1Z2GA

Solution structure of apo, oxidized yeast cox17
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
69
structure length
69
Chain Sequence
MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folding studies of Cox17 reveal an important interplay of cysteine oxidation and copper binding
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords Cytochrome c oxidase copper chaperone
total genus 24
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 1z2gA00
2LQTA 2RNBA 2HP8A 1HP8A 1Z2GA 1U97A 2RN9A 2LGQA 1U96A
chains in the Genus database with same CATH superfamily
5J2UA 1TUEB 1S76D 3ZBHA 4QNHB 1KQSU 4IYHA 4MTOA 5JCOC 5DEDA 4DV3B 2ILMA 3P32A 2UXDB 1YIJV 1WA8B 4IHJB 4LC1A 4IYIA 2NN4A 4JYAB 3HB3B 1K34A 4NXMO 4MT8A 5BXZA 3ZMZA 3JYCA 3TXSA 4JYBA 2PZSA 5LBQA 4X1YB 3G6BA 2F4VO 1PV0A 5KHKA 2ZE8A 3IJ4A 3J7AU 1L1FA 2JGUA 1Z5VA 5A2QN 1FXKA 1OV9A 3AG7A 3E2EA 4R6ZA 4H0LB 3K59A 5IYBO 2DYRC 4PDVA 3K57A 4DV3O 4ICGA 2QDOA 4JGSA 4DR3B 4OPAA 5JH7B 4UCUA 1I7FA 3AG1B 3D3QA 1XI1A 1EFRG 3SJCC 4F4LA 5B3SC 2QWPB 2L6LA 3WG7C 3BFRA 2Q7HA 3OD4A 1M57B 1FYJA 3R65A 3OGCC 4FLXA 4GLXA 4JI4O 1THZA 3X2QB 1TVKA 1F51A 3RGBA 1J5EB 1FXHA 1TA8A 2E5LO 4JI2O 3IFXA 3KCXA 1NQTA 3C3SA 1AI6A 3K03A 4QE7A 2Z3YA 2LQTA 1P84F 2JK5C 3IGAC 3E22A 1XL4A 3SPIA 5KA6A 3ABMB 1R3KC 5EK0A 3CHXA 4JYYA 4K0KB 4WFGA 2AHYA 2PYLA 2OT5A 4FMTA 2QM7A 1CPYA 3I5DA 4DV2B 4G2KA 4GKKO 4YY3B 2UXCO 2MK3A 1HNWO 1IVSA 1URFA 2X6AA 5B1BB 5GONB 4JF3A 5EC1C 3EXAA 1AR1B 1VF6C 5CA0B 3JD0A 3UQ8A 3CRCA 4DR4B 2XAQA 5LMUB 2Y0IA 2A0LA 4FZ0A 1VQ7V 1UPGA 3FAVB 4NYKA 4X1IB 3RYFA 3CWBH 4KHPO 4ASUG 1OCZC 4DUYB 3JD4A 2B1IA 4DV0B 4DV4O 2JRIA 2QWQB 2E75B 4LCUC 3OR7C 3HKCA 4FLYA 4WFEA 3SJBC 1YCIA 5H5NA 2KKWA 4PA7A 1TUBB 3R66A 1G1XB 4JI6O 4J41A 3JD3A 4W4LA 4D7TA 3ETDA 3IAYA 4B3MO 1NKDA 3OUSA 1L8DA 4ZKIA 4RQFA 1MOFA 3CX5F 2OWOA 1HNZO 1PM9A 4FLUA 1MABG 2ZM6B 4TT3G 4FLTA 3T1YB 2EINB 4UUJC 4DYLA 3K5LA 3M8AA 1H8HG 2JS3A 1K7DA 4CH4A 1R6TA 4ZOLA 1GM7A 1BL8A 4YJ2A 3RBZA 4I55A 2XAFA 2ZT9B 1DF5A 3EHBB 4H37A 2ZE5A 4GCZA 1D5NA 3APQA 1EBOA 3E86A 4TUYA 3SPHA 5KAFZ 1YVWA 1OCRC 4DRXA 1NR1A 2R70A 2YIAA 2E5LB 2KG7B 4JI7B 1VQNV 2LW7A 2WLKA 5J2TB 3K0DA 3A0BZ 4AQYB 1RPOA 3CCLV 1Y67A 3L73H 2XTAA 2ODMA 1P4RA 5LP6C 2UU9O 3FB7C 2H3OA 3H1KH 1Q5OA 1ZLZA 2RNBA 1LNQA 1XBLA 3JAWA 2UUCB 4GUNA 3T2MA 2DN9A 5H6RA 1S77D 2ZNIA 3H1HH 4UVBA 1K8AW 2FKXA 4O4LA 1HNXO 1GM8A 2RQ6A 1XNQB 4LF6B 1PL4A 3JSLA 3JSNA 1IBLB 4JI5O 1GTOA 1M5IA 4EFEA 1EZVH 1KP3A 2JVDA 1K4DC 2CUGA 2YIDA 4D7SA 3DXRA 1VQ6V 2HVKC 3T4ZA 5EC2C 4WBNA 1UJWB 5B1AB 5LGUA 3UO3A 2Q0OC 2DWDC 3FYEB 2Y4TA 4X89A 1PPJH 2HKOA 3D36C 3AEIA 1IBLO 2P06A 4LBEC 1IZ3A 2ZINA 2ZR3A 3H1JH 2F66C 5EZYA 4CS2A 3OM3B 4DV6O 1WLEA 4G28B 4A5UB 1S5JA 4WF9V 3CMEV 2ZDIA 3DTUB 5J2UB 4LF8B 4DXWA 1XL6A 2P4KA 3TXQA 4YY3O 2A06H 1SKVA 2EJ7A 2GSMB 2Q7GA 3N2GA 5FNVA 4LFCB 1JR9A 4WFAV 4PDRA 1KB9F 1V9PA 4QJFB 4O2AA 2ZXWB 1XOUA 3W7XA 4B3RO 4I4TB 4GX5A 1R3JC 1SC5B 1IDSA 4DV1B 2AW9A 4CH3A 3CCJV 4GZRB 3ASNB 4O4JB 3JCUZ 3ZMUA 3T1YO 1XNRB 1IXBA 2UUAO 4LNUA 4LFBO 3CXHF 1W59A 3CE2A 4LFAO 3DC5A 4MVSA 1NT2B 2YIBA 1E1RG 2H8PC 1B6QA 3AG2B 2IJKA 4DR5O 3BABA 1H2GA 1XHXA 4FK5C 1XILA 3G67A 1SQXH 3ZRWA 4KP4A 3QVNA 4DV1O 4JAVA 3QNEA 3CRAA 4DV7O 3CYOA 1JFFA 2ZIOA 1IBKO 2DW4A 5IJ0B 4KXRA 2CTQA 3E83A 4PA6A 4KFMA 4LF4B 1JOYA 2XAGA 1KBHA 1YZBA 4FLWA 3FB6C 4P9PA 1WNSA 2DQ3A 4NTXA 4LR3A 1EN4A 3T1CA 2Z0AA 4ZI7A 3VQWA 4KL1A 3CRQA 2BTOA 1F7YA 2PI5A 2Y69B 3J80N 5B1NA 3CCSV 5EYPA 4HBNA 1M9NA 1D2DA 5L3EA 4LF9B 4UV9A 3AK2A 1R73A 1QU7A 1F23A 1OCOC 3A0HZ 3L72H 2OYQA 1N36O 3M7MX 4UVAA 2QTOA 4IHJA 4GYCB 3GVMA 2W0FC 1HWYA 1VF6A 4JV5O 1DGSA 4GKKB 1JFFB 1I5XA 3FB5C 4CH6A 1NVPD 5B1OA 5CB4B 1ZL8B 1ZUQA 5LYJA 4UXNA 3VQXA 4WFHA 5CA0A 2CH7A 1ROPA 5ITZB 4I55B 4PDLA 3ZS8C 3CC2V 3LSQA 2OTJV 3HKCB 1FXKB 5A9GA 1U96A 2WLLB 2VQEB 5LP6B 2KG7A 2AHZA 3ABMC 3B4SA 2JEUA 3DSQA 4B3SO 1GK9A 5BZBA 4DV6B 2PUSA 4MVRA 2QWOB 1H2LA 1OCRB 2QSAA 4FM0A 3BCCH 5JVDA 3Q4HA 2QEXV 3E89A 2DOSA 4U3FH 3A0RA 2VQEO 4XDLA 5CBFA 2EILC 2UXBO 4BAYA 3FKSG 3IC9A 4IL6Z 2EIKB 1JJ2U 1G8MA 4PA3A 4B3SB 5LA6A 1AJPA 5IE9A 1FFXB 2CAZC 4LFAB 3ABTA 2HFEC 2FL4A 2DQ0A 3L70H 5KUKA 1P7GA 3SJAC 4CC6A 4XDKA 2BOBC 2K9PA 4JI8B 4PHZA 4MW8A 1AI5A 2LFRA 3K58A 2UXBB 3FX7A 2DYRB 3SYAA 4EB6A 2RMKB 4LP8A 2UXXA 2X0LA 1V54B 2VQFB 1R6NA 2LJ2A 2UUBB 1Q6IA 5BY1A 3H01A 3K0GA 4JI0B 4DR3O 4JI1O 3JASB 2CK3G 1YJ9V 2WA4A 3FAVA 4FM2A 5LGTA 2JEXA 5KX5B 1JX9A 3APOA 4BR6A 5D5QA 4K35A 2F1MA 2PF4E 2Q6AA 1US6A 1PL0A 3OEEG 4TUYB 1J5EO 3CD6V 1YTFD 4MTFA 5IJ9A 4I50B 3FFQA 3B2EE 1K92A 1AI4A 3CB2A 1LUVA 1ZX3A 3SYCA 1IURA 1SQBH 3E8BA 1RFYA 2EIMC 3U0ZA 1FKAO 4GX2A 2WLIA 3OEHG 1JQ0A 3BRCA 1GKFA 1BSMA 2DMXA 2HJDA 1NTKH 2FYUH 3T4DA 2IH1C 3ZHQA 1I94O 3T1HB 2YEVB 3CJHA 3CCMV 1V55C 1Y4MA 1J95A 1VQKV 1M93A 4JAUA 3UKMA 5H9CA 4BWAA 2QKSA 3WU2Z 1OJHA 3HKDB 2YDEA 1QLEC 4X9QA 1A32A 4DR7B 2Y48A 5KAIZ 4J42A 5CA1B 2P6JA 3ZCCA 2YXHA 2FB5A 2WLHA 2Y4UA 2ZQMA 1G6UA 5LA6B 3CXCU 2XOKG 5D5PA 3E22B 4H33A 2XNDG 2CTWA 1W2BU 3ZMSA 1FFXA 1N0NA 3ICXA 4DR7O 3RVZA 3JALB 4P30A 1QLNA 2HHHO 2Q9LA 1K73W 5LHHA 3LDDA 4MSWC 4JTCB 5EBLC 4QPJA 4UVCA 5IWAB 3DC6A 4YHHB 3GWKC 4DO2A 3EFFK 3CP1A 1QR9A 1UFIA 1AR5A 5IJ0A 1SA0B 1HR0B 4N23A 4Z1MG 4O4LB 5ITZA 2HG5C 3EVKA 3QO7A 4O4IB 3P3PA 2FMLA 3W7WA 1XMOO 1JPXA 1MZEA 4PI2A 3GWOA 2KQXA 3IC7A 2F93B 4K8ZA 1BZKA 3KZIZ 4FFBA 1IBKB 4X20B 4B08A 2ARHA 4JI3O 4I9QA 2A7WA 2YIBD 1Q6HA 3HKBB 1W0KG 1YEWA 2GBOA 1SRYA 5JJNB 5IY5B 1YSCA 2WLIB 3L71H 4JI6B 2YI9A 1VMGA 1Y76B 3B77A 2Q0AA 2PYJA 3D8CA 1DK1A 3MHSC 2Y0PA 2UUAB 2B1GA 5L3DA 2QWRB 2RJZA 2M6YA 3ZX6A 2EZPA 2UXCB 1Y6XA 2N04A 2CDYA 3JAKA 5FPRA 1S3JA 5LOVA 1EN6A 3ZMVA 1F4MA 1NI8A 4O2AB 3ETEA 4QE9A 2LGQA 3GB7C 5LYJB 3B8MA 2LP7A 4CS4A 4I5SA 2ITDC 1SQGA 4YJ3B 4X62O 4X8AA 1OCZB 4PJ0Z 3BY6A 3J81N 4U7OA 2ZE6A 1TVKB 4H44B 2E74B 4TQDA 3K5MA 5HFLA 4DUZB 4NB5A 3A2FA 1MMMA 4HYOA 4EKWA 1H38A 1YDXA 1L0NH 3ZHRA 4X1YA 2LGWA 3HR0A 5EIBC 3CSXA 4HNAB 4EEQA 1RP3B 4UCVA 4HAMA 1YJNV 4DR4O 2EZOA 5IDJA 1AB3A 4JZ2A 3C3TA 5EZYB 3AG4B 4ZI7B 4Q6GA 1PP9H 2YC0A 1M56B 4YIPA 1TGOA 3JD1A 4HNAA 1OZ0A 4W4KA 5LXTA 1M1KW 1KUQA 5JWPA 4TV8A 1YHQV 2N05A 1JA8A 4N21A 4X66O 1BS3A 4WFBV 4X20A 2XT9A 1E1QG 2HR3A 2QM8A 5KMGB 4DV5O 2RN9A 4B3TB 4DV2O 1YTFB 3OR6C 4X1KA 3G4SV 1BQ0A 3LSSA 2BTQB 1NTMH 2X6CA 1S5LZ 4LNUB 3ASOC 1S72V 2N74A 3RVYA 2BE3A 4CC5A 2XUMA 4DR2O 1HR0O 4DR6B 5FNVB 5LMUO 1OCCC 2QM4A 1RM1B 2AZ2A 2DYSB 2ZDIC 5GW7A 1X4TA 4J80A 3G80A 3MD0A 4TV8B 2GUZA 2CGOA 3BEHA 2W6IG 2XHBA 2V4DA 1I0HA 1Y74A 1GN2A 4JI8O 3UM7A 4LFCO 5E1AC 5FL7G 1K5QA 1K97A 1COWG 3TK1A 3CCQV 5L3BA 2QWNB 1MA1A 3BVOA 3W7UA 2B5UA 4I0XA 5CA1A 3E35A 2UUBO 3ZN1A 4DRXB 1ORQC 2GV9A 2P4VA 1YJWV 3MDSA 3K79A 2GTAA 2WPDG 2ZR2A 3UT5A 3ML0A 2PTMA 1XEQA 1M90W 4NR1A 3UCSC 4DV7B 5EBMC 4NTYA 4NXMB 3QO5A 4JPRA 4G27B 5EYPB 3SYQA 5JJEB 5KHIA 1AI7A 2IJJA 3AG3C 4WCEV 4B7KA 4J7JA 1N34B 2DYSC 4O2BA 1RM1C 2PI4A 1OCCB 1MSWD 5IYZA 3DXRB 4OPHA 5GONA 1TUBA 1AILA 4TWKA 4AHCA 3G6EV 1SQQH 4GKJO 3ZRVA 1NS1A 1SF9A 3K08A 5H6QA 5LXTB 5FPOA 1BHAA 3VBBA 1NZ6A 3N27A 4X66B 2FTKA 1Q82W 1S0VA 2IW5A 4PA9A 3SPJA 3LNNA 4UCSA 4MTGA 1KYOF 4Q20A 1XHZA 1BCCH 2QKAA 3RYCA 2R9AA 4X65O 4DW1A 3JCZA 3RWRD 4LF5B 3ABKB 2HEPA 3S3XA 3JATA 3DGEA 3JARA 4J9YB 3F5TA 1PD3A 1FXKC 3VQVA 1ZL8A 1N33B 1VQ5V 4JI5B 4YIOA 2PY5A 3KG2A 4K8XA 4C7UA 2YUAA 3QG5A 3CC7V 4QPKA 3RYHB 1R6KA 5BMVA 2JIZG 3CRRA 5IYCO 5KUMA 2E3CA 5CBGA 4MVQA 3WFVA 3STZC 4NXNO 2AGAA 3HPLC 2A9HA 4U3JA 1JVMA 1VQLV 2P22C 5JCOA 4DV5B 1RSOA 4OGQB 4DV4B 3JD2A 4AILC 2ZD9A 4X64O 5KHGA 3FYIB 3STLC 2QGNA 4GT1A 1IX9A 2Q4PA 5BR8B 2LFSA 2WAMA 5JH7A 1MG1A 5JJJB 4DV0O 5LP6A 1CEZA 4J11A 3RFRA 4P2ZA 1RSOB 2P90A 1QLEB 2VWKA 1AJNA 1YF2A 3FD9A 4RWUA 1D5AA 4DR5B 3F5WC 3ZHVA 2BCCH 5B5EZ 4LF7B 2XAJA 1OHHG 1V55B 1T5EA 5L3GA 2UUCO 4UCTA 2RCVA 2K1EA 2IH3C 1HNZB 5IYZB 4LWSB 2F23A 1CP9A 2ZKOA 4X88A 2F43G 2EIKC 2ZIMA 5KHJA 4GKJB 1JJOA 2HP8A 4PA4A 4IGGA 3JARB 4FLZA 2KSDA 4AI8A 2VWJA 5JQGA 3THOA 1GH6A 1GN4A 4ZHQB 2WA3A 3P3NA 5LMNO 2UXNA 4O4HA 3VQYA 2EIJB 2OCCC 1EZJA 4BW5A 4X65B 1QVGU 1FJGB 1N4CA 4R7CA 4NKGB 3ZN0A 5JVDB 2BOCC 3TGUH 5K1PA 3CCVV 5BMVB 1SZXA 4UCRA 2A79B 2VQFO 3OFNG 3K5OA 2OIEA 1LR1A 2CE4A 2Q5ZA 1N34O 3KKYA 4L87A 1V54C 1QQCA 4J9ZB 3QO8A 3K5NA 3H1IH 1PNMA 2EBOA 1OCOB 2O57A 2X7RB 3OAAG 1W0JG 2L35A 3OMNB 3ABLC 4CBCA 4CS3A 1VARA 1CXZB 2W0XA 2EILB 2ZM6O 2UU9B 2AZ0A 2DWEC 4X1KB 4TSFG 3WB2A 1FAFA 2BTQA 3RYCB 3PN1A 4JYCA 2OIGA 3JAMN 2ZCEA 2LO1A 1VP7A 3U10A 5KHHA 3L75H 4GX0A 4FM1A 1DTOA 2EIJC 2OCCB 3BA8A 4R8CA 4KHPB 2QE7G 1H2SB 1NBMG 4EFBA 3AG2C 2RDCA 3O9OA 1WPXA 1X59A 3L74H 1N8RW 3ZHSA 2JGDA 4O4HB 4NXNB 1GRJA 3ASNC 1RPRA 2Z5UA 1BT8A 3CCRV 4X62B 1AVMA 2ZXWC 1NU1H 3WB1A 3E8HA 4DK1A 3MAQA 4JI0O 1R3IC 4EB6B 3JAWB 1AP5A 4I0XB 5BR8O 5F2VO 1F4NA 4FFBB 3K3WA 3OMAB 3D36A 5DECA 1SETA 5IWAO 1Q3EA 1NVPB 2F4VB 2AXTZ 1HW7A 2Y69C 2P5OA 4KUMA 4K3AA 4FIPC 3O65A 4UB6Z 4JTDB 4CH5A 4MVUA 4Z1VA 5C8YB 1Q81W 1VQPV 5CA3A 1SERA 3K9SA 1KKCA 4O4JA 1O9HA 4RUFA 1H2MA 1PKXA 4MW3A 3G71V 2D2CB 3OUFA 3LNMB 3Q4HB 1VQ4V 2LW1A 1Q86W 5CMUA 1M4UA 3ETGA 4H13B 3JAKB 1EM1A 1QCEA 2DJVA 4XDJA 1ZSPA 5IJ9B 1Q8IA 1FD9A 5IYDO 4JI2B 3UT5B 2YSUB 1YI2V 2YXLA 3LDCA 4DUYO 4JYAO 1AP6A 4PI0A 4LF8O 3K04A 2PGGA 4BW9A 4F6RB 4J10A 2ETNA 4JTAB 4J7KA 4OX9O 2CTRA 2VRZA 1L0LH 1SA0A 4DR2B 5LMNB 4ZBMA 2GHYA 4E2LA 1BGYH 2Q73A 3CJHB 5C8YA 5K1XA 4O2BB 1Q7YW 4FVMA 1EN5A 4ABMA 3WB0A 1KMIZ 1Y66A 2Q68A 3BA9A 4NVPA 1H2KA 2JJ2G 1R1BA 5AG2A 3ZRXA 3U11A 1HNWB 1GN3A 4R50A 1VIBA 1MSDA 4AQYO 3JATB 2WLNA 1ZTEA 1HP8A 4O4IA 1IBMO 2E76B 2WWWA 1I08A 1WP7A 2IM9A 4I4TA 2ATKC 4PELA 2NNUA 1O9GA 3QF7A 2Q7EA 1I5YA 2NR5A 4F6EA 3K9AA 1MZFA 5B1AC 1AROP 2GTSA 4F6RA 2YXYA 1MNGA 3ZRSA 2CGNA 4RQEA 5H2FZ 2OCHA 1DF4A 3WG7B 4LF6O 1Y76A 2HJFC 3K06A 1IBMB 5JQGB 3E8GA 1VQ9V 3JALA 4B3RB 3L9DA 4MTXA 4IT5A 2GUZB 1PNKA 4RO2A 1XMQB 3D3IA 1ENVA 3RYIB 5J9PC 2QTSA 4K0KO 5KX5A 2JDIG 2YEVA 2UXDO 4B3MB 1FXVA 2W6JG 3N2GB 4XBFA 2YI8A 2Q67A 4RAIA 1XREA 1FJGO 2WLJA 3LDEA 4JI1B 2V7QG 4CZZA 2P67A 1AJQA 2ADPA 1K33A 1Q90D 3NR7A 5CB4A 3HKEB 3KCYA 2H94A 4LH7A 3W7SA 1GM9A 2OTLV 1KP2A 4B3TO 4HZ3A 2VS0A 4IIJB 2XAHA 1LUWA 3N2KA 3BAAA 1I94B 1QVFU 4LWSA 4LF9O 1SQFA 4LF5O 1S5HC 4JI7O 5EIBD 5HFMA 2EX3A 4TV9A 2M7WA 3B09A 4MVOA 2IJHA 4DW0A 5B66Z 3ZHUA 4FJCC 4P9OA 1NTZH 3ZIAG 3T1HO 1BMFG 4B7EA 5IT9N 2IJIA 4LFBB 2IU3A 3LSUA 4NTWA 4JV5B 1NH2D 1XUQA 1P49A 4I9WA 3SDLA 4MVZA 4BIZA 4DR1B 4FPPA 3I56V 1WN7A 3CCEV 1NR7A 4YXWG 5L3CA 1G4YB 1XMOB 2ITCC 4YJ3A 1JCHA 4GX1A 2Q69A 3X2QC 1WA8A 4D6TH 1Q6UA 5LHGA 3ABLB 3H1LH 3N2KB 1B04A 3HKBA 4U3JB 1QBZA 4PV1B 3OW2U 3SGIA 3ZJZA 4UCOA 2CTPA 1BE3H 5KA5A 5J2TA 2HHHB 3AG3B 3AG4C 4JI4B 4YHHO 3B8NA 1ZAUA 3RYHA 3MHHC 4BIOA 4PDMA 3BHPA 3ZMTA 4WBNB 2JGDB 2HVJC 1XMQO 3RYIA 5LHIA 3B40A 3OT7A 1K4CC 3SPGA 1XQ8A 1GO3F 2B9ZA 2YICA 2ADQB 1Z2GA 4UB8Z 2Q8VA 2JS5A 2IBZH 1GMGA 1PNLA 4JZGA 3ABKC 3ZHTA 5EBWC 2HLDG 3P30A 1FFTB 2QA4V 3RW0A 2X6BA 3CEIA 4X64B 1SQPH 4ZOLB 1FPOA 1N36B 4JI3B 2WSSG 4IIJA 1WAZA 3LUTB 4FFKA 5TISZ 4UV8A 1VEWA 5KLVH 1WB8A 1NH2B 2QR4A 3PJSK 1YXBA 4J7ZA 1M57C 1KKDA 2EINC 2QJ1A 5KMGA 1VQMV 3F7VC 4TQFA 1N0JA 4MS2A 4U7NA 1XDCA 1WPBA 3AG1C 4Z2WA 4ZIBA 3TJTA 1H8EG 1KD1W 5L3FA 2MW2B 4I7ZB 4LF4O 3SYPA 5IY5C 1N32O 3ASOB 1BQZA 3M99B 3SPCA 2V1DA 2JJ1G 3OGIB 3AK3A 3CRMA 1R3LC 2R72A 1VF7A 3CC4V 3FB8C 2XASA 3ABUA 1VQ8V 3CCUV 1QNMA 3S3WA 5DM6V 1KU9A 1AR4A 1GN6A 1SQVH 3RN4A 1NJIW 3JASA 4WFFA 2BSKB 2CH7B 3CPWU 3ZRWB 2QKCA 2EULA 1DLBA 1K5SA 3HKEA 4TV9B 3F7YC 2P7TC 2DE0X 4I50A 3TETA 3OTOB 1KECA 1U97A 3A8TA 4PD4F 3TCUA 1FS0G 4UFZA 1KC8W 5GTHZ 4DUZO 3SYOA 3OTFA 1K9MW 3VOUA 3QTCA 3BPZA 5B1BC 1SESA 2ZE7A 3UO2A 3SR2C 5C93A 3I55V 3NXSA 2YS8A 4QGPA 2IU0A 1ZWIC 1SZTA 4LF7O 5LOVB 1YITV 1VF5B 5E79Z 3W7TA 2ZNJA 5GTIZ 4OX9B 4TOIA 4DK0A 1QR8A 3CS5A 3OTOO 5CN0A 4DR1O 3HKDA 2D3OW 1WP8A 4YJ2B 5FLXN 4L8JA 4QIWF 3OE7G 4BIUA 1SS3A 1K3EA 1N33O 2BSKA 4JAAA 1BHBA 2R9RB 3C90A 4X1IA 3RYFB 5CBHA 1VQOV 5LL6Y 1Z5WA 1XNQO 2NLJC 2A3QA 3SJQC 1HNXB 1QHTA 2WLMA 1B3QA 2C2AA 2EJRA 1IXMA 2R9IA 4E4EA 2G38A 2F95B 1WB7A 1Y74B 2WLLA 2GDSA 2KB1A 5B3SB 4RUEA 3AK1A 3ZEDA 1M56C 3H9VA 1WJZA 3RT3C 5LGNA 1XNRO 1E79G 5DN6G 3E8FA 4MVMA 4DR6O 1N32B 1B06A 4LH6A 1GAXA 3OMIB 1Q43A 1H2NA 1P7BA 4JASA 1HDJA 3ETQA 3CMAV 4ZHQA 2EIMB 4FLVA 4FZ1A 1TAEA 1JMKC 4OXSA
chains in the Genus database with same CATH topology
2LQTA 2RNBA 2HP8A 1HP8A 1Z2GA 1U97A 2RN9A 2LGQA 1U96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQT A;  2RNB A;  2HP8 A;  1HP8 A;  1Z2G A;  1U97 A;  2RN9 A;  2LGQ A;  1U96 A; 
#chains in the Genus database with same CATH topology
 5J2U A;  1TUE B;  1S76 D;  3ZBH A;  4QNH B;  1KQS U;  4IYH A;  4MTO A;  5JCO C;  5DED A;  4DV3 B;  2ILM A;  3P32 A;  2UXD B;  1YIJ V;  1WA8 B;  4IHJ B;  4LC1 A;  4IYI A;  2NN4 A;  4JYA B;  3HB3 B;  1K34 A;  4NXM O;  4MT8 A;  5BXZ A;  3ZMZ A;  3JYC A;  3TXS A;  4JYB A;  2PZS A;  5LBQ A;  4X1Y B;  3G6B A;  2F4V O;  1PV0 A;  5KHK A;  2ZE8 A;  3IJ4 A;  3J7A U;  1L1F A;  2JGU A;  1Z5V A;  5A2Q N;  1FXK A;  1OV9 A;  3AG7 A;  3E2E A;  4R6Z A;  4H0L B;  3K59 A;  5IYB O;  2DYR C;  4PDV A;  3K57 A;  4DV3 O;  4ICG A;  2QDO A;  4JGS A;  4DR3 B;  4OPA A;  5JH7 B;  4UCU A;  1I7F A;  3AG1 B;  3D3Q A;  1XI1 A;  1EFR G;  3SJC C;  4F4L A;  5B3S C;  2QWP B;  2L6L A;  3WG7 C;  3BFR A;  2Q7H A;  3OD4 A;  1M57 B;  1FYJ A;  3R65 A;  3OGC C;  4FLX A;  4GLX A;  4JI4 O;  1THZ A;  3X2Q B;  1TVK A;  1F51 A;  3RGB A;  1J5E B;  1FXH A;  1TA8 A;  2E5L O;  4JI2 O;  3IFX A;  3KCX A;  1NQT A;  3C3S A;  1AI6 A;  3K03 A;  4QE7 A;  2Z3Y A;  2LQT A;  1P84 F;  2JK5 C;  3IGA C;  3E22 A;  1XL4 A;  3SPI A;  5KA6 A;  3ABM B;  1R3K C;  5EK0 A;  3CHX A;  4JYY A;  4K0K B;  4WFG A;  2AHY A;  2PYL A;  2OT5 A;  4FMT A;  2QM7 A;  1CPY A;  3I5D A;  4DV2 B;  4G2K A;  4GKK O;  4YY3 B;  2UXC O;  2MK3 A;  1HNW O;  1IVS A;  1URF A;  2X6A A;  5B1B B;  5GON B;  4JF3 A;  5EC1 C;  3EXA A;  1AR1 B;  1VF6 C;  5CA0 B;  3JD0 A;  3UQ8 A;  3CRC A;  4DR4 B;  2XAQ A;  5LMU B;  2Y0I A;  2A0L A;  4FZ0 A;  1VQ7 V;  1UPG A;  3FAV B;  4NYK A;  4X1I B;  3RYF A;  3CWB H;  4KHP O;  4ASU G;  1OCZ C;  4DUY B;  3JD4 A;  2B1I A;  4DV0 B;  4DV4 O;  2JRI A;  2QWQ B;  2E75 B;  4LCU C;  3OR7 C;  3HKC A;  4FLY A;  4WFE A;  3SJB C;  1YCI A;  5H5N A;  2KKW A;  4PA7 A;  1TUB B;  3R66 A;  1G1X B;  4JI6 O;  4J41 A;  3JD3 A;  4W4L A;  4D7T A;  3ETD A;  3IAY A;  4B3M O;  1NKD A;  3OUS A;  1L8D A;  4ZKI A;  4RQF A;  1MOF A;  3CX5 F;  2OWO A;  1HNZ O;  1PM9 A;  4FLU A;  1MAB G;  2ZM6 B;  4TT3 G;  4FLT A;  3T1Y B;  2EIN B;  4UUJ C;  4DYL A;  3K5L A;  3M8A A;  1H8H G;  2JS3 A;  1K7D A;  4CH4 A;  1R6T A;  4ZOL A;  1GM7 A;  1BL8 A;  4YJ2 A;  3RBZ A;  4I55 A;  2XAF A;  2ZT9 B;  1DF5 A;  3EHB B;  4H37 A;  2ZE5 A;  4GCZ A;  1D5N A;  3APQ A;  1EBO A;  3E86 A;  4TUY A;  3SPH A;  5KAF Z;  1YVW A;  1OCR C;  4DRX A;  1NR1 A;  2R70 A;  2YIA A;  2E5L B;  2KG7 B;  4JI7 B;  1VQN V;  2LW7 A;  2WLK A;  5J2T B;  3K0D A;  3A0B Z;  4AQY B;  1RPO A;  3CCL V;  1Y67 A;  3L73 H;  2XTA A;  2ODM A;  1P4R A;  5LP6 C;  2UU9 O;  3FB7 C;  2H3O A;  3H1K H;  1Q5O A;  1ZLZ A;  2RNB A;  1LNQ A;  1XBL A;  3JAW A;  2UUC B;  4GUN A;  3T2M A;  2DN9 A;  5H6R A;  1S77 D;  2ZNI A;  3H1H H;  4UVB A;  1K8A W;  2FKX A;  4O4L A;  1HNX O;  1GM8 A;  2RQ6 A;  1XNQ B;  4LF6 B;  1PL4 A;  3JSL A;  3JSN A;  1IBL B;  4JI5 O;  1GTO A;  1M5I A;  4EFE A;  1EZV H;  1KP3 A;  2JVD A;  1K4D C;  2CUG A;  2YID A;  4D7S A;  3DXR A;  1VQ6 V;  2HVK C;  3T4Z A;  5EC2 C;  4WBN A;  1UJW B;  5B1A B;  5LGU A;  3UO3 A;  2Q0O C;  2DWD C;  3FYE B;  2Y4T A;  4X89 A;  1PPJ H;  2HKO A;  3D36 C;  3AEI A;  1IBL O;  2P06 A;  4LBE C;  1IZ3 A;  2ZIN A;  2ZR3 A;  3H1J H;  2F66 C;  5EZY A;  4CS2 A;  3OM3 B;  4DV6 O;  1WLE A;  4G28 B;  4A5U B;  1S5J A;  4WF9 V;  3CME V;  2ZDI A;  3DTU B;  5J2U B;  4LF8 B;  4DXW A;  1XL6 A;  2P4K A;  3TXQ A;  4YY3 O;  2A06 H;  1SKV A;  2EJ7 A;  2GSM B;  2Q7G A;  3N2G A;  5FNV A;  4LFC B;  1JR9 A;  4WFA V;  4PDR A;  1KB9 F;  1V9P A;  4QJF B;  4O2A A;  2ZXW B;  1XOU A;  3W7X A;  4B3R O;  4I4T B;  4GX5 A;  1R3J C;  1SC5 B;  1IDS A;  4DV1 B;  2AW9 A;  4CH3 A;  3CCJ V;  4GZR B;  3ASN B;  4O4J B;  3JCU Z;  3ZMU A;  3T1Y O;  1XNR B;  1IXB A;  2UUA O;  4LNU A;  4LFB O;  3CXH F;  1W59 A;  3CE2 A;  4LFA O;  3DC5 A;  4MVS A;  1NT2 B;  2YIB A;  1E1R G;  2H8P C;  1B6Q A;  3AG2 B;  2IJK A;  4DR5 O;  3BAB A;  1H2G A;  1XHX A;  4FK5 C;  1XIL A;  3G67 A;  1SQX H;  3ZRW A;  4KP4 A;  3QVN A;  4DV1 O;  4JAV A;  3QNE A;  3CRA A;  4DV7 O;  3CYO A;  1JFF A;  2ZIO A;  1IBK O;  2DW4 A;  5IJ0 B;  4KXR A;  2CTQ A;  3E83 A;  4PA6 A;  4KFM A;  4LF4 B;  1JOY A;  2XAG A;  1KBH A;  1YZB A;  4FLW A;  3FB6 C;  4P9P A;  1WNS A;  2DQ3 A;  4NTX A;  4LR3 A;  1EN4 A;  3T1C A;  2Z0A A;  4ZI7 A;  3VQW A;  4KL1 A;  3CRQ A;  2BTO A;  1F7Y A;  2PI5 A;  2Y69 B;  3J80 N;  5B1N A;  3CCS V;  5EYP A;  4HBN A;  1M9N A;  1D2D A;  5L3E A;  4LF9 B;  4UV9 A;  3AK2 A;  1R73 A;  1QU7 A;  1F23 A;  1OCO C;  3A0H Z;  3L72 H;  2OYQ A;  1N36 O;  3M7M X;  4UVA A;  2QTO A;  4IHJ A;  4GYC B;  3GVM A;  2W0F C;  1HWY A;  1VF6 A;  4JV5 O;  1DGS A;  4GKK B;  1JFF B;  1I5X A;  3FB5 C;  4CH6 A;  1NVP D;  5B1O A;  5CB4 B;  1ZL8 B;  1ZUQ A;  5LYJ A;  4UXN A;  3VQX A;  4WFH A;  5CA0 A;  2CH7 A;  1ROP A;  5ITZ B;  4I55 B;  4PDL A;  3ZS8 C;  3CC2 V;  3LSQ A;  2OTJ V;  3HKC B;  1FXK B;  5A9G A;  1U96 A;  2WLL B;  2VQE B;  5LP6 B;  2KG7 A;  2AHZ A;  3ABM C;  3B4S A;  2JEU A;  3DSQ A;  4B3S O;  1GK9 A;  5BZB A;  4DV6 B;  2PUS A;  4MVR A;  2QWO B;  1H2L A;  1OCR B;  2QSA A;  4FM0 A;  3BCC H;  5JVD A;  3Q4H A;  2QEX V;  3E89 A;  2DOS A;  4U3F H;  3A0R A;  2VQE O;  4XDL A;  5CBF A;  2EIL C;  2UXB O;  4BAY A;  3FKS G;  3IC9 A;  4IL6 Z;  2EIK B;  1JJ2 U;  1G8M A;  4PA3 A;  4B3S B;  5LA6 A;  1AJP A;  5IE9 A;  1FFX B;  2CAZ C;  4LFA B;  3ABT A;  2HFE C;  2FL4 A;  2DQ0 A;  3L70 H;  5KUK A;  1P7G A;  3SJA C;  4CC6 A;  4XDK A;  2BOB C;  2K9P A;  4JI8 B;  4PHZ A;  4MW8 A;  1AI5 A;  2LFR A;  3K58 A;  2UXB B;  3FX7 A;  2DYR B;  3SYA A;  4EB6 A;  2RMK B;  4LP8 A;  2UXX A;  2X0L A;  1V54 B;  2VQF B;  1R6N A;  2LJ2 A;  2UUB B;  1Q6I A;  5BY1 A;  3H01 A;  3K0G A;  4JI0 B;  4DR3 O;  4JI1 O;  3JAS B;  2CK3 G;  1YJ9 V;  2WA4 A;  3FAV A;  4FM2 A;  5LGT A;  2JEX A;  5KX5 B;  1JX9 A;  3APO A;  4BR6 A;  5D5Q A;  4K35 A;  2F1M A;  2PF4 E;  2Q6A A;  1US6 A;  1PL0 A;  3OEE G;  4TUY B;  1J5E O;  3CD6 V;  1YTF D;  4MTF A;  5IJ9 A;  4I50 B;  3FFQ A;  3B2E E;  1K92 A;  1AI4 A;  3CB2 A;  1LUV A;  1ZX3 A;  3SYC A;  1IUR A;  1SQB H;  3E8B A;  1RFY A;  2EIM C;  3U0Z A;  1FKA O;  4GX2 A;  2WLI A;  3OEH G;  1JQ0 A;  3BRC A;  1GKF A;  1BSM A;  2DMX A;  2HJD A;  1NTK H;  2FYU H;  3T4D A;  2IH1 C;  3ZHQ A;  1I94 O;  3T1H B;  2YEV B;  3CJH A;  3CCM V;  1V55 C;  1Y4M A;  1J95 A;  1VQK V;  1M93 A;  4JAU A;  3UKM A;  5H9C A;  4BWA A;  2QKS A;  3WU2 Z;  1OJH A;  3HKD B;  2YDE A;  1QLE C;  4X9Q A;  1A32 A;  4DR7 B;  2Y48 A;  5KAI Z;  4J42 A;  5CA1 B;  2P6J A;  3ZCC A;  2YXH A;  2FB5 A;  2WLH A;  2Y4U A;  2ZQM A;  1G6U A;  5LA6 B;  3CXC U;  2XOK G;  5D5P A;  3E22 B;  4H33 A;  2XND G;  2CTW A;  1W2B U;  3ZMS A;  1FFX A;  1N0N A;  3ICX A;  4DR7 O;  3RVZ A;  3JAL B;  4P30 A;  1QLN A;  2HHH O;  2Q9L A;  1K73 W;  5LHH A;  3LDD A;  4MSW C;  4JTC B;  5EBL C;  4QPJ A;  4UVC A;  5IWA B;  3DC6 A;  4YHH B;  3GWK C;  4DO2 A;  3EFF K;  3CP1 A;  1QR9 A;  1UFI A;  1AR5 A;  5IJ0 A;  1SA0 B;  1HR0 B;  4N23 A;  4Z1M G;  4O4L B;  5ITZ A;  2HG5 C;  3EVK A;  3QO7 A;  4O4I B;  3P3P A;  2FML A;  3W7W A;  1XMO O;  1JPX A;  1MZE A;  4PI2 A;  3GWO A;  2KQX A;  3IC7 A;  2F93 B;  4K8Z A;  1BZK A;  3KZI Z;  4FFB A;  1IBK B;  4X20 B;  4B08 A;  2ARH A;  4JI3 O;  4I9Q A;  2A7W A;  2YIB D;  1Q6H A;  3HKB B;  1W0K G;  1YEW A;  2GBO A;  1SRY A;  5JJN B;  5IY5 B;  1YSC A;  2WLI B;  3L71 H;  4JI6 B;  2YI9 A;  1VMG A;  1Y76 B;  3B77 A;  2Q0A A;  2PYJ A;  3D8C A;  1DK1 A;  3MHS C;  2Y0P A;  2UUA B;  2B1G A;  5L3D A;  2QWR B;  2RJZ A;  2M6Y A;  3ZX6 A;  2EZP A;  2UXC B;  1Y6X A;  2N04 A;  2CDY A;  3JAK A;  5FPR A;  1S3J A;  5LOV A;  1EN6 A;  3ZMV A;  1F4M A;  1NI8 A;  4O2A B;  3ETE A;  4QE9 A;  2LGQ A;  3GB7 C;  5LYJ B;  3B8M A;  2LP7 A;  4CS4 A;  4I5S A;  2ITD C;  1SQG A;  4YJ3 B;  4X62 O;  4X8A A;  1OCZ B;  4PJ0 Z;  3BY6 A;  3J81 N;  4U7O A;  2ZE6 A;  1TVK B;  4H44 B;  2E74 B;  4TQD A;  3K5M A;  5HFL A;  4DUZ B;  4NB5 A;  3A2F A;  1MMM A;  4HYO A;  4EKW A;  1H38 A;  1YDX A;  1L0N H;  3ZHR A;  4X1Y A;  2LGW A;  3HR0 A;  5EIB C;  3CSX A;  4HNA B;  4EEQ A;  1RP3 B;  4UCV A;  4HAM A;  1YJN V;  4DR4 O;  2EZO A;  5IDJ A;  1AB3 A;  4JZ2 A;  3C3T A;  5EZY B;  3AG4 B;  4ZI7 B;  4Q6G A;  1PP9 H;  2YC0 A;  1M56 B;  4YIP A;  1TGO A;  3JD1 A;  4HNA A;  1OZ0 A;  4W4K A;  5LXT A;  1M1K W;  1KUQ A;  5JWP A;  4TV8 A;  1YHQ V;  2N05 A;  1JA8 A;  4N21 A;  4X66 O;  1BS3 A;  4WFB V;  4X20 A;  2XT9 A;  1E1Q G;  2HR3 A;  2QM8 A;  5KMG B;  4DV5 O;  2RN9 A;  4B3T B;  4DV2 O;  1YTF B;  3OR6 C;  4X1K A;  3G4S V;  1BQ0 A;  3LSS A;  2BTQ B;  1NTM H;  2X6C A;  1S5L Z;  4LNU B;  3ASO C;  1S72 V;  2N74 A;  3RVY A;  2BE3 A;  4CC5 A;  2XUM A;  4DR2 O;  1HR0 O;  4DR6 B;  5FNV B;  5LMU O;  1OCC C;  2QM4 A;  1RM1 B;  2AZ2 A;  2DYS B;  2ZDI C;  5GW7 A;  1X4T A;  4J80 A;  3G80 A;  3MD0 A;  4TV8 B;  2GUZ A;  2CGO A;  3BEH A;  2W6I G;  2XHB A;  2V4D A;  1I0H A;  1Y74 A;  1GN2 A;  4JI8 O;  3UM7 A;  4LFC O;  5E1A C;  5FL7 G;  1K5Q A;  1K97 A;  1COW G;  3TK1 A;  3CCQ V;  5L3B A;  2QWN B;  1MA1 A;  3BVO A;  3W7U A;  2B5U A;  4I0X A;  5CA1 A;  3E35 A;  2UUB O;  3ZN1 A;  4DRX B;  1ORQ C;  2GV9 A;  2P4V A;  1YJW V;  3MDS A;  3K79 A;  2GTA A;  2WPD G;  2ZR2 A;  3UT5 A;  3ML0 A;  2PTM A;  1XEQ A;  1M90 W;  4NR1 A;  3UCS C;  4DV7 B;  5EBM C;  4NTY A;  4NXM B;  3QO5 A;  4JPR A;  4G27 B;  5EYP B;  3SYQ A;  5JJE B;  5KHI A;  1AI7 A;  2IJJ A;  3AG3 C;  4WCE V;  4B7K A;  4J7J A;  1N34 B;  2DYS C;  4O2B A;  1RM1 C;  2PI4 A;  1OCC B;  1MSW D;  5IYZ A;  3DXR B;  4OPH A;  5GON A;  1TUB A;  1AIL A;  4TWK A;  4AHC A;  3G6E V;  1SQQ H;  4GKJ O;  3ZRV A;  1NS1 A;  1SF9 A;  3K08 A;  5H6Q A;  5LXT B;  5FPO A;  1BHA A;  3VBB A;  1NZ6 A;  3N27 A;  4X66 B;  2FTK A;  1Q82 W;  1S0V A;  2IW5 A;  4PA9 A;  3SPJ A;  3LNN A;  4UCS A;  4MTG A;  1KYO F;  4Q20 A;  1XHZ A;  1BCC H;  2QKA A;  3RYC A;  2R9A A;  4X65 O;  4DW1 A;  3JCZ A;  3RWR D;  4LF5 B;  3ABK B;  2HEP A;  3S3X A;  3JAT A;  3DGE A;  3JAR A;  4J9Y B;  3F5T A;  1PD3 A;  1FXK C;  3VQV A;  1ZL8 A;  1N33 B;  1VQ5 V;  4JI5 B;  4YIO A;  2PY5 A;  3KG2 A;  4K8X A;  4C7U A;  2YUA A;  3QG5 A;  3CC7 V;  4QPK A;  3RYH B;  1R6K A;  5BMV A;  2JIZ G;  3CRR A;  5IYC O;  5KUM A;  2E3C A;  5CBG A;  4MVQ A;  3WFV A;  3STZ C;  4NXN O;  2AGA A;  3HPL C;  2A9H A;  4U3J A;  1JVM A;  1VQL V;  2P22 C;  5JCO A;  4DV5 B;  1RSO A;  4OGQ B;  4DV4 B;  3JD2 A;  4AIL C;  2ZD9 A;  4X64 O;  5KHG A;  3FYI B;  3STL C;  2QGN A;  4GT1 A;  1IX9 A;  2Q4P A;  5BR8 B;  2LFS A;  2WAM A;  5JH7 A;  1MG1 A;  5JJJ B;  4DV0 O;  5LP6 A;  1CEZ A;  4J11 A;  3RFR A;  4P2Z A;  1RSO B;  2P90 A;  1QLE B;  2VWK A;  1AJN A;  1YF2 A;  3FD9 A;  4RWU A;  1D5A A;  4DR5 B;  3F5W C;  3ZHV A;  2BCC H;  5B5E Z;  4LF7 B;  2XAJ A;  1OHH G;  1V55 B;  1T5E A;  5L3G A;  2UUC O;  4UCT A;  2RCV A;  2K1E A;  2IH3 C;  1HNZ B;  5IYZ B;  4LWS B;  2F23 A;  1CP9 A;  2ZKO A;  4X88 A;  2F43 G;  2EIK C;  2ZIM A;  5KHJ A;  4GKJ B;  1JJO A;  2HP8 A;  4PA4 A;  4IGG A;  3JAR B;  4FLZ A;  2KSD A;  4AI8 A;  2VWJ A;  5JQG A;  3THO A;  1GH6 A;  1GN4 A;  4ZHQ B;  2WA3 A;  3P3N A;  5LMN O;  2UXN A;  4O4H A;  3VQY A;  2EIJ B;  2OCC C;  1EZJ A;  4BW5 A;  4X65 B;  1QVG U;  1FJG B;  1N4C A;  4R7C A;  4NKG B;  3ZN0 A;  5JVD B;  2BOC C;  3TGU H;  5K1P A;  3CCV V;  5BMV B;  1SZX A;  4UCR A;  2A79 B;  2VQF O;  3OFN G;  3K5O A;  2OIE A;  1LR1 A;  2CE4 A;  2Q5Z A;  1N34 O;  3KKY A;  4L87 A;  1V54 C;  1QQC A;  4J9Z B;  3QO8 A;  3K5N A;  3H1I H;  1PNM A;  2EBO A;  1OCO B;  2O57 A;  2X7R B;  3OAA G;  1W0J G;  2L35 A;  3OMN B;  3ABL C;  4CBC A;  4CS3 A;  1VAR A;  1CXZ B;  2W0X A;  2EIL B;  2ZM6 O;  2UU9 B;  2AZ0 A;  2DWE C;  4X1K B;  4TSF G;  3WB2 A;  1FAF A;  2BTQ A;  3RYC B;  3PN1 A;  4JYC A;  2OIG A;  3JAM N;  2ZCE A;  2LO1 A;  1VP7 A;  3U10 A;  5KHH A;  3L75 H;  4GX0 A;  4FM1 A;  1DTO A;  2EIJ C;  2OCC B;  3BA8 A;  4R8C A;  4KHP B;  2QE7 G;  1H2S B;  1NBM G;  4EFB A;  3AG2 C;  2RDC A;  3O9O A;  1WPX A;  1X59 A;  3L74 H;  1N8R W;  3ZHS A;  2JGD A;  4O4H B;  4NXN B;  1GRJ A;  3ASN C;  1RPR A;  2Z5U A;  1BT8 A;  3CCR V;  4X62 B;  1AVM A;  2ZXW C;  1NU1 H;  3WB1 A;  3E8H A;  4DK1 A;  3MAQ A;  4JI0 O;  1R3I C;  4EB6 B;  3JAW B;  1AP5 A;  4I0X B;  5BR8 O;  5F2V O;  1F4N A;  4FFB B;  3K3W A;  3OMA B;  3D36 A;  5DEC A;  1SET A;  5IWA O;  1Q3E A;  1NVP B;  2F4V B;  2AXT Z;  1HW7 A;  2Y69 C;  2P5O A;  4KUM A;  4K3A A;  4FIP C;  3O65 A;  4UB6 Z;  4JTD B;  4CH5 A;  4MVU A;  4Z1V A;  5C8Y B;  1Q81 W;  1VQP V;  5CA3 A;  1SER A;  3K9S A;  1KKC A;  4O4J A;  1O9H A;  4RUF A;  1H2M A;  1PKX A;  4MW3 A;  3G71 V;  2D2C B;  3OUF A;  3LNM B;  3Q4H B;  1VQ4 V;  2LW1 A;  1Q86 W;  5CMU A;  1M4U A;  3ETG A;  4H13 B;  3JAK B;  1EM1 A;  1QCE A;  2DJV A;  4XDJ A;  1ZSP A;  5IJ9 B;  1Q8I A;  1FD9 A;  5IYD O;  4JI2 B;  3UT5 B;  2YSU B;  1YI2 V;  2YXL A;  3LDC A;  4DUY O;  4JYA O;  1AP6 A;  4PI0 A;  4LF8 O;  3K04 A;  2PGG A;  4BW9 A;  4F6R B;  4J10 A;  2ETN A;  4JTA B;  4J7K A;  4OX9 O;  2CTR A;  2VRZ A;  1L0L H;  1SA0 A;  4DR2 B;  5LMN B;  4ZBM A;  2GHY A;  4E2L A;  1BGY H;  2Q73 A;  3CJH B;  5C8Y A;  5K1X A;  4O2B B;  1Q7Y W;  4FVM A;  1EN5 A;  4ABM A;  3WB0 A;  1KMI Z;  1Y66 A;  2Q68 A;  3BA9 A;  4NVP A;  1H2K A;  2JJ2 G;  1R1B A;  5AG2 A;  3ZRX A;  3U11 A;  1HNW B;  1GN3 A;  4R50 A;  1VIB A;  1MSD A;  4AQY O;  3JAT B;  2WLN A;  1ZTE A;  1HP8 A;  4O4I A;  1IBM O;  2E76 B;  2WWW A;  1I08 A;  1WP7 A;  2IM9 A;  4I4T A;  2ATK C;  4PEL A;  2NNU A;  1O9G A;  3QF7 A;  2Q7E A;  1I5Y A;  2NR5 A;  4F6E A;  3K9A A;  1MZF A;  5B1A C;  1ARO P;  2GTS A;  4F6R A;  2YXY A;  1MNG A;  3ZRS A;  2CGN A;  4RQE A;  5H2F Z;  2OCH A;  1DF4 A;  3WG7 B;  4LF6 O;  1Y76 A;  2HJF C;  3K06 A;  1IBM B;  5JQG B;  3E8G A;  1VQ9 V;  3JAL A;  4B3R B;  3L9D A;  4MTX A;  4IT5 A;  2GUZ B;  1PNK A;  4RO2 A;  1XMQ B;  3D3I A;  1ENV A;  3RYI B;  5J9P C;  2QTS A;  4K0K O;  5KX5 A;  2JDI G;  2YEV A;  2UXD O;  4B3M B;  1FXV A;  2W6J G;  3N2G B;  4XBF A;  2YI8 A;  2Q67 A;  4RAI A;  1XRE A;  1FJG O;  2WLJ A;  3LDE A;  4JI1 B;  2V7Q G;  4CZZ A;  2P67 A;  1AJQ A;  2ADP A;  1K33 A;  1Q90 D;  3NR7 A;  5CB4 A;  3HKE B;  3KCY A;  2H94 A;  4LH7 A;  3W7S A;  1GM9 A;  2OTL V;  1KP2 A;  4B3T O;  4HZ3 A;  2VS0 A;  4IIJ B;  2XAH A;  1LUW A;  3N2K A;  3BAA A;  1I94 B;  1QVF U;  4LWS A;  4LF9 O;  1SQF A;  4LF5 O;  1S5H C;  4JI7 O;  5EIB D;  5HFM A;  2EX3 A;  4TV9 A;  2M7W A;  3B09 A;  4MVO A;  2IJH A;  4DW0 A;  5B66 Z;  3ZHU A;  4FJC C;  4P9O A;  1NTZ H;  3ZIA G;  3T1H O;  1BMF G;  4B7E A;  5IT9 N;  2IJI A;  4LFB B;  2IU3 A;  3LSU A;  4NTW A;  4JV5 B;  1NH2 D;  1XUQ A;  1P49 A;  4I9W A;  3SDL A;  4MVZ A;  4BIZ A;  4DR1 B;  4FPP A;  3I56 V;  1WN7 A;  3CCE V;  1NR7 A;  4YXW G;  5L3C A;  1G4Y B;  1XMO B;  2ITC C;  4YJ3 A;  1JCH A;  4GX1 A;  2Q69 A;  3X2Q C;  1WA8 A;  4D6T H;  1Q6U A;  5LHG A;  3ABL B;  3H1L H;  3N2K B;  1B04 A;  3HKB A;  4U3J B;  1QBZ A;  4PV1 B;  3OW2 U;  3SGI A;  3ZJZ A;  4UCO A;  2CTP A;  1BE3 H;  5KA5 A;  5J2T A;  2HHH B;  3AG3 B;  3AG4 C;  4JI4 B;  4YHH O;  3B8N A;  1ZAU A;  3RYH A;  3MHH C;  4BIO A;  4PDM A;  3BHP A;  3ZMT A;  4WBN B;  2JGD B;  2HVJ C;  1XMQ O;  3RYI A;  5LHI A;  3B40 A;  3OT7 A;  1K4C C;  3SPG A;  1XQ8 A;  1GO3 F;  2B9Z A;  2YIC A;  2ADQ B;  1Z2G A;  4UB8 Z;  2Q8V A;  2JS5 A;  2IBZ H;  1GMG A;  1PNL A;  4JZG A;  3ABK C;  3ZHT A;  5EBW C;  2HLD G;  3P30 A;  1FFT B;  2QA4 V;  3RW0 A;  2X6B A;  3CEI A;  4X64 B;  1SQP H;  4ZOL B;  1FPO A;  1N36 B;  4JI3 B;  2WSS G;  4IIJ A;  1WAZ A;  3LUT B;  4FFK A;  5TIS Z;  4UV8 A;  1VEW A;  5KLV H;  1WB8 A;  1NH2 B;  2QR4 A;  3PJS K;  1YXB A;  4J7Z A;  1M57 C;  1KKD A;  2EIN C;  2QJ1 A;  5KMG A;  1VQM V;  3F7V C;  4TQF A;  1N0J A;  4MS2 A;  4U7N A;  1XDC A;  1WPB A;  3AG1 C;  4Z2W A;  4ZIB A;  3TJT A;  1H8E G;  1KD1 W;  5L3F A;  2MW2 B;  4I7Z B;  4LF4 O;  3SYP A;  5IY5 C;  1N32 O;  3ASO B;  1BQZ A;  3M99 B;  3SPC A;  2V1D A;  2JJ1 G;  3OGI B;  3AK3 A;  3CRM A;  1R3L C;  2R72 A;  1VF7 A;  3CC4 V;  3FB8 C;  2XAS A;  3ABU A;  1VQ8 V;  3CCU V;  1QNM A;  3S3W A;  5DM6 V;  1KU9 A;  1AR4 A;  1GN6 A;  1SQV H;  3RN4 A;  1NJI W;  3JAS A;  4WFF A;  2BSK B;  2CH7 B;  3CPW U;  3ZRW B;  2QKC A;  2EUL A;  1DLB A;  1K5S A;  3HKE A;  4TV9 B;  3F7Y C;  2P7T C;  2DE0 X;  4I50 A;  3TET A;  3OTO B;  1KEC A;  1U97 A;  3A8T A;  4PD4 F;  3TCU A;  1FS0 G;  4UFZ A;  1KC8 W;  5GTH Z;  4DUZ O;  3SYO A;  3OTF A;  1K9M W;  3VOU A;  3QTC A;  3BPZ A;  5B1B C;  1SES A;  2ZE7 A;  3UO2 A;  3SR2 C;  5C93 A;  3I55 V;  3NXS A;  2YS8 A;  4QGP A;  2IU0 A;  1ZWI C;  1SZT A;  4LF7 O;  5LOV B;  1YIT V;  1VF5 B;  5E79 Z;  3W7T A;  2ZNJ A;  5GTI Z;  4OX9 B;  4TOI A;  4DK0 A;  1QR8 A;  3CS5 A;  3OTO O;  5CN0 A;  4DR1 O;  3HKD A;  2D3O W;  1WP8 A;  4YJ2 B;  5FLX N;  4L8J A;  4QIW F;  3OE7 G;  4BIU A;  1SS3 A;  1K3E A;  1N33 O;  2BSK A;  4JAA A;  1BHB A;  2R9R B;  3C90 A;  4X1I A;  3RYF B;  5CBH A;  1VQO V;  5LL6 Y;  1Z5W A;  1XNQ O;  2NLJ C;  2A3Q A;  3SJQ C;  1HNX B;  1QHT A;  2WLM A;  1B3Q A;  2C2A A;  2EJR A;  1IXM A;  2R9I A;  4E4E A;  2G38 A;  2F95 B;  1WB7 A;  1Y74 B;  2WLL A;  2GDS A;  2KB1 A;  5B3S B;  4RUE A;  3AK1 A;  3ZED A;  1M56 C;  3H9V A;  1WJZ A;  3RT3 C;  5LGN A;  1XNR O;  1E79 G;  5DN6 G;  3E8F A;  4MVM A;  4DR6 O;  1N32 B;  1B06 A;  4LH6 A;  1GAX A;  3OMI B;  1Q43 A;  1H2N A;  1P7B A;  4JAS A;  1HDJ A;  3ETQ A;  3CMA V;  4ZHQ A;  2EIM B;  4FLV A;  4FZ1 A;  1TAE A;  1JMK C;  4OXS A; 
#chains in the Genus database with same CATH homology
 2LQT A;  2RNB A;  2HP8 A;  1HP8 A;  1Z2G A;  1U97 A;  2RN9 A;  2LGQ A;  1U96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...