1Z2GA

Solution structure of apo, oxidized yeast cox17
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
69
structure length
69
Chain Sequence
MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Cytochrome c oxidase copper chaperone
publication title Folding studies of Cox17 reveal an important interplay of cysteine oxidation and copper binding
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 24
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 1z2gA00
2RN9A 1U96A 1Z2GA 1HP8A 1U97A 2LQTA 2HP8A 2RNBA 2LGQA
chains in the Genus database with same CATH superfamily
4GT1A 2FYUH 2QM7A 1H2KA 1N34B 3BABA 2EIMC 1NTZH 1M56C 2A06H 2B9ZA 4J7ZA 3VBBA 2ZNIA 3ML0A 2UUBB 3ABTA 5KMGB 3SYQA 1VARA 1K7DA 4FJCC 1K9MW 3ETQA 3F5WC 3LSSA 3T1HO 1PP9H 5KA5A 1N33O 4JI7B 4XDLA 1YSCA 4IT5A 5FPOA 4OX9O 1MSWD 3BRCA 2AZ2A 3OM3B 2AGAA 1GMGA 4B3MB 3I5DA 4GKKO 2D3OW 4RQFA 5LOVB 4F4LA 3QO5A 4UV9A 1ZX3A 4JI1B 1SZXA 4JV5O 2YXLA 1M57C 5LHHA 4PA9A 3U10A 2OT5A 3H1JH 3CCEV 1TAEA 1FPOA 1QQCA 3A0RA 1BS3A 2PZSA 2ARHA 2K9PA 4GX2A 2F4VB 1KUQA 2H8PC 3ZRVA 4Q20A 4TQFA 4PHZA 5CN0A 4HAMA 5F2VO 2YICA 4J7KA 2QTOA 2GDSA 1CEZA 5LYJB 2CTQA 4YIOA 3UT5A 4HBNA 2UXXA 1XL6A 2OTLV 4FK5C 5J2UA 1KMIZ 2EIKB 2HVKC 3M8AA 4JTCB 1AI6A 4PD4F 1FJGB 2QTSA 4H37A 3UKMA 3FKSG 3AK2A 1N34O 1NZ6A 3FB8C 2Q73A 1LNQA 4GKJB 2F23A 1H38A 2UUBO 2A79B 3K08A 4IHJA 5B1NA 1M90W 1IBKB 1GM9A 1BMFG 3JASB 3BHPA 3ZRSA 4DV5B 2ZINA 4JI7O 4HZ3A 2FB5A 2JK5C 3OEEG 3CX5F 4YJ3A 5EC2C 4K3AA 4B3MO 3JD2A 1KECA 4WCEV 3C3TA 1VQ4V 4YIPA 1NH2B 3HKDA 4QJFB 2V4DA 1IX9A 3UT5B 1N4CA 4JI6B 1YDXA 4B3RB 5KHHA 4JI1O 5J2UB 3RVYA 2QWPB 4B3SB 3W7UA 1EN4A 3JD1A 4NTYA 2WAMA 3ZS8C 4PV1B 1B04A 1XQ8A 2V1DA 2WLJA 4DR7B 2YI8A 2DYRB 2Q69A 5IJ9A 2QSAA 4XBFA 3AG4B 1R3IC 4BIUA 1DK1A 4IHJB 1HR0B 3CCVV 5GTHZ 1AP5A 3RW0A 3CRMA 3G6BA 4LBEC 2JVDA 5A9GA 4I9QA 1W0JG 4YJ3B 5B1AB 5KX5A 1AR1B 2C2AA 2X0LA 3T4ZA 3H1LH 3HKDB 3B2EE 1K8AW 1FJGO 4JGSA 5LGTA 5EZYA 3E35A 1QHTA 3HKBA 4R7CA 4GKJO 2RNBA 3SDLA 2NNUA 4CS2A 3LNNA 1IBKO 4O4LA 3SYAA 4DV5O 1JJOA 5DECA 2KB1A 5IJ9B 3ZMUA 4MW8A 4J80A 1KYOF 2GHYA 5B1BC 4TUYA 4N21A 4FIPC 1KQSU 1DF4A 1KU9A 1PNKA 3D36A 5LP6C 4Z1VA 3J81N 4JI6O 4GLXA 4B3RO 4DR4B 1BGYH 1SZTA 5KX5B 4UCSA 4B3SO 1D5AA 1K5QA 3IC9A 1S5JA 4J11A 2YIBA 2P4VA 4H0LB 1YITV 5EZYB 4DR7O 5CBGA 3NR7A 3HKBB 4BR6A 4ZIBA 2EZOA 2XOKG 4I50A 4FLWA 5IWAB 4DR1B 1TUBA 3M99B 3LSQA 1WAZA 3RT3C 2HR3A 4ABMA 4AI8A 2WPDG 5B3SC 5JJJB 3IFXA 4TUYB 5CA3A 1TVKA 3ZHTA 3A8TA 4CS3A 1IXMA 1DTOA 4X20B 4DV0B 5DM6V 1QLEC 2K1EA 4GYCB 1GKFA 5HFLA 3K5LA 4CS4A 3IJ4A 4D6TH 5L3DA 4Z2WA 4G27B 2E76B 2PI5A 4DV4B 1G8MA 4I50B 3K04A 1JMKC 4MS2A 1DF5A 1M93A 3CPWU 1TUBB 2W6JG 2PF4E 3JARA 4N23A 2EIKC 1DGSA 5KUMA 3QO7A 1YHQV 3AG2C 2CH7A 1BSMA 2RCVA 4DV1B 1TVKB 3K9SA 2VWJA 1M1KW 1URFA 3K06A 3UCSC 1UFIA 2YSUB 3FB5C 4LF4B 3P30A 4UCRA 1R6TA 1BL8A 4DYLA 2KG7A 1I0HA 2OCCC 1BQZA 2Q5ZA 2WLIB 2LQTA 1BZKA 2Z0AA 4I5SA 4X1YA 2ZE8A 1VQMV 5IWAO 4JI0B 4NYKA 4X89A 1HNXB 3N27A 1X4TA 2FMLA 3DGEA 2AXTZ 3GWKC 4E4EA 1PL0A 2EBOA 2PGGA 2LJ2A 2AZ0A 1YJNV 4FLUA 4PA3A 1WJZA 1Z2GA 2F66C 3JARB 1F7YA 1A32A 1FXHA 4JI5B 4DV0O 4W4KA 2CH7B 1QR8A 2IU0A 3RYHB 1Q43A 1MZFA 4RO2A 1VF6A 1RM1C 1IXBA 4PA6A 2JEXA 4L87A 3D3QA 4X62B 5L3EA 5CB4A 4PI0A 2UXBB 1R3KC 2OWOA 2Q7HA 2ZDIC 4LF6B 2EZPA 4DV4O 1AI5A 3CB2A 4TQDA 1F4MA 3CCJV 4X1YB 5CBHA 4FM0A 4UCTA 2CUGA 3OR6C 1H2GA 1WNSA 5B66Z 3TCUA 2P22C 4TV9A 3WG7B 4Q6GA 3ASOB 3KCXA 5KHIA 2JS5A 1SQGA 3G4SV 1NJIW 2YIBD 4LF4O 2AHYA 2WLKA 4OPHA 2HVJC 1SERA 4CZZA 3WB2A 4UB6Z 3G67A 3OGCC 3ABLB 4JI0O 5CB4B 1GTOA 1HNXO 4I55A 1JJ2U 2HKOA 2ZE5A 4DV7B 3ZRXA 2ITDC 2ZCEA 5ITZA 1US6A 1AR5A 3FAVA 2L35A 4K0KB 3H9VA 2M7WA 2IW5A 2O57A 1K5SA 4O4HA 2ILMA 2HJDA 4JI5O 2RN9A 4DK1A 4HYOA 2Y4TA 4TV9B 3H1KH 3GVMA 2QR4A 3P3NA 2DE0X 4RQEA 3L72H 3JATB 4LH7A 4X62O 4DV2B 4PDLA 4LF5B 4LF8B 2UXBO 1K97A 2XAHA 2ATKC 1VQNV 2LO1A 4LF6O 4BWAA 2VRZA 2UUAO 4I9WA 1HW7A 4I55B 2BOBC 2YUAA 1F51A 3ASNB 3DTUB 2YS8A 3CCUV 2UU9B 3FAVB 2A9HA 1OCZC 1BCCH 1XNRB 1MABG 1CXZB 4EFBA 3STZC 2ADQB 2CK3G 1YIJV 1YZBA 1ZTEA 1NVPD 4FFBA 4U7OA 5IJ0A 3RYFA 2EIJB 3ZHUA 4YY3B 3CRCA 2NN4A 1AJQA 2Y69C 1F4NA 1JPXA 4FM2A 3RN4A 4DV7O 5IY5B 4MTXA 2XUMA 2YXHA 2UXCB 3LDDA 4K0KO 4JAAA 1GN3A 4KL1A 2JGDB 1NR7A 1T5EA 3SJAC 1L0LH 1EBOA 1PV0A 2Z5UA 1O9GA 4MVZA 5JJNB 1WPBA 3CMEV 1GN4A 1ENVA 4ZKIA 4DR3B 1Y6XA 5BR8B 1N8RW 2R72A 4FFBB 4LF8O 5IJ0B 3RYFB 4CH3A 1ZWIC 1V54B 4ZOLB 1NQTA 3BY6A 2HJFC 1AJNA 3O65A 2JJ1G 4AILC 1W59A 2ZR3A 3HB3B 5B5EZ 1I7FA 4F6EA 3F7VC 2XTAA 1J95A 4B3TB 4FZ0A 1R6NA 2WLNA 4LFCB 4ZI7A 4H33A 1VQ7V 3W7XA 4F6RB 1BE3H 3OMAB 4O4IA 3SJBC 1RSOB 4B7EA 1QLNA 2Z3YA 2FTKA 2X6AA 4UCVA 1H2MA 2Q68A 4YY3O 4JI8O 1KB9F 3CP1A 1Y67A 4P2ZA 4CC5A 3AK1A 4X88A 3JSNA 4ASUG 5H9CA 2NLJC 3CWBH 1WB8A 2UXCO 3LDCA 1G4YB 5JCOC 3BEHA 5IE9A 2QM4A 3BA9A 2XAJA 2FKXA 3ASOC 1WP8A 4DRXA 4O4JA 3SJCC 3CYOA 3ZN1A 3U11A 5IYBO 5E1AC 3MD0A 3DXRA 4DR3O 5BR8O 4LCUC 4QNHB 4O4IB 1I08A 5GTIZ 5LBQA 3J7AU 1B6QA 3ZX6A 2PUSA 3R66A 5FLXN 3F7YC 1O9HA 3ZHQA 5L3GA 4L8JA 3ZRWA 2KKWA 1G1XB 3TXQA 3B40A 1QBZA 4B7KA 1NR1A 4B3TO 3JALA 2QKCA 1WP7A 4LFCO 2F93B 3GB7C 4MTOA 2VQEB 1OZ0A 4DRXB 4O4JB 5GW7A 3G71V 3JCZA 4LFAB 5DN6G 2H3OA 1R1BA 1WA8A 3A0BZ 1XL4A 3DXRB 3T1CA 3DC5A 4TT3G 1GRJA 4LH6A 5JH7A 5LL6Y 1OCRC 3ZN0A 1NKDA 4LNUA 1VQKV 2WSSG 4LFBB 2VWKA 3H01A 4UCOA 4JTDB 5KLVH 5L3CA 5K1PA 3IAYA 1M9NA 3ZRWB 1E79G 4OGQB 1Y4MA 2E3CA 2XAQA 1YTFB 1JA8A 4NKGB 1K33A 3JALB 1YEWA 4PDRA 1MZEA 5FPRA 2QWNB 2EIJC 1B3QA 3M7MX 4D7SA 1Q7YW 3OW2U 4X9QA 3RWRD 4FFKA 1WA8B 3EHBB 1Q6IA 2F4VO 3CCLV 3K59A 3JD3A 2JEUA 4LNUB 2QWQB 3KG2A 4FLTA 1Y66A 4I4TA 2DWDC 4FM1A 3FD9A 1ZLZA 2DYSC 1IURA 3ABUA 1NS1A 2N04A 1U96A 2HEPA 2VQEO 3CMAV 1H8HG 2GTAA 5JJEB 3K0DA 3N2KA 2Y0IA 5C93A 4LFAO 2QWOB 4Z1MG 5J9PC 1HNWB 5GONA 5IYDO 4PA7A 3WU2Z 1WLEA 1GH6A 5LXTA 3SPIA 3HKCA 2ZXWC 3E83A 4JZ2A 4UVCA 2DQ3A 1TUEB 3K58A 4KFMA 4EKWA 2CTPA 1GN6A 4I4TB 4YJ2A 2GV9A 3QO8A 4LF7B 1FD9A 3AG3B 4PJ0Z 1TA8A 2ZM6B 2P4KA 3K0GA 3RFRA 5KAIZ 4P9OA 4NTXA 4BW5A 1JCHA 3THOA 4UB8Z 2A7WA 4R6ZA 3VQYA 4C7UA 4JI2B 2DMXA 4TOIA 2UXDB 5GONB 4TWKA 3OE7G 1JFFA 1S5HC 3JAWA 2Y4UA 1HR0O 5HFMA 1OV9A 5E79Z 3PJSK 1KKDA 4O4LB 5LXTB 3T1YB 1NH2D 4DV6B 1YTFD 1MG1A 2ZIMA 1UJWB 1EM1A 2KSDA 1RP3B 1SS3A 4YJ2B 2WLHA 4IL6Z 4DO2A 2EILB 4FVMA 2OTJV 2ZIOA 1K34A 1K4CC 2JJ2G 1JR9A 1XDCA 1N0JA 5C8YA 1EZVH 1VQ5V 1K92A 2FL4A 1OCCB 5BY1A 2MK3A 3LUTB 1U97A 5LMNB 4BAYA 1JFFB 1I5XA 3FB7C 3JAWB 3HR0A 3CEIA 3CHXA 1SA0A 1MMMA 4LF7O 4MSWC 5CBFA 2BCCH 4JYYA 4AQYB 2ZM6O 1N36B 4K8XA 4DR6B 4DR4O 2NR5A 1KD1W 4G28B 1S77D 1D2DA 4DW0A 3ZIAG 4DUZB 1NTKH 5CA0A 4JI2O 1H2NA 2HHHB 2CE4A 3RYCA 2ZE6A 2UXDO 2E75B 3KKYA 2PTMA 1P7BA 1QVGU 2EINB 4CH5A 2Q7GA 5IYZA 1D5NA 4DR1O 1QCEA 4FLVA 3T1YO 4DV6O 3E89A 2F95B 1YJWV 1R3LC 1BHAA 3JD0A 2P5OA 3ABMB 3OD4A 2Q4PA 4NVPA 3D3IA 1R3JC 4J42A 1XUQA 1FFXA 4KHPB 3JCUZ 4MW3A 3BA8A 1SA0B 4FZ1A 4NXMB 4CC6A 4OPAA 4WFFA 1JVMA 4TSFG 4XDJA 2G38A 3AEIA 4I0XA 3S3WA 2DYRC 3CRQA 5EBMC 2ZKOA 4H44B 5EIBD 4RUFA 4NXNB 2ETNA 3KCYA 5EK0A 5CA0B 2LP7A 3AG4C 3CRAA 3RYCB 2GTSA 1HWYA 3SPHA 5LMNO 2E5LB 2A0LA 1J5EB 1MSDA 1W2BU 2Q0OC 2KG7B 4E2LA 1JX9A 4GUNA 5IYZB 4FMTA 1GN2A 1OCOB 1YVWA 1LUWA 5B1AC 3CC7V 3VQVA 4IYHA 4PA4A 4AQYO 1N36O 4DR6O 3B09A 2EIMB 1DLBA 2ZQMA 1ROPA 3OTFA 2X6CA 2RJZA 4DV1O 1FFXB 3CS5A 3MAQA 2Q8VA 1XBLA 4UV8A 1WN7A 4DUZO 3SGIA 3I56V 2P06A 3CXHF 3E2EA 3QVNA 2HHHO 3OEHG 3BFRA 5KUKA 1PM9A 2LW1A 1GM7A 4I0XB 2PY5A 2AW9A 2BTQA 4WFEA 2WWWA 2CTRA 1Z5VA 3A2FA 2LGQA 4O2AA 1B06A 3JAKA 1E1RG 3OFNG 2VQFB 5TISZ 4JI4B 3SYCA 4KHPO 2PI4A 2JDIG 2DOSA 1BT8A 1FXVA 3GWOA 1XMQB 4O2BA 3U0ZA 5J2TA 3CC4V 3C3SA 4NXMO 1P7GA 4HNAA 5BZBA 3LDEA 1XHZA 1PNMA 4NXNO 2HFEC 2QKSA 1MNGA 2LFRA 4U7NA 1XREA 4LF9B 3B8MA 2E5LO 1MOFA 2M6YA 1J5EO 3K79A 3RVZA 3SJQC 4MVMA 2BTQB 1BHBA 5L3BA 1QR9A 5EBLC 3FYIB 4JTAB 2JS3A 3D8CA 3JSLA 2P90A 4O2AB 3S3XA 1GK9A 2HG5C 3JAKB 3D36C 5ITZB 3W7WA 1KP2A 1SETA 3BAAA 4JAVA 4CBCA 1VF5B 3VOUA 4IGGA 3QG5A 4CH6A 2CTWA 3JD4A 4O4HB 3BPZA 4J9YB 3IC7A 5J2TB 2YEVA 3W7TA 2DN9A 5H2FZ 4HNAB 3AG1B 1EN6A 2UUCB 4PELA 1VQLV 2OCHA 2QKAA 4DW1A 2ZD9A 4IIJA 4X64B 1QVFU 5LGNA 2PYLA 4WFGA 1CPYA 2BOCC 5LGUA 1K73W 3L74H 2VQFO 3BCCH 4JI4O 2WLMA 2IH3C 4J10A 3K57A 3CXCU 5A2QN 1XMQO 3ICXA 3OR7C 2LW7A 2IH1C 4LR3A 2EX3A 2OYQA 4OX9B 1KC8W 1Q82W 3TK1A 1TGOA 2YEVB 2EINC 4DV2O 2BE3A 4LF5O 4LF9O 1X59A 5LP6A 2ODMA 1AVMA 4I7ZB 4JPRA 4KXRA 1ZAUA 2WA3A 3L71H 1NI8A 2W0FC 5H6QA 2ZT9B 2GUZA 2UU9O 1LUVA 5KMGA 3T2MA 4X65B 2WLLA 1S3JA 2Q67A 1XNRO 2ZE7A 4MVQA 1FFTB 4MVUA 2PYJA 1R73A 2ZNJA 1SQQH 5LHGA 1OHHG 3MDSA 4K35A 1SQVH 5B1BB 4X66B 4X64O 3B77A 2HP8A 4DK0A 1HDJA 1OCOC 4CH4A 3SPGA 2IJJA 3ZMZA 3EFFK 1W0KG 1S72V 4P9PA 4QIWF 2F1MA 3SPCA 3WG7C 5H5NA 2JIZG 5BMVA 3QTCA 1P49A 2GUZB 1XILA 1H2LA 1M4UA 4MT8A 5IDJA 1PD3A 2WLLB 1AP6A 4DR2B 1SQFA 4ZI7B 1YJ9V 5LYJA 3K3WA 1R6KA 3FB6C 1VF6C 3C90A 3ABLC 5KHKA 1SQXH 1XMOB 4ZHQA 1P84F 5B3SB 3ABKB 3CJHA 3TJTA 4FLYA 3CCRV 3R65A 4X65O 2Q0AA 4NR1A 1K3EA 1FXKA 3JASA 1QLEB 3DSQA 5BMVB 1IVSA 2H94A 4MVSA 2CGOA 5K1XA 4UXNA 3Q4HA 2KQXA 4DV3B 3LNMB 3K5NA 4X66O 5BXZA 2QJ1A 4RUEA 1AI7A 2EJRA 3ZMTA 1ZL8A 4ZHQB 1JQ0A 1BQ0A 1RFYA 3AG2B 4QPJA 1VQ6V 3ASNC 3SPJA 4YHHB 5H6RA 2CAZC 3CJHB 4W4LA 5CMUA 1RPOA 1FKAO 1FYJA 1YF2A 2QGNA 3K03A 2DWEC 3HPLC 2GBOA 1L1FA 1I94B 5JVDA 4DR2O 2W6IG 2ZDIA 1EFRG 1FXKB 3RBZA 2JRIA 3AG1C 2OCCB 1RPRA 2F43G 4GZRB 5LMUB 2DJVA 3ZCCA 4DXWA 1XMOO 5JQGA 3Q4HB 2D2CB 4BW9A 3K5OA 5IY5C 2EJ7A 3CC2V 3VQWA 4QE7A 2OIEA 5JH7B 1ZL8B 3ETGA 2N05A 4QPKA 5KHGA 4AHCA 1AB3A 2ITCC 3ZHRA 2YI9A 1RM1B 2WA4A 4OXSA 2Q9LA 2E74B 1VMGA 2R9AA 1Q6UA 1HNZB 1N32B 3ZHVA 4KUMA 5JVDB 4DV3O 4ZBMA 2QEXV 1AJPA 4MTGA 2IJHA 4JF3A 1Q5OA 1VQPV 1V54C 3SYOA 4X1IA 3G80A 1WB7A 1UPGA 3H1HH 5JQGB 4LFBO 4FLZA 3AG7A 1IDSA 4YHHO 5IT9N 3T4DA 1NTMH 1Z5WA 3AK3A 4WFHA 3EVKA 1E1QG 1SC5B 3E8HA 5KHJA 1I94O 1Q81W 5FL7G 3VQXA 5B1OA 1SF9A 3SYPA 4YXWG 3WB0A 1YI2V 1VEWA 4UCUA 3ZMSA 1S5LZ 1GAXA 5LMUO 1SRYA 3N2KB 2RDCA 4PDVA 4EEQA 4X1IB 4RAIA 4X20A 1Q8IA 2IU3A 2RQ6A 2R70A 4JYAB 1ORQC 1EZJA 1MA1A 1H2SB 4NTWA 1AI4A 1I5YA 2XHBA 3HKCB 2CGNA 3JYCA 1IBLB 2XAFA 3FFQA 2YIAA 1ZUQA 3W7SA 3MHHC 1HNZO 1N32O 1XNQB 1NBMG 1HNWO 3CSXA 3TXSA 3OGIB 1ZSPA 3LSUA 1XOUA 1V9PA 4J7JA 1Q3EA 3G6EV 2MW2B 3ABKC 1VQOV 4WF9V 4J41A 1Q6HA 1V55B 1N0NA 1CP9A 1OJHA 1OCZB 4GX0A 3CCSV 1FS0G 2HLDG 4LWSA 2YXYA 3P32A 5L3FA 3BVOA 2B5UA 2N74A 1AR4A 2X7RB 1VQ8V 2WLIA 4DR5B 1LR1A 1XHXA 1PKXA 1YXBA 4TV8A 1G6UA 1M5IA 2OIGA 3F5TA 2CDYA 2Y69B 1JOYA 3OAAG 2IJIA 2XASA 4BIZA 2YIDA 3CD6V 3PN1A 3H1IH 5C8YB 1VF7A 4MVOA 4WFAV 3CRRA 4GX5A 3CCMV 2P7TC 1SQPH 4JYAO 3X2QB 3RYHA 3K5MA 1VQ9V 4ICGA 1EN5A 3P3PA 3ZJZA 1IBLO 2AHZA 4GCZA 3OUSA 4UVBA 5LA6A 4LWSB 4QGPA 2DW4A 3UM7A 4MVRA 1FXKC 2ADPA 4RWUA 4PDMA 1XNQO 3HKEA 4JYBA 5LHIA 4TV8B 1S76D 4KP4A 4FLXA 5JCOA 3ZMVA 2L6LA 4JYCA 2UXNA 2Y48A 4D7TA 4IYIA 1P4RA 1NU1H 3RYIA 3UO2A 4JI3B 1SESA 4LC1A 1GO3F 4P30A 4EB6A 1NVPB 3SR2C 4DR5O 2B1IA 4K8ZA 3APOA 2BSKA 1SQBH 5LA6B 1M56B 4QE9A 3E8GA 2QM8A 3UQ8A 1L8DA 3CCQV 3STLC 5CA1A 1XI1A 3HKEB 1VP7A 3QF7A 4B08A 4GX1A 3O9OA 2UUAB 1IZ3A 1QNMA 1Y76A 5EC1C 2GSMB 2RMKB 1SKVA 2YC0A 3APQA 3DC6A 1NT2B 1Q86W 2Y0PA 1THZA 4MTFA 1AROP 3JATA 3QNEA 3K9AA 3RYIB 3AG3C 4A5UB 4XDKA 3B4SA 1M57B 4BIOA 4EB6B 4UUJC 3ETDA 2R9RB 3TETA 1K4DC 2BSKB 3OTOB 4LP8A 5CA1B 1Q90D 2XT9A 3B8NA 2BTOA 2Q6AA 5EIBC 2DQ0A 4WBNA 4WFBV 1GM8A 2V7QG 3OUFA 1Y76B 1L0NH 4PI2A 2QDOA 3E8BA 5KA6A 4JI3O 3A0HZ 1PNLA 3WB1A 5KAFZ 1IBMB 3ZHSA 1COWG 4JZGA 2EULA 1PL4A 1AILA 4FPPA 5D5QA 4J9ZB 4X1KA 2EILC 3E8FA 4DUYB 3RGBA 4G2KA 3ZEDA 1F23A 4JASA 1FAFA 2XAGA 3N2GA 2X6BA 1OCRB 1YCIA 4O2BB 4EFEA 5FNVA 2JGDA 1KKCA 1OCCC 2IBZH 1V55C 5JWPA 3ETEA 4WBNB 3CE2A 1H8EG 3IGAC 2YDEA 1KP3A 5DEDA 3FYEB 3UO3A 3OMNB 3J80N 3JAMN 2VS0A 2W0XA 4JAUA 2R9IA 4U3JA 5AG2A 4ZOLA 3L73H 3OT7A 4JI8B 1Y74A 2XNDG 3OTOO 4X1KB 3MHSC 2IJKA 4X8AA 3E22A 4NB5A 1HP8A 2ZR2A 3ZBHA 3T1HB 1N33B 3N2GB 2JGUA 3TGUH 4R8CA 5EYPA 3L9DA 1WPXA 5FNVB 1KBHA 3X2QC 3WFVA 4GKKB 4F6RA 3E86A 1VIBA 1RSOA 5EBWC 2DYSB 2QWRB 1IBMO 4U3FH 2LFSA 4IIJB 3NXSA 3ABMC 3FX7A 4JV5B 1PPJH 2B1GA 2P67A 4DUYO 3KZIZ 2QA4V 2Q7EA 5IYCO 4U3JB 1S0VA 5D5PA 1Y74B 1QU7A 3L75H 2IM9A 2A3QA 4UFZA 4H13B 2UUCO 3E22B 2ZXWB 3L70H 5LOVA 3OMIB 2QE7G 3EXAA 5EYPB 3I55V 4UVAA 2P6JA 5LP6B 4R50A 2LGWA 1XEQA
chains in the Genus database with same CATH topology
2RN9A 1U96A 1Z2GA 1HP8A 1U97A 2LQTA 2HP8A 2RNBA 2LGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RN9 A;  1U96 A;  1Z2G A;  1HP8 A;  1U97 A;  2LQT A;  2HP8 A;  2RNB A;  2LGQ A; 
#chains in the Genus database with same CATH topology
 4GT1 A;  2FYU H;  2QM7 A;  1H2K A;  1N34 B;  3BAB A;  2EIM C;  1NTZ H;  1M56 C;  2A06 H;  2B9Z A;  4J7Z A;  3VBB A;  2ZNI A;  3ML0 A;  2UUB B;  3ABT A;  5KMG B;  3SYQ A;  1VAR A;  1K7D A;  4FJC C;  1K9M W;  3ETQ A;  3F5W C;  3LSS A;  3T1H O;  1PP9 H;  5KA5 A;  1N33 O;  4JI7 B;  4XDL A;  1YSC A;  4IT5 A;  5FPO A;  4OX9 O;  1MSW D;  3BRC A;  2AZ2 A;  3OM3 B;  2AGA A;  1GMG A;  4B3M B;  3I5D A;  4GKK O;  2D3O W;  4RQF A;  5LOV B;  4F4L A;  3QO5 A;  4UV9 A;  1ZX3 A;  4JI1 B;  1SZX A;  4JV5 O;  2YXL A;  1M57 C;  5LHH A;  4PA9 A;  3U10 A;  2OT5 A;  3H1J H;  3CCE V;  1TAE A;  1FPO A;  1QQC A;  3A0R A;  1BS3 A;  2PZS A;  2ARH A;  2K9P A;  4GX2 A;  2F4V B;  1KUQ A;  2H8P C;  3ZRV A;  4Q20 A;  4TQF A;  4PHZ A;  5CN0 A;  4HAM A;  5F2V O;  2YIC A;  4J7K A;  2QTO A;  2GDS A;  1CEZ A;  5LYJ B;  2CTQ A;  4YIO A;  3UT5 A;  4HBN A;  2UXX A;  1XL6 A;  2OTL V;  4FK5 C;  5J2U A;  1KMI Z;  2EIK B;  2HVK C;  3M8A A;  4JTC B;  1AI6 A;  4PD4 F;  1FJG B;  2QTS A;  4H37 A;  3UKM A;  3FKS G;  3AK2 A;  1N34 O;  1NZ6 A;  3FB8 C;  2Q73 A;  1LNQ A;  4GKJ B;  2F23 A;  1H38 A;  2UUB O;  2A79 B;  3K08 A;  4IHJ A;  5B1N A;  1M90 W;  1IBK B;  1GM9 A;  1BMF G;  3JAS B;  3BHP A;  3ZRS A;  4DV5 B;  2ZIN A;  4JI7 O;  4HZ3 A;  2FB5 A;  2JK5 C;  3OEE G;  3CX5 F;  4YJ3 A;  5EC2 C;  4K3A A;  4B3M O;  3JD2 A;  1KEC A;  4WCE V;  3C3T A;  1VQ4 V;  4YIP A;  1NH2 B;  3HKD A;  4QJF B;  2V4D A;  1IX9 A;  3UT5 B;  1N4C A;  4JI6 B;  1YDX A;  4B3R B;  5KHH A;  4JI1 O;  5J2U B;  3RVY A;  2QWP B;  4B3S B;  3W7U A;  1EN4 A;  3JD1 A;  4NTY A;  2WAM A;  3ZS8 C;  4PV1 B;  1B04 A;  1XQ8 A;  2V1D A;  2WLJ A;  4DR7 B;  2YI8 A;  2DYR B;  2Q69 A;  5IJ9 A;  2QSA A;  4XBF A;  3AG4 B;  1R3I C;  4BIU A;  1DK1 A;  4IHJ B;  1HR0 B;  3CCV V;  5GTH Z;  1AP5 A;  3RW0 A;  3CRM A;  3G6B A;  4LBE C;  2JVD A;  5A9G A;  4I9Q A;  1W0J G;  4YJ3 B;  5B1A B;  5KX5 A;  1AR1 B;  2C2A A;  2X0L A;  3T4Z A;  3H1L H;  3HKD B;  3B2E E;  1K8A W;  1FJG O;  4JGS A;  5LGT A;  5EZY A;  3E35 A;  1QHT A;  3HKB A;  4R7C A;  4GKJ O;  2RNB A;  3SDL A;  2NNU A;  4CS2 A;  3LNN A;  1IBK O;  4O4L A;  3SYA A;  4DV5 O;  1JJO A;  5DEC A;  2KB1 A;  5IJ9 B;  3ZMU A;  4MW8 A;  4J80 A;  1KYO F;  2GHY A;  5B1B C;  4TUY A;  4N21 A;  4FIP C;  1KQS U;  1DF4 A;  1KU9 A;  1PNK A;  3D36 A;  5LP6 C;  4Z1V A;  3J81 N;  4JI6 O;  4GLX A;  4B3R O;  4DR4 B;  1BGY H;  1SZT A;  5KX5 B;  4UCS A;  4B3S O;  1D5A A;  1K5Q A;  3IC9 A;  1S5J A;  4J11 A;  2YIB A;  2P4V A;  4H0L B;  1YIT V;  5EZY B;  4DR7 O;  5CBG A;  3NR7 A;  3HKB B;  4BR6 A;  4ZIB A;  2EZO A;  2XOK G;  4I50 A;  4FLW A;  5IWA B;  4DR1 B;  1TUB A;  3M99 B;  3LSQ A;  1WAZ A;  3RT3 C;  2HR3 A;  4ABM A;  4AI8 A;  2WPD G;  5B3S C;  5JJJ B;  3IFX A;  4TUY B;  5CA3 A;  1TVK A;  3ZHT A;  3A8T A;  4CS3 A;  1IXM A;  1DTO A;  4X20 B;  4DV0 B;  5DM6 V;  1QLE C;  2K1E A;  4GYC B;  1GKF A;  5HFL A;  3K5L A;  4CS4 A;  3IJ4 A;  4D6T H;  5L3D A;  4Z2W A;  4G27 B;  2E76 B;  2PI5 A;  4DV4 B;  1G8M A;  4I50 B;  3K04 A;  1JMK C;  4MS2 A;  1DF5 A;  1M93 A;  3CPW U;  1TUB B;  2W6J G;  2PF4 E;  3JAR A;  4N23 A;  2EIK C;  1DGS A;  5KUM A;  3QO7 A;  1YHQ V;  3AG2 C;  2CH7 A;  1BSM A;  2RCV A;  4DV1 B;  1TVK B;  3K9S A;  2VWJ A;  1M1K W;  1URF A;  3K06 A;  3UCS C;  1UFI A;  2YSU B;  3FB5 C;  4LF4 B;  3P30 A;  4UCR A;  1R6T A;  1BL8 A;  4DYL A;  2KG7 A;  1I0H A;  2OCC C;  1BQZ A;  2Q5Z A;  2WLI B;  2LQT A;  1BZK A;  2Z0A A;  4I5S A;  4X1Y A;  2ZE8 A;  1VQM V;  5IWA O;  4JI0 B;  4NYK A;  4X89 A;  1HNX B;  3N27 A;  1X4T A;  2FML A;  3DGE A;  2AXT Z;  3GWK C;  4E4E A;  1PL0 A;  2EBO A;  2PGG A;  2LJ2 A;  2AZ0 A;  1YJN V;  4FLU A;  4PA3 A;  1WJZ A;  1Z2G A;  2F66 C;  3JAR B;  1F7Y A;  1A32 A;  1FXH A;  4JI5 B;  4DV0 O;  4W4K A;  2CH7 B;  1QR8 A;  2IU0 A;  3RYH B;  1Q43 A;  1MZF A;  4RO2 A;  1VF6 A;  1RM1 C;  1IXB A;  4PA6 A;  2JEX A;  4L87 A;  3D3Q A;  4X62 B;  5L3E A;  5CB4 A;  4PI0 A;  2UXB B;  1R3K C;  2OWO A;  2Q7H A;  2ZDI C;  4LF6 B;  2EZP A;  4DV4 O;  1AI5 A;  3CB2 A;  4TQD A;  1F4M A;  3CCJ V;  4X1Y B;  5CBH A;  4FM0 A;  4UCT A;  2CUG A;  3OR6 C;  1H2G A;  1WNS A;  5B66 Z;  3TCU A;  2P22 C;  4TV9 A;  3WG7 B;  4Q6G A;  3ASO B;  3KCX A;  5KHI A;  2JS5 A;  1SQG A;  3G4S V;  1NJI W;  2YIB D;  4LF4 O;  2AHY A;  2WLK A;  4OPH A;  2HVJ C;  1SER A;  4CZZ A;  3WB2 A;  4UB6 Z;  3G67 A;  3OGC C;  3ABL B;  4JI0 O;  5CB4 B;  1GTO A;  1HNX O;  4I55 A;  1JJ2 U;  2HKO A;  2ZE5 A;  4DV7 B;  3ZRX A;  2ITD C;  2ZCE A;  5ITZ A;  1US6 A;  1AR5 A;  3FAV A;  2L35 A;  4K0K B;  3H9V A;  2M7W A;  2IW5 A;  2O57 A;  1K5S A;  4O4H A;  2ILM A;  2HJD A;  4JI5 O;  2RN9 A;  4DK1 A;  4HYO A;  2Y4T A;  4TV9 B;  3H1K H;  3GVM A;  2QR4 A;  3P3N A;  2DE0 X;  4RQE A;  3L72 H;  3JAT B;  4LH7 A;  4X62 O;  4DV2 B;  4PDL A;  4LF5 B;  4LF8 B;  2UXB O;  1K97 A;  2XAH A;  2ATK C;  1VQN V;  2LO1 A;  4LF6 O;  4BWA A;  2VRZ A;  2UUA O;  4I9W A;  1HW7 A;  4I55 B;  2BOB C;  2YUA A;  1F51 A;  3ASN B;  3DTU B;  2YS8 A;  3CCU V;  2UU9 B;  3FAV B;  2A9H A;  1OCZ C;  1BCC H;  1XNR B;  1MAB G;  1CXZ B;  4EFB A;  3STZ C;  2ADQ B;  2CK3 G;  1YIJ V;  1YZB A;  1ZTE A;  1NVP D;  4FFB A;  4U7O A;  5IJ0 A;  3RYF A;  2EIJ B;  3ZHU A;  4YY3 B;  3CRC A;  2NN4 A;  1AJQ A;  2Y69 C;  1F4N A;  1JPX A;  4FM2 A;  3RN4 A;  4DV7 O;  5IY5 B;  4MTX A;  2XUM A;  2YXH A;  2UXC B;  3LDD A;  4K0K O;  4JAA A;  1GN3 A;  4KL1 A;  2JGD B;  1NR7 A;  1T5E A;  3SJA C;  1L0L H;  1EBO A;  1PV0 A;  2Z5U A;  1O9G A;  4MVZ A;  5JJN B;  1WPB A;  3CME V;  1GN4 A;  1ENV A;  4ZKI A;  4DR3 B;  1Y6X A;  5BR8 B;  1N8R W;  2R72 A;  4FFB B;  4LF8 O;  5IJ0 B;  3RYF B;  4CH3 A;  1ZWI C;  1V54 B;  4ZOL B;  1NQT A;  3BY6 A;  2HJF C;  1AJN A;  3O65 A;  2JJ1 G;  4AIL C;  1W59 A;  2ZR3 A;  3HB3 B;  5B5E Z;  1I7F A;  4F6E A;  3F7V C;  2XTA A;  1J95 A;  4B3T B;  4FZ0 A;  1R6N A;  2WLN A;  4LFC B;  4ZI7 A;  4H33 A;  1VQ7 V;  3W7X A;  4F6R B;  1BE3 H;  3OMA B;  4O4I A;  3SJB C;  1RSO B;  4B7E A;  1QLN A;  2Z3Y A;  2FTK A;  2X6A A;  4UCV A;  1H2M A;  2Q68 A;  4YY3 O;  4JI8 O;  1KB9 F;  3CP1 A;  1Y67 A;  4P2Z A;  4CC5 A;  3AK1 A;  4X88 A;  3JSN A;  4ASU G;  5H9C A;  2NLJ C;  3CWB H;  1WB8 A;  2UXC O;  3LDC A;  1G4Y B;  5JCO C;  3BEH A;  5IE9 A;  2QM4 A;  3BA9 A;  2XAJ A;  2FKX A;  3ASO C;  1WP8 A;  4DRX A;  4O4J A;  3SJC C;  3CYO A;  3ZN1 A;  3U11 A;  5IYB O;  5E1A C;  3MD0 A;  3DXR A;  4DR3 O;  5BR8 O;  4LCU C;  4QNH B;  4O4I B;  1I08 A;  5GTI Z;  5LBQ A;  3J7A U;  1B6Q A;  3ZX6 A;  2PUS A;  3R66 A;  5FLX N;  3F7Y C;  1O9H A;  3ZHQ A;  5L3G A;  4L8J A;  3ZRW A;  2KKW A;  1G1X B;  3TXQ A;  3B40 A;  1QBZ A;  4B7K A;  1NR1 A;  4B3T O;  3JAL A;  2QKC A;  1WP7 A;  4LFC O;  2F93 B;  3GB7 C;  4MTO A;  2VQE B;  1OZ0 A;  4DRX B;  4O4J B;  5GW7 A;  3G71 V;  3JCZ A;  4LFA B;  5DN6 G;  2H3O A;  1R1B A;  1WA8 A;  3A0B Z;  1XL4 A;  3DXR B;  3T1C A;  3DC5 A;  4TT3 G;  1GRJ A;  4LH6 A;  5JH7 A;  5LL6 Y;  1OCR C;  3ZN0 A;  1NKD A;  4LNU A;  1VQK V;  2WSS G;  4LFB B;  2VWK A;  3H01 A;  4UCO A;  4JTD B;  5KLV H;  5L3C A;  5K1P A;  3IAY A;  1M9N A;  3ZRW B;  1E79 G;  4OGQ B;  1Y4M A;  2E3C A;  2XAQ A;  1YTF B;  1JA8 A;  4NKG B;  1K33 A;  3JAL B;  1YEW A;  4PDR A;  1MZE A;  5FPR A;  2QWN B;  2EIJ C;  1B3Q A;  3M7M X;  4D7S A;  1Q7Y W;  3OW2 U;  4X9Q A;  3RWR D;  4FFK A;  1WA8 B;  3EHB B;  1Q6I A;  2F4V O;  3CCL V;  3K59 A;  3JD3 A;  2JEU A;  4LNU B;  2QWQ B;  3KG2 A;  4FLT A;  1Y66 A;  4I4T A;  2DWD C;  4FM1 A;  3FD9 A;  1ZLZ A;  2DYS C;  1IUR A;  3ABU A;  1NS1 A;  2N04 A;  1U96 A;  2HEP A;  2VQE O;  3CMA V;  1H8H G;  2GTA A;  5JJE B;  3K0D A;  3N2K A;  2Y0I A;  5C93 A;  4LFA O;  2QWO B;  4Z1M G;  5J9P C;  1HNW B;  5GON A;  5IYD O;  4PA7 A;  3WU2 Z;  1WLE A;  1GH6 A;  5LXT A;  3SPI A;  3HKC A;  2ZXW C;  3E83 A;  4JZ2 A;  4UVC A;  2DQ3 A;  1TUE B;  3K58 A;  4KFM A;  4EKW A;  2CTP A;  1GN6 A;  4I4T B;  4YJ2 A;  2GV9 A;  3QO8 A;  4LF7 B;  1FD9 A;  3AG3 B;  4PJ0 Z;  1TA8 A;  2ZM6 B;  2P4K A;  3K0G A;  3RFR A;  5KAI Z;  4P9O A;  4NTX A;  4BW5 A;  1JCH A;  3THO A;  4UB8 Z;  2A7W A;  4R6Z A;  3VQY A;  4C7U A;  4JI2 B;  2DMX A;  4TOI A;  2UXD B;  5GON B;  4TWK A;  3OE7 G;  1JFF A;  1S5H C;  3JAW A;  2Y4U A;  1HR0 O;  5HFM A;  1OV9 A;  5E79 Z;  3PJS K;  1KKD A;  4O4L B;  5LXT B;  3T1Y B;  1NH2 D;  4DV6 B;  1YTF D;  1MG1 A;  2ZIM A;  1UJW B;  1EM1 A;  2KSD A;  1RP3 B;  1SS3 A;  4YJ2 B;  2WLH A;  4IL6 Z;  4DO2 A;  2EIL B;  4FVM A;  2OTJ V;  2ZIO A;  1K34 A;  1K4C C;  2JJ2 G;  1JR9 A;  1XDC A;  1N0J A;  5C8Y A;  1EZV H;  1VQ5 V;  1K92 A;  2FL4 A;  1OCC B;  5BY1 A;  2MK3 A;  3LUT B;  1U97 A;  5LMN B;  4BAY A;  1JFF B;  1I5X A;  3FB7 C;  3JAW B;  3HR0 A;  3CEI A;  3CHX A;  1SA0 A;  1MMM A;  4LF7 O;  4MSW C;  5CBF A;  2BCC H;  4JYY A;  4AQY B;  2ZM6 O;  1N36 B;  4K8X A;  4DR6 B;  4DR4 O;  2NR5 A;  1KD1 W;  4G28 B;  1S77 D;  1D2D A;  4DW0 A;  3ZIA G;  4DUZ B;  1NTK H;  5CA0 A;  4JI2 O;  1H2N A;  2HHH B;  2CE4 A;  3RYC A;  2ZE6 A;  2UXD O;  2E75 B;  3KKY A;  2PTM A;  1P7B A;  1QVG U;  2EIN B;  4CH5 A;  2Q7G A;  5IYZ A;  1D5N A;  4DR1 O;  1QCE A;  4FLV A;  3T1Y O;  4DV6 O;  3E89 A;  2F95 B;  1YJW V;  1R3L C;  1BHA A;  3JD0 A;  2P5O A;  3ABM B;  3OD4 A;  2Q4P A;  4NVP A;  3D3I A;  1R3J C;  4J42 A;  1XUQ A;  1FFX A;  4KHP B;  3JCU Z;  4MW3 A;  3BA8 A;  1SA0 B;  4FZ1 A;  4NXM B;  4CC6 A;  4OPA A;  4WFF A;  1JVM A;  4TSF G;  4XDJ A;  2G38 A;  3AEI A;  4I0X A;  3S3W A;  2DYR C;  3CRQ A;  5EBM C;  2ZKO A;  4H44 B;  5EIB D;  4RUF A;  4NXN B;  2ETN A;  3KCY A;  5EK0 A;  5CA0 B;  2LP7 A;  3AG4 C;  3CRA A;  3RYC B;  2GTS A;  1HWY A;  3SPH A;  5LMN O;  2E5L B;  2A0L A;  1J5E B;  1MSD A;  1W2B U;  2Q0O C;  2KG7 B;  4E2L A;  1JX9 A;  4GUN A;  5IYZ B;  4FMT A;  1GN2 A;  1OCO B;  1YVW A;  1LUW A;  5B1A C;  3CC7 V;  3VQV A;  4IYH A;  4PA4 A;  4AQY O;  1N36 O;  4DR6 O;  3B09 A;  2EIM B;  1DLB A;  2ZQM A;  1ROP A;  3OTF A;  2X6C A;  2RJZ A;  4DV1 O;  1FFX B;  3CS5 A;  3MAQ A;  2Q8V A;  1XBL A;  4UV8 A;  1WN7 A;  4DUZ O;  3SGI A;  3I56 V;  2P06 A;  3CXH F;  3E2E A;  3QVN A;  2HHH O;  3OEH G;  3BFR A;  5KUK A;  1PM9 A;  2LW1 A;  1GM7 A;  4I0X B;  2PY5 A;  2AW9 A;  2BTQ A;  4WFE A;  2WWW A;  2CTR A;  1Z5V A;  3A2F A;  2LGQ A;  4O2A A;  1B06 A;  3JAK A;  1E1R G;  3OFN G;  2VQF B;  5TIS Z;  4JI4 B;  3SYC A;  4KHP O;  2PI4 A;  2JDI G;  2DOS A;  1BT8 A;  1FXV A;  3GWO A;  1XMQ B;  4O2B A;  3U0Z A;  5J2T A;  3CC4 V;  3C3S A;  4NXM O;  1P7G A;  4HNA A;  5BZB A;  3LDE A;  1XHZ A;  1PNM A;  4NXN O;  2HFE C;  2QKS A;  1MNG A;  2LFR A;  4U7N A;  1XRE A;  4LF9 B;  3B8M A;  2E5L O;  1MOF A;  2M6Y A;  1J5E O;  3K79 A;  3RVZ A;  3SJQ C;  4MVM A;  2BTQ B;  1BHB A;  5L3B A;  1QR9 A;  5EBL C;  3FYI B;  4JTA B;  2JS3 A;  3D8C A;  3JSL A;  2P90 A;  4O2A B;  3S3X A;  1GK9 A;  2HG5 C;  3JAK B;  3D36 C;  5ITZ B;  3W7W A;  1KP2 A;  1SET A;  3BAA A;  4JAV A;  4CBC A;  1VF5 B;  3VOU A;  4IGG A;  3QG5 A;  4CH6 A;  2CTW A;  3JD4 A;  4O4H B;  3BPZ A;  4J9Y B;  3IC7 A;  5J2T B;  2YEV A;  3W7T A;  2DN9 A;  5H2F Z;  4HNA B;  3AG1 B;  1EN6 A;  2UUC B;  4PEL A;  1VQL V;  2OCH A;  2QKA A;  4DW1 A;  2ZD9 A;  4IIJ A;  4X64 B;  1QVF U;  5LGN A;  2PYL A;  4WFG A;  1CPY A;  2BOC C;  5LGU A;  1K73 W;  3L74 H;  2VQF O;  3BCC H;  4JI4 O;  2WLM A;  2IH3 C;  4J10 A;  3K57 A;  3CXC U;  5A2Q N;  1XMQ O;  3ICX A;  3OR7 C;  2LW7 A;  2IH1 C;  4LR3 A;  2EX3 A;  2OYQ A;  4OX9 B;  1KC8 W;  1Q82 W;  3TK1 A;  1TGO A;  2YEV B;  2EIN C;  4DV2 O;  2BE3 A;  4LF5 O;  4LF9 O;  1X59 A;  5LP6 A;  2ODM A;  1AVM A;  4I7Z B;  4JPR A;  4KXR A;  1ZAU A;  2WA3 A;  3L71 H;  1NI8 A;  2W0F C;  5H6Q A;  2ZT9 B;  2GUZ A;  2UU9 O;  1LUV A;  5KMG A;  3T2M A;  4X65 B;  2WLL A;  1S3J A;  2Q67 A;  1XNR O;  2ZE7 A;  4MVQ A;  1FFT B;  4MVU A;  2PYJ A;  1R73 A;  2ZNJ A;  1SQQ H;  5LHG A;  1OHH G;  3MDS A;  4K35 A;  1SQV H;  5B1B B;  4X66 B;  4X64 O;  3B77 A;  2HP8 A;  4DK0 A;  1HDJ A;  1OCO C;  4CH4 A;  3SPG A;  2IJJ A;  3ZMZ A;  3EFF K;  1W0K G;  1S72 V;  4P9P A;  4QIW F;  2F1M A;  3SPC A;  3WG7 C;  5H5N A;  2JIZ G;  5BMV A;  3QTC A;  1P49 A;  2GUZ B;  1XIL A;  1H2L A;  1M4U A;  4MT8 A;  5IDJ A;  1PD3 A;  2WLL B;  1AP6 A;  4DR2 B;  1SQF A;  4ZI7 B;  1YJ9 V;  5LYJ A;  3K3W A;  1R6K A;  3FB6 C;  1VF6 C;  3C90 A;  3ABL C;  5KHK A;  1SQX H;  1XMO B;  4ZHQ A;  1P84 F;  5B3S B;  3ABK B;  3CJH A;  3TJT A;  4FLY A;  3CCR V;  3R65 A;  4X65 O;  2Q0A A;  4NR1 A;  1K3E A;  1FXK A;  3JAS A;  1QLE B;  3DSQ A;  5BMV B;  1IVS A;  2H94 A;  4MVS A;  2CGO A;  5K1X A;  4UXN A;  3Q4H A;  2KQX A;  4DV3 B;  3LNM B;  3K5N A;  4X66 O;  5BXZ A;  2QJ1 A;  4RUE A;  1AI7 A;  2EJR A;  3ZMT A;  1ZL8 A;  4ZHQ B;  1JQ0 A;  1BQ0 A;  1RFY A;  3AG2 B;  4QPJ A;  1VQ6 V;  3ASN C;  3SPJ A;  4YHH B;  5H6R A;  2CAZ C;  3CJH B;  4W4L A;  5CMU A;  1RPO A;  1FKA O;  1FYJ A;  1YF2 A;  2QGN A;  3K03 A;  2DWE C;  3HPL C;  2GBO A;  1L1F A;  1I94 B;  5JVD A;  4DR2 O;  2W6I G;  2ZDI A;  1EFR G;  1FXK B;  3RBZ A;  2JRI A;  3AG1 C;  2OCC B;  1RPR A;  2F43 G;  4GZR B;  5LMU B;  2DJV A;  3ZCC A;  4DXW A;  1XMO O;  5JQG A;  3Q4H B;  2D2C B;  4BW9 A;  3K5O A;  5IY5 C;  2EJ7 A;  3CC2 V;  3VQW A;  4QE7 A;  2OIE A;  5JH7 B;  1ZL8 B;  3ETG A;  2N05 A;  4QPK A;  5KHG A;  4AHC A;  1AB3 A;  2ITC C;  3ZHR A;  2YI9 A;  1RM1 B;  2WA4 A;  4OXS A;  2Q9L A;  2E74 B;  1VMG A;  2R9A A;  1Q6U A;  1HNZ B;  1N32 B;  3ZHV A;  4KUM A;  5JVD B;  4DV3 O;  4ZBM A;  2QEX V;  1AJP A;  4MTG A;  2IJH A;  4JF3 A;  1Q5O A;  1VQP V;  1V54 C;  3SYO A;  4X1I A;  3G80 A;  1WB7 A;  1UPG A;  3H1H H;  5JQG B;  4LFB O;  4FLZ A;  3AG7 A;  1IDS A;  4YHH O;  5IT9 N;  3T4D A;  1NTM H;  1Z5W A;  3AK3 A;  4WFH A;  3EVK A;  1E1Q G;  1SC5 B;  3E8H A;  5KHJ A;  1I94 O;  1Q81 W;  5FL7 G;  3VQX A;  5B1O A;  1SF9 A;  3SYP A;  4YXW G;  3WB0 A;  1YI2 V;  1VEW A;  4UCU A;  3ZMS A;  1S5L Z;  1GAX A;  5LMU O;  1SRY A;  3N2K B;  2RDC A;  4PDV A;  4EEQ A;  4X1I B;  4RAI A;  4X20 A;  1Q8I A;  2IU3 A;  2RQ6 A;  2R70 A;  4JYA B;  1ORQ C;  1EZJ A;  1MA1 A;  1H2S B;  4NTW A;  1AI4 A;  1I5Y A;  2XHB A;  3HKC B;  2CGN A;  3JYC A;  1IBL B;  2XAF A;  3FFQ A;  2YIA A;  1ZUQ A;  3W7S A;  3MHH C;  1HNZ O;  1N32 O;  1XNQ B;  1NBM G;  1HNW O;  3CSX A;  3TXS A;  3OGI B;  1ZSP A;  3LSU A;  1XOU A;  1V9P A;  4J7J A;  1Q3E A;  3G6E V;  2MW2 B;  3ABK C;  1VQO V;  4WF9 V;  4J41 A;  1Q6H A;  1V55 B;  1N0N A;  1CP9 A;  1OJH A;  1OCZ B;  4GX0 A;  3CCS V;  1FS0 G;  2HLD G;  4LWS A;  2YXY A;  3P32 A;  5L3F A;  3BVO A;  2B5U A;  2N74 A;  1AR4 A;  2X7R B;  1VQ8 V;  2WLI A;  4DR5 B;  1LR1 A;  1XHX A;  1PKX A;  1YXB A;  4TV8 A;  1G6U A;  1M5I A;  2OIG A;  3F5T A;  2CDY A;  2Y69 B;  1JOY A;  3OAA G;  2IJI A;  2XAS A;  4BIZ A;  2YID A;  3CD6 V;  3PN1 A;  3H1I H;  5C8Y B;  1VF7 A;  4MVO A;  4WFA V;  3CRR A;  4GX5 A;  3CCM V;  2P7T C;  1SQP H;  4JYA O;  3X2Q B;  3RYH A;  3K5M A;  1VQ9 V;  4ICG A;  1EN5 A;  3P3P A;  3ZJZ A;  1IBL O;  2AHZ A;  4GCZ A;  3OUS A;  4UVB A;  5LA6 A;  4LWS B;  4QGP A;  2DW4 A;  3UM7 A;  4MVR A;  1FXK C;  2ADP A;  4RWU A;  4PDM A;  1XNQ O;  3HKE A;  4JYB A;  5LHI A;  4TV8 B;  1S76 D;  4KP4 A;  4FLX A;  5JCO A;  3ZMV A;  2L6L A;  4JYC A;  2UXN A;  2Y48 A;  4D7T A;  4IYI A;  1P4R A;  1NU1 H;  3RYI A;  3UO2 A;  4JI3 B;  1SES A;  4LC1 A;  1GO3 F;  4P30 A;  4EB6 A;  1NVP B;  3SR2 C;  4DR5 O;  2B1I A;  4K8Z A;  3APO A;  2BSK A;  1SQB H;  5LA6 B;  1M56 B;  4QE9 A;  3E8G A;  2QM8 A;  3UQ8 A;  1L8D A;  3CCQ V;  3STL C;  5CA1 A;  1XI1 A;  3HKE B;  1VP7 A;  3QF7 A;  4B08 A;  4GX1 A;  3O9O A;  2UUA B;  1IZ3 A;  1QNM A;  1Y76 A;  5EC1 C;  2GSM B;  2RMK B;  1SKV A;  2YC0 A;  3APQ A;  3DC6 A;  1NT2 B;  1Q86 W;  2Y0P A;  1THZ A;  4MTF A;  1ARO P;  3JAT A;  3QNE A;  3K9A A;  3RYI B;  3AG3 C;  4A5U B;  4XDK A;  3B4S A;  1M57 B;  4BIO A;  4EB6 B;  4UUJ C;  3ETD A;  2R9R B;  3TET A;  1K4D C;  2BSK B;  3OTO B;  4LP8 A;  5CA1 B;  1Q90 D;  2XT9 A;  3B8N A;  2BTO A;  2Q6A A;  5EIB C;  2DQ0 A;  4WBN A;  4WFB V;  1GM8 A;  2V7Q G;  3OUF A;  1Y76 B;  1L0N H;  4PI2 A;  2QDO A;  3E8B A;  5KA6 A;  4JI3 O;  3A0H Z;  1PNL A;  3WB1 A;  5KAF Z;  1IBM B;  3ZHS A;  1COW G;  4JZG A;  2EUL A;  1PL4 A;  1AIL A;  4FPP A;  5D5Q A;  4J9Z B;  4X1K A;  2EIL C;  3E8F A;  4DUY B;  3RGB A;  4G2K A;  3ZED A;  1F23 A;  4JAS A;  1FAF A;  2XAG A;  3N2G A;  2X6B A;  1OCR B;  1YCI A;  4O2B B;  4EFE A;  5FNV A;  2JGD A;  1KKC A;  1OCC C;  2IBZ H;  1V55 C;  5JWP A;  3ETE A;  4WBN B;  3CE2 A;  1H8E G;  3IGA C;  2YDE A;  1KP3 A;  5DED A;  3FYE B;  3UO3 A;  3OMN B;  3J80 N;  3JAM N;  2VS0 A;  2W0X A;  4JAU A;  2R9I A;  4U3J A;  5AG2 A;  4ZOL A;  3L73 H;  3OT7 A;  4JI8 B;  1Y74 A;  2XND G;  3OTO O;  4X1K B;  3MHS C;  2IJK A;  4X8A A;  3E22 A;  4NB5 A;  1HP8 A;  2ZR2 A;  3ZBH A;  3T1H B;  1N33 B;  3N2G B;  2JGU A;  3TGU H;  4R8C A;  5EYP A;  3L9D A;  1WPX A;  5FNV B;  1KBH A;  3X2Q C;  3WFV A;  4GKK B;  4F6R A;  3E86 A;  1VIB A;  1RSO A;  5EBW C;  2DYS B;  2QWR B;  1IBM O;  4U3F H;  2LFS A;  4IIJ B;  3NXS A;  3ABM C;  3FX7 A;  4JV5 B;  1PPJ H;  2B1G A;  2P67 A;  4DUY O;  3KZI Z;  2QA4 V;  2Q7E A;  5IYC O;  4U3J B;  1S0V A;  5D5P A;  1Y74 B;  1QU7 A;  3L75 H;  2IM9 A;  2A3Q A;  4UFZ A;  4H13 B;  2UUC O;  3E22 B;  2ZXW B;  3L70 H;  5LOV A;  3OMI B;  2QE7 G;  3EXA A;  5EYP B;  3I55 V;  4UVA A;  2P6J A;  5LP6 B;  4R50 A;  2LGW A;  1XEQ A; 
#chains in the Genus database with same CATH homology
 2RN9 A;  1U96 A;  1Z2G A;  1HP8 A;  1U97 A;  2LQT A;  2HP8 A;  2RNB A;  2LGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...