3BCCH

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
66
structure length
66
Chain Sequence
LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELFDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
total genus 20
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3bccH00
1PPJH 3L74H 1BE3H 1KYOF 1EZVH 3H1HH 1P84F 1SQXH 4D6TH 1SQQH 1PP9H 3CXHF 5KLVH 3CX5F 1BCCH 2BCCH 3CWBH 3L70H 1SQBH 3H1KH 2FYUH 1NTZH 3L73H 4U3FH 1KB9F 1L0LH 2IBZH 3L72H 3TGUH 1NU1H 1NTKH 3H1LH 1SQPH 3H1JH 2A06H 3BCCH 1L0NH 3L75H 3L71H 1SQVH 1BGYH 3H1IH 4PD4F 1NTMH
chains in the Genus database with same CATH superfamily
1DF5A 1K7DA 2RMKB 4OXSA 2X6CA 1P7GA 4FMTA 5BMVA 1S0VA 3ZRXA 3SYCA 5IYBO 3CXHF 4O4LA 3MD0A 3STZC 4B3RB 4JI6O 1V55B 2ZCEA 1SF9A 4UCTA 2XAHA 4B08A 4HNAA 4P2ZA 2OYQA 4JI5O 3JATB 4DR3O 1OZ0A 2FB5A 4TV8A 4QE7A 4DR6O 4GKJO 1JFFB 3VQYA 1YJ9V 4HBNA 2YIBD 1I7FA 3W7WA 2ZQMA 1D5NA 4FLTA 1MNGA 1Z5VA 4UVAA 3ZMTA 3NR7A 5DN6G 3RFRA 2ATKC 1WJZA 2QKCA 2JJ1G 3J80N 4U7NA 1NBMG 3HKBA 3CC2V 2BCCH 5IJ9B 2UXBO 3CXCU 3CS5A 4LF5B 2VWKA 4RAIA 3PN1A 4N23A 1FXKB 1CPYA 4FLXA 2AW9A 1I94B 1S77D 1US6A 2AHZA 3CJHB 3AK2A 2Y4UA 1M4UA 2ODMA 4JI8O 3ZRWB 2EILC 1Q90D 4BIZA 1F4MA 1BQ0A 1O9HA 2EX3A 4CBCA 1B04A 4MTXA 1M90W 1VQ7V 2EINC 2YIBA 3AG7A 2AZ0A 2UUBO 1U97A 4GYCB 4ASUG 4DR7O 4GCZA 2VWJA 1M93A 4D6TH 3HB3B 4B3SO 1LUVA 5H6RA 2XAJA 3A0RA 2HHHO 5HFLA 2F23A 3KZIZ 4FLWA 1K97A 4GKKO 1YIJV 1DF4A 4WBNA 1R3KC 4J10A 1G1XB 3A0BZ 3NXSA 4CH4A 1H2SB 2W6JG 3AG2C 3DGEA 1RP3B 3PJSK 1IBMB 4AHCA 3LUTB 3ETDA 5CB4A 1NQTA 4I55A 4X62O 1NJIW 1QLEB 4MVMA 3CCVV 3OUSA 3I5DA 2JDIG 2QSAA 3T1YO 3Q4HB 2UU9B 1U96A 4LF7O 4FVMA 5EYPB 2HVJC 3OD4A 5IWAB 5KHKA 1SQFA 3VQXA 1KMIZ 4JV5O 5JCOC 4I50B 2P67A 2WLJA 3S3WA 1HNXO 3ZCCA 4LC1A 1JJOA 3EHBB 2Z0AA 1KUQA 1RPRA 1AP6A 3GWKC 3DXRA 4O4JA 3C3SA 2YS8A 2Y69B 2XHBA 1SRYA 3FAVA 4HYOA 3SGIA 2PGGA 1YJNV 3IAYA 4X88A 3JAKB 3QG5A 3CMAV 4LF9O 3K5OA 3E8GA 3P3PA 5H6QA 1OJHA 5LMUO 4GX0A 3ABLC 3OW2U 4J41A 2CTPA 2ADQB 2KB1A 2V1DA 2DYRB 1EFRG 1N0JA 4NXNB 1EBOA 5CA1B 4BIUA 2R9RB 4DYLA 1NTMH 5IY5C 1L1FA 3DTUB 4IHJB 2HG5C 1SA0A 2P4VA 4CC6A 5IJ0B 5JQGB 3O9OA 4NR1A 3IC7A 2YDEA 5B1AB 3LDEA 1YJWV 3VQVA 3B09A 4FPPA 5EC2C 1K3EA 4PD4F 3K5NA 5KAFZ 2QEXV 4IYHA 5E79Z 4P9OA 4LNUB 4PA4A 3SJAC 1WAZA 3TK1A 3ZRVA 3R65A 4CH3A 4N21A 1SQBH 5K1PA 3ABUA 5IYCO 1OCRC 3RYIB 1OCOC 1IBKO 2UUAB 2Q0OC 1XNRB 4JI7O 1K9MW 1XMQO 2EJRA 4DR5B 3BFRA 4K8ZA 4B3MB 4K8XA 1XMOB 3HKDB 3I55V 3D3QA 4UB8Z 3SPJA 2Q9LA 2LW1A 3H9VA 5LGTA 4QPJA 2XOKG 1HNWB 3QO7A 1PNLA 4PA7A 3AG3B 3CEIA 3ZHUA 5BR8B 4O2AB 1V55C 4Z2WA 4JYAB 4KHPB 3CCJV 4ZOLB 1DLBA 4IIJB 1GN6A 1ZLZA 2VQEO 2QWQB 1JJ2U 4X1YA 1TVKA 5FPOA 4OX9B 3CMEV 2XTAA 2UXNA 5TISZ 2HR3A 5LMNO 5H9CA 3OT7A 5LHGA 1NKDA 1S3JA 3EXAA 4Z1MG 4W4LA 3CSXA 3T1HB 2VQFO 2MW2B 2H8PC 4DR2B 3VOUA 4X65B 2H94A 2YI9A 1D2DA 2IJKA 3K03A 4FM0A 2F4VO 5H5NA 4EB6B 2IU3A 2WSSG 2YEVA 1J5EO 2R9AA 4OGQB 1KYOF 5L3EA 1ENVA 3SJBC 4XBFA 1M56B 1H38A 4UVBA 3K5MA 1Y67A 5FLXN 4QJFB 1VQ8V 3UO2A 3T2MA 4MTGA 2UU9O 4JI6B 2QWRB 2YSUB 1FXVA 2CAZC 5EBWC 2ZD9A 3M99B 2Q68A 3KKYA 1K4CC 1M9NA 3ZS8C 3JD1A 4MW8A 1IZ3A 4JI5B 3EVKA 5FNVA 2BE3A 3FFQA 1NS1A 1BT8A 2OCHA 4DR3B 4DR6B 4GKJB 2DJVA 3G71V 4RO2A 5EZYA 3L70H 1FS0G 4OPAA 1LNQA 4UCOA 3LSQA 3DSQA 3FB5C 3FYIB 4FLVA 3OGIB 3GVMA 3CCSV 2R70A 4FLUA 4H37A 2Q7EA 3UCSC 4I0XB 4G28B 3UT5B 1RSOA 2E76B 1JVMA 2WLIA 3ZJZA 4PDVA 4MVRA 5JJJB 1VQKV 2OIGA 1H2NA 1EN5A 2EBOA 2CH7B 4NB5A 2A0LA 2UXBB 4O4HB 4YJ3A 1F7YA 3LNNA 4LWSA 2GUZB 3JYCA 3N27A 2QTOA 1VQ5V 1QLEC 1IDSA 2ZDIC 4NTWA 3E83A 4DV2O 3J7AU 4X8AA 3ICXA 2OTLV 4ZI7A 3K0GA 4R7CA 2YIDA 1QQCA 2B1GA 1QNMA 4X64B 3TETA 4X9QA 4JI8B 3JCZA 2HFEC 4U3JA 2ARHA 3CCQV 2P22C 4CS3A 4QE9A 2YXHA 2HVKC 2KG7A 1S76D 4IT5A 1O9GA 3CRAA 2ZR2A 4DRXA 1AR5A 2GTSA 5C93A 2UUCO 2UUBB 2RNBA 3RYFB 5IT9N 1Q86W 2WA3A 5LP6B 2DWDC 3P30A 1YVWA 5JCOA 2FYUH 2Q67A 1KP2A 2LGWA 2LP7A 1WNSA 3FYEB 5JH7A 2HHHB 1UPGA 1VMGA 2JEXA 4X20B 5FPRA 3K06A 4YJ2B 1Y76B 2PI5A 3I56V 1S5JA 1YTFD 1GTOA 4UVCA 4BIOA 2DYRC 3F5TA 4X62B 2PZSA 3W7TA 1JCHA 3L9DA 4OPHA 1GMGA 4DV0B 2IJHA 5L3BA 5LHIA 3T1YB 2EIKB 3HKEB 4LF7B 5KMGA 2XASA 4LP8A 4JI4O 1GH6A 1Q6IA 3OR7C 5ITZA 5BR8O 4YIPA 5EBLC 5GONB 4JV5B 2E3CA 5B1AC 3RWRD 1HNXB 1XDCA 1XNQO 2E75B 2JGDB 1MG1A 2DYSB 1IXMA 2ZE8A 1M57B 1WPXA 4CC5A 1Q8IA 4FLZA 3L71H 3OTFA 2B5UA 4K3AA 5LOVA 5D5PA 2EJ7A 4LF9B 3B2EE 1P7BA 1YITV 2X6AA 5LMUB 1S5LZ 3ZBHA 4UFZA 2RN9A 1Q82W 4O2BA 1ZWIC 4YY3O 4PELA 4QPKA 4LCUC 3RN4A 4FLYA 1K5SA 1HW7A 1WB7A 5KAIZ 1I5XA 2ZXWB 3OMAB 3DC5A 5B1BC 5BMVB 5JJEB 2BSKB 2DOSA 2QM7A 2FKXA 4LBEC 4MT8A 2IH3C 3RBZA 2M6YA 1NT2B 1ZTEA 3C3TA 4J42A 4QNHB 3AG3C 2P90A 4R8CA 1P4RA 2N05A 1AI6A 2EIMB 1I08A 3MHSC 4O4IA 5CA0A 4NTXA 3WG7C 1KU9A 2ZNIA 3G4SV 4JI0O 4WFFA 4MW3A 1PP9H 2LJ2A 4FFBB 4DV6O 1WN7A 2DMXA 5J2UB 1DTOA 1R6NA 1Y74B 1SC5B 4PHZA 1IBKB 4ABMA 4JI7B 1H2MA 3D36C 1XMQB 3HKBB 1JFFA 1W59A 2JS3A 1ORQC 1FD9A 1M56C 2A3QA 1XOUA 4LH6A 1SZTA 4GX1A 2AGAA 4Q20A 3UKMA 2W0FC 1SS3A 1VQ4V 3F7YC 3ZHRA 4DO2A 3LSUA 2LW7A 5GTHZ 4RUFA 4TOIA 4X64O 2VQEB 5IJ9A 4J11A 1YZBA 4DV5B 4H33A 2N04A 5KA6A 5IYZB 4LH7A 4JASA 2D2CB 2QWOB 1V54B 5LMNB 4JF3A 4FM1A 1IVSA 2FMLA 2DE0X 3E8BA 2IU0A 3CPWU 3CJHA 1AJNA 3THOA 2VQFB 4LFAB 2KQXA 1I5YA 3ZRWA 5LYJB 1AROP 4W4KA 5CBFA 5L3FA 2QWPB 4PI0A 3ABMB 2IJIA 1VF6C 4GT1A 1H8EG 1L0NH 3ZX6A 5B3SC 3L75H 1FFTB 2CDYA 2F4VB 4UV9A 1XL4A 4BR6A 1J5EB 1N36O 1FJGO 1YI2V 2YC0A 4DV0O 4WFBV 2F1MA 2QR4A 1GRJA 4P30A 3D8CA 2IBZH 2JRIA 1HR0O 1GM7A 4DV7O 2D3OW 2GHYA 1XI1A 1BL8A 4MSWC 1R3LC 2OTJV 1R3JC 1KD1W 4YHHO 2ZDIA 1G4YB 1Q43A 3CX5F 4TV9B 3AK1A 2AZ2A 1XQ8A 1LR1A 2ZR3A 3G6EV 2Q6AA 2QE7G 3MDSA 3Q4HA 3B8MA 4EKWA 1MA1A 5EYPA 2UXCO 3H01A 1R1BA 5LP6C 3OFNG 3B8NA 1FFXB 4JTCB 3TXSA 1G8MA 5KX5B 2BTQB 4I50A 1RPOA 3UM7A 4FZ0A 4TQDA 4NXMO 3AG1B 4YXWG 5LA6B 3OTOO 1JMKC 4X1IB 1T5EA 3QTCA 4TWKA 1VQMV 2UXDO 2UXXA 3IJ4A 4U3FH 4F4LA 3KCYA 3DC6A 1R6KA 1SQPH 2P6JA 3BA9A 4DV2B 3JSNA 5J2TB 3JAKA 4G27B 1TUBB 3JD0A 1HDJA 3B4SA 1V9PA 1H8HG 1OHHG 2WLLA 4WFAV 3RVZA 4MVZA 4CH5A 3ETGA 4H44B 1VEWA 3F5WC 5J9PC 2YI8A 1VQPV 2QM4A 1AI7A 3KG2A 2WWWA 2XUMA 4FJCC 1VQ6V 3ASOB 2DYSC 3ABKC 1RM1C 5BZBA 2UUCB 2WPDG 4IHJA 2KSDA 3OGCC 3JALB 5JQGA 1BZKA 2HKOA 4WFHA 3CCRV 3E22B 1S72V 4ZIBA 2JGUA 4F6RB 4H0LB 5C8YB 1VQ9V 3TGUH 4B3TO 3SPIA 4A5UB 1PKXA 1I0HA 1X4TA 4Z1VA 3UQ8A 1PPJH 3SJCC 2Q5ZA 1NVPB 2Y0IA 4LNUA 3JCUZ 1GM9A 5CMUA 4LFCB 4EEQA 3X2QB 2VRZA 2ZXWC 3RYHB 1Q81W 1Y4MA 3RYIA 3MAQA 1H2LA 5B1OA 1PNKA 1KKDA 3P32A 3JAWB 4JI4B 2ZM6O 1WA8B 3VBBA 3GWOA 4PDRA 4J80A 1BMFG 3JASB 3OUFA 1XNQB 4DR4O 3HKDA 2EIMC 1JA8A 3FB8C 1YHQV 2LGQA 4I4TB 1W0JG 3ZMZA 4DV5O 2N74A 4BWAA 4NYKA 1BQZA 1XUQA 1HP8A 4RUEA 4JTDB 4XDKA 3BRCA 3T4DA 3EFFK 3L74H 4O2AA 3TCUA 2W6IG 2O57A 4ZOLA 4LFAO 4IIJA 1P49A 2ZE5A 3ZMSA 3FKSG 4RWUA 3CWBH 3ZEDA 1LUWA 3WB2A 3CRCA 1DGSA 2QKAA 2P5OA 1VIBA 4TUYB 4ICGA 2K9PA 4IYIA 3SYQA 4YY3B 3BCCH 4E4EA 4DUZB 3BVOA 3H1IH 4LF8O 2XT9A 1XHZA 3ZN1A 4X1KB 2DQ3A 2OWOA 1UFIA 3QNEA 2YUAA 4JAAA 3RT3C 2LFSA 2P7TC 2NNUA 5KHJA 1FXKC 1WP8A 1XREA 3HPLC 4JTAB 4JI3O 2XAGA 3D36A 1AJQA 1SZXA 2X6BA 4EB6A 2BOCC 3HKCB 3JARA 3K9SA 1AVMA 1Z5WA 4TSFG 1QR8A 1N34B 2KKWA 3BHPA 1BE3H 5KHHA 2JS5A 4Q6GA 3H1HH 3JD2A 1PNMA 4B7EA 4NTYA 4JI0B 3APOA 3CHXA 4DV6B 3AEIA 3RW0A 1JOYA 3QO5A 2QM8A 1KC8W 1NTZH 2RQ6A 1KQSU 2HJFC 3K57A 3BY6A 5IE9A 2PI4A 2EZPA 2JJ2G 1HWYA 4R50A 1JPXA 3STLC 3ABMC 4DW0A 5JVDB 2EINB 2HP8A 3C90A 1L8DA 2HLDG 3FB7C 5LGUA 4ZKIA 1IX9A 4LWSB 5KHIA 5LHHA 4KL1A 1W2BU 3W7XA 1GKFA 3F7VC 2DW4A 1J95A 1AI4A 1TA8A 3A2FA 3P3NA 4QIWF 4I0XA 1VP7A 1VF6A 3UT5A 3HR0A 3B40A 4PA3A 2PY5A 4U3JB 3KCXA 2CH7A 2R9IA 3LDDA 1VF5B 4KXRA 4UXNA 2CE4A 4O4HA 2GUZA 3ZMUA 3A0HZ 4JAVA 1B3QA 2NN4A 1Q7YW 2W0XA 1E1RG 1QHTA 5LXTB 4UB6Z 3CC7V 4FK5C 2Y69C 1YDXA 2AXTZ 2LFRA 5CBHA 1QLNA 4ZHQB 5CN0A 4J7KA 5CBGA 3LSSA 3WB0A 3AG1C 1K92A 4WFGA 4LR3A 5JWPA 2ILMA 3N2GB 4DUYB 1N32O 1AJPA 1Q6HA 2EZOA 3K5LA 1N36B 2Q4PA 2QDOA 3RYFA 4WFEA 1FJGB 4NVPA 4LFCO 5LP6A 1QR9A 1K34A 1G6UA 1R73A 1YSCA 1HR0B 4MVQA 4DV7B 4J7JA 2Y4TA 4UUJC 4X20A 4YJ2A 5ITZB 1Y76A 3CRRA 4AI8A 1EZVH 2PTMA 4TQFA 4AILC 2HEPA 4AQYO 5JJNB 3JD3A 4YHHB 4E2LA 1PL4A 1DK1A 3OEHG 4HZ3A 2OT5A 4CS2A 3ABTA 1ZL8B 2IH1C 2G38A 2ADPA 2XAQA 3HKEA 2UXCB 1SERA 1IBLO 4DV4O 2Z3YA 3OR6C 5DEDA 1MMMA 5GONA 2CTRA 1WPBA 2RDCA 1WB8A 2CTQA 1B06A 4NXMB 4EFBA 2JGDA 3SPGA 2QA4V 3OTOB 1MSDA 2ETNA 3RYCB 4K35A 3N2KB 2UXDB 1OV9A 1RFYA 4LF6O 4UV8A 4DUZO 3IFXA 2ZNJA 2F95B 3X2QC 3ASNB 5FL7G 1OCRB 1B6QA 2EULA 3CRQA 4I5SA 5EIBD 1OCOB 4I9WA 1EM1A 4O4LB 5KUKA 1URFA 5L3DA 2E74B 4DK1A 4C7UA 1TUEB 4JZ2A 4QGPA 3E35A 4PJ0Z 2PYLA 1K33A 4HNAB 4X89A 1N34O 1KKCA 1UJWB 1IXBA 2BSKA 4TV8B 3OMNB 5KUMA 4DR1O 2EIJB 4PA6A 2GBOA 1BCCH 1MOFA 1YCIA 5DECA 3ZHVA 1QCEA 2CUGA 4D7TA 3K9AA 3L72H 1K5QA 4DV1O 5H2FZ 4BW5A 4B3TB 4PI2A 3CCMV 4LFBO 3U11A 3E8FA 1Q6UA 3W7SA 3D3IA 1EZJA 1OCCB 1AP5A 4LF4O 4IL6Z 3JATA 1F23A 3RGBA 4G2KA 1Q3EA 5L3CA 4FFBA 1M5IA 3BABA 2AHYA 5J2UA 4XDJA 4FIPC 2HJDA 3K58A 3QF7A 4JPRA 4KP4A 2QTSA 1Y74A 4PDMA 1XL6A 1NH2D 1YEWA 4CS4A 4BW9A 2ZM6B 4UCRA 2X0LA 3CYOA 4DR4B 2Q73A 4FZ1A 4MVOA 1Q5OA 2YIAA 1HNZB 2FTKA 2F43G 4L8JA 3G80A 2PUSA 4GX2A 1YF2A 2A7WA 1FXKA 1QVGU 3ETEA 5BXZA 4RQFA 1F4NA 4JYYA 1NR1A 3BAAA 3E2EA 1NH2B 1VARA 1L0LH 2PF4E 2QJ1A 5HFMA 5B5EZ 3WU2Z 4WBNB 5IYZA 4DUYO 3CB2A 3G6BA 4LF8B 2M7WA 1E1QG 5CB4B 4I55B 2DQ0A 5E1AC 5LYJA 3JAMN 1JR9A 4KUMA 2ZE7A 4JI3B 1PM9A 1ZAUA 5D5QA 2OCCB 3K79A 3QO8A 1KBHA 2Q0AA 3A8TA 4JI2O 2PYJA 4L87A 3CCUV 1WLEA 1F51A 4K0KB 3CD6V 4UCSA 2NLJC 1AR4A 2WA4A 4J9YB 3H1KH 3CRMA 3DXRB 4O4JB 3O65A 1PV0A 4YIOA 1Z2GA 5EK0A 3FAVB 3APQA 1KP3A 5GW7A 3JD4A 1R6TA 4D7SA 4X66O 2FL4A 1NR7A 1VF7A 2JEUA 3OE7G 2E5LB 1GN3A 1JQ0A 3B77A 4TV9A 2CGOA 1N33O 2ZT9B 2V4DA 1K4DC 4GUNA 3E89A 1NI8A 4DV3O 1IURA 1N4CA 2WLHA 3MHHC 2CTWA 3K0DA 1FFXA 2K1EA 1AB3A 2LO1A 1JX9A 5KX5A 3CCLV 2BTQA 4PA9A 2WLLB 1K8AW 1YXBA 2EIKC 1SA0B 5LA6A 4X1IA 2XAFA 3K08A 5LBQA 3IC9A 1QU7A 2CK3G 1NVPD 3CC4V 3ZHSA 5LL6Y 2ITCC 5CA1A 5J2TA 1SQGA 2Y0PA 2P4KA 1TUBA 3T4ZA 3SYAA 2JK5C 2R72A 1M57C 1MZFA 4JYBA 1TGOA 4B3RO 5IJ0A 3J81N 3M8AA 5L3GA 1SKVA 4B7KA 3T1CA 1OCZB 3WFVA 3SYOA 1ZSPA 4J7ZA 1VQLV 1XILA 1N32B 4U7OA 2JVDA 2L35A 3ZMVA 3JALA 2NR5A 5EBMC 2WLNA 4I9QA 4MTFA 1XBLA 3E22A 3ASNC 4IGGA 4F6RA 2DWEC 5C8YA 4MS2A 2V7QG 3H1JH 5KHGA 1M1KW 1FYJA 3SPCA 3FX7A 3AG4B 1GM8A 2YXLA 3BA8A 1SESA 2WLKA 2ZIOA 2GDSA 2IM9A 1FKAO 4AQYB 1FPOA 1SQXH 3ETQA 5KLVH 4X1YB 4UCUA 1TVKB 4UCVA 2YXYA 5B1BB 1HNZO 4LF5O 3OM3B 3RYHA 1Y6XA 2Q7GA 1A32A 2EIJC 1GO3F 1I94O 2QGNA 3JAWA 1EN6A 1WA8A 1S5HC 1IBLB 1X59A 4DV4B 4BAYA 1P84F 3FB6C 5EIBC 2RJZA 3JASA 3ZHTA 3ML0A 1ZUQA 2VS0A 2C2AA 3WG7B 5BY1A 3SDLA 3OEEG 4I4TA 2B9ZA 3L73H 4MTOA 5AG2A 4H13B 4JI1B 3H1LH 1OCCC 4ZBMA 4LF6B 2YEVB 1MZEA 3BPZA 1BSMA 1CEZA 5B66Z 1QVFU 5GTIZ 1H2KA 4GLXA 1FXHA 3E8HA 5A2QN 4TUYA 3TJTA 3U0ZA 2IJJA 3JARB 5KA5A 4PV1B 3CP1A 3QVNA 3TXQA 1N0NA 1IBMO 4JGSA 5FNVB 2ITDC 5B1NA 2OIEA 4X1KA 4K0KO 1H2GA 1WP7A 4DW1A 1TAEA 4DR1B 5EZYB 2CGNA 1V54C 2MK3A 4NKGB 4CZZA 1NTKH 3K04A 4CH6A 4J9ZB 4DV1B 3OMIB 4R6ZA 2EILB 4TT3G 5DM6V 5IWAO 1FAFA 3HKCA 4LFBB 2A9HA 1QBZA 3GB7C 1SETA 2ZINA 2QWNB 1RSOB 1D5AA 1GK9A 2Z5UA 2ZE6A 2WLIB 3ZN0A 4LF4B 2E5LO 2WAMA 2ZIMA 2YICA 3K3WA 1MSWD 2X7RB 4YJ3B 2BOBC 3S3XA 1COWG 2RCVA 1GN4A 1THZA 1AI5A 4ZI7B 1KECA 3LDCA 3W7UA 4GZRB 5IDJA 5B3SB 3SPHA 4JAUA 2Q7HA 5JVDA 1BHAA 3LNMB 3AG2B 2OCCC 2B1IA 3SR2C 3K59A 2KG7B 4NXNO 2A06H 4JYCA 1EN4A 3BEHA 2QKSA 4DRXB 2Y48A 3WB1A 1PL0A 3ZIAG 4DXWA 1BHBA 1AILA 4FM2A 1R3IC 3VQWA 1KB9F 1NU1H 5JH7B 5F2VO 1ROPA 5IYDO 2GSMB 4EFEA 5LXTA 2A79B 4RQEA 3E86A 4DR7B 4JZGA 3FD9A 4B3SB 4ZHQA 3SJQC 2H3OA 4GX5A 2XNDG 4GKKB 5KMGB 2UUAO 1MABG 3ABLB 1XNRO 3N2GA 3UO3A 2ZKOA 1CP9A 1NZ6A 1XEQA 1W0KG 4DR5O 2WLMA 4JI2B 2IW5A 4B3MO 1AR1B 5K1XA 1XMOO 4MVUA 1ZX3A 5IY5B 3ASOC 2P06A 3RVYA 3IGAC 2GTAA 4PDLA 4F6EA 5LGNA 4XDLA 1HNWO 2F66C 3JSLA 1E79G 5LOVB 1SQVH 1K73W 4P9PA 2F93B 4MVSA 5EC1C 4KHPO 3ZHQA 4JYAO 1GAXA 4WF9V 4X66B 1CXZB 1OCZC 1PD3A 2GV9A 3ABKB 1RM1B 4DK0A 4OX9O 4WCEV 1VQNV 3AK3A 1YTFB 1N33B 4O2BB 1XHXA 1ZL8A 2BTOA 4JI1O 3SYPA 4HAMA 3U10A 2LQTA 4DV3B 1Y66A 4KFMA 3T1HO 3G67A 2Q69A 2DN9A 3R66A 4FFKA 4DR2O 4I7ZB 3ZRSA 1BS3A 4X65O 1VQOV 1SQQH 1GN2A 2L6LA 5A9GA 1N8RW 3AG4C 3CCEV 3RYCA 3CE2A 5CA3A 3M7MX 3OAAG 3N2KA 2Q8VA 2JIZG 1BGYH 4O4IB 5CA0B
chains in the Genus database with same CATH topology
1PPJH 3L74H 1BE3H 1KYOF 1EZVH 3H1HH 1P84F 1SQXH 4D6TH 1SQQH 1PP9H 3CXHF 5KLVH 3CX5F 1BCCH 2BCCH 3CWBH 3L70H 1SQBH 3H1KH 2FYUH 1NTZH 3L73H 4U3FH 1KB9F 1L0LH 2IBZH 3L72H 3TGUH 1NU1H 1NTKH 3H1LH 1SQPH 3H1JH 2A06H 3BCCH 1L0NH 3L75H 3L71H 1SQVH 1BGYH 3H1IH 4PD4F 1NTMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPJ H;  3L74 H;  1BE3 H;  1KYO F;  1EZV H;  3H1H H;  1P84 F;  1SQX H;  4D6T H;  1SQQ H;  1PP9 H;  3CXH F;  5KLV H;  3CX5 F;  1BCC H;  2BCC H;  3CWB H;  3L70 H;  1SQB H;  3H1K H;  2FYU H;  1NTZ H;  3L73 H;  4U3F H;  1KB9 F;  1L0L H;  2IBZ H;  3L72 H;  3TGU H;  1NU1 H;  1NTK H;  3H1L H;  1SQP H;  3H1J H;  2A06 H;  3BCC H;  1L0N H;  3L75 H;  3L71 H;  1SQV H;  1BGY H;  3H1I H;  4PD4 F;  1NTM H; 
#chains in the Genus database with same CATH topology
 1DF5 A;  1K7D A;  2RMK B;  4OXS A;  2X6C A;  1P7G A;  4FMT A;  5BMV A;  1S0V A;  3ZRX A;  3SYC A;  5IYB O;  3CXH F;  4O4L A;  3MD0 A;  3STZ C;  4B3R B;  4JI6 O;  1V55 B;  2ZCE A;  1SF9 A;  4UCT A;  2XAH A;  4B08 A;  4HNA A;  4P2Z A;  2OYQ A;  4JI5 O;  3JAT B;  4DR3 O;  1OZ0 A;  2FB5 A;  4TV8 A;  4QE7 A;  4DR6 O;  4GKJ O;  1JFF B;  3VQY A;  1YJ9 V;  4HBN A;  2YIB D;  1I7F A;  3W7W A;  2ZQM A;  1D5N A;  4FLT A;  1MNG A;  1Z5V A;  4UVA A;  3ZMT A;  3NR7 A;  5DN6 G;  3RFR A;  2ATK C;  1WJZ A;  2QKC A;  2JJ1 G;  3J80 N;  4U7N A;  1NBM G;  3HKB A;  3CC2 V;  2BCC H;  5IJ9 B;  2UXB O;  3CXC U;  3CS5 A;  4LF5 B;  2VWK A;  4RAI A;  3PN1 A;  4N23 A;  1FXK B;  1CPY A;  4FLX A;  2AW9 A;  1I94 B;  1S77 D;  1US6 A;  2AHZ A;  3CJH B;  3AK2 A;  2Y4U A;  1M4U A;  2ODM A;  4JI8 O;  3ZRW B;  2EIL C;  1Q90 D;  4BIZ A;  1F4M A;  1BQ0 A;  1O9H A;  2EX3 A;  4CBC A;  1B04 A;  4MTX A;  1M90 W;  1VQ7 V;  2EIN C;  2YIB A;  3AG7 A;  2AZ0 A;  2UUB O;  1U97 A;  4GYC B;  4ASU G;  4DR7 O;  4GCZ A;  2VWJ A;  1M93 A;  4D6T H;  3HB3 B;  4B3S O;  1LUV A;  5H6R A;  2XAJ A;  3A0R A;  2HHH O;  5HFL A;  2F23 A;  3KZI Z;  4FLW A;  1K97 A;  4GKK O;  1YIJ V;  1DF4 A;  4WBN A;  1R3K C;  4J10 A;  1G1X B;  3A0B Z;  3NXS A;  4CH4 A;  1H2S B;  2W6J G;  3AG2 C;  3DGE A;  1RP3 B;  3PJS K;  1IBM B;  4AHC A;  3LUT B;  3ETD A;  5CB4 A;  1NQT A;  4I55 A;  4X62 O;  1NJI W;  1QLE B;  4MVM A;  3CCV V;  3OUS A;  3I5D A;  2JDI G;  2QSA A;  3T1Y O;  3Q4H B;  2UU9 B;  1U96 A;  4LF7 O;  4FVM A;  5EYP B;  2HVJ C;  3OD4 A;  5IWA B;  5KHK A;  1SQF A;  3VQX A;  1KMI Z;  4JV5 O;  5JCO C;  4I50 B;  2P67 A;  2WLJ A;  3S3W A;  1HNX O;  3ZCC A;  4LC1 A;  1JJO A;  3EHB B;  2Z0A A;  1KUQ A;  1RPR A;  1AP6 A;  3GWK C;  3DXR A;  4O4J A;  3C3S A;  2YS8 A;  2Y69 B;  2XHB A;  1SRY A;  3FAV A;  4HYO A;  3SGI A;  2PGG A;  1YJN V;  3IAY A;  4X88 A;  3JAK B;  3QG5 A;  3CMA V;  4LF9 O;  3K5O A;  3E8G A;  3P3P A;  5H6Q A;  1OJH A;  5LMU O;  4GX0 A;  3ABL C;  3OW2 U;  4J41 A;  2CTP A;  2ADQ B;  2KB1 A;  2V1D A;  2DYR B;  1EFR G;  1N0J A;  4NXN B;  1EBO A;  5CA1 B;  4BIU A;  2R9R B;  4DYL A;  1NTM H;  5IY5 C;  1L1F A;  3DTU B;  4IHJ B;  2HG5 C;  1SA0 A;  2P4V A;  4CC6 A;  5IJ0 B;  5JQG B;  3O9O A;  4NR1 A;  3IC7 A;  2YDE A;  5B1A B;  3LDE A;  1YJW V;  3VQV A;  3B09 A;  4FPP A;  5EC2 C;  1K3E A;  4PD4 F;  3K5N A;  5KAF Z;  2QEX V;  4IYH A;  5E79 Z;  4P9O A;  4LNU B;  4PA4 A;  3SJA C;  1WAZ A;  3TK1 A;  3ZRV A;  3R65 A;  4CH3 A;  4N21 A;  1SQB H;  5K1P A;  3ABU A;  5IYC O;  1OCR C;  3RYI B;  1OCO C;  1IBK O;  2UUA B;  2Q0O C;  1XNR B;  4JI7 O;  1K9M W;  1XMQ O;  2EJR A;  4DR5 B;  3BFR A;  4K8Z A;  4B3M B;  4K8X A;  1XMO B;  3HKD B;  3I55 V;  3D3Q A;  4UB8 Z;  3SPJ A;  2Q9L A;  2LW1 A;  3H9V A;  5LGT A;  4QPJ A;  2XOK G;  1HNW B;  3QO7 A;  1PNL A;  4PA7 A;  3AG3 B;  3CEI A;  3ZHU A;  5BR8 B;  4O2A B;  1V55 C;  4Z2W A;  4JYA B;  4KHP B;  3CCJ V;  4ZOL B;  1DLB A;  4IIJ B;  1GN6 A;  1ZLZ A;  2VQE O;  2QWQ B;  1JJ2 U;  4X1Y A;  1TVK A;  5FPO A;  4OX9 B;  3CME V;  2XTA A;  2UXN A;  5TIS Z;  2HR3 A;  5LMN O;  5H9C A;  3OT7 A;  5LHG A;  1NKD A;  1S3J A;  3EXA A;  4Z1M G;  4W4L A;  3CSX A;  3T1H B;  2VQF O;  2MW2 B;  2H8P C;  4DR2 B;  3VOU A;  4X65 B;  2H94 A;  2YI9 A;  1D2D A;  2IJK A;  3K03 A;  4FM0 A;  2F4V O;  5H5N A;  4EB6 B;  2IU3 A;  2WSS G;  2YEV A;  1J5E O;  2R9A A;  4OGQ B;  1KYO F;  5L3E A;  1ENV A;  3SJB C;  4XBF A;  1M56 B;  1H38 A;  4UVB A;  3K5M A;  1Y67 A;  5FLX N;  4QJF B;  1VQ8 V;  3UO2 A;  3T2M A;  4MTG A;  2UU9 O;  4JI6 B;  2QWR B;  2YSU B;  1FXV A;  2CAZ C;  5EBW C;  2ZD9 A;  3M99 B;  2Q68 A;  3KKY A;  1K4C C;  1M9N A;  3ZS8 C;  3JD1 A;  4MW8 A;  1IZ3 A;  4JI5 B;  3EVK A;  5FNV A;  2BE3 A;  3FFQ A;  1NS1 A;  1BT8 A;  2OCH A;  4DR3 B;  4DR6 B;  4GKJ B;  2DJV A;  3G71 V;  4RO2 A;  5EZY A;  3L70 H;  1FS0 G;  4OPA A;  1LNQ A;  4UCO A;  3LSQ A;  3DSQ A;  3FB5 C;  3FYI B;  4FLV A;  3OGI B;  3GVM A;  3CCS V;  2R70 A;  4FLU A;  4H37 A;  2Q7E A;  3UCS C;  4I0X B;  4G28 B;  3UT5 B;  1RSO A;  2E76 B;  1JVM A;  2WLI A;  3ZJZ A;  4PDV A;  4MVR A;  5JJJ B;  1VQK V;  2OIG A;  1H2N A;  1EN5 A;  2EBO A;  2CH7 B;  4NB5 A;  2A0L A;  2UXB B;  4O4H B;  4YJ3 A;  1F7Y A;  3LNN A;  4LWS A;  2GUZ B;  3JYC A;  3N27 A;  2QTO A;  1VQ5 V;  1QLE C;  1IDS A;  2ZDI C;  4NTW A;  3E83 A;  4DV2 O;  3J7A U;  4X8A A;  3ICX A;  2OTL V;  4ZI7 A;  3K0G A;  4R7C A;  2YID A;  1QQC A;  2B1G A;  1QNM A;  4X64 B;  3TET A;  4X9Q A;  4JI8 B;  3JCZ A;  2HFE C;  4U3J A;  2ARH A;  3CCQ V;  2P22 C;  4CS3 A;  4QE9 A;  2YXH A;  2HVK C;  2KG7 A;  1S76 D;  4IT5 A;  1O9G A;  3CRA A;  2ZR2 A;  4DRX A;  1AR5 A;  2GTS A;  5C93 A;  2UUC O;  2UUB B;  2RNB A;  3RYF B;  5IT9 N;  1Q86 W;  2WA3 A;  5LP6 B;  2DWD C;  3P30 A;  1YVW A;  5JCO A;  2FYU H;  2Q67 A;  1KP2 A;  2LGW A;  2LP7 A;  1WNS A;  3FYE B;  5JH7 A;  2HHH B;  1UPG A;  1VMG A;  2JEX A;  4X20 B;  5FPR A;  3K06 A;  4YJ2 B;  1Y76 B;  2PI5 A;  3I56 V;  1S5J A;  1YTF D;  1GTO A;  4UVC A;  4BIO A;  2DYR C;  3F5T A;  4X62 B;  2PZS A;  3W7T A;  1JCH A;  3L9D A;  4OPH A;  1GMG A;  4DV0 B;  2IJH A;  5L3B A;  5LHI A;  3T1Y B;  2EIK B;  3HKE B;  4LF7 B;  5KMG A;  2XAS A;  4LP8 A;  4JI4 O;  1GH6 A;  1Q6I A;  3OR7 C;  5ITZ A;  5BR8 O;  4YIP A;  5EBL C;  5GON B;  4JV5 B;  2E3C A;  5B1A C;  3RWR D;  1HNX B;  1XDC A;  1XNQ O;  2E75 B;  2JGD B;  1MG1 A;  2DYS B;  1IXM A;  2ZE8 A;  1M57 B;  1WPX A;  4CC5 A;  1Q8I A;  4FLZ A;  3L71 H;  3OTF A;  2B5U A;  4K3A A;  5LOV A;  5D5P A;  2EJ7 A;  4LF9 B;  3B2E E;  1P7B A;  1YIT V;  2X6A A;  5LMU B;  1S5L Z;  3ZBH A;  4UFZ A;  2RN9 A;  1Q82 W;  4O2B A;  1ZWI C;  4YY3 O;  4PEL A;  4QPK A;  4LCU C;  3RN4 A;  4FLY A;  1K5S A;  1HW7 A;  1WB7 A;  5KAI Z;  1I5X A;  2ZXW B;  3OMA B;  3DC5 A;  5B1B C;  5BMV B;  5JJE B;  2BSK B;  2DOS A;  2QM7 A;  2FKX A;  4LBE C;  4MT8 A;  2IH3 C;  3RBZ A;  2M6Y A;  1NT2 B;  1ZTE A;  3C3T A;  4J42 A;  4QNH B;  3AG3 C;  2P90 A;  4R8C A;  1P4R A;  2N05 A;  1AI6 A;  2EIM B;  1I08 A;  3MHS C;  4O4I A;  5CA0 A;  4NTX A;  3WG7 C;  1KU9 A;  2ZNI A;  3G4S V;  4JI0 O;  4WFF A;  4MW3 A;  1PP9 H;  2LJ2 A;  4FFB B;  4DV6 O;  1WN7 A;  2DMX A;  5J2U B;  1DTO A;  1R6N A;  1Y74 B;  1SC5 B;  4PHZ A;  1IBK B;  4ABM A;  4JI7 B;  1H2M A;  3D36 C;  1XMQ B;  3HKB B;  1JFF A;  1W59 A;  2JS3 A;  1ORQ C;  1FD9 A;  1M56 C;  2A3Q A;  1XOU A;  4LH6 A;  1SZT A;  4GX1 A;  2AGA A;  4Q20 A;  3UKM A;  2W0F C;  1SS3 A;  1VQ4 V;  3F7Y C;  3ZHR A;  4DO2 A;  3LSU A;  2LW7 A;  5GTH Z;  4RUF A;  4TOI A;  4X64 O;  2VQE B;  5IJ9 A;  4J11 A;  1YZB A;  4DV5 B;  4H33 A;  2N04 A;  5KA6 A;  5IYZ B;  4LH7 A;  4JAS A;  2D2C B;  2QWO B;  1V54 B;  5LMN B;  4JF3 A;  4FM1 A;  1IVS A;  2FML A;  2DE0 X;  3E8B A;  2IU0 A;  3CPW U;  3CJH A;  1AJN A;  3THO A;  2VQF B;  4LFA B;  2KQX A;  1I5Y A;  3ZRW A;  5LYJ B;  1ARO P;  4W4K A;  5CBF A;  5L3F A;  2QWP B;  4PI0 A;  3ABM B;  2IJI A;  1VF6 C;  4GT1 A;  1H8E G;  1L0N H;  3ZX6 A;  5B3S C;  3L75 H;  1FFT B;  2CDY A;  2F4V B;  4UV9 A;  1XL4 A;  4BR6 A;  1J5E B;  1N36 O;  1FJG O;  1YI2 V;  2YC0 A;  4DV0 O;  4WFB V;  2F1M A;  2QR4 A;  1GRJ A;  4P30 A;  3D8C A;  2IBZ H;  2JRI A;  1HR0 O;  1GM7 A;  4DV7 O;  2D3O W;  2GHY A;  1XI1 A;  1BL8 A;  4MSW C;  1R3L C;  2OTJ V;  1R3J C;  1KD1 W;  4YHH O;  2ZDI A;  1G4Y B;  1Q43 A;  3CX5 F;  4TV9 B;  3AK1 A;  2AZ2 A;  1XQ8 A;  1LR1 A;  2ZR3 A;  3G6E V;  2Q6A A;  2QE7 G;  3MDS A;  3Q4H A;  3B8M A;  4EKW A;  1MA1 A;  5EYP A;  2UXC O;  3H01 A;  1R1B A;  5LP6 C;  3OFN G;  3B8N A;  1FFX B;  4JTC B;  3TXS A;  1G8M A;  5KX5 B;  2BTQ B;  4I50 A;  1RPO A;  3UM7 A;  4FZ0 A;  4TQD A;  4NXM O;  3AG1 B;  4YXW G;  5LA6 B;  3OTO O;  1JMK C;  4X1I B;  1T5E A;  3QTC A;  4TWK A;  1VQM V;  2UXD O;  2UXX A;  3IJ4 A;  4U3F H;  4F4L A;  3KCY A;  3DC6 A;  1R6K A;  1SQP H;  2P6J A;  3BA9 A;  4DV2 B;  3JSN A;  5J2T B;  3JAK A;  4G27 B;  1TUB B;  3JD0 A;  1HDJ A;  3B4S A;  1V9P A;  1H8H G;  1OHH G;  2WLL A;  4WFA V;  3RVZ A;  4MVZ A;  4CH5 A;  3ETG A;  4H44 B;  1VEW A;  3F5W C;  5J9P C;  2YI8 A;  1VQP V;  2QM4 A;  1AI7 A;  3KG2 A;  2WWW A;  2XUM A;  4FJC C;  1VQ6 V;  3ASO B;  2DYS C;  3ABK C;  1RM1 C;  5BZB A;  2UUC B;  2WPD G;  4IHJ A;  2KSD A;  3OGC C;  3JAL B;  5JQG A;  1BZK A;  2HKO A;  4WFH A;  3CCR V;  3E22 B;  1S72 V;  4ZIB A;  2JGU A;  4F6R B;  4H0L B;  5C8Y B;  1VQ9 V;  3TGU H;  4B3T O;  3SPI A;  4A5U B;  1PKX A;  1I0H A;  1X4T A;  4Z1V A;  3UQ8 A;  1PPJ H;  3SJC C;  2Q5Z A;  1NVP B;  2Y0I A;  4LNU A;  3JCU Z;  1GM9 A;  5CMU A;  4LFC B;  4EEQ A;  3X2Q B;  2VRZ A;  2ZXW C;  3RYH B;  1Q81 W;  1Y4M A;  3RYI A;  3MAQ A;  1H2L A;  5B1O A;  1PNK A;  1KKD A;  3P32 A;  3JAW B;  4JI4 B;  2ZM6 O;  1WA8 B;  3VBB A;  3GWO A;  4PDR A;  4J80 A;  1BMF G;  3JAS B;  3OUF A;  1XNQ B;  4DR4 O;  3HKD A;  2EIM C;  1JA8 A;  3FB8 C;  1YHQ V;  2LGQ A;  4I4T B;  1W0J G;  3ZMZ A;  4DV5 O;  2N74 A;  4BWA A;  4NYK A;  1BQZ A;  1XUQ A;  1HP8 A;  4RUE A;  4JTD B;  4XDK A;  3BRC A;  3T4D A;  3EFF K;  3L74 H;  4O2A A;  3TCU A;  2W6I G;  2O57 A;  4ZOL A;  4LFA O;  4IIJ A;  1P49 A;  2ZE5 A;  3ZMS A;  3FKS G;  4RWU A;  3CWB H;  3ZED A;  1LUW A;  3WB2 A;  3CRC A;  1DGS A;  2QKA A;  2P5O A;  1VIB A;  4TUY B;  4ICG A;  2K9P A;  4IYI A;  3SYQ A;  4YY3 B;  3BCC H;  4E4E A;  4DUZ B;  3BVO A;  3H1I H;  4LF8 O;  2XT9 A;  1XHZ A;  3ZN1 A;  4X1K B;  2DQ3 A;  2OWO A;  1UFI A;  3QNE A;  2YUA A;  4JAA A;  3RT3 C;  2LFS A;  2P7T C;  2NNU A;  5KHJ A;  1FXK C;  1WP8 A;  1XRE A;  3HPL C;  4JTA B;  4JI3 O;  2XAG A;  3D36 A;  1AJQ A;  1SZX A;  2X6B A;  4EB6 A;  2BOC C;  3HKC B;  3JAR A;  3K9S A;  1AVM A;  1Z5W A;  4TSF G;  1QR8 A;  1N34 B;  2KKW A;  3BHP A;  1BE3 H;  5KHH A;  2JS5 A;  4Q6G A;  3H1H H;  3JD2 A;  1PNM A;  4B7E A;  4NTY A;  4JI0 B;  3APO A;  3CHX A;  4DV6 B;  3AEI A;  3RW0 A;  1JOY A;  3QO5 A;  2QM8 A;  1KC8 W;  1NTZ H;  2RQ6 A;  1KQS U;  2HJF C;  3K57 A;  3BY6 A;  5IE9 A;  2PI4 A;  2EZP A;  2JJ2 G;  1HWY A;  4R50 A;  1JPX A;  3STL C;  3ABM C;  4DW0 A;  5JVD B;  2EIN B;  2HP8 A;  3C90 A;  1L8D A;  2HLD G;  3FB7 C;  5LGU A;  4ZKI A;  1IX9 A;  4LWS B;  5KHI A;  5LHH A;  4KL1 A;  1W2B U;  3W7X A;  1GKF A;  3F7V C;  2DW4 A;  1J95 A;  1AI4 A;  1TA8 A;  3A2F A;  3P3N A;  4QIW F;  4I0X A;  1VP7 A;  1VF6 A;  3UT5 A;  3HR0 A;  3B40 A;  4PA3 A;  2PY5 A;  4U3J B;  3KCX A;  2CH7 A;  2R9I A;  3LDD A;  1VF5 B;  4KXR A;  4UXN A;  2CE4 A;  4O4H A;  2GUZ A;  3ZMU A;  3A0H Z;  4JAV A;  1B3Q A;  2NN4 A;  1Q7Y W;  2W0X A;  1E1R G;  1QHT A;  5LXT B;  4UB6 Z;  3CC7 V;  4FK5 C;  2Y69 C;  1YDX A;  2AXT Z;  2LFR A;  5CBH A;  1QLN A;  4ZHQ B;  5CN0 A;  4J7K A;  5CBG A;  3LSS A;  3WB0 A;  3AG1 C;  1K92 A;  4WFG A;  4LR3 A;  5JWP A;  2ILM A;  3N2G B;  4DUY B;  1N32 O;  1AJP A;  1Q6H A;  2EZO A;  3K5L A;  1N36 B;  2Q4P A;  2QDO A;  3RYF A;  4WFE A;  1FJG B;  4NVP A;  4LFC O;  5LP6 A;  1QR9 A;  1K34 A;  1G6U A;  1R73 A;  1YSC A;  1HR0 B;  4MVQ A;  4DV7 B;  4J7J A;  2Y4T A;  4UUJ C;  4X20 A;  4YJ2 A;  5ITZ B;  1Y76 A;  3CRR A;  4AI8 A;  1EZV H;  2PTM A;  4TQF A;  4AIL C;  2HEP A;  4AQY O;  5JJN B;  3JD3 A;  4YHH B;  4E2L A;  1PL4 A;  1DK1 A;  3OEH G;  4HZ3 A;  2OT5 A;  4CS2 A;  3ABT A;  1ZL8 B;  2IH1 C;  2G38 A;  2ADP A;  2XAQ A;  3HKE A;  2UXC B;  1SER A;  1IBL O;  4DV4 O;  2Z3Y A;  3OR6 C;  5DED A;  1MMM A;  5GON A;  2CTR A;  1WPB A;  2RDC A;  1WB8 A;  2CTQ A;  1B06 A;  4NXM B;  4EFB A;  2JGD A;  3SPG A;  2QA4 V;  3OTO B;  1MSD A;  2ETN A;  3RYC B;  4K35 A;  3N2K B;  2UXD B;  1OV9 A;  1RFY A;  4LF6 O;  4UV8 A;  4DUZ O;  3IFX A;  2ZNJ A;  2F95 B;  3X2Q C;  3ASN B;  5FL7 G;  1OCR B;  1B6Q A;  2EUL A;  3CRQ A;  4I5S A;  5EIB D;  1OCO B;  4I9W A;  1EM1 A;  4O4L B;  5KUK A;  1URF A;  5L3D A;  2E74 B;  4DK1 A;  4C7U A;  1TUE B;  4JZ2 A;  4QGP A;  3E35 A;  4PJ0 Z;  2PYL A;  1K33 A;  4HNA B;  4X89 A;  1N34 O;  1KKC A;  1UJW B;  1IXB A;  2BSK A;  4TV8 B;  3OMN B;  5KUM A;  4DR1 O;  2EIJ B;  4PA6 A;  2GBO A;  1BCC H;  1MOF A;  1YCI A;  5DEC A;  3ZHV A;  1QCE A;  2CUG A;  4D7T A;  3K9A A;  3L72 H;  1K5Q A;  4DV1 O;  5H2F Z;  4BW5 A;  4B3T B;  4PI2 A;  3CCM V;  4LFB O;  3U11 A;  3E8F A;  1Q6U A;  3W7S A;  3D3I A;  1EZJ A;  1OCC B;  1AP5 A;  4LF4 O;  4IL6 Z;  3JAT A;  1F23 A;  3RGB A;  4G2K A;  1Q3E A;  5L3C A;  4FFB A;  1M5I A;  3BAB A;  2AHY A;  5J2U A;  4XDJ A;  4FIP C;  2HJD A;  3K58 A;  3QF7 A;  4JPR A;  4KP4 A;  2QTS A;  1Y74 A;  4PDM A;  1XL6 A;  1NH2 D;  1YEW A;  4CS4 A;  4BW9 A;  2ZM6 B;  4UCR A;  2X0L A;  3CYO A;  4DR4 B;  2Q73 A;  4FZ1 A;  4MVO A;  1Q5O A;  2YIA A;  1HNZ B;  2FTK A;  2F43 G;  4L8J A;  3G80 A;  2PUS A;  4GX2 A;  1YF2 A;  2A7W A;  1FXK A;  1QVG U;  3ETE A;  5BXZ A;  4RQF A;  1F4N A;  4JYY A;  1NR1 A;  3BAA A;  3E2E A;  1NH2 B;  1VAR A;  1L0L H;  2PF4 E;  2QJ1 A;  5HFM A;  5B5E Z;  3WU2 Z;  4WBN B;  5IYZ A;  4DUY O;  3CB2 A;  3G6B A;  4LF8 B;  2M7W A;  1E1Q G;  5CB4 B;  4I55 B;  2DQ0 A;  5E1A C;  5LYJ A;  3JAM N;  1JR9 A;  4KUM A;  2ZE7 A;  4JI3 B;  1PM9 A;  1ZAU A;  5D5Q A;  2OCC B;  3K79 A;  3QO8 A;  1KBH A;  2Q0A A;  3A8T A;  4JI2 O;  2PYJ A;  4L87 A;  3CCU V;  1WLE A;  1F51 A;  4K0K B;  3CD6 V;  4UCS A;  2NLJ C;  1AR4 A;  2WA4 A;  4J9Y B;  3H1K H;  3CRM A;  3DXR B;  4O4J B;  3O65 A;  1PV0 A;  4YIO A;  1Z2G A;  5EK0 A;  3FAV B;  3APQ A;  1KP3 A;  5GW7 A;  3JD4 A;  1R6T A;  4D7S A;  4X66 O;  2FL4 A;  1NR7 A;  1VF7 A;  2JEU A;  3OE7 G;  2E5L B;  1GN3 A;  1JQ0 A;  3B77 A;  4TV9 A;  2CGO A;  1N33 O;  2ZT9 B;  2V4D A;  1K4D C;  4GUN A;  3E89 A;  1NI8 A;  4DV3 O;  1IUR A;  1N4C A;  2WLH A;  3MHH C;  2CTW A;  3K0D A;  1FFX A;  2K1E A;  1AB3 A;  2LO1 A;  1JX9 A;  5KX5 A;  3CCL V;  2BTQ A;  4PA9 A;  2WLL B;  1K8A W;  1YXB A;  2EIK C;  1SA0 B;  5LA6 A;  4X1I A;  2XAF A;  3K08 A;  5LBQ A;  3IC9 A;  1QU7 A;  2CK3 G;  1NVP D;  3CC4 V;  3ZHS A;  5LL6 Y;  2ITC C;  5CA1 A;  5J2T A;  1SQG A;  2Y0P A;  2P4K A;  1TUB A;  3T4Z A;  3SYA A;  2JK5 C;  2R72 A;  1M57 C;  1MZF A;  4JYB A;  1TGO A;  4B3R O;  5IJ0 A;  3J81 N;  3M8A A;  5L3G A;  1SKV A;  4B7K A;  3T1C A;  1OCZ B;  3WFV A;  3SYO A;  1ZSP A;  4J7Z A;  1VQL V;  1XIL A;  1N32 B;  4U7O A;  2JVD A;  2L35 A;  3ZMV A;  3JAL A;  2NR5 A;  5EBM C;  2WLN A;  4I9Q A;  4MTF A;  1XBL A;  3E22 A;  3ASN C;  4IGG A;  4F6R A;  2DWE C;  5C8Y A;  4MS2 A;  2V7Q G;  3H1J H;  5KHG A;  1M1K W;  1FYJ A;  3SPC A;  3FX7 A;  3AG4 B;  1GM8 A;  2YXL A;  3BA8 A;  1SES A;  2WLK A;  2ZIO A;  2GDS A;  2IM9 A;  1FKA O;  4AQY B;  1FPO A;  1SQX H;  3ETQ A;  5KLV H;  4X1Y B;  4UCU A;  1TVK B;  4UCV A;  2YXY A;  5B1B B;  1HNZ O;  4LF5 O;  3OM3 B;  3RYH A;  1Y6X A;  2Q7G A;  1A32 A;  2EIJ C;  1GO3 F;  1I94 O;  2QGN A;  3JAW A;  1EN6 A;  1WA8 A;  1S5H C;  1IBL B;  1X59 A;  4DV4 B;  4BAY A;  1P84 F;  3FB6 C;  5EIB C;  2RJZ A;  3JAS A;  3ZHT A;  3ML0 A;  1ZUQ A;  2VS0 A;  2C2A A;  3WG7 B;  5BY1 A;  3SDL A;  3OEE G;  4I4T A;  2B9Z A;  3L73 H;  4MTO A;  5AG2 A;  4H13 B;  4JI1 B;  3H1L H;  1OCC C;  4ZBM A;  4LF6 B;  2YEV B;  1MZE A;  3BPZ A;  1BSM A;  1CEZ A;  5B66 Z;  1QVF U;  5GTI Z;  1H2K A;  4GLX A;  1FXH A;  3E8H A;  5A2Q N;  4TUY A;  3TJT A;  3U0Z A;  2IJJ A;  3JAR B;  5KA5 A;  4PV1 B;  3CP1 A;  3QVN A;  3TXQ A;  1N0N A;  1IBM O;  4JGS A;  5FNV B;  2ITD C;  5B1N A;  2OIE A;  4X1K A;  4K0K O;  1H2G A;  1WP7 A;  4DW1 A;  1TAE A;  4DR1 B;  5EZY B;  2CGN A;  1V54 C;  2MK3 A;  4NKG B;  4CZZ A;  1NTK H;  3K04 A;  4CH6 A;  4J9Z B;  4DV1 B;  3OMI B;  4R6Z A;  2EIL B;  4TT3 G;  5DM6 V;  5IWA O;  1FAF A;  3HKC A;  4LFB B;  2A9H A;  1QBZ A;  3GB7 C;  1SET A;  2ZIN A;  2QWN B;  1RSO B;  1D5A A;  1GK9 A;  2Z5U A;  2ZE6 A;  2WLI B;  3ZN0 A;  4LF4 B;  2E5L O;  2WAM A;  2ZIM A;  2YIC A;  3K3W A;  1MSW D;  2X7R B;  4YJ3 B;  2BOB C;  3S3X A;  1COW G;  2RCV A;  1GN4 A;  1THZ A;  1AI5 A;  4ZI7 B;  1KEC A;  3LDC A;  3W7U A;  4GZR B;  5IDJ A;  5B3S B;  3SPH A;  4JAU A;  2Q7H A;  5JVD A;  1BHA A;  3LNM B;  3AG2 B;  2OCC C;  2B1I A;  3SR2 C;  3K59 A;  2KG7 B;  4NXN O;  2A06 H;  4JYC A;  1EN4 A;  3BEH A;  2QKS A;  4DRX B;  2Y48 A;  3WB1 A;  1PL0 A;  3ZIA G;  4DXW A;  1BHB A;  1AIL A;  4FM2 A;  1R3I C;  3VQW A;  1KB9 F;  1NU1 H;  5JH7 B;  5F2V O;  1ROP A;  5IYD O;  2GSM B;  4EFE A;  5LXT A;  2A79 B;  4RQE A;  3E86 A;  4DR7 B;  4JZG A;  3FD9 A;  4B3S B;  4ZHQ A;  3SJQ C;  2H3O A;  4GX5 A;  2XND G;  4GKK B;  5KMG B;  2UUA O;  1MAB G;  3ABL B;  1XNR O;  3N2G A;  3UO3 A;  2ZKO A;  1CP9 A;  1NZ6 A;  1XEQ A;  1W0K G;  4DR5 O;  2WLM A;  4JI2 B;  2IW5 A;  4B3M O;  1AR1 B;  5K1X A;  1XMO O;  4MVU A;  1ZX3 A;  5IY5 B;  3ASO C;  2P06 A;  3RVY A;  3IGA C;  2GTA A;  4PDL A;  4F6E A;  5LGN A;  4XDL A;  1HNW O;  2F66 C;  3JSL A;  1E79 G;  5LOV B;  1SQV H;  1K73 W;  4P9P A;  2F93 B;  4MVS A;  5EC1 C;  4KHP O;  3ZHQ A;  4JYA O;  1GAX A;  4WF9 V;  4X66 B;  1CXZ B;  1OCZ C;  1PD3 A;  2GV9 A;  3ABK B;  1RM1 B;  4DK0 A;  4OX9 O;  4WCE V;  1VQN V;  3AK3 A;  1YTF B;  1N33 B;  4O2B B;  1XHX A;  1ZL8 A;  2BTO A;  4JI1 O;  3SYP A;  4HAM A;  3U10 A;  2LQT A;  4DV3 B;  1Y66 A;  4KFM A;  3T1H O;  3G67 A;  2Q69 A;  2DN9 A;  3R66 A;  4FFK A;  4DR2 O;  4I7Z B;  3ZRS A;  1BS3 A;  4X65 O;  1VQO V;  1SQQ H;  1GN2 A;  2L6L A;  5A9G A;  1N8R W;  3AG4 C;  3CCE V;  3RYC A;  3CE2 A;  5CA3 A;  3M7M X;  3OAA G;  3N2K A;  2Q8V A;  2JIZ G;  1BGY H;  4O4I B;  5CA0 B; 
#chains in the Genus database with same CATH homology
 1PPJ H;  3L74 H;  1BE3 H;  1KYO F;  1EZV H;  3H1H H;  1P84 F;  1SQX H;  4D6T H;  1SQQ H;  1PP9 H;  3CXH F;  5KLV H;  3CX5 F;  1BCC H;  2BCC H;  3CWB H;  3L70 H;  1SQB H;  3H1K H;  2FYU H;  1NTZ H;  3L73 H;  4U3F H;  1KB9 F;  1L0L H;  2IBZ H;  3L72 H;  3TGU H;  1NU1 H;  1NTK H;  3H1L H;  1SQP H;  3H1J H;  2A06 H;  3BCC H;  1L0N H;  3L75 H;  3L71 H;  1SQV H;  1BGY H;  3H1I H;  4PD4 F;  1NTM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...