3BCCH

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
66
structure length
66
Chain Sequence
b'LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELFDFLHARDHCVAHKLFNSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
molecule tags Oxidoreductase
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
total genus 20
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3bccH00
1P84F 3L74H 1PP9H 1SQVH 1L0LH 2FYUH 3CX5F 3H1LH 3L75H 1NTKH 3BCCH 4D6TH 5KLVH 1SQQH 3H1KH 4U3FH 2IBZH 1KYOF 3CWBH 3TGUH 1SQXH 1KB9F 1SQPH 3L71H 3L73H 1BE3H 2BCCH 1BGYH 1L0NH 3L70H 1NU1H 1NTZH 2A06H 3H1HH 1SQBH 3L72H 3H1JH 1PPJH 4PD4F 1BCCH 3CXHF 3H1IH 1EZVH 1NTMH
chains in the Genus database with same CATH superfamily
4L87A 2OIGA 2P5OA 1WJZA 1SQVH 2VQEO 2UXDB 3AG3C 4D6TH 3JD4A 1R3KC 4RUEA 3D3QA 3Q4HA 2IU0A 1N34B 4K8ZA 2OWOA 3J7AU 5DM6V 2RQ6A 4GKJO 4KUMA 4KP4A 3CC4V 4X62B 4JI8O 1NH2D 2H94A 4RUFA 4DR4O 3IFXA 2JRIA 5IJ9A 4NTYA 2X6AA 5CA0B 4JI8B 4JYCA 4LF5O 3T1HB 3ABKB 3IJ4A 3SJCC 1PL4A 3K59A 2IBZH 2LFRA 3GB7C 4LR3A 1NR7A 4LFCO 4J7ZA 1JOYA 5CA0A 1Q86W 2C2AA 1VQOV 1TVKA 3AG7A 2OCHA 3L72H 3J81N 4KHPB 5CN0A 4JYBA 2PF4E 5IWAO 1B04A 3IAYA 4B3SO 3ABUA 3CPWU 2W0XA 1V54C 3FAVA 2JS5A 4HYOA 5B3SC 2UXDO 2QM8A 2IJKA 1OCZC 5EC2C 3WB1A 4WBNB 3B77A 3T1HO 4H33A 5LA6B 2GBOA 3E89A 3E83A 4O4IB 3JARA 2OTLV 4P9OA 1F4NA 2VQFB 2RN9A 4IGGA 1L1FA 3LNMB 1YTFB 2KQXA 2VWJA 1FD9A 2K1EA 1VQMV 2P22C 2QKAA 4B3RO 2Y4UA 3A8TA 3IC7A 4CBCA 3I5DA 3FB6C 3BAAA 2YC0A 4X1KA 4UV8A 3L70H 1K73W 4YHHB 4NXNO 1YXBA 4PD4F 4E4EA 3SR2C 1GO3F 1I08A 1PKXA 3L74H 4B3SB 3SGIA 3RT3C 4MVUA 5D5QA 1MG1A 2ATKC 1NI8A 5EIBD 3W7XA 2GUZB 2HVJC 1VQNV 5EYPB 4DV6O 4DR2O 2E5LB 4JGSA 1VIBA 4UCUA 3HKBB 1U96A 1QLEB 4JI2O 4LF6O 1NU1H 4MTOA 1CP9A 1HNZO 3CCRV 4LF8B 4X66B 3BEHA 2EULA 1P84F 4HNAB 1QLNA 1NBMG 3ZMSA 1KMIZ 1QR9A 2YEVA 1YVWA 1E1QG 3PN1A 4FK5C 4IIJA 1JQ0A 5DN6G 2WSSG 2DYRB 3H9VA 3B8NA 3WB2A 4O4LA 4EEQA 2QE7G 3HKDA 1S72V 3TETA 1PPJH 4IIJB 3T4DA 2JEXA 1EFRG 4CC6A 3H1IH 2ZE8A 1DTOA 4JYYA 4TT3G 3K9AA 2YI9A 3HKEA 3GWOA 2CUGA 4OX9O 4HZ3A 1AR1B 1H8HG 4JI5O 4XBFA 4U7OA 5IYZA 3ETDA 1I94O 5IYBO 4JI1O 3MDSA 4UVCA 4WFEA 2A06H 3DTUB 2RCVA 2AZ2A 4ABMA 2EINB 4G28B 1V55B 2ODMA 2YSUB 1MA1A 1I5XA 3SPGA 2HHHO 1QLEC 3E22A 1Z2GA 2BE3A 1IBLO 2JDIG 2ZDIA 3RBZA 4JYAO 2JS3A 1T5EA 5JJJB 1LUWA 2IJIA 3GVMA 4ZHQB 1NQTA 1PM9A 3ASNB 1QHTA 2V4DA 4MVZA 3OEEG 1XHXA 3APOA 3KG2A 4GLXA 1IURA 1OJHA 3SJAC 5IWAB 3QNEA 1KUQA 1MZFA 2DYRC 4GX2A 1KP2A 1KP3A 2XOKG 2F66C 4J11A 4DR6O 4UVAA 1Y6XA 2E75B 3AK2A 4DV3O 3OFNG 4QE7A 2PYJA 3MD0A 1PV0A 3O65A 4FFKA 4ZKIA 4CH4A 4PDLA 1Q6UA 3ZRWB 3U11A 1E79G 1S0VA 1HDJA 3CB2A 5EBWC 4B3TB 1RPOA 2QJ1A 3SPIA 1EN5A 3DGEA 1JFFA 4JAUA 1Q90D 4YJ2A 4I4TA 1Q81W 1NJIW 3RVZA 2IH3C 5E1AC 2F1MA 1K5SA 3OGCC 1JFFB 3CCLV 1BQ0A 4YJ2B 4FM1A 4B08A 1Y66A 1S3JA 1NTMH 3CHXA 1FS0G 4DV5B 1RPRA 4IYHA 3ASNC 4CH6A 2CTRA 2YIBA 4Q6GA 2Q0AA 1G8MA 1L8DA 1D5AA 5JVDB 1R1BA 1KKCA 4JTDB 2R72A 1GN2A 2EZPA 3G71V 4AQYB 4FLTA 4YJ3B 1OCOB 3W7TA 3CEIA 4X66O 5JVDA 1NVPD 2XTAA 4NVPA 4N23A 2GHYA 4LP8A 3F5TA 4LNUA 2HP8A 3HKDB 1ZTEA 1GAXA 3KZIZ 4JI5B 2XAGA 5IE9A 1HNXO 4K0KB 3ZIAG 5JJEB 3VQYA 4YIOA 1ORQC 3QVNA 5KHJA 3E8FA 4U3JB 5KHIA 2X0LA 4QIWF 1M93A 2WPDG 2QSAA 1GM9A 2OT5A 1VF6C 1COWG 1UFIA 3LSQA 3WU2Z 1SA0B 3K5OA 2DE0X 3D3IA 1QCEA 2QR4A 3E22B 3WG7C 1S5HC 3O9OA 4LFBB 1US6A 2B9ZA 4IYIA 2CH7B 4PJ0Z 1SA0A 2BSKB 1WA8B 3ABMB 1FYJA 2E76B 1SZXA 5GW7A 2KKWA 3FD9A 2CH7A 3CC7V 3CS5A 1AJNA 1SRYA 2Q7HA 3E8GA 5B3SB 4B7EA 1TGOA 2OCCB 1YJ9V 4B7KA 3H1HH 3EHBB 3QTCA 5KHGA 4BWAA 2L6LA 1NH2B 5LP6B 3ZX6A 4MTGA 2P4KA 1K3EA 3JSNA 4BIZA 2XHBA 4O4JA 2LW1A 4B3MO 4DV3B 1BE3H 3OTFA 4FZ0A 4IT5A 4QE9A 2OTJV 1L0NH 4UCOA 2UXBO 3BA8A 3K58A 2XAJA 4LFBO 5CA3A 4BAYA 2KSDA 1RM1B 5L3EA 5LOVA 4X65B 2WLJA 5IYDO 2PYLA 1Q43A 2HR3A 5DEDA 3ICXA 1Y67A 4OXSA 2JJ1G 1EN6A 4X65O 3DXRA 4PDMA 1P49A 1TVKB 3C3TA 3FB7C 3T1CA 4BIUA 1AI7A 3H1JH 1R6KA 4NR1A 1YIJV 1IBKO 3RYCB 5LGTA 4GYCB 5ITZB 3W7WA 4RWUA 1VQ6V 1H2MA 2IW5A 5GTIZ 2A3QA 2GDSA 4YJ3A 1F4MA 4O2AA 1R3IC 1H2KA 4JZGA 5LA6A 4MVQA 1XHZA 1Z5VA 1YJNV 4JI3B 2GV9A 3E8HA 4DV7O 2Q68A 4O2AB 1SERA 1Y76A 1KC8W 3UQ8A 3AG4B 1O9GA 1EBOA 3K08A 2Q8VA 3STZC 3K06A 5EC1C 1ZL8A 3CD6V 1N0JA 3HPLC 4X1IA 2WLKA 2E74B 4DV1O 2JIZG 4X1KB 1ZL8B 2JGUA 4LBEC 2YDEA 2BTQA 1LUVA 2PY5A 2RDCA 3JAKB 1MMMA 2A79B 1K4CC 2W6IG 5GONA 4GX1A 2Q9LA 1WPXA 2OIEA 5KAFZ 2AHZA 1W0JG 2AZ0A 1HP8A 4X64B 4GKKB 4GKJB 2VQFO 1N33B 5J2TB 5GONB 4OPHA 1SESA 2HKOA 4ICGA 4L8JA 5LBQA 3ZRVA 5FL7G 4ZBMA 4JI4B 1TUEB 4JTAB 3D8CA 3OMNB 2W6JG 5J2TA 1WPBA 3KCYA 2YEVB 2LGQA 4TSFG 2Y69B 2UXCO 3HR0A 1YZBA 3D36C 3JCUZ 1K9MW 4UUJC 2CGOA 4X8AA 1ZAUA 4N21A 4PA6A 4YY3O 4CS4A 1GN4A 4U7NA 2Q67A 5KAIZ 1G1XB 4PI2A 3I55V 4O4JB 4JI4O 4HAMA 2MW2B 2NN4A 2XAHA 2ZXWC 3HKEB 2M6YA 1R3LC 3UKMA 3ABKC 1PNMA 2F23A 3QG5A 2WA3A 3P3NA 5IYZB 4B3MB 2JJ2G 4DUYO 1A32A 2ZR2A 4ZI7A 1SQBH 3ZN1A 4JAAA 3G6BA 4MTFA 1M9NA 4F6EA 3RN4A 2FL4A 3CX5F 3WFVA 3ETGA 4PA9A 4LFAO 1OCCB 1GRJA 4P30A 2QWPB 1N32O 1FFXB 2A0LA 4GT1A 1P4RA 3L73H 1SC5B 3RYCA 1GH6A 4JYAB 2CDYA 2JGDB 2QM7A 2Q6AA 3KCXA 4R8CA 2UUBO 1W59A 1J5EO 5CA1B 3EFFK 3P3PA 3CSXA 2XAQA 2JGDA 3CE2A 1DK1A 2F4VB 3FAVB 2N74A 3K9SA 5JH7B 2MK3A 2H8PC 5CA1A 2ZE7A 4I55A 3A2FA 3CWBH 3CRCA 2EIJB 5JH7A 2BOCC 3N27A 5KHKA 4J80A 3LUTB 1OV9A 3ZMUA 2QWQB 2EBOA 3JASA 1Q7YW 5A2QN 4OGQB 1J5EB 4X1IB 4AI8A 5B1AC 1M56C 1IXMA 5AG2A 1VQLV 3OGIB 4DV6B 5KUKA 3AK1A 1AILA 4H37A 1SQQH 5KLVH 1K5QA 4FVMA 1YJWV 1V54B 3A0HZ 1AR4A 5EBLC 3B40A 3R66A 2EZOA 4JV5O 4PHZA 4XDLA 4H13B 3CRRA 1JPXA 3JSLA 3H01A 4MVSA 3K57A 4DK0A 2Y69C 4DRXA 4X89A 1IZ3A 2Q5ZA 4DV0B 2VRZA 3FKSG 2DW4A 2B1IA 1D5NA 1PD3A 1WN7A 1KECA 5BZBA 4X62O 3C90A 4KXRA 2XASA 3JD0A 3TJTA 4O4HA 5EIBC 1WP8A 4LNUB 2LQTA 3AG1C 4DV1B 1EM1A 1X59A 1HWYA 2QWOB 3K3WA 2B1GA 4FLUA 4O4LB 4O4HB 4MW8A 1BQZA 4PV1B 1URFA 1XNQO 2CAZC 2ZXWB 3N2GA 1E1RG 2ZKOA 3ASOB 3CCSV 3KKYA 4P9PA 1B3QA 2UUBB 1PNLA 1OCCC 4ZI7B 4RO2A 3OAAG 2OCCC 3OUFA 3ZMTA 2WLMA 1Q82W 3N2GB 3TXQA 4I5SA 4ZIBA 1BS3A 2HLDG 3ZHSA 5TISZ 4FLWA 5EZYA 2Y48A 1QNMA 1GM8A 4MVOA 2FTKA 5KUMA 1F51A 4WFFA 1ZWIC 1WA8A 3MAQA 4PA4A 2GTAA 2HEPA 4TV8A 1VEWA 1KU9A 1N32B 2BTOA 3LSSA 2VS0A 5B1BC 2Y0PA 2JVDA 3N2KA 5LHGA 2G38A 4TV8B 2YUAA 4KHPO 1CEZA 2PGGA 3NXSA 1SZTA 2ZNJA 4I55B 5BR8B 4GUNA 4W4KA 3RVYA 1XREA 3BHPA 1XILA 1AI6A 3QO5A 3TGUH 2WA4A 1YEWA 1YSCA 4UCVA 5B1AB 3ZMZA 4LWSB 3ZRWA 5IT9N 4UXNA 4YHHO 1Y74A 4R50A 1AB3A 1K34A 1S5JA 3OEHG 1K92A 5GTHZ 1F7YA 4FLXA 4FM0A 2LO1A 3DXRB 3QO7A 2YIBD 3B09A 4DRXB 1FFTB 2YI8A 1SS3A 3ETQA 4DXWA 2R9AA 1FXKA 1N33O 1XNQB 3X2QB 1DLBA 3F5WC 4J41A 4K8XA 3CP1A 5KX5B 3T1YO 3SYPA 4X1YA 4DR4B 2YXHA 3K0DA 2D2CB 4DV4B 3CJHB 2CE4A 3K5LA 4K0KO 4DV0O 1HNWO 5K1PA 3SYAA 5F2VO 5LMUB 3U10A 1VQ5V 4NKGB 4BW9A 1FKAO 4MSWC 3BFRA 4DR5B 1XEQA 4NTWA 4PDVA 4I9QA 3K5NA 5FNVB 2UUCB 4X20A 2EIKC 4U3JA 1ROPA 4JI2B 2CK3G 3ML0A 4XDKA 4MS2A 5EZYB 4LH7A 5BXZA 4I9WA 2UUAB 3A0RA 3ZS8C 2VQEB 4Z1MG 1J95A 2Y0IA 4DV2B 1I5YA 2F93B 4DK1A 5D5PA 3S3WA 4PELA 1S76D 4DR1B 1JX9A 1MZEA 3OR6C 4DV7B 1VF5B 4FFBB 3RGBA 2EINC 1KYOF 3ABLC 4QGPA 2BCCH 1BGYH 1TUBB 4BR6A 4BIOA 2QEXV 3OMAB 4EB6A 1FJGB 1MABG 3EVKA 2ZNIA 5H2FZ 1BZKA 3QF7A 5KA6A 5LP6A 3IGAC 3ABLB 3BRCA 5L3DA 5JQGB 2XNDG 3CMEV 5H6QA 1RM1C 1TUBA 3VBBA 1AP6A 3VQXA 1M5IA 4LF5B 1XDCA 2YXYA 5J2UB 1M4UA 2F4VO 1H2SB 3CCQV 5JQGA 5KA5A 1N8RW 1YITV 3AG4C 1W0KG 4DV2O 3AEIA 2P90A 1XMQB 3LSUA 2UXXA 1Z5WA 2WAMA 5LOVB 4TWKA 1JVMA 2ZM6B 2DQ3A 4F6RA 4YIPA 1BHBA 3SJQC 1ZSPA 1JJ2U 1FXKB 3K5MA 5FPOA 3CC2V 4B3TO 3AK3A 4JI6B 2PZSA 1XBLA 2EILC 3DC6A 5ITZA 1RSOA 3DSQA 4YY3B 4I0XA 4Z2WA 3SYCA 5A9GA 4JI0O 4IL6Z 2P06A 1N34O 4R7CA 3CJHA 1IVSA 2X7RB 1GN3A 1BT8A 2RJZA 1SQGA 2DYSC 2ADQB 3G67A 1AJPA 2FYUH 1XL4A 2W0FC 1F23A 3BCCH 1H8EG 5JCOA 2Q0OC 4UFZA 1LR1A 4LF7O 5H5NA 1VF7A 1VMGA 3E35A 4JI7O 1NR1A 3CCEV 4X88A 5FNVA 4CS2A 3M7MX 4GX0A 2GSMB 2X6CA 1FXHA 3ZBHA 3SPJA 3HB3B 1X4TA 2BTQB 2XAFA 3JALB 3FYEB 4H44B 1MSWD 3BVOA 3E8BA 1UJWB 4I50B 3JATB 4MW3A 4JASA 4KL1A 3THOA 4DW0A 5LMUO 4DW1A 2E5LO 1AROP 1HW7A 4DV4O 4LF9B 2IJJA 3ZRSA 1K97A 4JAVA 1W2BU 3FB8C 2UXCB 4UV9A 3G4SV 3SPCA 4GCZA 3T2MA 4MVMA 1SETA 3MHSC 1TAEA 3SJBC 1VQ9V 4QJFB 3BA9A 5CBFA 4RAIA 4I7ZB 1ZX3A 3FFQA 4PDRA 1JMKC 3E2EA 1YDXA 3ZJZA 4TQFA 2DQ0A 2P4VA 1GTOA 3SDLA 2X6BA 2DWEC 1PP9H 4RQFA 5B1NA 4FJCC 5B1BB 4UCSA 3M8AA 5JWPA 1AI4A 4D7SA 1OHHG 2YS8A 3VQVA 4JZ2A 1D2DA 1Q3EA 2M7WA 3UCSC 1BSMA 2ADPA 4F6RB 1R3JC 4ZOLA 4LFCB 1NKDA 1O9HA 2ZCEA 2E3CA 4PA7A 1Y4MA 1OCRB 4IHJA 4O2BA 3TXSA 1AVMA 5DECA 2YICA 4ZOLB 1FFXA 2YXLA 2VWKA 3M99B 2P7TC 3P32A 3N2KB 2ILMA 4DUZB 4IHJB 4O2BB 4CH5A 1XNRO 1OZ0A 1OCRC 1MSDA 1Q8IA 1ENVA 4CS3A 4TOIA 4NTXA 3D36A 2ZM6O 4E2LA 2PI4A 2Z0AA 2KG7B 3OD4A 5IY5B 1VQ4V 1K33A 2P67A 4UVBA 2WWWA 1S5LZ 3VQWA 1VARA 4JTCB 5B1OA 4G27B 2Q7GA 1IBMO 2RMKB 3JASB 4EKWA 1EZVH 5H9CA 1Y74B 2ZIOA 1OCZB 4GZRB 1YF2A 3MHHC 4TV9A 1VF6A 3JAMN 1KB9F 4LF6B 2R9IA 4GX5A 2ZR3A 2HVKC 1N0NA 3I56V 5CB4B 2H3OA 3JALA 2FKXA 4TV9B 2ZINA 4I50A 1MOFA 3RYFA 2XT9A 1YHQV 4DR3O 4CZZA 2Y4TA 4FLYA 4DO2A 4OX9B 3B8MA 2QTOA 2UXNA 3K79A 3RW0A 3S3XA 4J9YB 1SQPH 3OMIB 1M56B 5KMGB 4DR6B 5LHHA 4X1YB 1UPGA 4KFMA 1BL8A 5J9PC 2Q4PA 3LNNA 1NS1A 1HNXB 2ZD9A 1R73A 4UCTA 3SPHA 5IJ0B 4X9QA 1AI5A 2FMLA 2PTMA 4J10A 2QDOA 4MT8A 3CRAA 4FIPC 2HFEC 5IJ0A 3HKCB 2CGNA 1NVPB 1WP7A 5C93A 1BMFG 3G80A 2IU3A 5JJNB 4FLVA 1BHAA 2EIJC 5LYJB 1YCIA 3CXHF 2CTQA 4WFHA 1B06A 3AG2B 1GMGA 3B2EE 1QQCA 2UU9B 4WBNA 4NXMO 2QWRB 2JEUA 3EXAA 4LFAB 3F7YC 4J7JA 1VP7A 1KD1W 4YXWG 3UM7A 3OE7G 3RYHB 3OTOO 5H6RA 3JARB 2NLJC 4NXMB 3AG1B 5KHHA 1RFYA 1V55C 1V9PA 5K1XA 3ABTA 2HJFC 3RYHA 1THZA 3K04A 4CC5A 1P7BA 1K4DC 3PJSK 1G4YB 3APQA 4RQEA 2D3OW 3ETEA 1KKDA 1SQXH 5B5EZ 2EJ7A 3UO2A 4J42A 5BR8O 3LDEA 1SF9A 2L35A 2A7WA 3J80N 2QA4V 1M57C 2IJHA 2KG7A 3F7VC 3JD1A 3P30A 1XNRB 3CCMV 5EK0A 2IH1C 3LDDA 2AW9A 1R6NA 1H2GA 4PA3A 2WLNA 1U97A 3L71H 1G6UA 5J2UA 5LL6Y 4LH6A 1NTZH 2CTWA 4LWSA 1R6TA 3W7SA 3GWKC 1SKVA 2HJDA 4NXNB 3CYOA 1H38A 1VQPV 1GM7A 2YIAA 5CB4A 4LF8O 1JA8A 3T1YB 4LCUC 1WAZA 4WFGA 3ZRXA 3OUSA 3RYFB 4Q20A 1VQKV 1HNZB 1WLEA 1IBKB 1I94B 1I0HA 1JJOA 1IXBA 3CRMA 4JPRA 5L3BA 1RSOB 3Q4HB 1JCHA 1HR0B 3CRQA 1XMOB 3OM3B 1M57B 3DC5A 4EFBA 4ASUG 5KX5A 1KBHA 3ABMC 1XMQO 5E79Z 1AP5A 1HR0O 3CMAV 1OCOC 2V1DA 3BPZA 2R70A 5IJ9B 3NR7A 1BCCH 4LF9O 2LW7A 4PI0A 3UO3A 3SYQA 2F95B 2AXTZ 3BY6A 4OPAA 2V7QG 1QBZA 3W7UA 3CCVV 4DR7B 2ETNA 4JF3A 5LYJA 1IX9A 3ZHRA 1DGSA 4Z1VA 1FXKC 4ZHQA 4X64O 5HFLA 2UUCO 3X2QC 1FJGO 2ZQMA 1YTFD 5IDJA 2R9RB 3ZCCA 2ARHA 3FB5C 1L0LH 3H1LH 4HBNA 4QPKA 4X20B 1M90W 1RP3B 4AILC 2DWDC 1GK9A 3BABA 4O4IA 4BW5A 1K7DA 4DUYB 2WLLA 4WFAV 4B3RB 4FFBA 3H1KH 2Z5UA 1H2NA 3RWRD 2ZE6A 2WLLB 2YIDA 2ITCC 4G2KA 3G6EV 2LJ2A 1MNGA 3CXCU 5LP6C 2DMXA 4EB6B 5LMNB 2ZE5A 2CTPA 1QR8A 4J9ZB 3JAWA 3ZHTA 1AR5A 2GUZA 4FM2A 1PNKA 5IYCO 1B6QA 3OTOB 1Q6IA 2P6JA 2QKCA 2QWNB 3HKBA 3WG7B 3K03A 3SYOA 3JD2A 3ZHVA 3JAWB 1AJQA 2UU9O 1Q5OA 2EIMC 2PI5A 2IM9A 4R6ZA 2QTSA 4TUYA 5IY5C 2Z3YA 3IC9A 1IDSA 2HHHB 2Q73A 1LNQA 5CMUA 4AHCA 5FLXN 5LXTA 2NNUA 1QVFU 1XOUA 4K35A 5LXTB 2AGAA 4H0LB 4LF4O 3FX7A 3CCJV 1P7GA 2EIKB 1XMOO 4DV5O 4I0XB 2Q69A 5JCOC 3UT5A 3B4SA 3ZHUA 4LF4B 2QM4A 1N36O 1PL0A 2NR5A 4UCRA 3RYIB 2ZIMA 3ZMVA 1XQ8A 2DJVA 2QGNA 3ZHQA 1FXVA 4FPPA 3VOUA 1IBLB 3AG2C 4GKKO 2AHYA 4QNHB 4DUZO 4JI1B 2ZT9B 4DR7O 2KB1A 2A9HA 4XDJA 1QU7A 4J7KA 4UB8Z 1SQFA 1GKFA 3T4ZA 4LC1A 2K9PA 4DR5O 1QVGU 4JI7B 5LGNA 4DYLA 1FAFA 3ZEDA 2FB5A 4A5UB 3K0GA 2ZDIC 2EILB 1HNWB 4EFEA 1FPOA 3JATA 2LP7A 4FZ1A 2HG5C 1N4CA 1IBMB 1DF5A 1XI1A 5KMGA 4MVRA 4NB5A 3R65A 2UXBB 1ZLZA 1GN6A 2N04A 5EBMC 3TCUA 2BOBC 3CCUV 4U3FH 4I4TB 2WLHA 3FYIB 4JI6O 3HKCA 4UB6Z 3QO8A 2QKSA 3C3SA 5CBGA 3LDCA 1NZ6A 4DR1O 1DF4A 4MTXA 4NYKA 4QPJA 5LMNO 3RFRA 2OYQA 2DOSA 1VQ7V 1EZJA 2LFSA 3OR7C 2EIMB 3A0BZ 5FPRA 4FLZA 5B66Z 4TUYB 2DN9A 1Y76B 2PUSA 1CPYA 3JYCA 5C8YB 2JK5C 5BMVB 2Q7EA 3OT7A 4JV5B 2DYSB 3TK1A 3U0ZA 2RNBA 1NTKH 2N05A 5C8YA 1ZUQA 3E86A 5BMVA 3WB0A 4DR2B 3L9DA 3ZN0A 5L3GA 4W4LA 5HFMA 1XUQA 1YI2V 3JD3A 3JAKA 3UT5B 3OW2U 1WNSA 5CBHA 1H2LA 4WCEV 1TA8A 3RYIA 4K3AA 5L3FA 5BY1A 5L3CA 2UUAO 2GTSA 4WFBV 2WLIB 5LGUA 2XUMA 1I7FA 4JI0B 4D7TA 4P2ZA 4F4LA 1EN4A 4JI3O 5EYPA 2O57A 2WLIA 4DR3B 2BSKA 1XL6A 1NT2B 2B5UA 1M1KW 4WF9V 3L75H 4AQYO 2EJRA 5LHIA 4TQDA 4FMTA 2LGWA 1Q6HA 1JR9A 1WB8A 1WB7A 3JCZA 1N36B 4HNAA 4C7UA 2ITDC 3AG3B 4LF7B 3STLC 1K8AW 2F43G 3ASOC 1VQ8V 4CH3A 2EX3A 1CXZB 1KQSU 1S77D
chains in the Genus database with same CATH topology
1P84F 3L74H 1PP9H 1SQVH 1L0LH 2FYUH 3CX5F 3H1LH 3L75H 1NTKH 3BCCH 4D6TH 5KLVH 1SQQH 3H1KH 4U3FH 2IBZH 1KYOF 3CWBH 3TGUH 1SQXH 1KB9F 1SQPH 3L71H 3L73H 1BE3H 2BCCH 1BGYH 1L0NH 3L70H 1NU1H 1NTZH 2A06H 3H1HH 1SQBH 3L72H 3H1JH 1PPJH 4PD4F 1BCCH 3CXHF 3H1IH 1EZVH 1NTMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P84 F;  3L74 H;  1PP9 H;  1SQV H;  1L0L H;  2FYU H;  3CX5 F;  3H1L H;  3L75 H;  1NTK H;  3BCC H;  4D6T H;  5KLV H;  1SQQ H;  3H1K H;  4U3F H;  2IBZ H;  1KYO F;  3CWB H;  3TGU H;  1SQX H;  1KB9 F;  1SQP H;  3L71 H;  3L73 H;  1BE3 H;  2BCC H;  1BGY H;  1L0N H;  3L70 H;  1NU1 H;  1NTZ H;  2A06 H;  3H1H H;  1SQB H;  3L72 H;  3H1J H;  1PPJ H;  4PD4 F;  1BCC H;  3CXH F;  3H1I H;  1EZV H;  1NTM H; 
#chains in the Genus database with same CATH topology
 4L87 A;  2OIG A;  2P5O A;  1WJZ A;  1SQV H;  2VQE O;  2UXD B;  3AG3 C;  4D6T H;  3JD4 A;  1R3K C;  4RUE A;  3D3Q A;  3Q4H A;  2IU0 A;  1N34 B;  4K8Z A;  2OWO A;  3J7A U;  5DM6 V;  2RQ6 A;  4GKJ O;  4KUM A;  4KP4 A;  3CC4 V;  4X62 B;  4JI8 O;  1NH2 D;  2H94 A;  4RUF A;  4DR4 O;  3IFX A;  2JRI A;  5IJ9 A;  4NTY A;  2X6A A;  5CA0 B;  4JI8 B;  4JYC A;  4LF5 O;  3T1H B;  3ABK B;  3IJ4 A;  3SJC C;  1PL4 A;  3K59 A;  2IBZ H;  2LFR A;  3GB7 C;  4LR3 A;  1NR7 A;  4LFC O;  4J7Z A;  1JOY A;  5CA0 A;  1Q86 W;  2C2A A;  1VQO V;  1TVK A;  3AG7 A;  2OCH A;  3L72 H;  3J81 N;  4KHP B;  5CN0 A;  4JYB A;  2PF4 E;  5IWA O;  1B04 A;  3IAY A;  4B3S O;  3ABU A;  3CPW U;  2W0X A;  1V54 C;  3FAV A;  2JS5 A;  4HYO A;  5B3S C;  2UXD O;  2QM8 A;  2IJK A;  1OCZ C;  5EC2 C;  3WB1 A;  4WBN B;  3B77 A;  3T1H O;  4H33 A;  5LA6 B;  2GBO A;  3E89 A;  3E83 A;  4O4I B;  3JAR A;  2OTL V;  4P9O A;  1F4N A;  2VQF B;  2RN9 A;  4IGG A;  1L1F A;  3LNM B;  1YTF B;  2KQX A;  2VWJ A;  1FD9 A;  2K1E A;  1VQM V;  2P22 C;  2QKA A;  4B3R O;  2Y4U A;  3A8T A;  3IC7 A;  4CBC A;  3I5D A;  3FB6 C;  3BAA A;  2YC0 A;  4X1K A;  4UV8 A;  3L70 H;  1K73 W;  4YHH B;  4NXN O;  1YXB A;  4PD4 F;  4E4E A;  3SR2 C;  1GO3 F;  1I08 A;  1PKX A;  3L74 H;  4B3S B;  3SGI A;  3RT3 C;  4MVU A;  5D5Q A;  1MG1 A;  2ATK C;  1NI8 A;  5EIB D;  3W7X A;  2GUZ B;  2HVJ C;  1VQN V;  5EYP B;  4DV6 O;  4DR2 O;  2E5L B;  4JGS A;  1VIB A;  4UCU A;  3HKB B;  1U96 A;  1QLE B;  4JI2 O;  4LF6 O;  1NU1 H;  4MTO A;  1CP9 A;  1HNZ O;  3CCR V;  4LF8 B;  4X66 B;  3BEH A;  2EUL A;  1P84 F;  4HNA B;  1QLN A;  1NBM G;  3ZMS A;  1KMI Z;  1QR9 A;  2YEV A;  1YVW A;  1E1Q G;  3PN1 A;  4FK5 C;  4IIJ A;  1JQ0 A;  5DN6 G;  2WSS G;  2DYR B;  3H9V A;  3B8N A;  3WB2 A;  4O4L A;  4EEQ A;  2QE7 G;  3HKD A;  1S72 V;  3TET A;  1PPJ H;  4IIJ B;  3T4D A;  2JEX A;  1EFR G;  4CC6 A;  3H1I H;  2ZE8 A;  1DTO A;  4JYY A;  4TT3 G;  3K9A A;  2YI9 A;  3HKE A;  3GWO A;  2CUG A;  4OX9 O;  4HZ3 A;  1AR1 B;  1H8H G;  4JI5 O;  4XBF A;  4U7O A;  5IYZ A;  3ETD A;  1I94 O;  5IYB O;  4JI1 O;  3MDS A;  4UVC A;  4WFE A;  2A06 H;  3DTU B;  2RCV A;  2AZ2 A;  4ABM A;  2EIN B;  4G28 B;  1V55 B;  2ODM A;  2YSU B;  1MA1 A;  1I5X A;  3SPG A;  2HHH O;  1QLE C;  3E22 A;  1Z2G A;  2BE3 A;  1IBL O;  2JDI G;  2ZDI A;  3RBZ A;  4JYA O;  2JS3 A;  1T5E A;  5JJJ B;  1LUW A;  2IJI A;  3GVM A;  4ZHQ B;  1NQT A;  1PM9 A;  3ASN B;  1QHT A;  2V4D A;  4MVZ A;  3OEE G;  1XHX A;  3APO A;  3KG2 A;  4GLX A;  1IUR A;  1OJH A;  3SJA C;  5IWA B;  3QNE A;  1KUQ A;  1MZF A;  2DYR C;  4GX2 A;  1KP2 A;  1KP3 A;  2XOK G;  2F66 C;  4J11 A;  4DR6 O;  4UVA A;  1Y6X A;  2E75 B;  3AK2 A;  4DV3 O;  3OFN G;  4QE7 A;  2PYJ A;  3MD0 A;  1PV0 A;  3O65 A;  4FFK A;  4ZKI A;  4CH4 A;  4PDL A;  1Q6U A;  3ZRW B;  3U11 A;  1E79 G;  1S0V A;  1HDJ A;  3CB2 A;  5EBW C;  4B3T B;  1RPO A;  2QJ1 A;  3SPI A;  1EN5 A;  3DGE A;  1JFF A;  4JAU A;  1Q90 D;  4YJ2 A;  4I4T A;  1Q81 W;  1NJI W;  3RVZ A;  2IH3 C;  5E1A C;  2F1M A;  1K5S A;  3OGC C;  1JFF B;  3CCL V;  1BQ0 A;  4YJ2 B;  4FM1 A;  4B08 A;  1Y66 A;  1S3J A;  1NTM H;  3CHX A;  1FS0 G;  4DV5 B;  1RPR A;  4IYH A;  3ASN C;  4CH6 A;  2CTR A;  2YIB A;  4Q6G A;  2Q0A A;  1G8M A;  1L8D A;  1D5A A;  5JVD B;  1R1B A;  1KKC A;  4JTD B;  2R72 A;  1GN2 A;  2EZP A;  3G71 V;  4AQY B;  4FLT A;  4YJ3 B;  1OCO B;  3W7T A;  3CEI A;  4X66 O;  5JVD A;  1NVP D;  2XTA A;  4NVP A;  4N23 A;  2GHY A;  4LP8 A;  3F5T A;  4LNU A;  2HP8 A;  3HKD B;  1ZTE A;  1GAX A;  3KZI Z;  4JI5 B;  2XAG A;  5IE9 A;  1HNX O;  4K0K B;  3ZIA G;  5JJE B;  3VQY A;  4YIO A;  1ORQ C;  3QVN A;  5KHJ A;  3E8F A;  4U3J B;  5KHI A;  2X0L A;  4QIW F;  1M93 A;  2WPD G;  2QSA A;  1GM9 A;  2OT5 A;  1VF6 C;  1COW G;  1UFI A;  3LSQ A;  3WU2 Z;  1SA0 B;  3K5O A;  2DE0 X;  3D3I A;  1QCE A;  2QR4 A;  3E22 B;  3WG7 C;  1S5H C;  3O9O A;  4LFB B;  1US6 A;  2B9Z A;  4IYI A;  2CH7 B;  4PJ0 Z;  1SA0 A;  2BSK B;  1WA8 B;  3ABM B;  1FYJ A;  2E76 B;  1SZX A;  5GW7 A;  2KKW A;  3FD9 A;  2CH7 A;  3CC7 V;  3CS5 A;  1AJN A;  1SRY A;  2Q7H A;  3E8G A;  5B3S B;  4B7E A;  1TGO A;  2OCC B;  1YJ9 V;  4B7K A;  3H1H H;  3EHB B;  3QTC A;  5KHG A;  4BWA A;  2L6L A;  1NH2 B;  5LP6 B;  3ZX6 A;  4MTG A;  2P4K A;  1K3E A;  3JSN A;  4BIZ A;  2XHB A;  4O4J A;  2LW1 A;  4B3M O;  4DV3 B;  1BE3 H;  3OTF A;  4FZ0 A;  4IT5 A;  4QE9 A;  2OTJ V;  1L0N H;  4UCO A;  2UXB O;  3BA8 A;  3K58 A;  2XAJ A;  4LFB O;  5CA3 A;  4BAY A;  2KSD A;  1RM1 B;  5L3E A;  5LOV A;  4X65 B;  2WLJ A;  5IYD O;  2PYL A;  1Q43 A;  2HR3 A;  5DED A;  3ICX A;  1Y67 A;  4OXS A;  2JJ1 G;  1EN6 A;  4X65 O;  3DXR A;  4PDM A;  1P49 A;  1TVK B;  3C3T A;  3FB7 C;  3T1C A;  4BIU A;  1AI7 A;  3H1J H;  1R6K A;  4NR1 A;  1YIJ V;  1IBK O;  3RYC B;  5LGT A;  4GYC B;  5ITZ B;  3W7W A;  4RWU A;  1VQ6 V;  1H2M A;  2IW5 A;  5GTI Z;  2A3Q A;  2GDS A;  4YJ3 A;  1F4M A;  4O2A A;  1R3I C;  1H2K A;  4JZG A;  5LA6 A;  4MVQ A;  1XHZ A;  1Z5V A;  1YJN V;  4JI3 B;  2GV9 A;  3E8H A;  4DV7 O;  2Q68 A;  4O2A B;  1SER A;  1Y76 A;  1KC8 W;  3UQ8 A;  3AG4 B;  1O9G A;  1EBO A;  3K08 A;  2Q8V A;  3STZ C;  3K06 A;  5EC1 C;  1ZL8 A;  3CD6 V;  1N0J A;  3HPL C;  4X1I A;  2WLK A;  2E74 B;  4DV1 O;  2JIZ G;  4X1K B;  1ZL8 B;  2JGU A;  4LBE C;  2YDE A;  2BTQ A;  1LUV A;  2PY5 A;  2RDC A;  3JAK B;  1MMM A;  2A79 B;  1K4C C;  2W6I G;  5GON A;  4GX1 A;  2Q9L A;  1WPX A;  2OIE A;  5KAF Z;  2AHZ A;  1W0J G;  2AZ0 A;  1HP8 A;  4X64 B;  4GKK B;  4GKJ B;  2VQF O;  1N33 B;  5J2T B;  5GON B;  4OPH A;  1SES A;  2HKO A;  4ICG A;  4L8J A;  5LBQ A;  3ZRV A;  5FL7 G;  4ZBM A;  4JI4 B;  1TUE B;  4JTA B;  3D8C A;  3OMN B;  2W6J G;  5J2T A;  1WPB A;  3KCY A;  2YEV B;  2LGQ A;  4TSF G;  2Y69 B;  2UXC O;  3HR0 A;  1YZB A;  3D36 C;  3JCU Z;  1K9M W;  4UUJ C;  2CGO A;  4X8A A;  1ZAU A;  4N21 A;  4PA6 A;  4YY3 O;  4CS4 A;  1GN4 A;  4U7N A;  2Q67 A;  5KAI Z;  1G1X B;  4PI2 A;  3I55 V;  4O4J B;  4JI4 O;  4HAM A;  2MW2 B;  2NN4 A;  2XAH A;  2ZXW C;  3HKE B;  2M6Y A;  1R3L C;  3UKM A;  3ABK C;  1PNM A;  2F23 A;  3QG5 A;  2WA3 A;  3P3N A;  5IYZ B;  4B3M B;  2JJ2 G;  4DUY O;  1A32 A;  2ZR2 A;  4ZI7 A;  1SQB H;  3ZN1 A;  4JAA A;  3G6B A;  4MTF A;  1M9N A;  4F6E A;  3RN4 A;  2FL4 A;  3CX5 F;  3WFV A;  3ETG A;  4PA9 A;  4LFA O;  1OCC B;  1GRJ A;  4P30 A;  2QWP B;  1N32 O;  1FFX B;  2A0L A;  4GT1 A;  1P4R A;  3L73 H;  1SC5 B;  3RYC A;  1GH6 A;  4JYA B;  2CDY A;  2JGD B;  2QM7 A;  2Q6A A;  3KCX A;  4R8C A;  2UUB O;  1W59 A;  1J5E O;  5CA1 B;  3EFF K;  3P3P A;  3CSX A;  2XAQ A;  2JGD A;  3CE2 A;  1DK1 A;  2F4V B;  3FAV B;  2N74 A;  3K9S A;  5JH7 B;  2MK3 A;  2H8P C;  5CA1 A;  2ZE7 A;  4I55 A;  3A2F A;  3CWB H;  3CRC A;  2EIJ B;  5JH7 A;  2BOC C;  3N27 A;  5KHK A;  4J80 A;  3LUT B;  1OV9 A;  3ZMU A;  2QWQ B;  2EBO A;  3JAS A;  1Q7Y W;  5A2Q N;  4OGQ B;  1J5E B;  4X1I B;  4AI8 A;  5B1A C;  1M56 C;  1IXM A;  5AG2 A;  1VQL V;  3OGI B;  4DV6 B;  5KUK A;  3AK1 A;  1AIL A;  4H37 A;  1SQQ H;  5KLV H;  1K5Q A;  4FVM A;  1YJW V;  1V54 B;  3A0H Z;  1AR4 A;  5EBL C;  3B40 A;  3R66 A;  2EZO A;  4JV5 O;  4PHZ A;  4XDL A;  4H13 B;  3CRR A;  1JPX A;  3JSL A;  3H01 A;  4MVS A;  3K57 A;  4DK0 A;  2Y69 C;  4DRX A;  4X89 A;  1IZ3 A;  2Q5Z A;  4DV0 B;  2VRZ A;  3FKS G;  2DW4 A;  2B1I A;  1D5N A;  1PD3 A;  1WN7 A;  1KEC A;  5BZB A;  4X62 O;  3C90 A;  4KXR A;  2XAS A;  3JD0 A;  3TJT A;  4O4H A;  5EIB C;  1WP8 A;  4LNU B;  2LQT A;  3AG1 C;  4DV1 B;  1EM1 A;  1X59 A;  1HWY A;  2QWO B;  3K3W A;  2B1G A;  4FLU A;  4O4L B;  4O4H B;  4MW8 A;  1BQZ A;  4PV1 B;  1URF A;  1XNQ O;  2CAZ C;  2ZXW B;  3N2G A;  1E1R G;  2ZKO A;  3ASO B;  3CCS V;  3KKY A;  4P9P A;  1B3Q A;  2UUB B;  1PNL A;  1OCC C;  4ZI7 B;  4RO2 A;  3OAA G;  2OCC C;  3OUF A;  3ZMT A;  2WLM A;  1Q82 W;  3N2G B;  3TXQ A;  4I5S A;  4ZIB A;  1BS3 A;  2HLD G;  3ZHS A;  5TIS Z;  4FLW A;  5EZY A;  2Y48 A;  1QNM A;  1GM8 A;  4MVO A;  2FTK A;  5KUM A;  1F51 A;  4WFF A;  1ZWI C;  1WA8 A;  3MAQ A;  4PA4 A;  2GTA A;  2HEP A;  4TV8 A;  1VEW A;  1KU9 A;  1N32 B;  2BTO A;  3LSS A;  2VS0 A;  5B1B C;  2Y0P A;  2JVD A;  3N2K A;  5LHG A;  2G38 A;  4TV8 B;  2YUA A;  4KHP O;  1CEZ A;  2PGG A;  3NXS A;  1SZT A;  2ZNJ A;  4I55 B;  5BR8 B;  4GUN A;  4W4K A;  3RVY A;  1XRE A;  3BHP A;  1XIL A;  1AI6 A;  3QO5 A;  3TGU H;  2WA4 A;  1YEW A;  1YSC A;  4UCV A;  5B1A B;  3ZMZ A;  4LWS B;  3ZRW A;  5IT9 N;  4UXN A;  4YHH O;  1Y74 A;  4R50 A;  1AB3 A;  1K34 A;  1S5J A;  3OEH G;  1K92 A;  5GTH Z;  1F7Y A;  4FLX A;  4FM0 A;  2LO1 A;  3DXR B;  3QO7 A;  2YIB D;  3B09 A;  4DRX B;  1FFT B;  2YI8 A;  1SS3 A;  3ETQ A;  4DXW A;  2R9A A;  1FXK A;  1N33 O;  1XNQ B;  3X2Q B;  1DLB A;  3F5W C;  4J41 A;  4K8X A;  3CP1 A;  5KX5 B;  3T1Y O;  3SYP A;  4X1Y A;  4DR4 B;  2YXH A;  3K0D A;  2D2C B;  4DV4 B;  3CJH B;  2CE4 A;  3K5L A;  4K0K O;  4DV0 O;  1HNW O;  5K1P A;  3SYA A;  5F2V O;  5LMU B;  3U10 A;  1VQ5 V;  4NKG B;  4BW9 A;  1FKA O;  4MSW C;  3BFR A;  4DR5 B;  1XEQ A;  4NTW A;  4PDV A;  4I9Q A;  3K5N A;  5FNV B;  2UUC B;  4X20 A;  2EIK C;  4U3J A;  1ROP A;  4JI2 B;  2CK3 G;  3ML0 A;  4XDK A;  4MS2 A;  5EZY B;  4LH7 A;  5BXZ A;  4I9W A;  2UUA B;  3A0R A;  3ZS8 C;  2VQE B;  4Z1M G;  1J95 A;  2Y0I A;  4DV2 B;  1I5Y A;  2F93 B;  4DK1 A;  5D5P A;  3S3W A;  4PEL A;  1S76 D;  4DR1 B;  1JX9 A;  1MZE A;  3OR6 C;  4DV7 B;  1VF5 B;  4FFB B;  3RGB A;  2EIN C;  1KYO F;  3ABL C;  4QGP A;  2BCC H;  1BGY H;  1TUB B;  4BR6 A;  4BIO A;  2QEX V;  3OMA B;  4EB6 A;  1FJG B;  1MAB G;  3EVK A;  2ZNI A;  5H2F Z;  1BZK A;  3QF7 A;  5KA6 A;  5LP6 A;  3IGA C;  3ABL B;  3BRC A;  5L3D A;  5JQG B;  2XND G;  3CME V;  5H6Q A;  1RM1 C;  1TUB A;  3VBB A;  1AP6 A;  3VQX A;  1M5I A;  4LF5 B;  1XDC A;  2YXY A;  5J2U B;  1M4U A;  2F4V O;  1H2S B;  3CCQ V;  5JQG A;  5KA5 A;  1N8R W;  1YIT V;  3AG4 C;  1W0K G;  4DV2 O;  3AEI A;  2P90 A;  1XMQ B;  3LSU A;  2UXX A;  1Z5W A;  2WAM A;  5LOV B;  4TWK A;  1JVM A;  2ZM6 B;  2DQ3 A;  4F6R A;  4YIP A;  1BHB A;  3SJQ C;  1ZSP A;  1JJ2 U;  1FXK B;  3K5M A;  5FPO A;  3CC2 V;  4B3T O;  3AK3 A;  4JI6 B;  2PZS A;  1XBL A;  2EIL C;  3DC6 A;  5ITZ A;  1RSO A;  3DSQ A;  4YY3 B;  4I0X A;  4Z2W A;  3SYC A;  5A9G A;  4JI0 O;  4IL6 Z;  2P06 A;  1N34 O;  4R7C A;  3CJH A;  1IVS A;  2X7R B;  1GN3 A;  1BT8 A;  2RJZ A;  1SQG A;  2DYS C;  2ADQ B;  3G67 A;  1AJP A;  2FYU H;  1XL4 A;  2W0F C;  1F23 A;  3BCC H;  1H8E G;  5JCO A;  2Q0O C;  4UFZ A;  1LR1 A;  4LF7 O;  5H5N A;  1VF7 A;  1VMG A;  3E35 A;  4JI7 O;  1NR1 A;  3CCE V;  4X88 A;  5FNV A;  4CS2 A;  3M7M X;  4GX0 A;  2GSM B;  2X6C A;  1FXH A;  3ZBH A;  3SPJ A;  3HB3 B;  1X4T A;  2BTQ B;  2XAF A;  3JAL B;  3FYE B;  4H44 B;  1MSW D;  3BVO A;  3E8B A;  1UJW B;  4I50 B;  3JAT B;  4MW3 A;  4JAS A;  4KL1 A;  3THO A;  4DW0 A;  5LMU O;  4DW1 A;  2E5L O;  1ARO P;  1HW7 A;  4DV4 O;  4LF9 B;  2IJJ A;  3ZRS A;  1K97 A;  4JAV A;  1W2B U;  3FB8 C;  2UXC B;  4UV9 A;  3G4S V;  3SPC A;  4GCZ A;  3T2M A;  4MVM A;  1SET A;  3MHS C;  1TAE A;  3SJB C;  1VQ9 V;  4QJF B;  3BA9 A;  5CBF A;  4RAI A;  4I7Z B;  1ZX3 A;  3FFQ A;  4PDR A;  1JMK C;  3E2E A;  1YDX A;  3ZJZ A;  4TQF A;  2DQ0 A;  2P4V A;  1GTO A;  3SDL A;  2X6B A;  2DWE C;  1PP9 H;  4RQF A;  5B1N A;  4FJC C;  5B1B B;  4UCS A;  3M8A A;  5JWP A;  1AI4 A;  4D7S A;  1OHH G;  2YS8 A;  3VQV A;  4JZ2 A;  1D2D A;  1Q3E A;  2M7W A;  3UCS C;  1BSM A;  2ADP A;  4F6R B;  1R3J C;  4ZOL A;  4LFC B;  1NKD A;  1O9H A;  2ZCE A;  2E3C A;  4PA7 A;  1Y4M A;  1OCR B;  4IHJ A;  4O2B A;  3TXS A;  1AVM A;  5DEC A;  2YIC A;  4ZOL B;  1FFX A;  2YXL A;  2VWK A;  3M99 B;  2P7T C;  3P32 A;  3N2K B;  2ILM A;  4DUZ B;  4IHJ B;  4O2B B;  4CH5 A;  1XNR O;  1OZ0 A;  1OCR C;  1MSD A;  1Q8I A;  1ENV A;  4CS3 A;  4TOI A;  4NTX A;  3D36 A;  2ZM6 O;  4E2L A;  2PI4 A;  2Z0A A;  2KG7 B;  3OD4 A;  5IY5 B;  1VQ4 V;  1K33 A;  2P67 A;  4UVB A;  2WWW A;  1S5L Z;  3VQW A;  1VAR A;  4JTC B;  5B1O A;  4G27 B;  2Q7G A;  1IBM O;  2RMK B;  3JAS B;  4EKW A;  1EZV H;  5H9C A;  1Y74 B;  2ZIO A;  1OCZ B;  4GZR B;  1YF2 A;  3MHH C;  4TV9 A;  1VF6 A;  3JAM N;  1KB9 F;  4LF6 B;  2R9I A;  4GX5 A;  2ZR3 A;  2HVK C;  1N0N A;  3I56 V;  5CB4 B;  2H3O A;  3JAL A;  2FKX A;  4TV9 B;  2ZIN A;  4I50 A;  1MOF A;  3RYF A;  2XT9 A;  1YHQ V;  4DR3 O;  4CZZ A;  2Y4T A;  4FLY A;  4DO2 A;  4OX9 B;  3B8M A;  2QTO A;  2UXN A;  3K79 A;  3RW0 A;  3S3X A;  4J9Y B;  1SQP H;  3OMI B;  1M56 B;  5KMG B;  4DR6 B;  5LHH A;  4X1Y B;  1UPG A;  4KFM A;  1BL8 A;  5J9P C;  2Q4P A;  3LNN A;  1NS1 A;  1HNX B;  2ZD9 A;  1R73 A;  4UCT A;  3SPH A;  5IJ0 B;  4X9Q A;  1AI5 A;  2FML A;  2PTM A;  4J10 A;  2QDO A;  4MT8 A;  3CRA A;  4FIP C;  2HFE C;  5IJ0 A;  3HKC B;  2CGN A;  1NVP B;  1WP7 A;  5C93 A;  1BMF G;  3G80 A;  2IU3 A;  5JJN B;  4FLV A;  1BHA A;  2EIJ C;  5LYJ B;  1YCI A;  3CXH F;  2CTQ A;  4WFH A;  1B06 A;  3AG2 B;  1GMG A;  3B2E E;  1QQC A;  2UU9 B;  4WBN A;  4NXM O;  2QWR B;  2JEU A;  3EXA A;  4LFA B;  3F7Y C;  4J7J A;  1VP7 A;  1KD1 W;  4YXW G;  3UM7 A;  3OE7 G;  3RYH B;  3OTO O;  5H6R A;  3JAR B;  2NLJ C;  4NXM B;  3AG1 B;  5KHH A;  1RFY A;  1V55 C;  1V9P A;  5K1X A;  3ABT A;  2HJF C;  3RYH A;  1THZ A;  3K04 A;  4CC5 A;  1P7B A;  1K4D C;  3PJS K;  1G4Y B;  3APQ A;  4RQE A;  2D3O W;  3ETE A;  1KKD A;  1SQX H;  5B5E Z;  2EJ7 A;  3UO2 A;  4J42 A;  5BR8 O;  3LDE A;  1SF9 A;  2L35 A;  2A7W A;  3J80 N;  2QA4 V;  1M57 C;  2IJH A;  2KG7 A;  3F7V C;  3JD1 A;  3P30 A;  1XNR B;  3CCM V;  5EK0 A;  2IH1 C;  3LDD A;  2AW9 A;  1R6N A;  1H2G A;  4PA3 A;  2WLN A;  1U97 A;  3L71 H;  1G6U A;  5J2U A;  5LL6 Y;  4LH6 A;  1NTZ H;  2CTW A;  4LWS A;  1R6T A;  3W7S A;  3GWK C;  1SKV A;  2HJD A;  4NXN B;  3CYO A;  1H38 A;  1VQP V;  1GM7 A;  2YIA A;  5CB4 A;  4LF8 O;  1JA8 A;  3T1Y B;  4LCU C;  1WAZ A;  4WFG A;  3ZRX A;  3OUS A;  3RYF B;  4Q20 A;  1VQK V;  1HNZ B;  1WLE A;  1IBK B;  1I94 B;  1I0H A;  1JJO A;  1IXB A;  3CRM A;  4JPR A;  5L3B A;  1RSO B;  3Q4H B;  1JCH A;  1HR0 B;  3CRQ A;  1XMO B;  3OM3 B;  1M57 B;  3DC5 A;  4EFB A;  4ASU G;  5KX5 A;  1KBH A;  3ABM C;  1XMQ O;  5E79 Z;  1AP5 A;  1HR0 O;  3CMA V;  1OCO C;  2V1D A;  3BPZ A;  2R70 A;  5IJ9 B;  3NR7 A;  1BCC H;  4LF9 O;  2LW7 A;  4PI0 A;  3UO3 A;  3SYQ A;  2F95 B;  2AXT Z;  3BY6 A;  4OPA A;  2V7Q G;  1QBZ A;  3W7U A;  3CCV V;  4DR7 B;  2ETN A;  4JF3 A;  5LYJ A;  1IX9 A;  3ZHR A;  1DGS A;  4Z1V A;  1FXK C;  4ZHQ A;  4X64 O;  5HFL A;  2UUC O;  3X2Q C;  1FJG O;  2ZQM A;  1YTF D;  5IDJ A;  2R9R B;  3ZCC A;  2ARH A;  3FB5 C;  1L0L H;  3H1L H;  4HBN A;  4QPK A;  4X20 B;  1M90 W;  1RP3 B;  4AIL C;  2DWD C;  1GK9 A;  3BAB A;  4O4I A;  4BW5 A;  1K7D A;  4DUY B;  2WLL A;  4WFA V;  4B3R B;  4FFB A;  3H1K H;  2Z5U A;  1H2N A;  3RWR D;  2ZE6 A;  2WLL B;  2YID A;  2ITC C;  4G2K A;  3G6E V;  2LJ2 A;  1MNG A;  3CXC U;  5LP6 C;  2DMX A;  4EB6 B;  5LMN B;  2ZE5 A;  2CTP A;  1QR8 A;  4J9Z B;  3JAW A;  3ZHT A;  1AR5 A;  2GUZ A;  4FM2 A;  1PNK A;  5IYC O;  1B6Q A;  3OTO B;  1Q6I A;  2P6J A;  2QKC A;  2QWN B;  3HKB A;  3WG7 B;  3K03 A;  3SYO A;  3JD2 A;  3ZHV A;  3JAW B;  1AJQ A;  2UU9 O;  1Q5O A;  2EIM C;  2PI5 A;  2IM9 A;  4R6Z A;  2QTS A;  4TUY A;  5IY5 C;  2Z3Y A;  3IC9 A;  1IDS A;  2HHH B;  2Q73 A;  1LNQ A;  5CMU A;  4AHC A;  5FLX N;  5LXT A;  2NNU A;  1QVF U;  1XOU A;  4K35 A;  5LXT B;  2AGA A;  4H0L B;  4LF4 O;  3FX7 A;  3CCJ V;  1P7G A;  2EIK B;  1XMO O;  4DV5 O;  4I0X B;  2Q69 A;  5JCO C;  3UT5 A;  3B4S A;  3ZHU A;  4LF4 B;  2QM4 A;  1N36 O;  1PL0 A;  2NR5 A;  4UCR A;  3RYI B;  2ZIM A;  3ZMV A;  1XQ8 A;  2DJV A;  2QGN A;  3ZHQ A;  1FXV A;  4FPP A;  3VOU A;  1IBL B;  3AG2 C;  4GKK O;  2AHY A;  4QNH B;  4DUZ O;  4JI1 B;  2ZT9 B;  4DR7 O;  2KB1 A;  2A9H A;  4XDJ A;  1QU7 A;  4J7K A;  4UB8 Z;  1SQF A;  1GKF A;  3T4Z A;  4LC1 A;  2K9P A;  4DR5 O;  1QVG U;  4JI7 B;  5LGN A;  4DYL A;  1FAF A;  3ZED A;  2FB5 A;  4A5U B;  3K0G A;  2ZDI C;  2EIL B;  1HNW B;  4EFE A;  1FPO A;  3JAT A;  2LP7 A;  4FZ1 A;  2HG5 C;  1N4C A;  1IBM B;  1DF5 A;  1XI1 A;  5KMG A;  4MVR A;  4NB5 A;  3R65 A;  2UXB B;  1ZLZ A;  1GN6 A;  2N04 A;  5EBM C;  3TCU A;  2BOB C;  3CCU V;  4U3F H;  4I4T B;  2WLH A;  3FYI B;  4JI6 O;  3HKC A;  4UB6 Z;  3QO8 A;  2QKS A;  3C3S A;  5CBG A;  3LDC A;  1NZ6 A;  4DR1 O;  1DF4 A;  4MTX A;  4NYK A;  4QPJ A;  5LMN O;  3RFR A;  2OYQ A;  2DOS A;  1VQ7 V;  1EZJ A;  2LFS A;  3OR7 C;  2EIM B;  3A0B Z;  5FPR A;  4FLZ A;  5B66 Z;  4TUY B;  2DN9 A;  1Y76 B;  2PUS A;  1CPY A;  3JYC A;  5C8Y B;  2JK5 C;  5BMV B;  2Q7E A;  3OT7 A;  4JV5 B;  2DYS B;  3TK1 A;  3U0Z A;  2RNB A;  1NTK H;  2N05 A;  5C8Y A;  1ZUQ A;  3E86 A;  5BMV A;  3WB0 A;  4DR2 B;  3L9D A;  3ZN0 A;  5L3G A;  4W4L A;  5HFM A;  1XUQ A;  1YI2 V;  3JD3 A;  3JAK A;  3UT5 B;  3OW2 U;  1WNS A;  5CBH A;  1H2L A;  4WCE V;  1TA8 A;  3RYI A;  4K3A A;  5L3F A;  5BY1 A;  5L3C A;  2UUA O;  2GTS A;  4WFB V;  2WLI B;  5LGU A;  2XUM A;  1I7F A;  4JI0 B;  4D7T A;  4P2Z A;  4F4L A;  1EN4 A;  4JI3 O;  5EYP A;  2O57 A;  2WLI A;  4DR3 B;  2BSK A;  1XL6 A;  1NT2 B;  2B5U A;  1M1K W;  4WF9 V;  3L75 H;  4AQY O;  2EJR A;  5LHI A;  4TQD A;  4FMT A;  2LGW A;  1Q6H A;  1JR9 A;  1WB8 A;  1WB7 A;  3JCZ A;  1N36 B;  4HNA A;  4C7U A;  2ITD C;  3AG3 B;  4LF7 B;  3STL C;  1K8A W;  2F43 G;  3ASO C;  1VQ8 V;  4CH3 A;  2EX3 A;  1CXZ B;  1KQS U;  1S77 D; 
#chains in the Genus database with same CATH homology
 1P84 F;  3L74 H;  1PP9 H;  1SQV H;  1L0L H;  2FYU H;  3CX5 F;  3H1L H;  3L75 H;  1NTK H;  3BCC H;  4D6T H;  5KLV H;  1SQQ H;  3H1K H;  4U3F H;  2IBZ H;  1KYO F;  3CWB H;  3TGU H;  1SQX H;  1KB9 F;  1SQP H;  3L71 H;  3L73 H;  1BE3 H;  2BCC H;  1BGY H;  1L0N H;  3L70 H;  1NU1 H;  1NTZ H;  2A06 H;  3H1H H;  1SQB H;  3L72 H;  3H1J H;  1PPJ H;  4PD4 F;  1BCC H;  3CXH F;  3H1I H;  1EZV H;  1NTM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...