5H5NA

The crystal structure of the ns1 (h17n10) rna-binding domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
71
structure length
71
Chain Sequence
EPNPTTIAFQVDCYLWHLKKTLSMMGEVDAPFEDRLRREQKALKGRSMTLGIDIQSATQEGYYKIKSITEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Non-structural protein 1
publication title The NS1 gene from bat-derived influenza-like virus H17N10 can be rescued in influenza A PR8 backbone
pubmed doi rcsb
source organism Influenza a virus (a/little yellow-shouldered bat/guatemala/060/2010(h17n10))
total genus 30
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5h5nA00
3J80N 4JI6O 1F7YA 4DV0O 4LF4O 1N32O 1R6TA 4JI8O 1HR0O 4JI1O 1IBMO 4GKKO 4LFAO 3OTOO 4YHHO 1XEQA 4DR4O 1XNRO 3RT3C 4JI2O 5A2QN 2LW7A 2ZKOA 1IBKO 2N74A 1FKAO 5LMUO 4X66O 1HNXO 4LFCO 1XNQO 2UUAO 3T1YO 4B3MO 4DV5O 1FYJA 1J5EO 4LF8O 1D2DA 1G1XB 4DR7O 4X65O 4DR5O 4B3RO 4LF7O 2DJVA 4DR3O 4NXMO 3SDLA 4A5UB 2UXDO 4NXNO 4B3SO 4OPAA 1YZBA 1DK1A 4DV6O 2VQFO 4DR1O 4DR2O 4DR6O 1XMQO 1XMOO 4OPHA 2FKXA 4DV1O 4KHPO 4LF5O 3J81N 4DUZO 1X59A 5IT9N 3M8AA 2Z0AA 5LL6Y 4X62O 2E5LO 2UXBO 2F4VO 4AQYO 4JI7O 2UUCO 2JRIA 1N33O 4JI5O 2HHHO 1IBLO 1HNWO 2UU9O 2ZM6O 4LF9O 4OX9O 5BR8O 3R66A 4LF6O 2UXCO 1AILA 4DV7O 4JI3O 3T1HO 4X64O 1NS1A 4DV4O 1I94O 4JYAO 4LFBO 5LMNO 2AGAA 1A32A 1FJGO 2VQEO 4DV3O 4K0KO 2DOSA 5BXZA 3J7AU 3O65A 1N36O 4YY3O 1KUQA 1AB3A 1N34O 4JV5O 1R1BA 2UUBO 4JI4O 4JI0O 4DV2O 4B3TO 5BY1A 5IWAO 5FLXN 3JAMN 5H5NA 3F5TA 1HNZO 4GKJO 4DUYO
chains in the Genus database with same CATH superfamily
1K9MW 2P6JA 2W6IG 4JI8O 3L71H 1S76D 2C2AA 2A3QA 2F1MA 4GLXA 3HKBA 4PA9A 2ZKOA 1BQZA 3AG2B 1XILA 2N74A 1HR0B 4X66O 3JSNA 1HNXO 1I08A 3ZS8C 1XNQO 4LF8O 4GZRB 1W0JG 4UCUA 1B6QA 5IY5B 1AI4A 2JVDA 1K4CC 2HJFC 4J10A 4XDKA 1GRJA 5LYJA 3I56V 2EIKC 2BSKB 1LNQA 4DR1O 2LFSA 3ZHQA 4WCEV 4LF6B 5JQGB 3N2GA 3WB0A 2LGWA 1JFFA 2Z0AA 3AEIA 1WPBA 3A0BZ 3P3NA 4YJ3A 3HKEA 4R7CA 4LF5B 2R70A 4AILC 3PN1A 4OX9O 3SYQA 2YICA 3CXHF 1QR8A 4I55A 4YXWG 3CC7V 1S72V 3A0HZ 1K92A 5CN0A 2IM9A 1TUBB 1HWYA 4DRXB 5A9GA 1QQCA 2MW2B 4JTDB 1KUQA 3ZIAG 1JOYA 3OTOB 1I5YA 3N2KA 5B1AB 1YJWV 1L1FA 1EFRG 4GKJO 1Q90D 3DC6A 4CH5A 3E8GA 4J41A 4F6RB 4JTAB 1N32O 4ZKIA 3UCSC 4MVQA 3E35A 5EYPB 1IXMA 3JAKA 2PZSA 3JATB 3VQWA 1KD1W 5B1OA 3RT3C 4EKWA 1FKAO 4YIOA 1TVKA 4JI1B 3CCSV 1VQ4V 2IH1C 3RW0A 5LMUO 1R3JC 2NNUA 5FPRA 1BS3A 5LGNA 3JASA 2EJRA 1WP7A 2IW5A 3D3QA 2DE0X 2QDOA 2X6CA 2P5OA 1CXZB 2RNBA 4O4LB 4DR7O 4PV1B 4PHZA 5DECA 1QNMA 1GKFA 4RO2A 3IGAC 1HDJA 3H1IH 2JGDA 1MZFA 3CYOA 3OFNG 2M6YA 1VQ9V 2BTQB 3B40A 2KB1A 3KCXA 1SC5B 3LSQA 4LR3A 2B9ZA 3ABLC 2ZDIA 5K1XA 5JCOC 2DYSB 4LC1A 4ZHQB 1V9PA 2HVJC 2XAHA 5H6QA 4DV1B 1GM9A 4KHPB 3QNEA 4Z1VA 4I9QA 4O4IA 1FFXA 1G4YB 5L3DA 3SR2C 3E8HA 3T1HO 3HKCB 5KA5A 3X2QB 1TUEB 5LMNO 3ETDA 1ENVA 1SKVA 4F6EA 3ABKC 3OMNB 4DUYB 3BAAA 1JMKC 2P90A 3ZRWA 3Q4HA 1N4CA 2OIEA 4BAYA 3F5TA 3VBBA 1HNZO 2ZE5A 5EIBD 2X0LA 1Y76B 3FB8C 1QVFU 1AP5A 1M9NA 1QLEB 1SERA 2BTOA 1P84F 2KG7A 1DF5A 1QLNA 2Q8VA 2LW7A 3TGUH 2DQ3A 5HFMA 1SETA 3AK2A 5KAIZ 1CEZA 3STLC 1IBKB 3BVOA 3A0RA 3ZHRA 4MW8A 3TXQA 2HEPA 2RDCA 1WA8A 3BPZA 5L3CA 5KUKA 4MTXA 1BMFG 3L74H 4CH4A 5DN6G 1YSCA 4TV9A 1N8RW 4LNUA 4QE7A 3K0GA 4TSFG 5B1BB 1EBOA 4CC5A 3UQ8A 2WLMA 1I0HA 5IJ0B 4I50A 2IJIA 5BR8B 3CE2A 3U10A 1NH2B 1D5AA 4DR2B 1KKDA 1PNKA 3B09A 4U3JA 2EILC 5CBGA 4X62O 3MD0A 1TGOA 1NR1A 3W7UA 2DN9A 1Y66A 3JARA 5KMGB 1K7DA 3CMAV 4UCSA 2B5UA 1Q6HA 2G38A 2NR5A 3RYFB 5IYCO 4LWSB 1AI7A 1H2KA 1EZVH 4JZGA 1FAFA 1HNWB 3AG3B 3LNMB 1YTFD 4F4LA 3I55V 4DV3O 1JA8A 4FLYA 5BMVA 4U7NA 1V54B 2HP8A 1Z2GA 4PDMA 2YIBD 3E2EA 2ZNJA 3AG4B 4JI8B 4X9QA 2DYRC 4FM2A 5D5PA 4O4JB 4IGGA 4PDLA 3RYCA 5IWAO 3FAVB 2IJKA 4FJCC 1RSOA 3RYHB 3VQYA 4G2KA 1KYOF 2M7WA 2P7TC 3SYOA 3K9SA 4PI2A 3WB1A 1HNXB 1BHBA 1XNQB 4RAIA 4LFAO 1XNRO 1ZX3A 5FNVB 3T1CA 3JAWB 1VQOV 4GKKB 5J2UA 1AVMA 1XREA 2YIBA 4N23A 1S5HC 5KX5A 4OGQB 4ASUG 4I4TB 4DR5O 1OV9A 3DXRB 4LFCB 3BY6A 3ZX6A 1Q86W 3ZRXA 4TWKA 4DV5B 1Q6IA 3RYIB 4B3SO 1M90W 4BW5A 3QO5A 1GTOA 4O2BB 4LF7B 1TAEA 3B8NA 4NXMB 4IHJB 1QBZA 4TV8B 4DV6O 1G8MA 3JALA 4DR6O 1XMQO 1F23A 2QWPB 3FFQA 4X1IB 4OX9B 1NVPD 3JSLA 3E8BA 1Y4MA 2LP7A 5K1PA 4MTOA 3J81N 3W7TA 1JCHA 5C93A 2EIJB 1R3IC 4QJFB 1XMOB 4IL6Z 2B1GA 5B5EZ 4D7TA 2HHHO 1IBLO 4IIJB 3DTUB 2Q7HA 1BGYH 2FYUH 3CS5A 4JI5B 4CS4A 5TISZ 4NTYA 1MABG 4QPJA 2YI8A 4W4KA 5CMUA 1VQNV 1RFYA 4L87A 1WP8A 2OCCB 3IAYA 3WG7B 4GKJB 3GWOA 5IYZB 3DGEA 4FIPC 3STZC 1KKCA 4MVOA 4O2AB 3ZMZA 3CCJV 2ZXWC 4JI0O 2ZR3A 4ABMA 4ZOLB 4K0KB 2VWKA 1U96A 1VF7A 5H5NA 3ETQA 2Q4PA 2CH7A 2F23A 2PF4E 2NLJC 4JI4B 4PA3A 4JI6O 5KHIA 3L73H 1R73A 2QR4A 4GX1A 5LMUB 4LF4O 4X89A 1YHQV 4NKGB 4DR4O 1FXKB 5GONB 3UO2A 5DM6V 2YXYA 5B3SC 4UUJC 2XAGA 4J9YB 2ZDIC 4TUYA 1PV0A 5KUMA 1QHTA 4O4HB 4WFAV 4NB5A 1L0LH 4JPRA 1PNLA 3IFXA 1HP8A 2EIKB 4EB6A 5LOVB 3E89A 1SA0A 4J42A 3W7SA 2AHYA 4KP4A 3CRCA 2VQFO 3CP1A 1PPJH 3AK1A 4BIUA 1X59A 1O9GA 2Q6AA 1SQQH 3CC2V 2YEVA 2E5LO 2UXBO 4JI7O 2LW1A 2BSKA 1OCCC 2UXCO 1BSMA 4UCRA 5JVDA 2D2CB 1AJNA 3CRAA 4NYKA 3ETEA 4X64O 4B7KA 4FZ1A 2YIDA 1K3EA 4UXNA 1URFA 4PDVA 1YIJV 2JIZG 1Q7YW 1HNZB 3G6EV 4YJ2A 1FXHA 1PNMA 2Y48A 2DWEC 3K58A 5DEDA 1KP2A 5BY1A 1NT2B 2PGGA 1TUBA 4PD4F 2UUBB 1Y67A 4DRXA 5IYDO 3C3TA 4GYCB 5EIBC 1KBHA 3VOUA 4B7EA 3E22B 2DMXA 3QG5A 4ZI7B 2IJJA 2A79B 2AZ0A 4G27B 4MS2A 3NR7A 4H33A 4GT1A 2YI9A 4YHHB 1N0JA 2ADQB 4F6RA 2KKWA 2XOKG 3H01A 5EYPA 5IJ9B 1M5IA 1Q82W 3G67A 3JATA 1KP3A 1SS3A 2WAMA 2RN9A 4GCZA 2PTMA 3EFFK 4I0XB 5GTIZ 3K3WA 2Q0AA 1VIBA 4K3AA 1M57C 5CA0B 3SJCC 1IZ3A 2ADPA 4DW0A 5EZYA 5FPOA 3ZHTA 4X62B 1VQ6V 1H8EG 4WFHA 3ABLB 4JASA 3ZEDA 3P30A 3JCUZ 5FL7G 4FZ0A 2HJDA 1N0NA 1I7FA 1Q81W 3ABTA 4PELA 4YIPA 4D6TH 1MNGA 3NXSA 1FS0G 1KECA 4X1YA 4JYYA 4AQYO 5C8YB 3LDEA 4ICGA 5GW7A 5LGUA 2ATKC 1R3LC 4LF9O 5AG2A 1SQBH 4DV7O 2JEXA 1H2MA 2WLLA 3CJHA 1VQ8V 3H1LH 4FFKA 3SJQC 4DV4O 3AG1C 1JR9A 1EN5A 5IWAB 4FLZA 1FJGO 1P7BA 1Y74A 4HYOA 1EZJA 2ARHA 1NI8A 2A7WA 1YXBA 4JYAB 1QCEA 5J2TB 3B77A 2JGUA 4RQEA 2VQEB 1IXBA 1PKXA 3HKCA 4X1KB 2R72A 2HG5C 5KAFZ 4DV2B 3H1HH 3FB7C 2GTSA 1OCZC 4B08A 3BFRA 4N21A 1PP9H 3JCZA 3P32A 1GAXA 3B8MA 1JQ0A 2FTKA 4DK1A 1H2SB 5L3EA 3LSUA 4B3SB 3LDCA 1K5SA 1OCRC 4JI2B 2ZE8A 2O57A 4X20B 2X6AA 1J5EO 3IJ4A 1D2DA 2EX3A 2QJ1A 4DV6B 2YDEA 1SQPH 1NH2D 1BT8A 4UB8Z 1Q8IA 3CB2A 2GV9A 3CRRA 3K03A 5LP6A 2XAJA 3QF7A 1ZL8B 4QE9A 1MOFA 1XDCA 1YZBA 1M93A 2LQTA 3UT5A 1DK1A 2EILB 1HW7A 2HHHB 3UO3A 1WN7A 1RPRA 2PY5A 3EXAA 5H2FZ 4RUFA 4BIZA 3BABA 4TOIA 3MDSA 3FD9A 2A06H 1QU7A 4KFMA 3ZMSA 3HKDB 2VS0A 4DYLA 5LHGA 2F4VB 3BEHA 2F66C 4PA6A 4KUMA 3ZMTA 5E79Z 2DYRB 2XAFA 1MSDA 4QNHB 4UVBA 3J7AU 1N36O 5EC1C 4LWSA 2Q5ZA 4FK5C 2IH3C 3ABMB 2YIAA 1IVSA 3L75H 1H2GA 2FB5A 3G6BA 4J7JA 4DV0O 2Y0PA 3N27A 1M4UA 3OR6C 3CCMV 3W7WA 1G6UA 1AR4A 1JFFB 4O4JA 2CUGA 5IY5C 3HKEB 3RYHA 1YJNV 2A9HA 1NQTA 5L3FA 3T2MA 1XOUA 2ZR2A 3OR7C 2UUAO 3T1YO 1YI2V 2YSUB 4QPKA 5ITZA 3A2FA 3OM3B 4FFBA 2HKOA 4X65O 2VQFB 4B3RO 3ZJZA 3G80A 3R65A 5CA1A 2CGNA 3K9AA 3K5LA 2P22C 2PI5A 2AHZA 3ZN1A 3WB2A 4JI7B 1O9HA 3CC4V 1W0KG 2GTAA 3ZBHA 1H2LA 3MHHC 1GN3A 1OHHG 4PA4A 3F5WC 1AJQA 3RYIA 4WBNA 5LL6Y 1GN2A 4X64B 1Z5WA 4DXWA 3IC9A 2UUCO 1N33O 1JJOA 3K57A 3JAKB 4TV8A 4DUZB 4MTGA 3OAAG 3GB7C 2BCCH 5IE9A 4JI3O 1SRYA 2ZM6B 2WLJA 3LSSA 3JASB 2WLNA 3K0DA 4U7OA 2FMLA 3OW2U 2XUMA 2EIMB 2LJ2A 4KL1A 4HNAB 4IIJA 4KXRA 1R3KC 5EC2C 2DOSA 1J95A 2WA3A 2E76B 2E75B 3SYPA 4LFBB 3L70H 1R1BA 1X4TA 1Y6XA 5JJNB 1OCOC 4ZBMA 2YXLA 2JGDB 2CE4A 4UFZA 1N34B 3FYEB 5KLVH 4WFGA 4JV5B 4RUEA 2QTSA 4XDLA 2NN4A 2XNDG 2YUAA 1HR0O 4H0LB 4O2AA 1VARA 3D36A 3E8FA 2Y69B 4ZOLA 1V55B 4Q6GA 4E2LA 2JS5A 2OWOA 1VQ7V 3FX7A 1BE3H 3H9VA 1NZ6A 2DWDC 1DGSA 1BCCH 1FXKA 4X66B 5GONA 4DR3O 4BW9A 1EN6A 4LF8B 5J9PC 1SQVH 5KHGA 5EBMC 4AQYB 4UV9A 3ZRWB 4EFBA 2QM4A 2R9IA 3JYCA 1NU1H 3T4DA 5CA3A 2PI4A 4OPHA 3H1JH 4LF5O 1OCCB 1ZWIC 4DR1B 4PDRA 4IT5A 1CPYA 2DQ0A 3QTCA 2LFRA 3C3SA 3X2QC 4MT8A 2GUZB 2P06A 2AW9A 1K8AW 4FMTA 2QEXV 1QR9A 4R8CA 1JVMA 1FFTB 3RWRD 1H38A 4FM0A 1ZLZA 1SESA 3OTFA 3SPCA 1NS1A 1NKDA 3ZRSA 2QGNA 4DO2A 3MHSC 3BHPA 2F93B 2ODMA 4YY3O 4P30A 2JDIG 1QLEC 4AI8A 3OEEG 5D5QA 4TV9B 2Q73A 4LNUB 1ZSPA 4JYCA 1YITV 1MSWD 5FLXN 3KZIZ 4CBCA 1FXVA 3VQVA 3CMEV 2CTRA 4JTCB 4I50B 2RCVA 5LP6C 1NTMH 4JAUA 2N05A 2E3CA 4JI1O 4EEQA 5CBHA 1J5EB 1XEQA 2BE3A 4UVCA 3JD1A 1N32B 1GK9A 4W4LA 5B1NA 1CP9A 3JARB 2H3OA 3JD3A 3CCLV 3E22A 5B66Z 2DJVA 2KQXA 4MW3A 2JEUA 2UXDO 4NXNO 5BMVB 4DR7B 1B3QA 5IJ9A 2GHYA 5LXTA 3TXSA 2FKXA 3K04A 3RYCB 1KB9F 4DV1O 4KHPO 3HPLC 3LNNA 5LA6B 3EHBB 2Q68A 2HVKC 1SF9A 3AG3C 1T5EA 4MVZA 5LHIA 2CK3G 1V54C 3ASOC 2PUSA 1VF6A 1N36B 2Q7GA 1YTFB 3AG7A 5HFLA 4RQFA 1OZ0A 1NR7A 3D8CA 5C8YA 4LH7A 5KX5B 3T1HB 2QM8A 3OGCC 4OXSA 1OJHA 1NTZH 5LMNB 4FLTA 3APQA 5JH7B 1E1QG 5JQGA 1OCZB 3ICXA 5L3GA 1VF5B 1XHZA 2CTPA 4UVAA 3ABUA 4GX0A 4UCVA 1IBMO 2K1EA 1US6A 1M56C 4MVUA 2QKAA 4LBEC 1OCRB 4B3RB 4X1KA 1IBKO 4NTWA 2ZT9B 2JK5C 1AJPA 4D7SA 4XDJA 3SGIA 5L3BA 2X7RB 1UFIA 4Z1MG 4B3MO 1S3JA 1KC8W 2F43G 1XHXA 3M7MX 3OMAB 1U97A 4MSWC 3CCQV 3OD4A 2RJZA 1RM1C 4OPAA 4DW1A 3FKSG 2DW4A 2ZIMA 2EIJC 5CB4B 4E4EA 2YXHA 3W7XA 4DR2O 3L9DA 1N33B 1THZA 1WB8A 4K35A 1W2BU 1XBLA 5EBLC 2QTOA 4JI3B 3CCRV 2L6LA 1GN6A 4MVRA 4LH6A 3RVZA 1EM1A 2ZD9A 4JGSA 1HNWO 2UU9O 1EN4A 2OCCC 5KA6A 2ZINA 1AILA 3SJAC 4O4LA 3D36C 1YCIA 4UV8A 3SYAA 1WLEA 4TUYB 5GTHZ 5F2VO 2R9AA 4IYIA 1MZEA 3HKDA 4WFBV 1LR1A 4FPPA 2QWRB 2CDYA 4JAVA 4CH6A 3K5MA 5LGTA 2W0XA 4EB6B 3CHXA 1SA0B 3JD2A 4DV3B 2BTQA 3APOA 1FXKC 1SZXA 2XT9A 2WLIB 3M99B 1FPOA 1GH6A 2QWQB 3ABKB 2ZCEA 2ZIOA 1IDSA 4ZHQA 1DTOA 4GKKO 4CS3A 4TQDA 2YEVB 3G71V 2Y0IA 4DR3B 4LFAB 4JF3A 4LFCO 1XNRB 2X6BA 5JVDB 4DV5O 2JS3A 1F51A 2OCHA 1G1XB 3QO7A 4LF7O 2R9RB 3TJTA 4NXMO 3D3IA 1VQMV 4DR5B 1F4NA 3OT7A 3T4ZA 4YJ2B 2HR3A 2IU0A 1Y76A 3K5OA 1XMOO 3AK3A 3S3XA 4JYBA 3FYIB 4GX5A 2RQ6A 2WWWA 5IT9N 2OT5A 4DR6B 1XMQB 1GMGA 5BZBA 1FD9A 4J7KA 1YVWA 1L8DA 1SQXH 4FLXA 3UM7A 4JI5O 2EBOA 2ITDC 1WNSA 1B06A 3KKYA 4NTXA 2EINC 2GDSA 3IC7A 4YY3B 3ASNC 4Z2WA 1MMMA 2ZQMA 1IBLB 1BL8A 4J7ZA 1OCOB 4K0KO 1XL6A 4HAMA 2WLHA 3LDDA 3S3WA 1E79G 4JI4O 2QSAA 3RBZA 5IJ0A 1XQ8A 1Q3EA 3OUSA 2QWNB 5EZYB 3HKBB 3JAMN 1AR1B 1S77D 3ZCCA 1P49A 4HNAA 2EZPA 3ZHUA 4JI0B 2BOCC 1VQLV 2L35A 1R6TA 4TQFA 1JJ2U 2D3OW 3RN4A 5KMGA 3SPHA 3B2EE 3CSXA 1M1KW 2CGOA 2QWOB 4JI6B 5KHHA 5IDJA 4X1YB 1VP7A 3OMIB 3RYFA 4LF4B 1SZTA 1VQPV 2UXDB 4NXNB 1NBMG 4WFFA 5LYJB 4DR4B 1UPGA 2XTAA 3KCYA 4Q20A 3AG2C 3K5NA 1FYJA 4FM1A 2WLLB 2BOBC 1AROP 1JX9A 3CJHB 1NTKH 4BIOA 3OUFA 2QM7A 3ML0A 1VF6C 3N2GB 2CTQA 5KHKA 3CRQA 1P4RA 3ZHVA 2VWJA 2B1IA 1L0NH 1Y74B 3K08A 3WU2Z 5JWPA 2W0FC 3FAVA 4YJ3B 3DSQA 2OTLV 3P3PA 3BA8A 4MVSA 5JJJB 2CAZC 3PJSK 4DK0A 3CXCU 1AR5A 1SQGA 2VRZA 4AHCA 3M8AA 4I55B 3OE7G 4CZZA 1PM9A 1PD3A 3DC5A 5FNVA 1GN4A 1TA8A 4MVMA 3JAWA 3THOA 2AXTZ 1AI6A 3SYCA 2HLDG 3G4SV 3R66A 4MTFA 2ZNIA 2E5LB 2UXBB 4FLVA 2AZ2A 1YF2A 4I4TA 1UJWB 2OIGA 2V4DA 3DXRA 1I94O 2JJ1G 2UXCB 1DF4A 3N2KB 2XAQA 4QGPA 1IURA 2GUZA 2UXNA 2IU3A 3K06A 2IJHA 4O2BA 5BXZA 4IHJA 3OGIB 1Q43A 2UUBO 4J80A 1IBMB 1ZTEA 4B3TO 5LP6B 2QE7G 4X1IA 1GM7A 3CX5F 1R6NA 3JD0A 3UT5B 1TVKB 4CC6A 3J80N 2P67A 2E74B 3BRCA 1ORQC 2YS8A 5B1AC 2ZXWB 4B3MB 2Q69A 4R6ZA 3CCEV 4YHHO 1S5JA 4I9WA 1XL4A 1BZKA 2CTWA 4U3FH 1YDXA 4HZ3A 2WPDG 3CCUV 2EJ7A 4I5SA 3GVMA 3CRMA 3B4SA 5IYZA 5B3SB 3SDLA 4JAAA 2V1DA 4GUNA 4FVMA 2P4VA 1QVGU 3U11A 3U0ZA 4FLWA 4O4IB 2YC0A 2UU9B 1VMGA 1K34A 3QVNA 1FFXB 2ETNA 4J11A 2JJ2G 4UCOA 3MAQA 2EULA 4JZ2A 3ZHSA 1GM8A 1H8HG 3ASOB 1B04A 4LP8A 1D5NA 1PL4A 4LF6O 2DYSC 4O4HA 3Q4HB 4CS2A 5LA6A 3ABMC 3SPGA 4LF9B 2Y4TA 4JYAO 3TETA 1S5LZ 4DV7B 2F95B 5LOVA 3C90A 5ITZB 3HB3B 3JD4A 4R50A 2VQEO 3CD6V 4FFBB 2RMKB 3RFRA 3RVYA 4DV4B 2OTJV 2QKSA 5CA1B 4X8AA 4K8ZA 1K4DC 1KQSU 2KG7B 1FJGB 3FB5C 3VQXA 1ZAUA 4DV2O 1H2NA 1JPXA 5LHHA 2WSSG 3ZRVA 2WLKA 3K79A 5H9CA 1WPXA 1M56B 2Z5UA 2ITCC 1PL0A 2ILMA 5JH7A 3OTOO 4X88A 1WA8B 4WBNB 4GX2A 4JI2O 5A2QN 1YEWA 1I5XA 1YJ9V 4BR6A 2ZE6A 1LUVA 4UB6Z 3SJBC 2Q7EA 1VQKV 3GWKC 4J9ZB 5H6RA 1RM1B 3F7VC 3TCUA 3SPJA 3ZN0A 4WF9V 4WFEA 5IYBO 2W6JG 2OYQA 4A5UB 2GSMB 4U3JB 3LUTB 4BWAA 2V7QG 4FLUA 1AP6A 3CEIA 3E86A 5B1BC 3CPWU 2GBOA 1M57B 2Q0OC 5EK0A 3H1KH 4ZI7A 4P9OA 1K5QA 2F4VO 1VEWA 4H44B 1IX9A 1KU9A 1P7GA 5EBWC 4TT3G 4ZIBA 1NJIW 3CCVV 2JRIA 5CB4A 5CBFA 2EIMC 1ZUQA 2HFEC 3KG2A 2Q9LA 1BHAA 2UXXA 4UCTA 3E83A 3EVKA 3K59A 4PJ0Z 2H8PC 4PA7A 2A0LA 1BQ0A 4I0XA 1RSOB 4NVPA 4LCUC 1A32A 5CA0A 3I5DA 4PI0A 3F7YC 3O65A 1AB3A 5LBQA 1W59A 2LGQA 2IBZH 1VQ5V 5JCOA 2Y4UA 2Y69C 3AG1B 3WFVA 2PYJA 2MK3A 1K97A 3AG4C 1V55C 3TK1A 4DUYO 5J2UB 1F7YA 3SPIA 1SQFA 3BA9A 2P4KA 1XUQA 4K8XA 3A8TA 5KHJA 1Q6UA 2WA4A 2WLIA 4EFEA 4DV0B 4P9PA 1GO3F 4G28B 3ETGA 1Z5VA 4L8JA 1AI5A 1K33A 1WB7A 3L72H 2Z3YA 4C7UA 3HR0A 3JALB 5JJEB 4I7ZB 4HBNA 2N04A 3O9OA 2UUAB 1KMIZ 3ZMVA 5J2TA 3T1YB 1WJZA 4IYHA 4X65B 4QIWF 2KSDA 1ROPA 1S0VA 2XHBA 4RWUA 1F4MA 2QA4V 4DUZO 4P2ZA 1DLBA 1LUWA 3RGBA 4CH3A 2XASA 2EINB 4H13B 1I94B 3ASNB 2PYLA 1WAZA 1MA1A 2FL4A 5E1AC 2ZM6O 5BR8O 1Q5OA 1K73W 4X20A 4H37A 2UUCB 2Q67A 1NVPB 1R6KA 2EZOA 1RP3B 2K9PA 4XBFA 3UKMA 4B3TB 4LFBO 2AGAA 3FB6C 3QO8A 2CH7B 1MG1A 2QKCA 2ZE7A 1RPOA 1ZL8A 1N34O 4JV5O 1COWG 2H94A 3CWBH 3WG7C 3ZMUA 3OEHG 4NR1A 1E1RG 3BCCH 1XI1A 5LXTB 2LO1A
chains in the Genus database with same CATH topology
3J80N 4JI6O 1F7YA 4DV0O 4LF4O 1N32O 1R6TA 4JI8O 1HR0O 4JI1O 1IBMO 4GKKO 4LFAO 3OTOO 4YHHO 1XEQA 4DR4O 1XNRO 3RT3C 4JI2O 5A2QN 2LW7A 2ZKOA 1IBKO 2N74A 1FKAO 5LMUO 4X66O 1HNXO 4LFCO 1XNQO 2UUAO 3T1YO 4B3MO 4DV5O 1FYJA 1J5EO 4LF8O 1D2DA 1G1XB 4DR7O 4X65O 4DR5O 4B3RO 4LF7O 2DJVA 4DR3O 4NXMO 3SDLA 4A5UB 2UXDO 4NXNO 4B3SO 4OPAA 1YZBA 1DK1A 4DV6O 2VQFO 4DR1O 4DR2O 4DR6O 1XMQO 1XMOO 4OPHA 2FKXA 4DV1O 4KHPO 4LF5O 3J81N 4DUZO 1X59A 5IT9N 3M8AA 2Z0AA 5LL6Y 4X62O 2E5LO 2UXBO 2F4VO 4AQYO 4JI7O 2UUCO 2JRIA 1N33O 4JI5O 2HHHO 1IBLO 1HNWO 2UU9O 2ZM6O 4LF9O 4OX9O 5BR8O 3R66A 4LF6O 2UXCO 1AILA 4DV7O 4JI3O 3T1HO 4X64O 1NS1A 4DV4O 1I94O 4JYAO 4LFBO 5LMNO 2AGAA 1A32A 1FJGO 2VQEO 4DV3O 4K0KO 2DOSA 5BXZA 3J7AU 3O65A 1N36O 4YY3O 1KUQA 1AB3A 1N34O 4JV5O 1R1BA 2UUBO 4JI4O 4JI0O 4DV2O 4B3TO 5BY1A 5IWAO 5FLXN 3JAMN 5H5NA 3F5TA 1HNZO 4GKJO 4DUYO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 N;  4JI6 O;  1F7Y A;  4DV0 O;  4LF4 O;  1N32 O;  1R6T A;  4JI8 O;  1HR0 O;  4JI1 O;  1IBM O;  4GKK O;  4LFA O;  3OTO O;  4YHH O;  1XEQ A;  4DR4 O;  1XNR O;  3RT3 C;  4JI2 O;  5A2Q N;  2LW7 A;  2ZKO A;  1IBK O;  2N74 A;  1FKA O;  5LMU O;  4X66 O;  1HNX O;  4LFC O;  1XNQ O;  2UUA O;  3T1Y O;  4B3M O;  4DV5 O;  1FYJ A;  1J5E O;  4LF8 O;  1D2D A;  1G1X B;  4DR7 O;  4X65 O;  4DR5 O;  4B3R O;  4LF7 O;  2DJV A;  4DR3 O;  4NXM O;  3SDL A;  4A5U B;  2UXD O;  4NXN O;  4B3S O;  4OPA A;  1YZB A;  1DK1 A;  4DV6 O;  2VQF O;  4DR1 O;  4DR2 O;  4DR6 O;  1XMQ O;  1XMO O;  4OPH A;  2FKX A;  4DV1 O;  4KHP O;  4LF5 O;  3J81 N;  4DUZ O;  1X59 A;  5IT9 N;  3M8A A;  2Z0A A;  5LL6 Y;  4X62 O;  2E5L O;  2UXB O;  2F4V O;  4AQY O;  4JI7 O;  2UUC O;  2JRI A;  1N33 O;  4JI5 O;  2HHH O;  1IBL O;  1HNW O;  2UU9 O;  2ZM6 O;  4LF9 O;  4OX9 O;  5BR8 O;  3R66 A;  4LF6 O;  2UXC O;  1AIL A;  4DV7 O;  4JI3 O;  3T1H O;  4X64 O;  1NS1 A;  4DV4 O;  1I94 O;  4JYA O;  4LFB O;  5LMN O;  2AGA A;  1A32 A;  1FJG O;  2VQE O;  4DV3 O;  4K0K O;  2DOS A;  5BXZ A;  3J7A U;  3O65 A;  1N36 O;  4YY3 O;  1KUQ A;  1AB3 A;  1N34 O;  4JV5 O;  1R1B A;  2UUB O;  4JI4 O;  4JI0 O;  4DV2 O;  4B3T O;  5BY1 A;  5IWA O;  5FLX N;  3JAM N;  5H5N A;  3F5T A;  1HNZ O;  4GKJ O;  4DUY O; 
#chains in the Genus database with same CATH topology
 1K9M W;  2P6J A;  2W6I G;  4JI8 O;  3L71 H;  1S76 D;  2C2A A;  2A3Q A;  2F1M A;  4GLX A;  3HKB A;  4PA9 A;  2ZKO A;  1BQZ A;  3AG2 B;  1XIL A;  2N74 A;  1HR0 B;  4X66 O;  3JSN A;  1HNX O;  1I08 A;  3ZS8 C;  1XNQ O;  4LF8 O;  4GZR B;  1W0J G;  4UCU A;  1B6Q A;  5IY5 B;  1AI4 A;  2JVD A;  1K4C C;  2HJF C;  4J10 A;  4XDK A;  1GRJ A;  5LYJ A;  3I56 V;  2EIK C;  2BSK B;  1LNQ A;  4DR1 O;  2LFS A;  3ZHQ A;  4WCE V;  4LF6 B;  5JQG B;  3N2G A;  3WB0 A;  2LGW A;  1JFF A;  2Z0A A;  3AEI A;  1WPB A;  3A0B Z;  3P3N A;  4YJ3 A;  3HKE A;  4R7C A;  4LF5 B;  2R70 A;  4AIL C;  3PN1 A;  4OX9 O;  3SYQ A;  2YIC A;  3CXH F;  1QR8 A;  4I55 A;  4YXW G;  3CC7 V;  1S72 V;  3A0H Z;  1K92 A;  5CN0 A;  2IM9 A;  1TUB B;  1HWY A;  4DRX B;  5A9G A;  1QQC A;  2MW2 B;  4JTD B;  1KUQ A;  3ZIA G;  1JOY A;  3OTO B;  1I5Y A;  3N2K A;  5B1A B;  1YJW V;  1L1F A;  1EFR G;  4GKJ O;  1Q90 D;  3DC6 A;  4CH5 A;  3E8G A;  4J41 A;  4F6R B;  4JTA B;  1N32 O;  4ZKI A;  3UCS C;  4MVQ A;  3E35 A;  5EYP B;  1IXM A;  3JAK A;  2PZS A;  3JAT B;  3VQW A;  1KD1 W;  5B1O A;  3RT3 C;  4EKW A;  1FKA O;  4YIO A;  1TVK A;  4JI1 B;  3CCS V;  1VQ4 V;  2IH1 C;  3RW0 A;  5LMU O;  1R3J C;  2NNU A;  5FPR A;  1BS3 A;  5LGN A;  3JAS A;  2EJR A;  1WP7 A;  2IW5 A;  3D3Q A;  2DE0 X;  2QDO A;  2X6C A;  2P5O A;  1CXZ B;  2RNB A;  4O4L B;  4DR7 O;  4PV1 B;  4PHZ A;  5DEC A;  1QNM A;  1GKF A;  4RO2 A;  3IGA C;  1HDJ A;  3H1I H;  2JGD A;  1MZF A;  3CYO A;  3OFN G;  2M6Y A;  1VQ9 V;  2BTQ B;  3B40 A;  2KB1 A;  3KCX A;  1SC5 B;  3LSQ A;  4LR3 A;  2B9Z A;  3ABL C;  2ZDI A;  5K1X A;  5JCO C;  2DYS B;  4LC1 A;  4ZHQ B;  1V9P A;  2HVJ C;  2XAH A;  5H6Q A;  4DV1 B;  1GM9 A;  4KHP B;  3QNE A;  4Z1V A;  4I9Q A;  4O4I A;  1FFX A;  1G4Y B;  5L3D A;  3SR2 C;  3E8H A;  3T1H O;  3HKC B;  5KA5 A;  3X2Q B;  1TUE B;  5LMN O;  3ETD A;  1ENV A;  1SKV A;  4F6E A;  3ABK C;  3OMN B;  4DUY B;  3BAA A;  1JMK C;  2P90 A;  3ZRW A;  3Q4H A;  1N4C A;  2OIE A;  4BAY A;  3F5T A;  3VBB A;  1HNZ O;  2ZE5 A;  5EIB D;  2X0L A;  1Y76 B;  3FB8 C;  1QVF U;  1AP5 A;  1M9N A;  1QLE B;  1SER A;  2BTO A;  1P84 F;  2KG7 A;  1DF5 A;  1QLN A;  2Q8V A;  2LW7 A;  3TGU H;  2DQ3 A;  5HFM A;  1SET A;  3AK2 A;  5KAI Z;  1CEZ A;  3STL C;  1IBK B;  3BVO A;  3A0R A;  3ZHR A;  4MW8 A;  3TXQ A;  2HEP A;  2RDC A;  1WA8 A;  3BPZ A;  5L3C A;  5KUK A;  4MTX A;  1BMF G;  3L74 H;  4CH4 A;  5DN6 G;  1YSC A;  4TV9 A;  1N8R W;  4LNU A;  4QE7 A;  3K0G A;  4TSF G;  5B1B B;  1EBO A;  4CC5 A;  3UQ8 A;  2WLM A;  1I0H A;  5IJ0 B;  4I50 A;  2IJI A;  5BR8 B;  3CE2 A;  3U10 A;  1NH2 B;  1D5A A;  4DR2 B;  1KKD A;  1PNK A;  3B09 A;  4U3J A;  2EIL C;  5CBG A;  4X62 O;  3MD0 A;  1TGO A;  1NR1 A;  3W7U A;  2DN9 A;  1Y66 A;  3JAR A;  5KMG B;  1K7D A;  3CMA V;  4UCS A;  2B5U A;  1Q6H A;  2G38 A;  2NR5 A;  3RYF B;  5IYC O;  4LWS B;  1AI7 A;  1H2K A;  1EZV H;  4JZG A;  1FAF A;  1HNW B;  3AG3 B;  3LNM B;  1YTF D;  4F4L A;  3I55 V;  4DV3 O;  1JA8 A;  4FLY A;  5BMV A;  4U7N A;  1V54 B;  2HP8 A;  1Z2G A;  4PDM A;  2YIB D;  3E2E A;  2ZNJ A;  3AG4 B;  4JI8 B;  4X9Q A;  2DYR C;  4FM2 A;  5D5P A;  4O4J B;  4IGG A;  4PDL A;  3RYC A;  5IWA O;  3FAV B;  2IJK A;  4FJC C;  1RSO A;  3RYH B;  3VQY A;  4G2K A;  1KYO F;  2M7W A;  2P7T C;  3SYO A;  3K9S A;  4PI2 A;  3WB1 A;  1HNX B;  1BHB A;  1XNQ B;  4RAI A;  4LFA O;  1XNR O;  1ZX3 A;  5FNV B;  3T1C A;  3JAW B;  1VQO V;  4GKK B;  5J2U A;  1AVM A;  1XRE A;  2YIB A;  4N23 A;  1S5H C;  5KX5 A;  4OGQ B;  4ASU G;  4I4T B;  4DR5 O;  1OV9 A;  3DXR B;  4LFC B;  3BY6 A;  3ZX6 A;  1Q86 W;  3ZRX A;  4TWK A;  4DV5 B;  1Q6I A;  3RYI B;  4B3S O;  1M90 W;  4BW5 A;  3QO5 A;  1GTO A;  4O2B B;  4LF7 B;  1TAE A;  3B8N A;  4NXM B;  4IHJ B;  1QBZ A;  4TV8 B;  4DV6 O;  1G8M A;  3JAL A;  4DR6 O;  1XMQ O;  1F23 A;  2QWP B;  3FFQ A;  4X1I B;  4OX9 B;  1NVP D;  3JSL A;  3E8B A;  1Y4M A;  2LP7 A;  5K1P A;  4MTO A;  3J81 N;  3W7T A;  1JCH A;  5C93 A;  2EIJ B;  1R3I C;  4QJF B;  1XMO B;  4IL6 Z;  2B1G A;  5B5E Z;  4D7T A;  2HHH O;  1IBL O;  4IIJ B;  3DTU B;  2Q7H A;  1BGY H;  2FYU H;  3CS5 A;  4JI5 B;  4CS4 A;  5TIS Z;  4NTY A;  1MAB G;  4QPJ A;  2YI8 A;  4W4K A;  5CMU A;  1VQN V;  1RFY A;  4L87 A;  1WP8 A;  2OCC B;  3IAY A;  3WG7 B;  4GKJ B;  3GWO A;  5IYZ B;  3DGE A;  4FIP C;  3STZ C;  1KKC A;  4MVO A;  4O2A B;  3ZMZ A;  3CCJ V;  2ZXW C;  4JI0 O;  2ZR3 A;  4ABM A;  4ZOL B;  4K0K B;  2VWK A;  1U96 A;  1VF7 A;  5H5N A;  3ETQ A;  2Q4P A;  2CH7 A;  2F23 A;  2PF4 E;  2NLJ C;  4JI4 B;  4PA3 A;  4JI6 O;  5KHI A;  3L73 H;  1R73 A;  2QR4 A;  4GX1 A;  5LMU B;  4LF4 O;  4X89 A;  1YHQ V;  4NKG B;  4DR4 O;  1FXK B;  5GON B;  3UO2 A;  5DM6 V;  2YXY A;  5B3S C;  4UUJ C;  2XAG A;  4J9Y B;  2ZDI C;  4TUY A;  1PV0 A;  5KUM A;  1QHT A;  4O4H B;  4WFA V;  4NB5 A;  1L0L H;  4JPR A;  1PNL A;  3IFX A;  1HP8 A;  2EIK B;  4EB6 A;  5LOV B;  3E89 A;  1SA0 A;  4J42 A;  3W7S A;  2AHY A;  4KP4 A;  3CRC A;  2VQF O;  3CP1 A;  1PPJ H;  3AK1 A;  4BIU A;  1X59 A;  1O9G A;  2Q6A A;  1SQQ H;  3CC2 V;  2YEV A;  2E5L O;  2UXB O;  4JI7 O;  2LW1 A;  2BSK A;  1OCC C;  2UXC O;  1BSM A;  4UCR A;  5JVD A;  2D2C B;  1AJN A;  3CRA A;  4NYK A;  3ETE A;  4X64 O;  4B7K A;  4FZ1 A;  2YID A;  1K3E A;  4UXN A;  1URF A;  4PDV A;  1YIJ V;  2JIZ G;  1Q7Y W;  1HNZ B;  3G6E V;  4YJ2 A;  1FXH A;  1PNM A;  2Y48 A;  2DWE C;  3K58 A;  5DED A;  1KP2 A;  5BY1 A;  1NT2 B;  2PGG A;  1TUB A;  4PD4 F;  2UUB B;  1Y67 A;  4DRX A;  5IYD O;  3C3T A;  4GYC B;  5EIB C;  1KBH A;  3VOU A;  4B7E A;  3E22 B;  2DMX A;  3QG5 A;  4ZI7 B;  2IJJ A;  2A79 B;  2AZ0 A;  4G27 B;  4MS2 A;  3NR7 A;  4H33 A;  4GT1 A;  2YI9 A;  4YHH B;  1N0J A;  2ADQ B;  4F6R A;  2KKW A;  2XOK G;  3H01 A;  5EYP A;  5IJ9 B;  1M5I A;  1Q82 W;  3G67 A;  3JAT A;  1KP3 A;  1SS3 A;  2WAM A;  2RN9 A;  4GCZ A;  2PTM A;  3EFF K;  4I0X B;  5GTI Z;  3K3W A;  2Q0A A;  1VIB A;  4K3A A;  1M57 C;  5CA0 B;  3SJC C;  1IZ3 A;  2ADP A;  4DW0 A;  5EZY A;  5FPO A;  3ZHT A;  4X62 B;  1VQ6 V;  1H8E G;  4WFH A;  3ABL B;  4JAS A;  3ZED A;  3P30 A;  3JCU Z;  5FL7 G;  4FZ0 A;  2HJD A;  1N0N A;  1I7F A;  1Q81 W;  3ABT A;  4PEL A;  4YIP A;  4D6T H;  1MNG A;  3NXS A;  1FS0 G;  1KEC A;  4X1Y A;  4JYY A;  4AQY O;  5C8Y B;  3LDE A;  4ICG A;  5GW7 A;  5LGU A;  2ATK C;  1R3L C;  4LF9 O;  5AG2 A;  1SQB H;  4DV7 O;  2JEX A;  1H2M A;  2WLL A;  3CJH A;  1VQ8 V;  3H1L H;  4FFK A;  3SJQ C;  4DV4 O;  3AG1 C;  1JR9 A;  1EN5 A;  5IWA B;  4FLZ A;  1FJG O;  1P7B A;  1Y74 A;  4HYO A;  1EZJ A;  2ARH A;  1NI8 A;  2A7W A;  1YXB A;  4JYA B;  1QCE A;  5J2T B;  3B77 A;  2JGU A;  4RQE A;  2VQE B;  1IXB A;  1PKX A;  3HKC A;  4X1K B;  2R72 A;  2HG5 C;  5KAF Z;  4DV2 B;  3H1H H;  3FB7 C;  2GTS A;  1OCZ C;  4B08 A;  3BFR A;  4N21 A;  1PP9 H;  3JCZ A;  3P32 A;  1GAX A;  3B8M A;  1JQ0 A;  2FTK A;  4DK1 A;  1H2S B;  5L3E A;  3LSU A;  4B3S B;  3LDC A;  1K5S A;  1OCR C;  4JI2 B;  2ZE8 A;  2O57 A;  4X20 B;  2X6A A;  1J5E O;  3IJ4 A;  1D2D A;  2EX3 A;  2QJ1 A;  4DV6 B;  2YDE A;  1SQP H;  1NH2 D;  1BT8 A;  4UB8 Z;  1Q8I A;  3CB2 A;  2GV9 A;  3CRR A;  3K03 A;  5LP6 A;  2XAJ A;  3QF7 A;  1ZL8 B;  4QE9 A;  1MOF A;  1XDC A;  1YZB A;  1M93 A;  2LQT A;  3UT5 A;  1DK1 A;  2EIL B;  1HW7 A;  2HHH B;  3UO3 A;  1WN7 A;  1RPR A;  2PY5 A;  3EXA A;  5H2F Z;  4RUF A;  4BIZ A;  3BAB A;  4TOI A;  3MDS A;  3FD9 A;  2A06 H;  1QU7 A;  4KFM A;  3ZMS A;  3HKD B;  2VS0 A;  4DYL A;  5LHG A;  2F4V B;  3BEH A;  2F66 C;  4PA6 A;  4KUM A;  3ZMT A;  5E79 Z;  2DYR B;  2XAF A;  1MSD A;  4QNH B;  4UVB A;  3J7A U;  1N36 O;  5EC1 C;  4LWS A;  2Q5Z A;  4FK5 C;  2IH3 C;  3ABM B;  2YIA A;  1IVS A;  3L75 H;  1H2G A;  2FB5 A;  3G6B A;  4J7J A;  4DV0 O;  2Y0P A;  3N27 A;  1M4U A;  3OR6 C;  3CCM V;  3W7W A;  1G6U A;  1AR4 A;  1JFF B;  4O4J A;  2CUG A;  5IY5 C;  3HKE B;  3RYH A;  1YJN V;  2A9H A;  1NQT A;  5L3F A;  3T2M A;  1XOU A;  2ZR2 A;  3OR7 C;  2UUA O;  3T1Y O;  1YI2 V;  2YSU B;  4QPK A;  5ITZ A;  3A2F A;  3OM3 B;  4FFB A;  2HKO A;  4X65 O;  2VQF B;  4B3R O;  3ZJZ A;  3G80 A;  3R65 A;  5CA1 A;  2CGN A;  3K9A A;  3K5L A;  2P22 C;  2PI5 A;  2AHZ A;  3ZN1 A;  3WB2 A;  4JI7 B;  1O9H A;  3CC4 V;  1W0K G;  2GTA A;  3ZBH A;  1H2L A;  3MHH C;  1GN3 A;  1OHH G;  4PA4 A;  3F5W C;  1AJQ A;  3RYI A;  4WBN A;  5LL6 Y;  1GN2 A;  4X64 B;  1Z5W A;  4DXW A;  3IC9 A;  2UUC O;  1N33 O;  1JJO A;  3K57 A;  3JAK B;  4TV8 A;  4DUZ B;  4MTG A;  3OAA G;  3GB7 C;  2BCC H;  5IE9 A;  4JI3 O;  1SRY A;  2ZM6 B;  2WLJ A;  3LSS A;  3JAS B;  2WLN A;  3K0D A;  4U7O A;  2FML A;  3OW2 U;  2XUM A;  2EIM B;  2LJ2 A;  4KL1 A;  4HNA B;  4IIJ A;  4KXR A;  1R3K C;  5EC2 C;  2DOS A;  1J95 A;  2WA3 A;  2E76 B;  2E75 B;  3SYP A;  4LFB B;  3L70 H;  1R1B A;  1X4T A;  1Y6X A;  5JJN B;  1OCO C;  4ZBM A;  2YXL A;  2JGD B;  2CE4 A;  4UFZ A;  1N34 B;  3FYE B;  5KLV H;  4WFG A;  4JV5 B;  4RUE A;  2QTS A;  4XDL A;  2NN4 A;  2XND G;  2YUA A;  1HR0 O;  4H0L B;  4O2A A;  1VAR A;  3D36 A;  3E8F A;  2Y69 B;  4ZOL A;  1V55 B;  4Q6G A;  4E2L A;  2JS5 A;  2OWO A;  1VQ7 V;  3FX7 A;  1BE3 H;  3H9V A;  1NZ6 A;  2DWD C;  1DGS A;  1BCC H;  1FXK A;  4X66 B;  5GON A;  4DR3 O;  4BW9 A;  1EN6 A;  4LF8 B;  5J9P C;  1SQV H;  5KHG A;  5EBM C;  4AQY B;  4UV9 A;  3ZRW B;  4EFB A;  2QM4 A;  2R9I A;  3JYC A;  1NU1 H;  3T4D A;  5CA3 A;  2PI4 A;  4OPH A;  3H1J H;  4LF5 O;  1OCC B;  1ZWI C;  4DR1 B;  4PDR A;  4IT5 A;  1CPY A;  2DQ0 A;  3QTC A;  2LFR A;  3C3S A;  3X2Q C;  4MT8 A;  2GUZ B;  2P06 A;  2AW9 A;  1K8A W;  4FMT A;  2QEX V;  1QR9 A;  4R8C A;  1JVM A;  1FFT B;  3RWR D;  1H38 A;  4FM0 A;  1ZLZ A;  1SES A;  3OTF A;  3SPC A;  1NS1 A;  1NKD A;  3ZRS A;  2QGN A;  4DO2 A;  3MHS C;  3BHP A;  2F93 B;  2ODM A;  4YY3 O;  4P30 A;  2JDI G;  1QLE C;  4AI8 A;  3OEE G;  5D5Q A;  4TV9 B;  2Q73 A;  4LNU B;  1ZSP A;  4JYC A;  1YIT V;  1MSW D;  5FLX N;  3KZI Z;  4CBC A;  1FXV A;  3VQV A;  3CME V;  2CTR A;  4JTC B;  4I50 B;  2RCV A;  5LP6 C;  1NTM H;  4JAU A;  2N05 A;  2E3C A;  4JI1 O;  4EEQ A;  5CBH A;  1J5E B;  1XEQ A;  2BE3 A;  4UVC A;  3JD1 A;  1N32 B;  1GK9 A;  4W4L A;  5B1N A;  1CP9 A;  3JAR B;  2H3O A;  3JD3 A;  3CCL V;  3E22 A;  5B66 Z;  2DJV A;  2KQX A;  4MW3 A;  2JEU A;  2UXD O;  4NXN O;  5BMV B;  4DR7 B;  1B3Q A;  5IJ9 A;  2GHY A;  5LXT A;  3TXS A;  2FKX A;  3K04 A;  3RYC B;  1KB9 F;  4DV1 O;  4KHP O;  3HPL C;  3LNN A;  5LA6 B;  3EHB B;  2Q68 A;  2HVK C;  1SF9 A;  3AG3 C;  1T5E A;  4MVZ A;  5LHI A;  2CK3 G;  1V54 C;  3ASO C;  2PUS A;  1VF6 A;  1N36 B;  2Q7G A;  1YTF B;  3AG7 A;  5HFL A;  4RQF A;  1OZ0 A;  1NR7 A;  3D8C A;  5C8Y A;  4LH7 A;  5KX5 B;  3T1H B;  2QM8 A;  3OGC C;  4OXS A;  1OJH A;  1NTZ H;  5LMN B;  4FLT A;  3APQ A;  5JH7 B;  1E1Q G;  5JQG A;  1OCZ B;  3ICX A;  5L3G A;  1VF5 B;  1XHZ A;  2CTP A;  4UVA A;  3ABU A;  4GX0 A;  4UCV A;  1IBM O;  2K1E A;  1US6 A;  1M56 C;  4MVU A;  2QKA A;  4LBE C;  1OCR B;  4B3R B;  4X1K A;  1IBK O;  4NTW A;  2ZT9 B;  2JK5 C;  1AJP A;  4D7S A;  4XDJ A;  3SGI A;  5L3B A;  2X7R B;  1UFI A;  4Z1M G;  4B3M O;  1S3J A;  1KC8 W;  2F43 G;  1XHX A;  3M7M X;  3OMA B;  1U97 A;  4MSW C;  3CCQ V;  3OD4 A;  2RJZ A;  1RM1 C;  4OPA A;  4DW1 A;  3FKS G;  2DW4 A;  2ZIM A;  2EIJ C;  5CB4 B;  4E4E A;  2YXH A;  3W7X A;  4DR2 O;  3L9D A;  1N33 B;  1THZ A;  1WB8 A;  4K35 A;  1W2B U;  1XBL A;  5EBL C;  2QTO A;  4JI3 B;  3CCR V;  2L6L A;  1GN6 A;  4MVR A;  4LH6 A;  3RVZ A;  1EM1 A;  2ZD9 A;  4JGS A;  1HNW O;  2UU9 O;  1EN4 A;  2OCC C;  5KA6 A;  2ZIN A;  1AIL A;  3SJA C;  4O4L A;  3D36 C;  1YCI A;  4UV8 A;  3SYA A;  1WLE A;  4TUY B;  5GTH Z;  5F2V O;  2R9A A;  4IYI A;  1MZE A;  3HKD A;  4WFB V;  1LR1 A;  4FPP A;  2QWR B;  2CDY A;  4JAV A;  4CH6 A;  3K5M A;  5LGT A;  2W0X A;  4EB6 B;  3CHX A;  1SA0 B;  3JD2 A;  4DV3 B;  2BTQ A;  3APO A;  1FXK C;  1SZX A;  2XT9 A;  2WLI B;  3M99 B;  1FPO A;  1GH6 A;  2QWQ B;  3ABK B;  2ZCE A;  2ZIO A;  1IDS A;  4ZHQ A;  1DTO A;  4GKK O;  4CS3 A;  4TQD A;  2YEV B;  3G71 V;  2Y0I A;  4DR3 B;  4LFA B;  4JF3 A;  4LFC O;  1XNR B;  2X6B A;  5JVD B;  4DV5 O;  2JS3 A;  1F51 A;  2OCH A;  1G1X B;  3QO7 A;  4LF7 O;  2R9R B;  3TJT A;  4NXM O;  3D3I A;  1VQM V;  4DR5 B;  1F4N A;  3OT7 A;  3T4Z A;  4YJ2 B;  2HR3 A;  2IU0 A;  1Y76 A;  3K5O A;  1XMO O;  3AK3 A;  3S3X A;  4JYB A;  3FYI B;  4GX5 A;  2RQ6 A;  2WWW A;  5IT9 N;  2OT5 A;  4DR6 B;  1XMQ B;  1GMG A;  5BZB A;  1FD9 A;  4J7K A;  1YVW A;  1L8D A;  1SQX H;  4FLX A;  3UM7 A;  4JI5 O;  2EBO A;  2ITD C;  1WNS A;  1B06 A;  3KKY A;  4NTX A;  2EIN C;  2GDS A;  3IC7 A;  4YY3 B;  3ASN C;  4Z2W A;  1MMM A;  2ZQM A;  1IBL B;  1BL8 A;  4J7Z A;  1OCO B;  4K0K O;  1XL6 A;  4HAM A;  2WLH A;  3LDD A;  3S3W A;  1E79 G;  4JI4 O;  2QSA A;  3RBZ A;  5IJ0 A;  1XQ8 A;  1Q3E A;  3OUS A;  2QWN B;  5EZY B;  3HKB B;  3JAM N;  1AR1 B;  1S77 D;  3ZCC A;  1P49 A;  4HNA A;  2EZP A;  3ZHU A;  4JI0 B;  2BOC C;  1VQL V;  2L35 A;  1R6T A;  4TQF A;  1JJ2 U;  2D3O W;  3RN4 A;  5KMG A;  3SPH A;  3B2E E;  3CSX A;  1M1K W;  2CGO A;  2QWO B;  4JI6 B;  5KHH A;  5IDJ A;  4X1Y B;  1VP7 A;  3OMI B;  3RYF A;  4LF4 B;  1SZT A;  1VQP V;  2UXD B;  4NXN B;  1NBM G;  4WFF A;  5LYJ B;  4DR4 B;  1UPG A;  2XTA A;  3KCY A;  4Q20 A;  3AG2 C;  3K5N A;  1FYJ A;  4FM1 A;  2WLL B;  2BOB C;  1ARO P;  1JX9 A;  3CJH B;  1NTK H;  4BIO A;  3OUF A;  2QM7 A;  3ML0 A;  1VF6 C;  3N2G B;  2CTQ A;  5KHK A;  3CRQ A;  1P4R A;  3ZHV A;  2VWJ A;  2B1I A;  1L0N H;  1Y74 B;  3K08 A;  3WU2 Z;  5JWP A;  2W0F C;  3FAV A;  4YJ3 B;  3DSQ A;  2OTL V;  3P3P A;  3BA8 A;  4MVS A;  5JJJ B;  2CAZ C;  3PJS K;  4DK0 A;  3CXC U;  1AR5 A;  1SQG A;  2VRZ A;  4AHC A;  3M8A A;  4I55 B;  3OE7 G;  4CZZ A;  1PM9 A;  1PD3 A;  3DC5 A;  5FNV A;  1GN4 A;  1TA8 A;  4MVM A;  3JAW A;  3THO A;  2AXT Z;  1AI6 A;  3SYC A;  2HLD G;  3G4S V;  3R66 A;  4MTF A;  2ZNI A;  2E5L B;  2UXB B;  4FLV A;  2AZ2 A;  1YF2 A;  4I4T A;  1UJW B;  2OIG A;  2V4D A;  3DXR A;  1I94 O;  2JJ1 G;  2UXC B;  1DF4 A;  3N2K B;  2XAQ A;  4QGP A;  1IUR A;  2GUZ A;  2UXN A;  2IU3 A;  3K06 A;  2IJH A;  4O2B A;  5BXZ A;  4IHJ A;  3OGI B;  1Q43 A;  2UUB O;  4J80 A;  1IBM B;  1ZTE A;  4B3T O;  5LP6 B;  2QE7 G;  4X1I A;  1GM7 A;  3CX5 F;  1R6N A;  3JD0 A;  3UT5 B;  1TVK B;  4CC6 A;  3J80 N;  2P67 A;  2E74 B;  3BRC A;  1ORQ C;  2YS8 A;  5B1A C;  2ZXW B;  4B3M B;  2Q69 A;  4R6Z A;  3CCE V;  4YHH O;  1S5J A;  4I9W A;  1XL4 A;  1BZK A;  2CTW A;  4U3F H;  1YDX A;  4HZ3 A;  2WPD G;  3CCU V;  2EJ7 A;  4I5S A;  3GVM A;  3CRM A;  3B4S A;  5IYZ A;  5B3S B;  3SDL A;  4JAA A;  2V1D A;  4GUN A;  4FVM A;  2P4V A;  1QVG U;  3U11 A;  3U0Z A;  4FLW A;  4O4I B;  2YC0 A;  2UU9 B;  1VMG A;  1K34 A;  3QVN A;  1FFX B;  2ETN A;  4J11 A;  2JJ2 G;  4UCO A;  3MAQ A;  2EUL A;  4JZ2 A;  3ZHS A;  1GM8 A;  1H8H G;  3ASO B;  1B04 A;  4LP8 A;  1D5N A;  1PL4 A;  4LF6 O;  2DYS C;  4O4H A;  3Q4H B;  4CS2 A;  5LA6 A;  3ABM C;  3SPG A;  4LF9 B;  2Y4T A;  4JYA O;  3TET A;  1S5L Z;  4DV7 B;  2F95 B;  5LOV A;  3C90 A;  5ITZ B;  3HB3 B;  3JD4 A;  4R50 A;  2VQE O;  3CD6 V;  4FFB B;  2RMK B;  3RFR A;  3RVY A;  4DV4 B;  2OTJ V;  2QKS A;  5CA1 B;  4X8A A;  4K8Z A;  1K4D C;  1KQS U;  2KG7 B;  1FJG B;  3FB5 C;  3VQX A;  1ZAU A;  4DV2 O;  1H2N A;  1JPX A;  5LHH A;  2WSS G;  3ZRV A;  2WLK A;  3K79 A;  5H9C A;  1WPX A;  1M56 B;  2Z5U A;  2ITC C;  1PL0 A;  2ILM A;  5JH7 A;  3OTO O;  4X88 A;  1WA8 B;  4WBN B;  4GX2 A;  4JI2 O;  5A2Q N;  1YEW A;  1I5X A;  1YJ9 V;  4BR6 A;  2ZE6 A;  1LUV A;  4UB6 Z;  3SJB C;  2Q7E A;  1VQK V;  3GWK C;  4J9Z B;  5H6R A;  1RM1 B;  3F7V C;  3TCU A;  3SPJ A;  3ZN0 A;  4WF9 V;  4WFE A;  5IYB O;  2W6J G;  2OYQ A;  4A5U B;  2GSM B;  4U3J B;  3LUT B;  4BWA A;  2V7Q G;  4FLU A;  1AP6 A;  3CEI A;  3E86 A;  5B1B C;  3CPW U;  2GBO A;  1M57 B;  2Q0O C;  5EK0 A;  3H1K H;  4ZI7 A;  4P9O A;  1K5Q A;  2F4V O;  1VEW A;  4H44 B;  1IX9 A;  1KU9 A;  1P7G A;  5EBW C;  4TT3 G;  4ZIB A;  1NJI W;  3CCV V;  2JRI A;  5CB4 A;  5CBF A;  2EIM C;  1ZUQ A;  2HFE C;  3KG2 A;  2Q9L A;  1BHA A;  2UXX A;  4UCT A;  3E83 A;  3EVK A;  3K59 A;  4PJ0 Z;  2H8P C;  4PA7 A;  2A0L A;  1BQ0 A;  4I0X A;  1RSO B;  4NVP A;  4LCU C;  1A32 A;  5CA0 A;  3I5D A;  4PI0 A;  3F7Y C;  3O65 A;  1AB3 A;  5LBQ A;  1W59 A;  2LGQ A;  2IBZ H;  1VQ5 V;  5JCO A;  2Y4U A;  2Y69 C;  3AG1 B;  3WFV A;  2PYJ A;  2MK3 A;  1K97 A;  3AG4 C;  1V55 C;  3TK1 A;  4DUY O;  5J2U B;  1F7Y A;  3SPI A;  1SQF A;  3BA9 A;  2P4K A;  1XUQ A;  4K8X A;  3A8T A;  5KHJ A;  1Q6U A;  2WA4 A;  2WLI A;  4EFE A;  4DV0 B;  4P9P A;  1GO3 F;  4G28 B;  3ETG A;  1Z5V A;  4L8J A;  1AI5 A;  1K33 A;  1WB7 A;  3L72 H;  2Z3Y A;  4C7U A;  3HR0 A;  3JAL B;  5JJE B;  4I7Z B;  4HBN A;  2N04 A;  3O9O A;  2UUA B;  1KMI Z;  3ZMV A;  5J2T A;  3T1Y B;  1WJZ A;  4IYH A;  4X65 B;  4QIW F;  2KSD A;  1ROP A;  1S0V A;  2XHB A;  4RWU A;  1F4M A;  2QA4 V;  4DUZ O;  4P2Z A;  1DLB A;  1LUW A;  3RGB A;  4CH3 A;  2XAS A;  2EIN B;  4H13 B;  1I94 B;  3ASN B;  2PYL A;  1WAZ A;  1MA1 A;  2FL4 A;  5E1A C;  2ZM6 O;  5BR8 O;  1Q5O A;  1K73 W;  4X20 A;  4H37 A;  2UUC B;  2Q67 A;  1NVP B;  1R6K A;  2EZO A;  1RP3 B;  2K9P A;  4XBF A;  3UKM A;  4B3T B;  4LFB O;  2AGA A;  3FB6 C;  3QO8 A;  2CH7 B;  1MG1 A;  2QKC A;  2ZE7 A;  1RPO A;  1ZL8 A;  1N34 O;  4JV5 O;  1COW G;  2H94 A;  3CWB H;  3WG7 C;  3ZMU A;  3OEH G;  4NR1 A;  1E1R G;  3BCC H;  1XI1 A;  5LXT B;  2LO1 A; 
#chains in the Genus database with same CATH homology
 3J80 N;  4JI6 O;  1F7Y A;  4DV0 O;  4LF4 O;  1N32 O;  1R6T A;  4JI8 O;  1HR0 O;  4JI1 O;  1IBM O;  4GKK O;  4LFA O;  3OTO O;  4YHH O;  1XEQ A;  4DR4 O;  1XNR O;  3RT3 C;  4JI2 O;  5A2Q N;  2LW7 A;  2ZKO A;  1IBK O;  2N74 A;  1FKA O;  5LMU O;  4X66 O;  1HNX O;  4LFC O;  1XNQ O;  2UUA O;  3T1Y O;  4B3M O;  4DV5 O;  1FYJ A;  1J5E O;  4LF8 O;  1D2D A;  1G1X B;  4DR7 O;  4X65 O;  4DR5 O;  4B3R O;  4LF7 O;  2DJV A;  4DR3 O;  4NXM O;  3SDL A;  4A5U B;  2UXD O;  4NXN O;  4B3S O;  4OPA A;  1YZB A;  1DK1 A;  4DV6 O;  2VQF O;  4DR1 O;  4DR2 O;  4DR6 O;  1XMQ O;  1XMO O;  4OPH A;  2FKX A;  4DV1 O;  4KHP O;  4LF5 O;  3J81 N;  4DUZ O;  1X59 A;  5IT9 N;  3M8A A;  2Z0A A;  5LL6 Y;  4X62 O;  2E5L O;  2UXB O;  2F4V O;  4AQY O;  4JI7 O;  2UUC O;  2JRI A;  1N33 O;  4JI5 O;  2HHH O;  1IBL O;  1HNW O;  2UU9 O;  2ZM6 O;  4LF9 O;  4OX9 O;  5BR8 O;  3R66 A;  4LF6 O;  2UXC O;  1AIL A;  4DV7 O;  4JI3 O;  3T1H O;  4X64 O;  1NS1 A;  4DV4 O;  1I94 O;  4JYA O;  4LFB O;  5LMN O;  2AGA A;  1A32 A;  1FJG O;  2VQE O;  4DV3 O;  4K0K O;  2DOS A;  5BXZ A;  3J7A U;  3O65 A;  1N36 O;  4YY3 O;  1KUQ A;  1AB3 A;  1N34 O;  4JV5 O;  1R1B A;  2UUB O;  4JI4 O;  4JI0 O;  4DV2 O;  4B3T O;  5BY1 A;  5IWA O;  5FLX N;  3JAM N;  5H5N A;  3F5T A;  1HNZ O;  4GKJ O;  4DUY O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...