3OD4A

Crystal structure of factor inhibiting hif-1 alpha complexed with inhibitor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
342
structure length
342
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Factor Inhibiting HIF-1 Alpha Complexed with Inhibitor
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 105
structure length 342
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3od4A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3od4A01
1H2MA 3P3NA 3D8CA 3P3PA 2Y0IA 2XUMA 1MZFA 1H2LA 4BIOA 2CGOA 5JWPA 2WA4A 4JAAA 4QU2A 2YDEA 3OD4A 4B7KA 4B7EA 1H2NA 3KCXA 4Z1VA 2YC0A 2WA3A 4AI8A 1MZEA 4Z2WA 2ILMA 1IZ3A 1YCIA 2W0XA 3KCYA 4NR1A 2CGNA 1H2KA
chains in the Genus database with same CATH superfamily
1I7FA 1JZ2A 1JYWA 4YZ1A 2E51A 2JJ6A 3PDQA 3TCUA 3B00A 1WCDJ 5IFPA 4L2NA 4MVMA 4UVCA 2RR12 4EN8B 2B42B 1NLRA 2JJ1G 1ZBE3 4B3SO 1NT0A 1VRH2 4AEDC 2IVJA 2BNNA 2HVJC 3STZC 2RCVA 3WDYA 2GDSA 5I0RA 4CC6A 5J98B 5DZFA 3OUFA 5GONB 2J1AA 1WW7A 1SDDB 1V55C 3JD3A 1NH2B 5F5CA 2ZGPA 3MF9A 5JOXA 3K5OA 1CXZB 1ENRA 4JYYA 4QKNA 2PF4E 4JHZA 4ZOLB 1G7YA 1TME3 2WAOA 5BXZA 1PMJX 1EZJA 1ZRFA 4ATEA 3L70H 1NA1A 4XFAA 3ACGA 1ND2B 1G9FA 1QH6A 5IT6A 3AXDA 2QQPA 2A3XA 1JQ0A 4MHUA 4CEYC 3MUY1 3ME2A 4IIJA 1UY2A 4YJ3A 3A0NA 3S57A 2PUSA 4UFMA 1NY72 3FBYA 1MACA 3APOA 3FHQA 1IXBA 4RO2A 4HSLA 5F8PA 4XF0A 3Q8CA 3ZM8A 5JVDA 2OIEA 1ULOA 4GUNA 5JCOA 2EIEA 1E1RG 4CCLA 4UI9L 4XXPA 3DXUA 4LK6A 1U97A 4IETA 2YC4A 2A79B 2KXLA 1HNWB 4LF6B 4W6WA 3CRMA 3QD6A 1YFYA 1KKCA 2MPFA 1PGW2 2VQFB 3ML0A 1DLCA 1K5JA 1PNMA 2VC9A 1BKZA 1FV2A 4GKXA 3FUQA 4B3RB 2KSDA 1NUKA 2KQXA 1V9U3 1LEMA 1OPMA 4CP0A 3IAPA 4QD2A 1Z78A 2IWGB 3MDPA 4UBHA 1IURA 4FT8A 4KHPB 1JYVA 3BGAA 4G27B 2LQTA 2RJLA 4E9KA 3WLUA 5LYJA 4JI7O 1TMF1 4AFMA 1DQ0A 1K4CC 4OHVA 4UFJA 3WNLA 3I59A 4QPKA 4IIJB 3AMHA 4YZ5A 1NVPB 1ULCA 3U37A 3ICXA 1CD3G 2VUCA 3ABUA 2V5DA 2ZX2A 4LIUA 1K42A 4YG3A 4BAYA 3ZRVA 2LO1A 4UFIA 2DOSA 3H8RA 4MXWB 1UOGA 5IYCO 2ET7A 3ZMTA 3WG2A 1SQXH 4HOOA 4M3CF 3ZDSA 5F6LB 3E5UA 4CPBD 3QCWA 1LOFC 4GMP1 4QU2A 1H8TA 1WCUA 2G19A 4I5SA 1MS3A 2IXCA 1K73W 3HN3A 2IJKA 5FQ0B 5A6ZA 1SA0A 4XBLA 4IV1C 5BZBA 4N43B 1W8NA 4JHTA 4CRQA 3BVOA 5EYXA 2V73A 4OXSA 4X1KA 3S5QA 4BQ2A 1JYTA 2ZDIA 2CWMA 4ZHQB 5IJ0A 1V9U1 1BS3A 1ZNPA 5C3OA 2GN3A 4GYCB 2C1FA 2IXLA 5ITZA 5LASA 2AREA 3AJZA 3X29B 4DUVA 1QY4A 3O1SA 3LWCA 3JALA 5CA6A 3ZN6A 4ITCA 1W9FA 3MW2A 3GBGA 4BQ1A 2ENRA 1BZKA 1SMVA 3BALA 4K8ZA 3FB8C 2O8QA 4QU1A 4PHZA 1J1TA 4AI8A 4FPCA 4DNYA 2GMEA 1YNAA 2BWAA 1RUF1 5JR2A 4GKJO 3QOPA 4M0HA 3W7WA 3P32A 4L97A 2HBUA 4FFFA 2WQ4A 3CCUV 3I2OA 1EUUA 1ULDA 1PK6C 1OT5A 2C26A 2Y8KA 5F32A 4OQ8A 1FNZA 2OYQA 5ANQA 1HQNA 4V2VA 1NKDA 3T1YO 2P5OA 4L0PA 5LOVA 4JI2O 2PHUA 3ZFFA 4WM8A 1YI9A 4XDKA 2WRAA 3N2KB 5FP9A 2GUZB 1HRI2 5JMOA 1AR1B 3UKVA 5ACA3 4YZ3A 1DK1A 2ZHNA 1KGYA 5B66Z 2FZ2A 1N0JA 4FMTA 2WN3A 2CGPA 2DE0X 2OPWA 5A3PA 3RZMA 4XIOA 3BVCA 5AVAA 3HB3B 2BOCC 1CAUA 4NHKA 3HNMA 5BNNC 3KWVA 1MZ6A 1W6MA 1G9DA 1YJLA 1IGOA 5JQGA 4BH9A 4QX3A 1BBT3 1X50A 2QDNA 3BI3A 2P67A 3K51A 1ZL8B 3ETQA 1F51A 3H3ZA 3AP4A 1PV0A 4LR4A 2BUKA 4JAVA 2RVAA 4YW6A 3AG4B 1VQ9V 2X6BA 3BA9A 4KWJA 4FP3A 1JFFA 1ORQC 1N1VA 4XYXA 3DYMA 5CB4A 2P90A 2EICA 1SERA 4Y24A 1N32B 2VW2A 2FL4A 3VDDC 2WS93 3N7JA 1NXMA 3MIDA 1OZ0A 2BYVE 1Y9MA 1TQ5A 1I94O 5JWPA 3D3AA 3H1JH 1US2A 1HWYA 2IFWA 1HW7A 3AJYA 1M1KW 3WCRA 1VBB1 2RHPA 2ZD9A 3B01A 3MLLA 3GHMA 3AKQA 4UAPA 2LM3A 3UKMA 1LHVA 4X65O 4AE2A 4NIDA 4TV9A 5LWBA 1VF6A 1VQKV 2A73B 4AHZA 1TUEB 1XHXA 1CWPA 3SYOA 4KGGA 1JODA 1UYZA 4Q4V3 5GTIZ 1VQMV 2NZ9A 2DWDC 5FPOA 2DQ3A 3ORJA 5EBLC 1UJWB 4R9AA 3R05A 5CA0A 3DKQA 4B8EA 2LP7A 1J5EO 4CTEA 4K9SA 2ZX3A 1W0OA 1WW5A 4A3XA 4EN7B 2XUEA 5IDJA 4HANA 3ZMSA 5FLHA 4A4AA 2VUAA 3M99B 1VLNA 1HB4A 4Y1VA 3FJSA 1RUH2 2GC0A 1G8WA 1DQ1A 3BY6A 4FTBA 4MGTA 4CU9A 4QDRA 2QKCA 1BMV2 4RR3C 1YIFA 3OBAA 4TTGA 2DCZA 3ZFFC 4GA9A 3MDSA 1TMF3 5F3CA 4JI4O 1VQLV 3MW3A 2NQYA 4E2QA 1Y9GA 3ZIWA 2Y60A 2ZM6O 4AOCA 3OR6C 2M7WA 4Q1PA 2RS53 3GVMA 2AR6A 2XONA 4WFFA 3I2DA 1W6PB 5DQ0A 5GZDA 2AACA 4AEJA 5FZCA 4WBNB 5LA0A 1B35B 1MS9A 2BOIA 1SQPH 4UFZA 3O1UA 3I59B 2ZE8A 4HVOA 5JR7B 4I09A 5CBFA 1RUD1 2UUCO 3O9OA 3O14A 1LGCA 1DGRA 1GMMA 3DCQA 4WM7B 5HV4A 4Q4V1 1HNWO 2XB6C 3T1LA 1AR93 1PNKA 2KD7A 1BJQA 3KMHA 1ALYA 2SBAA 3HKDA 5DUUA 3KHBA 4FVVA 1GOFA 5A3UA 2D3SA 3SITA 1QQP3 3D82A 4O4LA 1PGL1 5FV3A 2V7QG 5I8SA 1OJHA 5C70A 1JS9A 4PA4A 2WNEA 4ASLA 2R49A 1SCSA 2GC2A 3W5MA 3CCSV 1BE3H 4S2FA 4YARA 2H3OA 1AL21 4QDQA 4F8AA 5FNVB 1Y66A 3D0JA 1BVP1 4FFKA 3A23A 4I50A 1RUI2 2XWBB 1FXKC 3VB9A 2VQEB 1GH6A 4NRQA 1W6OB 3L73H 3J7AU 4M4PA 2ZXWB 5LGTA 3VBOA 1OCCB 3R66A 4Y26A 4IE7A 3NAPC 3HKEB 5A3OA 3OUJA 4DV7B 2EIJC 2VQEO 4FLUA 4XQDA 1K8AW 4JRAA 2VMHA 3HEIA 4P14A 3VDBA 2RS31 1VQNV 4PDRA 1HRI1 4G9SB 2W94A 4Y5Z0 3FHIB 1J3PA 5FMBA 1SETA 4JI8O 2FCUA 2L6LA 5CB7A 2BDRA 3Q8BA 3LE0A 4SLIA 1R1A1 4MGZE 1IHMA 3HKCB 4TQDA 1ZZ8A 4BE3A 1UMZA 2O57A 3DXRB 5LMUB 1WPXA 4OHXA 4H33A 3DC6A 3ZRSA 2E5LO 3X2QC 1Q8SA 2HJFC 5ANNA 4OX9B 4BQXA 3VKNA 3M3OA 2WABA 2ET1A 3R6SA 1JBCA 5FYUA 4BWOA 1QXRA 1V9PA 1S1AA 2PYTA 1MZEA 3ZPOA 4UV9A 4R9BA 4BK5A 1H8TB 5AFBA 3FMGA 5DZGA 2UU9O 4AQ6A 4AVSA 4SBVA 2E74B 5LXTB 3WP3A 3BODA 1AP6A 2R7EB 1WA8A 3CRRA 4FAGA 3DSQA 3ALQA 4PDLA 4XTPA 4QE7A 5FPAA 4J7JA 3WQ0A 1N1SA 2YPJA 3LKJA 1JTZX 4DV4O 4IQPA 5F5QA 4XFGA 3HBKA 4CS4A 5K0UA 5LZ6A 1ZRCA 3ETGA 2CTVA 1FOD3 4BIUA 4U3JB 4P2ZA 2D40A 2WS91 3KM5A 2GP5A 4LHLA 4JASA 3C3VA 5C9AA 3U14A 4KU8A 5FY0A 2VUJA 2FMDA 5FYSA 2EF6A 1QLNA 1AP5A 4I0XA 1RUJ1 4HKLA 3OD0A 4PLOA 4ZKIA 1BMV1 2HEPA 4J11A 2W0FC 3DTUB 1ODMA 1RHI1 2NPIA 4IEUA 1DF0A 2CU5A 1ZSPA 3AKSA 4XBFA 3OMAB 2PAMA 4DUXA 3I49A 1RSOB 1Y9QA 3T2QA 4I4TB 1JYCA 4I7ZB 4FXGB 1U96A 3IAYA 1CQ9A 2OW4A 4DUZB 3B2EE 1E5HA 4YM0A 3HBZA 3R4SA 2Y34A 2EIJB 4DOUA 3ZN5A 1M57B 1W9WA 2JXAA 2QVSB 5DMYA 1EN4A 5JXHA 1V6NA 5JCOC 2D6LX 2XQRA 1X33A 2VS0A 4UF0B 2VBPA 4BQYA 4X65B 3BUCA 4DV6B 3TK1A 5CZKA 1WGPA 5FPVA 4P02B 3LIGA 3TOJA 1S0GA 2BOBC 5JJEB 1X9PA 4X1YA 3A0HZ 3AKRA 4AI0A 1HDJA 1X36A 1REDA 4HYOA 4N23A 2P4EA 4UCOA 1OPOA 4DO0A 3MD0A 3D6EA 3C7OA 2IU0A 2WC2A 5FOJB 1Y67A 2QFEA 1RUD2 4UXNA 1HJFA 5C4WB 2WZ8A 5CU1A 4P30A 4I30A 3BU0A 1WP7A 1NA1C 3VBRB 3H8XA 4ZBMA 5C8WA 2LW8A 1W8UA 4ES9A 3SMHA 4HZFA 3CWBH 4NIAA 4XW3A 4LF7O 3IDEA 3ZYRA 2JDIG 1SZXA 2PHDA 4YNIA 3AC0A 1RSOA 4LFBO 3JD71 4U36A 3ZCCA 2VQUA 3ABKB 3NW4A 3PU8A 1GO3F 1W6PA 1N3OA 2HFEC 4FLXA 5GZFA 1G9AA 1Q82W 2R041 3BFRA 1RUE3 3AMPA 5ERLA 2R071 5GALA 4LORA 1AR92 2FCTA 3ABLB 2QQMA 1GMGA 4MSVA 5LMNB 5LBEA 2JG9C 5CKQA 1FAFA 1E5IA 2FKXA 4DV1B 1KFXL 3R4DB 2J1TA 4XFFA 2PLV3 4HKWA 4OFGA 3S3XA 3EVKA 4YLZA 1TVKB 3LQCA 4MGIE 2QWOB 2FDIA 1V54C 4AWDA 2VCCA 4FPEA 1QR8A 2XJSA 2QQJA 3EFFK 1XXNA 3ZRXA 1NQDA 2OZJA 1VARA 4NAOA 1SLLA 4J42A 3ZKYA 4FPYA 1FPN2 4L8JA 2I45A 4X88A 1N3QA 4JDOA 1VEWA 4UVAA 5CA0B 3B77A 1KS4A 3H50A 3W7XA 4ASMB 4GULA 1WLWA 1QOOA 2XJRA 5DUVA 3E6BA 4M3CE 4FOYA 1WCSA 3LF7A 2R72A 4IGPA 1F4AA 5H9PA 1KFUL 5T50A 4DV2O 1COV3 2RJ2A 1OFSA 3LPFA 3VBSA 3D5OA 1KQRA 1BVVA 1U5IA 5BNNA 2UUCB 1BHAA 5BNOC 1Y74B 2WLLB 2A75A 1XBLA 4YW5A 2QQIA 4I02A 3AYDA 5C3RA 2VZSA 4GH4A 2WINB 2JDNA 5EV7A 5IJRA 4AGRA 5CYYA 2W87A 1SG3A 1F2NA 1AR83 3FX7A 4M3CA 1SS3A 2RV9A 4Z1VA 2AENA 1X9TA 4XFBA 1FPN3 3KQ4B 2BERA 2PLV1 1GQPA 4K40A 1AILA 4E4HA 4DR4B 2ZCWA 4Y1UA 4JGYA 4C90A 2Q9LA 4ZONA 1I3HA 3LDCA 1AI5A 2B5HA 2WO1A 2VTFA 4MVZA 2NN8A 1ZBA1 3CPWU 5FRAA 1BEV1 3CS5A 2R061 1H30A 5H9CA 1WLDA 1WBFA 4XE9A 3B09A 2WIIB 4IXLA 5KWRA 5JCTA 1S55A 3ABKC 3T1HB 3FC0A 3HKBB 5JSPA 1RUH1 1GAXA 4CP1A 3SPCA 1V6OA 1Q86W 4LULA 3T2TA 4YPJA 4IE0A 3DF0A 4A45A 4MVOA 1FYUA 4TT3G 1UZVA 4ZXKA 5DZEA 1C5HA 1P49A 3OY8B 1POV3 5EYYA 2ZT9B 3AVRA 3OPTA 4NROA 5ACA2 2PHRA 5KHKA 1OHHG 4F6EA 3TN92 1XC6A 2NP0A 3I4IA 3UJQA 1MMMA 4NIGA 3OE7G 5KAIZ 3T2OA 5DAVA 4NO4A 1HJGA 2G1MA 4EROA 4TWKA 2VVDA 2LGWA 5CNAA 4JTOA 3ZIAG 2JGDB 2V4DA 2X10A 2EJRA 1M4WA 2ZEWA 1YZBA 3HKCA 5B3SB 4WVZA 3KZIZ 2DBNA 2VMFA 2L35A 5GW7A 2XLGA 3FE5A 4XFIA 3RYCB 2UWBA 2HEYF 1OKQA 2P6CA 1M4UA 2DCTA 4RA0A 1NTMH 3GHNA 3OUHA 2W1QA 2ZS6B 3E8FA 1HIXA 2HYKA 3WG3A 1JJ2U 4AI9A 2HWE2 4CCCA 3LDRA 3ELNA 5A7NA 4E4ZA 2QQWA 1HQWA 3HNBM 4N53A 1XNQB 1OUXA 3THDA 5LMNO 4BXFA 1S0CA 2RMKB 2PQSA 1HRV1 2CDOA 1KQSU 1O5UA 4LFAO 3MV01 2JJ2G 2ZGSA 3TXSA 1M06G 1H2KA 4BYYA 1EP0A 1QU0A 4QXBA 1JOYA 4FLYA 3WZ1A 2AGSA 2ZGLA 1G1XB 4YZ2A 2XLAA 4PLNA 4M01A 4DINB 4H13B 5A7PA 1T5EA 5FYYA 5LY2A 1HN0A 2P34A 4QQOA 1JMUB 3SPIA 4LA2A 4GKKB 1XU2A 3N4MA 1D5AA 1V6KA 3MUZ1 1ZYBA 4RR3A 5E16A 3LUTB 2XAGA 4LKSA 4Z07A 4B3SB 4DUWA 1RUG1 1OCOB 3ZFGC 3JQXA 1AJQA 3OMNB 5FZOA 2RDSA 5J2TA 2CGOA 3WW1A 2XLFA 4EWAA 3F5TA 4XDJA 4FLTA 5C8YA 2WQ8A 4G3YC 1GM9A 4KU7A 4MV2A 4XQWA 5HBAA 3WW3A 1YDXA 2YFUA 2VZ1A 2OIGA 5FZIA 2DVFA 1UKRA 1UIKA 3N2GB 3AG1B 1CAWA 2W1UA 2GP3A 3LA3A 4QQLA 4GH4B 3K0DA 3MEPA 3AMQA 5A7WA 1OLQA 3BOPA 3F2ZA 2P4KA 1NVPD 2YYOA 2G4IA 3PVEA 3K5NA 4QM9A 1AI4A 1O9GA 1C28A 1Z2GA 4CDXB 1CZVA 3WR0A 5FWEA 5KA5A 3O0WA 1XHZA 5JIUA 5D2AA 4LBLA 2XOMA 4CCJA 1AXKA 3QTCA 4TV8A 4DV5B 2Q4PA 2VXRA 5BNQA 1LHWA 2B9VA 2M6YA 2JD9A 1YI2V 4B3NA 2QBXA 4RUEA 4DV7O 1AL0G 4LH7A 1MEC3 3LZZA 4AFDA 2Y6HA 1UXXX 2Y6FA 5T55A 4PQQA 3N7LA 3VHNA 2BWCA 2ZAAA 3JD73 2VW0A 2UUBO 3LFMA 1FXKB 2YUAA 4YW1A 1AYN2 2YBKA 2O1QA 4DYLA 5LA6B 3I2HA 1XB9A 3SXWA 5LCWL 3WDVA 3E86A 1DP0A 1OH3A 2XXZA 2WNVA 3T2PA 5IWFA 3WP5A 4AAXA 1CAVA 1OCZC 2P6JA 5FNVA 1JX9A 3ILNA 4FFIA 1RMU1 2JEMA 2JG8C 1VBC2 2FMYA 1DQ2A 4KHPO 5D8AB 2OX0A 4ZZ5A 5IK7A 5C9AB 3SCFA 4EEQA 5HXVA 1GKBA 2WLQA 1OCRB 2DWEC 1POV0 2DYSC 3VOUA 2YIBA 4COUA 4DK0A 2MEV3 1JYXA 4Q20A 3ZXLA 4ZXEA 1GUIA 5FZ1A 3UYJA 2VD7A 3HKDB 1RUH3 4DR6B 3U75A 3L9DA 2E26A 3SC7X 4DY5A 5A7SA 2DUPA 2A1XA 1Z7S2 5B1BC 3KV9A 4JRLA 1O5LA 2Q0AA 4YM3A 2CDPA 3EHBB 4JI8B 2OTLV 3CLPA 1SPPA 3ZJZA 2D6MA 3ETPA 1AYM3 1AXZA 3WY6A 4A5UB 1S0IA 2KM2A 3GZEA 2WZEA 3A22A 4MOAA 3ZMZA 4AILC 1WW6A 3TGUH 4UCRA 4N7IA 1WD3A 3KVBA 2CDYA 3U0ZA 1FPN1 4GWJA 2ZEZA 2E32A 3N36A 4B1MA 3DXRA 3WW4A 1RMU3 5J96B 1D4M3 4RFRB 1J3QA 4DV5O 3PTYA 3Q4HA 3TEYA 3KG2A 3OGVA 3Q8AA 4HNAA 2D5FA 2KR2A 5H9RA 3JSNA 1RUC2 4K8FA 5IW0A 5EZYA 4ZU5A 3OGIB 5A33A 4QXKA 3TYJA 4B29A 2GNDA 2C5DA 4OI0A 3T1MA 1UL9A 1PM9A 2IXKA 5BY5A 1MS0A 3JAMN 3JUUA 4OYUA 4EQVA 4CUBA 2ZR3A 2WLIA 2UXXA 4K0KB 4L8QA 1PMHX 1GZWA 1IXMA 1POV1 4EV0A 1RUF3 4JI6O 4XACA 2IH1C 2BCCH 4OHZA 3M7MX 4FPLA 3WF3A 4Y4RA 3JATB 5FZDA 5FZ0A 1R3IC 1LR1A 2P06A 3ZDVA 4KGQA 2GH8A 2OWOA 3JSLA 1Y7BA 2OPKA 2QCSB 4DUZO 1RJ8A 1HV1A 3H1HH 3NNMA 4N43A 3KT7A 4LA3A 4AFBA 3C3SA 4WCEV 4JI4B 5LK5A 4JV5B 2QQUA 5I91A 3SJAC 4FFGA 1UY1A 3CF6E 3ASOC 5CB4B 2VM9A 2ZZJA 5BMVB 3POSA 1LB2A 3ZHSA 3G4SV 4MYEA 3M1HA 4D3WA 4TV8B 1GN3A 4PJYA 4F83A 3OF1A 1VB2A 3HT2A 4DY3A 3NJXA 2WLLA 3ZXEA 4BISA 4FFHA 4X20A 1L3JA 2RE9A 1AJPA 4XOGA 1EY2A 4LKEA 2B1GA 4RS5B 2VH9A 1TNRA 1YXWA 3LD8A 5G05L 2DTWA 1KP2A 3J7NA 4QPIC 4CEYA 4CP2A 1S5JA 2IW5A 1OBNA 4RQPC 3T0BA 2ZIMA 2BZDA 4B3TO 3ZSLA 3WNNA 3WV6A 2LW1A 5J9PC 1YTFB 3LB9A 1F4NA 4CDXC 1JOJA 2Q67A 5IHRA 4XPVA 2JD4A 1FNYA 4LEJA 2D97A 1FMD3 3ITQA 1G86A 1GNHA 1QF3A 4GX1A 1JU3A 4DR2O 1FOD1 4XXAA 2UY9A 5C93A 4DR6O 4NYKA 1YEWA 2GH2A 4KBBA 4YFZA 3INAA 3ZSEA 3JD4A 4NOTA 5FPUA 3VBOC 2DW4A 2PGGA 3RWNA 5K4LA 3L71H 3DL3A 1A32A 3IWZA 2ZE5A 4QKFA 1D4VB 5JSOA 4RHV3 5LEJA 5A9GA 4Z2AA 5FZKA 5FP3A 3NJZA 2VVEA 3N9MA 4LHKA 5D5PA 1Q8OA 5T5OA 2RDRA 2PN5A 4NHMA 3CEWA 3B94A 4NXNB 2XAFA 4TZDA 1HRV2 5KBFA 2DURA 4LK7A 3RZKA 4QPGB 1HLCA 2XAHA 4QX2A 4X6QB 2F4LA 4CDUA 4MO3M 3RS6A 3JAKB 5KXCA 1RUF2 3LOBA 1W6NB 3ZHVA 1CAXB 1BBT1 1WLTA 2QWNB 1ZA7A 2VCMA 1M5IA 3IDBB 1FJGB 1J84A 2BU9A 1LHNA 1NJIW 2W2IA 1XPWA 1WB7A 1B06A 1MR5A 2QQNA 4BW9A 2YPDA 1QU7A 3H7JA 1GZ9A 2FDFA 5IT9N 1O4YA 1HXS3 2WKKA 2WZR1 2QUOA 2IZWA 4FOQA 3JBG1 5KAFZ 1YTFD 2NNUA 1DIWA 5F5AA 3CO2A 4LHNA 5GTHZ 4LE4A 4LF4O 2D6KA 2XHBA 1UXZA 1F7YA 4EYUA 2DVAA 4XILA 4HK8A 1UU6A 3VZJA 1YJ9V 1W9TA 2XJPA 3NNLA 5C8YB 3T1YB 3B4SA 1XL6A 3ZN6B 5FYCA 2JG9B 4RHV2 2JK5C 1X82A 1IKPA 1I08A 3ABLC 4XJAA 2DWRA 3VBFC 3LDDA 3I2IA 2IBZH 2WT1A 1VQ7V 3EB7A 1K4DC 4CEWA 1RUI3 2WLIB 1R1ZA 2VQAA 4TV9B 3WT3A 4ES8A 3HIFA 2R1BA 3OSDA 4IEPA 4TSFG 1KEXA 1DYPA 1AR61 4FZ1A 3WDXA 2ZOEB 4BPZA 1WUVA 2EXHA 1UKGA 2W39A 1Q8PA 2JDHA 3OBTA 3OM3B 5F9TA 3OOXA 1OKOA 4OZOA 4MUVA 3I97A 2UXCB 4CDUC 3DV8A 4FJCC 4EN9B 5HXMA 4A3ZA 2W47A 3NJYA 2OQ6A 5C33A 1IS6A 4XETA 1OLRA 3OEHG 1CR7A 5LMUO 1DBNA 1H4HA 2WZPP 1UCXA 1VBD3 2LFRA 1RUC3 2GU9A 3H1WA 2WZR3 1PZ8A 4LF6O 3PUAA 1Q3EA 3HPLC 2QR4A 3AYAA 5FFOC 3UKNA 1KB9F 3IDCB 2GBOA 5FZ7A 2E31A 1AX2A 3UL2A 5JJJB 4I01A 2Y6GA 5J2UA 3L72H 5LY1A 3GBWA 2ARAA 4KNCA 1HDKA 2WYFA 1XREA 2D3RA 3K06A 2JX9A 4DR7B 1VQPV 1KXGA 4XJ8A 3RVYA 1BGYH 4IEOA 4LWSB 2WNVB 2R9AA 2Y0OA 1YQ5A 1ND2C 2QM7A 1LOAA 3VBRA 1EPWA 3CMGA 1PIV2 4LF7B 2B45X 3FWEA 3GJAA 5H9SA 3APBA 4LOTA 2ADPA 2D93A 4IV3B 3CE2A 1AI7A 4H44B 4IV1A 1QLEB 4DR1B 1AYN1 3PUIA 5LRSA 4I0XB 1SF9A 1B35A 4XF9A 1VRH3 5L19A 3H0OA 5GONA 3B7MA 3SH5A 1X59A 4UW3A 2HWB1 3VL9A 1CPMA 4JKMA 2BFUL 3VKOA 1LOFA 3QO8A 1LODA 2BFUS 4C1WA 4DR3B 1XU1A 2VGDA 3OPWA 2ADDA 3WG1A 1RHI2 1YXBA 1I0HA 2CH7B 1N36B 2UURA 1AJNA 1ZX3A 1CIYA 4Z82A 4QPGA 4QB1A 5C4WA 2VQFO 4CXWA 2YXYA 4Q0QA 3FKSG 1ENVA 4R50A 5A7WB 1NOVA 5CG8A 4DK1A 3C7FA 1I5XA 5C8CC 4RFT0 2GNBA 5BPXA 1XSRA 1SQVH 3NAPA 1WNSA 4LWSA 5A2QN 2YHJA 4NE9A 3W7UA 1LOCA 2H0VA 3BPZA 5CIRA 4NIIA 4MSWC 3H8OA 2X09A 1EFRG 1D2SA 1MQTB 2R32A 2ZPXA 3X2QB 4RYDA 4LFAB 4XABA 1LENA 1UYYA 4BOWA 3K77A 4JYAB 3ZN4A 2EULA 4LFBB 4YY3O 2RR13 1K5MB 5HI0A 3G7DA 3ZFEB 1RUG3 4CYDA 5BMVA 2PHLA 1H1MA 2DYRC 4YVWC 4W50A 2W08A 1DQ4A 2XVLA 1XNBA 3OGCC 2P3KA 2Q30A 1BL8A 4I50B 4RS5C 4TUYB 1JCHA 4LLOA 2HJDA 2DMXA 1YIJV 3RYHB 2YXLA 3JASA 5HFLA 4IE6A 5LL6Y 1IZ3A 2GHYA 2D98A 5J1XA 2UY8A 4PDWC 2EIGA 4GB32 5A1FA 2GN7A 1UNBA 1L7RA 3RZHA 4HPKB 1W0PA 2E75B 2YU2A 1PD3A 2ATFA 4AQSA 4BXSV 1KMIZ 1OD3A 2KB1A 4W6YA 5FREA 5L7OA 1HRV3 1S2KA 2XVKA 1W03A 3UK9A 4BHPA 1ASJ1 1DZQA 1TZOA 1IG0A 2R042 4AGVA 1EAH1 2VE1A 3DECA 1PZ9A 3QF7A 3CBNA 1ZUQA 1XQ8A 4CH4A 1CPNA 1QEXA 2VJXA 1AB3A 1IPJA 2YC0A 4F4LA 3VZMA 1REFA 4AQ2A 2VPVA 3ZHQA 3GJBA 1OVSA 1COWG 1FXKA 4CS3A 4IYHA 4Q4Y2 1S0DA 4UVBA 5F5IA 4XF3A 4URTA 1SFNA 1IS5A 1QNYA 4LBEC 4YSFA 4G2KA 4JYBA 3CNAA 4JGYC 2JENA 3ES1A 2LW7A 2V1DA 3WDWA 3O1PA 4E2LA 1R6KA 4UYBA 2D3OW 5KXEA 1MS4A 1T6GC 2IJHA 4AVBA 2XKOA 5EIBD 1N47A 4Q4X3 2WT2A 1QJZA 5G04L 4XAEA 1R091 1W8OA 4D8MA 2BJSA 1C5IA 5EZWA 1WPBA 3Q9OA 1GQGA 1VBE1 1B35C 2YC2A 5AG2A 2VQ0A 2OXBA 3AG1C 4IEQA 2HH9A 2VXJA 1Q8VA 1YIPA 3ZXJA 4ONUA 4AF9A 1RUNA 1QBZA 1XI1A 3WEZA 2V72A 4M4RA 4ZPIA 4UOJA 5LRRA 4FTSA 2E7AA 3H42B 1RPRA 4JZ2A 3RGBA 1LR5A 1DZRA 1QIQA 3BEHA 5LA9A 2VO5A 5EPAA 4QMAA 4UW4A 3I3EA 1US6A 4Q2FA 4LNUB 4LR3A 1PVC1 2IFRA 2UXBO 2SLIA 1U0AA 4H55A 3ZEDA 3JBG3 2X05A 2YSUB 5LHHA 5DEDA 1GR3A 2EA7A 2XT9A 4GX2A 5LEKA 1L0NH 3KV4A 2PQQA 2RS51 1NZCA 4JVAA 1PL0A 1PIV1 2R0FA 2YGLA 4QT6A 4W8JA 2K0GA 4UB6Z 5KUKA 1BEV2 3E35A 1JN2P 4F6RA 3VBHB 3UO3A 5BNPC 3ZVXA 2ZGMA 1V6IA 1SHWB 1C57A 3G6EV 2QM8A 5B1AB 3CIHA 1GP6A 2IM9A 4E8CA 2AW9A 1GP4A 3JCUZ 3E83A 5DXDA 4IE5A 1TGOA 3G80A 1VP6A 4KWUA 1AR81 2VCAA 5J09A 2QZ2A 3POGA 2VBDA 1K45A 1DQ6A 5IFTA 1QOTA 1G8MA 5IY5B 4ASUG 2BNMA 4XZPA 2DFCA 4B7EA 4LPLA 2QZ3A 1BMFG 4JTAB 2A3YA 2RS11 5K0UB 3SDLA 2CAUA 2EALA 1VBD1 3VZLA 4TLGA 3E2EA 4MT8A 3TETA 2DBIA 3O7OA 1VAMA 4EE2A 1COV2 5GLVA 1VQOV 2ITDC 2I74A 5FP7A 3NQHA 5FWJA 1W0KG 1WA8B 1DCSA 1FFXA 2ZNJA 3TEZA 1VQ8V 4TN7A 5FXWA 3ZSJA 4NTWA 2BVVA 1FKAO 3LNMB 3LSDA 1WN7A 4NXMB 5FQ0A 1BCXA 3NNFA 4W4KA 2VY0A 2JRIA 1S5HC 1IBMO 4LLFA 3TNPB 1KYOF 1NR1A 1KJRA 3C90A 5FYTA 1Q6UA 4FPOB 4MTOA 2Y69C 4UWDA 4YW3A 4B4PA 2XTAA 3AL6A 4YM1A 1PX4A 2XBO3 1DF5A 3UGHA 2B1IA 5A80A 4HONA 1F35A 2TUNA 3FBMA 1BCCH 3A4UA 4XC9A 2F4VO 4YGBA 3FX3A 1BHBA 2WSUA 3M7AA 3K4AA 4RQFA 1WMXA 3P1IA 3IAQA 3VHRA 1K5MC 1DQ5A 5CFDA 5CFCC 4L92A 3POFA 3J7LA 5J7MA 5IVBA 1S2EA 4R8CA 1Q6HA 2QKDA 3OGJA 1WZXA 5ACA1 3VBFB 2EX3A 2HWC2 5ABJB 4UFLA 2ZIOA 4B7KA 3ZFGA 2CTPA 5T52A 4OZXA 2Q7HA 4G4FA 2NR5A 4HVQA 5A3LA 1TG7A 4D6RA 1V70A 1BT8A 2PLV2 4XURA 2QTWB 3SYPA 2GMPA 3AYCA 4J6GA 2B39A 1C3HA 3P6BA 5HCHA 3WB1A 4AL9A 3ST7A 4X1IA 1EV13 3WHTA 4HAMA 2EINC 4KWKA 4FLWA 3RYHA 4FPKA 3E6CC 4X66B 4UF0A 3A21A 4MW8A 3J8F2 1MPXA 1YJNV 3MO4A 4Q4Y1 3PNAA 5FZOB 5A1LA 3KKYA 2B9UA 4RWUA 5DECA 3RFRA 2C24A 2BGCA 4K3AA 1RUOA 4TYSA 5K7PA 5IVVA 2A6VA 1BQPA 2HKXA 1A8DA 1AJOA 3OAAG 1K7DA 1UOFA 5BV6A 1Q5OA 1HN1A 4XJZA 1H8EG 4QPGC 4JI3O 1ASJ2 3WNMA 1Q7YW 3O1VA 1BK0A 1UPSA 2QTOA 1PO11 1S0FA 3ZIXA 5K8SA 1YLLA 1NCQC 5GZCA 1XNRO 4ZU4A 2CUGA 4N21A 1QJX2 1JUHA 3CRCA 1Y4MA 1FT9A 4GALA 5A6YA 4ZS2A 2HVKC 1R093 5D21A 1AUYA 1FI2A 1W05A 2YBSA 3I3BA 2AZ5A 4A7ZA 2Q68A 1KDKA 5LBBA 2Y48A 3W7TA 1UY3A 4R9DA 2XPJA 3AFKA 2HR3A 3CSXA 5CA3A 2JKBA 1GKFA 4M0NA 3KF5A 4JQRA 2ZGNA 3D8CA 4C0BA 3EHKA 4LTAA 2MHFA 1KU9A 4Q4X2 3LFIA 2QJ1A 3WSOA 1JU4A 5B3SC 4ISQA 4NPRA 3B40A 3VKFC 4IHJA 4CDWA 3DPRB 2RDQA 3VBHA 3O1OA 3ZMNA 5K9YA 3AG4C 1FMD1 2Z42A 4K35A 4B3MB 2LALA 2V4AA 2KKWA 5IK5A 2L9LA 4E8DA 1XUQA 1H2LA 4JX0A 4PBOA 4JAAA 4DV0B 4IL6Z 2BEOA 5KHJA 1CIWA 2JVDA 2W6JG 3LGRA 4XCBA 4XVHA 3WDTA 4D6TH 3DUIA 5JH7B 5CADA 1PKXA 2XHKA 2V4VA 2RM22 2JKXA 3CKHA 2MK3A 2WT0A 2GTSA 4JV4A 4UB8Z 1QQCA 2H6CA 3BB6A 4O2BA 4QE9A 3PL0A 1PO13 4CVUA 4C7UA 1M93A 4D7SA 1PNFA 3JAKA 2F23A 5KC5A 1H2SB 1F4HA 3OTFA 1HNXB 4HKOA 3H9AA 1AYM1 2QQLA 2RG4A 2HWC3 2WNUC 4YW2A 4FLZA 4CCMA 3U4XA 2CHHA 3E8HA 1Z7S1 4O61A 3AZYA 3H01A 1UYXA 3LDBA 5KMGA 2ZMNA 2EIDA 2GNMA 3RI8A 2HWE3 4Y5TA 5FJKA 3LOIA 5FK7A 3AZVA 3NKTA 1R3LC 1QWRA 1QJU1 1XYNA 4YHHB 2ZX0A 1N4CA 4P9JA 2JDPA 5EC2C 2Z0AA 2UU9B 2ILMA 4LUKA 1MS5A 4WFHA 3LCPA 3HQRA 1DGWA 4LF8O 4LF9O 2XUMA 2ADQB 2XWJB 5FY9A 3BA8A 4U2AA 2BSKA 1QJX3 3OT7A 3VDDA 4ZOLA 2JGUA 5EBWC 2P22C 1I9RA 2XR4A 1K92A 1HNZB 1Q8IA 1N33B 5E89A 4CDWB 3VUOA 3R4UA 4DR3O 1NLSA 1M9NA 1C8M1 4K8RB 2GC3A 2HG5C 1Z5VA 4TLFA 1ZREA 4P9GA 1YQ8A 1KKDA 2VMGA 2W95A 2W46A 1MSDA 4XJWA 5JLVA 4Y5SA 4JZGA 1UN1A 4DB5A 1LTEA 1BXHA 3OCPA 4HPKA 3UV9A 4GWMA 2JDYA 3GDBA 3S7EA 1X8EA 1FAYA 2E76B 4GJZA 5KMGB 1UZ0A 2HJIA 5KA6A 1ZRIA 3U78A 3D4KA 2JG8A 3HN1A 3AM2A 4DPNA 4FPHA 3CYOA 5IVFA 4JC1A 3L2HA 3ZYIB 3R65A 2ZTNA 4U7NA 2P3JA 3N7MA 4AR2A 2EJ7A 4FIPC 2ZMLA 5JDBA 4ET7A 1R1A2 1DG6A 5FXVA 3BN6A 4YFWA 3PHMA 3W20A 5DN2A 4BR6A 2P4VA 3KGLA 4DV0O 3K57A 3WUDA 2DUOA 3TEWA 1B6QA 4UCTA 3C7HA 3VBSB 1OA2A 4CU8A 2CH7A 3UCSC 3EQEA 3NNJA 1F5FA 2CTQA 1PM4A 5C9AC 5D8AC 4CSWA 2B8MA 2PHFA 3I8TA 1Q43A 4QQ2A 1S4CA 3SISA 4FQZA 4UCVA 2EAAA 2TBVA 1JPXA 3D36A 1LAJA 2XJVA 2UWCA 2Y69B 4GMP3 1RP3B 4QGNA 4CDXA 4Y22B 2WPDG 3MICA 1EUTA 4KUMA 3J4UH 1J95A 3BYWA 3IC7A 3J8F3 1E1QG 4QX8A 1FPOA 3RZZA 2YI9A 2A6WA 3S0MA 1UY4A 2HYXA 3LSQA 4N9HA 4YVSB 1BQ0A 5JXIA 4WM8B 3CL1A 1AYN3 1OVPA 1WBLA 5FMDA 3QH6A 3K2OA 4I3GA 4MXWA 5DABA 3ZYPA 1VBC3 4X1KB 2A6XA 1XMQO 1R64A 3PTRB 1Q8QA 1R081 4HNAB 4CEYB 1CPYA 4IGGA 1CN1A 1DLBA 4YGEA 4O9GA 3ASIA 2ATKC 5FZ3A 1AF9A 3I56V 3JU9A 3MGUA 2H6BA 2BTOA 1ZBE2 3UT5B 3FLTA 4AGGA 4A7YA 1ZZBA 1JFFB 5L3FA 3CZUA 3OGGA 3VV1A 3A0RA 4UW5A 4Y20A 1J5EB 1WCQA 1V55B 3FB5C 2OA2A 2XJTA 2J1VA 4QGMA 1BZWA 4LNUA 4JYAO 4CP9B 3ES4A 1O91A 4P9WA 4JI5O 4WM7A 4CE8A 4O4JA 2X53S 4JZRA 1Y6XA 4NKGB 1RVF1 3JASB 3CMAV 1S0VA 1UWWA 3RMXA 5IK4A 1SBFA 1UO9A 2K9ZA 3HJRA 1QGLA 2AYHA 2F6BA 2FB5A 1AR72 3IGAC 2GDFA 4Q0VA 2D2CB 5IUQA 3I3QA 2OVUA 3AG3B 1Q90D 1XE8A 2ZDIC 1ZA4A 2P17A 2ZR2A 1MA1A 4IV3A 4O4IB 1NG0A 1W2NA 3AG7A 3OUIA 3N9PA 3H8UA 5LOVB 5F6KA 1OI6A 4Y4YA 2VNOA 3ZFFB 4LXLA 4O4HA 1S77D 4BJ0A 2LRPA 3M70A 5FXXA 3ABMB 5T54A 3ZMUA 3U4SA 3PUHA 3HVDA 5CBHA 5BR8O 1GANA 5CA1B 4TXWA 5JMCA 1WLCA 2G38A 5LA6A 1OOPB 1H8TC 3ABTA 3GZUC 2W52A 4O2AA 3CJHB 1QVFU 2WDBA 4AVTA 3G71V 1UMHA 1PGL2 3THTA 1IQDC 1DDLA 1XOUA 3D36C 4X64O 3HQUA 3T08A 4BIFA 2IVIB 4IV3C 1EAH3 4DR2B 1A3KA 1E5SA 4EN0A 5FYVA 4IGOA 4S2GA 2R072 4CU7A 3T4DA 4LF4B 4HFSA 2CTWA 4OLLA 4R52A 4JGZC 4RSUA 1J1LA 4MG2A 1SBEA 1Z0HA 1GYKA 5B5EZ 5C6CA 2PAKA 4ZS3A 5M0TA 4OULA 1SRYA 4WBNA 5FPLA 1SCRA 2Q1FA 3SYQA 4MH0E 2IH3C 5A32B 4MLOA 1ZM1A 4BQ5A 2WZR2 2NMNA 3SJQC 3PJYA 4MS2A 4AI1A 2P3YA 1L7LA 3POWA 4FP2A 1R1BA 1CESA 4Q4X1 2ZACA 1Y4WA 3ZYFA 4QGPA 1FS0G 2DJVA 3ZXAC 4FPJA 3E8BA 5E1RA 5IYBO 3VZNA 3DGEA 2YICA 1ULEA 3E97A 3UGFA 4BDVB 4GZRB 3ZHTA 3Q4HB 3BTZA 1NXD1 3NV1A 5CBGA 4ZIBA 3CD6V 2R1DA 4DZGA 4YG0A 1JOPA 4ZY9A 4A44A 3HR0A 3WHUA 1EPZA 5FUPA 1VBA2 3ZR5A 2XQXA 1IPKA 1CZSA 3NKGA 2A5ZA 4EFEA 3F95A 3RVHA 4FXKB 3RDIA 4LF8B 3FYEB 3RYKA 4CBCA 1NTZH 2CGNA 1W6MB 4AFCA 1ND2A 1ZRRA 1CX4A 4I55B 5KXDA 4BMBA 4UV8A 4LCUC 4JKKA 1HR0B 3VQWA 5DDJ1 2Q73A 5CAZA 4X89A 2LS6A 2WFF2 5IATA 3SYCA 1JHJA 5D1IA 4AQYB 2P37A 4WFAV 3N27A 4FLVA 2Y6KA 5FY4A 3THCA 5JOWA 1VBB2 4PIYA 3ATGA 4KP4A 2ZMKA 5GLTA 5FPXA 5FY1A 1Y74A 3K75B 5DN6G 3H9VA 3W7SA 2G9FA 3ZPYA 2HWD3 1GM8A 1QNWA 5C8CB 1FV3A 3HQXA 2WA4A 3RBZA 3SPGA 2N04A 3IM0A 5CMUA 3LDKA 4ATFA 2VVFA 4YY3B 1SDWA 2A6YA 4TUYA 1OCOC 3VHOA 3E5QA 2D6PA 4XBNA 4KWLA 5FO7B 3ZLIA 5JOYA 5KC6A 4O9EA 3RZLA 2YU1A 1FXZA 4XF4A 2CL2A 3OJBA 5IJ9B 1WB8A 5BNOB 3MI8A 4OMDA 4EJRA 3OGSA 4GD4A 4WV8A 2ZZQA 4YWAA 3N9NA 1N8RW 2R0HA 3TBDA 4LBQD 3WINE 3RI9A 3H1MA 4PELA 4RD7A 2HWB3 1W99A 5FUIA 3NV2A 4IEVA 5EWSA 1SACA 1QHTA 1OQDA 4NPLA 5EJZB 4LO4B 4WVVA 3B8MA 1W8HA 5T3NA 1YQ6A 4DMIA 4COZA 3CCQV 1AHSA 4ZI7A 1ASJ3 2X5IC 1YQCA 2VRZA 2Y4UA 1NBMG 1JI6A 2R9IA 2QWQB 5I0UA 3CCJV 3V0AA 4KL1A 4GXLA 2O0OA 1D7PM 5IAVA 4OHYA 1OQEA 4HETA 3O65A 1UMIA 3LIHA 4Y22A 3ZYBA 2WAAA 1JYIA 3AEIA 1FXHA 1YUDA 2E7QA 4AZZA 2C9AA 4O7XA 4GQ7A 3RQ0A 1H0BA 1SLIA 4H0LB 2VMDA 3JATA 3TB0A 4JI3B 1XL4A 1AX0A 1XNAA 2WBKA 5CFCB 2Z5UA 2N74A 2YFZA 5FP8A 1CAVB 4J7ZA 3B93A 4DRXA 3W9AA 1GTOA 1RVF2 4I0AA 2FMLA 1GZWB 1XE0A 4QPIB 4X1YB 5HPOA 3H1KH 3GALA 4MGKE 3QH7A 1RITA 5GLZA 1AR71 3KGZA 4E4EA 1QOSA 3KT4A 1LESA 2AZ2A 4LFCO 3C8XA 1SQGA 1UZYA 2GZWA 5BNNB 5JAXA 2VOVA 1S72V 1K5QA 4JDMA 5L3DA 5LP6C 5IYDO 3WQ1A 1BLZA 3WNOA 4NWWA 2ARBA 4QHZA 2WYSA 3SHRA 2DU0A 5JZGC 2CWSA 4Q0PA 1YFWA 2R6QA 1QDCA 4YGCA 1W8ZA 2E53A 2PHTA 2W5FA 1UX6A 3S30A 1K33A 3GGLA 4I4TA 2VR4A 4EZHA 4Y20B 1GBGA 1DU3D 3USUB 3OBZA 2OT5A 2EZPA 4AQTA 4LBOA 1LNSA 1NTKH 2YY1A 4QXHA 3N3HA 1LHOA 4GB31 3SKJE 4HSJA 2XGXA 5K0UC 1H9PA 1SZBA 2J22A 1GNYA 3ZHUA 5KLVH 3USSA 2G9GA 1R3KC 4KG8A 3I7DA 1P4RA 3OTOO 3ASNC 1A78A 3NSTA 2GUZA 2GNTA 4AHCA 4KI5M 1EN6A 4RQPA 3KT1A 1SPPB 2QE7G 4CCDA 5DDJ2 2XHNA 3KB5A 4XDLA 3ZX6A 1NCQB 3AL5A 1K3EA 1KECA 4Z2WA 4LIVA 3IIAA 5LYJB 5B1AC 2GTAA 1D4M2 1NE4A 4B4RA 3GNEA 5IWAB 1WAZA 3AP5A 4LO6B 1QXJA 2ZABA 4AEKA 1MOFA 1LOEA 4YG6A 4GKKO 1KUQA 3GZTB 3VBBA 4CH5A 5GJ6A 4X8PA 3CX5F 5AFEA 3L2YA 2WLMA 5HCBA 2F1MA 4MGYE 1N1YA 3M8LA 4WVMA 3QO5A 1UYPA 4N43C 3DKWA 2ZJCA 4CA9A 2EIMC 4V2WA 2JS5A 2DYCA 1I5YA 2ZEXA 1D2QA 1ZBA2 1CP9A 1G9CA 4HVRA 5KHGA 4QX5A 3P30A 3BRCA 2PYJA 1DYKA 1RM1C 2ZINA 1UOBA 2A9HA 3WFVA 3BCWA 1SQ4A 4QX1A 3VDAA 3RWRD 2LROA 2EIKC 3SNMA 2PTMA 1OH4A 2QQKA 2QEXV 3ZYGA 3ZYJB 2FDHA 2VZRA 3H1LH 2VZUA 3M3QA 1EAH2 2Z79A 4DV4B 1W6OA 1VBB3 4CPBA 4AAPA 1APNA 4ZZ8A 4N53B 3PMEA 1C8M3 2K46A 5ABJC 4L87A 4B1LA 4DV3B 1VRBA 2Y6LA 1LU2A 2PYLA 1ZVFA 3PJQA 3ZX7A 2DV9A 3LA2A 5FMOS 2HWF2 5IYZA 2ZCEA 3KCXA 2IXIA 2CSGA 4RN5A 2X6CA 4NHXA 4OPHA 1GK9A 1WMEA 2W6IG 3J81N 3T30A 2QA4V 2VNRA 1BBT2 1LJ7A 2LUWA 1CGPA 2RQ6A 2RN9A 2HWD2 4JCKA 4CCOA 1LOBA 3GWKC 1NA1B 3VBRC 2ZE6A 4UBGA 3JCZA 3LNNA 2PELA 2NM1A 4X1IB 3N9QA 2XVGA 1R092 1UIJA 1UU4A 3ZHRA 1UPGA 2YUEA 1W2AX 3HR9A 5CFDC 2UWAA 1PVC3 4XF1A 2VECA 1K5MA 2PY5A 4INDA 4CUAA 2ZKOA 3R0RA 4V1PA 1BHGA 4N9IA 4Q26A 2QWPB 5F3IA 5DDJ3 2K9PA 3SGIA 3WUCA 2WWSA 2DN9A 4B3TB 1UF2C 1U5YA 3P3PA 2Q1MA 1MVEA 1EV11 1RPOA 3NJVA 4YXWG 5FZHA 5F7UA 1H2GA 3G6BA 4UXAA 5FTTC 1IDSA 1R73A 4DR7O 4Q4Y3 4HMZA 1JUIA 2QGNA 1TAEA 1FATA 5DM6V 5H9QA 1OLME 3WNPA 3MIFA 3MFAA 3SCGA 2YV8A 2ZKLA 2XAQA 2AGAA 1DGRN 1VALA 4E2GA 4LT5A 1UU5A 3KCCA 1RUI1 4N90A 3VBUB 3VQYA 1J59A 1RTVA 1NAEA 1K9MW 3K58A 2ZEYA 3J8F1 5H5NA 3SH4A 4XIKA 4Z1MG 1AR91 4C1XA 5FP4A 4XUNA 1Q81W 1N33O 1KS5A 4E4SA 2RMU1 2TNFA 4EWDA 5JPNB 3JB4C 3OY8A 1H6YA 3A2FA 4XZUG 4P5YA 4WVMB 1OUSA 1ENXA 1VQ4V 2RS52 4CZZA 2OCHA 3AB0A 3HPNA 1SFPA 5DPNA 4D7YA 1ZBA3 2O14A 2XBO2 5L9BA 4BU2A 1WLEA 2IXHA 1R083 2VG9A 3SQOA 4NIHA 4FTEA 3AZXA 1CAXA 3A7QA 2UXDO 1W9YA 3QG5A 2F17A 5ABJA 3IKWA 4DV3O 2A7AA 2ES3A 3VHPA 3UJOA 2QSAA 4BQ4A 3GYDA 4RR3B 3ZMVA 5FY8A 3USUA 4CS2A 2EIMB 1GN4A 1D0HA 5B2GB 5C3SA 4XQ4A 1EN5A 3UM7A 1MSWD 1GWMA 1VIBA 3T1HO 3POYA 4H7LA 4JI0O 5JOZA 3WB2A 4NXMO 5FIXA 2JDKA 5EXOA 1SLCA 1HNXO 4MTGA 3LSEA 2P5BA 4Q8LA 1DGWX 4NJ4A 4RUFA 3UETA 5T5PA 4CDWC 3DN7A 4GKYA 3MHZA 1QJY1 5EQUA 4ZU7A 3GCWA 1OOPA 5D5QA 4F7ZA 1O8SA 1I6XA 1QQP2 1IBKB 2XJUA 2RMU3 2H8PC 1DFQA 1GOGA 3VN4A 4PA9A 2HLDG 3WVJA 2JWPA 1GV9A 1W8FA 3AKTA 3ZN1A 3ASNB 4K7JA 3B02A 3FAVA 1J3RA 2VULA 5BYNA 5FCCA 2EXKA 1CAWB 2YG0A 1VBE3 2ORXA 5GZGA 2Q1ZB 2XL7A 4HXCA 2Y6JA 3CRAA 2W9XA 1NCQA 1RXGA 2J42A 2R062 3CHXA 4X8NA 1EZVH 2Q7GA 4P9IA 4FOVA 2YS8A 4IE4A 1NKGA 3QLQA 2Y4TA 1LNQA 1W04A 2HWF1 4WM8C 2Y0PA 3BCCH 2JIGA 1WCKA 4GMP0 1POQA 2EILB 3ETDA 1XNKA 1WJZA 1RC6A 1JZ4A 4UCSA 3J26N 1VF7A 5FZAA 1QKQA 2P3IA 1W6NA 3IZOA 4WFBV 4CDQA 5LHGA 1AL22 1JR9A 5LBQA 1UQXA 3OW2U 4ASKA 1C8NA 4FZ0A 1JVMA 4FK5C 4LE3A 5LP6B 4IEWA 5T5JA 4R8HA 1RYYA 1EBOA 1VMHA 4PT6A 2FBEA 2IU3A 4QPIA 1TVGA 3VDCA 4QNHB 1UOJA 3ZYHA 1H1AA 2UXBB 4NUBA 2OTJV 1YFXA 2X8KA 3BIEA 1PIV3 1G9BA 1S5LZ 5J36A 2DCYA 5AC92 2DF7A 4J25A 4H37A 4K3UA 1YF2A 3RYFA 2Q8EA 4B08A 3JBG2 1U5ZA 2A71A 1LHUA 1VF5B 1H2MA 3UO2A 5L73A 5CBLA 1HV0A 4ZHNA 2YROA 5ISLA 3K5MA 1AX1A 5F1RA 2FCVA 5BXXA 3K9SA 4IEYA 2WLHA 4MTFA 2HBTA 5A6XA 3APQA 1JW6A 4GH4C 1QHDA 4OI1A 5HFMA 3H7YA 2GC1A 4FCAA 3ZXKA 4J9YB 1OSGA 4LP8A 1DGSA 2ZQMA 4W4ZA 5FKBA 2HWF3 5FPZA 2W3JA 3M3CA 4XCAA 1FD9A 3NWKA 3PVOA 2E63A 3CXHF 3IMNA 2IJJA 2BGOA 3ZMOA 3DEMA 4Q4W1 4FM0A 4CUGA 2ZGRA 1QJX1 4M00A 1NT2B 3F7VC 1N1TA 5FL7G 2VWJA 3LA7A 3FB7C 4DRXB 5F2VO 1H4GA 2CV6A 1HKDA 2Q8VA 4K1ZA 2DCKA 4DR5O 3VKLA 1PX3A 2HHHO 4DV6O 2ORZA 3H1YA 3P3NA 1W2OA 3BKZA 3F5WC 1MS8A 3CJIB 4DR1O 5A7OA 4AI2A 5CKMA 5D8AA 4NRMA 3I2KA 1QLEC 4H3WA 1X7NA 1OA3A 1G6NA 1P7GA 3S5AA 3MAQA 1VIWB 1JZ6A 1E79G 3DYPA 3AMMA 1V6LA 1PM7A 2ARCA 3I2JA 4CC5A 2UXNA 1GFF2 1H2NA 4CXYA 4X9QA 1O3SA 3WB0A 2O8OA 4PA3A 4Z8BA 4XFCA 2UUBB 1NI8A 4LF5B 4Q27A 4CEWC 2WNVC 1V54B 4AVCA 5H2FZ 4XJ9A 1RXFA 3PN1A 3AXEA 3C2UA 1STMA 1KRIA 3WG7B 1PGSA 3PLQA 1QJY2 4FQ4A 4PV1B 2VAUA 1OXCA 4Q8KA 3ON7A 4GX5A 2ZKNA 1AL23 1W3VA 5H6RA 3V56A 2TEPA 1PPJH 1UX7A 4Q4W3 4QPYA 3VZOA 1ND3A 3KLSA 1V00A 4FOWA 4RL7A 4ICGA 1XNQO 1A8MA 4NHLA 1AYM2 5FLIA 1FFTB 1NZIA 1SQBH 1MABG 2WO7A 4RQPB 4LHSA 4W6XA 4HBNA 2FTKA 3NVCA 5FYBA 2YIBD 1B3QA 4YIOA 3E5XA 2GMMA 3T0AA 1JH5A 2ZGKA 4AQYO 3O1RA 3ILFA 2VNGA 1ND3B 1FOD2 3VD7A 1ND3C 2HWD1 4XUQA 3FYIB 4CDUB 3GWOA 4OUMA 4AG4A 4O65A 2OT7A 5A3WA 1YI7A 1HQLA 4D0QA 5EYPB 4M3CB 4QHOA 4XBQA 1UFIA 5FXZA 3LDEA 3LPGA 3ZKUA 4Y1ZA 2XG3A 3KQRA 1SEFA 3KF3A 4EZ4A 3MIBA 3JAWB 5L9VA 4CCEA 4AXOA 4UT5A 5FZLA 5A3MA 2BW8A 4AYUA 3IDAA 4CDQB 5SV8A 1LUVA 2JG9A 1PK6B 2YEVA 1MZFA 5HCFA 3S7IA 1AR73 2NLRA 3OPZA 4ZI7B 4FO9A 2YI8A 2VZ3A 3AK3A 5JJNB 4RGAA 4Y1XA 1NE6A 3AMNA 3UT5A 2R063 2VMEA 2DDUA 5FY5A 2BQPA 4XDPA 4DO2A 4D69A 3ZRWA 2Y64A 2FHRA 3MZHA 1NR7A 2J1SA 4J80A 3RPQA 1LUWA 1IBKO 2Y38A 4D6QA 1GRJA 1OF4A 1WW4A 2B4KA 4GCZA 1K34A 3J7MA 4QDSA 3CEIA 3PMSA 1H6XA 3VBHC 1CEZA 1N0NA 2AHYA 1PZ7A 3UGGA 3CJXA 3I5DA 3TN93 4MGQA 5FO8B 3OEEG 5IVCA 1ZX5A 2DTYA 4HK9A 1TA8A 4JV5O 4U3JA 2WQZC 2JDAA 5C7GA 1XEQA 2JECA 4JI0B 3QBQA 4Y1YA 1KITA 2R16A 2ZHLA 2CY6A 1ZAUA 1BYHA 4NXNO 3FUOA 1NY71 1W8WA 1YCIA 1H8VA 1YC61 2EINB 5FO9B 2MEV2 3RYCA 1YWKA 2VNVA 3E1F1 3E6DA 1XNDA 2UXCO 1ZZCA 4OVEA 2UXDB 4CCNA 2BSKB 2GV9A 2WLJA 4ORFA 2BOJA 4AI3A 1GN6A 1Z7S3 2JDZA 1W2TA 4W4LA 1IG3A 4S2HA 1PO22 5TSWA 4K0KO 4URAA 4J10A 5BR8B 1ONAA 4QAWA 4UUJC 2AZ0A 3AP6A 3V0BB 4MHRA 2VTXJ 2RMU2 1GLHA 2DUQA 2WNUA 3W5NA 3ZR6A 4COYA 2ZNIA 2FYUH 5GKAC 4A2UA 3JD2A 3LEGA 5FMOL 4PIXA 5CEHA 2B46X 4TOIA 4LMFA 2LTNA 4HLTA 4JTDB 4D7TA 3C7GA 3W59A 4BIOA 2HWB2 2YGMA 4K20A 1N32O 4O2AB 5LHIA 2BGPA 2IJIA 3VQXA 5C3QA 4MTXA 4A41A 3NV4A 3MBWA 3I55V 2QDOA 3MV11 3IFXA 4OI2A 3T0DA 2HKOA 4QKDA 4GB33 1P8JA 2RS32 4COVA 1YHQV 2OKXA 1QH7A 2JG8B 2EIBA 3K48A 3U10A 1JMKC 3AVSA 3AZZA 2VTXA 2X6AA 2DQ0A 1HW5A 4DV1O 4OMCA 5C4WC 4DRVA 3MFCA 3SEPA 1SESA 1TVKA 3JD1A 2OCCB 3ACHA 2YIDA 4XHBA 2EXIA 2OUHA 1K12A 1WP8A 2A6ZA 4PI2A 2CAVA 1RUD3 3UT0A 4R9CA 4XUOA 3RYFB 1VPHA 2J1RA 1AR4A 2ERFA 5F37A 3VQVA 1XILA 4KG0A 5JXGA 1K5SA 1XRUA 1JXNA 3RYRA 4NAMA 3SR2C 5CFDB 4F6RB 3PUSA 4IEXA 2ZHKA 2HP8A 4YJ2A 4JI2B 5FZ4A 3N2KA 2WWWA 3AK2A 1F23A 4I9QA 2Z3YA 3A8TA 1L1FA 5FZ8A 5E6HA 4JI6B 3UESA 3LAGA 2C6SA 3BPSA 1O9HA 5FZFA 1ULFA 5FKCA 4JI7B 3KS7A 5B4XA 3W21A 4BQWA 3NNGA 3JARA 4QQPA 1GP5A 2W0XA 2P2KA 5JPMB 1JHNA 5IJ9A 1HXS2 4QPWA 2WNOA 4WVWA 2BPA2 3CCEV 4WM7C 3OBRA 4A6OA 3WF4A 1SLBA 1BK1A 2CNAA 1IX9A 1HB1A 5LXTA 5LBCA 5FBJA 4AEDB 4CU6A 3RT3C 2ID4A 1L7QA 3G67A 1MQTC 2RM21 3BOWA 4HN1A 5KX5B 3N9OA 4JYCA 5C71A 3IN9A 1VBA1 5AVPA 1E57A 3CCMV 4QB2A 5FAXA 1S76D 4LITA 2BRTA 1XNCA 1W28A 5F3EA 5JZGA 1AR5A 1B09A 3ABMC 3B5LB 5E8AA 2Q8OA 2HEWF 2UU8A 2P1BA 4QHBA 3PIJA 2JIZG 3ZFGB 3MF6A 1U12A 2PAEA 3JCIA 2FDGA 5FLJA 2F4PA 3OUSA 4X62B 2QJVA 1W39A 2VQTA 4R6ZA 1MZ5A 5KHIA 1UAIA 3DYOA 5F2SA 4CP9A 1N34B 4DR4O 3CJIA 1UPIA 4GWNA 5FMCA 4LBKA 1LECA 1URXA 3WNXA 1L0LH 1LKNA 3Q8EA 5A6QA 4P9YA 1V6JA 5T5LA 3WXPA 1O59A 4IYIA 4NTYA 2Y0IA 4QB6A 5FK8A 4OUEA 2W92A 3QNEA 1GZCA 4GIQA 3CCRV 5GLWA 1WA6X 4Q0SA 3LSUA 4XUTA 5DAXA 3K08A 4MVTA 3UKTA 3NR7A 1FYJA 4AVVA 5GZEA 1K3IA 5FZMA 5GLUA 4DR5B 1H1IA 2ITCC 4Q4W2 3LSSA 4MGSA 1LEDA 4JDNA 3NAPB 2Q5ZA 1RFYA 3CU7A 1O4TA 2LGQA 5A1AA 3D3QA 3WF1A 5IYYA 3WD5A 3T2MA 2XMLA 2OS2A 1GWLA 2OIIA 1R1A3 2YB7A 4LBMA 2KG7A 5JUVA 3POBA 3ZFEA 1ENSA 4A42A 1PO21 3MLKA 1J83A 1AI6A 4OQ9A 3O1TA 3QACA 5JZGB 1PMIA 4FPGA 4H7MA 3TEXA 3A0KA 1ENQA 2OCCC 5DG1A 3CZJA 1VRH1 1QJEA 1IQAA 1ZWIC 3HT1A 3BHPA 3J9SA 2YMZA 5A33B 1XOYA 3FAVB 2LJ2A 4FM2A 4EB6B 1QR9A 1WMFA 3RW0A 4DQAA 4FI9A 3WQ7A 3PVBB 5L7OB 1D0GA 5GM0A 1PP9H 4YVWB 2DYRB 1FJGO 4J1WA 3ZFEC 5IE9A 1YYNA 3FZ3A 4I2OA 2DVBA 3HD8B 2VZVA 1VJ2A 1UW8A 3V65A 4FAHA 2XAJA 1LGNA 3QVNA 5FR3A 1GICA 4JGSA 1VMGA 4N53C 3K3NA 2RDCA 4UFHA 3JB8A 2JS3A 1KD7A 5LA1A 5FLXN 1QJY3 1KC8W 3OYWA 2BE3A 1GN2A 4GKJB 1DGLA 4NR1A 5FYIA 1IS4A 3A0BZ 1ZZ7A 1T6BX 2EIKB 2YEVB 3ILRA 3HNYM 1CX1A 4Q1RA 4DRRA 2X5IB 4QWNA 2E3CA 3URFA 1RM1B 4UFKA 5JI9A 4P9XA 3D0SA 4S2DA 3RSJA 2Q0OC 3LEMA 3IMMA 5JVDB 1RINA 2BBVA 2JE9A 3PU3A 1RIRA 1GNZA 2W68A 4TWTA 4RGKA 1EM1A 4BMEA 2RJKA 3L9JT 1UY0A 3UQ8A 2A3QA 1N34O 3CJIC 3P5BA 2X0LA 2HLEA 4BLIA 1S0JA 1LCLA 1C4RA 5L3EA 3K9AA 4X8AA 1ZBE1 3O0XA 2C9KA 3DXTA 3I54A 3K04A 3VD5A 2AUYA 2JE8A 2VOXA 4LBQA 1JA8A 4PLMA 4X62O 3SH3A 2WWJA 2VZQA 4PCRA 1LRHA 4J7KA 4AFAA 1JZ5A 1VBD2 1DYOA 2JEUA 2ZXQA 2D5HA 2G9ZA 4I0BA 2Z2SB 3CXCU 2AEYA 1Z5WA 3LEIA 1AJKA 1QVGU 1ULGA 1PK6A 4G28B 1YVWA 2MEV1 4J9ZB 4D6SA 1BSMA 2H0BA 2JIJA 3K3OA 1W6QA 4LH6A 3AKPA 1MVQA 2YZ4A 3KSCA 5FZGA 3KV6A 2QQOA 1PGW1 2PFWA 4JF3A 3CP1A 4CXXA 1VBA3 3RRDA 1W9SA 2K2SA 5C8CA 4CDQC 5J48A 4MZUA 1XMQB 5I0SA 2VW1A 1SFYA 3VKMA 3JXSA 5K1PA 3MPBA 5FPBA 2W1WA 1KD1W 2I07B 3GCXA 3SKVA 2J1UA 4PDWA 4AK3A 5JH7A 1QDOA 1NQTA 4OCTA 4KXRA 2WR9A 3SEEA 3JALB 2R073 2DFBA 1W0JG 3E8GA 3AZWA 4RS5A 1LOGA 4IT5A 2XDVA 1O7FA 1YHFA 3M4FA 3BTXA 1OV9A 2WA3A 2VOTA 2XKPA 3TWIA 4I55A 3O12A 4N7UA 1W06A 2WFPA 5KX5A 1D4M1 4B3RO 1QJFA 4BZ4A 1MS1A 2N7GA 4IHJB 3DPRA 4DW0A 2DVDA 2YXSA 1RUE2 2Q5TA 5B1NA 4YW7A 4MVRA 3FFQA 3K46A 4J1XA 2BTVC 3CCLV 4U3FH 3KV5A 3WDUA 1VE0A 2BTQA 1XJAA 1GSLA 4EKWA 2UUAO 3RYIB 1R6NA 2GAUA 1DHKB 1W59A 4WF9V 5A3NA 3ZN0A 1VQ6V 4ARYA 3WU2Z 4F3JA 2WJSA 4KMQA 2ZGOA 2NMOA 1O3TA 3GF6A 2R9RB 2D7FA 2CYFA 3WG7C 2JGDA 3SCHA 2QE3A 4NMIA 2VMIA 2ZGUA 4E27A 4BIZA 4PA6A 4WZFA 4LF5O 4KQ7A 1RJ7A 1CZTA 1TE1B 1CAUB 3ZSMA 1V9U2 3J7HA 2E6VA 1W6QB 1AZDA 1I5ZA 3K4DA 2XJQA 3WP4A 2X29A 1WD4A 4UW6A 2ZX1A 2QM4A 3HKEA 5JXJA 2N05A 4FSJA 4PBPA 5LATA 2VU9A 1PO12 5FYMA 1OHFA 3Q8FA 1YITV 3B3QE 1OLMA 1TUBA 5J2TB 3BABA 4AW7A 5BY1A 3RG0A 2AXTZ 4NRPA 2PMWB 3AG2B 3OTOB 3NO8A 1MEC2 2Q6AA 2XH6A 3GXUA 3K5LA 3KZ4C 3J80N 1VF6C 1OOPC 1ZL8A 2WL1A 4QXCA 1I5PA 2PXJA 5EYPA 5DUWA 1XMOB 5JQGB 5EIBC 3RNSA 1OF3A 1NU1H 2BV4A 1XBFA 3AP9A 1W8TA 2VL4A 3E22A 4HL0A 3TXQA 4DXZA 4DUYB 1NCRA 1YFUA 1K97A 1P84F 3G6JB 1FMD2 3S6PA 1ZLZA 2XBO1 3T4HB 4IW3A 3NL1A 3VBOB 3ZXGA 1I1EA 1SLAA 1RL3A 4XTMA 4IESA 3O0VA 1VMJA 2EVXA 3IT8A 4YHHO 1YQ2A 5B1BB 3QO7A 4U7OA 3NV3A 4DXSA 1Y3TA 5I93A 1AVMA 3CDZB 2I2SA 2RJZA 1US3A 3NXSA 4KH9A 2P7TC 2WO3A 2PHXA 1X4TA 4HG6B 1PHMA 4YYOA 4R7CA 1OCRC 1DF4A 2Q8DA 2C4XA 1LULA 4HZ3A 1XE7A 4LUMA 2D43A 5IVJA 1G4YB 1AVBA 1YO8A 4CH3A 1VBC1 2E7TA 3SLIA 1AR62 1W2UA 5I0TA 5J3UA 1NX9A 2ODMA 2QQVA 2ZHMA 4YGDA 5I0DA 2Y33A 1VB4A 1U5XA 5DAWA 1OCZB 1XYPA 4LKFA 3PURA 1OCCC 3PJSK 3M8AA 1VAKA 4DIQA 2ZXWC 2VMCA 4NB5A 1QJU2 2FD8A 5A70A 3FLRA 4LOSA 3WF2A 3ABZA 2XL9A 2ARXA 2R70A 4WZCA 5F2WA 1THZA 1EYBA 4OGQB 5I8YA 2GSYA 3MPPG 1LU1A 4K21A 4XEZA 4BB3A 3OGRA 1HNZO 2VZOA 1AROP 2NN4A 1TME1 4WFEA 3RZGA 1RVF3 4LO5B 5K1XA 1I94B 2QDRA 2VOKA 2VUDA 3V0BA 3POIA 3ENRA 4MVSA 3PVNA 1Q56A 2QWRB 3JQWA 5HCAA 4IGQA 5IY5C 4LF9B 4QX7A 1VBE2 4P9PA 1FXVA 4XFHA 1JZ7A 4FVMA 3O1MA 1ST8A 5LGNA 4HT1T 4Y3OA 4JGZB 1SZTA 4FFBA 3OR7C 3BIWE 4JKLA 1OQ1A 4GZ9A 1MG1A 1SC5B 2QTSA 3TAYA 5CISA 1A6CA 3B69A 3POEA 2J7MA 4YRDA 5H6QA 3OEBA 3RMYA 2HWC1 4KFMA 2BTQB 5FOBB 4OUSA 4K8XA 1AR63 3CCVV 1C1LA 4R4XA 3JARB 1RUE1 1V6MA 3FL7A 3N7KA 3WQBA 1ACCA 2J1EA 1HB2A 3VBUA 1NS1A 3SPJA 5AC91 1XYOA 2WWUA 4P9LA 1GM7A 1B04A 3L75H 3K3WA 1QJU3 5B4NA 3BU7A 4W65A 1KJLA 4MX3A 2Y26A 1YJKA 4YVSA 3T1CA 4IDZA 2WAMA 3K0GA 4FBFA 2VBBA 3VZKA 2R30A 3IIIA 1DLLA 4LJHA 5SV5A 4XMAA 3IB3A 3ACFA 3L74H 2VCBA 2VZTA 3ZSKA 4BLJA 3VD4A 4I3PA 4H14A 4LKDA 4A6SA 4Q0UA 5FBZA 1KP3A 2IC1A 3T4ZA 1ZZ6A 1HB3A 3EXAA 3GM8A 3AG3C 2HHHB 5EFUA 1M56B 4L9BA 2H94A 4X20B 4AHYA 5FZ9A 3ECQA 5L3CA 4IL7A 1MEC1 5LP6A 5E88A 4Z92B 1AR82 4TSVA 3AG2C 4LO7A 5DAQA 1VP7A 1OC1A 4N8MA 1IBLO 2JDMA 1PVC2 3IPVA 1ZTEA 2ZGTA 4WFGA 2VZPA 1RMU2 2Q8CA 5BUVA 5EJ3A 2RS33 1NCRB 1N36O 3MLJA 2Q7EA 4AEMA 2F66C 4XUPA 4EWEA 2D6NA 2D44A 2DYSB 3DC5A 1IBLB 2C0ZA 5TISZ 4P9OA 2WFF1 1QXPA 3FB6C 1YSCA 4PA7A 2R043 4YZ4A 4IUGA 3OFNG 4YVWA 3ZOIA 1XSQA 3VL8A 1IPSA 3N2GA 2KA3A 3VBUC 1MNGA 1QQP1 4JGYB 1YJWV 1NLQA 3HWJA 5EHDA 3WNKA 3ACIA 3ZBHA 2GALA 2CAZC 5DUXA 2WUHA 3IBMA 2DU1A 3U11A 1XNRB 3BAAA 4BW5A 1JYNA 2PI4A 2AEZA 3K59A 3VLBB 1IKQA 3TRSB 4MVUA 1RUJ2 3RJRA 2W91A 3MIGA 4QGLA 1QCEA 5EP9A 5BNOA 4DW1A 5C3PA 1DZTA 1BEV3 1F5JA 1F9KA 2WNUB 5FZBA 3U1XA 2WS92 1M90W 3SPHA 3EJKA 2EXJA 3B9IA 5J37A 2IXJA 2YXHA 1WKYA 4ARXA 3JZVA 3JAWA 4NVPA 2RNBA 4PDWB 4XDQA 4JTCB 2A70A 4META 5IWAO 1COV1 3IC9A 2JICA 2CTRA 1ZZ9A 4PD4F 1HRI3 1F4MA 3FLPA 3U07A 5JIAA 1SQQH 3VD9A 4R4ZA 2UUAB 1OA4A 3MW4A 1HR0O 5FY7A 3WW2A 2JB4A 2DVGA 5FYHA 1SKVA 2A0LA 1J58A 2WFF3 3GBFA 5EBMC 3MIHA 1SQFA 4XDOA 2XOKG 1NZ6A 3EO6A 3K03A 4XMIA 4AHWA 2DCJA 5C5TA 2D3PA 5FPRA 2RR11 4NN0A 1PL4A 1RUG2 4YJ3B 2ARHA 2FZ1A 4ZHQA 5IJ0B 2E5LB 2F43G 1RGSA 1S0BA 1F8VA 3M2MA 3FN9A 2C2AA 3CRQA 2Q4SA 4CH6A 4TQFA 1URFA 4BCUA 5CFCA 1S0EA 3UNPA 1F15A 2Z5WA 1SA0B 1OMIA 4CEWB 4PQ9A 1YRZA 1DTOA 2F4VB 5IVYA 5DG2A 1CVNA 1H9WA 4IEZA 1JZ8A 4GX0A 3V64A 3SJCC 2ZX4A 3T4VA 4JI5B 3MIEA 4BA6A 2MW2B 2X7RB 2WLPA 3THPA 3STLC 1GWKA 2PI5A 5IVEA 3SYAA 3HAGA 3OYWB 3AK1A 4LQRA 2IUWA 1V0AA 2PHWA 4CUCA 3EBRA 5FYZA 2EAKA 5LGUA 2B7YA 3AYEA 4JTNA 4GWIA 1OURA 4QM8A 2XNDG 3ZXFA 4LC1A 5F3GA 4DEVA 3TJTA 4K1YA 5KHHA 3CJHA 4AEDA 4AVAA 3WG4A 1T2XA 1SLTA 4DXWA 1RUJ3 4E4DX 5C5UA 4GJYA 4GT1A 5LK7B 4X6RB 5I8TA 3OB8A 1W2BU 1REEA 4HN0A 3WOGA 3GZAA 1CJPA 1ROPA 4X66O 5KUMA 4JI1O 4C8DA 1IOAA 2GSMB 1VR3A 2ZBJA 4DEQA 4AHXA 2YIAA 4QJFB 3KVAA 3ZO0B 3B9CA 1O3QA 3KCYA 5ITZB 2W1SA 2ZGQA 4OI4A 4PDVA 1O8PA 3N9LA 3AP7A 2NLJC 3RYPA 4NHYA 1TMF2 4KBZA 5AC93 5FUNA 4UCUA 2FDKA 2D6OX 4O4LB 5CVRA 3VDDB 3W58A 3CC2V 4O4JB 1XMOO 5A32A 3POJA 4I0WB 2EBOA 2RS12 3WX5A 3ZS8C 1C1FA 4JGZA 3I2GA 4QQHA 3BTYA 5HV0A 2CK3G 4DXTA 4LNVA 4PI0A 1PNLA 2MNGA 3ROUA 1MQTA 3D3IA 4PJ0Z 1TUBB 4EN6B 1WA4A 1O3RA 1GOHA 3JD72 1Y76A 5LBFA 4O4IA 2B5UA 1PVXA 5L7OC 3TN91 1IS3A 2WSSG 4WBBA 3IJ4A 4IERA 4L11A 3JD0A 2OZ6A 3RN4A 2F93B 3AX4A 3O5SA 1HX6A 4PIZA 2V09A 3CMEV 5F39A 3H1IH 3RVZA 4ABMA 3WP6A 2ZE7A 5FJHA 2ZAHA 3THOA 2OQ7A 3ZRWB 1W0NA 3HKBA 2RDNA 2P6HA 4LBJA 3H3UA 4COWA 1RHI3 1Y43B 3K79A 1UZWA 4FFBB 5APAA 3DPRC 4EFBA 2EILC 1GZTA 1OFNA 4FPFA 4CCKA 2LFSA 4J41A 4O2BB 1OD5A 4MVQA 2F95B 1UD1A 1G6UA 1E5RA 2K1EA 5EJ1B 1L8DA 3OMIB 4EB6A 1TME2 4C0HA 5CG9A 2FQPA 1GQHA 4BK4A 3GB7C 3FHAA 5B1OA 3BTAA 4YIPA 2AC1A 2FDJA 2WN2A 3SJBC 3ACLA 3KD4A 2RS13 3PIGA 1XQNA 4DV2B 4P5HA 4OHWA 5CKNA 1W90A 1TNFA 1RUC1 4B3MO 3ETEA 2WSVA 1S2BA 3EXUA 1Y76B 3VGIA 2ETNA 4L99A 4P00B 4C91A 3FD9A 5CA1A 4OX9O 1HP8A 2BVBA 1TEIA 2V5YA 4ZKTB 2A3WA 2BNOA 5DAPA 4QPJA 3F7YC 3EYPA 4K6BA 2QKAA 1O6UA 3K4ZA 3CB2A 2WLKA 5EK0A 1X8MA 1NH2D 4BM8A 3NMBA 4DFSA 4QIWF 1M56C 2YDEA 4B4QA 5IYZB 4CZSA 4IV1B 2JE7A 1W3XA 1VQ5V 1XNTA 1JOBA 5EZYB 5FDBA 2QKSA 4JI1B 5EC1C 1IVSA 2UYAA 2E9QA 1F31A 2NYYA 4PF5A 1ZRDA 2XASA 5J2UB 2HEVF 3M3IA 3OD4A 2AHZA 4LFCB 4P08A 1PO23 5E1AC 4ISRA 1C8M2 4XHXA 2Z69A 2HWE1 4GAZA 1FX5A 2JDUA 3HOBA 1H8HG 1PNGA 1P7BA 3C3TA 1WWYA 4YJ2B 3OG2A 4LBNA 2A06H 4NWVA 2KG7B 1JZ3A 4JPRA 1H38A 3KHCA 5IK8A 1FFXB 1D5NA 4YW4A 4JAUA 5A3TA 2E33A 1QMJA 3CC7V 4A7KA 3JYCA 1R6TA 1SBDA 4RQEA 5E79Z 1N3PA 2ADEA 4X64B 4MADA 1R3JC 2EZOA 1CJDA 1ULPA 3VD3A 3WCSA 4BWAA 2QNKA 2BP6A 2RM23 1CONA 3T09A 4DUYO 2OUJA 2ZA9A 2VOWA 3H3LA 3HMYA 3LEKA 2JB8A 1KBHA 1BQZA 2BBAA 2Z4FA 1JJOA 2WO2A 3I3MA 2CE4A 4NTXA 2PA7A 3AFGA 3RWKX 5L9RA 4LO8A 4XAAA 1GU3A 1Q6IA 4D94A 3RZJA 4JQTA 3ASOB 5CN0A 3ZXDA 3T3YA 2OYZA 3EMRA 2AH2A 4H2AA 4I9WA 3E89A 4YVSC 3CC4V 4PF1A 5LW9A 1QNMA 2ZM6B 3WF0A 4E2SA 3MYXA 2JEXA 4OPAA 4FM1A 1KDMA 4MXVA 4XJUA 5LA2A 4RGGA 5JSRA 3OEAA 3IPVB 3VBFA 3E22B 1M57C 4GLXA 4Y33A 3I2FA 3AK0A 3MHHC 3N35A 4QKBA 3RJ2X 3I3DA 4Q6GA 3DGTA 4RAIA 4Q5OA 4YM2A 4PDMA 5L3BA 5FZEA 3M3EA 3RYIA 5BNPA 1ODNA 3V0AB 1IBMB 3S3WA 2VWKA 5EIYB 2UYBA 5JI7A 2X5IA 3VBSC 3B8NA 5LB6A 1XDCA 5JVVA 4NPMA 1D2DA 3TNQA 1HXS1 1LGBA 1NCRC 1RB8G 1UZZA 5BNPB 1WMDA 3FFZA 1NQJA 1R082 1O4ZA 1AXYA 3NRUA 1EV12 3PUQA 2A7WA 2ETEA 2WLNA 4QX0A 4O4HB 2B9ZA 2YBPA 3CQOA 1A34A 5KR7A 5KXBA 4Q29A 4DS0A 4MW3A 5IAXA 3MHSC 5A7QA 4Q4V2 5L3GA 2PZSA 5L36A 4DXRA 3C7EA 1VMFA 4LBQB 4RHV1 1NYWA 5FZ6A 4FPPA 2Q69A 1VAVA 4BQ3A 1S3JA
chains in the Genus database with same CATH topology
2F4PA 1WD3A 2QJVA 1W39A 3M70A 5T54A 3U0ZA 1FPN1 4YZ1A 2E51A 2JJ6A 1GANA 3N36A 1MZ5A 5JMCA 5KHIA 1WLCA 3WW4A 3B00A 1OOPB 1RMU3 1H8TC 1WCDJ 5J96B 1UAIA 3GZUC 4L2NA 1D4M3 2W52A 1J3QA 3PTYA 3CJIA 1UPIA 2RR12 4GWNA 4EN8B 4LBKA 2D5FA 2B42B 4AVTA 1NLRA 1LECA 5H9RA 1PGL2 3THTA 1RUC2 1URXA 4K8FA 3WNXA 1DDLA 1LKNA 1ZBE3 1VRH2 4AEDC 2BNNA 4P9YA 4ZU5A 3WDYA 5A33A 3TYJA 1V6JA 4QXKA 5I0RA 5J98B 5T5LA 5DZFA 4BIFA 4B29A 2GNDA 3WXPA 4IV3C 1WW7A 2C5DA 4OI0A 3T1MA 2Y0IA 1UL9A 1EAH3 2ZGPA 3MF9A 1A3KA 5JOXA 1ENRA 2IXKA 5BY5A 4EN0A 1MS0A 4S2GA 1GZCA 3JUUA 4GIQA 2R072 1G7YA 1TME3 5GLWA 4Q0SA 1ZRFA 4ATEA 1NA1A 4HFSA 4XFAA 1ND2B 1G9FA 1QH6A 5IT6A 3AXDA 4MVTA 3UKTA 3V17A 4OLLA 4AVVA 2QQPA 4R52A 5GZEA 4JGZC 4L8QA 4RSUA 2A3XA 1J1LA 5GLUA 1SBEA 1Z0HA 1GZWA 1POV1 4CEYC 4EV0A 1GYKA 1H1IA 3ME2A 5C6CA 2PAKA 1RUF3 4Q4W2 4OULA 1LEDA 4JDNA 3A0NA 3NAPB 1SCRA 3CU7A 4OHZA 1O4TA 4MH0E 4FPLA 5A32B 4MLOA 3WD5A 1NY72 3FBYA 1MACA 1ZM1A 2WZR2 4HSLA 4KGQA 4XF0A 2NMNA 2OIIA 2GH8A 1R1A3 3PJYA 4AI1A 4LBMA 1Y7BA 2OPKA 2QCSB 1RJ8A 1HV1A 3POWA 4FP2A 1CESA 3ZFEA 4N43A 4Q4X1 3KT7A 4XXPA 1ENSA 2ZACA 1PO21 3MLKA 4LA3A 3QACA 4AFBA 4IETA 5LK5A 5JZGB 3ZXAC 1PMIA 4FPJA 5I91A 2KXLA 5E1RA 4FPGA 3CF6E 4H7MA 4W6WA 3QD6A 1YFYA 3A0KA 2MPFA 1PGW2 3VZNA 1ENQA 4CVYA 2ZZJA 5DG1A 1ULEA 1VRH1 3E97A 3POSA 1LB2A 4MYEA 1IQAA 3M1HA 1BKZA 1FV2A 3HT1A 4D3WA 1NXD1 3NV1A 4GKXA 3FUQA 4PJYA 4F83A 3J9SA 3OF1A 1VB2A 2YMZA 5A33B 3HT2A 4DY3A 3ZXEA 1L3JA 2RE9A 2R1DA 1EY2A 4XOGA 4DZGA 1V9U3 1LEMA 4YG0A 4RS5B 1WMFA 1OPMA 2VH9A 3WHUA 4CP0A 1EPZA 4QD2A 1TNRA 1YXWA 1Z78A 2IWGB 2DTWA 4DQAA 3WQ7A 1VBA2 3MDPA 3PVBB 4UBHA 5L7OB 1IPKA 4QPIC 3NKGA 4FT8A 1D0GA 2A5ZA 4CEYA 5GM0A 4FXKB 4CP2A 4YVWB 3RDIA 4RQPC 3RYKA 4J1WA 2CGNA 1W6MB 2RJLA 3ZFEC 4AFCA 1ND2A 4E9KA 3WLUA 1TMF1 3ZSLA 3WV6A 1DQ0A 1ZRRA 1CX4A 3LB9A 4CWDA 4AFMA 1YYNA 3FZ3A 5KXDA 4I2OA 2DVBA 4CDXC 1JOJA 4BMBA 3HD8B 5KEUA 4OHVA 1VZ5A 4XPVA 5DDJ1 2JD4A 1FNYA 3I59A 4LEJA 2D97A 1FMD3 1G86A 1VJ2A 1UW8A 3V65A 4FAHA 1GNHA 1QF3A 3AMHA 4YZ5A 1LGNA 1ULCA 5CAZA 1CD3G 2WFF2 1FOD1 5D1IA 4XXAA 2P37A 1GICA 2UY9A 2ZX2A 5JOWA 1VBB2 2GH2A 4PIYA 3ATGA 4N53C 4KBBA 2ZMKA 4YFZA 4YG3A 3INAA 3JB8A 3ZSEA 1KD7A 5GLTA 5FPXA 4NOTA 4MXWB 3VBOC 1QJY3 2ET7A 3OYWA 3WG2A 2G9FA 3RWNA 4M3CF 3ZDSA 3ZPYA 2HWD3 3DL3A 3IWZA 5F6LB 3E5UA 1DGLA 4NR1A 1IS4A 1ZZ7A 3QCWA 1QNWA 5C8CB 1FV3A 1DS0A 1LOFC 1OIJA