3OD4A

Crystal structure of factor inhibiting hif-1 alpha complexed with inhibitor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
342
structure length
342
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Crystal Structure of Factor Inhibiting HIF-1 Alpha Complexed with Inhibitor
rcsb
source organism Homo sapiens
total genus 105
structure length 342
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3od4A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3od4A01
3D8CA 4QU2A 1H2LA 2YC0A 1MZFA 3OD4A 2ILMA 2Y0IA 4B7EA 1H2NA 2CGNA 4Z1VA 4B7KA 5JWPA 2W0XA 2WA4A 4AI8A 4NR1A 2YDEA 3P3PA 4Z2WA 1IZ3A 3KCYA 3KCXA 4JAAA 2XUMA 1H2MA 2WA3A 3P3NA 4BIOA 1MZEA 1YCIA 1H2KA 2CGOA
chains in the Genus database with same CATH superfamily
4AWDA 2OTJV 2WL1A 1UN1A 3LA7A 3OYWA 2XHKA 2ZACA 4V2VA 3N9PA 5TSWA 4DV2B 3Q8FA 3OUJA 1POQA 3HKEB 2QWNB 4JTDB 4WBBA 1GZWB 2ADPA 5FMOL 2Y8KA 1APNA 4E27A 1EBOA 4K20A 2DN9A 5CFCB 5LXTB 1B09A 1EAH1 4EFEA 1RUF1 2ZNIA 1ZLZA 1W8WA 2W87A 1JFFB 3NJZA 4Y5Z0 4N7UA 4QPGA 1O9HA 4FLUA 2Q9LA 3L74H 2QQKA 4O9GA 4CDUB 4PD4F 2HWC2 3AG3B 5LASA 1VB2A 2FZ1A 4Z2AA 2F93B 1ZRIA 4BQ3A 3JD71 1YFUA 4BLIA 4FI9A 2OVUA 4LKDA 3KV6A 2DYRB 3R4UA 4UT5A 2VOWA 4KWJA 4X88A 2WKKA 2YYOA 2WLLB 1ALYA 1IXMA 3VD3A 2BERA 3PJYA 1OCRB 2ZBJA 1UFIA 4XF1A 2AREA 5HV0A 5A7SA 3RYIA 1N3OA 3ZIWA 3ZRVA 2FL4A 5I91A 1KXGA 4P30A 1TMF2 4XVHA 3T1LA 4FQ4A 2Y6LA 2Q8CA 2VR4A 1M57C 3ZSEA 4JQTA 3UETA 3AM2A 4DV5B 3ETGA 1ZRFA 3H50A 1ZZ6A 4LF8B 3WINE 3FYEB 3HJRA 4K21A 1G6UA 4CDWC 2UXXA 4EN9B 4FP2A 1DQ4A 4O7XA 4QGPA 1WB7A 4BMBA 3JAWA 4PJYA 1US6A 3TN92 4BK5A 5A6ZA 1RGSA 4CPBD 5A33B 1OHHG 2VTXJ 1ULGA 3ZDSA 1U0AA 2JD9A 2JG9B 4YHHO 4NTXA 1AR5A 1G9DA 2BDRA 3ASNB 2EJ7A 2BV4A 1ZBA1 2AR6A 1QXJA 2R1DA 4JZRA 3JCUZ 2XG3A 1YJNV 4A41A 1P84F 1ZA4A 3GDBA 2JIJA 3CJIA 2Q7EA 4OUSA 3UT5A 2PA7A 1XE8A 2HEYF 1DYOA 4F7ZA 4JHTA 2R043 1P49A 3AG7A 2VZTA 3JD2A 1W9YA 2HJFC 5B2GB 4CZZA 1SPPB 2KG7A 4TLFA 3W7TA 1ST8A 1RUI1 2PHLA 2Y4TA 1LHNA 1YNAA 3WNOA 1LGCA 2XLAA 2QM4A 2AEYA 2ZR2A 3JZVA 4ZU7A 2UXNA 2NR5A 5JCOC 3ZVXA 1W6OB 1NCQA 1GH6A 2EF6A 3L73H 4N23A 3KS7A 4GX0A 2P34A 2HWE2 2L6LA 1N0NA 1KD7A 3WR0A 3I2DA 5EFUA 3PUQA 1UU6A 2EAAA 2Y4UA 1MG1A 5CKMA 5GZDA 2Q73A 1TE1B 1QWRA 2VBDA 1IBMO 1OSGA 5IYZB 3NAPA 1WLTA 2B4KA 4M00A 3ZDVA 5FKCA 3LKJA 1E5RA 1VMGA 5IY5C 3KHBA 5FZFA 4RAIA 4ZHNA 2ZGPA 1JN2P 4QX2A 3B5LB 1AJKA 3LNMB 4LFAB 4YG6A 4RQPB 3RJRA 2C9AA 4JDNA 2EA7A 3NR7A 1R093 2OA2A 3HT1A 1OZ0A 5EC2C 1SLBA 4OYUA 3WG1A 3MICA 3S57A 5DZEA 3POSA 2OPKA 4D6TH 4WM8B 2BOBC 4M3CF 4WFHA 3N3HA 2YPJA 1ULPA 3ML0A 5IDJA 1Q6UA 3B93A 4QMAA 1AYM1 3SR2C 3DV8A 2Y0PA 4EV0A 4FLWA 5A7WA 1QXRA 2V09A 4X9QA 3MZHA 4LO6B 3MPBA 1I94O 1TUBA 4YG0A 4LMFA 2OQ7A 4YRDA 2WSVA 1IHMA 5JVDB 4BQ2A 4QWNA 4LK6A 3PTRB 2JEUA 3ENRA 1VIBA 4I9WA 4OLLA 1CJPA 2LRPA 1WBFA 2EILB 2JDNA 1W6MB 3SKJE 2P90A 2G9ZA 4LH7A 3J8F3 4CXYA 2UU9O 1SHWB 2DVDA 5FMBA 1PZ7A 5EJ3A 4R4XA 4A6SA 5H9PA 3JD3A 3S30A 3B00A 4JF3A 4XFHA 4RD7A 3WCRA 4TLGA 3DKWA 5FZDA 1PNLA 4FAGA 1MS0A 2EXKA 4UFMA 3E1F1 3SMHA 2WT2A 2ZKLA 3ACIA 3E8BA 5CFDA 2A7AA 4AHWA 2JB4A 3VBRC 3OD0A 3H1LH 5DAVA 2B45X 3M99B 4CEYB 5L3FA 1AR1B 4KQ7A 3AJYA 1JZ8A 4EWAA 4BIZA 1AR61 1CAXB 1NE4A 4AEMA 2A3XA 1MOFA 2HBTA 4HPKB 2A6XA 1DQ0A 3VBFA 5FL7G 1H4HA 3LD8A 2Q0OC 3BOWA 4DIQA 3DEMA 1W9TA 5F1RA 4L9BA 4WFAV 4LOTA 2XT9A 4XF3A 4L11A 2JS5A 1I08A 3WF4A 4WZCA 4ZBMA 4NHMA 4LFCO 5C8CC 3M4FA 4J1WA 4W8JA 1OCZC 2EIBA 4MSVA 3OGRA 4AAXA 2D5FA 1UX6A 3BN6A 1BEV1 5FZ7A 1GU3A 4X64B 5BNPA 4QJFB 3B3QE 4DS0A 2ZXWB 1FPN2 2NM1A 4UB6Z 3AVRA 1JTZX 2X5IC 4LBLA 4P5YA 1WD4A 5IFTA 5C93A 3FLPA 3AG1C 3ZMOA 4YW6A 1KQSU 2OCCC 1AYN3 4QIWF 2F4PA 4DUVA 1WCSA 5A3OA 2Z5UA 1YQ5A 3FC0A 3LSSA 1ZZ8A 3ZHTA 3BA9A 2QWRB 2DWEC 1PVC3 4BR6A 3BGAA 3RYRA 2C4XA 2ZAAA 2WZR1 3VBHA 2J7MA 4AEDA 5LA6A 3C2UA 1S0IA 1D7PM 1UY1A 4MH0E 3WG4A 4TOIA 1EN6A 5BNOB 4LF8O 5B4XA 1YIFA 1WCDJ 1DU3D 1QH6A 3NKTA 1Q82W 5FV3A 1RHI2 4DUXA 4Q27A 3SJBC 2F4VO 1CESA 4QPIA 1DFQA 3P3NA 1RXFA 4NE9A 4FMTA 2RS53 2VMHA 5A3MA 1XDCA 1PIV1 2QVSB 3LFIA 1PKXA 2FCTA 1GZTA 1RUG2 4LF7B 2BEOA 1S77D 4O2BA 4Q1RA 4ET7A 5C9AB 1PK6C 5F6LB 3AZXA 4PLNA 3VBUB 4CYDA 1XYPA 4R9DA 1S0JA 1B35B 5G04L 5EBWC 2Q68A 4KL1A 3ILRA 3T30A 1JOPA 5JAXA 4TXWA 1F4NA 1S0CA 4Y22B 3AL6A 2P7TC 2DVFA 2RS31 2EICA 4HETA 4XHXA 1X4TA 4HFSA 3U75A 2WLJA 1HXS3 1ND3A 2B42B 5AC91 3TXQA 4JV5B 1VALA 5FXVA 1YJKA 1AR81 4I0AA 2FDHA 2JDUA 2B8MA 2WSSG 3E2EA 5IVYA 4KGQA 1OPOA 4UFJA 4Q4V2 1XRUA 2QQMA 1AF9A 4CDXA 1UMZA 3J7NA 5CBHA 4OX9O 2RN9A 4I55B 4CP0A 4KWUA 5FZGA 4XFCA 4QKNA 1YF2A 2ZIOA 3CS5A 3I4IA 4QDRA 3I2IA 4PELA 4DUYB 2WFPA 2WN2A 5BY5A 1OCOB 4B3TB 3RI8A 3FBMA 4B7EA 4WZFA 2YXSA 1HQWA 4IDZA 2BBAA 3ZSMA 1RUH1 3JCZA 4FLTA 1XHZA 3RPQA 3O1UA 3CMEV 4JV4A 3IN9A 4HOOA 3MDSA 1BBT1 2R071 5ITZA 5TISZ 3MFCA 1DP0A 1RMU2 1QJX3 3SJAC 5CZKA 1OI6A 2ZX0A 2VJXA 2YROA 4D6SA 2UYBA 2ET1A 3IC9A 4ZONA 1TNRA 2P67A 3SXWA 4DUZO 4UFKA 4DOUA 2GNMA 2N05A 2ZHNA 4UAPA 4UFLA 4JKMA 3ITQA 2VQTA 2A3YA 3JU9A 3CRCA 2ZM6O 4ARXA 2QTOA 3VHNA 2RQ6A 4UXNA 4XAAA 2V4AA 1VJ2A 2LUWA 3WCSA 4CUGA 1SC5B 4GKKO 1W6PB 3O1MA 3HR9A 3VDDA 4TYSA 3JBG1 4HSJA 4JAAA 1SQGA 3AZWA 3MF6A 4TSVA 1WA6X 3K57A 2Y33A 4IGQA 1I5PA 2RDNA 2JB8A 1R3IC 2WT1A 2E33A 4X8NA 1WCUA 2VL4A 1K4CC 1NYWA 2P37A 4LLOA 1YSCA 5GZCA 1D0HA 2X05A 4R52A 4LFBO 2BTVC 5D8AA 4N53B 5K8SA 3QO8A 2ZGNA 3UYJA 4MHUA 1XPWA 4Q4Y2 4HXCA 3T4HB 3I2FA 5IATA 4IL7A 1MS3A 2ZIMA 3S5AA 3MDPA 2AC1A 1AI7A 1JYCA 2UWCA 3FD9A 4LNUA 1N3PA 5GM0A 1JX9A 2X8KA 2DDUA 3J7LA 2GNTA 4MGYE 4MVMA 4FOQA 2PGGA 1H6XA 1PO22 5T52A 1XHXA 1V9U1 5F5IA 3PL0A 3ZMSA 3H0OA 4AAPA 4DW0A 2PLV2 5KLVH 5DUVA 1BYHA 1XNDA 4CP9A 4BDVB 1VBB1 1W8FA 1AR73 1HW7A 3LE0A 3RFRA 4GMP0 4UBGA 1E5IA 1AL0G 4CUAA 5FP9A 2A6YA 3RZGA 2MEV3 5K0UA 1AX0A 4XDJA 4ES9A 4CCJA 1D2DA 2WQZC 3PJQA 3RMXA 2ARAA 1QQP3 2XAHA 3T2QA 2HWD3 4MGQA 5IE9A 5CA0A 4DV0B 1O5LA 3PTYA 5HCBA 1NA1A 1ODMA 1W8OA 3CWBH 1WLWA 2B1GA 2VXJA 2PTMA 5C4WA 4JYBA 1OKOA 2BE3A 3T1CA 3OUIA 4Q4X3 5FLIA 4AK3A 5KX5B 1M57B 2B39A 2GUZA 2CGNA 1QGLA 5KA6A 4IEYA 2ZX1A 5BNNA 3VDBA 4YYOA 2RM21 3MW3A 2UURA 2VD7A 1HRV2 3LZZA 2PMWB 3ZHVA 4CDWB 3LPFA 4RSUA 3F5TA 2IXJA 2E9QA 1NR7A 4PLOA 3EYPA 1OQEA 2P4VA 3LDRA 2QQIA 2W68A 1BZWA 2SLIA 3B9IA 2YICA 4KH9A 1YI2V 3SCFA 3R66A 5JXIA 4Q6GA 5IJ0B 1CR7A 4B29A 1DLCA 4FPPA 3O0WA 4NKGB 3U4SA 1ND2C 5FPRA 3VV1A 3BVCA 3E5QA 4COWA 3HKEA 1HDJA 3N35A 2HEWF 2Q69A 2GC3A 2DFCA 1A8MA 4NN0A 5T5LA 1GZWA 2YEVB 1DQ6A 4YPJA 4PA3A 1B04A 3OT7A 1I5XA 2BOJA 3VHPA 3AZVA 1AJNA 2LTNA 4NPLA 1S0GA 2E51A 1ENXA 4R8CA 5FOBB 5A3UA 4OZXA 5LXTA 2A70A 4QKDA 5K1PA 1GP5A 1JFFA 3K75B 3MHZA 4XJ9A 2ETNA 4JZ2A 4XUPA 1GUIA 3V0AB 3CCSV 4CDUA 4QX3A 4I3PA 3NNGA 4DXSA 4DK1A 1QDOA 4ICGA 1UMIA 4RWUA 4NRPA 3WQ0A 3I8TA 4DFSA 4BCUA 5LY2A 4PA7A 2HG5C 3T1HB 4XFGA 2DURA 1V55C 1S76D 1Q5OA 5A7OA 3KSCA 3WVJA 3AP9A 1XOYA 2H6BA 1KDMA 2WLLA 3WF3A 2XL9A 4HN1A 3OTOO 3OMIB 1DDLA 3H1KH 2YIBD 5DG2A 3O0XA 1IS6A 3ZX7A 2ZGMA 4RS5C 4ZKIA 3K3OA 3JARB 1PNFA 2VAUA 1VBA1 4JTOA 4XEZA 4LIVA 2UUCO 4BWAA 1HNZO 3AVSA 5CBLA 5C5UA 3ETEA 4Z82A 2GMEA 5CISA 3LSDA 1XNTA 3WOGA 3CRQA 3HQUA 1LOCA 1DQ1A 2AENA 2H3OA 4CH3A 5FZAA 4QPJA 2R0HA 4QDQA 4LHSA 4X1IB 1N32B 2IXLA 1FS0G 5I0UA 2IU0A 3NKGA 4A4AA 1YQ8A 2C5DA 3F7VC 1XE7A 4EEQA 4RFT0 5A33A 2FD8A 1YHQV 3KV9A 3LSEA 1VBD2 2J1TA 3LSQA 1DYPA 4MVZA 5I0TA 2R9IA 3ON7A 3N36A 1PNMA 4NIAA 2R72A 1NR1A 4HKOA 3D82A 3O1TA 3CKHA 1SQQH 4FXGB 2R9AA 4EN6B 2YBPA 2LROA 3WDXA 1FT9A 2AHYA 3V0BB 1W99A 1ZZ9A 2VCMA 5LGTA 2V4DA 3KKYA 4XCAA 5FY8A 2LO1A 1WPBA 2YV8A 3K9AA 3S0MA 2WC2A 4JI7B 4GJYA 1JPXA 5K4LA 2NZ9A 2QKCA 3D36A 3ZN6B 3ZN1A 1GAXA 4EFBA 4AQ2A 3VBRB 2VTXA 4XJWA 5F5CA 3IDBB 4ABMA 2PF4E 3DN7A 1F5JA 4WFEA 4WVWA 4QKFA 2OCHA 2RV9A 2EXHA 4YWAA 3NAPC 3WY6A 2W52A 2RR13 2BNNA 3AP6A 1HQLA 3H1HH 2OZ6A 4Y24A 4I9QA 2LW7A 1C4RA 2ZNJA 5IYZA 5C3OA 3R0RA 4DR4B 5C8CB 4GH4C 4I4TB 2EX3A 1IKPA 1OCZB 1S72V 1R091 5F9TA 2DCTA 3LQCA 2W3JA 5LB6A 5EYPA 2VXRA 4TT3G 4NJ4A 3H8XA 5A6XA 5B1BB 4YG3A 3AXEA 3WP3A 2W95A 4YW3A 4RQPA 1WUVA 5IK8A 4B3NA 4FCAA 2PHDA 4Q0QA 2Y69B 4XETA 2Z5WA 3VKMA 4IV1C 1QNYA 1TAEA 3TBDA 3O14A 3P30A 2HYXA 4MGIE 3ECQA 1AI5A 3WNXA 5IYBO 4C8DA 3W20A 1W9FA 5J2TB 4LBOA 1JODA 1QJY2 4N8MA 1WNSA 4MVQA 1F8VA 1W9WA 1CX4A 5FPXA 3AG1B 1OLRA 5FLXN 3NNLA 1ZAUA 2OCCB 3HWJA 4M4PA 2CAVA 3DKQA 2DWRA 4K0KO 1UIJA 2NN8A 4MGTA 1J1TA 4LF6B 3ABUA 3MIEA 2WLPA 1R1A2 2VC9A 1LECA 1FYJA 1W04A 3J8F1 3PIGA 4E4SA 4EQVA 5JVDA 5FP8A 1VQNV 1H2MA 1FXZA 3AKSA 3VHOA 1MACA 1H1IA 4CXXA 1WMDA 2QCSB 1W6MA 2WNUA 3ZXEA 2A5ZA 4B4RA 2HWF2 1FXHA 5FJKA 3AYEA 1SQFA 3WW2A 3FX3A 1TZOA 1M06G 3FKSG 4BQ4A 2OZJA 3BTAA 2ZABA 4CU9A 4W50A 2B9ZA 1LHOA 1WW6A 5B3SC 4FIPC 1MQTA 1QJU3 2OIEA 1UZYA 3JALB 4FFIA 4U36A 5DUUA 3VBFC 4WFBV 2VH9A 4NPMA 1HQNA 5BY1A 1QOTA 4NPRA 3F2ZA 2E7AA 4CEYA 1LOGA 2JE7A 3E5UA 2PHXA 3N2KB 3WQBA 2O14A 4GZ9A 1HB2A 1PK6B 1X36A 1CAXA 4D7TA 5FP3A 1VARA 5FYZA 4Y4RA 4HPKA 1VB4A 4O2AA 4OUMA 4LE4A 2P2KA 4V2WA 1M93A 3RI9A 2UXBO 5FY9A 2K2SA 3T08A 2P6HA 5D5QA 1H9WA 1G9BA 1KP2A 4IEOA 1PZ8A 1LJ7A 4OI2A 4LEJA 4EN8B 1VAKA 1BVP1 5KBFA 2GSYA 1DGRN 5C3RA 4IW3A 5A7QA 2ZE7A 4LF4O 5FZ0A 2I2SA 3A8TA 2VZSA 1EN4A 3HNYM 1T2XA 5C33A 2ZCEA 3WSOA 1RUF2 3DL3A 1Q8PA 5BNPC 2GSMB 5T50A 3TEWA 1WPXA 2QZ2A 4RYDA 4BHPA 2Q7GA 2Q30A 5FYHA 2VOTA 3JASB 4IYIA 2VVEA 4JHZA 3C7GA 2ARXA 5KHKA 2G9GA 3J80N 1U5IA 1EUTA 2ID4A 5E1RA 4DV3O 1AX2A 5LRRA 4LBMA 2VULA 3OGIB 4WV8A 1O5UA 2YHJA 2CUGA 1AYN1 4BWOA 4GAZA 3O5SA 1IVSA 3K77A 4PLMA 1XL6A 3VZLA 1R6TA 5C8WA 2LGQA 3SJQC 3FB8C 1K73W 3I3EA 4DO2A 3ZXGA 3U78A 3K03A 1M9NA 2IVJA 3POIA 4GB32 5H9SA 2O57A 2IFRA 2MK3A 1KS4A 3TK1A 3BIEA 3VDAA 1S2EA 1RYYA 2C0ZA 3KM5A 3FYIB 4NRQA 3VD5A 3ZSJA 4N21A 2W0XA 2RS51 1CPYA 3VBBA 2RS13 4CCCA 4GKJB 5BNOA 3ZYHA 4LWSA 4ZHQB 4IESA 4MGZE 1O91A 1JVMA 1NH2D 2YI9A 2E26A 1XILA 3THOA 1IBKO 4C0HA 5F3IA 1W8HA 1SLIA 1ULEA 3ZRSA 3S7IA 1Z5VA 2Q4PA 1DGSA 4I3GA 5IK4A 1TMF3 2RMU3 1K92A 5FQ0B 4MW3A 4XQDA 1ZBA2 1JZ7A 4HANA 4DRRA 2B7YA 2FB5A 4ZS2A 5H5NA 1ASJ3 3TRSB 4YZ2A 1XSRA 1R082 3CC4V 5C9AA 4JI5B 4MZUA 4IYHA 2DBIA 1Y76B 2D97A 1WZXA 5H6QA 2ODMA 3ZKUA 3VBUA 1HP8A 3WLUA 2VMDA 5BUVA 1DBNA 1HXS1 5LMNB 4JI0B 4UWDA 1BHGA 1HRI3 5JZGC 4AGGA 2Y38A 4Y22A 1GANA 1WW5A 1OUSA 1RUI2 3VL9A 1FI2A 1JW6A 3AFGA 1WA4A 2H6CA 1DZQA 1BZKA 1WJZA 1QVGU 3GCWA 5F5AA 3RYKA 4CXWA 4NROA 2HH9A 2EULA 4I0XB 1GOHA 4AVCA 3O7OA 4FPJA 2IJJA 2ES3A 3R05A 3HN1A 1B6QA 1TEIA 4AQYB 5I8TA 5SV8A 1MS8A 4MG2A 1SESA 3UGFA 1KRIA 3AP4A 4I55A 1VQ6V 3T2MA 4DR4O 4XILA 4CCMA 2XOMA 3IKWA 1CX1A 3ABLC 3L9JT 2XJQA 3SYQA 1G86A 1QJX1 1RUC3 2JGDB 4IGPA 5ACA1 2PYLA 5A6YA 2WN3A 2Q4SA 3LWCA 4MSWC 1SS3A 4O4HB 1R64A 2BVBA 2JJ6A 4NIIA 5CYYA 3UL2A 5EHDA 1CZVA 1YXWA 1G8MA 2X53S 3CRMA 4NHLA 4P02B 2ZINA 2ZGTA 3FN9A 3B40A 4BXFA 3VDDC 1RJ7A 2DU0A 1GK9A 4GWMA 2EIMC 1ODNA 4TQDA 2VCAA 2DCJA 1GKFA 2BTOA 5FZKA 1J3PA 3H7YA 1RVF3 1UZZA 4DR7B 1H4GA 1ZWIC 4RUFA 2W46A 4CPBA 4ITCA 3V56A 5IWAB 2VZQA 3BI3A 4OZOA 1ND2B 2ZJCA 1UZVA 2DUPA 3MW2A 2ATFA 4MXWB 3CCMV 2QE7G 4N53A 3KVAA 1O8PA 2E53A 1XU2A 1PMJX 2WS91 3L70H 4P9PA 3JAMN 1AHSA 5JIUA 3RDIA 3PIJA 5EXOA 3POWA 3KQ4B 3SYCA 3OGGA 2KA3A 1AR71 4QKBA 4CP2A 2VVFA 2NMOA 4YM1A 3ME2A 3VL8A 4QHZA 4YXWG 1EAH3 2ZZQA 2Z3YA 3LEMA 5I0DA 3OEBA 3W7UA 2IWGB 2MEV1 4K3AA 1SZXA 1ULFA 1JUIA 4BIOA 3KZ4C 4AYUA 4XPVA 2VQEO 1X82A 2QA4V 3NXSA 2E5LO 1AR62 4KFMA 3PN1A 3RS6A 3ILNA 2WLMA 3W58A 1JOJA 3RJ2X 4XUQA 5LGNA 1QQP1 2JK5C 2VZRA 3JD73 2HWD1 1F2NA 2XHNA 2W1WA 2Q8EA 3RWNA 1V55B 4GD4A 1JZ5A 4MOAA 1XNAA 2EJRA 4NYKA 3IMMA 3FAVB 5KR7A 2YU1A 3KLSA 1VQMV 3ASIA 3CMGA 4Q4X1 5L7OC 3Q8BA 4YZ1A 5FMOS 2J1UA 3QVNA 4IEQA 1XUQA 2YFUA 4DINB 1BHAA 3IDAA 3QO5A 1FAFA 4RS5B 4Q0UA 1BEV2 1MPXA 2J1VA 5FPBA 2P3JA 5J09A 4UCRA 1G4YB 3TCUA 3VB9A 5KX5A 3OMNB 1HIXA 3JAWB 1W6QB 5GLVA 5DZFA 2Z2SB 1C5HA 2QJ1A 3CHXA 2N04A 3VKNA 1NKDA 1HV0A 3GBGA 2G1MA 1FJGB 2AACA 4IL6Z 2WWWA 2XJSA 1R73A 4W4LA 4CDWA 1HX6A 1W2TA 3WQ1A 2FBEA 1FFTB 3OEHG 3CC2V 4GKXA 4X6QB 3WDYA 1QJEA 3USUB 3DXRB 4MTFA 2ILMA 2ZPXA 2IUWA 5IAXA 3G67A 1S3JA 4X20B 2CWMA 1IURA 2E7TA 2WZR2 2D3SA 4KUMA 1XMQB 2JKXA 4HVRA 2R70A 1W8ZA 2Y6GA 3S3WA 1JQ0A 3ES4A 1FPN3 1TA8A 3FMGA 2JXAA 2VS0A 5CMUA 4AQSA 5FXZA 1SBEA 4B3SB 4EKWA 2QQLA 2ZGRA 2KG7B 2TEPA 4AI2A 4IEZA 3D3IA 4BIFA 2XOKG 2YEVA 5BR8B 1THZA 5EJZB 4GKYA 5DUWA 3SYOA 1PIV2 1QKQA 1Q81W 1UZ0A 2WA4A 1WW7A 3CJXA 1A32A 4CCLA 2NNUA 4Q8LA 3ATGA 2ADEA 4FJCC 4ARYA 2ARHA 1AR93 4BQ1A 1HNXB 5K7PA 3K5MA 4XBNA 3V0AA 4OI0A 1MZEA 5H2FZ 2WSUA 1DLBA 2CU5A 2ZE5A 1O9GA 2YZ4A 3ZMTA 3CRAA 5BXZA 4ZKTB 4C7UA 5F3EA 1GN6A 4HZFA 4NIHA 4YW1A 5B5EZ 4JTAB 2D40A 2X6CA 1KYOF 2WINB 3E6BA 1F15A 4F83A 3LNNA 4QQOA 1RITA 3SYPA 4BH9A 1WBLA 2GZWA 4FOWA 4JAUA 1KEXA 2DV9A 4AHYA 3I55V 5A3TA 1GM8A 1YIPA 2EIGA 2B1IA 1SQBH 4AEKA 4GH4B 2RS32 2F6BA 2A73B 2DCYA 4LTAA 5I93A 4KU8A 1J5EO 4BK4A 1AR82 2EINC 1W59A 2XGXA 1W2BU 2DTYA 3JARA 3VOUA 2JD4A 4RR3C 4IV1B 1PGW2 4AQYO 5HXMA 1QNWA 3POGA 2VQ0A 2VCBA 2YXLA 1C8M3 3USSA 2RE9A 1UOFA 1JYIA 2BBVA 4EN0A 1TQ5A 3IAYA 2JDYA 3TXSA 2H0VA 4X1IA 1GOGA 1Q6HA 3BB6A 4NIGA 1X8MA 1AYM3 1M90W 2D6KA 3AFKA 2ZXQA 4CUBA 1H38A 1SACA 4ISRA 3LFMA 2G38A 5FNVB 2JICA 3PVNA 1RINA 3WD5A 4XHBA 1IXBA 3K3NA 4COVA 4E8CA 4J1XA 1L7RA 3E22B 4YSFA 3P5BA 4LLFA 1BBT2 2R072 2VNVA 3D8CA 3ZX6A 2GH2A 4QPKA 4RHV1 4A3XA 1S5LZ 5HFLA 1WB8A 2ENRA 1MZ6A 5JMOA 2XUEA 4FM2A 4GJZA 1O4ZA 3V0BA 3OGVA 3C8XA 5CG9A 4GYCB 2XB6C 3G6EV 1YFWA 1ZBE3 1J95A 1W8UA 4CU8A 2UXCO 4JI6O 5B3SB 1NH2B 4EE2A 3UJQA 3JBG2 3ZN6A 4TWTA 2AZ5A 2RR11 4K8FA 3WEZA 1BVVA 3VBFB 4Y3OA 3PUSA 1TVKB 1OLQA 3VD7A 4DR2B 2F66C 2CDPA 1M1KW 2WNEA 2BW8A 3RYCB 4ATEA 3I5DA 1VF6A 1DCSA 2B46X 1VQ7V 2YS8A 1AROP 1PO11 2QQPA 1VIWB 4BJ0A 4PCRA 1IBLB 1V6KA 3INAA 3TETA 3RNSA 5JXHA 1NCRB 3OUFA 3IBMA 4K8XA 3EO6A 3QF7A 3GYDA 1VRH3 2VO5A 4BQWA 5JOYA 3K5NA 1S0BA 4J7KA 3FZ3A 5FYIA 4GX2A 1KECA 4LHKA 4RQPC 5H9CA 4I4TA 3ZMZA 4CP1A 3ZXLA 2BGPA 2GTAA 5BPXA 4AI9A 3P32A 1V9U2 1Q56A 3NSTA 2UWBA 2ORZA 2YMZA 2QKDA 3N9OA 4XW3A 3FLTA 5FY5A 1VBB2 5E8AA 4JVAA 4H37A 3ZCCA 2XONA 4HSLA 3GB7C 1OT5A 5ANNA 5CA1B 3K0GA 2EZPA 2EXJA 3MFAA 3RZKA 5A9GA 3H8UA 2EZOA 1VAVA 3OPZA 3CF6E 1OUXA 2L9LA 1IPSA 3CO2A 1GYKA 5FYUA 2XJRA 1UIKA 1JYVA 4P9OA 5BV6A 3LIHA 1YDXA 1DQ5A 1FXVA 2WNUC 5LA9A 1SLLA 1YCIA 4UCVA 1UYXA 1WMFA 4BXSV 4K1YA 4UVCA 1SCRA 1FV3A 1PPJH 1N4CA 3IB3A 3ZFEC 2EBOA 3RZZA 2R49A 1YJ9V 1X9PA 2RM22 2LM3A 3FWEA 3G4SV 4L92A 4P2ZA 1QJU1 1IG0A 1KKDA 1MQTC 4QPYA 2XVGA 5BZBA 2JJ1G 1SBDA 1BGYH 3UQ8A 4R50A 2A9HA 4QB6A 4J11A 5EK0A 1QH7A 1M4WA 4NHKA 3JALA 4B8EA 4W4ZA 4XFIA 3R65A 1I7FA 1H6YA 1T6GC 2VM9A 4H14A 1VQPV 1LKNA 3LDCA 1W2OA 1QHDA 3MHHC 1LR1A 3IGAC 3N2KA 1PK6A 5A1AA 3U10A 4EZ4A 3WX5A 5JR2A 4F3JA 4LNVA 5EBLC 4GLXA 3TB0A 5JCTA 1UXXX 4MLOA 5JZGB 4C90A 5FYYA 1Y66A 2YSUB 2X0LA 1V6JA 4K8RB 2PYJA 4UFZA 3J7AU 4H33A 2IW5A 1BCCH 1VF7A 1DG6A 1DIWA 1V6NA 3H1YA 1SZTA 5AC93 1JR9A 3JASA 2ZXWC 5DXDA 4YNIA 5FZOB 3ZYGA 4GA9A 1X33A 2X10A 1XOUA 1UKGA 3WNMA 4JI8O 3HD8B 5CEHA 1N33O 4FTEA 3RYPA 5C71A 3ACLA 1NXD1 4HZ3A 3ST7A 3UKTA 3B8NA 1ROPA 1IKQA 3QACA 3E8GA 3T4ZA 5E88A 1YFXA 5SV5A 1KUQA 2R1BA 3ABLB 4Q29A 2O8QA 4LR3A 5C5TA 2A71A 2DYSC 3JATB 4NXMO 2RS11 2GP3A 1HNWO 3K79A 5I8SA 3VN4A 5BNOC 3ZHSA 1RUH3 1K34A 3WG3A 2VMFA 4JKKA 5GLTA 4UFHA 3NWKA 2V1DA 3OGCC 3N7KA 5DZGA 4O4JB 1H8TA 3CCUV 5FK7A 1N1YA 2N7GA 1TMF1 5FZ3A 3B7MA 2FCVA 2RMU1 2HHHO 3AKQA 1LOFC 5DM6V 1Y67A 1I3HA 3VDDB 3CP1A 1GR3A 2BWCA 2UWAA 4PA6A 1ASJ1 1RUJ3 2EIMB 4FPGA 2DQ0A 4O61A 1NS1A 3KB5A 1YZBA 1NX9A 5CN0A 1JZ3A 2RHPA 3TN91 5FDBA 3OSDA 1JZ4A 1NTMH 4YIPA 2R042 1GQHA 4DXRA 5IK5A 1HRI1 3THPA 4X65O 3P6BA 4L99A 1MSWD 4JDMA 1Y76A 2CTPA 4LNUB 3WUDA 4Q0SA 4EZHA 1IBMB 1KB9F 3LUTB 4I7ZB 5FUNA 5FZ4A 4K3UA 1LU1A 2VZOA 4AVVA 2WNVC 3I2GA 1LUVA 1A3KA 4JYYA 4IV3C 5B4NA 3FBYA 2WJSA 3K46A 1ZM1A 4G3YC 4LHNA 2W92A 2YPDA 1RP3B 2I07B 4K1ZA 2HKOA 3B02A 1JU4A 5FZ1A 4I0XA 3NV2A 5IYDO 2VY0A 1REEA 3ZFFA 4TV8B 3HIFA 1CGPA 4TWKA 3N7JA 3FB7C 1RUC1 3RT3C 4PDLA 2WIIB 3WG2A 5EWSA 3WNNA 4PF5A 1ZYBA 4META 4FPYA 3Q8AA 3ZPOA 3MD0A 1I94B 2YUEA 1TG7A 5F2SA 1R092 5L7OB 3B2EE 1WCKA 5FIXA 2P22C 3MIDA 2ZAHA 2GUZB 2JGDA 2HFEC 3KT7A 2E76B 3MLJA 1XNQB 2ZE6A 1IS3A 1BKZA 1NQDA 1XQNA 4JASA 1VQ9V 4O4HA 3BU7A 1MS9A 5J37A 1UZWA 4HKLA 2KM2A 1YLLA 2UU9B 3K08A 2WRAA 3ZRWB 2A7WA 4DNYA 1RVF1 1SQ4A 3I2JA 2XXZA 2RCVA 4IIJB 3POJA 3ABMC 4DV4O 1DLLA 2UUAO 3ZXDA 4OGQB 1KU9A 3H7JA 3WW3A 2QJVA 3J8F2 1YO8A 4EWEA 2ZKOA 2CH7B 1WA8B 4LQRA 2QQVA 4N53C 3STLC 1ND2A 3I2KA 4Q26A 4GCZA 4YW4A 5FO9B 4MXWA 3VKOA 1IX9A 3H3LA 1PV0A 3LDEA 2P3IA 2C26A 2DTWA 4YJ2B 4LFCB 1AL22 1S0EA 4K40A 1YXBA 2JKBA 1H8HG 3RVHA 3DYOA 4UB8Z 4BYYA 4I5SA 1XI1A 4OMCA 4JI2B 1PGL1 4WVMA 3FLRA 2FQPA 2YFZA 5FPAA 2JX9A 1U97A 4YARA 2XWJB 4RN5A 4FZ1A 2W5FA 5H9RA 1SRYA 2B5UA 1BL8A 5A80A 5GLUA 3RBZA 3MHSC 3IIAA 1KFUL 3KZIZ 1JI6A 4LULA 3A0RA 5KMGB 3HB3B 3KV4A 4Y20A 3MW4A 1HV1A 3FE5A 3JD1A 2FDKA 2WAMA 3TAYA 1VMJA 3JQXA 3R6SA 2C24A 5FUIA 5LA0A 2C6SA 3DSQA 3FAVA 5LCWL 4LH6A 3KGLA 3B8MA 4FLXA 2ERFA 2P6JA 2BRTA 4QQPA 5L9VA 2VMCA 4RO2A 1LHWA 4S2DA 4FFGA 4IEVA 3WZ1A 1EP0A 2EINB 3OPWA 1OJHA 2YIAA 2VBPA 4RS5A 1V6LA 4AOCA 4JGYC 2CDYA 1S5HC 3OBAA 3SPHA 1VBA3 4RR3B 3KVBA 1RUD3 3G80A 1AYN2 1PZ9A 3TOJA 4DB5A 1XMOO 5FKBA 1YFYA 1NI8A 3AMQA 1W6QA 4L2NA 2F4VB 4FPKA 4YY3B 2BTQA 5L36A 1NY71 1OD5A 3JAKA 1GNHA 1LR5A 1PVC2 3ZMUA 1DGRA 3JSNA 4NOTA 4WM7C 4U3JA 4O9EA 3KMHA 1A8DA 5FZ6A 2DE0X 3H42B 1FPN1 4YLZA 2XR4A 5A3LA 1GP4A 4HKWA 3THTA 1OOPC 4LBJA 3USUA 2ZX2A 3DXRA 2FDJA 4DY3A 3KCYA 5FCCA 4GUNA 2P3YA 4X20A 1KD1W 4DW1A 3FUOA 1SQPH 2RVAA 1UY2A 3J7HA 1Y9GA 3ALQA 1Q7YW 4CTEA 2J22A 2RS52 4CDQB 3AL5A 3PMSA 2A06H 2UXDO 1QDCA 2FKXA 5A32A 4QX7A 1S0VA 4M3CA 1AI6A 1UD1A 2K1EA 2OKXA 3F7YC 1AR91 4YIOA 1K42A 1JYXA 1S55A 3W21A 2QZ3A 2VZUA 2J1RA 3K04A 2ARBA 3MGUA 2RJKA 3OBZA 3GZEA 3X29B 1N34B 5FPLA 1LODA 3MF9A 2GNDA 1L0NH 5GJ6A 2IXHA 1V54C 2TBVA 3BODA 1XJAA 3GXUA 3A21A 1MS5A 1HB3A 1GN4A 2OYQA 4KBBA 1E79G 2I74A 3V65A 4URTA 5FZ8A 4YM0A 1PMHX 4ASKA 4OX9B 1OF4A 4JKLA 4UW6A 5FP7A 2N74A 3OR6C 3WDTA 3A0HZ 3MBWA 3NW4A 4YFWA 2D93A 1HXS2 2BFUS 5EYPB 3I2OA 1KGYA 1HW5A 4NR1A 5DAPA 1A78A 3HAGA 2WLNA 2LALA 3B01A 4KGGA 3IPVA 4FLYA 4GH4A 2H8PC 2QFEA 5E16A 1AP6A 2VUCA 1MMMA 3CCLV 3DCQA 1DZRA 5F2VO 3RRDA 1C8M1 4TSFG 4YW7A 1VBC2 4DRXB 1NT0A 3O0VA 3W7WA 4DUZB 4IV1A 2CGPA 2DCZA 1GN2A 2E63A 2QWPB 3X2QC 4BLJA 1OH3A 3J26N 4QHOA 2Z0AA 1FPOA 3N9QA 3AG2C 2P06A 2LGWA 3MI8A 5DABA 4QB2A 2UUBO 4LF9O 2ZM6B 4MXVA 2R16A 2H0BA 4FFBB 1MEC3 4UCTA 4FFFA 4GKKB 3M1HA 3RYHB 1COV2 2W08A 3VQWA 2XJUA 3VKLA 5M0TA 1JJ2U 4DQAA 2W2IA 3I7DA 3CX5F 4JRLA 5FWEA 1PL0A 3K06A 3ZPYA 1XNQO 5FNVA 4DR5O 4JX0A 2ZHMA 4JPRA 1L7LA 2V72A 1QBZA 1LOEA 2WNUB 3E22A 2GN7A 4D3WA 3BPSA 3EXUA 2ZOEB 1UYZA 3WB0A 1GNYA 4LFBB 3PVOA 5CB7A 1ZBE1 2JRIA 3ZFEB 2G19A 3E8FA 1CN1A 2XAGA 3RMYA 5LEKA 1OA3A 3I3MA 3T3YA 4JI4O 4PIZA 3G71V 2BNMA 1AB3A 1V0AA 1MQTB 3AYCA 1OC1A 1OA2A 1H1MA 3HPNA 3WP5A 3K58A 1O4TA 3JB8A 5KXCA 5B1NA 2FDGA 5L19A 2CYFA 1CPNA 2E74B 2WABA 1C5IA 5D2AA 3OR7C 3H3UA 3OEAA 2K0GA 2QQNA 2JDMA 1VF6C 1K33A 4O2AB 4AVSA 1OKQA 4B7KA 2WWUA 1LHVA 1TVKA 5JSPA 2L35A 1YWKA 1VRH1 5KC6A 4G4FA 2VZPA 3AJZA 1C1FA 3OAAG 3RYCA 3PDQA 4N90A 4X1KB 3J4UH 2R32A 3BABA 4AXOA 2ZGOA 4JTCB 1VMFA 2HWB3 3ZFGA 1WAZA 3GM8A 2ITDC 3JUUA 1DGWX 1NCRA 5CADA 4IGOA 3ZXAC 4X89A 1UYPA 4A44A 3IAPA 3EQEA 5B1BC 2KB1A 3CZUA 5L73A 4JI2O 4WBNB 1D0GA 1WCQA 1SFNA 4QB1A 5JPMB 4BB3A 1AR72 4E4EA 4PQ9A 4Q4Y1 2Y69C 1FXKB 4J6GA 1LNQA 1H9PA 2JEXA 1QXPA 5LBEA 5J3UA 2ET7A 4XACA 1QCEA 5E1AC 2MEV2 4N43C 3DYPA 4EYUA 4K7JA 4UI9L 4BQ5A 2R063 4D7SA 2Q1FA 3TNPB 4AILC 2DBNA 2ADQB 1QJFA 2Q67A 2X09A 2XNDG 4MGSA 1OMIA 1PO21 1QQP2 1P4RA 3CXHF 2E7QA 5JXGA 5CA1A 3T1YO 4NO4A 1I0HA 3MIFA 1H0BA 4MADA 2TNFA 3WUCA 2A75A 3QCWA 4K9SA 1TUEB 3LA3A 4Q4X2 2H94A 3NL1A 4CCDA 1O59A 5GZEA 4AVTA 2D6LX 2DYSB 1SQVH 1O3RA 1AUYA 2ZEXA 5HPOA 1FV2A 5FYCA 4QXHA 4LWSB 1HR0B 5IVEA 1D5AA 4C91A 1SBFA 5EBMC 1GSLA 1M5IA 4XZUG 1PNKA 3UT0A 5L3GA 3DC6A 3A23A 5FXXA 3AK0A 2P1BA 4YVSC 4UV9A 1XC6A 5A3WA 4CU7A 5FPUA 1Q8QA 4YY3O 3GZTB 2Y64A 2CE4A 2HVKC 1EUUA 1FOD3 2ZMNA 4IE4A 4NVPA 1SLTA 2PN5A 4FPEA 1JYNA 3K59A 4IETA 4LP8A 2FZ2A 1OXCA 2EAKA 3LOBA 3AXDA 3DPRC 1V70A 4FPHA 4AW7A 4AHCA 5LBCA 2WLHA 2E31A 1Q90D 4JC1A 4J7JA 1GMMA 1XREA 2PQQA 5A1FA 4N7IA 4DV7B 3U1XA 4ZI7B 3SH4A 1UU4A 4IEXA 3ZM8A 5IYYA 2AW9A 3VQVA 1MSDA 1LOBA 1EPWA 1KJLA 5A7PA 1KJRA 2QDRA 1W2NA 3M8AA 3PU3A 1Z0HA 1U5XA 2WNVB 4IEUA 3OTOB 4IV3B 3GBWA 4IEWA 1IDSA 2WYFA 3D0JA 4GX1A 2WO3A 5JZGA 2WWJA 1N34O 4OQ9A 4JQRA 4HK8A 2JGUA 5CU1A 3B9CA 2R9RB 4C1WA 3GF6A 3GHMA 1ZL8B 2XQXA 1LESA 2EIEA 1SF9A 2VWKA 4LITA 2UUCB 1HNZB 2XLFA 2CY6A 1N0JA 4GALA 1OCCC 3DYMA 5FZOA 5JJJB 2NYYA 4QGNA 4MVRA 2HLDG 5GZFA 3L75H 4A6OA 2X7RB 2Q1MA 3HN3A 3FUQA 4QDSA 4MYEA 5LRSA 5CKNA 2LP7A 4PIXA 3OEEG 4LC1A 3BUCA 1L8DA 2NMNA 4FM1A 1RUE3 2W6JG 4JCKA 1GOFA 3MAQA 2PFWA 1H2SB 1LRHA 2WT0A 2XVKA 3AP7A 5DDJ3 2WLIA 2JWPA 1G6NA 4RGKA 3IMNA 4A42A 2ZGUA 3JATA 1H8TC 5ACA3 4PA4A 4DZGA 2YY1A 4FT8A 4HVQA 4DYLA 2FMLA 2HYKA 3ZYPA 4B4PA 1RUJ1 1QNMA 5ABJA 4O4JA 1H2LA 3FJSA 3K0DA 3EHBB 1CVNA 1FMD3 1V6OA 3OBRA 4AFAA 1D2SA 1WLEA 2KSDA 1WLCA 3BTYA 2WFF3 3CMAV 3QLQA 5DN2A 4LKEA 1R3LC 5FZHA 2Y26A 3ABKC 3ABMB 5KHHA 1LU2A 4RGGA 4MS2A 5JXJA 4SBVA 4R9AA 3ZHRA 2OWOA 2WQ8A 1I6XA 3K51A 4ZZ8A 4LPLA 3HQXA 3ZYBA 2W6IG 5FYBA 3VZOA 4GIQA 3GJBA 4WFFA 3RVYA 4D7YA 4DXTA 2X6AA 1JMKC 1VBD1 1CWPA 3PMEA 4LO8A 2VQFO 3U4XA 1QQCA 1K5MC 3T1MA 2DOSA 3APQA 4DEQA 4E2LA 2AH2A 1KMIZ 2VNOA 1W0OA 2JVDA 2UYAA 1XNKA 2WAAA 4TV9B 5T3NA 2GMPA 2YC0A 3FB6C 4R6ZA 3HKCB 2WS93 2WUHA 1LOAA 4OHVA 5F5QA 4LR4A 4P00B 3WDWA 2F17A 1GICA 1YJWV 1MNGA 4PHZA 2RR12 1VBE3 4PBOA 4XDPA 2A3QA 3ZFFC 3LDDA 3VDCA 5EQUA 5GTHZ 4AGVA 2M6YA 5FK8A 1N1VA 2FDFA 3LSUA 3UCSC 4IUGA 4FSJA 1US3A 5CNAA 5JSOA 3PUHA 4TV8A 2GC1A 2P4KA 4QXBA 3RGBA 5FYMA 3I56V 1NT2B 2PELA 4Y1ZA 5LMUO 4K0KB 1ONAA 3SPCA 1IOAA 4PQQA 2YXHA 1ACCA 4CZSA 1MVQA 1ORQC 1UMHA 5L7OA 5EIYB 1BS3A 4CEWC 4O4IA 4OFGA 1XB9A 5LK5A 5IT6A 2P6CA 4RFRB 3KG2A 2PHWA 3FX7A 4Y5TA 4HL0A 3QNEA 1A6CA 4JGYB 1UOBA 4JI3O 2AYHA 5J48A 4W65A 3ABZA 2GAUA 1LEMA 2W0FC 3GVMA 5FPOA 3ZRXA 4JAVA 1JOBA 1C28A 3PUIA 3ZRWA 1F35A 5KXBA 5LP6C 4MTGA 1AX1A 3ZS8C 2DUQA 4FTBA 4WM7B 2Z4FA 4LA2A 4IIJA 4COYA 1NQTA 1ZA7A 1G7YA 2PI5A 3VLBB 1BMFG 2VZVA 2YU2A 1PM7A 2HLEA 5KA5A 1OOPB 3IT8A 1GWKA 4QQHA 1AVMA 1HWYA 1HR0O 4XABA 1BK0A 2CH7A 1V9PA 3HVDA 1LGNA 1WA8A 3ACHA 3NNMA 4XF9A 2B5HA 5KUKA 3URFA 2XAFA 3KCCA 1R1A1 2UXBB 1W3XA 1POV0 2IH1C 5IUQA 4KNCA 5LATA 3ZKYA 4XOGA 2CK3G 1QJU2 1R6KA 3L2HA 4LF4B 3E35A 3D3AA 2OT5A 4YJ2A 5FTTC 1W0JG 1DGWA 4JI1O 2PHFA 4UF0B 3OCPA 1Q8IA 4KBZA 4OI4A 2HWF1 1O3QA 4EROA 2ETEA 3DXUA 4D0QA 2BU9A 1V54B 3OY8B 1I9RA 4HN0A 2MNGA 5JI7A 1IQDC 4DV3B 3GJAA 3KT4A 4DV7O 3ZOIA 5J36A 4ISQA 3AX4A 3FB5C 1BMV1 3SKVA 1UY4A 1G9AA 2D7FA 5KMGA 4Q5OA 3WF0A 2IXKA 1L0LH 5JVVA 3UKMA 4B08A 2D6OX 4CBCA 3MLLA 1Z7S3 4AI8A 1LCLA 4A7KA 2EIKC 5E79Z 1KP3A 3I97A 4OPHA 2F43G 2KKWA 4X62O 4BW9A 1Y3TA 4WVZA 4FBFA 1RUD1 1TME3 1DK1A 3ELNA 4MGKE 3RZHA 2QWOB 5I0SA 1XL4A 1UOGA 3T2OA 3QOPA 1SMVA 4RR3A 3ZN4A 5FY1A 1RM1C 5LBBA 1YRZA 1HDKA 2W9XA 5HFMA 3X2QB 3CSXA 3AG2B 1IBKB 4AL9A 4G2KA 4B1MA 1XNRO 2ZKNA 1ZRCA 3E89A 4J10A 1W05A 3K9SA 1VLNA 4FPOB 1K5QA 4XDKA 3T2PA 3ACGA 1URFA 3MIHA 1PX4A 1W03A 3R4DB 2JDZA 1I5YA 4YGEA 5GTIZ 3OTFA 1I1EA 2RS12 3O1SA 3OGJA 1M56C 1YUDA 5FMDA 4F6RB 4CH5A 3CNAA 3SHRA 3SDLA 5C8YB 4CU6A 4GB31 4W4KA 1Y9QA 3N9MA 1Q6IA 4XC9A 4CDQA 3VZJA 1D4M3 1XU1A 3A7QA 4PT6A 5LWBA 1ENVA 3CPWU 4RHV3 3CU7A 1REFA 2RMU2 3GZAA 4JGZB 3W5NA 2QKAA 4GWJA 2BQPA 1Q8OA 2F23A 1ASJ2 3UM7A 1SDDB 4CCEA 2QWQB 5IVBA 3T4DA 3DXTA 4YGDA 5IT9N 3LEIA 3FFQA 5LOVB 4Y5SA 3IFXA 2DVBA 4QU1A 3SEEA 2OYZA 4AI1A 4CS2A 4Y4YA 5F32A 2VW1A 3TEZA 3GALA 3DGEA 5FJHA 1HRI2 4V1PA 4E4DX 1BQ0A 3QTCA 4IHJB 1N47A 4A7ZA 3ACFA 2IBZH 3CE2A 1Q8VA 1QVFU 2ZZJA 1PO13 2BZDA 3HMYA 3AYAA 2YC2A 3TEYA 1R081 1QLNA 4BAYA 1BLZA 4CCOA 3L2YA 3ICXA 1N8RW 4GMP3 5LEJA 2DW4A 1VP7A 2K9ZA 3WU2Z 5DUXA 3AZZA 4JRAA 4IEPA 3EJKA 3ZLIA 3I49A 2HBUA 2MPFA 1S0FA 5LK7B 4PDWC 1AR4A 4N43B 3UO2A 4XF0A 4NTWA 2CAZC 3M3QA 5LBFA 3VBOC 3ZHUA 3LEKA 5D21A 4LF5O 1IPJA 5JOWA 2F95B 1MEC1 5J98B 4DRXA 3H8RA 2Y6KA 3ZN0A 1DGLA 1UPGA 4XFAA 1RUC2 4PIYA 4DR1O 4DEVA 4DV1O 4FFBA 3W59A 5DMYA 4FFKA 4N9IA 1SLAA 3RYHA 3AZYA 2AUYA 3ABTA 2VMIA 2QE3A 3PUAA 1P7BA 3ZN5A 2FDIA 3KGZA 1HLCA 4DR6B 3NV4A 3U0ZA 3SPIA 3CIHA 2XKPA 3AG4C 4U2AA 2A0LA 1EV13 4H13B 4AQTA 1YHFA 4AHZA 2XBO3 4XJAA 5GALA 4UFIA 3UKVA 4YVSB 4NRMA 2KQXA 3NO8A 3ZFEA 3QBQA 1J59A 3ZYIB 2JS3A 2D98A 1N1SA 1UOJA 2LW8A 2PUSA 2Y0IA 1RVF2 3PU8A 4FO9A 4UV8A 1M4UA 5FFOC 3NV1A 4OUEA 2V5YA 4CC6A 3P1IA 3GHNA 4B3MO 3DPRB 3OUSA 5IVJA 4AFCA 4B4QA 5JI9A 1G1XB 4E2QA 2VQEB 1W2UA 2E5LB 4D6QA 1POV3 1UNBA 2DVAA 3N2GB 3D5OA 2HWB1 4X66O 5F7UA 1LTEA 4F4LA 1WWYA 4LKFA 3ZFGC 1Y74A 1NCRC 5GONB 4XDLA 2HJIA 2PY5A 5JH7A 4Z1VA 3HR0A 4X1KA 2LJ2A 1G8WA 1GQPA 1UQXA 3VZMA 3CRRA 4Q4W3 4EN7B 4ZXKA 2WLKA 2NPIA 5DAQA 3TEXA 1EAH2 2XQRA 3T09A 5L3CA 2ZEYA 2MW2B 2BP6A 4YM3A 4QGLA 5IJRA 3SGIA 4M0NA 3S5QA 2R061 1RL3A 1U5YA 4WBNA 3SCGA 4UCOA 1T6BX 4I02A 5FZLA 1PGL2 3W7XA 3SH3A 3ASOC 1FXKA 3JD72 3M8LA 1OLMA 3J9SA 1GFF2 4DV6O 3HQRA 4P08A 1UAIA 3UK9A 1OCCB 1NU1H 3IAQA 5T5OA 1AL23 4JYAO 5FREA 2Y6JA 3BTXA 2CTVA 4DV2O 3K48A 4I30A 1KBHA 2HWC3 1QLEC 4XFBA 5FZ9A 3PNAA 2DVGA 2JG8C 3B69A 4XZPA 1RXGA 4G27B 1WKYA 3MYXA 1OBNA 4COUA 3POFA 3H1IH 3D4KA 4HNAB 1NJIW 2XUMA 4P9XA 2CGOA 4Q0PA 1ZNPA 5EYXA 2MHFA 4MTOA 3CCQV 2E32A 2NLJC 3JD0A 5FZIA 1JZ6A 1H8TB 3B77A 1F31A 3IDCB 4X6RB 4MVUA 2PAKA 1FOD1 4J9YB 1YQ2A 3N7MA 2Q8DA 1XXNA 1P7GA 3G6BA 3O1VA 5FXWA 3W5MA 1PMIA 1JYWA 1MA1A 1VQ8V 3LAGA 2QTWB 3NQHA 1W2AX 1NY72 3LOIA 2D2CB 1LOFA 2IU3A 1JHNA 1LULA 4ATFA 3ABKB 4LBNA 3AMPA 3WQ7A 1AZDA 2IH3C 1YI7A 1AJOA 2XPJA 2J1AA 1N3QA 3VD4A 4R4ZA 2LS6A 4PDRA 4AHXA 3TN93 1CP9A 2GC0A 1EZVH 4HBNA 3QH7A 3H1MA 3W9AA 4ZI7A 2W39A 4NXNB 3PHMA 1K5MB 5B1AC 1E1RG 3M7MX 1EPZA 2CDOA 2XH6A 1LAJA 1JXNA 4YZ5A 1ZTEA 5CAZA 4DV5O 1AR92 2WNVA 4YVWC 4U7NA 4IV3A 2PAEA 3BVOA 1VQ5V 2VUJA 3RZLA 3FFZA 2CHHA 1J5EB 3W7SA 4XFFA 5IVCA 4UYBA 2KR2A 1ZL8A 3C7EA 2ZX3A 4NAOA 5EZYB 4ZOLA 1B3QA 5DG1A 3ZFFB 2YI8A 4P9JA 2RDRA 1QR9A 1BJQA 2QUOA 5CVRA 2IXIA 5KXEA 3MIGA 2NQYA 3E97A 5C3SA 3K5OA 2XHBA 5J7MA 5JOXA 2K46A 1RUE1 4L87A 4LUKA 4JYCA 2OS2A 2XWBB 3B09A 5DPNA 3H9VA 5B66Z 1CQ9A 5HBAA 3HNBM 3E8HA 3DF0A 3POBA 5DDJ1 1O3TA 4B3RB 1KC8W 4RQFA 2DJVA 3NNJA 4XAEA 3BIWE 1SFYA 1SDWA 4UCUA 5EIBC 2HWE3 5LGUA 3CD6V 4QGMA 1TGOA 1NKGA 2ZDIA 3UKNA 4CEWB 4MVSA 4EB6B 1O4YA 1C8M2 4Z8BA 4ZU4A 3RYFB 5ABJC 1X7NA 4D8MA 1FMD1 3DC5A 3SLIA 1K3EA 2WFF1 2ZGKA 1AYM2 3MLKA 4OI1A 4QM9A 5JR7B 1C1LA 3BPZA 3KF3A 1W90A 1W9SA 5FY4A 5LP6B 5A6QA 1WW4A 3S7EA 2UXCB 3EB7A 4JI6B 1PGW1 3EBRA 4QX5A 5L9BA 2P4EA 1X9TA 1ENQA 3TNQA 3VBSC 1HN1A 5GLWA 3M3IA 2Q8VA 4DR6O 3NNFA 1QY4A 5GZGA 4GWIA 1VBC3 3I3BA 2OUJA 3K4DA 2QSAA 3ZR5A 4FLZA 1W8TA 4H7MA 4XQ4A 3R4SA 1EYBA 1U5ZA 5IVVA 1ZBE2 2D3RA 4LFAO 4L0PA 3OBTA 2WZ8A 3ZIXA 5I0RA 4HT1T 2YDEA 4RA0A 4A2UA 1COV3 4E9KA 4DUWA 1VBE1 3WF1A 1F4AA 4WVMB 1YC61 2R7EB 3WDVA 4TN7A 4TV9A 2EALA 3HPLC 3HKCA 4P9LA 1QJZA 3JB4C 2KXLA 4Y1XA 2YB7A 3LF7A 4LA3A 5T55A 3ZXKA 3SPJA 1HB4A 4FAHA 4NAMA 4C0BA 2EVXA 2BSKB 4Z1MG 5JPNB 4U3FH 1WLDA 3OUHA 3ZHQA 3WHUA 1C57A 1R1BA 2J1EA 1VRH2 4Y20B 3O1RA 5A1LA 1UW8A 3HKBB 4BA6A 1K12A 3ZR6A 2RDSA 2XL7A 2O0OA 3SJCC 1E57A 4BOWA 1LB2A 2RJ2A 5EIBD 2XMLA 5FMCA 1O3SA 4LBKA 2FCUA 1EY2A 2EIKB 1GWLA 3A0NA 1WN7A 1OLME 2A3WA 2XJVA 1OVPA 2QNKA 4XURA 2R30A 4NWWA 3OJBA 3ILFA 1ZZCA 4ASUG 2QKSA 3Q4HB 4J7ZA 4OMDA 1BSMA 3BCWA 2FYUH 5JJEB 2M7WA 2WA3A 3I59B 1QOOA 2BTQB 3JCIA 4JGYA 4AVBA 4AR2A 5LY1A 3JAKB 4UXAA 4QD2A 2JIZG 1RM1B 4TUYB 5J9PC 2ZX4A 2IC1A 4U3JB 3E6DA 3Q8CA 2DMXA 4MVOA 3MO4A 3WW4A 4Z2WA 1CAUB 3BHPA 4ZZ5A 1SZBA 2ZA9A 5LYJB 4WM7A 3OD4A 3M3CA 1BE3H 2OW4A 2F1MA 1BHBA 2IJHA 2VECA 2GHYA 4OHYA 1NE6A 1OOPA 1M56B 3NJXA 2Y48A 2EIJC 1GTOA 1RSOA 5A32B 4GX5A 4M3CB 1FKAO 3L72H 3HOBA 3RSJA 3UGHA 5B1OA 3WNKA 2HJDA 1WD3A 1CXZB 2RJLA 1SKVA 4CCKA 3AKTA 4X64O 4G28B 4X8AA 1JMUB 1H8EG 3SPGA 3CCRV 1JBCA 1L1FA 3KQRA 2SBAA 3AYDA 4CA9A 4UF0A 4NWVA 3SYAA 4OCTA 2G4IA 1PGSA 5FOJB 4Y26A 4LBQA 1UPSA 1RHI3 1H2GA 3OY8A 4UW5A 4L8JA 3H1WA 2QM7A 2XJPA 4JI8B 2OUHA 3BAAA 1Z7S1 1N33B 1DF0A 4NXNO 1O8SA 5IW0A 1NZIA 1X50A 1PL4A 2A79B 5HV4A 4PF1A 2QDOA 3WF2A 4FFHA 3IPVB 3PVEA 1RUG3 2JE8A 1YITV 2P5BA 5JDBA 2QQWA 4NMIA 2WO2A 1TME1 4P9IA 3ZJZA 1GNZA 5FZMA 4LE3A 4OULA 5AC92 1W0NA 4NXMB 1J83A 1R1ZA 3IJ4A 1HNWB 1VR3A 4IERA 3WB1A 4QPGC 4PDWB 1SFPA 4K6BA 3BEHA 2DUOA 4AFBA 5LBQA 3VBOB 1S2KA 4EJRA 2VPVA 5CFCA 1Z5WA 3AKRA 1GN3A 4LF7O 2HHHB 4A5UB 2Q8OA 5IFPA 2RDQA 4B3RO 5C7GA 2D6MA 1WMEA 1MZFA 2BCCH 1NG0A 1RUOA 1RUH2 4JZGA 3VQXA 2LW1A 3T4VA 3WV6A 5DECA 4Q4V3 3WP6A 2A6VA 2V73A 4AE2A 1UF2C 1Z2GA 4NIDA 4W6WA 1D4M1 4MW8A 4MV2A 1VQ4V 3AG4B 4CDQC 4F6RA 4X65B 5IY5B 2ZEZA 2VOVA 3TYJA 2VOKA 3HKDB 4ZY9A 5K1XA 2DF7A 4CSWA 4Q20A 3AKPA 5C8YA 2VG9A 4XQWA 4DMIA 2A1XA 4JV5O 4L97A 1OQ1A 1RUJ2 5LZ6A 3APBA 1NLQA 4Y1VA 3IC7A 4E8DA 4KI5M 4KG8A 5T54A 2VOXA 4IGGA 1JUHA 2FMYA 4JTNA 1SG3A 4JGZA 2ARCA 4F8AA 4L8QA 5DAXA 1WMXA 1RMU3 4O4LB 2J1SA 4DY5A 3CB2A 2UY8A 4C1XA 1MZ5A 1W28A 2UU8A 5LOVA 3DECA 3FL7A 1HN0A 1VEWA 3A4UA 3OPTA 4DUYO 3F5WC 4B3TO 2DFBA 5F3CA 3THCA 3ZFGB 4QNHB 4H0LB 2JG9A 1ZREA 2VVDA 4IHJA 2JDKA 5JMCA 3CJIC 4OXSA 3BA8A 4GMP1 3CEIA 3H8OA 4WF9V 3MIBA 4XTMA 2R041 4DRVA 3EMRA 2FTKA 2BFUL 1K4DC 3ZBHA 1NAEA 4YJ3B 2V5DA 1MR5A 4QQ2A 1URXA 3AC0A 1F4MA 2RG4A 3CEWA 4Z07A 3CCVV 3ASOB 3C3TA 2B9VA 5KXDA 1RUNA 3RWRD 1LEDA 5H9QA 2QDNA 4Q4Y3 1EFRG 4N43A 1SPPA 1NCQC 4EWDA 1JS9A 1H1AA 3IM0A 3RWKX 4WVVA 4NTYA 4I2OA 4XBFA 4XMIA 3D6EA 1PO23 1YYNA 1W6OA 2D43A 4CUCA 1RJ8A 3NJYA 1SA0B 1QLEB 1XNCA 4WFGA 2PLV3 3ETPA 4FXKB 5JWPA 2JG8B 1F9KA 2CNAA 4DV4B 2UUAB 1EV11 2E6VA 2RJZA 3RZJA 2QQJA 1SERA 2Y60A 1UY3A 3MPPG 1JOYA 4OQ8A 2XBO1 5LHHA 2GDSA 5FY7A 2CL2A 3TGUH 1B06A 4LKSA 3PJSK 3BALA 4FM0A 2JECA 2AZ2A 2VQUA 4LT5A 4PI0A 1E5SA 1GBGA 1G9CA 4CH6A 1F23A 4PDVA 1KITA 4BE3A 1OA4A 3CQOA 5CA3A 5L3EA 2JDAA 2VU9A 1K5SA 1Y4WA 4MHRA 2Q0AA 1BT8A 2Q5TA 4YVSA 4I50B 5CA6A 5BNQA 1DF4A 2KD7A 4OPAA 4XF4A 5D1IA 5ERLA 1EZJA 1AXZA 3I2HA 4AVAA 3NJVA 4DR3B 4LUMA 1POV1 1AJPA 2XVLA 2GP5A 2HR3A 3UV9A 3D3QA 3OW2U 5JQGB 3DPRA 4I01A 1YIJV 2X5IB 4WM8A 2PQSA 1W0KG 4XMAA 5FLHA 5DAWA 1HRV3 3F95A 4HYOA 5JUVA 4LO4B 2VW2A 4Q4W1 4TQFA 3N2GA 3CCJV 3LGRA 4DV0O 4HK9A 4XXAA 1CAVB 1N1TA 5GONA 1PM4A 3APOA 1CJDA 2YBKA 4J41A 5B1AB 2OPWA 4XDQA 1MABG 2VUDA 1NZCA 5FP4A 1MVEA 2HVJC 1K5JA 4FPCA 5F3GA 1V00A 1PVXA 1UXZA 4YVWB 3BYWA 4P9WA 3CJHB 3CDZB 5FLJA 1FXKC 3QG5A 3VQYA 1R3JC 3MUZ1 1BQZA 4KWLA 5DQ0A 3OE7G 1SETA 4QM8A 4KP4A 1OQDA 4CRQA 4AG4A 2CTWA 1AL21 3O12A 3OGSA 5CFDC 5H6RA 1CAWB 2VNRA 3AP5A 1L3JA 1E1QG 1IG3A 3WG7C 3L9DA 1GLHA 5EPAA 4ZU5A 3HBZA 1WP7A 5FZEA 5CG8A 1EN5A 1XMOB 5CB4B 3HNMA 2HWC1 2QQUA 5I8YA 1YQ6A 4BMEA 1BMV2 3N7LA 1VQLV 1QR8A 1W6NB 3ZSKA 3AB0A 2OIGA 4YZ3A 3ZYFA 3RZMA 1GKBA 1J1LA 2WLIB 1YEWA 3IIIA 2V4VA 1VPHA 4LOSA 4XBQA 4E2SA 1YQCA 2VTFA 1ZUQA 1T5EA 1P8JA 1W0PA 3AK1A 1H2KA 1VBA2 2GH8A 4HNAA 1S5JA 1RUD2 2DCKA 4P9GA 2XDVA 3U14A 3D0SA 4RL7A 2D44A 1LGBA 5ABJB 5F39A 2X29A 1XQ8A 1VP6A 2UXDB 3C7OA 3JQWA 5C3QA 4YZ4A 1UJWB 4QAWA 1GM7A 1PP9H 1LUWA 4R9CA 4GXLA 1U12A 3B94A 2HKXA 2OT7A 5KHIA 4NUBA 1HKDA 5FYTA 4DXZA 5BXXA 4ONUA 3GCXA 1UX7A 4MX3A 3T1HO 3VBSB 4SLIA 5J2UB 2YG0A 2I45A 4K35A 5G05L 1OH4A 1NOVA 4YGBA 3M7AA 1JJOA 1AP5A 1PVC1 3GBFA 4NHXA 4MTXA 1UY0A 2GALA 2TUNA 4IQPA 3BOPA 3VBHC 3VKFC 3CL1A 4AEDC 3K4AA 2W94A 4WCEV 2NLRA 4OHXA 3CLPA 1VBD3 5IK7A 5C70A 1K5MA 1RC6A 4YW2A 4KHPB 5IJ9B 5JJNB 3CBNA 5KAIZ 2QR4A 4QPIC 5AG2A 1O7FA 4UW3A 3CC7V 4KMQA 4G9SB 3ES1A 3VUOA 4Z92B 3WDUA 1N32O 2AEZA 4ZPIA 3S3XA 1OV9A 1DTOA 1S2BA 1FATA 1SCSA 3OMAB 5EZYA 5FAXA 2Z42A 4UVBA 2FMDA 4QHBA 1S1AA 1CD3G 1FYUA 1Q3EA 2XTAA 1CPMA 2UUBB 5IVFA 4LF9B 2J42A 3GZUC 2YC4A 2HWE1 3K3WA 3SNMA 1BK1A 2PZSA 2ZT9B 1NVPD 2ZDIC 3WNPA 4O4IB 4BZ4A 4N9HA 3JYCA 1YTFD 1BXHA 2CWSA 4Q2FA 1IQAA 4XTPA 5A2QN 4DR5B 1S0DA 1NBMG 4XJZA 1B35A 2WQ4A 3SISA 4QX1A 2C2AA 4JI7O 4CEWA 5E89A 4EB6A 4PBPA 1ND3C 5KHJA 3RYFA 3AK2A 5HCFA 1ULCA 2GNBA 4PV1B 4XIOA 1UYYA 5KHGA 1MEC2 2RNBA 1OVSA 3ZYRA 4JI4B 3UO3A 4HLTA 5L3DA 4X1YB 2JDHA 4CDXC 1Y6XA 2YBSA 4IE7A 3QO7A 2YGMA 1VBC1 5LP6A 4XBLA 2GV9A 3ETQA 1STMA 1D2QA 3ZMNA 5IAVA 5DN6G 2Z69A 1QF3A 2GU9A 1AI4A 1RTVA 2P3KA 3TWIA 4CE8A 1E5HA 2CV6A 1GMGA 1QJY3 4O65A 4FOVA 2EIJB 2PHTA 1COV1 5LA1A 5HXVA 2OIIA 1FFXB 4B1LA 1QHTA 2E3CA 1BQPA 4ASLA 2ATKC 3H3ZA 3ZMVA 4MT8A 4AF9A 2VRZA 2Q6AA 1MS4A 3QH6A 1R1A3 4BW5A 4A7YA 2X6BA 3ZSLA 2P5OA 3K5LA 1ZVFA 1EM1A 3GWKC 4DR3O 1W8NA 2Q1ZB 4FK5C 1NTZH 4LXLA 2AGAA 4R8HA 4YW5A 4AEJA 1NQJA 3AMHA 1OURA 2ZR3A 5BMVB 2BUKA 2HWF3 2WZPP 1YJLA 5LHGA 5LHIA 4Y1YA 1ENSA 2BSKA 1PM9A 1NLRA 4LF6O 2HWB2 3IZOA 5EC1C 3CYOA 1HB1A 1NTKH 2Y6FA 3OYWB 1VE0A 4Q8KA 3WP4A 3KT1A 1W6PA 2Z79A 4QQLA 4AI3A 5FYVA 3HKBA 1QIQA 3T1YB 5FBZA 1H8VA 2ZQMA 1AVBA 4OHWA 5D8AC 5D5PA 3ROUA 4NB5A 4QT6A 1RIRA 4LBEC 1OHFA 4M4RA 2R062 5EZWA 4HONA 1F51A 2VGDA 4A45A 3RVZA 5HI0A 2QTSA 2W91A 3A2FA 3SH5A 1YI9A 5FY0A 2VZ3A 4M01A 4QPGB 4P9YA 1BCXA 4I09A 3Q4HA 1RPRA 2VQAA 4GT1A 2D5HA 2IJIA 2W1UA 3OF1A 4GZRB 2F4LA 3I59A 2VUAA 1GWMA 2AZ0A 1XBFA 3T2TA 4HAMA 2DQ3A 1RUF3 5ANQA 4TUYA 1AILA 3IWZA 4P14A 3VHRA 5K0UC 1CAUA 3DGTA 2WR9A 3SC7X 2IXCA 4KWKA 2DYCA 1OFNA 3G6JB 1F4HA 2JEMA 5LYJA 2IVIB 3ZEDA 4LORA 4NHYA 3AMMA 2AHZA 4LK7A 3BFRA 3SITA 3EHKA 4GULA 2JDIG 2WLQA 1NA1C 1FOD2 3RYIB 1DYKA 4W6YA 4S2HA 5C4WC 1IS4A 4ZXEA 1UWWA 3OOXA 5CKQA 2ZHLA 2ZGSA 3M3OA 2PXJA 4KG0A 2BWAA 2LFRA 3NRUA 4GB33 5LW9A 3HBKA 4XJUA 3LEGA 5BNNC 1US2A 1PD3A 3KHCA 4CC5A 1D5NA 1RHI1 2OXBA 4BISA 5IWFA 2W47A 4MUVA 5EJ1B 2EXIA 2QEXV 1UCXA 5K9YA 3SEPA 2XAQA 4DPNA 3TJTA 3ZXFA 4LIUA 5GLZA 3M3EA 1C3HA 3ORJA 1IZ3A 3NMBA 1RUG1 4FTSA 4QU2A 1FX5A 3EVKA 1PHMA 4Q0VA 1UO9A 1GRJA 2Q5ZA 4UOJA 2Y6HA 3CJIB 5IJ0A 2FHRA 3UT5B 1CIWA 1RB8G 4KHPO 1AJQA 1ZBA3 3N9LA 3IDEA 3H01A 2QGNA 2ZGLA 4GKJO 4QXCA 3OB8A 1R083 4BIUA 3ZO0B 4F6EA 4Y33A 4XYXA 4FLVA 2WNOA 1W3VA 3FHAA 1J3RA 1NUKA 5KWRA 4CS4A 1Z78A 2D3OW 2GC2A 3QD6A 1U96A 5CFCC 4XJ8A 3WT3A 3J81N 4D94A 1VF5B 3EXAA 5FO7B 4QE9A 2NP0A 4CH4A 5J96B 2AGSA 4HG6B 4IE6A 4PDWA 3O1OA 4FVMA 2YUAA 4CDUC 3AG3C 2D6NA 1NCQB 1VQKV 3ZXJA 3VBOA 3C3SA 3EFFK 4BQXA 1RUE2 1RUI3 4LHLA 4YFZA 4AFDA 4Q4V1 4FQZA 1XNBA 2QM8A 5JCOA 4M0HA 4S2GA 2ADDA 5DDJ2 1ZX5A 4JI5O 2O1QA 1QJX2 3STZC 3U37A 3RG0A 3T0AA 1CEZA 5ACA2 3GNEA 2DYRC 2W1SA 3NAPB 4RQEA 1ULOA 3A22A 4ES8A 3U07A 4AZZA 5LMNO 4JI0O 1TVGA 1OCRC 1X59A 1S4CA 5KC5A 4YGCA 3C90A 1FMD2 3BKZA 4TZDA 2VQFB 1V6MA 2PI4A 3HKDA 2Y0OA 4BQYA 2WFF2 5A3PA 4R9BA 1DHKB 2Y34A 3V64A 4JGZC 2GBOA 2BGCA 1RMU1 2VMGA 2DWDC 4LBQD 3DUIA 3LA2A 4H44B 4H55A 3SQOA 1Q86W 2IJKA 3P3PA 2ZCWA 1UL9A 3SCHA 3RQ0A 1AXYA 2WWSA 4A3ZA 3E86A 2ORXA 2ZGQA 3L71H 5KUMA 1JCHA 2YXYA 4KU7A 4KXRA 2V7QG 4O4LA 5A7WB 5ISLA 3E83A 3BRCA 4I0BA 1Y74B 2VZ1A 3JXSA 2JG9C 1TUBB 1JU3A 1JYTA 3Q9OA 4J80A 4IE5A 5JH7B 5T5JA 3ASNC 3WW1A 3A0BZ 1ZRDA 5JOZA 1F7YA 1L7QA 2WS92 2PAMA 4ZIBA 5LMUB 1N36B 1A34A 4OHZA 1VBE2 3KWVA 4GQ7A 1IS5A 2G9FA 4XIKA 4QXKA 4YJ3A 3POYA 2XASA 2VNGA 2YGLA 4BU2A 2QBXA 3BCCH 4FZ0A 1ULDA 5FBJA 3D36C 5FPZA 5AFBA 3DTUB 4E4ZA 5CFDB 4JI3B 5FZCA 5L3BA 3WG7B 4XE9A 3GGLA 1Q43A 1ZZ7A 2HWD2 5FRAA 2BNOA 5F2WA 4DR7O 2PLV1 4P5HA 4FVVA 2PYTA 1RPOA 3LDKA 3VBRA 3ETDA 1OF3A 5IWAO 2QQOA 2GMMA 1K97A 1H2NA 3O1PA 4H3WA 1FD9A 4S2FA 4Y1UA 3K4ZA 2IFWA 1SA0A 2WPDG 2XJTA 2IZWA 3M2MA 2JG8A 5FPVA 1AR63 1XYNA 3K2OA 5CBFA 4INDA 3C7HA 1NVPB 3WB2A 1TNFA 3KV5A 1O6UA 2HEPA 1YTFB 4LO5B 4FPLA 1AXKA 4CS3A 5C8CA 1VRBA 3OM3B 4TTGA 2WO1A 4XXPA 3VD9A 5AFEA 1ZX3A 5BNPB 5EYYA 5APAA 2RMKB 2BGOA 3CZJA 2D6PA 1GM9A 2PHUA 1Y9MA 3J7MA 5F8PA 4I50A 2CTQA 2WAOA 4JI1B 1VMHA 2P17A 5FYSA 4QX8A 2IM9A 4WM8C 1HRV1 2OX0A 2WYSA 4E2GA 3LPGA 3N9NA 1BEV3 1Y4MA 5CIRA 1KDKA 4W6XA 3PLQA 5GKAC 1K8AW 1I5ZA 1J3QA 4LCUC 3CCEV 5JQGA 3FHIB 1OFSA 5HCHA 2X5IA 5J2TA 2OQ6A 2BPA2 3O9OA 2JIGA 2C1FA 4M3CE 2ZE8A 1GP6A 3AEIA 1Q8SA 1R6NA 3WXPA 1W06A 5GW7A 3VBHB 1VQOV 3VZNA 4AEDB 4GWNA 1LNSA 5LA6B 5L9RA 5FUPA 1CAVA 1Y43B 3I3QA 4UCSA 2BOCC 2EILC 2BOIA 1J58A 4MO3M 2WZR3 3UJOA 4X62B 3UESA 1JA8A 3LCPA 4YVWA 4QPIB 4ZOLB 3CJHA 1KFXL 4RGAA 1W39A 1FJGO 1SQXH 3BU0A 4JDOA 1QOSA 2ZHKA 1MS1A 4H2AA 3MV01 3FHQA 5E6HA 2R0FA 1CAWA 2UY9A 3C7FA 5BYNA 1JHJA 1R3KC 4H7LA 1Z7S2 3POEA 1XEQA 5FWJA 4O2BB 4CEYC 5CB4A 1VAMA 1PIV3 2XLGA 1XMQO 1XNRB 1GZ9A 4UVAA 1DQ2A 3MEPA 1W6NA 2RDCA 4ASMB 1XE0A 1XYOA 4XCBA 1TME2 2HP8A 2VCCA 4B3SO 4IXLA 1PNGA 2ZTNA 2BYVE 1K7DA 2C9KA 2DU1A 3VGIA 5BR8O 3OFNG 4PDMA 3AMNA 1YVWA 3N27A 1NLSA 1ND3B 3E6CC 4BM8A 2GN3A 2VE1A 4X8PA 3PVBB 4DXWA 5J1XA 2LQTA 2OTLV 1K3IA 1GQGA 4ZS3A 4J9ZB 1HNXO 1UU5A 2RS33 3GWOA 5AVAA 3BTZA 3E5XA 3KCXA 3WFVA 4XUOA 4CDXB 4URAA 1CONA 1GV9A 1J84A 4PJ0Z 4DO0A 1QEXA 2HEVF 1AR83 1SEFA 1JH5A 5LL6Y 2ZD9A 4HVOA 4OVEA 1XBLA 4CCNA 3C3VA 3KD4A 2R6QA 3THDA 2ITCC 5T5PA 3VBSA 4FP3A 5J2UA 3AK3A 1D4M2 4U7OA 4RHV2 2JENA 4YHHB 3H9AA 4AGRA 2WO7A 3UGGA 5F37A 2YIDA 3O65A 5ITZB 4HMZA 1ZRRA 3NVCA 3RW0A 1XSQA 2ZMKA 4J25A 1RFYA 1LHUA 2NN4A 2WZEA 2B9UA 5FZBA 2A6ZA 4QPWA 4AI0A 3WHTA 4R7CA 4I0WB 5IJ9A 1BBT3 2R073 4RUEA 3B4SA 3LDBA 4MVTA 4XDOA 2CAUA 4ZHQA 2ZEWA 1IGOA 4LF5B 1C8NA 4D6RA 4QX0A 1PO12 4YM2A 3M70A 1CZTA 3HEIA 4IT5A 3PURA 3RN4A 5FQ0A 2XAJA 4UUJC 5C9AC 1REDA 4PA9A 4DR1B 3WNLA 4LJHA 1N36O 4FPFA 3JBG3 3KF5A 1NZ6A 3VBUC 4DV1B 1ENRA 5D8AB 3OG2A 1ZZBA 1F5FA 1B35C 1WGPA 1GO3F 2GDFA 4IE0A 1KQRA 4PI2A 1X8EA 2BJSA 4XUTA 3H1JH 5LA2A 2O8OA 1QU0A 1QU7A 2WDBA 1HJGA 4COZA 3HT2A 3Q8EA 2W1QA 4DK0A 5C6CA 3I54A 4E4HA 1ZSPA 1UKRA 4XUNA 2XKOA 5KAFZ 2JJ2G 1HJFA 1FNYA 3VZKA 2ZMLA 4LO7A 5FO8B 1OPMA 1NXMA 4Q1PA 1FNZA 2BVVA 4CP9B 2JDPA 1Y7BA 4CVUA 1FAYA 4ORFA 1D4VB 2VWJA 1DF5A 4X1YA 2Q7HA 4DR2O 1V9U3 2VBBA 5K0UB 4B3MB 2E75B 3NV3A 5CBGA 1V6IA 1UPIA 1EV12 2WBKA 3CXCU 1QJY1 1K45A 3S6PA 3BY6A 1VBB3 2A6WA 1IBLO 5IYCO 5IHRA 4JGSA 2XBO2 1COWG 4K8ZA 1RSOB 3JSLA 5JLVA 5CA0B 1OCOC 2LFSA 1IPKA 4BPZA 4X66B 4QE7A 1NA1B 3ZYJB 1JZ2A 3T0BA 3N4MA 5C4WB 3A0KA 1DZTA 3MV11 1FFXA 5EV7A 4FOYA 3MUY1 4AQ6A 5C3PA 5DEDA 1K9MW 5F6KA 5BNNB 1SLCA 2GTSA 5A7NA 2CTRA 2AXTZ 1WP8A 3LB9A 1CZSA 2YIBA 1GZCA 1PX3A 1OD3A 2D3PA 4UBHA 2VW0A 2JE9A 1LENA 4LBQB 1QMJA 3T0DA 3ZIAG 2EIDA 5JSRA 5A3NA 5AVPA 5EP9A 5JIAA 5HCAA 2RM23 4AFMA 1KKCA 1KS5A 3G7DA 2CSGA 4DV6B 3UNPA 1G9FA 4J42A 1H30A 2K9PA 5A70A 5BMVA 2ZS6B 2VMEA 3JD4A 4UW4A 4D69A 2PHRA 3LIGA 4Q4W2 1CIYA 5FR3A 3I3DA 3U11A 4JYAB
chains in the Genus database with same CATH topology
3MIFA 1FI2A 1JW6A 4Y1VA 3AFGA 1H0BA 4AWDA 1WA4A 2H6CA 1DZQA 1UN1A 2WL1A 3LA7A 3OYWA 2TNFA 2XHKA 4KG8A 3WUCA 2ZACA 2A75A 5T54A 3QCWA 2VOXA 4K9SA 5TSWA 1JUHA 2FMYA 4JTNA 3LA3A 4Q4X2 3RYKA 3NL1A 4JGZA 5GZEA 4AVTA 4F8AA 4AVCA 4L8QA 2D6LX 1RMU3 3O7OA 1O3RA 4FPJA 1AUYA 4DY5A 2ES3A 4WBBA 1GZWB 1FV2A 3R05A 3HN1A 2UY8A 1TEIA 4C1XA 5FMOL 1MZ5A 2UU8A 5I8TA 5SV8A 1MS8A 1SBFA 4C91A 1GSLA 1APNA 3A4UA 3AK0A 1KRIA 4E27A 3AP4A 4K20A 4YVSC 2DFBA 5CFCB 1B09A 1Q8QA 3GZTB 1EAH1 3ZFGB 4XILA 1RUF1 1FOD3 2ZMNA 3IKWA 2JG9A 3NJZA 4Y5Z0 4N7UA 4NVPA 4QPGA 1ZREA 1SLTA 2VVDA 2PN5A 4FPEA 3L9JT 4O9GA 4CDUB 3CJIC 5JMCA 2HWC2 2XJQA 1G86A 1QJX1 1RUC3 4GMP1 1VB2A 4IETA 5ACA1 3MIBA 2FZ1A 2WBPA 4XTMA 2FZ2A 2EAKA 2R041 4DRVA 3LOBA 3AXDA 3DPRC 1V70A 2Q4SA 4FPHA 2BFUL 4AW7A 3LWCA 3JD71 2BVBA 1YFUA 2JJ6A 4BLIA 4JC1A 1MR5A 2OVUA 4QQ2A 3UL2A 1URXA 2PQQA 1YXWA 3CEWA 4Z07A 3R4UA 2X53S 2VOWA 4KWJA 5KXDA 1RUNA 2WKKA 4N7IA 3SH4A 4NHLA 1LEDA 2YYOA 5H9QA 1ALYA 2ZGTA 1UU4A 2QDNA 4IEXA 4Q4Y3 4N43A 3PJYA 3VDDC 2ZBJA 4XF1A 1NCQC 4EWDA 1RJ7A 2AREA 2DU0A 1LOBA 1EPWA 1KJLA 1KJRA 2QDRA 1H1AA 3IM0A 1Z0HA 4GWMA 1U5XA 2WNVB 4WVVA 1N3OA 3ZIWA 4IEUA 5I91A 1KXGA 1TMF2 2DCJA 3GBWA 4IV3B 4IEWA 3T1LA 4I2OA 1J3PA 3H7YA 4XMIA 3D0JA 5JZGA 3D6EA 1PO23 1YYNA 4FQ4A 1RVF3 1UZZA 4JQRA 1H4GA 1W6OA 2D43A 4HK8A 3ZSEA 1RJ8A 5CU1A 1XNCA 3AM2A 3B9CA 1ZRFA 2PLV3 4FXKB 5JWPA 2JG8B 4C1WA 4ITCA 3V56A 1F9KA 2CNAA 3H50A 3GF6A 1EV11 1ZZ6A 2E6VA 3GHMA 1LESA 3WINE 1ND2B 2ZJCA 3MPPG 2DUPA 3MW2A 4K21A 2ATFA 4CDWC 2XBO1 4EN9B 4FP2A 1DQ4A 2XLFA 2CY6A 4GALA 2CL2A 4MXWB 4BMBA 3BALA 4PJYA 3TN92 2JECA 4LT5A 2NYYA 4QGNA 4N53A 5GZFA 1GBGA 1G9CA 1RGSA 1XU2A 2E53A 5A33B 1KITA 4BE3A 2WS91 1OA4A 1ULGA 3ZDSA 1U0AA 2Q1MA 1AHSA 2JG9B 2VU9A 1G9DA 3FUQA 5JIUA 4MYEA 3RDIA 5LRSA 2Q0AA 5EXOA 2Q5TA 3POWA 1ZBA1 2AR6A 4YVSA 4PIXA 3OGGA 1QXJA 2R1DA 2KA3A 2XG3A 5CA6A 5BNQA 4XF4A 1AR71 2NMNA 4CP2A 5D1IA 1RUE3 2VVFA 2NMOA 4JCKA 1AXZA 4YM1A 3ME2A 3VL8A 1EAH3 1ZA4A 2ZZQA 1OIJB 4AVAA 2IWGB 2MEV1 2PFWA 4LUMA 1LRHA 2WT0A 3CJIA 1POV1 1ULFA 1JUIA 2XVKA 3AP7A 4OUSA 4BIOA 3KZ4C 5DDJ3 4AYUA 2PA7A 4XPVA 1X82A 1G6NA 2XVLA 1XE8A 3IMNA 1AR62 2HEYF 4F7ZA 2ZGUA 3UV9A 1H8TC 3RS6A 5ACA3 3DPRA 3ILNA 4I01A 2X5IB 3W58A 4WM8A 1JOJA 3RJ2X 2R043 4XMAA 4DZGA 5FLHA 2YY1A 1QQP1 4FT8A 1HRV3 4HVQA 2HYKA 3JD73 3ZYPA 4LO4B 2HWD1 1F2NA 2VW2A 5B2GB 4B4PA 3RWNA 4Q4W1 4TLFA