RYF A;  1QLN A;  2Q7E A;  4ZOL A;  2RN9 A;  1FPO A;  4FFB A;  3JAR A;  2O57 A;  3ZRV A;  2H94 A;  1W0K G;  1BHB A;  1AR5 A;  4J7J A;  2IBZ H;  2ADQ B;  3K5O A;  4Z1M G;  2NR5 A;  3OGC C;  3CP1 A;  1J5E B;  2Q0A A;  3N2K B;  4IT5 A;  5B3S B;  3OMI B;  1GH6 A;  1IZ3 A;  3F7Y C;  3CCU V;  1SES A;  4IYH A;  5LBQ A;  4PI2 A;  1Q7Y W;  4L87 A;  1WLE A;  1DF4 A;  2ZM6 B;  4DV7 B;  2RCV A;  2JS3 A;  2QSA A;  2JK5 C;  3A0R A;  1MNG A;  2R70 A;  1YCI A;  1DK1 A;  4LNU A;  1TUB A;  3CD6 V;  1HW7 A;  3CSX A;  2F43 G;  3OM3 B;  2M6Y A;  4YJ2 B;  3B4S A;  2R9A A;  1VQ6 V;  3S3X A;  1URF A;  2YDE A;  3ETD A;  4ICG A;  1XNR B;  4DUY O;  3FFQ A;  5EBW C;  3JAM N;  3H1K H;  1GK9 A;  1EZJ A;  2LGQ A;  5CB4 A;  4JI0 B;  4CBC A;  4I9Q A;  3I55 V;  4R7C A;  1VQP V;  1LUW A;  1FS0 G;  3TCU A;  3J7A U;  1YEW A;  3JAL B;  1VQK V;  5EK0 A;  1JVM A;  4LF5 O;  1K92 A;  1L1F A;  1L8D A;  1XRE A;  5J2U A;  2XAJ A;  3FB6 C;  1JCH A;  2JGD B;  4DR5 O;  4AHC A;  1V55 B;  1R6T A;  4DR4 B;  1TVK B;  1XNR O;  1S5L Z;  2F93 B;  1XEQ A;  3P3N A;  1ORQ C;  5EYP B;  2ARH A;  3VQY A;  2EIK B;  3UT5 B;  4EFB A;  1NS1 A;  5CBF A;  2WAM A;  2FB5 A;  3I5D A;  1HR0 B;  4LF4 B;  1X59 A;  4RWU A;  1YZB A;  1JPX A;  1YTF D;  1VF6 C;  4FFK A;  4JI6 B;  3ABK B;  1BS3 A;  2NN4 A;  2XAG A;  1KU9 A;  2KKW A;  5IYZ B;  4TSF G;  2PYJ A;  1AIL A;  5FNV A;  3ASO C;  4DR6 O;  5KHK A;  4IL6 Z;  2ZIN A;  1Q6U A;  4YHH B;  5GON B;  5FL7 G;  3THO A;  2W0F C;  1ZLZ A;  1NH2 D;  3K03 A;  2PUS A;  4QE7 A;  3WB0 A;  1JX9 A;  1VIB A;  3LDD A;  4J7Z A;  2UUA O;  1S5H C;  3D8C A;  4OPH A;  5CB4 B;  2HVK C;  3KZI Z;  1NVP B;  1FFX B;  4X62 B;  2JJ1 G;  5KLV H;  1BCC H;  5KHI A;  5J2T B;  4DW0 A;  2ZE8 A;  1IVS A;  1EN6 A;  4B3T O;  1XHZ A;  3CRR A;  2WPD G;  1ZWI C;  3HKB A;  4I50 A;  4P2Z A;  1Q6I A;  4X62 O;  1BT8 A;  1XIL A;  4DV2 B;  3NXS A;  1HNX O;  5IYD O;  2D2C B;  2JGD A;  5KA6 A;  5BY1 A;  2WA4 A;  1G6U A;  4UCT A;  4JI3 O;  2ZXW C;  1ZTE A;  3RFR A;  1RP3 B;  4GZR B;  3UM7 A;  4JYA O;  5B3S C;  4X89 A;  4O2A A;  2RNB A;  1H2N A;  1Y76 B;  3VQV A;  4LFC O;  5IYC O;  3O9O A;  1QHT A;  4HNA B;  4B08 A;  2F66 C;  4KXR A;  1G4Y B;  3K06 A;  1PKX A;  4JI2 B;  4LF7 B;  1ARO P;  1S0V A;  3K0G A;  2ZIO A;  4DR3 B;  2XAQ A;  5FNV B;  2Y4U A;  1ZL8 A;  3L74 H;  3QVN A;  1WNS A;  4I4T A;  1MA1 A;  2DWD C;  4RUF A;  5JVD A;  2NLJ C;  4JAS A;  2XOK G;  5GON A;  2N74 A;  3ZHQ A;  1NR1 A;  3CCJ V;  3AK3 A;  1K34 A;  5JJN B;  5LHG A;  2CUG A;  2YUA A;  3O65 A;  4DV4 B;  3G80 A;  5IJ0 A;  5H6R A;  2YXH A;  4O2B A;  4QGP A;  2OYQ A;  3HKD A;  1LNQ A;  2DQ3 A;  1L0N H;  1HWY A;  3IFX A;  1TGO A;  3BFR A;  1OCO C;  2A0L A;  4J10 A;  1M1K W;  2GBO A;  4B3S B;  1Q6H A;  4FZ1 A;  3AG4 B;  3AK2 A;  3BPZ A;  3E8H A;  2EBO A;  1SZX A;  3CX5 F;  1FYJ A;  1K8A W;  3ABU A;  3H9V A;  2XND G;  2XAH A;  1KC8 W;  4GKK B;  1NJI W;  3K79 A;  4N23 A;  2HJD A;  2Y0I A;  1BQZ A;  3N2G A;  1EBO A;  1FJG O;  1AI5 A;  3IC9 A;  3ZBH A;  2L35 A;  2F1M A;  1EFR G;  2PTM A;  4H37 A;  3ETG A;  2YEV A;  3CCL V;  1R1B A;  4JAU A;  3LUT B;  3LSS A;  1M4U A;  1FXK C;  3QO5 A;  1NZ6 A;  2WLI A;  2HFE C;  3B40 A;  2CTQ A;  4NVP A;  2W0X A;  2VS0 A;  3L71 H;  3ZMU A;  5LYJ A;  3JCU Z;  4DW1 A;  4MVS A;  1TUB B;  1GO3 F;  4K35 A;  4DV5 O;  2UU9 B;  2LP7 A;  4U3J B;  4FLW A;  3BVO A;  1KUQ A;  3OT7 A;  5C93 A;  2V4D A;  5LXT B;  1WP8 A;  5HFL A;  3B09 A;  5EBM C;  1N34 B;  3ABL C;  2IM9 A;  1IUR A;  2HLD G;  1HNW O;  1N33 B;  2UXC B;  4O4I A;  3VBB A;  4YY3 O;  1I7F A;  2VQE O;  5EZY B;  1K5Q A;  4PA9 A;  3CMA V;  2Q5Z A;  2LW1 A;  1RPO A;  2IJK A;  4HAM A;  1T5E A;  2NNU A;  2XHB A;  1RM1 B;  2PI4 A;  1P7G A;  1I5Y A;  4Q6G A;  4JV5 B;  1OCC C;  3JD0 A;  3JYC A;  2A3Q A;  4RQF A;  2VWK A;  4TV9 B;  4CC6 A;  1LR1 A;  1M9N A;  1Q86 W;  3RYI A;  4QNH B;  4JI4 B;  4BW5 A;  3JD2 A;  1E1Q G;  3CC4 V;  4O4H A;  2BSK A;  1AI6 A;  4CZZ A;  1NH2 B;  1PNL A;  4QIW F;  3ABL B;  2WLI B;  3E89 A;  5CA1 A;  2MK3 A;  2Y4T A;  2EIM C;  3CRM A;  1YIJ V;  4XDK A;  5IJ9 B;  4WBN B;  2DJV A;  3JAW A;  1WAZ A;  3N27 A;  1KKC A;  1TAE A;  5C8Y B;  5DN6 G;  2IH1 C;  1VQO V;  2V1D A;  2LFR A;  5LXT A;  4GUN A;  4XDL A;  4KFM A;  3QO8 A;  3T1C A;  4MS2 A;  4PA6 A;  2X6A A;  2OCC C;  2Z5U A;  4EFE A;  4OXS A;  4I9W A;  3J80 N;  3W7X A;  5LMN B;  2GV9 A;  2A9H A;  1JQ0 A;  2EIN C;  3CC2 V;  4GX1 A;  1FXH A;  1Y74 A;  2AXT Z;  4MVM A;  3VQW A;  4YY3 B;  1I08 A;  2L6L A;  4X1K B;  1U97 A;  1Q8I A;  2QWO B;  4DUY B;  1Y67 A;  5AG2 A;  3W7T A;  4DV0 O;  3B77 A;  3DTU B;  5DED A;  2GUZ B;  3RVY A;  2VRZ A;  2WLN A;  4LC1 A;  5B1B C;  4E2L A;  3SJB C;  2KG7 B;  3AG3 C;  2KSD A;  4LH6 A;  4U7N A;  3HKE A;  1K3E A;  2DYS B;  4DRX A;  3K9S A;  2DQ0 A;  1KBH A;  5H6Q A;  3PJS K;  2ATK C;  4K3A A;  4CH6 A;  5ITZ B;  1WN7 A;  1Q81 W;  5KHG A;  4J9Y B;  3ZRW B;  1L0L H;  2CH7 A;  4ZI7 B;  2CAZ C;  3DXR A;  2FKX A;  3TET A;  1QNM A;  5H9C A;  1IBM O;  3S3W A;  1E79 G;  1OCR C;  1QVF U;  1AR4 A;  4FK5 C;  3CS5 A;  2FYU H;  2P90 A;  2YXL A;  3ZIA G;  2IW5 A;  4X1Y A;  1SQB H;  4PDV A;  3HKD B;  3OD4 A;  5LMU B;  3ZHT A;  4LWS B;  4CH4 A;  1JJO A;  1S72 V;  3RWR D;  1HNW B;  2CTP A;  1JA8 A;  3MHH C;  4DK0 A;  4XBF A;  3AG1 C;  4X1K A;  4DV4 O;  1VP7 A;  4PI0 A;  3HKC B;  4PDM A;  3A8T A;  1Y6X A;  1VQ8 V;  3FB8 C;  3QO7 A;  4B3R B;  3AK1 A;  3JAT A;  2F4V O;  3Q4H B;  1OCC B;  3CYO A;  4DV1 O;  1R3L C;  4F6R A;  1BQ0 A;  1KD1 W;  3QTC A;  4AIL C;  4W4K A;  5KX5 B;  2X6C A;  2ZNI A;  2A79 B;  2W6I G;  5KAI Z;  4BW9 A;  4GKJ B;  4JI2 O;  4TQD A;  3ZMZ A;  3TXQ A;  2HVJ C;  5CMU A;  3P32 A;  1UPG A;  3ZHR A;  1OCZ C;  2CGN A;  4JAV A;  4GKJ O;  1K5S A;  2QM7 A;  4OPA A;  1S77 D;  2PF4 E;  1OCO B;  4KHP B;  1GN2 A;  1VAR A;  1PL4 A;  1I94 B;  2EIL B;  3CCE V;  4J42 A;  4RUE A;  2QWQ B;  4JI3 B;  4BIO A;  2A06 H;  2LO1 A;  1N36 B;  1GM8 A;  2Y69 C;  4IYI A;  3R66 A;  4FZ0 A;  3D3I A;  4MVR A;  1IBK B;  3SPC A;  1IBL B;  1GN3 A;  4EEQ A;  1JOY A;  1MG1 A;  3ABT A;  5LMU O;  2F23 A;  1W59 A;  1K33 A;  1FXK B;  4LFB B;  1KQS U;  2YSU B;  3TXS A;  3OFN G;  1IXB A;  2C2A A;  4N21 A;  4DV3 B;  1H2K A;  1R3I C;  2LQT A;  4JI5 O;  2PYL A;  5GTI Z;  5D5Q A;  2YIC A;  1J95 A;  2R9R B;  4H33 A;  3Q4H A;  2HEP A;  4B7E A;  4IHJ A;  4MSW C;  2ZDI A;  2ZE6 A;  4F6R B;  2VQF B;  3QNE A;  4TV9 A;  2PGG A;  3DSQ A;  3E83 A;  5K1X A;  1MMM A;  3B2E E;  3H1J H;  4O4H B;  2CE4 A;  2Q9L A;  2WLL A;  3KCX A;  1HR0 O;  1GKF A;  4K0K B;  1QU7 A;  3UKM A;  1FAF A;  4UUJ C;  1THZ A;  5IY5 C;  3WG7 C;  2WLK A;  5IY5 B;  3JSN A;  3JAW B;  4J9Z B;  3BA8 A;  1XNQ O;  1PD3 A;  2ZE5 A;  5C8Y A;  1N8R W;  3ZMV A;  4JI7 B;  1KEC A;  3T1Y B;  1AJP A;  4PEL A;  5L3B A;  2EIJ C;  3SJC C;  4UCV A;  3E22 B;  1FXV A;  2Q6A A;  2EIK C;  4JAA A;  5HFM A;  1W2B U;  1MAB G;  5LA6 A;  3GWO A;  5LMN O;  5D5P A;  1Q90 D;  2EX3 A;  2GDS A;  3ZHU A;  1IBK O;  3JCZ A;  4R50 A;  2ZT9 B;  1YIT V;  2ZNJ A;  3D3Q A;  2Y48 A;  3LNM B;  3DC5 A;  4XDJ A;  2GTS A;  1S3J A;  2YIB D;  5LGU A;  4DR6 B;  1WJZ A;  4DR2 O;  2KG7 A;  5BMV A;  5EC2 C;  2VWJ A;  1YHQ V;  1G1X B;  4A5U B;  1CXZ B;  4DRX B;  2RMK B;  2H3O A;  2P4V A;  4NTW A;  4MVQ A;  1SQV H;  2ZE7 A;  4TUY A;  1TUE B;  5KMG A;  2LGW A;  4CS2 A;  1QQC A;  2MW2 B;  1XMQ O;  3RYH B;  2IJH A;  1O9G A;  2IU3 A;  2UXX A;  3AG3 B;  4O4L B;  2X0L A;  2E5L O;  1D5N A;  1GMG A;  4K8Z A;  3CEI A;  2LFS A;  3IGA C;  2B5U A;  1GM7 A;  2XUM A;  4DR5 B;  5LP6 A;  1Q82 W;  2QEX V;  2PI5 A;  2P67 A;  1D5A A;  3K3W A;  4X66 O;  4U7O A;  4IIJ B;  3GWK C;  3ZS8 C;  1WB8 A;  4AQY O;  1EZV H;  5LA6 B;  1XL6 A;  2GTA A;  1YI2 V;  4C7U A;  1XBL A;  1S5J A;  1OCR B;  1KP2 A;  3RVZ A;  1SRY A;  5GW7 A;  2CDY A;  1NVP D;  3HKC A;  5LHI A;  2ZKO A;  3L9D A;  1F51 A;  3SDL A;  1LUV A;  4ZBM A;  2E3C A;  1GM9 A;  3FD9 A;  1R6N A;  4Q20 A;  4YHH O;  3MAQ A;  1WB7 A;  2YID A;  2EJR A;  2UU9 O;  1SA0 A;  2BTQ B;  1NKD A;  1QBZ A;  2DN9 A;  3BA9 A;  4OX9 B;  3K9A A;  2YI8 A;  1EN4 A;  2UXD B;  4FFB B;  2Z0A A;  1KMI Z;  5DEC A;  4QJF B;  4DV7 O;  1NU1 H;  3WB1 A;  3ICX A;  1M57 C;  5CBG A;  3RBZ A;  2Z3Y A;  3HR0 A;  3CPW U;  2Q73 A;  2QWN B;  1FKA O;  1EM1 A;  5KMG B;  1MSW D;  3JD4 A;  3F7V C;  5JWP A;  2ZDI C;  3RYH A;  4NXM B;  3GB7 C;  4JPR A;  3SR2 C;  4LR3 A;  2IH3 C;  3MHS C;  4UV8 A;  1K9M W;  2WLH A;  2RDC A;  1BSM A;  3ZRS A;  4MTF A;  2ZCE A;  4NR1 A;  1M90 W;  1HNX B;  5LP6 B;  2UXD O;  2DWE C;  3BRC A;  5L3D A;  4UCU A;  2HJF C;  5JQG B;  1H2S B;  1NI8 A;  3FX7 A;  1R6K A;  4LF6 O;  1SC5 B;  2QM4 A;  4LF5 B;  1AP5 A;  4PDR A;  1MZF A;  4EB6 A;  4FVM A;  5EIB D;  2P7T C;  2XAS A;  4L8J A;  1JFF A;  3C3T A;  1AJN A;  3RYF B;  3CRC A;  3P30 A;  5J9P C;  1PNM A;  2QR4 A;  1OHH G;  4WFF A;  4ZHQ B;  2BOC C;  2ZQM A;  3A0B Z;  1DLB A;  3EFF K;  3C3S A;  1XL4 A;  2Q7H A;  5LGN A;  2P6J A;  2HP8 A;  3BY6 A;  5E1A C;  3SPG A;  2G38 A;  3OEE G;  4TT3 G;  4JI4 O;  4I55 B;  2EIJ B;  3E8F A;  1F4M A;  5BR8 B;  1S76 D;  1R3K C;  1CPY A;  4WFE A;  1EN5 A;  1D2D A;  1KYO F;  1VF5 B;  2F4V B;  1IXM A;  1MZE A;  2WLM A;  4DO2 A;  3M99 B;  1BGY H;  1CP9 A;  2BCC H;  4JZG A;  3P3P A;  4FM2 A;  5A2Q N;  2XT9 A;  2DMX A;  4JI1 B;  3SPI A;  4X65 O;  3JAL A;  2E74 B;  1BZK A;  1V54 C;  2UUC O;  3T4Z A;  3T1H O;  1GTO A;  4LF9 O;  2OCH A;  2N05 A;  1JFF B;  4FLV A;  4NTY A;  1FFX A;  2CGO A;  3RYC A;  3FB5 C;  2YXY A;  2EZO A;  1HDJ A;  2JEU A;  2OCC B;  5KHJ A;  4GLX A;  2D3O W;  4G27 B;  5B66 Z;  4LFA B;  2BE3 A;  4UB8 Z;  4DR7 O;  5BZB A;  4JI7 O;  1H8H G;  1KB9 F;  2JRI A;  3ETE A;  1OJH A;  4MTO A;  2IJI A;  3ZED A;  1MSD A;  2VQF O;  2OIG A;  4P9P A;  3I56 V;  4UCR A;  1Y76 A;  3CC7 V;  4HZ3 A;  4JYC A;  3JSL A;  4YJ3 A;  4TOI A;  3TGU H;  1NTK H;  4JF3 A;  3X2Q B;  4DV0 B;  3BAB A;  2P5O A;  4ZKI A;  4X9Q A;  2IU0 A;  1QCE A;  2AHZ A;  3OW2 U;  4OX9 O;  4ABM A;  4AQY B;  5H2F Z;  3APQ A;  2OTJ V;  2ZR2 A;  1SET A;  2DOS A;  3ZN0 A;  1OZ0 A;  3OUS A;  4DV3 O;  2BOB C;  1O9H A;  3OAA G;  1N0N A;  5IJ0 B;  4FLX A;  3ZMS A;  4TV8 A;  5A9G A;  3JAR B;  2DYR C;  4NKG B;  3K58 A;  3RYC B;  1XUQ A;  3K5N A;  2FML A;  1F4N A;  4AI8 A;  3DC6 A;  4X66 B;  2JGU A;  3LDC A;  1R3J C;  3UO3 A;  4DR1 B;  2GSM B;  3ZHS A;  1VF6 A;  1TA8 A;  4LF7 O;  4X20 B;  3G71 V;  4DXW A;  5EYP A;  1N0J A;  1NR7 A;  4PA4 A;  5B1O A;  3SYQ A;  5K1P A;  1AB3 A;  5L3C A;  3UT5 A;  2Q7G A;  1US6 A;  1B04 A;  5BR8 O;  4DR2 B;  5IT9 N;  5KUM A;  3E8B A;  2B1I A;  1J5E O;  1UFI A;  4FMT A;  2CTW A;  4RQE A;  1ZL8 B;  4JV5 O;  2KQX A;  3CCV V;  5CBH A;  4FLT A;  4KL1 A;  5EIB C;  2F95 B;  3AG1 B;  5FPR A;  2Q8V A;  1F23 A;  5IYZ A;  4R8C A;  3SJQ C;  3J81 N;  4DV2 O;  1SQP H;  5IDJ A;  4BR6 A;  2JDI G;  5JQG A;  3OUF A;  2OWO A;  4U3J A;  1FFT B;  1U96 A;  1KP3 A;  3OTO O;  4U3F H;  5FLX N;  1B3Q A;  1RPR A;  4PA3 A;  4EB6 B;  4B3R O;  1IDS A;  1B06 A;  3X2Q C;  3E86 A;  4DUZ O;  4JGS A;  2YS8 A;  1N34 O;  2EZP A;  1RFY A;  3D36 C;  1YDX A;  2HHH O;  1TVK A;  1E1R G;  2DW4 A;  4NXN O;  4X64 B;  1N32 O;  2R72 A;  3MD0 A;  4GX2 A;  2YIB A;  1ROP A;  2UXB O;  4LBE C;  4O4J B;  1W0J G;  2Y69 B;  3CXH F;  3IJ4 A;  1NTM H;  2DYS C;  1HNZ B;  4CH5 A;  4PV1 B;  2AW9 A;  4X20 A;  3UCS C;  5JJE B;  2QTO A;  4NTX A;  1VQ7 V;  1PL0 A;  4LF4 O;  3ASO B;  3U0Z A;  1H2M A;  4JYB A;  4I55 A;  4B3M O;  4O2A B;  3CRA A;  5IYB O;  3QF7 A;  4PDL A;  4K0K O;  3K59 A;  3RT3 C;  4J11 A;  1PV0 A;  3GVM A;  1HP8 A;  3FYE B;  4JI5 B;  3FB7 C;  2LJ2 A;  1VMG A;  1X4T A;  4GKK O;  3JD3 A;  2LW7 A;  4MT8 A;  2AZ2 A;  4DR7 B;  4MVZ A;  3E2E A;  3SYC A;  4UVB A;  4JTC B;  4LFA O;  2EIM B;  3OE7 G;  2JIZ G;  2PZS A;  5IWA O;  3E8G A;  4O4I B;  4JYY A;  5J2T A;  3ML0 A;  2IJJ A;  1B6Q A;  2JEX A;  4I50 B;  1Q5O A;  4J7K A;  2KB1 A;  5CA3 A;  4LCU C;  4HBN A;  1H8E G;  2B1G A;  4O2B B;  1BHA A;  4LF9 B;  3G6E V;  1P84 F;  1P4R A;  3OTO B;  2OTL V;  2YIA A;  1GRJ A;  4JI8 B;  1I94 O;  2QE7 G;  3LNN A;  4UVA A;  3CJH B;  2UUB B;  4JI1 O;  5H5N A;  4O4J A;  2QKC A;  5L3E A;  1P7B A;  2JJ2 G;  3FKS G;  2W6J G;  3BCC H;  3N2G B;  4QE9 A;  2BSK B;  1ZSP A;  4JTD B;  2CTR A;  4B7K A;  5CA1 B;  3ETQ A;  2ZIM A;  4MW8 A;  5TIS Z;  1JR9 A;  4GT1 A;  4YIP A;  1QR8 A;  4UFZ A;  2E75 B;  3ZCC A;  4I4T B;  4YJ3 B;  4TQF A;  4NYK A;  3OR7 C;  2AHY A;  1PM9 A;  4UXN A;  4P30 A;  3CCS V;  1SQX H;  3SYP A;  5B1B B;  1K4C C;  1OV9 A;  3K0D A;  1ZAU A;  3SGI A;  1BE3 H;  4ZI7 A;  5F2V O;  5KUK A;  3SPJ A;  2P4K A;  2Q68 A;  2QTS A;  2QDO A;  5LOV B;  2HHH B;  1K4D C;  3BEH A;  5L3F A;  4D6T H;  2CK3 G;  4I0X B;  4X1Y B;  4TV8 B;  2ILM A;  3STL C;  2Q0O C;  1GAX A;  4F4L A;  4LWS A;  3W7W A;  3WU2 Z;  1VEW A;  2GUZ A;  2ITC C;  1XDC A;  1RSO B;  2WLJ A;  4H0L B;  1YSC A;  3OGI B;  4WFG A;  1JMK C;  2YEV B;  1XMO B;  3T1Y O;  1Q3E A;  4X88 A;  1WPB A;  2OT5 A;  4LF8 O;  1YJ9 V;  5ITZ A;  3K5M A;  5LYJ B;  1KKD A;  1QR9 A;  4YIO A;  2AGA A;  2Q4P A;  3RYI B;  4J80 A;  5B1A B;  4UB6 Z;  3R65 A;  1NT2 B;  3LSU A;  3JD1 A;  2JVD A;  1VQ9 V;  1AJQ A;  1GN6 A;  3JAS A;  1M57 B;  2UXN A;  3ZRX A;  4BIU A;  2ITD C;  4I7Z B;  1Z2G A;  4WBN A;  5JJJ B;  1BL8 A;  5JCO A;  4JI8 O;  3ZN1 A;  5EZY A;  5B1N A;  1PNK A;  1AI4 A;  1JJ2 U;  3K08 A;  4ZIB A;  4FLU A;  5LOV A;  4JI0 O;  4PHZ A;  3D36 A;  1SQF A;  4FLZ A;  3OMN B;  3L75 H;  4CH3 A;  1M93 A;  4LFB O;  1YXB A;  1XHX A;  2UUC B;  3JAT B;  1AP6 A;  4MVO A;  3KG2 A;  4WFB V;  4WF9 V;  4H13 B;  3OEH G;  3WG7 B;  4FLY A;  1RSO A;  1AI7 A;  1Y66 A;  1IBL O;  4TWK A;  1WA8 B;  3K04 A;  2ZM6 O;  3EHB B;  2YC0 A;  1AR1 B;  2A7W A;  3EXA A;  4UV9 A;  3AG2 B;  2ZXW B;  3VOU A;  1Q43 A;  4DR3 O;  5IJ9 A;  2EIN B;  1FD9 A;  3KCY A;  4IGG A;  4LF8 B;  3OMA B;  3G6B A;  4RAI A;  2QKS A;  3RN4 A;  2FTK A;  4KP4 A;  4CC5 A;  3JAS B;  2WLL B;  2WA3 A;  4G28 B;  3LSQ A;  1Y4M A;  2P06 A;  2ETN A;  3FAV B;  1ENV A;  4E4E A;  1NTZ H;  4D7T A;  4DV1 B;  3DXR B;  3OR6 C;  2VQE B;  4HYO A;  5DM6 V;  2X6B A;  4GX0 A;  1Y74 B;  3SPH A;  1N33 O;  5FPO A;  1FXK A;  2UUA B;  3ASN C;  4JTA B;  5E79 Z;  5LHH A;  3K5L A;  1GN4 A;  3VQX A;  4CS3 A;  2H8P C;  3ZMT A;  3UO2 A;  3JAK A;  3T1H B;  4DV6 O;  3WFV A;  3B8M A;  4PA7 A;  4LF6 B;  3CJH A;  3A0H Z;  3CCQ V;  2QM8 A;  4EKW A;  2PY5 A;  3ABK C;  1PP9 H;  5JH7 B;  3HKE B;  1I0H A;  1ZX3 A;  2HR3 A;  2DYR B;  1IBM B;  2M7W A;  4LP8 A;  4R6Z A;  2EJ7 A;  1WP7 A;  1XNQ B;  3KKY A;  1RM1 C;  4FJC C;  1M56 C;  4NXM O;  4WFH A;  3SYA A;  4DK1 A;  5KX5 A;  2GHY A;  1XI1 A;  5EC1 C;  5B5E Z;  3W7S A;  3ZRW A;  3SJA C;  2XTA A;  2CH7 B;  3MDS A;  5CA0 A;  1V55 C;  4JI6 O;  3CCR V;  3H01 A;  3CRQ A;  5KHH A;  1H2L A;  4DR4 O;  3WB2 A;  4DR1 O;  3IC7 A;  3CCM V;  1K97 A;  2XAF A;  1Z5V A;  3AG4 C;  4W4L A;  3UQ8 A;  5B1A C;  4KUM A;  2HG5 C;  1Z5W A;  2QKA A;  4G2K A;  1P49 A;  3RGB A;  3LDE A;  4OGQ B;  4I0X A;  3PN1 A;  2FL4 A;  3A2F A;  2V7Q G;  4Z1V A;  3H1H H;  1QLE B;  4BWA A;  1V9P A;  5JCO C;  1H2G A;  1QLE C;  4ZOL B;  2Q69 A;  2RQ6 A;  4BIZ A;  5CN0 A;  1COW G;  4MW3 A;  4GYC B;  3H1I H;  5BMV B;  5JH7 A;  1N36 O;  1WPX A;  3DGE A;  4BAY A;  2R9I A;  2E5L B;  3ZJZ A;  1F7Y A;  4IHJ B;  4PD4 F;  1NQT A;  2X7R B;  2ODM A;  1XMQ B;  4TUY B;  1AVM A;  3N2K A;  1K73 W;  4H44 B;  4CS4 A;  4UVC A;  3ASN B;  5KA5 A;  5LL6 Y;  4QPK A;  5CA0 B;  1OCZ B;  1R73 A;  1YJW V;  4X8A A;  4WCE V;  2JS5 A;  1NBM G;  1SQG A;  1XMO O;  4LNU B;  2YI9 A;  1UJW B;  2UUB O; 
#chains in the Genus database with same CATH homology
 4DR6 O;  3F5T A;  4B3M O;  4X65 O;  4K0K O;  3RT3 C;  5LMU O;  4DR2 O;  2UUC O;  2FKX A;  3T1H O;  4LF9 O;  1IBL O;  1IBM O;  1G1X B;  4A5U B;  1FYJ A;  4LF7 O;  4JI6 O;  4GKK O;  2LW7 A;  2ZM6 O;  2UUA O;  4DR4 O;  4OPH A;  1AB3 A;  2UXD O;  4JI5 O;  4DR1 O;  4LFA O;  1DK1 A;  5BR8 O;  1FJG O;  5IWA O;  4LF6 O;  4B3T O;  4KHP O;  5IT9 N;  1XMQ O;  1J5E O;  4DR3 O;  4X62 O;  2DJV A;  4JV5 O;  2UXC O;  2E5L O;  3M8A A;  1R1B A;  1HNX O;  4DR7 O;  3T1Y O;  4JI7 O;  4DUY O;  4DV4 O;  2JRI A;  3JAM N;  5BY1 A;  4LF8 O;  3J81 N;  3J7A U;  4DV2 O;  4JI3 O;  1HR0 O;  3J80 N;  2F4V O;  4X66 O;  2VQF O;  4DV1 O;  1I94 O;  2AGA A;  4DV5 O;  4LF5 O;  4JI1 O;  4JYA O;  4AQY O;  5H5N A;  4X64 O;  3OTO O;  5FLX N;  1KUQ A;  1XNQ O;  5BXZ A;  4B3R O;  4LFC O;  1N33 O;  4DR5 O;  4DUZ O;  1R6T A;  1HNZ O;  1N34 O;  4JI2 O;  1XNR O;  1A32 A;  1N36 O;  1XEQ A;  2ZKO A;  2HHH O;  4DV0 O;  3SDL A;  1HNW O;  4GKJ O;  4NXN O;  4JI4 O;  1F7Y A;  4OX9 O;  4DV6 O;  4YY3 O;  4OPA A;  2VQE O;  4YHH O;  1N32 O;  2UU9 O;  1NS1 A;  4JI8 O;  2DOS A;  1D2D A;  5LMN O;  2UXB O;  2N74 A;  4DV3 O;  1X59 A;  1YZB A;  5LL6 Y;  2Z0A A;  3R66 A;  4JI0 O;  4DV7 O;  1IBK O;  3O65 A;  4LFB O;  1XMO O;  4B3S O;  5A2Q N;  4NXM O;  1AIL A;  1FKA O;  4LF4 O;  2UUB O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...