3BCCH

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
66
structure length
66
Chain Sequence
b'LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELFDFLHARDHCVAHKLFNSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 20
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3bccH00
2IBZH 3L75H 4U3FH 1SQQH 1NU1H 3L71H 2BCCH 1KYOF 5KLVH 3H1KH 3H1LH 1P84F 1KB9F 3L70H 1SQVH 4D6TH 1NTZH 3BCCH 3L74H 2A06H 3H1HH 1SQPH 3CXHF 3CX5F 1BGYH 3H1IH 2FYUH 1NTMH 1SQXH 1BCCH 1L0NH 3H1JH 1BE3H 3L72H 3L73H 1PPJH 1PP9H 4PD4F 1L0LH 1EZVH 3TGUH 3CWBH 1NTKH 1SQBH
chains in the Genus database with same CATH superfamily
2XT9A 2QE7G 2P06A 4BW5A 4GX1A 1D2DA 3SPHA 1Z2GA 1WJZA 5LOVA 2ZIOA 5JVDA 3CXHF 2QWPB 1CEZA 2HKOA 3FX7A 5IYDO 4K8ZA 1QR9A 3ZHTA 1FXHA 1R3IC 5JJNB 4HZ3A 3K79A 2DWEC 4KHPB 4DV0O 5KLVH 4YJ3A 4I55B 4Q6GA 3OW2U 4FLYA 3BVOA 3P32A 1FKAO 1HNZO 5ITZA 2X0LA 3CCRV 3TK1A 1Q86W 1UPGA 1MOFA 4TV9A 4UV9A 1QNMA 2QM7A 2OWOA 2Y69B 1NI8A 5IY5C 4B3RO 5KUKA 1NR7A 4NTXA 4X20A 4GUNA 1FYJA 4Z1MG 1Q3EA 4DW1A 1JJOA 5AG2A 5E1AC 3CCQV 4O4IA 3ZHVA 4CBCA 1QLEC 2P22C 3GWOA 4LF7O 1OCZB 2Y0PA 1PL0A 4N23A 4G28B 1F51A 4GX0A 4X64B 4EFEA 3APQA 2C2AA 1LUVA 4MW8A 5CA0A 1YHQV 2UXCB 1HDJA 3CCVV 2QWRB 1Q8IA 4QGPA 2V4DA 4JI5B 1AVMA 4MVMA 1WPXA 2RQ6A 5L3DA 2ZM6B 4LH6A 1ZL8A 2CAZC 1Q7YW 1Y66A 4K35A 2HHHO 1YI2V 2CH7B 1N33B 4RAIA 3W7XA 2EX3A 3FD9A 3U11A 5CMUA 2JGDA 1Y76A 4I0XA 3RYCA 4JZGA 2Q7GA 5IJ9B 1XNQO 3ICXA 3ETGA 2Q8VA 2YS8A 3H1HH 2H94A 5H5NA 2VQFB 1QBZA 2R9IA 2PYLA 4GKKO 2Q5ZA 1PP9H 4FFBA 4DR1O 5K1PA 3CHXA 4MSWC 5GONB 3JAKA 1S3JA 2QGNA 2N74A 3IC9A 1QR8A 3SJAC 3OMAB 4GT1A 3CX5F 4O2BB 2UXXA 1VQ8V 4MVZA 4DR7O 2R72A 2Y69C 1VQ9V 4BWAA 4GX5A 3HKEB 2DYRB 2YICA 3CJHB 3ABMB 3OEEG 2CGOA 4GLXA 2X6AA 4O4LA 5LL6Y 1AI7A 2ZE8A 4Q20A 4DV0B 3B4SA 3KZIZ 4YHHB 2IU3A 1GMGA 1OV9A 4LFBO 1IBKB 3ZMUA 2ZKOA 4CH6A 5EZYB 3UO3A 1NH2B 3DGEA 4AQYO 4JF3A 3E8HA 3ZRSA 3OTFA 4DV7B 1NTZH 1Q5OA 1ZWIC 4JI7O 3RBZA 4B3SO 1B04A 3R66A 3TXSA 3ZHUA 3TXQA 2D3OW 1A32A 5CA3A 3RVYA 1IDSA 2Y4TA 4EFBA 4BIOA 5LMUO 5EC1C 1R6TA 3RYIA 2JS5A 5ITZB 1UFIA 1SQVH 2PYJA 1IURA 4TV9B 1P49A 3SYOA 3QO5A 3K5LA 1JOYA 4LFCB 3ABUA 4WFHA 4X20B 3OMIB 4XDJA 2W0XA 2YIAA 2QKCA 2H8PC 3LSSA 3SYAA 3ZEDA 1NT2B 3E8BA 5BMVB 2XTAA 2PGGA 3L70H 2VWKA 5KHJA 4CH3A 1HNWO 1ZTEA 1BL8A 1KMIZ 4L87A 5JQGA 5HFLA 4X62O 3VBBA 5KHKA 2ODMA 3LNNA 5CA0B 4KFMA 1BHBA 3K59A 1S76D 5DM6V 1JQ0A 5EIBD 1RM1C 3ABMC 1TAEA 4DV3O 2Q68A 3CYOA 5KX5A 4OGQB 2OTLV 3L74H 4JGSA 2FL4A 5KA5A 2FYUH 2IW5A 1E1QG 2UUBO 1K8AW 2AHZA 2RMKB 2UXNA 3WU2Z 1IBMO 1Y76B 4MVSA 4J7JA 3RYCB 3DC5A 4DR7B 3P3NA 1Y6XA 2WLHA 1KD1W 1HNXB 4JYCA 3BRCA 1WA8B 1OCCB 5GTIZ 2EBOA 3THOA 4DR4B 3ZMVA 3FB8C 4DW0A 1Q6HA 4UCUA 1U97A 4RUEA 3BA8A 2ZCEA 1K9MW 4E4EA 3E83A 1JFFA 4TWKA 4U3JB 1OHHG 3HR0A 1M90W 4H37A 4I9WA 3ZRXA 1FJGO 1AP6A 3SJQC 4R6ZA 1TGOA 3ZMTA 3UM7A 1GN4A 4NYKA 2EIKB 2WLLA 5JJEB 3OFNG 1QVGU 1N32O 3W7TA 1BHAA 1M57B 2XOKG 2YXHA 1N36O 3DXRB 2QWQB 3LSUA 4WF9V 2ZE6A 4JI6B 4LWSB 2OTJV 3J81N 2DWDC 5B66Z 4B3SB 3L75H 1ORQC 4UVAA 2KSDA 3X2QB 1THZA 4DR5B 1US6A 2PI5A 1SA0A 5FNVB 2Y48A 1VQNV 1AI5A 1PV0A 1F7YA 2X6BA 2BSKB 3CC2V 4PDMA 3H9VA 2A0LA 4OXSA 4JAAA 1HW7A 4L8JA 1ZSPA 4CS4A 2ADQB 2CTRA 3ZBHA 5JCOA 3JATA 5BR8O 2Q67A 1LR1A 2W0FC 4FLWA 2LO1A 1WB7A 3U0ZA 4JI8O 2QDOA 2NR5A 1IBLO 2ZE5A 1RFYA 1V55C 3CP1A 1YEWA 1VQLV 5LGNA 3F5WC 3JAWA 5IJ0A 4H33A 4JI2B 2ZT9B 4WFFA 5CN0A 2JVDA 1YVWA 5GTHZ 4IL6Z 2QR4A 3M99B 5LXTA 2F66C 1NH2D 4DR2B 3MHSC 3CCUV 1NVPB 3A2FA 2F95B 2GTAA 2EILC 1E79G 1KP3A 2WA4A 1GN6A 5LYJA 2IH3C 2EIKC 2WLKA 1SZTA 3TCUA 4ZHQB 4TSFG 3U10A 2WSSG 1DLBA 1FFXA 4C7UA 1M57C 3N27A 4ASUG 2EZOA 1EZJA 2WA3A 4FLXA 3CD6V 2LP7A 2PUSA 4X65O 3SJCC 2YC0A 1H2GA 2CTWA 1VP7A 3RVZA 2OIGA 4FPPA 1EM1A 2CE4A 4JI4B 4FLUA 3O65A 1NKDA 3LDCA 5IWAB 1TUEB 2Q4PA 3ETQA 1P7BA 3OD4A 4HYOA 4OPHA 1N36B 4QJFB 2ZDIA 1YJ9V 1H2SB 4I7ZB 4LNUA 2P6JA 4TT3G 1L8DA 3E22A 2FKXA 1YJNV 4UUJC 4OX9B 1AJNA 1MMMA 3UT5A 1I94O 4ABMA 1IVSA 1M9NA 4PA4A 5LP6A 4F4LA 1MA1A 4JI0B 1ENVA 5IY5B 3CS5A 3CC7V 2ARHA 5J2TB 5JJJB 4X88A 2BTOA 3T4DA 2WLLB 3JALB 1K97A 3G80A 1KB9F 1YTFB 3KCYA 3T1CA 4O4JA 5C8YB 2A06H 2YIBA 1QLNA 1P7GA 2UXDB 1YJWV 1K34A 2EIMC 2XAJA 1FFTB 4TOIA 4PA9A 1F4NA 2IJHA 2YI9A 2L35A 2HEPA 4FLVA 3G67A 1M93A 5KHGA 3SPIA 1WNSA 3K9SA 3M7MX 1XMOO 1SA0B 3HKBB 3EVKA 4CC5A 1R1BA 1S5JA 3C3TA 3H1KH 2JJ1G 5FLXN 4R7CA 4PDVA 1RSOB 1MABG 2QEXV 5F2VO 1SKVA 4LF5B 4O2AB 1XBLA 2FB5A 2R9AA 1YSCA 3CB2A 2A7WA 4F6RB 5KMGA 1F23A 1AJPA 4WFGA 2HJFC 3B77A 1KC8W 3OR7C 5L3GA 2YIDA 3LNMB 4EEQA 1KQSU 3JAWB 1K4DC 4I4TB 1WPBA 5IJ0B 3NR7A 4MT8A 1PPJH 1W59A 4JPRA 4PD4F 4PHZA 3KCXA 1TVKB 3OTOB 5J2UB 4JASA 4EB6A 4WFBV 3ABLB 5DECA 5LXTB 3CRMA 1YF2A 4FZ1A 4TV8B 4DR6O 2GUZA 2WLIA 5B1NA 2EZPA 4CZZA 1J5EB 3AG2C 1XMQB 3KKYA 4UVCA 2IJIA 4MVUA 4JTCB 2FMLA 3IC7A 1JA8A 4DUZO 2A3QA 3JAMN 5HFMA 3AG3C 2Z3YA 4YY3O 2AZ2A 5JH7A 4J9YB 5B3SC 3ZN0A 4ZOLA 2WAMA 2RJZA 2FTKA 4LCUC 2P5OA 3K9AA 2VQEB 5CA1A 1I94B 2QTSA 4WCEV 1Z5VA 4JYAB 3DTUB 4LFAO 3EFFK 3VQXA 1ZAUA 4HNAA 4NTYA 1Q6IA 3DC6A 2XUMA 1BSMA 4NXMO 1VQ6V 4X9QA 4KUMA 4NVPA 1G1XB 1NVPD 2LW1A 4X66O 2HJDA 4PJ0Z 4FZ0A 5JCOC 3J80N 2QSAA 3K5MA 5H6RA 4LNUB 4NXNB 3E22B 1URFA 1JMKC 4DV6B 1HP8A 3UT5B 2N05A 1B6QA 2UU9O 3RYFA 2RN9A 3FKSG 4LF4O 1SERA 1ZLZA 3UKMA 4LF9B 4JAUA 4CH5A 5DEDA 3RN4A 1BCCH 1VARA 5KA6A 3TETA 1L0LH 3JASA 2LFRA 4AILC 4R50A 4B3TO 2HLDG 3ABLC 2IJJA 3G6EV 4X1KB 3P3PA 2Y0IA 1VQKV 3K08A 1IXBA 2CTQA 1WP7A 3RFRA 3K58A 2VWJA 2NN4A 4DV1O 3FB7C 1I08A 4MTFA 3MAQA 1DF4A 2ITCC 3BABA 1N0JA 3D3QA 2Q9LA 1XOUA 2Q7HA 3JSNA 2CDYA 3K03A 3SGIA 1QCEA 2WPDG 1RM1B 1J95A 5IYZB 1FXKA 2GHYA 1KKCA 3ASOC 2ZE7A 4K8XA 3ZMSA 3HPLC 4PA7A 3K04A 1R73A 5LA6A 2W6IG 4DV2O 1HNZB 3QF7A 3CXCU 5EBLC 1YTFD 1SQBH 4FLZA 3SYQA 4FM1A 4E2LA 1XL4A 4U7NA 4W4KA 5LOVB 4DUZB 4J9ZB 3DSQA 4B3RB 3ABTA 5JVDB 3MHHC 4K3AA 1HR0O 2NLJC 3QO8A 4UVBA 3K5NA 3WB0A 4WFEA 4BR6A 4LF7B 2MK3A 4IYIA 2ZDIC 2EULA 5LHHA 3TGUH 4JZ2A 1K92A 4YJ3B 4TUYA 2JIZG 2WLIB 1LUWA 1COWG 3VQVA 3CCLV 5LP6C 2UUAO 1K5QA 4AI8A 2AXTZ 2IH1C 4DV5O 3B09A 4JI1O 4ZKIA 2X7RB 4O4HA 3OMNB 1K33A 3FB6C 3ZN1A 4CS2A 4WBNA 4O4IB 2HHHB 3FFQA 1I0HA 4DR3O 1GAXA 2BTQA 4UB8Z 1Z5WA 5CA1B 1GTOA 1XEQA 2XNDG 4P2ZA 1XNQB 3LDEA 1L1FA 1PM9A 3IFXA 2ILMA 1F4MA 4LF4B 5CB4A 1YITV 2F43G 3ETEA 3W7SA 1R3JC 2YI8A 5JWPA 4F6EA 4HNAB 4P9OA 3GVMA 4ICGA 2LQTA 4YIOA 4GKKB 2QWOB 3LSQA 3OE7G 4RQEA 1W0JG 4ZI7A 5KHIA 2QA4V 4DR1B 4B3TB 1ZL8B 2YXYA 1V55B 4X8AA 2VRZA 1MSDA 4NKGB 2UUCO 2JGDB 4I0XB 1XDCA 2ZR2A 3AEIA 4LF8O 3JARA 4QIWF 1D5NA 1M56C 1EFRG 2UXBO 3HKCA 4IIJA 3BAAA 2LGQA 2NNUA 4MVRA 2YSUB 3RGBA 1N8RW 3T1YO 1AI4A 4YJ2A 1MG1A 3CPWU 2F4VO 3EXAA 4FFBB 1SS3A 2G38A 1BE3H 1SC5B 1IZ3A 1S5LZ 2AW9A 3JAKB 4LFBB 1BQZA 1BS3A 3A0RA 4GYCB 5B5EZ 3E8GA 2BCCH 4DV2B 3ZX6A 2EILB 2XHBA 4RO2A 1OCOC 1OCRC 1VQPV 2LFSA 1Y67A 3CRQA 5EBWC 4K0KO 1M5IA 1XNRO 4UCOA 3AG4B 4AQYB 1KP2A 3SYPA 3STZC 4X89A 3E8FA 4MS2A 1HR0B 2GTSA 4JI7B 3JD0A 4O4LB 4FLTA 3RWRD 1XQ8A 3F5TA 1G8MA 2L6LA 3N2GA 3UO2A 4P9PA 1K5SA 4LH7A 4FM0A 5LMUB 2DMXA 1NR1A 2R70A 1N4CA 2EJRA 4CC6A 2UUAB 1R6KA 4MVQA 4G27B 3B8MA 3OAAG 4FMTA 2YIBD 1KECA 2XAGA 5EC2C 3SJBC 2B1IA 3ZCCA 1PNLA 4OPAA 4J80A 4PDRA 1AR5A 1N34O 5C93A 2BOCC 4DRXA 2ZINA 1JCHA 1X4TA 2DQ0A 4PA3A 2P4KA 1TUBA 2Z0AA 2LGWA 1SRYA 3HB3B 3KG2A 1H2NA 4G2KA 1HNWB 4TUYB 3TJTA 1NTKH 3G4SV 2OYQA 3FYEB 2EINB 3RYIB 4X62B 4PELA 1PL4A 1XUQA 4H44B 4TQDA 2QWNB 4DV3B 4QNHB 3O9OA 4MTGA 1B06A 4IGGA 1GK9A 5TISZ 1N0NA 1JR9A 1M1KW 4JI3O 3AK1A 4O4HB 2EIMB 3H1JH 2O57A 2EIJB 3ZHRA 2BE3A 5KHHA 4YIPA 4WBNB 4UCRA 2HVKC 3FYIB 4AHCA 2UUBB 4DUYO 1IBMB 1KYOF 4WFAV 3NXSA 2E5LO 4LF8B 1W0KG 1QHTA 4I55A 4D7TA 2UXBB 3AG4C 5JQGB 4BAYA 4J10A 3SR2C 5A2QN 1AP5A 5KAIZ 2H3OA 3CCSV 3WB1A 2JEXA 2F93B 2ZXWC 3L72H 3T1YB 2P90A 1NQTA 1XREA 4DK0A 5KX5B 3ZRWA 4B7EA 1FXKC 1S0VA 4J41A 3ZHQA 4RWUA 5LGTA 1FJGB 3H01A 1SQPH 2JRIA 4RUFA 2MW2B 3SDLA 3C3SA 3I5DA 2BOBC 1Q90D 1XNRB 1X59A 1N32B 3HKCB 3CWBH 4B08A 2LJ2A 1YDXA 4CS3A 4YJ2B 2GSMB 5CBGA 3J7AU 3AG2B 1JFFB 3EHBB 5D5QA 4IHJA 4UXNA 4P30A 4JYBA 3Q4HA 2CH7A 1K3EA 1MZEA 2EINC 1Y74A 3AG3B 3LDDA 4NR1A 4W4LA 1SZXA 3OUSA 5CBHA 5B3SB 1QVFU 2A9HA 1QQCA 2WWWA 5BR8B 4J42A 3IAYA 4X64O 3W7WA 4JYYA 4UCTA 4FFKA 2RDCA 2WLMA 2WLJA 2EIJC 4JI8B 2UXCO 1IBLB 1R3LC 5B1BC 4FK5C 3D3IA 4FVMA 4JI5O 1BQ0A 2ETNA 4GZRB 4FIPC 2B5UA 1W2BU 3D36A 2E75B 2ZM6O 5GONA 1S5HC 2VS0A 3VOUA 1N33O 2XAFA 4H0LB 4I50A 4O2BA 3B8NA 3E86A 2AGAA 3BA9A 3JATB 3K5OA 4ZBMA 2Z5UA 3OM3B 3G71V 4DXWA 1H2LA 1M4UA 1FXVA 3HKEA 1DF5A 4DRXB 5K1XA 1XL6A 1GRJA 3CJHA 3P30A 1RPOA 1PNKA 5EBMC 5EYPA 4QE7A 4PI2A 1VQ5V 1SETA 5LGUA 4JAVA 3N2KA 4HBNA 3F7YC 3K06A 1FD9A 1VEWA 3R65A 3MDSA 2JJ2G 3SYCA 4X1YA 4R8CA 5B1OA 2ZR3A 1KU9A 2D2CB 4X65B 5LMNO 2EJ7A 1P84F 3OT7A 2HVJC 3IJ4A 3W7UA 1KKDA 3JD1A 1K7DA 1G4YB 1CPYA 3JD4A 3OR6C 3G6BA 3D8CA 4U7OA 3S3WA 1BMFG 1GM8A 4IYHA 5B1AC 3CMAV 3A0BZ 2DOSA 2IJKA 4YHHO 1YZBA 5LYJB 3QG5A 1IBKO 1FFXB 4BW9A 3WB2A 1T5EA 1IXMA 3RYHA 3ASOB 3PN1A 3UCSC 1AILA 5BZBA 3CRAA 1E1RG 3JCZA 1MZFA 3ZRWB 4XDKA 1AR1B 2DYSC 3ML0A 1SQFA 3ETDA 1XHXA 4JV5O 2JGUA 4DV7O 4JTDB 1SQQH 4DK1A 5BXZA 2XAHA 1BZKA 5BMVA 2CTPA 3HKDA 2ZNIA 4TQFA 1WAZA 4LF6O 4UCVA 3L73H 1NZ6A 2HR3A 4KP4A 3JSLA 1VQOV 2CK3G 3JYCA 4PA6A 4LFCO 4YXWG 1AR4A 2GDSA 5H6QA 4IHJB 3ZJZA 5LP6B 5LHIA 1XMOB 5H9CA 3MD0A 1OJHA 3FB5C 3K0GA 3Q4HB 2IM9A 3AK2A 4NB5A 1Y74B 3B2EE 2YUAA 1VIBA 2KG7A 4O4JB 5BY1A 3CEIA 4B3MO 1WA8A 1Y4MA 2B1GA 1IX9A 4UFZA 4BIZA 1JJ2U 1SESA 1V54B 1FAFA 3JCUZ 2Q0AA 2P7TC 1EN5A 4U3JA 1H8HG 3CCMV 3OGIB 3RT3C 4I9QA 3T1HO 4KL1A 5EIBC 4I50B 5IDJA 1CP9A 4IT5A 5LMNB 2OCHA 3UQ8A 1EBOA 1SQXH 4J7KA 4DR6B 1L0NH 3T4ZA 5KMGB 1HNXO 1WLEA 3DXRA 3S3XA 5H2FZ 3CCJV 3BPZA 4DR4O 4LWSA 4X1IA 5EYPB 1KBHA 1M56B 3N2KB 2YDEA 3CE2A 1OCZC 3BCCH 3F7VC 4YY3B 5FNVA 1DK1A 4ZIBA 4X1YB 1PNMA 2Q73A 1XILA 2RCVA 2BSKA 4H13B 4PV1B 1XI1A 4EB6B 4GCZA 3CRCA 2YXLA 3ZIAG 1JPXA 2IBZH 1I5XA 1ZUQA 3L71H 4EKWA 2GUZB 1UJWB 2RNBA 3B40A 4JV5B 2M6YA 4LFAB 2Q0OC 1LNQA 1OCOB 3AK3A 1OCRB 4JI6O 5KAFZ 3H1IH 2PY5A 4NXMB 5EK0A 4Z1VA 1VF6A 4Z2WA 1GKFA 4X66B 4LF6B 1VQ7V 4DR5O 2AHYA 1WP8A 1JVMA 4GKJO 5JH7B 3RYHB 4ZOLB 3QVNA 1GH6A 3K57A 2HG5C 1SQGA 3AG7A 1GM7A 2QM8A 1CXZB 5E79Z 4KXRA 2ZNJA 3I55V 1Q6UA 5LBQA 3WG7B 2OIEA 3C90A 2YEVA 1GO3F 4LP8A 1V54C 2UU9B 1D5AA 3K0DA 4UV8A 4GX2A 1EZVH 3D36C 4MTXA 1WB8A 2QJ1A 3HKDB 4J7ZA 3WFVA 1PD3A 4N21A 1AB3A 4JI2O 4JTAB 2JDIG 4ZHQA 1O9HA 1Q43A 4MW3A 4DYLA 4B3MB 2E74B 3OUFA 2ATKC 4DV1B 2DYRC 2QM4A 3BY6A 4U3FH 3BEHA 3RYFB 4DR2O 1VMGA 5FPOA 3ABKB 3CSXA 2QKAA 3STLC 3T1HB 1K73W 3JASB 1NS1A 1QU7A 4XDLA 3VQWA 1V9PA 4PI0A 1GM9A 2KG7B 5A9GA 2JK5C 3E2EA 2A79B 3H1LH 4PDLA 2DE0X 1AROP 5IYBO 3QO7A 3GWKC 4D7SA 1K4CC 1OZ0A 2X6CA 2QTOA 1VF7A 2ZXWB 3VQYA 3I56V 5L3FA 2R9RB 4JI4O 2Q7EA 5FPRA 1R6NA 2Q69A 1I7FA 2N04A 1FXKB 5J2TA 5IWAO 3ZMZA 2KKWA 3A8TA 1RPRA 1NJIW 3SPGA 2CGNA 3JALA 3QNEA 4DV4O 3WG7C 5LA6B 4UB6Z 3LUTB 5C8YA 3ZS8C 2PF4E 3M8AA 4QE9A 1MSWD 2P67A 4X1IB 2ITDC 2GBOA 4OX9O 1BT8A 4DV5B 1WN7A 2ZQMA 4JI1B 4I5SA 1GN3A 2OCCB 1G6UA 3ZHSA 3HKBA 2KQXA 1VQ4V 4GKJB 4JI0O 1SF9A 3FAVA 3AG1B 3RW0A 4DR3B 4XBFA 3QTCA 1RSOA 2HFEC 1NTMH 2KB1A 4O2AA 2AZ0A 1S72V 3ASNB 2HP8A 1U96A 4F6RA 1JX9A 1NU1H 3GB7C 2UXDO 3ABKC 1PKXA 4HAMA 1HWYA 5D5PA 1S77D 2PI4A 1R3KC 4I4TA 1NBMG 3OGCC 5B1BB 1O9GA 1TVKA 5J2UA 2BTQB 2UUCB 1YXBA 5FL7G 1OCCC 4LF5O 4J11A 3CRRA 4QPKA 2YEVB 2DN9A 3PJSK 1TA8A 1H8EG 3CCEV 1Q82W 4TV8A 1KUQA 2DJVA 2B9ZA 5CB4B 4CH4A 1VF5B 3K3WA 4QPJA 5GW7A 2F23A 1YCIA 3BFRA 4LBEC 4NTWA 4MVOA 3ZRVA 2F4VB 3SPCA 4ZI7B 3L9DA 5L3CA 5IE9A 2ZIMA 1AJQA 1BGYH 3CMEV 3OTOO 4BIUA 5DN6G 2V1DA 4KHPO 4DO2A 1ZX3A 3JARB 4K0KB 2DQ3A 3APOA 1VQMV 4IIJB 1J5EO 3E35A 4UCSA 1P4RA 3IGAC 3X2QC 3A0HZ 2JS3A 2OCCC 2XASA 1XMQO 2GV9A 3JD3A 2PTMA 5KUMA 3AG1C 1EN6A 2Y4UA 3SPJA 3E89A 4RQFA 4DV4B 1B3QA 4B7KA 5B1AB 3ASNC 2K9PA 2LW7A 2W6JG 1GN2A 4MTOA 3CC4V 2VQEO 2E76B 2IU0A 5IJ9A 4JYAO 4A5UB 1VF6C 1H2MA 2OT5A 1N34B 1XHZA 5IT9N 4FM2A 2QKSA 2DYSB 1FS0G 2ADPA 1RP3B 5CBFA 1ROPA 1H38A 2CUGA 2E3CA 2F1MA 1FPOA 3JD2A 3N2GB 4LC1A 1DTOA 4LR3A 4X1KA 1QLEB 5J9PC 4NXNO 4FJCC 5LHGA 1I5YA 4DV6O 2V7QG 1DGSA 2XAQA 2P4VA 2DW4A 4JI3B 1EN4A 1H2KA 2WLNA 5L3BA 1AI6A 4LF9O 3BHPA 3FAVB 2VQFO 5L3EA 2K1EA 3T2MA 2Q6AA 4D6TH 1TUBB 3OEHG 5IYZA 4DUYB 2JEUA 1YIJV 2M7WA 2E5LB 1Q81W 5IYCO 2ZD9A 1MNGA 2PZSA 5EZYA
chains in the Genus database with same CATH topology
2IBZH 3L75H 4U3FH 1SQQH 1NU1H 3L71H 2BCCH 1KYOF 5KLVH 3H1KH 3H1LH 1P84F 1KB9F 3L70H 1SQVH 4D6TH 1NTZH 3BCCH 3L74H 2A06H 3H1HH 1SQPH 3CXHF 3CX5F 1BGYH 3H1IH 2FYUH 1NTMH 1SQXH 1BCCH 1L0NH 3H1JH 1BE3H 3L72H 3L73H 1PPJH 1PP9H 4PD4F 1L0LH 1EZVH 3TGUH 3CWBH 1NTKH 1SQBH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IBZ H;  3L75 H;  4U3F H;  1SQQ H;  1NU1 H;  3L71 H;  2BCC H;  1KYO F;  5KLV H;  3H1K H;  3H1L H;  1P84 F;  1KB9 F;  3L70 H;  1SQV H;  4D6T H;  1NTZ H;  3BCC H;  3L74 H;  2A06 H;  3H1H H;  1SQP H;  3CXH F;  3CX5 F;  1BGY H;  3H1I H;  2FYU H;  1NTM H;  1SQX H;  1BCC H;  1L0N H;  3H1J H;  1BE3 H;  3L72 H;  3L73 H;  1PPJ H;  1PP9 H;  4PD4 F;  1L0L H;  1EZV H;  3TGU H;  3CWB H;  1NTK H;  1SQB H; 
#chains in the Genus database with same CATH topology
 2XT9 A;  2QE7 G;  2P06 A;  4BW5 A;  4GX1 A;  1D2D A;  3SPH A;  1Z2G A;  1WJZ A;  5LOV A;  2ZIO A;  5JVD A;  3CXH F;  2QWP B;  1CEZ A;  2HKO A;  3FX7 A;  5IYD O;  4K8Z A;  1QR9 A;  3ZHT A;  1FXH A;  1R3I C;  5JJN B;  4HZ3 A;  3K79 A;  2DWE C;  4KHP B;  4DV0 O;  5KLV H;  4YJ3 A;  4I55 B;  4Q6G A;  3OW2 U;  4FLY A;  3BVO A;  3P32 A;  1FKA O;  1HNZ O;  5ITZ A;  2X0L A;  3CCR V;  3TK1 A;  1Q86 W;  1UPG A;  1MOF A;  4TV9 A;  4UV9 A;  1QNM A;  2QM7 A;  2OWO A;  2Y69 B;  1NI8 A;  5IY5 C;  4B3R O;  5KUK A;  1NR7 A;  4NTX A;  4X20 A;  4GUN A;  1FYJ A;  4Z1M G;  1Q3E A;  4DW1 A;  1JJO A;  5AG2 A;  5E1A C;  3CCQ V;  4O4I A;  3ZHV A;  4CBC A;  1QLE C;  2P22 C;  3GWO A;  4LF7 O;  1OCZ B;  2Y0P A;  1PL0 A;  4N23 A;  4G28 B;  1F51 A;  4GX0 A;  4X64 B;  4EFE A;  3APQ A;  2C2A A;  1LUV A;  4MW8 A;  5CA0 A;  1YHQ V;  2UXC B;  1HDJ A;  3CCV V;  2QWR B;  1Q8I A;  4QGP A;  2V4D A;  4JI5 B;  1AVM A;  4MVM A;  1WPX A;  2RQ6 A;  5L3D A;  2ZM6 B;  4LH6 A;  1ZL8 A;  2CAZ C;  1Q7Y W;  1Y66 A;  4K35 A;  2HHH O;  1YI2 V;  2CH7 B;  1N33 B;  4RAI A;  3W7X A;  2EX3 A;  3FD9 A;  3U11 A;  5CMU A;  2JGD A;  1Y76 A;  4I0X A;  3RYC A;  4JZG A;  2Q7G A;  5IJ9 B;  1XNQ O;  3ICX A;  3ETG A;  2Q8V A;  2YS8 A;  3H1H H;  2H94 A;  5H5N A;  2VQF B;  1QBZ A;  2R9I A;  2PYL A;  4GKK O;  2Q5Z A;  1PP9 H;  4FFB A;  4DR1 O;  5K1P A;  3CHX A;  4MSW C;  5GON B;  3JAK A;  1S3J A;  2QGN A;  2N74 A;  3IC9 A;  1QR8 A;  3SJA C;  3OMA B;  4GT1 A;  3CX5 F;  4O2B B;  2UXX A;  1VQ8 V;  4MVZ A;  4DR7 O;  2R72 A;  2Y69 C;  1VQ9 V;  4BWA A;  4GX5 A;  3HKE B;  2DYR B;  2YIC A;  3CJH B;  3ABM B;  3OEE G;  2CGO A;  4GLX A;  2X6A A;  4O4L A;  5LL6 Y;  1AI7 A;  2ZE8 A;  4Q20 A;  4DV0 B;  3B4S A;  3KZI Z;  4YHH B;  2IU3 A;  1GMG A;  1OV9 A;  4LFB O;  1IBK B;  3ZMU A;  2ZKO A;  4CH6 A;  5EZY B;  3UO3 A;  1NH2 B;  3DGE A;  4AQY O;  4JF3 A;  3E8H A;  3ZRS A;  3OTF A;  4DV7 B;  1NTZ H;  1Q5O A;  1ZWI C;  4JI7 O;  3RBZ A;  4B3S O;  1B04 A;  3R66 A;  3TXS A;  3ZHU A;  3TXQ A;  2D3O W;  1A32 A;  5CA3 A;  3RVY A;  1IDS A;  2Y4T A;  4EFB A;  4BIO A;  5LMU O;  5EC1 C;  1R6T A;  3RYI A;  2JS5 A;  5ITZ B;  1UFI A;  1SQV H;  2PYJ A;  1IUR A;  4TV9 B;  1P49 A;  3SYO A;  3QO5 A;  3K5L A;  1JOY A;  4LFC B;  3ABU A;  4WFH A;  4X20 B;  3OMI B;  4XDJ A;  2W0X A;  2YIA A;  2QKC A;  2H8P C;  3LSS A;  3SYA A;  3ZED A;  1NT2 B;  3E8B A;  5BMV B;  2XTA A;  2PGG A;  3L70 H;  2VWK A;  5KHJ A;  4CH3 A;  1HNW O;  1ZTE A;  1BL8 A;  1KMI Z;  4L87 A;  5JQG A;  5HFL A;  4X62 O;  3VBB A;  5KHK A;  2ODM A;  3LNN A;  5CA0 B;  4KFM A;  1BHB A;  3K59 A;  1S76 D;  5DM6 V;  1JQ0 A;  5EIB D;  1RM1 C;  3ABM C;  1TAE A;  4DV3 O;  2Q68 A;  3CYO A;  5KX5 A;  4OGQ B;  2OTL V;  3L74 H;  4JGS A;  2FL4 A;  5KA5 A;  2FYU H;  2IW5 A;  1E1Q G;  2UUB O;  1K8A W;  2AHZ A;  2RMK B;  2UXN A;  3WU2 Z;  1IBM O;  1Y76 B;  4MVS A;  4J7J A;  3RYC B;  3DC5 A;  4DR7 B;  3P3N A;  1Y6X A;  2WLH A;  1KD1 W;  1HNX B;  4JYC A;  3BRC A;  1WA8 B;  1OCC B;  5GTI Z;  2EBO A;  3THO A;  4DR4 B;  3ZMV A;  3FB8 C;  4DW0 A;  1Q6H A;  4UCU A;  1U97 A;  4RUE A;  3BA8 A;  2ZCE A;  1K9M W;  4E4E A;  3E83 A;  1JFF A;  4TWK A;  4U3J B;  1OHH G;  3HR0 A;  1M90 W;  4H37 A;  4I9W A;  3ZRX A;  1FJG O;  1AP6 A;  3SJQ C;  4R6Z A;  1TGO A;  3ZMT A;  3UM7 A;  1GN4 A;  4NYK A;  2EIK B;  2WLL A;  5JJE B;  3OFN G;  1QVG U;  1N32 O;  3W7T A;  1BHA A;  1M57 B;  2XOK G;  2YXH A;  1N36 O;  3DXR B;  2QWQ B;  3LSU A;  4WF9 V;  2ZE6 A;  4JI6 B;  4LWS B;  2OTJ V;  3J81 N;  2DWD C;  5B66 Z;  4B3S B;  3L75 H;  1ORQ C;  4UVA A;  2KSD A;  3X2Q B;  1THZ A;  4DR5 B;  1US6 A;  2PI5 A;  1SA0 A;  5FNV B;  2Y48 A;  1VQN V;  1AI5 A;  1PV0 A;  1F7Y A;  2X6B A;  2BSK B;  3CC2 V;  4PDM A;  3H9V A;  2A0L A;  4OXS A;  4JAA A;  1HW7 A;  4L8J A;  1ZSP A;  4CS4 A;  2ADQ B;  2CTR A;  3ZBH A;  5JCO A;  3JAT A;  5BR8 O;  2Q67 A;  1LR1 A;  2W0F C;  4FLW A;  2LO1 A;  1WB7 A;  3U0Z A;  4JI8 O;  2QDO A;  2NR5 A;  1IBL O;  2ZE5 A;  1RFY A;  1V55 C;  3CP1 A;  1YEW A;  1VQL V;  5LGN A;  3F5W C;  3JAW A;  5IJ0 A;  4H33 A;  4JI2 B;  2ZT9 B;  4WFF A;  5CN0 A;  2JVD A;  1YVW A;  5GTH Z;  4IL6 Z;  2QR4 A;  3M99 B;  5LXT A;  2F66 C;  1NH2 D;  4DR2 B;  3MHS C;  3CCU V;  1NVP B;  3A2F A;  2F95 B;  2GTA A;  2EIL C;  1E79 G;  1KP3 A;  2WA4 A;  1GN6 A;  5LYJ A;  2IH3 C;  2EIK C;  2WLK A;  1SZT A;  3TCU A;  4ZHQ B;  4TSF G;  3U10 A;  2WSS G;  1DLB A;  1FFX A;  4C7U A;  1M57 C;  3N27 A;  4ASU G;  2EZO A;  1EZJ A;  2WA3 A;  4FLX A;  3CD6 V;  2LP7 A;  2PUS A;  4X65 O;  3SJC C;  2YC0 A;  1H2G A;  2CTW A;  1VP7 A;  3RVZ A;  2OIG A;  4FPP A;  1EM1 A;  2CE4 A;  4JI4 B;  4FLU A;  3O65 A;  1NKD A;  3LDC A;  5IWA B;  1TUE B;  2Q4P A;  3ETQ A;  1P7B A;  3OD4 A;  4HYO A;  4OPH A;  1N36 B;  4QJF B;  2ZDI A;  1YJ9 V;  1H2S B;  4I7Z B;  4LNU A;  2P6J A;  4TT3 G;  1L8D A;  3E22 A;  2FKX A;  1YJN V;  4UUJ C;  4OX9 B;  1AJN A;  1MMM A;  3UT5 A;  1I94 O;  4ABM A;  1IVS A;  1M9N A;  4PA4 A;  5LP6 A;  4F4L A;  1MA1 A;  4JI0 B;  1ENV A;  5IY5 B;  3CS5 A;  3CC7 V;  2ARH A;  5J2T B;  5JJJ B;  4X88 A;  2BTO A;  3T4D A;  2WLL B;  3JAL B;  1K97 A;  3G80 A;  1KB9 F;  1YTF B;  3KCY A;  3T1C A;  4O4J A;  5C8Y B;  2A06 H;  2YIB A;  1QLN A;  1P7G A;  2UXD B;  1YJW V;  1K34 A;  2EIM C;  2XAJ A;  1FFT B;  4TOI A;  4PA9 A;  1F4N A;  2IJH A;  2YI9 A;  2L35 A;  2HEP A;  4FLV A;  3G67 A;  1M93 A;  5KHG A;  3SPI A;  1WNS A;  3K9S A;  3M7M X;  1XMO O;  1SA0 B;  3HKB B;  3EVK A;  4CC5 A;  1R1B A;  1S5J A;  3C3T A;  3H1K H;  2JJ1 G;  5FLX N;  4R7C A;  4PDV A;  1RSO B;  1MAB G;  2QEX V;  5F2V O;  1SKV A;  4LF5 B;  4O2A B;  1XBL A;  2FB5 A;  2R9A A;  1YSC A;  3CB2 A;  2A7W A;  4F6R B;  5KMG A;  1F23 A;  1AJP A;  4WFG A;  2HJF C;  3B77 A;  1KC8 W;  3OR7 C;  5L3G A;  2YID A;  3LNM B;  4EEQ A;  1KQS U;  3JAW B;  1K4D C;  4I4T B;  1WPB A;  5IJ0 B;  3NR7 A;  4MT8 A;  1PPJ H;  1W59 A;  4JPR A;  4PD4 F;  4PHZ A;  3KCX A;  1TVK B;  3OTO B;  5J2U B;  4JAS A;  4EB6 A;  4WFB V;  3ABL B;  5DEC A;  5LXT B;  3CRM A;  1YF2 A;  4FZ1 A;  4TV8 B;  4DR6 O;  2GUZ A;  2WLI A;  5B1N A;  2EZP A;  4CZZ A;  1J5E B;  3AG2 C;  1XMQ B;  3KKY A;  4UVC A;  2IJI A;  4MVU A;  4JTC B;  2FML A;  3IC7 A;  1JA8 A;  4DUZ O;  2A3Q A;  3JAM N;  5HFM A;  3AG3 C;  2Z3Y A;  4YY3 O;  2AZ2 A;  5JH7 A;  4J9Y B;  5B3S C;  3ZN0 A;  4ZOL A;  2WAM A;  2RJZ A;  2FTK A;  4LCU C;  2P5O A;  3K9A A;  2VQE B;  5CA1 A;  1I94 B;  2QTS A;  4WCE V;  1Z5V A;  4JYA B;  3DTU B;  4LFA O;  3EFF K;  3VQX A;  1ZAU A;  4HNA A;  4NTY A;  1Q6I A;  3DC6 A;  2XUM A;  1BSM A;  4NXM O;  1VQ6 V;  4X9Q A;  4KUM A;  4NVP A;  1G1X B;  1NVP D;  2LW1 A;  4X66 O;  2HJD A;  4PJ0 Z;  4FZ0 A;  5JCO C;  3J80 N;  2QSA A;  3K5M A;  5H6R A;  4LNU B;  4NXN B;  3E22 B;  1URF A;  1JMK C;  4DV6 B;  1HP8 A;  3UT5 B;  2N05 A;  1B6Q A;  2UU9 O;  3RYF A;  2RN9 A;  3FKS G;  4LF4 O;  1SER A;  1ZLZ A;  3UKM A;  4LF9 B;  4JAU A;  4CH5 A;  5DED A;  3RN4 A;  1BCC H;  1VAR A;  5KA6 A;  3TET A;  1L0L H;  3JAS A;  2LFR A;  4AIL C;  4R50 A;  4B3T O;  2HLD G;  3ABL C;  2IJJ A;  3G6E V;  4X1K B;  3P3P A;  2Y0I A;  1VQK V;  3K08 A;  1IXB A;  2CTQ A;  1WP7 A;  3RFR A;  3K58 A;  2VWJ A;  2NN4 A;  4DV1 O;  3FB7 C;  1I08 A;  4MTF A;  3MAQ A;  1DF4 A;  2ITC C;  3BAB A;  1N0J A;  3D3Q A;  2Q9L A;  1XOU A;  2Q7H A;  3JSN A;  2CDY A;  3K03 A;  3SGI A;  1QCE A;  2WPD G;  1RM1 B;  1J95 A;  5IYZ B;  1FXK A;  2GHY A;  1KKC A;  3ASO C;  2ZE7 A;  4K8X A;  3ZMS A;  3HPL C;  4PA7 A;  3K04 A;  1R73 A;  5LA6 A;  2W6I G;  4DV2 O;  1HNZ B;  3QF7 A;  3CXC U;  5EBL C;  1YTF D;  1SQB H;  4FLZ A;  3SYQ A;  4FM1 A;  4E2L A;  1XL4 A;  4U7N A;  4W4K A;  5LOV B;  4DUZ B;  4J9Z B;  3DSQ A;  4B3R B;  3ABT A;  5JVD B;  3MHH C;  4K3A A;  1HR0 O;  2NLJ C;  3QO8 A;  4UVB A;  3K5N A;  3WB0 A;  4WFE A;  4BR6 A;  4LF7 B;  2MK3 A;  4IYI A;  2ZDI C;  2EUL A;  5LHH A;  3TGU H;  4JZ2 A;  1K92 A;  4YJ3 B;  4TUY A;  2JIZ G;  2WLI B;  1LUW A;  1COW G;  3VQV A;  3CCL V;  5LP6 C;  2UUA O;  1K5Q A;  4AI8 A;  2AXT Z;  2IH1 C;  4DV5 O;  3B09 A;  4JI1 O;  4ZKI A;  2X7R B;  4O4H A;  3OMN B;  1K33 A;  3FB6 C;  3ZN1 A;  4CS2 A;  4WBN A;  4O4I B;  2HHH B;  3FFQ A;  1I0H A;  4DR3 O;  1GAX A;  2BTQ A;  4UB8 Z;  1Z5W A;  5CA1 B;  1GTO A;  1XEQ A;  2XND G;  4P2Z A;  1XNQ B;  3LDE A;  1L1F A;  1PM9 A;  3IFX A;  2ILM A;  1F4M A;  4LF4 B;  5CB4 A;  1YIT V;  2F43 G;  3ETE A;  3W7S A;  1R3J C;  2YI8 A;  5JWP A;  4F6E A;  4HNA B;  4P9O A;  3GVM A;  4ICG A;  2LQT A;  4YIO A;  4GKK B;  2QWO B;  3LSQ A;  3OE7 G;  4RQE A;  1W0J G;  4ZI7 A;  5KHI A;  2QA4 V;  4DR1 B;  4B3T B;  1ZL8 B;  2YXY A;  1V55 B;  4X8A A;  2VRZ A;  1MSD A;  4NKG B;  2UUC O;  2JGD B;  4I0X B;  1XDC A;  2ZR2 A;  3AEI A;  4LF8 O;  3JAR A;  4QIW F;  1D5N A;  1M56 C;  1EFR G;  2UXB O;  3HKC A;  4IIJ A;  3BAA A;  2LGQ A;  2NNU A;  4MVR A;  2YSU B;  3RGB A;  1N8R W;  3T1Y O;  1AI4 A;  4YJ2 A;  1MG1 A;  3CPW U;  2F4V O;  3EXA A;  4FFB B;  1SS3 A;  2G38 A;  1BE3 H;  1SC5 B;  1IZ3 A;  1S5L Z;  2AW9 A;  3JAK B;  4LFB B;  1BQZ A;  1BS3 A;  3A0R A;  4GYC B;  5B5E Z;  3E8G A;  2BCC H;  4DV2 B;  3ZX6 A;  2EIL B;  2XHB A;  4RO2 A;  1OCO C;  1OCR C;  1VQP V;  2LFS A;  1Y67 A;  3CRQ A;  5EBW C;  4K0K O;  1M5I A;  1XNR O;  4UCO A;  3AG4 B;  4AQY B;  1KP2 A;  3SYP A;  3STZ C;  4X89 A;  3E8F A;  4MS2 A;  1HR0 B;  2GTS A;  4JI7 B;  3JD0 A;  4O4L B;  4FLT A;  3RWR D;  1XQ8 A;  3F5T A;  1G8M A;  2L6L A;  3N2G A;  3UO2 A;  4P9P A;  1K5S A;  4LH7 A;  4FM0 A;  5LMU B;  2DMX A;  1NR1 A;  2R70 A;  1N4C A;  2EJR A;  4CC6 A;  2UUA B;  1R6K A;  4MVQ A;  4G27 B;  3B8M A;  3OAA G;  4FMT A;  2YIB D;  1KEC A;  2XAG A;  5EC2 C;  3SJB C;  2B1I A;  3ZCC A;  1PNL A;  4OPA A;  4J80 A;  4PDR A;  1AR5 A;  1N34 O;  5C93 A;  2BOC C;  4DRX A;  2ZIN A;  1JCH A;  1X4T A;  2DQ0 A;  4PA3 A;  2P4K A;  1TUB A;  2Z0A A;  2LGW A;  1SRY A;  3HB3 B;  3KG2 A;  1H2N A;  4G2K A;  1HNW B;  4TUY B;  3TJT A;  1NTK H;  3G4S V;  2OYQ A;  3FYE B;  2EIN B;  3RYI B;  4X62 B;  4PEL A;  1PL4 A;  1XUQ A;  4H44 B;  4TQD A;  2QWN B;  4DV3 B;  4QNH B;  3O9O A;  4MTG A;  1B06 A;  4IGG A;  1GK9 A;  5TIS Z;  1N0N A;  1JR9 A;  1M1K W;  4JI3 O;  3AK1 A;  4O4H B;  2EIM B;  3H1J H;  2O57 A;  2EIJ B;  3ZHR A;  2BE3 A;  5KHH A;  4YIP A;  4WBN B;  4UCR A;  2HVK C;  3FYI B;  4AHC A;  2UUB B;  4DUY O;  1IBM B;  1KYO F;  4WFA V;  3NXS A;  2E5L O;  4LF8 B;  1W0K G;  1QHT A;  4I55 A;  4D7T A;  2UXB B;  3AG4 C;  5JQG B;  4BAY A;  4J10 A;  3SR2 C;  5A2Q N;  1AP5 A;  5KAI Z;  2H3O A;  3CCS V;  3WB1 A;  2JEX A;  2F93 B;  2ZXW C;  3L72 H;  3T1Y B;  2P90 A;  1NQT A;  1XRE A;  4DK0 A;  5KX5 B;  3ZRW A;  4B7E A;  1FXK C;  1S0V A;  4J41 A;  3ZHQ A;  4RWU A;  5LGT A;  1FJG B;  3H01 A;  1SQP H;  2JRI A;  4RUF A;  2MW2 B;  3SDL A;  3C3S A;  3I5D A;  2BOB C;  1Q90 D;  1XNR B;  1X59 A;  1N32 B;  3HKC B;  3CWB H;  4B08 A;  2LJ2 A;  1YDX A;  4CS3 A;  4YJ2 B;  2GSM B;  5CBG A;  3J7A U;  3AG2 B;  1JFF B;  3EHB B;  5D5Q A;  4IHJ A;  4UXN A;  4P30 A;  4JYB A;  3Q4H A;  2CH7 A;  1K3E A;  1MZE A;  2EIN C;  1Y74 A;  3AG3 B;  3LDD A;  4NR1 A;  4W4L A;  1SZX A;  3OUS A;  5CBH A;  5B3S B;  1QVF U;  2A9H A;  1QQC A;  2WWW A;  5BR8 B;  4J42 A;  3IAY A;  4X64 O;  3W7W A;  4JYY A;  4UCT A;  4FFK A;  2RDC A;  2WLM A;  2WLJ A;  2EIJ C;  4JI8 B;  2UXC O;  1IBL B;  1R3L C;  5B1B C;  4FK5 C;  3D3I A;  4FVM A;  4JI5 O;  1BQ0 A;  2ETN A;  4GZR B;  4FIP C;  2B5U A;  1W2B U;  3D36 A;  2E75 B;  2ZM6 O;  5GON A;  1S5H C;  2VS0 A;  3VOU A;  1N33 O;  2XAF A;  4H0L B;  4I50 A;  4O2B A;  3B8N A;  3E86 A;  2AGA A;  3BA9 A;  3JAT B;  3K5O A;  4ZBM A;  2Z5U A;  3OM3 B;  3G71 V;  4DXW A;  1H2L A;  1M4U A;  1FXV A;  3HKE A;  1DF5 A;  4DRX B;  5K1X A;  1XL6 A;  1GRJ A;  3CJH A;  3P30 A;  1RPO A;  1PNK A;  5EBM C;  5EYP A;  4QE7 A;  4PI2 A;  1VQ5 V;  1SET A;  5LGU A;  4JAV A;  3N2K A;  4HBN A;  3F7Y C;  3K06 A;  1FD9 A;  1VEW A;  3R65 A;  3MDS A;  2JJ2 G;  3SYC A;  4X1Y A;  4R8C A;  5B1O A;  2ZR3 A;  1KU9 A;  2D2C B;  4X65 B;  5LMN O;  2EJ7 A;  1P84 F;  3OT7 A;  2HVJ C;  3IJ4 A;  3W7U A;  1KKD A;  3JD1 A;  1K7D A;  1G4Y B;  1CPY A;  3JD4 A;  3OR6 C;  3G6B A;  3D8C A;  4U7O A;  3S3W A;  1BMF G;  1GM8 A;  4IYH A;  5B1A C;  3CMA V;  3A0B Z;  2DOS A;  2IJK A;  4YHH O;  1YZB A;  5LYJ B;  3QG5 A;  1IBK O;  1FFX B;  4BW9 A;  3WB2 A;  1T5E A;  1IXM A;  3RYH A;  3ASO B;  3PN1 A;  3UCS C;  1AIL A;  5BZB A;  3CRA A;  1E1R G;  3JCZ A;  1MZF A;  3ZRW B;  4XDK A;  1AR1 B;  2DYS C;  3ML0 A;  1SQF A;  3ETD A;  1XHX A;  4JV5 O;  2JGU A;  4DV7 O;  4JTD B;  1SQQ H;  4DK1 A;  5BXZ A;  2XAH A;  1BZK A;  5BMV A;  2CTP A;  3HKD A;  2ZNI A;  4TQF A;  1WAZ A;  4LF6 O;  4UCV A;  3L73 H;  1NZ6 A;  2HR3 A;  4KP4 A;  3JSL A;  1VQO V;  2CK3 G;  3JYC A;  4PA6 A;  4LFC O;  4YXW G;  1AR4 A;  2GDS A;  5H6Q A;  4IHJ B;  3ZJZ A;  5LP6 B;  5LHI A;  1XMO B;  5H9C A;  3MD0 A;  1OJH A;  3FB5 C;  3K0G A;  3Q4H B;  2IM9 A;  3AK2 A;  4NB5 A;  1Y74 B;  3B2E E;  2YUA A;  1VIB A;  2KG7 A;  4O4J B;  5BY1 A;  3CEI A;  4B3M O;  1WA8 A;  1Y4M A;  2B1G A;  1IX9 A;  4UFZ A;  4BIZ A;  1JJ2 U;  1SES A;  1V54 B;  1FAF A;  3JCU Z;  2Q0A A;  2P7T C;  1EN5 A;  4U3J A;  1H8H G;  3CCM V;  3OGI B;  3RT3 C;  4I9Q A;  3T1H O;  4KL1 A;  5EIB C;  4I50 B;  5IDJ A;  1CP9 A;  4IT5 A;  5LMN B;  2OCH A;  3UQ8 A;  1EBO A;  1SQX H;  4J7K A;  4DR6 B;  1L0N H;  3T4Z A;  5KMG B;  1HNX O;  1WLE A;  3DXR A;  3S3X A;  5H2F Z;  3CCJ V;  3BPZ A;  4DR4 O;  4LWS A;  4X1I A;  5EYP B;  1KBH A;  1M56 B;  3N2K B;  2YDE A;  3CE2 A;  1OCZ C;  3BCC H;  3F7V C;  4YY3 B;  5FNV A;  1DK1 A;  4ZIB A;  4X1Y B;  1PNM A;  2Q73 A;  1XIL A;  2RCV A;  2BSK A;  4H13 B;  4PV1 B;  1XI1 A;  4EB6 B;  4GCZ A;  3CRC A;  2YXL A;  3ZIA G;  1JPX A;  2IBZ H;  1I5X A;  1ZUQ A;  3L71 H;  4EKW A;  2GUZ B;  1UJW B;  2RNB A;  3B40 A;  4JV5 B;  2M6Y A;  4LFA B;  2Q0O C;  1LNQ A;  1OCO B;  3AK3 A;  1OCR B;  4JI6 O;  5KAF Z;  3H1I H;  2PY5 A;  4NXM B;  5EK0 A;  4Z1V A;  1VF6 A;  4Z2W A;  1GKF A;  4X66 B;  4LF6 B;  1VQ7 V;  4DR5 O;  2AHY A;  1WP8 A;  1JVM A;  4GKJ O;  5JH7 B;  3RYH B;  4ZOL B;  3QVN A;  1GH6 A;  3K57 A;  2HG5 C;  1SQG A;  3AG7 A;  1GM7 A;  2QM8 A;  1CXZ B;  5E79 Z;  4KXR A;  2ZNJ A;  3I55 V;  1Q6U A;  5LBQ A;  3WG7 B;  2OIE A;  3C90 A;  2YEV A;  1GO3 F;  4LP8 A;  1V54 C;  2UU9 B;  1D5A A;  3K0D A;  4UV8 A;  4GX2 A;  1EZV H;  3D36 C;  4MTX A;  1WB8 A;  2QJ1 A;  3HKD B;  4J7Z A;  3WFV A;  1PD3 A;  4N21 A;  1AB3 A;  4JI2 O;  4JTA B;  2JDI G;  4ZHQ A;  1O9H A;  1Q43 A;  4MW3 A;  4DYL A;  4B3M B;  2E74 B;  3OUF A;  2ATK C;  4DV1 B;  2DYR C;  2QM4 A;  3BY6 A;  4U3F H;  3BEH A;  3RYF B;  4DR2 O;  1VMG A;  5FPO A;  3ABK B;  3CSX A;  2QKA A;  3STL C;  3T1H B;  1K73 W;  3JAS B;  1NS1 A;  1QU7 A;  4XDL A;  3VQW A;  1V9P A;  4PI0 A;  1GM9 A;  2KG7 B;  5A9G A;  2JK5 C;  3E2E A;  2A79 B;  3H1L H;  4PDL A;  2DE0 X;  1ARO P;  5IYB O;  3QO7 A;  3GWK C;  4D7S A;  1K4C C;  1OZ0 A;  2X6C A;  2QTO A;  1VF7 A;  2ZXW B;  3VQY A;  3I56 V;  5L3F A;  2R9R B;  4JI4 O;  2Q7E A;  5FPR A;  1R6N A;  2Q69 A;  1I7F A;  2N04 A;  1FXK B;  5J2T A;  5IWA O;  3ZMZ A;  2KKW A;  3A8T A;  1RPR A;  1NJI W;  3SPG A;  2CGN A;  3JAL A;  3QNE A;  4DV4 O;  3WG7 C;  5LA6 B;  4UB6 Z;  3LUT B;  5C8Y A;  3ZS8 C;  2PF4 E;  3M8A A;  4QE9 A;  1MSW D;  2P67 A;  4X1I B;  2ITD C;  2GBO A;  4OX9 O;  1BT8 A;  4DV5 B;  1WN7 A;  2ZQM A;  4JI1 B;  4I5S A;  1GN3 A;  2OCC B;  1G6U A;  3ZHS A;  3HKB A;  2KQX A;  1VQ4 V;  4GKJ B;  4JI0 O;  1SF9 A;  3FAV A;  3AG1 B;  3RW0 A;  4DR3 B;  4XBF A;  3QTC A;  1RSO A;  2HFE C;  1NTM H;  2KB1 A;  4O2A A;  2AZ0 A;  1S72 V;  3ASN B;  2HP8 A;  1U96 A;  4F6R A;  1JX9 A;  1NU1 H;  3GB7 C;  2UXD O;  3ABK C;  1PKX A;  4HAM A;  1HWY A;  5D5P A;  1S77 D;  2PI4 A;  1R3K C;  4I4T A;  1NBM G;  3OGC C;  5B1B B;  1O9G A;  1TVK A;  5J2U A;  2BTQ B;  2UUC B;  1YXB A;  5FL7 G;  1OCC C;  4LF5 O;  4J11 A;  3CRR A;  4QPK A;  2YEV B;  2DN9 A;  3PJS K;  1TA8 A;  1H8E G;  3CCE V;  1Q82 W;  4TV8 A;  1KUQ A;  2DJV A;  2B9Z A;  5CB4 B;  4CH4 A;  1VF5 B;  3K3W A;  4QPJ A;  5GW7 A;  2F23 A;  1YCI A;  3BFR A;  4LBE C;  4NTW A;  4MVO A;  3ZRV A;  2F4V B;  3SPC A;  4ZI7 B;  3L9D A;  5L3C A;  5IE9 A;  2ZIM A;  1AJQ A;  1BGY H;  3CME V;  3OTO O;  4BIU A;  5DN6 G;  2V1D A;  4KHP O;  4DO2 A;  1ZX3 A;  3JAR B;  4K0K B;  2DQ3 A;  3APO A;  1VQM V;  4IIJ B;  1J5E O;  3E35 A;  4UCS A;  1P4R A;  3IGA C;  3X2Q C;  3A0H Z;  2JS3 A;  2OCC C;  2XAS A;  1XMQ O;  2GV9 A;  3JD3 A;  2PTM A;  5KUM A;  3AG1 C;  1EN6 A;  2Y4U A;  3SPJ A;  3E89 A;  4RQF A;  4DV4 B;  1B3Q A;  4B7K A;  5B1A B;  3ASN C;  2K9P A;  2LW7 A;  2W6J G;  1GN2 A;  4MTO A;  3CC4 V;  2VQE O;  2E76 B;  2IU0 A;  5IJ9 A;  4JYA O;  4A5U B;  1VF6 C;  1H2M A;  2OT5 A;  1N34 B;  1XHZ A;  5IT9 N;  4FM2 A;  2QKS A;  2DYS B;  1FS0 G;  2ADP A;  1RP3 B;  5CBF A;  1ROP A;  1H38 A;  2CUG A;  2E3C A;  2F1M A;  1FPO A;  3JD2 A;  3N2G B;  4LC1 A;  1DTO A;  4LR3 A;  4X1K A;  1QLE B;  5J9P C;  4NXN O;  4FJC C;  5LHG A;  1I5Y A;  4DV6 O;  2V7Q G;  1DGS A;  2XAQ A;  2P4V A;  2DW4 A;  4JI3 B;  1EN4 A;  1H2K A;  2WLN A;  5L3B A;  1AI6 A;  4LF9 O;  3BHP A;  3FAV B;  2VQF O;  5L3E A;  2K1E A;  3T2M A;  2Q6A A;  4D6T H;  1TUB B;  3OEH G;  5IYZ A;  4DUY B;  2JEU A;  1YIJ V;  2M7W A;  2E5L B;  1Q81 W;  5IYC O;  2ZD9 A;  1MNG A;  2PZS A;  5EZY A; 
#chains in the Genus database with same CATH homology
 2IBZ H;  3L75 H;  4U3F H;  1SQQ H;  1NU1 H;  3L71 H;  2BCC H;  1KYO F;  5KLV H;  3H1K H;  3H1L H;  1P84 F;  1KB9 F;  3L70 H;  1SQV H;  4D6T H;  1NTZ H;  3BCC H;  3L74 H;  2A06 H;  3H1H H;  1SQP H;  3CXH F;  3CX5 F;  1BGY H;  3H1I H;  2FYU H;  1NTM H;  1SQX H;  1BCC H;  1L0N H;  3H1J H;  1BE3 H;  3L72 H;  3L73 H;  1PPJ H;  1PP9 H;  4PD4 F;  1L0L H;  1EZV H;  3TGU H;  3CWB H;  1NTK H;  1SQB H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...