3OD4A

Crystal structure of factor inhibiting hif-1 alpha complexed with inhibitor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
342
structure length
342
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Factor Inhibiting HIF-1 Alpha Complexed with Inhibitor
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 105
structure length 342
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3od4A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3od4A01
2WA3A 4Z2WA 2YDEA 4B7EA 2WA4A 2CGNA 4Z1VA 2Y0IA 4NR1A 1H2LA 4B7KA 1YCIA 1IZ3A 3KCYA 3OD4A 4JAAA 2CGOA 3P3PA 1H2KA 2YC0A 4BIOA 1H2NA 3P3NA 2XUMA 2ILMA 3D8CA 2W0XA 3KCXA 1MZEA 1MZFA 5JWPA 4AI8A 1H2MA 4QU2A
chains in the Genus database with same CATH superfamily
3SC7X 4E9KA 5I8YA 1YEWA 3ZXGA 3ZIWA 2QKSA 4ZPIA 1WD4A 4MGIE 4QB2A 4TSVA 5LBEA 5A33A 5A7WA 2A3WA 4GH4A 2GUZA 4AILC 4P02B 4OMDA 4XQDA 2ZTNA 1DLLA 1I0HA 5IAVA 3SGIA 3PVEA 4LHSA 5FJKA 1EAH3 1SG3A 2W1QA 1YQ8A 3QG5A 5FP9A 3HVDA 3S3XA 4QE7A 4XJZA 4XF4A 3VBHB 3WNMA 4IV1B 1LEMA 1WMFA 1LOAA 4Y1ZA 1F7YA 2XQXA 4JF3A 5IUQA 4C1WA 4RD7A 4DR6B 5GONB 4UW6A 4L8QA 5JSOA 3KQRA 1KGYA 2BWAA 2ARHA 4XFAA 4I0WB 4HT1T 3GB7C 4A42A 4DPNA 1Y9QA 3WNOA 1OPOA 3WF3A 4KUMA 1CAWB 5T55A 5FL7G 1NKDA 3TGUH 1OA2A 3WP5A 1CONA 2FCUA 3S30A 4QWNA 4XC9A 3KZ4C 4ZZ5A 4N8MA 4O61A 5DEDA 5JR7B 3W21A 4MSWC 3AZWA 2R061 5FY8A 2YXLA 1BL8A 4QXHA 5E79Z 1T6GC 3ZO0B 5DN6G 4LHNA 1HN0A 2PLV3 3OPZA 5A3WA 3FFQA 4UVCA 4X1YB 2OCCB 4CUGA 4JI0O 4EZ4A 2Q8CA 2KA3A 1K9MW 4J11A 4LPLA 3TCUA 4XDKA 2ETEA 4RL7A 1B09A 1MQTA 1YXBA 2W47A 1COWG 3BODA 3ABKB 3AVSA 4CDXA 4JAAA 2RE9A 5C5TA 3IIIA 1K34A 4DUVA 2CH7A 1DLBA 2D6NA 5DM6V 4HVRA 1FPN1 4FPCA 4KWUA 2Q7HA 3ZIAG 2VQUA 2J1TA 3FHIB 3T1CA 4WBNB 2EA7A 3ACGA 2FMDA 1J5EO 3WP4A 4DQAA 3ZEDA 5K0UB 2E53A 4CP9B 3P30A 3DKWA 4XJAA 3PU3A 3I56V 1X4TA 3H42B 3OJBA 3GM8A 1N34O 5A32A 1F2NA 2VQ0A 1F4HA 1HJGA 3UETA 1XL4A 1SQ4A 3ZDVA 4FOYA 4BQ1A 2LS6A 4JI7O 1QHDA 5ANNA 4WM7C 2I74A 4FQZA 1AYM1 4HK9A 1K5JA 5IW0A 1Y9MA 1CPMA 5FYTA 3J7HA 4BQ3A 3QO7A 1JTZX 4MLOA 1D2DA 4WVVA 1BCXA 1MNGA 1PNGA 3B93A 1CWPA 4FI9A 1W8TA 4G28B 4GZ9A 3ASOC 3JD4A 1EYBA 4A6OA 1UIKA 1EBOA 1VQ5V 2PHFA 2GNDA 4YW5A 3ABLC 3FB6C 5A3LA 1W2OA 2DBNA 2WNOA 5EJ1B 3PVBB 3PTRB 3AG3B 1ALYA 2ZM6O 3L2YA 4LR3A 5CMUA 2HKOA 2P4VA 3EMRA 4CDUC 1UF2C 3I2DA 2JG8C 4FPJA 3SKJE 4QDQA 3GXUA 4PQQA 3CCUV 3ATGA 4QKFA 2Y4TA 4LO4B 2RCVA 1GQGA 2WNVC 4HAMA 1V9U2 3ZMOA 2NN8A 2WFF2 3K48A 1XNRB 1W9YA 3HPNA 4NOTA 1U5IA 4BWAA 1PVC1 2IBZH 2EXHA 3JASA 2OCCC 4XDJA 2G9ZA 3JBG2 2X5IC 4JI5B 2GDFA 4BHPA 4IERA 4PLOA 1G9AA 5A6YA 1AVMA 4RA0A 2QWOB 1W9TA 2WLMA 2B45X 2WO3A 4LLOA 1NCQB 2QZ3A 3LDRA 2HWC1 3ZM8A 4JYAB 3UM7A 1RUC1 2RV9A 5JOXA 4QHBA 1AR83 3WB2A 2DBIA 2RHPA 4B3TB 5GJ6A 1IOAA 5C8YB 1FXHA 1C57A 3O1UA 3IJ4A 2ZNIA 2GTSA 2C5DA 3ST7A 3C7FA 2F66C 2VZTA 4Q2FA 5DPNA 2VCMA 5FZBA 3DL3A 1ODMA 3G67A 4DXRA 1SBDA 2QKDA 2FTKA 1UJWB 3LEIA 3E2EA 3RGBA 1XYOA 2FL4A 3AXEA 3I49A 4OI1A 4COVA 2BV4A 5EBLC 3PMSA 1VBA2 1OLMA 5K0UC 4BQWA 3LDKA 1R1A2 4R4ZA 4XW3A 4FM1A 1NUKA 3KVBA 4NWWA 4CDQB 5E89A 5I91A 2Z5WA 2VXJA 2MPFA 4R50A 2PAKA 1J83A 2D7FA 1HRV2 3AZZA 1LHOA 1N33O 5C9AA 3OPWA 3K0DA 2FZ1A 1URFA 3IZOA 3S57A 1DYOA 3T2MA 3T1YB 1LOFA 4HVOA 4AI8A 1YO8A 5GONA 2XAHA 1LHVA 4Z92B 1RVF1 4LOTA 5IYDO 4X62O 4FPHA 1XU1A 2ZEYA 2JG9C 4ZZ8A 5LA6A 3G4SV 2DUQA 2AW9A 1FNZA 4AG4A 5D2AA 2ZE7A 4Q4W3 2QWQB 1POV3 4YGCA 2HLDG 3LSDA 5IVBA 3KV4A 1RUE1 4UI9L 2WYFA 4JI4B 1L0LH 3B01A 3L73H 2RMU2 3OMIB 3B8MA 2CAUA 2FKXA 1FD9A 3NV4A 4MSVA 1VQKV 5F3CA 4NHLA 3RYCA 1RTVA 4M00A 1C28A 4AZZA 1KECA 4WFBV 1JHNA 4FPEA 4E27A 3E22B 2IXKA 1G4YB 2V5YA 2EIEA 4Z8BA 4HNAA 2QQKA 4JHTA 4LBOA 5KWRA 1SERA 2XAJA 3AM2A 3BEHA 1D2SA 2OIEA 4DIQA 2WO1A 5B1AB 3ZHSA 3ZFFB 3VL8A 3K3WA 1C3HA 3N7MA 3K5OA 5C3OA 4FT8A 4J9YB 1S0DA 1MEC1 1QGLA 2D2CB 1KXGA 3BFRA 3QO8A 4AF9A 1M9NA 5KHJA 5FKBA 1LOBA 1FMD1 1JX9A 4QX7A 1HNZB 1XNQO 4QQPA 4FFBB 3RYHB 2JDHA 2Z79A 3THPA 1J95A 2OA2A 4RUEA 1H8EG 3AG3C 2OXBA 4DW1A 2XJUA 2UXXA 4YVSC 4YRDA 5GLWA 2RS52 1YI2V 1DGWA 2RJ2A 3RW0A 4M4RA 4C7UA 2VNRA 4YG6A 4K40A 4PF5A 3CCSV 4ZU5A 3POSA 2X10A 3SH5A 2DVGA 2R9RB 2WS91 2DWEC 4BXFA 1GM8A 4GMP3 4NRPA 1JI6A 4DINB 1YXWA 1V6JA 3I2GA 1HQWA 3ZSLA 1ULEA 5E1AC 3WF0A 1Y9GA 3R6SA 3HKBB 3ZR6A 1T5EA 1HW5A 3VKMA 4UVBA 3RYCB 1GZ9A 3N9MA 4DUYO 4CEYB 5IVVA 3B4SA 3VQYA 3LSUA 4EYUA 3UCSC 4D7TA 5BUVA 3ZVXA 2PYJA 1GRJA 1ULCA 3QOPA 1OOPB 1O5UA 1ZAUA 4WM8C 5L3CA 4OUMA 1NS1A 4LFAB 3O1MA 5DUVA 2Y60A 2LALA 2HWF2 4N90A 1WNSA 4CEWC 3BOPA 5B4NA 2KG7A 1Q6HA 2O0OA 2IU3A 4DR4O 4KU8A 4X89A 4MGZE 4M4PA 4GWIA 3ZXLA 2GU9A 5I93A 1JHJA 1JFFA 4BE3A 4DR2O 4G4FA 1GICA 3ILRA 2RMKB 2ORXA 3PVNA 1IVSA 4BIOA 1XQ8A 4H0LB 1DYKA 2FDKA 4XETA 3F2ZA 2Q8VA 3E6DA 2H0BA 2RS11 1V6KA 1UX6A 1Z7S2 3BABA 1LKNA 4E4HA 2IM9A 3POFA 2YS8A 1C8M3 2E3CA 2QUOA 4EB6A 4KU7A 2DU0A 4UCTA 3WB0A 1ZBA3 2EBOA 2ET7A 1WB8A 2NMOA 4O2AB 5CA0A 2A71A 4I0XB 3L75H 1WLCA 2WSVA 2KQXA 2UUAO 3MPPG 2ZX1A 2CU5A 1APNA 1BHGA 3ZHVA 4DRXA 5JI7A 5CBLA 2C26A 4DY3A 1QVGU 1TQ5A 2D6LX 3AXDA 1OD3A 3CJXA 1PZ8A 3B7MA 3RQ0A 2ZZJA 4ASMB 4LR4A 1QDCA 4OI2A 2E26A 4NXMO 2HEYF 3HKDB 2N7GA 4OHYA 1LNQA 1ZSPA 4LF4O 1SDDB 4MTXA 2UYBA 4JRAA 1W0JG 5JH7B 4D69A 4Z2WA 3GWKC 4TV8A 1X8MA 4XTMA 3T3YA 1IBMO 3ZYFA 2VY0A 4YWAA 5FMBA 5FPAA 2ZGKA 3JALA 3F95A 3MLLA 2DYSB 4GAZA 4OZOA 2V4AA 2XWBB 4J7KA 4MX3A 2XASA 2DV9A 5J7MA 3MIGA 4BYYA 1QR8A 1F5FA 4FOQA 4JC1A 1HRV1 3ZRWB 3VHOA 4HKOA 2C24A 3WVJA 4QAWA 3CDZB 3CJHB 1VBA1 2VZOA 4M0HA 2DMXA 1AR61 1W2NA 3WUCA 2B46X 2Q8OA 1K3EA 2ZX2A 2JD9A 5BMVB 1ASJ3 3QF7A 1F9KA 2F4PA 3IPVA 3QTCA 2P4EA 2UU8A 4O4HB 5DQ0A 1K5MC 1FFXB 1RUG1 1WW7A 1OHHG 2EIBA 3ACLA 1QJX3 5FCCA 2JE7A 3NQHA 1K33A 4WFEA 3I2JA 4J6GA 4LF9B 3MBWA 1M4WA 1CAVA 2XVLA 4DV3B 1NVPB 3ENRA 4QKDA 5FOBB 5FYYA 4I09A 4LA2A 2CK3G 5L3EA 3S7IA 5CU1A 2JS3A 2PUSA 3ZFFC 2RR12 4GULA 3FYEB 4Q26A 4BXSV 2QDNA 1I1EA 2LRPA 4K35A 1AJQA 1ND3A 4A41A 3JBG1 1ND2C 3BRCA 4MVUA 5FK8A 1KYOF 5FR3A 5FPXA 4LF6B 2DWDC 1KBHA 2VZSA 3TAYA 1WLDA 1FPN3 2IH3C 3KMHA 3W7SA 1K92A 4OMCA 4BIZA 4RGGA 4XJ8A 4AVVA 4J80A 3UGHA 1K4CC 2V1DA 1DP0A 1KC8W 1GNZA 3UKTA 5F2SA 3H50A 4CH6A 5HCFA 5LY1A 1BZKA 2XUEA 3MFAA 1MPXA 1AXZA 1FV3A 1QOOA 4MV2A 1RUF2 1B6QA 4Y3OA 1CVNA 1OF3A 2RMU3 4EN9B 1JU4A 3PN1A 1BK0A 1P7BA 3JQXA 5IYZB 3AMHA 3U75A 3RYHA 3IN9A 5F6LB 1RUJ3 2EZPA 1XOUA 3U4SA 5B3SB 1OH4A 5FPBA 3BYWA 4FAHA 3PVOA 3Q8AA 5FZMA 1VMHA 4GYCB 2FB5A 1NX9A 3DPRC 4Y26A 3RZKA 5FJHA 1OUSA 4YIOA 5L9BA 3WNKA 1KDMA 5EJZB 5A3NA 4RHV2 4A7YA 1OBNA 4CDXB 3ASNC 4IEOA 4DXZA 4L11A 3JYCA 4WVMB 2HVKC 4LKDA 4CXWA 1RXFA 1DQ2A 2DCYA 4M3CA 2D98A 2WZR3 4D7YA 2HWB2 5K1PA 3CRAA 1PP9H 1N1TA 4JYYA 3TEZA 1TME2 1RB8G 2ZMLA 1LGCA 4X1YA 2RS31 4WF9V 1JYVA 1FAFA 3AYDA 4GA9A 3WW1A 1OXCA 3VDDC 3BA8A 2VS0A 2YC2A 1QKQA 2ORZA 4UOJA 4AI1A 2XQRA 3VD3A 4A3ZA 1D2QA 2BE3A 5LYJB 2AR6A 3KV9A 3Q4HB 3MIFA 3HJRA 3FUQA 5KHHA 3HPLC 1NE6A 3BU7A 3NW4A 3O1SA 1LHNA 1EAH1 1XREA 1J1TA 3AG2B 1CAUA 1I5ZA 3O65A 5IJRA 4NPMA 1LECA 3RZJA 4XFIA 4YM0A 5J98B 4AHYA 5F2VO 1W05A 3BVOA 2YIBD 1R64A 2WABA 1NQDA 1AYN2 2X29A 5B4XA 4FTSA 2B1IA 1XYNA 4I02A 1TZOA 3B00A 1UZZA 2WWJA 3I2FA 4IV3A 5AFBA 2RS33 4JKMA 3MHSC 1O3QA 1BEV3 3ZYPA 1XC6A 4PJYA 1TGOA 2VL4A 1ZA4A 3CHXA 1GP4A 5LBBA 1FNYA 2BFUS 3ZPOA 1CGPA 2N05A 2VTFA 1F23A 4MADA 3ORJA 4BB3A 2RNBA 2HWD2 1JZ8A 1AJNA 4AE2A 1QQP3 5LA0A 3HNBM 1F4AA 5F37A 2PHLA 3HKCB 5FBJA 4JI1O 1US6A 1HQLA 4H7MA 5C9AC 5A6ZA 1M1KW 5FMOS 1WPXA 4XACA 1M4UA 1ORQC 1I6XA 1W6OB 2WLKA 4AEDC 2DU1A 3BY6A 3WNLA 4XF3A 1WMXA 3MO4A 3BGAA 1PGW2 4XDOA 5A7WB 3E8BA 3O1OA 1V6NA 3LGRA 3NJVA 2O1QA 3ABKC 5CBHA 1W2UA 5LASA 1RUH3 4JCKA 3AL6A 3K4ZA 2NP0A 4XAEA 1VIBA 1JS9A 2LFRA 4TTGA 4AVCA 3BTZA 4PA9A 1S55A 2IC1A 4X8AA 2K9PA 1YJ9V 4COZA 4MXWA 3CPWU 2LO1A 3Q9OA 5JPMB 4JYBA 4LF6O 3O12A 4JAVA 1SLCA 1YC61 2RDSA 1OMIA 2LW1A 3M2MA 4YZ4A 1LR1A 3POIA 3DXRA 3U11A 4LQRA 4AAPA 4UCUA 3UO2A 1IHMA 4URAA 5EIBC 4JGYA 1EN5A 2VBPA 5CFDB 1W8HA 3VQVA 5GZCA 2VUAA 2WN3A 4BLJA 3T1MA 1W03A 5FYVA 1MR5A 4IGOA 2XB6C 1AR92 4FLVA 2JVDA 3VD7A 5C8CC 2QM7A 3VV1A 3DV8A 4FCAA 2W1SA 2ZPXA 3GBFA 4LT5A 1QBZA 3K51A 1H1AA 2P4KA 1SA0A 2EX3A 3OR6C 4DMIA 1R6NA 4QPIC 4DR6O 1C4RA 1VBE3 1NH2B 1GANA 3U78A 1DQ4A 3AP5A 3CCJV 1F35A 3M3IA 4GXLA 3G71V 5DUUA 5AFEA 1S77D 3PIJA 1XJAA 1OKOA 1YI9A 2J42A 3OSDA 1VRH2 3MDSA 3ASIA 3D6EA 1MS5A 4PBPA 5FO7B 1QQP1 2VWKA 3CMGA 2V73A 2C9AA 4AFCA 4BWOA 4S2GA 2A7WA 4B1LA 3JSLA 4XUQA 1UL9A 4MG2A 3OUIA 3JB8A 3FN9A 1JA8A 3ABUA 5LHGA 4NN0A 4D6SA 4XTPA 2KD7A 3IIAA 4Z2AA 4COWA 4X8PA 5CG8A 4PLMA 3K06A 1XHZA 4AAXA 2R072 3ETQA 4D7SA 4YSFA 3ZXJA 2YUEA 5DZGA 1ZBA1 2ZGUA 1WA4A 3LOBA 2ZABA 4COUA 3VD4A 1RHI2 2P3IA 5IYYA 2FCTA 2F6BA 1FYJA 5EBMC 1RUD1 4COYA 4N23A 3VOUA 1POQA 5JMOA 3J7NA 2OS2A 3M8LA 1RHI1 1QU7A 4LIUA 4CEWA 4ZU7A 2XJPA 1GM9A 4UF0B 4LC1A 1ZBA2 2GN3A 2CTPA 2UYAA 3K5LA 4S2DA 1JOYA 4IEVA 2YG0A 2Q73A 3E22A 1I3HA 4XBFA 1AJKA 2ZR2A 5BY1A 3NKGA 3CJIC 2VOXA 3P1IA 4FVVA 3S5AA 1G1XB 1DQ0A 3B5LB 3WY6A 3ZHTA 4JTAB 3CCVV 1FXZA 2HWF3 3SCGA 3MFCA 4OXSA 4QM9A 4AVBA 5IE9A 1BXHA 1I08A 3VBSC 5D1IA 2QTSA 4YJ3B 3H1MA 2VECA 3HD8B 4LEJA 3EBRA 4BH9A 2EIJB 1VRH1 1QOTA 4DV1B 4J7ZA 1UXXX 4R9DA 2Y6KA 1Q8OA 1JOJA 5E6HA 1BK1A 5FPRA 2D43A 4EROA 1QQCA 3J7LA 3NNFA 1NQTA 2BW8A 5AVPA 5B5EZ 3OM3B 4J10A 4UFHA 4J42A 4ABMA 1K5MB 4DK1A 2X5IB 3WQ0A 4FZ0A 1GN3A 1GKFA 2UXBB 2XL7A 1TVKA 1B06A 3VBUA 1SC5B 2GNMA 1O4ZA 1FV2A 4JV5B 4IETA 1S0IA 1SF9A 2XOKG 4YY3B 1YFYA 1UOBA 2R9AA 4S2FA 5H9RA 1S0CA 4BDVB 5EIYB 4RR3B 1AZDA 4ASLA 5B1BC 2ZXWB 1AL23 2WLHA 3GHNA 3MHZA 2PQSA 4ZS2A 3VBUC 1MA1A 1D5AA 4B08A 1XNCA 4Q4Y3 5F5AA 3OGSA 5GZEA 1S2KA 2P37A 1N3OA 2IXIA 2VZ1A 2IU0A 4AHCA 1OCCC 4LUMA 3VZOA 4V1PA 3T0AA 4YW4A 1AX0A 4WM8B 4I2OA 2E6VA 3NWKA 1ZX5A 1HNZO 4RWUA 2PHTA 4LH6A 5FZEA 4KP4A 1YYNA 4QX2A 2WSSG 2CH7B 3USSA 2VZQA 1QH6A 1QH7A 1XEQA 4BM8A 2VMGA 1ZM1A 5KAIZ 3JAKA 4YIPA 1VMGA 3DSQA 1US2A 2YEVA 2W0FC 2J1UA 3GZTB 2WAAA 3WLUA 4B1MA 3MDPA 1WCUA 1FMD3 1LUWA 2BOIA 3FMGA 1X8EA 3A0BZ 4A7KA 4R8CA 1U5ZA 2WIIB 4FLYA 1Y74B 4QPGA 2DQ3A 1PGW1 1JYCA 2HJFC 3VDBA 1WBFA 3DGEA 5JI9A 3W7TA 3P5BA 2FCVA 1W9FA 5L3FA 1ZZCA 2AGSA 4XJWA 1S4CA 3HNMA 1IG0A 1QY4A 1VBC3 1NCQC 4ISRA 5ABJA 3OUJA 4YW6A 1JU3A 3UV9A 4FVMA 2BCCH 2HWD1 1PV0A 4JRLA 4CC6A 4AVTA 3USUB 2ILMA 3D8CA 2IVIB 4YW2A 1EP0A 4NYKA 5KXEA 5EK0A 5FXXA 1ENQA 1X9TA 1K3IA 5DAPA 5IYBO 4FPPA 1UYZA 5T5OA 5FK7A 1UU4A 3AMQA 5J2UA 2RR13 1JOBA 4FJCC 4RGKA 2YFZA 5FZ7A 3OPTA 2DCJA 2DVBA 2N04A 3ITQA 2PI4A 3H9VA 3ALQA 3WG7B 4EFBA 2Q6AA 1AROP 4PT6A 4QX5A 5CN0A 3WDXA 2E32A 4NMIA 3WB1A 4ZHQA 1RL3A 1H2MA 4EFEA 2AH2A 4LFBO 1H6XA 3AKPA 3JD72 2ATKC 3BA9A 3HKDA 3D0SA 3MGUA 1HDKA 3I3QA 1A32A 1ZVFA 4FOVA 1OV9A 4YVSB 3GWOA 3RRDA 2F4VO 5AC93 2Z69A 2IH1C 4JDMA 3HKEB 1GN6A 3Q8FA 3J8F3 2FDHA 4JGZA 3TEXA 5EPAA 4R7CA 2H6CA 5DDJ2 4UB6Z 5CKNA 4MVMA 2WS93 2JD4A 2Z5UA 2ZHNA 4XHXA 3FAVB 2D3OW 2Q7EA 4RHV1 3D36A 4WFFA 2D93A 3N4MA 1NBMG 1OVSA 2WNEA 2RM22 1FFXA 2DUOA 4QNHB 1XI1A 2BVBA 1RYYA 3H1LH 2D3SA 1AJPA 4O4LA 1OOPA 1GZWA 3C2UA 1DGWX 4ATFA 1OQEA 2ZGPA 4TUYB 1WMDA 2D40A 5BMVA 3KVAA 3SKVA 2PN5A 4HETA 2ADPA 3BIEA 4CDQC 3M3QA 1RUE3 3VDDB 1FOD1 2HH9A 2JECA 4N43B 2OYQA 3MIHA 4KH9A 2K1EA 4YVSA 1WLWA 3OBTA 5KBFA 4LJHA 1NH2D 4B3MO 1WUVA 2GC3A 5EV7A 1MSWD 5F39A 1JZ5A 3OUSA 4GMP1 2AYHA 5LHHA 1AYN1 4NAMA 4OX9O 1KFUL 4CDQA 2IJKA 1MQTB 1SESA 4FPGA 4RN5A 3FHQA 3GGLA 4NIIA 2ADEA 3FAVA 5FPOA 2M6YA 1FXVA 1AF9A 1OKQA 2O8OA 2K2SA 4IEUA 1KS4A 1Y76B 4NTYA 5LEJA 4KGQA 4DOUA 4DXTA 1ULOA 3AG2C 1FXKC 3IDCB 3TEWA 4Q1RA 1XMQB 5F6KA 4LF5B 3E6CC 2P6CA 3KD4A 2RR11 2X6CA 3HBZA 4JZGA 2OT5A 4H55A 5APAA 1W90A 2JJ1G 1BLZA 1PGL2 3CE2A 3D36C 2RS32 3S5QA 2JKXA 2R49A 1G6NA 1OZ0A 5HV0A 2HWB1 1V6IA 2PMWB 5JZGB 1MOFA 1RUG2 2YXSA 5DAQA 3GBGA 2A1XA 3LA7A 5KHGA 4O4LB 1RMU2 4WVWA 4QKNA 2R043 1PX3A 5EFUA 1ZA7A 3ZRVA 2MEV1 3T4VA 4DV2O 4FLWA 2AZ2A 4RHV3 2VQEB 3GBWA 3VD5A 1AR62 4GZRB 1CAUB 4K7JA 4LF4B 1XMOB 2E31A 1YITV 1O9HA 2AUYA 1SLBA 2CTVA 3TOJA 3A0NA 4UBGA 3VBHA 1VQ4V 3C3VA 3W7WA 1BQZA 2QJ1A 2WWWA 4KGGA 1JYXA 5JH7A 5CA1A 3ZSJA 3STLC 2QWNB 2G1MA 4PJ0Z 2YIDA 3JARB 2LQTA 4AWDA 5CNAA 1VEWA 2UUAB 4KWKA 3BCCH 2ZQMA 2QCSB 3H1YA 1PL4A 5GZFA 1YIPA 1WN7A 1FT9A 1N1VA 4X1IA 4ZIBA 3ZFGB 1WBLA 2BPA2 4IW3A 1SZXA 3R05A 5DAXA 4NIHA 2TUNA 3RBZA 1YTFD 4V2WA 2KB1A 5FYBA 2QSAA 1FXKB 3B3QE 1AX1A 1GP5A 4XF0A 1SFNA 2VUJA 5C4WA 3WXPA 3W59A 3N9LA 4P2ZA 1IS3A 4HL0A 3O5SA 4JI2O 5ABJB 2BTOA 5JWPA 5LGUA 5JSPA 3U4XA 1OCOC 2WA4A 2CGPA 2WZEA 3KGZA 1V55B 4ZY9A 4ZONA 3ZCCA 3UKMA 5K1XA 5F3IA 5KUKA 2CL2A 4GX0A 2Y48A 1HR0O 4LUKA 1OT5A 4IDZA 4UXNA 5A1AA 4RR3C 3ON7A 1YZBA 2XPJA 1N4CA 3BOWA 3AP6A 4CDWA 4X1KB 1RMU3 1XOYA 2R0FA 2GNBA 3NJYA 2VGDA 4BQ4A 3WDUA 1HXS2 4JZ2A 1ONAA 2J1AA 2HYXA 3K3OA 2VMIA 4QU2A 1SQGA 4CVUA 1VBD3 4YZ3A 3M3EA 5FY0A 4J25A 1HKDA 5IT6A 3S0MA 2ZGQA 3DC6A 4W6WA 2JS5A 4MVQA 1ZRIA 4KXRA 1ZNPA 4IE5A 3AG4C 1HNWB 1U12A 4DR2B 3FLTA 3D5OA 4JX0A 2HWF1 2VG9A 5E16A 5A3TA 4N9IA 3BTYA 4D3WA 4O65A 3OEAA 1MZ6A 2WL1A 1PK6B 4XUPA 2ZAHA 3RZLA 3K9AA 2MW2B 3THCA 3VUOA 3ZDSA 4B8EA 2XH6A 1VBE1 3R4DB 4I5SA 3ZN0A 5HCBA 5FPZA 1W8UA 1M06G 4WVMA 2PHDA 1X50A 2PHXA 4FP3A 1BKZA 1S5HC 4I0XA 3NR7A 1UOFA 2AZ5A 1JVMA 4ZOLB 2VM9A 1N34B 3IMNA 4FMTA 1GZWB 4FOWA 4K6BA 2MHFA 2Y69B 1W8NA 5A9GA 3AX4A 2R16A 4X1KA 3NNGA 4GMP0 3LEGA 2WQ8A 4QE9A 3RJRA 3LFIA 3KM5A 3PUQA 4U2AA 1SQVH 3V0AA 1COV3 3GF6A 4ONUA 4LNUA 2CTRA 2ZKLA 3NVCA 1VQ6V 3BI3A 1KD1W 4L2NA 1Z7S1 4EWEA 2A3YA 4YM1A 1Z7S3 2BOBC 4OI4A 2P5BA 1MEC2 1H1IA 4Q27A 3I55V 4AGGA 1RFYA 2QTWB 1QMJA 1BS3A 1M5IA 4YVWB 5A33B 3RYIB 2CY6A 4PIZA 1NY71 1XNKA 4UCOA 2H6BA 1VQ8V 3EQEA 5GTHZ 2XVKA 3T09A 2V09A 4CCJA 2PHUA 1OLME 1HJFA 3SMHA 3NAPB 1SLLA 1YLLA 2RDRA 1AI7A 2YGMA 1SKVA 5JZGA 4TZDA 2G19A 4YNIA 2QQOA 3SYOA 3RWRD 3ZYJB 5LMNO 3UQ8A 4BIFA 5HI0A 1J59A 5CBFA 2VNOA 1S3JA 4P9OA 4E2GA 1W6OA 2UUBO 3AYAA 2ADDA 2GN7A 2W92A 5FOJB 2XAQA 3VQXA 2A3QA 1RUE2 2D3RA 2WLQA 3K2OA 5FO9B 3LOIA 2XJSA 4BK4A 5C7GA 2QEXV 1NOVA 4OYUA 2Q5ZA 3I54A 2PLV1 3M70A 4CXYA 5L73A 4MGKE 1VQ9V 5IHRA 2WS92 1L7QA 1LOCA 1VBC2 4A45A 3CC4V 1IS5A 2B5HA 4BPZA 4CP9A 1UFIA 2JE9A 2VAUA 2QWPB 3RN4A 4CCKA 1TNRA 2F4LA 3OD0A 2BGPA 1FKAO 4FTEA 5ACA3 4LNUB 3JCUZ 5HXMA 5FUNA 4J41A 1OOPC 1WB7A 3SJAC 3JARA 1W6QA 4QGPA 1H8TB 4HPKA 5FAXA 1X7NA 5KXBA 5CKQA 3OTOO 5GM0A 4OCTA 4XIOA 3F5TA 1FMD2 5SV5A 4QPYA 4META 1CZVA 1RIRA 4N53A 1HNWO 1RUG3 4Q0SA 2DTWA 3JD73 1ULDA 2YBPA 4INDA 1S1AA 3UJQA 4KBBA 1QEXA 2VZUA 1LU2A 3VDCA 1VE0A 1MS9A 2YBKA 5FNVA 3K59A 5BNPC 5DG1A 1M57C 4FPKA 1RGSA 3OGCC 4TUYA 5JCOA 2WUHA 4MVZA 1SBFA 4EV0A 3NNMA 1IQAA 4E4SA 5A32B 4QQOA 5FRAA 3NXSA 4RR3A 5B1OA 4NIDA 4DV3O 1V55C 4QPWA 2VC9A 1U97A 3S6PA 3OT7A 1A6CA 3VDDA 3HQXA 3O1RA 1W0OA 2XJRA 1WP8A 4J1WA 4HZ3A 3Q8BA 2ES3A 4QU1A 3EO6A 2E75B 2XL9A 2HG5C 2UU9O 5LHIA 1SFPA 3Q4HA 1N32B 1NLRA 2YC4A 2VD7A 4M3CF 4QIWF 5DN2A 4K21A 1H2GA 1NTMH 5KXDA 1CAXA 5D21A 3IMMA 1ZZ9A 3ZHQA 4B3SB 4K0KO 4Y4YA 5ERLA 3T1LA 3IPVB 1HLCA 3QH6A 5JJNB 2QJVA 3QD6A 4Q8LA 4CCNA 5JXHA 2VOWA 1IPJA 5CA3A 5FZCA 4QT6A 2WLJA 3M8AA 3OUFA 1TG7A 5LL6Y 3KQ4B 3DUIA 3HBKA 4QXBA 1R3JC 4ZBMA 4OQ8A 1R1A1 2VCBA 3FBMA 2CHHA 1HRI3 1A78A 3UL2A 1SQBH 1BZWA 4DR5B 1XMQO 4NHYA 4BW5A 5B1BB 4GB33 5SV8A 2MEV2 2B9ZA 5JVDA 2RS53 4L8JA 2G9FA 4HONA 1V9PA 4OZXA 1P49A 4H44B 3ECQA 1BCCH 3HQUA 3HOBA 3ZN5A 4M3CE 1UU6A 4YLZA 3EXAA 2WNUA 1NJIW 3POYA 3G6EV 4FBFA 4K3UA 3QVNA 3MIEA 1D4VB 3I2OA 3N9PA 3AZVA 1RUC2 4QDSA 4CP2A 1VBA3 4ARXA 3WNNA 4BIUA 4GX5A 1O3TA 1MS0A 5C9AB 1FPN2 5DAVA 2JDPA 2P17A 1LOFC 1UIJA 5ANQA 3ZSEA 4EEQA 4YVWC 1VARA 2YPJA 3SISA 5EBWC 1WCSA 3ZN4A 1K42A 1H2LA 1OSGA 4O4IB 3LFMA 4NRQA 4JKLA 2KR2A 4EJRA 4QKBA 1IG3A 4UFJA 1JR9A 2E51A 1Z78A 2V5DA 2HFEC 1GBGA 1K45A 1VMFA 3A7QA 1HXS3 5FLXN 2CWMA 5LP6A 1J3QA 5CEHA 3HB3B 1NQJA 1TUBA 1XL6A 1E57A 5K4LA 4G9SB 3N9QA 3KCXA 3T2TA 1UYXA 3B9CA 4CU6A 4JYCA 2RJKA 4CH3A 1JZ6A 4ITCA 3GZEA 3SLIA 1Q8SA 1GZCA 5T50A 4AI0A 2B42B 2WC2A 1Q43A 4B3TO 2B8MA 4URTA 3NV2A 3VDAA 4HBNA 5LA2A 2VH9A 1V54B 3PNAA 3JXSA 4LBNA 3FX3A 3G6JB 4X8NA 3V0BB 4IE6A 4UB8Z 4NJ4A 1GV9A 3RVZA 2RQ6A 5JXGA 2R1BA 4GH4B 2UURA 3RFRA 3LNNA 4NAOA 1K12A 3JAWA 4EE2A 2YGLA 3JBG3 3F7VC 2RN9A 4AHXA 4IHJA 3D4KA 2OZJA 3HR0A 4I9WA 3LEMA 1PVXA 1Y7BA 2WWSA 1LJ7A 1QIQA 4FFKA 3C7GA 3AJYA 3KT4A 1H8TC 1JYNA 2WNVA 3FFZA 3PHMA 1JJOA 4EN6B 3JATA 5T3NA 1R083 5JVVA 1UKRA 3ZFFA 3A8TA 3ZXKA 1CR7A 5FYIA 3LA3A 2XOMA 4I55A 1OA4A 2EIJC 2IVJA 1Q8PA 2B5UA 1PIV3 4LLFA 3JD71 3L9JT 4MGTA 2LGWA 1E5SA 3LB9A 3ZXAC 1JZ7A 2PY5A 3VKLA 2AREA 1V6LA 3E6BA 4LF7O 1YIFA 1YRZA 2XKPA 1ZWIC 5JJEB 3IC7A 4LBQB 5D8AC 4MYEA 4OLLA 1CAWA 1R091 4ASUG 1IBMB 1X36A 5LXTB 3QO5A 2JDZA 4LWSB 2KKWA 2VWJA 1HN1A 5FYUA 2OWOA 2P34A 1HRV3 3WG2A 3H7JA 4PQ9A 4OFGA 1A3KA 1RM1C 2JIZG 1KUQA 2VE1A 3JAMN 2ZXQA 5I8SA 4I3GA 1LNSA 5IVJA 3MIDA 5BV6A 3K77A 4LBKA 4KMQA 3ZJZA 3JALB 4TLGA 3WNPA 5DXDA 4X6QB 1OCZB 3B40A 4JTDB 2UXCO 4BJ0A 3K57A 1UN1A 3VBSA 3R66A 3ZMSA 2W6JG 2JJ6A 1H8VA 3AJZA 2HEVF 2W94A 5BNQA 3AEIA 3AMNA 3ZKUA 2DVDA 3L70H 3WCSA 3GYDA 1PPJH 4FIPC 1P7GA 4Z1MG 2D5FA 4LBQA 1CX1A 2ZHKA 3I59A 4YHHO 1MZ5A 3R4UA 2F4VB 4N53C 4GKJB 4Y5SA 1E5RA 1DGLA 3ML0A 3RYIA 5JDBA 4HYOA 5L7OB 4FSJA 4JI7B 3D3AA 1M56B 4CPBA 5K0UA 5LA6B 4LH7A 1R1A3 1R3IC 3BTAA 4AI3A 3X2QC 1QVFU 3C8XA 5C4WC 1SHWB 4F7ZA 2Y33A 1DCSA 3TNPB 4YW1A 4NWVA 4TYSA 4MT8A 2P90A 3VBSB 4XMIA 3TYJA 3VBUB 2V4VA 1IS4A 3DECA 4QMAA 1QJY3 1UOGA 3SEPA 2B7YA 1MVQA 1NLSA 3VHNA 3KB5A 3IFXA 3SJCC 2BJSA 1S0BA 1IPKA 2D3PA 3W5NA 2ZGOA 4LITA 4OUEA 2P6JA 1EN6A 4I01A 5J1XA 2AHYA 2JDKA 1OA3A 3CJHA 1GK9A 5DUWA 3ETGA 1PIV1 2Q5TA 3AYEA 5FUIA 1JCHA 2ZS6B 4F4LA 4LIVA 1VAMA 1C8M1 1RM1B 1QJU3 1GYKA 5L7OC 5A6XA 3FZ3A 2QQLA 4Q4Y1 2PHWA 5EZWA 3WQ7A 2W95A 1RPRA 3SH4A 4D0QA 2Y6HA 4GKYA 2P2KA 5CYYA 1J3PA 4H14A 3WD5A 4YGEA 4XYXA 4CP0A 2ZIMA 1YJNV 2K0GA 5FDBA 4YGBA 4RS5B 1XBLA 5HFMA 1UMZA 3QH7A 4DR3O 3CX5F 1IPSA 1MVEA 1OCRB 5LY2A 2EZOA 2MK3A 3RWKX 2FMLA 4QPGB 4V2VA 1NA1C 4AHZA 3ZN1A 1ZTEA 1WJZA 2BGOA 3RNSA 5C8CA 1O3RA 3OCPA 2E7QA 3OGJA 4ES8A 2IJHA 1UY2A 4ET7A 4W6YA 4IV3C 4O4HA 3CL1A 2Y38A 5KXCA 1H0BA 2Q1ZB 1EPWA 4OHXA 4LKFA 4IT5A 1I94B 1WGPA 5FZ4A 4CXXA 4NTWA 4YZ2A 3C7HA 3R65A 1Z0HA 4NHXA 1AI4A 5JCOC 1GU3A 2HBTA 4PI2A 4BOWA 1Q3EA 1Q56A 4W4KA 4XXPA 2VOTA 2UU9B 5FFOC 3N2GA 5C3QA 1UYPA 1BMV2 3SYAA 3POBA 1ULPA 1TMF3 4HANA 4NROA 5J09A 5KA5A 4Q0PA 3RG0A 4NIGA 1DHKB 1PM9A 4FLTA 4A7ZA 3GVMA 4AYUA 3CKHA 5JCTA 1SDWA 2J7MA 4P9YA 1PM7A 5J2TB 1EM1A 3I2HA 4YW3A 2R071 4IEYA 3B09A 1PZ7A 4XFCA 4Y24A 2PZSA 2AC1A 3SQOA 1RUI3 2ZCEA 5FZ0A 2ZX3A 4R4XA 2WNVB 4YPJA 3ABLB 2PFWA 3P3NA 2ENRA 3ZSMA 1GSLA 1V00A 1NXD1 1GR3A 4HG6B 5JR2A 1CPNA 1SLAA 2V7QG 3HQRA 5L3GA 4I55B 3TETA 4BAYA 2VZRA 1D4M3 2A3XA 2KSDA 3N9OA 3SH3A 5F7UA 2PTMA 1EUTA 2EAAA 1NR1A 2Y6FA 1TVKB 4P5YA 1US3A 3MW2A 4FP2A 1VRBA 2GALA 2XJVA 3ZXFA 1VBB1 4H3WA 4IEPA 3SPCA 3KLSA 2X5IA 3N36A 2OIGA 1DZTA 1MS8A 3ILNA 4JI2B 4AK3A 3KF5A 4ORFA 1JOPA 4XABA 1Q8IA 3H8XA 3VBBA 4O9EA 1VMJA 2QDRA 3VBFC 1LOEA 4CZZA 1VBD2 2RVAA 1QF3A 2YYOA 3H8UA 2J1VA 3LDDA 4LF8B 3SEEA 2E74B 5I0RA 2VBBA 1AR91 4YGDA 3WW2A 1ZLZA 5IY5B 2YBSA 4GB32 2OKXA 1ASJ2 4P9GA 3ZXEA 3A0HZ 1ZBE3 4UAPA 4DK0A 3CB2A 3NMBA 2CDOA 4DR5O 2HR3A 1UOJA 3JAKB 1PMJX 4OULA 3VKOA 4AFBA 4KL1A 3HEIA 3M4FA 1CN1A 1BSMA 4BZ4A 1U0AA 2DYCA 3X29B 4JI1B 4DV2B 4Y20A 4NR1A 5CB4A 4Y22B 1CIYA 2P6HA 4UV8A 3I5DA 3GJAA 4I3PA 3E1F1 5A6QA 4JTNA 1H38A 1OCZC 2ZHLA 1XE0A 4IESA 1JUIA 2VQFO 2QA4V 4AFAA 5JPNB 1N8RW 1MACA 1HRI2 4JI6B 4N7UA 2B9UA 5KMGB 2IUWA 3U0ZA 5JIUA 2ZNJA 5JQGB 4MZUA 2H94A 2J1EA 4CYDA 1IBLO 4AW7A 3K03A 5J3UA 2Q1FA 5A7SA 1COV2 4GUNA 4DV0O 3I3BA 3O1TA 3RPQA 4XCAA 3H8RA 2WWUA 1AUYA 5E8AA 4ZHQB 4WCEV 4A44A 1JZ4A 2YROA 4DEVA 3CIHA 4PIYA 3CMEV 1S0GA 2OYZA 2GTAA 2LFSA 2HJDA 3OBRA 2DVAA 4DB5A 3ZN6A 4DV5O 5DUXA 2BVVA 4MXWB 2IW5A 3FD9A 2EF6A 1IKQA 2UUBB 1MZFA 1A8MA 1SBEA 2WDBA 2WA3A 4OHVA 1L1FA 4B7EA 1E79G 1NZCA 1QJU1 3IB3A 1KP2A 4W65A 5CVRA 2OTLV 1BQPA 2QDOA 2VTXA 1BBT1 1N32O 4JGZC 1EAH2 1TEIA 4LO5B 5K9YA 5LK5A 1EZVH 1VQLV 3AFKA 2DYSC 4YM2A 4MVSA 4PA7A 2ZGSA 3B2EE 3DN7A 3CBNA 4OHWA 1NZ6A 2Y0IA 3ZMVA 4DXSA 1HV1A 4C90A 1LHUA 3BPZA 4PLNA 1PL0A 3AP9A 1N36O 1XNBA 3MV11 4LBEC 3KHCA 3H01A 3J8F1 3R0RA 2R063 1GWLA 2YY1A 2E5LO 5IVEA 2CUGA 4BK5A 1TME1 3SCHA 5FZ9A 5JLVA 1QJY2 2LW8A 3INAA 2D97A 5EXOA 3E83A 3FYIB 1XE8A 4J9ZB 2B9VA 5LOVA 4UBHA 5C71A 2HJIA 4LHKA 1OLQA 4OQ9A 5GLUA 3N7LA 5IK5A 2BP6A 2WZ8A 2ZKOA 5IK8A 1UWWA 3QBQA 3LPGA 4HN1A 4FXKB 1C1FA 1Q86W 4LF5O 2W68A 5LMUB 3O9OA 4E4DX 3IM0A 1ZRFA 3F7YC 2XBO2 1RUH2 3AG1C 1YF2A 3IAQA 4ISQA 1UW8A 2FD8A 1ODNA 4CCDA 2YI8A 1N36B 2JB4A 4BQXA 3DXUA 4JI4O 1VQNV 3CCLV 4DV6B 1L7RA 1W6NB 1X33A 3WEZA 3B77A 2BNNA 2HHHO 5FYSA 3KV6A 2Q9LA 2WO7A 3AKQA 4Q8KA 1RUF1 4H33A 4UFZA 1XRUA 1JYWA 4AVSA 4E8CA 4FXGB 1EN4A 2R073 3JB4C 4JGSA 1BHAA 1OLRA 4DUWA 4YFZA 1XBFA 1D0GA 2A6WA 1UZWA 1UZYA 2RM23 4UCSA 2A79B 5H2FZ 3VBHC 4FTBA 4I4TA 1OFNA 5T5PA 2WSUA 5IVCA 1TME3 4DXWA 4XDLA 4AQSA 4XOGA 1UU5A 1VP6A 2NYYA 5A3UA 3MV01 1JPXA 4QD2A 2C4XA 2EXJA 4QB1A 4UT5A 3WNXA 4CCMA 2JGUA 2DTYA 2B39A 3ZYGA 3TEYA 1AXKA 1XDCA 1QR9A 4NO4A 3RVYA 4YW7A 2H0VA 4P9IA 3ZHUA 1O6UA 4DRVA 3E5UA 1YI7A 3RT3C 1AP6A 1RHI3 5HCAA 1ND2A 5EQUA 5KAFZ 4S2HA 4PA6A 3UYJA 2YU1A 2JWPA 3LDBA 1DZQA 2EILC 1XPWA 4Q4X2 5BNNC 2YSUB 2ETNA 4JASA 1R73A 1H2KA 2J1RA 4I7ZB 1YSCA 1VP7A 1JUHA 3PMEA 1KKCA 1YVWA 2ZBJA 3CRQA 4PDWC 4Q5OA 4CDWB 2AACA 2XDVA 3OTFA 5LGTA 4AL9A 1DLCA 1QJZA 1PO13 4XFBA 2Y6JA 4WM7B 1OURA 5BXZA 1HX6A 1BEV2 2VW2A 2IFRA 1DK1A 4QM8A 4DV0B 1S76D 4AI2A 2EINC 3TXSA 2R7EB 1HWYA 4QX3A 2CE4A 3AKSA 1GLHA 2QQWA 5LBQA 1AP5A 3APQA 1C8NA 4RGAA 2XLGA 4MTFA 5J36A 2YIBA 2VMFA 4JKKA 2ZZQA 1Z2GA 4JAUA 3PJSK 3M1HA 1V0AA 2Z3YA 5LCWL 3N2KB 3K46A 2HHHB 2VW0A 4XBNA 4RS5A 3I2IA 1EFRG 2AENA 3AP7A 1WZXA 3H9AA 1NT2B 3TWIA 1AI6A 3WDYA 1CPYA 1VF7A 3ZYIB 4E2QA 3ABMB 2XXZA 2D6KA 2Y0PA 5LWBA 5JVDB 1AILA 1JN2P 3THDA 2JXAA 2EIMB 4D6TH 3AK3A 5DABA 4RS5C 4Y22A 4K0KB 3X2QB 2XT9A 4UFMA 3WX5A 3MUZ1 5TSWA 1K7DA 1BVP1 1VB4A 1W8FA 5BNPA 5HXVA 2WFPA 4UWDA 4TWTA 4Q0VA 2PXJA 3CEWA 1ZRDA 1VB2A 2JIGA 4PDLA 1PMIA 5AVAA 1OUXA 3M7MX 4P00B 5L36A 4ARYA 4NXMB 1ZL8B 2A0LA 3CP1A 3BALA 5GKAC 1HIXA 4AFMA 5CZKA 1K97A 4DYLA 3MPBA 3B02A 3E5QA 1NVPD 4XQWA 1F4MA 2XBO3 2JDAA 1HW7A 2CTWA 4JI5O 2LUWA 3O0WA 1GH6A 2RS12 5ACA2 1VJ2A 1RUOA 1HB3A 4QQLA 2Q0OC 3I2KA 3W5MA 3C7OA 5FKCA 4CBCA 1I5XA 2UXNA 5C93A 2DQ0A 1GQPA 4MH0E 4FFHA 2ZX0A 5T5JA 2GMMA 4CRQA 1Q8VA 4IV3B 2RJLA 1O59A 1W6PB 1ZRRA 4KG0A 1YJKA 3JUUA 5IWFA 2BZDA 4AEJA 1OCRC 2FDGA 2ODMA 2RG4A 2XHBA 1B3QA 2GNTA 4X65O 3L72H 1JH5A 4NB5A 1OJHA 1PK6A 4O2BA 3SCFA 4N9HA 3SPIA 1M93A 3VZKA 4JQTA 3TN93 4XJUA 4HSJA 5JZGC 4X6RB 4R8HA 3FE5A 3N35A 1LOGA 3MZHA 4WBBA 4Z07A 2F95B 3O1PA 4MVTA 4IL7A 5CA1B 1GNYA 4H2AA 1GUIA 4PHZA 4QGLA 1V9U3 4Q6GA 3K5MA 1QXPA 3F5WC 1SLTA 4FLZA 2RS51 1E1QG 2O57A 4IYHA 5A3MA 4JGYC 1NLQA 2W39A 1OVPA 4Y1VA 3JZVA 5FYZA 4W50A 3SPJA 3VZLA 1CX4A 2OT7A 1CAXB 1YQCA 3L9DA 2BDRA 3R4SA 5C5UA 2Q68A 2VZVA 4JPRA 1AL21 4IV1A 1O4TA 1GN4A 1GO3F 1VQ7V 4QB6A 1N0NA 3OG2A 3AZXA 2ET1A 4NRMA 5FZKA 5GLVA 1RITA 1XNDA 2HEWF 4X64O 4KHPB 1QJFA 1IDSA 4DY5A 4JGZB 2Z42A 3MF9A 1HV0A 2JGDA 2JG8B 3N2GB 2WR9A 4CA9A 5KLVH 2ZE5A 2P5OA 4LF7B 4N43A 1T2XA 3D0JA 3KCCA 5LK7B 5GLZA 5KMGA 1O8SA 3SITA 4LK7A 3DC5A 1L0NH 4CCCA 1URXA 3L71H 2KXLA 5LBCA 2BOJA 1R082 3I4IA 1UD1A 3BCWA 1XSRA 5LRRA 3GJBA 4B3MB 2A6XA 4BMEA 3VL9A 4Q4V1 5F9TA 4GJZA 4YJ2A 5FP8A 5J37A 2FBEA 3POWA 1XNAA 4MXVA 4E2SA 4CCOA 2BGCA 1QOSA 4GWNA 2RMU1 3ZN6B 4R6ZA 4IEXA 3T08A 4DV1O 5AC91 1G8WA 4XBQA 3D82A 1IXBA 5J9PC 4PELA 2VVEA 1QJX1 3ZFGA 4GX2A 4TT3G 2RJZA 2VTXJ 4MUVA 4NIAA 3LSEA 2JG9B 3C3SA 2A06H 1WD3A 3POJA 4DR3B 4R9AA 5AC92 1RVF2 2ZMKA 3VN4A 1PNMA 1GOHA 1F31A 2LTNA 3OMNB 2EIGA 3LE0A 2YI9A 2F23A 2GSYA 3N7JA 1KQRA 1DU3D 1RUD3 5IWAB 4DR1O 3O1VA 4YZ5A 1RXGA 3WDTA 5FWEA 3N2KA 1Q8QA 2CGNA 2YV8A 1Q90D 1MABG 1H9PA 4MVRA 2VU9A 2R32A 5IVFA 5IJ0A 1F4NA 4CUAA 1O7FA 1DGRA 1FOD3 4PDWB 1RP3B 2PYLA 1K5MA 4FPYA 3C3TA 3IDEA 4Q4X3 3M3OA 5LOVB 4H37A 5FZ6A 4XZUG 5FPLA 3UT0A 1N33B 2OW4A 4K8FA 1WW4A 2Y69C 2VMDA 3Q8CA 4CTEA 1ZBE1 1Y6XA 3E5XA 5B1AC 2HBUA 1AYM3 1ROPA 4QX0A 2QQUA 1QU0A 3O14A 3BTXA 1KFXL 3ABTA 4Y33A 1I94O 3J4UH 5T54A 1NU1H 4XFGA 3A0RA 3DGTA 4OPAA 3ELNA 4LO6B 4CU8A 1FAYA 2R0HA 2IZWA 2P3KA 1QWRA 4I0AA 2WLLA 5BNPB 1G8MA 1YJLA 1AR63 4FO9A 1ZL8A 2XVGA 2OZ6A 4K8ZA 5FMDA 5BZBA 2HWC2 1Y66A 4LORA 1Z5WA 5DDJ3 2XR4A 4B3RB 2ZMNA 3GCWA 3AKTA 2TNFA 4GKJO 3I97A 4DUXA 4NTXA 1V6MA 4Y1UA 1QDOA 3T2OA 1LAJA 4PDRA 3LZZA 4X20A 1PVC2 3AK1A 4J1XA 5FYHA 2QTOA 2WFF1 5IYCO 2HWB3 1RUJ1 4IEWA 5F3GA 1V9U1 2VR4A 3A2FA 5KX5B 3UNPA 3FJSA 3GHMA 3H1HH 2VOKA 3EXUA 4AGVA 3HKEA 3U14A 3VGIA 3WINE 3UJOA 2YU2A 2HP8A 1YHFA 2ZKNA 1QJEA 2DFBA 2PYTA 2FYUH 3FWEA 3QCWA 2HWE2 4FFFA 1DGRN 4FFIA 5EYPA 5JXJA 1AVBA 2Q69A 3A4UA 4UF0A 2ZINA 4XJ9A 4KBZA 4L97A 4I0BA 4W4ZA 3SYCA 1GP6A 3MF6A 3PUIA 5HPOA 2BOCC 3SYPA 1YJWV 2DWRA 1JW6A 1OQ1A 4O2BB 3KS7A 1AYM2 4D94A 2DN9A 1CZSA 3OYWA 3P3PA 1RUI2 1FPOA 1E5HA 3RYKA 5GALA 1J3RA 4WM7A 3AMMA 4P5HA 1XHXA 3CSXA 4W6XA 3WCRA 1W0NA 2EAKA 4NHMA 1OHFA 3DPRA 1IBKB 3WP6A 3P6BA 1FS0G 2P22C 3I3DA 4XAAA 2P06A 5ABJC 3LSSA 4YYOA 2NM1A 5G04L 4OUSA 1P8JA 2C2AA 2H8PC 4LKEA 2XLFA 1GFF2 2JDUA 3ZX6A 2R30A 2GHYA 1UYYA 5KC6A 2FHRA 2Y6LA 5LXTA 2Z2SB 3KG2A 4EN8B 3ZOIA 3TN91 1TVGA 4M3CB 4UFIA 4CDXC 2JEXA 1UZ0A 3ZS8C 1GZTA 4PDVA 2AZ0A 4P14A 3K5NA 1N1SA 4UV9A 2Q1MA 5FZHA 4TV9A 2QQPA 2R062 4DV4O 3N3HA 1FATA 3IC9A 3U10A 1OQDA 4IEZA 3PLQA 4HXCA 4X66B 2YHJA 1U5YA 3UKVA 3NJXA 4MGSA 2CDPA 5FXZA 1WCKA 2ADQB 3NKTA 4IEQA 1DTOA 1V6OA 2YUAA 1POV0 2CNAA 4WZFA 3W7XA 3KV5A 3RWNA 2WZR2 1M90W 1KMIZ 3V64A 1KJLA 2OUHA 4XXAA 2XGXA 5EC1C 4BQYA 2WBKA 4AI9A 2VW1A 1HP8A 1W2BU 5GW7A 2EXIA 4QQ2A 1GMGA 1OFSA 2JDMA 4QXKA 2SLIA 3MD0A 3VKFC 1OD5A 2K9ZA 3I59B 4B3SO 1VQMV 4N43C 4XFHA 3UKNA 3FL7A 1JJ2U 3JD0A 3K04A 2C6SA 5FYMA 2VUCA 4MW3A 3CS5A 2A9HA 1REFA 4WFHA 1WLEA 2ZOEB 1H30A 1W6NA 4IIJA 1UKGA 5FZAA 1NYWA 4UYBA 2C0ZA 2EIMC 4FZ1A 1W6PA 4TV9B 2JK5C 3W20A 3J26N 5D8AA 3J9SA 2PA7A 4YARA 5IJ9B 2BWCA 2HKXA 3DTUB 4DUZB 3NNLA 2A75A 3SJBC 5JQGA 1YIJV 1GM7A 4LF9O 3KGLA 2P67A 3KT1A 3ACHA 3ZXDA 4CUBA 3LUTB 3NO8A 4X88A 2ZE8A 4IE7A 2WNUB 3CZJA 1EV12 4RFT0 1OCCB 5JJJB 4Y1XA 2W0XA 3B8NA 4UW3A 3AG4B 1I9RA 1Q82W 4Q4W1 3WG1A 5JOYA 3OGRA 2Q8EA 4K8XA 2ITCC 3LSQA 3URFA 2HYKA 1BGYH 2BQPA 3I3MA 4D8MA 5BR8B 4O4IA 4AEKA 5ITZA 4FPOB 3DYMA 1DQ6A 1ND3B 1IKPA 1RUF3 1VF6A 4M0NA 2QQJA 3VBRA 1IQDC 4JI3B 3ZRWA 5FZDA 3H3ZA 1SCSA 5CFDC 3LDCA 3JCZA 1RUH1 2VPVA 1F5JA 2XLAA 1UX7A 4HZFA 1ZZBA 3B9IA 3WF4A 3OBZA 4L99A 1W9WA 3HNYM 3NNJA 5KX5A 3VBOC 2JGDB 4GD4A 3K4AA 3D3IA 1HR0B 2W46A 4EWDA 3ES1A 4IXLA 1IZ3A 1F8VA 5A7QA 1B35A 2QWRB 2XNDG 5A7OA 3IGAC 4ZKIA 4JDOA 4AOCA 3HN1A 4YY3O 3V0BA 1SPPB 1VIWB 5IK7A 1HB4A 5L3DA 3WR0A 1VALA 1WA8A 3H8OA 5IWAO 3ASNB 5LW9A 4B4RA 5EYPB 4YM3A 4GCZA 3VLBB 4U3JA 3NV3A 2I45A 1TNFA 4HOOA 2WT2A 2ZACA 4AGRA 4OVEA 3VBRB 4GALA 2CDYA 1DZRA 4CP1A 1YDXA 3FB7C 3ZFEA 1PO11 5BPXA 2XAFA 3PDQA 1QJU2 1NG0A 4NKGB 3RJ2X 4A5UB 3OEEG 3GALA 2ZGRA 4QHZA 1HNXB 4JI8B 3SR2C 1J58A 4F6RB 4XEZA 1VF6C 2EALA 1OI6A 2I07B 2GMEA 1LULA 5IT9N 1AYN3 1BE3H 3IT8A 1VRH3 2X6BA 1Q6UA 4UW5A 4TQFA 2LROA 2LJ2A 4BU2A 1S0FA 3BN6A 1N47A 4LK6A 3CNAA 1QXJA 1AR71 4AQ6A 1YQ2A 4J7JA 4LP8A 5B3SC 2BNOA 3SJQC 1XMOO 1FJGO 4LMFA 1V54C 2A6VA 5CB4B 2JX9A 2Y6GA 1W3XA 2R72A 5L9RA 3UESA 3WFVA 3ACFA 3KKYA 2VVFA 2Q7GA 2D6PA 1QLEC 3BU0A 4QDRA 5FY7A 2VCAA 2JIJA 1FXKA 2JB8A 3MI8A 1IS6A 4E4EA 2ZCWA 3SYQA 3RZMA 1XXNA 1G7YA 3HKBA 1CAVB 1PNLA 2B1GA 3ES4A 3OF1A 5LRSA 1SQQH 1D4M1 2DVFA 2X6AA 4IHJB 5J2TA 1R093 2W08A 4MTOA 1VQPV 4XQ4A 3ICXA 4GLXA 3LD8A 2R70A 1CIWA 1QNYA 3CXCU 1WPBA 3PIGA 2KG7B 1K8AW 4GKKO 1ZZ6A 3OE7G 3AC0A 3WT3A 4A6SA 2YXHA 5BNNA 3PU8A 3T4DA 1LU1A 5A80A 4BISA 2WINB 1YFWA 4A4AA 4B3RO 4XVHA 5M0TA 4QJFB 1N3PA 4AVAA 1KP3A 4WBNA 4F8AA 1S0JA 3DEMA 4JVAA 3AG1B 3WW3A 2O14A 5FLIA 3TNQA 4CC5A 3K3NA 3O0VA 4JDNA 1D4M2 1OC1A 5A3OA 2QM8A 4O4JB 5B2GB 2ZE6A 1H8TA 4HPKB 5KC5A 4QX8A 2H3OA 1RSOB 3DF0A 2ZR3A 4IIJB 2JG8A 1MS4A 4W4LA 5F1RA 4O2AA 4CDUA 4DO2A 2OPWA 1LHWA 2ZXWC 2MEV3 1SS3A 2G4IA 1ZUQA 1BQ0A 4DV6O 3K79A 1CEZA 1LGBA 2R041 2E7AA 4HNAB 5DMYA 1ENSA 2YPDA 1AR1B 5T5LA 5IAXA 4QHOA 3WZ1A 4PI0A 1O5LA 3VZNA 1RJ7A 3SNMA 5LP6B 1UPIA 4F3JA 2ZGNA 4DW0A 3NL1A 1AR72 5H6RA 3KSCA 2PAEA 5KA6A 2C1FA 2WAOA 3K9SA 3E8GA 2VXRA 5GLTA 3K75B 3VZJA 1EZJA 2QGNA 2Q4PA 1XNQB 1CD3G 1D0HA 5EHDA 3ZX7A 2NLJC 4QQHA 3NAPC 5J48A 4GQ7A 3CCQV 2NMNA 3BPSA 4HVQA 4B3NA 1OPMA 1HB1A 4QXCA 4LFBB 1N1YA 4XMAA 4YJ2B 3ZMZA 1XUQA 3ZHRA 3ZYHA 1LRHA 1E1RG 4ZHNA 4DS0A 3UO3A 4ZI7A 1XQNA 4MOAA 5DG2A 4P9WA 2UY9A 3AZYA 5H9QA 1T6BX 3OBAA 4YVWA 4UUJC 1O8PA 1SCRA 5LMNB 2JDYA 2Q67A 1TMF1 1ZZ7A 2ZAAA 1D5NA 2OPKA 2GP5A 3VHRA 5CIRA 1GMMA 3H7YA 1Y67A 4M01A 4BR6A 2CWSA 2JE8A 2DCKA 5FNVB 3IWZA 2MNGA 1QHTA 2AEZA 2YIAA 4P9PA 1VPHA 4C1XA 4PD4F 1SFYA 1KITA 3BKZA 4RFRB 4Z1VA 4O7XA 4X62B 3AKRA 2ITDC 1XE7A 2IXHA 3STZC 1BYHA 5AG2A 1AB3A 4CS4A 3PTYA 4DEQA 5FP3A 1YFXA 2LW7A 1GOGA 3L2HA 5L7OA 1H2SB 3T1YO 3KT7A 3QACA 2EJRA 2YB7A 4DUYB 4UXAA 3WUDA 5DZFA 1FYUA 2QVSB 3A0KA 3H1JH 1NCRC 2ZX4A 2Y26A 2XUMA 4GX1A 1GN2A 3B94A 1W0KG 5EP9A 3CC2V 1L3JA 1XB9A 4TN7A 5C8CB 4EN0A 4IE0A 1OCOB 2HLEA 4YG3A 4CS3A 1JMKC 1PNKA 1UNBA 5DECA 2F17A 4P30A 1W59A 3DXRB 1W6QB 5CADA 3RI9A 4LXLA 5GTIZ 2DF7A 4WFGA 1REEA 3N9NA 4O9GA 3RDIA 4UFLA 3N27A 3V65A 4GH4C 5K7PA 3H1KH 5IVYA 3WG4A 4YG0A 2VQEO 2V4DA 3OYWB 5F5CA 4XE9A 2Y64A 1GQHA 5FXVA 2PQQA 2VMCA 2FMYA 3LAGA 1NT0A 4MGQA 4P9XA 1CJDA 3ACIA 2WLPA 4EQVA 4XURA 1ZX3A 3RZZA 3S3WA 2DW4A 4LO7A 1VQOV 2HWD3 3GNEA 5HFLA 3ZMNA 1W2TA 4WV8A 3M3CA 4G2KA 4P9JA 3FX7A 4AR2A 3OW2U 2FDFA 3LKJA 4F6EA 3AP4A 4IGPA 2AEYA 2I2SA 3KZIZ 1W99A 2UWAA 5LB6A 1AR73 5J2UB 2D6MA 1KD7A 2R6QA 3CRMA 4B4QA 1EV13 2BRTA 3LA2A 3ZFGC 1Y4MA 2ZHMA 2IXJA 4JTOA 2BYVE 1RUC3 3OFNG 4HSLA 1NZIA 3A23A 2K46A 1BT8A 3WDWA 2YICA 1CZTA 2J22A 2L6LA 3PJYA 1NA1A 5BNNB 1RINA 4N7IA 2UY8A 5C3SA 4OX9B 2J1SA 4XIKA 2EIKC 5BNOA 4ZXEA 5A1FA 3U37A 2XJQA 4TWKA 5L3BA 2TEPA 3RSJA 3FLPA 3UGFA 4LTAA 5IATA 1R1ZA 1RJ8A 5IDJA 3T4HB 4MHRA 2FDJA 1ZRCA 4LNVA 2AGAA 2BSKB 3CCMV 1Y74A 3EB7A 4FM2A 1A34A 1X59A 3WP3A 2OCHA 5I0DA 5IFPA 1DDLA 5G05L 2XMLA 1WKYA 1FFTB 1B04A 4Q1PA 1R092 5C8YA 4BW9A 2ATFA 1ACCA 1F15A 3NJZA 1WA6X 1NTKH 4C0HA 4E2LA 1Y3TA 3OGGA 2JEMA 1U5XA 3U07A 2JICA 1R3LC 5LMUO 4Y5TA 5JAXA 1EUUA 3K4DA 2GSMB 4PIXA 1K5SA 4F6RA 2YMZA 4EN7B 2GUZB 3ILFA 3UGGA 5FO8B 4EB6B 4IV1C 2VOVA 4XCBA 4NHKA 2W1UA 5EZYA 3LCPA 4CSWA 1UY0A 1C5HA 4CH5A 4K20A 4OI0A 2CV6A 3DYOA 3AYCA 2BERA 2R1DA 4TQDA 2O8QA 1MQTC 1S5JA 1S5LZ 3NV1A 3WHUA 4PBOA 1GNHA 1PMHX 2WZR1 4DO0A 4XPVA 1TUBB 2DURA 1UY1A 1PO23 1RC6A 4U36A 1XU2A 1RVF3 3W7UA 3CF6E 5H9SA 2GH2A 4C91A 3ZBHA 1G86A 4GKXA 1XNRO 4FQ4A 1XILA 4BQ5A 1W8OA 3BAAA 2PHRA 4ZU4A 1PX4A 1LB2A 2VCCA 2HEPA 2RDQA 3J81N 1XNTA 2DYRB 1ST8A 3PJQA 4U7NA 4XUNA 5CA0B 2LP7A 4TOIA 1IGOA 3K0GA 1DQ5A 1YHQV 2RDCA 1RUJ2 2B4KA 3TN92 3AVRA 1E5IA 2Q8DA 1THZA 3FB8C 1O91A 4QPGC 2CSGA 2D44A 3WF1A 1CP9A 2QKCA 3POEA 2Q30A 2WJSA 3I3EA 2WNUC 5ISLA 1O3SA 3LIHA 1LR5A 2W5FA 1Y4WA 4Z82A 3LNMB 2E33A 4A2UA 2ZGMA 1MS3A 4U7OA 4AQYB 1YNAA 4DRRA 1JFFB 1F51A 4KWLA 4R9BA 4L92A 2IXCA 1VAVA 1BHBA 2Z0AA 3OY8B 1EPZA 2IJIA 3T2QA 3LPFA 1RPOA 4CDUB 4AFDA 5GZGA 3WHTA 5A3PA 3IAPA 1RUI1 1KU9A 3RYRA 1J5EB 2ARBA 5FREA 4NVPA 1IX9A 3PUHA 1UPGA 4HKWA 1XSQA 4HLTA 1S2BA 2SBAA 5FPUA 1O4YA 2CYFA 4CDWC 1SQPH 2VZ3A 4HFSA 5FYCA 3THTA 2VUDA 3E8FA 1QNMA 3HWJA 4YZ1A 2IFWA 2ERFA 2BU9A 2OIIA 2A5ZA 5HCHA 2ZGLA 1DIWA 3GDBA 1JYIA 2HWE1 2F93B 3GCXA 5CFCA 3JAWB 3ZYBA 3ETPA 3V56A 4PDMA 2VNVA 4I9QA 4MO3M 1MG1A 3H3UA 4C0BA 3FC0A 3UT5B 2QM4A 5FMCA 3VZMA 5IY5C 3AK0A 2OUJA 1UAIA 2VMEA 1SRYA 3G6BA 3BVCA 4FFGA 4HK8A 1IBKO 4I4TB 2W2IA 1CESA 4AEDB 4DV4B 3EJKA 3SHRA 4X65B 3CU7A 4K9SA 5CFCC 2Y4UA 3PUSA 3CC7V 3AB0A 1WW6A 1JQ0A 5JMCA 3LWCA 3ROUA 1OF4A 5DZEA 1JODA 2AXTZ 1G9CA 1MSDA 4DV7O 5LA9A 2QE7G 5E1RA 4Q4V2 5IJ9A 4ZI7B 1H4GA 1NCQA 1KDKA 5H5NA 3CJIA 1K5QA 3MYXA 4F83A 2WPDG 3IDBB 4ICGA 2BTVC 4PDWA 2YZ4A 5KR7A 2ARXA 3Q8EA 4QPJA 3RVHA 2PF4E 1SZTA 1M56C 2TBVA 4CEWB 4R52A 2FDIA 3CMAV 2LGQA 4AQ2A 1AR82 1PO22 4GIQA 4PA3A 4RQPB 4ES9A 2UWBA 1ZBE2 2ZEWA 4JV4A 3SDLA 2EIDA 2E63A 3DYPA 4LHLA 3ZYRA 5FZ1A 1PO21 4MW8A 1AR81 2GV9A 1XYPA 3VBFA 1SACA 1ULGA 1W8ZA 4FAGA 5C8WA 2QBXA 4FLXA 1UZVA 4DUZO 2XJTA 1LGNA 2X05A 1I5YA 4Y1YA 5A70A 2JG9A 4X64B 4KHPO 4FFBA 1QXRA 1WWYA 3A22A 1YCIA 1LCLA 1KKDA 2GC1A 1NAEA 3RI8A 2WFF3 3THOA 3WF2A 4I30A 2XG3A 2Y34A 5FZFA 2DYRC 4RUFA 4R9CA 4NXNO 4IYIA 1VBC1 3UK9A 5FZ8A 3LEKA 1VBB3 5FIXA 5IK4A 1N3QA 1B35C 1QJX2 5FBZA 4DR4B 4RSUA 2PLV2 1PM4A 1WCDJ 4EZHA 5FXWA 4YFWA 4QGNA 5LGNA 4KI5M 2HWE3 5IJ0B 1WP7A 3VBOA 2WT0A 3CJIB 2ZEZA 2ZDIC 1QNWA 4BA6A 2F1MA 5FMOL 1UY4A 2UUCO 2QNKA 1ENVA 2N74A 3E89A 5A7NA 1GKBA 2EVXA 2PAMA 5FZ3A 1SLIA 4NUBA 1R081 2WLLB 3S7EA 4CH4A 5FUPA 5C70A 4Q20A 5FZOA 1LUVA 2XHNA 5LZ6A 3RYFB 1NY72 1MMMA 5C3RA 3BHPA 2ZD9A 4JYAO 3ZIXA 1AJOA 2W1WA 2GAUA 2F43G 2VO5A 1JBCA 4OPHA 2D5HA 2VVDA 2DDUA 2W52A 4ZOLA 2WQZC 5F32A 2BTQB 2QZ2A 2HWC3 4UVAA 5B1NA 1RUNA 3JCIA 4IGGA 3SPGA 1PD3A 4PA4A 5HV4A 3VHPA 1YFUA 4K3AA 1AL0G 3MEPA 3CYOA 5H9PA 1JZ2A 4MTGA 1AL22 2EULA 5LYJA 1U96A 1PNFA 3WQ1A 2E76B 4H13B 2Q0AA 4UCVA 1O9GA 1UQXA 3WG3A 1NE4A 2DE0X 3CLPA 1P84F 3LIGA 3OY8A 1ULFA 2BUKA 2X53S 3H1WA 3MW3A 1AR93 4G3YC 2QKAA 4PV1B 4LO8A 2UWCA 1OH3A 2LM3A 4Y20B 5FY5A 3U1XA 5JOWA 5K8SA 3T30A 3I7DA 4DR1B 3IBMA 5FPVA 4L87A 3FLRA 1VBE2 3OEHG 1W39A 1W6MB 4N53B 1NTZH 2VQTA 2OTJV 3TXQA 4LCUC 1PGSA 1MEC3 2ZGTA 4AQTA 4TV8B 3MICA 4XBLA 1HNXO 1BJQA 3CZUA 4EKWA 2ID4A 1MS1A 5LA1A 4KQ7A 5BY5A 5FZIA 4CEYC 2P3JA 2QQNA 5C33A 3MHHC 2X09A 1IXMA 2P7TC 4LA3A 4CZSA 4IE4A 2QE3A 4LOSA 5F2WA 4WVZA 3FHAA 2OX0A 5A7PA 5I8TA 4UCRA 3QNEA 2EXKA 1W2AX 1P4RA 4XDPA 2VNGA 2KM2A 1NKGA 4LE4A 3GZAA 2C9KA 4P08A 5FQ0A 3CCRV 3UT5A 1QCEA 2Y8KA 3E35A 2GDSA 3CWBH 1L8DA 4E4ZA 1Q81W 3D3QA 3RYPA 2FQPA 3RZGA 3FKSG 4LE3A 3LDEA 1BEV1 4B4PA 2CAVA 3OB8A 2EIKB 1HXS1 4XUTA 3WDVA 5C6CA 3VB9A 5ACA1 1JXNA 1GWMA 4K1ZA 4AQYO 3CRRA 1LEDA 1VF5B 5FLHA 4XILA 4IGQA 2JDNA 3JSNA 2D6OX 1H1MA 1SZBA 2VMHA 3FB5C 3MAQA 4BQ2A 1HDJA 3AL5A 2WKKA 2EICA 4DR7B 1IURA 3MIBA 2ARCA 4IQPA 3T1HB 2GMPA 4B29A 4CEYA 4LBLA 2A6ZA 2QQIA 3KCYA 2XAGA 4YJ3A 4BCUA 1WLTA 1KB9F 1KRIA 4LBMA 3M7AA 1DF5A 2GBOA 5CA6A 1SQFA 1H6YA 3WG7C 3EHBB 1D7PM 1S0VA 1GAXA 3VBFB 4AHWA 3WU2Z 3EHKA 2X0LA 2GH8A 2OVUA 1NCRA 1TUEB 3A21A 2A73B 4D6RA 3ZKYA 1Y43B 3E97A 4U3JB 5FP7A 1X82A 5FTTC 4QGMA 5FQ0B 3ZR5A 1Y76A 4X1IB 4ATEA 4PF1A 2PGGA 2DCZA 1H8HG 3C90A 4OHZA 4QPKA 3VQWA 4GJYA 3VD9A 4QPIA 3OUHA 2E9QA 2BFUL 1X9PA 5BNOC 4LWSA 1DGSA 1NR7A 2XBO1 1WMEA 3VBOB 5JSRA 2WLNA 4GKKB 1TE1B 1ZZ8A 1AR4A 3ZMUA 3TJTA 1RMU1 5BNOB 4XDQA 3KF3A 4I50A 1BBT3 1WW5A 4L9BA 2ZJCA 2M7WA 1PHMA 1BMFG 5IFTA 4W8JA 3RZHA 5J96B 4JTCB 1QJY1 2IXLA 2L35A 2NNUA 2DOSA 2BSKA 1G9FA 5EWSA 1DF0A 3J8F2 1C1LA 4Q29A 4LULA 3HMYA 2JEUA 1PGL1 1SPPA 1VAKA 1QLNA 2BNMA 4Q4X1 1LENA 1WCQA 4H7LA 2E5LB 3OTOB 1R3KC 2NQYA 4A3XA 4KG8A 5ITZB 3G80A 2VRZA 4DZGA 4K8RB 1PZ9A 3RYFA 1BBT2 5CISA 3JD1A 4FLUA 4TLFA 4NE9A 4RQEA 3ME2A 5L19A 1N0JA 2DUPA 4JI6O 3OEBA 2JKBA 5TISZ 2JJ2G 3ZRXA 2ZDIA 3TK1A 5I0TA 5JUVA 5LP6C 1UMIA 4L0PA 3AK2A 4IUGA 5FLJA 4AEDA 4GT1A 4UW4A 2A6YA 1GOFA 4XFFA 3AG7A 1ZREA 5FZGA 3OMAB 5HBAA 2QQVA 2V72A 2WYSA 3TBDA 1FOD2 2XWJB 2NN4A 1AHSA 2W91A 4DFSA 1SMVA 3KHBA 2JDIG 3T1HO 5F8PA 4JI0B 1H4HA 1POV1 3K08A 3HR9A 5CKMA 3NSTA 3APBA 3T4ZA 1ND2B 3ETEA 1R6KA 4B7KA 1NI8A 2RM21 3HKCA 3IAYA 3O0XA 5H9CA 4LBJA 2EINB 4X9QA 3HN3A 1W28A 4FK5C 2GP3A 5BYNA 4QX1A 1TAEA 1W6MA 2G38A 4NPLA 1K4DC 3ZMTA 4K1YA 2G9GA 4Y4RA 5DDJ1 5T52A 2DFCA 1DYPA 1CJPA 3QLQA 4X20B 3PURA 3ETDA 3OAAG 1CQ9A 3MUY1 3ZFEC 4FPFA 1TMF2 4JI8O 4XF1A 3T0BA 1WA8B 4ASKA 4MS2A 1Z5VA 4G27B 3CXHF 5BXXA 4NPRA 3JD2A 2IWGB 4HMZA 1PVC3 2VJXA 2CTQA 3EVKA 3M99B 2UXDB 3OOXA 4MGYE 2X7RB 2GC0A 1W06A 4RAIA 2W87A 3PL0A 4CU9A 1K73W 4TSFG 2NZ9A 1FX5A 2PI5A 2OQ6A 1S0EA 2GZWA 4DV5B 3H3LA 4JGYB 3E8HA 2ZIOA 4GB31 4Q0UA 2A70A 2UXCB 2X8KA 5I0SA 3EYPA 4N21A 2YDEA 1DF4A 1GWKA 1I5PA 1HB2A 5IYZA 2VULA 1YWKA 3HAGA 1ENXA 3NAPA 3ZSKA 5FY9A 5EC2C 1SETA 5DAWA 5JXIA 2NLRA 4CS2A 4LFAO 2JRIA 5CFDA 2QR4A 3GZUC 4P9LA 1VBB2 1VR3A 1A8DA 4C8DA 1COV1 4DRXB 2CGOA 3W9AA 4Q0QA 3CCEV 1UMHA 2VBDA 1W04A 3P32A 5LATA 1S2EA 2AHZA 4XF9A 5KUMA 1W0PA 4BLIA 4MHUA 4KWJA 4RQPC 1GTOA 1HRI1 3WW4A 2R042 2EJ7A 4CU7A 3LQCA 5FZOB 3JD3A 1LTEA 1ZYBA 3ASOB 5F5IA 3V0AB 5FV3A 3G7DA 5D5QA 4DNYA 2ZEXA 1I7FA 2W3JA 3O7OA 2NPIA 2WLIB 3OR7C 3MW4A 2ZT9B 1WAZA 5A2QN 1NCRB 3CD6V 1FI2A 1UXZA 5C3PA 1R6TA 1STMA 1H2NA 5B66Z 4QPIB 1AI5A 5EYYA 3H1IH 1CXZB 1V70A 1IBLB 3JU9A 5A1LA 2FZ2A 1ND3C 5H6QA 5D8AB 3AFGA 2WO2A 5EZYB 1DBNA 1SEFA 1PK6C 3I8TA 2VQFB 2QFEA 3N7KA 3JASB 3J80N 3E86A 1LODA 3FBYA 5FY4A 1BMV1 4O4JA 5D5PA 1G9DA 4KNCA 2UUCB 1ASJ1 2E7TA 2VQAA 2WQ4A 3H0OA 4CE8A 1HQNA 4I50B 4Q4V3 4XUOA 3WQBA 5EJ3A 4X66O 1FJGB 1JZ3A 3CRCA 4ZS3A 2NR5A 2RDNA 4JHZA 1VBD1 3SXWA 4IL6Z 1JMUB 4JQRA 4FM0A 2WZPP 3IKWA 5KHIA 2XTAA 3OD4A 2WN2A 4LFCB 1W8WA 3IDAA 1AX2A 3HT1A 4JI3O 4ZKTB 2Q4SA 2WAMA 3VBRC 3ZFEB 3EFFK 2YFUA 4FPLA 4CUCA 3J7MA 2PELA 3ABMC 1J84A 2XKOA 2ZM6B 4RQFA 4EWAA 3VKNA 1QLEB 1S72V 2XHKA 2RS13 4NXNB 1C5IA 1KS5A 1PKXA 4LFCO 3PUAA 3CO2A 1VLNA 5LBFA 5CG9A 4LF8O 2WLIA 5FZLA 1DFQA 4Q4Y2 4DR7O 3ZPYA 3JQWA 4U3FH 3LF7A 1C8M2 3BB6A 1AR5A 2UXBO 2L9LA 1M57B 4JZRA 4HN0A 2P1BA 2VZPA 3TRSB 3MLKA 1G9BA 1KJRA 3ABZA 2A7AA 3SPHA 3AMPA 5CB7A 2QQMA 5F3EA 5LEKA 3POGA 2OQ7A 1YTFB 1Q5OA 3J7AU 1BVVA 1PO12 4ZXKA 4AEMA 3W58A 1NA1B 4HKLA 1SA0B 3K58A 5FWJA 2GC2A 1JYTA 4D6QA 5BR8O 1H9WA 1RUD2 3ZLIA 2BBAA 5EIBD 4SLIA 1NXMA 5CAZA 4PCRA 4Y5Z0 5E88A 4XHBA 1LESA 1UO9A 5EYXA 4MVOA 2YXYA 4BMBA 4GWMA 4CCEA 2YC0A 1ENRA 4CPBD 2XONA 2HVJC 1Q6IA 1TA8A 2CAZC 3OGIB 2ARAA 3NRUA 1YQ6A 3L74H 3WOGA 4E8DA 5FY1A 3CQOA 1YUDA 2BBVA 4KFMA 3RMXA 2JENA 2W6IG 3DKQA 2YEVB 4LBQD 3T0DA 4OGQB 5FP4A 3OGVA 5CFCB 4YHHB 2W9XA 4JV5O 4UFKA 5JOZA 1QQP2 4WM8A 1YQ5A 1Q7YW 4XZPA 3HT2A 4CCLA 1MZEA 3RMYA 1B35B 1UCXA 1DG6A 3MLJA 3C7EA 3JATB 3DPRB 2DCTA 1KEXA 1RSOA 4WZCA 3CEIA 1L7LA 1KQSU 5CBGA 1EY2A 3ZRSA 2BTQA 2WRAA 1G6UA 2Y0OA 4YXWG 3WSOA 4DV7B 4LKSA 3DCQA 2DJVA 2BEOA 1PIV2 2WT1A 5KHKA 1UPSA 5GZDA 4RQPA 1W9SA 4Q4W2 3FUOA 4TXWA 5I0UA 2Z4FA 3DXTA 2UXDO 5L9VA 1R1BA 1UY3A 3HIFA 2P3YA 4GWJA 3KWVA 4RYDA 2R9IA 1AXYA 1W3VA 3BUCA 4AXOA 1J1LA 5C4WB 3TB0A 2IJJA 1EV11 3APOA 5JIAA 5F5QA 3WV6A 1REDA 2ZA9A 3B69A 1SQXH 4WFAV 2EILB 4RO2A 3BIWE 4SBVA 3T2PA 3USUA 3RS6A 1DQ1A
chains in the Genus database with same CATH topology
3OYWB 2AH2A 4YM2A 3AKPA 4XE9A 1GQHA 3JD72 2ZGSA 2PQQA 3DN7A 3D0SA 4E9KA 5I8YA 3ZXGA 4OHWA 2FMYA 3MGUA 2Y0IA 3LAGA 3ZIWA 1WD4A 1HDKA 1HV1A 4MGIE 4C90A 4P9XA 1LHUA 1ZVFA 4FOVA 1CJDA 4TSVA 3BPZA 4YVSB 4PLNA 5A33A 3AP9A 2WLPA 2A3WA 4GH4A 3RZZA 1XNBA 3RRDA 4LO7A 5AC93 2HWD3 4XQDA 2ZTNA 1DLLA 3J8F1 2Z69A 3R0RA 2R063 2YY1A 3GNEA 4JDMA 1TME1 3PVEA 1EAH3 3SCHA 3ZMNA 4WV8A 3M3CA 3J8F3 5JLVA 4P9JA 1QJY2 3INAA 2D97A 5EXOA 4JGZA 2H6CA 5DDJ2 1OIJC 3LKJA 1XE8A 4XJZA 2WS93 2JD4A 4XF4A 3VBHB 2ZHNA 4UBHA 4XHXA 4IV1B 2HJIA 1LEMA 4LHKA 1WMFA 1LOAA 1OLQA 5GLUA 4Y1ZA 3N7LA 5IK5A 3AP4A 4RHV1 5IK8A 5IUQA 3QBQA 2D93A 4C1WA 4RD7A 3N4MA 2I2SA 4J5IA 2WNEA 4HN1A 4UW6A 4FXKB 1C1FA 4L8QA 2UWAA 2RM22 5JSOA 1AR73 3KQRA 2W68A 2BWAA 2D6MA 2DUOA 1KD7A 4E4DX 2R6QA 3IM0A 1ZRFA 2XBO2 1RUH2 2BVBA 4B4QA 1EV13 4ISQA 4XFAA 2D3SA 4I0WB 1UW8A 3LA2A 4HT1T 1OOPA 1GZWA 3C2UA 3ZFGC 1DGWX 4ATFA 2ZHMA 2IXJA 1Y9QA 1OQEA 4JTOA 4DPNA 2BYVE 1RUC3 4HSLA 1OPOA 2ZGPA 1WMDA 2D40A 5T55A 1CAWB 3WDWA 1W6NB 1X33A 3PJYA 1NA1A 5BNNB 2PN5A 1RINA 4HETA 1OA2A 4N7IA 3WP5A 2UY8A 2BNNA 1CONA 3S30A 4CDQC 4XIKA 3M3QA 1RUE3 3VDDB 1FOD1 2JECA 5BNOA 4N43B 3MIHA 3KZ4C 3V17A 4KH9A 2XJQA 3AKQA 4Q8KA 1RUF1 2TEPA 3RSJA 1XRUA 3FLPA 4AVSA 5JR7B 4FXGB 4LTAA 4YVSA 1WLWA 3OBTA 5KBFA 3AZWA 2R073 3JB4C 1R1ZA 1RJ8A 2R061 1OLRA 4YFZA 1WUVA 1T6GC 1D0GA 1ZRCA 2A6WA 3ZO0B 1UZYA 4LHNA 2GC3A 2RM23 4LNVA 5EV7A 2PLV3 3VBHC 3OPZA 4FTBA 3R1JA 1OFNA 3FFQA 4GMP1 5T5PA 2AYHA 3WP3A 2WSUA 1AYN1 1KFUL 1TME3 4CDQA 4AQSA 4XOGA 1MQTB 1UU5A 2KA3A 1VP6A 4FPGA 2NYYA 1DDLA 2ETEA 4QD2A 1AF9A 1OKQA 2EXJA 1R092 2K2SA 2O8OA 4Q1PA 1B09A 1MQTA 4RL7A 4IEUA 1KS4A 3BODA 3WNXA 4CDXA 2DTYA 2B39A 3ZYGA 1AXKA 4JAAA 5LEJA 2ATFA 4KGQA 2RE9A 4DOUA 4NO4A 1OIHA 3NJZA 2H0VA 4P9IA 2D6NA 3IDCB 4DRVA 3E5UA 1YI7A 4C0HA 4Q1RA 1RHI3 1Y3TA 3OGGA 2JEMA 5HCAA 1ND2A 5F6KA 4HVRA 1U5XA 1FPN1 3U07A 3E6CC 4FPCA 2JICA 4S2HA 3KD4A 2RR11 3HBZA 3FHIB 5JAXA 1DZQA 4Q4X2 4H55A 5BNNC 2EA7A 4PIXA 2FMDA 1PGL2 3WP4A 4DQAA 2RS32 1H2KA 2YMZA 4EN7B 3ILFA 5FO8B 2R49A 5K0UB 1JUHA 2E53A 3PMEA 4IV1C 1G6NA 2VOVA 2ZBJA 4NHKA 4PDWC 3DKWA 4CDWB 4XJAA 3LCPA 3OTFA 2HWB1 1V6IA 5JZGB 3OJBA 4M27A 1QJZA 1RUG2 2YXSA 5A32A 1PO13 1F2NA 4XFBA 3GBGA 2VQ0A 4WM7B 1C5HA 3LA7A 1HX6A 1SQ4A 1BEV2 2VW2A 2IFRA 4K20A 5KHGA 2CV6A 4FOYA 4BQ1A 4OI0A 3N6WA 1RMU2 1QHDA 4QM8A 4WVWA 4AI2A 2R043 3AYCA 3AKSA 5EFUA