5H5NA

The crystal structure of the ns1 (h17n10) rna-binding domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
71
structure length
71
Chain Sequence
b'EPNPTTIAFQVDCYLWHLKKTLSMMGEVDAPFEDRLRREQKALKGRSMTLGIDIQSATQEGYYKIKSITEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title The NS1 gene from bat-derived influenza-like virus H17N10 can be rescued in influenza A PR8 backbone
pubmed doi rcsb
source organism Influenza a virus (a/little yellow-shouldered bat/guatemala/060/2010(h17n10))
molecule tags Rna binding protein
total genus 30
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5h5nA00
4DUZO 2DJVA 5IWAO 1FYJA 4JI0O 1XMQO 5BR8O 4OPHA 4JI7O 5LL6Y 4JI1O 4DR2O 4A5UB 2UUBO 4JI4O 1A32A 5FLXN 4DV7O 5BXZA 4YHHO 4KHPO 4OX9O 4DV1O 1R6TA 4LF8O 3J81N 2JRIA 2N74A 2UU9O 1F7YA 3T1HO 2UUCO 1NS1A 4X64O 4B3TO 1HNXO 4DR7O 1KUQA 3F5TA 4DV0O 4GKJO 1AB3A 2VQFO 4JI5O 2UXBO 1HNWO 4AQYO 1HNZO 4JI6O 1XNQO 2DOSA 5H5NA 2ZM6O 3O65A 4JI8O 3T1YO 4NXNO 2AGAA 2E5LO 2UXDO 3R66A 1J5EO 5LMNO 2ZKOA 4LF6O 4DR4O 1DK1A 2F4VO 4DV2O 1FJGO 1XNRO 1YZBA 3RT3C 2UUAO 3J80N 1N33O 4K0KO 4DR5O 1N32O 1XEQA 4DV3O 2Z0AA 3M8AA 4B3MO 1R1BA 1IBMO 4B3SO 1I94O 1AILA 4LFCO 4LF5O 4NXMO 5LMUO 4DV6O 4X66O 4DR6O 4DV5O 4GKKO 4X65O 1G1XB 1X59A 4JV5O 4LF4O 4LFAO 5A2QN 1N36O 4LF7O 4JYAO 3OTOO 2HHHO 1HR0O 5BY1A 1N34O 2UXCO 4DR3O 5IT9N 4X62O 2FKXA 1XMOO 4LF9O 4OPAA 4B3RO 1IBKO 4DV4O 1IBLO 4JI2O 2VQEO 3JAMN 4LFBO 3SDLA 4JI3O 4DR1O 4YY3O 1FKAO 2LW7A 3J7AU 1D2DA 4DUYO
chains in the Genus database with same CATH superfamily
1YHQV 4DW1A 1GMGA 4DV5B 2IJKA 1JFFB 2GHYA 4MVMA 2HEPA 4GX5A 5B66Z 2M6YA 4B3RB 2YIDA 1IBKB 5GONA 2IU3A 1BCCH 1OCRC 4O4IA 5HFMA 4PJ0Z 1IX9A 2Y69C 2QWRB 1U97A 1P49A 3PN1A 1RM1C 3CRMA 2IH3C 4YJ3B 2DYSC 2OCHA 2PUSA 4CS3A 4FFBB 2HVJC 4OX9B 4BWAA 2WLLA 3ZHSA 3CB2A 4DV1B 3CEIA 1GM8A 1B3QA 4FLTA 4DR4O 2F4VO 2QM7A 1AR4A 1SESA 2P5OA 3E8FA 1XI1A 1N0NA 2IW5A 1OCOB 3J80N 4XDKA 4L87A 2PY5A 5FNVA 1DLBA 1BZKA 1IBMO 1JQ0A 4B3SO 3R65A 4LFCO 1YVWA 4LCUC 3LSUA 3CRCA 1LUWA 4ZOLB 2GUZB 4EFEA 4LFAO 5EZYA 2B5UA 5KMGB 4LF6B 4R8CA 1HR0O 1KU9A 4TV9A 2FL4A 2FKXA 2ZE6A 4DO2A 5KAFZ 2HP8A 5C8YA 4ZI7A 1OHHG 4UV9A 4JI2O 1N4CA 3M7MX 1Y4MA 2NLJC 2N05A 3FYEB 1M57B 2Y48A 2G38A 4LF5B 1D2DA 3UO2A 1YSCA 4HAMA 2ATKC 3OE7G 5IWAO 2HJDA 1E79G 1SA0B 3B8NA 5JVDA 4HYOA 4PI2A 2XUMA 1NVPB 4DRXA 2IJJA 5CA0B 4YHHO 4KHPO 1F4MA 5D5PA 4IGGA 3L9DA 4RUEA 2UXNA 4X1KB 5CBFA 3CRAA 3ZN0A 1HNXO 1RSOB 3JD0A 1CP9A 1Y6XA 4UV8A 3T4ZA 1WA8B 4UCOA 3FAVB 1R3KC 3OAAG 1FXVA 5KX5A 3JARB 3RBZA 3K5NA 3UT5A 5A9GA 1XDCA 2GTAA 4TT3G 5B1AB 1DK1A 2UU9B 4TUYA 3CWBH 1ROPA 3LUTB 4I9WA 1JR9A 4LH6A 1XEQA 2ZXWB 4JI6B 4UVBA 4FZ1A 2QM4A 5B1OA 3K58A 3CCVV 3NXSA 2F43G 2UXDB 3K0DA 3FB7C 1NZ6A 1FXKA 2QTOA 3SJCC 3CHXA 5L3EA 1MG1A 5JH7A 4PA9A 1WPXA 3TJTA 4DR3O 4X62O 4P2ZA 4OGQB 2R9IA 2X0LA 3G67A 3DC6A 4H33A 1B6QA 1GN6A 3L71H 5L3GA 4X1YB 3HKEA 1I94B 4GX1A 2V4DA 4NXMB 5IYCO 5LMUB 3K06A 2CAZC 3E89A 2K1EA 4JF3A 5JJEB 5J2UA 1XMQO 4CC6A 2E75B 1N36B 3AK2A 3OTOB 1PL4A 1BHAA 5GONB 1V9PA 4AHCA 3CXCU 1L0LH 4O4IB 4IT5A 1WN7A 4ASUG 1R6TA 5LA6A 4DV4B 1U96A 3M99B 1US6A 2IBZH 4ICGA 3BABA 4WCEV 1OCZC 3ETGA 3RFRA 4MW3A 3A0RA 3JALB 4JI0B 5LOVA 5BR8B 5L3DA 2D3OW 1SQVH 4JI7B 2GV9A 2AGAA 2WLLB 3H1HH 3B40A 3N2KB 2ZQMA 1IXBA 1VP7A 2Q6AA 4HNAA 1XHZA 1VQ5V 3QF7A 1NTMH 2A06H 5LHHA 3RVZA 2UUAO 4FLZA 2BE3A 3MAQA 4K0KO 4J9YB 2Z0AA 3BEHA 1VIBA 4UCRA 2ZDIC 2ZM6B 4JI8B 4WFFA 4O4HA 2Q73A 3AG4C 1ZLZA 1AI4A 4UFZA 1WP7A 2ODMA 2Q7EA 1VF6C 4GX0A 4ZI7B 2AZ0A 2UXCO 5IT9N 5B3SB 3WB0A 2W0XA 1S3JA 4AI8A 2AW9A 2EIMC 2ZNJA 3JD2A 4CS4A 4DR5B 4JYYA 4LFBO 5IJ0A 2ZIMA 2W6JG 2WA4A 2EINB 3OT7A 3ZHVA 4DR1O 1FKAO 4DUYO 4WFBV 5JVDB 4WF9V 3IFXA 1BMFG 1M4UA 4GKKB 3RYHB 2A7WA 2DN9A 3JASA 3OMNB 4IYIA 1VQOV 1NBMG 1QLNA 2XAJA 4PDVA 3AK3A 2LQTA 2QWNB 2PZSA 3GWOA 1UPGA 2JRIA 2ZE5A 2LO1A 3HKBA 4UUJC 1IBLB 1SC5B 3JCUZ 3GWKC 2YDEA 1Q86W 1P4RA 2JEXA 5EBMC 1K9MW 2DWEC 4GKJO 3P3PA 1QU7A 1OCCB 3FX7A 1LUVA 4P9OA 4XDLA 1QNMA 4UCTA 2GDSA 1K73W 4I50A 3RYFA 2F23A 4KUMA 1V55C 2W0FC 1MSWD 4MVQA 3EHBB 3K0GA 2E5LO 4YIOA 4EFBA 3BA8A 4TUYB 2QJ1A 1AR1B 3ZX6A 3Q4HB 1S0VA 5EIBC 1JMKC 4QIWF 4PDLA 2EILB 3T2MA 4PA6A 5HFLA 4NVPA 2DW4A 1PV0A 2EZOA 2PI4A 2KKWA 2JGDA 3E8BA 1AJQA 1FXKB 3EVKA 4RWUA 4ZHQA 5JH7B 2KG7B 3RVYA 3CD6V 3CCRV 1EN5A 3THOA 1SRYA 4LF7O 2OWOA 4LC1A 3I5DA 4DR4B 1TVKB 3WB1A 4IHJA 5KA5A 2F4VB 5B5EZ 2IU0A 1XMOO 1MSDA 1GK9A 1PNKA 2HR3A 4NTYA 1H2GA 3VQVA 2VRZA 1QBZA 3ZMSA 3CC2V 2QSAA 3JD1A 1IBMB 3ABMB 4B3SB 2P90A 3CCEV 3W7WA 4LFCB 4FVMA 2WLNA 3L70H 5J2UB 1YI2V 3SYOA 1FYJA 4MTFA 3SPHA 1URFA 3B77A 3CRQA 4LFAB 3H1JH 1HR0B 2YC0A 1KD1W 4RAIA 2QE7G 3U11A 1S77D 2Y0PA 4JI2B 3BAAA 4DXWA 2XASA 4B3TO 4DR7O 3ZRWA 4OXSA 2BSKA 1AB3A 5LOVB 1XHXA 3LDCA 2JEUA 2YXHA 5IWAB 2PYLA 1ZSPA 2DOSA 1M90W 2P6JA 5KUMA 1KB9F 1SERA 3DTUB 1SF9A 4YHHB 4KHPB 4UCSA 4LNUB 4FM2A 3HPLC 2AZ2A 1J5EO 5JCOC 4N21A 1S76D 4DV2O 4Z2WA 3ZBHA 4MTOA 3K04A 1HNXB 3OUSA 1H2SB 1CXZB 3CJHB 4X89A 4FIPC 4JASA 4X20A 3K3WA 3AG1C 3P32A 1Z2GA 4FMTA 5KUKA 3H01A 2YIBD 3OR6C 5JJNB 3D3IA 1VQ8V 1DTOA 4DR6B 2E3CA 4BIUA 3ETEA 3S3WA 3P30A 1Z5WA 2DE0X 4QPKA 1G8MA 4U3FH 4JYAO 3OGIB 2QWPB 4J7ZA 5DM6V 1YDXA 1EM1A 4F6EA 5KHGA 2M7WA 4TOIA 3CCLV 5DN6G 1IVSA 3J7AU 2NNUA 4DUZO 5DECA 1PD3A 4OPHA 3D3QA 5LL6Y 5C93A 3CC4V 2LGWA 1NH2B 4DR3B 3HKBB 1OJHA 1FPOA 4X62B 5B1BC 3E35A 1Q5OA 1NI8A 2AXTZ 4TWKA 2N74A 2CGOA 4Q20A 4WFGA 4WFAV 3ZN1A 4DV0O 3BA9A 2VS0A 5LP6C 5KHIA 1HNZO 4N23A 3E22B 3LSQA 3W7TA 1XNQO 1XMQB 3ZJZA 2JJ1G 5F2VO 4O2AB 2FTKA 3LSSA 4EKWA 4UCVA 1OZ0A 4QJFB 2DWDC 4LWSA 2OT5A 1NJIW 5LMNO 1CEZA 4UVCA 2HJFC 2R9AA 2RN9A 2W6IG 1I5YA 1P84F 5H6RA 3ZS8C 4KL1A 5CBGA 4U3JA 2JGDB 4ZIBA 3C3SA 1ENVA 3ASOB 4ZHQB 2K9PA 1SETA 3ABUA 2F66C 1XBLA 3JAWA 1Y76B 3A0BZ 4IHJB 4E2LA 3G71V 2QR4A 5A2QN 1PM9A 1IZ3A 2R72A 2YUAA 1SZXA 1GTOA 2ZDIA 1OV9A 4OPAA 2UUAB 4O2BA 5JQGA 1QVFU 4FZ0A 3SPIA 4K0KB 5CB4B 3WFVA 2Q7HA 2Q67A 5EC2C 2WLHA 5KA6A 4JYBA 3VOUA 4NB5A 2YI9A 1EFRG 4U7NA 5LGTA 1ZL8A 4JI4O 1K33A 1JOYA 2AHZA 3VBBA 2UXCB 3SPCA 1VQLV 3CX5F 1MOFA 4J42A 1FFXA 1OCOC 4MVOA 2ZR3A 4X1IB 1TA8A 4H44B 4I0XA 5BMVA 1COWG 4LFBB 2B9ZA 4EB6A 2UUCO 1NS1A 3HKCB 4FLVA 2GBOA 4DR1B 5IJ9A 3JAKA 4DUYB 1YIJV 1Z5VA 3RYIA 1RPOA 2RNBA 5H5NA 3O65A 3CRRA 3GB7C 3CCQV 3T1YO 1EN4A 2E76B 4I55A 2Q0OC 3ZHRA 2EIJB 1AROP 5IYDO 4FFKA 3CXHF 3ABTA 4H0LB 2ITCC 2WA3A 1Q6UA 2EZPA 3ZIAG 3RT3C 4X20B 1M57C 3ZHTA 3K79A 4GKJB 3MHHC 1N32O 1BL8A 4G27B 1XREA 2KSDA 1NR7A 2E74B 3KG2A 2MK3A 5LXTA 2LFRA 4DV6O 1YJNV 1AI5A 2E5LB 4DR6O 4J7KA 4BIZA 3ZHQA 4G28B 4X65O 1MA1A 1X59A 2H94A 2WLMA 2A0LA 1KKDA 3ZMZA 4D7TA 4NTXA 5CA1A 2IJIA 1SS3A 5EYPA 2VQEO 5FPRA 4R7CA 4F6RA 3CSXA 1Q8IA 1N8RW 4PELA 2OIEA 2CTQA 3H1IH 4MVZA 3CMEV 4LF7B 5B1AC 1H2LA 4DV7O 3CCUV 4LBEC 1XMOB 1Q81W 3APQA 3K9SA 3CCJV 3L74H 3SJAC 3J81N 1SQQH 1Q7YW 2ZXWC 2PGGA 2WLIA 3JSLA 4MVRA 4I9QA 1JVMA 4NKGB 3OFNG 2WPDG 4QE7A 2NR5A 1HNWO 1JCHA 1YJ9V 4JAVA 3DXRA 4LWSB 4CC5A 1KECA 5IY5B 2Y0IA 2H3OA 2ZKOA 4U3JB 1PP9H 1W59A 1YZBA 2CDYA 2DQ3A 4B3TB 4DR7B 3BHPA 3A8TA 3LDEA 3OMAB 3QNEA 4XDJA 3AG2B 3SJQC 3M8AA 5EC1C 1K4CC 3ABKB 4QPJA 2WLKA 4X88A 1QLEB 5ITZA 2QWQB 2QKCA 1J5EB 3AK1A 5LHIA 3CE2A 5JQGB 5FNVB 5EK0A 4IYHA 4DV2B 3P3NA 3AG4B 2OCCB 1V54B 5IYBO 4JZ2A 1YTFD 4AILC 1PL0A 3QTCA 1E1QG 5KHJA 5CMUA 2P4KA 5EZYB 1H8HG 2EIKB 2EIMB 1WP8A 4TV9B 5GTHZ 3SPGA 3OUFA 3VQYA 5C8YB 1VF7A 3BY6A 2XAHA 2UUBO 4JYAB 4HBNA 2DYRB 1TUEB 2C2AA 5FLXN 1WLEA 1NT2B 5BMVB 1AI7A 2Q4PA 4BAYA 3X2QB 2YIBA 2F95B 5IJ9B 2Z5UA 2Y4UA 3A2FA 1O9HA 3QO8A 4X64O 1SQXH 3HKDA 1B06A 1FD9A 1P7BA 3IC9A 4WFEA 4JAAA 3K9AA 4J7JA 2UXBO 4DRXB 4DUZB 5L3BA 5GTIZ 2QM8A 1VQ6V 2CTWA 3T4DA 2OTLV 4UVAA 4Z1VA 3OMIB 4I7ZB 5H6QA 5B3SC 5KAIZ 2BOCC 1TUBA 5EIBD 5LP6A 5H9CA 5J2TA 1FJGO 3U0ZA 3C90A 2A79B 2EINC 3F7YC 4DV0B 1N33O 1D5AA 4U7OA 1HNZB 4DV3O 5LXTB 1XNQB 5KX5B 4B3MO 1PNLA 3UT5B 5D5QA 2YEVA 4X66O 2GSMB 1JX9A 3HB3B 2CUGA 4Q6GA 4D7SA 1G1XB 5LMNB 3E83A 5CA1B 4MS2A 3OTFA 4F6RB 3ABLC 4FPPA 1OCCC 3ETDA 2L35A 2X6BA 1F23A 2CTPA 4X8AA 1LR1A 4YY3O 3JATA 1S5LZ 4MVUA 2WLJA 3FFQA 4GCZA 3BRCA 3OM3B 4DR2O 2XNDG 1R3JC 3HKEB 2XHBA 1QVGU 4QE9A 3ZCCA 3JD4A 4YJ3A 2EILC 3OD4A 1L1FA 1K7DA 4GZRB 3ML0A 4FFBA 1F7YA 1BS3A 3T1HO 1AJPA 4DW0A 1Q6IA 4UB6Z 4TQFA 2VWJA 2JS3A 3WG7B 1B04A 3STZC 1AJNA 3L72H 4FJCC 5JJJB 2QEXV 5LA6B 4NXNO 4JI4B 2X6AA 1DGSA 5IDJA 4PD4F 4HZ3A 2PI5A 1Q43A 4ZOLA 3AG3B 2UUCB 2GUZA 1CPYA 1QCEA 3B8MA 2GTSA 5KMGA 2ETNA 1RPRA 1Y66A 3E2EA 3QG5A 4BW5A 1AILA 3RYCA 4PA7A 3T1YB 1BHBA 3BPZA 3OGCC 4HNAB 1H2MA 4ZKIA 2ZNIA 5EBLC 4GX2A 1QQCA 2WSSG 3C3TA 4RQEA 2LFSA 4LF4O 3AG1B 2L6LA 2HHHO 2JK5C 4PHZA 3A0HZ 4PDMA 1IXMA 1SA0A 4JGSA 3ASNB 4O4HB 2YSUB 1N32B 4B7EA 4FM1A 1JA8A 5CA0A 3RWRD 3SDLA 3K08A 4P30A 5IYZA 4JI3O 1P7GA 1PKXA 4CH5A 3W7UA 4DV6B 1TAEA 2JJ2G 4PDRA 4L8JA 4I5SA 2OTJV 1THZA 2DJVA 2IH1C 2DMXA 5AG2A 4X65B 2RJZA 1R3IC 1QR8A 4B7KA 2JGUA 1GO3F 4EEQA 4W4LA 1M56C 3E8GA 5IJ0B 1WAZA 5L3CA 4H13B 3MHSC 3FAVA 1WB7A 5FPOA 2VQEB 4TV8A 1HDJA 3CS5A 3E8HA 3JASB 1XOUA 4JI5O 1I7FA 2X6CA 1GM7A 3WB2A 2CTRA 2BOBC 5DEDA 1XILA 4F4LA 2O57A 1Q3EA 4DV7B 4MT8A 1UJWB 1GAXA 1ZUQA 5B1NA 4JTCB 4YIPA 3R66A 1BQZA 1H8EG 2P06A 2OIGA 4BIOA 4ZBMA 4RQFA 1TGOA 4I50B 3RYFB 4KFMA 4H37A 4IIJA 1OCRB 2IJHA 3OEHG 1HNWB 1RFYA 3K03A 2XOKG 2F1MA 5CBHA 2YEVB 3AG7A 1R3LC 2Y69B 1FS0G 3F5WC 2P7TC 1QHTA 4YJ2A 3H9VA 1NR1A 4JZGA 4X1YA 1S5JA 1RM1B 4FLUA 2JVDA 3B09A 4JV5O 2DYSB 3NR7A 1SZTA 3QO7A 4LF9O 1K97A 2LJ2A 1JJ2U 4G2KA 3JATB 3H1LH 2V7QG 2ZE7A 5L3FA 1IURA 2JDIG 2DQ0A 3F7VC 3ZRVA 4TQDA 1KYOF 4P9PA 2CH7A 3OEEG 3ZHUA 4R50A 1W2BU 4A5UB 2WWWA 3JALA 2OYQA 1PPJH 4MTXA 3D36C 3U10A 1J95A 2VWKA 3FD9A 4LF8O 3CMAV 4WBNA 5CN0A 3GVMA 3BFRA 3ASOC 4MW8A 3N2KA 1K5QA 2EJRA 1VF6A 4RUFA 3S3XA 1G6UA 1KC8W 2Q8VA 2LGQA 1W0JG 1IDSA 4J11A 3N27A 3EFFK 2R70A 3ZEDA 2XAQA 4NR1A 2UUBB 3KKYA 2LP7A 3APOA 1R73A 5LGNA 4NYKA 3IGAC 3ZRWB 1ZTEA 4JPRA 2V1DA 2BSKB 1KMIZ 1KP2A 4RO2A 3QO5A 1BT8A 3OW2U 4MVSA 4X64B 2ZR2A 3RYCB 1AI6A 1BSMA 2UXBB 4UB8Z 4TSFG 1E1RG 2ITDC 2YS8A 1R1BA 3ZMUA 1O9GA 3VQXA 1NVPD 2MW2B 2JS5A 5FL7G 1VEWA 1XL4A 4J10A 3RGBA 3B2EE 1YCIA 1SQFA 1VQMV 3MDSA 2KB1A 4MSWC 3TXSA 1I5XA 3JD3A 5BY1A 1N34O 1FJGB 2P67A 2YXYA 3RYHA 1N33B 4ABMA 5IYZB 3IJ4A 4K35A 1MMMA 3ETQA 4CBCA 4DV3B 4B3MB 2QA4V 1VQPV 1M1KW 1LNQA 1YJWV 1YXBA 1YEWA 4GYCB 4X66B 5LBQA 2EIJC 4YXWG 4PA3A 2IM9A 1HP8A 5KHKA 2F93B 1SQPH 4JI1O 2BTQA 3OR7C 2QTSA 2QKSA 3VQWA 1HWYA 1XQ8A 3BCCH 4TV8B 4BR6A 4FLXA 1L0NH 2P4VA 3UM7A 1EBOA 1SQGA 3CPWU 4O4JA 2A9HA 1JJOA 4CH3A 1K92A 3F5TA 4YY3B 2VQFO 3G4SV 1Y74A 3Q4HA 4AQYO 4O4LA 5LGUA 2RMKB 4LR3A 2NN4A 3N2GA 4DR2B 1KP3A 2ZINA 3RW0A 3L73H 5J9PC 5KHHA 2XAGA 2HFEC 4K8ZA 2KG7A 3T1HB 1Q90D 4IIJB 1RP3B 1XNRO 4GLXA 1DF5A 1TVKA 4YJ2B 2HG5C 1WB8A 2EULA 2Q69A 1OCZB 4NXNB 2Q5ZA 3K57A 3TK1A 1S72V 4DV5O 2P22C 4W4KA 3ZRXA 3TGUH 1WNSA 1GN3A 2XAFA 1VQNV 4CH4A 4B3RO 1ORQC 1K34A 1IBKO 4JYCA 1XL6A 3JAWB 1NQTA 5JCOA 2CH7B 1ZWIC 4BW9A 1DF4A 4Z1MG 4UCUA 4LH7A 5H2FZ 3B4SA 5K1PA 5IY5C 1KBHA 3PJSK 1M93A 1I08A 3CCSV 4O2BB 2EBOA 2HKOA 3ZRSA 4LF4B 1T5EA 2FYUH 2HHHB 1GM9A 1VARA 4WBNB 4OX9O 4DV1O 4DK1A 2PYJA 2B1GA 3AG2C 3KCXA 2KQXA 5IE9A 3ABKC 3ZMTA 4JI3B 4LNUA 3I56V 1ZL8B 2Q0AA 1MZFA 2ADQB 1L8DA 1FAFA 3KCYA 1QLEC 3STLC 1UFIA 1FFXB 1YTFB 1WJZA 2X7RB 4FLWA 3CJHA 1MABG 2PTMA 4X9QA 2ZCEA 4I0XB 1EZVH 1K8AW 4EB6B 1EN6A 4FM0A 4GUNA 5LYJA 2OCCC 1QR9A 3SYQA 1V54C 3JAKB 1AVMA 4LF6O 3RYIB 3JYCA 1NU1H 1HW7A 4C7UA 1Y67A 4I55B 4JI5B 2EIKC 5BZBA 3JCZA 1S5HC 4LF5O 2QWOB 3H1KH 1FXHA 2DYRC 4LP8A 3G80A 1GN2A 1V55B 3X2QC 1F51A 1VQ9V 4DYLA 4FK5C 3EXAA 4QNHB 4KP4A 4MTGA 1D5NA 3JAMN 1R6KA 1AR5A 1SQBH 5K1XA 2CGNA 1GH6A 5KLVH 2RDCA 3CYOA 1N0JA 3G6EV 3ABLB 2BTQB 2AHYA 4I4TA 4JV5B 1NKDA 4J41A 4KXRA 1W0KG 1JPXA 1R6NA 1A32A 3DGEA 5EYPB 3MD0A 1JFFA 3E22A 4O4JB 4CH6A 5E1AC 4LF9B 3LNNA 4O2AA 2RQ6A 5EBWC 1NTKH 2Q7GA 2UU9O 1Y74B 3W7SA 1VQ4V 1BQ0A 2LW1A 4O4LB 2XT9A 5LHGA 4UXNA 4PV1B 3HR0A 3N2GB 4JI6O 4NTWA 2CK3G 3D36A 1GKFA 1PNMA 3LNMB 1BE3H 2YI8A 4PI0A 3ZMVA 4B08A 1YF2A 3SJBC 2WLIB 3D8CA 2UXDO 3TCUA 4LF8B 2YICA 2ILMA 4FLYA 4GT1A 2YIAA 1Y76A 3K5OA 4DK0A 1VQKV 1AP5A 1FXKC 4E4EA 3L75H 3DXRB 3QVNA 3K59A 2FMLA 1I94O 3FB6C 2EJ7A 4NXMO 3SYPA 2ADPA 1G4YB 5CB4A 5LMUO 1KKCA 1BGYH 2XTAA 2Z3YA 2EX3A 1ZX3A 3K5LA 3E86A 2HLDG 1N36O 3UQ8A 2D2CB 3OTOO 3ABMC 5GW7A 2BCCH 2ARHA 1VMGA 4CS2A 1K4DC 4DV4O 3WG7C 3SGIA 2WAMA 4QGPA 3SYCA 2JIZG 1AP6A 3BVOA 5ITZB 1Q82W 3I55V 1I0HA 4X1IA 3CP1A 2HVKC 2FB5A 3HKCA 4JI0O 5BR8O 4JI7O 2RCVA 1KQSU 1X4TA 1VQ7V 1N34B 3AG3C 5BXZA 1EZJA 1Q6HA 2ZT9B 5E79Z 1ZAUA 4K8XA 4JTAB 5TISZ 4D6TH 1M56B 1VF5B 1KUQA 3W7XA 2B1IA 3AEIA 4X1KA 1MZEA 3UO3A 2N04A 1RSOA 2ZE8A 3TETA 2QKAA 2YXLA 1H2NA 2ZM6O 2A3QA 3SR2C 4XBFA 2PF4E 4JI8O 1MNGA 4JI1B 5LYJB 1H38A 1GRJA 1WA8A 3IC7A 1H2KA 3DC5A 2H8PC 1GN4A 3KZIZ 3HKDB 3ASNC 3ICXA 2R9RB 3FKSG 3JARA 3FB5C 5B1BB 3O9OA 4R6ZA 3T1CA 2QGNA 3UCSC 1K5SA 3CCMV 2VQFB 1NTZH 4DR5O 3SPJA 3UKMA 4AQYB 3FB8C 2Q9LA 1K3EA 4IL6Z 2ZD9A 1TUBB 3FYIB 3K5MA 1NH2D 3RN4A 1WPBA 5LP6B 5J2TB 4GKKO 3G6BA 5JWPA 3DSQA 2Q68A 3LDDA 4J9ZB 2CE4A 3IAYA 1M5IA 1F4NA 4JAUA 2Y4TA 2ZIOA 3JSNA 2QDOA 3WU2Z 1FFTB 1XNRB 3TXQA 3CC7V 2UXXA 4J80A 2BTOA 5CA3A 1IBLO 4K3AA 1SKVA 1XUQA 1YITV 1M9NA 3SYAA 4WFHA 4CZZA 2LW7A 4JTDB 4I4TB 4PA4A
chains in the Genus database with same CATH topology
4DUZO 2DJVA 5IWAO 1FYJA 4JI0O 1XMQO 5BR8O 4OPHA 4JI7O 5LL6Y 4JI1O 4DR2O 4A5UB 2UUBO 4JI4O 1A32A 5FLXN 4DV7O 5BXZA 4YHHO 4KHPO 4OX9O 4DV1O 1R6TA 4LF8O 3J81N 2JRIA 2N74A 2UU9O 1F7YA 3T1HO 2UUCO 1NS1A 4X64O 4B3TO 1HNXO 4DR7O 1KUQA 3F5TA 4DV0O 4GKJO 1AB3A 2VQFO 4JI5O 2UXBO 1HNWO 4AQYO 1HNZO 4JI6O 1XNQO 2DOSA 5H5NA 2ZM6O 3O65A 4JI8O 3T1YO 4NXNO 2AGAA 2E5LO 2UXDO 3R66A 1J5EO 5LMNO 2ZKOA 4LF6O 4DR4O 1DK1A 2F4VO 4DV2O 1FJGO 1XNRO 1YZBA 3RT3C 2UUAO 3J80N 1N33O 4K0KO 4DR5O 1N32O 1XEQA 4DV3O 2Z0AA 3M8AA 4B3MO 1R1BA 1IBMO 4B3SO 1I94O 1AILA 4LFCO 4LF5O 4NXMO 5LMUO 4DV6O 4X66O 4DR6O 4DV5O 4GKKO 4X65O 1G1XB 1X59A 4JV5O 4LF4O 4LFAO 5A2QN 1N36O 4LF7O 4JYAO 3OTOO 2HHHO 1HR0O 5BY1A 1N34O 2UXCO 4DR3O 5IT9N 4X62O 2FKXA 1XMOO 4LF9O 4OPAA 4B3RO 1IBKO 4DV4O 1IBLO 4JI2O 2VQEO 3JAMN 4LFBO 3SDLA 4JI3O 4DR1O 4YY3O 1FKAO 2LW7A 3J7AU 1D2DA 4DUYO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ O;  2DJV A;  5IWA O;  1FYJ A;  4JI0 O;  1XMQ O;  5BR8 O;  4OPH A;  4JI7 O;  5LL6 Y;  4JI1 O;  4DR2 O;  4A5U B;  2UUB O;  4JI4 O;  1A32 A;  5FLX N;  4DV7 O;  5BXZ A;  4YHH O;  4KHP O;  4OX9 O;  4DV1 O;  1R6T A;  4LF8 O;  3J81 N;  2JRI A;  2N74 A;  2UU9 O;  1F7Y A;  3T1H O;  2UUC O;  1NS1 A;  4X64 O;  4B3T O;  1HNX O;  4DR7 O;  1KUQ A;  3F5T A;  4DV0 O;  4GKJ O;  1AB3 A;  2VQF O;  4JI5 O;  2UXB O;  1HNW O;  4AQY O;  1HNZ O;  4JI6 O;  1XNQ O;  2DOS A;  5H5N A;  2ZM6 O;  3O65 A;  4JI8 O;  3T1Y O;  4NXN O;  2AGA A;  2E5L O;  2UXD O;  3R66 A;  1J5E O;  5LMN O;  2ZKO A;  4LF6 O;  4DR4 O;  1DK1 A;  2F4V O;  4DV2 O;  1FJG O;  1XNR O;  1YZB A;  3RT3 C;  2UUA O;  3J80 N;  1N33 O;  4K0K O;  4DR5 O;  1N32 O;  1XEQ A;  4DV3 O;  2Z0A A;  3M8A A;  4B3M O;  1R1B A;  1IBM O;  4B3S O;  1I94 O;  1AIL A;  4LFC O;  4LF5 O;  4NXM O;  5LMU O;  4DV6 O;  4X66 O;  4DR6 O;  4DV5 O;  4GKK O;  4X65 O;  1G1X B;  1X59 A;  4JV5 O;  4LF4 O;  4LFA O;  5A2Q N;  1N36 O;  4LF7 O;  4JYA O;  3OTO O;  2HHH O;  1HR0 O;  5BY1 A;  1N34 O;  2UXC O;  4DR3 O;  5IT9 N;  4X62 O;  2FKX A;  1XMO O;  4LF9 O;  4OPA A;  4B3R O;  1IBK O;  4DV4 O;  1IBL O;  4JI2 O;  2VQE O;  3JAM N;  4LFB O;  3SDL A;  4JI3 O;  4DR1 O;  4YY3 O;  1FKA O;  2LW7 A;  3J7A U;  1D2D A;  4DUY O; 
#chains in the Genus database with same CATH topology
 1YHQ V;  4DW1 A;  1GMG A;  4DV5 B;  2IJK A;  1JFF B;  2GHY A;  4MVM A;  2HEP A;  4GX5 A;  5B66 Z;  2M6Y A;  4B3R B;  2YID A;  1IBK B;  5GON A;  2IU3 A;  1BCC H;  1OCR C;  4O4I A;  5HFM A;  4PJ0 Z;  1IX9 A;  2Y69 C;  2QWR B;  1U97 A;  1P49 A;  3PN1 A;  1RM1 C;  3CRM A;  2IH3 C;  4YJ3 B;  2DYS C;  2OCH A;  2PUS A;  4CS3 A;  4FFB B;  2HVJ C;  4OX9 B;  4BWA A;  2WLL A;  3ZHS A;  3CB2 A;  4DV1 B;  3CEI A;  1GM8 A;  1B3Q A;  4FLT A;  4DR4 O;  2F4V O;  2QM7 A;  1AR4 A;  1SES A;  2P5O A;  3E8F A;  1XI1 A;  1N0N A;  2IW5 A;  1OCO B;  3J80 N;  4XDK A;  4L87 A;  2PY5 A;  5FNV A;  1DLB A;  1BZK A;  1IBM O;  1JQ0 A;  4B3S O;  3R65 A;  4LFC O;  1YVW A;  4LCU C;  3LSU A;  3CRC A;  1LUW A;  4ZOL B;  2GUZ B;  4EFE A;  4LFA O;  5EZY A;  2B5U A;  5KMG B;  4LF6 B;  4R8C A;  1HR0 O;  1KU9 A;  4TV9 A;  2FL4 A;  2FKX A;  2ZE6 A;  4DO2 A;  5KAF Z;  2HP8 A;  5C8Y A;  4ZI7 A;  1OHH G;  4UV9 A;  4JI2 O;  1N4C A;  3M7M X;  1Y4M A;  2NLJ C;  2N05 A;  3FYE B;  1M57 B;  2Y48 A;  2G38 A;  4LF5 B;  1D2D A;  3UO2 A;  1YSC A;  4HAM A;  2ATK C;  3OE7 G;  5IWA O;  2HJD A;  1E79 G;  1SA0 B;  3B8N A;  5JVD A;  4HYO A;  4PI2 A;  2XUM A;  1NVP B;  4DRX A;  2IJJ A;  5CA0 B;  4YHH O;  4KHP O;  1F4M A;  5D5P A;  4IGG A;  3L9D A;  4RUE A;  2UXN A;  4X1K B;  5CBF A;  3CRA A;  3ZN0 A;  1HNX O;  1RSO B;  3JD0 A;  1CP9 A;  1Y6X A;  4UV8 A;  3T4Z A;  1WA8 B;  4UCO A;  3FAV B;  1R3K C;  3OAA G;  1FXV A;  5KX5 A;  3JAR B;  3RBZ A;  3K5N A;  3UT5 A;  5A9G A;  1XDC A;  2GTA A;  4TT3 G;  5B1A B;  1DK1 A;  2UU9 B;  4TUY A;  3CWB H;  1ROP A;  3LUT B;  4I9W A;  1JR9 A;  4LH6 A;  1XEQ A;  2ZXW B;  4JI6 B;  4UVB A;  4FZ1 A;  2QM4 A;  5B1O A;  3K58 A;  3CCV V;  3NXS A;  2F43 G;  2UXD B;  3K0D A;  3FB7 C;  1NZ6 A;  1FXK A;  2QTO A;  3SJC C;  3CHX A;  5L3E A;  1MG1 A;  5JH7 A;  4PA9 A;  1WPX A;  3TJT A;  4DR3 O;  4X62 O;  4P2Z A;  4OGQ B;  2R9I A;  2X0L A;  3G67 A;  3DC6 A;  4H33 A;  1B6Q A;  1GN6 A;  3L71 H;  5L3G A;  4X1Y B;  3HKE A;  1I94 B;  4GX1 A;  2V4D A;  4NXM B;  5IYC O;  5LMU B;  3K06 A;  2CAZ C;  3E89 A;  2K1E A;  4JF3 A;  5JJE B;  5J2U A;  1XMQ O;  4CC6 A;  2E75 B;  1N36 B;  3AK2 A;  3OTO B;  1PL4 A;  1BHA A;  5GON B;  1V9P A;  4AHC A;  3CXC U;  1L0L H;  4O4I B;  4IT5 A;  1WN7 A;  4ASU G;  1R6T A;  5LA6 A;  4DV4 B;  1U96 A;  3M99 B;  1US6 A;  2IBZ H;  4ICG A;  3BAB A;  4WCE V;  1OCZ C;  3ETG A;  3RFR A;  4MW3 A;  3A0R A;  3JAL B;  4JI0 B;  5LOV A;  5BR8 B;  5L3D A;  2D3O W;  1SQV H;  4JI7 B;  2GV9 A;  2AGA A;  2WLL B;  3H1H H;  3B40 A;  3N2K B;  2ZQM A;  1IXB A;  1VP7 A;  2Q6A A;  4HNA A;  1XHZ A;  1VQ5 V;  3QF7 A;  1NTM H;  2A06 H;  5LHH A;  3RVZ A;  2UUA O;  4FLZ A;  2BE3 A;  3MAQ A;  4K0K O;  4J9Y B;  2Z0A A;  3BEH A;  1VIB A;  4UCR A;  2ZDI C;  2ZM6 B;  4JI8 B;  4WFF A;  4O4H A;  2Q73 A;  3AG4 C;  1ZLZ A;  1AI4 A;  4UFZ A;  1WP7 A;  2ODM A;  2Q7E A;  1VF6 C;  4GX0 A;  4ZI7 B;  2AZ0 A;  2UXC O;  5IT9 N;  5B3S B;  3WB0 A;  2W0X A;  1S3J A;  4AI8 A;  2AW9 A;  2EIM C;  2ZNJ A;  3JD2 A;  4CS4 A;  4DR5 B;  4JYY A;  4LFB O;  5IJ0 A;  2ZIM A;  2W6J G;  2WA4 A;  2EIN B;  3OT7 A;  3ZHV A;  4DR1 O;  1FKA O;  4DUY O;  4WFB V;  5JVD B;  4WF9 V;  3IFX A;  1BMF G;  1M4U A;  4GKK B;  3RYH B;  2A7W A;  2DN9 A;  3JAS A;  3OMN B;  4IYI A;  1VQO V;  1NBM G;  1QLN A;  2XAJ A;  4PDV A;  3AK3 A;  2LQT A;  2QWN B;  2PZS A;  3GWO A;  1UPG A;  2JRI A;  2ZE5 A;  2LO1 A;  3HKB A;  4UUJ C;  1IBL B;  1SC5 B;  3JCU Z;  3GWK C;  2YDE A;  1Q86 W;  1P4R A;  2JEX A;  5EBM C;  1K9M W;  2DWE C;  4GKJ O;  3P3P A;  1QU7 A;  1OCC B;  3FX7 A;  1LUV A;  4P9O A;  4XDL A;  1QNM A;  4UCT A;  2GDS A;  1K73 W;  4I50 A;  3RYF A;  2F23 A;  4KUM A;  1V55 C;  2W0F C;  1MSW D;  4MVQ A;  3EHB B;  3K0G A;  2E5L O;  4YIO A;  4EFB A;  3BA8 A;  4TUY B;  2QJ1 A;  1AR1 B;  3ZX6 A;  3Q4H B;  1S0V A;  5EIB C;  1JMK C;  4QIW F;  4PDL A;  2EIL B;  3T2M A;  4PA6 A;  5HFL A;  4NVP A;  2DW4 A;  1PV0 A;  2EZO A;  2PI4 A;  2KKW A;  2JGD A;  3E8B A;  1AJQ A;  1FXK B;  3EVK A;  4RWU A;  4ZHQ A;  5JH7 B;  2KG7 B;  3RVY A;  3CD6 V;  3CCR V;  1EN5 A;  3THO A;  1SRY A;  4LF7 O;  2OWO A;  4LC1 A;  3I5D A;  4DR4 B;  1TVK B;  3WB1 A;  4IHJ A;  5KA5 A;  2F4V B;  5B5E Z;  2IU0 A;  1XMO O;  1MSD A;  1GK9 A;  1PNK A;  2HR3 A;  4NTY A;  1H2G A;  3VQV A;  2VRZ A;  1QBZ A;  3ZMS A;  3CC2 V;  2QSA A;  3JD1 A;  1IBM B;  3ABM B;  4B3S B;  2P90 A;  3CCE V;  3W7W A;  4LFC B;  4FVM A;  2WLN A;  3L70 H;  5J2U B;  1YI2 V;  3SYO A;  1FYJ A;  4MTF A;  3SPH A;  1URF A;  3B77 A;  3CRQ A;  4LFA B;  3H1J H;  1HR0 B;  2YC0 A;  1KD1 W;  4RAI A;  2QE7 G;  3U11 A;  1S77 D;  2Y0P A;  4JI2 B;  3BAA A;  4DXW A;  2XAS A;  4B3T O;  4DR7 O;  3ZRW A;  4OXS A;  2BSK A;  1AB3 A;  5LOV B;  1XHX A;  3LDC A;  2JEU A;  2YXH A;  5IWA B;  2PYL A;  1ZSP A;  2DOS A;  1M90 W;  2P6J A;  5KUM A;  1KB9 F;  1SER A;  3DTU B;  1SF9 A;  4YHH B;  4KHP B;  4UCS A;  4LNU B;  4FM2 A;  3HPL C;  2AZ2 A;  1J5E O;  5JCO C;  4N21 A;  1S76 D;  4DV2 O;  4Z2W A;  3ZBH A;  4MTO A;  3K04 A;  1HNX B;  3OUS A;  1H2S B;  1CXZ B;  3CJH B;  4X89 A;  4FIP C;  4JAS A;  4X20 A;  3K3W A;  3AG1 C;  3P32 A;  1Z2G A;  4FMT A;  5KUK A;  3H01 A;  2YIB D;  3OR6 C;  5JJN B;  3D3I A;  1VQ8 V;  1DTO A;  4DR6 B;  2E3C A;  4BIU A;  3ETE A;  3S3W A;  3P30 A;  1Z5W A;  2DE0 X;  4QPK A;  1G8M A;  4U3F H;  4JYA O;  3OGI B;  2QWP B;  4J7Z A;  5DM6 V;  1YDX A;  1EM1 A;  4F6E A;  5KHG A;  2M7W A;  4TOI A;  3CCL V;  5DN6 G;  1IVS A;  3J7A U;  2NNU A;  4DUZ O;  5DEC A;  1PD3 A;  4OPH A;  3D3Q A;  5LL6 Y;  5C93 A;  3CC4 V;  2LGW A;  1NH2 B;  4DR3 B;  3HKB B;  1OJH A;  1FPO A;  4X62 B;  5B1B C;  3E35 A;  1Q5O A;  1NI8 A;  2AXT Z;  4TWK A;  2N74 A;  2CGO A;  4Q20 A;  4WFG A;  4WFA V;  3ZN1 A;  4DV0 O;  3BA9 A;  2VS0 A;  5LP6 C;  5KHI A;  1HNZ O;  4N23 A;  3E22 B;  3LSQ A;  3W7T A;  1XNQ O;  1XMQ B;  3ZJZ A;  2JJ1 G;  5F2V O;  4O2A B;  2FTK A;  3LSS A;  4EKW A;  4UCV A;  1OZ0 A;  4QJF B;  2DWD C;  4LWS A;  2OT5 A;  1NJI W;  5LMN O;  1CEZ A;  4UVC A;  2HJF C;  2R9A A;  2RN9 A;  2W6I G;  1I5Y A;  1P84 F;  5H6R A;  3ZS8 C;  4KL1 A;  5CBG A;  4U3J A;  2JGD B;  4ZIB A;  3C3S A;  1ENV A;  3ASO B;  4ZHQ B;  2K9P A;  1SET A;  3ABU A;  2F66 C;  1XBL A;  3JAW A;  1Y76 B;  3A0B Z;  4IHJ B;  4E2L A;  3G71 V;  2QR4 A;  5A2Q N;  1PM9 A;  1IZ3 A;  2R72 A;  2YUA A;  1SZX A;  1GTO A;  2ZDI A;  1OV9 A;  4OPA A;  2UUA B;  4O2B A;  5JQG A;  1QVF U;  4FZ0 A;  3SPI A;  4K0K B;  5CB4 B;  3WFV A;  2Q7H A;  2Q67 A;  5EC2 C;  2WLH A;  5KA6 A;  4JYB A;  3VOU A;  4NB5 A;  2YI9 A;  1EFR G;  4U7N A;  5LGT A;  1ZL8 A;  4JI4 O;  1K33 A;  1JOY A;  2AHZ A;  3VBB A;  2UXC B;  3SPC A;  1VQL V;  3CX5 F;  1MOF A;  4J42 A;  1FFX A;  1OCO C;  4MVO A;  2ZR3 A;  4X1I B;  1TA8 A;  4H44 B;  4I0X A;  5BMV A;  1COW G;  4LFB B;  2B9Z A;  4EB6 A;  2UUC O;  1NS1 A;  3HKC B;  4FLV A;  2GBO A;  4DR1 B;  5IJ9 A;  3JAK A;  4DUY B;  1YIJ V;  1Z5V A;  3RYI A;  1RPO A;  2RNB A;  5H5N A;  3O65 A;  3CRR A;  3GB7 C;  3CCQ V;  3T1Y O;  1EN4 A;  2E76 B;  4I55 A;  2Q0O C;  3ZHR A;  2EIJ B;  1ARO P;  5IYD O;  4FFK A;  3CXH F;  3ABT A;  4H0L B;  2ITC C;  2WA3 A;  1Q6U A;  2EZP A;  3ZIA G;  3RT3 C;  4X20 B;  1M57 C;  3ZHT A;  3K79 A;  4GKJ B;  3MHH C;  1N32 O;  1BL8 A;  4G27 B;  1XRE A;  2KSD A;  1NR7 A;  2E74 B;  3KG2 A;  2MK3 A;  5LXT A;  2LFR A;  4DV6 O;  1YJN V;  1AI5 A;  2E5L B;  4DR6 O;  4J7K A;  4BIZ A;  3ZHQ A;  4G28 B;  4X65 O;  1MA1 A;  1X59 A;  2H94 A;  2WLM A;  2A0L A;  1KKD A;  3ZMZ A;  4D7T A;  4NTX A;  5CA1 A;  2IJI A;  1SS3 A;  5EYP A;  2VQE O;  5FPR A;  4R7C A;  4F6R A;  3CSX A;  1Q8I A;  1N8R W;  4PEL A;  2OIE A;  2CTQ A;  3H1I H;  4MVZ A;  3CME V;  4LF7 B;  5B1A C;  1H2L A;  4DV7 O;  3CCU V;  4LBE C;  1XMO B;  1Q81 W;  3APQ A;  3K9S A;  3CCJ V;  3L74 H;  3SJA C;  3J81 N;  1SQQ H;  1Q7Y W;  2ZXW C;  2PGG A;  2WLI A;  3JSL A;  4MVR A;  4I9Q A;  1JVM A;  4NKG B;  3OFN G;  2WPD G;  4QE7 A;  2NR5 A;  1HNW O;  1JCH A;  1YJ9 V;  4JAV A;  3DXR A;  4LWS B;  4CC5 A;  1KEC A;  5IY5 B;  2Y0I A;  2H3O A;  2ZKO A;  4U3J B;  1PP9 H;  1W59 A;  1YZB A;  2CDY A;  2DQ3 A;  4B3T B;  4DR7 B;  3BHP A;  3A8T A;  3LDE A;  3OMA B;  3QNE A;  4XDJ A;  3AG2 B;  3SJQ C;  3M8A A;  5EC1 C;  1K4C C;  3ABK B;  4QPJ A;  2WLK A;  4X88 A;  1QLE B;  5ITZ A;  2QWQ B;  2QKC A;  1J5E B;  3AK1 A;  5LHI A;  3CE2 A;  5JQG B;  5FNV B;  5EK0 A;  4IYH A;  4DV2 B;  3P3N A;  3AG4 B;  2OCC B;  1V54 B;  5IYB O;  4JZ2 A;  1YTF D;  4AIL C;  1PL0 A;  3QTC A;  1E1Q G;  5KHJ A;  5CMU A;  2P4K A;  5EZY B;  1H8H G;  2EIK B;  2EIM B;  1WP8 A;  4TV9 B;  5GTH Z;  3SPG A;  3OUF A;  3VQY A;  5C8Y B;  1VF7 A;  3BY6 A;  2XAH A;  2UUB O;  4JYA B;  4HBN A;  2DYR B;  1TUE B;  2C2A A;  5FLX N;  1WLE A;  1NT2 B;  5BMV B;  1AI7 A;  2Q4P A;  4BAY A;  3X2Q B;  2YIB A;  2F95 B;  5IJ9 B;  2Z5U A;  2Y4U A;  3A2F A;  1O9H A;  3QO8 A;  4X64 O;  1SQX H;  3HKD A;  1B06 A;  1FD9 A;  1P7B A;  3IC9 A;  4WFE A;  4JAA A;  3K9A A;  4J7J A;  2UXB O;  4DRX B;  4DUZ B;  5L3B A;  5GTI Z;  2QM8 A;  1VQ6 V;  2CTW A;  3T4D A;  2OTL V;  4UVA A;  4Z1V A;  3OMI B;  4I7Z B;  5H6Q A;  5B3S C;  5KAI Z;  2BOC C;  1TUB A;  5EIB D;  5LP6 A;  5H9C A;  5J2T A;  1FJG O;  3U0Z A;  3C90 A;  2A79 B;  2EIN C;  3F7Y C;  4DV0 B;  1N33 O;  1D5A A;  4U7O A;  1HNZ B;  4DV3 O;  5LXT B;  1XNQ B;  5KX5 B;  4B3M O;  1PNL A;  3UT5 B;  5D5Q A;  2YEV A;  4X66 O;  2GSM B;  1JX9 A;  3HB3 B;  2CUG A;  4Q6G A;  4D7S A;  1G1X B;  5LMN B;  3E83 A;  5CA1 B;  4MS2 A;  3OTF A;  4F6R B;  3ABL C;  4FPP A;  1OCC C;  3ETD A;  2L35 A;  2X6B A;  1F23 A;  2CTP A;  4X8A A;  1LR1 A;  4YY3 O;  3JAT A;  1S5L Z;  4MVU A;  2WLJ A;  3FFQ A;  4GCZ A;  3BRC A;  3OM3 B;  4DR2 O;  2XND G;  1R3J C;  3HKE B;  2XHB A;  1QVG U;  4QE9 A;  3ZCC A;  3JD4 A;  4YJ3 A;  2EIL C;  3OD4 A;  1L1F A;  1K7D A;  4GZR B;  3ML0 A;  4FFB A;  1F7Y A;  1BS3 A;  3T1H O;  1AJP A;  4DW0 A;  1Q6I A;  4UB6 Z;  4TQF A;  2VWJ A;  2JS3 A;  3WG7 B;  1B04 A;  3STZ C;  1AJN A;  3L72 H;  4FJC C;  5JJJ B;  2QEX V;  5LA6 B;  4NXN O;  4JI4 B;  2X6A A;  1DGS A;  5IDJ A;  4PD4 F;  4HZ3 A;  2PI5 A;  1Q43 A;  4ZOL A;  3AG3 B;  2UUC B;  2GUZ A;  1CPY A;  1QCE A;  3B8M A;  2GTS A;  5KMG A;  2ETN A;  1RPR A;  1Y66 A;  3E2E A;  3QG5 A;  4BW5 A;  1AIL A;  3RYC A;  4PA7 A;  3T1Y B;  1BHB A;  3BPZ A;  3OGC C;  4HNA B;  1H2M A;  4ZKI A;  2ZNI A;  5EBL C;  4GX2 A;  1QQC A;  2WSS G;  3C3T A;  4RQE A;  2LFS A;  4LF4 O;  3AG1 B;  2L6L A;  2HHH O;  2JK5 C;  4PHZ A;  3A0H Z;  4PDM A;  1IXM A;  1SA0 A;  4JGS A;  3ASN B;  4O4H B;  2YSU B;  1N32 B;  4B7E A;  4FM1 A;  1JA8 A;  5CA0 A;  3RWR D;  3SDL A;  3K08 A;  4P30 A;  5IYZ A;  4JI3 O;  1P7G A;  1PKX A;  4CH5 A;  3W7U A;  4DV6 B;  1TAE A;  2JJ2 G;  4PDR A;  4L8J A;  4I5S A;  2OTJ V;  1THZ A;  2DJV A;  2IH1 C;  2DMX A;  5AG2 A;  4X65 B;  2RJZ A;  1R3I C;  1QR8 A;  4B7K A;  2JGU A;  1GO3 F;  4EEQ A;  4W4L A;  1M56 C;  3E8G A;  5IJ0 B;  1WAZ A;  5L3C A;  4H13 B;  3MHS C;  3FAV A;  1WB7 A;  5FPO A;  2VQE B;  4TV8 A;  1HDJ A;  3CS5 A;  3E8H A;  3JAS B;  1XOU A;  4JI5 O;  1I7F A;  2X6C A;  1GM7 A;  3WB2 A;  2CTR A;  2BOB C;  5DED A;  1XIL A;  4F4L A;  2O57 A;  1Q3E A;  4DV7 B;  4MT8 A;  1UJW B;  1GAX A;  1ZUQ A;  5B1N A;  4JTC B;  4YIP A;  3R66 A;  1BQZ A;  1H8E G;  2P06 A;  2OIG A;  4BIO A;  4ZBM A;  4RQF A;  1TGO A;  4I50 B;  3RYF B;  4KFM A;  4H37 A;  4IIJ A;  1OCR B;  2IJH A;  3OEH G;  1HNW B;  1RFY A;  3K03 A;  2XOK G;  2F1M A;  5CBH A;  2YEV B;  3AG7 A;  1R3L C;  2Y69 B;  1FS0 G;  3F5W C;  2P7T C;  1QHT A;  4YJ2 A;  3H9V A;  1NR1 A;  4JZG A;  4X1Y A;  1S5J A;  1RM1 B;  4FLU A;  2JVD A;  3B09 A;  4JV5 O;  2DYS B;  3NR7 A;  1SZT A;  3QO7 A;  4LF9 O;  1K97 A;  2LJ2 A;  1JJ2 U;  4G2K A;  3JAT B;  3H1L H;  2V7Q G;  2ZE7 A;  5L3F A;  1IUR A;  2JDI G;  2DQ0 A;  3F7V C;  3ZRV A;  4TQD A;  1KYO F;  4P9P A;  2CH7 A;  3OEE G;  3ZHU A;  4R50 A;  1W2B U;  4A5U B;  2WWW A;  3JAL A;  2OYQ A;  1PPJ H;  4MTX A;  3D36 C;  3U10 A;  1J95 A;  2VWK A;  3FD9 A;  4LF8 O;  3CMA V;  4WBN A;  5CN0 A;  3GVM A;  3BFR A;  3ASO C;  4MW8 A;  3N2K A;  1K5Q A;  2EJR A;  1VF6 A;  4RUF A;  3S3X A;  1G6U A;  1KC8 W;  2Q8V A;  2LGQ A;  1W0J G;  1IDS A;  4J11 A;  3N27 A;  3EFF K;  2R70 A;  3ZED A;  2XAQ A;  4NR1 A;  2UUB B;  3KKY A;  2LP7 A;  3APO A;  1R73 A;  5LGN A;  4NYK A;  3IGA C;  3ZRW B;  1ZTE A;  4JPR A;  2V1D A;  2BSK B;  1KMI Z;  1KP2 A;  4RO2 A;  3QO5 A;  1BT8 A;  3OW2 U;  4MVS A;  4X64 B;  2ZR2 A;  3RYC B;  1AI6 A;  1BSM A;  2UXB B;  4UB8 Z;  4TSF G;  1E1R G;  2ITD C;  2YS8 A;  1R1B A;  3ZMU A;  1O9G A;  3VQX A;  1NVP D;  2MW2 B;  2JS5 A;  5FL7 G;  1VEW A;  1XL4 A;  4J10 A;  3RGB A;  3B2E E;  1YCI A;  1SQF A;  1VQM V;  3MDS A;  2KB1 A;  4MSW C;  3TXS A;  1I5X A;  3JD3 A;  5BY1 A;  1N34 O;  1FJG B;  2P67 A;  2YXY A;  3RYH A;  1N33 B;  4ABM A;  5IYZ B;  3IJ4 A;  4K35 A;  1MMM A;  3ETQ A;  4CBC A;  4DV3 B;  4B3M B;  2QA4 V;  1VQP V;  1M1K W;  1LNQ A;  1YJW V;  1YXB A;  1YEW A;  4GYC B;  4X66 B;  5LBQ A;  2EIJ C;  4YXW G;  4PA3 A;  2IM9 A;  1HP8 A;  5KHK A;  2F93 B;  1SQP H;  4JI1 O;  2BTQ A;  3OR7 C;  2QTS A;  2QKS A;  3VQW A;  1HWY A;  1XQ8 A;  3BCC H;  4TV8 B;  4BR6 A;  4FLX A;  1L0N H;  2P4V A;  3UM7 A;  1EBO A;  1SQG A;  3CPW U;  4O4J A;  2A9H A;  1JJO A;  4CH3 A;  1K92 A;  3F5T A;  4YY3 B;  2VQF O;  3G4S V;  1Y74 A;  3Q4H A;  4AQY O;  4O4L A;  5LGU A;  2RMK B;  4LR3 A;  2NN4 A;  3N2G A;  4DR2 B;  1KP3 A;  2ZIN A;  3RW0 A;  3L73 H;  5J9P C;  5KHH A;  2XAG A;  2HFE C;  4K8Z A;  2KG7 A;  3T1H B;  1Q90 D;  4IIJ B;  1RP3 B;  1XNR O;  4GLX A;  1DF5 A;  1TVK A;  4YJ2 B;  2HG5 C;  1WB8 A;  2EUL A;  2Q69 A;  1OCZ B;  4NXN B;  2Q5Z A;  3K57 A;  3TK1 A;  1S72 V;  4DV5 O;  2P22 C;  4W4K A;  3ZRX A;  3TGU H;  1WNS A;  1GN3 A;  2XAF A;  1VQN V;  4CH4 A;  4B3R O;  1ORQ C;  1K34 A;  1IBK O;  4JYC A;  1XL6 A;  3JAW B;  1NQT A;  5JCO A;  2CH7 B;  1ZWI C;  4BW9 A;  1DF4 A;  4Z1M G;  4UCU A;  4LH7 A;  5H2F Z;  3B4S A;  5K1P A;  5IY5 C;  1KBH A;  3PJS K;  1M93 A;  1I08 A;  3CCS V;  4O2B B;  2EBO A;  2HKO A;  3ZRS A;  4LF4 B;  1T5E A;  2FYU H;  2HHH B;  1GM9 A;  1VAR A;  4WBN B;  4OX9 O;  4DV1 O;  4DK1 A;  2PYJ A;  2B1G A;  3AG2 C;  3KCX A;  2KQX A;  5IE9 A;  3ABK C;  3ZMT A;  4JI3 B;  4LNU A;  3I56 V;  1ZL8 B;  2Q0A A;  1MZF A;  2ADQ B;  1L8D A;  1FAF A;  3KCY A;  1QLE C;  3STL C;  1UFI A;  1FFX B;  1YTF B;  1WJZ A;  2X7R B;  4FLW A;  3CJH A;  1MAB G;  2PTM A;  4X9Q A;  2ZCE A;  4I0X B;  1EZV H;  1K8A W;  4EB6 B;  1EN6 A;  4FM0 A;  4GUN A;  5LYJ A;  2OCC C;  1QR9 A;  3SYQ A;  1V54 C;  3JAK B;  1AVM A;  4LF6 O;  3RYI B;  3JYC A;  1NU1 H;  1HW7 A;  4C7U A;  1Y67 A;  4I55 B;  4JI5 B;  2EIK C;  5BZB A;  3JCZ A;  1S5H C;  4LF5 O;  2QWO B;  3H1K H;  1FXH A;  2DYR C;  4LP8 A;  3G80 A;  1GN2 A;  1V55 B;  3X2Q C;  1F51 A;  1VQ9 V;  4DYL A;  4FK5 C;  3EXA A;  4QNH B;  4KP4 A;  4MTG A;  1D5N A;  3JAM N;  1R6K A;  1AR5 A;  1SQB H;  5K1X A;  2CGN A;  1GH6 A;  5KLV H;  2RDC A;  3CYO A;  1N0J A;  3G6E V;  3ABL B;  2BTQ B;  2AHY A;  4I4T A;  4JV5 B;  1NKD A;  4J41 A;  4KXR A;  1W0K G;  1JPX A;  1R6N A;  1A32 A;  3DGE A;  5EYP B;  3MD0 A;  1JFF A;  3E22 A;  4O4J B;  4CH6 A;  5E1A C;  4LF9 B;  3LNN A;  4O2A A;  2RQ6 A;  5EBW C;  1NTK H;  2Q7G A;  2UU9 O;  1Y74 B;  3W7S A;  1VQ4 V;  1BQ0 A;  2LW1 A;  4O4L B;  2XT9 A;  5LHG A;  4UXN A;  4PV1 B;  3HR0 A;  3N2G B;  4JI6 O;  4NTW A;  2CK3 G;  3D36 A;  1GKF A;  1PNM A;  3LNM B;  1BE3 H;  2YI8 A;  4PI0 A;  3ZMV A;  4B08 A;  1YF2 A;  3SJB C;  2WLI B;  3D8C A;  2UXD O;  3TCU A;  4LF8 B;  2YIC A;  2ILM A;  4FLY A;  4GT1 A;  2YIA A;  1Y76 A;  3K5O A;  4DK0 A;  1VQK V;  1AP5 A;  1FXK C;  4E4E A;  3L75 H;  3DXR B;  3QVN A;  3K59 A;  2FML A;  1I94 O;  3FB6 C;  2EJ7 A;  4NXM O;  3SYP A;  2ADP A;  1G4Y B;  5CB4 A;  5LMU O;  1KKC A;  1BGY H;  2XTA A;  2Z3Y A;  2EX3 A;  1ZX3 A;  3K5L A;  3E86 A;  2HLD G;  1N36 O;  3UQ8 A;  2D2C B;  3OTO O;  3ABM C;  5GW7 A;  2BCC H;  2ARH A;  1VMG A;  4CS2 A;  1K4D C;  4DV4 O;  3WG7 C;  3SGI A;  2WAM A;  4QGP A;  3SYC A;  2JIZ G;  1AP6 A;  3BVO A;  5ITZ B;  1Q82 W;  3I55 V;  1I0H A;  4X1I A;  3CP1 A;  2HVK C;  2FB5 A;  3HKC A;  4JI0 O;  5BR8 O;  4JI7 O;  2RCV A;  1KQS U;  1X4T A;  1VQ7 V;  1N34 B;  3AG3 C;  5BXZ A;  1EZJ A;  1Q6H A;  2ZT9 B;  5E79 Z;  1ZAU A;  4K8X A;  4JTA B;  5TIS Z;  4D6T H;  1M56 B;  1VF5 B;  1KUQ A;  3W7X A;  2B1I A;  3AEI A;  4X1K A;  1MZE A;  3UO3 A;  2N04 A;  1RSO A;  2ZE8 A;  3TET A;  2QKA A;  2YXL A;  1H2N A;  2ZM6 O;  2A3Q A;  3SR2 C;  4XBF A;  2PF4 E;  4JI8 O;  1MNG A;  4JI1 B;  5LYJ B;  1H38 A;  1GRJ A;  1WA8 A;  3IC7 A;  1H2K A;  3DC5 A;  2H8P C;  1GN4 A;  3KZI Z;  3HKD B;  3ASN C;  3ICX A;  2R9R B;  3FKS G;  3JAR A;  3FB5 C;  5B1B B;  3O9O A;  4R6Z A;  3T1C A;  2QGN A;  3UCS C;  1K5S A;  3CCM V;  2VQF B;  1NTZ H;  4DR5 O;  3SPJ A;  3UKM A;  4AQY B;  3FB8 C;  2Q9L A;  1K3E A;  4IL6 Z;  2ZD9 A;  1TUB B;  3FYI B;  3K5M A;  1NH2 D;  3RN4 A;  1WPB A;  5LP6 B;  5J2T B;  4GKK O;  3G6B A;  5JWP A;  3DSQ A;  2Q68 A;  3LDD A;  4J9Z B;  2CE4 A;  3IAY A;  1M5I A;  1F4N A;  4JAU A;  2Y4T A;  2ZIO A;  3JSN A;  2QDO A;  3WU2 Z;  1FFT B;  1XNR B;  3TXQ A;  3CC7 V;  2UXX A;  4J80 A;  2BTO A;  5CA3 A;  1IBL O;  4K3A A;  1SKV A;  1XUQ A;  1YIT V;  1M9N A;  3SYA A;  4WFH A;  4CZZ A;  2LW7 A;  4JTD B;  4I4T B;  4PA4 A; 
#chains in the Genus database with same CATH homology
 4DUZ O;  2DJV A;  5IWA O;  1FYJ A;  4JI0 O;  1XMQ O;  5BR8 O;  4OPH A;  4JI7 O;  5LL6 Y;  4JI1 O;  4DR2 O;  4A5U B;  2UUB O;  4JI4 O;  1A32 A;  5FLX N;  4DV7 O;  5BXZ A;  4YHH O;  4KHP O;  4OX9 O;  4DV1 O;  1R6T A;  4LF8 O;  3J81 N;  2JRI A;  2N74 A;  2UU9 O;  1F7Y A;  3T1H O;  2UUC O;  1NS1 A;  4X64 O;  4B3T O;  1HNX O;  4DR7 O;  1KUQ A;  3F5T A;  4DV0 O;  4GKJ O;  1AB3 A;  2VQF O;  4JI5 O;  2UXB O;  1HNW O;  4AQY O;  1HNZ O;  4JI6 O;  1XNQ O;  2DOS A;  5H5N A;  2ZM6 O;  3O65 A;  4JI8 O;  3T1Y O;  4NXN O;  2AGA A;  2E5L O;  2UXD O;  3R66 A;  1J5E O;  5LMN O;  2ZKO A;  4LF6 O;  4DR4 O;  1DK1 A;  2F4V O;  4DV2 O;  1FJG O;  1XNR O;  1YZB A;  3RT3 C;  2UUA O;  3J80 N;  1N33 O;  4K0K O;  4DR5 O;  1N32 O;  1XEQ A;  4DV3 O;  2Z0A A;  3M8A A;  4B3M O;  1R1B A;  1IBM O;  4B3S O;  1I94 O;  1AIL A;  4LFC O;  4LF5 O;  4NXM O;  5LMU O;  4DV6 O;  4X66 O;  4DR6 O;  4DV5 O;  4GKK O;  4X65 O;  1G1X B;  1X59 A;  4JV5 O;  4LF4 O;  4LFA O;  5A2Q N;  1N36 O;  4LF7 O;  4JYA O;  3OTO O;  2HHH O;  1HR0 O;  5BY1 A;  1N34 O;  2UXC O;  4DR3 O;  5IT9 N;  4X62 O;  2FKX A;  1XMO O;  4LF9 O;  4OPA A;  4B3R O;  1IBK O;  4DV4 O;  1IBL O;  4JI2 O;  2VQE O;  3JAM N;  4LFB O;  3SDL A;  4JI3 O;  4DR1 O;  4YY3 O;  1FKA O;  2LW7 A;  3J7A U;  1D2D A;  4DUY O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...