3BCCH

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
66
structure length
66
Chain Sequence
LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELFDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 20
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3bccH00
5KLVH 3CWBH 4U3FH 2A06H 1PPJH 3H1IH 3L70H 3L72H 3L71H 3H1HH 1NTZH 4PD4F 1BGYH 1SQXH 1KYOF 1L0LH 3L73H 1EZVH 1BE3H 2IBZH 1KB9F 1L0NH 1SQPH 3H1JH 3H1LH 1BCCH 3L75H 1SQQH 3TGUH 3CX5F 4D6TH 3L74H 1SQVH 1NTMH 2BCCH 1SQBH 3BCCH 3CXHF 3H1KH 1NTKH 2FYUH 1PP9H 1P84F 1NU1H
chains in the Genus database with same CATH superfamily
3G6EV 4LBEC 2WAMA 1IXMA 4LFAB 4WF9V 4K0KO 5B1NA 3HKDA 4JI3B 2QWPB 4UV8A 1AJNA 1J5EB 2IW5A 5CA1A 2GUZB 4WFEA 1Q6UA 3JYCA 3UT5A 2VWJA 2QWRB 2DW4A 1VQ6V 4B08A 5AG2A 2Q7EA 1I0HA 4JAUA 1GRJA 3RYCA 5K1PA 3OD4A 1AI7A 2G38A 1VMGA 2F4VO 2R72A 2F23A 4DR6B 4ZBMA 2RCVA 1YXBA 2VWKA 3T4ZA 2F95B 3TXSA 1WNSA 1K34A 2PY5A 3APQA 2WLJA 2ZE5A 4X1IA 2Z3YA 2CUGA 3RYIB 2QWQB 3OTOB 5LMUO 1K7DA 3CCEV 2ZDIC 2HHHO 4CC6A 2VQFB 5J2UA 1KP3A 1XMQB 1Z5VA 1UPGA 4I50B 3LSQA 4JI7O 1IDSA 3ETDA 2NLJC 3A2FA 3D8CA 1IBLO 4TUYA 3S3WA 5LHIA 4HBNA 4IHJB 1OCCC 2WLLB 3UO2A 2EJRA 3WB2A 1SQVH 1OCRC 2CH7B 4UUJC 3JALB 3ASOB 3SYPA 4HYOA 1GAXA 4H37A 1HWYA 1GH6A 1Z2GA 1G4YB 3L72H 1O9GA 3GVMA 3N2KB 4GKJB 2HFEC 1QHTA 3D3IA 1N36B 4LF9B 3LSUA 2L35A 4DV0B 2ARHA 3F5TA 1KUQA 3FX7A 1Q5OA 5EZYB 5FNVA 1SQBH 4FM2A 2ZIMA 4H0LB 5J2TB 2MW2B 3JASA 4DR4B 4O4HA 4DO2A 1JOYA 1NU1H 2A7WA 2QTSA 3J81N 5LMNO 1NQTA 4O4IA 1YSCA 3AEIA 3G80A 1AR4A 4LC1A 4HNAA 1QQCA 3CJHB 5IJ0B 4MW8A 1VF6A 1QVFU 2YC0A 1I5XA 2M7WA 2JEXA 1N32B 4X65B 2OCHA 3O65A 2HVJC 1FKAO 1I08A 1B6QA 2H3OA 2WLMA 1K73W 4NVPA 1XILA 5KHKA 4OXSA 3ZMUA 2CTWA 2ZKOA 3QNEA 2QDOA 4WFHA 2KKWA 4PV1B 4UVAA 1FXVA 2IJKA 1P7BA 3ZHTA 2ODMA 1TUBA 4JYBA 4YJ2A 4U7OA 1KYOF 2Y4UA 4DUZO 4LF5O 1TA8A 2KG7B 2B1IA 1I94O 1NBMG 4KFMA 1SC5B 4J7KA 5EC2C 1GM9A 1URFA 2UXCB 1WB7A 4JI4O 3G6BA 2ZR3A 2A79B 3H1IH 3K04A 4UCUA 4JI2O 3FB5C 4DV4O 2E5LO 4GLXA 4MTOA 3U10A 5B1AC 4JI8B 5C8YA 3VQVA 1KU9A 1AB3A 4I0XB 5DM6V 3CCRV 3RYHA 1YVWA 3FB6C 5LOVA 1M4UA 5KMGA 1JVMA 2P06A 3E8BA 4X20B 2JDIG 3CE2A 1GO3F 2WLIB 1IVSA 2EIMC 1KBHA 4PDVA 5A2QN 5JCOC 1N0NA 1RPOA 4ZI7A 1NH2D 3TK1A 1D5AA 1ZL8A 3E8GA 1ORQC 3TXQA 1S3JA 1FXKB 5B66Z 2KSDA 4FIPC 3QO5A 2P6JA 5EYPB 1M56B 1ZX3A 2LO1A 3BHPA 3KCXA 2YICA 3OM3B 3JSLA 3ZMZA 5CA0B 4B3SB 1O9HA 4X66O 2RNBA 1Z5WA 4LR3A 4MVSA 5KA6A 5KUMA 1IBKB 2V7QG 4GX1A 1N34B 3CMAV 3K5NA 1WJZA 4O2BB 1K92A 2CTQA 2H8PC 3B8MA 1RM1B 5JCOA 1YCIA 4LP8A 1LR1A 4I4TB 3UCSC 2JS3A 1Y76B 4H33A 2A3QA 3RYFB 1OV9A 2UU9B 1MZEA 5CA1B 3CC7V 4GKKO 3K9AA 3WU2Z 1GTOA 2BSKB 1GN4A 4JTAB 2ITDC 4JPRA 1Q43A 1TUEB 1V54B 1SETA 1BHAA 1EN4A 2K1EA 4TV8B 1XBLA 1FFXB 2YIBA 2UUCO 1VQMV 5JQGB 1FFXA 1HNZB 2ATKC 2UUBO 4UB8Z 5B5EZ 1THZA 5LYJA 5KHIA 3BA9A 4I55B 4PJ0Z 2JIZG 4UCVA 4GX5A 1VQNV 3ZBHA 5KA5A 4PDMA 1K5SA 1SQFA 3K08A 1RP3B 4OX9O 4KUMA 2ZM6B 3JASB 2Q6AA 3BAAA 4FLXA 4YHHB 4B3MO 1Q6HA 1HNWB 4J7ZA 4JI6B 1CEZA 3AG2C 2JK5C 3HPLC 4P9PA 2Q73A 1BT8A 4PA3A 1D5NA 2VS0A 2VRZA 4IT5A 2Q68A 5IT9N 4FZ1A 5L3GA 5EIBC 3UT5B 1SESA 1AJQA 4LWSA 5LP6A 2GUZA 1AJPA 2AW9A 2FL4A 1NKDA 2XAGA 1YTFB 4DV6O 2UXBO 2HEPA 5IYZA 1WN7A 3JD0A 4PI0A 2LJ2A 4FFKA 1AP5A 2E76B 2JJ1G 4FVMA 1WPBA 2YDEA 4LNUB 4FM1A 2ZD9A 3HR0A 4JV5O 2AZ0A 4X1YA 3FD9A 1H38A 1GN2A 1K97A 3UQ8A 1F7YA 1R3IC 1M57B 3AG3B 3U0ZA 1XMOO 1DF5A 5LGNA 3J80N 1Y67A 1BL8A 2VQEB 4LF4O 2XUMA 3HKBB 3OR7C 1VQOV 1M1KW 4DV3O 4MTFA 4KXRA 2C2AA 4R50A 4EKWA 1JX9A 3U11A 1JCHA 3P30A 3K57A 2OIGA 2HP8A 2XTAA 2XAJA 1KP2A 4TQDA 2JGDA 1L8DA 3TETA 1S72V 3K5OA 4GX0A 2LGQA 3OT7A 1Y6XA 4KL1A 4DR7B 3VQWA 1VF7A 2QKSA 3SYQA 4ZHQB 1OCZB 5EC1C 4WCEV 3SJQC 2ILMA 1NTZH 3ABMC 5F2VO 1MA1A 2D2CB 3T4DA 4K0KB 1SQXH 1YDXA 1EZVH 3B8NA 2ZNIA 4O4HB 1VQLV 1R3JC 4O4IB 1Q7YW 4F6RB 1XNRB 1QLEC 1ENVA 2EULA 1GM8A 2E75B 4HNAB 4ZI7B 4DV2O 1AROP 4DK1A 2WLIA 1H2GA 4FK5C 1OHHG 2DQ3A 2Y0IA 3A8TA 1B06A 1SA0A 1S5LZ 2YEVA 1TVKA 1V9PA 3CC4V 4LFCB 4PDRA 5GTIZ 3Q4HB 4BAYA 4JF3A 3OEHG 4QE9A 4U3FH 4JTCB 5LA6B 2V4DA 2KQXA 4J7JA 3SJBC 5LA6A 4B3TO 4DR5B 3WB0A 2QKAA 2IU3A 2YI9A 1COWG 3O9OA 3BY6A 3DSQA 5CMUA 2Q4PA 4DV1B 1IX9A 2P4VA 2BE3A 4AQYO 1AI5A 1WAZA 4LFBB 4H13B 4X64B 3RYHB 2CTRA 4PHZA 1RSOB 5B3SC 4OGQB 1MSWD 3CCQV 3CS5A 2LP7A 3STZC 3CEIA 4MSWC 5LP6C 3ZEDA 4NR1A 2UXXA 2EINC 5IYZB 5JQGA 4H44B 4ZKIA 4R7CA 3B2EE 1KMIZ 1PNMA 1SKVA 2R70A 4X1IB 3OFNG 4DR1B 1W0JG 2DYRC 1K9MW 1EFRG 1FYJA 5EBWC 1W0KG 3LUTB 1WB8A 3Q4HA 4DR4O 1BHBA 4OPAA 3W7WA 2ZT9B 2OT5A 1Q3EA 4KP4A 3AG1C 3T1HB 2W6IG 5DEDA 5IJ9B 2WSSG 4HAMA 2PF4E 2Y4TA 4R8CA 2CDYA 4IGGA 1DGSA 4I4TA 4B3RB 1VP7A 3KCYA 1N33B 1B04A 2CGNA 3CX5F 3L74H 4KHPB 1T5EA 4B7EA 1NTKH 4JZ2A 1HP8A 2MK3A 1R1BA 2XT9A 3JD2A 1M56C 2WLHA 3R66A 1CP9A 4IIJA 3BABA 5A9GA 4ICGA 2CE4A 5CN0A 2EILC 1SF9A 1E1RG 4LF5B 5E1AC 1VQ8V 4ZOLA 1P4RA 1B3QA 2JS5A 2F66C 4L87A 3ICXA 2QE7G 4Z1MG 2YSUB 1SQQH 3J7AU 4JI5B 3OAAG 3CCJV 3OTFA 3DTUB 2F1MA 3MDSA 3LDEA 5EZYA 5FNVB 4QJFB 4BR6A 3ZHVA 2ITCC 2JJ2G 5CBFA 4FLZA 1H8HG 4MVMA 1K5QA 3K5MA 5KAIZ 3RYIA 3W7UA 2DOSA 3ZHQA 1AR5A 3H1JH 4GUNA 3RVZA 1H2MA 3RW0A 1VEWA 1FXHA 2XASA 4WFBV 2QEXV 4JGSA 4X62B 4J11A 4A5UB 3CRMA 5KLVH 4NTYA 3HKBA 4W4KA 3M8AA 3OTOO 1BZKA 2WA4A 2AXTZ 2WLNA 1MOFA 4QPJA 4BIUA 1KB9F 3ZHSA 5HFLA 2ZE8A 4QPKA 2GTAA 2Q7HA 3RFRA 2DWEC 1TUBB 1R73A 1BMFG 4FFBB 1Q8IA 2YXHA 2QGNA 4JI7B 2PYLA 1YHQV 3AG3C 1TGOA 2ZE6A 5IYCO 2PZSA 2M6YA 5KHGA 4JI0B 3L70H 1ZL8B 4UCRA 4X66B 4JYAO 1IBLB 5JJJB 3OUFA 1NI8A 4RQEA 1RPRA 4X89A 3BEHA 1N34O 3H1LH 1H2LA 1V55C 5CB4A 1EN6A 5J2UB 4UCTA 3QG5A 4MVRA 4DR3B 5C8YB 2IJHA 1S5JA 3T1YB 4U7NA 1EM1A 2JEUA 3AK2A 5LOVB 1N36O 3LNMB 4LF9O 1XHZA 2YIDA 4QNHB 1L0NH 4JI1B 4AHCA 1KECA 4UB6Z 3ZN1A 2Q7GA 4AILC 2R9AA 3N27A 1WP7A 1ZLZA 2CK3G 1AVMA 3E35A 3RT3C 2WPDG 2UUBB 2GHYA 3W7SA 2DN9A 4EFEA 4DV7B 3ZRSA 4K8XA 1XNQO 4P9OA 5BMVA 1JPXA 2EBOA 2PYJA 2F93B 4UVBA 4YJ2B 1KKDA 3IC9A 4J42A 3KG2A 1BS3A 4YY3B 2OCCC 2D3OW 5EK0A 1PNLA 2ZM6O 4QE7A 2X6BA 4WFAV 1I94B 2BTQA 4GYCB 1HNWO 3ZHUA 3IC7A 4FZ0A 4ASUG 5LHGA 3G4SV 2QR4A 1W2BU 4X88A 4N21A 1SERA 1RSOA 2BSKA 3ZRVA 1NR7A 4I9QA 4Z1VA 5BR8O 4WBNB 4JI2B 3CD6V 3E22A 3DC5A 4ZIBA 3I55V 5J9PC 4DV4B 2E5LB 4DRXB 1SZXA 2JRIA 4JI8O 3HKEA 1N0JA 3SDLA 1FJGO 1IXBA 4IHJA 5DECA 5BMVB 4FFBA 4IYHA 4LF8B 5LP6B 4LF6B 4DV6B 2Y48A 5L3BA 3SJAC 2FMLA 5B3SB 1AP6A 1Y4MA 2ZNJA 3GWKC 3JARB 1ZTEA 4DUYB 2BOBC 3FYIB 1BSMA 4HZ3A 2PI4A 2GDSA 4D7SA 3TJTA 1XHXA 4MVQA 1XREA 5JH7A 4P30A 4DW0A 1GN6A 5D5PA 3OR6C 4TT3G 4CH6A 2GV9A 1HNXO 2UUAO 2W0XA 4Q20A 4BW9A 5L3FA 1HR0B 4B3SO 2ZCEA 1MSDA 4X20A 1IBKO 4X1YB 4MVOA 2BTQB 1J95A 4NTXA 4NXMO 1XL4A 2ZR2A 1FXKC 3SPGA 1SS3A 3ZRWA 3CYOA 3JCUZ 4DV3B 4TV9B 4J41A 4JYYA 5KAFZ 4ZOLB 2EIJC 3CB2A 4F6EA 5HFMA 1NVPD 2UU9O 4TWKA 1QR9A 1XL6A 2OCCB 2HKOA 3CPWU 4CH3A 3RBZA 3ZMTA 4D7TA 3CCLV 3SGIA 3OMNB 1F23A 1CXZB 3L9DA 2CAZC 1QLEB 4UCSA 3SYCA 4X9QA 2QSAA 3N2GB 2A0LA 1Y74A 2EIJB 4DR7O 3GWOA 4YIPA 3E2EA 1Y76A 2QA4V 2XAFA 1FPOA 1U97A 4B7KA 3F5WC 4AI8A 4E2LA 2XOKG 1VQ5V 2PGGA 1H2NA 3DXRB 2LFSA 2DMXA 5KX5B 4WBNA 3JAWB 4MVZA 2HJFC 3STLC 5JVDA 2Y69B 2BTOA 1WPXA 4W4LA 3G71V 1BE3H 3ZHRA 1U96A 3ASNB 1WA8A 2JVDA 3BFRA 3EVKA 3H1KH 4XDJA 4GX2A 3WFVA 3ABUA 2N05A 2EIKC 5LL6Y 4O2AA 1Q82W 1YITV 1IBMB 2EIKB 1E79G 3E8FA 4NTWA 1JA8A 2FKXA 1JFFA 1FD9A 1IZ3A 5IWAB 1PKXA 3X2QC 1EN5A 1NVPB 2DWDC 3A0RA 1OCZC 4Z2WA 4X64O 3KKYA 2NN4A 3ASOC 1OCOB 3C3TA 2DQ0A 3SPIA 3MD0A 1H8EG 1S76D 1YJNV 4P2ZA 3QO8A 2HVKC 3ETQA 4K35A 3GB7C 3A0BZ 3H9VA 2RJZA 3NR7A 1M90W 1DTOA 1DF4A 5LYJB 4RQFA 4DR1O 2QM7A 4MS2A 3S3XA 5L3EA 5D5QA 1SRYA 4FM0A 1S77D 1QLNA 1VQ7V 1AI6A 2LGWA 2IH3C 1XDCA 3LNNA 1RM1C 5IE9A 2HG5C 2HLDG 1JJOA 4N23A 2IH1C 5GONB 3K9SA 3K79A 1N33O 4I0XA 2Q67A 1Q86W 4KHPO 1R6TA 1GN3A 5BY1A 3WB1A 4E4EA 4LH7A 5B1BC 2ZIOA 1M93A 1SQGA 1AI4A 1KKCA 4LF7O 1V55B 3VOUA 4JAVA 3K0DA 1HW7A 3PJSK 4RWUA 1K3EA 4FLTA 3E86A 4NXNB 3EHBB 1A32A 4I5SA 4UVCA 3UO3A 4DW1A 3CCMV 4C7UA 3JALA 1TVKB 1XNRO 4JI5O 4JAAA 5B1BB 3OGIB 1MNGA 3CP1A 5H6QA 4U3JA 3THOA 1YJWV 3RVYA 3CMEV 4DV2B 3ZMVA 3CRRA 3CCSV 4J9YB 4WFFA 5B1AB 4K3AA 4JI3O 3TCUA 1VIBA 3B77A 3P3PA 1JMKC 3PN1A 4TQFA 5C93A 4LNUA 1P7GA 2IJIA 2A9HA 1YIJV 3C90A 3P3NA 3ZRXA 2HJDA 3CSXA 4ZHQA 3H1HH 3OGCC 3SYAA 3X2QB 2PTMA 4YXWG 2F4VB 4B3TB 4DR5O 3JCZA 1SZTA 4FMTA 4FLUA 2L6LA 3ZJZA 1LUWA 1PM9A 4G27B 5JJNB 2V1DA 2EIMB 2B5UA 3NXSA 1PL0A 4JI0O 4JYAB 4YJ3B 4LFBO 2QM8A 2AHZA 2HHHB 1YTFD 2Q8VA 2VQFO 4DXWA 5FLXN 1SA0B 5K1XA 5KHHA 2YIAA 3QO7A 3L75H 3K06A 2P4KA 1I5YA 3BA8A 2IJJA 3FYEB 4DR3O 3OUSA 3UKMA 4O2AB 3K03A 1K33A 2Y69C 3T1YO 5CA3A 2ZQMA 4RO2A 4O4JB 1L1FA 4EB6B 2OTJV 2RN9A 2KB1A 1M57C 2QTOA 4JI1O 3SJCC 3E8HA 5KHJA 5KMGB 3T1CA 4RUFA 2XAQA 3JAWA 2EINB 5LGUA 1KC8W 2QKCA 2HR3A 1G8MA 2IM9A 1FAFA 1JJ2U 3F7VC 1BGYH 2WLKA 1TAEA 4DV7O 4DV0O 2IBZH 1XNQB 4U3JB 2PI5A 2K9PA 3OMIB 3VBBA 1NS1A 1AILA 4FLWA 2ZXWC 5GTHZ 1AR1B 3ML0A 1R6KA 3JD3A 4YY3O 3ABTA 1RFYA 3K58A 2N74A 2YIBD 2N04A 4DR2O 2EZPA 3F7YC 3G67A 5IYBO 1VF5B 2KG7A 3APOA 4DV5B 4MVUA 5H9CA 3LDDA 4QIWF 4FLYA 1N32O 2R9IA 4PELA 4X65O 1LNQA 1DLBA 2UXDB 1XEQA 4CS4A 5H6RA 3RYFA 2CGOA 3HKDB 4PA6A 3ZIAG 4L8JA 5E79Z 3SPHA 3JD1A 5GONA 5JWPA 5BR8B 3CJHA 4TV9A 5IJ0A 2DJVA 4LFAO 4G2KA 1FJGB 1J5EO 3CCUV 2P7TC 2DYSC 2W6JG 5LXTB 2UXCO 1MG1A 4X62O 1UFIA 1Q81W 5CA0A 3D3QA 4DUYO 2UXNA 4BWAA 3E89A 1FFTB 4PA4A 2R9RB 1K4CC 2B9ZA 4X1KA 4IL6Z 3T2MA 4XDKA 4JTDB 3AK1A 4DR6O 3JATA 3HKCA 3JAMN 4MTGA 1PV0A 3FB8C 3ABLC 3IAYA 4RAIA 3BCCH 1W59A 2ETNA 2Z0AA 2F43G 4GCZA 5JH7B 5LGTA 1F4MA 3L71H 5LMUB 4O4LB 1LUVA 2GSMB 4O4LA 2E3CA 4NXMB 1EZJA 2YUAA 1JFFB 1XMQO 1GKFA 1VF6C 3MAQA 3E22B 1YJ9V 1VQPV 2YXLA 3P32A 4LWSB 2H94A 3ABKC 3FAVA 3HKEB 5IY5B 2OIEA 2DYRB 4X1KB 2ADPA 5EYPA 2NR5A 3CC2V 1OZ0A 3FKSG 2AGAA 2YEVB 3C3SA 5LXTA 3AG1B 2Y0PA 2X6AA 3ASNC 3QTCA 3ABKB 2FYUH 2Q69A 2OTLV 5L3DA 4MTXA 3EXAA 4XBFA 1P49A 3AG2B 4GKKB 3CRQA 2X6CA 1MABG 1QCEA 4PD4F 4GKJO 3B4SA 4FJCC 3AK3A 2AZ2A 2WA3A 4OPHA 1G1XB 2GBOA 1YEWA 1UJWB 4CZZA 4CS3A 5IYDO 4MW3A 1ZAUA 1VARA 3LDCA 4GT1A 3OEEG 2UUCB 5LMNB 4GZRB 5ITZA 3D36C 4IIJB 4TV8A 1NJIW 1L0LH 3L73H 3OW2U 1BQZA 3ETGA 1FS0G 1YI2V 3SPCA 1BCCH 3SR2C 3HB3B 4BIZA 3TGUH 4TUYB 3DGEA 1M9NA 5BXZA 3ZS8C 2X0LA 1EBOA 4LCUC 2WLLA 3IFXA 1E1QG 2EZOA 1PL4A 4YJ3A 3JAKB 4OX9B 4X8AA 1H2KA 3QF7A 4F4LA 3K3WA 4DUZB 1XQ8A 3HKCB 4LH6A 3R65A 4LF8O 4JI6O 4LF6O 5IY5C 2QM4A 2LFRA 4JI4B 4NKGB 5FPRA 5IWAO 1QU7A 2P22C 5LHHA 4EB6A 5CB4B 2A06H 1OCRB 3W7TA 5FL7G 1I7FA 1ZUQA 1N8RW 4I50A 5GW7A 5J2TA 4J9ZB 1Y66A 1QR8A 1US6A 3LSSA 2BOCC 3FAVB 1QBZA 4PDLA 5EBLC 4DYLA 2Q5ZA 3CXHF 1NTMH 3DC6A 3K0GA 2LW1A 1DK1A 3BVOA 2UXBB 2IU0A 2W0FC 1HNXB 5KUKA 2XNDG 2UUAB 2QJ1A 1HR0O 5BZBA 1X59A 2LQTA 3BRCA 2AHYA 2P67A 2EX3A 2JGUA 4PA7A 4DK0A 4CC5A 1F51A 3RGBA 3W7XA 2EJ7A 2JGDB 3SPJA 4JV5B 3B09A 3RYCB 3ZCCA 4FLVA 1YF2A 3B40A 3H01A 2XAHA 2YI8A 3CRAA 4XDLA 1CPYA 3FB7C 3BPZA 3ZX6A 1VQ9V 3VQXA 3N2GA 1ZSPA 4I55A 3JATB 3VQYA 3ETEA 1XI1A 3JD4A 1MZFA 3KZIZ 4I9WA 4NB5A 1VQ4V 1JQ0A 1S0VA 2VQEO 2OYQA 5DN6G 3AG4B 4LF4B 3D36A 5EIBD 1PP9H 4JASA 4IYIA 2E74B 2FB5A 4I7ZB 1KQSU 5KX5A 3MHHC 3ABMB 4CH4A 2NNUA 4QGPA 5JVDB 4NXNO 2CTPA 1OCCB 4J10A 3RWRD 4BW5A 4CH5A 2XHBA 5EBMC 2DYSB 4MT8A 3QVNA 1Q6IA 1WP8A 4ABMA 2P90A 2YS8A 1ZWIC 1S5HC 2Z5UA 2PUSA 3OE7G 1YZBA 3CXCU 1Y74B 3CWBH 5L3CA 4RUEA 2ADQB 1HNZO 2CH7A 1N4CA 3ZMSA 3SYOA 1QVGU 5B1OA 1NH2B 3N2KA 4JZGA 4BIOA 1R6NA 3RN4A 3A0HZ 5IJ9A 4UFZA 1QNMA 1R3LC 1NT2B 1KD1W 2RMKB 4WFGA 5ITZB 4O2BA 2Q9LA 1XOUA 4JYCA 1XUQA 3K5LA 1BQ0A 2ZXWB 4NYKA 1IBMO 1MMMA 4YHHO 4B3MB 2RDCA 3UM7A 4LFCO 2Q0AA 3CRCA 3WG7C 2QWOB 4K8ZA 3M99B 2YXYA 4FPPA 1JR9A 1ROPA 1VQKV 2Q0OC 3MHSC 3IJ4A 4CS2A 3ZRWB 1X4TA 4TOIA 4CBCA 2B1GA 1NR1A 1IURA 4UCOA 5CBHA 5LBQA 3WG7B 5IDJA 1R3KC 1WA8B 3AG4C 3JAKA 3OMAB 3IGAC 4G28B 1OJHA 2WWWA 4DV1O 4J80A 2GTSA 3JARA 4AQYB 1V54C 4YIOA 1NZ6A 1K4DC 1OCOC 3ZN0A 2DE0X 2ZE7A 4UXNA 1SQPH 1D2DA 2BCCH 4PI2A 1PNKA 3FFQA 1GK9A 1H2SB 1Q90D 2FTKA 3AG7A 1F4NA 3I5DA 5CBGA 5FPOA 3E83A 1GM7A 1K8AW 4F6RA 3M7MX 1XMOB 1HDJA 4DRXA 2X7RB 2ZDIA 4UV9A 3EFFK 4D6TH 1WLEA 5H5NA 2RQ6A 4EEQA 1P84F 2QWNB 3CCVV 2OWOA 4Q6GA 5TISZ 2O57A 1PPJH 1G6UA 4DR2B 4PA9A 4LF7B 3T1HO 1FXKA 2LW7A 3CHXA 4DV5O 1M5IA 5H2FZ 3JSNA 2EILB 4TSFG 1PD3A 4B3RO 5JJEB 3K59A 4O4JA 2UXDO 4EFBA 3ABLB 2P5OA 1GMGA 2ZINA 3I56V 4R6ZA 3DXRA
chains in the Genus database with same CATH topology
5KLVH 3CWBH 4U3FH 2A06H 1PPJH 3H1IH 3L70H 3L72H 3L71H 3H1HH 1NTZH 4PD4F 1BGYH 1SQXH 1KYOF 1L0LH 3L73H 1EZVH 1BE3H 2IBZH 1KB9F 1L0NH 1SQPH 3H1JH 3H1LH 1BCCH 3L75H 1SQQH 3TGUH 3CX5F 4D6TH 3L74H 1SQVH 1NTMH 2BCCH 1SQBH 3BCCH 3CXHF 3H1KH 1NTKH 2FYUH 1PP9H 1P84F 1NU1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV H;  3CWB H;  4U3F H;  2A06 H;  1PPJ H;  3H1I H;  3L70 H;  3L72 H;  3L71 H;  3H1H H;  1NTZ H;  4PD4 F;  1BGY H;  1SQX H;  1KYO F;  1L0L H;  3L73 H;  1EZV H;  1BE3 H;  2IBZ H;  1KB9 F;  1L0N H;  1SQP H;  3H1J H;  3H1L H;  1BCC H;  3L75 H;  1SQQ H;  3TGU H;  3CX5 F;  4D6T H;  3L74 H;  1SQV H;  1NTM H;  2BCC H;  1SQB H;  3BCC H;  3CXH F;  3H1K H;  1NTK H;  2FYU H;  1PP9 H;  1P84 F;  1NU1 H; 
#chains in the Genus database with same CATH topology
 3G6E V;  4LBE C;  2WAM A;  1IXM A;  4LFA B;  4WF9 V;  4K0K O;  5B1N A;  3HKD A;  4JI3 B;  2QWP B;  4UV8 A;  1AJN A;  1J5E B;  2IW5 A;  5CA1 A;  2GUZ B;  4WFE A;  1Q6U A;  3JYC A;  3UT5 A;  2VWJ A;  2QWR B;  2DW4 A;  1VQ6 V;  4B08 A;  5AG2 A;  2Q7E A;  1I0H A;  4JAU A;  1GRJ A;  3RYC A;  5K1P A;  3OD4 A;  1AI7 A;  2G38 A;  1VMG A;  2F4V O;  2R72 A;  2F23 A;  4DR6 B;  4ZBM A;  2RCV A;  1YXB A;  2VWK A;  3T4Z A;  2F95 B;  3TXS A;  1WNS A;  1K34 A;  2PY5 A;  3APQ A;  2WLJ A;  2ZE5 A;  4X1I A;  2Z3Y A;  2CUG A;  3RYI B;  2QWQ B;  3OTO B;  5LMU O;  1K7D A;  3CCE V;  2ZDI C;  2HHH O;  4CC6 A;  2VQF B;  5J2U A;  1KP3 A;  1XMQ B;  1Z5V A;  1UPG A;  4I50 B;  3LSQ A;  4JI7 O;  1IDS A;  3ETD A;  2NLJ C;  3A2F A;  3D8C A;  1IBL O;  4TUY A;  3S3W A;  5LHI A;  4HBN A;  4IHJ B;  1OCC C;  2WLL B;  3UO2 A;  2EJR A;  3WB2 A;  1SQV H;  1OCR C;  2CH7 B;  4UUJ C;  3JAL B;  3ASO B;  3SYP A;  4HYO A;  1GAX A;  4H37 A;  1HWY A;  1GH6 A;  1Z2G A;  1G4Y B;  3L72 H;  1O9G A;  3GVM A;  3N2K B;  4GKJ B;  2HFE C;  1QHT A;  3D3I A;  1N36 B;  4LF9 B;  3LSU A;  2L35 A;  4DV0 B;  2ARH A;  3F5T A;  1KUQ A;  3FX7 A;  1Q5O A;  5EZY B;  5FNV A;  1SQB H;  4FM2 A;  2ZIM A;  4H0L B;  5J2T B;  2MW2 B;  3JAS A;  4DR4 B;  4O4H A;  4DO2 A;  1JOY A;  1NU1 H;  2A7W A;  2QTS A;  3J81 N;  5LMN O;  1NQT A;  4O4I A;  1YSC A;  3AEI A;  3G80 A;  1AR4 A;  4LC1 A;  4HNA A;  1QQC A;  3CJH B;  5IJ0 B;  4MW8 A;  1VF6 A;  1QVF U;  2YC0 A;  1I5X A;  2M7W A;  2JEX A;  1N32 B;  4X65 B;  2OCH A;  3O65 A;  2HVJ C;  1FKA O;  1I08 A;  1B6Q A;  2H3O A;  2WLM A;  1K73 W;  4NVP A;  1XIL A;  5KHK A;  4OXS A;  3ZMU A;  2CTW A;  2ZKO A;  3QNE A;  2QDO A;  4WFH A;  2KKW A;  4PV1 B;  4UVA A;  1FXV A;  2IJK A;  1P7B A;  3ZHT A;  2ODM A;  1TUB A;  4JYB A;  4YJ2 A;  4U7O A;  1KYO F;  2Y4U A;  4DUZ O;  4LF5 O;  1TA8 A;  2KG7 B;  2B1I A;  1I94 O;  1NBM G;  4KFM A;  1SC5 B;  4J7K A;  5EC2 C;  1GM9 A;  1URF A;  2UXC B;  1WB7 A;  4JI4 O;  3G6B A;  2ZR3 A;  2A79 B;  3H1I H;  3K04 A;  4UCU A;  4JI2 O;  3FB5 C;  4DV4 O;  2E5L O;  4GLX A;  4MTO A;  3U10 A;  5B1A C;  4JI8 B;  5C8Y A;  3VQV A;  1KU9 A;  1AB3 A;  4I0X B;  5DM6 V;  3CCR V;  3RYH A;  1YVW A;  3FB6 C;  5LOV A;  1M4U A;  5KMG A;  1JVM A;  2P06 A;  3E8B A;  4X20 B;  2JDI G;  3CE2 A;  1GO3 F;  2WLI B;  1IVS A;  2EIM C;  1KBH A;  4PDV A;  5A2Q N;  5JCO C;  1N0N A;  1RPO A;  4ZI7 A;  1NH2 D;  3TK1 A;  1D5A A;  1ZL8 A;  3E8G A;  1ORQ C;  3TXQ A;  1S3J A;  1FXK B;  5B66 Z;  2KSD A;  4FIP C;  3QO5 A;  2P6J A;  5EYP B;  1M56 B;  1ZX3 A;  2LO1 A;  3BHP A;  3KCX A;  2YIC A;  3OM3 B;  3JSL A;  3ZMZ A;  5CA0 B;  4B3S B;  1O9H A;  4X66 O;  2RNB A;  1Z5W A;  4LR3 A;  4MVS A;  5KA6 A;  5KUM A;  1IBK B;  2V7Q G;  4GX1 A;  1N34 B;  3CMA V;  3K5N A;  1WJZ A;  4O2B B;  1K92 A;  2CTQ A;  2H8P C;  3B8M A;  1RM1 B;  5JCO A;  1YCI A;  4LP8 A;  1LR1 A;  4I4T B;  3UCS C;  2JS3 A;  1Y76 B;  4H33 A;  2A3Q A;  3RYF B;  1OV9 A;  2UU9 B;  1MZE A;  5CA1 B;  3CC7 V;  4GKK O;  3K9A A;  3WU2 Z;  1GTO A;  2BSK B;  1GN4 A;  4JTA B;  2ITD C;  4JPR A;  1Q43 A;  1TUE B;  1V54 B;  1SET A;  1BHA A;  1EN4 A;  2K1E A;  4TV8 B;  1XBL A;  1FFX B;  2YIB A;  2UUC O;  1VQM V;  5JQG B;  1FFX A;  1HNZ B;  2ATK C;  2UUB O;  4UB8 Z;  5B5E Z;  1THZ A;  5LYJ A;  5KHI A;  3BA9 A;  4I55 B;  4PJ0 Z;  2JIZ G;  4UCV A;  4GX5 A;  1VQN V;  3ZBH A;  5KA5 A;  4PDM A;  1K5S A;  1SQF A;  3K08 A;  1RP3 B;  4OX9 O;  4KUM A;  2ZM6 B;  3JAS B;  2Q6A A;  3BAA A;  4FLX A;  4YHH B;  4B3M O;  1Q6H A;  1HNW B;  4J7Z A;  4JI6 B;  1CEZ A;  3AG2 C;  2JK5 C;  3HPL C;  4P9P A;  2Q73 A;  1BT8 A;  4PA3 A;  1D5N A;  2VS0 A;  2VRZ A;  4IT5 A;  2Q68 A;  5IT9 N;  4FZ1 A;  5L3G A;  5EIB C;  3UT5 B;  1SES A;  1AJQ A;  4LWS A;  5LP6 A;  2GUZ A;  1AJP A;  2AW9 A;  2FL4 A;  1NKD A;  2XAG A;  1YTF B;  4DV6 O;  2UXB O;  2HEP A;  5IYZ A;  1WN7 A;  3JD0 A;  4PI0 A;  2LJ2 A;  4FFK A;  1AP5 A;  2E76 B;  2JJ1 G;  4FVM A;  1WPB A;  2YDE A;  4LNU B;  4FM1 A;  2ZD9 A;  3HR0 A;  4JV5 O;  2AZ0 A;  4X1Y A;  3FD9 A;  1H38 A;  1GN2 A;  1K97 A;  3UQ8 A;  1F7Y A;  1R3I C;  1M57 B;  3AG3 B;  3U0Z A;  1XMO O;  1DF5 A;  5LGN A;  3J80 N;  1Y67 A;  1BL8 A;  2VQE B;  4LF4 O;  2XUM A;  3HKB B;  3OR7 C;  1VQO V;  1M1K W;  4DV3 O;  4MTF A;  4KXR A;  2C2A A;  4R50 A;  4EKW A;  1JX9 A;  3U11 A;  1JCH A;  3P30 A;  3K57 A;  2OIG A;  2HP8 A;  2XTA A;  2XAJ A;  1KP2 A;  4TQD A;  2JGD A;  1L8D A;  3TET A;  1S72 V;  3K5O A;  4GX0 A;  2LGQ A;  3OT7 A;  1Y6X A;  4KL1 A;  4DR7 B;  3VQW A;  1VF7 A;  2QKS A;  3SYQ A;  4ZHQ B;  1OCZ B;  5EC1 C;  4WCE V;  3SJQ C;  2ILM A;  1NTZ H;  3ABM C;  5F2V O;  1MA1 A;  2D2C B;  3T4D A;  4K0K B;  1SQX H;  1YDX A;  1EZV H;  3B8N A;  2ZNI A;  4O4H B;  1VQL V;  1R3J C;  4O4I B;  1Q7Y W;  4F6R B;  1XNR B;  1QLE C;  1ENV A;  2EUL A;  1GM8 A;  2E75 B;  4HNA B;  4ZI7 B;  4DV2 O;  1ARO P;  4DK1 A;  2WLI A;  1H2G A;  4FK5 C;  1OHH G;  2DQ3 A;  2Y0I A;  3A8T A;  1B06 A;  1SA0 A;  1S5L Z;  2YEV A;  1TVK A;  1V9P A;  3CC4 V;  4LFC B;  4PDR A;  5GTI Z;  3Q4H B;  4BAY A;  4JF3 A;  3OEH G;  4QE9 A;  4U3F H;  4JTC B;  5LA6 B;  2V4D A;  2KQX A;  4J7J A;  3SJB C;  5LA6 A;  4B3T O;  4DR5 B;  3WB0 A;  2QKA A;  2IU3 A;  2YI9 A;  1COW G;  3O9O A;  3BY6 A;  3DSQ A;  5CMU A;  2Q4P A;  4DV1 B;  1IX9 A;  2P4V A;  2BE3 A;  4AQY O;  1AI5 A;  1WAZ A;  4LFB B;  4H13 B;  4X64 B;  3RYH B;  2CTR A;  4PHZ A;  1RSO B;  5B3S C;  4OGQ B;  1MSW D;  3CCQ V;  3CS5 A;  2LP7 A;  3STZ C;  3CEI A;  4MSW C;  5LP6 C;  3ZED A;  4NR1 A;  2UXX A;  2EIN C;  5IYZ B;  5JQG A;  4H44 B;  4ZKI A;  4R7C A;  3B2E E;  1KMI Z;  1PNM A;  1SKV A;  2R70 A;  4X1I B;  3OFN G;  4DR1 B;  1W0J G;  2DYR C;  1K9M W;  1EFR G;  1FYJ A;  5EBW C;  1W0K G;  3LUT B;  1WB8 A;  3Q4H A;  4DR4 O;  1BHB A;  4OPA A;  3W7W A;  2ZT9 B;  2OT5 A;  1Q3E A;  4KP4 A;  3AG1 C;  3T1H B;  2W6I G;  5DED A;  5IJ9 B;  2WSS G;  4HAM A;  2PF4 E;  2Y4T A;  4R8C A;  2CDY A;  4IGG A;  1DGS A;  4I4T A;  4B3R B;  1VP7 A;  3KCY A;  1N33 B;  1B04 A;  2CGN A;  3CX5 F;  3L74 H;  4KHP B;  1T5E A;  4B7E A;  1NTK H;  4JZ2 A;  1HP8 A;  2MK3 A;  1R1B A;  2XT9 A;  3JD2 A;  1M56 C;  2WLH A;  3R66 A;  1CP9 A;  4IIJ A;  3BAB A;  5A9G A;  4ICG A;  2CE4 A;  5CN0 A;  2EIL C;  1SF9 A;  1E1R G;  4LF5 B;  5E1A C;  1VQ8 V;  4ZOL A;  1P4R A;  1B3Q A;  2JS5 A;  2F66 C;  4L87 A;  3ICX A;  2QE7 G;  4Z1M G;  2YSU B;  1SQQ H;  3J7A U;  4JI5 B;  3OAA G;  3CCJ V;  3OTF A;  3DTU B;  2F1M A;  3MDS A;  3LDE A;  5EZY A;  5FNV B;  4QJF B;  4BR6 A;  3ZHV A;  2ITC C;  2JJ2 G;  5CBF A;  4FLZ A;  1H8H G;  4MVM A;  1K5Q A;  3K5M A;  5KAI Z;  3RYI A;  3W7U A;  2DOS A;  3ZHQ A;  1AR5 A;  3H1J H;  4GUN A;  3RVZ A;  1H2M A;  3RW0 A;  1VEW A;  1FXH A;  2XAS A;  4WFB V;  2QEX V;  4JGS A;  4X62 B;  4J11 A;  4A5U B;  3CRM A;  5KLV H;  4NTY A;  3HKB A;  4W4K A;  3M8A A;  3OTO O;  1BZK A;  2WA4 A;  2AXT Z;  2WLN A;  1MOF A;  4QPJ A;  4BIU A;  1KB9 F;  3ZHS A;  5HFL A;  2ZE8 A;  4QPK A;  2GTA A;  2Q7H A;  3RFR A;  2DWE C;  1TUB B;  1R73 A;  1BMF G;  4FFB B;  1Q8I A;  2YXH A;  2QGN A;  4JI7 B;  2PYL A;  1YHQ V;  3AG3 C;  1TGO A;  2ZE6 A;  5IYC O;  2PZS A;  2M6Y A;  5KHG A;  4JI0 B;  3L70 H;  1ZL8 B;  4UCR A;  4X66 B;  4JYA O;  1IBL B;  5JJJ B;  3OUF A;  1NI8 A;  4RQE A;  1RPR A;  4X89 A;  3BEH A;  1N34 O;  3H1L H;  1H2L A;  1V55 C;  5CB4 A;  1EN6 A;  5J2U B;  4UCT A;  3QG5 A;  4MVR A;  4DR3 B;  5C8Y B;  2IJH A;  1S5J A;  3T1Y B;  4U7N A;  1EM1 A;  2JEU A;  3AK2 A;  5LOV B;  1N36 O;  3LNM B;  4LF9 O;  1XHZ A;  2YID A;  4QNH B;  1L0N H;  4JI1 B;  4AHC A;  1KEC A;  4UB6 Z;  3ZN1 A;  2Q7G A;  4AIL C;  2R9A A;  3N27 A;  1WP7 A;  1ZLZ A;  2CK3 G;  1AVM A;  3E35 A;  3RT3 C;  2WPD G;  2UUB B;  2GHY A;  3W7S A;  2DN9 A;  4EFE A;  4DV7 B;  3ZRS A;  4K8X A;  1XNQ O;  4P9O A;  5BMV A;  1JPX A;  2EBO A;  2PYJ A;  2F93 B;  4UVB A;  4YJ2 B;  1KKD A;  3IC9 A;  4J42 A;  3KG2 A;  1BS3 A;  4YY3 B;  2OCC C;  2D3O W;  5EK0 A;  1PNL A;  2ZM6 O;  4QE7 A;  2X6B A;  4WFA V;  1I94 B;  2BTQ A;  4GYC B;  1HNW O;  3ZHU A;  3IC7 A;  4FZ0 A;  4ASU G;  5LHG A;  3G4S V;  2QR4 A;  1W2B U;  4X88 A;  4N21 A;  1SER A;  1RSO A;  2BSK A;  3ZRV A;  1NR7 A;  4I9Q A;  4Z1V A;  5BR8 O;  4WBN B;  4JI2 B;  3CD6 V;  3E22 A;  3DC5 A;  4ZIB A;  3I55 V;  5J9P C;  4DV4 B;  2E5L B;  4DRX B;  1SZX A;  2JRI A;  4JI8 O;  3HKE A;  1N0J A;  3SDL A;  1FJG O;  1IXB A;  4IHJ A;  5DEC A;  5BMV B;  4FFB A;  4IYH A;  4LF8 B;  5LP6 B;  4LF6 B;  4DV6 B;  2Y48 A;  5L3B A;  3SJA C;  2FML A;  5B3S B;  1AP6 A;  1Y4M A;  2ZNJ A;  3GWK C;  3JAR B;  1ZTE A;  4DUY B;  2BOB C;  3FYI B;  1BSM A;  4HZ3 A;  2PI4 A;  2GDS A;  4D7S A;  3TJT A;  1XHX A;  4MVQ A;  1XRE A;  5JH7 A;  4P30 A;  4DW0 A;  1GN6 A;  5D5P A;  3OR6 C;  4TT3 G;  4CH6 A;  2GV9 A;  1HNX O;  2UUA O;  2W0X A;  4Q20 A;  4BW9 A;  5L3F A;  1HR0 B;  4B3S O;  2ZCE A;  1MSD A;  4X20 A;  1IBK O;  4X1Y B;  4MVO A;  2BTQ B;  1J95 A;  4NTX A;  4NXM O;  1XL4 A;  2ZR2 A;  1FXK C;  3SPG A;  1SS3 A;  3ZRW A;  3CYO A;  3JCU Z;  4DV3 B;  4TV9 B;  4J41 A;  4JYY A;  5KAF Z;  4ZOL B;  2EIJ C;  3CB2 A;  4F6E A;  5HFM A;  1NVP D;  2UU9 O;  4TWK A;  1QR9 A;  1XL6 A;  2OCC B;  2HKO A;  3CPW U;  4CH3 A;  3RBZ A;  3ZMT A;  4D7T A;  3CCL V;  3SGI A;  3OMN B;  1F23 A;  1CXZ B;  3L9D A;  2CAZ C;  1QLE B;  4UCS A;  3SYC A;  4X9Q A;  2QSA A;  3N2G B;  2A0L A;  1Y74 A;  2EIJ B;  4DR7 O;  3GWO A;  4YIP A;  3E2E A;  1Y76 A;  2QA4 V;  2XAF A;  1FPO A;  1U97 A;  4B7K A;  3F5W C;  4AI8 A;  4E2L A;  2XOK G;  1VQ5 V;  2PGG A;  1H2N A;  3DXR B;  2LFS A;  2DMX A;  5KX5 B;  4WBN A;  3JAW B;  4MVZ A;  2HJF C;  3STL C;  5JVD A;  2Y69 B;  2BTO A;  1WPX A;  4W4L A;  3G71 V;  1BE3 H;  3ZHR A;  1U96 A;  3ASN B;  1WA8 A;  2JVD A;  3BFR A;  3EVK A;  3H1K H;  4XDJ A;  4GX2 A;  3WFV A;  3ABU A;  2N05 A;  2EIK C;  5LL6 Y;  4O2A A;  1Q82 W;  1YIT V;  1IBM B;  2EIK B;  1E79 G;  3E8F A;  4NTW A;  1JA8 A;  2FKX A;  1JFF A;  1FD9 A;  1IZ3 A;  5IWA B;  1PKX A;  3X2Q C;  1EN5 A;  1NVP B;  2DWD C;  3A0R A;  1OCZ C;  4Z2W A;  4X64 O;  3KKY A;  2NN4 A;  3ASO C;  1OCO B;  3C3T A;  2DQ0 A;  3SPI A;  3MD0 A;  1H8E G;  1S76 D;  1YJN V;  4P2Z A;  3QO8 A;  2HVK C;  3ETQ A;  4K35 A;  3GB7 C;  3A0B Z;  3H9V A;  2RJZ A;  3NR7 A;  1M90 W;  1DTO A;  1DF4 A;  5LYJ B;  4RQF A;  4DR1 O;  2QM7 A;  4MS2 A;  3S3X A;  5L3E A;  5D5Q A;  1SRY A;  4FM0 A;  1S77 D;  1QLN A;  1VQ7 V;  1AI6 A;  2LGW A;  2IH3 C;  1XDC A;  3LNN A;  1RM1 C;  5IE9 A;  2HG5 C;  2HLD G;  1JJO A;  4N23 A;  2IH1 C;  5GON B;  3K9S A;  3K79 A;  1N33 O;  4I0X A;  2Q67 A;  1Q86 W;  4KHP O;  1R6T A;  1GN3 A;  5BY1 A;  3WB1 A;  4E4E A;  4LH7 A;  5B1B C;  2ZIO A;  1M93 A;  1SQG A;  1AI4 A;  1KKC A;  4LF7 O;  1V55 B;  3VOU A;  4JAV A;  3K0D A;  1HW7 A;  3PJS K;  4RWU A;  1K3E A;  4FLT A;  3E86 A;  4NXN B;  3EHB B;  1A32 A;  4I5S A;  4UVC A;  3UO3 A;  4DW1 A;  3CCM V;  4C7U A;  3JAL A;  1TVK B;  1XNR O;  4JI5 O;  4JAA A;  5B1B B;  3OGI B;  1MNG A;  3CP1 A;  5H6Q A;  4U3J A;  3THO A;  1YJW V;  3RVY A;  3CME V;  4DV2 B;  3ZMV A;  3CRR A;  3CCS V;  4J9Y B;  4WFF A;  5B1A B;  4K3A A;  4JI3 O;  3TCU A;  1VIB A;  3B77 A;  3P3P A;  1JMK C;  3PN1 A;  4TQF A;  5C93 A;  4LNU A;  1P7G A;  2IJI A;  2A9H A;  1YIJ V;  3C90 A;  3P3N A;  3ZRX A;  2HJD A;  3CSX A;  4ZHQ A;  3H1H H;  3OGC C;  3SYA A;  3X2Q B;  2PTM A;  4YXW G;  2F4V B;  4B3T B;  4DR5 O;  3JCZ A;  1SZT A;  4FMT A;  4FLU A;  2L6L A;  3ZJZ A;  1LUW A;  1PM9 A;  4G27 B;  5JJN B;  2V1D A;  2EIM B;  2B5U A;  3NXS A;  1PL0 A;  4JI0 O;  4JYA B;  4YJ3 B;  4LFB O;  2QM8 A;  2AHZ A;  2HHH B;  1YTF D;  2Q8V A;  2VQF O;  4DXW A;  5FLX N;  1SA0 B;  5K1X A;  5KHH A;  2YIA A;  3QO7 A;  3L75 H;  3K06 A;  2P4K A;  1I5Y A;  3BA8 A;  2IJJ A;  3FYE B;  4DR3 O;  3OUS A;  3UKM A;  4O2A B;  3K03 A;  1K33 A;  2Y69 C;  3T1Y O;  5CA3 A;  2ZQM A;  4RO2 A;  4O4J B;  1L1F A;  4EB6 B;  2OTJ V;  2RN9 A;  2KB1 A;  1M57 C;  2QTO A;  4JI1 O;  3SJC C;  3E8H A;  5KHJ A;  5KMG B;  3T1C A;  4RUF A;  2XAQ A;  3JAW A;  2EIN B;  5LGU A;  1KC8 W;  2QKC A;  2HR3 A;  1G8M A;  2IM9 A;  1FAF A;  1JJ2 U;  3F7V C;  1BGY H;  2WLK A;  1TAE A;  4DV7 O;  4DV0 O;  2IBZ H;  1XNQ B;  4U3J B;  2PI5 A;  2K9P A;  3OMI B;  3VBB A;  1NS1 A;  1AIL A;  4FLW A;  2ZXW C;  5GTH Z;  1AR1 B;  3ML0 A;  1R6K A;  3JD3 A;  4YY3 O;  3ABT A;  1RFY A;  3K58 A;  2N74 A;  2YIB D;  2N04 A;  4DR2 O;  2EZP A;  3F7Y C;  3G67 A;  5IYB O;  1VF5 B;  2KG7 A;  3APO A;  4DV5 B;  4MVU A;  5H9C A;  3LDD A;  4QIW F;  4FLY A;  1N32 O;  2R9I A;  4PEL A;  4X65 O;  1LNQ A;  1DLB A;  2UXD B;  1XEQ A;  4CS4 A;  5H6R A;  3RYF A;  2CGO A;  3HKD B;  4PA6 A;  3ZIA G;  4L8J A;  5E79 Z;  3SPH A;  3JD1 A;  5GON A;  5JWP A;  5BR8 B;  3CJH A;  4TV9 A;  5IJ0 A;  2DJV A;  4LFA O;  4G2K A;  1FJG B;  1J5E O;  3CCU V;  2P7T C;  2DYS C;  2W6J G;  5LXT B;  2UXC O;  1MG1 A;  4X62 O;  1UFI A;  1Q81 W;  5CA0 A;  3D3Q A;  4DUY O;  2UXN A;  4BWA A;  3E89 A;  1FFT B;  4PA4 A;  2R9R B;  1K4C C;  2B9Z A;  4X1K A;  4IL6 Z;  3T2M A;  4XDK A;  4JTD B;  3AK1 A;  4DR6 O;  3JAT A;  3HKC A;  3JAM N;  4MTG A;  1PV0 A;  3FB8 C;  3ABL C;  3IAY A;  4RAI A;  3BCC H;  1W59 A;  2ETN A;  2Z0A A;  2F43 G;  4GCZ A;  5JH7 B;  5LGT A;  1F4M A;  3L71 H;  5LMU B;  4O4L B;  1LUV A;  2GSM B;  4O4L A;  2E3C A;  4NXM B;  1EZJ A;  2YUA A;  1JFF B;  1XMQ O;  1GKF A;  1VF6 C;  3MAQ A;  3E22 B;  1YJ9 V;  1VQP V;  2YXL A;  3P32 A;  4LWS B;  2H94 A;  3ABK C;  3FAV A;  3HKE B;  5IY5 B;  2OIE A;  2DYR B;  4X1K B;  2ADP A;  5EYP A;  2NR5 A;  3CC2 V;  1OZ0 A;  3FKS G;  2AGA A;  2YEV B;  3C3S A;  5LXT A;  3AG1 B;  2Y0P A;  2X6A A;  3ASN C;  3QTC A;  3ABK B;  2FYU H;  2Q69 A;  2OTL V;  5L3D A;  4MTX A;  3EXA A;  4XBF A;  1P49 A;  3AG2 B;  4GKK B;  3CRQ A;  2X6C A;  1MAB G;  1QCE A;  4PD4 F;  4GKJ O;  3B4S A;  4FJC C;  3AK3 A;  2AZ2 A;  2WA3 A;  4OPH A;  1G1X B;  2GBO A;  1YEW A;  1UJW B;  4CZZ A;  4CS3 A;  5IYD O;  4MW3 A;  1ZAU A;  1VAR A;  3LDC A;  4GT1 A;  3OEE G;  2UUC B;  5LMN B;  4GZR B;  5ITZ A;  3D36 C;  4IIJ B;  4TV8 A;  1NJI W;  1L0L H;  3L73 H;  3OW2 U;  1BQZ A;  3ETG A;  1FS0 G;  1YI2 V;  3SPC A;  1BCC H;  3SR2 C;  3HB3 B;  4BIZ A;  3TGU H;  4TUY B;  3DGE A;  1M9N A;  5BXZ A;  3ZS8 C;  2X0L A;  1EBO A;  4LCU C;  2WLL A;  3IFX A;  1E1Q G;  2EZO A;  1PL4 A;  4YJ3 A;  3JAK B;  4OX9 B;  4X8A A;  1H2K A;  3QF7 A;  4F4L A;  3K3W A;  4DUZ B;  1XQ8 A;  3HKC B;  4LH6 A;  3R65 A;  4LF8 O;  4JI6 O;  4LF6 O;  5IY5 C;  2QM4 A;  2LFR A;  4JI4 B;  4NKG B;  5FPR A;  5IWA O;  1QU7 A;  2P22 C;  5LHH A;  4EB6 A;  5CB4 B;  2A06 H;  1OCR B;  3W7T A;  5FL7 G;  1I7F A;  1ZUQ A;  1N8R W;  4I50 A;  5GW7 A;  5J2T A;  4J9Z B;  1Y66 A;  1QR8 A;  1US6 A;  3LSS A;  2BOC C;  3FAV B;  1QBZ A;  4PDL A;  5EBL C;  4DYL A;  2Q5Z A;  3CXH F;  1NTM H;  3DC6 A;  3K0G A;  2LW1 A;  1DK1 A;  3BVO A;  2UXB B;  2IU0 A;  2W0F C;  1HNX B;  5KUK A;  2XND G;  2UUA B;  2QJ1 A;  1HR0 O;  5BZB A;  1X59 A;  2LQT A;  3BRC A;  2AHY A;  2P67 A;  2EX3 A;  2JGU A;  4PA7 A;  4DK0 A;  4CC5 A;  1F51 A;  3RGB A;  3W7X A;  2EJ7 A;  2JGD B;  3SPJ A;  4JV5 B;  3B09 A;  3RYC B;  3ZCC A;  4FLV A;  1YF2 A;  3B40 A;  3H01 A;  2XAH A;  2YI8 A;  3CRA A;  4XDL A;  1CPY A;  3FB7 C;  3BPZ A;  3ZX6 A;  1VQ9 V;  3VQX A;  3N2G A;  1ZSP A;  4I55 A;  3JAT B;  3VQY A;  3ETE A;  1XI1 A;  3JD4 A;  1MZF A;  3KZI Z;  4I9W A;  4NB5 A;  1VQ4 V;  1JQ0 A;  1S0V A;  2VQE O;  2OYQ A;  5DN6 G;  3AG4 B;  4LF4 B;  3D36 A;  5EIB D;  1PP9 H;  4JAS A;  4IYI A;  2E74 B;  2FB5 A;  4I7Z B;  1KQS U;  5KX5 A;  3MHH C;  3ABM B;  4CH4 A;  2NNU A;  4QGP A;  5JVD B;  4NXN O;  2CTP A;  1OCC B;  4J10 A;  3RWR D;  4BW5 A;  4CH5 A;  2XHB A;  5EBM C;  2DYS B;  4MT8 A;  3QVN A;  1Q6I A;  1WP8 A;  4ABM A;  2P90 A;  2YS8 A;  1ZWI C;  1S5H C;  2Z5U A;  2PUS A;  3OE7 G;  1YZB A;  3CXC U;  1Y74 B;  3CWB H;  5L3C A;  4RUE A;  2ADQ B;  1HNZ O;  2CH7 A;  1N4C A;  3ZMS A;  3SYO A;  1QVG U;  5B1O A;  1NH2 B;  3N2K A;  4JZG A;  4BIO A;  1R6N A;  3RN4 A;  3A0H Z;  5IJ9 A;  4UFZ A;  1QNM A;  1R3L C;  1NT2 B;  1KD1 W;  2RMK B;  4WFG A;  5ITZ B;  4O2B A;  2Q9L A;  1XOU A;  4JYC A;  1XUQ A;  3K5L A;  1BQ0 A;  2ZXW B;  4NYK A;  1IBM O;  1MMM A;  4YHH O;  4B3M B;  2RDC A;  3UM7 A;  4LFC O;  2Q0A A;  3CRC A;  3WG7 C;  2QWO B;  4K8Z A;  3M99 B;  2YXY A;  4FPP A;  1JR9 A;  1ROP A;  1VQK V;  2Q0O C;  3MHS C;  3IJ4 A;  4CS2 A;  3ZRW B;  1X4T A;  4TOI A;  4CBC A;  2B1G A;  1NR1 A;  1IUR A;  4UCO A;  5CBH A;  5LBQ A;  3WG7 B;  5IDJ A;  1R3K C;  1WA8 B;  3AG4 C;  3JAK A;  3OMA B;  3IGA C;  4G28 B;  1OJH A;  2WWW A;  4DV1 O;  4J80 A;  2GTS A;  3JAR A;  4AQY B;  1V54 C;  4YIO A;  1NZ6 A;  1K4D C;  1OCO C;  3ZN0 A;  2DE0 X;  2ZE7 A;  4UXN A;  1SQP H;  1D2D A;  2BCC H;  4PI2 A;  1PNK A;  3FFQ A;  1GK9 A;  1H2S B;  1Q90 D;  2FTK A;  3AG7 A;  1F4N A;  3I5D A;  5CBG A;  5FPO A;  3E83 A;  1GM7 A;  1K8A W;  4F6R A;  3M7M X;  1XMO B;  1HDJ A;  4DRX A;  2X7R B;  2ZDI A;  4UV9 A;  3EFF K;  4D6T H;  1WLE A;  5H5N A;  2RQ6 A;  4EEQ A;  1P84 F;  2QWN B;  3CCV V;  2OWO A;  4Q6G A;  5TIS Z;  2O57 A;  1PPJ H;  1G6U A;  4DR2 B;  4PA9 A;  4LF7 B;  3T1H O;  1FXK A;  2LW7 A;  3CHX A;  4DV5 O;  1M5I A;  5H2F Z;  3JSN A;  2EIL B;  4TSF G;  1PD3 A;  4B3R O;  5JJE B;  3K59 A;  4O4J A;  2UXD O;  4EFB A;  3ABL B;  2P5O A;  1GMG A;  2ZIN A;  3I56 V;  4R6Z A;  3DXR A; 
#chains in the Genus database with same CATH homology
 5KLV H;  3CWB H;  4U3F H;  2A06 H;  1PPJ H;  3H1I H;  3L70 H;  3L72 H;  3L71 H;  3H1H H;  1NTZ H;  4PD4 F;  1BGY H;  1SQX H;  1KYO F;  1L0L H;  3L73 H;  1EZV H;  1BE3 H;  2IBZ H;  1KB9 F;  1L0N H;  1SQP H;  3H1J H;  3H1L H;  1BCC H;  3L75 H;  1SQQ H;  3TGU H;  3CX5 F;  4D6T H;  3L74 H;  1SQV H;  1NTM H;  2BCC H;  1SQB H;  3BCC H;  3CXH F;  3H1K H;  1NTK H;  2FYU H;  1PP9 H;  1P84 F;  1NU1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...