3ZS8C

S. cerevisiae get3 complexed with a cytosolic get1 fragment
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
67
structure length
67
Chain Sequence
NELSKKYLAKVKERHELKEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHLHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Mechanism of Membrane-Associated Steps in Tail-Anchored Protein Insertion.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase/transport protein
molecule keywords ATPASE GET3
total genus 29
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.660 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3zs8C00
1NT2B 3B2EE 3ICXA 2P22C 3CSXA 3SJAC 3SJCC 3SJBC 2F66C 3QF7A 2CAZC 3ZS8C 3QG5A 3THOA 2JS5A 1SKVA 1X4TA
chains in the Genus database with same CATH superfamily
4O4HA 2DQ3A 4O4LA 4FFBA 1N0NA 2LFRA 2A9HA 3SYAA 1IBMO 4X64B 4NXNB 2EINC 2C2AA 2ZM6O 2VQFB 5B3SB 1SZTA 3K59A 3T2MA 2WLNA 4YXWG 2DWDC 3E89A 3KCYA 4B3RO 5KHHA 3CS5A 5FNVB 1AR4A 1MA1A 2QWQB 3RT3C 1FXVA 1G8MA 1IXMA 3VQYA 4O4IB 3M7MX 2V1DA 1V55B 3E83A 2JGUA 5LA6A 1IZ3A 5GW7A 1WPBA 3A0RA 3BEHA 4HNAA 5CA0A 1NH2D 3BVOA 1AILA 3GVMA 4LH6A 1GK9A 2EX3A 2Q9LA 4B3TO 4FPPA 4CH4A 3ASOB 1HNZB 2GUZB 3E35A 1AP5A 1AR1B 1SQQH 4UCOA 1E79G 3MHHC 2AXTZ 2RNBA 1PP9H 3CX5F 4LWSA 3JCUZ 2ZE5A 4KHPO 2B9ZA 3E8BA 1DF4A 5LMUO 2DOSA 1K9MW 1JCHA 1K4DC 4PD4F 1M5IA 4U7OA 5CB4A 4O2AB 4QPKA 3BABA 3OEHG 2KSDA 5LP6A 1ZTEA 2X6AA 4MVQA 3HKEB 4IIJA 2M6YA 4LF9B 1BHBA 4EEQA 2CTPA 2X7RB 2OCCC 3C90A 1UPGA 1GN4A 4J9YB 3JAKA 2BTQA 3OD4A 1ZL8A 3P32A 4ASUG 1GM9A 3RYHA 1H2KA 4I50A 1HNXO 3CCVV 4DR7B 1IURA 4FLUA 2LGWA 3A8TA 2XOKG 3P30A 1BGYH 1WPXA 1KYOF 4GX5A 3ZEDA 4OPAA 2YSUB 2Q0OC 3CCMV 2DJVA 1TVKB 2YIBA 2HVKC 4W4LA 1FXKB 4MTFA 1N32B 1GN3A 4KUMA 4LF5O 4I9WA 4A5UB 4NXMO 4I0XB 4RO2A 3EXAA 1B04A 2UUCO 1FS0G 3CC4V 3NR7A 5EYPB 2CUGA 1XOUA 1N33B 1TUEB 1M56C 1GM8A 3CYOA 4X1KA 3CD6V 4FLWA 3A2FA 3ZBHA 1V54C 5JVDA 3ASNB 3DXRA 3STLC 4B3SB 1RPOA 3Q4HA 2ADPA 2MW2B 4B3MO 3IC9A 2R9RB 2P22C 4R6ZA 4FJCC 3ABMB 2XAJA 3AG7A 5EIBC 2DW4A 1MOFA 2CTRA 3CRMA 4HAMA 4JI3B 3X2QB 1R6TA 5BMVB 3K58A 3OR6C 3HPLC 4DUYO 3B2EE 5JCOC 4J7ZA 4FIPC 1US6A 2LFSA 2YEVB 1QNMA 1XNRO 3CHXA 4DV3O 4UFZA 2BTQB 4ZOLA 4Z1MG 2XT9A 4PA4A 1XMQO 1EN5A 1BCCH 4JI8B 3IFXA 2OCHA 2ILMA 3F5TA 1WP8A 1M9NA 3ZRWB 1B6QA 2EIJC 4X1KB 4UCVA 4R8CA 1GN2A 2Q6AA 1UFIA 2BSKB 2XHBA 2R9IA 2ZT9B 1GRJA 3K79A 3P3NA 3ZHUA 5GONA 1CPYA 5KA6A 4YY3B 1L8DA 4JYAB 1XNQO 2CGOA 2Y69C 2Q7GA 1QLEB 4CS2A 4WCEV 4H13B 4DV0B 3LSUA 3BHPA 2B5UA 1G4YB 1G6UA 4PJ0Z 3RYIB 1N36O 1SQFA 2OTLV 2GSMB 1Q86W 1Z5VA 2JS5A 3U0ZA 5JVDB 3JALB 3CJHB 4UVBA 2ZDIC 5B1AB 1H8HG 3O65A 3EVKA 4QIWF 1NVPB 3SDLA 3FD9A 4GX1A 4I9QA 1CP9A 3RYFB 2JEXA 1V55C 5LP6C 2PZSA 4BIOA 3AK3A 3QO5A 3S3WA 1JFFA 3SJAC 5LXTB 4DV4O 2W0FC 1BQ0A 1SQPH 3KG2A 2YS8A 4CH5A 3D3IA 1P7GA 1NH2B 2Q7EA 5IYZA 1FAFA 2F95B 1F23A 3BFRA 5BR8B 2ATKC 2WLLB 1XI1A 2QTSA 5FNVA 1WB8A 3CCSV 4J42A 4JPRA 4LF8B 2EILB 4AQYB 1PD3A 5K1PA 3E22A 1EZJA 4JYBA 2B1IA 4J7JA 4NXNO 2ZNIA 2ZDIA 4X20A 3CXCU 1NR7A 1Q3EA 4DUZB 4IYHA 4EFBA 1PNKA 1BMFG 2YXYA 3C3TA 4W4KA 4DR3O 2Q5ZA 4J11A 2OIEA 4K0KO 3CCRV 3H1IH 2XAFA 3K04A 4MVZA 4OPHA 1FXKC 1AI7A 4TOIA 4GX0A 3FYIB 2JGDB 3H1HH 3IC7A 2QWPB 4WF9V 5KHIA 1YTFB 3JARA 1OCCC 2EJRA 2GUZA 1XDCA 1SZXA 3DC6A 3T1HB 1F51A 2VQEO 3SPCA 2DN9A 4RUEA 2P4VA 1KQSU 1AJQA 2IJIA 3JSLA 4QPJA 4F4LA 3IJ4A 5F2VO 2JJ2G 2BCCH 4CH3A 2QDOA 3W7SA 4ZIBA 4TQDA 4OX9B 4O2AA 4FLYA 2N05A 2NN4A 3OT7A 3RYIA 1O9GA 3AG2B 2PYJA 3A0BZ 1P84F 5KX5A 3O9OA 3SYQA 4ZBMA 3CJHA 4CZZA 1NT2B 4MW8A 4D6TH 1YF2A 1S3JA 4LH7A 2EIKC 3CEIA 3HKCB 2OWOA 4JV5O 1COWG 1LUWA 2GHYA 4ZHQB 3RYFA 3ZRWA 3QNEA 4IGGA 2ODMA 2AZ0A 2IJKA 3WFVA 1MSWD 3THOA 5J9PC 1BZKA 1VARA 3SPIA 2Y48A 3K0GA 1FJGO 2CTWA 4JI0O 4C7UA 5GONB 2IM9A 2CDYA 4DV5B 2IU3A 2N74A 2IU0A 1YDXA 1QVFU 1SC5B 1ZWIC 2M7WA 3DGEA 3AG4B 4B7EA 4YJ3B 1I5XA 2RQ6A 2Q68A 2Y4UA 1R3LC 1TUBB 4UUJC 5H6RA 1VF7A 1X4TA 3WB1A 2WPDG 4I4TB 4DV2B 4RQEA 2YI8A 3DXRB 4X64O 4ZKIA 2RCVA 1GM7A 4DR6O 1QLNA 2YICA 4ZHQA 5KAIZ 5IE9A 4B3RB 3G6EV 1Q6UA 1BL8A 4DR1B 3UO2A 1TGOA 2DE0X 3QG5A 2BSKA 2NR5A 4TUYB 5BZBA 2YUAA 2ITCC 1DTOA 2DYRB 1SA0A 1MG1A 1F7YA 5IDJA 4X1YA 4DV1B 3UCSC 3VQVA 2GBOA 1LUVA 2D3OW 3WB2A 4X89A 1K5SA 1NKDA 2YIAA 1MZEA 4U3JB 1Q6IA 3IGAC 1W2BU 4TV9B 2UXCO 5IJ9B 4U3FH 3LDEA 3HKDB 4ZI7A 4HBNA 4EB6A 1KKDA 2CK3G 1A32A 1I94O 4OXSA 5IYDO 2VRZA 1KECA 1VP7A 2DYSB 1FYJA 1KKCA 1H2NA 4O2BA 4JI2B 1VQ6V 2A79B 2QTOA 1U97A 3K9AA 3E2EA 1S72V 1AB3A 1M57B 5LGTA 1Q7YW 4K35A 1XREA 1XMOO 3QVNA 1BE3H 1SERA 2HHHO 4K8ZA 1OHHG 4JTAB 1IXBA 4TSFG 3UT5A 3K03A 4UVAA 4BIUA 2F4VO 1FKAO 3JAKB 4L87A 1XILA 5J2UA 2JRIA 3F7VC 1SQBH 2QKAA 1HDJA 1OCOC 1QBZA 1QQCA 1XEQA 5KMGA 1AVMA 4CS3A 3WB0A 1Q81W 4P2ZA 1NQTA 1RM1B 4P9OA 1JFFB 1NJIW 3E8FA 1R3JC 1S76D 1H2SB 1B06A 2QSAA 1YIJV 4RAIA 5AG2A 5ITZB 5CA1A 1WLEA 3W7TA 2OYQA 3UO3A 1J5EB 4XDJA 4LF6B 3C3SA 2F66C 4J9ZB 4UV9A 4DV7O 1NU1H 2QEXV 3SPHA 4LFAO 1K7DA 3L72H 3JASA 5L3BA 2LGQA 1OCZC 2R9AA 4IHJA 3JAWA 1IBKB 2ETNA 4O4IA 2PGGA 3RW0A 1NR1A 1AI4A 1XL6A 2Y0PA 3N2GB 2EIMB 1W0KG 4LF4O 1AI6A 3BA8A 2ZIMA 5B1OA 5LHIA 4RWUA 1VQ7V 5L3DA 4DUZO 1Q43A 2FB5A 4X1IA 4WFAV 3RBZA 2N04A 1VQNV 4I5SA 5JH7A 4PDVA 5LXTA 2YXHA 2UXXA 3FB5C 1IBLB 4UB6Z 2UU9O 4DUYB 3CWBH 1KMIZ 2EINB 4NKGB 4LNUB 1KBHA 2HLDG 3OTOO 1XNRB 4MVMA 4TUYA 3CPWU 3CRRA 3K3WA 4RQFA 2WLIA 4DV6O 1N34O 4X65B 3TCUA 1D5AA 1I5YA 3OE7G 2P4KA 2YDEA 2F43G 1URFA 1S5JA 1JVMA 3SYPA 4I0XA 1Y74B 3D3QA 1E1RG 5LYJA 4X62B 1EN4A 4DR4B 3RWRD 3WG7B 2UXDB 2DMXA 4FLXA 1OZ0A 3DTUB 1AR5A 3EHBB 3FB8C 4YIOA 4LWSB 3OTFA 3MDSA 1GMGA 2QKSA 1S77D 3D36C 4X8AA 4TV8A 1OCZB 2OCCB 3JCZA 2EULA 1WP7A 2VQFO 4FLTA 4CS4A 3B40A 5K1XA 4KFMA 2GTSA 2YXLA 2WLMA 2AW9A 1EFRG 2P67A 1ORQC 4X88A 3OFNG 2QKCA 4NB5A 3H01A 3ZHQA 4FLZA 2PYLA 4O4JB 4U7NA 2DYRC 3ZRSA 1K33A 2X0LA 1OCRB 1GAXA 2KG7B 1H2MA 3OMIB 4DR2O 3TK1A 4JAAA 4LFBO 2PI4A 2PUSA 3OM3B 1RFYA 1F4NA 5LP6B 3W7XA 1N4CA 5FPOA 1YJNV 5EK0A 1GH6A 2HFEC 2W6IG 1CEZA 2OTJV 4HZ3A 3OUSA 3CXHF 1T5EA 4DV5O 2MK3A 3TXQA 5IYZB 5B3SC 4GKJO 1IX9A 4EFEA 2HVJC 1KB9F 2YIBD 4CH6A 1I0HA 3K5LA 4JGSA 4Z1VA 2HR3A 1IVSA 3ZS8C 3W7UA 2LO1A 3ZMSA 5IT9N 2DQ0A 1Y67A 4PDRA 2UXBO 3ETEA 3M8AA 4QNHB 1JOYA 3R65A 2ITDC 2PF4E 4JI7B 4R7CA 1SQXH 3E86A 1M56B 4Z2WA 1QCEA 1D2DA 5JJNB 4LF7B 4GT1A 1AP6A 4BW5A 1H2LA 2CGNA 5CMUA 2X6CA 4MTXA 3J7AU 3FB7C 4BWAA 2EIMC 1UJWB 5BMVA 1VF5B 3GWKC 3SGIA 4LR3A 1N8RW 3ABKB 1L1FA 5LBQA 3ABLC 1GN6A 2L35A 5IY5C 2ZD9A 3G4SV 2ZNJA 1Q5OA 3BA9A 3F5WC 2X6BA 1ENVA 3RFRA 1R73A 3JARB 2ZM6B 3U10A 1SF9A 1PL0A 2WWWA 3B8MA 2QR4A 3D36A 3KKYA 3K06A 1BHAA 3G80A 3AG2C 4H33A 5H5NA 2P5OA 1BSMA 1IBMB 2JK5C 3HR0A 5DECA 5IJ0B 1N0JA 5C8YB 4YHHB 1JJ2U 2IW5A 2GV9A 4QE9A 2HJFC 3ZCCA 2WLJA 2HHHB 1DK1A 3IAYA 2XASA 4LBEC 5JQGA 1XUQA 3RVYA 2FYUH 3B09A 5JJEB 1EZVH 5KX5B 5FLXN 4J10A 1RSOB 5KLVH 3QO7A 3T4ZA 4H37A 1J95A 4MW3A 1P4RA 1NTMH 3BRCA 1E1QG 4U3JA 3LSSA 5EYPA 5E79Z 3ZHSA 2EZPA 1XL4A 1NZ6A 3E8GA 5IWAO 3CCUV 1Y4MA 1ZAUA 1VIBA 4PA6A 4PV1B 4KHPB 5TISZ 5A2QN 3OGCC 5LMUB 3JALA 3HB3B 2UUAB 3CRQA 1R6NA 1PL4A 5H2FZ 2ZE7A 3UKMA 1VQKV 4WFFA 3H1LH 4GKKO 4AI8A 2WLKA 1HNXB 1KP2A 3ZHVA 3OGIB 4LF9O 1IBKO 3PN1A 2QWRB 5LGUA 3HKBA 1S0VA 1K4CC 4PI0A 4FMTA 3ZIAG 4O4JA 4LNUA 1HWYA 1S5HC 4BAYA 3CRAA 4L8JA 1SA0B 4D7SA 3K57A 1NTZH 1BT8A 1RP3B 1M90W 4DR6B 4PI2A 5J2TA 4ZOLB 3N27A 4DR5B 2ZCEA 1JR9A 2QE7G 2QM4A 4G2KA 4FZ1A 3ICXA 4LF5B 3VQWA 4F6EA 5EZYA 2A0LA 1DF5A 4G28B 3WU2Z 1QR9A 4GCZA 1IBLO 2UU9B 5JH7B 4JZ2A 1N33O 1AJPA 1VQOV 4WBNB 2Z3YA 3KCXA 5ITZA 2OT5A 3UM7A 4FK5C 2JJ1G 4O2BB 4X1YB 4NXMB 3JATB 5GTHZ 3ETQA 4JTCB 3SJCC 2UUCB 4MT8A 4DK1A 3OR7C 3SYCA 3D8CA 4X62O 2Y4TA 3RYCB 1QHTA 1ZUQA 2KB1A 1JMKC 1SS3A 2WAMA 1AI5A 4LF8O 5B1AC 4B08A 1TUBA 5EBMC 1Y76B 1DGSA 3CCJV 5J2UB 4HNAB 5CA0B 1MNGA 2YIDA 3RN4A 2UUBO 5LHHA 4KXRA 2WA4A 2NNUA 2IJJA 4X66O 4JI3O 4JF3A 4DR3B 2R72A 1QVGU 3HKBB 5FPRA 1X59A 5KHJA 3QTCA 3DSQA 3TJTA 1YVWA 4FM2A 2E3CA 3APOA 1L0LH 3G67A 1HNWB 3J81N 4JI8O 2H3OA 5KHGA 2RJZA 3W7WA 1PNLA 1PNMA 2Z0AA 1BS3A 5LMNO 5LOVB 2WLLA 4BR6A 4JI6O 1M4UA 4JI4B 3JD1A 1WJZA 3K5OA 3HKDA 4ZI7B 2VQEB 2FMLA 1EM1A 3ZRXA 2R70A 4DRXA 1P7BA 3L71H 4H44B 4JI1O 3SJQC 1YHQV 4FM0A 2G38A 2AGAA 2LP7A 1OCCB 4GX2A 3ABUA 3MHSC 4JYAO 1MABG 3HKCA 3PJSK 5FL7G 4KL1A 2QA4V 4OX9O 4QE7A 2Q69A 5B5EZ 4N21A 2EJ7A 5JCOA 5H6QA 5JQGB 1JPXA 4JAVA 4JI5O 1M57C 5KHKA 4G27B 3NXSA 1R6KA 3FFQA 1FFXA 4TWKA 4XDLA 2K9PA 4GUNA 3T4DA 3ZRVA 1AJNA 2EILC 1Y74A 4FZ0A 3CRCA 5CB4B 2PI5A 1EBOA 4WFBV 2RDCA 3L9DA 4YJ3A 2FKXA 5D5QA 5CN0A 1YZBA 1FXHA 1Y6XA 1K73W 4O4HB 1SESA 2Q67A 1QU7A 3E22B 4X65O 2CAZC 4LCUC 2XNDG 1OCOB 4AQYO 5IJ0A 2E5LB 4X20B 3RGBA 1PKXA 4AILC 4TV9A 3ZN1A 2LW1A 1R3KC 2Q8VA 3A0HZ 4PA7A 4FFKA 4WFGA 4IIJB 4P9PA 4UXNA 1PM9A 2E74B 4PELA 1VQ9V 4UB8Z 1WNSA 3R66A 5A9GA 4OGQB 2ZXWB 4GYCB 5KUKA 1NTKH 4DV3B 2ZINA 1M93A 2PY5A 3I5DA 1H38A 5KAFZ 2K1EA 1FPOA 4I7ZB 3K9SA 4LFCB 4IYIA 4K0KB 1K3EA 3ML0A 2ZR3A 4LP8A 3AG3C 4BW9A 2XAHA 4NTYA 2WLHA 2Q7HA 2W6JG 4JTDB 3SYOA 5CA1B 3T1YO 2YEVA 4MVUA 2F1MA 4QJFB 1P49A 4MSWC 3N2KB 3ABMC 2AZ2A 2H8PC 2UXCB 1MZFA 4K3AA 3VQXA 1XHZA 2HEPA 1YJWV 2HKOA 3T1HO 4K8XA 2AHYA 1XNQB 5IWAB 4MVOA 4PDMA 1LNQA 2F93B 2DYSC 1I94B 3T1CA 3QO8A 4GLXA 2QWOB 3UT5B 3JD0A 2UUAO 2PTMA 2ZR2A 3J80N 2VS0A 1OCRC 2RMKB 3Q4HB 5C8YA 1YXBA 1PV0A 3CCEV 1KD1W 4GKKB 4TV8B 5BXZA 3S3XA 4Q20A 4J80A 3CMAV 4JV5B 1RPRA 4JYYA 5EZYB 4EKWA 3CC7V 4B3TB 4ABMA 1Z2GA 5CBHA 2P06A 3UQ8A 1VQ8V 4JZGA 3GWOA 1GO3F 3AG4C 1YI2V 2YI9A 4JI0B 5DEDA 4NYKA 2BE3A 1B3QA 3ASNC 3ZMVA 3JD4A 5L3FA 4UCTA 2GDSA 1CXZB 1FD9A 2AHZA 2XAGA 3APQA 1L0NH 5BR8O 4B7KA 3LUTB 1IDSA 4I55B 1I08A 2H94A 2XUMA 3VBBA 1FJGB 5JJJB 2JDIG 4YJ2A 2A06H 5B66Z 2OIGA 5EBLC 5EC1C 1Z5WA 4DV2O 2ZE8A 3JAMN 2E76B 5LHGA 3CCLV 2A3QA 2CH7B 3K08A 3RYHB 3JSNA 4UCRA 1HR0O 1MMMA 2RN9A 1Q82W 2JVDA 2WSSG 3P3PA 5CBGA 5BY1A 2KKWA 1KP3A 1G1XB 2JIZG 4DR7O 1TAEA 3RYCA 1Q90D 3ZJZA 2HJDA 4TT3G 4IHJB 3TETA 1K8AW 3B77A 1YITV 3KZIZ 1U96A 3JD3A 2F23A 1WB7A 5J2TB 1YTFD 1RSOA 5IY5B 1ZLZA 4PA3A 2Q4PA 3ZMUA 1SQVH 3MD0A 1KU9A 2KG7A 4X66B 5L3GA 1K5QA 1N32O 3L75H 4FM1A 5H9CA 1I7FA 5IYCO 2BTOA 3K5NA 1WN7A 4DXWA 3WG7C 1S5LZ 5CA3A 3OTOB 4YJ2B 1JQ0A 1W59A 2IBZH 4MVSA 1YJ9V 4O4LB 1N34B 3F7YC 1XBLA 3RVZA 1FXKA 2L6LA 3AK1A 3OEEG 4TQFA 1DLBA 3ETDA 2Y0IA 4MTGA 5DN6G 4RUFA 1M1KW 5IYBO 4B3MB 2P6JA 4QGPA 4JI4O 2ZQMA 4DYLA 4NR1A 5LGNA 3ZX6A 2ZE6A 3L73H 3OMNB 3CCQV 3ABKC 3ASOC 2Z5UA 3I55V 1NI8A 2CTQA 2QM8A 4JI2O 1FFXB 3CP1A 5E1AC 3STZC 3EFFK 4UCUA 4Q6GA 4DO2A 4DW0A 3ZHTA 1KC8W 3FX7A 5L3CA 2QGNA 3I56V 3BPZA 1BQZA 4H0LB 1XMQB 3JYCA 2KQXA 1HNZO 1ZX3A 1SRYA 4KP4A 5B1NA 2F4VB 1W0JG 3ABLB 4E4EA 1AROP 3K5MA 4CBCA 3VOUA 2WLIB 2B1GA 3FAVB 1SKVA 3H1KH 5LA6B 4DR5O 4LC1A 5C93A 3L70H 3QF7A 2BOCC 2FTKA 3H1JH 1OJHA 1YSCA 4DR2B 1ZSPA 3ZMZA 3DC5A 5B1BB 3FB6C 1NBMG 2BOBC 2D2CB 4YY3O 4JASA 2O57A 3LDDA 1XHXA 5D5PA 3AG3B 3AG1B 3FYEB 1HP8A 4JYCA 4GZRB 2HP8A 1PPJH 4LFAB 4DV0O 3ETGA 3G71V 2ZIOA 1GTOA 2W0XA 4IT5A 1SETA 4ICGA 4FFBB 4N23A 2EZOA 4LF6O 3U11A 4DV7B 4PDLA 2LW7A 4IL6Z 3BCCH 1K92A 5HFMA 4NTWA 2QJ1A 3SR2C 2LQTA 3JASB 1WA8A 3JAWB 4P30A 1LR1A 4DR1O 4DV4B 1VQ5V 1VQMV 3FAVA 4LF4B 2ZXWC 4CC6A 2UUBB 2LJ2A 5JWPA 4DW1A 1VEWA 3OUFA 3BAAA 4DV1O 3LNNA 4XDKA 4F6RB 3SJBC 3E8HA 1ZL8B 3AG1C 1GKFA 1K34A 1R3IC 2WA3A 5KUMA 4EB6B 2IH3C 4CC5A 1VMGA 5KMGB 4LFCO 1Q8IA 1VQPV 4DRXB 1ROPA 1YEWA 5GTIZ 5DM6V 3SPGA 2ARHA 3SPJA 3LSQA 4JAUA 4NTXA 4I4TA 3T1YB 3X2QC 1NS1A 4DV6B 1HNWO 5B1BC 2E75B 3MAQA 2Y69B 4B3SO 2CH7A 3CMEV 5LMNB 1Q6HA 1Y66A 4JI6B 1WAZA 5KA5A 3LDCA 5CBFA 2UXDO 2A7WA 3ZN0A 1VQLV 1V54B 4JI1B 3OW2U 1YCIA 1XMOB 3CE2A 3TGUH 3B8NA 1VQ4V 4BIZA 2DWEC 3JD2A 4X9QA 3TXSA 4WFEA 3N2GA 4PA9A 4WFHA 1JA8A 2VWKA 3G6BA 4YHHO 3H9VA 4UCSA 4E2LA 1TA8A 5IJ9A 4I50B 4LFBB 2CE4A 4XBFA 2IJHA 2P7TC 3OAAG 4X1IB 2VWJA 3ZHRA 4JI5B 4I55A 1D5NA 2IH1C 4DK0A 4MS2A 3OMAB 1WA8B 2JS3A 4AHCA 2XAQA 1H8EG 1VF6C 5EC2C 2ADQB 4J7KA 3AEIA 1HW7A 3M99B 4PHZA 2QM7A 5LL6Y 1JX9A 2XTAA 1F4MA 2QWNB 2Q0AA 1J5EO 4UVCA 4R50A 5LYJB 1EN6A 3AK2A 3FKSG 3CC2V 3L74H 5L3EA 5EIBD 3BY6A 4NVPA 1OV9A 2FL4A 3B4SA 3K0DA 1N36B 2ZKOA 1FFTB 2V7QG 1XQ8A 3CB2A 4GKJB 2E5LO 2EIKB 2UXBB 4FVMA 1R1BA 4YIPA 1HR0B 4JI7O 1KUQA 1QLEC 2P90A 4HYOA 4MVRA 2YC0A 2HG5C 3LNMB 1O9HA 4MTOA 1SQGA 2GTAA 1NVPD 1TVKA 1Y76A 4WBNA 4FLVA 5HFLA 1VF6A 2EBOA 3JATA 3N2KA 2EIJB 2UXNA 4UV8A 4LF7O 1RM1C 5EBWC 3ZMTA 2JGDA 1V9PA 4J41A 5LOVA 2NLJC 4F6RA 1H2GA 1QR8A 1JJOA 3ABTA 3CSXA 4D7TA 3HKEA 2JEUA 2V4DA 4DR4O 1THZA 2Q73A 1K97A 3GB7C 1MSDA
chains in the Genus database with same CATH topology
1NT2B 3UQ8A 4LH7A 3RFRA 3JARB 2ZM6B 4O4HA 3U10A 4O4LA 4FFBA 3HKCB 2OWOA 4ZHQB 3RYFA 2YI9A 4X64B 4NXNB 4JI0B 2VQFB 3THOA 3K59A 2P5OA 1IBMB 4UCTA 5KHHA 5FNVB 5IJ0B 5GONB 2IM9A 5C8YB 3VQYA 4DV5B 4O4IB 4YHHB 3M7MX 2GV9A 4I55B 2JGUA 5LA6A 1WPBA 1FJGB 5JJJB 4YJ2A 2HHHB 4HNAA 5CA0A 3IAYA 5JQGA 4LH6A 2EX3A 1Z5WA 4YJ3B 5JJEB 2RQ6A 4CH4A 1HNZB 1TUBB 5KX5B 1VF7A 3JSNA 1X4TA 4UCRA 3RYHB 4UCOA 2JVDA 3WB1A 4I4TB 2KKWA 3BRCA 4U3JA 4DV2B 2YI8A 1TAEA 3RYCA 5EYPA 4IHJB 4ZHQA 1ZAUA 5J2TB 1RSOA 1M5IA 4B3RB 4KHPB 1KU9A 5LMUB 3JALA 4DR1B 5CB4A 1TGOA 4O2AB 3QG5A 4X66B 3BABA 2UUAB 5LP6A 3HKEB 4IIJA 4TUYB 4FM1A 4LF9B 1I7FA 1SA0A 4X1YA 4EEQA 4DV1B 2BTOA 3VQVA 3K5NA 1WN7A 1HNXB 3JAKA 3WB2A 3OTOB 4YJ2B 2YIAA 4U3JB 4TV9B 3PN1A 5IJ9B 2BTQA 3HKBA 4O4LB 1N34B 3HKDB 4ZI7A 4HBNA 4EB6A 4PI0A 3RYHA 4I50A 4O4JA 4LNUA 4DR7B 4TQFA 4FLUA 4L8JA 1SA0B 4D7SA 3K57A 4DR6B 4PI2A 5J2TA 4B3MB 4ZOLB 4DR5B 2ZCEA 2QM4A 3ZEDA 3ICXA 4LF5B 4O2BA 4JI2B 3VQWA 1TVKB 2YIBA 5EZYA 2UU9B 5JH7B 1N32B 1FFXB 1B04A 4UCUA 4Q6GA 4WBNB 5ITZA 3BPZA 5EYPB 4O2BB 4K8ZA 4X1YB 4NXMB 3JATB 3UT5A 1N33B 3ETQA 3SJCC 2UUCB 4X1KA 4DK1A 1XMQB 4FLWA 3JAKB 3A2FA 5J2UA 5JVDA 3RYCB 1QHTA 4B3SB 2F4VB 1JMKC 1QQCA 3K5MA 5KMGA 1SKVA 5LA6B 2P22C 4B08A 1TUBA 4CS3A 3WB0A 3QF7A 1JFFB 5EIBC 1DGSA 4DR2B 1H2SB 4JI3B 5J2UB 4HNAB 5CA0B 5BMVB 3K58A 1XHXA 5D5PA 5ITZB 3B2EE 5CA1A 5JCOC 2OYQA 4LFAB 1J5EB 4LF6B 3CHXA 4DR3B 4UFZA 2R72A 2ZIOA 2F66C 2BTQB 3HKBB 4ZOLA 5FPRA 4FFBB 3QTCA 3DSQA 5KHJA 4JI8B 3JASA 4IHJA 2R9AA 4FM2A 3JAWA 2E3CA 3U11A 1IBKB 4O4IA 2PGGA 4DV7B 1HNWB 4X1KB 4UCVA 3N2GB 5KHGA 2RJZA 2XHBA 3BA8A 2ZIMA 5LOVB 2QJ1A 3SR2C 3JASB 3JAWB 1M4UA 4JI4B 5GONA 3K5OA 3HKDA 1Q43A 4ZI7B 2VQEB 4DV4B 2R70A 4DRXA 4X1IA 4LF4B 4YY3B 1L8DA 4CC6A 2UUBB 5JH7A 4JYAB 5LXTA 3BAAA 4FM0A 1IBLB 3LNNA 4DUYB 2Q7GA 3SJBC 4F6RB 1KMIZ 4CS2A 4LNUB 4DV0B 3BHPA 1XNRB 4EB6B 1G6UA 4TUYA 3RYIB 4CC5A 3HKCA 1SQFA 4KL1A 5KMGB 1Q8IA 4X65B 1D5AA 4DRXB 1YEWA 1Z5VA 2JS5A 3U0ZA 5JVDB 3JALB 1S5JA 5JCOA 5JQGB 4I4TA 3T1YB 5LYJA 4DV6B 4X62B 4I9QA 3RYFB 5KHKA 3MAQA 3RWRD 4DR4B 2UXDB 4FLXA 5LP6C 2PZSA 5LMNB 3FFQA 1FFXA 1JFFA 4JI6B 3SJAC 3OTFA 5LXTB 4TV8A 4JI1B 5CB4B 1XMOB 4CH5A 4FLTA 4YJ3A 2Q7EA 4CS4A 5IYZA 5D5QA 5K1XA 2F95B 2YXLA 3N2GA 4O4HB 2VWKA 5BR8B 3E22B 2CAZC 1XI1A 4UCSA 4FLZA 2PYLA 1TA8A 5IJ9A 5IJ0A 5FNVA 4I50B 4O4JB 4LFBB 2E5LB 4X20B 3RGBA 4X1IB 4LF8B 4AILC 2VWJA 4TV9A 4I55A 4JI5B 4DK0A 4AQYB 5K1PA 3E22A 4AHCA 2PUSA 4IIJB 1HW7A 2ZNIA 4X20A 5LP6B 4PHZA 5FPOA 1Q3EA 4DUZB 4EFBA 1WNSA 2Q0AA 4GYCB 1T5EA 4DV3B 2ZINA 1M93A 2PY5A 5LYJB 5IYZB 4EFEA 5EIBD 4NVPA 4TOIA 2YIBD 1N36B 4CH6A 3K5LA 4LFCB 1XQ8A 4K0KB 3CB2A 4GKJB 4BW9A 5KHIA 2UXBB 4FVMA 3ZS8C 1HR0B 3JARA 2Q7HA 5CA1B 2F1MA 3T1HB 1P49A 3N2KB 2UXCB 4JI7B 1O9HA 3VQXA 1XHZA 2HEPA 1SQGA 4K8XA 1XNQB 3JSLA 5IWAB 2F93B 1TVKA 4WBNA 5JJNB 4LF7B 1I94B 4FLVA 4GLXA 4CH3A 3JATA 3UT5B 3N2KA 4BWAA 5BMVA 4ZIBA 2PTMA 4TQDA 4OX9B 1V9PA 4O2AA 5LOVA 4FLYA 3SGIA 4F6RA 5C8YA 4LR3A 1JJOA 3CSXA 4GKKB 4TV8B 4D7TA 3HKEA 3RYIA 1O9GA 2V4DA 2PYJA 4JV5B 5KX5A 5EZYB 4B3TB 2ZNJA 1Q5OA 3BA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NT2 B;  3B2E E;  3ICX A;  2P22 C;  3CSX A;  3SJA C;  3SJC C;  3SJB C;  2F66 C;  3QF7 A;  2CAZ C;  3ZS8 C;  3QG5 A;  3THO A;  2JS5 A;  1SKV A;  1X4T A; 
#chains in the Genus database with same CATH topology
 4O4H A;  2DQ3 A;  4O4L A;  4FFB A;  1N0N A;  2LFR A;  2A9H A;  3SYA A;  1IBM O;  4X64 B;  4NXN B;  2EIN C;  2C2A A;  2ZM6 O;  2VQF B;  5B3S B;  1SZT A;  3K59 A;  3T2M A;  2WLN A;  4YXW G;  2DWD C;  3E89 A;  3KCY A;  4B3R O;  5KHH A;  3CS5 A;  5FNV B;  1AR4 A;  1MA1 A;  2QWQ B;  3RT3 C;  1FXV A;  1G8M A;  1IXM A;  3VQY A;  4O4I B;  3M7M X;  2V1D A;  1V55 B;  3E83 A;  2JGU A;  5LA6 A;  1IZ3 A;  5GW7 A;  1WPB A;  3A0R A;  3BEH A;  4HNA A;  5CA0 A;  1NH2 D;  3BVO A;  1AIL A;  3GVM A;  4LH6 A;  1GK9 A;  2EX3 A;  2Q9L A;  4B3T O;  4FPP A;  4CH4 A;  3ASO B;  1HNZ B;  2GUZ B;  3E35 A;  1AP5 A;  1AR1 B;  1SQQ H;  4UCO A;  1E79 G;  3MHH C;  2AXT Z;  2RNB A;  1PP9 H;  3CX5 F;  4LWS A;  3JCU Z;  2ZE5 A;  4KHP O;  2B9Z A;  3E8B A;  1DF4 A;  5LMU O;  2DOS A;  1K9M W;  1JCH A;  1K4D C;  4PD4 F;  1M5I A;  4U7O A;  5CB4 A;  4O2A B;  4QPK A;  3BAB A;  3OEH G;  2KSD A;  5LP6 A;  1ZTE A;  2X6A A;  4MVQ A;  3HKE B;  4IIJ A;  2M6Y A;  4LF9 B;  1BHB A;  4EEQ A;  2CTP A;  2X7R B;  2OCC C;  3C90 A;  1UPG A;  1GN4 A;  4J9Y B;  3JAK A;  2BTQ A;  3OD4 A;  1ZL8 A;  3P32 A;  4ASU G;  1GM9 A;  3RYH A;  1H2K A;  4I50 A;  1HNX O;  3CCV V;  4DR7 B;  1IUR A;  4FLU A;  2LGW A;  3A8T A;  2XOK G;  3P30 A;  1BGY H;  1WPX A;  1KYO F;  4GX5 A;  3ZED A;  4OPA A;  2YSU B;  2Q0O C;  3CCM V;  2DJV A;  1TVK B;  2YIB A;  2HVK C;  4W4L A;  1FXK B;  4MTF A;  1N32 B;  1GN3 A;  4KUM A;  4LF5 O;  4I9W A;  4A5U B;  4NXM O;  4I0X B;  4RO2 A;  3EXA A;  1B04 A;  2UUC O;  1FS0 G;  3CC4 V;  3NR7 A;  5EYP B;  2CUG A;  1XOU A;  1N33 B;  1TUE B;  1M56 C;  1GM8 A;  3CYO A;  4X1K A;  3CD6 V;  4FLW A;  3A2F A;  3ZBH A;  1V54 C;  5JVD A;  3ASN B;  3DXR A;  3STL C;  4B3S B;  1RPO A;  3Q4H A;  2ADP A;  2MW2 B;  4B3M O;  3IC9 A;  2R9R B;  2P22 C;  4R6Z A;  4FJC C;  3ABM B;  2XAJ A;  3AG7 A;  5EIB C;  2DW4 A;  1MOF A;  2CTR A;  3CRM A;  4HAM A;  4JI3 B;  3X2Q B;  1R6T A;  5BMV B;  3K58 A;  3OR6 C;  3HPL C;  4DUY O;  3B2E E;  5JCO C;  4J7Z A;  4FIP C;  1US6 A;  2LFS A;  2YEV B;  1QNM A;  1XNR O;  3CHX A;  4DV3 O;  4UFZ A;  2BTQ B;  4ZOL A;  4Z1M G;  2XT9 A;  4PA4 A;  1XMQ O;  1EN5 A;  1BCC H;  4JI8 B;  3IFX A;  2OCH A;  2ILM A;  3F5T A;  1WP8 A;  1M9N A;  3ZRW B;  1B6Q A;  2EIJ C;  4X1K B;  4UCV A;  4R8C A;  1GN2 A;  2Q6A A;  1UFI A;  2BSK B;  2XHB A;  2R9I A;  2ZT9 B;  1GRJ A;  3K79 A;  3P3N A;  3ZHU A;  5GON A;  1CPY A;  5KA6 A;  4YY3 B;  1L8D A;  4JYA B;  1XNQ O;  2CGO A;  2Y69 C;  2Q7G A;  1QLE B;  4CS2 A;  4WCE V;  4H13 B;  4DV0 B;  3LSU A;  3BHP A;  2B5U A;  1G4Y B;  1G6U A;  4PJ0 Z;  3RYI B;  1N36 O;  1SQF A;  2OTL V;  2GSM B;  1Q86 W;  1Z5V A;  2JS5 A;  3U0Z A;  5JVD B;  3JAL B;  3CJH B;  4UVB A;  2ZDI C;  5B1A B;  1H8H G;  3O65 A;  3EVK A;  4QIW F;  1NVP B;  3SDL A;  3FD9 A;  4GX1 A;  4I9Q A;  1CP9 A;  3RYF B;  2JEX A;  1V55 C;  5LP6 C;  2PZS A;  4BIO A;  3AK3 A;  3QO5 A;  3S3W A;  1JFF A;  3SJA C;  5LXT B;  4DV4 O;  2W0F C;  1BQ0 A;  1SQP H;  3KG2 A;  2YS8 A;  4CH5 A;  3D3I A;  1P7G A;  1NH2 B;  2Q7E A;  5IYZ A;  1FAF A;  2F95 B;  1F23 A;  3BFR A;  5BR8 B;  2ATK C;  2WLL B;  1XI1 A;  2QTS A;  5FNV A;  1WB8 A;  3CCS V;  4J42 A;  4JPR A;  4LF8 B;  2EIL B;  4AQY B;  1PD3 A;  5K1P A;  3E22 A;  1EZJ A;  4JYB A;  2B1I A;  4J7J A;  4NXN O;  2ZNI A;  2ZDI A;  4X20 A;  3CXC U;  1NR7 A;  1Q3E A;  4DUZ B;  4IYH A;  4EFB A;  1PNK A;  1BMF G;  2YXY A;  3C3T A;  4W4K A;  4DR3 O;  2Q5Z A;  4J11 A;  2OIE A;  4K0K O;  3CCR V;  3H1I H;  2XAF A;  3K04 A;  4MVZ A;  4OPH A;  1FXK C;  1AI7 A;  4TOI A;  4GX0 A;  3FYI B;  2JGD B;  3H1H H;  3IC7 A;  2QWP B;  4WF9 V;  5KHI A;  1YTF B;  3JAR A;  1OCC C;  2EJR A;  2GUZ A;  1XDC A;  1SZX A;  3DC6 A;  3T1H B;  1F51 A;  2VQE O;  3SPC A;  2DN9 A;  4RUE A;  2P4V A;  1KQS U;  1AJQ A;  2IJI A;  3JSL A;  4QPJ A;  4F4L A;  3IJ4 A;  5F2V O;  2JJ2 G;  2BCC H;  4CH3 A;  2QDO A;  3W7S A;  4ZIB A;  4TQD A;  4OX9 B;  4O2A A;  4FLY A;  2N05 A;  2NN4 A;  3OT7 A;  3RYI A;  1O9G A;  3AG2 B;  2PYJ A;  3A0B Z;  1P84 F;  5KX5 A;  3O9O A;  3SYQ A;  4ZBM A;  3CJH A;  4CZZ A;  1NT2 B;  4MW8 A;  4D6T H;  1YF2 A;  1S3J A;  4LH7 A;  2EIK C;  3CEI A;  3HKC B;  2OWO A;  4JV5 O;  1COW G;  1LUW A;  2GHY A;  4ZHQ B;  3RYF A;  3ZRW A;  3QNE A;  4IGG A;  2ODM A;  2AZ0 A;  2IJK A;  3WFV A;  1MSW D;  3THO A;  5J9P C;  1BZK A;  1VAR A;  3SPI A;  2Y48 A;  3K0G A;  1FJG O;  2CTW A;  4JI0 O;  4C7U A;  5GON B;  2IM9 A;  2CDY A;  4DV5 B;  2IU3 A;  2N74 A;  2IU0 A;  1YDX A;  1QVF U;  1SC5 B;  1ZWI C;  2M7W A;  3DGE A;  3AG4 B;  4B7E A;  4YJ3 B;  1I5X A;  2RQ6 A;  2Q68 A;  2Y4U A;  1R3L C;  1TUB B;  4UUJ C;  5H6R A;  1VF7 A;  1X4T A;  3WB1 A;  2WPD G;  4I4T B;  4DV2 B;  4RQE A;  2YI8 A;  3DXR B;  4X64 O;  4ZKI A;  2RCV A;  1GM7 A;  4DR6 O;  1QLN A;  2YIC A;  4ZHQ A;  5KAI Z;  5IE9 A;  4B3R B;  3G6E V;  1Q6U A;  1BL8 A;  4DR1 B;  3UO2 A;  1TGO A;  2DE0 X;  3QG5 A;  2BSK A;  2NR5 A;  4TUY B;  5BZB A;  2YUA A;  2ITC C;  1DTO A;  2DYR B;  1SA0 A;  1MG1 A;  1F7Y A;  5IDJ A;  4X1Y A;  4DV1 B;  3UCS C;  3VQV A;  2GBO A;  1LUV A;  2D3O W;  3WB2 A;  4X89 A;  1K5S A;  1NKD A;  2YIA A;  1MZE A;  4U3J B;  1Q6I A;  3IGA C;  1W2B U;  4TV9 B;  2UXC O;  5IJ9 B;  4U3F H;  3LDE A;  3HKD B;  4ZI7 A;  4HBN A;  4EB6 A;  1KKD A;  2CK3 G;  1A32 A;  1I94 O;  4OXS A;  5IYD O;  2VRZ A;  1KEC A;  1VP7 A;  2DYS B;  1FYJ A;  1KKC A;  1H2N A;  4O2B A;  4JI2 B;  1VQ6 V;  2A79 B;  2QTO A;  1U97 A;  3K9A A;  3E2E A;  1S72 V;  1AB3 A;  1M57 B;  5LGT A;  1Q7Y W;  4K35 A;  1XRE A;  1XMO O;  3QVN A;  1BE3 H;  1SER A;  2HHH O;  4K8Z A;  1OHH G;  4JTA B;  1IXB A;  4TSF G;  3UT5 A;  3K03 A;  4UVA A;  4BIU A;  2F4V O;  1FKA O;  3JAK B;  4L87 A;  1XIL A;  5J2U A;  2JRI A;  3F7V C;  1SQB H;  2QKA A;  1HDJ A;  1OCO C;  1QBZ A;  1QQC A;  1XEQ A;  5KMG A;  1AVM A;  4CS3 A;  3WB0 A;  1Q81 W;  4P2Z A;  1NQT A;  1RM1 B;  4P9O A;  1JFF B;  1NJI W;  3E8F A;  1R3J C;  1S76 D;  1H2S B;  1B06 A;  2QSA A;  1YIJ V;  4RAI A;  5AG2 A;  5ITZ B;  5CA1 A;  1WLE A;  3W7T A;  2OYQ A;  3UO3 A;  1J5E B;  4XDJ A;  4LF6 B;  3C3S A;  2F66 C;  4J9Z B;  4UV9 A;  4DV7 O;  1NU1 H;  2QEX V;  3SPH A;  4LFA O;  1K7D A;  3L72 H;  3JAS A;  5L3B A;  2LGQ A;  1OCZ C;  2R9A A;  4IHJ A;  3JAW A;  1IBK B;  2ETN A;  4O4I A;  2PGG A;  3RW0 A;  1NR1 A;  1AI4 A;  1XL6 A;  2Y0P A;  3N2G B;  2EIM B;  1W0K G;  4LF4 O;  1AI6 A;  3BA8 A;  2ZIM A;  5B1O A;  5LHI A;  4RWU A;  1VQ7 V;  5L3D A;  4DUZ O;  1Q43 A;  2FB5 A;  4X1I A;  4WFA V;  3RBZ A;  2N04 A;  1VQN V;  4I5S A;  5JH7 A;  4PDV A;  5LXT A;  2YXH A;  2UXX A;  3FB5 C;  1IBL B;  4UB6 Z;  2UU9 O;  4DUY B;  3CWB H;  1KMI Z;  2EIN B;  4NKG B;  4LNU B;  1KBH A;  2HLD G;  3OTO O;  1XNR B;  4MVM A;  4TUY A;  3CPW U;  3CRR A;  3K3W A;  4RQF A;  2WLI A;  4DV6 O;  1N34 O;  4X65 B;  3TCU A;  1D5A A;  1I5Y A;  3OE7 G;  2P4K A;  2YDE A;  2F43 G;  1URF A;  1S5J A;  1JVM A;  3SYP A;  4I0X A;  1Y74 B;  3D3Q A;  1E1R G;  5LYJ A;  4X62 B;  1EN4 A;  4DR4 B;  3RWR D;  3WG7 B;  2UXD B;  2DMX A;  4FLX A;  1OZ0 A;  3DTU B;  1AR5 A;  3EHB B;  3FB8 C;  4YIO A;  4LWS B;  3OTF A;  3MDS A;  1GMG A;  2QKS A;  1S77 D;  3D36 C;  4X8A A;  4TV8 A;  1OCZ B;  2OCC B;  3JCZ A;  2EUL A;  1WP7 A;  2VQF O;  4FLT A;  4CS4 A;  3B40 A;  5K1X A;  4KFM A;  2GTS A;  2YXL A;  2WLM A;  2AW9 A;  1EFR G;  2P67 A;  1ORQ C;  4X88 A;  3OFN G;  2QKC A;  4NB5 A;  3H01 A;  3ZHQ A;  4FLZ A;  2PYL A;  4O4J B;  4U7N A;  2DYR C;  3ZRS A;  1K33 A;  2X0L A;  1OCR B;  1GAX A;  2KG7 B;  1H2M A;  3OMI B;  4DR2 O;  3TK1 A;  4JAA A;  4LFB O;  2PI4 A;  2PUS A;  3OM3 B;  1RFY A;  1F4N A;  5LP6 B;  3W7X A;  1N4C A;  5FPO A;  1YJN V;  5EK0 A;  1GH6 A;  2HFE C;  2W6I G;  1CEZ A;  2OTJ V;  4HZ3 A;  3OUS A;  3CXH F;  1T5E A;  4DV5 O;  2MK3 A;  3TXQ A;  5IYZ B;  5B3S C;  4GKJ O;  1IX9 A;  4EFE A;  2HVJ C;  1KB9 F;  2YIB D;  4CH6 A;  1I0H A;  3K5L A;  4JGS A;  4Z1V A;  2HR3 A;  1IVS A;  3ZS8 C;  3W7U A;  2LO1 A;  3ZMS A;  5IT9 N;  2DQ0 A;  1Y67 A;  4PDR A;  2UXB O;  3ETE A;  3M8A A;  4QNH B;  1JOY A;  3R65 A;  2ITD C;  2PF4 E;  4JI7 B;  4R7C A;  1SQX H;  3E86 A;  1M56 B;  4Z2W A;  1QCE A;  1D2D A;  5JJN B;  4LF7 B;  4GT1 A;  1AP6 A;  4BW5 A;  1H2L A;  2CGN A;  5CMU A;  2X6C A;  4MTX A;  3J7A U;  3FB7 C;  4BWA A;  2EIM C;  1UJW B;  5BMV A;  1VF5 B;  3GWK C;  3SGI A;  4LR3 A;  1N8R W;  3ABK B;  1L1F A;  5LBQ A;  3ABL C;  1GN6 A;  2L35 A;  5IY5 C;  2ZD9 A;  3G4S V;  2ZNJ A;  1Q5O A;  3BA9 A;  3F5W C;  2X6B A;  1ENV A;  3RFR A;  1R73 A;  3JAR B;  2ZM6 B;  3U10 A;  1SF9 A;  1PL0 A;  2WWW A;  3B8M A;  2QR4 A;  3D36 A;  3KKY A;  3K06 A;  1BHA A;  3G80 A;  3AG2 C;  4H33 A;  5H5N A;  2P5O A;  1BSM A;  1IBM B;  2JK5 C;  3HR0 A;  5DEC A;  5IJ0 B;  1N0J A;  5C8Y B;  4YHH B;  1JJ2 U;  2IW5 A;  2GV9 A;  4QE9 A;  2HJF C;  3ZCC A;  2WLJ A;  2HHH B;  1DK1 A;  3IAY A;  2XAS A;  4LBE C;  5JQG A;  1XUQ A;  3RVY A;  2FYU H;  3B09 A;  5JJE B;  1EZV H;  5KX5 B;  5FLX N;  4J10 A;  1RSO B;  5KLV H;  3QO7 A;  3T4Z A;  4H37 A;  1J95 A;  4MW3 A;  1P4R A;  1NTM H;  3BRC A;  1E1Q G;  4U3J A;  3LSS A;  5EYP A;  5E79 Z;  3ZHS A;  2EZP A;  1XL4 A;  1NZ6 A;  3E8G A;  5IWA O;  3CCU V;  1Y4M A;  1ZAU A;  1VIB A;  4PA6 A;  4PV1 B;  4KHP B;  5TIS Z;  5A2Q N;  3OGC C;  5LMU B;  3JAL A;  3HB3 B;  2UUA B;  3CRQ A;  1R6N A;  1PL4 A;  5H2F Z;  2ZE7 A;  3UKM A;  1VQK V;  4WFF A;  3H1L H;  4GKK O;  4AI8 A;  2WLK A;  1HNX B;  1KP2 A;  3ZHV A;  3OGI B;  4LF9 O;  1IBK O;  3PN1 A;  2QWR B;  5LGU A;  3HKB A;  1S0V A;  1K4C C;  4PI0 A;  4FMT A;  3ZIA G;  4O4J A;  4LNU A;  1HWY A;  1S5H C;  4BAY A;  3CRA A;  4L8J A;  1SA0 B;  4D7S A;  3K57 A;  1NTZ H;  1BT8 A;  1RP3 B;  1M90 W;  4DR6 B;  4PI2 A;  5J2T A;  4ZOL B;  3N27 A;  4DR5 B;  2ZCE A;  1JR9 A;  2QE7 G;  2QM4 A;  4G2K A;  4FZ1 A;  3ICX A;  4LF5 B;  3VQW A;  4F6E A;  5EZY A;  2A0L A;  1DF5 A;  4G28 B;  3WU2 Z;  1QR9 A;  4GCZ A;  1IBL O;  2UU9 B;  5JH7 B;  4JZ2 A;  1N33 O;  1AJP A;  1VQO V;  4WBN B;  2Z3Y A;  3KCX A;  5ITZ A;  2OT5 A;  3UM7 A;  4FK5 C;  2JJ1 G;  4O2B B;  4X1Y B;  4NXM B;  3JAT B;  5GTH Z;  3ETQ A;  4JTC B;  3SJC C;  2UUC B;  4MT8 A;  4DK1 A;  3OR7 C;  3SYC A;  3D8C A;  4X62 O;  2Y4T A;  3RYC B;  1QHT A;  1ZUQ A;  2KB1 A;  1JMK C;  1SS3 A;  2WAM A;  1AI5 A;  4LF8 O;  5B1A C;  4B08 A;  1TUB A;  5EBM C;  1Y76 B;  1DGS A;  3CCJ V;  5J2U B;  4HNA B;  5CA0 B;  1MNG A;  2YID A;  3RN4 A;  2UUB O;  5LHH A;  4KXR A;  2WA4 A;  2NNU A;  2IJJ A;  4X66 O;  4JI3 O;  4JF3 A;  4DR3 B;  2R72 A;  1QVG U;  3HKB B;  5FPR A;  1X59 A;  5KHJ A;  3QTC A;  3DSQ A;  3TJT A;  1YVW A;  4FM2 A;  2E3C A;  3APO A;  1L0L H;  3G67 A;  1HNW B;  3J81 N;  4JI8 O;  2H3O A;  5KHG A;  2RJZ A;  3W7W A;  1PNL A;  1PNM A;  2Z0A A;  1BS3 A;  5LMN O;  5LOV B;  2WLL A;  4BR6 A;  4JI6 O;  1M4U A;  4JI4 B;  3JD1 A;  1WJZ A;  3K5O A;  3HKD A;  4ZI7 B;  2VQE B;  2FML A;  1EM1 A;  3ZRX A;  2R70 A;  4DRX A;  1P7B A;  3L71 H;  4H44 B;  4JI1 O;  3SJQ C;  1YHQ V;  4FM0 A;  2G38 A;  2AGA A;  2LP7 A;  1OCC B;  4GX2 A;  3ABU A;  3MHS C;  4JYA O;  1MAB G;  3HKC A;  3PJS K;  5FL7 G;  4KL1 A;  2QA4 V;  4OX9 O;  4QE7 A;  2Q69 A;  5B5E Z;  4N21 A;  2EJ7 A;  5JCO A;  5H6Q A;  5JQG B;  1JPX A;  4JAV A;  4JI5 O;  1M57 C;  5KHK A;  4G27 B;  3NXS A;  1R6K A;  3FFQ A;  1FFX A;  4TWK A;  4XDL A;  2K9P A;  4GUN A;  3T4D A;  3ZRV A;  1AJN A;  2EIL C;  1Y74 A;  4FZ0 A;  3CRC A;  5CB4 B;  2PI5 A;  1EBO A;  4WFB V;  2RDC A;  3L9D A;  4YJ3 A;  2FKX A;  5D5Q A;  5CN0 A;  1YZB A;  1FXH A;  1Y6X A;  1K73 W;  4O4H B;  1SES A;  2Q67 A;  1QU7 A;  3E22 B;  4X65 O;  2CAZ C;  4LCU C;  2XND G;  1OCO B;  4AQY O;  5IJ0 A;  2E5L B;  4X20 B;  3RGB A;  1PKX A;  4AIL C;  4TV9 A;  3ZN1 A;  2LW1 A;  1R3K C;  2Q8V A;  3A0H Z;  4PA7 A;  4FFK A;  4WFG A;  4IIJ B;  4P9P A;  4UXN A;  1PM9 A;  2E74 B;  4PEL A;  1VQ9 V;  4UB8 Z;  1WNS A;  3R66 A;  5A9G A;  4OGQ B;  2ZXW B;  4GYC B;  5KUK A;  1NTK H;  4DV3 B;  2ZIN A;  1M93 A;  2PY5 A;  3I5D A;  1H38 A;  5KAF Z;  2K1E A;  1FPO A;  4I7Z B;  3K9S A;  4LFC B;  4IYI A;  4K0K B;  1K3E A;  3ML0 A;  2ZR3 A;  4LP8 A;  3AG3 C;  4BW9 A;  2XAH A;  4NTY A;  2WLH A;  2Q7H A;  2W6J G;  4JTD B;  3SYO A;  5CA1 B;  3T1Y O;  2YEV A;  4MVU A;  2F1M A;  4QJF B;  1P49 A;  4MSW C;  3N2K B;  3ABM C;  2AZ2 A;  2H8P C;  2UXC B;  1MZF A;  4K3A A;  3VQX A;  1XHZ A;  2HEP A;  1YJW V;  2HKO A;  3T1H O;  4K8X A;  2AHY A;  1XNQ B;  5IWA B;  4MVO A;  4PDM A;  1LNQ A;  2F93 B;  2DYS C;  1I94 B;  3T1C A;  3QO8 A;  4GLX A;  2QWO B;  3UT5 B;  3JD0 A;  2UUA O;  2PTM A;  2ZR2 A;  3J80 N;  2VS0 A;  1OCR C;  2RMK B;  3Q4H B;  5C8Y A;  1YXB A;  1PV0 A;  3CCE V;  1KD1 W;  4GKK B;  4TV8 B;  5BXZ A;  3S3X A;  4Q20 A;  4J80 A;  3CMA V;  4JV5 B;  1RPR A;  4JYY A;  5EZY B;  4EKW A;  3CC7 V;  4B3T B;  4ABM A;  1Z2G A;  5CBH A;  2P06 A;  3UQ8 A;  1VQ8 V;  4JZG A;  3GWO A;  1GO3 F;  3AG4 C;  1YI2 V;  2YI9 A;  4JI0 B;  5DED A;  4NYK A;  2BE3 A;  1B3Q A;  3ASN C;  3ZMV A;  3JD4 A;  5L3F A;  4UCT A;  2GDS A;  1CXZ B;  1FD9 A;  2AHZ A;  2XAG A;  3APQ A;  1L0N H;  5BR8 O;  4B7K A;  3LUT B;  1IDS A;  4I55 B;  1I08 A;  2H94 A;  2XUM A;  3VBB A;  1FJG B;  5JJJ B;  2JDI G;  4YJ2 A;  2A06 H;  5B66 Z;  2OIG A;  5EBL C;  5EC1 C;  1Z5W A;  4DV2 O;  2ZE8 A;  3JAM N;  2E76 B;  5LHG A;  3CCL V;  2A3Q A;  2CH7 B;  3K08 A;  3RYH B;  3JSN A;  4UCR A;  1HR0 O;  1MMM A;  2RN9 A;  1Q82 W;  2JVD A;  2WSS G;  3P3P A;  5CBG A;  5BY1 A;  2KKW A;  1KP3 A;  1G1X B;  2JIZ G;  4DR7 O;  1TAE A;  3RYC A;  1Q90 D;  3ZJZ A;  2HJD A;  4TT3 G;  4IHJ B;  3TET A;  1K8A W;  3B77 A;  1YIT V;  3KZI Z;  1U96 A;  3JD3 A;  2F23 A;  1WB7 A;  5J2T B;  1YTF D;  1RSO A;  5IY5 B;  1ZLZ A;  4PA3 A;  2Q4P A;  3ZMU A;  1SQV H;  3MD0 A;  1KU9 A;  2KG7 A;  4X66 B;  5L3G A;  1K5Q A;  1N32 O;  3L75 H;  4FM1 A;  5H9C A;  1I7F A;  5IYC O;  2BTO A;  3K5N A;  1WN7 A;  4DXW A;  3WG7 C;  1S5L Z;  5CA3 A;  3OTO B;  4YJ2 B;  1JQ0 A;  1W59 A;  2IBZ H;  4MVS A;  1YJ9 V;  4O4L B;  1N34 B;  3F7Y C;  1XBL A;  3RVZ A;  1FXK A;  2L6L A;  3AK1 A;  3OEE G;  4TQF A;  1DLB A;  3ETD A;  2Y0I A;  4MTG A;  5DN6 G;  4RUF A;  1M1K W;  5IYB O;  4B3M B;  2P6J A;  4QGP A;  4JI4 O;  2ZQM A;  4DYL A;  4NR1 A;  5LGN A;  3ZX6 A;  2ZE6 A;  3L73 H;  3OMN B;  3CCQ V;  3ABK C;  3ASO C;  2Z5U A;  3I55 V;  1NI8 A;  2CTQ A;  2QM8 A;  4JI2 O;  1FFX B;  3CP1 A;  5E1A C;  3STZ C;  3EFF K;  4UCU A;  4Q6G A;  4DO2 A;  4DW0 A;  3ZHT A;  1KC8 W;  3FX7 A;  5L3C A;  2QGN A;  3I56 V;  3BPZ A;  1BQZ A;  4H0L B;  1XMQ B;  3JYC A;  2KQX A;  1HNZ O;  1ZX3 A;  1SRY A;  4KP4 A;  5B1N A;  2F4V B;  1W0J G;  3ABL B;  4E4E A;  1ARO P;  3K5M A;  4CBC A;  3VOU A;  2WLI B;  2B1G A;  3FAV B;  1SKV A;  3H1K H;  5LA6 B;  4DR5 O;  4LC1 A;  5C93 A;  3L70 H;  3QF7 A;  2BOC C;  2FTK A;  3H1J H;  1OJH A;  1YSC A;  4DR2 B;  1ZSP A;  3ZMZ A;  3DC5 A;  5B1B B;  3FB6 C;  1NBM G;  2BOB C;  2D2C B;  4YY3 O;  4JAS A;  2O57 A;  3LDD A;  1XHX A;  5D5P A;  3AG3 B;  3AG1 B;  3FYE B;  1HP8 A;  4JYC A;  4GZR B;  2HP8 A;  1PPJ H;  4LFA B;  4DV0 O;  3ETG A;  3G71 V;  2ZIO A;  1GTO A;  2W0X A;  4IT5 A;  1SET A;  4ICG A;  4FFB B;  4N23 A;  2EZO A;  4LF6 O;  3U11 A;  4DV7 B;  4PDL A;  2LW7 A;  4IL6 Z;  3BCC H;  1K92 A;  5HFM A;  4NTW A;  2QJ1 A;  3SR2 C;  2LQT A;  3JAS B;  1WA8 A;  3JAW B;  4P30 A;  1LR1 A;  4DR1 O;  4DV4 B;  1VQ5 V;  1VQM V;  3FAV A;  4LF4 B;  2ZXW C;  4CC6 A;  2UUB B;  2LJ2 A;  5JWP A;  4DW1 A;  1VEW A;  3OUF A;  3BAA A;  4DV1 O;  3LNN A;  4XDK A;  4F6R B;  3SJB C;  3E8H A;  1ZL8 B;  3AG1 C;  1GKF A;  1K34 A;  1R3I C;  2WA3 A;  5KUM A;  4EB6 B;  2IH3 C;  4CC5 A;  1VMG A;  5KMG B;  4LFC O;  1Q8I A;  1VQP V;  4DRX B;  1ROP A;  1YEW A;  5GTI Z;  5DM6 V;  3SPG A;  2ARH A;  3SPJ A;  3LSQ A;  4JAU A;  4NTX A;  4I4T A;  3T1Y B;  3X2Q C;  1NS1 A;  4DV6 B;  1HNW O;  5B1B C;  2E75 B;  3MAQ A;  2Y69 B;  4B3S O;  2CH7 A;  3CME V;  5LMN B;  1Q6H A;  1Y66 A;  4JI6 B;  1WAZ A;  5KA5 A;  3LDC A;  5CBF A;  2UXD O;  2A7W A;  3ZN0 A;  1VQL V;  1V54 B;  4JI1 B;  3OW2 U;  1YCI A;  1XMO B;  3CE2 A;  3TGU H;  3B8N A;  1VQ4 V;  4BIZ A;  2DWE C;  3JD2 A;  4X9Q A;  3TXS A;  4WFE A;  3N2G A;  4PA9 A;  4WFH A;  1JA8 A;  2VWK A;  3G6B A;  4YHH O;  3H9V A;  4UCS A;  4E2L A;  1TA8 A;  5IJ9 A;  4I50 B;  4LFB B;  2CE4 A;  4XBF A;  2IJH A;  2P7T C;  3OAA G;  4X1I B;  2VWJ A;  3ZHR A;  4JI5 B;  4I55 A;  1D5N A;  2IH1 C;  4DK0 A;  4MS2 A;  3OMA B;  1WA8 B;  2JS3 A;  4AHC A;  2XAQ A;  1H8E G;  1VF6 C;  5EC2 C;  2ADQ B;  4J7K A;  3AEI A;  1HW7 A;  3M99 B;  4PHZ A;  2QM7 A;  5LL6 Y;  1JX9 A;  2XTA A;  1F4M A;  2QWN B;  2Q0A A;  1J5E O;  4UVC A;  4R50 A;  5LYJ B;  1EN6 A;  3AK2 A;  3FKS G;  3CC2 V;  3L74 H;  5L3E A;  5EIB D;  3BY6 A;  4NVP A;  1OV9 A;  2FL4 A;  3B4S A;  3K0D A;  1N36 B;  2ZKO A;  1FFT B;  2V7Q G;  1XQ8 A;  3CB2 A;  4GKJ B;  2E5L O;  2EIK B;  2UXB B;  4FVM A;  1R1B A;  4YIP A;  1HR0 B;  4JI7 O;  1KUQ A;  1QLE C;  2P90 A;  4HYO A;  4MVR A;  2YC0 A;  2HG5 C;  3LNM B;  1O9H A;  4MTO A;  1SQG A;  2GTA A;  1NVP D;  1TVK A;  1Y76 A;  4WBN A;  4FLV A;  5HFL A;  1VF6 A;  2EBO A;  3JAT A;  3N2K A;  2EIJ B;  2UXN A;  4UV8 A;  4LF7 O;  1RM1 C;  5EBW C;  3ZMT A;  2JGD A;  1V9P A;  4J41 A;  5LOV A;  2NLJ C;  4F6R A;  1H2G A;  1QR8 A;  1JJO A;  3ABT A;  3CSX A;  4D7T A;  3HKE A;  2JEU A;  2V4D A;  4DR4 O;  1THZ A;  2Q73 A;  1K97 A;  3GB7 C;  1MSD A; 
#chains in the Genus database with same CATH homology
 1NT2 B;  3UQ8 A;  4LH7 A;  3RFR A;  3JAR B;  2ZM6 B;  4O4H A;  3U10 A;  4O4L A;  4FFB A;  3HKC B;  2OWO A;  4ZHQ B;  3RYF A;  2YI9 A;  4X64 B;  4NXN B;  4JI0 B;  2VQF B;  3THO A;  3K59 A;  2P5O A;  1IBM B;  4UCT A;  5KHH A;  5FNV B;  5IJ0 B;  5GON B;  2IM9 A;  5C8Y B;  3VQY A;  4DV5 B;  4O4I B;  4YHH B;  3M7M X;  2GV9 A;  4I55 B;  2JGU A;  5LA6 A;  1WPB A;  1FJG B;  5JJJ B;  4YJ2 A;  2HHH B;  4HNA A;  5CA0 A;  3IAY A;  5JQG A;  4LH6 A;  2EX3 A;  1Z5W A;  4YJ3 B;  5JJE B;  2RQ6 A;  4CH4 A;  1HNZ B;  1TUB B;  5KX5 B;  1VF7 A;  3JSN A;  1X4T A;  4UCR A;  3RYH B;  4UCO A;  2JVD A;  3WB1 A;  4I4T B;  2KKW A;  3BRC A;  4U3J A;  4DV2 B;  2YI8 A;  1TAE A;  3RYC A;  5EYP A;  4IHJ B;  4ZHQ A;  1ZAU A;  5J2T B;  1RSO A;  1M5I A;  4B3R B;  4KHP B;  1KU9 A;  5LMU B;  3JAL A;  4DR1 B;  5CB4 A;  1TGO A;  4O2A B;  3QG5 A;  4X66 B;  3BAB A;  2UUA B;  5LP6 A;  3HKE B;  4IIJ A;  4TUY B;  4FM1 A;  4LF9 B;  1I7F A;  1SA0 A;  4X1Y A;  4EEQ A;  4DV1 B;  2BTO A;  3VQV A;  3K5N A;  1WN7 A;  1HNX B;  3JAK A;  3WB2 A;  3OTO B;  4YJ2 B;  2YIA A;  4U3J B;  4TV9 B;  3PN1 A;  5IJ9 B;  2BTQ A;  3HKB A;  4O4L B;  1N34 B;  3HKD B;  4ZI7 A;  4HBN A;  4EB6 A;  4PI0 A;  3RYH A;  4I50 A;  4O4J A;  4LNU A;  4DR7 B;  4TQF A;  4FLU A;  4L8J A;  1SA0 B;  4D7S A;  3K57 A;  4DR6 B;  4PI2 A;  5J2T A;  4B3M B;  4ZOL B;  4DR5 B;  2ZCE A;  2QM4 A;  3ZED A;  3ICX A;  4LF5 B;  4O2B A;  4JI2 B;  3VQW A;  1TVK B;  2YIB A;  5EZY A;  2UU9 B;  5JH7 B;  1N32 B;  1FFX B;  1B04 A;  4UCU A;  4Q6G A;  4WBN B;  5ITZ A;  3BPZ A;  5EYP B;  4O2B B;  4K8Z A;  4X1Y B;  4NXM B;  3JAT B;  3UT5 A;  1N33 B;  3ETQ A;  3SJC C;  2UUC B;  4X1K A;  4DK1 A;  1XMQ B;  4FLW A;  3JAK B;  3A2F A;  5J2U A;  5JVD A;  3RYC B;  1QHT A;  4B3S B;  2F4V B;  1JMK C;  1QQC A;  3K5M A;  5KMG A;  1SKV A;  5LA6 B;  2P22 C;  4B08 A;  1TUB A;  4CS3 A;  3WB0 A;  3QF7 A;  1JFF B;  5EIB C;  1DGS A;  4DR2 B;  1H2S B;  4JI3 B;  5J2U B;  4HNA B;  5CA0 B;  5BMV B;  3K58 A;  1XHX A;  5D5P A;  5ITZ B;  3B2E E;  5CA1 A;  5JCO C;  2OYQ A;  4LFA B;  1J5E B;  4LF6 B;  3CHX A;  4DR3 B;  4UFZ A;  2R72 A;  2ZIO A;  2F66 C;  2BTQ B;  3HKB B;  4ZOL A;  5FPR A;  4FFB B;  3QTC A;  3DSQ A;  5KHJ A;  4JI8 B;  3JAS A;  4IHJ A;  2R9A A;  4FM2 A;  3JAW A;  2E3C A;  3U11 A;  1IBK B;  4O4I A;  2PGG A;  4DV7 B;  1HNW B;  4X1K B;  4UCV A;  3N2G B;  5KHG A;  2RJZ A;  2XHB A;  3BA8 A;  2ZIM A;  5LOV B;  2QJ1 A;  3SR2 C;  3JAS B;  3JAW B;  1M4U A;  4JI4 B;  5GON A;  3K5O A;  3HKD A;  1Q43 A;  4ZI7 B;  2VQE B;  4DV4 B;  2R70 A;  4DRX A;  4X1I A;  4LF4 B;  4YY3 B;  1L8D A;  4CC6 A;  2UUB B;  5JH7 A;  4JYA B;  5LXT A;  3BAA A;  4FM0 A;  1IBL B;  3LNN A;  4DUY B;  2Q7G A;  3SJB C;  4F6R B;  1KMI Z;  4CS2 A;  4LNU B;  4DV0 B;  3BHP A;  1XNR B;  4EB6 B;  1G6U A;  4TUY A;  3RYI B;  4CC5 A;  3HKC A;  1SQF A;  4KL1 A;  5KMG B;  1Q8I A;  4X65 B;  1D5A A;  4DRX B;  1YEW A;  1Z5V A;  2JS5 A;  3U0Z A;  5JVD B;  3JAL B;  1S5J A;  5JCO A;  5JQG B;  4I4T A;  3T1Y B;  5LYJ A;  4DV6 B;  4X62 B;  4I9Q A;  3RYF B;  5KHK A;  3MAQ A;  3RWR D;  4DR4 B;  2UXD B;  4FLX A;  5LP6 C;  2PZS A;  5LMN B;  3FFQ A;  1FFX A;  1JFF A;  4JI6 B;  3SJA C;  3OTF A;  5LXT B;  4TV8 A;  4JI1 B;  5CB4 B;  1XMO B;  4CH5 A;  4FLT A;  4YJ3 A;  2Q7E A;  4CS4 A;  5IYZ A;  5D5Q A;  5K1X A;  2F95 B;  2YXL A;  3N2G A;  4O4H B;  2VWK A;  5BR8 B;  3E22 B;  2CAZ C;  1XI1 A;  4UCS A;  4FLZ A;  2PYL A;  1TA8 A;  5IJ9 A;  5IJ0 A;  5FNV A;  4I50 B;  4O4J B;  4LFB B;  2E5L B;  4X20 B;  3RGB A;  4X1I B;  4LF8 B;  4AIL C;  2VWJ A;  4TV9 A;  4I55 A;  4JI5 B;  4DK0 A;  4AQY B;  5K1P A;  3E22 A;  4AHC A;  2PUS A;  4IIJ B;  1HW7 A;  2ZNI A;  4X20 A;  5LP6 B;  4PHZ A;  5FPO A;  1Q3E A;  4DUZ B;  4EFB A;  1WNS A;  2Q0A A;  4GYC B;  1T5E A;  4DV3 B;  2ZIN A;  1M93 A;  2PY5 A;  5LYJ B;  5IYZ B;  4EFE A;  5EIB D;  4NVP A;  4TOI A;  2YIB D;  1N36 B;  4CH6 A;  3K5L A;  4LFC B;  1XQ8 A;  4K0K B;  3CB2 A;  4GKJ B;  4BW9 A;  5KHI A;  2UXB B;  4FVM A;  3ZS8 C;  1HR0 B;  3JAR A;  2Q7H A;  5CA1 B;  2F1M A;  3T1H B;  1P49 A;  3N2K B;  2UXC B;  4JI7 B;  1O9H A;  3VQX A;  1XHZ A;  2HEP A;  1SQG A;  4K8X A;  1XNQ B;  3JSL A;  5IWA B;  2F93 B;  1TVK A;  4WBN A;  5JJN B;  4LF7 B;  1I94 B;  4FLV A;  4GLX A;  4CH3 A;  3JAT A;  3UT5 B;  3N2K A;  4BWA A;  5BMV A;  4ZIB A;  2PTM A;  4TQD A;  4OX9 B;  1V9P A;  4O2A A;  5LOV A;  4FLY A;  3SGI A;  4F6R A;  5C8Y A;  4LR3 A;  1JJO A;  3CSX A;  4GKK B;  4TV8 B;  4D7T A;  3HKE A;  3RYI A;  1O9G A;  2V4D A;  2PYJ A;  4JV5 B;  5KX5 A;  5EZY B;  4B3T B;  2ZNJ A;  1Q5O A;  3BA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...