1Z2GA

Solution structure of apo, oxidized yeast cox17
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
69
structure length
69
Chain Sequence
MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase copper chaperone
publication title Folding studies of Cox17 reveal an important interplay of cysteine oxidation and copper binding
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 24
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 1z2gA00
2LGQA 1Z2GA 1U96A 2RN9A 1U97A 2RNBA 2HP8A 2LQTA 1HP8A
chains in the Genus database with same CATH superfamily
1EN6A 3HKDB 1JA8A 4X1KB 1WB8A 2ZIMA 2BTQB 4ZI7B 4PA6A 4X66O 2UU9B 4B3MB 3CRRA 1SZTA 4EFEA 3OT7A 4FJCC 3CXCU 4LCUC 4FM0A 3BA8A 2E5LO 5KHHA 3CCEV 3TJTA 5K1PA 4GKKO 1PNMA 4ZBMA 1S5HC 1FFXB 3RWRD 4DR1B 1Q86W 2JIZG 3AG7A 4LF4B 3FFQA 3HKEA 4U3JA 4B3RB 4D7SA 3SJCC 4BW5A 3CEIA 4XDLA 3OUFA 1ZWIC 4LH6A 1AVMA 1YTFB 3HR0A 4FZ1A 1EM1A 3TETA 5LHIA 5K1XA 3OAAG 2R9AA 1IBMB 1MNGA 1NU1H 2AW9A 4BIZA 4ZIBA 3U11A 4KXRA 1NTMH 3LSSA 1OCCB 3UKMA 1GTOA 3K5MA 3RN4A 4K0KO 1FXVA 2EIJB 4C7UA 1XL4A 4OGQB 2AHYA 3I5DA 2YC0A 3E8FA 4DR4O 1QCEA 1Q5OA 4Z1MG 2HJFC 3L70H 4I0XA 5FPOA 3BABA 1YTFD 3T1HO 5LGTA 1LUWA 5BY1A 1WLEA 1TA8A 4DR3O 4K3AA 3ZHTA 1S72V 4FLVA 5CB4B 1FS0G 4LWSB 2YEVB 4U7NA 1QQCA 2XAHA 2WLNA 3LUTB 2CUGA 1MZFA 2EIJC 2UXCB 1ZSPA 2F1MA 3H9VA 2DYRB 3JAMN 4X1YA 2CTPA 1XI1A 4O4HA 3L72H 2DQ3A 2PY5A 2V1DA 4XBFA 3PN1A 4LF6O 2ZT9B 5EC2C 3TCUA 3OTOO 2WLHA 3DGEA 2F4VO 3KCYA 1AR1B 3RW0A 2NLJC 3OMAB 4I9QA 5C8YA 3CJHA 2CDYA 5L3DA 3E22B 3H1HH 2F66C 4B3TO 3ML0A 4RWUA 1I5YA 1DF5A 2Y69B 1NH2B 2LO1A 3SYQA 4NXMB 5LGNA 5LGUA 4YJ3A 1FXKA 1BL8A 1SA0A 2K1EA 4TQFA 2QTSA 4H33A 1VQ9V 2DYSB 1X4TA 1KKCA 1Z5VA 4JI5O 4I7ZB 5BXZA 2Y48A 1KBHA 3HKEB 3T4DA 5LA6B 3OM3B 5LHGA 5ITZA 4UV8A 1EFRG 3BAAA 4H13B 2Y69C 3OTFA 4FMTA 4LFCB 4O2AA 2UUCO 4KHPO 4X66B 3CB2A 2DQ0A 3L74H 2DYSC 1XEQA 4IHJA 4G28B 1JX9A 4UXNA 2YI8A 1FYJA 2GV9A 2X6AA 1Y6XA 2E5LB 2CTQA 2XHBA 3CC2V 1U97A 4DV6O 1UJWB 1K34A 4GKKB 3FD9A 3CCSV 2IH1C 3JARA 1V9PA 5DM6V 4UFZA 2BOBC 1R6TA 3K58A 2E75B 1R6KA 2QGNA 1XQ8A 5JJJB 2QWPB 4OPHA 3OGIB 4RUEA 2PZSA 5EBWC 1AILA 2Z5UA 3HKBB 2Z3YA 3LNMB 4O4LB 5HFMA 5KUKA 1P84F 1ZL8B 3I55V 4JI1B 3EHBB 1W2BU 4MSWC 1R3IC 4JZ2A 4O4HB 1V54C 3EXAA 1P49A 4K0KB 3CWBH 1H2NA 4BWAA 1OCRB 2FL4A 3SJAC 5EZYB 3CMAV 1YI2V 4DV7O 1RP3B 2EX3A 4UV9A 4U7OA 4DR4B 1K8AW 5JVDA 2ETNA 1GN2A 5C8YB 3CJHB 4YHHO 2Q69A 2AHZA 1GN4A 2W6JG 1PL0A 2GUZB 3JATA 1WA8A 2BTOA 4B3SO 1QR8A 4OX9B 1US6A 4MTGA 4BW9A 3ASNB 1NTZH 2IBZH 3L75H 4Q20A 1P7GA 2VQFB 2UUBO 4I4TB 1OCRC 1Q6HA 5IYBO 1HNXO 3U10A 4FM2A 4RUFA 2X0LA 3E35A 1GRJA 1K3EA 2KSDA 2K9PA 4UB8Z 1LR1A 2BSKA 5ITZB 4XDKA 3MAQA 5B66Z 3OTOB 4PA4A 5LP6A 2ZNJA 2F4VB 1K97A 5A9GA 5L3FA 3ASNC 1VF5B 2HVJC 2Q0OC 5EBMC 5KHIA 2L35A 3TXQA 2EIMC 3GVMA 3FB8C 3J81N 2A9HA 1AR5A 1JR9A 1O9HA 4JYCA 4JI8O 4NVPA 1DK1A 2V7QG 3B4SA 1Q81W 2XT9A 4KFMA 1I08A 3W7TA 2VQEO 4CC5A 1S5LZ 2LFSA 1CP9A 5CA1B 3LSQA 4O4JB 2QKSA 4X1IA 5IWAO 4LF8O 3IFXA 5LYJB 2Q4PA 5L3BA 4JZGA 2P4KA 1S0VA 5CA0A 5EYPA 2UUCB 5J2UB 4YJ2A 3WFVA 1PKXA 3ZEDA 2A3QA 4FLWA 3RVZA 3ZIAG 2ADPA 4DV6B 5DECA 5JVDB 2QM4A 4FLTA 4EEQA 2CE4A 2JJ1G 4FFBA 1HDJA 1THZA 1M4UA 4OXSA 4JYAO 3G6BA 1TAEA 3CPWU 5A2QN 1GH6A 1JJ2U 2HJDA 1VQOV 2R70A 1I94B 2CK3G 3F5WC 2QM8A 4BAYA 4LBEC 3RYHB 3WB2A 2P67A 4QPJA 5GONB 4J7JA 2BSKB 5KHGA 1F23A 3IJ4A 1BQZA 2Y4UA 1R3KC 5KX5B 1RPRA 3QO8A 5FL7G 1WB7A 3FYEB 4K8XA 2QJ1A 5B1AC 5CBGA 1VQ7V 1JFFA 2EZOA 4PI2A 5HFLA 4I5SA 4YHHB 2Y4TA 1Q7YW 1SRYA 3KZIZ 3ZHUA 5J2TB 4P9PA 3ZRVA 4WCEV 3WB0A 4DR6B 3UM7A 3I56V 1SQPH 3JALA 5LOVA 4B3SB 3HKCB 1P4RA 1RFYA 2UUBB 2ADQB 5LP6C 1DGSA 1E79G 1HNXB 3LDEA 1BMFG 4GX2A 2A7WA 5J9PC 2YIBA 4FLUA 4J7ZA 3ZHVA 1RM1B 1GO3F 2ZIOA 2ILMA 4FZ0A 3JD1A 3TGUH 4UUJC 1NJIW 3ZN1A 2ZKOA 1F4MA 5KMGB 2MW2B 2YSUB 1NKDA 3T4ZA 4IT5A 1HW7A 3RT3C 5KAFZ 1N32O 3E86A 2QWOB 2ZD9A 1J95A 3ZHQA 4I55A 4JI8B 1RM1C 1WP7A 2GTSA 4MVUA 2JS5A 1ZUQA 4H0LB 3ICXA 1B06A 3BVOA 2O57A 1XHZA 4CS2A 3T1YO 2M6YA 1H8EG 3SYOA 3ZRSA 2VQEB 1IXBA 5KUMA 3X2QB 2YIDA 2ZDIA 2EULA 4RAIA 2Q7GA 3M7MX 2ZR2A 4ZKIA 2OT5A 5IWAB 1O9GA 1PD3A 3S3XA 3AEIA 3JYCA 2M7WA 2AGAA 5BMVB 3LDDA 4JI3O 1NI8A 2HFEC 1QBZA 3K0DA 5JJEB 4UB6Z 4MVSA 3M8AA 2EJ7A 1M5IA 1GM8A 1M57C 3MHHC 3FB5C 3Q4HB 2YXHA 1HP8A 1AJNA 3ASOB 4GLXA 4AILC 2N05A 1JFFB 2EBOA 4HNAA 1VQ5V 1R3JC 3CSXA 4F6EA 1WP8A 1H2GA 3QVNA 3BFRA 4QE9A 1AJQA 3QG5A 1D2DA 4D6TH 1XILA 2RDCA 3T2MA 4MVQA 5LXTA 1S3JA 2ITDC 4LF5O 1XNRO 1BGYH 3HB3B 3C3TA 3K9SA 3D3IA 1XREA 2WPDG 3ASOC 5B3SB 2VS0A 5BR8O 4TV9B 5FPRA 4K8ZA 4LNUB 2QSAA 2LFRA 5FNVA 5B1BB 1KP2A 4IIJA 2OTJV 3JSLA 3S3WA 5BZBA 3N2GA 3L73H 2ZM6O 4ASUG 1G8MA 3FYIB 1LUVA 3VBBA 3GWKC 2F43G 3QO7A 1B04A 1WJZA 2W0XA 3SYAA 4X65O 1F51A 5B3SC 2YICA 3OEEG 3KG2A 3G71V 4J42A 2F93B 1HNWO 1PL4A 5B1BC 5LMNB 1Y76A 1GAXA 4QJFB 3BPZA 2D3OW 2AZ0A 3GB7C 4PA9A 5IYDO 1VQKV 5IJ0A 2B1GA 3DXRB 4JAAA 1PNLA 4R50A 3H1LH 1QVFU 2E76B 4O4IA 1MZEA 1ZX3A 3TXSA 4X89A 4EKWA 4X64O 2ZNIA 5EC1C 1SQGA 4PHZA 1PV0A 2Q7HA 5IJ9B 4X20B 1YCIA 4PDMA 3SYPA 1I7FA 5IY5B 2XUMA 1N32B 1G4YB 1Y66A 2QM7A 4HZ3A 2JGDB 2GDSA 4Z2WA 1Z5WA 3CCMV 3UO3A 1JJOA 2DE0X 2QWQB 1ENVA 3JD0A 2X6BA 1NVPB 5H9CA 4HNAB 1V55B 1JVMA 2HKOA 2RJZA 4FVMA 4DK1A 3R65A 5IY5C 1COWG 1G6UA 1MA1A 2BCCH 2VWJA 4H37A 2GHYA 2NR5A 2CH7A 4KP4A 3JASA 5LXTB 4GCZA 1KQSU 3UO2A 1F7YA 4ZOLA 1K4DC 4AQYO 3K04A 3JD4A 4FLZA 4JTCB 4CH6A 1V55C 1J5EO 1BHBA 4YY3O 2XAFA 4E2LA 1NVPD 4IIJB 3SJQC 1JCHA 4DUZO 1BT8A 3WG7C 2EZPA 2RCVA 4JYBA 3B8MA 1A32A 4O2BA 3BCCH 4QNHB 5JCOA 3SYCA 1H8HG 5JH7A 2R72A 4R7CA 4U3JB 2UXXA 2OWOA 4X8AA 3CMEV 4DV3O 2AZ2A 1N34O 3APQA 2JDIG 2V4DA 4G27B 4HAMA 1XNRB 4TWKA 1NH2D 3EVKA 4E4EA 3APOA 2ZQMA 4BIUA 2LP7A 2A79B 1JPXA 3ABMB 2XAGA 3JAWA 3UT5A 5BR8B 1ROPA 2PUSA 3CE2A 3G67A 4IL6Z 4OPAA 1CPYA 2XNDG 4MVRA 3OE7G 4ABMA 1H38A 2WLIA 3SGIA 4UCVA 3CC4V 2ZM6B 1YJ9V 4I0XB 2R9RB 1V54B 3OR7C 2FKXA 5IE9A 2PYLA 4J80A 4JF3A 1YDXA 4X65B 1DF4A 2UXDO 1K73W 1MSWD 4WFEA 5DN6G 2PF4E 3ABMC 4RO2A 1HNZO 3IC7A 1R73A 4MT8A 1HNWB 1WAZA 1ZAUA 2Q73A 1OJHA 2NN4A 3C3SA 3SR2C 4Z1VA 4DV5O 4LFBO 1L1FA 5L3GA 3G4SV 2ZE6A 4X1YB 1XUQA 1VF6A 1S77D 3FAVA 4DV2O 3CCJV 5D5PA 1AP5A 3OUSA 4DR7O 4BR6A 4YIOA 1Z2GA 4UVAA 1Q6IA 1YHQV 4DV0O 4X64B 5C93A 3JASB 2XTAA 1F4NA 3RYIA 3VOUA 4PDRA 2AXTZ 1K5QA 3T1CA 2IJIA 1Q3EA 3T1HB 2WA4A 3OW2U 3A2FA 4TV8A 3H1KH 5H2FZ 4DR3B 1EZVH 4CH3A 3ETQA 1AI6A 4B7EA 2ZXWC 3AK2A 4PD4F 4DV4O 4HYOA 1G1XB 3OMNB 4YJ3B 1FXKB 1SA0B 3E8BA 4DV1O 2EIMB 3CX5F 3CHXA 1WN7A 1BS3A 4O2BB 4WFHA 5JH7B 4GX1A 5LBQA 1IURA 4DR5O 2P22C 4UCOA 2YXLA 1QVGU 1DTOA 4WFAV 4JI6O 4LF6B 3W7XA 2KKWA 4JV5O 1NS1A 3P3PA 2WA3A 4O2AB 4P2ZA 1N8RW 3IC9A 1FXKC 4WBNA 1IX9A 2IM9A 4R8CA 4PA7A 1EBOA 3W7SA 2Q9LA 2CGOA 4IHJB 3RYFA 3LDCA 1EN5A 4PV1B 4ZHQA 3DTUB 5JCOC 4J9ZB 4B3TB 3WB1A 3CCLV 2HG5C 2YIAA 3JAKA 2ARHA 3ZHSA 2LQTA 1URFA 1HR0O 1XDCA 2XAQA 1VQNV 2GTAA 2WLIB 2BE3A 3JARB 1AI5A 4GT1A 5EBLC 3RBZA 3GWOA 4JI5B 3K0GA 5IYZA 2ZR3A 4DXWA 2DJVA 1W59A 1QLNA 3ABTA 1N0NA 3A0BZ 3L9DA 1JMKC 2WAMA 2JRIA 2EILB 4N21A 4DV3B 2VWKA 1N34B 1Q43A 2FB5A 2YS8A 3K3WA 4JAUA 4KHPB 3F7YC 1W0KG 3FAVB 3CRMA 3W7WA 1KKDA 1AB3A 2FMLA 4J7KA 3BHPA 4J11A 2QKCA 4J10A 3ZCCA 4CC6A 3ABLB 5JJNB 2RMKB 2X6CA 4DUYO 4DO2A 1I5XA 2A0LA 4UVCA 3UQ8A 2KG7A 1VQ6V 1S5JA 2HLDG 3K06A 2EILC 1VMGA 1OHHG 3ZN0A 3E8HA 2PI5A 2WWWA 5KA5A 1IXMA 2HHHO 1JOYA 1NR1A 4CH5A 4EB6A 1R6NA 5CN0A 3JATB 1WA8B 1Q90D 2UXDB 4XDJA 2A06H 5JQGA 5B1AB 1HNZB 1XNQO 3ZMSA 3ABLC 1L0LH 3LNNA 4W4LA 4LFBB 4LF7O 1BSMA 3THOA 4MTOA 4A5UB 4JTDB 4DV2B 3VQWA 1Q8IA 4DR7B 1KP3A 4NXNO 5IT9N 5LP6B 2UU9O 3J80N 4DV0B 4DV7B 3F5TA 4LFAO 2P7TC 1SQVH 3ETEA 3VQYA 4DRXA 2Q7EA 1GK9A 1TUBA 1E1QG 1YSCA 1FFTB 4K35A 3N27A 1OV9A 1ZTEA 4JI0O 1QLEB 5LHHA 4ZHQB 3KCXA 2YXYA 1M9NA 3SPGA 4UCUA 3O9OA 2JJ2G 1R3LC 3ZRWA 3CYOA 2KQXA 3B40A 4WF9V 3B77A 3B2EE 3U0ZA 4UCTA 1VARA 1QLEC 3HKDA 4X1KA 4JI6B 2N74A 4X1IB 3O65A 1JQ0A 5GW7A 1K5SA 2BTQA 1EN4A 4ZI7A 3OEHG 3K79A 3SPIA 4JV5B 3A8TA 3ZBHA 2QKAA 2W0FC 1YZBA 5CA0B 5EYPB 4FLYA 5IDJA 3VQXA 4YJ2B 1SQXH 1IDSA 4N23A 2ZE8A 2FYUH 3B09A 3VQVA 1WPXA 1FFXA 3G6EV 2H94A 1HR0B 1NZ6A 2QDOA 3BEHA 4WFGA 1VEWA 2PYJA 3P3NA 2WLLA 3OGCC 4FFBB 2CTRA 3MHSC 4KL1A 1GN6A 1XL6A 1M57B 2IJKA 1NQTA 4W4KA 3KKYA 2UXCO 1Y4MA 4HBNA 4LF8B 1HWYA 1FAFA 3OMIB 2ODMA 3P30A 2PTMA 1CEZA 3ZHRA 1M1KW 3ZMTA 3L71H 3N2KA 1BE3H 4FLXA 2JGUA 4DW1A 3IGAC 2C2AA 3C90A 2E3CA 1TVKA 2QE7G 4JTAB 2IH3C 1VQPV 2F95B 1TUBB 2ZCEA 2DW4A 2OTLV 5CB4A 1KB9F 4LWSA 1OCOB 1FPOA 2YEVA 3K57A 2B5UA 4JYAB 2Q6AA 5B1OA 3JALB 5LOVB 2QR4A 4R6ZA 1SETA 1XNQB 3CS5A 1T5EA 1UPGA 1EZJA 2ZINA 1DLBA 1QHTA 1WNSA 1AP6A 4NR1A 4YXWG 4TSFG 4FFKA 3PJSK 1OCOC 4CS4A 1M93A 2OIEA 4NXNB 4EFBA 3D36A 2DWEC 4J41A 2ATKC 3SPCA 1XHXA 4NTWA 4LFAB 3E22A 1TUEB 2KB1A 3ABKB 5LMUO 2IW5A 4MW3A 3M99B 3OD4A 4DYLA 2B9ZA 3HPLC 4NTXA 3ABUA 3TK1A 4JI0B 5FLXN 4I55B 4TQDA 2LGQA 2OCCC 2HVKC 2D2CB 1KU9A 2P5OA 1B3QA 4PJ0Z 1VP7A 2YIBD 2LW7A 4QE7A 4F6RA 1D5NA 2DOSA 2YI9A 1UFIA 5LA6A 2WLLB 2ZE7A 3K5LA 2H3OA 3ABKC 5EIBC 3D3QA 1GMGA 5EIBD 2IJJA 4QGPA 2HR3A 4NKGB 2PI4A 2QWRB 4G2KA 4GX0A 4JI1O 2GSMB 1M90W 3AG1B 3K03A 2Q5ZA 5KAIZ 3BY6A 3DSQA 4RQEA 3NR7A 4WFBV 1N33O 3N2KB 1PP9H 4FK5C 2WLKA 2ZDIC 1MG1A 2WLJA 3QF7A 2OIGA 4NYKA 1TVKB 2XASA 2UUAO 3AG4B 1R1BA 1AR4A 3T1YB 1AROP 3AG1C 3AK3A 4OX9O 3ETDA 1OCCC 2Q68A 4MVOA 2VQFO 5H6QA 1XMQO 3WG7B 2LJ2A 2WLMA 3SDLA 5GTIZ 3HKBA 4O4LA 4IYIA 2XOKG 1TGOA 3DC6A 2CGNA 1ZL8A 4IGGA 2B1IA 4BIOA 4LR3A 4JI3B 1GKFA 2IU3A 4CZZA 4JGSA 3AG4C 3G80A 3OFNG 4MTXA 5EZYA 5FNVB 4DW0A 1FKAO 3ZS8C 3E89A 3N2GB 4B7KA 1K9MW 3CRQA 1H2KA 3SPHA 4GYCB 1OZ0A 1BCCH 2GUZA 2DYRC 4JI4O 1H2MA 5LL6Y 3F7VC 4NB5A 1K4CC 4I4TA 3WU2Z 5CBHA 2YUAA 3B8NA 1Y76B 2UXNA 3H1IH 1VQMV 1H2SB 1VIBA 4LF5B 4GZRB 1S76D 3E83A 4F6RB 5IJ0B 3D36C 3K5OA 4UVBA 1KD1W 1PPJH 5TISZ 4MW8A 4O4IB 5E1AC 1PNKA 4X62O 1RPOA 1XBLA 2DMXA 1L8DA 4P9OA 3STLC 1N4CA 5DEDA 1SERA 1X59A 2P4VA 3P32A 5LMUB 1YEWA 4JI7O 1AI4A 1MABG 4YIPA 2VRZA 1KECA 3ZMUA 1FD9A 4GKJO 4MVMA 3CRCA 1YVWA 3FB7C 1SQFA 4PA3A 2EIKB 4CS3A 5CA1A 4Q6GA 2MK3A 3AG3B 4O4JA 1MSDA 3D8CA 2ZXWB 3BRCA 1FJGO 3A0RA 2CTWA 4LF9O 3FKSG 5KLVH 5LYJA 1I94O 3K9AA 4TOIA 1QR9A 4JI2O 2CH7B 4DK0A 2UXBO 3FX7A 3ZMZA 2HEPA 2JS3A 4ZOLB 2DWDC 2QA4V 2EIKC 1K92A 5J2UA 4X9QA 3AG3C 1N36O 1P7BA 1N33B 1BHAA 1GM9A 1PM9A 2GBOA 1KYOF 1M56B 2ITCC 4TUYA 2UUAB 4DR6O 2PGGA 3JD3A 1VQLV 1SC5B 2YDEA 4D7TA 2NNUA 1XMQB 1YJNV 4TT3G 2IJHA 3CRAA 3CD6V 1KMIZ 1WPBA 4JAVA 1ZLZA 3RYHA 3RFRA 3CCUV 2JEUA 3E2EA 4MVZA 5GONA 1M56C 4AQYB 5F2VO 4FIPC 3JAWB 4JASA 3UT5B 1LNQA 4JPRA 1J5EB 4YY3B 5KX5A 3ZMVA 1VF7A 1Q6UA 4PDVA 1XOUA 4DUZB 1IBKO 2X7RB 2IU0A 5D5QA 5KHJA 3ZRXA 4LH7A 1SQBH 5J2TA 3ZX6A 2JEXA 1AI7A 4JI4B 2DN9A 3FB6C 3RVYA 4CH4A 3DC5A 3HKCA 2Q67A 1XMOO 5KA6A 2Y0PA 2E74B 3JCZA 2BOCC 1QU7A 1BQ0A 1H2LA 3ZJZA 3RGBA 2LW1A 2QEXV 5CMUA 3H1JH 1MOFA 2P06A 3OR6C 4DR2O 1VQ8V 2RQ6A 1CXZB 4P30A 1GM7A 4RQFA 4X62B 4L87A 1NR7A 4CBCA 2W6IG 5KMGA 3RYIB 5L3CA 4I50A 2L6LA 4MS2A 3AK1A 5EK0A 3AG2B 5CA3A 4TV8B 2XAJA 2P90A 1I0HA 1VF6C 5B1NA 4JI7B 3JCUZ 2RN9A 3CP1A 2FTKA 1K33A 4F4LA 1RSOA 3CC7V 4X88A 4GKJB 1NTKH 3MDSA 1SF9A 4FM1A 1IBLO 4I9WA 2R9IA 4DV5B 4TUYB 1K7DA 1FJGB 1YIJV 5E79Z 3ETGA 5CBFA 5GTHZ 2ZE5A 4MTFA 3AG2C 4LF9B 3STZC 4AI8A 3CCQV 3R66A 3RYCA 2HP8A 4LP8A 4JI2B 2UXBB 5BMVA 4B3MO 1U96A 2H8PC 4ICGA 4J9YB 4WBNB 3K5NA 2Q8VA 4IYHA 2Q0AA 1Q82W 3RYFB 1Y74A 3QTCA 1N36B 1E1RG 3Q4HA 4DV4B 3JAKB 4DR1O 4B08A 3J7AU 4L8JA 4LF4O 1QNMA 4DV1B 3QNEA 5KHKA 1SZXA 4B3RO 2CAZC 1YITV 2EINB 5IYZB 4JYYA 2OYQA 5IYCO 5AG2A 4DR5B 5LMNO 1SKVA 2N04A 3W7UA 1IBMO 3BA9A 4PDLA 3NXSA 2JK5C 5H5NA 4TV9A 4LNUA 4NTYA 2EINC 2RNBA 3IAYA 1IZ3A 4QPKA 1SQQH 4GX5A 2KG7B 4FPPA 1IBKB 3CCRV 1SS3A 1YF2A 2Z0AA 4I50B 1Y67A 3UCSC 2JVDA 3EFFK 3JSNA 3A0HZ 4EB6B 4PI0A 1D5AA 1N0JA 3MD0A 1BZKA 1XMOB 3E8GA 3H01A 5JQGB 1RSOB 1L0NH 2LGWA 3LSUA 2QWNB 3DXRA 1YJWV 1FXHA 2G38A 2F23A 4LC1A 4WFFA 3K08A 2WSSG 4UCRA 4H44B 1MMMA 1OCZB 2Y0IA 4DR2B 4AHCA 3RYCB 5B5EZ 4U3FH 4DUYB 1YXBA 5IJ9A 4X20A 1SESA 4GUNA 1B6QA 1NT2B 4DRXB 1AJPA 5H6RA 4NXMO 2JGDA 1ORQC 1Y74B 3CXHF 2HHHB 2P6JA 3X2QC 1W0JG 3K59A 2OCHA 1OCZC 1GN3A 3JD2A 4UCSA 2QTOA 4KUMA 3ZRWB 1IVSA 5L3EA 1KUQA 1KC8W 4QIWF 3CCVV 1IBLB 4LF7B 1NBMG 2EJRA 3QO5A 2OCCB 4PELA 3SPJA 3SJBC 1VQ4V 5JWPA 4LFCO
chains in the Genus database with same CATH topology
2LGQA 1Z2GA 1U96A 2RN9A 1U97A 2RNBA 2HP8A 2LQTA 1HP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LGQ A;  1Z2G A;  1U96 A;  2RN9 A;  1U97 A;  2RNB A;  2HP8 A;  2LQT A;  1HP8 A; 
#chains in the Genus database with same CATH topology
 1EN6 A;  3HKD B;  1JA8 A;  4X1K B;  1WB8 A;  2ZIM A;  2BTQ B;  4ZI7 B;  4PA6 A;  4X66 O;  2UU9 B;  4B3M B;  3CRR A;  1SZT A;  4EFE A;  3OT7 A;  4FJC C;  3CXC U;  4LCU C;  4FM0 A;  3BA8 A;  2E5L O;  5KHH A;  3CCE V;  3TJT A;  5K1P A;  4GKK O;  1PNM A;  4ZBM A;  1S5H C;  1FFX B;  3RWR D;  4DR1 B;  1Q86 W;  2JIZ G;  3AG7 A;  4LF4 B;  3FFQ A;  3HKE A;  4U3J A;  4B3R B;  4D7S A;  3SJC C;  4BW5 A;  3CEI A;  4XDL A;  3OUF A;  1ZWI C;  4LH6 A;  1AVM A;  1YTF B;  3HR0 A;  4FZ1 A;  1EM1 A;  3TET A;  5LHI A;  5K1X A;  3OAA G;  2R9A A;  1IBM B;  1MNG A;  1NU1 H;  2AW9 A;  4BIZ A;  4ZIB A;  3U11 A;  4KXR A;  1NTM H;  3LSS A;  1OCC B;  3UKM A;  1GTO A;  3K5M A;  3RN4 A;  4K0K O;  1FXV A;  2EIJ B;  4C7U A;  1XL4 A;  4OGQ B;  2AHY A;  3I5D A;  2YC0 A;  3E8F A;  4DR4 O;  1QCE A;  1Q5O A;  4Z1M G;  2HJF C;  3L70 H;  4I0X A;  5FPO A;  3BAB A;  1YTF D;  3T1H O;  5LGT A;  1LUW A;  5BY1 A;  1WLE A;  1TA8 A;  4DR3 O;  4K3A A;  3ZHT A;  1S72 V;  4FLV A;  5CB4 B;  1FS0 G;  4LWS B;  2YEV B;  4U7N A;  1QQC A;  2XAH A;  2WLN A;  3LUT B;  2CUG A;  1MZF A;  2EIJ C;  2UXC B;  1ZSP A;  2F1M A;  3H9V A;  2DYR B;  3JAM N;  4X1Y A;  2CTP A;  1XI1 A;  4O4H A;  3L72 H;  2DQ3 A;  2PY5 A;  2V1D A;  4XBF A;  3PN1 A;  4LF6 O;  2ZT9 B;  5EC2 C;  3TCU A;  3OTO O;  2WLH A;  3DGE A;  2F4V O;  3KCY A;  1AR1 B;  3RW0 A;  2NLJ C;  3OMA B;  4I9Q A;  5C8Y A;  3CJH A;  2CDY A;  5L3D A;  3E22 B;  3H1H H;  2F66 C;  4B3T O;  3ML0 A;  4RWU A;  1I5Y A;  1DF5 A;  2Y69 B;  1NH2 B;  2LO1 A;  3SYQ A;  4NXM B;  5LGN A;  5LGU A;  4YJ3 A;  1FXK A;  1BL8 A;  1SA0 A;  2K1E A;  4TQF A;  2QTS A;  4H33 A;  1VQ9 V;  2DYS B;  1X4T A;  1KKC A;  1Z5V A;  4JI5 O;  4I7Z B;  5BXZ A;  2Y48 A;  1KBH A;  3HKE B;  3T4D A;  5LA6 B;  3OM3 B;  5LHG A;  5ITZ A;  4UV8 A;  1EFR G;  3BAA A;  4H13 B;  2Y69 C;  3OTF A;  4FMT A;  4LFC B;  4O2A A;  2UUC O;  4KHP O;  4X66 B;  3CB2 A;  2DQ0 A;  3L74 H;  2DYS C;  1XEQ A;  4IHJ A;  4G28 B;  1JX9 A;  4UXN A;  2YI8 A;  1FYJ A;  2GV9 A;  2X6A A;  1Y6X A;  2E5L B;  2CTQ A;  2XHB A;  3CC2 V;  1U97 A;  4DV6 O;  1UJW B;  1K34 A;  4GKK B;  3FD9 A;  3CCS V;  2IH1 C;  3JAR A;  1V9P A;  5DM6 V;  4UFZ A;  2BOB C;  1R6T A;  3K58 A;  2E75 B;  1R6K A;  2QGN A;  1XQ8 A;  5JJJ B;  2QWP B;  4OPH A;  3OGI B;  4RUE A;  2PZS A;  5EBW C;  1AIL A;  2Z5U A;  3HKB B;  2Z3Y A;  3LNM B;  4O4L B;  5HFM A;  5KUK A;  1P84 F;  1ZL8 B;  3I55 V;  4JI1 B;  3EHB B;  1W2B U;  4MSW C;  1R3I C;  4JZ2 A;  4O4H B;  1V54 C;  3EXA A;  1P49 A;  4K0K B;  3CWB H;  1H2N A;  4BWA A;  1OCR B;  2FL4 A;  3SJA C;  5EZY B;  3CMA V;  1YI2 V;  4DV7 O;  1RP3 B;  2EX3 A;  4UV9 A;  4U7O A;  4DR4 B;  1K8A W;  5JVD A;  2ETN A;  1GN2 A;  5C8Y B;  3CJH B;  4YHH O;  2Q69 A;  2AHZ A;  1GN4 A;  2W6J G;  1PL0 A;  2GUZ B;  3JAT A;  1WA8 A;  2BTO A;  4B3S O;  1QR8 A;  4OX9 B;  1US6 A;  4MTG A;  4BW9 A;  3ASN B;  1NTZ H;  2IBZ H;  3L75 H;  4Q20 A;  1P7G A;  2VQF B;  2UUB O;  4I4T B;  1OCR C;  1Q6H A;  5IYB O;  1HNX O;  3U10 A;  4FM2 A;  4RUF A;  2X0L A;  3E35 A;  1GRJ A;  1K3E A;  2KSD A;  2K9P A;  4UB8 Z;  1LR1 A;  2BSK A;  5ITZ B;  4XDK A;  3MAQ A;  5B66 Z;  3OTO B;  4PA4 A;  5LP6 A;  2ZNJ A;  2F4V B;  1K97 A;  5A9G A;  5L3F A;  3ASN C;  1VF5 B;  2HVJ C;  2Q0O C;  5EBM C;  5KHI A;  2L35 A;  3TXQ A;  2EIM C;  3GVM A;  3FB8 C;  3J81 N;  2A9H A;  1AR5 A;  1JR9 A;  1O9H A;  4JYC A;  4JI8 O;  4NVP A;  1DK1 A;  2V7Q G;  3B4S A;  1Q81 W;  2XT9 A;  4KFM A;  1I08 A;  3W7T A;  2VQE O;  4CC5 A;  1S5L Z;  2LFS A;  1CP9 A;  5CA1 B;  3LSQ A;  4O4J B;  2QKS A;  4X1I A;  5IWA O;  4LF8 O;  3IFX A;  5LYJ B;  2Q4P A;  5L3B A;  4JZG A;  2P4K A;  1S0V A;  5CA0 A;  5EYP A;  2UUC B;  5J2U B;  4YJ2 A;  3WFV A;  1PKX A;  3ZED A;  2A3Q A;  4FLW A;  3RVZ A;  3ZIA G;  2ADP A;  4DV6 B;  5DEC A;  5JVD B;  2QM4 A;  4FLT A;  4EEQ A;  2CE4 A;  2JJ1 G;  4FFB A;  1HDJ A;  1THZ A;  1M4U A;  4OXS A;  4JYA O;  3G6B A;  1TAE A;  3CPW U;  5A2Q N;  1GH6 A;  1JJ2 U;  2HJD A;  1VQO V;  2R70 A;  1I94 B;  2CK3 G;  3F5W C;  2QM8 A;  4BAY A;  4LBE C;  3RYH B;  3WB2 A;  2P67 A;  4QPJ A;  5GON B;  4J7J A;  2BSK B;  5KHG A;  1F23 A;  3IJ4 A;  1BQZ A;  2Y4U A;  1R3K C;  5KX5 B;  1RPR A;  3QO8 A;  5FL7 G;  1WB7 A;  3FYE B;  4K8X A;  2QJ1 A;  5B1A C;  5CBG A;  1VQ7 V;  1JFF A;  2EZO A;  4PI2 A;  5HFL A;  4I5S A;  4YHH B;  2Y4T A;  1Q7Y W;  1SRY A;  3KZI Z;  3ZHU A;  5J2T B;  4P9P A;  3ZRV A;  4WCE V;  3WB0 A;  4DR6 B;  3UM7 A;  3I56 V;  1SQP H;  3JAL A;  5LOV A;  4B3S B;  3HKC B;  1P4R A;  1RFY A;  2UUB B;  2ADQ B;  5LP6 C;  1DGS A;  1E79 G;  1HNX B;  3LDE A;  1BMF G;  4GX2 A;  2A7W A;  5J9P C;  2YIB A;  4FLU A;  4J7Z A;  3ZHV A;  1RM1 B;  1GO3 F;  2ZIO A;  2ILM A;  4FZ0 A;  3JD1 A;  3TGU H;  4UUJ C;  1NJI W;  3ZN1 A;  2ZKO A;  1F4M A;  5KMG B;  2MW2 B;  2YSU B;  1NKD A;  3T4Z A;  4IT5 A;  1HW7 A;  3RT3 C;  5KAF Z;  1N32 O;  3E86 A;  2QWO B;  2ZD9 A;  1J95 A;  3ZHQ A;  4I55 A;  4JI8 B;  1RM1 C;  1WP7 A;  2GTS A;  4MVU A;  2JS5 A;  1ZUQ A;  4H0L B;  3ICX A;  1B06 A;  3BVO A;  2O57 A;  1XHZ A;  4CS2 A;  3T1Y O;  2M6Y A;  1H8E G;  3SYO A;  3ZRS A;  2VQE B;  1IXB A;  5KUM A;  3X2Q B;  2YID A;  2ZDI A;  2EUL A;  4RAI A;  2Q7G A;  3M7M X;  2ZR2 A;  4ZKI A;  2OT5 A;  5IWA B;  1O9G A;  1PD3 A;  3S3X A;  3AEI A;  3JYC A;  2M7W A;  2AGA A;  5BMV B;  3LDD A;  4JI3 O;  1NI8 A;  2HFE C;  1QBZ A;  3K0D A;  5JJE B;  4UB6 Z;  4MVS A;  3M8A A;  2EJ7 A;  1M5I A;  1GM8 A;  1M57 C;  3MHH C;  3FB5 C;  3Q4H B;  2YXH A;  1HP8 A;  1AJN A;  3ASO B;  4GLX A;  4AIL C;  2N05 A;  1JFF B;  2EBO A;  4HNA A;  1VQ5 V;  1R3J C;  3CSX A;  4F6E A;  1WP8 A;  1H2G A;  3QVN A;  3BFR A;  4QE9 A;  1AJQ A;  3QG5 A;  1D2D A;  4D6T H;  1XIL A;  2RDC A;  3T2M A;  4MVQ A;  5LXT A;  1S3J A;  2ITD C;  4LF5 O;  1XNR O;  1BGY H;  3HB3 B;  3C3T A;  3K9S A;  3D3I A;  1XRE A;  2WPD G;  3ASO C;  5B3S B;  2VS0 A;  5BR8 O;  4TV9 B;  5FPR A;  4K8Z A;  4LNU B;  2QSA A;  2LFR A;  5FNV A;  5B1B B;  1KP2 A;  4IIJ A;  2OTJ V;  3JSL A;  3S3W A;  5BZB A;  3N2G A;  3L73 H;  2ZM6 O;  4ASU G;  1G8M A;  3FYI B;  1LUV A;  3VBB A;  3GWK C;  2F43 G;  3QO7 A;  1B04 A;  1WJZ A;  2W0X A;  3SYA A;  4X65 O;  1F51 A;  5B3S C;  2YIC A;  3OEE G;  3KG2 A;  3G71 V;  4J42 A;  2F93 B;  1HNW O;  1PL4 A;  5B1B C;  5LMN B;  1Y76 A;  1GAX A;  4QJF B;  3BPZ A;  2D3O W;  2AZ0 A;  3GB7 C;  4PA9 A;  5IYD O;  1VQK V;  5IJ0 A;  2B1G A;  3DXR B;  4JAA A;  1PNL A;  4R50 A;  3H1L H;  1QVF U;  2E76 B;  4O4I A;  1MZE A;  1ZX3 A;  3TXS A;  4X89 A;  4EKW A;  4X64 O;  2ZNI A;  5EC1 C;  1SQG A;  4PHZ A;  1PV0 A;  2Q7H A;  5IJ9 B;  4X20 B;  1YCI A;  4PDM A;  3SYP A;  1I7F A;  5IY5 B;  2XUM A;  1N32 B;  1G4Y B;  1Y66 A;  2QM7 A;  4HZ3 A;  2JGD B;  2GDS A;  4Z2W A;  1Z5W A;  3CCM V;  3UO3 A;  1JJO A;  2DE0 X;  2QWQ B;  1ENV A;  3JD0 A;  2X6B A;  1NVP B;  5H9C A;  4HNA B;  1V55 B;  1JVM A;  2HKO A;  2RJZ A;  4FVM A;  4DK1 A;  3R65 A;  5IY5 C;  1COW G;  1G6U A;  1MA1 A;  2BCC H;  2VWJ A;  4H37 A;  2GHY A;  2NR5 A;  2CH7 A;  4KP4 A;  3JAS A;  5LXT B;  4GCZ A;  1KQS U;  3UO2 A;  1F7Y A;  4ZOL A;  1K4D C;  4AQY O;  3K04 A;  3JD4 A;  4FLZ A;  4JTC B;  4CH6 A;  1V55 C;  1J5E O;  1BHB A;  4YY3 O;  2XAF A;  4E2L A;  1NVP D;  4IIJ B;  3SJQ C;  1JCH A;  4DUZ O;  1BT8 A;  3WG7 C;  2EZP A;  2RCV A;  4JYB A;  3B8M A;  1A32 A;  4O2B A;  3BCC H;  4QNH B;  5JCO A;  3SYC A;  1H8H G;  5JH7 A;  2R72 A;  4R7C A;  4U3J B;  2UXX A;  2OWO A;  4X8A A;  3CME V;  4DV3 O;  2AZ2 A;  1N34 O;  3APQ A;  2JDI G;  2V4D A;  4G27 B;  4HAM A;  1XNR B;  4TWK A;  1NH2 D;  3EVK A;  4E4E A;  3APO A;  2ZQM A;  4BIU A;  2LP7 A;  2A79 B;  1JPX A;  3ABM B;  2XAG A;  3JAW A;  3UT5 A;  5BR8 B;  1ROP A;  2PUS A;  3CE2 A;  3G67 A;  4IL6 Z;  4OPA A;  1CPY A;  2XND G;  4MVR A;  3OE7 G;  4ABM A;  1H38 A;  2WLI A;  3SGI A;  4UCV A;  3CC4 V;  2ZM6 B;  1YJ9 V;  4I0X B;  2R9R B;  1V54 B;  3OR7 C;  2FKX A;  5IE9 A;  2PYL A;  4J80 A;  4JF3 A;  1YDX A;  4X65 B;  1DF4 A;  2UXD O;  1K73 W;  1MSW D;  4WFE A;  5DN6 G;  2PF4 E;  3ABM C;  4RO2 A;  1HNZ O;  3IC7 A;  1R73 A;  4MT8 A;  1HNW B;  1WAZ A;  1ZAU A;  2Q73 A;  1OJH A;  2NN4 A;  3C3S A;  3SR2 C;  4Z1V A;  4DV5 O;  4LFB O;  1L1F A;  5L3G A;  3G4S V;  2ZE6 A;  4X1Y B;  1XUQ A;  1VF6 A;  1S77 D;  3FAV A;  4DV2 O;  3CCJ V;  5D5P A;  1AP5 A;  3OUS A;  4DR7 O;  4BR6 A;  4YIO A;  1Z2G A;  4UVA A;  1Q6I A;  1YHQ V;  4DV0 O;  4X64 B;  5C93 A;  3JAS B;  2XTA A;  1F4N A;  3RYI A;  3VOU A;  4PDR A;  2AXT Z;  1K5Q A;  3T1C A;  2IJI A;  1Q3E A;  3T1H B;  2WA4 A;  3OW2 U;  3A2F A;  4TV8 A;  3H1K H;  5H2F Z;  4DR3 B;  1EZV H;  4CH3 A;  3ETQ A;  1AI6 A;  4B7E A;  2ZXW C;  3AK2 A;  4PD4 F;  4DV4 O;  4HYO A;  1G1X B;  3OMN B;  4YJ3 B;  1FXK B;  1SA0 B;  3E8B A;  4DV1 O;  2EIM B;  3CX5 F;  3CHX A;  1WN7 A;  1BS3 A;  4O2B B;  4WFH A;  5JH7 B;  4GX1 A;  5LBQ A;  1IUR A;  4DR5 O;  2P22 C;  4UCO A;  2YXL A;  1QVG U;  1DTO A;  4WFA V;  4JI6 O;  4LF6 B;  3W7X A;  2KKW A;  4JV5 O;  1NS1 A;  3P3P A;  2WA3 A;  4O2A B;  4P2Z A;  1N8R W;  3IC9 A;  1FXK C;  4WBN A;  1IX9 A;  2IM9 A;  4R8C A;  4PA7 A;  1EBO A;  3W7S A;  2Q9L A;  2CGO A;  4IHJ B;  3RYF A;  3LDC A;  1EN5 A;  4PV1 B;  4ZHQ A;  3DTU B;  5JCO C;  4J9Z B;  4B3T B;  3WB1 A;  3CCL V;  2HG5 C;  2YIA A;  3JAK A;  2ARH A;  3ZHS A;  2LQT A;  1URF A;  1HR0 O;  1XDC A;  2XAQ A;  1VQN V;  2GTA A;  2WLI B;  2BE3 A;  3JAR B;  1AI5 A;  4GT1 A;  5EBL C;  3RBZ A;  3GWO A;  4JI5 B;  3K0G A;  5IYZ A;  2ZR3 A;  4DXW A;  2DJV A;  1W59 A;  1QLN A;  3ABT A;  1N0N A;  3A0B Z;  3L9D A;  1JMK C;  2WAM A;  2JRI A;  2EIL B;  4N21 A;  4DV3 B;  2VWK A;  1N34 B;  1Q43 A;  2FB5 A;  2YS8 A;  3K3W A;  4JAU A;  4KHP B;  3F7Y C;  1W0K G;  3FAV B;  3CRM A;  3W7W A;  1KKD A;  1AB3 A;  2FML A;  4J7K A;  3BHP A;  4J11 A;  2QKC A;  4J10 A;  3ZCC A;  4CC6 A;  3ABL B;  5JJN B;  2RMK B;  2X6C A;  4DUY O;  4DO2 A;  1I5X A;  2A0L A;  4UVC A;  3UQ8 A;  2KG7 A;  1VQ6 V;  1S5J A;  2HLD G;  3K06 A;  2EIL C;  1VMG A;  1OHH G;  3ZN0 A;  3E8H A;  2PI5 A;  2WWW A;  5KA5 A;  1IXM A;  2HHH O;  1JOY A;  1NR1 A;  4CH5 A;  4EB6 A;  1R6N A;  5CN0 A;  3JAT B;  1WA8 B;  1Q90 D;  2UXD B;  4XDJ A;  2A06 H;  5JQG A;  5B1A B;  1HNZ B;  1XNQ O;  3ZMS A;  3ABL C;  1L0L H;  3LNN A;  4W4L A;  4LFB B;  4LF7 O;  1BSM A;  3THO A;  4MTO A;  4A5U B;  4JTD B;  4DV2 B;  3VQW A;  1Q8I A;  4DR7 B;  1KP3 A;  4NXN O;  5IT9 N;  5LP6 B;  2UU9 O;  3J80 N;  4DV0 B;  4DV7 B;  3F5T A;  4LFA O;  2P7T C;  1SQV H;  3ETE A;  3VQY A;  4DRX A;  2Q7E A;  1GK9 A;  1TUB A;  1E1Q G;  1YSC A;  1FFT B;  4K35 A;  3N27 A;  1OV9 A;  1ZTE A;  4JI0 O;  1QLE B;  5LHH A;  4ZHQ B;  3KCX A;  2YXY A;  1M9N A;  3SPG A;  4UCU A;  3O9O A;  2JJ2 G;  1R3L C;  3ZRW A;  3CYO A;  2KQX A;  3B40 A;  4WF9 V;  3B77 A;  3B2E E;  3U0Z A;  4UCT A;  1VAR A;  1QLE C;  3HKD A;  4X1K A;  4JI6 B;  2N74 A;  4X1I B;  3O65 A;  1JQ0 A;  5GW7 A;  1K5S A;  2BTQ A;  1EN4 A;  4ZI7 A;  3OEH G;  3K79 A;  3SPI A;  4JV5 B;  3A8T A;  3ZBH A;  2QKA A;  2W0F C;  1YZB A;  5CA0 B;  5EYP B;  4FLY A;  5IDJ A;  3VQX A;  4YJ2 B;  1SQX H;  1IDS A;  4N23 A;  2ZE8 A;  2FYU H;  3B09 A;  3VQV A;  1WPX A;  1FFX A;  3G6E V;  2H94 A;  1HR0 B;  1NZ6 A;  2QDO A;  3BEH A;  4WFG A;  1VEW A;  2PYJ A;  3P3N A;  2WLL A;  3OGC C;  4FFB B;  2CTR A;  3MHS C;  4KL1 A;  1GN6 A;  1XL6 A;  1M57 B;  2IJK A;  1NQT A;  4W4K A;  3KKY A;  2UXC O;  1Y4M A;  4HBN A;  4LF8 B;  1HWY A;  1FAF A;  3OMI B;  2ODM A;  3P30 A;  2PTM A;  1CEZ A;  3ZHR A;  1M1K W;  3ZMT A;  3L71 H;  3N2K A;  1BE3 H;  4FLX A;  2JGU A;  4DW1 A;  3IGA C;  2C2A A;  3C90 A;  2E3C A;  1TVK A;  2QE7 G;  4JTA B;  2IH3 C;  1VQP V;  2F95 B;  1TUB B;  2ZCE A;  2DW4 A;  2OTL V;  5CB4 A;  1KB9 F;  4LWS A;  1OCO B;  1FPO A;  2YEV A;  3K57 A;  2B5U A;  4JYA B;  2Q6A A;  5B1O A;  3JAL B;  5LOV B;  2QR4 A;  4R6Z A;  1SET A;  1XNQ B;  3CS5 A;  1T5E A;  1UPG A;  1EZJ A;  2ZIN A;  1DLB A;  1QHT A;  1WNS A;  1AP6 A;  4NR1 A;  4YXW G;  4TSF G;  4FFK A;  3PJS K;  1OCO C;  4CS4 A;  1M93 A;  2OIE A;  4NXN B;  4EFB A;  3D36 A;  2DWE C;  4J41 A;  2ATK C;  3SPC A;  1XHX A;  4NTW A;  4LFA B;  3E22 A;  1TUE B;  2KB1 A;  3ABK B;  5LMU O;  2IW5 A;  4MW3 A;  3M99 B;  3OD4 A;  4DYL A;  2B9Z A;  3HPL C;  4NTX A;  3ABU A;  3TK1 A;  4JI0 B;  5FLX N;  4I55 B;  4TQD A;  2LGQ A;  2OCC C;  2HVK C;  2D2C B;  1KU9 A;  2P5O A;  1B3Q A;  4PJ0 Z;  1VP7 A;  2YIB D;  2LW7 A;  4QE7 A;  4F6R A;  1D5N A;  2DOS A;  2YI9 A;  1UFI A;  5LA6 A;  2WLL B;  2ZE7 A;  3K5L A;  2H3O A;  3ABK C;  5EIB C;  3D3Q A;  1GMG A;  5EIB D;  2IJJ A;  4QGP A;  2HR3 A;  4NKG B;  2PI4 A;  2QWR B;  4G2K A;  4GX0 A;  4JI1 O;  2GSM B;  1M90 W;  3AG1 B;  3K03 A;  2Q5Z A;  5KAI Z;  3BY6 A;  3DSQ A;  4RQE A;  3NR7 A;  4WFB V;  1N33 O;  3N2K B;  1PP9 H;  4FK5 C;  2WLK A;  2ZDI C;  1MG1 A;  2WLJ A;  3QF7 A;  2OIG A;  4NYK A;  1TVK B;  2XAS A;  2UUA O;  3AG4 B;  1R1B A;  1AR4 A;  3T1Y B;  1ARO P;  3AG1 C;  3AK3 A;  4OX9 O;  3ETD A;  1OCC C;  2Q68 A;  4MVO A;  2VQF O;  5H6Q A;  1XMQ O;  3WG7 B;  2LJ2 A;  2WLM A;  3SDL A;  5GTI Z;  3HKB A;  4O4L A;  4IYI A;  2XOK G;  1TGO A;  3DC6 A;  2CGN A;  1ZL8 A;  4IGG A;  2B1I A;  4BIO A;  4LR3 A;  4JI3 B;  1GKF A;  2IU3 A;  4CZZ A;  4JGS A;  3AG4 C;  3G80 A;  3OFN G;  4MTX A;  5EZY A;  5FNV B;  4DW0 A;  1FKA O;  3ZS8 C;  3E89 A;  3N2G B;  4B7K A;  1K9M W;  3CRQ A;  1H2K A;  3SPH A;  4GYC B;  1OZ0 A;  1BCC H;  2GUZ A;  2DYR C;  4JI4 O;  1H2M A;  5LL6 Y;  3F7V C;  4NB5 A;  1K4C C;  4I4T A;  3WU2 Z;  5CBH A;  2YUA A;  3B8N A;  1Y76 B;  2UXN A;  3H1I H;  1VQM V;  1H2S B;  1VIB A;  4LF5 B;  4GZR B;  1S76 D;  3E83 A;  4F6R B;  5IJ0 B;  3D36 C;  3K5O A;  4UVB A;  1KD1 W;  1PPJ H;  5TIS Z;  4MW8 A;  4O4I B;  5E1A C;  1PNK A;  4X62 O;  1RPO A;  1XBL A;  2DMX A;  1L8D A;  4P9O A;  3STL C;  1N4C A;  5DED A;  1SER A;  1X59 A;  2P4V A;  3P32 A;  5LMU B;  1YEW A;  4JI7 O;  1AI4 A;  1MAB G;  4YIP A;  2VRZ A;  1KEC A;  3ZMU A;  1FD9 A;  4GKJ O;  4MVM A;  3CRC A;  1YVW A;  3FB7 C;  1SQF A;  4PA3 A;  2EIK B;  4CS3 A;  5CA1 A;  4Q6G A;  2MK3 A;  3AG3 B;  4O4J A;  1MSD A;  3D8C A;  2ZXW B;  3BRC A;  1FJG O;  3A0R A;  2CTW A;  4LF9 O;  3FKS G;  5KLV H;  5LYJ A;  1I94 O;  3K9A A;  4TOI A;  1QR9 A;  4JI2 O;  2CH7 B;  4DK0 A;  2UXB O;  3FX7 A;  3ZMZ A;  2HEP A;  2JS3 A;  4ZOL B;  2DWD C;  2QA4 V;  2EIK C;  1K92 A;  5J2U A;  4X9Q A;  3AG3 C;  1N36 O;  1P7B A;  1N33 B;  1BHA A;  1GM9 A;  1PM9 A;  2GBO A;  1KYO F;  1M56 B;  2ITC C;  4TUY A;  2UUA B;  4DR6 O;  2PGG A;  3JD3 A;  1VQL V;  1SC5 B;  2YDE A;  4D7T A;  2NNU A;  1XMQ B;  1YJN V;  4TT3 G;  2IJH A;  3CRA A;  3CD6 V;  1KMI Z;  1WPB A;  4JAV A;  1ZLZ A;  3RYH A;  3RFR A;  3CCU V;  2JEU A;  3E2E A;  4MVZ A;  5GON A;  1M56 C;  4AQY B;  5F2V O;  4FIP C;  3JAW B;  4JAS A;  3UT5 B;  1LNQ A;  4JPR A;  1J5E B;  4YY3 B;  5KX5 A;  3ZMV A;  1VF7 A;  1Q6U A;  4PDV A;  1XOU A;  4DUZ B;  1IBK O;  2X7R B;  2IU0 A;  5D5Q A;  5KHJ A;  3ZRX A;  4LH7 A;  1SQB H;  5J2T A;  3ZX6 A;  2JEX A;  1AI7 A;  4JI4 B;  2DN9 A;  3FB6 C;  3RVY A;  4CH4 A;  3DC5 A;  3HKC A;  2Q67 A;  1XMO O;  5KA6 A;  2Y0P A;  2E74 B;  3JCZ A;  2BOC C;  1QU7 A;  1BQ0 A;  1H2L A;  3ZJZ A;  3RGB A;  2LW1 A;  2QEX V;  5CMU A;  3H1J H;  1MOF A;  2P06 A;  3OR6 C;  4DR2 O;  1VQ8 V;  2RQ6 A;  1CXZ B;  4P30 A;  1GM7 A;  4RQF A;  4X62 B;  4L87 A;  1NR7 A;  4CBC A;  2W6I G;  5KMG A;  3RYI B;  5L3C A;  4I50 A;  2L6L A;  4MS2 A;  3AK1 A;  5EK0 A;  3AG2 B;  5CA3 A;  4TV8 B;  2XAJ A;  2P90 A;  1I0H A;  1VF6 C;  5B1N A;  4JI7 B;  3JCU Z;  2RN9 A;  3CP1 A;  2FTK A;  1K33 A;  4F4L A;  1RSO A;  3CC7 V;  4X88 A;  4GKJ B;  1NTK H;  3MDS A;  1SF9 A;  4FM1 A;  1IBL O;  4I9W A;  2R9I A;  4DV5 B;  4TUY B;  1K7D A;  1FJG B;  1YIJ V;  5E79 Z;  3ETG A;  5CBF A;  5GTH Z;  2ZE5 A;  4MTF A;  3AG2 C;  4LF9 B;  3STZ C;  4AI8 A;  3CCQ V;  3R66 A;  3RYC A;  2HP8 A;  4LP8 A;  4JI2 B;  2UXB B;  5BMV A;  4B3M O;  1U96 A;  2H8P C;  4ICG A;  4J9Y B;  4WBN B;  3K5N A;  2Q8V A;  4IYH A;  2Q0A A;  1Q82 W;  3RYF B;  1Y74 A;  3QTC A;  1N36 B;  1E1R G;  3Q4H A;  4DV4 B;  3JAK B;  4DR1 O;  4B08 A;  3J7A U;  4L8J A;  4LF4 O;  1QNM A;  4DV1 B;  3QNE A;  5KHK A;  1SZX A;  4B3R O;  2CAZ C;  1YIT V;  2EIN B;  5IYZ B;  4JYY A;  2OYQ A;  5IYC O;  5AG2 A;  4DR5 B;  5LMN O;  1SKV A;  2N04 A;  3W7U A;  1IBM O;  3BA9 A;  4PDL A;  3NXS A;  2JK5 C;  5H5N A;  4TV9 A;  4LNU A;  4NTY A;  2EIN C;  2RNB A;  3IAY A;  1IZ3 A;  4QPK A;  1SQQ H;  4GX5 A;  2KG7 B;  4FPP A;  1IBK B;  3CCR V;  1SS3 A;  1YF2 A;  2Z0A A;  4I50 B;  1Y67 A;  3UCS C;  2JVD A;  3EFF K;  3JSN A;  3A0H Z;  4EB6 B;  4PI0 A;  1D5A A;  1N0J A;  3MD0 A;  1BZK A;  1XMO B;  3E8G A;  3H01 A;  5JQG B;  1RSO B;  1L0N H;  2LGW A;  3LSU A;  2QWN B;  3DXR A;  1YJW V;  1FXH A;  2G38 A;  2F23 A;  4LC1 A;  4WFF A;  3K08 A;  2WSS G;  4UCR A;  4H44 B;  1MMM A;  1OCZ B;  2Y0I A;  4DR2 B;  4AHC A;  3RYC B;  5B5E Z;  4U3F H;  4DUY B;  1YXB A;  5IJ9 A;  4X20 A;  1SES A;  4GUN A;  1B6Q A;  1NT2 B;  4DRX B;  1AJP A;  5H6R A;  4NXM O;  2JGD A;  1ORQ C;  1Y74 B;  3CXH F;  2HHH B;  2P6J A;  3X2Q C;  1W0J G;  3K59 A;  2OCH A;  1OCZ C;  1GN3 A;  3JD2 A;  4UCS A;  2QTO A;  4KUM A;  3ZRW B;  1IVS A;  5L3E A;  1KUQ A;  1KC8 W;  4QIW F;  3CCV V;  1IBL B;  4LF7 B;  1NBM G;  2EJR A;  3QO5 A;  2OCC B;  4PEL A;  3SPJ A;  3SJB C;  1VQ4 V;  5JWP A;  4LFC O; 
#chains in the Genus database with same CATH homology
 2LGQ A;  1Z2G A;  1U96 A;  2RN9 A;  1U97 A;  2RNB A;  2HP8 A;  2LQT A;  1HP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...