1Z2GA

Solution structure of apo, oxidized yeast cox17
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
69
structure length
69
Chain Sequence
MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase copper chaperone
publication title Folding studies of Cox17 reveal an important interplay of cysteine oxidation and copper binding
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 24
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 1z2gA00
1U96A 1Z2GA 2LQTA 2HP8A 2RN9A 2RNBA 2LGQA 1U97A 1HP8A
chains in the Genus database with same CATH superfamily
4BIZA 3R65A 3F5TA 4KXRA 4XBFA 1CXZB 5IE9A 4YHHB 4DR7O 1W0KG 1CEZA 3L75H 3JALB 2UU9B 5IYCO 4ZHQA 2YIAA 1YJ9V 1FJGB 1OZ0A 2NLJC 3VQWA 1H2MA 1NJIW 2ZE8A 3ZRXA 1B6QA 1N0JA 4JI5B 5EBLC 1R6NA 3HPLC 4JAVA 2HVJC 3E22B 4KHPB 1GN6A 2Q68A 1Z2GA 2QWOB 4QE9A 2QWRB 3SJCC 3FB8C 3ZRVA 3JASA 4YY3B 2L35A 2XTAA 4O4LB 4X89A 1LUWA 1R6KA 5FPOA 4TOIA 4C7UA 1P4RA 3N2GA 1RM1C 4X1KA 2RNBA 2LJ2A 3E86A 3OTFA 1SF9A 3NXSA 1HNWO 3P3PA 4AQYB 4I4TB 1FS0G 2MW2B 2EJ7A 4JYBA 2HG5C 3RYHB 3W7XA 4B7EA 1S5LZ 1MSDA 2ZR2A 3UT5A 4EFEA 1KUQA 4FLVA 1GRJA 1Q7YW 4LNUA 3U10A 3IGAC 3G4SV 3H1HH 4GZRB 1KU9A 4GKJB 4FLTA 3C90A 4H0LB 4E2LA 1W59A 1TUBB 5LMUO 3JAKA 3DC5A 2Q0OC 4PDLA 3QG5A 3G80A 2K9PA 2WLIA 3WB1A 3CPWU 1Q6IA 4H13B 3ZS8C 1A32A 3N2KA 1H2NA 4I0XA 4BR6A 1DF4A 1M93A 3LSSA 5KAFZ 4JI8O 4I9QA 2JGDA 2F23A 4O4JB 1VQOV 5B1OA 5J2UB 5KUMA 1AB3A 1KQSU 1YCIA 1XNQO 4PDMA 5IWAB 2CGNA 3OAAG 3O9OA 2JJ1G 4JASA 4LFCO 5JJEB 4NB5A 2A06H 3G71V 4UUJC 3K03A 1VQMV 1MZEA 1QLEC 4UXNA 3TXSA 1KP3A 1VQPV 1N32O 1AI7A 4MT8A 2FKXA 2BOBC 2OTJV 1WJZA 4TT3G 1ENVA 1L0NH 3CYOA 1QNMA 1BSMA 2LFRA 4CS2A 2ZM6O 4XDKA 2YICA 3HKCB 2Q73A 3K9SA 1WB8A 1WAZA 3OR6C 4QE7A 4JI0O 1Q43A 5CA3A 1IX9A 4MVQA 4LH6A 3E8GA 5BMVA 4YJ2A 4F4LA 3WG7B 1FXKB 3L70H 1K34A 2O57A 2VQEO 1TVKB 1Q82W 4EFBA 4RWUA 1GM7A 2LW1A 4BIUA 3C3SA 4MS2A 5B1BB 1AI6A 1FFTB 3G6EV 2BE3A 4PD4F 4D7SA 4HAMA 2QM7A 5KUKA 2YI8A 4X65B 2XUMA 4PA9A 4JZ2A 2IU0A 2YI9A 4MVUA 4QPJA 1K9MW 1SZXA 2JGUA 3E2EA 2JDIG 1KP2A 4UCSA 2ZDIA 1XMQO 4GKKO 5JCOC 1WPXA 5LP6C 4I5SA 4UCRA 1GH6A 1JFFA 4JI3O 1N8RW 4B3RO 3DGEA 1JVMA 4WFBV 4WFFA 1NQTA 3IC7A 4UV8A 3J7AU 2EIMC 3K5OA 3JCZA 4EB6B 2F1MA 1IBLB 1ZL8A 1AVMA 4X20A 5CA1A 3L74H 1K33A 1BQZA 5IY5B 1NBMG 3I56V 3SJBC 5B3SC 5EZYA 1TA8A 2Q4PA 1WPBA 2JRIA 5FL7G 2UUCB 4L8JA 2GUZA 3ABUA 4PV1B 1HDJA 4U7OA 4TV8A 3K08A 1J5EB 4JI1O 2WSSG 4DR4O 2ZINA 1MMMA 2VRZA 2CGOA 3OMNB 4DV4B 3UCSC 3FFQA 5JWPA 4GX1A 4U3JA 5EC1C 3WFVA 2P4KA 4FFBA 1XREA 1Y6XA 2YEVA 1GMGA 4DR2O 5IYBO 4X1YA 1AP6A 3ZRWA 4LF7O 2ZR3A 3RFRA 2RQ6A 3AG1C 5KHKA 1M56B 4I55B 2XAJA 1R6TA 1NH2D 4JI4O 4X1KB 1Y76A 2W0XA 1QLNA 4PA4A 5B1AB 4LF6B 2ZE7A 2QR4A 4MTXA 5LHGA 4JPRA 1SQVH 2B5UA 1K97A 4WFHA 3UT5B 2ZE5A 3AG3B 1Q6HA 3FB6C 2RDCA 3ZMTA 2YS8A 2E3CA 2AZ2A 1B04A 4NXNO 2WLJA 3CXHF 1AR4A 3STZC 4MVSA 3RN4A 3CCMV 3ZJZA 3E22A 5BZBA 1VQ4V 5C8YB 3KKYA 3JAKB 2XT9A 2GHYA 3RYIA 2WLIB 5D5PA 1WA8A 4GUNA 2GV9A 5CBGA 1GN4A 4AHCA 4O4LA 1XQ8A 2UUBB 4GYCB 2KB1A 3QF7A 2Q0AA 1I7FA 3H1IH 1VQLV 1I5XA 4J80A 3CC2V 5A2QN 2CUGA 2D3OW 1J95A 1RPOA 1FD9A 4CS3A 3JATB 1Q5OA 3O65A 2B1IA 4I4TA 4H44B 2AHZA 1U97A 4HBNA 1PL4A 4K35A 1S5JA 2WLHA 2AXTZ 2WA3A 3RYHA 3N27A 5LYJB 4LFAO 3ZMSA 2MK3A 2UXDO 3HR0A 2VWJA 1L1FA 2Q6AA 5CA0B 2N05A 4L87A 4WF9V 1JJ2U 4O4HB 1IZ3A 1Q6UA 3D3QA 2CTQA 1E79G 1TUBA 1XMOB 1VF6C 4RQFA 3CRRA 2EILB 4DUZO 1MA1A 2NNUA 4B3MO 3MHSC 3CSXA 4J9YB 2YXLA 1KBHA 2JIZG 5A9GA 3AG7A 1YZBA 1D5AA 3CRQA 4O4JA 5H2FZ 4ABMA 4DR1O 3CCJV 2YIDA 1YI2V 3F7VC 2W6JG 4FJCC 2QA4V 4CH5A 1XBLA 1SQBH 3K9AA 1RSOA 1V55B 5BR8B 3E8FA 4DK0A 3ZCCA 4UCVA 2QGNA 2Q7HA 4J11A 5FLXN 1BHBA 3BY6A 1N34B 3ZHSA 2W6IG 4LF5O 4JGSA 1G1XB 2WLMA 1M5IA 4IYIA 4G2KA 4UVCA 1SQFA 2ZNIA 2CAZC 5IYZB 2Z3YA 5DM6V 3CXCU 4DV0B 4QGPA 3UM7A 2P7TC 2DYSB 4LP8A 4J7JA 1IDSA 1YSCA 3SYPA 4J9ZB 4DV6O 3I5DA 3IC9A 1MSWD 2XASA 4CC5A 5GW7A 3LDEA 1RM1B 2AW9A 1FXKA 2QWNB 1M57C 1ZL8B 1KKCA 2UUAO 1B3QA 1TVKA 3FB5C 4JI2O 1HW7A 4K8ZA 1S5HC 2P22C 2Q7EA 4LF9B 4LF4B 4J10A 4O2BA 1JCHA 4MW3A 3EVKA 3AG4B 3ZHVA 1OCZC 1SQQH 4UB6Z 5KX5A 2X6AA 1SZTA 1COWG 4J7KA 3ZEDA 4MTOA 3JAWA 3ETDA 1I94O 2DWDC 3BA8A 1SETA 4KP4A 2Y69C 5B5EZ 1BZKA 1N36B 3THOA 5JQGB 4JV5B 1W2BU 1P84F 2EZOA 2GTSA 4U3JB 3CX5F 2X0LA 1I5YA 1VF5B 2YEVB 3CE2A 4X1YB 4JTAB 1VQ5V 1HNXO 2QEXV 4DR5O 2IM9A 2XAGA 1K7DA 2KSDA 2X6BA 5CMUA 4DR3O 3WB0A 4DUYO 1NT2B 3VBBA 3JD4A 4JI7O 2GBOA 4LF8O 4DYLA 4OGQB 4FLWA 4KL1A 1V54B 3SPGA 3RW0A 3JSNA 2R9IA 2YUAA 3OMAB 2JS5A 1BE3H 1XL6A 1K92A 1X59A 1FFXA 3SPIA 4OX9O 3RYFB 1KKDA 5IJ0B 1BCCH 1ZUQA 3LDCA 1K73W 1GAXA 2R9AA 2HJFC 5JJJB 3ABMB 3ABLC 2HJDA 1NTKH 2ODMA 5J2TA 2R70A 3RYIB 5LMNO 2UU9O 4OXSA 1PM9A 1WA8B 1AILA 1FJGO 1QVGU 2XAHA 1JOYA 3B8MA 1DTOA 1AP5A 4I55A 3A0BZ 1R3LC 4TV9B 1XI1A 5IJ9B 4Z1MG 3B40A 3OR7C 2OT5A 4P9OA 2ZXWC 3QO8A 3JD1A 4I50A 4ICGA 1PL0A 1PV0A 1M1KW 2IBZH 3W7TA 4PI2A 2FMLA 2D2CB 3WB2A 4AI8A 2DMXA 4HNAB 1HWYA 1DK1A 4MW8A 1B06A 4X1IB 1WNSA 3H1LH 3FD9A 5LMUB 1JX9A 1H2LA 1GTOA 1ZSPA 3JD2A 5FPRA 4DRXA 1KC8W 4DV7B 4GX0A 5C8YA 4AILC 3LDDA 2EINB 3ASNC 1Y4MA 2QJ1A 2WWWA 1H2SB 1E1QG 2EIKC 2IJKA 4JI8B 2ETNA 3ZHTA 1BT8A 1UPGA 4BW9A 3CCQV 1VQKV 1XNQB 4GKJO 1CPYA 2IH3C 2FTKA 4LFCB 3W7UA 1K3EA 2CDYA 1JPXA 2A9HA 3JATA 1TGOA 1RSOB 3H9VA 1OCOC 2OTLV 4MVOA 5LYJA 2OCHA 4CZZA 1PNMA 4NTYA 2UXCO 4DO2A 4NXMB 3OEEG 2GTAA 5CA0A 3H1JH 2R72A 4O4HA 2M6YA 4LFBB 3A8TA 5IWAO 3CRMA 1HR0O 2Q7GA 3HKEA 2QTOA 5KHGA 2A0LA 2RN9A 3F5WC 2AZ0A 3KCYA 2QKSA 4OPHA 4B3TB 4PA7A 3AG1B 3GB7C 3ZHUA 4ZKIA 4PDVA 3MAQA 5TISZ 4FVMA 2VQEB 1NR1A 1GN3A 4MVMA 4DW0A 5KMGB 4UCOA 1QR8A 4RUFA 3TGUH 4R7CA 4O2BB 3K58A 2E5LO 1LNQA 4NTXA 2CTPA 5KX5B 2IH1C 2Y4UA 3CC7V 3JAWB 2EULA 2L6LA 1Q86W 1XNRO 1IBMO 2P5OA 1NU1H 4R50A 2JK5C 4PA3A 2IJIA 1I08A 2PY5A 4O2AB 1GM8A 1KMIZ 4I9WA 2LGWA 1XMQB 3JAMN 1SQPH 1EN5A 5IYZA 3FB7C 4GKKB 1HP8A 3H1KH 2EIJB 3LNNA 4JI3B 4B3RB 1K5SA 4JYCA 3TJTA 1YVWA 2H94A 4X65O 3AK3A 1TAEA 4TWKA 5EK0A 3T4ZA 5H6QA 4X64B 2UXBO 4IT5A 2B9ZA 4Q20A 4X66B 4XDLA 1NI8A 3MHHC 4X9QA 5L3FA 4FZ1A 3E35A 5EYPB 4IGGA 4EKWA 4FLXA 3KZIZ 5GONA 4J41A 1UFIA 4YJ3B 3DTUB 3OFNG 3JARB 4DV5O 3ZN0A 1G8MA 1P7BA 4JI1B 1YTFB 4DR4B 2JJ2G 4FIPC 2BOCC 3P3NA 4WFAV 1MABG 1FFXB 3OM3B 4GLXA 5IYDO 1S0VA 5JH7B 2HKOA 5BXZA 3VQYA 3TETA 1MOFA 5JQGA 3UKMA 4LCUC 4DR6B 4DR2B 3RVZA 5ITZA 5IT9N 5J2TB 1T5EA 3R66A 1US6A 4F6EA 1K4CC 5KA5A 1XOUA 3HB3B 1J5EO 1XILA 4D6TH 1D5NA 1SESA 4JI4B 3DXRA 1KECA 1QQCA 4CS4A 2X7RB 1GKFA 3T2MA 4PDRA 2JVDA 4X62O 4B3SO 3H01A 1OCRC 3A0HZ 1BGYH 5B66Z 3CRCA 2YXYA 4X8AA 3U11A 4I50B 1IXMA 1XEQA 2A3QA 2HP8A 2JEXA 2WAMA 4QIWF 1SERA 2ATKC 4IYHA 3LSUA 1F51A 4DV1B 3QTCA 2RJZA 3WG7C 1FXKC 3K79A 3ZN1A 1YDXA 2HR3A 2H3OA 1F4MA 2OIGA 3RYFA 1O9HA 4K3AA 3SYQA 3T1YB 4LF6O 5IJ0A 3BEHA 3D36A 2ADPA 4K0KB 4DRXB 3ETQA 5B1BC 2YDEA 4MTFA 3SPCA 4TUYB 2Q69A 1VMGA 3PN1A 5KHHA 2ITDC 5GTIZ 1VP7A 3APQA 4A5UB 2PI4A 5L3CA 2XOKG 2ZIMA 3UO2A 3HKDA 4TV9A 5IJ9A 2ZKOA 4JTDB 1H2GA 1GN2A 2F66C 3EHBB 2QM8A 4FMTA 3RWRD 2LGQA 1RPRA 2Y4TA 2FB5A 4LFAB 2UXDB 1Y66A 4CH6A 2DOSA 2UUBO 4HNAA 2CH7B 2F4VO 2V7QG 1AR1B 3L71H 2Y69B 1N33B 1H8HG 1P49A 1S72V 3BHPA 4X1IA 4P9PA 1NZ6A 1Y74B 4W4LA 3HKEB 4DUZB 2LFSA 3AG2B 5JCOA 3ZRSA 2VQFB 2QWPB 2F93B 3P32A 4KFMA 4NKGB 1R3JC 1DF5A 2OCCB 1VQ6V 1OCCC 4R6ZA 1TUEB 1HNZB 4DR1B 2A79B 3ASOB 3VQVA 1GK9A 1MG1A 1XMOO 2V4DA 3SYCA 4LBEC 1IBKO 4BAYA 4B7KA 1SA0A 3TK1A 1YITV 2ZCEA 3BCCH 5KHJA 3CCRV 4DV3B 3ZIAG 5CB4B 4FLZA 1FKAO 1NTMH 1IVSA 3OTOB 2X6CA 2OYQA 4Z2WA 4JYAO 5JJNB 3BFRA 3OD4A 1M56C 1XHXA 3CD6V 3Q4HB 3AK1A 2GDSA 1URFA 2QM4A 3LNMB 4FZ0A 2P67A 3ABLB 4WCEV 5L3BA 1JJOA 2XNDG 3CCEV 4U3FH 1W0JG 2NN4A 3JD3A 4GX5A 2P06A 3CP1A 4DV6B 3AG3C 3WU2Z 4QPKA 3ML0A 1AJQA 3K3WA 4ZOLB 2F43G 4RQEA 3CMEV 2KG7B 4JI6O 4U7NA 2ZXWB 5LGTA 5CBHA 1L8DA 1L0LH 4JF3A 5EC2C 5KMGA 1EZJA 4TQFA 1R73A 1QVFU 4PHZA 1NS1A 3FAVA 1Y67A 5GONB 1QR9A 2XHBA 3STLC 2CE4A 5L3EA 3VOUA 4PA6A 2ZQMA 2VWKA 2RMKB 4YXWG 2WLLA 4NYKA 1SC5B 3ZHQA 3T1HO 4O2AA 1N4CA 3LSQA 1S77D 3CB2A 2H8PC 3EXAA 3BVOA 4LF9O 4FLUA 3T4DA 2YC0A 4J42A 1NVPB 5ITZB 3RT3C 4G28B 4CC6A 5LOVB 1VQ8V 4Z1VA 2ZNJA 1F7YA 4UCUA 2HVKC 3AK2A 5AG2A 2HHHB 3DXRB 5CN0A 5KA6A 2NR5A 5JVDB 2W0FC 1N36O 1CP9A 1OJHA 1AI4A 2DYRC 2Z5UA 4IIJB 4UCTA 3CS5A 2WLKA 1ZX3A 4JI7B 2EILC 1OCOB 5EYPA 2YIBA 1QLEB 4DR7B 2AHYA 3X2QC 4YJ3A 5HFMA 3CCUV 4JZGA 3JARA 3JSLA 2V1DA 2QDOA 2UXNA 3K59A 3ABKC 4DV2O 1YHQV 4N23A 4UVAA 4K8XA 5JH7A 2VS0A 1VF6A 2LQTA 2WLNA 5H6RA 3PJSK 1V55C 3S3WA 3CEIA 5IDJA 1EBOA 3C3TA 4YHHO 5LMNB 2G38A 1M9NA 3K5NA 4MSWC 3BRCA 2IW5A 3CJHB 3SYOA 2DWEC 4YIPA 4PI0A 1ORQC 2R9RB 3DSQA 3HKDB 3DC6A 3B09A 4JI5O 5EIBD 2QSAA 4F6RA 4KHPO 1YJWV 1HNWB 1ZTEA 4BW5A 3B2EE 3CHXA 5GTHZ 1VEWA 3G6BA 1JQ0A 4ASUG 2ZDIC 3JYCA 2DYSC 5FNVB 4YY3O 2PZSA 5LGUA 4OPAA 3I55V 2Q8VA 3QVNA 2LO1A 1EM1A 5H9CA 3K06A 2BSKB 3A0RA 3UQ8A 2Q5ZA 2CTRA 1LR1A 4P30A 4AQYO 4TUYA 3AG4C 5LP6B 1M90W 5HFLA 1EFRG 4FFKA 4FPPA 1GM9A 2EIMB 4KUMA 4W4KA 1ZAUA 1BQ0A 1AJPA 1FYJA 2E74B 3S3XA 5B3SB 2QE7G 4DV7O 3IFXA 3OGCC 4JTCB 3JD0A 1SA0B 4PJ0Z 4GX2A 2OWOA 4ZI7B 3HKBB 2UXCB 5L3GA 5LXTB 4IL6Z 2QKAA 1MZFA 3GVMA 2HEPA 1N32B 2CH7A 3W7SA 4FLYA 1HR0B 4HZ3A 4LWSB 2PI5A 1Y74A 5F2VO 3M7MX 2JEUA 2QKCA 5LHIA 1YF2A 4WBNB 1VQ7V 4FK5C 1V54C 1NTZH 1Q8IA 1LUVA 2ZM6B 2ZIOA 1GO3F 3OT7A 2ILMA 2ITCC 4NXMO 4JI0B 4RAIA 5LA6B 2EJRA 1VF7A 3VQXA 3IJ4A 4D7TA 4J7ZA 4LFBO 4UV9A 1OCRB 3L72H 2KQXA 1S3JA 3ZHRA 5LBQA 3D36C 3ABMC 4NTWA 1DGSA 4BWAA 2E5LB 4P2ZA 2UXXA 3ETGA 1RFYA 3FAVB 4B3TO 5CB4A 2IJHA 1BS3A 3ICXA 2BTQB 1IURA 5EIBC 1XNRB 1IBMB 3Q4HA 1AR5A 4JAAA 1Z5VA 1S76D 3SJQC 1VARA 2WLLB 4NR1A 2K1EA 1H38A 2N74A 1IXBA 3P30A 4QJFB 2Y48A 5H5NA 2C2AA 1PNLA 2YSUB 5CBFA 3SYAA 1PPJH 2PF4E 4WFGA 1KD1W 1QBZA 3GWKC 2PGGA 1RP3B 3UO3A 2N04A 4X88A 4HYOA 2UXBB 4ZOLA 3CRAA 4RO2A 4UFZA 1SRYA 2KG7A 4RUEA 4TQDA 1PP9H 1PKXA 3G67A 3J81N 4LH7A 1D2DA 2EINC 5K1PA 2GSMB 3AEIA 3M8AA 4DV5B 4O4IB 4IHJB 3KG2A 2YIBD 1OHHG 2PTMA 4DW1A 4X64O 4X66O 3ZMVA 1YIJV 1YJNV 1IBLO 5KHIA 1YTFD 4MVZA 1I0HA 3E8HA 4N21A 3ETEA 1BL8A 2KKWA 3FYEB 2PYLA 1Q81W 3A2FA 4MVRA 3OGIB 3E89A 3GWOA 1OCCB 2UUCO 3FYIB 1F4NA 4ZHQB 5LOVA 4LF7B 2ZD9A 1H8EG 1EN6A 1WP8A 3ZX6A 1EN4A 5D5QA 5J9PC 3BABA 4X62B 4B3SB 2E76B 3ZMZA 5JVDA 3RYCA 2F95B 1XL4A 4IIJA 4QNHB 3EFFK 4DV4O 4F6RB 3FKSG 5DEDA 3SDLA 4DR6O 5LL6Y 1AJNA 3JASB 3J80N 2Y0PA 1NH2B 2QTSA 4H37A 5EBWC 3K04A 2ZT9B 3N2GB 4R8CA 4NXNB 4JYYA 3OW2U 3APOA 4LC1A 2EBOA 1ZWIC 2FL4A 4GT1A 1FXVA 2ARHA 2XAFA 3OUSA 1XDCA 3M99B 3L9DA 3K5MA 2EX3A 1F23A 1NR7A 4FM1A 3JALA 1AI5A 2DJVA 4BIOA 1U96A 4EEQA 3CJHA 5LGNA 1EZVH 2DQ0A 1ZLZA 2Q9LA 2XAQA 4LNUB 4DV1O 3D3IA 3RVYA 3K0DA 1O9GA 2PUSA 4DXWA 3MDSA 5LHHA 3U0ZA 3B4SA 1E1RG 1M57B 3BA9A 4PELA 3T1YO 2BCCH 3FX7A 4K0KO 2FYUH 1H2KA 3JCUZ 1K8AW 2DN9A 1JMKC 4CH4A 1SS3A 1OCZB 2DE0X 1Z5WA 1PD3A 2EIJC 1JA8A 3N2KB 4I0XB 5FNVA 3RGBA 2JGDB 3W7WA 2F4VB 2HFEC 1PNKA 1M4UA 4H33A 2BSKA 2HLDG 1FAFA 2CTWA 3CCSV 3LUTB 1VIBA 3F7YC 5IY5C 2DW4A 1YXBA 2P4VA 5LP6A 4B3MB 1P7GA 3KCXA 1K5QA 3K5LA 3ZMUA 4B08A 2Z0AA 5DN6G 1BMFG 3BAAA 1N33O 1WN7A 2DYRB 4E4EA 5KLVH 3OUFA 5DECA 4ZBMA 3E83A 5E1AC 1IBKB 3CMAV 3SJAC 3L73H 2VQFO 3X2QB 1V9PA 4CH3A 1QU7A 3SR2C 3B8NA 1Q3EA 1Q90D 4ZI7A 2M7WA 3HKBA 3QO5A 3SPJA 4JYAB 5LXTA 1G4YB 4FM2A 3RBZA 5L3DA 1HNZO 5KAIZ 4MTGA 3ABKB 4YJ2B 5BMVB 5J2UA 3IAYA 1AROP 2RCVA 4LF5B 5C93A 1NKDA 2IU3A 1QHTA 5B1NA 4LWSA 2CK3G 3QNEA 1R3KC 5B1AC 1SKVA 5E79Z 5BR8O 4WBNA 1R3IC 3CCLV 1SQXH 4DV3O 3OTOO 1MNGA 1WLEA 4WFEA 3TCUA 1VQ9V 3CC4V 1JR9A 2Y0IA 3CCVV 5LA6A 1THZA 1UJWB 1N34O 2LW7A 1G6UA 4JI6B 1ROPA 1SQGA 5BY1A 2UUAB 3OE7G 4YIOA 4JI2B 2EZPA 3OMIB 4CBCA 3QO7A 1YEWA 2B1GA 4FM0A 3HKCA 2WPDG 4DV0O 1JFFB 2P90A 2ZE6A 2JS3A 1FPOA 1KB9F 2BTQA 2OIEA 1I94B 3CWBH 4DK1A 1OV9A 3NR7A 1XHZA 4ZIBA 4GCZA 4X20B 3ABTA 5CA1B 1WB7A 3BPZA 3T1HB 2WA4A 4XDJA 2LP7A 5EZYB 2YXHA 4UVBA 4G27B 1DLBA 2IJJA 4LF4O 3ASNB 2GUZB 4UB8Z 4TSFG 1R1BA 2EIKB 2AGAA 4TV8B 3K57A 1X4TA 3SGIA 1BHAA 2PYJA 4I7ZB 3E8BA 1NVPD 1HNXB 2Q67A 2P6JA 4DR5B 3D8CA 3SPHA 4DR3B 3ZBHA 4DUYB 3RYCB 1FXHA 1KYOF 4JV5O 3OEHG 4LF8B 2DQ3A 3AG2C 4FFBB 1VQNV 4Q6GA 2QWQB 3ZRWB 2OCCC 1WP7A 3TXQA 4O4IA 4IHJA 4NVPA 3MD0A 2A7WA 3T1CA 2HHHO 1N0NA 4DV2B 4JAUA 4EB6A 4LR3A 1XUQA 3ASOC 4OX9B 1QCEA 1Y76B 5EBMC 3K0GA 2BTOA 1K4DC 5K1XA 2ADQB 2E75B 3B77A
chains in the Genus database with same CATH topology
1U96A 1Z2GA 2LQTA 2HP8A 2RN9A 2RNBA 2LGQA 1U97A 1HP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U96 A;  1Z2G A;  2LQT A;  2HP8 A;  2RN9 A;  2RNB A;  2LGQ A;  1U97 A;  1HP8 A; 
#chains in the Genus database with same CATH topology
 4BIZ A;  3R65 A;  3F5T A;  4KXR A;  4XBF A;  1CXZ B;  5IE9 A;  4YHH B;  4DR7 O;  1W0K G;  1CEZ A;  3L75 H;  3JAL B;  2UU9 B;  5IYC O;  4ZHQ A;  2YIA A;  1YJ9 V;  1FJG B;  1OZ0 A;  2NLJ C;  3VQW A;  1H2M A;  1NJI W;  2ZE8 A;  3ZRX A;  1B6Q A;  1N0J A;  4JI5 B;  5EBL C;  1R6N A;  3HPL C;  4JAV A;  2HVJ C;  3E22 B;  4KHP B;  1GN6 A;  2Q68 A;  1Z2G A;  2QWO B;  4QE9 A;  2QWR B;  3SJC C;  3FB8 C;  3ZRV A;  3JAS A;  4YY3 B;  2L35 A;  2XTA A;  4O4L B;  4X89 A;  1LUW A;  1R6K A;  5FPO A;  4TOI A;  4C7U A;  1P4R A;  3N2G A;  1RM1 C;  4X1K A;  2RNB A;  2LJ2 A;  3E86 A;  3OTF A;  1SF9 A;  3NXS A;  1HNW O;  3P3P A;  4AQY B;  4I4T B;  1FS0 G;  2MW2 B;  2EJ7 A;  4JYB A;  2HG5 C;  3RYH B;  3W7X A;  4B7E A;  1S5L Z;  1MSD A;  2ZR2 A;  3UT5 A;  4EFE A;  1KUQ A;  4FLV A;  1GRJ A;  1Q7Y W;  4LNU A;  3U10 A;  3IGA C;  3G4S V;  3H1H H;  4GZR B;  1KU9 A;  4GKJ B;  4FLT A;  3C90 A;  4H0L B;  4E2L A;  1W59 A;  1TUB B;  5LMU O;  3JAK A;  3DC5 A;  2Q0O C;  4PDL A;  3QG5 A;  3G80 A;  2K9P A;  2WLI A;  3WB1 A;  3CPW U;  1Q6I A;  4H13 B;  3ZS8 C;  1A32 A;  3N2K A;  1H2N A;  4I0X A;  4BR6 A;  1DF4 A;  1M93 A;  3LSS A;  5KAF Z;  4JI8 O;  4I9Q A;  2JGD A;  2F23 A;  4O4J B;  1VQO V;  5B1O A;  5J2U B;  5KUM A;  1AB3 A;  1KQS U;  1YCI A;  1XNQ O;  4PDM A;  5IWA B;  2CGN A;  3OAA G;  3O9O A;  2JJ1 G;  4JAS A;  4LFC O;  5JJE B;  4NB5 A;  2A06 H;  3G71 V;  4UUJ C;  3K03 A;  1VQM V;  1MZE A;  1QLE C;  4UXN A;  3TXS A;  1KP3 A;  1VQP V;  1N32 O;  1AI7 A;  4MT8 A;  2FKX A;  2BOB C;  2OTJ V;  1WJZ A;  4TT3 G;  1ENV A;  1L0N H;  3CYO A;  1QNM A;  1BSM A;  2LFR A;  4CS2 A;  2ZM6 O;  4XDK A;  2YIC A;  3HKC B;  2Q73 A;  3K9S A;  1WB8 A;  1WAZ A;  3OR6 C;  4QE7 A;  4JI0 O;  1Q43 A;  5CA3 A;  1IX9 A;  4MVQ A;  4LH6 A;  3E8G A;  5BMV A;  4YJ2 A;  4F4L A;  3WG7 B;  1FXK B;  3L70 H;  1K34 A;  2O57 A;  2VQE O;  1TVK B;  1Q82 W;  4EFB A;  4RWU A;  1GM7 A;  2LW1 A;  4BIU A;  3C3S A;  4MS2 A;  5B1B B;  1AI6 A;  1FFT B;  3G6E V;  2BE3 A;  4PD4 F;  4D7S A;  4HAM A;  2QM7 A;  5KUK A;  2YI8 A;  4X65 B;  2XUM A;  4PA9 A;  4JZ2 A;  2IU0 A;  2YI9 A;  4MVU A;  4QPJ A;  1K9M W;  1SZX A;  2JGU A;  3E2E A;  2JDI G;  1KP2 A;  4UCS A;  2ZDI A;  1XMQ O;  4GKK O;  5JCO C;  1WPX A;  5LP6 C;  4I5S A;  4UCR A;  1GH6 A;  1JFF A;  4JI3 O;  1N8R W;  4B3R O;  3DGE A;  1JVM A;  4WFB V;  4WFF A;  1NQT A;  3IC7 A;  4UV8 A;  3J7A U;  2EIM C;  3K5O A;  3JCZ A;  4EB6 B;  2F1M A;  1IBL B;  1ZL8 A;  1AVM A;  4X20 A;  5CA1 A;  3L74 H;  1K33 A;  1BQZ A;  5IY5 B;  1NBM G;  3I56 V;  3SJB C;  5B3S C;  5EZY A;  1TA8 A;  2Q4P A;  1WPB A;  2JRI A;  5FL7 G;  2UUC B;  4L8J A;  2GUZ A;  3ABU A;  4PV1 B;  1HDJ A;  4U7O A;  4TV8 A;  3K08 A;  1J5E B;  4JI1 O;  2WSS G;  4DR4 O;  2ZIN A;  1MMM A;  2VRZ A;  2CGO A;  3OMN B;  4DV4 B;  3UCS C;  3FFQ A;  5JWP A;  4GX1 A;  4U3J A;  5EC1 C;  3WFV A;  2P4K A;  4FFB A;  1XRE A;  1Y6X A;  2YEV A;  1GMG A;  4DR2 O;  5IYB O;  4X1Y A;  1AP6 A;  3ZRW A;  4LF7 O;  2ZR3 A;  3RFR A;  2RQ6 A;  3AG1 C;  5KHK A;  1M56 B;  4I55 B;  2XAJ A;  1R6T A;  1NH2 D;  4JI4 O;  4X1K B;  1Y76 A;  2W0X A;  1QLN A;  4PA4 A;  5B1A B;  4LF6 B;  2ZE7 A;  2QR4 A;  4MTX A;  5LHG A;  4JPR A;  1SQV H;  2B5U A;  1K97 A;  4WFH A;  3UT5 B;  2ZE5 A;  3AG3 B;  1Q6H A;  3FB6 C;  2RDC A;  3ZMT A;  2YS8 A;  2E3C A;  2AZ2 A;  1B04 A;  4NXN O;  2WLJ A;  3CXH F;  1AR4 A;  3STZ C;  4MVS A;  3RN4 A;  3CCM V;  3ZJZ A;  3E22 A;  5BZB A;  1VQ4 V;  5C8Y B;  3KKY A;  3JAK B;  2XT9 A;  2GHY A;  3RYI A;  2WLI B;  5D5P A;  1WA8 A;  4GUN A;  2GV9 A;  5CBG A;  1GN4 A;  4AHC A;  4O4L A;  1XQ8 A;  2UUB B;  4GYC B;  2KB1 A;  3QF7 A;  2Q0A A;  1I7F A;  3H1I H;  1VQL V;  1I5X A;  4J80 A;  3CC2 V;  5A2Q N;  2CUG A;  2D3O W;  1J95 A;  1RPO A;  1FD9 A;  4CS3 A;  3JAT B;  1Q5O A;  3O65 A;  2B1I A;  4I4T A;  4H44 B;  2AHZ A;  1U97 A;  4HBN A;  1PL4 A;  4K35 A;  1S5J A;  2WLH A;  2AXT Z;  2WA3 A;  3RYH A;  3N27 A;  5LYJ B;  4LFA O;  3ZMS A;  2MK3 A;  2UXD O;  3HR0 A;  2VWJ A;  1L1F A;  2Q6A A;  5CA0 B;  2N05 A;  4L87 A;  4WF9 V;  1JJ2 U;  4O4H B;  1IZ3 A;  1Q6U A;  3D3Q A;  2CTQ A;  1E79 G;  1TUB A;  1XMO B;  1VF6 C;  4RQF A;  3CRR A;  2EIL B;  4DUZ O;  1MA1 A;  2NNU A;  4B3M O;  3MHS C;  3CSX A;  4J9Y B;  2YXL A;  1KBH A;  2JIZ G;  5A9G A;  3AG7 A;  1YZB A;  1D5A A;  3CRQ A;  4O4J A;  5H2F Z;  4ABM A;  4DR1 O;  3CCJ V;  2YID A;  1YI2 V;  3F7V C;  2W6J G;  4FJC C;  2QA4 V;  4CH5 A;  1XBL A;  1SQB H;  3K9A A;  1RSO A;  1V55 B;  5BR8 B;  3E8F A;  4DK0 A;  3ZCC A;  4UCV A;  2QGN A;  2Q7H A;  4J11 A;  5FLX N;  1BHB A;  3BY6 A;  1N34 B;  3ZHS A;  2W6I G;  4LF5 O;  4JGS A;  1G1X B;  2WLM A;  1M5I A;  4IYI A;  4G2K A;  4UVC A;  1SQF A;  2ZNI A;  2CAZ C;  5IYZ B;  2Z3Y A;  5DM6 V;  3CXC U;  4DV0 B;  4QGP A;  3UM7 A;  2P7T C;  2DYS B;  4LP8 A;  4J7J A;  1IDS A;  1YSC A;  3SYP A;  4J9Z B;  4DV6 O;  3I5D A;  3IC9 A;  1MSW D;  2XAS A;  4CC5 A;  5GW7 A;  3LDE A;  1RM1 B;  2AW9 A;  1FXK A;  2QWN B;  1M57 C;  1ZL8 B;  1KKC A;  2UUA O;  1B3Q A;  1TVK A;  3FB5 C;  4JI2 O;  1HW7 A;  4K8Z A;  1S5H C;  2P22 C;  2Q7E A;  4LF9 B;  4LF4 B;  4J10 A;  4O2B A;  1JCH A;  4MW3 A;  3EVK A;  3AG4 B;  3ZHV A;  1OCZ C;  1SQQ H;  4UB6 Z;  5KX5 A;  2X6A A;  1SZT A;  1COW G;  4J7K A;  3ZED A;  4MTO A;  3JAW A;  3ETD A;  1I94 O;  2DWD C;  3BA8 A;  1SET A;  4KP4 A;  2Y69 C;  5B5E Z;  1BZK A;  1N36 B;  3THO A;  5JQG B;  4JV5 B;  1W2B U;  1P84 F;  2EZO A;  2GTS A;  4U3J B;  3CX5 F;  2X0L A;  1I5Y A;  1VF5 B;  2YEV B;  3CE2 A;  4X1Y B;  4JTA B;  1VQ5 V;  1HNX O;  2QEX V;  4DR5 O;  2IM9 A;  2XAG A;  1K7D A;  2KSD A;  2X6B A;  5CMU A;  4DR3 O;  3WB0 A;  4DUY O;  1NT2 B;  3VBB A;  3JD4 A;  4JI7 O;  2GBO A;  4LF8 O;  4DYL A;  4OGQ B;  4FLW A;  4KL1 A;  1V54 B;  3SPG A;  3RW0 A;  3JSN A;  2R9I A;  2YUA A;  3OMA B;  2JS5 A;  1BE3 H;  1XL6 A;  1K92 A;  1X59 A;  1FFX A;  3SPI A;  4OX9 O;  3RYF B;  1KKD A;  5IJ0 B;  1BCC H;  1ZUQ A;  3LDC A;  1K73 W;  1GAX A;  2R9A A;  2HJF C;  5JJJ B;  3ABM B;  3ABL C;  2HJD A;  1NTK H;  2ODM A;  5J2T A;  2R70 A;  3RYI B;  5LMN O;  2UU9 O;  4OXS A;  1PM9 A;  1WA8 B;  1AIL A;  1FJG O;  1QVG U;  2XAH A;  1JOY A;  3B8M A;  1DTO A;  1AP5 A;  4I55 A;  3A0B Z;  1R3L C;  4TV9 B;  1XI1 A;  5IJ9 B;  4Z1M G;  3B40 A;  3OR7 C;  2OT5 A;  4P9O A;  2ZXW C;  3QO8 A;  3JD1 A;  4I50 A;  4ICG A;  1PL0 A;  1PV0 A;  1M1K W;  2IBZ H;  3W7T A;  4PI2 A;  2FML A;  2D2C B;  3WB2 A;  4AI8 A;  2DMX A;  4HNA B;  1HWY A;  1DK1 A;  4MW8 A;  1B06 A;  4X1I B;  1WNS A;  3H1L H;  3FD9 A;  5LMU B;  1JX9 A;  1H2L A;  1GTO A;  1ZSP A;  3JD2 A;  5FPR A;  4DRX A;  1KC8 W;  4DV7 B;  4GX0 A;  5C8Y A;  4AIL C;  3LDD A;  2EIN B;  3ASN C;  1Y4M A;  2QJ1 A;  2WWW A;  1H2S B;  1E1Q G;  2EIK C;  2IJK A;  4JI8 B;  2ETN A;  3ZHT A;  1BT8 A;  1UPG A;  4BW9 A;  3CCQ V;  1VQK V;  1XNQ B;  4GKJ O;  1CPY A;  2IH3 C;  2FTK A;  4LFC B;  3W7U A;  1K3E A;  2CDY A;  1JPX A;  2A9H A;  3JAT A;  1TGO A;  1RSO B;  3H9V A;  1OCO C;  2OTL V;  4MVO A;  5LYJ A;  2OCH A;  4CZZ A;  1PNM A;  4NTY A;  2UXC O;  4DO2 A;  4NXM B;  3OEE G;  2GTA A;  5CA0 A;  3H1J H;  2R72 A;  4O4H A;  2M6Y A;  4LFB B;  3A8T A;  5IWA O;  3CRM A;  1HR0 O;  2Q7G A;  3HKE A;  2QTO A;  5KHG A;  2A0L A;  2RN9 A;  3F5W C;  2AZ0 A;  3KCY A;  2QKS A;  4OPH A;  4B3T B;  4PA7 A;  3AG1 B;  3GB7 C;  3ZHU A;  4ZKI A;  4PDV A;  3MAQ A;  5TIS Z;  4FVM A;  2VQE B;  1NR1 A;  1GN3 A;  4MVM A;  4DW0 A;  5KMG B;  4UCO A;  1QR8 A;  4RUF A;  3TGU H;  4R7C A;  4O2B B;  3K58 A;  2E5L O;  1LNQ A;  4NTX A;  2CTP A;  5KX5 B;  2IH1 C;  2Y4U A;  3CC7 V;  3JAW B;  2EUL A;  2L6L A;  1Q86 W;  1XNR O;  1IBM O;  2P5O A;  1NU1 H;  4R50 A;  2JK5 C;  4PA3 A;  2IJI A;  1I08 A;  2PY5 A;  4O2A B;  1GM8 A;  1KMI Z;  4I9W A;  2LGW A;  1XMQ B;  3JAM N;  1SQP H;  1EN5 A;  5IYZ A;  3FB7 C;  4GKK B;  1HP8 A;  3H1K H;  2EIJ B;  3LNN A;  4JI3 B;  4B3R B;  1K5S A;  4JYC A;  3TJT A;  1YVW A;  2H94 A;  4X65 O;  3AK3 A;  1TAE A;  4TWK A;  5EK0 A;  3T4Z A;  5H6Q A;  4X64 B;  2UXB O;  4IT5 A;  2B9Z A;  4Q20 A;  4X66 B;  4XDL A;  1NI8 A;  3MHH C;  4X9Q A;  5L3F A;  4FZ1 A;  3E35 A;  5EYP B;  4IGG A;  4EKW A;  4FLX A;  3KZI Z;  5GON A;  4J41 A;  1UFI A;  4YJ3 B;  3DTU B;  3OFN G;  3JAR B;  4DV5 O;  3ZN0 A;  1G8M A;  1P7B A;  4JI1 B;  1YTF B;  4DR4 B;  2JJ2 G;  4FIP C;  2BOC C;  3P3N A;  4WFA V;  1MAB G;  1FFX B;  3OM3 B;  4GLX A;  5IYD O;  1S0V A;  5JH7 B;  2HKO A;  5BXZ A;  3VQY A;  3TET A;  1MOF A;  5JQG A;  3UKM A;  4LCU C;  4DR6 B;  4DR2 B;  3RVZ A;  5ITZ A;  5IT9 N;  5J2T B;  1T5E A;  3R66 A;  1US6 A;  4F6E A;  1K4C C;  5KA5 A;  1XOU A;  3HB3 B;  1J5E O;  1XIL A;  4D6T H;  1D5N A;  1SES A;  4JI4 B;  3DXR A;  1KEC A;  1QQC A;  4CS4 A;  2X7R B;  1GKF A;  3T2M A;  4PDR A;  2JVD A;  4X62 O;  4B3S O;  3H01 A;  1OCR C;  3A0H Z;  1BGY H;  5B66 Z;  3CRC A;  2YXY A;  4X8A A;  3U11 A;  4I50 B;  1IXM A;  1XEQ A;  2A3Q A;  2HP8 A;  2JEX A;  2WAM A;  4QIW F;  1SER A;  2ATK C;  4IYH A;  3LSU A;  1F51 A;  4DV1 B;  3QTC A;  2RJZ A;  3WG7 C;  1FXK C;  3K79 A;  3ZN1 A;  1YDX A;  2HR3 A;  2H3O A;  1F4M A;  2OIG A;  3RYF A;  1O9H A;  4K3A A;  3SYQ A;  3T1Y B;  4LF6 O;  5IJ0 A;  3BEH A;  3D36 A;  2ADP A;  4K0K B;  4DRX B;  3ETQ A;  5B1B C;  2YDE A;  4MTF A;  3SPC A;  4TUY B;  2Q69 A;  1VMG A;  3PN1 A;  5KHH A;  2ITD C;  5GTI Z;  1VP7 A;  3APQ A;  4A5U B;  2PI4 A;  5L3C A;  2XOK G;  2ZIM A;  3UO2 A;  3HKD A;  4TV9 A;  5IJ9 A;  2ZKO A;  4JTD B;  1H2G A;  1GN2 A;  2F66 C;  3EHB B;  2QM8 A;  4FMT A;  3RWR D;  2LGQ A;  1RPR A;  2Y4T A;  2FB5 A;  4LFA B;  2UXD B;  1Y66 A;  4CH6 A;  2DOS A;  2UUB O;  4HNA A;  2CH7 B;  2F4V O;  2V7Q G;  1AR1 B;  3L71 H;  2Y69 B;  1N33 B;  1H8H G;  1P49 A;  1S72 V;  3BHP A;  4X1I A;  4P9P A;  1NZ6 A;  1Y74 B;  4W4L A;  3HKE B;  4DUZ B;  2LFS A;  3AG2 B;  5JCO A;  3ZRS A;  2VQF B;  2QWP B;  2F93 B;  3P32 A;  4KFM A;  4NKG B;  1R3J C;  1DF5 A;  2OCC B;  1VQ6 V;  1OCC C;  4R6Z A;  1TUE B;  1HNZ B;  4DR1 B;  2A79 B;  3ASO B;  3VQV A;  1GK9 A;  1MG1 A;  1XMO O;  2V4D A;  3SYC A;  4LBE C;  1IBK O;  4BAY A;  4B7K A;  1SA0 A;  3TK1 A;  1YIT V;  2ZCE A;  3BCC H;  5KHJ A;  3CCR V;  4DV3 B;  3ZIA G;  5CB4 B;  4FLZ A;  1FKA O;  1NTM H;  1IVS A;  3OTO B;  2X6C A;  2OYQ A;  4Z2W A;  4JYA O;  5JJN B;  3BFR A;  3OD4 A;  1M56 C;  1XHX A;  3CD6 V;  3Q4H B;  3AK1 A;  2GDS A;  1URF A;  2QM4 A;  3LNM B;  4FZ0 A;  2P67 A;  3ABL B;  4WCE V;  5L3B A;  1JJO A;  2XND G;  3CCE V;  4U3F H;  1W0J G;  2NN4 A;  3JD3 A;  4GX5 A;  2P06 A;  3CP1 A;  4DV6 B;  3AG3 C;  3WU2 Z;  4QPK A;  3ML0 A;  1AJQ A;  3K3W A;  4ZOL B;  2F43 G;  4RQE A;  3CME V;  2KG7 B;  4JI6 O;  4U7N A;  2ZXW B;  5LGT A;  5CBH A;  1L8D A;  1L0L H;  4JF3 A;  5EC2 C;  5KMG A;  1EZJ A;  4TQF A;  1R73 A;  1QVF U;  4PHZ A;  1NS1 A;  3FAV A;  1Y67 A;  5GON B;  1QR9 A;  2XHB A;  3STL C;  2CE4 A;  5L3E A;  3VOU A;  4PA6 A;  2ZQM A;  2VWK A;  2RMK B;  4YXW G;  2WLL A;  4NYK A;  1SC5 B;  3ZHQ A;  3T1H O;  4O2A A;  1N4C A;  3LSQ A;  1S77 D;  3CB2 A;  2H8P C;  3EXA A;  3BVO A;  4LF9 O;  4FLU A;  3T4D A;  2YC0 A;  4J42 A;  1NVP B;  5ITZ B;  3RT3 C;  4G28 B;  4CC6 A;  5LOV B;  1VQ8 V;  4Z1V A;  2ZNJ A;  1F7Y A;  4UCU A;  2HVK C;  3AK2 A;  5AG2 A;  2HHH B;  3DXR B;  5CN0 A;  5KA6 A;  2NR5 A;  5JVD B;  2W0F C;  1N36 O;  1CP9 A;  1OJH A;  1AI4 A;  2DYR C;  2Z5U A;  4IIJ B;  4UCT A;  3CS5 A;  2WLK A;  1ZX3 A;  4JI7 B;  2EIL C;  1OCO B;  5EYP A;  2YIB A;  1QLE B;  4DR7 B;  2AHY A;  3X2Q C;  4YJ3 A;  5HFM A;  3CCU V;  4JZG A;  3JAR A;  3JSL A;  2V1D A;  2QDO A;  2UXN A;  3K59 A;  3ABK C;  4DV2 O;  1YHQ V;  4N23 A;  4UVA A;  4K8X A;  5JH7 A;  2VS0 A;  1VF6 A;  2LQT A;  2WLN A;  5H6R A;  3PJS K;  1V55 C;  3S3W A;  3CEI A;  5IDJ A;  1EBO A;  3C3T A;  4YHH O;  5LMN B;  2G38 A;  1M9N A;  3K5N A;  4MSW C;  3BRC A;  2IW5 A;  3CJH B;  3SYO A;  2DWE C;  4YIP A;  4PI0 A;  1ORQ C;  2R9R B;  3DSQ A;  3HKD B;  3DC6 A;  3B09 A;  4JI5 O;  5EIB D;  2QSA A;  4F6R A;  4KHP O;  1YJW V;  1HNW B;  1ZTE A;  4BW5 A;  3B2E E;  3CHX A;  5GTH Z;  1VEW A;  3G6B A;  1JQ0 A;  4ASU G;  2ZDI C;  3JYC A;  2DYS C;  5FNV B;  4YY3 O;  2PZS A;  5LGU A;  4OPA A;  3I55 V;  2Q8V A;  3QVN A;  2LO1 A;  1EM1 A;  5H9C A;  3K06 A;  2BSK B;  3A0R A;  3UQ8 A;  2Q5Z A;  2CTR A;  1LR1 A;  4P30 A;  4AQY O;  4TUY A;  3AG4 C;  5LP6 B;  1M90 W;  5HFL A;  1EFR G;  4FFK A;  4FPP A;  1GM9 A;  2EIM B;  4KUM A;  4W4K A;  1ZAU A;  1BQ0 A;  1AJP A;  1FYJ A;  2E74 B;  3S3X A;  5B3S B;  2QE7 G;  4DV7 O;  3IFX A;  3OGC C;  4JTC B;  3JD0 A;  1SA0 B;  4PJ0 Z;  4GX2 A;  2OWO A;  4ZI7 B;  3HKB B;  2UXC B;  5L3G A;  5LXT B;  4IL6 Z;  2QKA A;  1MZF A;  3GVM A;  2HEP A;  1N32 B;  2CH7 A;  3W7S A;  4FLY A;  1HR0 B;  4HZ3 A;  4LWS B;  2PI5 A;  1Y74 A;  5F2V O;  3M7M X;  2JEU A;  2QKC A;  5LHI A;  1YF2 A;  4WBN B;  1VQ7 V;  4FK5 C;  1V54 C;  1NTZ H;  1Q8I A;  1LUV A;  2ZM6 B;  2ZIO A;  1GO3 F;  3OT7 A;  2ILM A;  2ITC C;  4NXM O;  4JI0 B;  4RAI A;  5LA6 B;  2EJR A;  1VF7 A;  3VQX A;  3IJ4 A;  4D7T A;  4J7Z A;  4LFB O;  4UV9 A;  1OCR B;  3L72 H;  2KQX A;  1S3J A;  3ZHR A;  5LBQ A;  3D36 C;  3ABM C;  4NTW A;  1DGS A;  4BWA A;  2E5L B;  4P2Z A;  2UXX A;  3ETG A;  1RFY A;  3FAV B;  4B3T O;  5CB4 A;  2IJH A;  1BS3 A;  3ICX A;  2BTQ B;  1IUR A;  5EIB C;  1XNR B;  1IBM B;  3Q4H A;  1AR5 A;  4JAA A;  1Z5V A;  1S76 D;  3SJQ C;  1VAR A;  2WLL B;  4NR1 A;  2K1E A;  1H38 A;  2N74 A;  1IXB A;  3P30 A;  4QJF B;  2Y48 A;  5H5N A;  2C2A A;  1PNL A;  2YSU B;  5CBF A;  3SYA A;  1PPJ H;  2PF4 E;  4WFG A;  1KD1 W;  1QBZ A;  3GWK C;  2PGG A;  1RP3 B;  3UO3 A;  2N04 A;  4X88 A;  4HYO A;  2UXB B;  4ZOL A;  3CRA A;  4RO2 A;  4UFZ A;  1SRY A;  2KG7 A;  4RUE A;  4TQD A;  1PP9 H;  1PKX A;  3G67 A;  3J81 N;  4LH7 A;  1D2D A;  2EIN C;  5K1P A;  2GSM B;  3AEI A;  3M8A A;  4DV5 B;  4O4I B;  4IHJ B;  3KG2 A;  2YIB D;  1OHH G;  2PTM A;  4DW1 A;  4X64 O;  4X66 O;  3ZMV A;  1YIJ V;  1YJN V;  1IBL O;  5KHI A;  1YTF D;  4MVZ A;  1I0H A;  3E8H A;  4N21 A;  3ETE A;  1BL8 A;  2KKW A;  3FYE B;  2PYL A;  1Q81 W;  3A2F A;  4MVR A;  3OGI B;  3E89 A;  3GWO A;  1OCC B;  2UUC O;  3FYI B;  1F4N A;  4ZHQ B;  5LOV A;  4LF7 B;  2ZD9 A;  1H8E G;  1EN6 A;  1WP8 A;  3ZX6 A;  1EN4 A;  5D5Q A;  5J9P C;  3BAB A;  4X62 B;  4B3S B;  2E76 B;  3ZMZ A;  5JVD A;  3RYC A;  2F95 B;  1XL4 A;  4IIJ A;  4QNH B;  3EFF K;  4DV4 O;  4F6R B;  3FKS G;  5DED A;  3SDL A;  4DR6 O;  5LL6 Y;  1AJN A;  3JAS B;  3J80 N;  2Y0P A;  1NH2 B;  2QTS A;  4H37 A;  5EBW C;  3K04 A;  2ZT9 B;  3N2G B;  4R8C A;  4NXN B;  4JYY A;  3OW2 U;  3APO A;  4LC1 A;  2EBO A;  1ZWI C;  2FL4 A;  4GT1 A;  1FXV A;  2ARH A;  2XAF A;  3OUS A;  1XDC A;  3M99 B;  3L9D A;  3K5M A;  2EX3 A;  1F23 A;  1NR7 A;  4FM1 A;  3JAL A;  1AI5 A;  2DJV A;  4BIO A;  1U96 A;  4EEQ A;  3CJH A;  5LGN A;  1EZV H;  2DQ0 A;  1ZLZ A;  2Q9L A;  2XAQ A;  4LNU B;  4DV1 O;  3D3I A;  3RVY A;  3K0D A;  1O9G A;  2PUS A;  4DXW A;  3MDS A;  5LHH A;  3U0Z A;  3B4S A;  1E1R G;  1M57 B;  3BA9 A;  4PEL A;  3T1Y O;  2BCC H;  3FX7 A;  4K0K O;  2FYU H;  1H2K A;  3JCU Z;  1K8A W;  2DN9 A;  1JMK C;  4CH4 A;  1SS3 A;  1OCZ B;  2DE0 X;  1Z5W A;  1PD3 A;  2EIJ C;  1JA8 A;  3N2K B;  4I0X B;  5FNV A;  3RGB A;  2JGD B;  3W7W A;  2F4V B;  2HFE C;  1PNK A;  1M4U A;  4H33 A;  2BSK A;  2HLD G;  1FAF A;  2CTW A;  3CCS V;  3LUT B;  1VIB A;  3F7Y C;  5IY5 C;  2DW4 A;  1YXB A;  2P4V A;  5LP6 A;  4B3M B;  1P7G A;  3KCX A;  1K5Q A;  3K5L A;  3ZMU A;  4B08 A;  2Z0A A;  5DN6 G;  1BMF G;  3BAA A;  1N33 O;  1WN7 A;  2DYR B;  4E4E A;  5KLV H;  3OUF A;  5DEC A;  4ZBM A;  3E83 A;  5E1A C;  1IBK B;  3CMA V;  3SJA C;  3L73 H;  2VQF O;  3X2Q B;  1V9P A;  4CH3 A;  1QU7 A;  3SR2 C;  3B8N A;  1Q3E A;  1Q90 D;  4ZI7 A;  2M7W A;  3HKB A;  3QO5 A;  3SPJ A;  4JYA B;  5LXT A;  1G4Y B;  4FM2 A;  3RBZ A;  5L3D A;  1HNZ O;  5KAI Z;  4MTG A;  3ABK B;  4YJ2 B;  5BMV B;  5J2U A;  3IAY A;  1ARO P;  2RCV A;  4LF5 B;  5C93 A;  1NKD A;  2IU3 A;  1QHT A;  5B1N A;  4LWS A;  2CK3 G;  3QNE A;  1R3K C;  5B1A C;  1SKV A;  5E79 Z;  5BR8 O;  4WBN A;  1R3I C;  3CCL V;  1SQX H;  4DV3 O;  3OTO O;  1MNG A;  1WLE A;  4WFE A;  3TCU A;  1VQ9 V;  3CC4 V;  1JR9 A;  2Y0I A;  3CCV V;  5LA6 A;  1THZ A;  1UJW B;  1N34 O;  2LW7 A;  1G6U A;  4JI6 B;  1ROP A;  1SQG A;  5BY1 A;  2UUA B;  3OE7 G;  4YIO A;  4JI2 B;  2EZP A;  3OMI B;  4CBC A;  3QO7 A;  1YEW A;  2B1G A;  4FM0 A;  3HKC A;  2WPD G;  4DV0 O;  1JFF B;  2P90 A;  2ZE6 A;  2JS3 A;  1FPO A;  1KB9 F;  2BTQ A;  2OIE A;  1I94 B;  3CWB H;  4DK1 A;  1OV9 A;  3NR7 A;  1XHZ A;  4ZIB A;  4GCZ A;  4X20 B;  3ABT A;  5CA1 B;  1WB7 A;  3BPZ A;  3T1H B;  2WA4 A;  4XDJ A;  2LP7 A;  5EZY B;  2YXH A;  4UVB A;  4G27 B;  1DLB A;  2IJJ A;  4LF4 O;  3ASN B;  2GUZ B;  4UB8 Z;  4TSF G;  1R1B A;  2EIK B;  2AGA A;  4TV8 B;  3K57 A;  1X4T A;  3SGI A;  1BHA A;  2PYJ A;  4I7Z B;  3E8B A;  1NVP D;  1HNX B;  2Q67 A;  2P6J A;  4DR5 B;  3D8C A;  3SPH A;  4DR3 B;  3ZBH A;  4DUY B;  3RYC B;  1FXH A;  1KYO F;  4JV5 O;  3OEH G;  4LF8 B;  2DQ3 A;  3AG2 C;  4FFB B;  1VQN V;  4Q6G A;  2QWQ B;  3ZRW B;  2OCC C;  1WP7 A;  3TXQ A;  4O4I A;  4IHJ A;  4NVP A;  3MD0 A;  2A7W A;  3T1C A;  2HHH O;  1N0N A;  4DV2 B;  4JAU A;  4EB6 A;  4LR3 A;  1XUQ A;  3ASO C;  4OX9 B;  1QCE A;  1Y76 B;  5EBM C;  3K0G A;  2BTO A;  1K4D C;  5K1X A;  2ADQ B;  2E75 B;  3B77 A; 
#chains in the Genus database with same CATH homology
 1U96 A;  1Z2G A;  2LQT A;  2HP8 A;  2RN9 A;  2RNB A;  2LGQ A;  1U97 A;  1HP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...