3BCCH

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
66
structure length
66
Chain Sequence
LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELFDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 20
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3bccH00
2IBZH 3H1KH 1KYOF 2BCCH 4D6TH 3CWBH 1NU1H 1EZVH 3H1IH 3L71H 1P84F 2FYUH 4PD4F 1NTMH 3L74H 3H1HH 5KLVH 1SQBH 1SQVH 1L0LH 1SQXH 1BGYH 3TGUH 1L0NH 1SQQH 1SQPH 1KB9F 3CX5F 3L75H 1BCCH 1PPJH 3L73H 1NTKH 3L72H 1BE3H 3L70H 4U3FH 3BCCH 1PP9H 3CXHF 3H1JH 1NTZH 2A06H 3H1LH
chains in the Genus database with same CATH superfamily
1EN5A 5IJ9A 5EC2C 3SJCC 4LNUB 1Q5OA 4IIJB 1JCHA 2EIJC 4EKWA 4LFBO 1SS3A 1R73A 3OMAB 5ITZA 2RCVA 1VEWA 3FYEB 4TUYA 1SF9A 4WFFA 2WPDG 1AJQA 1Q6IA 1JR9A 1TAEA 1EBOA 4TV8B 1BT8A 1R6NA 4BW5A 1D5AA 2BSKB 2ZE7A 4NTWA 2ZR2A 2A3QA 2WAMA 2EIMC 4LR3A 1XHXA 4KHPO 2NLJC 3W7UA 3ASOB 5CMUA 2YI8A 1XMOO 1IDSA 2B9ZA 4DR6O 2JIZG 3JCUZ 2PI5A 4LH6A 4FFBB 2V7QG 1KBHA 2YXHA 2W6IG 4K8ZA 2F95B 2WLLA 3HKDB 2BE3A 5B1AB 5J2UB 3H1HH 2UU9O 2W0XA 3ABUA 2PF4E 4I55A 2JS3A 2MW2B 3CCQV 1N34O 3W7SA 4NXMO 1U97A 4JAVA 1WA8B 3U11A 4GYCB 3GWKC 4AQYB 5KA6A 3CC2V 3ASNB 1K4DC 4JTAB 5FPOA 1HR0O 3G80A 1Q81W 2XAJA 1ZSPA 4BIOA 2F4VB 3N2KA 5DM6V 2ARHA 4IGGA 3RW0A 2E5LB 4YIOA 3LSSA 3X2QC 2QKSA 2YDEA 1SKVA 4LNUA 2HFEC 5LBQA 1ZTEA 3WG7C 1VF6A 3A0BZ 1G6UA 2F66C 3E89A 1BHBA 2Q7EA 2CGNA 4GKJB 5B3SC 2ZXWB 4TSFG 2OCHA 2QM7A 1BCCH 1M56B 2R9IA 3CE2A 3VQWA 3QO8A 1I94O 2QKCA 1UJWB 4X9QA 1GMGA 2BSKA 4FLXA 4CC6A 3UT5B 2FL4A 3O9OA 1IBKB 1HNZB 3P32A 3LSQA 2P4KA 2PGGA 4BW9A 1GH6A 3TXQA 1CP9A 1M1KW 1L1FA 3THOA 1Q90D 4DR7O 4J10A 1QLNA 3HKDA 3CS5A 3OTFA 3LDDA 5FLXN 4RO2A 4EFEA 4DV0O 3UCSC 1K5QA 1XNQB 1SA0B 4Z2WA 1R3JC 2UXXA 1VF6C 2ITDC 4H33A 2ZE5A 3T1YO 2UXNA 5GONB 3E86A 1HNXB 4B3TB 2YIDA 1H2KA 2IJKA 2QDOA 1WP8A 2ITCC 5JVDB 4J7KA 1HNWB 5EZYB 3CMAV 2GHYA 5LGNA 2QGNA 2ZM6O 2UUCO 1O9HA 3ZRSA 3ZRXA 4PJ0Z 1PP9H 2W6JG 5H6QA 1ZL8A 4FMTA 4GUNA 1MSWD 3ASOC 3T4ZA 5E79Z 2IU0A 2HKOA 5L3BA 4DV5O 1R3KC 3EFFK 4LFBB 2QJ1A 5EBLC 4FM2A 4LCUC 4I9QA 2XOKG 2DYRB 2ZCEA 1V55B 5B1AC 3JARB 4AILC 3STLC 3UT5A 3U10A 4DV2O 4FFKA 2H94A 1GKFA 4H0LB 1KYOF 4JZ2A 1XREA 4DR4B 2OTJV 3AK2A 1V9PA 5EBMC 3TJTA 1RFYA 1BS3A 4NVPA 2DWEC 1OCRB 3ASNC 4O4LB 4JI2O 3SJAC 1K4CC 5BMVB 4MTOA 3DSQA 1PKXA 5IY5B 4RWUA 4KHPB 2BOBC 3I55V 5IYBO 1H2GA 1Q3EA 4DR6B 3F5TA 2PI4A 5JCOA 5EIBC 1GM8A 1SA0A 1QVGU 2FKXA 1PL4A 2DOSA 3RGBA 2LJ2A 3BFRA 5JJNB 1KC8W 2WA3A 4J7JA 3ZHTA 1YJNV 4J11A 1BHAA 2F1MA 1HWYA 3W7TA 1R3IC 1ZX3A 1OHHG 1VQPV 1F7YA 2ZXWC 3E8HA 3K3WA 1MOFA 3IJ4A 1FD9A 5BR8O 1M56C 5JVDA 5KA5A 4IT5A 3K08A 1HR0B 1EN6A 4FJCC 3J7AU 2E3CA 2AW9A 3BY6A 3LDEA 3IGAC 5B66Z 4CS2A 2VQEB 1DTOA 5LXTA 2Y4TA 1F23A 2GBOA 3ZIAG 2LO1A 4NXNB 5IWAO 3K58A 1JOYA 5LOVA 3CD6V 5EIBD 5A2QN 3ZHQA 4GLXA 2YC0A 2CH7B 1QR9A 1K33A 3BA9A 4CS4A 4WCEV 2UUAO 5CB4B 4BIZA 5JCOC 2IJIA 2DN9A 2EINB 4ABMA 3H1JH 3N2GA 4NB5A 1N33O 3OR7C 3CCLV 4JTDB 4UB8Z 3AG7A 1GM9A 1PNMA 2R9RB 5LMUO 5BMVA 1QVFU 1K3EA 1F4NA 4WFGA 1VQ6V 2LGQA 2UXCB 3BEHA 1GM7A 1SQQH 1W0JG 1GRJA 4DUZO 3B4SA 4MVRA 1BE3H 5IYCO 2R9AA 2PYJA 4DR7B 1LNQA 4G27B 3EVKA 4JV5B 4E2LA 2ZQMA 4BWAA 3OUSA 3RBZA 3L71H 1JPXA 4H44B 5EYPB 1I5XA 2JS5A 4DYLA 1TGOA 1L0NH 4FLVA 2YI9A 1S5LZ 2FTKA 4U3FH 1VF5B 4ASUG 3ABKB 5CA1B 3ABTA 2XT9A 4E4EA 3OGIB 2DYRC 4HNAA 3T1CA 1V55C 2CDYA 3K9AA 1NI8A 3CCMV 2Y69B 2WWWA 3DGEA 2WLMA 1NJIW 4MW3A 3QNEA 1DLBA 1Q43A 4TQDA 3HKBA 1VQNV 2Q4PA 3L73H 1QLEB 2JGDB 3L72H 1OCRC 4PA9A 2X6BA 4HZ3A 3M7MX 3TCUA 2ZM6B 2A06H 5IY5C 1PNLA 3KG2A 2BTOA 1IX9A 2CH7A 3D3IA 3CRQA 4YIPA 3ZHUA 5CB4A 4DV5B 5B1BB 3RYFA 2F4VO 3SPJA 3C3TA 4JI1O 4DV3O 4K0KO 1VQKV 2VRZA 4JI6O 5KX5B 5FPRA 1NTKH 1K92A 1Y4MA 3VQYA 1N0JA 4CH5A 3FYIB 4NR1A 1Y74A 3CCUV 1AROP 1KP2A 2Z5UA 1MNGA 4G28B 4R7CA 2XNDG 2JEXA 1Q86W 2GV9A 4JI2B 3WB2A 1AILA 4BIUA 4AHCA 4YY3B 4UUJC 1AR5A 4GX2A 3JALA 2LW7A 4B3RB 1FS0G 4UVBA 5LHHA 1H2LA 4HAMA 1NTZH 1OZ0A 5EYPA 4B7KA 3CHXA 2PUSA 3ZHVA 1IBKO 2V4DA 1DGSA 4DV6O 4JYBA 3QO5A 4HYOA 3CCVV 3SJQC 1H8HG 5LP6B 3WU2Z 1MZEA 2F23A 4JI7B 2PYLA 5CA1A 3L9DA 5KHIA 1YF2A 3HKCB 1R6TA 3B09A 2HJDA 3CC4V 1G1XB 4H37A 2IW5A 5BR8B 1EZVH 2EINC 2EBOA 4ZBMA 1US6A 4JI8O 2JGDA 1VF7A 1L8DA 1VQ7V 2QM8A 3FFQA 4DR2B 1KQSU 3SGIA 1WP7A 3SYAA 2UXBO 2E74B 3T2MA 3H1LH 3SPGA 3T1HB 3CPWU 4X20B 1WB7A 1HNXO 1FJGO 1H2NA 4IL6Z 2K1EA 1S5HC 1OCZB 1HP8A 4RUFA 3R65A 5KX5A 5KHJA 2L6LA 3OUFA 1HNWO 1KUQA 2UUAB 4O2BB 4UVCA 1ZAUA 3WB1A 3OR6C 4LFCO 4G2KA 4TQFA 2EULA 4X1KA 4JGSA 3QVNA 1YXBA 1I08A 4DV4O 5DEDA 1H2SB 5AG2A 4P9OA 5LMUB 2E75B 4FM1A 1XHZA 3ABKC 4ZHQB 4DW1A 1IBMO 4DUZB 2CTQA 3ZRVA 4DV1O 2Q5ZA 5H2FZ 1VQOV 1AI4A 1OCOB 2WLKA 2CTWA 1KKDA 2QWPB 1JQ0A 1XQ8A 2Q67A 1QLEC 4DR4O 4DW0A 3W7WA 3OD4A 3FB7C 4OPAA 3CCRV 4I5SA 3APQA 3RYCB 1XDCA 2H3OA 3HKCA 1KB9F 3GWOA 2ZINA 5JWPA 4GX0A 4FLWA 2RN9A 5B1BC 4WFBV 3DTUB 1WJZA 4K3AA 2ZNJA 2EZOA 2GTSA 2JVDA 3WFVA 1GN6A 3ZEDA 4I0XA 2IH3C 4CBCA 5L3GA 5IE9A 1IBLB 2QKAA 5H6RA 1Z5WA 3AG1B 3K9SA 4GKKO 2ZIOA 5LL6Y 1YITV 4UCSA 3B8MA 2XASA 3FB8C 2EZPA 2ZT9B 3P30A 3BCCH 1KECA 4LP8A 5F2VO 4OXSA 3S3WA 3VBBA 2L35A 4PELA 2BCCH 1Z5VA 1AI5A 1DK1A 3APOA 1T5EA 4PI0A 3J80N 1VP7A 4JI1B 5LHGA 3OMNB 4DV3B 4K0KB 1W59A 2XAGA 4WF9V 4LF9O 4JI6B 2VQEO 2B1GA 5LP6C 5C8YB 2WA4A 2F43G 2EJ7A 4IIJA 4U7OA 4ZHQA 4NXNO 1PL0A 3CP1A 2F93B 1GAXA 3AK3A 2AZ0A 4QE7A 3ZHRA 4MTFA 5CN0A 1K8AW 4LF5O 2ODMA 3LDCA 2ZDIC 3MD0A 4EFBA 4X64O 3CRAA 1NVPB 4TV8A 4QJFB 4LF8O 1VQMV 2MK3A 1O9GA 4DV6B 4NYKA 1URFA 1BL8A 2UXCO 4R6ZA 1S3JA 3TGUH 1V54B 4I4TB 3AEIA 2EJRA 4WFEA 2D3OW 1OCZC 4FFBA 2QTOA 2HP8A 4LFAO 1N36O 3AG4B 2QTSA 4JV5O 4TT3G 4EEQA 5J2UA 1MMMA 4NTYA 2QA4V 3A8TA 4GCZA 1GO3F 4JI8B 4XDKA 2KB1A 2VWJA 1WA8A 2YXLA 3J81N 3E8GA 4FPPA 2UXBB 1K9MW 2CK3G 1G8MA 3OEHG 1J95A 4PI2A 2VQFO 3M99B 3EXAA 4F6EA 1P4RA 4EB6B 3ZRWB 1FJGB 1OCOC 3PN1A 2QSAA 5HFLA 3UKMA 2YSUB 3OAAG 3B8NA 2JEUA 4TWKA 2A0LA 3QG5A 5CBGA 3ETDA 2DE0X 5LYJB 4X89A 2OYQA 4LFCB 5IYZB 4DV4B 5IT9N 4YJ2B 2B1IA 4CZZA 3ICXA 1COWG 3MHSC 1SQGA 1QBZA 5LA6B 2KQXA 4UCUA 5L3FA 1IBMB 1JMKC 4DV1B 3AG1C 4JPRA 3K04A 4UXNA 1J5EO 1Y6XA 1D2DA 1P7BA 1RSOB 4JYCA 4I4TA 2WLIB 4A5UB 3JYCA 1A32A 4KXRA 4YY3O 2P7TC 1B6QA 1M5IA 4B3RO 5JJEB 3AG3B 2BOCC 2P90A 3RFRA 3G6BA 4JI5B 1Q6UA 1BQZA 3DXRB 4J80A 4MVUA 4PV1B 1OJHA 3I56V 3C90A 4O4JB 4X1YB 1VQ4V 4JI7O 4GKKB 4N21A 1CPYA 2ZNIA 1LR1A 5GONA 2Y4UA 3QF7A 5DN6G 3JCZA 3GVMA 2XAFA 1WNSA 4LF7O 1KMIZ 1ROPA 1M57B 1W2BU 3CB2A 4L8JA 2GUZB 5EZYA 3TXSA 5JH7B 5LYJA 2C2AA 1GK9A 4DR2O 3MDSA 5CBHA 3SYOA 2JJ2G 4LF9B 4MVSA 1PD3A 2JK5C 3ABLB 1V54C 2QWNB 5B5EZ 4YJ2A 1QCEA 2CAZC 3HB3B 3MAQA 3T1HO 4FLZA 4ZOLB 3JAMN 4LBEC 5LA6A 1XNRO 1NR1A 3AG4C 4B7EA 3JARA 4LF5B 1MG1A 1HDJA 1DF5A 3U0ZA 3TETA 4X64B 1VMGA 1SQFA 2M6YA 1I7FA 4IHJB 2CE4A 3B40A 4DUYO 3UM7A 1RSOA 2JRIA 4Z1MG 2UUBO 4L87A 4O4LA 4LF8B 1FAFA 1QHTA 1NVPD 1AP5A 4B3SO 2KG7B 3SPIA 3ZX6A 1IVSA 3ETEA 1NR7A 3ETGA 1EZJA 3S3XA 2DQ3A 5BY1A 1I0HA 1TA8A 4LFAB 1P7GA 1XL6A 3TK1A 1AB3A 2R72A 1N36B 1WB8A 2DJVA 4D6TH 2IM9A 3F7YC 3RVZA 4LF6O 4KUMA 4UV9A 4MS2A 3F5WC 5C93A 3K59A 2GSMB 2HEPA 2WLHA 4FZ1A 4BAYA 1E1QG 1M93A 4JI4O 5KAIZ 1UPGA 4MT8A 3SJBC 1SZTA 3OE7G 5JJJB 3ZJZA 4PA7A 1RPOA 4JF3A 1X4TA 5JH7A 2VQFB 5BZBA 4B3MO 2FYUH 3RYHB 1IBLO 2CUGA 1KP3A 1Q6HA 3CX5F 2OTLV 3NXSA 3N27A 3T4DA 4C7UA 4ZOLA 3K5MA 3A2FA 2NN4A 3AG3C 1H8EG 5K1PA 3K57A 2KKWA 4ZKIA 1QR8A 4QPKA 2X0LA 5KLVH 4O2AB 1M90W 1BGYH 1R1BA 4IHJA 4FLTA 1XMQO 3BRCA 3BHPA 4Q20A 3G71V 2HJFC 2GTAA 1MA1A 4J41A 3CMEV 1J5EB 2IBZH 2P5OA 2B5UA 4LWSB 1YDXA 5JQGB 2Q69A 2JDIG 1HW7A 2KG7A 2CTRA 1SZXA 3IFXA 1XBLA 1L0LH 1M57C 1RM1B 4OGQB 3WB0A 2W0FC 1YHQV 1CEZA 1NS1A 2BTQB 4K35A 2OCCB 2P67A 4OX9B 2EILB 1H38A 1TVKB 2YEVB 5J2TB 3ABLC 5IJ9B 1OCCB 1SQVH 4J9ZB 5D5PA 2Z3YA 4JYYA 3ZMVA 3FB6C 3LSUA 2HHHO 4X66O 4DR3B 4TUYB 1DF4A 1G4YB 3JD2A 4FVMA 3RT3C 3G67A 3ETQA 2IU3A 5LMNO 3ABMB 3RYHA 4X62O 4LF7B 4K8XA 4UFZA 2Y0IA 4PDVA 2QEXV 1VQ9V 4WFHA 3LNMB 4TV9B 4DR1O 1NBMG 2H8PC 3DC5A 4DK1A 3SR2C 3KCXA 4I7ZB 4O4HB 1FPOA 1GN4A 2N04A 4X8AA 2FB5A 5L3CA 5B3SB 4O2AA 1LUVA 4JAAA 1XNRB 3OT7A 2WLLB 1AVMA 2YXYA 3VQVA 2ZKOA 1VARA 3FX7A 2PTMA 5E1AC 2O57A 1WAZA 4LWSA 2UXDO 5JQGA 2IH1C 3A0RA 1OV9A 2YUAA 4DUYB 2ATKC 1SESA 2YICA 4ZIBA 5KHKA 2UUBB 1E79G 3H1IH 3UO3A 2QWOB 1BQ0A 3ZS8C 1SQBH 3PJSK 2G38A 1UFIA 1YEWA 4B3SB 4DV7O 2P6JA 4BR6A 2Y69C 3JD1A 1S72V 2DQ0A 3CSXA 1NT2B 2Q6AA 4RQFA 1SRYA 4PA6A 2YEVA 5J2TA 1BMFG 3BABA 1K7DA 4MVZA 3K06A 4I50B 4U7NA 1PM9A 5LP6A 4LF6B 4FLYA 3D8CA 3H01A 3QO7A 5LGTA 2PZSA 4LH7A 4CH3A 1Q7YW 3SDLA 2AHZA 3W7XA 5KHGA 4JI4B 2QE7G 2KSDA 2ZDIA 4JI5O 3G6EV 2M7WA 1QQCA 1IXBA 4QNHB 1IXMA 4TV9A 2NNUA 4B3MB 1P84F 3CCSV 1TUBB 2RDCA 3K0DA 3CJHB 3ZN1A 4O4HA 1Y67A 1PV0A 1YSCA 3CRMA 2NR5A 3VQXA 1MSDA 4X20A 2YIAA 3QTCA 4JI0O 1RM1C 4DR5O 3BPZA 3H1KH 3E8FA 5LHIA 2OCCC 1N0NA 3ZMZA 3L74H 5KUMA 2DMXA 4O2BA 2YIBA 2EILC 3D36A 2HVKC 4RQEA 5KAFZ 1XMQB 1JA8A 2RJZA 1OCCC 2LFRA 1TUEB 2Y48A 1Q82W 3C3SA 4R50A 3FAVB 2ZD9A 1IZ3A 5EK0A 3F7VC 1YJ9V 3ABMC 1K5SA 4DXWA 5D5QA 1P49A 4WFAV 2AGAA 2VWKA 4XDLA 4JYAO 2AZ2A 3RWRD 4I50A 4CH4A 5FNVB 3RN4A 4CH6A 1F4MA 1ZL8B 3FB5C 5KHHA 1KU9A 3RYCA 1N8RW 1KKCA 1K97A 4PDMA 2P22C 3IC9A 3E2EA 1WPBA 1FXKB 1N32B 2JGUA 2HHHB 4X66B 3M8AA 4UV8A 2Q0OC 5LMNB 1TUBA 3JD4A 2DYSB 1NH2B 4X62B 1ZLZA 2ADPA 3D36C 1SERA 3CJHA 2R70A 4MSWC 2WLJA 2XAQA 4IYIA 1N4CA 2XUMA 5CA3A 4DR1B 3SPHA 4P9PA 1W0KG 3P3PA 4R8CA 4DRXB 4LC1A 2HLDG 1WPXA 1Y66A 4UCOA 1XEQA 3E83A 4F6RB 2GDSA 3IAYA 2ILMA 2JJ1G 4RAIA 1QU7A 4RUEA 5C8YA 5IJ0B 3E22B 1YZBA 1B04A 3HKEB 3FAVA 3Q4HB 4ICGA 1FYJA 2UXDB 3ZMSA 1XL4A 1IURA 4YHHB 1RP3B 3AK1A 4JASA 1BSMA 1EM1A 1FFXB 3CC7V 3CWBH 3LUTB 2QM4A 2ADQB 2FMLA 3SYCA 3SYQA 2CGOA 4PDRA 2YIBD 1YTFB 1AI6A 2Q73A 4MVOA 5EC1C 4DV7B 3E8BA 3CRCA 5FNVA 4GX5A 4YJ3B 3STZC 3DC6A 2Q8VA 4ZI7B 3CEIA 3OW2U 1ORQC 2HG5C 4B08A 1AR1B 5LXTB 5B1NA 1NU1H 4U3JB 3CRRA 1JVMA 3EHBB 5KMGB 5LGUA 1FXKA 3RVYA 5LOVB 5DECA 4UVAA 2HVJC 4JI3O 1WLEA 4P30A 3HPLC 1M9NA 2RQ6A 3K03A 3OTOO 1FKAO 1WN7A 2QR4A 4J7ZA 4X65O 1JJ2U 4OX9O 1H2MA 3OMIB 3N2GB 1D5NA 4DO2A 1XI1A 2EX3A 4PA3A 3ML0A 4DRXA 4LF4O 2Q7GA 4FIPC 1AJNA 3AG2B 3BAAA 5GW7A 1NZ6A 3L70H 4P2ZA 1XMOB 4QE9A 1EN4A 4D7TA 4DR3O 3K79A 4XBFA 3CCJV 4EB6A 3OFNG 3ZRWA 4JI0B 3VOUA 4F6RA 2A9HA 2Q68A 4DR5B 2A79B 3JAWB 1X59A 5IJ0A 1FFTB 3E22A 1YI2V 4D7SA 3HKEA 2UU9B 2Y0PA 3Q4HA 4HBNA 3L75H 4TOIA 1N34B 3UQ8A 1FFXA 4KFMA 2A7WA 5IYZA 2EIKB 1E1RG 4NXMB 1SETA 4GT1A 4PHZA 3BA8A 3BVOA 3FD9A 2IJJA 4GX1A 1FXKC 4J42A 1Z2GA 1MABG 4HNAB 2LFSA 4YJ3A 2DYSC 4KL1A 4NTXA 4F4LA 4ZI7A 1KD1W 4JYAB 5GTHZ 1U96A 4N23A 2RNBA 3JD0A 3HKBB 5CA0B 4U3JA 5KMGA 2WLIA 4QGPA 4MTGA 5BXZA 1S76D 3H9VA 4W4LA 2AHYA 2OWOA 2LW1A 1CXZB 1B3QA 1RPRA 3G4SV 3K0GA 1XOUA 4PA4A 1VIBA 3RYFB 1QNMA 3DXRA 3I5DA 1AR4A 2DWDC 3JASB 3CXHF 2AXTZ 1S5JA 1I94B 4O4JA 4X1IB 4MVQA 4X1YA 3SYPA 2N05A 1Y74B 2PY5A 1YJWV 4FZ0A 3JATB 2X6AA 1JX9A 3K5LA 1S77D 2WLNA 1NH2D 2XAHA 2LQTA 2P06A 1I5YA 3R66A 3ZMUA 1YCIA 3JAWA 2ZR3A 5H9CA 3JALB 4JZGA 4KP4A 4WBNB 1SC5B 4X88A 1EFRG 2GUZA 4W4KA 2V1DA 4DV0B 4CC5A 4UCTA 1JFFB 2Q9LA 3HR0A 2Q0AA 5CBFA 4O4IB 5L3EA 3ZN0A 1YVWA 5IDJA 1PNKA 3ZHSA 3A0HZ 1F51A 3T1YB 4UCRA 3JAKB 2XHBA 2EIJB 3OGCC 4YXWG 2CTPA 4AI8A 3B2EE 1GTOA 1AJPA 1B06A 3CXCU 2IJHA 2LGWA 4MW8A 3B77A 1YIJV 5IYDO 5CA0A 1GN2A 1THZA 1Y76B 2QWRB 2UUCB 1GN3A 2RMKB 4PDLA 4AQYO 5L3DA 3ZCCA 4DK0A 1YTFD 4JAUA 3AG2C 2EIMB 2XTAA 5K1XA 3CYOA 4PD4F 5TISZ 1Q8IA 4UB6Z 2VS0A 1AI7A 4NKGB 3RYIB 1SQXH 1ZWIC 2E5LO 3IC7A 4QPJA 1NQTA 3JASA 2WSSG 3K5OA 1PPJH 4JI3B 1XILA 1R3LC 4X1IA 3OTOB 4XDJA 4DV2B 1S0VA 4X65B 2D2CB 4IYHA 3D3QA 4Q6GA 3JATA 2EIKC 2E76B 3JSNA 4X1KB 2ZE6A 2ZE8A 1AP6A 4FK5C 4GKJO 4MTXA 4MVMA 1SQPH 4LF4B 4OPHA 5EBWC 5ITZB 4WBNA 4FM0A 2LP7A 4UCVA 1N32O 2OIEA 3ZBHA 5GTIZ 1JFFA 3MHHC 4FLUA 1HNZO 2ZIMA 5A9GA 4O4IA 1K73W 2OT5A 2X6CA 1NTMH 3X2QB 3FKSG 2DW4A 3NR7A 5KUKA 3JAKA 1JJOA 3WG7B 3KKYA 1ENVA 1XUQA 3LNNA 1ZUQA 3O65A 1M4UA 1BZKA 3SPCA 5HFMA 4GZRB 3KCYA 2YS8A 3OM3B 3K5NA 4H13B 5FL7G 4J9YB 1XNQO 3ZMTA 4I0XB 1Y76A 4I9WA 3P3NA 4JTCB 5H5NA 1R6KA 1NKDA 2OIGA 2ETNA 3OEEG 4QIWF 4I55B 2X7RB 1VQ5V 2N74A 1K34A 4YHHO 2K9PA 2Q7HA 4B3TO 1FXHA 3CCEV 3RYIA 3E35A 5IWAB 3JD3A 4Z1VA 1LUWA 3GB7C 2P4VA 1VQ8V 2BTQA 3UO2A 3KZIZ 1VQLV 2QWQB 3N2KB 5J9PC 1MZFA 1FXVA 4CS3A 5B1OA 1N33B 2Z0AA 1TVKA 3JSLA 2HR3A
chains in the Genus database with same CATH topology
2IBZH 3H1KH 1KYOF 2BCCH 4D6TH 3CWBH 1NU1H 1EZVH 3H1IH 3L71H 1P84F 2FYUH 4PD4F 1NTMH 3L74H 3H1HH 5KLVH 1SQBH 1SQVH 1L0LH 1SQXH 1BGYH 3TGUH 1L0NH 1SQQH 1SQPH 1KB9F 3CX5F 3L75H 1BCCH 1PPJH 3L73H 1NTKH 3L72H 1BE3H 3L70H 4U3FH 3BCCH 1PP9H 3CXHF 3H1JH 1NTZH 2A06H 3H1LH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IBZ H;  3H1K H;  1KYO F;  2BCC H;  4D6T H;  3CWB H;  1NU1 H;  1EZV H;  3H1I H;  3L71 H;  1P84 F;  2FYU H;  4PD4 F;  1NTM H;  3L74 H;  3H1H H;  5KLV H;  1SQB H;  1SQV H;  1L0L H;  1SQX H;  1BGY H;  3TGU H;  1L0N H;  1SQQ H;  1SQP H;  1KB9 F;  3CX5 F;  3L75 H;  1BCC H;  1PPJ H;  3L73 H;  1NTK H;  3L72 H;  1BE3 H;  3L70 H;  4U3F H;  3BCC H;  1PP9 H;  3CXH F;  3H1J H;  1NTZ H;  2A06 H;  3H1L H; 
#chains in the Genus database with same CATH topology
 1EN5 A;  5IJ9 A;  5EC2 C;  3SJC C;  4LNU B;  1Q5O A;  4IIJ B;  1JCH A;  2EIJ C;  4EKW A;  4LFB O;  1SS3 A;  1R73 A;  3OMA B;  5ITZ A;  2RCV A;  1VEW A;  3FYE B;  4TUY A;  1SF9 A;  4WFF A;  2WPD G;  1AJQ A;  1Q6I A;  1JR9 A;  1TAE A;  1EBO A;  4TV8 B;  1BT8 A;  1R6N A;  4BW5 A;  1D5A A;  2BSK B;  2ZE7 A;  4NTW A;  2ZR2 A;  2A3Q A;  2WAM A;  2EIM C;  4LR3 A;  1XHX A;  4KHP O;  2NLJ C;  3W7U A;  3ASO B;  5CMU A;  2YI8 A;  1XMO O;  1IDS A;  2B9Z A;  4DR6 O;  2JIZ G;  3JCU Z;  2PI5 A;  4LH6 A;  4FFB B;  2V7Q G;  1KBH A;  2YXH A;  2W6I G;  4K8Z A;  2F95 B;  2WLL A;  3HKD B;  2BE3 A;  5B1A B;  5J2U B;  3H1H H;  2UU9 O;  2W0X A;  3ABU A;  2PF4 E;  4I55 A;  2JS3 A;  2MW2 B;  3CCQ V;  1N34 O;  3W7S A;  4NXM O;  1U97 A;  4JAV A;  1WA8 B;  3U11 A;  4GYC B;  3GWK C;  4AQY B;  5KA6 A;  3CC2 V;  3ASN B;  1K4D C;  4JTA B;  5FPO A;  1HR0 O;  3G80 A;  1Q81 W;  2XAJ A;  1ZSP A;  4BIO A;  2F4V B;  3N2K A;  5DM6 V;  2ARH A;  4IGG A;  3RW0 A;  2E5L B;  4YIO A;  3LSS A;  3X2Q C;  2QKS A;  2YDE A;  1SKV A;  4LNU A;  2HFE C;  5LBQ A;  1ZTE A;  3WG7 C;  1VF6 A;  3A0B Z;  1G6U A;  2F66 C;  3E89 A;  1BHB A;  2Q7E A;  2CGN A;  4GKJ B;  5B3S C;  2ZXW B;  4TSF G;  2OCH A;  2QM7 A;  1BCC H;  1M56 B;  2R9I A;  3CE2 A;  3VQW A;  3QO8 A;  1I94 O;  2QKC A;  1UJW B;  4X9Q A;  1GMG A;  2BSK A;  4FLX A;  4CC6 A;  3UT5 B;  2FL4 A;  3O9O A;  1IBK B;  1HNZ B;  3P32 A;  3LSQ A;  2P4K A;  2PGG A;  4BW9 A;  1GH6 A;  3TXQ A;  1CP9 A;  1M1K W;  1L1F A;  3THO A;  1Q90 D;  4DR7 O;  4J10 A;  1QLN A;  3HKD A;  3CS5 A;  3OTF A;  3LDD A;  5FLX N;  4RO2 A;  4EFE A;  4DV0 O;  3UCS C;  1K5Q A;  1XNQ B;  1SA0 B;  4Z2W A;  1R3J C;  2UXX A;  1VF6 C;  2ITD C;  4H33 A;  2ZE5 A;  3T1Y O;  2UXN A;  5GON B;  3E86 A;  1HNX B;  4B3T B;  2YID A;  1H2K A;  2IJK A;  2QDO A;  1WP8 A;  2ITC C;  5JVD B;  4J7K A;  1HNW B;  5EZY B;  3CMA V;  2GHY A;  5LGN A;  2QGN A;  2ZM6 O;  2UUC O;  1O9H A;  3ZRS A;  3ZRX A;  4PJ0 Z;  1PP9 H;  2W6J G;  5H6Q A;  1ZL8 A;  4FMT A;  4GUN A;  1MSW D;  3ASO C;  3T4Z A;  5E79 Z;  2IU0 A;  2HKO A;  5L3B A;  4DV5 O;  1R3K C;  3EFF K;  4LFB B;  2QJ1 A;  5EBL C;  4FM2 A;  4LCU C;  4I9Q A;  2XOK G;  2DYR B;  2ZCE A;  1V55 B;  5B1A C;  3JAR B;  4AIL C;  3STL C;  3UT5 A;  3U10 A;  4DV2 O;  4FFK A;  2H94 A;  1GKF A;  4H0L B;  1KYO F;  4JZ2 A;  1XRE A;  4DR4 B;  2OTJ V;  3AK2 A;  1V9P A;  5EBM C;  3TJT A;  1RFY A;  1BS3 A;  4NVP A;  2DWE C;  1OCR B;  3ASN C;  4O4L B;  4JI2 O;  3SJA C;  1K4C C;  5BMV B;  4MTO A;  3DSQ A;  1PKX A;  5IY5 B;  4RWU A;  4KHP B;  2BOB C;  3I55 V;  5IYB O;  1H2G A;  1Q3E A;  4DR6 B;  3F5T A;  2PI4 A;  5JCO A;  5EIB C;  1GM8 A;  1SA0 A;  1QVG U;  2FKX A;  1PL4 A;  2DOS A;  3RGB A;  2LJ2 A;  3BFR A;  5JJN B;  1KC8 W;  2WA3 A;  4J7J A;  3ZHT A;  1YJN V;  4J11 A;  1BHA A;  2F1M A;  1HWY A;  3W7T A;  1R3I C;  1ZX3 A;  1OHH G;  1VQP V;  1F7Y A;  2ZXW C;  3E8H A;  3K3W A;  1MOF A;  3IJ4 A;  1FD9 A;  5BR8 O;  1M56 C;  5JVD A;  5KA5 A;  4IT5 A;  3K08 A;  1HR0 B;  1EN6 A;  4FJC C;  3J7A U;  2E3C A;  2AW9 A;  3BY6 A;  3LDE A;  3IGA C;  5B66 Z;  4CS2 A;  2VQE B;  1DTO A;  5LXT A;  2Y4T A;  1F23 A;  2GBO A;  3ZIA G;  2LO1 A;  4NXN B;  5IWA O;  3K58 A;  1JOY A;  5LOV A;  3CD6 V;  5EIB D;  5A2Q N;  3ZHQ A;  4GLX A;  2YC0 A;  2CH7 B;  1QR9 A;  1K33 A;  3BA9 A;  4CS4 A;  4WCE V;  2UUA O;  5CB4 B;  4BIZ A;  5JCO C;  2IJI A;  2DN9 A;  2EIN B;  4ABM A;  3H1J H;  3N2G A;  4NB5 A;  1N33 O;  3OR7 C;  3CCL V;  4JTD B;  4UB8 Z;  3AG7 A;  1GM9 A;  1PNM A;  2R9R B;  5LMU O;  5BMV A;  1QVF U;  1K3E A;  1F4N A;  4WFG A;  1VQ6 V;  2LGQ A;  2UXC B;  3BEH A;  1GM7 A;  1SQQ H;  1W0J G;  1GRJ A;  4DUZ O;  3B4S A;  4MVR A;  1BE3 H;  5IYC O;  2R9A A;  2PYJ A;  4DR7 B;  1LNQ A;  4G27 B;  3EVK A;  4JV5 B;  4E2L A;  2ZQM A;  4BWA A;  3OUS A;  3RBZ A;  3L71 H;  1JPX A;  4H44 B;  5EYP B;  1I5X A;  2JS5 A;  4DYL A;  1TGO A;  1L0N H;  4FLV A;  2YI9 A;  1S5L Z;  2FTK A;  4U3F H;  1VF5 B;  4ASU G;  3ABK B;  5CA1 B;  3ABT A;  2XT9 A;  4E4E A;  3OGI B;  2DYR C;  4HNA A;  3T1C A;  1V55 C;  2CDY A;  3K9A A;  1NI8 A;  3CCM V;  2Y69 B;  2WWW A;  3DGE A;  2WLM A;  1NJI W;  4MW3 A;  3QNE A;  1DLB A;  1Q43 A;  4TQD A;  3HKB A;  1VQN V;  2Q4P A;  3L73 H;  1QLE B;  2JGD B;  3L72 H;  1OCR C;  4PA9 A;  2X6B A;  4HZ3 A;  3M7M X;  3TCU A;  2ZM6 B;  2A06 H;  5IY5 C;  1PNL A;  3KG2 A;  2BTO A;  1IX9 A;  2CH7 A;  3D3I A;  3CRQ A;  4YIP A;  3ZHU A;  5CB4 A;  4DV5 B;  5B1B B;  3RYF A;  2F4V O;  3SPJ A;  3C3T A;  4JI1 O;  4DV3 O;  4K0K O;  1VQK V;  2VRZ A;  4JI6 O;  5KX5 B;  5FPR A;  1NTK H;  1K92 A;  1Y4M A;  3VQY A;  1N0J A;  4CH5 A;  3FYI B;  4NR1 A;  1Y74 A;  3CCU V;  1ARO P;  1KP2 A;  2Z5U A;  1MNG A;  4G28 B;  4R7C A;  2XND G;  2JEX A;  1Q86 W;  2GV9 A;  4JI2 B;  3WB2 A;  1AIL A;  4BIU A;  4AHC A;  4YY3 B;  4UUJ C;  1AR5 A;  4GX2 A;  3JAL A;  2LW7 A;  4B3R B;  1FS0 G;  4UVB A;  5LHH A;  1H2L A;  4HAM A;  1NTZ H;  1OZ0 A;  5EYP A;  4B7K A;  3CHX A;  2PUS A;  3ZHV A;  1IBK O;  2V4D A;  1DGS A;  4DV6 O;  4JYB A;  3QO5 A;  4HYO A;  3CCV V;  3SJQ C;  1H8H G;  5LP6 B;  3WU2 Z;  1MZE A;  2F23 A;  4JI7 B;  2PYL A;  5CA1 A;  3L9D A;  5KHI A;  1YF2 A;  3HKC B;  1R6T A;  3B09 A;  2HJD A;  3CC4 V;  1G1X B;  4H37 A;  2IW5 A;  5BR8 B;  1EZV H;  2EIN C;  2EBO A;  4ZBM A;  1US6 A;  4JI8 O;  2JGD A;  1VF7 A;  1L8D A;  1VQ7 V;  2QM8 A;  3FFQ A;  4DR2 B;  1KQS U;  3SGI A;  1WP7 A;  3SYA A;  2UXB O;  2E74 B;  3T2M A;  3H1L H;  3SPG A;  3T1H B;  3CPW U;  4X20 B;  1WB7 A;  1HNX O;  1FJG O;  1H2N A;  4IL6 Z;  2K1E A;  1S5H C;  1OCZ B;  1HP8 A;  4RUF A;  3R65 A;  5KX5 A;  5KHJ A;  2L6L A;  3OUF A;  1HNW O;  1KUQ A;  2UUA B;  4O2B B;  4UVC A;  1ZAU A;  3WB1 A;  3OR6 C;  4LFC O;  4G2K A;  4TQF A;  2EUL A;  4X1K A;  4JGS A;  3QVN A;  1YXB A;  1I08 A;  4DV4 O;  5DED A;  1H2S B;  5AG2 A;  4P9O A;  5LMU B;  2E75 B;  4FM1 A;  1XHZ A;  3ABK C;  4ZHQ B;  4DW1 A;  1IBM O;  4DUZ B;  2CTQ A;  3ZRV A;  4DV1 O;  2Q5Z A;  5H2F Z;  1VQO V;  1AI4 A;  1OCO B;  2WLK A;  2CTW A;  1KKD A;  2QWP B;  1JQ0 A;  1XQ8 A;  2Q67 A;  1QLE C;  4DR4 O;  4DW0 A;  3W7W A;  3OD4 A;  3FB7 C;  4OPA A;  3CCR V;  4I5S A;  3APQ A;  3RYC B;  1XDC A;  2H3O A;  3HKC A;  1KB9 F;  3GWO A;  2ZIN A;  5JWP A;  4GX0 A;  4FLW A;  2RN9 A;  5B1B C;  4WFB V;  3DTU B;  1WJZ A;  4K3A A;  2ZNJ A;  2EZO A;  2GTS A;  2JVD A;  3WFV A;  1GN6 A;  3ZED A;  4I0X A;  2IH3 C;  4CBC A;  5L3G A;  5IE9 A;  1IBL B;  2QKA A;  5H6R A;  1Z5W A;  3AG1 B;  3K9S A;  4GKK O;  2ZIO A;  5LL6 Y;  1YIT V;  4UCS A;  3B8M A;  2XAS A;  3FB8 C;  2EZP A;  2ZT9 B;  3P30 A;  3BCC H;  1KEC A;  4LP8 A;  5F2V O;  4OXS A;  3S3W A;  3VBB A;  2L35 A;  4PEL A;  2BCC H;  1Z5V A;  1AI5 A;  1DK1 A;  3APO A;  1T5E A;  4PI0 A;  3J80 N;  1VP7 A;  4JI1 B;  5LHG A;  3OMN B;  4DV3 B;  4K0K B;  1W59 A;  2XAG A;  4WF9 V;  4LF9 O;  4JI6 B;  2VQE O;  2B1G A;  5LP6 C;  5C8Y B;  2WA4 A;  2F43 G;  2EJ7 A;  4IIJ A;  4U7O A;  4ZHQ A;  4NXN O;  1PL0 A;  3CP1 A;  2F93 B;  1GAX A;  3AK3 A;  2AZ0 A;  4QE7 A;  3ZHR A;  4MTF A;  5CN0 A;  1K8A W;  4LF5 O;  2ODM A;  3LDC A;  2ZDI C;  3MD0 A;  4EFB A;  4X64 O;  3CRA A;  1NVP B;  4TV8 A;  4QJF B;  4LF8 O;  1VQM V;  2MK3 A;  1O9G A;  4DV6 B;  4NYK A;  1URF A;  1BL8 A;  2UXC O;  4R6Z A;  1S3J A;  3TGU H;  1V54 B;  4I4T B;  3AEI A;  2EJR A;  4WFE A;  2D3O W;  1OCZ C;  4FFB A;  2QTO A;  2HP8 A;  4LFA O;  1N36 O;  3AG4 B;  2QTS A;  4JV5 O;  4TT3 G;  4EEQ A;  5J2U A;  1MMM A;  4NTY A;  2QA4 V;  3A8T A;  4GCZ A;  1GO3 F;  4JI8 B;  4XDK A;  2KB1 A;  2VWJ A;  1WA8 A;  2YXL A;  3J81 N;  3E8G A;  4FPP A;  2UXB B;  1K9M W;  2CK3 G;  1G8M A;  3OEH G;  1J95 A;  4PI2 A;  2VQF O;  3M99 B;  3EXA A;  4F6E A;  1P4R A;  4EB6 B;  3ZRW B;  1FJG B;  1OCO C;  3PN1 A;  2QSA A;  5HFL A;  3UKM A;  2YSU B;  3OAA G;  3B8N A;  2JEU A;  4TWK A;  2A0L A;  3QG5 A;  5CBG A;  3ETD A;  2DE0 X;  5LYJ B;  4X89 A;  2OYQ A;  4LFC B;  5IYZ B;  4DV4 B;  5IT9 N;  4YJ2 B;  2B1I A;  4CZZ A;  3ICX A;  1COW G;  3MHS C;  1SQG A;  1QBZ A;  5LA6 B;  2KQX A;  4UCU A;  5L3F A;  1IBM B;  1JMK C;  4DV1 B;  3AG1 C;  4JPR A;  3K04 A;  4UXN A;  1J5E O;  1Y6X A;  1D2D A;  1P7B A;  1RSO B;  4JYC A;  4I4T A;  2WLI B;  4A5U B;  3JYC A;  1A32 A;  4KXR A;  4YY3 O;  2P7T C;  1B6Q A;  1M5I A;  4B3R O;  5JJE B;  3AG3 B;  2BOC C;  2P90 A;  3RFR A;  3G6B A;  4JI5 B;  1Q6U A;  1BQZ A;  3DXR B;  4J80 A;  4MVU A;  4PV1 B;  1OJH A;  3I56 V;  3C90 A;  4O4J B;  4X1Y B;  1VQ4 V;  4JI7 O;  4GKK B;  4N21 A;  1CPY A;  2ZNI A;  1LR1 A;  5GON A;  2Y4U A;  3QF7 A;  5DN6 G;  3JCZ A;  3GVM A;  2XAF A;  1WNS A;  4LF7 O;  1KMI Z;  1ROP A;  1M57 B;  1W2B U;  3CB2 A;  4L8J A;  2GUZ B;  5EZY A;  3TXS A;  5JH7 B;  5LYJ A;  2C2A A;  1GK9 A;  4DR2 O;  3MDS A;  5CBH A;  3SYO A;  2JJ2 G;  4LF9 B;  4MVS A;  1PD3 A;  2JK5 C;  3ABL B;  1V54 C;  2QWN B;  5B5E Z;  4YJ2 A;  1QCE A;  2CAZ C;  3HB3 B;  3MAQ A;  3T1H O;  4FLZ A;  4ZOL B;  3JAM N;  4LBE C;  5LA6 A;  1XNR O;  1NR1 A;  3AG4 C;  4B7E A;  3JAR A;  4LF5 B;  1MG1 A;  1HDJ A;  1DF5 A;  3U0Z A;  3TET A;  4X64 B;  1VMG A;  1SQF A;  2M6Y A;  1I7F A;  4IHJ B;  2CE4 A;  3B40 A;  4DUY O;  3UM7 A;  1RSO A;  2JRI A;  4Z1M G;  2UUB O;  4L87 A;  4O4L A;  4LF8 B;  1FAF A;  1QHT A;  1NVP D;  1AP5 A;  4B3S O;  2KG7 B;  3SPI A;  3ZX6 A;  1IVS A;  3ETE A;  1NR7 A;  3ETG A;  1EZJ A;  3S3X A;  2DQ3 A;  5BY1 A;  1I0H A;  1TA8 A;  4LFA B;  1P7G A;  1XL6 A;  3TK1 A;  1AB3 A;  2R72 A;  1N36 B;  1WB8 A;  2DJV A;  4D6T H;  2IM9 A;  3F7Y C;  3RVZ A;  4LF6 O;  4KUM A;  4UV9 A;  4MS2 A;  3F5W C;  5C93 A;  3K59 A;  2GSM B;  2HEP A;  2WLH A;  4FZ1 A;  4BAY A;  1E1Q G;  1M93 A;  4JI4 O;  5KAI Z;  1UPG A;  4MT8 A;  3SJB C;  1SZT A;  3OE7 G;  5JJJ B;  3ZJZ A;  4PA7 A;  1RPO A;  4JF3 A;  1X4T A;  5JH7 A;  2VQF B;  5BZB A;  4B3M O;  2FYU H;  3RYH B;  1IBL O;  2CUG A;  1KP3 A;  1Q6H A;  3CX5 F;  2OTL V;  3NXS A;  3N27 A;  3T4D A;  4C7U A;  4ZOL A;  3K5M A;  3A2F A;  2NN4 A;  3AG3 C;  1H8E G;  5K1P A;  3K57 A;  2KKW A;  4ZKI A;  1QR8 A;  4QPK A;  2X0L A;  5KLV H;  4O2A B;  1M90 W;  1BGY H;  1R1B A;  4IHJ A;  4FLT A;  1XMQ O;  3BRC A;  3BHP A;  4Q20 A;  3G71 V;  2HJF C;  2GTA A;  1MA1 A;  4J41 A;  3CME V;  1J5E B;  2IBZ H;  2P5O A;  2B5U A;  4LWS B;  1YDX A;  5JQG B;  2Q69 A;  2JDI G;  1HW7 A;  2KG7 A;  2CTR A;  1SZX A;  3IFX A;  1XBL A;  1L0L H;  1M57 C;  1RM1 B;  4OGQ B;  3WB0 A;  2W0F C;  1YHQ V;  1CEZ A;  1NS1 A;  2BTQ B;  4K35 A;  2OCC B;  2P67 A;  4OX9 B;  2EIL B;  1H38 A;  1TVK B;  2YEV B;  5J2T B;  3ABL C;  5IJ9 B;  1OCC B;  1SQV H;  4J9Z B;  5D5P A;  2Z3Y A;  4JYY A;  3ZMV A;  3FB6 C;  3LSU A;  2HHH O;  4X66 O;  4DR3 B;  4TUY B;  1DF4 A;  1G4Y B;  3JD2 A;  4FVM A;  3RT3 C;  3G67 A;  3ETQ A;  2IU3 A;  5LMN O;  3ABM B;  3RYH A;  4X62 O;  4LF7 B;  4K8X A;  4UFZ A;  2Y0I A;  4PDV A;  2QEX V;  1VQ9 V;  4WFH A;  3LNM B;  4TV9 B;  4DR1 O;  1NBM G;  2H8P C;  3DC5 A;  4DK1 A;  3SR2 C;  3KCX A;  4I7Z B;  4O4H B;  1FPO A;  1GN4 A;  2N04 A;  4X8A A;  2FB5 A;  5L3C A;  5B3S B;  4O2A A;  1LUV A;  4JAA A;  1XNR B;  3OT7 A;  2WLL B;  1AVM A;  2YXY A;  3VQV A;  2ZKO A;  1VAR A;  3FX7 A;  2PTM A;  5E1A C;  2O57 A;  1WAZ A;  4LWS A;  2UXD O;  5JQG A;  2IH1 C;  3A0R A;  1OV9 A;  2YUA A;  4DUY B;  2ATK C;  1SES A;  2YIC A;  4ZIB A;  5KHK A;  2UUB B;  1E79 G;  3H1I H;  3UO3 A;  2QWO B;  1BQ0 A;  3ZS8 C;  1SQB H;  3PJS K;  2G38 A;  1UFI A;  1YEW A;  4B3S B;  4DV7 O;  2P6J A;  4BR6 A;  2Y69 C;  3JD1 A;  1S72 V;  2DQ0 A;  3CSX A;  1NT2 B;  2Q6A A;  4RQF A;  1SRY A;  4PA6 A;  2YEV A;  5J2T A;  1BMF G;  3BAB A;  1K7D A;  4MVZ A;  3K06 A;  4I50 B;  4U7N A;  1PM9 A;  5LP6 A;  4LF6 B;  4FLY A;  3D8C A;  3H01 A;  3QO7 A;  5LGT A;  2PZS A;  4LH7 A;  4CH3 A;  1Q7Y W;  3SDL A;  2AHZ A;  3W7X A;  5KHG A;  4JI4 B;  2QE7 G;  2KSD A;  2ZDI A;  4JI5 O;  3G6E V;  2M7W A;  1QQC A;  1IXB A;  4QNH B;  1IXM A;  4TV9 A;  2NNU A;  4B3M B;  1P84 F;  3CCS V;  1TUB B;  2RDC A;  3K0D A;  3CJH B;  3ZN1 A;  4O4H A;  1Y67 A;  1PV0 A;  1YSC A;  3CRM A;  2NR5 A;  3VQX A;  1MSD A;  4X20 A;  2YIA A;  3QTC A;  4JI0 O;  1RM1 C;  4DR5 O;  3BPZ A;  3H1K H;  3E8F A;  5LHI A;  2OCC C;  1N0N A;  3ZMZ A;  3L74 H;  5KUM A;  2DMX A;  4O2B A;  2YIB A;  2EIL C;  3D36 A;  2HVK C;  4RQE A;  5KAF Z;  1XMQ B;  1JA8 A;  2RJZ A;  1OCC C;  2LFR A;  1TUE B;  2Y48 A;  1Q82 W;  3C3S A;  4R50 A;  3FAV B;  2ZD9 A;  1IZ3 A;  5EK0 A;  3F7V C;  1YJ9 V;  3ABM C;  1K5S A;  4DXW A;  5D5Q A;  1P49 A;  4WFA V;  2AGA A;  2VWK A;  4XDL A;  4JYA O;  2AZ2 A;  3RWR D;  4I50 A;  4CH4 A;  5FNV B;  3RN4 A;  4CH6 A;  1F4M A;  1ZL8 B;  3FB5 C;  5KHH A;  1KU9 A;  3RYC A;  1N8R W;  1KKC A;  1K97 A;  4PDM A;  2P22 C;  3IC9 A;  3E2E A;  1WPB A;  1FXK B;  1N32 B;  2JGU A;  2HHH B;  4X66 B;  3M8A A;  4UV8 A;  2Q0O C;  5LMN B;  1TUB A;  3JD4 A;  2DYS B;  1NH2 B;  4X62 B;  1ZLZ A;  2ADP A;  3D36 C;  1SER A;  3CJH A;  2R70 A;  4MSW C;  2WLJ A;  2XAQ A;  4IYI A;  1N4C A;  2XUM A;  5CA3 A;  4DR1 B;  3SPH A;  4P9P A;  1W0K G;  3P3P A;  4R8C A;  4DRX B;  4LC1 A;  2HLD G;  1WPX A;  1Y66 A;  4UCO A;  1XEQ A;  3E83 A;  4F6R B;  2GDS A;  3IAY A;  2ILM A;  2JJ1 G;  4RAI A;  1QU7 A;  4RUE A;  5C8Y A;  5IJ0 B;  3E22 B;  1YZB A;  1B04 A;  3HKE B;  3FAV A;  3Q4H B;  4ICG A;  1FYJ A;  2UXD B;  3ZMS A;  1XL4 A;  1IUR A;  4YHH B;  1RP3 B;  3AK1 A;  4JAS A;  1BSM A;  1EM1 A;  1FFX B;  3CC7 V;  3CWB H;  3LUT B;  2QM4 A;  2ADQ B;  2FML A;  3SYC A;  3SYQ A;  2CGO A;  4PDR A;  2YIB D;  1YTF B;  1AI6 A;  2Q73 A;  4MVO A;  5EC1 C;  4DV7 B;  3E8B A;  3CRC A;  5FNV A;  4GX5 A;  4YJ3 B;  3STZ C;  3DC6 A;  2Q8V A;  4ZI7 B;  3CEI A;  3OW2 U;  1ORQ C;  2HG5 C;  4B08 A;  1AR1 B;  5LXT B;  5B1N A;  1NU1 H;  4U3J B;  3CRR A;  1JVM A;  3EHB B;  5KMG B;  5LGU A;  1FXK A;  3RVY A;  5LOV B;  5DEC A;  4UVA A;  2HVJ C;  4JI3 O;  1WLE A;  4P30 A;  3HPL C;  1M9N A;  2RQ6 A;  3K03 A;  3OTO O;  1FKA O;  1WN7 A;  2QR4 A;  4J7Z A;  4X65 O;  1JJ2 U;  4OX9 O;  1H2M A;  3OMI B;  3N2G B;  1D5N A;  4DO2 A;  1XI1 A;  2EX3 A;  4PA3 A;  3ML0 A;  4DRX A;  4LF4 O;  2Q7G A;  4FIP C;  1AJN A;  3AG2 B;  3BAA A;  5GW7 A;  1NZ6 A;  3L70 H;  4P2Z A;  1XMO B;  4QE9 A;  1EN4 A;  4D7T A;  4DR3 O;  3K79 A;  4XBF A;  3CCJ V;  4EB6 A;  3OFN G;  3ZRW A;  4JI0 B;  3VOU A;  4F6R A;  2A9H A;  2Q68 A;  4DR5 B;  2A79 B;  3JAW B;  1X59 A;  5IJ0 A;  1FFT B;  3E22 A;  1YI2 V;  4D7S A;  3HKE A;  2UU9 B;  2Y0P A;  3Q4H A;  4HBN A;  3L75 H;  4TOI A;  1N34 B;  3UQ8 A;  1FFX A;  4KFM A;  2A7W A;  5IYZ A;  2EIK B;  1E1R G;  4NXM B;  1SET A;  4GT1 A;  4PHZ A;  3BA8 A;  3BVO A;  3FD9 A;  2IJJ A;  4GX1 A;  1FXK C;  4J42 A;  1Z2G A;  1MAB G;  4HNA B;  2LFS A;  4YJ3 A;  2DYS C;  4KL1 A;  4NTX A;  4F4L A;  4ZI7 A;  1KD1 W;  4JYA B;  5GTH Z;  1U96 A;  4N23 A;  2RNB A;  3JD0 A;  3HKB B;  5CA0 B;  4U3J A;  5KMG A;  2WLI A;  4QGP A;  4MTG A;  5BXZ A;  1S76 D;  3H9V A;  4W4L A;  2AHY A;  2OWO A;  2LW1 A;  1CXZ B;  1B3Q A;  1RPR A;  3G4S V;  3K0G A;  1XOU A;  4PA4 A;  1VIB A;  3RYF B;  1QNM A;  3DXR A;  3I5D A;  1AR4 A;  2DWD C;  3JAS B;  3CXH F;  2AXT Z;  1S5J A;  1I94 B;  4O4J A;  4X1I B;  4MVQ A;  4X1Y A;  3SYP A;  2N05 A;  1Y74 B;  2PY5 A;  1YJW V;  4FZ0 A;  3JAT B;  2X6A A;  1JX9 A;  3K5L A;  1S77 D;  2WLN A;  1NH2 D;  2XAH A;  2LQT A;  2P06 A;  1I5Y A;  3R66 A;  3ZMU A;  1YCI A;  3JAW A;  2ZR3 A;  5H9C A;  3JAL B;  4JZG A;  4KP4 A;  4WBN B;  1SC5 B;  4X88 A;  1EFR G;  2GUZ A;  4W4K A;  2V1D A;  4DV0 B;  4CC5 A;  4UCT A;  1JFF B;  2Q9L A;  3HR0 A;  2Q0A A;  5CBF A;  4O4I B;  5L3E A;  3ZN0 A;  1YVW A;  5IDJ A;  1PNK A;  3ZHS A;  3A0H Z;  1F51 A;  3T1Y B;  4UCR A;  3JAK B;  2XHB A;  2EIJ B;  3OGC C;  4YXW G;  2CTP A;  4AI8 A;  3B2E E;  1GTO A;  1AJP A;  1B06 A;  3CXC U;  2IJH A;  2LGW A;  4MW8 A;  3B77 A;  1YIJ V;  5IYD O;  5CA0 A;  1GN2 A;  1THZ A;  1Y76 B;  2QWR B;  2UUC B;  1GN3 A;  2RMK B;  4PDL A;  4AQY O;  5L3D A;  3ZCC A;  4DK0 A;  1YTF D;  4JAU A;  3AG2 C;  2EIM B;  2XTA A;  5K1X A;  3CYO A;  4PD4 F;  5TIS Z;  1Q8I A;  4UB6 Z;  2VS0 A;  1AI7 A;  4NKG B;  3RYI B;  1SQX H;  1ZWI C;  2E5L O;  3IC7 A;  4QPJ A;  1NQT A;  3JAS A;  2WSS G;  3K5O A;  1PPJ H;  4JI3 B;  1XIL A;  1R3L C;  4X1I A;  3OTO B;  4XDJ A;  4DV2 B;  1S0V A;  4X65 B;  2D2C B;  4IYH A;  3D3Q A;  4Q6G A;  3JAT A;  2EIK C;  2E76 B;  3JSN A;  4X1K B;  2ZE6 A;  2ZE8 A;  1AP6 A;  4FK5 C;  4GKJ O;  4MTX A;  4MVM A;  1SQP H;  4LF4 B;  4OPH A;  5EBW C;  5ITZ B;  4WBN A;  4FM0 A;  2LP7 A;  4UCV A;  1N32 O;  2OIE A;  3ZBH A;  5GTI Z;  1JFF A;  3MHH C;  4FLU A;  1HNZ O;  2ZIM A;  5A9G A;  4O4I A;  1K73 W;  2OT5 A;  2X6C A;  1NTM H;  3X2Q B;  3FKS G;  2DW4 A;  3NR7 A;  5KUK A;  3JAK A;  1JJO A;  3WG7 B;  3KKY A;  1ENV A;  1XUQ A;  3LNN A;  1ZUQ A;  3O65 A;  1M4U A;  1BZK A;  3SPC A;  5HFM A;  4GZR B;  3KCY A;  2YS8 A;  3OM3 B;  3K5N A;  4H13 B;  5FL7 G;  4J9Y B;  1XNQ O;  3ZMT A;  4I0X B;  1Y76 A;  4I9W A;  3P3N A;  4JTC B;  5H5N A;  1R6K A;  1NKD A;  2OIG A;  2ETN A;  3OEE G;  4QIW F;  4I55 B;  2X7R B;  1VQ5 V;  2N74 A;  1K34 A;  4YHH O;  2K9P A;  2Q7H A;  4B3T O;  1FXH A;  3CCE V;  3RYI A;  3E35 A;  5IWA B;  3JD3 A;  4Z1V A;  1LUW A;  3GB7 C;  2P4V A;  1VQ8 V;  2BTQ A;  3UO2 A;  3KZI Z;  1VQL V;  2QWQ B;  3N2K B;  5J9P C;  1MZF A;  1FXV A;  4CS3 A;  5B1O A;  1N33 B;  2Z0A A;  1TVK A;  3JSL A;  2HR3 A; 
#chains in the Genus database with same CATH homology
 2IBZ H;  3H1K H;  1KYO F;  2BCC H;  4D6T H;  3CWB H;  1NU1 H;  1EZV H;  3H1I H;  3L71 H;  1P84 F;  2FYU H;  4PD4 F;  1NTM H;  3L74 H;  3H1H H;  5KLV H;  1SQB H;  1SQV H;  1L0L H;  1SQX H;  1BGY H;  3TGU H;  1L0N H;  1SQQ H;  1SQP H;  1KB9 F;  3CX5 F;  3L75 H;  1BCC H;  1PPJ H;  3L73 H;  1NTK H;  3L72 H;  1BE3 H;  3L70 H;  4U3F H;  3BCC H;  1PP9 H;  3CXH F;  3H1J H;  1NTZ H;  2A06 H;  3H1L H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...