3ZS8C

S. cerevisiae get3 complexed with a cytosolic get1 fragment
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
67
structure length
67
Chain Sequence
b'NELSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHLHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATPASE GET3
publication title The Mechanism of Membrane-Associated Steps in Tail-Anchored Protein Insertion.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
total genus 29
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3zs8C00
3SJAC 1X4TA 2F66C 3SJBC 3QF7A 3B2EE 3THOA 3ZS8C 3ICXA 2P22C 3QG5A 3SJCC 2CAZC 3CSXA 1SKVA 1NT2B 2JS5A
chains in the Genus database with same CATH superfamily
3BABA 3K0GA 1HP8A 4NXNB 3ZJZA 4DV7O 1FFXB 4JGSA 5CA0B 4KUMA 3OM3B 1YXBA 1G8MA 4MTXA 1FXKB 5GONA 1RPOA 4I9QA 2Y4TA 2XNDG 2AGAA 1DK1A 4E2LA 3SPCA 2F23A 2P06A 4UB6Z 4GYCB 3ZRVA 2VQEB 1V55C 1MNGA 2UXDB 1K5SA 3WU2Z 4KHPB 2EIKC 5H6RA 3BFRA 4PDRA 5GTIZ 2XAGA 1IXMA 4GZRB 4EKWA 4BIOA 1P7GA 1PP9H 3UKMA 4JTAB 2BCCH 1KYOF 3CC2V 4LCUC 3H9VA 4X62B 2H94A 2QTOA 3JD0A 1FJGO 1JJOA 1NQTA 3H1LH 1K9MW 4GKKB 1WJZA 5B3SC 1YEWA 1BZKA 2Y0IA 3STZC 1QHTA 5JCOC 3E22B 3OGCC 1QLEC 1IXBA 1OCCB 1VEWA 1PNLA 3DXRA 2P67A 3VOUA 3R66A 3UT5B 1JX9A 2UUBB 4CC6A 3CEIA 2ZXWC 1P4RA 2UUCO 1KBHA 2EINB 3APOA 3CCJV 1Q8IA 3PJSK 4JI0B 4DR4O 3WB0A 1I7FA 1K3EA 4Q20A 2H8PC 2DJVA 4RQFA 5FPRA 4DR5O 1JA8A 5L3EA 4YIOA 1SRYA 2ZR3A 1WPXA 1R1BA 3G4SV 5LYJA 1JFFA 1M4UA 4O4LB 1N8RW 3JD4A 3HKCA 5IJ0B 4QPKA 2UXBB 2JEXA 2E74B 4I55B 4LFCB 4TSFG 2Z0AA 3QO8A 4JI5O 1YF2A 3C90A 4CH3A 3ABMB 3L74H 1QLNA 4CBCA 3D3QA 1Q7YW 3BVOA 2PF4E 3CRAA 1IBLB 4FLWA 4YIPA 3CJHA 3S3XA 5B1AC 5EYPA 2R70A 1VQ5V 5KUMA 5BY1A 4WBNB 1L1FA 1I5XA 4JV5O 1N34B 3J81N 1NI8A 1BS3A 1N33O 5EZYB 3CXCU 3DGEA 2DYRC 4JI2B 3AG4B 2ADPA 1BHBA 3KZIZ 4HNAA 5JJEB 4TT3G 4FLZA 4B3MB 4X1KA 4EB6B 5EIBC 2X6AA 1Y67A 3GWKC 4UUJC 4BR6A 3KG2A 3I5DA 1NTMH 4Z2WA 2CTWA 3F7YC 5JJJB 2VQFB 3AG3C 1U96A 2ETNA 5JVDA 1P84F 2QDOA 3THOA 3BEHA 2HKOA 3CX5F 4CH5A 1LUVA 3AG1B 3F5TA 1IBKO 2NN4A 2WA4A 2GDSA 1NBMG 4NTWA 4H44B 2DYSB 2YI9A 4QPJA 4Z1MG 5EBWC 4JI4B 4JAAA 3N2KA 5LP6C 1JJ2U 4W4LA 2AHZA 3SYOA 4DR1B 5DECA 1AI7A 3J80N 3JD1A 2JVDA 3ZMUA 2F93B 4UXNA 5FLXN 5J2TB 3RW0A 3BRCA 1H2NA 4JAUA 4LF4O 2PY5A 3U11A 3CMEV 1F51A 3K3WA 4K0KO 1FFXA 3TCUA 3FYIB 5CA0A 2EX3A 2KKWA 2EILC 3A8TA 1FXKA 1GN2A 3QTCA 2W6IG 4AHCA 5LMNB 2IM9A 1M5IA 1H2GA 1VQKV 5TISZ 4RQEA 4LF8O 2F66C 4JTCB 3MAQA 1PPJH 3RYFB 2KG7B 4H13B 4UVBA 4U3JB 4BIUA 2GUZB 3CD6V 1ENVA 2OT5A 4FM1A 3LSQA 3FAVB 3SJAC 4CS4A 3NXSA 3CRMA 3WB1A 2LGWA 5D5QA 4FVMA 4TUYB 2RMKB 4P2ZA 2M6YA 1VQ7V 3CPWU 4UCSA 3JAKA 1IX9A 2YS8A 4W4KA 3IC7A 4JYAO 4DK0A 4IYHA 3AG7A 4XDJA 3U10A 2QWPB 4DV1B 2FTKA 2CAZC 3ZMTA 3E22A 1MSDA 1S3JA 2XAFA 3JAMN 2QEXV 3JSLA 1BQZA 1GTOA 2E76B 2ZM6O 1XMQB 4DV5O 3UT5A 4I50A 3OR7C 1SQXH 3CE2A 2HHHB 4B08A 1SQVH 2OCHA 3DC5A 1WP8A 5LGUA 1URFA 1SETA 3MHSC 4J9YB 1XNQO 3L71H 4MW3A 3JASB 4X88A 3CC4V 5IY5B 1ZAUA 3OUSA 4IL6Z 2CTPA 5HFLA 3JD3A 1N32O 1Q86W 2WLLB 4LFAB 4WFGA 1NZ6A 5H2FZ 4DV1O 2QA4V 2ZDIA 1EM1A 1Q43A 1VF5B 4X20B 1YVWA 4O4LA 1XNRO 3DTUB 4L87A 3SGIA 2PGGA 4I4TB 1VF6A 1NU1H 4FLUA 1XMQO 5L3FA 1UFIA 1BMFG 1TUEB 5CA1B 3KCYA 4TV8B 4I55A 2IJKA 1AR1B 1CXZB 2HEPA 3ZHQA 4DYLA 2EJ7A 1S72V 2QR4A 2WLJA 4X65O 3B2EE 4R7CA 3AEIA 1VIBA 4UCUA 1BQ0A 1XMOO 2JRIA 3DC6A 4PI0A 4JI1B 2YXLA 3E8HA 4X89A 2IJHA 4B3RO 1FAFA 3CSXA 2UUAO 1HR0O 3CCUV 4NXMB 5IYBO 5EZYA 2L35A 5LA6B 2ZNIA 4JI3O 1JCHA 2EIJC 4HAMA 2Y4UA 4UCVA 4EB6A 2ITCC 3MHHC 4UCRA 1QVFU 1R73A 2UU9B 1OCZB 4TV9B 4B3SB 5BXZA 5IWAO 1NT2B 2Q7EA 5LMUB 4LF7O 3KKYA 4JI1O 2Y0PA 2QM4A 5F2VO 5JWPA 3AG2C 2B1IA 1XL4A 1BGYH 2RN9A 2ZD9A 5KAFZ 4DR7B 2X6BA 1N36O 1RPRA 2F95B 4PD4F 5J2TA 2Y69B 3ETQA 2A7WA 1IBMB 2OIGA 3ABLB 2QKAA 3RYHB 4O4JB 3ABKB 2X7RB 4K8ZA 5CBHA 1T5EA 2ARHA 4O2AB 1GRJA 3RYCB 5L3DA 3VQVA 2YUAA 3JCUZ 4PI2A 4DV4O 2ZE5A 3RYFA 2KG7A 2NLJC 3ZHSA 4U3JA 1GM9A 2GUZA 3CCMV 2PYJA 1IBMO 1H2LA 2ODMA 3JCZA 1VARA 4C7UA 2QJ1A 4CS2A 3G6BA 4TUYA 3K0DA 2WLIB 3OGIB 3JALB 2Y48A 1MZFA 4XDLA 2F4VB 2V7QG 1XILA 2Z3YA 2EIMC 4DR2B 4DR3O 3SPIA 2XHBA 1CPYA 5J2UB 4GX1A 4GCZA 4MVQA 3CCSV 1AB3A 3BHPA 4RAIA 1I0HA 4DK1A 4PHZA 5IT9N 5B1BB 2IU0A 4DV7B 1X59A 3JSNA 1YTFB 3K79A 3N27A 4FFKA 4JYYA 2YIAA 5CB4B 1U97A 3ZN0A 4MS2A 5B1NA 1AI5A 3J7AU 3B4SA 5IJ9B 3X2QB 2EBOA 2RQ6A 4MSWC 4DV6B 1Q6IA 4LF5O 2R9AA 1H2MA 3JASA 4X8AA 4ZBMA 1QBZA 3E83A 3CRCA 3BPZA 2QWNB 1LUWA 3LDDA 3ZRXA 1QCEA 1FXVA 2OIEA 4QGPA 1R3IC 4EFEA 3OE7G 1FD9A 1UJWB 4I4TA 1X4TA 2HG5C 3ZRSA 4FLYA 3CB2A 5CA1A 4I5SA 2HVJC 2R72A 4TV8A 3ZHRA 2QWQB 4UV9A 4JI8O 2D2CB 1FJGB 1M93A 1NVPB 1FFTB 1KC8W 4GLXA 3ASNC 4DV6O 1OCRC 2CTRA 1SESA 4YY3O 4AQYO 2P7TC 2OYQA 1O9HA 1S76D 1IZ3A 1N0NA 3DSQA 2P6JA 3T2MA 2MK3A 4PELA 1S5JA 4AI8A 4UFZA 2ZCEA 3OEHG 3WG7B 5KHKA 1D2DA 3SR2C 1DGSA 4WFEA 2ZE6A 2UUCB 2LO1A 1SA0B 5EC1C 4DR4B 1RFYA 3P3NA 1AJQA 1R6KA 3JARB 3L73H 2JGDB 4FZ1A 2DW4A 2G38A 1F4NA 4DR5B 3OD4A 3CCLV 1YTFD 1MMMA 1GN3A 4BIZA 1WPBA 3SPHA 2R9IA 1VQ6V 3ZMSA 1LNQA 2QKCA 3T1YB 4PA4A 4TV9A 2LQTA 3D36A 1S5LZ 5K1PA 2OCCB 2IW5A 4UV8A 3ZHVA 4JI5B 1RM1B 3JAWB 5GTHZ 3PN1A 1OCOC 1QR9A 2IJIA 1S0VA 1CEZA 3OTFA 2BTQB 3D3IA 1EN4A 3CC7V 1B3QA 1M57B 2Q8VA 5IYZA 4DV2O 3QVNA 4GX2A 2QM8A 5DN6G 1TAEA 2NNUA 2N04A 1E1RG 2LW7A 3ABUA 1NR7A 2RNBA 1NVPD 4K8XA 3NR7A 3T1YO 2EZPA 3L75H 4JV5B 3RYHA 1BL8A 4O4JA 5H9CA 2N74A 2WLMA 1E1QG 2Q5ZA 1AR4A 2CE4A 2YXYA 2DWEC 1N33B 4X66O 3UQ8A 3HKDB 4O2AA 1AP5A 2YICA 3RYCA 2KB1A 2DN9A 3LSUA 3W7TA 2WLKA 5CMUA 1FYJA 5C93A 5FPOA 2BTOA 1K97A 4I9WA 1WAZA 4O4IB 3GB7C 1WN7A 1CP9A 3UCSC 1SQPH 4BW9A 2K9PA 3H1HH 1AI4A 2MW2B 2ADQB 1GAXA 1YDXA 1IBKB 3O9OA 2WLIA 1SF9A 4NYKA 3JALA 3T4DA 4LC1A 1M1KW 5KX5A 3RT3C 3JATB 4IHJB 2CDYA 4DR6O 5J2UA 4LH7A 3B77A 3E89A 1AJPA 2JS5A 4OGQB 2ITDC 1M56C 3C3SA 4LF4B 2LGQA 4DV0O 1ZL8B 2QWOB 4PA6A 2AW9A 4K0KB 4ZOLB 2B9ZA 1E79G 3JD2A 3OMIB 3I55V 4E4EA 5HFMA 1FKAO 2HR3A 3RVYA 1SKVA 5CB4A 1NTKH 4KL1A 4PA7A 4MTFA 4FJCC 5IJ9A 1XHXA 1ZWIC 4ZKIA 3STLC 4NB5A 3E2EA 4LF8B 1VQNV 4D7TA 1HWYA 1MOFA 4ICGA 5FL7G 3TXSA 4FM0A 1YI2V 2ZNJA 3ASOB 4I0XA 3VBBA 3AK2A 1KKCA 2GV9A 3JYCA 2F43G 3LNNA 1D5NA 1W59A 3H1IH 2XTAA 3P30A 4K35A 3ZIAG 1PM9A 1PNMA 3BCCH 4IGGA 4FFBB 2XUMA 4JYAB 1ORQC 3OMNB 1VQ4V 2A0LA 2A79B 4NR1A 3OTOB 3HKEB 4P9PA 5LGTA 1V55B 3B40A 5LGNA 5B1OA 1TUBB 4WFFA 2EIKB 5EK0A 4MVRA 2ZM6B 2R9RB 3CHXA 4DV5B 3LDEA 1H2SB 5IYCO 2HP8A 2Q73A 3Q4HB 3F7VC 4DXWA 3T1HB 2PI5A 2IJJA 1W0JG 2GTSA 3FB7C 1I08A 1LR1A 4GT1A 1QVGU 1IURA 2LW1A 2EZOA 1XNQB 1JQ0A 3JARA 1Z5VA 2JGDA 3CWBH 2KQXA 3W7XA 5B3SB 3VQYA 1N32B 3VQXA 4H33A 2WPDG 4F6EA 1VQ9V 4X9QA 1Y74B 3FB5C 4JTDB 2WAMA 1QLEB 3BAAA 3L70H 4F4LA 3OTOO 3M8AA 2A3QA 1M9NA 5L3BA 1GO3F 1XNRB 1R6NA 3QF7A 3IFXA 4U7OA 1H38A 2OWOA 2YDEA 1BE3H 5CN0A 2ZXWB 4PJ0Z 2WLNA 4MVOA 4OXSA 4DW0A 1SQFA 2P4VA 1YSCA 3T1HO 4ABMA 4AILC 4PA9A 2CH7B 5LL6Y 4X65B 2LFRA 2BTQA 5LOVB 3K9AA 3OFNG 1XMOB 1I5YA 3ZRWB 1YHQV 5BR8B 1DLBA 2XOKG 5LBQA 4GX0A 1R3KC 1Q82W 1NJIW 4B3RB 4F6RB 1DTOA 2UUAB 4UCTA 1HR0B 1GH6A 2W0FC 4RWUA 1HDJA 1VP7A 3HR0A 2P5OA 3EFFK 1R3JC 5IJ0A 4JI3B 4LF6O 4B3TO 3HKDA 1B04A 4MVZA 2CTQA 1XOUA 5H5NA 4HZ3A 2Q4PA 5B5EZ 5BMVB 5E79Z 1HNWO 2W0XA 4RUFA 2OTLV 4J10A 4O4IA 5B1AB 1VQPV 5KMGB 1KECA 4TWKA 5AG2A 1EN5A 5IWAB 3IC9A 4LF7B 1P49A 5BR8O 2E5LB 4LFBO 2DWDC 4WBNA 3CS5A 1FXKC 2PZSA 2DYRB 4HYOA 5D5PA 3S3WA 1HNZO 2WLHA 3M99B 3E8GA 1SQGA 3CCEV 3OT7A 3SPGA 3LSSA 1N36B 2HJFC 1B06A 3FFQA 2A06H 4H37A 3E86A 4LF9O 3K5NA 1XDCA 2EULA 4LR3A 1K92A 1Y66A 3LDCA 1OHHG 4IIJB 3AG3B 4YHHO 4P30A 4DV3O 1ZL8A 1WLEA 4ZOLA 3K5OA 2CGOA 1TGOA 4JZGA 4DUZO 5LHGA 1O9GA 2E5LO 2GTAA 1L0NH 2VWJA 2E3CA 5LP6B 5JH7B 1YJWV 2YIBD 2QE7G 2XASA 1FXHA 4DV4B 3R65A 4BAYA 3BY6A 4RO2A 1BT8A 1OCCC 5KAIZ 1ZSPA 5A9GA 2AXTZ 3AK1A 4JI6O 2VS0A 1COWG 3TETA 2XAQA 1BHAA 1KUQA 2EILB 3FB8C 2EINC 3OW2U 1HNXO 4FFBA 4UVCA 2YEVB 4DUYB 4TOIA 2JJ1G 4DR3B 1KU9A 5KHIA 1J95A 1AP6A 1F23A 3HKEA 1I94O 1K73W 1HW7A 4FPPA 3W7WA 1YJNV 1NS1A 1WP7A 1PD3A 4FK5C 1Q81W 1TUBA 1OJHA 2Q0AA 2ZDIC 1BSMA 1IDSA 1QQCA 2IH1C 3HKCB 1WB8A 2QSAA 3ETGA 3QG5A 4Q6GA 3Q4HA 2RJZA 4OPHA 1VF6C 3FAVA 3SJQC 1BCCH 5EIBD 1Q5OA 2HVKC 4FLXA 3QO7A 4LF5B 3ABMC 3TGUH 3H1JH 1SQQH 2IU3A 2Q69A 3T1CA 4G28B 3T4ZA 1K5QA 3SYAA 1XHZA 3ZEDA 4JAVA 1PL0A 4DRXB 3H01A 5JCOA 1Y74A 4DUYO 5EYPB 2E75B 2Q68A 4X64O 3F5WC 3A2FA 2LP7A 1R3LC 1GN6A 2H3OA 5A2QN 4MVMA 3SYCA 4LWSB 1MA1A 4MVSA 2B5UA 1D5AA 5KHGA 2JDIG 4JI8B 1TA8A 2DOSA 3TJTA 3AG4C 2CH7A 2QKSA 4X1KB 4YJ2B 4YY3B 4AQYB 5LOVA 5IDJA 3ML0A 4CZZA 1KP3A 3ZRWA 2Q7GA 2WLLA 3K04A 2XT9A 4X1IB 1NH2D 4F6RA 2WSSG 4L8JA 4X20A 4FM2A 4WFHA 3HB3B 2JK5C 3TK1A 3AG1C 1H2KA 4EFBA 2DYSC 2PYLA 2FMLA 3MDSA 1IVSA 5BMVA 3G6EV 4UVAA 2CK3G 3UM7A 4GUNA 1SS3A 4JZ2A 1AI6A 4X1YB 5KMGA 2GSMB 1VQLV 2BOCC 1GN4A 3FX7A 4JPRA 3K03A 2Q6AA 1RSOB 3ICXA 4JASA 5LHHA 5B66Z 5EBLC 2P90A 4EEQA 3RYIB 5LXTB 4BWAA 4OX9O 4XDKA 5LA6A 2EIJB 4JYBA 2LFSA 4LH6A 3ZMVA 4DV2B 2F1MA 3FB6C 2UXCB 1H8HG 4JI7O 5H6QA 1XBLA 4QNHB 2LJ2A 4QJFB 1MABG 4IIJA 1R6TA 4U7NA 2B1GA 1NR1A 2ZQMA 4NXNO 3HPLC 4X66B 4PDVA 1L8DA 3K9SA 1QU7A 4DW1A 3AG2B 3JAKB 1MSWD 2Q7HA 1Q90D 2QTSA 3CCVV 5LP6A 5JH7A 1WB7A 4G27B 4WFBV 2OTJV 2JEUA 3EXAA 2VQEO 5DM6V 2UXDO 2UXCO 3OUFA 4KHPO 4I50B 3K5MA 1XI1A 3B8MA 3RWRD 3UO2A 1NKDA 2AZ0A 3I56V 3ZHUA 2K1EA 5IE9A 4XBFA 1Z5WA 4J41A 3SDLA 4I7ZB 1SZTA 4X62O 1NTZH 3P3PA 2YEVA 5L3CA 5IY5C 1OV9A 4PDLA 4GKKO 4DR6B 4IYIA 1TVKB 2A9HA 5KLVH 3K06A 1Y76B 1W2BU 1S77D 4LBEC 3HKBB 4NTYA 4NKGB 4DV0B 1AVMA 5E1AC 2VRZA 2IBZH 2UUBO 4B7EA 5KA6A 4R8CA 3FKSG 1Z2GA 1WA8B 1YITV 4NTXA 4JI0O 2ZIOA 1G1XB 2EIMB 1SQBH 1K33A 4DRXA 1PKXA 3RVZA 2BOBC 3N2GB 4KFMA 5FNVB 2P22C 1GKFA 3E8FA 1V54C 3SYPA 1JMKC 4P9OA 3CCRV 4O2BB 5IYDO 3OR6C 2YIDA 1PNKA 4LWSA 2DE0X 1ZUQA 1ZLZA 2UXBO 3CYOA 3O65A 1XQ8A 4LFCO 1MZEA 2IH3C 2WWWA 4YJ2A 2Q67A 5JQGB 1M90W 4U3FH 1DF5A 1WNSA 2FKXA 3SJCC 1IBLO 1AILA 1OCZC 2BE3A 1VQOV 3D36C 4X1IA 5DEDA 2O57A 3SJBC 3E8BA 2M7WA 4BW5A 1QNMA 3B09A 1EZVH 1N34O 3QO5A 1UPGA 3QNEA 4Z1VA 2UXXA 4JI2O 1S5HC 1PV0A 4D6TH 1F4MA 1GM7A 3ASNB 3G80A 1OCRB 4YJ3B 2D3OW 4B3MO 2GHYA 3A0HZ 2Q9LA 4MTGA 2Y69C 1OZ0A 4X1YA 5CBGA 2ZT9B 1ZTEA 3K59A 2VQFO 4GKJB 3K08A 3A0RA 2NR5A 3ABLC 4MT8A 2BSKB 1JVMA 4ZHQB 1Q6UA 3ABKC 5J9PC 1RSOA 1GM8A 4J7JA 2PUSA 3ZCCA 4OPAA 3RYIA 2UXNA 5LXTA 4IT5A 3APQA 1PL4A 1SA0A 3L72H 4JI4O 2L6LA 1MG1A 5KHJA 3ABTA 2PTMA 3CXHF 2QM7A 4DR1O 1GMGA 1VQMV 2QWRB 1J5EB 3BA9A 1DF4A 1YJ9V 4CS3A 3K58A 1KKDA 5C8YB 1G4YB 3BA8A 1EZJA 4MW8A 4JYCA 1SERA 2Z5UA 1AJNA 2N05A 1AR5A 4ZI7B 4GKJO 2RDCA 3ETDA 5CBFA 1GK9A 2ILMA 4LNUB 5ITZB 4LF6B 1US6A 1V9PA 4B3TB 3L9DA 1H8EG 2HFEC 1OCOB 1HNWB 5LMNO 3JAWA 3RFRA 4LP8A 2DQ0A 2JJ2G 4HBNA 1VQ8V 4PA3A 1J5EO 3P32A 5B1BC 1KQSU 4QIWF 4LFBB 3B8NA 1KD1W 2VWKA 4B7KA 4WF9V 4O4HB 1P7BA 3X2QC 1HNZB 2JGUA 4KP4A 4MVUA 4J80A 3OEEG 2V4DA 3CCQV 2DQ3A 1TVKA 1Y76A 3SPJA 4LF9B 4K3AA 3ZS8C 4YXWG 3HKBA 4JF3A 4WCEV 4YHHB 3RN4A 3KCXA 3ZMZA 4DV3B 1K34A 2RCVA 2DMXA 4DUZB 3G71V 1F7YA 2HJDA 3ZHTA 4FMTA 5KA5A 4D7SA 2HHHO 4QE9A 1EN6A 3MD0A 3CRQA 2JS3A 2P4KA 5K1XA 5GONB 4CH6A 3FD9A 2CUGA 3A0BZ 3TXQA 1THZA 1WA8A 4J42A 5BZBA 4FZ0A 1A32A 3IJ4A 1YCIA 1KMIZ 2FB5A 5EC2C 3JATA 3AK3A 1V54B 3N2GA 4IHJA 5FNVA 4RUEA 4LFAO 1M56B 3GWOA 4O2BA 4JI6B 4NVPA 4J7ZA 3CRRA 1ZX3A 4A5UB 1W0KG 3WG7C 1QR8A 5KHHA 4J7KA 1KP2A 2JIZG 2WA3A 4PV1B 1HNXB 4WFAV 2FL4A 2X0LA 5LHIA 4MTOA 2ZKOA 4FLVA 5JQGA 4KXRA 1I94B 2AZ2A 3U0ZA 4R6ZA 3WB2A 1RP3B 2HLDG 3D8CA 1JOYA 3UO3A 1AROP 3DXRB 1KB9F 3FYEB 4R50A 2ZIMA 4TQDA 2OCCC 1XL6A 1SZXA 2EJRA 4PDMA 4NXMO 1N0JA 4CC5A 3ZN1A 1RM1C 2GBOA 2XAHA 1NH2B 5IYZB 3CP1A 3LNMB 3ZBHA 1M57C 4YJ3A 3CMAV 3OMAB 3G67A 1VF7A 2YSUB 4X64B 3IAYA 2ZE8A 3K5LA 4UB8Z 3SYQA 2UU9O 5LYJB 3ZX6A 1JFFB 4B3SO 2ZR2A 1K4DC 3GVMA 5LMUO 2XAJA 1N4CA 2BSKA 5JJNB 3W7UA 4UCOA 4ZHQA 1Y4MA 1SC5B 1L0LH 3M7MX 1YZBA 4ASUG 1K8AW 3EHBB 2W6JG 4J11A 2C2AA 1ROPA 4TQFA 1Q6HA 1Y6XA 4DR7O 4CH4A 3OAAG 4H0LB 3CJHB 1XUQA 1JPXA 1B6QA 2ZINA 1K4CC 5C8YA 2YC0A 2PI4A 4G2KA 4N21A 2AHYA 1K7DA 3EVKA 4ZI7A 4FIPC 1EBOA 4LNUA 5ITZA 2FYUH 4GX5A 2ZE7A 5KX5B 1XREA 5EBMC 2QGNA 2CGNA 4HNAB 3WFVA 1FS0G 3K57A 3RBZA 2KSDA 1FPOA 3ETEA 3RGBA 1XEQA 5L3GA 5CA3A 3H1KH 3LUTB 3E35A 5JVDB 3C3TA 1G6UA 3W7SA 2YXHA 3IGAC 1VMGA 4N23A 2YIBA 4ZIBA 2ATKC 4QE7A 5GW7A 2X6CA 4DO2A 5KUKA 4O4HA 1JR9A 1YIJV 4OX9B 3N2KB 2V1DA 2F4VO 2YI8A 1EFRG 1Q3EA 2Q0OC 4FLTA 4I0XB 4JI7B 4DR2O 4J9ZB 3ASOC 3VQWA
chains in the Genus database with same CATH topology
1XNRB 3QF7A 3BABA 2OWOA 4NXNB 2ZIOA 4DR7B 1FFXB 5CA0B 4DRXA 2F95B 5J2TA 3N2GB 5FNVB 2P22C 3ETQA 1SQFA 5GONA 1IBMB 4AILC 1JMKC 4I9QA 4O2BB 4X65B 2BTQA 5LOVB 3RYHB 4O4JB 4GYCB 2VQEB 1XMOB 2UXDB 4K8ZA 1XQ8A 4KHPB 5BR8B 1T5EA 4O2AB 3RYCB 4B3RB 4YJ2A 3VQVA 4F6RB 5JQGB 2UUAB 4UCTA 1HR0B 4PI2A 1WNSA 2P5OA 3SJCC 3RYFA 5IJ0A 4JI3B 3HKDA 1B04A 4U3JA 4X1IA 4X62B 1JJOA 3SJBC 5BMVB 4GKKB 2PYJA 1YEWA 2QJ1A 1QHTA 5JCOC 4CS2A 3E22B 4TUYA 4O4IA 5KMGB 3JALB 5IWAB 2F4VB 4LF7B 3UT5B 1P49A 2E5LB 2UUBB 4DR2B 4CC6A 4YJ3B 2XHBA 5J2UB 4WBNA 2PZSA 4X1YA 3K59A 3BHPA 5D5PA 1Q8IA 4JI0B 4DK1A 4PHZA 4GKJB 3WB0A 1I7FA 4DV7B 1SQGA 3JSNA 5FPRA 2YIAA 4ZHQB 1N36B 5CB4B 1RSOA 3FFQA 2PUSA 3K5NA 4LR3A 5IJ9B 3RYIA 5LXTA 2RQ6A 5LYJA 4DV6B 1JFFA 4IIJB 1M4UA 4O4LB 1SA0A 2R9AA 4ZOLA 5KHJA 3K5OA 3JASA 1TGOA 2PTMA 3HKCA 5IJ0B 1O9GA 3BPZA 1J5EB 2UXBB 3BA9A 4I55B 4LFCB 4CS3A 3K58A 2VWJA 4CH3A 4EFEA 5C8YB 3BA8A 2E3CA 5LP6B 5JH7B 2YIBD 4I4TA 4ZI7B 4DV4B 1X4TA 1IBLB 4FLWA 4FLYA 4LF6B 4LNUB 3CB2A 5CA1A 5ITZB 1V9PA 4B3TB 2R72A 4TV8A 5EYPA 2R70A 1FJGB 1M93A 1HNWB 4GLXA 3JAWA 3RFRA 4WBNB 4HBNA 1N34B 1O9HA 2OYQA 5EZYB 4JI2B 3DSQA 4FFBA 4DUYB 4HNAA 5JJEB 4TOIA 4FLZA 4DR3B 4B3MB 1S5JA 1KU9A 4UFZA 2ZCEA 4X1KA 4EB6B 5KHIA 5EIBC 4LFBB 3HKEA 5KHKA 3SR2C 1HW7A 1DGSA 2VWKA 2UUCB 1TUBA 1SA0B 2Q0AA 4O4HB 5JJJB 1HNZB 2VQFB 4DR4B 5JVDA 1QQCA 3HKCB 2JGUA 3JARB 3QG5A 4Q6GA 2V4DA 2RJZA 4DR5B 3THOA 4CH5A 1TVKA 1WPBA 5EIBD 4LF9B 3ZS8C 3HKBA 1Q5OA 4FLXA 4YHHB 3T1YB 4LF5B 4TV9A 4DV3B 4JI4B 2YI9A 5K1PA 3N2KA 5LP6C 4DUZB 4DR1B 1XHZA 4D7SA 3ZEDA 2JVDA 4DRXB 2F93B 5JCOA 5EYPB 5J2TB 4JI5B 3BRCA 5K1XA 5GONB 4CH6A 3A2FA 3JAWB 2PY5A 3PN1A 3U11A 3OTFA 2BTQB 1FFXA 1KMIZ 5CA0A 2EX3A 5IYZA 2KKWA 3JATA 1TAEA 3N2GA 4IHJA 5FNVA 1D5AA 5KHGA 4JI8B 1TA8A 3QTCA 4AHCA 4X1KB 5LMNB 2IM9A 4O2BA 4YJ2B 4NVPA 4JI6B 4K8XA 1M5IA 4YY3B 4AQYB 5LOVA 4JV5B 3RYHA 4O4JA 1N33B 5KHHA 2F66C 3MAQA 3RYFB 3UQ8A 3HKDB 2Q7GA 4U3JB 1HNXB 4O2AA 4X1IB 4FM1A 3RYCA 4FLVA 3SJAC 4F6RA 5JQGA 4L8JA 4X20A 4FM2A 1I94B 4CS4A 3U0ZA 3WB2A 3WB1A 5D5QA 5FPOA 2BTOA 4FVMA 4TUYB 4O4IB 1WN7A 4UCSA 4EFBA 2PYLA 3JAKA 2ZIMA 5BMVA 4BW9A 4TQDA 4DK0A 3U10A 4DV1B 1IBKB 2CAZC 3E22A 4CC5A 4X1YB 3JSLA 5KMGA 3JALA 1XMQB 3UT5A 5IYZB 4I50A 5KX5A 3JATB 4B08A 2HHHB 4YJ3A 4IHJB 3ICXA 5J2UA 4LH7A 1VF7A 3IAYA 4X64B 4EEQA 3RYIB 3K5LA 2JS5A 5LXTB 5LYJB 4LF4B 1JFFB 4BWAA 5LA6A 4K0KB 4ZOLB 4LH6A 3JASB 1ZAUA 5JJNB 4DV2B 2F1MA 4UCOA 4ZHQA 1SKVA 5CB4A 2UXCB 3M7MX 4KL1A 4LFAB 5IJ9A 1XHXA 1Q43A 4IIJA 4TQFA 4X20B 4O4LA 3SGIA 4LF8B 2PGGA 4I4TB 4FLUA 4CH4A 4D7TA 4X66B 4FM0A 1L8DA 2ZNJA 5CA1B 4TV8B 4I55A 3JAKB 2HEPA 2Q7HA 2ZINA 5C8YA 2GV9A 5LP6A 5JH7A 3LNNA 3B2EE 4ZI7A 4UCUA 4LNUA 5ITZA 4PI0A 4I50B 3K5MA 1XI1A 4JI1B 2YXLA 4FFBB 5KX5B 3RWRD 4JYAB 4HNAB 3CSXA 3K57A 3OTOB 3HKEB 4NXMB 1Z5WA 5EZYA 3RGBA 1TUBB 5LA6B 2ZNIA 2ZM6B 5JVDB 3CHXA 4DV5B 1H2SB 1G6UA 2YIBA 4UCVA 4EB6A 4DR6B 3T1HB 1TVKB 4ZIBA 4UCRA 3HKBB 2UU9B 4O4HA 4DV0B 4TV9B 4OX9B 4B3SB 1XNQB 3JARA 3N2KB 1Z5VA 1NT2B 2Q7EA 5LMUB 2YI8A 1Q3EA 3VQYA 1N32B 3VQXA 4FLTA 4JI7B 2QM4A 3VQWA 3BAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SJA C;  1X4T A;  2F66 C;  3SJB C;  3QF7 A;  3B2E E;  3THO A;  3ZS8 C;  3ICX A;  2P22 C;  3QG5 A;  3SJC C;  2CAZ C;  3CSX A;  1SKV A;  1NT2 B;  2JS5 A; 
#chains in the Genus database with same CATH topology
 3BAB A;  3K0G A;  1HP8 A;  4NXN B;  3ZJZ A;  4DV7 O;  1FFX B;  4JGS A;  5CA0 B;  4KUM A;  3OM3 B;  1YXB A;  1G8M A;  4MTX A;  1FXK B;  5GON A;  1RPO A;  4I9Q A;  2Y4T A;  2XND G;  2AGA A;  1DK1 A;  4E2L A;  3SPC A;  2F23 A;  2P06 A;  4UB6 Z;  4GYC B;  3ZRV A;  2VQE B;  1V55 C;  1MNG A;  2UXD B;  1K5S A;  3WU2 Z;  4KHP B;  2EIK C;  5H6R A;  3BFR A;  4PDR A;  5GTI Z;  2XAG A;  1IXM A;  4GZR B;  4EKW A;  4BIO A;  1P7G A;  1PP9 H;  3UKM A;  4JTA B;  2BCC H;  1KYO F;  3CC2 V;  4LCU C;  3H9V A;  4X62 B;  2H94 A;  2QTO A;  3JD0 A;  1FJG O;  1JJO A;  1NQT A;  3H1L H;  1K9M W;  4GKK B;  1WJZ A;  5B3S C;  1YEW A;  1BZK A;  2Y0I A;  3STZ C;  1QHT A;  5JCO C;  3E22 B;  3OGC C;  1QLE C;  1IXB A;  1OCC B;  1VEW A;  1PNL A;  3DXR A;  2P67 A;  3VOU A;  3R66 A;  3UT5 B;  1JX9 A;  2UUB B;  4CC6 A;  3CEI A;  2ZXW C;  1P4R A;  2UUC O;  1KBH A;  2EIN B;  3APO A;  3CCJ V;  1Q8I A;  3PJS K;  4JI0 B;  4DR4 O;  3WB0 A;  1I7F A;  1K3E A;  4Q20 A;  2H8P C;  2DJV A;  4RQF A;  5FPR A;  4DR5 O;  1JA8 A;  5L3E A;  4YIO A;  1SRY A;  2ZR3 A;  1WPX A;  1R1B A;  3G4S V;  5LYJ A;  1JFF A;  1M4U A;  4O4L B;  1N8R W;  3JD4 A;  3HKC A;  5IJ0 B;  4QPK A;  2UXB B;  2JEX A;  2E74 B;  4I55 B;  4LFC B;  4TSF G;  2Z0A A;  3QO8 A;  4JI5 O;  1YF2 A;  3C90 A;  4CH3 A;  3ABM B;  3L74 H;  1QLN A;  4CBC A;  3D3Q A;  1Q7Y W;  3BVO A;  2PF4 E;  3CRA A;  1IBL B;  4FLW A;  4YIP A;  3CJH A;  3S3X A;  5B1A C;  5EYP A;  2R70 A;  1VQ5 V;  5KUM A;  5BY1 A;  4WBN B;  1L1F A;  1I5X A;  4JV5 O;  1N34 B;  3J81 N;  1NI8 A;  1BS3 A;  1N33 O;  5EZY B;  3CXC U;  3DGE A;  2DYR C;  4JI2 B;  3AG4 B;  2ADP A;  1BHB A;  3KZI Z;  4HNA A;  5JJE B;  4TT3 G;  4FLZ A;  4B3M B;  4X1K A;  4EB6 B;  5EIB C;  2X6A A;  1Y67 A;  3GWK C;  4UUJ C;  4BR6 A;  3KG2 A;  3I5D A;  1NTM H;  4Z2W A;  2CTW A;  3F7Y C;  5JJJ B;  2VQF B;  3AG3 C;  1U96 A;  2ETN A;  5JVD A;  1P84 F;  2QDO A;  3THO A;  3BEH A;  2HKO A;  3CX5 F;  4CH5 A;  1LUV A;  3AG1 B;  3F5T A;  1IBK O;  2NN4 A;  2WA4 A;  2GDS A;  1NBM G;  4NTW A;  4H44 B;  2DYS B;  2YI9 A;  4QPJ A;  4Z1M G;  5EBW C;  4JI4 B;  4JAA A;  3N2K A;  5LP6 C;  1JJ2 U;  4W4L A;  2AHZ A;  3SYO A;  4DR1 B;  5DEC A;  1AI7 A;  3J80 N;  3JD1 A;  2JVD A;  3ZMU A;  2F93 B;  4UXN A;  5FLX N;  5J2T B;  3RW0 A;  3BRC A;  1H2N A;  4JAU A;  4LF4 O;  2PY5 A;  3U11 A;  3CME V;  1F51 A;  3K3W A;  4K0K O;  1FFX A;  3TCU A;  3FYI B;  5CA0 A;  2EX3 A;  2KKW A;  2EIL C;  3A8T A;  1FXK A;  1GN2 A;  3QTC A;  2W6I G;  4AHC A;  5LMN B;  2IM9 A;  1M5I A;  1H2G A;  1VQK V;  5TIS Z;  4RQE A;  4LF8 O;  2F66 C;  4JTC B;  3MAQ A;  1PPJ H;  3RYF B;  2KG7 B;  4H13 B;  4UVB A;  4U3J B;  4BIU A;  2GUZ B;  3CD6 V;  1ENV A;  2OT5 A;  4FM1 A;  3LSQ A;  3FAV B;  3SJA C;  4CS4 A;  3NXS A;  3CRM A;  3WB1 A;  2LGW A;  5D5Q A;  4FVM A;  4TUY B;  2RMK B;  4P2Z A;  2M6Y A;  1VQ7 V;  3CPW U;  4UCS A;  3JAK A;  1IX9 A;  2YS8 A;  4W4K A;  3IC7 A;  4JYA O;  4DK0 A;  4IYH A;  3AG7 A;  4XDJ A;  3U10 A;  2QWP B;  4DV1 B;  2FTK A;  2CAZ C;  3ZMT A;  3E22 A;  1MSD A;  1S3J A;  2XAF A;  3JAM N;  2QEX V;  3JSL A;  1BQZ A;  1GTO A;  2E76 B;  2ZM6 O;  1XMQ B;  4DV5 O;  3UT5 A;  4I50 A;  3OR7 C;  1SQX H;  3CE2 A;  2HHH B;  4B08 A;  1SQV H;  2OCH A;  3DC5 A;  1WP8 A;  5LGU A;  1URF A;  1SET A;  3MHS C;  4J9Y B;  1XNQ O;  3L71 H;  4MW3 A;  3JAS B;  4X88 A;  3CC4 V;  5IY5 B;  1ZAU A;  3OUS A;  4IL6 Z;  2CTP A;  5HFL A;  3JD3 A;  1N32 O;  1Q86 W;  2WLL B;  4LFA B;  4WFG A;  1NZ6 A;  5H2F Z;  4DV1 O;  2QA4 V;  2ZDI A;  1EM1 A;  1Q43 A;  1VF5 B;  4X20 B;  1YVW A;  4O4L A;  1XNR O;  3DTU B;  4L87 A;  3SGI A;  2PGG A;  4I4T B;  1VF6 A;  1NU1 H;  4FLU A;  1XMQ O;  5L3F A;  1UFI A;  1BMF G;  1TUE B;  5CA1 B;  3KCY A;  4TV8 B;  4I55 A;  2IJK A;  1AR1 B;  1CXZ B;  2HEP A;  3ZHQ A;  4DYL A;  2EJ7 A;  1S72 V;  2QR4 A;  2WLJ A;  4X65 O;  3B2E E;  4R7C A;  3AEI A;  1VIB A;  4UCU A;  1BQ0 A;  1XMO O;  2JRI A;  3DC6 A;  4PI0 A;  4JI1 B;  2YXL A;  3E8H A;  4X89 A;  2IJH A;  4B3R O;  1FAF A;  3CSX A;  2UUA O;  1HR0 O;  3CCU V;  4NXM B;  5IYB O;  5EZY A;  2L35 A;  5LA6 B;  2ZNI A;  4JI3 O;  1JCH A;  2EIJ C;  4HAM A;  2Y4U A;  4UCV A;  4EB6 A;  2ITC C;  3MHH C;  4UCR A;  1QVF U;  1R73 A;  2UU9 B;  1OCZ B;  4TV9 B;  4B3S B;  5BXZ A;  5IWA O;  1NT2 B;  2Q7E A;  5LMU B;  4LF7 O;  3KKY A;  4JI1 O;  2Y0P A;  2QM4 A;  5F2V O;  5JWP A;  3AG2 C;  2B1I A;  1XL4 A;  1BGY H;  2RN9 A;  2ZD9 A;  5KAF Z;  4DR7 B;  2X6B A;  1N36 O;  1RPR A;  2F95 B;  4PD4 F;  5J2T A;  2Y69 B;  3ETQ A;  2A7W A;  1IBM B;  2OIG A;  3ABL B;  2QKA A;  3RYH B;  4O4J B;  3ABK B;  2X7R B;  4K8Z A;  5CBH A;  1T5E A;  2ARH A;  4O2A B;  1GRJ A;  3RYC B;  5L3D A;  3VQV A;  2YUA A;  3JCU Z;  4PI2 A;  4DV4 O;  2ZE5 A;  3RYF A;  2KG7 A;  2NLJ C;  3ZHS A;  4U3J A;  1GM9 A;  2GUZ A;  3CCM V;  2PYJ A;  1IBM O;  1H2L A;  2ODM A;  3JCZ A;  1VAR A;  4C7U A;  2QJ1 A;  4CS2 A;  3G6B A;  4TUY A;  3K0D A;  2WLI B;  3OGI B;  3JAL B;  2Y48 A;  1MZF A;  4XDL A;  2F4V B;  2V7Q G;  1XIL A;  2Z3Y A;  2EIM C;  4DR2 B;  4DR3 O;  3SPI A;  2XHB A;  1CPY A;  5J2U B;  4GX1 A;  4GCZ A;  4MVQ A;  3CCS V;  1AB3 A;  3BHP A;  4RAI A;  1I0H A;  4DK1 A;  4PHZ A;  5IT9 N;  5B1B B;  2IU0 A;  4DV7 B;  1X59 A;  3JSN A;  1YTF B;  3K79 A;  3N27 A;  4FFK A;  4JYY A;  2YIA A;  5CB4 B;  1U97 A;  3ZN0 A;  4MS2 A;  5B1N A;  1AI5 A;  3J7A U;  3B4S A;  5IJ9 B;  3X2Q B;  2EBO A;  2RQ6 A;  4MSW C;  4DV6 B;  1Q6I A;  4LF5 O;  2R9A A;  1H2M A;  3JAS A;  4X8A A;  4ZBM A;  1QBZ A;  3E83 A;  3CRC A;  3BPZ A;  2QWN B;  1LUW A;  3LDD A;  3ZRX A;  1QCE A;  1FXV A;  2OIE A;  4QGP A;  1R3I C;  4EFE A;  3OE7 G;  1FD9 A;  1UJW B;  4I4T A;  1X4T A;  2HG5 C;  3ZRS A;  4FLY A;  3CB2 A;  5CA1 A;  4I5S A;  2HVJ C;  2R72 A;  4TV8 A;  3ZHR A;  2QWQ B;  4UV9 A;  4JI8 O;  2D2C B;  1FJG B;  1M93 A;  1NVP B;  1FFT B;  1KC8 W;  4GLX A;  3ASN C;  4DV6 O;  1OCR C;  2CTR A;  1SES A;  4YY3 O;  4AQY O;  2P7T C;  2OYQ A;  1O9H A;  1S76 D;  1IZ3 A;  1N0N A;  3DSQ A;  2P6J A;  3T2M A;  2MK3 A;  4PEL A;  1S5J A;  4AI8 A;  4UFZ A;  2ZCE A;  3OEH G;  3WG7 B;  5KHK A;  1D2D A;  3SR2 C;  1DGS A;  4WFE A;  2ZE6 A;  2UUC B;  2LO1 A;  1SA0 B;  5EC1 C;  4DR4 B;  1RFY A;  3P3N A;  1AJQ A;  1R6K A;  3JAR B;  3L73 H;  2JGD B;  4FZ1 A;  2DW4 A;  2G38 A;  1F4N A;  4DR5 B;  3OD4 A;  3CCL V;  1YTF D;  1MMM A;  1GN3 A;  4BIZ A;  1WPB A;  3SPH A;  2R9I A;  1VQ6 V;  3ZMS A;  1LNQ A;  2QKC A;  3T1Y B;  4PA4 A;  4TV9 A;  2LQT A;  3D36 A;  1S5L Z;  5K1P A;  2OCC B;  2IW5 A;  4UV8 A;  3ZHV A;  4JI5 B;  1RM1 B;  3JAW B;  5GTH Z;  3PN1 A;  1OCO C;  1QR9 A;  2IJI A;  1S0V A;  1CEZ A;  3OTF A;  2BTQ B;  3D3I A;  1EN4 A;  3CC7 V;  1B3Q A;  1M57 B;  2Q8V A;  5IYZ A;  4DV2 O;  3QVN A;  4GX2 A;  2QM8 A;  5DN6 G;  1TAE A;  2NNU A;  2N04 A;  1E1R G;  2LW7 A;  3ABU A;  1NR7 A;  2RNB A;  1NVP D;  4K8X A;  3NR7 A;  3T1Y O;  2EZP A;  3L75 H;  4JV5 B;  3RYH A;  1BL8 A;  4O4J A;  5H9C A;  2N74 A;  2WLM A;  1E1Q G;  2Q5Z A;  1AR4 A;  2CE4 A;  2YXY A;  2DWE C;  1N33 B;  4X66 O;  3UQ8 A;  3HKD B;  4O2A A;  1AP5 A;  2YIC A;  3RYC A;  2KB1 A;  2DN9 A;  3LSU A;  3W7T A;  2WLK A;  5CMU A;  1FYJ A;  5C93 A;  5FPO A;  2BTO A;  1K97 A;  4I9W A;  1WAZ A;  4O4I B;  3GB7 C;  1WN7 A;  1CP9 A;  3UCS C;  1SQP H;  4BW9 A;  2K9P A;  3H1H H;  1AI4 A;  2MW2 B;  2ADQ B;  1GAX A;  1YDX A;  1IBK B;  3O9O A;  2WLI A;  1SF9 A;  4NYK A;  3JAL A;  3T4D A;  4LC1 A;  1M1K W;  5KX5 A;  3RT3 C;  3JAT B;  4IHJ B;  2CDY A;  4DR6 O;  5J2U A;  4LH7 A;  3B77 A;  3E89 A;  1AJP A;  2JS5 A;  4OGQ B;  2ITD C;  1M56 C;  3C3S A;  4LF4 B;  2LGQ A;  4DV0 O;  1ZL8 B;  2QWO B;  4PA6 A;  2AW9 A;  4K0K B;  4ZOL B;  2B9Z A;  1E79 G;  3JD2 A;  3OMI B;  3I55 V;  4E4E A;  5HFM A;  1FKA O;  2HR3 A;  3RVY A;  1SKV A;  5CB4 A;  1NTK H;  4KL1 A;  4PA7 A;  4MTF A;  4FJC C;  5IJ9 A;  1XHX A;  1ZWI C;  4ZKI A;  3STL C;  4NB5 A;  3E2E A;  4LF8 B;  1VQN V;  4D7T A;  1HWY A;  1MOF A;  4ICG A;  5FL7 G;  3TXS A;  4FM0 A;  1YI2 V;  2ZNJ A;  3ASO B;  4I0X A;  3VBB A;  3AK2 A;  1KKC A;  2GV9 A;  3JYC A;  2F43 G;  3LNN A;  1D5N A;  1W59 A;  3H1I H;  2XTA A;  3P30 A;  4K35 A;  3ZIA G;  1PM9 A;  1PNM A;  3BCC H;  4IGG A;  4FFB B;  2XUM A;  4JYA B;  1ORQ C;  3OMN B;  1VQ4 V;  2A0L A;  2A79 B;  4NR1 A;  3OTO B;  3HKE B;  4P9P A;  5LGT A;  1V55 B;  3B40 A;  5LGN A;  5B1O A;  1TUB B;  4WFF A;  2EIK B;  5EK0 A;  4MVR A;  2ZM6 B;  2R9R B;  3CHX A;  4DV5 B;  3LDE A;  1H2S B;  5IYC O;  2HP8 A;  2Q73 A;  3Q4H B;  3F7V C;  4DXW A;  3T1H B;  2PI5 A;  2IJJ A;  1W0J G;  2GTS A;  3FB7 C;  1I08 A;  1LR1 A;  4GT1 A;  1QVG U;  1IUR A;  2LW1 A;  2EZO A;  1XNQ B;  1JQ0 A;  3JAR A;  1Z5V A;  2JGD A;  3CWB H;  2KQX A;  3W7X A;  5B3S B;  3VQY A;  1N32 B;  3VQX A;  4H33 A;  2WPD G;  4F6E A;  1VQ9 V;  4X9Q A;  1Y74 B;  3FB5 C;  4JTD B;  2WAM A;  1QLE B;  3BAA A;  3L70 H;  4F4L A;  3OTO O;  3M8A A;  2A3Q A;  1M9N A;  5L3B A;  1GO3 F;  1XNR B;  1R6N A;  3QF7 A;  3IFX A;  4U7O A;  1H38 A;  2OWO A;  2YDE A;  1BE3 H;  5CN0 A;  2ZXW B;  4PJ0 Z;  2WLN A;  4MVO A;  4OXS A;  4DW0 A;  1SQF A;  2P4V A;  1YSC A;  3T1H O;  4ABM A;  4AIL C;  4PA9 A;  2CH7 B;  5LL6 Y;  4X65 B;  2LFR A;  2BTQ A;  5LOV B;  3K9A A;  3OFN G;  1XMO B;  1I5Y A;  3ZRW B;  1YHQ V;  5BR8 B;  1DLB A;  2XOK G;  5LBQ A;  4GX0 A;  1R3K C;  1Q82 W;  1NJI W;  4B3R B;  4F6R B;  1DTO A;  2UUA B;  4UCT A;  1HR0 B;  1GH6 A;  2W0F C;  4RWU A;  1HDJ A;  1VP7 A;  3HR0 A;  2P5O A;  3EFF K;  1R3J C;  5IJ0 A;  4JI3 B;  4LF6 O;  4B3T O;  3HKD A;  1B04 A;  4MVZ A;  2CTQ A;  1XOU A;  5H5N A;  4HZ3 A;  2Q4P A;  5B5E Z;  5BMV B;  5E79 Z;  1HNW O;  2W0X A;  4RUF A;  2OTL V;  4J10 A;  4O4I A;  5B1A B;  1VQP V;  5KMG B;  1KEC A;  4TWK A;  5AG2 A;  1EN5 A;  5IWA B;  3IC9 A;  4LF7 B;  1P49 A;  5BR8 O;  2E5L B;  4LFB O;  2DWD C;  4WBN A;  3CS5 A;  1FXK C;  2PZS A;  2DYR B;  4HYO A;  5D5P A;  3S3W A;  1HNZ O;  2WLH A;  3M99 B;  3E8G A;  1SQG A;  3CCE V;  3OT7 A;  3SPG A;  3LSS A;  1N36 B;  2HJF C;  1B06 A;  3FFQ A;  2A06 H;  4H37 A;  3E86 A;  4LF9 O;  3K5N A;  1XDC A;  2EUL A;  4LR3 A;  1K92 A;  1Y66 A;  3LDC A;  1OHH G;  4IIJ B;  3AG3 B;  4YHH O;  4P30 A;  4DV3 O;  1ZL8 A;  1WLE A;  4ZOL A;  3K5O A;  2CGO A;  1TGO A;  4JZG A;  4DUZ O;  5LHG A;  1O9G A;  2E5L O;  2GTA A;  1L0N H;  2VWJ A;  2E3C A;  5LP6 B;  5JH7 B;  1YJW V;  2YIB D;  2QE7 G;  2XAS A;  1FXH A;  4DV4 B;  3R65 A;  4BAY A;  3BY6 A;  4RO2 A;  1BT8 A;  1OCC C;  5KAI Z;  1ZSP A;  5A9G A;  2AXT Z;  3AK1 A;  4JI6 O;  2VS0 A;  1COW G;  3TET A;  2XAQ A;  1BHA A;  1KUQ A;  2EIL B;  3FB8 C;  2EIN C;  3OW2 U;  1HNX O;  4FFB A;  4UVC A;  2YEV B;  4DUY B;  4TOI A;  2JJ1 G;  4DR3 B;  1KU9 A;  5KHI A;  1J95 A;  1AP6 A;  1F23 A;  3HKE A;  1I94 O;  1K73 W;  1HW7 A;  4FPP A;  3W7W A;  1YJN V;  1NS1 A;  1WP7 A;  1PD3 A;  4FK5 C;  1Q81 W;  1TUB A;  1OJH A;  2Q0A A;  2ZDI C;  1BSM A;  1IDS A;  1QQC A;  2IH1 C;  3HKC B;  1WB8 A;  2QSA A;  3ETG A;  3QG5 A;  4Q6G A;  3Q4H A;  2RJZ A;  4OPH A;  1VF6 C;  3FAV A;  3SJQ C;  1BCC H;  5EIB D;  1Q5O A;  2HVK C;  4FLX A;  3QO7 A;  4LF5 B;  3ABM C;  3TGU H;  3H1J H;  1SQQ H;  2IU3 A;  2Q69 A;  3T1C A;  4G28 B;  3T4Z A;  1K5Q A;  3SYA A;  1XHZ A;  3ZED A;  4JAV A;  1PL0 A;  4DRX B;  3H01 A;  5JCO A;  1Y74 A;  4DUY O;  5EYP B;  2E75 B;  2Q68 A;  4X64 O;  3F5W C;  3A2F A;  2LP7 A;  1R3L C;  1GN6 A;  2H3O A;  5A2Q N;  4MVM A;  3SYC A;  4LWS B;  1MA1 A;  4MVS A;  2B5U A;  1D5A A;  5KHG A;  2JDI G;  4JI8 B;  1TA8 A;  2DOS A;  3TJT A;  3AG4 C;  2CH7 A;  2QKS A;  4X1K B;  4YJ2 B;  4YY3 B;  4AQY B;  5LOV A;  5IDJ A;  3ML0 A;  4CZZ A;  1KP3 A;  3ZRW A;  2Q7G A;  2WLL A;  3K04 A;  2XT9 A;  4X1I B;  1NH2 D;  4F6R A;  2WSS G;  4L8J A;  4X20 A;  4FM2 A;  4WFH A;  3HB3 B;  2JK5 C;  3TK1 A;  3AG1 C;  1H2K A;  4EFB A;  2DYS C;  2PYL A;  2FML A;  3MDS A;  1IVS A;  5BMV A;  3G6E V;  4UVA A;  2CK3 G;  3UM7 A;  4GUN A;  1SS3 A;  4JZ2 A;  1AI6 A;  4X1Y B;  5KMG A;  2GSM B;  1VQL V;  2BOC C;  1GN4 A;  3FX7 A;  4JPR A;  3K03 A;  2Q6A A;  1RSO B;  3ICX A;  4JAS A;  5LHH A;  5B66 Z;  5EBL C;  2P90 A;  4EEQ A;  3RYI B;  5LXT B;  4BWA A;  4OX9 O;  4XDK A;  5LA6 A;  2EIJ B;  4JYB A;  2LFS A;  4LH6 A;  3ZMV A;  4DV2 B;  2F1M A;  3FB6 C;  2UXC B;  1H8H G;  4JI7 O;  5H6Q A;  1XBL A;  4QNH B;  2LJ2 A;  4QJF B;  1MAB G;  4IIJ A;  1R6T A;  4U7N A;  2B1G A;  1NR1 A;  2ZQM A;  4NXN O;  3HPL C;  4X66 B;  4PDV A;  1L8D A;  3K9S A;  1QU7 A;  4DW1 A;  3AG2 B;  3JAK B;  1MSW D;  2Q7H A;  1Q90 D;  2QTS A;  3CCV V;  5LP6 A;  5JH7 A;  1WB7 A;  4G27 B;  4WFB V;  2OTJ V;  2JEU A;  3EXA A;  2VQE O;  5DM6 V;  2UXD O;  2UXC O;  3OUF A;  4KHP O;  4I50 B;  3K5M A;  1XI1 A;  3B8M A;  3RWR D;  3UO2 A;  1NKD A;  2AZ0 A;  3I56 V;  3ZHU A;  2K1E A;  5IE9 A;  4XBF A;  1Z5W A;  4J41 A;  3SDL A;  4I7Z B;  1SZT A;  4X62 O;  1NTZ H;  3P3P A;  2YEV A;  5L3C A;  5IY5 C;  1OV9 A;  4PDL A;  4GKK O;  4DR6 B;  4IYI A;  1TVK B;  2A9H A;  5KLV H;  3K06 A;  1Y76 B;  1W2B U;  1S77 D;  4LBE C;  3HKB B;  4NTY A;  4NKG B;  4DV0 B;  1AVM A;  5E1A C;  2VRZ A;  2IBZ H;  2UUB O;  4B7E A;  5KA6 A;  4R8C A;  3FKS G;  1Z2G A;  1WA8 B;  1YIT V;  4NTX A;  4JI0 O;  2ZIO A;  1G1X B;  2EIM B;  1SQB H;  1K33 A;  4DRX A;  1PKX A;  3RVZ A;  2BOB C;  3N2G B;  4KFM A;  5FNV B;  2P22 C;  1GKF A;  3E8F A;  1V54 C;  3SYP A;  1JMK C;  4P9O A;  3CCR V;  4O2B B;  5IYD O;  3OR6 C;  2YID A;  1PNK A;  4LWS A;  2DE0 X;  1ZUQ A;  1ZLZ A;  2UXB O;  3CYO A;  3O65 A;  1XQ8 A;  4LFC O;  1MZE A;  2IH3 C;  2WWW A;  4YJ2 A;  2Q67 A;  5JQG B;  1M90 W;  4U3F H;  1DF5 A;  1WNS A;  2FKX A;  3SJC C;  1IBL O;  1AIL A;  1OCZ C;  2BE3 A;  1VQO V;  3D36 C;  4X1I A;  5DED A;  2O57 A;  3SJB C;  3E8B A;  2M7W A;  4BW5 A;  1QNM A;  3B09 A;  1EZV H;  1N34 O;  3QO5 A;  1UPG A;  3QNE A;  4Z1V A;  2UXX A;  4JI2 O;  1S5H C;  1PV0 A;  4D6T H;  1F4M A;  1GM7 A;  3ASN B;  3G80 A;  1OCR B;  4YJ3 B;  2D3O W;  4B3M O;  2GHY A;  3A0H Z;  2Q9L A;  4MTG A;  2Y69 C;  1OZ0 A;  4X1Y A;  5CBG A;  2ZT9 B;  1ZTE A;  3K59 A;  2VQF O;  4GKJ B;  3K08 A;  3A0R A;  2NR5 A;  3ABL C;  4MT8 A;  2BSK B;  1JVM A;  4ZHQ B;  1Q6U A;  3ABK C;  5J9P C;  1RSO A;  1GM8 A;  4J7J A;  2PUS A;  3ZCC A;  4OPA A;  3RYI A;  2UXN A;  5LXT A;  4IT5 A;  3APQ A;  1PL4 A;  1SA0 A;  3L72 H;  4JI4 O;  2L6L A;  1MG1 A;  5KHJ A;  3ABT A;  2PTM A;  3CXH F;  2QM7 A;  4DR1 O;  1GMG A;  1VQM V;  2QWR B;  1J5E B;  3BA9 A;  1DF4 A;  1YJ9 V;  4CS3 A;  3K58 A;  1KKD A;  5C8Y B;  1G4Y B;  3BA8 A;  1EZJ A;  4MW8 A;  4JYC A;  1SER A;  2Z5U A;  1AJN A;  2N05 A;  1AR5 A;  4ZI7 B;  4GKJ O;  2RDC A;  3ETD A;  5CBF A;  1GK9 A;  2ILM A;  4LNU B;  5ITZ B;  4LF6 B;  1US6 A;  1V9P A;  4B3T B;  3L9D A;  1H8E G;  2HFE C;  1OCO B;  1HNW B;  5LMN O;  3JAW A;  3RFR A;  4LP8 A;  2DQ0 A;  2JJ2 G;  4HBN A;  1VQ8 V;  4PA3 A;  1J5E O;  3P32 A;  5B1B C;  1KQS U;  4QIW F;  4LFB B;  3B8N A;  1KD1 W;  2VWK A;  4B7K A;  4WF9 V;  4O4H B;  1P7B A;  3X2Q C;  1HNZ B;  2JGU A;  4KP4 A;  4MVU A;  4J80 A;  3OEE G;  2V4D A;  3CCQ V;  2DQ3 A;  1TVK A;  1Y76 A;  3SPJ A;  4LF9 B;  4K3A A;  3ZS8 C;  4YXW G;  3HKB A;  4JF3 A;  4WCE V;  4YHH B;  3RN4 A;  3KCX A;  3ZMZ A;  4DV3 B;  1K34 A;  2RCV A;  2DMX A;  4DUZ B;  3G71 V;  1F7Y A;  2HJD A;  3ZHT A;  4FMT A;  5KA5 A;  4D7S A;  2HHH O;  4QE9 A;  1EN6 A;  3MD0 A;  3CRQ A;  2JS3 A;  2P4K A;  5K1X A;  5GON B;  4CH6 A;  3FD9 A;  2CUG A;  3A0B Z;  3TXQ A;  1THZ A;  1WA8 A;  4J42 A;  5BZB A;  4FZ0 A;  1A32 A;  3IJ4 A;  1YCI A;  1KMI Z;  2FB5 A;  5EC2 C;  3JAT A;  3AK3 A;  1V54 B;  3N2G A;  4IHJ A;  5FNV A;  4RUE A;  4LFA O;  1M56 B;  3GWO A;  4O2B A;  4JI6 B;  4NVP A;  4J7Z A;  3CRR A;  1ZX3 A;  4A5U B;  1W0K G;  3WG7 C;  1QR8 A;  5KHH A;  4J7K A;  1KP2 A;  2JIZ G;  2WA3 A;  4PV1 B;  1HNX B;  4WFA V;  2FL4 A;  2X0L A;  5LHI A;  4MTO A;  2ZKO A;  4FLV A;  5JQG A;  4KXR A;  1I94 B;  2AZ2 A;  3U0Z A;  4R6Z A;  3WB2 A;  1RP3 B;  2HLD G;  3D8C A;  1JOY A;  3UO3 A;  1ARO P;  3DXR B;  1KB9 F;  3FYE B;  4R50 A;  2ZIM A;  4TQD A;  2OCC C;  1XL6 A;  1SZX A;  2EJR A;  4PDM A;  4NXM O;  1N0J A;  4CC5 A;  3ZN1 A;  1RM1 C;  2GBO A;  2XAH A;  1NH2 B;  5IYZ B;  3CP1 A;  3LNM B;  3ZBH A;  1M57 C;  4YJ3 A;  3CMA V;  3OMA B;  3G67 A;  1VF7 A;  2YSU B;  4X64 B;  3IAY A;  2ZE8 A;  3K5L A;  4UB8 Z;  3SYQ A;  2UU9 O;  5LYJ B;  3ZX6 A;  1JFF B;  4B3S O;  2ZR2 A;  1K4D C;  3GVM A;  5LMU O;  2XAJ A;  1N4C A;  2BSK A;  5JJN B;  3W7U A;  4UCO A;  4ZHQ A;  1Y4M A;  1SC5 B;  1L0L H;  3M7M X;  1YZB A;  4ASU G;  1K8A W;  3EHB B;  2W6J G;  4J11 A;  2C2A A;  1ROP A;  4TQF A;  1Q6H A;  1Y6X A;  4DR7 O;  4CH4 A;  3OAA G;  4H0L B;  3CJH B;  1XUQ A;  1JPX A;  1B6Q A;  2ZIN A;  1K4C C;  5C8Y A;  2YC0 A;  2PI4 A;  4G2K A;  4N21 A;  2AHY A;  1K7D A;  3EVK A;  4ZI7 A;  4FIP C;  1EBO A;  4LNU A;  5ITZ A;  2FYU H;  4GX5 A;  2ZE7 A;  5KX5 B;  1XRE A;  5EBM C;  2QGN A;  2CGN A;  4HNA B;  3WFV A;  1FS0 G;  3K57 A;  3RBZ A;  2KSD A;  1FPO A;  3ETE A;  3RGB A;  1XEQ A;  5L3G A;  5CA3 A;  3H1K H;  3LUT B;  3E35 A;  5JVD B;  3C3T A;  1G6U A;  3W7S A;  2YXH A;  3IGA C;  1VMG A;  4N23 A;  2YIB A;  4ZIB A;  2ATK C;  4QE7 A;  5GW7 A;  2X6C A;  4DO2 A;  5KUK A;  4O4H A;  1JR9 A;  1YIJ V;  4OX9 B;  3N2K B;  2V1D A;  2F4V O;  2YI8 A;  1EFR G;  1Q3E A;  2Q0O C;  4FLT A;  4I0X B;  4JI7 B;  4DR2 O;  4J9Z B;  3ASO C;  3VQW A; 
#chains in the Genus database with same CATH homology
 1XNR B;  3QF7 A;  3BAB A;  2OWO A;  4NXN B;  2ZIO A;  4DR7 B;  1FFX B;  5CA0 B;  4DRX A;  2F95 B;  5J2T A;  3N2G B;  5FNV B;  2P22 C;  3ETQ A;  1SQF A;  5GON A;  1IBM B;  4AIL C;  1JMK C;  4I9Q A;  4O2B B;  4X65 B;  2BTQ A;  5LOV B;  3RYH B;  4O4J B;  4GYC B;  2VQE B;  1XMO B;  2UXD B;  4K8Z A;  1XQ8 A;  4KHP B;  5BR8 B;  1T5E A;  4O2A B;  3RYC B;  4B3R B;  4YJ2 A;  3VQV A;  4F6R B;  5JQG B;  2UUA B;  4UCT A;  1HR0 B;  4PI2 A;  1WNS A;  2P5O A;  3SJC C;  3RYF A;  5IJ0 A;  4JI3 B;  3HKD A;  1B04 A;  4U3J A;  4X1I A;  4X62 B;  1JJO A;  3SJB C;  5BMV B;  4GKK B;  2PYJ A;  1YEW A;  2QJ1 A;  1QHT A;  5JCO C;  4CS2 A;  3E22 B;  4TUY A;  4O4I A;  5KMG B;  3JAL B;  5IWA B;  2F4V B;  4LF7 B;  3UT5 B;  1P49 A;  2E5L B;  2UUB B;  4DR2 B;  4CC6 A;  4YJ3 B;  2XHB A;  5J2U B;  4WBN A;  2PZS A;  4X1Y A;  3K59 A;  3BHP A;  5D5P A;  1Q8I A;  4JI0 B;  4DK1 A;  4PHZ A;  4GKJ B;  3WB0 A;  1I7F A;  4DV7 B;  1SQG A;  3JSN A;  5FPR A;  2YIA A;  4ZHQ B;  1N36 B;  5CB4 B;  1RSO A;  3FFQ A;  2PUS A;  3K5N A;  4LR3 A;  5IJ9 B;  3RYI A;  5LXT A;  2RQ6 A;  5LYJ A;  4DV6 B;  1JFF A;  4IIJ B;  1M4U A;  4O4L B;  1SA0 A;  2R9A A;  4ZOL A;  5KHJ A;  3K5O A;  3JAS A;  1TGO A;  2PTM A;  3HKC A;  5IJ0 B;  1O9G A;  3BPZ A;  1J5E B;  2UXB B;  3BA9 A;  4I55 B;  4LFC B;  4CS3 A;  3K58 A;  2VWJ A;  4CH3 A;  4EFE A;  5C8Y B;  3BA8 A;  2E3C A;  5LP6 B;  5JH7 B;  2YIB D;  4I4T A;  4ZI7 B;  4DV4 B;  1X4T A;  1IBL B;  4FLW A;  4FLY A;  4LF6 B;  4LNU B;  3CB2 A;  5CA1 A;  5ITZ B;  1V9P A;  4B3T B;  2R72 A;  4TV8 A;  5EYP A;  2R70 A;  1FJG B;  1M93 A;  1HNW B;  4GLX A;  3JAW A;  3RFR A;  4WBN B;  4HBN A;  1N34 B;  1O9H A;  2OYQ A;  5EZY B;  4JI2 B;  3DSQ A;  4FFB A;  4DUY B;  4HNA A;  5JJE B;  4TOI A;  4FLZ A;  4DR3 B;  4B3M B;  1S5J A;  1KU9 A;  4UFZ A;  2ZCE A;  4X1K A;  4EB6 B;  5KHI A;  5EIB C;  4LFB B;  3HKE A;  5KHK A;  3SR2 C;  1HW7 A;  1DGS A;  2VWK A;  2UUC B;  1TUB A;  1SA0 B;  2Q0A A;  4O4H B;  5JJJ B;  1HNZ B;  2VQF B;  4DR4 B;  5JVD A;  1QQC A;  3HKC B;  2JGU A;  3JAR B;  3QG5 A;  4Q6G A;  2V4D A;  2RJZ A;  4DR5 B;  3THO A;  4CH5 A;  1TVK A;  1WPB A;  5EIB D;  4LF9 B;  3ZS8 C;  3HKB A;  1Q5O A;  4FLX A;  4YHH B;  3T1Y B;  4LF5 B;  4TV9 A;  4DV3 B;  4JI4 B;  2YI9 A;  5K1P A;  3N2K A;  5LP6 C;  4DUZ B;  4DR1 B;  1XHZ A;  4D7S A;  3ZED A;  2JVD A;  4DRX B;  2F93 B;  5JCO A;  5EYP B;  5J2T B;  4JI5 B;  3BRC A;  5K1X A;  5GON B;  4CH6 A;  3A2F A;  3JAW B;  2PY5 A;  3PN1 A;  3U11 A;  3OTF A;  2BTQ B;  1FFX A;  1KMI Z;  5CA0 A;  2EX3 A;  5IYZ A;  2KKW A;  3JAT A;  1TAE A;  3N2G A;  4IHJ A;  5FNV A;  1D5A A;  5KHG A;  4JI8 B;  1TA8 A;  3QTC A;  4AHC A;  4X1K B;  5LMN B;  2IM9 A;  4O2B A;  4YJ2 B;  4NVP A;  4JI6 B;  4K8X A;  1M5I A;  4YY3 B;  4AQY B;  5LOV A;  4JV5 B;  3RYH A;  4O4J A;  1N33 B;  5KHH A;  2F66 C;  3MAQ A;  3RYF B;  3UQ8 A;  3HKD B;  2Q7G A;  4U3J B;  1HNX B;  4O2A A;  4X1I B;  4FM1 A;  3RYC A;  4FLV A;  3SJA C;  4F6R A;  5JQG A;  4L8J A;  4X20 A;  4FM2 A;  1I94 B;  4CS4 A;  3U0Z A;  3WB2 A;  3WB1 A;  5D5Q A;  5FPO A;  2BTO A;  4FVM A;  4TUY B;  4O4I B;  1WN7 A;  4UCS A;  4EFB A;  2PYL A;  3JAK A;  2ZIM A;  5BMV A;  4BW9 A;  4TQD A;  4DK0 A;  3U10 A;  4DV1 B;  1IBK B;  2CAZ C;  3E22 A;  4CC5 A;  4X1Y B;  3JSL A;  5KMG A;  3JAL A;  1XMQ B;  3UT5 A;  5IYZ B;  4I50 A;  5KX5 A;  3JAT B;  4B08 A;  2HHH B;  4YJ3 A;  4IHJ B;  3ICX A;  5J2U A;  4LH7 A;  1VF7 A;  3IAY A;  4X64 B;  4EEQ A;  3RYI B;  3K5L A;  2JS5 A;  5LXT B;  5LYJ B;  4LF4 B;  1JFF B;  4BWA A;  5LA6 A;  4K0K B;  4ZOL B;  4LH6 A;  3JAS B;  1ZAU A;  5JJN B;  4DV2 B;  2F1M A;  4UCO A;  4ZHQ A;  1SKV A;  5CB4 A;  2UXC B;  3M7M X;  4KL1 A;  4LFA B;  5IJ9 A;  1XHX A;  1Q43 A;  4IIJ A;  4TQF A;  4X20 B;  4O4L A;  3SGI A;  4LF8 B;  2PGG A;  4I4T B;  4FLU A;  4CH4 A;  4D7T A;  4X66 B;  4FM0 A;  1L8D A;  2ZNJ A;  5CA1 B;  4TV8 B;  4I55 A;  3JAK B;  2HEP A;  2Q7H A;  2ZIN A;  5C8Y A;  2GV9 A;  5LP6 A;  5JH7 A;  3LNN A;  3B2E E;  4ZI7 A;  4UCU A;  4LNU A;  5ITZ A;  4PI0 A;  4I50 B;  3K5M A;  1XI1 A;  4JI1 B;  2YXL A;  4FFB B;  5KX5 B;  3RWR D;  4JYA B;  4HNA B;  3CSX A;  3K57 A;  3OTO B;  3HKE B;  4NXM B;  1Z5W A;  5EZY A;  3RGB A;  1TUB B;  5LA6 B;  2ZNI A;  2ZM6 B;  5JVD B;  3CHX A;  4DV5 B;  1H2S B;  1G6U A;  2YIB A;  4UCV A;  4EB6 A;  4DR6 B;  3T1H B;  1TVK B;  4ZIB A;  4UCR A;  3HKB B;  2UU9 B;  4O4H A;  4DV0 B;  4TV9 B;  4OX9 B;  4B3S B;  1XNQ B;  3JAR A;  3N2K B;  1Z5V A;  1NT2 B;  2Q7E A;  5LMU B;  2YI8 A;  1Q3E A;  3VQY A;  1N32 B;  3VQX A;  4FLT A;  4JI7 B;  2QM4 A;  3VQW A;  3BAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...