3BCCH

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
66
structure length
66
Chain Sequence
LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELFDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 20
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 3bccH00
1BE3H 2IBZH 1P84F 3H1KH 3L73H 1KYOF 3H1HH 4D6TH 4U3FH 1PPJH 3H1IH 3H1JH 1SQBH 1SQQH 1KB9F 3CWBH 1PP9H 3L72H 3L75H 1SQVH 1SQPH 1NTKH 1SQXH 1L0NH 3L74H 3CXHF 3BCCH 5KLVH 1BGYH 3TGUH 2BCCH 3H1LH 1EZVH 1NTZH 1L0LH 1NU1H 1BCCH 2A06H 1NTMH 3CX5F 3L71H 4PD4F 3L70H 2FYUH
chains in the Genus database with same CATH superfamily
3OE7G 3J7AU 4DR4B 1OCOB 3JALA 1FXKA 1P7BA 1H2GA 2WLLA 2QTSA 3N2KA 1B6QA 4EFBA 2L35A 2RJZA 3F7YC 4YIPA 5JCOA 2XAHA 1FS0G 4I9QA 1QLEB 2OCCB 1XHZA 4B7KA 1R6NA 1E1RG 4DYLA 1XMQO 3EHBB 3RYHA 3OTOB 2NNUA 2YS8A 2ZIOA 4GX0A 4MW8A 2PYJA 2HKOA 1SC5B 1GM9A 3QO7A 1F4MA 1H2LA 1NKDA 4EB6A 3RYIA 1DF5A 1R73A 2RNBA 5D5PA 1AI6A 1O9GA 4LH7A 2ODMA 4FIPC 1P4RA 1F4NA 3RGBA 4DR6B 5IJ0B 1SETA 3K59A 4YIOA 3G67A 4HAMA 2DQ3A 4C7UA 3I55V 4CS3A 2V4DA 3TETA 4B3MO 3HPLC 1NVPD 3W7SA 4CC6A 1K5SA 4W4LA 1Y4MA 2R9RB 5B1BC 3GVMA 4PDRA 3I56V 5LOVB 4JI6O 5IE9A 3VOUA 1HNWO 1ZX3A 1AROP 3OGIB 3JAKA 2YXLA 3C90A 2B1IA 2ILMA 1NBMG 1NI8A 4LF9O 2EIJC 3T1HO 4PV1B 4HNAB 2Q7HA 3G6BA 5IT9N 4B08A 1PL4A 1RPRA 4FLXA 5JJJB 1D5AA 3W7UA 3ZN0A 4LF6B 4UV8A 2EZPA 4BAYA 3SR2C 2HVJC 1GAXA 3UM7A 4TT3G 4RQEA 4UUJC 5LP6C 1YXBA 1HNXO 1AP6A 3VQWA 1VF5B 4CC5A 3HR0A 2E74B 2A3QA 4GYCB 1PKXA 2QKSA 2HJFC 5IJ9B 2F93B 2YXHA 3JAKB 4X1KA 3HKDB 2WLIA 1SQQH 1WLEA 1AJPA 1QLEC 3DXRB 3OTFA 5CB4B 3ABMB 3SDLA 4OX9O 1IBMB 4X1KB 1KD1W 2F43G 1BSMA 2Q7EA 1VQ8V 4UVCA 4MS2A 2IJHA 2HR3A 2JGUA 2ADPA 2LGWA 4JTDB 2IH1C 1F51A 1VQOV 2GBOA 4UVAA 4DV6B 2ZNJA 1K5QA 1Y66A 3O65A 4NXMO 1I5YA 1WP7A 1IBKB 3BCCH 2WLMA 2RMKB 1Q5OA 2JS5A 2QE7G 5H6RA 3ZJZA 1IVSA 4FLTA 4XDJA 4TV8A 5C8YA 4DR6O 1SZTA 4JI7B 2ZDIC 3RYFA 3JCUZ 1NH2B 4AI8A 3K5MA 3DC5A 3IGAC 2GV9A 1MA1A 1I08A 3ZMTA 2ZKOA 3FKSG 4IGGA 3P30A 3WU2Z 1L1FA 3P3PA 3FB8C 3L73H 3H1HH 1W2BU 1NJIW 4DXWA 2DWEC 2HHHB 2YIDA 2OCCC 3OR7C 3M99B 5H2FZ 4X8AA 1HR0O 4TV9B 4JI8O 4WBNB 5EBLC 5BZBA 1DLBA 2X6AA 3QVNA 2LGQA 3D3QA 3F5WC 1S5HC 4LFAO 5CB4A 2YUAA 1GMGA 5AG2A 1JQ0A 4DV0O 1BQ0A 2Z5UA 3ETEA 4J11A 1VQKV 3OGCC 2Y0PA 2IU0A 4AQYB 2RQ6A 2JIZG 1H2KA 4ZI7B 1MOFA 1WPBA 1HNXB 4MVUA 1G4YB 1DF4A 1H2SB 1XL4A 2DN9A 1VP7A 4LCUC 4XDLA 5DN6G 2ZCEA 1Y74A 3APOA 3OFNG 1YZBA 1Q6HA 4JI2B 3JAMN 3A0BZ 2ZE6A 4IL6Z 4LNUB 2B1GA 4B3RB 1MMMA 5CA3A 4JI4B 4RO2A 1MZFA 5ITZB 3PJSK 3K57A 3K0DA 3ASNB 2CE4A 2QM8A 4DR4O 3D36C 1Q6IA 2QJ1A 1WA8B 4LF5O 2P4VA 3AG1B 1AR4A 4JI1B 2ZE5A 2NR5A 1OV9A 5B1AC 4DR5O 1COWG 1YI2V 3ABUA 1ZWIC 4LP8A 4PA4A 1W0KG 5IWAB 3GB7C 4Z1VA 1TAEA 3ABMC 3ZHTA 3E83A 2ZNIA 4KUMA 5EZYA 4YY3B 2R9IA 3FB6C 1W59A 4TWKA 4DR7B 3Q4HA 3ETDA 1M5IA 5L3EA 5KMGB 3K06A 5KAFZ 1HNZB 2R9AA 4J41A 5IYCO 2EIKB 4DV3B 4GX1A 1QLNA 2BTQB 2W6JG 2YI8A 1VQ9V 3CMEV 4R50A 1G1XB 2QGNA 2HP8A 4O4IA 4PD4F 4JI7O 3JAWB 1XMOO 3ETQA 2XASA 1BE3H 4JAAA 1QVGU 1EN6A 4NR1A 3SPJA 4GCZA 3AG2B 1K4DC 1R1BA 2Z3YA 4B3TO 3STZC 3OAAG 1KUQA 1S5JA 2JVDA 3JD0A 1WAZA 2EIJB 3JSLA 2N74A 4HBNA 4OXSA 3ZMVA 3OR6C 1JR9A 1BS3A 1J95A 2IH3C 2CGNA 4G28B 4DV2B 5A9GA 4O2AB 4GX5A 1NH2D 1N0JA 2QWPB 2Z0AA 1KECA 4JI8B 5IDJA 2DYRC 1JCHA 3ASOC 2CUGA 2ADQB 2GTSA 3DXRA 4TQFA 2HFEC 1K92A 1RM1B 3G4SV 1Q86W 2UU9O 1I0HA 3ZX6A 3K5NA 1FJGB 4LFAB 3CB2A 3W7XA 3GWKC 2ETNA 3H1IH 2KKWA 4O4LB 4GZRB 4DV5B 4UFZA 1QBZA 2ZE8A 3JD4A 3JCZA 1US6A 1ZAUA 3LSUA 1D5NA 4TOIA 4WFGA 1PV0A 3CS5A 3SYPA 2DWDC 2A79B 1VEWA 5FL7G 3CRAA 2CTWA 4TQDA 2P4KA 3RWRD 4LF8O 4YY3O 1FXKC 4I5SA 4MTOA 3EFFK 1GK9A 3T1YO 4ZI7A 1BGYH 2K9PA 1SZXA 1KP3A 3QO8A 3CCLV 1FYJA 4W4KA 4O2BB 2YSUB 3CCEV 1OCOC 1JMKC 2DJVA 4KHPO 2WLKA 5KX5A 2A7WA 3QG5A 3T4DA 4JI6B 4ABMA 1HP8A 1D2DA 1PP9H 2Q68A 4J7ZA 4JI0B 1Q8IA 4ASUG 3FYIB 1VQ6V 4DV3O 1YDXA 1NTZH 5KHGA 1V55C 4LC1A 5JVDB 3PN1A 1FFXB 1VQPV 5LXTB 1ZTEA 4LBEC 2Q67A 3H01A 1RFYA 5LMUO 1PNMA 1N36B 3RVYA 1YIJV 3APQA 3X2QC 4EB6B 1V9PA 1VQ5V 3TCUA 2N05A 5LMNB 4P2ZA 5D5QA 5LGNA 4I7ZB 4O4IB 3H9VA 3L71H 3E8BA 4WFFA 4J9ZB 4B3SO 3RW0A 3ABKB 4E2LA 2OTLV 1GKFA 4FLZA 2P5OA 2Y69B 2QDOA 3RFRA 1FJGO 4X66O 3ZRXA 5LXTA 1XMOB 2PUSA 1Y74B 5B3SB 4TV9A 3BABA 3SYOA 3FYEB 4MW3A 4DV5O 1VF6A 1SERA 1S72V 1BL8A 2XT9A 4DO2A 2PI5A 2IJJA 4B3TB 3P3NA 4H44B 1F7YA 2DMXA 1DGSA 1Y67A 1MSWD 1XDCA 4AQYO 5BR8B 1RP3B 2WLHA 3SPCA 4BW9A 4JV5B 1G6UA 4DV4B 3K04A 3SJCC 3D36A 2XNDG 3K5LA 4KP4A 2BTQA 3IFXA 2EIKC 4QPJA 1PNKA 1RPOA 3B8MA 2HJDA 2ZXWB 2QEXV 4JYCA 1YJNV 4DR7O 3A0RA 5J9PC 2IM9A 3Q4HB 1HNZO 3N27A 4JTAB 4B3MB 3ASOB 4DV7O 5LGUA 4HYOA 3CCVV 2CGOA 1OJHA 2XAJA 4PJ0Z 1K8AW 4MSWC 1E79G 1XL6A 4X65O 3UO2A 2ARHA 2UXDB 1YTFB 1SQPH 4X62B 4I50B 4FFBA 4JYBA 3T2MA 3CRMA 2XTAA 4FK5C 2GHYA 5TISZ 2W0XA 1GRJA 5CA1B 1QR9A 4JAUA 4QPKA 4FM2A 2MW2B 1HNWB 4QJFB 1M57B 2RDCA 4J7KA 1CEZA 4B3SB 2LW7A 4EFEA 1K73W 3SYCA 2JJ1G 1EZVH 2F66C 2YI9A 2YIBD 4JTCB 4F4LA 1I7FA 3B8NA 5HFLA 1AP5A 3LDDA 4MVMA 5E1AC 1N8RW 1RM1C 5JWPA 4FLUA 5CN0A 4LF6O 4CH4A 1QU7A 2KB1A 2DYRB 4UB6Z 3JAWA 4JZGA 4WFEA 4IIJB 2Q0OC 5EYPB 4JPRA 2CTQA 1MABG 1EBOA 2VQFB 4K0KO 1N33O 1VQMV 2FMLA 3TJTA 2ZM6O 2UUCO 2XUMA 3CEIA 2BTOA 4YJ2B 5FNVA 1UPGA 2ZR2A 3KCYA 4F6RB 1K4CC 1K7DA 2VQEO 3CSXA 3TXQA 1WB7A 3MAQA 5L3DA 1R3LC 3CCMV 4DV7B 4NTXA 1XHXA 1H8EG 4WF9V 1IDSA 3CC2V 4PA6A 4MVSA 4GKJB 4LF5B 1WB8A 5LP6B 1NTKH 1H2NA 5EC1C 4UXNA 4X1IA 3ZRVA 4X65B 3P32A 4NXMB 1UJWB 1KBHA 5LHGA 2QWRB 2HEPA 4PI0A 3H1KH 1R3JC 3JD1A 2YC0A 2OWOA 1EN4A 3DSQA 1KB9F 1YITV 4R7CA 2QWNB 3IAYA 3JASB 3ZMSA 1M9NA 2QWOB 1KQSU 5KAIZ 2LP7A 2X7RB 1N36O 4IT5A 3MHHC 2E75B 1HW7A 5LP6A 4IYIA 3CCQV 2F23A 3KZIZ 1FFXA 2OYQA 3K5OA 3NXSA 2UXBB 4UCSA 4PA7A 1M4UA 1PPJH 1WPXA 4LFBO 4GT1A 3ZBHA 4DUZO 3CJHA 4DUYO 2GSMB 4UCTA 5B3SC 1K97A 3UKMA 3VQXA 2AHYA 3GWOA 3AG7A 2NN4A 4WCEV 2WWWA 1QHTA 2Y69C 2V1DA 2B5UA 1Q3EA 3MDSA 4UCUA 1T5EA 1GO3F 4U3FH 2W6IG 1IZ3A 3E89A 4MT8A 1IBLB 5KA6A 1WJZA 4MVZA 2ZD9A 3K3WA 5EIBC 3B4SA 1EFRG 5H9CA 5LMUB 1VF6C 4QE9A 4DV0B 4OX9B 5JVDA 1QCEA 4F6RA 1IXMA 1Q7YW 2ZXWC 1XILA 5DECA 1VIBA 4YXWG 4UCOA 4WFAV 4DR1B 3G71V 5C93A 2WLNA 1YSCA 3OMNB 3E35A 3K9AA 2EJRA 3M7MX 4GLXA 4TSFG 3UT5A 3HKCA 4CS2A 5KHIA 1Q81W 2Q4PA 4JI5B 3CC4V 4IIJA 3CYOA 2DYSB 3A0HZ 2F4VB 4H33A 1X4TA 2ZE7A 4LWSA 2ITCC 2JDIG 2VQEB 1KKCA 5FPRA 2UUBO 1QNMA 2PZSA 3ZIAG 2XHBA 1W0JG 1RSOB 4X1YA 5BY1A 4NVPA 2CH7A 3LNNA 2VQFO 5EZYB 4FLWA 4N23A 2H8PC 5BR8O 4R8CA 1KMIZ 4I50A 2JS3A 2KG7B 1KP2A 1Y76B 2LFSA 3L72H 3JARA 4NYKA 4ICGA 4RQFA 2EIMB 4HNAA 4B3RO 4LF8B 1OCRB 4N21A 2KQXA 2PYLA 4KL1A 3K08A 3WB2A 2VWJA 1SQFA 4JYAO 5CBGA 1AJNA 1RSOA 1ZSPA 4X1YB 3CMAV 4LF7B 3OMIB 5LA6A 4I55B 3LSSA 3FAVB 1GM8A 4PA9A 5B1NA 4NB5A 2MK3A 2UXCO 2Q8VA 5IY5C 4JYYA 2E5LO 1U96A 1CP9A 4E4EA 3VQYA 2D2CB 4G27B 4DRXA 2WLJA 3S3XA 3ZHQA 5B1BB 3O9OA 1NT2B 2E5LB 4RWUA 3L74H 4IHJB 3U11A 2V7QG 3E22B 2BCCH 1X59A 3CPWU 4I55A 1BQZA 4JI2O 3T1HB 3ZEDA 3U0ZA 2DW4A 5LMNO 1A32A 1N0NA 1Q43A 4D6TH 1GN3A 4I4TA 1CXZB 1WA8A 3T4ZA 4D7SA 5DM6V 4DR3B 5LGTA 2YEVA 3N2KB 3ZMZA 4GKKO 3ABLB 2C2AA 4AHCA 3ZHVA 4BWAA 1MZEA 2CK3G 1MSDA 3E8GA 1AR5A 1HDJA 1B06A 1TVKA 1NVPB 2QM4A 5IYZA 2EULA 4NTWA 2BSKB 2P67A 1J5EB 1R3IC 2A9HA 1XREA 3AK3A 4DR5B 1YTFD 4JAVA 4YHHO 3K03A 4JI4O 3D3IA 2UUBB 1DTOA 2Y4TA 4O2BA 2WA4A 5CA1A 5B1AB 2R72A 1FPOA 3T1YB 1IBKO 3AG1C 1M90W 1K34A 1ZUQA 1QVFU 1R6TA 5H5NA 3OTOO 3CRRA 1PM9A 3ZCCA 2EJ7A 2VWKA 3UO3A 3E8HA 1ORQC 2Q9LA 1LUVA 1SA0B 1PL0A 4JI1O 5LOVA 2XAQA 3AG2C 3JSNA 3G6EV 2FTKA 4NXNO 4NTYA 2OIGA 5IYBO 4LH6A 1AI4A 2UUAO 4RUFA 1TVKB 4K8ZA 4QIWF 3DC6A 3SJQC 4ZHQB 5EC2C 5EIBD 4Z1MG 3JATA 1SQXH 2AXTZ 2EBOA 5EBWC 4NKGB 5B1OA 4J9YB 3J81N 1TUBB 3ZRWB 3W7WA 5KHHA 2ZR3A 2JGDB 1M56C 5KUKA 1QQCA 2L6LA 5JJEB 1KYOF 3LUTB 2XOKG 1P7GA 5LYJA 3IC7A 4RAIA 5HFMA 2PI4A 3SJBC 1L0NH 2E3CA 1V54B 4O2AA 4JYAB 3AG3C 4DUYB 5KMGA 1DK1A 3FB5C 2YXYA 2X0LA 1GN2A 2E76B 3AG3B 3B40A 2JGDA 4PDLA 1VQNV 3OT7A 2WSSG 1AI5A 1Z5WA 4DRXB 1JA8A 1URFA 2X6BA 3CRCA 3K79A 5KHJA 2UUCB 4QNHB 4FMTA 4OPAA 2Y4UA 4GKKB 3R66A 1M56B 4YHHB 2QKAA 3SYAA 2O57A 4MTGA 2IW5A 3BRCA 4FVMA 2F1MA 1B3QA 3G80A 3E2EA 1MG1A 1H38A 2GUZB 5LHIA 5L3BA 5LA6B 3BAAA 3NR7A 4DR2B 4B7EA 1OHHG 4MVRA 2QA4V 2KSDA 2XAFA 2IBZH 4GKJO 1GN4A 1U97A 1XQ8A 5DEDA 4LFCB 3S3WA 4LF4B 2BSKA 3OEHG 1BZKA 4WFHA 3ETGA 3ZS8C 4BIOA 1BMFG 4FZ0A 2QR4A 3JYCA 4FLVA 1F23A 1JJOA 1FXHA 4DV6O 5B5EZ 1BHBA 1I94O 2ZT9B 4ZOLB 4Q6GA 4PHZA 1IURA 3SPIA 1OZ0A 4LWSB 3E86A 4H37A 5GTIZ 4K3AA 3IJ4A 1AI7A 1KC8W 1THZA 1XMQB 2CTRA 3OM3B 3HKBA 2YIBA 3ZHRA 2GUZA 2Y0IA 1E1QG 1N34O 5IYDO 4LNUA 2RN9A 4IHJA 4K8XA 2GTAA 3FD9A 4ZHQA 1SQVH 4I0XB 2EIMC 1QR8A 4NXNB 5IJ0A 3W7TA 2AW9A 4X66B 5CA0A 1AR1B 3CCUV 5KA5A 2YEVB 1VQ7V 4D7TA 4XDKA 4KXRA 3TXSA 3OEEG 5JH7A 2UXDO 2FB5A 3RYCB 1R3KC 3EXAA 1HWYA 4I4TB 5BXZA 1BHAA 2PGGA 4PDVA 5KHKA 3MHSC 3U10A 4YJ3A 1ZLZA 3VQVA 5GONA 1EZJA 2B9ZA 2X6CA 3OUFA 5B66Z 1ENVA 1K3EA 1IXBA 2WLLB 4P30A 1M93A 4ZIBA 3ABKC 5IJ9A 4WBNA 2R70A 5IY5B 4L87A 2DYSC 3QNEA 4U7OA 5EBMC 1LNQA 3AG4C 3L9DA 3ZRWA 2M7WA 1IX9A 2F4VO 2KG7A 2Q7GA 5J2UB 1ZL8B 5K1XA 1OCZB 4LF4O 4LFCO 4J7JA 1AVMA 4CZZA 3LNMB 4KFMA 4IYHA 2YDEA 1N4CA 3LDEA 4J10A 1XUQA 2G38A 2P06A 3CXCU 1FXVA 3THOA 2A0LA 1S76D 3STLC 4K35A 3QO5A 4O4JA 4UCRA 4Q20A 1YEWA 1Q82W 3AG4B 1XNQO 2DE0X 2AZ0A 2Q5ZA 4X64B 3A8TA 5BMVA 2FYUH 2OIEA 2Q69A 3LDCA 3B2EE 4JV5O 1EN5A 3CC7V 2QTOA 2QWQB 3WB0A 3BVOA 1SQBH 1Z2GA 5IYZB 5FLXN 1JJ2U 2IU3A 4I0XA 2HLDG 4DV1O 3CXHF 3WFVA 4ZBMA 1FD9A 3JATB 4BIZA 1FAFA 1FXKB 1Q90D 1YF2A 4I9WA 3N2GA 1SESA 4X20B 2HG5C 4MTFA 3QTCA 1SRYA 2YIAA 3OD4A 4CS4A 2ZIMA 3R65A 3CP1A 3ZHUA 4LR3A 4X62O 3KG2A 1XNRO 3H1JH 4HZ3A 1N34B 1K33A 5EK0A 5CBHA 3CCSV 4BR6A 5KX5B 3ICXA 1SQGA 4GUNA 3OUSA 3ML0A 4RUEA 4JZ2A 2UXXA 3X2QB 1GN6A 1NS1A 2QSAA 1K9MW 4G2KA 4O4HB 3I5DA 1S3JA 3ZMUA 3FX7A 3C3SA 3JD3A 4ZKIA 3BA8A 1S5LZ 5L3GA 4GX2A 1ROPA 2BOBC 1KU9A 4CH5A 4OGQB 3CRQA 2WA3A 4TUYB 2JJ2G 3CCJV 2EINC 1ZL8A 1NU1H 1Q6UA 3CCRV 1OCCC 2P22C 3OMAB 1P49A 4PI2A 5GTHZ 1JVMA 1JOYA 3JALB 5FPOA 3LSQA 4DR2O 3UQ8A 4JI5O 1YJWV 3VBBA 3HKBB 5LYJB 3DGEA 2M6YA 5A2QN 4EKWA 4FM0A 1PNLA 1M1KW 3SYQA 1SF9A 1R6KA 4DR1O 3SPHA 4FZ1A 4Z2WA 2YICA 1NTMH 4QE7A 2P7TC 5JQGA 3BY6A 1N33B 2OT5A 2LO1A 2WAMA 3BEHA 1OCCB 1XEQA 4F6EA 3JARB 3UCSC 2BE3A 3HKCB 2EINB 3WB1A 5J2UA 4UCVA 3K0GA 4OPHA 2PY5A 1TUBA 4X1IB 4K0KB 2A06H 2XAGA 1YJ9V 3K58A 2P6JA 1FFTB 2CDYA 1IBMO 2Y48A 3ZHSA 4FLYA 2ATKC 4H13B 3D8CA 4U7NA 5L3CA 3M8AA 1G8MA 4PA3A 3WG7B 3FAVA 1UFIA 4DUZB 3ABTA 4LF7O 4UVBA 1KKDA 1M57C 1YVWA 5J2TB 4MVQA 5K1PA 5LBQA 3OW2U 4FFBB 4AILC 4QGPA 1I94B 1BT8A 1S0VA 2F95B 4X64O 3RYHB 2ZINA 1GTOA 4TUYA 3RYCA 2UUAB 1NR7A 3H1LH 4LFBB 4JASA 3J80N 2HHHO 4JI0O 1FKAO 2QKCA 1MNGA 1SKVA 4JI3B 2FL4A 3A2FA 3FB7C 3K9SA 1H8HG 3CWBH 1VMGA 2QM7A 5EYPA 3JASA 3C3TA 3WG7C 2OTJV 2W0FC 3HKEB 1L0LH 4H0LB 4LF9B 4DW1A 2P90A 2LQTA 5JQGB 4P9OA 4U3JA 2DOSA 3HKEA 1JFFB 5JCOC 1SS3A 1N32O 1V55B 4EEQA 2D3OW 4MVOA 3N2GB 2DQ0A 4J80A 2FKXA 1YHQV 3E22A 5GW7A 2VS0A 5KLVH 3UT5B 4DK1A 2ITDC 1NQTA 1BCCH 2UXNA 2N04A 4X88A 2EILC 1VQ4V 1O9HA 2EX3A 4DV4O 3AEIA 5JJNB 3F7VC 3AK2A 2EZOA 2PF4E 1WNSA 5FNVB 1Y6XA 3ZRSA 2IJKA 3IC9A 1VARA 2K1EA 1V54C 2HVKC 4FJCC 1TGOA 2AGAA 4DK0A 4DV2O 2WPDG 4O4JB 5GONB 3AK1A 3MD0A 3RYIB 2CAZC 2ZQMA 3E8FA 3BHPA 1H2MA 4A5UB 3JD2A 4PDMA 3CD6V 3TK1A 1P84F 5H6QA 5LL6Y 1GM7A 3HKDA 2Q0AA 2BOCC 1JFFA 4R6ZA 2EILB 4DW0A 3ABLC 4BIUA 1Y76A 4PELA 2UU9B 3KKYA 1XNRB 4CH3A 3CE2A 4ZOLA 4FPPA 5CA0B 1AILA 5CBFA 4UV9A 5F2VO 2GDSA 1Z5VA 1AJQA 4UB8Z 2LW1A 4X20A 1XBLA 3RVZA 2NLJC 4BW5A 4X9QA 1TA8A 1NZ6A 2AHZA 4O4LA 1XNQB 4CBCA 3SPGA 1PD3A 1L8DA 1OCZC 3L75H 2OCHA 1XI1A 2JK5C 4FM1A 1SA0A 3BPZA 3F5TA 3T1CA 2UXBO 1WP8A 2CH7B 3QF7A 3TGUH 3CX5F 5J2TA 3DTUB 5BMVB 1GH6A 1YCIA 4WFBV 3B77A 3BFRA 4JF3A 5IWAO 1VQLV 2JEUA 4U3JB 4DV1B 3RBZA 3CHXA 2LFRA 1I5XA 1NR1A 2RCVA 2ZDIA 2UXCB 3SJAC 3HB3B 4JGSA 5C8YB 1XOUA 2LJ2A 3ASNC 4KHPB 1N32B 3RN4A 2Q73A 4FFKA 1AB3A 3ZN1A 1HR0B 1IBLO 4CH6A 3RT3C 3SGIA 3BA9A 1OCRC 1LUWA 4P9PA 5LHHA 4X89A 4YJ2A 1EM1A 2PTMA 2H94A 2WLIB 2AZ2A 2ZM6B 1JX9A 4JI3O 4MTXA 2H3OA 1J5EO 4J42A 1JPXA 1WN7A 3RYFB 4L8JA 4O4HA 4YJ3B 4DR3O 2CTPA 4XBFA 5KUMA 2IJIA 3KCXA 2Q6AA 4TV8B 1B04A 1S77D 5ITZA 3FFQA 2JEXA 3CJHB 1LR1A 5JH7B 1CPYA 3EVKA 5CMUA 5E79Z 1VF7A 2JRIA 1TUEB 5L3FA 3B09A 3L70H 2VRZA
chains in the Genus database with same CATH topology
1BE3H 2IBZH 1P84F 3H1KH 3L73H 1KYOF 3H1HH 4D6TH 4U3FH 1PPJH 3H1IH 3H1JH 1SQBH 1SQQH 1KB9F 3CWBH 1PP9H 3L72H 3L75H 1SQVH 1SQPH 1NTKH 1SQXH 1L0NH 3L74H 3CXHF 3BCCH 5KLVH 1BGYH 3TGUH 2BCCH 3H1LH 1EZVH 1NTZH 1L0LH 1NU1H 1BCCH 2A06H 1NTMH 3CX5F 3L71H 4PD4F 3L70H 2FYUH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 H;  2IBZ H;  1P84 F;  3H1K H;  3L73 H;  1KYO F;  3H1H H;  4D6T H;  4U3F H;  1PPJ H;  3H1I H;  3H1J H;  1SQB H;  1SQQ H;  1KB9 F;  3CWB H;  1PP9 H;  3L72 H;  3L75 H;  1SQV H;  1SQP H;  1NTK H;  1SQX H;  1L0N H;  3L74 H;  3CXH F;  3BCC H;  5KLV H;  1BGY H;  3TGU H;  2BCC H;  3H1L H;  1EZV H;  1NTZ H;  1L0L H;  1NU1 H;  1BCC H;  2A06 H;  1NTM H;  3CX5 F;  3L71 H;  4PD4 F;  3L70 H;  2FYU H; 
#chains in the Genus database with same CATH topology
 3OE7 G;  3J7A U;  4DR4 B;  1OCO B;  3JAL A;  1FXK A;  1P7B A;  1H2G A;  2WLL A;  2QTS A;  3N2K A;  1B6Q A;  4EFB A;  2L35 A;  2RJZ A;  3F7Y C;  4YIP A;  5JCO A;  2XAH A;  1FS0 G;  4I9Q A;  1QLE B;  2OCC B;  1XHZ A;  4B7K A;  1R6N A;  1E1R G;  4DYL A;  1XMQ O;  3EHB B;  3RYH A;  3OTO B;  2NNU A;  2YS8 A;  2ZIO A;  4GX0 A;  4MW8 A;  2PYJ A;  2HKO A;  1SC5 B;  1GM9 A;  3QO7 A;  1F4M A;  1H2L A;  1NKD A;  4EB6 A;  3RYI A;  1DF5 A;  1R73 A;  2RNB A;  5D5P A;  1AI6 A;  1O9G A;  4LH7 A;  2ODM A;  4FIP C;  1P4R A;  1F4N A;  3RGB A;  4DR6 B;  5IJ0 B;  1SET A;  3K59 A;  4YIO A;  3G67 A;  4HAM A;  2DQ3 A;  4C7U A;  3I55 V;  4CS3 A;  2V4D A;  3TET A;  4B3M O;  3HPL C;  1NVP D;  3W7S A;  4CC6 A;  1K5S A;  4W4L A;  1Y4M A;  2R9R B;  5B1B C;  3GVM A;  4PDR A;  3I56 V;  5LOV B;  4JI6 O;  5IE9 A;  3VOU A;  1HNW O;  1ZX3 A;  1ARO P;  3OGI B;  3JAK A;  2YXL A;  3C90 A;  2B1I A;  2ILM A;  1NBM G;  1NI8 A;  4LF9 O;  2EIJ C;  3T1H O;  4PV1 B;  4HNA B;  2Q7H A;  3G6B A;  5IT9 N;  4B08 A;  1PL4 A;  1RPR A;  4FLX A;  5JJJ B;  1D5A A;  3W7U A;  3ZN0 A;  4LF6 B;  4UV8 A;  2EZP A;  4BAY A;  3SR2 C;  2HVJ C;  1GAX A;  3UM7 A;  4TT3 G;  4RQE A;  4UUJ C;  5LP6 C;  1YXB A;  1HNX O;  1AP6 A;  3VQW A;  1VF5 B;  4CC5 A;  3HR0 A;  2E74 B;  2A3Q A;  4GYC B;  1PKX A;  2QKS A;  2HJF C;  5IJ9 B;  2F93 B;  2YXH A;  3JAK B;  4X1K A;  3HKD B;  2WLI A;  1SQQ H;  1WLE A;  1AJP A;  1QLE C;  3DXR B;  3OTF A;  5CB4 B;  3ABM B;  3SDL A;  4OX9 O;  1IBM B;  4X1K B;  1KD1 W;  2F43 G;  1BSM A;  2Q7E A;  1VQ8 V;  4UVC A;  4MS2 A;  2IJH A;  2HR3 A;  2JGU A;  2ADP A;  2LGW A;  4JTD B;  2IH1 C;  1F51 A;  1VQO V;  2GBO A;  4UVA A;  4DV6 B;  2ZNJ A;  1K5Q A;  1Y66 A;  3O65 A;  4NXM O;  1I5Y A;  1WP7 A;  1IBK B;  3BCC H;  2WLM A;  2RMK B;  1Q5O A;  2JS5 A;  2QE7 G;  5H6R A;  3ZJZ A;  1IVS A;  4FLT A;  4XDJ A;  4TV8 A;  5C8Y A;  4DR6 O;  1SZT A;  4JI7 B;  2ZDI C;  3RYF A;  3JCU Z;  1NH2 B;  4AI8 A;  3K5M A;  3DC5 A;  3IGA C;  2GV9 A;  1MA1 A;  1I08 A;  3ZMT A;  2ZKO A;  3FKS G;  4IGG A;  3P30 A;  3WU2 Z;  1L1F A;  3P3P A;  3FB8 C;  3L73 H;  3H1H H;  1W2B U;  1NJI W;  4DXW A;  2DWE C;  2HHH B;  2YID A;  2OCC C;  3OR7 C;  3M99 B;  5H2F Z;  4X8A A;  1HR0 O;  4TV9 B;  4JI8 O;  4WBN B;  5EBL C;  5BZB A;  1DLB A;  2X6A A;  3QVN A;  2LGQ A;  3D3Q A;  3F5W C;  1S5H C;  4LFA O;  5CB4 A;  2YUA A;  1GMG A;  5AG2 A;  1JQ0 A;  4DV0 O;  1BQ0 A;  2Z5U A;  3ETE A;  4J11 A;  1VQK V;  3OGC C;  2Y0P A;  2IU0 A;  4AQY B;  2RQ6 A;  2JIZ G;  1H2K A;  4ZI7 B;  1MOF A;  1WPB A;  1HNX B;  4MVU A;  1G4Y B;  1DF4 A;  1H2S B;  1XL4 A;  2DN9 A;  1VP7 A;  4LCU C;  4XDL A;  5DN6 G;  2ZCE A;  1Y74 A;  3APO A;  3OFN G;  1YZB A;  1Q6H A;  4JI2 B;  3JAM N;  3A0B Z;  2ZE6 A;  4IL6 Z;  4LNU B;  2B1G A;  4B3R B;  1MMM A;  5CA3 A;  4JI4 B;  4RO2 A;  1MZF A;  5ITZ B;  3PJS K;  3K57 A;  3K0D A;  3ASN B;  2CE4 A;  2QM8 A;  4DR4 O;  3D36 C;  1Q6I A;  2QJ1 A;  1WA8 B;  4LF5 O;  2P4V A;  3AG1 B;  1AR4 A;  4JI1 B;  2ZE5 A;  2NR5 A;  1OV9 A;  5B1A C;  4DR5 O;  1COW G;  1YI2 V;  3ABU A;  1ZWI C;  4LP8 A;  4PA4 A;  1W0K G;  5IWA B;  3GB7 C;  4Z1V A;  1TAE A;  3ABM C;  3ZHT A;  3E83 A;  2ZNI A;  4KUM A;  5EZY A;  4YY3 B;  2R9I A;  3FB6 C;  1W59 A;  4TWK A;  4DR7 B;  3Q4H A;  3ETD A;  1M5I A;  5L3E A;  5KMG B;  3K06 A;  5KAF Z;  1HNZ B;  2R9A A;  4J41 A;  5IYC O;  2EIK B;  4DV3 B;  4GX1 A;  1QLN A;  2BTQ B;  2W6J G;  2YI8 A;  1VQ9 V;  3CME V;  4R50 A;  1G1X B;  2QGN A;  2HP8 A;  4O4I A;  4PD4 F;  4JI7 O;  3JAW B;  1XMO O;  3ETQ A;  2XAS A;  1BE3 H;  4JAA A;  1QVG U;  1EN6 A;  4NR1 A;  3SPJ A;  4GCZ A;  3AG2 B;  1K4D C;  1R1B A;  2Z3Y A;  4B3T O;  3STZ C;  3OAA G;  1KUQ A;  1S5J A;  2JVD A;  3JD0 A;  1WAZ A;  2EIJ B;  3JSL A;  2N74 A;  4HBN A;  4OXS A;  3ZMV A;  3OR6 C;  1JR9 A;  1BS3 A;  1J95 A;  2IH3 C;  2CGN A;  4G28 B;  4DV2 B;  5A9G A;  4O2A B;  4GX5 A;  1NH2 D;  1N0J A;  2QWP B;  2Z0A A;  1KEC A;  4JI8 B;  5IDJ A;  2DYR C;  1JCH A;  3ASO C;  2CUG A;  2ADQ B;  2GTS A;  3DXR A;  4TQF A;  2HFE C;  1K92 A;  1RM1 B;  3G4S V;  1Q86 W;  2UU9 O;  1I0H A;  3ZX6 A;  3K5N A;  1FJG B;  4LFA B;  3CB2 A;  3W7X A;  3GWK C;  2ETN A;  3H1I H;  2KKW A;  4O4L B;  4GZR B;  4DV5 B;  4UFZ A;  1QBZ A;  2ZE8 A;  3JD4 A;  3JCZ A;  1US6 A;  1ZAU A;  3LSU A;  1D5N A;  4TOI A;  4WFG A;  1PV0 A;  3CS5 A;  3SYP A;  2DWD C;  2A79 B;  1VEW A;  5FL7 G;  3CRA A;  2CTW A;  4TQD A;  2P4K A;  3RWR D;  4LF8 O;  4YY3 O;  1FXK C;  4I5S A;  4MTO A;  3EFF K;  1GK9 A;  3T1Y O;  4ZI7 A;  1BGY H;  2K9P A;  1SZX A;  1KP3 A;  3QO8 A;  3CCL V;  1FYJ A;  4W4K A;  4O2B B;  2YSU B;  3CCE V;  1OCO C;  1JMK C;  2DJV A;  4KHP O;  2WLK A;  5KX5 A;  2A7W A;  3QG5 A;  3T4D A;  4JI6 B;  4ABM A;  1HP8 A;  1D2D A;  1PP9 H;  2Q68 A;  4J7Z A;  4JI0 B;  1Q8I A;  4ASU G;  3FYI B;  1VQ6 V;  4DV3 O;  1YDX A;  1NTZ H;  5KHG A;  1V55 C;  4LC1 A;  5JVD B;  3PN1 A;  1FFX B;  1VQP V;  5LXT B;  1ZTE A;  4LBE C;  2Q67 A;  3H01 A;  1RFY A;  5LMU O;  1PNM A;  1N36 B;  3RVY A;  1YIJ V;  3APQ A;  3X2Q C;  4EB6 B;  1V9P A;  1VQ5 V;  3TCU A;  2N05 A;  5LMN B;  4P2Z A;  5D5Q A;  5LGN A;  4I7Z B;  4O4I B;  3H9V A;  3L71 H;  3E8B A;  4WFF A;  4J9Z B;  4B3S O;  3RW0 A;  3ABK B;  4E2L A;  2OTL V;  1GKF A;  4FLZ A;  2P5O A;  2Y69 B;  2QDO A;  3RFR A;  1FJG O;  4X66 O;  3ZRX A;  5LXT A;  1XMO B;  2PUS A;  1Y74 B;  5B3S B;  4TV9 A;  3BAB A;  3SYO A;  3FYE B;  4MW3 A;  4DV5 O;  1VF6 A;  1SER A;  1S72 V;  1BL8 A;  2XT9 A;  4DO2 A;  2PI5 A;  2IJJ A;  4B3T B;  3P3N A;  4H44 B;  1F7Y A;  2DMX A;  1DGS A;  1Y67 A;  1MSW D;  1XDC A;  4AQY O;  5BR8 B;  1RP3 B;  2WLH A;  3SPC A;  4BW9 A;  4JV5 B;  1G6U A;  4DV4 B;  3K04 A;  3SJC C;  3D36 A;  2XND G;  3K5L A;  4KP4 A;  2BTQ A;  3IFX A;  2EIK C;  4QPJ A;  1PNK A;  1RPO A;  3B8M A;  2HJD A;  2ZXW B;  2QEX V;  4JYC A;  1YJN V;  4DR7 O;  3A0R A;  5J9P C;  2IM9 A;  3Q4H B;  1HNZ O;  3N27 A;  4JTA B;  4B3M B;  3ASO B;  4DV7 O;  5LGU A;  4HYO A;  3CCV V;  2CGO A;  1OJH A;  2XAJ A;  4PJ0 Z;  1K8A W;  4MSW C;  1E79 G;  1XL6 A;  4X65 O;  3UO2 A;  2ARH A;  2UXD B;  1YTF B;  1SQP H;  4X62 B;  4I50 B;  4FFB A;  4JYB A;  3T2M A;  3CRM A;  2XTA A;  4FK5 C;  2GHY A;  5TIS Z;  2W0X A;  1GRJ A;  5CA1 B;  1QR9 A;  4JAU A;  4QPK A;  4FM2 A;  2MW2 B;  1HNW B;  4QJF B;  1M57 B;  2RDC A;  4J7K A;  1CEZ A;  4B3S B;  2LW7 A;  4EFE A;  1K73 W;  3SYC A;  2JJ1 G;  1EZV H;  2F66 C;  2YI9 A;  2YIB D;  4JTC B;  4F4L A;  1I7F A;  3B8N A;  5HFL A;  1AP5 A;  3LDD A;  4MVM A;  5E1A C;  1N8R W;  1RM1 C;  5JWP A;  4FLU A;  5CN0 A;  4LF6 O;  4CH4 A;  1QU7 A;  2KB1 A;  2DYR B;  4UB6 Z;  3JAW A;  4JZG A;  4WFE A;  4IIJ B;  2Q0O C;  5EYP B;  4JPR A;  2CTQ A;  1MAB G;  1EBO A;  2VQF B;  4K0K O;  1N33 O;  1VQM V;  2FML A;  3TJT A;  2ZM6 O;  2UUC O;  2XUM A;  3CEI A;  2BTO A;  4YJ2 B;  5FNV A;  1UPG A;  2ZR2 A;  3KCY A;  4F6R B;  1K4C C;  1K7D A;  2VQE O;  3CSX A;  3TXQ A;  1WB7 A;  3MAQ A;  5L3D A;  1R3L C;  3CCM V;  4DV7 B;  4NTX A;  1XHX A;  1H8E G;  4WF9 V;  1IDS A;  3CC2 V;  4PA6 A;  4MVS A;  4GKJ B;  4LF5 B;  1WB8 A;  5LP6 B;  1NTK H;  1H2N A;  5EC1 C;  4UXN A;  4X1I A;  3ZRV A;  4X65 B;  3P32 A;  4NXM B;  1UJW B;  1KBH A;  5LHG A;  2QWR B;  2HEP A;  4PI0 A;  3H1K H;  1R3J C;  3JD1 A;  2YC0 A;  2OWO A;  1EN4 A;  3DSQ A;  1KB9 F;  1YIT V;  4R7C A;  2QWN B;  3IAY A;  3JAS B;  3ZMS A;  1M9N A;  2QWO B;  1KQS U;  5KAI Z;  2LP7 A;  2X7R B;  1N36 O;  4IT5 A;  3MHH C;  2E75 B;  1HW7 A;  5LP6 A;  4IYI A;  3CCQ V;  2F23 A;  3KZI Z;  1FFX A;  2OYQ A;  3K5O A;  3NXS A;  2UXB B;  4UCS A;  4PA7 A;  1M4U A;  1PPJ H;  1WPX A;  4LFB O;  4GT1 A;  3ZBH A;  4DUZ O;  3CJH A;  4DUY O;  2GSM B;  4UCT A;  5B3S C;  1K97 A;  3UKM A;  3VQX A;  2AHY A;  3GWO A;  3AG7 A;  2NN4 A;  4WCE V;  2WWW A;  1QHT A;  2Y69 C;  2V1D A;  2B5U A;  1Q3E A;  3MDS A;  4UCU A;  1T5E A;  1GO3 F;  4U3F H;  2W6I G;  1IZ3 A;  3E89 A;  4MT8 A;  1IBL B;  5KA6 A;  1WJZ A;  4MVZ A;  2ZD9 A;  3K3W A;  5EIB C;  3B4S A;  1EFR G;  5H9C A;  5LMU B;  1VF6 C;  4QE9 A;  4DV0 B;  4OX9 B;  5JVD A;  1QCE A;  4F6R A;  1IXM A;  1Q7Y W;  2ZXW C;  1XIL A;  5DEC A;  1VIB A;  4YXW G;  4UCO A;  4WFA V;  4DR1 B;  3G71 V;  5C93 A;  2WLN A;  1YSC A;  3OMN B;  3E35 A;  3K9A A;  2EJR A;  3M7M X;  4GLX A;  4TSF G;  3UT5 A;  3HKC A;  4CS2 A;  5KHI A;  1Q81 W;  2Q4P A;  4JI5 B;  3CC4 V;  4IIJ A;  3CYO A;  2DYS B;  3A0H Z;  2F4V B;  4H33 A;  1X4T A;  2ZE7 A;  4LWS A;  2ITC C;  2JDI G;  2VQE B;  1KKC A;  5FPR A;  2UUB O;  1QNM A;  2PZS A;  3ZIA G;  2XHB A;  1W0J G;  1RSO B;  4X1Y A;  5BY1 A;  4NVP A;  2CH7 A;  3LNN A;  2VQF O;  5EZY B;  4FLW A;  4N23 A;  2H8P C;  5BR8 O;  4R8C A;  1KMI Z;  4I50 A;  2JS3 A;  2KG7 B;  1KP2 A;  1Y76 B;  2LFS A;  3L72 H;  3JAR A;  4NYK A;  4ICG A;  4RQF A;  2EIM B;  4HNA A;  4B3R O;  4LF8 B;  1OCR B;  4N21 A;  2KQX A;  2PYL A;  4KL1 A;  3K08 A;  3WB2 A;  2VWJ A;  1SQF A;  4JYA O;  5CBG A;  1AJN A;  1RSO A;  1ZSP A;  4X1Y B;  3CMA V;  4LF7 B;  3OMI B;  5LA6 A;  4I55 B;  3LSS A;  3FAV B;  1GM8 A;  4PA9 A;  5B1N A;  4NB5 A;  2MK3 A;  2UXC O;  2Q8V A;  5IY5 C;  4JYY A;  2E5L O;  1U96 A;  1CP9 A;  4E4E A;  3VQY A;  2D2C B;  4G27 B;  4DRX A;  2WLJ A;  3S3X A;  3ZHQ A;  5B1B B;  3O9O A;  1NT2 B;  2E5L B;  4RWU A;  3L74 H;  4IHJ B;  3U11 A;  2V7Q G;  3E22 B;  2BCC H;  1X59 A;  3CPW U;  4I55 A;  1BQZ A;  4JI2 O;  3T1H B;  3ZED A;  3U0Z A;  2DW4 A;  5LMN O;  1A32 A;  1N0N A;  1Q43 A;  4D6T H;  1GN3 A;  4I4T A;  1CXZ B;  1WA8 A;  3T4Z A;  4D7S A;  5DM6 V;  4DR3 B;  5LGT A;  2YEV A;  3N2K B;  3ZMZ A;  4GKK O;  3ABL B;  2C2A A;  4AHC A;  3ZHV A;  4BWA A;  1MZE A;  2CK3 G;  1MSD A;  3E8G A;  1AR5 A;  1HDJ A;  1B06 A;  1TVK A;  1NVP B;  2QM4 A;  5IYZ A;  2EUL A;  4NTW A;  2BSK B;  2P67 A;  1J5E B;  1R3I C;  2A9H A;  1XRE A;  3AK3 A;  4DR5 B;  1YTF D;  4JAV A;  4YHH O;  3K03 A;  4JI4 O;  3D3I A;  2UUB B;  1DTO A;  2Y4T A;  4O2B A;  2WA4 A;  5CA1 A;  5B1A B;  2R72 A;  1FPO A;  3T1Y B;  1IBK O;  3AG1 C;  1M90 W;  1K34 A;  1ZUQ A;  1QVF U;  1R6T A;  5H5N A;  3OTO O;  3CRR A;  1PM9 A;  3ZCC A;  2EJ7 A;  2VWK A;  3UO3 A;  3E8H A;  1ORQ C;  2Q9L A;  1LUV A;  1SA0 B;  1PL0 A;  4JI1 O;  5LOV A;  2XAQ A;  3AG2 C;  3JSN A;  3G6E V;  2FTK A;  4NXN O;  4NTY A;  2OIG A;  5IYB O;  4LH6 A;  1AI4 A;  2UUA O;  4RUF A;  1TVK B;  4K8Z A;  4QIW F;  3DC6 A;  3SJQ C;  4ZHQ B;  5EC2 C;  5EIB D;  4Z1M G;  3JAT A;  1SQX H;  2AXT Z;  2EBO A;  5EBW C;  4NKG B;  5B1O A;  4J9Y B;  3J81 N;  1TUB B;  3ZRW B;  3W7W A;  5KHH A;  2ZR3 A;  2JGD B;  1M56 C;  5KUK A;  1QQC A;  2L6L A;  5JJE B;  1KYO F;  3LUT B;  2XOK G;  1P7G A;  5LYJ A;  3IC7 A;  4RAI A;  5HFM A;  2PI4 A;  3SJB C;  1L0N H;  2E3C A;  1V54 B;  4O2A A;  4JYA B;  3AG3 C;  4DUY B;  5KMG A;  1DK1 A;  3FB5 C;  2YXY A;  2X0L A;  1GN2 A;  2E76 B;  3AG3 B;  3B40 A;  2JGD A;  4PDL A;  1VQN V;  3OT7 A;  2WSS G;  1AI5 A;  1Z5W A;  4DRX B;  1JA8 A;  1URF A;  2X6B A;  3CRC A;  3K79 A;  5KHJ A;  2UUC B;  4QNH B;  4FMT A;  4OPA A;  2Y4U A;  4GKK B;  3R66 A;  1M56 B;  4YHH B;  2QKA A;  3SYA A;  2O57 A;  4MTG A;  2IW5 A;  3BRC A;  4FVM A;  2F1M A;  1B3Q A;  3G80 A;  3E2E A;  1MG1 A;  1H38 A;  2GUZ B;  5LHI A;  5L3B A;  5LA6 B;  3BAA A;  3NR7 A;  4DR2 B;  4B7E A;  1OHH G;  4MVR A;  2QA4 V;  2KSD A;  2XAF A;  2IBZ H;  4GKJ O;  1GN4 A;  1U97 A;  1XQ8 A;  5DED A;  4LFC B;  3S3W A;  4LF4 B;  2BSK A;  3OEH G;  1BZK A;  4WFH A;  3ETG A;  3ZS8 C;  4BIO A;  1BMF G;  4FZ0 A;  2QR4 A;  3JYC A;  4FLV A;  1F23 A;  1JJO A;  1FXH A;  4DV6 O;  5B5E Z;  1BHB A;  1I94 O;  2ZT9 B;  4ZOL B;  4Q6G A;  4PHZ A;  1IUR A;  3SPI A;  1OZ0 A;  4LWS B;  3E86 A;  4H37 A;  5GTI Z;  4K3A A;  3IJ4 A;  1AI7 A;  1KC8 W;  1THZ A;  1XMQ B;  2CTR A;  3OM3 B;  3HKB A;  2YIB A;  3ZHR A;  2GUZ A;  2Y0I A;  1E1Q G;  1N34 O;  5IYD O;  4LNU A;  2RN9 A;  4IHJ A;  4K8X A;  2GTA A;  3FD9 A;  4ZHQ A;  1SQV H;  4I0X B;  2EIM C;  1QR8 A;  4NXN B;  5IJ0 A;  3W7T A;  2AW9 A;  4X66 B;  5CA0 A;  1AR1 B;  3CCU V;  5KA5 A;  2YEV B;  1VQ7 V;  4D7T A;  4XDK A;  4KXR A;  3TXS A;  3OEE G;  5JH7 A;  2UXD O;  2FB5 A;  3RYC B;  1R3K C;  3EXA A;  1HWY A;  4I4T B;  5BXZ A;  1BHA A;  2PGG A;  4PDV A;  5KHK A;  3MHS C;  3U10 A;  4YJ3 A;  1ZLZ A;  3VQV A;  5GON A;  1EZJ A;  2B9Z A;  2X6C A;  3OUF A;  5B66 Z;  1ENV A;  1K3E A;  1IXB A;  2WLL B;  4P30 A;  1M93 A;  4ZIB A;  3ABK C;  5IJ9 A;  4WBN A;  2R70 A;  5IY5 B;  4L87 A;  2DYS C;  3QNE A;  4U7O A;  5EBM C;  1LNQ A;  3AG4 C;  3L9D A;  3ZRW A;  2M7W A;  1IX9 A;  2F4V O;  2KG7 A;  2Q7G A;  5J2U B;  1ZL8 B;  5K1X A;  1OCZ B;  4LF4 O;  4LFC O;  4J7J A;  1AVM A;  4CZZ A;  3LNM B;  4KFM A;  4IYH A;  2YDE A;  1N4C A;  3LDE A;  4J10 A;  1XUQ A;  2G38 A;  2P06 A;  3CXC U;  1FXV A;  3THO A;  2A0L A;  1S76 D;  3STL C;  4K35 A;  3QO5 A;  4O4J A;  4UCR A;  4Q20 A;  1YEW A;  1Q82 W;  3AG4 B;  1XNQ O;  2DE0 X;  2AZ0 A;  2Q5Z A;  4X64 B;  3A8T A;  5BMV A;  2FYU H;  2OIE A;  2Q69 A;  3LDC A;  3B2E E;  4JV5 O;  1EN5 A;  3CC7 V;  2QTO A;  2QWQ B;  3WB0 A;  3BVO A;  1SQB H;  1Z2G A;  5IYZ B;  5FLX N;  1JJ2 U;  2IU3 A;  4I0X A;  2HLD G;  4DV1 O;  3CXH F;  3WFV A;  4ZBM A;  1FD9 A;  3JAT B;  4BIZ A;  1FAF A;  1FXK B;  1Q90 D;  1YF2 A;  4I9W A;  3N2G A;  1SES A;  4X20 B;  2HG5 C;  4MTF A;  3QTC A;  1SRY A;  2YIA A;  3OD4 A;  4CS4 A;  2ZIM A;  3R65 A;  3CP1 A;  3ZHU A;  4LR3 A;  4X62 O;  3KG2 A;  1XNR O;  3H1J H;  4HZ3 A;  1N34 B;  1K33 A;  5EK0 A;  5CBH A;  3CCS V;  4BR6 A;  5KX5 B;  3ICX A;  1SQG A;  4GUN A;  3OUS A;  3ML0 A;  4RUE A;  4JZ2 A;  2UXX A;  3X2Q B;  1GN6 A;  1NS1 A;  2QSA A;  1K9M W;  4G2K A;  4O4H B;  3I5D A;  1S3J A;  3ZMU A;  3FX7 A;  3C3S A;  3JD3 A;  4ZKI A;  3BA8 A;  1S5L Z;  5L3G A;  4GX2 A;  1ROP A;  2BOB C;  1KU9 A;  4CH5 A;  4OGQ B;  3CRQ A;  2WA3 A;  4TUY B;  2JJ2 G;  3CCJ V;  2EIN C;  1ZL8 A;  1NU1 H;  1Q6U A;  3CCR V;  1OCC C;  2P22 C;  3OMA B;  1P49 A;  4PI2 A;  5GTH Z;  1JVM A;  1JOY A;  3JAL B;  5FPO A;  3LSQ A;  4DR2 O;  3UQ8 A;  4JI5 O;  1YJW V;  3VBB A;  3HKB B;  5LYJ B;  3DGE A;  2M6Y A;  5A2Q N;  4EKW A;  4FM0 A;  1PNL A;  1M1K W;  3SYQ A;  1SF9 A;  1R6K A;  4DR1 O;  3SPH A;  4FZ1 A;  4Z2W A;  2YIC A;  1NTM H;  4QE7 A;  2P7T C;  5JQG A;  3BY6 A;  1N33 B;  2OT5 A;  2LO1 A;  2WAM A;  3BEH A;  1OCC B;  1XEQ A;  4F6E A;  3JAR B;  3UCS C;  2BE3 A;  3HKC B;  2EIN B;  3WB1 A;  5J2U A;  4UCV A;  3K0G A;  4OPH A;  2PY5 A;  1TUB A;  4X1I B;  4K0K B;  2A06 H;  2XAG A;  1YJ9 V;  3K58 A;  2P6J A;  1FFT B;  2CDY A;  1IBM O;  2Y48 A;  3ZHS A;  4FLY A;  2ATK C;  4H13 B;  3D8C A;  4U7N A;  5L3C A;  3M8A A;  1G8M A;  4PA3 A;  3WG7 B;  3FAV A;  1UFI A;  4DUZ B;  3ABT A;  4LF7 O;  4UVB A;  1KKD A;  1M57 C;  1YVW A;  5J2T B;  4MVQ A;  5K1P A;  5LBQ A;  3OW2 U;  4FFB B;  4AIL C;  4QGP A;  1I94 B;  1BT8 A;  1S0V A;  2F95 B;  4X64 O;  3RYH B;  2ZIN A;  1GTO A;  4TUY A;  3RYC A;  2UUA B;  1NR7 A;  3H1L H;  4LFB B;  4JAS A;  3J80 N;  2HHH O;  4JI0 O;  1FKA O;  2QKC A;  1MNG A;  1SKV A;  4JI3 B;  2FL4 A;  3A2F A;  3FB7 C;  3K9S A;  1H8H G;  3CWB H;  1VMG A;  2QM7 A;  5EYP A;  3JAS A;  3C3T A;  3WG7 C;  2OTJ V;  2W0F C;  3HKE B;  1L0L H;  4H0L B;  4LF9 B;  4DW1 A;  2P90 A;  2LQT A;  5JQG B;  4P9O A;  4U3J A;  2DOS A;  3HKE A;  1JFF B;  5JCO C;  1SS3 A;  1N32 O;  1V55 B;  4EEQ A;  2D3O W;  4MVO A;  3N2G B;  2DQ0 A;  4J80 A;  2FKX A;  1YHQ V;  3E22 A;  5GW7 A;  2VS0 A;  5KLV H;  3UT5 B;  4DK1 A;  2ITD C;  1NQT A;  1BCC H;  2UXN A;  2N04 A;  4X88 A;  2EIL C;  1VQ4 V;  1O9H A;  2EX3 A;  4DV4 O;  3AEI A;  5JJN B;  3F7V C;  3AK2 A;  2EZO A;  2PF4 E;  1WNS A;  5FNV B;  1Y6X A;  3ZRS A;  2IJK A;  3IC9 A;  1VAR A;  2K1E A;  1V54 C;  2HVK C;  4FJC C;  1TGO A;  2AGA A;  4DK0 A;  4DV2 O;  2WPD G;  4O4J B;  5GON B;  3AK1 A;  3MD0 A;  3RYI B;  2CAZ C;  2ZQM A;  3E8F A;  3BHP A;  1H2M A;  4A5U B;  3JD2 A;  4PDM A;  3CD6 V;  3TK1 A;  1P84 F;  5H6Q A;  5LL6 Y;  1GM7 A;  3HKD A;  2Q0A A;  2BOC C;  1JFF A;  4R6Z A;  2EIL B;  4DW0 A;  3ABL C;  4BIU A;  1Y76 A;  4PEL A;  2UU9 B;  3KKY A;  1XNR B;  4CH3 A;  3CE2 A;  4ZOL A;  4FPP A;  5CA0 B;  1AIL A;  5CBF A;  4UV9 A;  5F2V O;  2GDS A;  1Z5V A;  1AJQ A;  4UB8 Z;  2LW1 A;  4X20 A;  1XBL A;  3RVZ A;  2NLJ C;  4BW5 A;  4X9Q A;  1TA8 A;  1NZ6 A;  2AHZ A;  4O4L A;  1XNQ B;  4CBC A;  3SPG A;  1PD3 A;  1L8D A;  1OCZ C;  3L75 H;  2OCH A;  1XI1 A;  2JK5 C;  4FM1 A;  1SA0 A;  3BPZ A;  3F5T A;  3T1C A;  2UXB O;  1WP8 A;  2CH7 B;  3QF7 A;  3TGU H;  3CX5 F;  5J2T A;  3DTU B;  5BMV B;  1GH6 A;  1YCI A;  4WFB V;  3B77 A;  3BFR A;  4JF3 A;  5IWA O;  1VQL V;  2JEU A;  4U3J B;  4DV1 B;  3RBZ A;  3CHX A;  2LFR A;  1I5X A;  1NR1 A;  2RCV A;  2ZDI A;  2UXC B;  3SJA C;  3HB3 B;  4JGS A;  5C8Y B;  1XOU A;  2LJ2 A;  3ASN C;  4KHP B;  1N32 B;  3RN4 A;  2Q73 A;  4FFK A;  1AB3 A;  3ZN1 A;  1HR0 B;  1IBL O;  4CH6 A;  3RT3 C;  3SGI A;  3BA9 A;  1OCR C;  1LUW A;  4P9P A;  5LHH A;  4X89 A;  4YJ2 A;  1EM1 A;  2PTM A;  2H94 A;  2WLI B;  2AZ2 A;  2ZM6 B;  1JX9 A;  4JI3 O;  4MTX A;  2H3O A;  1J5E O;  4J42 A;  1JPX A;  1WN7 A;  3RYF B;  4L8J A;  4O4H A;  4YJ3 B;  4DR3 O;  2CTP A;  4XBF A;  5KUM A;  2IJI A;  3KCX A;  2Q6A A;  4TV8 B;  1B04 A;  1S77 D;  5ITZ A;  3FFQ A;  2JEX A;  3CJH B;  1LR1 A;  5JH7 B;  1CPY A;  3EVK A;  5CMU A;  5E79 Z;  1VF7 A;  2JRI A;  1TUE B;  5L3F A;  3B09 A;  3L70 H;  2VRZ A; 
#chains in the Genus database with same CATH homology
 1BE3 H;  2IBZ H;  1P84 F;  3H1K H;  3L73 H;  1KYO F;  3H1H H;  4D6T H;  4U3F H;  1PPJ H;  3H1I H;  3H1J H;  1SQB H;  1SQQ H;  1KB9 F;  3CWB H;  1PP9 H;  3L72 H;  3L75 H;  1SQV H;  1SQP H;  1NTK H;  1SQX H;  1L0N H;  3L74 H;  3CXH F;  3BCC H;  5KLV H;  1BGY H;  3TGU H;  2BCC H;  3H1L H;  1EZV H;  1NTZ H;  1L0L H;  1NU1 H;  1BCC H;  2A06 H;  1NTM H;  3CX5 F;  3L71 H;  4PD4 F;  3L70 H;  2FYU H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...