3OD4A

Crystal structure of factor inhibiting hif-1 alpha complexed with inhibitor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
342
structure length
342
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Factor Inhibiting HIF-1 Alpha Complexed with Inhibitor
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
total genus 105
structure length 342
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3od4A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3od4A01
2ILMA 2Y0IA 4JAAA 2CGOA 2XUMA 1YCIA 4B7EA 2YC0A 4Z1VA 2WA4A 1MZEA 1H2NA 1H2KA 3D8CA 2YDEA 1H2LA 3P3PA 2W0XA 5JWPA 1H2MA 3KCXA 3OD4A 2WA3A 4Z2WA 3KCYA 1IZ3A 4QU2A 4BIOA 1MZFA 3P3NA 4AI8A 4B7KA 2CGNA 4NR1A
chains in the Genus database with same CATH superfamily
4PI2A 4QM8A 4A3XA 4PLMA 4EKWA 1W0KG 3JU9A 2TNFA 5LZ6A 4XIOA 3JALB 3J7HA 2KG7A 1TMF3 1NCRC 1GTOA 1VQ5V 3BPSA 5GTIZ 5EXOA 3VL9A 5HCAA 3PVOA 4RFRB 4TSVA 2KKWA 4BM8A 1OCCB 1GP5A 3WF0A 4EWDA 2ITCC 3D3IA 5FYUA 2VW2A 1YSCA 1UXXX 1X33A 1FKAO 4I55B 3UT5A 2FHRA 5BPXA 3G7DA 4CH5A 3AM2A 1AL22 4XQWA 3ILFA 1RJ8A 5F3EA 1HKDA 1N8RW 2VQ0A 1I5XA 3EHBB 2E63A 1SS3A 3AMQA 4QQ2A 4HPKB 5KHKA 1KFXL 5FAXA 5CBGA 3TN92 1PPJH 2C4XA 1E5RA 5HV4A 1VLNA 3OW2U 1MQTB 1LCLA 2N7GA 3K2OA 3DSQA 3PMEA 3H8XA 1W28A 3ES4A 4DY5A 1UXZA 3CSXA 2ZEWA 3QTCA 4TYSA 4DUZO 4UW6A 4HANA 3AG2B 4Q5OA 4XQDA 2EULA 4OULA 3S6PA 1SFPA 3AP7A 3D8CA 2ZDIC 1YHFA 1ZSPA 4IEWA 3KT7A 1UZ0A 3OEBA 4QPGB 1K33A 5FZ6A 1XBFA 2TUNA 3O1UA 1NY71 1MEC2 1W8HA 2W95A 1JJOA 3ZYFA 4FT8A 3MIDA 2XXZA 2UWBA 1YO8A 1KC8W 1X59A 2KXLA 5FLJA 2YC2A 3I54A 2CUGA 1TMF1 3OJBA 4OXSA 3K46A 4DRVA 1Q6UA 1W06A 4DV1B 1OCOB 3AG1B 4PCRA 3MHHC 1AX2A 2EIBA 4AI8A 4K0KB 1VQOV 5FUIA 3AVSA 1DYOA 4HL0A 1SCRA 2GH2A 3RYHB 3I7DA 3LSSA 3CEWA 1XQ8A 1R3JC 4XBQA 1QR8A 4V1PA 1QJFA 3HPNA 4QX5A 1RXFA 1KQRA 4YVWC 3BA8A 3ZN5A 4FTBA 5H6RA 2WN2A 1I5PA 5K9YA 3PJQA 2YB7A 4D6RA 1Y74B 1KJRA 1OQ1A 3IT8A 1RUD1 2DW4A 2W1UA 1O3SA 5C3SA 4M4PA 4IV3B 3LDKA 4YXWG 2D5HA 4GIQA 5CEHA 3P30A 2E74B 2C1FA 4XJAA 2DN9A 5B1AC 4RQPC 3QO7A 2AHZA 2W87A 1DQ1A 1QWRA 4W6YA 4BIOA 2MPFA 1PM9A 2XWBB 4LWSA 3BGAA 3RZGA 3JD4A 3ELNA 1NT0A 1QJY2 2J22A 1F9KA 1ZRFA 1F51A 5K8SA 3LAGA 1J3PA 2CY6A 3KM5A 5TSWA 2Y34A 4YVSA 1WN7A 4ZXEA 5LP6A 2QQKA 5BY1A 4QPJA 3CC2V 5A7PA 1UZYA 2ZXQA 3M99B 1OXCA 5FR3A 1ZZ9A 3U4SA 1CAWA 3QLQA 1SZTA 2YZ4A 2R49A 1GK9A 4P9JA 1Z0HA 2VE1A 2KSDA 4CRQA 4IE4A 2XJVA 5LMUB 1UCXA 1TUBB 1RGSA 1UOBA 3KS7A 4MVZA 2P06A 3ZFFA 1UX7A 4NIGA 2P6JA 4GJZA 5LY2A 4DV1O 1RUC3 4URAA 3WSOA 3T4VA 2AZ2A 1OKOA 2HWD1 4BU2A 1XHZA 3RZHA 4HVQA 4DO0A 4UB8Z 5B1NA 1FPN2 2HYKA 2Y6FA 3WP4A 3EB7A 2WT0A 2C9KA 2ZZJA 2EIJB 2BOCC 2BZDA 3OE7G 3GBWA 2EILC 4LBOA 4UCRA 5AVAA 3T1HO 4QX1A 1XMOB 3T4ZA 2BTVC 1IOAA 3RYHA 5C93A 2HBTA 3K5MA 4CDWB 2NLJC 1RSOB 5BNPC 1JOYA 2LM3A 2R7EB 4BE3A 3BN6A 1TEIA 1J5EB 4WVWA 2BFUL 1K97A 2YC0A 3FYIB 2WAOA 4ZPIA 4BQXA 3JD72 2EICA 4BMEA 5FZ3A 4BXFA 1EY2A 2YC4A 1RUJ1 1QMJA 4HNAA 1N36B 2CSGA 3H1LH 2Z5UA 2Q8OA 2ZACA 4TN7A 1JFFB 2QQMA 2X53S 1V6JA 4F4LA 3J4UH 3FN9A 5C8YA 4DUZB 3RNSA 1HDJA 2DU1A 3FHIB 4JGZA 1D2DA 3VOUA 4YNIA 2VW0A 3FHAA 4ZONA 2BTQB 1H1MA 1H2NA 4MLOA 1O3QA 5FXWA 3X2QC 1SC5B 5T5PA 2HWD3 4O4LB 2ZS6B 2LQTA 3HKEA 4PLOA 2XDVA 3P3NA 3KV4A 4ZY9A 4QIWF 3ZMTA 1F5JA 4XXPA 4CEWB 4IESA 2DU0A 4JAVA 3VN4A 3VHOA 1LEDA 5ACA3 1GAXA 2JDKA 2JXAA 4X62B 4DUYB 1SLTA 5KXCA 4OI2A 1Q8OA 2WLKA 3BU7A 4NO4A 1EV13 1F15A 1E1QG 4QDQA 4BYYA 4FZ0A 1QQP1 4J9YB 4IV3A 2JWPA 4R9BA 1QJX2 3SJAC 4JX0A 4EEQA 5FNVA 1DZRA 3BALA 5A80A 4LBQB 4YM0A 3N36A 2GMEA 2QDNA 1ZNPA 3JALA 1YJNV 2WZR2 3A21A 1RC6A 4LP8A 1IS6A 3NAPA 5BY5A 1H2MA 2IFWA 1Y4WA 3EFFK 2YEVA 3OY8B 1M06G 1I3HA 5F37A 1NTZH 1QCEA 4QKBA 1UOFA 2BOBC 4RGGA 4JQRA 1I1EA 4DV5O 1PGL1 2VR4A 3OCPA 3RG0A 5C9AB 3Q4HB 1JZ6A 4WBNB 5FK7A 4O4JA 1NVPB 1XI1A 5JAXA 4WFAV 3F7YC 5IJ9B 1JN2P 2OUHA 3KHBA 4DXRA 1R3KC 4PA3A 3QBQA 4K21A 4XZPA 3IMNA 1TUBA 2AGSA 4DV2O 3B09A 5EHDA 3HKDA 3G4SV 3GBFA 1VMGA 4JI8B 1UD1A 1O9GA 4NROA 2H0VA 4X65O 3WQ7A 3VKMA 2GH8A 4R8CA 1OUSA 1TVGA 3ABKC 1BKZA 4HAMA 4ZKTB 1FPN3 2DFCA 4U3FH 2FQPA 2MK3A 4OHYA 2JDYA 1AROP 2EJRA 2QDRA 5ACA1 4CS2A 1OHFA 3N3HA 4DXSA 2VOWA 4QX2A 2UWCA 3HN1A 1XNAA 5FO7B 3N7MA 3KT4A 4YZ3A 4BHPA 4MGTA 1QQP3 3MF9A 4EN0A 3DL3A 2WAAA 5BNOC 4SLIA 2UXNA 2QVSB 3THDA 1VF7A 2XNDG 3M3QA 5IT9N 3AKQA 3GCXA 1JZ2A 1P7GA 4HG6B 1H6XA 2PHRA 1VQ7V 2UXBB 2W47A 1KDMA 4N43A 5T55A 1A78A 4EROA 1H2KA 4XYXA 4GWNA 4Y5Z0 4IEXA 3ZYRA 2XLAA 5I93A 5CG8A 4NTYA 5JIUA 5A6YA 2CTRA 1VBB3 5DDJ1 2BBAA 2E33A 1N3QA 2ZQMA 4I55A 2XLFA 2C6SA 3RZJA 4UF0B 3DYMA 3QOPA 3ZXDA 3OUIA 3LDEA 2BU9A 5L36A 3EMRA 4W4KA 3IKWA 3W7SA 1V0AA 3DUIA 3HQXA 3CCLV 3BTXA 5B3SB 1NXD1 3HR9A 4RO2A 1WUVA 1PGL2 4CDUA 3K9SA 4YY3B 2GC3A 5F5QA 5J1XA 1DYKA 4TZDA 2ZOEB 2YS8A 1QU0A 4Y4RA 1K73W 4AEDC 5GLUA 2AENA 4QPKA 4JI8O 1XE8A 3JUUA 1JBCA 3N27A 1SEFA 3UNPA 4GX2A 2XGXA 3JD1A 4Q4V3 1A3KA 1S77D 1LHVA 1TE1B 3X2QB 3ZFEB 5J48A 1JH5A 3A7QA 3FD9A 4UV9A 1GKFA 1ZBE3 1OSGA 5T3NA 2VUDA 4UOJA 4BQYA 1W6OB 2KM2A 4KG0A 5B66Z 5EYPB 5F9TA 1S0VA 3TGUH 1RUNA 3K5OA 1LAJA 4YW1A 1H8VA 1ZZ8A 1DLLA 1RUF3 4WVZA 4JGZC 1VBA2 3THPA 5KLVH 1AI6A 5HBAA 3WG7C 4QKNA 3VKLA 2F4VO 1H8TC 2VQAA 5BZBA 1D4M3 4X66O 1JI6A 1W39A 5JVDB 1J3RA 3ZS8C 2UXCB 5FMCA 4CH3A 4K8XA 5JZGA 4LF6B 5HPOA 1G9CA 5FPLA 3KD4A 3K08A 5C8CA 4IGGA 2Y48A 2VCCA 1P8JA 5JXJA 1CX1A 3B7MA 4JAAA 1D4VB 2VZ3A 1F23A 5EQUA 3IC9A 3ETPA 4UFHA 5T54A 3L2HA 2UUCB 2WWSA 2ZIOA 4CEYA 4DY3A 1UOJA 2ZABA 2DWRA 1OPMA 2JKBA 5E6HA 2QQJA 2ZGLA 3RYIA 2RS51 3CRQA 4LR3A 1YDXA 2VVEA 5EC2C 2GALA 5FZLA 4K3UA 5F5IA 4A45A 2VBBA 4KP4A 4BQWA 4DR3O 5FYIA 1PVC1 2BJSA 2NNUA 2FDIA 1LENA 1AB3A 3NKTA 4LA3A 4XMIA 3W20A 3J7AU 5FMDA 4MADA 2RCVA 3KQRA 3AKRA 2J7MA 1JU3A 2RM22 2JE7A 4WM8B 5FZ4A 3RW0A 5B1AB 4M3CF 4RQPB 1UPSA 5DABA 1X7NA 5ABJC 2CK3G 3NNGA 5JXGA 1MS9A 1EV12 4L97A 4FFHA 2P5BA 2ADDA 1DF4A 2QKDA 4XETA 1V6OA 2I45A 1S5JA 2JG8B 2Q30A 5IY5B 2FBEA 3P6BA 5FY5A 5BUVA 2PHUA 2B1GA 3LDDA 2RE9A 1YI9A 5BYNA 1JZ8A 2K1EA 5I8YA 4CU6A 4ZBMA 5LK7B 5ANQA 1GSLA 4IXLA 2DVAA 1OC1A 2JS3A 3MLJA 2BNMA 2ZJCA 4JI5B 4Q0PA 4Z2AA 1XNQB 3S0MA 4IHJB 4I4TA 1OCOC 4Y26A 2RDSA 5FUPA 3HEIA 4WM8A 2D6MA 3B4SA 3BU0A 4JDMA 3U11A 2X5IB 5BNNC 2WA4A 5JCOA 1PZ8A 3UESA 4NTWA 4QQOA 2LO1A 1VARA 3SJBC 2IJJA 3VQXA 4TV9A 1YIJV 3O7OA 3HJRA 4BQ3A 3OFNG 5C3RA 2GC1A 1XNQO 3RQ0A 1HLCA 1CESA 5ANNA 3HPLC 1DHKB 1LU2A 5CBHA 4DR2B 3WF1A 3ZMNA 3G6BA 2ZM6B 4I01A 4LLFA 4M0HA 1DQ0A 2ZXWB 4L9BA 1IDSA 3QO8A 4YJ2A 4U2AA 4D8MA 3AG1C 2VMGA 4P02B 1W9SA 1NLSA 5FPAA 5C5TA 5JWPA 1POV1 4UV8A 1S0CA 1DF0A 1GICA 1O8PA 3ALQA 3WG2A 5HXVA 1U5YA 1MQTC 2EINB 2IBZH 1NCQB 3E8FA 4CDUC 1G8MA 4LF5B 3A2FA 1UY1A 1U96A 1OF4A 1KQSU 1DLBA 5CA1A 5GKAC 2VRZA 4FAHA 3SYCA 3VBSB 3UKNA 2F17A 4TWKA 5FXXA 5LYJB 5F2VO 1OQDA 2XAQA 3ZOIA 1YJWV 4XJ9A 1VF6A 3QF7A 5LATA 2RS13 5B2GB 1AVBA 3I97A 3F95A 3IPVA 2W6JG 2WABA 2WBKA 2Q1MA 1AYN2 2D98A 1OLME 3QNEA 2Q0AA 2Z79A 3RYIB 2O8OA 3A0BZ 1S2BA 3C7EA 4ASLA 4B3TB 5A9GA 1FD9A 2E26A 1YQ6A 4DS0A 1SQGA 4UBHA 1DGRA 2KR2A 1RFYA 3B2EE 4PIYA 1U0AA 1S3JA 4RFT0 1HX6A 4QAWA 4XHXA 1CAVB 1RB8G 2XJUA 1QHDA 2OWOA 1MS5A 5A3MA 4DV7O 2JE9A 3ASNC 2V1DA 3HIFA 5A2QN 3OBRA 2D6PA 4FLVA 1XBLA 1P7BA 1XNTA 2WO7A 1QVGU 4YZ4A 2A70A 2VCBA 4NXMB 4DV3B 3JAWB 3N2GA 1IG0A 2MEV2 3ROUA 1PO22 4M3CB 3IIIA 4PDWA 3D36C 1X50A 2ZEZA 3E86A 1UO9A 3RI8A 4GWJA 2BFUS 2Y6JA 1SKVA 2YXLA 5B4XA 4LFBO 2FMLA 2GNBA 2GHYA 3JB4C 1VB4A 1O59A 3ABTA 2JEMA 4OPAA 3VBOB 2QTSA 5KUKA 5D8AC 1EN4A 3H1MA 4DR7O 2VL4A 3DYOA 4H33A 5J36A 2Y6HA 5L7OA 1BHAA 4PV1B 1AXYA 4YWAA 3HT1A 2DYSC 2A3YA 1HNZO 4LO7A 3S5QA 3E8HA 3MZHA 3WF4A 5J96B 1ZVFA 3H1HH 2YSUB 3I3MA 2Y38A 3JYCA 2NM1A 5FY1A 5BNPA 1Y9QA 2HVJC 2RS32 3U0ZA 2HWF2 4PF1A 2X6BA 4CC5A 4D94A 5JJEB 3USUA 1FT9A 1UMIA 3K75B 1BBT1 4IEUA 1ZZ7A 4IEOA 4UF0A 3T0BA 4A44A 1I7FA 3SC7X 1W8FA 4OHVA 1XHXA 3RYFA 1K9MW 1BK0A 4JI1O 4X6RB 4EZ4A 4CXWA 1S0EA 4KBBA 5FUNA 4CCMA 5KA6A 4NXNO 1BGYH 2JIZG 5FBJA 3VBSC 4WZFA 3KT1A 3ST7A 5FPZA 3JAKA 3CB2A 3T08A 4JC1A 4DIQA 5C7GA 5B5EZ 4QB1A 2QDOA 4JV5B 2Q7GA 4NB5A 3J80N 1Q7YW 2LGWA 2X09A 1W0OA 2CGPA 1CD3G 3KCXA 5J7MA 3JD71 1ND2A 5FZ1A 2VO5A 3HNYM 2HEWF 2XAGA 4LFAO 4TLFA 1OA4A 3FBYA 3FLRA 1PGSA 4MG2A 3AXDA 1H9PA 3S57A 2QTOA 5IK4A 4MS2A 3IDCB 5EJ1B 4GKKO 2CDOA 5M0TA 3WP5A 4BWOA 4B1MA 1RUE1 4FQZA 1NA1C 3I8TA 1AJKA 2XUEA 4FFBB 4YGDA 1RUH3 4PLNA 4YHHO 1TG7A 3CL1A 1R1ZA 3FL7A 1R6TA 2XJPA 2PELA 5FL7G 2H8PC 1Q3EA 1XNKA 3O1TA 3I2OA 1YTFB 3RVZA 5H9CA 4BLIA 2YIBA 1OH3A 1R1A2 4P9IA 1SETA 1BBT3 2VUJA 2VXRA 1VBD2 1LHNA 1NCRB 4B7EA 5JOXA 1Z7S1 4D3WA 1HDKA 5K7PA 4OYUA 3VL8A 2AZ5A 1JZ3A 1NYWA 1GYKA 3LNMB 5KHJA 1PNFA 4GJYA 1GN6A 2Y33A 3N9OA 3RYFB 3ZX7A 4HKOA 4O4LA 1YVWA 1PNMA 4FPJA 2B9ZA 4DW0A 4CP0A 2YG0A 1SFYA 3LZZA 3WR0A 1VQ8V 5LCWL 4YZ2A 2IVIB 2UURA 3CC4V 4B3TO 5CZKA 3ZN6B 5APAA 3D6EA 4R50A 3NRUA 4ONUA 2FDJA 1YXBA 2RS33 1AL0G 2OCHA 2FCVA 4MGIE 1APNA 2PTMA 2XQXA 2WWUA 2W0FC 1UIKA 4B4PA 2QWOB 4NIAA 1LGNA 3IDBB 4HN1A 4MTFA 1CPMA 4LNVA 1QJU1 1NZIA 2WR9A 1HR0O 2A3WA 3OR7C 1XMOO 4LT5A 5ITZA 2LTNA 3VDDA 3I56V 2A3QA 4RSUA 2QWRB 3I59A 2XONA 1I94B 1BEV1 3ZN4A 1H6YA 4JI4O 1G9AA 5A1AA 5FP3A 4X8AA 1WLCA 3AJZA 1RMU1 4CCCA 3W59A 4K9SA 1SBFA 3E22A 1Y9GA 1VAMA 5FLHA 1RUH1 3E35A 3NR7A 3JQWA 2CL2A 1V6IA 3FB8C 1MPXA 4HMZA 5B1BB 2RMU2 4BMBA 3SEPA 4LBJA 3ZSLA 1HRI1 1GV9A 3BTAA 2ZCEA 4DW1A 4Y22A 5KHHA 4JI0O 3WW4A 1AHSA 2WWJA 2EXKA 1POV0 4LIVA 3A0KA 1NBMG 1ULEA 3OPTA 4ARXA 2P4VA 4M3CA 4DINB 1O9HA 1W6NA 2ARCA 2HH9A 2VNRA 2A71A 1WB7A 5JR2A 3JBG1 2P6HA 3DXRB 5A7OA 3R05A 3OPZA 3J7NA 4ZS3A 3CXCU 2BOIA 1JJ2U 4X1IA 1GM9A 4I9QA 4RUEA 1XQNA 3Q8BA 5CVRA 5K0UC 4RUFA 3SPHA 1AX1A 3ABMB 4O4IA 1SACA 2F66C 3CZJA 4I3PA 4CUCA 4Y4YA 3CMGA 3RMXA 1MS8A 3P3PA 4A7KA 4KHPO 2H3OA 2DF7A 3APBA 1SQPH 1PK6A 3MHSC 4GUNA 1POQA 2OIEA 1RVF3 1GWMA 3POGA 1BEV3 1VBA1 5FY8A 2GDFA 3BODA 3EO6A 3SNMA 3OAAG 1RMU3 5LB6A 1ALYA 4OZXA 4QT6A 3R4UA 1HNXO 1ND3A 3D82A 4G27B 4K40A 1ULDA 1ULPA 3WQBA 4FVMA 2Y69C 1YC61 3ZXKA 5GZCA 1JYWA 1CAUA 4I0XB 2WQ4A 1WB8A 4X64O 5FZOA 2WLLA 4FOWA 2VNVA 1BVP1 4YGEA 3O1MA 1QNYA 2DCYA 2ADPA 1K3EA 1RUF2 1IS4A 4JI6B 2EVXA 1NQJA 3NKGA 3HNBM 4LHKA 4UW5A 2L9LA 2PLV2 4NHXA 5KXEA 5LOVA 2W92A 3ZMVA 4OHXA 4Y5SA 4H44B 2UY9A 2WS93 1LESA 4N9HA 2ZA9A 1UYPA 1QXRA 3U10A 1IKQA 2Q4SA 1S2KA 1SQ4A 4D7YA 3ES1A 1OOPA 1ACCA 3SMHA 1VB2A 5F6LB 1NUKA 4GKJB 1GKBA 2BWCA 1MZFA 3VBOA 3PUSA 1C5IA 2BWAA 2W9XA 5IYBO 2UU9B 1PGW1 3UGFA 3S7IA 2DOSA 4FPHA 1X9PA 2IU3A 1UZZA 5EFUA 3NSTA 4Y33A 1A8MA 3N4MA 4J42A 5IYCO 2DUOA 5AFBA 1COV3 2WL1A 4AQ6A 1FV3A 1WW5A 3UT0A 2X8KA 1CWPA 4F3JA 1UMZA 2WIIB 2VZUA 4YSFA 3OT7A 4AQ2A 2PQSA 2FL4A 2OT7A 2CYFA 3OTFA 3I5DA 1LTEA 3LEIA 1W2AX 4B08A 1M57C 4GX1A 5BR8B 5BNOB 1DF5A 1G9DA 5KXBA 2GMMA 1TME2 2ZHNA 1NQTA 1YHQV 4E4SA 3BUCA 3PHMA 5BMVB 2GSYA 2OYZA 4JZRA 1J83A 4HBNA 2YFZA 4ITCA 3ILNA 5BNPB 5C33A 3O0XA 4XMAA 4G28B 4N8MA 2VMIA 2Z69A 3H8UA 2CU5A 1YLLA 1R091 3K59A 1FXKC 3BCCH 1XYPA 1UJWB 4I09A 3EXUA 2ZHKA 2UUBO 1LRHA 3TAYA 4XURA 1ZBA2 4HVOA 3JASA 4CDQB 3U1XA 4Q0VA 3OUSA 5GW7A 3WINE 1F4NA 1G6NA 5K1XA 3FB7C 4W65A 1KDKA 2B9UA 1BE3H 2IJHA 3UO3A 5JH7A 1DGWA 1WKYA 1FMD2 3H1KH 1COV1 3GDBA 4LBEC 3MUZ1 1RXGA 2RQ6A 4X8PA 2WNVB 2EBOA 1NXMA 5T5OA 1GFF2 5LA6A 3PUAA 3HOBA 3GYDA 3DXTA 4TUYB 2R72A 4HK8A 3AZXA 3ZRWA 2K46A 4MYEA 4O4HA 4MXVA 3T2OA 1V70A 1VBC3 4X9QA 1JXNA 1LOAA 3ITQA 5J2UA 2PHDA 4LF9B 4UFZA 4J25A 3ACHA 5AC92 5BMVA 3NV4A 1WBLA 1VMJA 3E8GA 2WZ8A 3DKWA 3QCWA 3DKQA 4KUMA 4D7SA 1GQGA 4NAOA 1VMFA 1RUG2 5LBFA 3LKJA 5EP9A 3BOWA 2QGNA 1W0PA 1IBKB 4WF9V 1HR0B 2BVVA 5FJKA 4K6BA 4PDLA 5FZAA 3ZPOA 3R0RA 3WDTA 3LOBA 5E89A 2LJ2A 4Q4V2 2RR11 4GULA 1I94O 2WNUB 2QNKA 4LNUB 4X20A 5E1AC 4L8QA 2PMWB 2ORZA 3CJHA 3I3QA 2DYSB 4XUNA 2K2SA 1W9YA 2YUEA 3HKBB 3IZOA 1W03A 4KI5M 1FOD3 3OTOO 1C57A 1WPBA 3D5OA 2R042 1PK6C 3ZSJA 4GLXA 1O8SA 4C1WA 4DV5B 3T4HB 1SZBA 4RGKA 1AR4A 4QD2A 3T30A 4JGYA 1VQ4V 3OMIB 1W2NA 1W6PB 3VBSA 4L0PA 3VBOC 1VJ2A 1YF2A 1SLLA 2CAUA 4Y1XA 1L7QA 1UNBA 2D3PA 3OEHG 1OD5A 4LPLA 5C3PA 5KR7A 3ZEDA 4UAPA 4S2FA 2P3JA 4HZFA 5FP8A 2WWWA 4BJ0A 4CCEA 1RINA 1OV9A 3H1WA 2ES3A 3MLLA 2QQPA 3LCPA 4NWWA 1N0JA 1ZUQA 1WP7A 2PHXA 1U5ZA 4A4AA 4UVAA 2WLLB 1BS3A 4A42A 2OUJA 1LOFC 4BZ4A 2VQEB 4XOGA 1CIWA 1DTOA 4JKMA 3AYEA 1ZRRA 2WLMA 2JDUA 4O61A 4WM7B 1N32O 4YW2A 3VBBA 2EIGA 2HJIA 4X1YB 2I07B 1VBC2 3A0RA 4JASA 4RS5B 4YW3A 4PDWC 1ENQA 1BMV2 3L71H 2A9HA 2VD7A 4GMP1 5KX5B 1NTMH 1WD3A 3ACFA 3CO2A 4DQAA 1B3QA 4TLGA 1BSMA 2ARAA 4LFCO 5SV8A 2QJVA 1W90A 1HRV3 2EILB 3WNKA 1W04A 4KHPB 3AK3A 2CAVA 3WT3A 3GNEA 4IT5A 1RP3B 1RUC2 4XFIA 3LDRA 3WY6A 2JG8A 4UFKA 3ASOC 1WMFA 4QB2A 5FPXA 4LKEA 5H9RA 1E79G 5H9PA 1Y3TA 4M3CE 4KNCA 4A41A 4PA4A 3ZRXA 3FHQA 2FCTA 3U75A 3JSLA 5F8PA 1IPSA 1DIWA 4HSLA 4U7NA 3D3QA 3C3VA 5IJ9A 3IM0A 1RYYA 4JI0B 4JTNA 1D7PM 1PZ7A 4GH4C 2WLQA 2AW9A 3V0BA 1WP8A 3FAVA 1B35C 2WLNA 1TQ5A 4P00B 1LULA 2DFBA 2O8QA 3PTRB 5L3GA 1IBLO 5FYYA 1DQ5A 4B3MB 2Q73A 1AR81 3PL0A 3VKOA 1DFQA 4QQHA 2A6ZA 5DQ0A 4NRQA 3GCWA 1WGPA 1NQDA 4UI9L 2GN3A 1F31A 3ON7A 2WLIA 5FZ9A 3MIFA 4AQSA 2RHPA 1H1IA 3JATB 5CN0A 4NRMA 4EFBA 2R073 1AR82 3M70A 1S4CA 2EIMB 2QM8A 4CPBA 1QLNA 1VQPV 4YYOA 1XU1A 3SKJE 3LA2A 4F7ZA 1QJZA 3JARB 1HRV1 2WA3A 5FZCA 4LO4B 4BA6A 5DN6G 1U97A 4J7KA 1CGPA 3F5TA 3WNXA 2BUKA 2ZR3A 2PXJA 2UXBO 5H2FZ 2FKXA 3FX3A 2RN9A 2FMDA 4ES9A 4O9GA 1V55C 2BPA2 1NE4A 5FMOS 3ETDA 3AK2A 4UT5A 3GVMA 1G7YA 3KZ4C 3OTOB 5A3OA 5EYYA 4LBLA 1AYM2 1GU3A 1YI2V 1KS5A 2JECA 5BR8O 5EYXA 2IW5A 1WCQA 3MLKA 1RL3A 4JRAA 3WOGA 4YRDA 2XUMA 3KQ4B 4Q4X1 5IDJA 2HEYF 2HWC2 3WDWA 5CB4A 1JMUB 5CG9A 2H94A 1AR83 5KX5A 2Z0AA 1W99A 4DR1O 4RN5A 3MICA 2F95B 3HQUA 3IIAA 5IY5C 1MACA 3T1HB 1Z5WA 4XUPA 3AFGA 2AYHA 4XIKA 3WU2Z 4KGGA 4CTEA 1K34A 3T0DA 5JSRA 4TQDA 1QXJA 3B93A 1WCSA 3CCVV 3O1SA 4AVVA 2R071 4LCUC 4TV8A 1H9WA 2DCZA 2WAMA 5FYMA 2NZ9A 3UO2A 4KH9A 3DF0A 3HKDB 4CDUB 1KECA 3ICXA 2D6KA 2OQ7A 4UB6Z 2Q5ZA 2VNOA 2VTXA 3AG4B 2WSUA 1HW5A 1SA0A 1SPPB 2ERFA 5FYTA 4ET7A 3CMAV 5EK0A 2D43A 4O4JB 3NJYA 2DBIA 4FOVA 2BNOA 4JYAO 1PVC2 5FQ0B 3CKHA 1Q8IA 1LOBA 5KHIA 2GN7A 1ZZCA 4DPNA 5GZEA 1MSWD 1SDWA 2IJKA 3CCSV 1IGOA 5E88A 2ZXWC 1N1VA 3GBGA 3CCUV 2VM9A 2Y6GA 1ZREA 2E76B 4RAIA 1DP0A 4CSWA 3IFXA 2WLPA 2A6VA 2P67A 4RQEA 4JGSA 2ZHLA 5F5CA 2WZEA 1UU5A 1UU6A 4N9IA 1HXS3 1M4WA 1RHI3 1RMU2 5L3EA 1UPIA 1YWKA 2EINC 4AVCA 3AG3C 2GBOA 4KMQA 4AL9A 3MV11 1CAWB 5LBEA 5CB4B 2X5IC 1V9U2 2XKPA 3OGGA 4RS5C 2W3JA 1NR1A 4IIJA 4UFMA 4OI0A 4LJHA 1MNGA 2HLEA 1JHJA 2ZX4A 1QLEB 3J8F3 2R061 3MW2A 1I5ZA 3I2DA 3FYEB 3K9AA 3B8MA 4FPYA 3WFVA 1H8HG 2GV9A 5D1IA 4K3AA 2A79B 1AILA 4ASKA 4DV4O 3O0WA 4LK6A 4FFIA 1IS5A 3GWOA 3Q8EA 3JD2A 3AMPA 1GWLA 1BZWA 1G6UA 1WZXA 1YFXA 3M3OA 3CIHA 2JG8C 5JOYA 3L9DA 1JZ4A 5B3SC 4DK0A 5I91A 5LHHA 3L2YA 4I5SA 3OUFA 2OTJV 3FFQA 1IPKA 5FDBA 2WO1A 2J1UA 4WBNA 3K4DA 4N21A 2ZE6A 4H3WA 2WNUC 1UN1A 1K7DA 3N2GB 5L19A 2PLV3 5D21A 4AEDB 3W7XA 1TGOA 4GA9A 2QQNA 4Q26A 2YICA 2ZZQA 4AI3A 1PO11 4KL1A 1KGYA 2B9VA 1Y76B 3AK0A 5FP9A 1XPWA 1VQMV 1RUE2 2WYFA 1X82A 4FPEA 3EXAA 3K0GA 1PK6B 4Q0UA 1RUOA 3INAA 3ZXJA 1VBE3 2XVKA 1C1LA 5H5NA 3U14A 2V5DA 5A7WA 4BWAA 4O4IB 5DUWA 2A3XA 4XFFA 3V0BB 2ZBJA 5J98B 2CAZC 2XB6C 3K0DA 5CADA 2ADQB 3M8LA 3J8F1 3ZFGA 1S0FA 4X64B 5C6CA 2R063 4MGZE 3W7UA 1W8ZA 2IFRA 5FXZA 2A7WA 2DQ3A 5C3OA 5IK5A 4FAGA 4A7ZA 4K35A 2IVJA 3W7WA 2EF6A 4AHZA 4QE7A 3B02A 4N7UA 3FE5A 4LF8O 2ORXA 1ZRIA 2VOKA 3FC0A 5IK8A 4JI4B 1JOBA 4HN0A 4MHRA 3T2PA 1PO23 2W5FA 4XVHA 4YVSC 3ZR6A 3N2KB 4R52A 4XBFA 2DCJA 4BPZA 4MOAA 3KV9A 5EIBC 1XRUA 1XNBA 2A73B 3GZEA 4UVBA 4F8AA 3H7JA 5A1FA 3D3AA 3BHPA 5K0UB 3TEZA 1KP2A 1Q8QA 4GAZA 1KITA 1S1AA 2VOVA 4ZZ8A 1VQ9V 2EXIA 3WDYA 5A3NA 2CTVA 3QACA 4V2VA 4FPPA 3OM3B 4L99A 1YNAA 2DMXA 4GB33 1UL9A 3RRDA 4IE5A 1W2TA 3CYOA 2XBO2 1M56B 1SBEA 4QHBA 3ABKB 2ZGMA 4IYHA 4OX9O 5EJ3A 2XAFA 5ISLA 1V9U3 1M57B 4AI1A 3SYPA 5F5AA 1PGW2 1H8TB 2LP7A 2UXDB 2DV9A 3WG7B 3AKTA 3ZIWA 2P3KA 3BABA 5GONA 3FJSA 4XABA 2QM7A 1CIYA 3CJIC 2XQRA 3POIA 2B8MA 4RS5A 2Y6LA 3GJAA 4AGVA 2QE3A 3OBAA 4Q4Y2 2HWB2 3FLTA 2V4DA 2H6CA 1UYZA 3I3EA 3BOPA 3GWKC 1US3A 4MXWA 2YXHA 1PKXA 3TEYA 4CU7A 3N9NA 4COVA 3RZMA 3TETA 3VBFB 3JD0A 4FXKB 4CEWC 2E7TA 1TMF2 1R3LC 2Q67A 1PO21 3WUCA 2MEV1 4PIZA 4CUGA 4QJFB 2W39A 4AEMA 1LECA 2PAMA 4BCUA 5KMGB 1QR9A 4QHOA 3VBHA 4KU8A 4MW8A 4CC6A 3SKVA 4DYLA 4LF7O 4C8DA 4DR1B 1FJGB 2CH7A 3Q8AA 4P08A 5F39A 5E16A 1OD3A 5JLVA 3BPZA 4LKSA 5A3LA 4JHTA 2CDYA 4LORA 5EYPA 2GTSA 2R70A 4RQPA 1UPGA 4FLWA 3WDUA 2P2KA 3BYWA 1MG1A 2JJ2G 1GQPA 3L74H 4A7YA 1Q5OA 4MSVA 1HB4A 3JB8A 3ZRSA 3MV01 2ZM6O 4I0BA 3SPJA 1JZ5A 4R7CA 1GWKA 5JPNB 2QQLA 1DGWX 1LODA 2HHHO 2RJLA 4QWNA 4Y1YA 2D93A 1WCKA 4CPBD 2Y69B 4URTA 1NH2B 3WNPA 3K51A 4DV2B 2F93B 2W6IG 3ACGA 2E75B 1VEWA 5A33B 2XOKG 2YFUA 3H42B 1VBD3 4HYOA 2JDPA 1YYNA 5L3CA 4IYIA 4AI2A 4NR1A 5JIAA 4AFMA 2UUAB 1Q90D 2VQUA 1SCSA 4RGAA 3SDLA 3MW4A 1C8M2 1BT8A 5FZ7A 1WMDA 1VIWB 3PUIA 1BHGA 2F6BA 4N53B 1EN6A 1GR3A 4CCLA 4YIPA 2NR5A 2MEV3 1JYNA 3RJ2X 4ZHQB 2W1SA 3G71V 3WB0A 2C0ZA 3AP6A 2PZSA 4QX8A 1QH6A 1Q82W 1GN2A 1RM1C 3FB6C 3ZO0B 3T1MA 5DPNA 2MW2B 3LSUA 2DE0X 1CPYA 3U78A 5G05L 5CBFA 2LW7A 2QQIA 3JCZA 2XT9A 4XCAA 2HP8A 4MGKE 3MYXA 1ASJ2 1LOEA 2WO2A 5FWEA 3LPFA 4P9LA 4I50B 4OHWA 3VDAA 3CBNA 3VZLA 2VCAA 1GH6A 2Q8VA 1F4AA 1DGRN 1KBHA 3VGIA 3NNMA 1PL4A 2JIJA 2YPDA 1H8EG 3T3YA 1CZSA 3ZFGC 1EPWA 5EJZB 2ZHMA 1SQXH 1L1FA 5JQGA 2PHFA 4QPIA 3I2FA 2AZ0A 3J81N 3IWZA 3LDCA 1GZWB 2N74A 4AGRA 3LE0A 2UYBA 4ISQA 4OMCA 4EFEA 1ZBA3 4KBZA 2Z5WA 1U5XA 4UCTA 1TNFA 5JCTA 3SH3A 2JD9A 4D6SA 2QQOA 2PYLA 5FZKA 3B9IA 2QM4A 1QOSA 3H1YA 4ATEA 4E8DA 1TUEB 2R062 5EWSA 1QVFU 1XYOA 3WG1A 1BYHA 2F23A 3ACIA 1FNYA 4FM2A 5FK8A 1R1BA 1YTFD 5FREA 2EXJA 2PYTA 4HONA 4LITA 3NV3A 5AC91 3PIGA 1K5SA 2JG9B 4R9CA 3C7HA 3OF1A 3A0HZ 1HNWO 4K20A 4AFBA 4XW3A 1ZLZA 3ZX6A 3ZYIB 1S72V 4PF5A 1LHOA 4JYBA 2BTOA 5LMNO 3MF6A 3PUHA 2HG5C 5FYSA 3W9AA 1XXNA 4PJ0Z 1H30A 1OHHG 1CR7A 4JI2B 3HN3A 5FNVB 4CCDA 2VQEO 4META 4CDWC 1O6UA 3ABZA 1HW7A 4YVWB 2A75A 4G4FA 1XB9A 2CV6A 2GUZA 2JDMA 2JIGA 1G1XB 4B8EA 4NXMO 1SLCA 3KCYA 1EPZA 4LO8A 2OTLV 5FYBA 3ZCCA 1AJQA 1BQZA 2CTPA 3JD3A 1OURA 4RHV3 2X6CA 1ZBA1 2QBXA 2DURA 2QCSB 1K3IA 1ODNA 4AVAA 2R072 4LH7A 2M7WA 3QH6A 3RN4A 1GMMA 3WDXA 5FP7A 2BRTA 1ND3B 2AR6A 4FFFA 1RUJ3 2JICA 5FYCA 3ZXFA 3H8RA 3K57A 3POBA 4JV4A 2RDCA 2R9IA 1VF5B 4P9WA 1ZRCA 1JVMA 2JGDB 1JW6A 1NY72 1NVPD 2C24A 1KJLA 4P14A 5LBBA 1NA1B 2HWC1 2GSMB 4UXNA 1TME1 3VBUC 1H8TA 3LUTB 1LGBA 2FCUA 1YQ2A 1UIJA 3ZHQA 1HNZB 5I0TA 1AI7A 4RR3B 4AFDA 3NL1A 5K4LA 1HV1A 4GT1A 2DQ0A 1AL23 1C4RA 4XF4A 2Y0PA 1V6MA 4XDJA 3CPWU 1I08A 2JKXA 3AVRA 5L3BA 3VBFA 3H50A 4AFAA 2PFWA 4CZZA 4BW9A 2CTWA 2ZEXA 4ZHNA 1RSOA 2JJ1G 2IJIA 1PIV2 3ZHUA 3WP6A 4HKWA 4DV6O 4LH6A 1HWYA 5EZYA 3MIGA 2LFSA 3RBZA 2RJKA 2V09A 3I2IA 2K0GA 3L70H 3M2MA 3ZYPA 2PYJA 4GX0A 2Z3YA 2TEPA 1HRV2 1AJNA 1FJGO 2P34A 1LHUA 2R1BA 4FLTA 5FY4A 3K3OA 4E4ZA 3ZYBA 3TWIA 1E57A 3V64A 4WFGA 3JXSA 1ULGA 5A32A 3OD0A 4YJ3A 3TXSA 3VZOA 1ZTEA 1OCZC 1FATA 4LLOA 1CJDA 2RJZA 3RDIA 2A7AA 5I0RA 2ZPXA 3NAPB 1H38A 5EV7A 5D5PA 5LP6C 4N7IA 4HLTA 5DAQA 4QE9A 2DVFA 3B00A 1JQ0A 1Y4MA 5IVCA 1GZ9A 4AW7A 3A22A 2IH3C 3FKSG 2W2IA 3UM7A 2LGQA 3APOA 3M3IA 3POYA 3UKTA 5HXMA 2V7QG 4PDMA 3WQ0A 4HK9A 4NKGB 1JUIA 4YG3A 4YM3A 4EE2A 2CDPA 2HR3A 4U3JB 1N34O 1CX4A 5F2WA 2QWQB 4I0XA 1VBB2 3OYWA 2YBKA 5DAPA 1W0NA 5JSPA 4YW5A 1NKGA 5AVPA 3LIHA 1AR93 3FWEA 3ASNB 4GH4B 4TT3G 4QPGC 1ULFA 3I3DA 2X7RB 4WFFA 4OX9B 4CEYC 4NHKA 1NA1A 5FTTC 5CA1B 4UW4A 5LA0A 3ZJZA 3WG3A 3RZKA 3B77A 2G4IA 1EUUA 2PI5A 4BH9A 4K0KO 1J95A 4AQTA 2K9PA 1DZQA 1QKQA 2IUWA 2VZTA 3ASOB 1C8NA 2RS12 1V9PA 2GTAA 2VULA 4J11A 3RYPA 2R32A 1RUG3 1G9FA 3FLPA 2Y64A 4YIOA 2UUAO 4AK3A 3CJIA 1C1FA 1CPNA 4MVRA 2RDNA 1ZA7A 2EJ7A 3AEIA 1OBNA 3KVBA 1MS4A 4Q0SA 3AZZA 5DDJ3 1ZYBA 4AAPA 5C4WC 1T6BX 2VWJA 3AG2C 3SPCA 2GZWA 2ZNJA 1NCQC 5A3TA 4OUSA 5A7QA 5CU1A 4G2KA 3AL6A 2YXYA 4DR2O 1LUWA 3L75H 1IHMA 1T2XA 1D0HA 2F43G 2OX0A 3RVHA 4Y22B 2J42A 4PA6A 3NV1A 5FO8B 2XOMA 4HXCA 1FAFA 3KHCA 4CCNA 1QY4A 1VMHA 5F6KA 1DCSA 3WXPA 5IYYA 3ZXGA 1GOFA 3SQOA 4CP9A 3LFMA 1AR62 4G9SB 4Q4W2 4BOWA 3TOJA 1JYIA 2A5ZA 5CYYA 3RMYA 3ZXEA 1RPRA 3ZDVA 4JI3O 2DBNA 3AC0A 1OUXA 4Q4V1 3SXWA 1GQHA 4BR6A 3PNAA 4UWDA 3O1RA 2XH6A 3H8OA 1DGSA 4CP1A 1ROPA 4BW5A 1RUG1 3LQCA 3OGSA 1N32B 2XHKA 4QKDA 5IJ0B 1XNCA 2WDBA 5IVVA 3AG7A 1F4MA 1JYCA 3POSA 1R64A 5LHIA 4C0BA 2ATKC 2KQXA 2DVDA 3VBUA 1ZRDA 3J7MA 5FP4A 4R6ZA 4DMIA 3KV5A 2P90A 3DV8A 2JG9A 4ZI7B 3BIWE 4TXWA 4PD4F 3JARA 3WVJA 5FY0A 5IVYA 1R3IC 2HWF3 3ZYHA 2ILMA 3TJTA 4FMTA 3TRSB 5FZIA 3NWKA 3I2HA 4QDSA 3ZSKA 4A3ZA 1R6KA 2L6LA 1ZZ6A 3CNAA 2OT5A 4J41A 5ABJB 2WN3A 1OLRA 1RHI2 3N9QA 4K8FA 2YV8A 4IW3A 2NPIA 3GF6A 3K4ZA 1WW7A 4LMFA 2EXHA 3Q8CA 2RS52 3J9SA 4CEYB 5FWJA 3VQVA 3CZUA 1NZCA 4FOYA 3OEEG 1D5NA 5KXDA 1AP5A 2G19A 1BLZA 3WQ1A 5BNQA 3GGLA 4I30A 4PHZA 2MNGA 3GXUA 2PN5A 5FZFA 2QUOA 1PVC3 2EAKA 3RFRA 1BQ0A 4IQPA 2G9FA 5IVEA 3JAWA 1UY0A 3KCCA 3URFA 3TEWA 4H55A 2CE4A 1LGCA 3OPWA 4Q1RA 4XDOA 4LNUA 5LEKA 4H14A 3I2GA 3G6JB 2JE8A 1JYTA 1FPOA 1FX5A 3ZHRA 1RJ7A 4COZA 1BBT2 3ECQA 2VUCA 4EWAA 5EIYB 3C3SA 2XKOA 4LBQA 1ODMA 2AHYA 1FOD2 2HWF1 1OCRC 5LGTA 4AVBA 5KAIZ 3O12A 2NQYA 1MMMA 4DNYA 4I2OA 2FTKA 3I4IA 2VY0A 2P7TC 4DR4B 1DYPA 3GB7C 3ZMUA 2V73A 1Y66A 2XL9A 5D2AA 4J7JA 1D0GA 3KG2A 2NLRA 3CEIA 4BQ4A 4K7JA 5HI0A 3SCGA 3VBRA 1YCIA 2WZR3 5DAXA 3VHPA 3UETA 3PVNA 1NOVA 4Q29A 2CNAA 3UYJA 3IJ4A 2EIDA 4CVUA 2BNNA 2XVGA 4OGQB 4S2HA 4AHCA 1OFNA 3RT3C 5AFEA 2L35A 4ABMA 1EFRG 4UFIA 3H3ZA 1PIV1 1N3PA 4EWEA 5C8YB 3EVKA 2ZINA 2ET1A 4WFEA 1LOCA 2JDZA 4F83A 4CCOA 1CVNA 4YW4A 5FPOA 3QG5A 4AQYB 2P17A 4JI6O 4UUJC 4B29A 4XXAA 5GTHZ 4H37A 3CCQV 2LRPA 4R9AA 1IX9A 4PBPA 5CFDA 3WF3A 1VRBA 1ENSA 1RITA 4WV8A 4DUVA 4AVTA 1W6PA 5DG2A 2B1IA 2YDEA 1J1TA 4NUBA 2VAUA 1UZVA 3MHZA 2J1VA 1DGLA 2WT2A 4HZ3A 5JZGC 4Y1VA 4CS4A 4PJYA 4IGPA 2Q5TA 4HVRA 3OEAA 4FLZA 2DJVA 2WFPA 2O1QA 1XILA 4IHJA 4JKLA 1BL8A 1AYN1 1WA8B 1W8OA 3POEA 5C8WA 5L7OC 2YIAA 2WNUA 4QB6A 3J7LA 5CFDB 2Q0OC 2WQZC 1OKQA 2TBVA 3MEPA 1LR1A 2W46A 4DV0O 1H2SB 5CIRA 4FZ1A 2YGMA 2V4AA 1VQKV 3A4UA 3OGJA 1NZ6A 2BP6A 4M4RA 1SF9A 3ZSEA 4Y3OA 4ZS2A 4HT1T 2E6VA 4R4ZA 4WFBV 4JTOA 3OG2A 5T5LA 5J37A 5BXZA 4IUGA 4WVMB 4S2DA 3STZC 3RYCA 1OVPA 3MPBA 2E51A 3THCA 2E9QA 1LNQA 3ZYJB 4D7TA 3GJBA 2E53A 2VBDA 2EALA 4DK1A 1Q8VA 2W52A 4Q27A 1X8EA 2BV4A 2GNDA 4MVUA 1GZCA 1LJ7A 4J9ZB 3M4FA 2XG3A 1C3HA 3TK1A 5ITZB 2QKCA 2ENRA 2ZKOA 2XMLA 1ND2C 2B45X 1BZKA 3Q9OA 4KWKA 3A23A 2WKKA 3F2ZA 4SBVA 4I3GA 5FCCA 4GZRB 3W21A 4E4DX 3ZM8A 4JGYC 4MVQA 4ZZ5A 1LHWA 4H0LB 4B3SO 3UL2A 4MGYE 1W05A 1AYN3 3RPQA 4JGYB 4AEDA 3N7JA 1QIQA 3LIGA 2WLJA 1AJOA 2D3SA 5IW0A 4Q0QA 2WQ8A 1PVXA 1UU4A 3K06A 2ZKNA 3L73H 5I0DA 2WUHA 4L87A 2Z42A 2Q8EA 1J59A 3MIBA 4FM0A 3BKZA 1DZTA 2OW4A 5H9SA 2BBVA 1GNHA 4JHZA 3VBRC 3NXSA 3SJCC 2GNMA 1HB3A 4P9YA 2P1BA 1D2SA 3WW1A 1BMFG 4MTGA 3DGTA 2A6YA 3WNMA 3THTA 1ASJ3 2B5HA 4QGNA 3GZUC 4XDPA 2YGLA 1SMVA 5B1OA 1JTZX 5EBMC 1J58A 4OPHA 5JH7B 2AXTZ 2AUYA 2R0FA 1MS0A 2H6BA 2VMDA 3UJQA 4K1YA 2NMOA 3N2KA 5LA9A 4F6EA 4B7KA 1QNWA 3O1PA 1VPHA 1K8AW 2AREA 3DPRA 5G04L 4XUOA 4QX0A 4IV3C 5DUXA 3O14A 1G8WA 3KVAA 4LA2A 4BK5A 3Q8FA 5J09A 3TCUA 3CJXA 1UY4A 3E83A 4UCUA 2F4VB 4K1ZA 4UXAA 3CC7V 4IDZA 1MZEA 2ZAAA 2CHHA 1K42A 2P3YA 4GZ9A 3OUHA 3X29B 4FJCC 4E2SA 4JPRA 3VBHB 1KU9A 4PI0A 3JAKB 1OLQA 3ZMOA 3AMHA 2J1AA 5CA6A 5IYZB 1GO3F 1Y76A 2NMNA 1G4YB 3CU7A 3VUOA 1XL4A 3EQEA 3VDCA 2OQ6A 4BQ2A 5F7UA 4EB6A 3AYDA 3VLBB 1RUE3 1O3RA 2JRIA 1GNYA 2Q1FA 1D2QA 1OLMA 3K3WA 1B35A 4ORFA 2ZX1A 2LW1A 1SG3A 4UFJA 2JGDA 4DXZA 3QO5A 1N1YA 4FQ4A 5CKQA 4GH4A 2ZGSA 4UFLA 2UYAA 1Z7S3 1M90W 3SITA 1CAXB 1WA6X 1NG0A 2HWB3 4X62O 4CH6A 3PMSA 5GZDA 1MABG 3O5SA 2FDKA 2FZ2A 3DN7A 5FPBA 2W0XA 1KYOF 5FV3A 2QQUA 2ARHA 1V6KA 4GALA 2N05A 3KKYA 4FPFA 1MS3A 3PLQA 1E1RG 3VD4A 1WA8A 4S2GA 5T5JA 2CGOA 1IVSA 4U7OA 2WT1A 1Q8PA 2W91A 5KA5A 2IC1A 3HNMA 5JMOA 1X9TA 5LBCA 3C3TA 3HKCB 1KB9F 5HFLA 2RS31 3VKNA 3B40A 2ZE8A 2QE7G 2GUZB 4MVOA 4LQRA 4P9XA 1PZ9A 2W1WA 4OLLA 4INDA 3AKSA 4ARYA 2KD7A 3QH7A 5FZOB 5T50A 5B4NA 4MVMA 3M7AA 2XJRA 4QX7A 3H0OA 2D6OX 3ETEA 3CCRV 2A0LA 1L0LH 2D3RA 4NOTA 4DOUA 1QXPA 4P9PA 1RUD3 5CAZA 4PDRA 1FAYA 4A6SA 3TN93 1REEA 1Q81W 3ML0A 3BI3A 1H2LA 1SRYA 1W9TA 1JUHA 5LOVB 1P4RA 5IFTA 4IERA 4XJ8A 1O4TA 3ME2A 1SESA 2ZE5A 2LUWA 4JTCB 5A7WB 1K5MC 3VV1A 1HRI3 4LO5B 3IDEA 2YIBD 2V5YA 1R73A 4EZHA 2BCCH 1SPPA 4DXTA 5DDJ2 4MX3A 1K12A 1OZ0A 2HWB1 4ICGA 4HSJA 2ZE7A 3E5XA 5D8AB 4DRXA 3ZRVA 4EN7B 4DZGA 1NLQA 2NN8A 2AH2A 1AF9A 1KD7A 3PU3A 4QGMA 2FYUH 3AXEA 1W3XA 4KU7A 4KFMA 2HFEC 3JBG3 4XACA 1IXBA 3I49A 3GALA 4PDVA 3K3NA 3C8XA 4MVSA 4JYAB 3DTUB 4MXWB 4HETA 4BQ1A 1QOTA 4YFWA 4GKJO 4IE7A 1JPXA 1UAIA 3T4DA 2XBO1 5IE9A 3CCMV 1QJEA 4JVAA 2ZGQA 3V65A 2CWMA 3ACLA 1XDCA 1IBKO 1NT2B 1RUC1 4A6OA 1L0NH 4BB3A 2HJFC 5CMUA 4LUMA 1H4GA 1D4M2 1WW4A 3ZYGA 2RJ2A 1EYBA 4NPRA 1RVF1 2QA4V 1JFFA 3E97A 2VMFA 1SLBA 3TN91 2ZDIA 3SYOA 4YJ2B 4Q8LA 2OCCB 5JPMB 2QEXV 5HFMA 3J8F2 1BQPA 1H1AA 3IBMA 1ENRA 3AYCA 1JOJA 4AFCA 5DECA 1BMV1 2RVAA 1I9RA 2W94A 1YJLA 1TNRA 1PMHX 4O7XA 3SR2C 2XL7A 2EIKC 1Z5VA 4OMDA 4NMIA 3K03A 1LOGA 3SPGA 2UUCO 4Z1MG 3EBRA 4QMAA 4LOTA 4JI7O 2RG4A 2Q9LA 1PO12 2P37A 1YJKA 1WA4A 4NYKA 2CGNA 1AUYA 3BAAA 3E6DA 3GM8A 3U4XA 2Q1ZB 4JI3B 3CDZB 2UY8A 2WS91 4WZCA 1PD3A 1FXVA 3H7YA 2BEOA 2I2SA 3C90A 1KKDA 2XBO3 1C5HA 5ABJA 2FMYA 3C7OA 5LXTB 1XU2A 3ZKYA 2YMZA 3K58A 1VIBA 4OUEA 4QQPA 1UKRA 4ASMB 1SA0B 4BIZA 4XTPA 5F3GA 3I2KA 1T6GC 1NLRA 4ZKIA 4A5UB 5A7SA 4MGQA 4QPWA 3SPIA 5A1LA 1TVKA 2GC2A 3VD5A 2YBSA 3PDQA 5JUVA 5FPVA 2PAEA 1STMA 2YY1A 2P6CA 2IWGB 5EIBD 3M3CA 2Y4UA 4WM7A 4MT8A 4CS3A 1Q6HA 4QPIB 2ODMA 1WLDA 3CQOA 2V72A 3SHRA 4R9DA 1ZAUA 4FPKA 2DWDC 1NX9A 1EV11 2YUAA 2ZR2A 1OA2A 4J80A 4AG4A 3EHKA 1AR72 2JS5A 3P1IA 2R9RB 3J26N 1N33B 4UBGA 4NIHA 2GP3A 2VTXJ 5KC6A 3LA7A 4P5YA 1W6QB 5IYZA 1Z7S2 3H3LA 4NRPA 4JI1B 5C71A 1W8NA 4XILA 4UCOA 1A6CA 4LKFA 5A3UA 1VE0A 2GP5A 3E1F1 4O2AA 1TZOA 2D2CB 2D3OW 2F4LA 1W8UA 3B8NA 3KF5A 4YG0A 1CP9A 1G9BA 4DEVA 4CU8A 3ZN1A 5J2TB 1Y7BA 3USUB 1YUDA 3FUQA 5E79Z 4TV9B 2ZCWA 3RVYA 1Q86W 4GCZA 4UCSA 1X4TA 4PA7A 3C7FA 5IAVA 2R9AA 3BEHA 4COUA 3UCSC 4W50A 4LIUA 5F3IA 5CB7A 1FPN1 1J84A 3MI8A 4WM8C 3HWJA 3F5WC 3OMAB 3SYQA 4CH4A 4W6WA 2YEVB 3OY8A 4Y20A 3WLUA 5BNNA 1HV0A 4PT6A 3MW3A 4I02A 1RTVA 3OGIB 1WW6A 4ZU5A 3ABUA 3WD5A 3POWA 2BSKB 4TOIA 4G3YC 4KXRA 2VXJA 3V0AA 1HIXA 2XR4A 4YW6A 3AMMA 1F35A 1V55B 2ZEYA 2JDIG 1JYVA 1L7LA 4FPOB 3MFAA 4UW3A 3NNFA 1CXZB 3AZWA 3H1IH 3HMYA 4OZOA 4NHYA 4NN0A 3ZHVA 3VHNA 3WW3A 3QD6A 3WDVA 1URXA 3AP5A 2ARBA 1NR7A 1AR5A 1R6NA 5GLTA 3R6SA 2DVBA 4AAXA 1AP6A 2OKXA 5FOJB 1QU7A 3OMNB 4RQFA 4E2QA 4ZU7A 1QH7A 5EPAA 3CMEV 4B3RB 1T5EA 1OT5A 2RR13 5CFCB 2WRAA 3T1YB 1EM1A 1VBB1 2R1DA 1VQNV 4LE4A 1MQTA 4OQ8A 4LF4O 1VRH2 4KQ7A 1OCZB 3LEKA 2VU9A 2VZSA 4JCKA 5IK7A 3N9MA 3OBZA 3MIEA 3DECA 4FLYA 2B46X 3W5NA 3S3XA 5C4WA 4LWSB 2Y0OA 1HNXB 5DAWA 3B9CA 2F4PA 4ZU4A 4IEVA 1DU3D 5LRSA 4JGZB 3RYRA 2YBPA 1QEXA 5FYVA 4LF8B 4A2UA 2ZGKA 2JJ6A 4NPMA 2JVDA 2W1QA 2H0BA 4CDXA 1A8DA 1HQNA 2ET7A 4L2NA 2FDHA 1IXMA 1S0IA 5J2UB 3G67A 1HN0A 1IQAA 1IPJA 2C5DA 1QGLA 1U12A 1R082 4OQ9A 2YXSA 1UFIA 3ZFEC 5CA0B 4DRRA 1LUVA 4Y5TA 2FD8A 4Q4Y1 1GRJA 4YW7A 3CLPA 4M0NA 1GN3A 2LW8A 4LFBB 5IWAO 3O9OA 3I2JA 4CXXA 1EUTA 4XAEA 4HFSA 1MVQA 3UK9A 1GOGA 4ZHQA 2JEXA 3OUJA 4XTMA 1ZBE1 1V6LA 3JCUZ 1KS4A 5BNOA 1W3VA 4FFKA 3VQYA 1GMGA 1Y6XA 2VW1A 4LC1A 4GD4A 2OCCC 3POJA 3L9JT 1O4ZA 2VZ1A 4XUTA 4RL7A 2D5FA 1RUF1 1JMKC 1WNSA 3VD9A 2XHBA 3KWVA 1E5HA 4N43C 1W6QA 5K0UA 4CA9A 4W4ZA 2HKOA 1RVF2 1CONA 3WNLA 3GZTB 5DAVA 1D4M1 4Y1ZA 5GZFA 3FZ3A 4B4QA 3IGAC 2ID4A 1MOFA 4LULA 2XTAA 5L9RA 4DUWA 1WCUA 3HD8B 3MFCA 1OOPC 4GMP3 4AYUA 1ZX5A 1CEZA 1LKNA 1PMIA 3OB8A 3MBWA 5GZGA 2IXKA 4QXBA 1N3OA 2BDRA 3PU8A 2VNGA 1HXS2 4YLZA 3V0AB 3AP9A 2DWEC 4DEQA 4XDLA 3LSDA 2JG9C 2BOJA 4LFAB 5JXIA 4UCVA 5HCBA 2XPJA 1MA1A 1ZBE2 2RS53 1NKDA 1IBMO 4LF6O 3H9AA 4X6QB 2VG9A 5GLWA 1K4CC 3RSJA 2ZGOA 1FS0G 4FK5C 3VZJA 4LO6B 4Q4Y3 5IWFA 2BGPA 4HOOA 3WB1A 4MH0E 1DBNA 1AR63 4DFSA 4TQFA 5IVJA 3E2EA 4C0HA 3TBDA 5I8TA 4FCAA 1PX3A 3AX4A 4GX5A 3NAPC 1GBGA 4R4XA 5LRRA 2QJ1A 4TV8B 2JX9A 1Y9MA 3JAMN 4LF5O 2ATFA 4D0QA 2Q6AA 4IV1A 1XREA 1UF2C 1JA8A 1PX4A 3HKEB 4MVTA 4EN9B 2WNEA 3ETQA 4XJUA 2P5OA 4MW3A 2DYRB 2PAKA 1WBFA 1K5MB 5LMNB 4FFGA 5C9AC 2VZOA 1FV2A 4JI5O 2VMHA 1ZL8B 4XFHA 1IURA 2VQFO 2R0HA 3AP4A 3LOIA 1PM4A 1KFUL 3WNOA 1UY2A 1BK1A 3M3EA 4LF9O 2AEYA 2E5LB 5DZFA 1DG6A 4X1IB 4HNAB 5I8SA 1PV0A 4XJWA 1URFA 1AR73 1GP6A 1I0HA 4YARA 4FLXA 5FPUA 4NTXA 1K92A 1K4DC 4XF1A 3S30A 4FPGA 3L72H 3VBRB 1TVKB 3VDDC 2UUBB 1GZTA 2Z4FA 1AR61 3ZFEA 3KF3A 4JYCA 4PQQA 3BVOA 1E5IA 4DV3O 2IXJA 2YIDA 5JQGB 1GANA 2WNVC 4XF9A 2WYSA 3ILRA 4OCTA 3HBZA 1S2EA 4LF7B 4Q4X3 3BB6A 5LHGA 1WLEA 4JI7B 2HYXA 1S5HC 4X65B 3CF6E 3ZBHA 3U37A 4Q6GA 4COWA 1AI4A 2QKAA 4J10A 1POV3 1F5FA 2ZIMA 1AXKA 3B01A 2NP0A 2J1EA 3C2UA 4UYBA 4NE9A 2B7YA 2WSVA 2GU9A 5LK5A 4DR6O 5LASA 3CX5F 1KUQA 4CDQC 1KEXA 4J7ZA 3AK1A 5H9QA 3DXRA 3ZFFB 1FXKB 1M93A 5L73A 4LBQD 2XWJB 4ZIBA 4FVVA 1LNSA 1NTKH 3TNQA 3DC6A 3E89A 2ZKLA 3CRMA 3ZFFC 1W9FA 4MZUA 2FB5A 1Y67A 1NH2D 4RA0A 2Q69A 4MHUA 5C5UA 5DZGA 1E5SA 4DR6B 5A6XA 1C28A 4XFAA 2RS11 4C91A 4D69A 3CRAA 1AR71 1CQ9A 3W58A 1OOPB 3FFZA 4IEQA 4V2WA 4FPCA 2UXXA 1XNRO 1O91A 2YI8A 4JKKA 1N1TA 3NNJA 3TXQA 3K48A 1Z2GA 3CXHF 3ZXAC 5I0UA 3IB3A 1OQEA 3PUQA 2XVLA 3O65A 2OVUA 2Q68A 5F3CA 1M5IA 4O2BB 4QGPA 1W8WA 1HXS1 1EN5A 3AMNA 4FOQA 1UX6A 2HBUA 1ZM1A 1JZ7A 1S76D 4K8ZA 2A6WA 1DQ2A 3E5QA 4ZI7A 4MGSA 4YY3O 1ZZBA 5A70A 1EAH3 1WMEA 4J6GA 4QGLA 1UY3A 4NAMA 5DMYA 1YQ5A 4ZXKA 4TWTA 3LF7A 2AC1A 1UMHA 4DR5O 4XQ4A 3HAGA 3ZR5A 4AHXA 4Y1UA 4LBKA 1M56C 2WJSA 2VMCA 4YGCA 1QJY1 4YM1A 5JOWA 2JENA 4WFHA 5EZWA 1XE7A 2PA7A 1P84F 3AJYA 5C8CC 2VZVA 4DR7B 1UW8A 2FDFA 2ZT9B 5C9AA 3WW2A 1W9WA 3G80A 3FB5C 5DEDA 1O5LA 2VPVA 2VZPA 4XE9A 1VQ6V 1FFTB 4LHLA 2VTFA 1N47A 5CKMA 5IAXA 3ETGA 3LPGA 2VOTA 4XHBA 2ZMKA 4EN8B 2ZX2A 2B4KA 1S0GA 2SBAA 1KKCA 2HWE2 3NV2A 3E8BA 1GOHA 3IAQA 3HQRA 3CHXA 3PIJA 2PLV1 2VGDA 3LEGA 4BISA 4KG8A 4DB5A 1HJGA 1OMIA 1JOPA 1DK1A 5C70A 4O65A 4O2BA 4BK4A 3WUDA 5FBZA 4FTSA 1EZVH 4I0WB 4OFGA 1ND2B 3FUOA 3FMGA 1SHWB 1VBE1 3N35A 3EJKA 4P2ZA 3KSCA 5DXDA 3O1VA 5LEJA 2RMU3 1EAH1 3WX5A 2GNTA 2VC9A 4YVSB 4CEWA 4CUBA 4XDKA 3ABMC 4QX3A 3OD4A 1LR5A 3DPRC 5CISA 2BE3A 4OVEA 4XBLA 3BCWA 1Q43A 1QJY3 4HPKA 1XOYA 3ZN0A 3BTZA 4EYUA 1Q56A 2BTQA 2HJDA 4NHMA 4X8NA 1WLWA 3IAYA 1OVSA 3LGRA 5ACA2 1IG3A 1YI7A 1KD1W 1FI2A 3JD73 4GQ7A 3S3WA 3NVCA 4PELA 4IL6Z 1XSQA 4PBOA 1N1SA 1X36A 1ORQC 4B3SB 1JODA 4YG6A 3R65A 1NI8A 2JK5C 3UJOA 3UQ8A 4MV2A 2ARXA 1VBE2 4IV1B 1F4HA 3E6CC 5JCOC 4L11A 3PURA 2XJTA 4IEYA 5CBLA 3LNNA 4CCKA 3OOXA 1VALA 3IAPA 2EZPA 5LA6B 3CP1A 1LU1A 2GC0A 4P30A 2WNVA 3VB9A 5D8AA 4D6QA 3WV6A 1YIFA 1VR3A 4C90A 1W2UA 4C7UA 1RPOA 1V6NA 4JF3A 1JX9A 3FAVB 4Q20A 3ATGA 3ABLC 2RMU1 5FFOC 2E5LO 5IUQA 1HNWB 3E5UA 2DDUA 3ORJA 4CDQA 2WLIB 1AR1B 3D36A 3SISA 2JB4A 2M6YA 1XYNA 2AEZA 4NVPA 2GDSA 1XNRB 1QQP2 1BEV2 2D7FA 2QQWA 5LL6Y 2XHNA 4JDOA 2ADEA 3V56A 4YJ3B 4LR4A 1CJPA 5LY1A 1NU1H 1HRI2 1XMQB 2VQTA 4DXWA 5FZMA 4AF9A 5JSOA 5C3QA 4AR2A 4NJ4A 1OCCC 1QQCA 4XAAA 4TSFG 5JDBA 1RUH2 4AILC 2K9ZA 1QJU3 3K79A 3H9VA 2HLDG 1SQBH 3MDPA 2F1MA 1OFSA 3CCJV 4LF4B 1V00A 1EP0A 3ENRA 3UGHA 1CAVA 4JAUA 2R6QA 1UKGA 3MD0A 4OUMA 4AHWA 2Q4PA 2D6LX 2P4KA 1CZVA 3E22B 3WNNA 1SDDB 1XC6A 2Y8KA 4GB32 4CYDA 1XL6A 1YXWA 4X1YA 1V54C 2XLGA 5FZHA 3HVDA 1PL0A 4B3NA 4CZSA 2AGAA 2J1SA 5GONB 2GMPA 5CNAA 1R1A1 1TAEA 1RUI1 1OCRB 2PI4A 1X8MA 4I0AA 2E7AA 1KXGA 1GM7A 4ATFA 1DLCA 3MAQA 5LA2A 2LS6A 3W7TA 2IH1C 4W6XA 1JYXA 3K5LA 2PHWA 4Z2WA 1YEWA 3UKMA 1Y74A 4NHLA 3A8TA 2EIKB 3MGUA 4X66B 2OIGA 5IHRA 5LBQA 2X5IA 1B06A 1US6A 3AG4C 4B3MO 2WZPP 1AYM3 2QWPB 1PP9H 2O57A 4EB6B 5KBFA 4NPLA 1VBD1 4P5HA 2X0LA 4FXGB 2RMKB 2RV9A 2ZTNA 1H4HA 5TISZ 4CDXB 4L8JA 2UXDO 1WWYA 4PQ9A 3SH5A 3CD6V 1MR5A 2OPKA 1DQ4A 4EN6B 5A7NA 3UKVA 4B1LA 2W08A 4QXHA 1SLIA 4IL7A 2DCTA 1SFNA 5FQ0A 1OA3A 1COV2 2D6NA 2VZRA 5DG1A 1C8M1 5FY7A 2P4EA 4DV7B 2IXCA 2SLIA 4OHZA 1TA8A 1SQVH 3DCQA 1J5EO 4CDXC 4Z8BA 1HJFA 2O0OA 2QSAA 4IEZA 1VBA3 3CWBH 4Z07A 4NIIA 5JI7A 4YVWA 3ZKUA 4IEPA 5LA1A 3RI9A 5CFCA 2JDNA 2VJXA 3HT2A 3O0VA 4XBNA 1ENVA 3OGVA 5DUUA 2B42B 1YJ9V 1Q8SA 5IFPA 2DTYA 3MDSA 5CA3A 1GZWA 1R092 2OPWA 4CUAA 4I4TB 5FJHA 4C1XA 3DPRB 2YI9A 4GYCB 1NE6A 1UYYA 4AEKA 5J3UA 1R1A3 1RUI3 3VD7A 3NJVA 3NJXA 1EZJA 1UZWA 1VP7A 3JSNA 5JJJB 2X29A 1MVEA 1FNZA 2EAAA 4LTAA 1BHBA 4FM1A 1D5AA 1WLTA 2AACA 1US2A 1DDLA 4Q4X2 2OIIA 3TEXA 2OYQA 1FXHA 3SYAA 3I55V 3ZMZA 2BSKA 4FPLA 5LWBA 1ZX3A 4NIDA 4Y24A 3HKBA 1B35B 1AYM1 1BCCH 5FY9A 3KMHA 5CA0A 4DR3B 2QQVA 3D0SA 4QHZA 2ZGPA 4JQTA 4LBMA 5DM6V 5FZGA 3OGCC 3FX7A 3D4KA 1FFXB 1QLEC 4X1KA 3ASIA 5A6QA 2Z2SB 3ZRWB 2A06H 1AX0A 1I6XA 3AB0A 2Y26A 4TUYA 3TNPB 1WJZA 4M01A 3IMMA 3WHTA 1OI6A 1PM7A 5IJRA 1RUD2 2FDGA 1C8M3 4AOCA 4RD7A 1V54B 2Q7HA 1VAKA 5C4WB 2OXBA 5K1PA 3SCFA 4JRLA 1XNDA 2RDRA 4W4LA 1HQWA 3GHMA 3I3BA 3H3UA 1JCHA 1M9NA 1VAVA 5AC93 1GLHA 4Z1VA 4XF0A 3VZMA 1YFYA 5HCHA 2ETEA 2B5UA 3T2QA 2UU9O 2XASA 3R66A 4Q8KA 5F2SA 1XOUA 2BERA 5A33A 3B5LB 4FI9A 3ABLB 1KP3A 1SLAA 2IXLA 4Z82A 2B39A 2DCKA 1ND3C 3JCIA 1UWWA 1JS9A 5ERLA 2XJSA 4IIJB 1M1KW 1XMQO 4LEJA 1IZ3A 4DUYO 1ZWIC 5FZ0A 2Y6KA 1BJQA 2VBPA 4WM7C 3SCHA 4JZGA 3RGBA 1SZXA 1WMXA 5JI9A 2G38A 4MUVA 3VBUB 2ZX0A 2BVBA 4RHV1 3H01A 3OBTA 5A3PA 1WPXA 1R093 4O9EA 4IV1C 4WBBA 5HCFA 1S0DA 3WB2A 2KG7B 3KV6A 3D0JA 4R8HA 5FYHA 2E3CA 4BIFA 5JVVA 1ULOA 2JGUA 5FYZA 4H7LA 1W2OA 4KWLA 1NCRA 1UOGA 5FPRA 2R30A 1GM8A 5F32A 5KMGA 4XFGA 1OH4A 4H7MA 3DC5A 2VS0A 1YFWA 4FP3A 1W2BU 3RWKX 4ISRA 2OS2A 4WVVA 1AXZA 2HWC3 5FO9B 1TME3 3VBHC 1Y43B 2P22C 3PVBB 4O2AB 5IATA 4E8CA 5DN2A 2C26A 3PN1A 5KUMA 1AL21 3OGRA 4KWUA 2VVFA 4W8JA 3WHUA 2YYOA 3NO8A 1A34A 1VBC1 4HKLA 4Y20B 1QDCA 5BNNB 2C2AA 3VD3A 2LFRA 5JXHA 4OI4A 3G6EV 3T1LA 3M1HA 3VKFC 3DYPA 2D44A 3M7MX 2BYVE 3LEMA 3RYKA 1SQFA 3B3QE 2ZGTA 5L3DA 2ZGRA 1XJAA 3A0NA 5A6ZA 4QPYA 4YFZA 4Q1PA 3PJSK 1K5QA 2LROA 2EIMC 4JDNA 3N7KA 3T1CA 1F2NA 3SH4A 4XUQA 2PGGA 3IN9A 4RYDA 2PQQA 2JDAA 4AI9A 1AJPA 2KA3A 3JZVA 5J2TA 1HB1A 3RZLA 3RWNA 1GNZA 4QXCA 3M8AA 2ZMNA 1JHNA 1CAUB 3VDDB 1FOD1 3VZKA 2VQFB 1FYUA 3N7LA 2JD4A 1UYXA 4DV4B 2G9ZA 1GP4A 4J1XA 1JU4A 4GKYA 3N9PA 1IS3A 3IC7A 2YU1A 1ZA4A 2IU0A 4FIPC 2ZGNA 5L3FA 4YGBA 5C8CB 1QJU2 2C9AA 4UVCA 1H0BA 1SERA 4E4HA 3WG4A 1OF3A 2D40A 3PVEA 4ES8A 5CKNA 4XF3A 5LGNA 4CP9B 4YM2A 2PHTA 1B6QA 1N33O 1MS1A 3EYPA 2Y4TA 3KZIZ 4QDRA 3ZLIA 4JTDB 3THOA 2QZ3A 1BXHA 1LB2A 4AE2A 4PA9A 2DYRC 4J1WA 2DVGA 3P32A 4BLJA 4DO2A 4RR3C 4X20B 2KB1A 3C7GA 4Q4W3 4X89A 2RM21 1AR91 3SLIA 5KC5A 5J9PC 1QF3A 5BXXA 1HN1A 1IQDC 4KGQA 4LK7A 3ZMSA 1JR9A 1RUJ2 2WFF3 2WPDG 1S0BA 2JDHA 2A6XA 2BGOA 2HHHB 1J3QA 3POFA 1FXKA 4I7ZB 5LGUA 1RM1B 5IVFA 1W0JG 1K5JA 4XFCA 4ASUG 1QNMA 4PDWB 3AFKA 2EA7A 4CP2A 1XSRA 3T09A 4E27A 4MSWC 3W5MA 1XE0A 3BIEA 1H2GA 1W8TA 3STLC 3ZXLA 4ZOLA 4XDQA 1W6NB 3VDBA 4IE6A 2ITDC 2VZQA 4LE3A 1MSDA 3WCSA 4XZUG 1Z78A 2BQPA 1YZBA 4EQVA 1AR92 3ZSMA 5IT6A 1XUQA 4GWMA 2V4VA 3I59B 4P9GA 5F1RA 3PTYA 3RS6A 4QM9A 4GKXA 5EZYB 2HVKC 2UXCO 2XAHA 4MTXA 1RUI2 1YITV 4QU1A 5IYDO 2BGCA 1ULCA 3DXUA 2HWD2 3WF2A 5HV0A 4CXYA 2HEVF 2UU8A 3KGLA 2O14A 3T2TA 5FZDA 1QBZA 5JJNB 1W6MA 2YROA 4B4RA 4FSJA 3ZN6A 5T52A 5FOBB 4QKFA 1MZ5A 4Q4W1 3QVNA 2RM23 1NS1A 1BVVA 1IBLB 2ZX3A 4N43B 3CRCA 3S5AA 4XCBA 4Q2FA 2WFF1 5FKCA 2UWAA 4CDWA 4XPVA 4LOSA 4Z92B 1THZA 1FYJA 4DUXA 5GLZA 1YIPA 1N4CA 4N23A 2DUQA 1CN1A 5JZGB 1KRIA 1NJIW 4IETA 1YQCA 4JTAB 1MEC3 2LALA 2VCMA 1B04A 4FFBA 3CS5A 3ZVXA 2WO3A 2BW8A 2CTQA 4F6RB 2VVDA 2VH9A 3SEEA 3AYAA 3JQXA 1WAZA 3ZIAG 2X05A 4DRXB 5JR7B 3LWCA 3LB9A 3BVCA 1W6OA 2GAUA 2WS92 1L3JA 5FKBA 3ZFGB 1I5YA 3HKCA 2XJQA 2IXHA 1AZDA 2YHJA 4DR4O 3LSQA 4YZ1A 1HQLA 4FBFA 2Q7EA 5FMOL 3AKPA 5L9VA 4X88A 2NN4A 3ZIXA 2I74A 5E8AA 2Y60A 5FZEA 5EC1C 3CJHB 2E31A 2X10A 1R083 4L92A 4AHYA 5E1RA 4GWIA 1XEQA 5EBWC 4BIUA 2EZOA 4JI2O 3USSA 5CFCC 1VF6C 5IJ0A 3KGZA 4RR3A 2R16A 5LW9A 4JYYA 1QHTA 4AEJA 3SGIA 2E32A 2RNBA 5DZEA 1N36O 4GMP0 1REFA 3APQA 4N53C 3UGGA 1L7RA 3AZYA 3WCRA 4H13B 3K5NA 5FLXN 2IXIA 1MEC1 5CFDC 2JB8A 4FTEA 4O4HB 1O4YA 4JZ2A 5JMCA 5AG2A 4F6RA 1VRH3 1W6MB 4WCEV 5B1BC 4H2AA 2J1RA 1QJX3 3TYJA 2Q8CA 3OYWB 1VP6A 4BQ5A 1S5LZ 2QWNB 1Q6IA 2HEPA 4LUKA 4QQLA 1EAH2 4COYA 4FLUA 4U3JA 5FMBA 4RHV2 4TTGA 3ZHTA 2ZAHA 1N34B 2QFEA 1CAXA 1WCDJ 3NW4A 2J1TA 2R043 2E7QA 1L8DA 1ST8A 2ZD9A 3VQWA 1ENXA 4AZZA 1NCQA 4OI1A 1YFUA 2VOXA 5FLIA 1HB2A 5GM0A 2WLHA 1U5IA 5JOZA 2MHFA 5GALA 1PMJX 3VBFC 3JASB 2X6AA 2IZWA 3CCEV 4I50A 2OZ6A 3N9LA 5L7OB 1N0NA 2ZNIA 1R081 2HWE1 5D5QA 2D97A 1PHMA 2VMEA 3TB0A 3JBG2 2VUAA 3H1JH 4WVMA 2WZR1 1FXZA 1GUIA 3CJIB 3O1OA 4IE0A 3K77A 3KLSA 3HR0A 2ZMLA 5FRAA 3F7VC 1PNGA 1LOFA 1OPOA 1RHI1 3U07A 5L9BA 5BV6A 5KAFZ 4LKDA 4QPGA 4LXLA 2G9GA 4DV6B 1K45A 1IKPA 1WD4A 5I0SA 4AXOA 3VZNA 2QR4A 4AQYO 2JEUA 5LXTA 1CZTA 2XAJA 3Q4HA 4KWJA 3VHRA 3AG3B 3MO4A 1PIV3 4YPJA 3ZDSA 2DUPA 1VRH1 1IBMB 2P3IA 2G1MA 4LHSA 4U36A 3K4AA 4M00A 1QJX1 3LDBA 4D6TH 1OJHA 3GHNA 2ZGUA 1M4UA 1F8VA 4ZOLB 2WC2A 3DGEA 3B94A 2WFF2 1GN4A 4CBCA 4AVSA 2A1XA 3IPVB 3T2MA 1O7FA 2R041 1W59A 1LEMA 4GXLA 1O3TA 3RZZA 1QDOA 3R4DB 3BY6A 3UT5B 3NJZA 5LYJA 3WP3A 2HKXA 2QKSA 3NMBA 2PY5A 4K8RB 2FZ1A 2RR12 1SQQH 3SJQC 2PHLA 2OZJA 4E2LA 5GJ6A 1KMIZ 3HB3B 2HWE3 1J1LA 3OSDA 3LSEA 4I9WA 3NQHA 4LBNA 4QXKA 5EBLC 4NXNB 3DEMA 5FIXA 4AWDA 4LHNA 1PO13 4MTOA 1ONAA 3WEZA 4P9OA 5IVBA 3HBKA 2CH7B 3RYCB 3MPPG 4FP2A 2EIJC 1PNLA 5A32B 2PUSA 3MIHA 1EBOA 1AVMA 1REDA 3IDAA 1ZL8A 3LFIA 4XC9A 5A3WA 3GZAA 5FXVA 1S0JA 3T1YO 4MO3M 4B3RO 4NWVA 3BRCA 2Q8DA 5H6QA 1YQ8A 5KHGA 2Y0IA 4CCJA 3OR6C 1S55A 4N53A 2VWKA 4IGQA 2DYCA 3S7EA 5KWRA 2NYYA 1FMD1 1FFXA 4X1KB 1MZ6A 3JATA 3BA9A 2N04A 4XJZA 3AZVA 4IGOA 1COWG 4DR5B 3MUY1 2EIEA 3RJRA 5GLVA 3PJYA 3UV9A 4YHHB 5SV5A 4BDVB 3E6BA 4JV5O 2WSSG 1B09A 3CE2A 4BXSV 2YU2A 4AGGA 3WZ1A 2WNOA 2CWSA 3FBMA 4E9KA 5JVDA 3CRRA 3LA3A 3P5BA 5FZ8A 3R4SA 1NAEA 1BCXA 3NNLA 2VECA 4E2GA 2WINB 4BAYA 3T0AA 1O5UA 3ZPYA 3BFRA 5FZBA 4YZ5A 4QNHB 4GB31 3ZHSA 4GKKB 2QZ2A 4AI0A 4CE8A 5IWAB 4EJRA 3LD8A 4EV0A 1RIRA 2DTWA 2RDQA 3K04A 1P49A 1SBDA 1V9U1 1PNKA 4XFBA 2YPJA 4FO9A 3KB5A 4XEZA 3B69A 4RWUA 2ETNA 1ASJ1 2IM9A 5LMUO 1A32A 2OA2A 4QPIC 2PF4E 5DUVA 3BTYA 1G86A 3AL5A 2QTWB 4E4EA 4PIXA 1UQXA 1AI5A 4DV0B 1VQLV 1HP8A 2EX3A 3RWRD 1FMD3 1QOOA 1F7YA 5LP6B 1K5MA 4QU2A 1DQ6A 4N90A 1YRZA 4CU9A 4LFCB 2W68A
chains in the Genus database with same CATH topology
4QM8A 1IKQA 1CPNA 2B7YA 1S2KA 2Q4SA 4PLMA 2WSVA 2GU9A 4A3XA 5LK5A 1SQ4A 3JU9A 4D7YA 3ES1A 2TNFA 4XIOA 4CDQC 1OOPA 1TMF3 1NCRC 3VL9A 3SMHA 5EXOA 5HCAA 1VB2A 5H9QA 3PVOA 5F6LB 4TSVA 4BM8A 1MS4A 4Q0SA 3ZFFB 3AZZA 5DDJ3 1ZYBA 4BG1A 5C4WC 1GKBA 2BWCA 5L73A 4EWDA 4LBQD 2XWJB 4FVVA 1MZFA 3VBOA 2GZWA 1C5IA 4M27A 1NCQC 2BWAA 3TNQA 2VW2A 4OUSA 1PGW1 5CU1A 2ZKLA 3ZFFC 4M26A 1X33A 3S7IA 4MZUA 4FPHA 2FHRA 5BPXA 3G7DA 4RA0A 4BGKA 3AM2A 1AL22 5EFUA 1UZZA 4XQWA 5DZGA 3ILFA 3NSTA 1A8MA 1IHMA 1RJ8A 1HKDA 1D0HA 1C28A 2VQ0A 4Y22B 3N4MA 3MS5A 4XFAA 2DUOA 2E63A 2RS11 5AFBA 3NV1A 1COV3 4C91A 5FO8B 3AMQA 4QQ2A 4D69A 2WL1A 4AQ6A 1FV3A 1AR71 1WW5A 4HPKB 1CQ9A 3W58A 5KHKA 1KFXL 2X8KA 1OOPB 3FFZA 5FAXA 4F3JA 1QY4A 4IEQA 4FPCA 3TN92 1UMZA 2WIIB 5F6KA 1O91A 4YSFA 1N1TA 1VLNA 4AQ2A 1MQTB 1LCLA 2N7GA 3WXPA 2CYFA 3OTFA 3PMEA 3ZXGA 3K48A 3ES4A 1LTEA 3ZXAC 4DY5A 5I0UA 1OQEA 1AR62 4G9SB 5BNOB 2XVLA 4TYSA 4Q4W2 2OVUA 4UW6A 4HANA 4XQDA 4BOWA 3S6PA 4OULA 5KXBA 1G9DA 3TOJA 2GMMA 1JYIA 2A5ZA 1TME2 2ZHNA 3AP7A 3D8CA 1YHFA 4E4SA 3RMYA 4IEWA 3ZXEA 3KT7A 1HXS1 3PHMA 2GSYA 4QPGB 3AMNA 2OYZA 4Q4V1 4FOQA 1UX6A 4HBNA 1ZM1A 3SXWA 1GQHA 2TUNA 4ITCA 2A6WA 1NY71 3PNAA 3ILNA 5BNPB 5C33A 1DQ2A 1MEC2 3E5QA 3O0XA 4XMAA 2XH6A 1ZZBA 4CP1A 1RUG1 1EAH3 2VMIA 2Z69A 1WMEA 3H8UA 4FT8A 3MIDA 3N6WA 2UWBA 4J6GA 4QGLA 1YO8A 2XHKA 1YLLA 1XNCA 4ZXKA 1R091 4TWTA 2KXLA 5FLJA 3I54A 4XQ4A 3HAGA 4AHXA 1JYCA 1XYPA 3POSA 1TMF1 4Y1UA 3OJBA 4I09A 3EXUA 2ZHKA 1LRHA 3TAYA 4LBKA 2WJSA 4C0BA 3VBUA 2DVDA 1ZRDA 1ZBA2 3V15A 4YGCA 1QJY1 4YM1A 4HVOA 4CDQB 5JOWA 4DRVA 2JENA 5EZWA 4DMIA 1XE7A 2PA7A 4Q0VA 3AJYA 5C8CC 3WINE 3DV8A 1G6NA 2JG9A 4PCRA 3BIWE 1UW8A 1AX2A 3WVJA 2HWF3 4AI8A 1DS0A 5C9AA 3WW2A 4W65A 1KDKA 2B9UA 2ILMA 4HL0A 1SCRA 2GH2A 3I7DA 1DGWA 3CEWA 3TRSB 1O5LA 4XBQA 3NWKA 2VPVA 4XE9A 3ZSKA 1FMD2 1ZZ6A 3CNAA 1COV1 4LHLA 4V1PA 5ABJB 1N47A 4QX5A 4X8PA 2WNVB 1OLRA 1RHI2 4K8FA 1NXMA 2YV8A 4XHBA 1GFF2 5T5OA 2ZMKA 4EN8B 2ZX2A 1KQRA 2NPIA 1S0GA 4YVWC 2SBAA 3ZN5A 3GF6A 1WW7A 4FTBA 2HWE2 2EXHA 3GYDA 3NV2A 2RS52 3J9SA 5K9YA 3SWTA 4CEYB 4HK8A 3PJQA 3AZXA 2PLV1 2VGDA 1NZCA 4MYEA 4FOYA 4MXVA 1V70A 1VBC3 4KG8A 1KJRA 1OQ1A 3IT8A 1JXNA 4DB5A 1RUD1 5KXDA 1LOAA 1OMIA 4QGNA 3WQ1A 5BNQA 1O3SA 4IV3B 2PHDA 2D5HA 4GIQA 4I30A 1VZ5A 5AC92 3NV4A 1OTJA 1WBLA 2C1FA 2MNGA 3DKWA 3QCWA 2PN5A 4XJAA 2QUOA 1PVC3 4RQPC 2EAKA 3WUDA 5FBZA