3ZS8C

S. cerevisiae get3 complexed with a cytosolic get1 fragment
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
67
structure length
67
Chain Sequence
NELSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHLHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPASE GET3
publication title The Mechanism of Membrane-Associated Steps in Tail-Anchored Protein Insertion.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 29
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3zs8C00
3THOA 3ICXA 3ZS8C 3QF7A 3SJCC 1NT2B 3CSXA 3SJBC 2P22C 3SJAC 1SKVA 1X4TA 2JS5A 2CAZC 3QG5A 3B2EE 2F66C
chains in the Genus database with same CATH superfamily
2UUCB 2CUGA 1KP2A 5IWAO 5CB4A 2QTOA 1NVPB 3A0BZ 2N74A 2AGAA 3ZMZA 1GN2A 4LH7A 1TUBB 3DXRB 3J7AU 4LFCO 1RSOA 3THOA 4RO2A 3E8BA 3O9OA 3GVMA 4NR1A 1DTOA 5GW7A 3L73H 3AG7A 3FB5C 3ICXA 1OCZC 1M57C 2RQ6A 3ZHUA 4JZ2A 1A32A 1V55B 2PTMA 4PA3A 5CMUA 1SQFA 1FFXA 1H2GA 4XBFA 4DV2B 1UJWB 3A8TA 4WFBV 1M56B 2CH7B 4F6RA 3KCXA 4JI5B 2IU3A 1RPRA 4JI8B 4O4JA 3E35A 4FMTA 1SZXA 3WB1A 3CCJV 4LFAO 3W7TA 1VARA 1NR7A 2WA3A 1YVWA 1JA8A 4BW5A 4UVBA 1KB9F 4LF5B 3UQ8A 5JQGB 3L71H 3SJCC 2DWEC 4P9PA 4NYKA 5IY5B 1Q81W 3ASNB 5KUKA 2UUBB 3SPHA 4DR4O 1KUQA 1Q43A 3CCLV 4UCUA 2Z3YA 5JJJB 1G8MA 1WN7A 2HEPA 2L6LA 2WA4A 4UVCA 4K3AA 1JJOA 4I7ZB 4RQEA 5LHGA 2Q73A 4A5UB 1K73W 1K92A 1ZAUA 5CA0B 5L3CA 1YDXA 2PF4E 3L70H 5CBHA 3L9DA 3IGAC 3SJAC 4GUNA 2ZXWB 1ZL8B 1Y74B 1N8RW 1VQ8V 3AG2B 1OCOC 3S3WA 5IJ9B 4WFHA 4KL1A 2PI4A 5B1BB 4HNAA 4WFAV 4YY3B 2VWJA 4D7SA 3JARB 4DR2B 1TVKA 4PA4A 5EZYB 1AB3A 4BAYA 2EILB 4AHCA 4KUMA 1JX9A 3DGEA 3RYHB 3N2GA 5KAIZ 2Y4TA 4YJ2A 1D5AA 4HBNA 2EIKC 1IBMO 1Z5WA 3TK1A 3IJ4A 3B4SA 3AG3B 3RYIA 4L87A 4K0KO 4UUJC 1QHTA 2Q5ZA 3I55V 4O4IB 1R6TA 1K33A 3SPCA 5KHKA 1BMFG 2KQXA 4LR3A 4OX9O 4LWSA 3RFRA 4FLUA 2JDIG 4DV2O 3CCEV 1HDJA 2JRIA 4DXWA 3AK3A 4YIPA 5IDJA 2JEUA 4J41A 4I0XA 1IBKO 2EBOA 4QJFB 4LF4O 4FFKA 4Q20A 4X20B 3T4DA 4DW0A 1KKDA 1DGSA 1KMIZ 1JQ0A 2EIJC 5FLXN 5BMVB 4DV3O 4QE7A 4WFEA 2HKOA 3CC2V 4LC1A 2UUBO 1Q6UA 4DR5O 1R3KC 4PDMA 2F1MA 4I55B 5H6RA 4ZOLB 2YXYA 4ZBMA 5JVDA 2C2AA 5GTIZ 2ITCC 1VQLV 1GM9A 2CTWA 1I7FA 1NTMH 4J9ZB 2BTQA 2P7TC 3F7YC 1N36B 4DR7O 4FLTA 3K5MA 2GTSA 2ZIOA 4JI6O 3A2FA 1YTFD 2V1DA 2EZPA 1OCZB 3ZMSA 1ZLZA 4X65B 1HNZB 1AJQA 2ZT9B 2VQEO 1W2BU 5LXTA 2ZE8A 2JGUA 3JALB 4DR2O 4PA7A 3FKSG 3CC7V 3KCYA 5CB4B 1WP8A 5LP6A 1Q8IA 4DV0B 2OCCB 1AR1B 3MDSA 2OWOA 3T1CA 3AK1A 4PA6A 2CTPA 4XDLA 1N32O 1XHXA 1X59A 2R9IA 3OTFA 2Q69A 2F43G 4MTXA 1Q82W 3CRQA 4PI0A 3MHSC 4YJ3A 1M1KW 4GKKB 1DF4A 3CMAV 1NH2D 4LF6O 1VEWA 2XUMA 2RMKB 1WP7A 4JASA 1RFYA 1L8DA 4JI2B 3EVKA 3OUFA 4JV5B 1JPXA 3B09A 2Y0IA 4CH6A 1EN5A 3SYCA 1GRJA 1EM1A 2O57A 3RYFB 1FFXB 1XDCA 5H2FZ 3LNMB 1MNGA 4MVQA 4F6RB 1Y4MA 2QR4A 1H8EG 4O4JB 4P9OA 3H1KH 3K04A 4O4HA 1SERA 4U3JA 4JAVA 2AHYA 3SYAA 3JD0A 2EZOA 1QVGU 2P06A 5FL7G 5J9PC 3RVZA 2EJRA 1MMMA 2VWKA 3ZRSA 2W0XA 3WG7C 2PZSA 1JMKC 3IFXA 4U3FH 3JAWA 3WU2Z 3JSNA 1SF9A 4U7OA 2ZINA 1ZUQA 4JTAB 2WWWA 5LMNO 1BQ0A 5LGTA 4ZHQA 3SJQC 1OCRC 1US6A 3CRMA 1VQPV 2IJJA 4WF9V 4N23A 3FB7C 2FB5A 2XOKG 3K9SA 3TCUA 3CD6V 4YIOA 1R3IC 4KXRA 4EEQA 2ATKC 4HNAB 1VQNV 3RT3C 5JQGA 5B1AC 4GX2A 1XL6A 1TVKB 4I5SA 1B6QA 1IBLB 5KHIA 4J10A 1J95A 1MZFA 1SQBH 1Y67A 2EIJB 3TXQA 3G71V 4I50A 4FLWA 2Q6AA 5IYCO 3UO2A 3EFFK 4FZ0A 2A06H 4R7CA 3RYIB 5IYDO 4GKKO 3GB7C 2UXCO 3JD2A 2JS3A 4UCVA 4B3SB 5E1AC 2CGNA 2XT9A 1QU7A 1BS3A 3OM3B 4B3TB 1XILA 3JD3A 5CA0A 4DYLA 4JV5O 4X66B 1IZ3A 4LWSB 2F4VO 2DWDC 1O9GA 1ZL8A 3H1JH 1Y74A 3JATA 3SJBC 4N21A 3CRAA 1BGYH 3ZRVA 4FM1A 1V54C 4W4LA 2YI8A 1VIBA 1R1BA 2WLLA 2QA4V 1IXBA 3JARA 1PNKA 3CHXA 4JI7B 3M8AA 5LA6A 4DR6O 3CCVV 2LP7A 5KUMA 5IWAB 2X6CA 1JOYA 1E79G 1NBMG 3K08A 4B3MB 2H8PC 3T1YO 1H8HG 1AROP 3Q4HB 3EHBB 5EK0A 4LFCB 1AR5A 5JVDB 4AI8A 3P3NA 5AG2A 2EX3A 3OGCC 4J9YB 1AP5A 3WB0A 1DLBA 3HB3B 1VF6A 3ZHRA 1GM7A 3OD4A 2BTQB 3D36C 1GAXA 1L0NH 3W7UA 3IC7A 3E8HA 4PDLA 1T5EA 3PN1A 4LF7O 2DYSC 1XNQO 2EJ7A 1NQTA 1AJNA 1B04A 5LXTB 2UU9O 1EBOA 4OPHA 4LF9O 1GMGA 4RAIA 3K5OA 4X20A 4X88A 1QNMA 3UCSC 4PJ0Z 1K7DA 3ZEDA 1P7BA 3K3WA 5CBFA 4LFAB 4MS2A 4EKWA 1HR0O 5LP6B 2KSDA 2GV9A 2PYJA 2XNDG 4I55A 4DV5O 1R3JC 3OW2U 5EBMC 2RDCA 1SQVH 4BW9A 1YCIA 4H37A 2OTLV 1BHAA 1H2LA 1UFIA 4CC5A 3ETDA 4NTWA 4B3TO 5FPOA 1FKAO 1NR1A 3WFVA 1OCCB 1IXMA 3LDEA 3SYPA 5B3SB 5JJEB 4DUZO 2XAFA 2M7WA 4K35A 1B06A 2UUAO 1NH2B 3SYQA 4CH3A 1W59A 2NNUA 3CC4V 2OTJV 1Y6XA 4KHPO 1PL0A 3U10A 4DR1O 2UXBO 1PNMA 2JK5C 1L0LH 1AILA 1FFTB 1HP8A 1QLEC 1FXHA 2IJKA 2DYRC 4O4HB 1GN4A 4U3JB 4B3MO 5GONA 1K34A 2EINB 2BOCC 1IVSA 5LHHA 5HFLA 3CYOA 4JI3O 1GN3A 4WFFA 5JJNB 2F95B 4OXSA 1N34O 4IL6Z 3IC9A 3OGIB 3HKCB 4CS3A 1I94O 1IBMB 2QDOA 3CCUV 5F2VO 4X9QA 3OR6C 4K0KB 1WB8A 1H2MA 3CE2A 1U96A 3BVOA 1UPGA 3JAWB 1CXZB 1Y76A 2E3CA 3TJTA 4FM0A 1VF7A 1RM1C 3E8GA 1HW7A 4OX9B 5CA1A 1QCEA 4ZHQB 1VQOV 3RYFA 2K1EA 2KB1A 3OEHG 1NI8A 5IYZB 4GYCB 1ENVA 3BCCH 3CP1A 1XEQA 2LQTA 1U97A 4EFBA 2ODMA 1IBKB 3CCMV 4LF4B 2GTAA 2ADQB 2Q7HA 3RVYA 4RUFA 3JAKA 2Q8VA 1FJGB 2JGDB 2Q0OC 4DV3B 1WLEA 3RGBA 5KHGA 5BXZA 4I50B 2MW2B 4DR5B 4GZRB 2V4DA 1DF5A 5FPRA 4WFGA 5L3GA 2BCCH 2ARHA 2R9RB 5JH7B 3FAVB 3ABMB 3BA9A 2E74B 5LOVA 1FXKC 2WSSG 4DV7O 4DR7B 1D5NA 2QM7A 1XMQB 4JI6B 5KMGB 3JATB 1TA8A 2VQEB 4DV4B 4P2ZA 1NS1A 3ASOC 4O2BB 4U7NA 5B66Z 3K5LA 2Z0AA 3ABKB 2WLLB 5DN6G 1AP6A 5A9GA 4TSFG 3ZS8C 5LA6B 3L75H 1Z2GA 3ABTA 3FYIB 2M6YA 1AVMA 5DM6V 1YJ9V 1PP9H 1DK1A 4FIPC 3T2MA 2CK3G 1KP3A 4I9QA 1N32B 4MTOA 3ETGA 3CRCA 3UM7A 3CCSV 2LW7A 4ZIBA 3LDCA 3ML0A 4G28B 4ZKIA 4AQYO 4MVUA 3ZHVA 2YXLA 3VQXA 4LF6B 5BZBA 3ABUA 2HHHO 2IBZH 2X0LA 3HKDA 4LNUA 2Q67A 1N33B 1O9HA 1RP3B 3G80A 2KKWA 1XMOO 3VBBA 4ABMA 2UXXA 4J7ZA 1M5IA 5ITZA 4HYOA 1FJGO 2WPDG 5CBGA 4TUYB 3GWOA 4X8AA 2ADPA 5IE9A 4X64B 2Q7GA 1SQGA 5J2UA 4CZZA 4DV1B 3EXAA 1GO3F 2DJVA 4PA9A 3Q4HA 2EULA 2YIBD 3RW0A 3CCRV 2YIBA 4J11A 3BFRA 3FFQA 5BR8O 5IYBO 3AK2A 2BE3A 1EFRG 2IH3C 2GUZA 1XMQO 1S77D 2QWNB 2WLNA 3ZHSA 1PNLA 4CC6A 5LMNB 1M57B 3N27A 3R66A 2Y0PA 4DV4O 1ZTEA 1PL4A 1SETA 3AG1C 1OV9A 2IH1C 3DTUB 3JYCA 5EBLC 5J2TB 1XL4A 3LUTB 4UCTA 3ZRXA 1YZBA 1SC5B 1XOUA 5GONB 1YF2A 3ZRWB 1J5EO 2ZM6B 4JAAA 4WCEV 4IYIA 3HKBA 1YXBA 1WJZA 1BL8A 3FYEB 2HR3A 3OFNG 2AHZA 2ZE6A 2VRZA 1K4CC 1AI7A 3UKMA 2VS0A 2AZ0A 2UXCB 3JD4A 5E79Z 1JJ2U 1VQ6V 4PV1B 2X6AA 4JF3A 4FLXA 1LNQA 2A9HA 4QE9A 1Y76B 1N33O 1S0VA 2YIDA 1QQCA 2DOSA 5DECA 5CA1B 3JD1A 2YDEA 2MK3A 2F4VB 3OUSA 2P67A 3CXCU 4TV8A 4TWKA 4BWAA 1FPOA 4BIUA 5LMUO 3A0HZ 2AW9A 4IGGA 3RWRD 3CEIA 3U11A 2FL4A 1OCOB 3ASOB 4JI0O 4X64O 1SKVA 1GTOA 1YI2V 3JAKB 4C7UA 3KKYA 5HFMA 4DR3O 4DV1O 3CS5A 2CDYA 5FNVB 1OHHG 4DR6B 4FLVA 4QIWF 3HKCA 1Q3EA 4DRXB 3H01A 3T1YB 2EIKB 3QF7A 5KLVH 2WLIA 3ZMTA 1P49A 2N04A 1PPJH 1SA0B 4X62O 4JI1B 2Q68A 3E83A 2AXTZ 4NTXA 4LFBO 3ZHTA 3H1HH 2CTRA 5LOVB 1EZJA 1XNRO 4NXMB 3E8FA 5IYZA 1WAZA 3KZIZ 4LF7B 4IIJB 3ABLC 3AG4C 1XNQB 3VQVA 3VQYA 2UU9B 4PDRA 2ZR3A 5D5QA 4PELA 4LF9B 2PYLA 2IJIA 2OCHA 3C90A 2ILMA 3I5DA 2JGDA 3VQWA 3G6BA 2ZM6O 2ZNIA 2LGQA 4FLYA 1LUVA 1KD1W 1HR0B 3CX5F 2NLJC 3J80N 4DV5B 5C93A 1R6NA 2LFSA 4NKGB 2QJ1A 3FAVA 5JH7A 1W0JG 3G6EV 2VQFB 2QKCA 4Z1VA 2FYUH 2IM9A 4ICGA 5EBWC 2BOBC 4BR6A 2YSUB 2GHYA 3JSLA 4DUZB 1TAEA 5KMGA 4UVAA 2UUAB 3HKDB 4LNUB 4MW8A 3TGUH 3QTCA 1V55C 4O2BA 3JCUZ 2E75B 1HNWO 5ITZB 4KHPB 4LF8O 4DR1B 3OEEG 1JR9A 3OT7A 2UXBB 4NVPA 3AG1B 3CJHA 3E22A 4P30A 1M56C 2GSMB 3T1HB 2DMXA 1NT2B 4KP4A 5J2UB 1D2DA 3GWKC 2ZDIC 4DK0A 1NKDA 4QPJA 4JYYA 4TV9A 3K0GA 2Y4UA 4JI3B 1N34B 4JGSA 3OTOO 1I94B 3P32A 5B1OA 4JI1O 3ASNC 2ZD9A 4JPRA 2A7WA 4R8CA 2ZIMA 5LL6Y 3SYOA 2LJ2A 1Q86W 1K3EA 2WLHA 4J80A 1PD3A 4PHZA 4NXMO 1IDSA 4CH5A 1THZA 2GUZB 1K8AW 2YICA 1KBHA 1PV0A 1F51A 2Y69C 2P5OA 1YTFB 1KC8W 1FXVA 1FS0G 2GDSA 4MTGA 1AI5A 3K59A 4NB5A 1I08A 2ZXWC 4TUYA 1BSMA 1YJWV 2ZE7A 3QNEA 4GLXA 2YS8A 3SR2C 5B1BC 1R3LC 3P30A 4EFEA 1NJIW 3LSQA 5EC1C 3FD9A 3HKBB 2EILC 4R6ZA 1S72V 3SDLA 3OR7C 5LYJB 2VQFO 3DC5A 3BABA 1H38A 4DV6O 1Q7YW 3AG3C 1HWYA 3WG7B 3BRCA 4UFZA 4UV8A 5KAFZ 2JS5A 1EN4A 2QM8A 4UCSA 4B3RO 3J81N 4QGPA 4FM2A 2RJZA 4DV7B 1JVMA 1VQ4V 2DQ3A 1OCRB 1WPBA 4X1IA 1JCHA 1P7GA 4TV8B 4H44B 1MOFA 4TOIA 4UCRA 4UV9A 5C8YA 3LSSA 5CA3A 1WA8A 4Z2WA 1ZX3A 5J2TA 2OIEA 5GTHZ 5KHHA 4ZI7A 4FLZA 3T1HO 4O4LA 3K03A 3K79A 2QE7G 5EC2C 4QNHB 1Q90D 2QM4A 3FX7A 3E89A 3ZRWA 3STLC 4D6TH 5B1AB 3MD0A 3N2KB 3SPJA 2G38A 3D3QA 1F7YA 1I5XA 2WLMA 1BT8A 1VQ5V 1IURA 2DW4A 2WLIB 5IJ0B 1VQMV 1SQPH 5JCOC 3CWBH 4CS2A 3B8MA 1X4TA 1Q6HA 2QKSA 3S3XA 4AQYB 2P4VA 1CEZA 2HHHB 1MG1A 1FXKA 2JIZG 4LP8A 1SQXH 3ZN0A 2YIAA 3QO7A 4MW3A 1XMOB 4JAUA 2NN4A 1PKXA 1V54B 1MZEA 4RQFA 3SGIA 3F7VC 4FZ1A 1YJNV 5FNVA 4WBNA 3JAMN 2CAZC 4CH4A 2A3QA 3M7MX 3ZN1A 4DRXA 3CPWU 1SZTA 2HJFC 1XI1A 3O65A 4PDVA 2IU0A 2A0LA 2OCCC 1NTKH 1KQSU 2LW1A 2ZKOA 1SA0A 3E2EA 4G2KA 5K1XA 5EIBD 3TETA 1VP7A 2F93B 2D3OW 5BR8B 1S3JA 4DUYO 1EZVH 4PI2A 3OMIB 1XQ8A 2NR5A 3LNNA 4IIJA 2LO1A 4GKJO 2IW5A 2DYSB 2Y69B 4JTDB 2YXHA 4GX5A 1S5HC 4UCOA 2YC0A 3I56V 2F66C 4JYAO 2H94A 1K5QA 3ZJZA 4FK5C 3SPGA 1MSDA 2PUSA 3B2EE 3CJHB 2XASA 3E22B 4MVMA 4O2AB 4GT1A 4XDJA 4RWUA 2W6IG 4QPKA 3QVNA 2OIGA 3CXHF 2UUCO 2F23A 4MVSA 4K8ZA 1J5EB 3BHPA 2Q0AA 2QEXV 3CSXA 2PI5A 1NZ6A 2EIMC 4TV9B 3CRRA 1LR1A 4GX0A 2XAJA 4DW1A 2Y48A 2JJ1G 4MVZA 5EIBC 3OMNB 3K58A 1JFFA 1CP9A 2B1IA 4IHJA 4FVMA 3RYCA 3L72H 4JZGA 2V7QG 3LDDA 3HKEB 3D3IA 5B1NA 2X6BA 3APQA 4NTYA 2BSKA 4H0LB 3H1LH 5LMUB 4D7TA 2HVJC 1VF5B 3SPIA 4IT5A 2ETNA 2KG7A 5JWPA 4JI0B 1QLEB 2Q9LA 1XUQA 3APOA 4F6EA 1G6UA 1VMGA 4L8JA 4DR3B 4JI5O 2W0FC 4JI8O 2DYRB 3OAAG 2QWPB 1AR4A 3STZC 1KECA 3JASB 3A0RA 4LF5O 1SESA 4OPAA 3ETQA 1F4NA 5KA5A 1H2NA 4YXWG 2DQ0A 4DO2A 1VQ7V 4G27B 3ZIAG 3FB8C 4X62B 1FD9A 2RN9A 5DEDA 3AEIA 4B7EA 2FMLA 4CS4A 4LFBB 2JVDA 5H6QA 1RM1B 1XNRB 1F4MA 2UXDB 2YEVA 5LHIA 5LGUA 3ZBHA 2WAMA 3P3PA 4X1IB 1K97A 5L3BA 5C8YB 1WA8B 2HFEC 4FFBA 2B5UA 4EB6A 1NU1H 1H2KA 4ZI7B 2ZNJA 2DN9A 1XBLA 4O4LB 4DK1A 3W7SA 2LGWA 4I4TA 5KX5A 4J7JA 4YY3O 1S5LZ 4GX1A 3ZCCA 3RN4A 5LYJA 4LCUC 4X1KA 4RUEA 1RPOA 1MSWD 3DC6A 2ZQMA 2YI9A 1QVFU 5K1PA 4E4EA 1ZWIC 1BZKA 4MSWC 1H2SB 1ORQC 1RSOB 1M9NA 1BHBA 1CPYA 5D5PA 1ROPA 4NXNB 2HLDG 1FXKB 5TISZ 3NR7A 4X1YA 2Z5UA 1AI4A 4J42A 3U0ZA 1TGOA 1WPXA 1QBZA 2CGOA 3CCQV 3X2QC 1SRYA 1HNWB 3UT5A 4K8XA 5EYPA 3NXSA 3W7WA 4LF8B 4MT8A 2HJDA 4Q6GA 1N0JA 1M90W 3G67A 2QGNA 2IJHA 2P6JA 3QO5A 5IT9N 3B40A 4WBNB 4W4KA 3N2KA 2ITDC 5KA6A 1NVPD 3ETEA 3RBZA 4X89A 5LP6C 3E86A 3HR0A 4JI4B 5IJ0A 2EIMB 3D8CA 3K0DA 5H5NA 3OTOB 4PD4F 5B5EZ 1HNXB 1TUBA 3DXRA 2E5LB 4ASUG 3QG5A 4JYCA 3BA8A 2WLKA 2X7RB 1YITV 2P22C 2UXDO 2QTSA 4MTFA 1OCCC 5B3SC 3FB6C 3BY6A 2HG5C 4R50A 3H1IH 1BE3H 1N36O 2GBOA 5LGNA 1YSCA 1F23A 4BIOA 4UB6Z 1P84F 4X65O 1HNZO 4J7KA 1KU9A 3K57A 1PM9A 1COWG 4UXNA 3B77A 1S76D 1E1RG 2HVKC 2QWRB 2CH7A 4CBCA 1I0HA 1OJHA 2QWQB 1I5YA 3L74H 3HPLC 4B08A 2ZDIA 2XTAA 2EINC 2PGGA 4TT3G 2CE4A 4DV0O 3TXSA 2K9PA 4XDKA 3W7XA 1FAFA 1XREA 4I9WA 1R73A 5L3EA 4DV6B 3CB2A 3K9AA 1NTZH 1AI6A 3N2GB 1SQQH 4YJ2B 4MVOA 1JFFB 4KFMA 3PJSK 1W0KG 1V9PA 2ZR2A 3D36A 4IHJB 3RYCB 4NXNO 1MA1A 2XHBA 1N4CA 1GM8A 2JEXA 4B3RB 2UXNA 4GCZA 5A2QN 1K5SA 1YEWA 4H13B 2P4KA 4YHHB 2A79B 2ZE5A 4LBEC 2BSKB 4JI2O 3G4SV 1GKFA 2R70A 4JYBA 1G4YB 1ZSPA 1LUWA 5H9CA 2B9ZA 2QSAA 1GK9A 2JJ2G 4O2AA 2RCVA 1M4UA 2KG7B 4TQFA 5IJ9A 1VQ9V 1EN6A 4FPPA 4BIZA 1Q6IA 3K06A 2R9AA 1Q5OA 4I0XB 1KKCA 5BY1A 3DSQA 2XAHA 2YUAA 5CN0A 4JI4O 3MAQA 1BCCH 3ZMUA 1GH6A 1HNXO 5EZYA 5IY5C 3WB2A 2E76B 3BAAA 3M99B 2E5LO 3RYHA 3ZMVA 4AILC 1S5JA 2AZ2A 1R6KA 2Q4PA 1FYJA 1YHQV 5LBQA 2XAQA 2CTQA 1TUEB 1Y66A 2PY5A 2BTOA 1URFA 3HKEA 4O4IA 3ABMC 1N0NA 2N05A 3F5TA 4F4LA 2YEVB 1KYOF 1P4RA 2WLJA 3UO3A 4FFBB 2LFRA 2B1GA 4TQDA 3AG2C 4EB6B 3OE7G 2ZCEA 1XHZA 3X2QB 3IAYA 3MHHC 3B8NA 3VOUA 5L3FA 1GN6A 2FKXA 4JTCB 3ABKC 2R72A 1VQKV 2OYQA 2OT5A 2QKAA 1QLNA 2FTKA 1QR8A 1E1QG 3JASA 4I4TB 4Z1MG 5KX5B 4HZ3A 1WB7A 5BMVA 3QO8A 2DE0X 3KG2A 1IBLO 3BPZA 4X1KB 2H3OA 1M93A 1AJPA 3C3SA 1IX9A 4LH6A 4UB8Z 2HP8A 1B3QA 5L3DA 3C3TA 4ZOLA 5JCOA 2XAGA 3R65A 3K5NA 4DUYB 4B3SO 2RNBA 1QR9A 1VF6C 4YHHO 4DR4B 2P90A 1G1XB 1Z5VA 4YJ3B 4X66O 3CMEV 1K9MW 4GKJB 1MABG 4X1YB 4H33A 3OMAB 3ABLB 3AG4B 3LSUA 2D2CB 4HAMA 4FJCC 2QWOB 3ZHQA 1SS3A 4OGQB 4JYAB 3UT5B 3ZX6A 5EYPB 3T4ZA 3H9VA 1K4DC 2L35A 2Q7EA 2W6JG 3JCZA 4MVRA 4E2LA 4IYHA 1BQZA 1YIJV 5KHJA 3JALA 1WNSA 3BEHA 1L1FA 3F5WC 4B7KA 1OZ0A 4JI7O
chains in the Genus database with same CATH topology
2UUCB 5EIBC 4FM1A 1QQCA 5CA1B 3K58A 5CB4A 2YI8A 1JFFA 2F4VB 4TV8A 4IHJA 4FVMA 3RYCA 3JARA 4LH7A 4BWAA 3CHXA 1TUBB 4JI7B 5LA6A 3HKEB 3RWRD 3U11A 5IWAB 1RSOA 3THOA 4B3MB 1SKVA 3JAKB 5LMUB 5FNVB 4D7TA 4DR6B 4FLVA 4LFCB 5JVDB 3ICXA 2EX3A 2RQ6A 3HKCA 1Q3EA 3WB0A 4JI0B 4DRXB 2PTMA 1G6UA 3T1YB 4L8JA 4DR3B 3QF7A 1SQFA 2BTQB 1FFXA 1P49A 4DV2B 1SA0B 3JASB 4JI1B 1T5EA 3ETQA 3PN1A 4F6RA 4JI5B 4JI8B 5LOVB 1B04A 5LXTB 4O4JA 4NXMB 3WB1A 4X62B 3K5OA 4LF5B 5IYZA 3UQ8A 5JQGB 4X20A 4LF7B 4IIJB 3SJCC 4CS4A 1XNQB 3VQVA 3ZEDA 4LFBB 3VQYA 2JVDA 2UU9B 1XNRB 5D5QA 2UXDB 4LF9B 2UUBB 4LFAB 5LP6B 2PYLA 1Q43A 4X1IB 4UCUA 2GV9A 2PYJA 5JJJB 4I55A 1WN7A 5C8YB 2HEPA 4FFBA 3VQWA 2ZNIA 4BW9A 4EB6A 1JJOA 4FLYA 4ZI7B 2ZNJA 4CC5A 1HR0B 1ZAUA 4O4LB 4DK1A 5CA0B 5FPOA 4DV5B 5JJEB 4I4TA 5KX5A 3SJAC 2QJ1A 5JH7A 2VQFB 5LYJA 2IM9A 5IJ9B 4X1KA 4CH3A 4KL1A 3JSLA 4DUZB 4HNAA 1TAEA 4YY3B 2VWJA 5KMGA 4D7SA 3JARB 4DR2B 1TVKA 3U10A 2UUAB 3HKDB 4LNUB 5EZYB 2YI9A 5K1PA 4AHCA 3QTCA 1H2SB 4O2BA 3RYHB 3N2GA 4YJ2A 1D5AA 4HBNA 5D5PA 1Z5WA 4NXNB 4O4HB 5ITZB 4U3JB 4KHPB 5GONA 4DR1B 3RYIA 2UXBB 4NVPA 4X1YA 1QHTA 3E22A 3U0ZA 1TGOA 4O4IB 5JJNB 2F95B 3T1HB 3HKCB 5KHKA 4CS3A 1NT2B 1IBMB 1HNWB 3UT5A 4K8XA 5EYPA 5J2UB 4LF8B 4LR3A 4Q6GA 4DK0A 4K0KB 3RFRA 4TV9A 4FLUA 4JI3B 4WBNB 1N34B 3JAWB 3N2KA 1I94B 2E3CA 4FM0A 1VF7A 2ZIMA 1HW7A 4OX9B 5CA1A 5LP6C 4ZHQB 3RYFA 4PHZA 4JI4B 5IJ0A 4CH5A 3OTOB 5IYZB 4GYCB 1HNXB 4X20B 1TUBA 1DGSA 2E5LB 1KMIZ 3QG5A 5BMVB 3BA8A 2P5OA 4EFBA 1IBKB 2P22C 4LF4B 2Q7HA 3JAKA 1FJGB 3K59A 2F1MA 4I55B 4ZOLB 4TUYA 4DV3B 5JVDA 4GLXA 3RGBA 5KHGA 4I50B 3SR2C 4DR5B 1I7FA 1KU9A 2V4DA 3K57A 4EFEA 2BTQA 5FPRA 1N36B 5JH7B 4FLTA 3K5MA 2ZIOA 3HKBB 3A2FA 3BA9A 5LYJB 4B08A 4X65B 1HNZB 3BABA 5LOVA 5LXTA 4DR7B 3BRCA 4UFZA 2PGGA 2JGUA 1XMQB 2JS5A 4JI6B 5KMGB 3JALB 4UCSA 3JATB 1TA8A 2VQEB 4DV4B 4DV6B 3CB2A 4FM2A 4O2BB 3N2GB 2RJZA 4YJ2B 5CB4B 4DV7B 1JFFB 5LP6A 1Q8IA 3K5LA 1WPBA 4X1IA 4DV0B 1V9PA 4TV8B 4IHJB 3RYCB 2XHBA 2OWOA 4TOIA 4UCRA 4B3RB 5C8YA 1XHXA 5LA6B 3ZS8C 1YEWA 3OTFA 5J2TA 4YHHB 5KHHA 4ZI7A 4FLZA 4O4LA 4PI0A 2R70A 2QM4A 4YJ3A 4GKKB 4I9QA 1N32B 4O2AA 3N2KB 1L8DA 1M4UA 4ZIBA 4JI2B 4TQFA 4JV5B 5IJ9A 4CH6A 2R9AA 2YXLA 3VQXA 1Q5OA 4LF6B 3RYFB 1FFXB 3DSQA 5IJ0B 5JCOC 4CS2A 3HKDA 1X4TA 4LNUA 3MAQA 1N33B 5EZYA 1O9HA 3WB2A 3BAAA 4F6RB 4AQYB 3RYHA 4AILC 2KKWA 1S5JA 4O4JB 2HHHB 4O4HA 1M5IA 5ITZA 4U3JA 2PY5A 2BTOA 2YIAA 4TUYB 3HKEA 4O4IA 1XMOB 4X64B 2Q7GA 1SQGA 5J2UA 2VWKA 3SGIA 4DV1B 2PZSA 1JMKC 5FNVA 2YIBD 4WBNA 3JAWA 4FFBB 3JSNA 2CAZC 4TQDA 4EB6B 2ZINA 2ZCEA 2YIBA 3M7MX 4CH4A 1XHZA 4DRXA 3IAYA 1XI1A 4ZHQA 3FFQA 2R72A 2OYQA 1SA0A 3JASA 4I4TB 5KX5B 5K1XA 5EIBD 4CC6A 5BMVA 5LMNB 3BPZA 2F93B 4X1KB 5BR8B 1M93A 4PI2A 4EEQA 4HNAB 4LH6A 5JQGA 1XQ8A 3LNNA 4IIJA 1TVKB 4ZOLA 5JCOA 1IBLB 5KHIA 3K5NA 5J2TB 4DUYB 4UCTA 4DR4B 4I50A 4FLWA 4UCOA 2F66C 1Z5VA 4YJ3B 5GONB 3RYIB 2PUSA 4GKJB 4X1YB 3B2EE 2ZM6B 3E22B 4UCVA 4O2AB 4B3SB 3HKBA 4B3TB 5CA0A 4JYAB 3UT5B 5EYPB 4X66B 4K8ZA 1J5EB 3BHPA 2Q0AA 2Q7EA 3CSXA 2UXCB 4TV9B 4FLXA 1O9GA 5KHJA 3JALA 1WNSA 3JATA 3SJBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3THO A;  3ICX A;  3ZS8 C;  3QF7 A;  3SJC C;  1NT2 B;  3CSX A;  3SJB C;  2P22 C;  3SJA C;  1SKV A;  1X4T A;  2JS5 A;  2CAZ C;  3QG5 A;  3B2E E;  2F66 C; 
#chains in the Genus database with same CATH topology
 2UUC B;  2CUG A;  1KP2 A;  5IWA O;  5CB4 A;  2QTO A;  1NVP B;  3A0B Z;  2N74 A;  2AGA A;  3ZMZ A;  1GN2 A;  4LH7 A;  1TUB B;  3DXR B;  3J7A U;  4LFC O;  1RSO A;  3THO A;  4RO2 A;  3E8B A;  3O9O A;  3GVM A;  4NR1 A;  1DTO A;  5GW7 A;  3L73 H;  3AG7 A;  3FB5 C;  3ICX A;  1OCZ C;  1M57 C;  2RQ6 A;  3ZHU A;  4JZ2 A;  1A32 A;  1V55 B;  2PTM A;  4PA3 A;  5CMU A;  1SQF A;  1FFX A;  1H2G A;  4XBF A;  4DV2 B;  1UJW B;  3A8T A;  4WFB V;  1M56 B;  2CH7 B;  4F6R A;  3KCX A;  4JI5 B;  2IU3 A;  1RPR A;  4JI8 B;  4O4J A;  3E35 A;  4FMT A;  1SZX A;  3WB1 A;  3CCJ V;  4LFA O;  3W7T A;  1VAR A;  1NR7 A;  2WA3 A;  1YVW A;  1JA8 A;  4BW5 A;  4UVB A;  1KB9 F;  4LF5 B;  3UQ8 A;  5JQG B;  3L71 H;  3SJC C;  2DWE C;  4P9P A;  4NYK A;  5IY5 B;  1Q81 W;  3ASN B;  5KUK A;  2UUB B;  3SPH A;  4DR4 O;  1KUQ A;  1Q43 A;  3CCL V;  4UCU A;  2Z3Y A;  5JJJ B;  1G8M A;  1WN7 A;  2HEP A;  2L6L A;  2WA4 A;  4UVC A;  4K3A A;  1JJO A;  4I7Z B;  4RQE A;  5LHG A;  2Q73 A;  4A5U B;  1K73 W;  1K92 A;  1ZAU A;  5CA0 B;  5L3C A;  1YDX A;  2PF4 E;  3L70 H;  5CBH A;  3L9D A;  3IGA C;  3SJA C;  4GUN A;  2ZXW B;  1ZL8 B;  1Y74 B;  1N8R W;  1VQ8 V;  3AG2 B;  1OCO C;  3S3W A;  5IJ9 B;  4WFH A;  4KL1 A;  2PI4 A;  5B1B B;  4HNA A;  4WFA V;  4YY3 B;  2VWJ A;  4D7S A;  3JAR B;  4DR2 B;  1TVK A;  4PA4 A;  5EZY B;  1AB3 A;  4BAY A;  2EIL B;  4AHC A;  4KUM A;  1JX9 A;  3DGE A;  3RYH B;  3N2G A;  5KAI Z;  2Y4T A;  4YJ2 A;  1D5A A;  4HBN A;  2EIK C;  1IBM O;  1Z5W A;  3TK1 A;  3IJ4 A;  3B4S A;  3AG3 B;  3RYI A;  4L87 A;  4K0K O;  4UUJ C;  1QHT A;  2Q5Z A;  3I55 V;  4O4I B;  1R6T A;  1K33 A;  3SPC A;  5KHK A;  1BMF G;  2KQX A;  4LR3 A;  4OX9 O;  4LWS A;  3RFR A;  4FLU A;  2JDI G;  4DV2 O;  3CCE V;  1HDJ A;  2JRI A;  4DXW A;  3AK3 A;  4YIP A;  5IDJ A;  2JEU A;  4J41 A;  4I0X A;  1IBK O;  2EBO A;  4QJF B;  4LF4 O;  4FFK A;  4Q20 A;  4X20 B;  3T4D A;  4DW0 A;  1KKD A;  1DGS A;  1KMI Z;  1JQ0 A;  2EIJ C;  5FLX N;  5BMV B;  4DV3 O;  4QE7 A;  4WFE A;  2HKO A;  3CC2 V;  4LC1 A;  2UUB O;  1Q6U A;  4DR5 O;  1R3K C;  4PDM A;  2F1M A;  4I55 B;  5H6R A;  4ZOL B;  2YXY A;  4ZBM A;  5JVD A;  2C2A A;  5GTI Z;  2ITC C;  1VQL V;  1GM9 A;  2CTW A;  1I7F A;  1NTM H;  4J9Z B;  2BTQ A;  2P7T C;  3F7Y C;  1N36 B;  4DR7 O;  4FLT A;  3K5M A;  2GTS A;  2ZIO A;  4JI6 O;  3A2F A;  1YTF D;  2V1D A;  2EZP A;  1OCZ B;  3ZMS A;  1ZLZ A;  4X65 B;  1HNZ B;  1AJQ A;  2ZT9 B;  2VQE O;  1W2B U;  5LXT A;  2ZE8 A;  2JGU A;  3JAL B;  4DR2 O;  4PA7 A;  3FKS G;  3CC7 V;  3KCY A;  5CB4 B;  1WP8 A;  5LP6 A;  1Q8I A;  4DV0 B;  2OCC B;  1AR1 B;  3MDS A;  2OWO A;  3T1C A;  3AK1 A;  4PA6 A;  2CTP A;  4XDL A;  1N32 O;  1XHX A;  1X59 A;  2R9I A;  3OTF A;  2Q69 A;  2F43 G;  4MTX A;  1Q82 W;  3CRQ A;  4PI0 A;  3MHS C;  4YJ3 A;  1M1K W;  4GKK B;  1DF4 A;  3CMA V;  1NH2 D;  4LF6 O;  1VEW A;  2XUM A;  2RMK B;  1WP7 A;  4JAS A;  1RFY A;  1L8D A;  4JI2 B;  3EVK A;  3OUF A;  4JV5 B;  1JPX A;  3B09 A;  2Y0I A;  4CH6 A;  1EN5 A;  3SYC A;  1GRJ A;  1EM1 A;  2O57 A;  3RYF B;  1FFX B;  1XDC A;  5H2F Z;  3LNM B;  1MNG A;  4MVQ A;  4F6R B;  1Y4M A;  2QR4 A;  1H8E G;  4O4J B;  4P9O A;  3H1K H;  3K04 A;  4O4H A;  1SER A;  4U3J A;  4JAV A;  2AHY A;  3SYA A;  3JD0 A;  2EZO A;  1QVG U;  2P06 A;  5FL7 G;  5J9P C;  3RVZ A;  2EJR A;  1MMM A;  2VWK A;  3ZRS A;  2W0X A;  3WG7 C;  2PZS A;  1JMK C;  3IFX A;  4U3F H;  3JAW A;  3WU2 Z;  3JSN A;  1SF9 A;  4U7O A;  2ZIN A;  1ZUQ A;  4JTA B;  2WWW A;  5LMN O;  1BQ0 A;  5LGT A;  4ZHQ A;  3SJQ C;  1OCR C;  1US6 A;  3CRM A;  1VQP V;  2IJJ A;  4WF9 V;  4N23 A;  3FB7 C;  2FB5 A;  2XOK G;  3K9S A;  3TCU A;  3CD6 V;  4YIO A;  1R3I C;  4KXR A;  4EEQ A;  2ATK C;  4HNA B;  1VQN V;  3RT3 C;  5JQG A;  5B1A C;  4GX2 A;  1XL6 A;  1TVK B;  4I5S A;  1B6Q A;  1IBL B;  5KHI A;  4J10 A;  1J95 A;  1MZF A;  1SQB H;  1Y67 A;  2EIJ B;  3TXQ A;  3G71 V;  4I50 A;  4FLW A;  2Q6A A;  5IYC O;  3UO2 A;  3EFF K;  4FZ0 A;  2A06 H;  4R7C A;  3RYI B;  5IYD O;  4GKK O;  3GB7 C;  2UXC O;  3JD2 A;  2JS3 A;  4UCV A;  4B3S B;  5E1A C;  2CGN A;  2XT9 A;  1QU7 A;  1BS3 A;  3OM3 B;  4B3T B;  1XIL A;  3JD3 A;  5CA0 A;  4DYL A;  4JV5 O;  4X66 B;  1IZ3 A;  4LWS B;  2F4V O;  2DWD C;  1O9G A;  1ZL8 A;  3H1J H;  1Y74 A;  3JAT A;  3SJB C;  4N21 A;  3CRA A;  1BGY H;  3ZRV A;  4FM1 A;  1V54 C;  4W4L A;  2YI8 A;  1VIB A;  1R1B A;  2WLL A;  2QA4 V;  1IXB A;  3JAR A;  1PNK A;  3CHX A;  4JI7 B;  3M8A A;  5LA6 A;  4DR6 O;  3CCV V;  2LP7 A;  5KUM A;  5IWA B;  2X6C A;  1JOY A;  1E79 G;  1NBM G;  3K08 A;  4B3M B;  2H8P C;  3T1Y O;  1H8H G;  1ARO P;  3Q4H B;  3EHB B;  5EK0 A;  4LFC B;  1AR5 A;  5JVD B;  4AI8 A;  3P3N A;  5AG2 A;  2EX3 A;  3OGC C;  4J9Y B;  1AP5 A;  3WB0 A;  1DLB A;  3HB3 B;  1VF6 A;  3ZHR A;  1GM7 A;  3OD4 A;  2BTQ B;  3D36 C;  1GAX A;  1L0N H;  3W7U A;  3IC7 A;  3E8H A;  4PDL A;  1T5E A;  3PN1 A;  4LF7 O;  2DYS C;  1XNQ O;  2EJ7 A;  1NQT A;  1AJN A;  1B04 A;  5LXT B;  2UU9 O;  1EBO A;  4OPH A;  4LF9 O;  1GMG A;  4RAI A;  3K5O A;  4X20 A;  4X88 A;  1QNM A;  3UCS C;  4PJ0 Z;  1K7D A;  3ZED A;  1P7B A;  3K3W A;  5CBF A;  4LFA B;  4MS2 A;  4EKW A;  1HR0 O;  5LP6 B;  2KSD A;  2GV9 A;  2PYJ A;  2XND G;  4I55 A;  4DV5 O;  1R3J C;  3OW2 U;  5EBM C;  2RDC A;  1SQV H;  4BW9 A;  1YCI A;  4H37 A;  2OTL V;  1BHA A;  1H2L A;  1UFI A;  4CC5 A;  3ETD A;  4NTW A;  4B3T O;  5FPO A;  1FKA O;  1NR1 A;  3WFV A;  1OCC B;  1IXM A;  3LDE A;  3SYP A;  5B3S B;  5JJE B;  4DUZ O;  2XAF A;  2M7W A;  4K35 A;  1B06 A;  2UUA O;  1NH2 B;  3SYQ A;  4CH3 A;  1W59 A;  2NNU A;  3CC4 V;  2OTJ V;  1Y6X A;  4KHP O;  1PL0 A;  3U10 A;  4DR1 O;  2UXB O;  1PNM A;  2JK5 C;  1L0L H;  1AIL A;  1FFT B;  1HP8 A;  1QLE C;  1FXH A;  2IJK A;  2DYR C;  4O4H B;  1GN4 A;  4U3J B;  4B3M O;  5GON A;  1K34 A;  2EIN B;  2BOC C;  1IVS A;  5LHH A;  5HFL A;  3CYO A;  4JI3 O;  1GN3 A;  4WFF A;  5JJN B;  2F95 B;  4OXS A;  1N34 O;  4IL6 Z;  3IC9 A;  3OGI B;  3HKC B;  4CS3 A;  1I94 O;  1IBM B;  2QDO A;  3CCU V;  5F2V O;  4X9Q A;  3OR6 C;  4K0K B;  1WB8 A;  1H2M A;  3CE2 A;  1U96 A;  3BVO A;  1UPG A;  3JAW B;  1CXZ B;  1Y76 A;  2E3C A;  3TJT A;  4FM0 A;  1VF7 A;  1RM1 C;  3E8G A;  1HW7 A;  4OX9 B;  5CA1 A;  1QCE A;  4ZHQ B;  1VQO V;  3RYF A;  2K1E A;  2KB1 A;  3OEH G;  1NI8 A;  5IYZ B;  4GYC B;  1ENV A;  3BCC H;  3CP1 A;  1XEQ A;  2LQT A;  1U97 A;  4EFB A;  2ODM A;  1IBK B;  3CCM V;  4LF4 B;  2GTA A;  2ADQ B;  2Q7H A;  3RVY A;  4RUF A;  3JAK A;  2Q8V A;  1FJG B;  2JGD B;  2Q0O C;  4DV3 B;  1WLE A;  3RGB A;  5KHG A;  5BXZ A;  4I50 B;  2MW2 B;  4DR5 B;  4GZR B;  2V4D A;  1DF5 A;  5FPR A;  4WFG A;  5L3G A;  2BCC H;  2ARH A;  2R9R B;  5JH7 B;  3FAV B;  3ABM B;  3BA9 A;  2E74 B;  5LOV A;  1FXK C;  2WSS G;  4DV7 O;  4DR7 B;  1D5N A;  2QM7 A;  1XMQ B;  4JI6 B;  5KMG B;  3JAT B;  1TA8 A;  2VQE B;  4DV4 B;  4P2Z A;  1NS1 A;  3ASO C;  4O2B B;  4U7N A;  5B66 Z;  3K5L A;  2Z0A A;  3ABK B;  2WLL B;  5DN6 G;  1AP6 A;  5A9G A;  4TSF G;  3ZS8 C;  5LA6 B;  3L75 H;  1Z2G A;  3ABT A;  3FYI B;  2M6Y A;  1AVM A;  5DM6 V;  1YJ9 V;  1PP9 H;  1DK1 A;  4FIP C;  3T2M A;  2CK3 G;  1KP3 A;  4I9Q A;  1N32 B;  4MTO A;  3ETG A;  3CRC A;  3UM7 A;  3CCS V;  2LW7 A;  4ZIB A;  3LDC A;  3ML0 A;  4G28 B;  4ZKI A;  4AQY O;  4MVU A;  3ZHV A;  2YXL A;  3VQX A;  4LF6 B;  5BZB A;  3ABU A;  2HHH O;  2IBZ H;  2X0L A;  3HKD A;  4LNU A;  2Q67 A;  1N33 B;  1O9H A;  1RP3 B;  3G80 A;  2KKW A;  1XMO O;  3VBB A;  4ABM A;  2UXX A;  4J7Z A;  1M5I A;  5ITZ A;  4HYO A;  1FJG O;  2WPD G;  5CBG A;  4TUY B;  3GWO A;  4X8A A;  2ADP A;  5IE9 A;  4X64 B;  2Q7G A;  1SQG A;  5J2U A;  4CZZ A;  4DV1 B;  3EXA A;  1GO3 F;  2DJV A;  4PA9 A;  3Q4H A;  2EUL A;  2YIB D;  3RW0 A;  3CCR V;  2YIB A;  4J11 A;  3BFR A;  3FFQ A;  5BR8 O;  5IYB O;  3AK2 A;  2BE3 A;  1EFR G;  2IH3 C;  2GUZ A;  1XMQ O;  1S77 D;  2QWN B;  2WLN A;  3ZHS A;  1PNL A;  4CC6 A;  5LMN B;  1M57 B;  3N27 A;  3R66 A;  2Y0P A;  4DV4 O;  1ZTE A;  1PL4 A;  1SET A;  3AG1 C;  1OV9 A;  2IH1 C;  3DTU B;  3JYC A;  5EBL C;  5J2T B;  1XL4 A;  3LUT B;  4UCT A;  3ZRX A;  1YZB A;  1SC5 B;  1XOU A;  5GON B;  1YF2 A;  3ZRW B;  1J5E O;  2ZM6 B;  4JAA A;  4WCE V;  4IYI A;  3HKB A;  1YXB A;  1WJZ A;  1BL8 A;  3FYE B;  2HR3 A;  3OFN G;  2AHZ A;  2ZE6 A;  2VRZ A;  1K4C C;  1AI7 A;  3UKM A;  2VS0 A;  2AZ0 A;  2UXC B;  3JD4 A;  5E79 Z;  1JJ2 U;  1VQ6 V;  4PV1 B;  2X6A A;  4JF3 A;  4FLX A;  1LNQ A;  2A9H A;  4QE9 A;  1Y76 B;  1N33 O;  1S0V A;  2YID A;  1QQC A;  2DOS A;  5DEC A;  5CA1 B;  3JD1 A;  2YDE A;  2MK3 A;  2F4V B;  3OUS A;  2P67 A;  3CXC U;  4TV8 A;  4TWK A;  4BWA A;  1FPO A;  4BIU A;  5LMU O;  3A0H Z;  2AW9 A;  4IGG A;  3RWR D;  3CEI A;  3U11 A;  2FL4 A;  1OCO B;  3ASO B;  4JI0 O;  4X64 O;  1SKV A;  1GTO A;  1YI2 V;  3JAK B;  4C7U A;  3KKY A;  5HFM A;  4DR3 O;  4DV1 O;  3CS5 A;  2CDY A;  5FNV B;  1OHH G;  4DR6 B;  4FLV A;  4QIW F;  3HKC A;  1Q3E A;  4DRX B;  3H01 A;  3T1Y B;  2EIK B;  3QF7 A;  5KLV H;  2WLI A;  3ZMT A;  1P49 A;  2N04 A;  1PPJ H;  1SA0 B;  4X62 O;  4JI1 B;  2Q68 A;  3E83 A;  2AXT Z;  4NTX A;  4LFB O;  3ZHT A;  3H1H H;  2CTR A;  5LOV B;  1EZJ A;  1XNR O;  4NXM B;  3E8F A;  5IYZ A;  1WAZ A;  3KZI Z;  4LF7 B;  4IIJ B;  3ABL C;  3AG4 C;  1XNQ B;  3VQV A;  3VQY A;  2UU9 B;  4PDR A;  2ZR3 A;  5D5Q A;  4PEL A;  4LF9 B;  2PYL A;  2IJI A;  2OCH A;  3C90 A;  2ILM A;  3I5D A;  2JGD A;  3VQW A;  3G6B A;  2ZM6 O;  2ZNI A;  2LGQ A;  4FLY A;  1LUV A;  1KD1 W;  1HR0 B;  3CX5 F;  2NLJ C;  3J80 N;  4DV5 B;  5C93 A;  1R6N A;  2LFS A;  4NKG B;  2QJ1 A;  3FAV A;  5JH7 A;  1W0J G;  3G6E V;  2VQF B;  2QKC A;  4Z1V A;  2FYU H;  2IM9 A;  4ICG A;  5EBW C;  2BOB C;  4BR6 A;  2YSU B;  2GHY A;  3JSL A;  4DUZ B;  1TAE A;  5KMG A;  4UVA A;  2UUA B;  3HKD B;  4LNU B;  4MW8 A;  3TGU H;  3QTC A;  1V55 C;  4O2B A;  3JCU Z;  2E75 B;  1HNW O;  5ITZ B;  4KHP B;  4LF8 O;  4DR1 B;  3OEE G;  1JR9 A;  3OT7 A;  2UXB B;  4NVP A;  3AG1 B;  3CJH A;  3E22 A;  4P30 A;  1M56 C;  2GSM B;  3T1H B;  2DMX A;  1NT2 B;  4KP4 A;  5J2U B;  1D2D A;  3GWK C;  2ZDI C;  4DK0 A;  1NKD A;  4QPJ A;  4JYY A;  4TV9 A;  3K0G A;  2Y4U A;  4JI3 B;  1N34 B;  4JGS A;  3OTO O;  1I94 B;  3P32 A;  5B1O A;  4JI1 O;  3ASN C;  2ZD9 A;  4JPR A;  2A7W A;  4R8C A;  2ZIM A;  5LL6 Y;  3SYO A;  2LJ2 A;  1Q86 W;  1K3E A;  2WLH A;  4J80 A;  1PD3 A;  4PHZ A;  4NXM O;  1IDS A;  4CH5 A;  1THZ A;  2GUZ B;  1K8A W;  2YIC A;  1KBH A;  1PV0 A;  1F51 A;  2Y69 C;  2P5O A;  1YTF B;  1KC8 W;  1FXV A;  1FS0 G;  2GDS A;  4MTG A;  1AI5 A;  3K59 A;  4NB5 A;  1I08 A;  2ZXW C;  4TUY A;  1BSM A;  1YJW V;  2ZE7 A;  3QNE A;  4GLX A;  2YS8 A;  3SR2 C;  5B1B C;  1R3L C;  3P30 A;  4EFE A;  1NJI W;  3LSQ A;  5EC1 C;  3FD9 A;  3HKB B;  2EIL C;  4R6Z A;  1S72 V;  3SDL A;  3OR7 C;  5LYJ B;  2VQF O;  3DC5 A;  3BAB A;  1H38 A;  4DV6 O;  1Q7Y W;  3AG3 C;  1HWY A;  3WG7 B;  3BRC A;  4UFZ A;  4UV8 A;  5KAF Z;  2JS5 A;  1EN4 A;  2QM8 A;  4UCS A;  4B3R O;  3J81 N;  4QGP A;  4FM2 A;  2RJZ A;  4DV7 B;  1JVM A;  1VQ4 V;  2DQ3 A;  1OCR B;  1WPB A;  4X1I A;  1JCH A;  1P7G A;  4TV8 B;  4H44 B;  1MOF A;  4TOI A;  4UCR A;  4UV9 A;  5C8Y A;  3LSS A;  5CA3 A;  1WA8 A;  4Z2W A;  1ZX3 A;  5J2T A;  2OIE A;  5GTH Z;  5KHH A;  4ZI7 A;  4FLZ A;  3T1H O;  4O4L A;  3K03 A;  3K79 A;  2QE7 G;  5EC2 C;  4QNH B;  1Q90 D;  2QM4 A;  3FX7 A;  3E89 A;  3ZRW A;  3STL C;  4D6T H;  5B1A B;  3MD0 A;  3N2K B;  3SPJ A;  2G38 A;  3D3Q A;  1F7Y A;  1I5X A;  2WLM A;  1BT8 A;  1VQ5 V;  1IUR A;  2DW4 A;  2WLI B;  5IJ0 B;  1VQM V;  1SQP H;  5JCO C;  3CWB H;  4CS2 A;  3B8M A;  1X4T A;  1Q6H A;  2QKS A;  3S3X A;  4AQY B;  2P4V A;  1CEZ A;  2HHH B;  1MG1 A;  1FXK A;  2JIZ G;  4LP8 A;  1SQX H;  3ZN0 A;  2YIA A;  3QO7 A;  4MW3 A;  1XMO B;  4JAU A;  2NN4 A;  1PKX A;  1V54 B;  1MZE A;  4RQF A;  3SGI A;  3F7V C;  4FZ1 A;  1YJN V;  5FNV A;  4WBN A;  3JAM N;  2CAZ C;  4CH4 A;  2A3Q A;  3M7M X;  3ZN1 A;  4DRX A;  3CPW U;  1SZT A;  2HJF C;  1XI1 A;  3O65 A;  4PDV A;  2IU0 A;  2A0L A;  2OCC C;  1NTK H;  1KQS U;  2LW1 A;  2ZKO A;  1SA0 A;  3E2E A;  4G2K A;  5K1X A;  5EIB D;  3TET A;  1VP7 A;  2F93 B;  2D3O W;  5BR8 B;  1S3J A;  4DUY O;  1EZV H;  4PI2 A;  3OMI B;  1XQ8 A;  2NR5 A;  3LNN A;  4IIJ A;  2LO1 A;  4GKJ O;  2IW5 A;  2DYS B;  2Y69 B;  4JTD B;  2YXH A;  4GX5 A;  1S5H C;  4UCO A;  2YC0 A;  3I56 V;  2F66 C;  4JYA O;  2H94 A;  1K5Q A;  3ZJZ A;  4FK5 C;  3SPG A;  1MSD A;  2PUS A;  3B2E E;  3CJH B;  2XAS A;  3E22 B;  4MVM A;  4O2A B;  4GT1 A;  4XDJ A;  4RWU A;  2W6I G;  4QPK A;  3QVN A;  2OIG A;  3CXH F;  2UUC O;  2F23 A;  4MVS A;  4K8Z A;  1J5E B;  3BHP A;  2Q0A A;  2QEX V;  3CSX A;  2PI5 A;  1NZ6 A;  2EIM C;  4TV9 B;  3CRR A;  1LR1 A;  4GX0 A;  2XAJ A;  4DW1 A;  2Y48 A;  2JJ1 G;  4MVZ A;  5EIB C;  3OMN B;  3K58 A;  1JFF A;  1CP9 A;  2B1I A;  4IHJ A;  4FVM A;  3RYC A;  3L72 H;  4JZG A;  2V7Q G;  3LDD A;  3HKE B;  3D3I A;  5B1N A;  2X6B A;  3APQ A;  4NTY A;  2BSK A;  4H0L B;  3H1L H;  5LMU B;  4D7T A;  2HVJ C;  1VF5 B;  3SPI A;  4IT5 A;  2ETN A;  2KG7 A;  5JWP A;  4JI0 B;  1QLE B;  2Q9L A;  1XUQ A;  3APO A;  4F6E A;  1G6U A;  1VMG A;  4L8J A;  4DR3 B;  4JI5 O;  2W0F C;  4JI8 O;  2DYR B;  3OAA G;  2QWP B;  1AR4 A;  3STZ C;  1KEC A;  3JAS B;  3A0R A;  4LF5 O;  1SES A;  4OPA A;  3ETQ A;  1F4N A;  5KA5 A;  1H2N A;  4YXW G;  2DQ0 A;  4DO2 A;  1VQ7 V;  4G27 B;  3ZIA G;  3FB8 C;  4X62 B;  1FD9 A;  2RN9 A;  5DED A;  3AEI A;  4B7E A;  2FML A;  4CS4 A;  4LFB B;  2JVD A;  5H6Q A;  1RM1 B;  1XNR B;  1F4M A;  2UXD B;  2YEV A;  5LHI A;  5LGU A;  3ZBH A;  2WAM A;  3P3P A;  4X1I B;  1K97 A;  5L3B A;  5C8Y B;  1WA8 B;  2HFE C;  4FFB A;  2B5U A;  4EB6 A;  1NU1 H;  1H2K A;  4ZI7 B;  2ZNJ A;  2DN9 A;  1XBL A;  4O4L B;  4DK1 A;  3W7S A;  2LGW A;  4I4T A;  5KX5 A;  4J7J A;  4YY3 O;  1S5L Z;  4GX1 A;  3ZCC A;  3RN4 A;  5LYJ A;  4LCU C;  4X1K A;  4RUE A;  1RPO A;  1MSW D;  3DC6 A;  2ZQM A;  2YI9 A;  1QVF U;  5K1P A;  4E4E A;  1ZWI C;  1BZK A;  4MSW C;  1H2S B;  1ORQ C;  1RSO B;  1M9N A;  1BHB A;  1CPY A;  5D5P A;  1ROP A;  4NXN B;  2HLD G;  1FXK B;  5TIS Z;  3NR7 A;  4X1Y A;  2Z5U A;  1AI4 A;  4J42 A;  3U0Z A;  1TGO A;  1WPX A;  1QBZ A;  2CGO A;  3CCQ V;  3X2Q C;  1SRY A;  1HNW B;  3UT5 A;  4K8X A;  5EYP A;  3NXS A;  3W7W A;  4LF8 B;  4MT8 A;  2HJD A;  4Q6G A;  1N0J A;  1M90 W;  3G67 A;  2QGN A;  2IJH A;  2P6J A;  3QO5 A;  5IT9 N;  3B40 A;  4WBN B;  4W4K A;  3N2K A;  2ITD C;  5KA6 A;  1NVP D;  3ETE A;  3RBZ A;  4X89 A;  5LP6 C;  3E86 A;  3HR0 A;  4JI4 B;  5IJ0 A;  2EIM B;  3D8C A;  3K0D A;  5H5N A;  3OTO B;  4PD4 F;  5B5E Z;  1HNX B;  1TUB A;  3DXR A;  2E5L B;  4ASU G;  3QG5 A;  4JYC A;  3BA8 A;  2WLK A;  2X7R B;  1YIT V;  2P22 C;  2UXD O;  2QTS A;  4MTF A;  1OCC C;  5B3S C;  3FB6 C;  3BY6 A;  2HG5 C;  4R50 A;  3H1I H;  1BE3 H;  1N36 O;  2GBO A;  5LGN A;  1YSC A;  1F23 A;  4BIO A;  4UB6 Z;  1P84 F;  4X65 O;  1HNZ O;  4J7K A;  1KU9 A;  3K57 A;  1PM9 A;  1COW G;  4UXN A;  3B77 A;  1S76 D;  1E1R G;  2HVK C;  2QWR B;  2CH7 A;  4CBC A;  1I0H A;  1OJH A;  2QWQ B;  1I5Y A;  3L74 H;  3HPL C;  4B08 A;  2ZDI A;  2XTA A;  2EIN C;  2PGG A;  4TT3 G;  2CE4 A;  4DV0 O;  3TXS A;  2K9P A;  4XDK A;  3W7X A;  1FAF A;  1XRE A;  4I9W A;  1R73 A;  5L3E A;  4DV6 B;  3CB2 A;  3K9A A;  1NTZ H;  1AI6 A;  3N2G B;  1SQQ H;  4YJ2 B;  4MVO A;  1JFF B;  4KFM A;  3PJS K;  1W0K G;  1V9P A;  2ZR2 A;  3D36 A;  4IHJ B;  3RYC B;  4NXN O;  1MA1 A;  2XHB A;  1N4C A;  1GM8 A;  2JEX A;  4B3R B;  2UXN A;  4GCZ A;  5A2Q N;  1K5S A;  1YEW A;  4H13 B;  2P4K A;  4YHH B;  2A79 B;  2ZE5 A;  4LBE C;  2BSK B;  4JI2 O;  3G4S V;  1GKF A;  2R70 A;  4JYB A;  1G4Y B;  1ZSP A;  1LUW A;  5H9C A;  2B9Z A;  2QSA A;  1GK9 A;  2JJ2 G;  4O2A A;  2RCV A;  1M4U A;  2KG7 B;  4TQF A;  5IJ9 A;  1VQ9 V;  1EN6 A;  4FPP A;  4BIZ A;  1Q6I A;  3K06 A;  2R9A A;  1Q5O A;  4I0X B;  1KKC A;  5BY1 A;  3DSQ A;  2XAH A;  2YUA A;  5CN0 A;  4JI4 O;  3MAQ A;  1BCC H;  3ZMU A;  1GH6 A;  1HNX O;  5EZY A;  5IY5 C;  3WB2 A;  2E76 B;  3BAA A;  3M99 B;  2E5L O;  3RYH A;  3ZMV A;  4AIL C;  1S5J A;  2AZ2 A;  1R6K A;  2Q4P A;  1FYJ A;  1YHQ V;  5LBQ A;  2XAQ A;  2CTQ A;  1TUE B;  1Y66 A;  2PY5 A;  2BTO A;  1URF A;  3HKE A;  4O4I A;  3ABM C;  1N0N A;  2N05 A;  3F5T A;  4F4L A;  2YEV B;  1KYO F;  1P4R A;  2WLJ A;  3UO3 A;  4FFB B;  2LFR A;  2B1G A;  4TQD A;  3AG2 C;  4EB6 B;  3OE7 G;  2ZCE A;  1XHZ A;  3X2Q B;  3IAY A;  3MHH C;  3B8N A;  3VOU A;  5L3F A;  1GN6 A;  2FKX A;  4JTC B;  3ABK C;  2R72 A;  1VQK V;  2OYQ A;  2OT5 A;  2QKA A;  1QLN A;  2FTK A;  1QR8 A;  1E1Q G;  3JAS A;  4I4T B;  4Z1M G;  5KX5 B;  4HZ3 A;  1WB7 A;  5BMV A;  3QO8 A;  2DE0 X;  3KG2 A;  1IBL O;  3BPZ A;  4X1K B;  2H3O A;  1M93 A;  1AJP A;  3C3S A;  1IX9 A;  4LH6 A;  4UB8 Z;  2HP8 A;  1B3Q A;  5L3D A;  3C3T A;  4ZOL A;  5JCO A;  2XAG A;  3R65 A;  3K5N A;  4DUY B;  4B3S O;  2RNB A;  1QR9 A;  1VF6 C;  4YHH O;  4DR4 B;  2P90 A;  1G1X B;  1Z5V A;  4YJ3 B;  4X66 O;  3CME V;  1K9M W;  4GKJ B;  1MAB G;  4X1Y B;  4H33 A;  3OMA B;  3ABL B;  3AG4 B;  3LSU A;  2D2C B;  4HAM A;  4FJC C;  2QWO B;  3ZHQ A;  1SS3 A;  4OGQ B;  4JYA B;  3UT5 B;  3ZX6 A;  5EYP B;  3T4Z A;  3H9V A;  1K4D C;  2L35 A;  2Q7E A;  2W6J G;  3JCZ A;  4MVR A;  4E2L A;  4IYH A;  1BQZ A;  1YIJ V;  5KHJ A;  3JAL A;  1WNS A;  3BEH A;  1L1F A;  3F5W C;  4B7K A;  1OZ0 A;  4JI7 O; 
#chains in the Genus database with same CATH homology
 2UUC B;  5EIB C;  4FM1 A;  1QQC A;  5CA1 B;  3K58 A;  5CB4 A;  2YI8 A;  1JFF A;  2F4V B;  4TV8 A;  4IHJ A;  4FVM A;  3RYC A;  3JAR A;  4LH7 A;  4BWA A;  3CHX A;  1TUB B;  4JI7 B;  5LA6 A;  3HKE B;  3RWR D;  3U11 A;  5IWA B;  1RSO A;  3THO A;  4B3M B;  1SKV A;  3JAK B;  5LMU B;  5FNV B;  4D7T A;  4DR6 B;  4FLV A;  4LFC B;  5JVD B;  3ICX A;  2EX3 A;  2RQ6 A;  3HKC A;  1Q3E A;  3WB0 A;  4JI0 B;  4DRX B;  2PTM A;  1G6U A;  3T1Y B;  4L8J A;  4DR3 B;  3QF7 A;  1SQF A;  2BTQ B;  1FFX A;  1P49 A;  4DV2 B;  1SA0 B;  3JAS B;  4JI1 B;  1T5E A;  3ETQ A;  3PN1 A;  4F6R A;  4JI5 B;  4JI8 B;  5LOV B;  1B04 A;  5LXT B;  4O4J A;  4NXM B;  3WB1 A;  4X62 B;  3K5O A;  4LF5 B;  5IYZ A;  3UQ8 A;  5JQG B;  4X20 A;  4LF7 B;  4IIJ B;  3SJC C;  4CS4 A;  1XNQ B;  3VQV A;  3ZED A;  4LFB B;  3VQY A;  2JVD A;  2UU9 B;  1XNR B;  5D5Q A;  2UXD B;  4LF9 B;  2UUB B;  4LFA B;  5LP6 B;  2PYL A;  1Q43 A;  4X1I B;  4UCU A;  2GV9 A;  2PYJ A;  5JJJ B;  4I55 A;  1WN7 A;  5C8Y B;  2HEP A;  4FFB A;  3VQW A;  2ZNI A;  4BW9 A;  4EB6 A;  1JJO A;  4FLY A;  4ZI7 B;  2ZNJ A;  4CC5 A;  1HR0 B;  1ZAU A;  4O4L B;  4DK1 A;  5CA0 B;  5FPO A;  4DV5 B;  5JJE B;  4I4T A;  5KX5 A;  3SJA C;  2QJ1 A;  5JH7 A;  2VQF B;  5LYJ A;  2IM9 A;  5IJ9 B;  4X1K A;  4CH3 A;  4KL1 A;  3JSL A;  4DUZ B;  4HNA A;  1TAE A;  4YY3 B;  2VWJ A;  5KMG A;  4D7S A;  3JAR B;  4DR2 B;  1TVK A;  3U10 A;  2UUA B;  3HKD B;  4LNU B;  5EZY B;  2YI9 A;  5K1P A;  4AHC A;  3QTC A;  1H2S B;  4O2B A;  3RYH B;  3N2G A;  4YJ2 A;  1D5A A;  4HBN A;  5D5P A;  1Z5W A;  4NXN B;  4O4H B;  5ITZ B;  4U3J B;  4KHP B;  5GON A;  4DR1 B;  3RYI A;  2UXB B;  4NVP A;  4X1Y A;  1QHT A;  3E22 A;  3U0Z A;  1TGO A;  4O4I B;  5JJN B;  2F95 B;  3T1H B;  3HKC B;  5KHK A;  4CS3 A;  1NT2 B;  1IBM B;  1HNW B;  3UT5 A;  4K8X A;  5EYP A;  5J2U B;  4LF8 B;  4LR3 A;  4Q6G A;  4DK0 A;  4K0K B;  3RFR A;  4TV9 A;  4FLU A;  4JI3 B;  4WBN B;  1N34 B;  3JAW B;  3N2K A;  1I94 B;  2E3C A;  4FM0 A;  1VF7 A;  2ZIM A;  1HW7 A;  4OX9 B;  5CA1 A;  5LP6 C;  4ZHQ B;  3RYF A;  4PHZ A;  4JI4 B;  5IJ0 A;  4CH5 A;  3OTO B;  5IYZ B;  4GYC B;  1HNX B;  4X20 B;  1TUB A;  1DGS A;  2E5L B;  1KMI Z;  3QG5 A;  5BMV B;  3BA8 A;  2P5O A;  4EFB A;  1IBK B;  2P22 C;  4LF4 B;  2Q7H A;  3JAK A;  1FJG B;  3K59 A;  2F1M A;  4I55 B;  4ZOL B;  4TUY A;  4DV3 B;  5JVD A;  4GLX A;  3RGB A;  5KHG A;  4I50 B;  3SR2 C;  4DR5 B;  1I7F A;  1KU9 A;  2V4D A;  3K57 A;  4EFE A;  2BTQ A;  5FPR A;  1N36 B;  5JH7 B;  4FLT A;  3K5M A;  2ZIO A;  3HKB B;  3A2F A;  3BA9 A;  5LYJ B;  4B08 A;  4X65 B;  1HNZ B;  3BAB A;  5LOV A;  5LXT A;  4DR7 B;  3BRC A;  4UFZ A;  2PGG A;  2JGU A;  1XMQ B;  2JS5 A;  4JI6 B;  5KMG B;  3JAL B;  4UCS A;  3JAT B;  1TA8 A;  2VQE B;  4DV4 B;  4DV6 B;  3CB2 A;  4FM2 A;  4O2B B;  3N2G B;  2RJZ A;  4YJ2 B;  5CB4 B;  4DV7 B;  1JFF B;  5LP6 A;  1Q8I A;  3K5L A;  1WPB A;  4X1I A;  4DV0 B;  1V9P A;  4TV8 B;  4IHJ B;  3RYC B;  2XHB A;  2OWO A;  4TOI A;  4UCR A;  4B3R B;  5C8Y A;  1XHX A;  5LA6 B;  3ZS8 C;  1YEW A;  3OTF A;  5J2T A;  4YHH B;  5KHH A;  4ZI7 A;  4FLZ A;  4O4L A;  4PI0 A;  2R70 A;  2QM4 A;  4YJ3 A;  4GKK B;  4I9Q A;  1N32 B;  4O2A A;  3N2K B;  1L8D A;  1M4U A;  4ZIB A;  4JI2 B;  4TQF A;  4JV5 B;  5IJ9 A;  4CH6 A;  2R9A A;  2YXL A;  3VQX A;  1Q5O A;  4LF6 B;  3RYF B;  1FFX B;  3DSQ A;  5IJ0 B;  5JCO C;  4CS2 A;  3HKD A;  1X4T A;  4LNU A;  3MAQ A;  1N33 B;  5EZY A;  1O9H A;  3WB2 A;  3BAA A;  4F6R B;  4AQY B;  3RYH A;  4AIL C;  2KKW A;  1S5J A;  4O4J B;  2HHH B;  4O4H A;  1M5I A;  5ITZ A;  4U3J A;  2PY5 A;  2BTO A;  2YIA A;  4TUY B;  3HKE A;  4O4I A;  1XMO B;  4X64 B;  2Q7G A;  1SQG A;  5J2U A;  2VWK A;  3SGI A;  4DV1 B;  2PZS A;  1JMK C;  5FNV A;  2YIB D;  4WBN A;  3JAW A;  4FFB B;  3JSN A;  2CAZ C;  4TQD A;  4EB6 B;  2ZIN A;  2ZCE A;  2YIB A;  3M7M X;  4CH4 A;  1XHZ A;  4DRX A;  3IAY A;  1XI1 A;  4ZHQ A;  3FFQ A;  2R72 A;  2OYQ A;  1SA0 A;  3JAS A;  4I4T B;  5KX5 B;  5K1X A;  5EIB D;  4CC6 A;  5BMV A;  5LMN B;  3BPZ A;  2F93 B;  4X1K B;  5BR8 B;  1M93 A;  4PI2 A;  4EEQ A;  4HNA B;  4LH6 A;  5JQG A;  1XQ8 A;  3LNN A;  4IIJ A;  1TVK B;  4ZOL A;  5JCO A;  1IBL B;  5KHI A;  3K5N A;  5J2T B;  4DUY B;  4UCT A;  4DR4 B;  4I50 A;  4FLW A;  4UCO A;  2F66 C;  1Z5V A;  4YJ3 B;  5GON B;  3RYI B;  2PUS A;  4GKJ B;  4X1Y B;  3B2E E;  2ZM6 B;  3E22 B;  4UCV A;  4O2A B;  4B3S B;  3HKB A;  4B3T B;  5CA0 A;  4JYA B;  3UT5 B;  5EYP B;  4X66 B;  4K8Z A;  1J5E B;  3BHP A;  2Q0A A;  2Q7E A;  3CSX A;  2UXC B;  4TV9 B;  4FLX A;  1O9G A;  5KHJ A;  3JAL A;  1WNS A;  3JAT A;  3SJB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...