3OD4A

Crystal structure of factor inhibiting hif-1 alpha complexed with inhibitor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
342
structure length
342
Chain Sequence
AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Crystal Structure of Factor Inhibiting HIF-1 Alpha Complexed with Inhibitor
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 342
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3od4A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3od4A01
2YC0A 2WA3A 1H2KA 4B7KA 2Y0IA 2CGOA 4BIOA 2XUMA 3OD4A 4Z1VA 2WA4A 4AI8A 3KCYA 4JAAA 1H2LA 4QU2A 3KCXA 2W0XA 4NR1A 2YDEA 3P3NA 2CGNA 3P3PA 1MZEA 3D8CA 1IZ3A 1YCIA 2ILMA 4Z2WA 1MZFA 5JWPA 1H2NA 1H2MA 4B7EA
chains in the Genus database with same CATH superfamily
2CWMA 2D6OX 2R1BA 1FXZA 2YEVA 4HOOA 3ABZA 2ZR3A 5A3UA 1WCKA 4QKDA 4LC1A 4Q4X2 3UJQA 1W2BU 2C26A 2ENRA 1AYM3 1SDWA 1K5SA 1K5MC 2IUWA 1NQDA 1TMF2 4NJ4A 1RUG3 1GOGA 1SZTA 2OCCB 1YSCA 1SPPA 2FDGA 1UYYA 4M0NA 1H4HA 4AHWA 5IYCO 3OGGA 1S5HC 4DO0A 1GH6A 4QXKA 4PDWC 4B3MB 2XJSA 3NL1A 4YSFA 1QXRA 2CE4A 1VQLV 5IUQA 2R072 3WNMA 5CIRA 3B4SA 3KHCA 4GQ7A 4N21A 1DF0A 1DYPA 3UGHA 5E1AC 2W39A 4GLXA 2ZMNA 2OXBA 1KXGA 5AFBA 5J2UA 2WNVA 4KGQA 1WN7A 4QPWA 1VAVA 3WG1A 3VBRC 2QNKA 2WA4A 4LA3A 2WNUC 4Q2FA 4LKDA 2H0VA 3Q4HA 1H6YA 2GDSA 4H2AA 4KG0A 3L2HA 4N53A 5CB4B 3Q9OA 2E63A 1HDJA 1C5HA 4DXZA 1XSRA 3ACGA 4GMP0 4CDUC 1WLDA 1VBE1 2QQUA 1Y9GA 3T4VA 4D7YA 1QMJA 3EFFK 3ES4A 1O9GA 1SLAA 2Z5UA 1OCRC 4K7JA 4DRXB 5GZCA 5BNPC 3LIHA 1NXD1 2UXCO 1UMIA 1KECA 4R9AA 3FB7C 1YHQV 1XPWA 3D3QA 1MZ6A 2ZA9A 5FPAA 5K0UA 4Q4W1 4JI4B 4DUYO 1MSWD 2IW5A 1Q6IA 3WDWA 3DN7A 3HOBA 1ULOA 1AR91 3E8GA 2P67A 1K97A 4PA9A 4JAAA 2UUCB 3HWJA 1K12A 5C6CA 3POWA 2ETEA 1WA4A 5FZCA 1VRBA 2GUZB 2ZGKA 1EM1A 4XUNA 5J2TA 2I45A 1S0BA 1Q8PA 3CHXA 4IE5A 4O4LB 4FPLA 4EEQA 4DUWA 4RHV3 1VIBA 3ZYJB 1W05A 1H1MA 4PT6A 2YIBA 2TEPA 4FTBA 4MX3A 3NKTA 3OTFA 3O1RA 3R0RA 2CK3G 2VWJA 3SITA 1SFNA 3IM0A 2ZZJA 3ZM8A 1VQOV 2QM4A 4XETA 4QQHA 3APBA 4TV8B 5CA0A 3VBFB 2PLV2 3J26N 1KYOF 1XBLA 1Q8VA 4ONUA 5FZDA 4YZ1A 3AXEA 1CD3G 2LW7A 2ZEZA 4IV3B 4XFIA 5FYMA 4XPVA 3TEXA 2VBDA 3S30A 2NPIA 1UYXA 3E86A 4COYA 3SPJA 4NHXA 3N2KB 3LCPA 4LF8O 3H01A 2A3WA 4L9BA 1JR9A 2YHJA 3BA9A 2XMLA 1W9SA 1W8WA 4A45A 2UU9B 1AF9A 3MIBA 4IHJA 3QD6A 2CUGA 1SQVH 2O8QA 3WB1A 1PM7A 5FPVA 1RUF3 2HWC1 3K4AA 2RS33 2YV8A 3ZXEA 3LZZA 3RYRA 2Q4PA 5FZMA 1FPOA 2Y6JA 1ZUQA 4W6WA 2DYSC 3Q8CA 1VF5B 1BS3A 2F95B 5F3EA 5D5PA 3FX7A 3H1JH 1RUJ3 4ABMA 2RMU3 5JOXA 2JE9A 1RUI3 3LB9A 1WLTA 2HP8A 4B4PA 1UZYA 5JXGA 5FQ0B 4BOWA 4E4EA 3STZC 3TOJA 4D7SA 4EZHA 1YHFA 3K57A 1K8AW 1AVMA 1QNYA 2D98A 1AR5A 3VLBB 2BVVA 4TWKA 4B7EA 1J59A 3ZXAC 3K5NA 2XJQA 2BV4A 2YFZA 3PU8A 4CP1A 2DW4A 4UT5A 4GALA 1NI8A 4Q4V1 1GP5A 3MHSC 4YRDA 5JZGC 4PJYA 5JVVA 4I55A 5LP6A 4K8XA 3QO5A 3OTOB 3KF5A 1UOGA 1VE0A 3C7FA 1NCQB 5M0TA 5LEKA 2ZX2A 1FX5A 4Z2WA 4IEWA 4XJ8A 4K35A 1BQZA 3OUFA 1SFPA 2VUAA 1UY0A 2ARXA 2DTYA 4HT1T 5L9RA 3ORJA 2BE3A 5CFCC 3TCUA 4DV1O 2Z4FA 1OC1A 1JPXA 2QKCA 1O91A 4H55A 3S5AA 5KX5A 1GUIA 2RMKB 3IC7A 3SGIA 1FMD1 3MLKA 4DR6O 2A7WA 4QU1A 3O1PA 4COUA 2JJ2G 3N2GA 2ZABA 4HKWA 4FTSA 5ERLA 2HWE3 3JD4A 2NN8A 2BOBC 3FAVA 3AKRA 5FZ6A 1AX0A 4MGYE 1NX9A 3D6EA 2Q8OA 4LK7A 2ZHMA 3HBZA 1NTMH 2HR3A 1EAH1 2E75B 4OMDA 4IUGA 3BFRA 4MHRA 1HN0A 1LOGA 1H6XA 3BALA 3CPWU 3LNNA 4YGDA 2D5FA 3E89A 3ZMZA 5F6KA 1SDDB 1WB8A 2RR12 2VO5A 1A6CA 4XJUA 3OR7C 4X88A 4YW4A 2B7YA 4DPNA 2BTVC 3WG4A 3OUHA 2RN9A 3F7VC 2QM7A 4ARYA 1NH2D 1H2NA 4B3MO 5BNNB 1US2A 1CR7A 5EJ3A 3QO8A 3AMQA 4B3RB 3MHZA 3AYAA 3OMIB 3LEKA 4RN5A 2E53A 4PLMA 1O4YA 3AJYA 1DG6A 4JZRA 2VBPA 4QDSA 1A3KA 1QVGU 3AYDA 5CYYA 5FPZA 2JDIG 3TEZA 2UY9A 1B04A 2PY5A 3IPVA 4CXXA 4E4ZA 1CVNA 3SDLA 2W2IA 2R061 3JALA 1FOD3 2JB4A 4LFCB 1ZTEA 3UNPA 2Q1MA 1LR1A 1OZ0A 2YUAA 3THTA 3E5UA 2EINB 4AHZA 3DGTA 2ARHA 4MGSA 3ABLB 4AEMA 3WNPA 4XQDA 4D69A 3SH5A 4CDWA 4Z1VA 2BNNA 1FPN1 5L9VA 1RHI1 4YJ3B 5C9AA 5LA6B 1GP4A 1ZBA1 5FZFA 4UFHA 1RUE3 1S2BA 3T1LA 4WBNA 3SPIA 3JB8A 1RUH1 4JKLA 1BT8A 5FZOB 3EHKA 4JI4O 2IXCA 3VUOA 2WNVC 4META 1MABG 2IM9A 2IJKA 2UUCO 3V56A 2RJKA 4JDNA 5FY5A 2A70A 3RWNA 2PFWA 4XHBA 2VQFB 4L92A 4CU8A 5C8CC 4HXCA 1ST8A 1PL4A 3E5XA 2FMLA 2NN4A 1ZZBA 1GMMA 4I50A 3VD4A 1WGPA 4NRMA 2ZE6A 2HYKA 4E2QA 3FBMA 2RG4A 3S0MA 1TG7A 2JEMA 1DQ1A 1ZZ8A 4M00A 4JRLA 3POEA 2VZUA 1NY72 2WLPA 4KGGA 4Q4X1 5A1LA 4TUYA 5JIUA 4Q20A 5GLUA 2XJPA 1W6MB 1R6KA 3DEMA 4M3CF 1YIJV 4DR1B 3JAWB 5FO9B 4DXWA 1GKBA 2QEXV 3M70A 3B09A 4DV6B 3I59A 4OULA 4KU8A 2G4IA 1RUOA 4URAA 2R071 2G19A 3Q8EA 4MVTA 3ZSJA 2Q69A 1O5UA 1N36B 4E27A 1AR73 3Q8FA 5D8AB 2UU9O 1UOBA 4CDXB 1RMU3 3MPBA 3WQ7A 1YF2A 4MG2A 2HBUA 4GKJB 2GDFA 3M7AA 4ZZ5A 2IH1C 2WO1A 1IQDC 2A3YA 3V0BB 1AZDA 2WJSA 5BUVA 2B42B 3LKJA 4OUEA 4Q4Y2 1PMJX 4BWAA 1M5IA 2Q0OC 1MPXA 2W1WA 2ZGOA 4DV0B 4XFGA 4CDQC 1NS1A 4TT3G 2UUAB 3A4UA 3SNMA 4YW3A 1I1EA 1Z7S3 5FMOS 3ZX7A 3AZZA 1WLCA 1KGYA 4U3JB 2WYSA 2A06H 2ETNA 3ZN5A 2XTAA 2EA7A 3T08A 3WDTA 4GX5A 3FKSG 4LTAA 2RM22 2Q7HA 3MIDA 5F1RA 2VZ1A 2VGDA 1AI5A 1W28A 1H8TC 2CNAA 3ZXGA 3N27A 3P3PA 2P3JA 1HW5A 4WVMA 3CCUV 3M4FA 3SC7X 2X7RB 1LHWA 4YARA 3J4UH 5GZGA 3SYAA 1AL0G 5GLVA 3CJHA 3HKCB 3USSA 4UV9A 1W9WA 1WWYA 5FUNA 4E2LA 4O2BA 2VXJA 4XBNA 2WC2A 2P3KA 4QPIB 4WM7A 3KV6A 4C8DA 4DK1A 3N7JA 1G7YA 4ICGA 3HR9A 3H9VA 4KXRA 3OTOO 3K0GA 4LJHA 5C8YB 4BQ2A 3AMMA 1ZVFA 2VXRA 4A42A 2WDBA 4DEQA 1K3EA 2Z0AA 1EY2A 2XOMA 3AJZA 3CC4V 5JDBA 1DYOA 2YC2A 3SMHA 3H8RA 3PIGA 4CBCA 1NE6A 4J11A 4PI0A 3AG4C 2PHFA 3RYIA 4Q27A 2JE7A 5BNOA 1US6A 4MADA 4QHZA 2IZWA 1ZL8B 1BHAA 1VQ7V 4JHZA 3QTCA 2R72A 3QNEA 5CBHA 1Q8SA 5FZHA 2W52A 3AG2C 2WLKA 4NAMA 2PLV1 4M3CB 1SCRA 3IKWA 4JGZA 5CB7A 5GM0A 5GZEA 4BMEA 3HMYA 3WINE 2ZAHA 1TVGA 1AUYA 2Q67A 1YLLA 2A6WA 1KB9F 5LP6C 4J42A 3BTXA 5KAFZ 4HKLA 1V9PA 1H1IA 1H0BA 1DHKB 3FUOA 4IQPA 1LU1A 4UFZA 1IGOA 5CMUA 5C8WA 3SYQA 2XAHA 4MVRA 2ZMLA 3H3LA 3TETA 5H6RA 3MW3A 1JZ2A 4Y3OA 3ASNC 2WL1A 5FPBA 2X09A 5A7NA 4GXLA 1AROP 4B3RO 5DECA 2XOKG 2JX9A 4ZI7B 1ZYBA 1J5EB 1CP9A 4WZFA 1BQ0A 2ZZQA 1CAWB 2JDHA 2OWOA 5EZWA 4Y5SA 4LBMA 3GCWA 2JGDA 5AFEA 4XBFA 2JB8A 3ENRA 5CAZA 5HI0A 4UVAA 5B66Z 3RFRA 2IC1A 1MA1A 2W5FA 1ZWIC 3J8F2 4AVAA 4GH4A 1WP8A 4YM1A 3S3XA 1AXZA 4O4JA 2P6JA 4LFCO 5D2AA 4Y26A 1ND3C 2SLIA 4UV8A 1YNAA 3IGAC 1DYKA 1D0GA 4LNUA 2VQAA 2HKOA 3R6SA 1H8VA 1VQ9V 1Q5OA 3N9MA 4A44A 2FCVA 2QTWB 3JCIA 1D5AA 2JGUA 5KXEA 1GRJA 4A3XA 1WBLA 3KGZA 5LXTB 4EN8B 2WABA 3B69A 2WZR2 4W65A 4JZ2A 4OHYA 5A33A 4BM8A 4FPKA 3TN93 4KBZA 3KVAA 2YSUB 2WO7A 1IHMA 4PA6A 3JQWA 4I01A 5FREA 3PJYA 5L19A 1QBZA 1TME3 2CL2A 5GLTA 2QBXA 1HRV2 3EXAA 3IMNA 4MS2A 3B02A 5FP8A 1NXMA 3O1SA 5FY1A 5LOVB 4K40A 1D5NA 1D0HA 2VCAA 4IGQA 1GP6A 3GZUC 3HJRA 4FOYA 3ZVXA 2ZE7A 4KU7A 2ZR2A 4QAWA 4I5SA 2AZ5A 3CCJV 3ZHUA 5FNVA 1VQKV 1VRH2 4X6RB 2GZWA 4XAAA 2UY8A 4H3WA 3CEWA 4FLUA 3O1TA 1XNRB 2WWUA 4LOTA 4P02B 4OQ9A 2MNGA 2EULA 3TXQA 5C9AC 2BUKA 4MGKE 3INAA 4KFMA 1W9FA 4XBLA 1R64A 1L8DA 1V6JA 3NV3A 4RQEA 1U5ZA 1VMFA 1JFFB 4Z82A 1VMHA 4O9GA 1GZWA 1D4M3 5FMDA 3KGLA 4P00B 5F5AA 2ZGPA 2RR11 3WNOA 1NR1A 1I5XA 2ZX4A 3LD8A 1HV1A 3I49A 4XF1A 5IJ9B 3SLIA 2J1VA 3VDDA 4DV6O 4HMZA 5FFOC 5LMUB 4WM8B 2NR5A 5F7UA 1K7DA 1LHOA 1OJHA 4L99A 4YVWC 1PVC3 1RUF1 3WW4A 4JAVA 1OD5A 2RS31 2QDRA 4B29A 1AR83 2D40A 1QGLA 1UZ0A 4YIOA 4RR3B 2F4LA 1FXVA 1Q3EA 1I08A 2D6MA 3I3QA 1N36O 4CVUA 1CAXB 1RL3A 3K2OA 2RV9A 1J84A 4GKJO 3AKTA 1JU4A 4BQWA 2VC9A 3LSUA 3SISA 2VG9A 1XMOB 2RMU1 3W7SA 3VL8A 2D3OW 1MSDA 4YVSB 1C8M2 4KI5M 4LNVA 3AYEA 5AC92 1BVP1 3M8AA 1U5IA 5JOZA 1X33A 3E8HA 5C3PA 3CD6V 1VF6A 4JC1A 1W8OA 3LFMA 4DV0O 1DGSA 1PO23 2UUAO 1XBFA 2X6AA 1V6MA 4EYUA 3N35A 4Y5TA 5KLVH 3ZFGB 2ZXWB 2XVKA 2VR4A 1SETA 4CSWA 5L73A 1QOSA 2IXIA 3J7LA 3I8TA 3ZMSA 4X1YB 3I2HA 3RYKA 1OXCA 3ALQA 1HB2A 4DR4B 5E79Z 3SCGA 4GD4A 2I2SA 3BB6A 4FLXA 4JTDB 1OCCB 3ZMOA 4HN0A 5JCOA 1UKGA 4WFBV 3ZYGA 3PLQA 1COWG 4E4SA 4CEWA 4ZPIA 2W94A 2DVFA 3NAPC 1BMV2 2WSVA 1REDA 5IT9N 1GMGA 5KXCA 1JHJA 4AQYB 5FLIA 1O3RA 1NVPB 2LTNA 5KR7A 2IFWA 2HKXA 3FFZA 4CCDA 5FWEA 4E8DA 2WSUA 5FZIA 1Q43A 1OKOA 4KUMA 1LRHA 3HD8B 4A2UA 4MLOA 2D97A 1NY71 2WLLB 4HBNA 1O59A 2EIMC 3O1MA 4A3ZA 2HWE1 5FP7A 4FTEA 4DW1A 2DUPA 5T5OA 4DYLA 4D3WA 2QJVA 3MUY1 1V9U3 3VBRB 2WNUB 1YQ5A 2FDHA 5CN0A 3ZYRA 4I3PA 4BQ5A 2VU9A 1IX9A 3WFVA 1Q6UA 3SR2C 4HYOA 4WBBA 3GBGA 1K3IA 2XUEA 4QNHB 4XOGA 5EJZB 2A6XA 4G4FA 4CS2A 2LW1A 5LY2A 3AZWA 4RUFA 1ALYA 4K1ZA 3GF6A 4LBEC 1F7YA 3CXHF 1XRUA 1OCRB 3VBHA 3IAQA 3BOPA 2P22C 3CDZB 1RXGA 1OF3A 3WQBA 3HIFA 5B4XA 2BZDA 2B4KA 4CEYC 2XDVA 2CHHA 1OI6A 4O4HB 1RM1C 4AI1A 2EXJA 4LBQD 3W5NA 3VBUC 1JI6A 1F23A 3LPGA 4RS5C 4NXNO 2VMDA 4LBNA 4QX0A 4Q0SA 1FJGB 1ZRIA 5IYBO 3CE2A 4O2AA 1VBD2 2X5IA 2RM21 4IE4A 4CXYA 3BPZA 5AG2A 1YFXA 3ACHA 1OLME 2PHWA 1AL22 1D4VB 4Y33A 4WVVA 3U78A 2WO2A 3TEYA 4BIOA 4FT8A 1YJNV 2OPWA 3KS7A 1IPKA 2B9ZA 2HEWF 1HW7A 4N23A 5FPOA 3P6BA 2ADEA 1ZBE2 4KP4A 4ZOLB 3IIIA 3PJSK 2HYXA 3BODA 4XXAA 1ZZ6A 1OVSA 1FNYA 1DQ5A 3S7IA 1E5SA 1F35A 4KBBA 4LH6A 4NTXA 2GC2A 4XUQA 2VCMA 3QOPA 2XBO3 3M3OA 5A32B 1YIPA 1LESA 5CBFA 4HSLA 4NO4A 1VP6A 3RMXA 1JZ8A 4J9YB 3WDUA 4B1LA 3H8OA 2DOSA 3OUIA 2JKBA 4IEQA 1QIQA 2HWF2 4XCBA 1REFA 4MO3M 5H9QA 5JR2A 1JYCA 4W4KA 1R083 5FXWA 5B2GB 5FYBA 4UW6A 2D3PA 3ABTA 3M1HA 2WUHA 3RRDA 4PDMA 5LZ6A 2BSKA 4X65B 4P08A 3CJIA 2BGCA 1ODMA 2Y6HA 3H8UA 3CSXA 2PYLA 2A73B 2NZ9A 3ZSMA 1PO13 1YDXA 3VZNA 2XKOA 1XNRO 2XL7A 1SLIA 1NCRB 2RS53 1O7FA 4Y4RA 1POV3 1PNLA 1L7QA 4CU7A 1DK1A 4W4ZA 5L7OB 1ZZCA 1DF5A 1DF4A 1GBGA 3FWEA 4XUOA 2WA3A 4O9EA 3NVCA 1S1AA 3L73H 1W3XA 2YXYA 3H7YA 4FOVA 5FZLA 5ABJA 3VZKA 3KG2A 3LSEA 3C3SA 2HWB2 4F4LA 1ASJ3 4XURA 4YG6A 1AR71 4IGOA 3T2OA 1RMU1 5LMUO 3CRAA 4H33A 4NN0A 4M0HA 5G04L 2Y4TA 4FFFA 3UCSC 1Y9MA 2WRAA 4FBFA 2BFUS 3KCCA 1L0NH 2E3CA 1H38A 1IZ3A 1GK9A 2HBTA 2C5DA 3AMNA 4XXPA 3POFA 1HNZB 2H6CA 4GB32 1ND2A 3UV9A 4RAIA 2FB5A 1IG0A 1XYNA 5JZGB 1HR0O 1PNGA 4OFGA 1M4UA 1Z7S1 2Q9LA 1G9BA 1PZ9A 1XMOO 3DXRA 4FLZA 1JOBA 4IE0A 3LNMB 3I2JA 4DMIA 2JK5C 3J8F1 2BOIA 2H3OA 1SLBA 3RI8A 2C1FA 2IXLA 4RQPA 2WBKA 4XTPA 4Q8KA 5B1OA 4UB6Z 3ZCCA 4LO6B 2W6IG 1A78A 2X0LA 4WVWA 5A7OA 3CC2V 4BQ3A 2E33A 3RJRA 3H3UA 4GIQA 3VDDC 3BHPA 1COV3 2MEV2 5EBLC 4PA7A 3HNYM 3K75B 3O0XA 3B7MA 5FJKA 3OBTA 5A7PA 4I09A 1IURA 5F2VO 1NG0A 1VLNA 1O3SA 4OCTA 3E8BA 1EN4A 1RJ7A 1W9YA 4R9BA 1AX1A 2OYQA 3RYHA 2WZR1 4A7KA 3GJBA 1P49A 1SQBH 2BPA2 2QA4V 4NMIA 4MVOA 4QPGC 2XLGA 4CP9A 2LM3A 3TK1A 1W0JG 4FVMA 3CCRV 4KWLA 1X50A 4AE2A 1O3TA 1AJPA 1QJX3 4ATEA 3ICXA 1HRV1 1R3KC 5DN2A 4MVSA 4LFBB 1GSLA 3THDA 2G9FA 3E8FA 1SKVA 3ASIA 4LEJA 1XL4A 4J80A 4NIIA 3MW2A 5KMGA 3DPRB 3KQ4B 1AJQA 4AQYO 2JIGA 1SQ4A 3I2DA 4JQRA 3POGA 4B4RA 1VRH1 4C1XA 3ZSLA 3WZ1A 1S55A 3CU7A 3HNBM 3FHQA 5H9CA 1WKYA 3DYOA 3C2UA 3W7TA 5JJEB 4PQQA 3H50A 5ISLA 3ILRA 1VBA2 1FATA 4EB6A 5EYPB 1W2AX 2EXKA 4CUCA 2W1SA 4A6OA 2VNVA 4A5UB 2Z3YA 4COWA 4LCUC 2N05A 4ATFA 5BMVA 4KWKA 3WP6A 4EWDA 4R8HA 2GH8A 4MXWB 2BERA 3PVNA 1NCQC 2EF6A 1EV12 1C3HA 1UD1A 2YEVB 2VW2A 2C0ZA 2WINB 5ACA2 2BP6A 4WFFA 5I8TA 1D7PM 4ITCA 4ASMB 3T4ZA 4LIUA 3ZFFA 5H5NA 5KXDA 4X1IB 4LFAO 4QXHA 4AZZA 4N7IA 1NYWA 1Z5WA 1SPPB 5C5TA 2OTJV 3JD72 1JHNA 4HPKA 3G67A 3ECQA 5DEDA 1UX7A 1GM9A 1ULCA 1YFWA 5F39A 2GHYA 2G9GA 1MEC2 1JX9A 2PHDA 5CFDC 2P17A 4Y1ZA 4LBOA 1V70A 3KT4A 4QGPA 1BXHA 3K3NA 2QQPA 3UKTA 5C5UA 1QKQA 1U5XA 3OYWA 3CMEV 5J2UB 1N0JA 2DTWA 2WNVB 2WAMA 1W2TA 2VOWA 2E7TA 1N47A 4LXLA 2JE8A 4OUMA 4NOTA 2F4VB 3Q4HB 4XF4A 2ZMKA 1MS0A 1FJGO 4AFDA 1HXS3 2XAJA 5FBJA 2PYTA 4LHSA 1PGL2 4GJZA 5LB6A 5IJ0A 3LOIA 3RDIA 1ULPA 4YY3O 1S72V 1N0NA 1VBE3 2J42A 3VBSA 1EFRG 3ZJZA 4XDPA 3AG1B 1YXWA 1W99A 4LHNA 2MW2B 3VQWA 2ATKC 1V00A 3VZOA 5DZFA 3HKEA 5FZGA 2AREA 1PP9H 5L3EA 1W6OA 3WQ1A 5A80A 5LHGA 2KG7A 1FAFA 1Z0HA 1DTOA 1K34A 2NP0A 4YIPA 4IXLA 3CO2A 4MVUA 4ZIBA 1BLZA 3BVCA 2XWJB 4ZONA 3E6CC 3MDPA 3T1HB 1BMV1 5A7WA 3HR0A 2R70A 2P5BA 4MYEA 3EQEA 2VMGA 3CB2A 5DG1A 3CZJA 2V1DA 1UAIA 1SBEA 2V72A 4AGGA 2VUJA 1W8TA 3I2OA 2JJ1G 1U12A 3WLUA 1R3LC 5H9PA 5T50A 2YIDA 2DDUA 3WQ0A 3K5LA 2BW8A 2E7AA 4YGEA 1IOAA 3OR6C 2FCTA 2XWBB 5A1FA 4BW5A 1AYN2 3WF2A 2NLRA 4CCCA 4I2OA 5CBLA 4OHXA 1YJWV 4Z2AA 1W0NA 4YZ5A 5J2TB 3UT0A 1JCHA 4JX0A 3DCQA 4QWNA 1VMGA 4EWAA 2ADQB 1DZRA 3AK3A 2IJJA 1TEIA 4QPYA 2Y6LA 5FYZA 4L8JA 4BXSV 2JKXA 3W21A 1VBC2 4X65O 1J3QA 5A6ZA 2XAGA 1XNDA 4IL7A 2UU8A 3EMRA 3PMSA 2Z69A 3G6BA 1D4M1 3L2YA 3TJTA 4AVCA 4MTFA 3BPSA 5KA6A 3P3NA 1DIWA 5IHRA 4CDQB 3PTRB 4DR7B 1YEWA 5BR8O 1GNHA 2WR9A 4QX3A 4AVBA 1L3JA 2CWSA 5CB4A 4QX7A 4UXNA 4AFAA 2AACA 5ITZA 1BEV2 1DGLA 2VZQA 1GANA 4QKFA 2B5HA 4J7KA 3N3HA 3PUSA 4K9SA 2QTSA 5DAPA 3AK0A 1X9TA 5E89A 2ZEYA 2D7FA 4KL1A 4LA2A 5I0DA 1QQP3 4IHJB 1LHUA 1V6NA 4PJ0Z 4E2SA 2P7TC 2WFF2 2R32A 5FP3A 4ZKIA 2D44A 1HNZO 5A3NA 3D0JA 3M3QA 4YPJA 3POYA 2DVDA 4PIXA 4HANA 5JSRA 1VBD1 4HKOA 4LR3A 1PO21 5A6XA 1OQDA 1AILA 2LFSA 2W1UA 4BQXA 1YQCA 4WFAV 4FAGA 3TRSB 4PLOA 1F15A 3D3AA 2WZ8A 2Q5TA 3TBDA 5HV0A 1AL21 1YUDA 4JZGA 4FZ1A 1RGSA 4X9QA 1S4CA 1RSOA 3A0NA 1YFUA 1ULGA 1Q7YW 2O0OA 1PVXA 2ZDIA 1XHXA 1SF9A 5DM6V 4CUAA 5IK8A 4O4LA 1WA8B 2BWAA 4GZ9A 2EX3A 1SCSA 2WYFA 5F32A 2BOJA 1S0DA 5LYJB 1JJOA 5FUIA 4DRVA 3KV5A 4GWNA 2VZSA 2YI8A 4UCRA 5KWRA 2JDPA 3BI3A 3AG2B 4L11A 3GM8A 3OF1A 3OT7A 5CA1B 4BK4A 1NQTA 1ZRCA 2JDKA 1UPSA 4DV2B 2VMHA 3BTZA 4DXSA 2WPDG 1VBB3 5E88A 3MPPG 1P4RA 4QQ2A 4TV8A 3K48A 1FXKC 2PGGA 3L9DA 4Q4V3 4QX1A 4J41A 3WCSA 1D2QA 3VBFA 4I55B 5LP6B 1GAXA 4YG0A 5K1PA 4XYXA 3ZRWA 3K9AA 4LFBO 2VZTA 4IV3A 3UKNA 4CXWA 4GYCB 1OFSA 4RQPC 1LOEA 2R6QA 5I0TA 4L87A 4S2DA 4PF5A 2H6BA 3I97A 1OQEA 1YYNA 3E2EA 4BHPA 3I2GA 3KZ4C 5FO8B 3P30A 1GNYA 4PCRA 5LMNB 3ASNB 1YI2V 2NM1A 5KX5B 2VJXA 2RDCA 3OBZA 5T55A 2UXBB 1V9U1 1FMD3 3USUB 2AGAA 1BSMA 1VMJA 3WP3A 3WF4A 1XYOA 4FQ4A 3N2GB 3RVZA 4IESA 2HFEC 2QQWA 3DC6A 1DP0A 3OFNG 1UIKA 3O14A 3FL7A 1TA8A 3V65A 1TUBA 4YJ2A 2K2SA 2HWB1 5LW9A 3WW2A 4KG8A 3HKDA 1EAH3 2AW9A 4LOSA 3K04A 1YI9A 2DWDC 5FQ0A 4NUBA 4XDKA 1B35C 5JIAA 4NB5A 5FZ8A 3I5DA 3ZHSA 3CZUA 4WV8A 3ACFA 1ND3B 3HKBB 5K9YA 4GB31 4RGAA 1Q8OA 1GN4A 4LBKA 4QX2A 5F6LB 4HSJA 3BTYA 3OB8A 3O12A 4PI2A 4QKNA 4DIQA 5HXMA 4OHZA 2DYCA 2A0LA 5IK5A 4MTGA 4AR2A 2V5YA 1CPNA 1E5IA 4XDJA 1ENRA 2DCKA 4KMQA 1KP2A 1LNSA 4NTYA 4DV3B 3ZDSA 4R4ZA 5B1NA 2ZIMA 2LRPA 1LU2A 4D94A 2HWD2 4QE9A 2F4VO 2MEV1 3B00A 1AI4A 4LIVA 2ZGRA 4AEDC 1KJLA 3IPVB 4FI9A 3RT3C 1RUC2 2RS12 4ISRA 2UXCB 2VZ3A 2R063 5FYCA 2HVKC 3W9AA 5KUKA 1NA1A 4AGVA 3OCPA 1AXKA 1T6GC 1G8MA 2HLEA 3A21A 2P06A 3ETGA 4F6RA 4DUYB 2QZ2A 1R73A 3GXUA 5JPNB 2YI9A 1GN6A 3M8LA 1FPN3 2GC1A 2YBPA 3ZOIA 1J3PA 5C9AB 4FQZA 4FSJA 1RHI3 1PD3A 3MYXA 1NLSA 3ZSKA 1RUD2 4WBNB 2VQTA 3T1HO 1M90W 4X66B 1ZBA3 2DCTA 2DURA 2H0BA 5CISA 5IVEA 1PIV2 1RUH3 4K3UA 2EXHA 1PK6A 4IDZA 2XH6A 3I3DA 1S0IA 2E76B 3H1HH 2R1DA 2YS8A 3WNKA 4I0WB 3LE0A 4I0BA 4KQ7A 3CRMA 3T30A 5EWSA 3PVOA 4YVWB 5FDBA 2F66C 5BY5A 1XQ8A 3VBBA 1VBA1 3RSJA 5FR3A 1IS5A 2NMOA 3N9QA 3B5LB 5EYYA 2GBOA 3GB7C 3MHHC 3THOA 2ZX1A 3VBSC 4YW5A 4DRRA 1PO11 5BNNA 4I50B 4W6XA 4MW3A 1EPZA 2VULA 3TAYA 3F5WC 1J1TA 2J1RA 3VKLA 4FPGA 1EV11 1LGCA 4I02A 3OE7G 4TUYB 3KCYA 1W6QA 4YYOA 3MI8A 1OOPA 2A9HA 2GN3A 4Q4X3 5C33A 5IY5B 2YPDA 5LA9A 3C8XA 4DR7O 5EJ1B 1PX4A 4XQ4A 1TMF3 1GOFA 1GQPA 1IVSA 4I9QA 3JD71 2BWCA 5F2WA 5FYVA 4LF8B 3NW4A 5C3SA 4QXBA 3EYPA 3I59B 5FP9A 3ZIXA 5DAQA 4JTOA 1N32B 1MEC1 4GKXA 4A7YA 4LO5B 4HVOA 3KD4A 1IXMA 2ZGSA 5E8AA 2R073 3A23A 3HN3A 3L70H 1QOTA 2LALA 2JEUA 1ZA4A 4UCTA 2L9LA 1QXJA 1DFQA 2AZ2A 4JI0B 4RWUA 4YJ3A 2VOXA 3FLRA 3SKVA 2WNEA 3OD0A 2Y0PA 1BBT2 5A6QA 2YICA 3JBG2 4TQFA 4D0QA 1XOUA 1ZRRA 5FZOA 3DYMA 3JCUZ 2YDEA 5HCAA 2X6CA 3NAPB 2ZIOA 3O1UA 1BKZA 3KZIZ 1LAJA 3I3MA 3E5QA 1SQQH 4DW0A 2UWAA 3GJAA 5FYYA 1BCCH 5FYIA 5FWJA 4WM8C 3OW2U 4CC5A 2QQMA 4W4LA 1YQ8A 3I3BA 2QKDA 3KQRA 2XXZA 4NHKA 4L0PA 2Y4UA 4RA0A 1GNZA 2IJHA 4RGGA 2VNOA 1QJU2 3TB0A 4LBQA 4IV1A 5IAVA 3OGVA 4MTXA 4YW7A 4IEZA 2EIMB 4PDVA 3AZVA 1T2XA 1M57C 4I4TB 4R9CA 4XMAA 2TUNA 5FIXA 1A8DA 1QJX1 1F51A 4MH0E 4Y1VA 3CJHB 5FZEA 2QCSB 4JI3O 5IVCA 5F3IA 4LR4A 4O2BB 2VW0A 1UNBA 1H30A 3KM5A 4DV2O 2VNGA 4TV9A 3OM3B 1REEA 2ZGNA 1W6MA 2CH7B 3B01A 1AYN1 3SJCC 2ZINA 4RFRB 3EO6A 2RJ2A 2C9AA 2GMEA 2R0HA 4G9SB 2Y0IA 1OF4A 3FLTA 4BXFA 2V4AA 3BCWA 1STMA 4ARXA 1UXXX 1BL8A 3ZFGC 2ZXWC 4DV1B 1KEXA 1RPOA 1HNXO 2HH9A 1G9AA 2AXTZ 2ZDIC 5LL6Y 2XJTA 5CA6A 1VBC1 5EFUA 4AXOA 4DR6B 1W2NA 5BNOB 1G86A 5D8AA 4YNIA 4XMIA 2GMPA 4CEYB 5J1XA 1WZXA 3AK1A 5LMNO 4HVQA 1F4AA 5A1AA 4ASLA 4LH7A 1DDLA 1OCCC 2ZTNA 1RM1B 1YVWA 2UXBO 4WF9V 3PMEA 2N7GA 3CCVV 3POIA 4RUEA 4XIOA 2ZCEA 3VBUB 1Q8QA 2H94A 4CZZA 4QHBA 2PLV3 1I5YA 3SH4A 4RS5B 1W6NA 3JD2A 5T54A 4FAHA 1HIXA 3H1MA 4J1XA 3I56V 1SA0A 1HQLA 3ZPYA 1BEV1 1PX3A 3WVJA 4JCKA 4QDRA 3ZPOA 2VMCA 3ZHTA 1XEQA 3ZMUA 2A3XA 3WDXA 3FB6C 4U3JA 3I4IA 2VBBA 1P7BA 1XB9A 3NJZA 3JSNA 4O4IB 4NIAA 1OD3A 1VQ8V 3WT3A 4QX5A 5DDJ2 1B6QA 1KRIA 2W92A 4FCAA 2WFF1 1YFYA 1FV2A 1FV3A 3NNFA 3POSA 1W04A 2WLHA 4UBHA 1XC6A 2XVLA 3F2ZA 5EP9A 2JS5A 1QHDA 2IU3A 1H4GA 1BE3H 1ODNA 4QPIA 3LIGA 3LA7A 2KA3A 2AHZA 2DQ0A 3PUHA 1HXS1 1NR7A 2BOCC 3G7DA 4YLZA 4OUSA 4BLJA 4ISQA 5C8YA 4NHYA 4EROA 4DV3O 1SZXA 3ZMNA 3U07A 1OT5A 5IWAO 3VD9A 1J58A 1IBLO 1ULDA 1IKPA 4JYAB 2OT7A 4L8QA 4FPHA 3JYCA 2W08A 4CPBD 3D4KA 1R6NA 2P4KA 3OY8B 4JGSA 1QXPA 4Q26A 5JR7B 3K51A 3HT1A 1DGWA 5KHIA 4X64B 3I7DA 2XB6C 2OS2A 4UXAA 4LNUB 4BIUA 1S0FA 1GQGA 4ZXEA 4TYSA 4NIDA 4M3CA 5DZGA 1LHVA 5K1XA 4Z07A 1MS3A 1C1LA 4LKFA 2XJVA 5SV5A 4QB1A 4F83A 4X66O 2WO3A 5A33B 3PU3A 3AVSA 3S6PA 4XHXA 3H1KH 1MQTC 1X8MA 4S2FA 1JOJA 2OZ6A 3C3VA 5LCWL 3K03A 2MK3A 2OZJA 1XNQB 1KJRA 3N36A 1LENA 2PHXA 4BA6A 1AVBA 5FZ1A 3O7OA 1X9PA 4CUGA 3BKZA 5CG9A 1VQMV 2XG3A 4H14A 3ZX6A 2WAOA 4N9IA 4BWOA 1NA1C 1JVMA 5DABA 3VHNA 5I8YA 4UCUA 3AXDA 4NRPA 1ZSPA 3B93A 5FNVB 1H2LA 2GMMA 1MZEA 1ZAUA 3GHNA 3JAKA 2VZOA 3BIEA 5T5PA 4IL6Z 1W8HA 5CBGA 1WMEA 4JKKA 1XXNA 2K46A 1HB3A 4DEVA 5IVJA 2Q6AA 4FOWA 2DFCA 1CAWA 1N34B 4UCSA 1QWRA 3BUCA 5EV7A 5BXXA 4FK5C 1PK6C 5LA1A 3JXSA 1Y4WA 3GCXA 2OKXA 2RR13 1D2DA 2X8KA 4JGYC 3AX4A 3VDDB 4ZU5A 4FPFA 2P4VA 3AKQA 1QQP1 1W8ZA 2WWJA 3E6DA 4PLNA 3GYDA 3K3OA 1R092 4PHZA 2D6LX 1N32O 1OLRA 3O9OA 1SERA 2QSAA 3G4SV 1VJ2A 1XL6A 2VL4A 4QGMA 1GKFA 4DR5B 5C4WC 1Y9QA 5IDJA 4JI0O 4FFHA 4QPGB 1NCRC 5LXTA 2PHRA 2LUWA 5FMBA 4E9KA 4BQYA 3JQXA 1Q81W 5L7OC 3OGCC 3ZXJA 2J22A 1YIFA 2Z79A 1Y6XA 1YO8A 4M4PA 4ZBMA 1OOPC 3QH7A 4AWDA 3ME2A 3H7JA 3RPQA 2RS11 1JH5A 4R4XA 2YC0A 4MGQA 2NLJC 1ENVA 4Y5Z0 4XAEA 3C7OA 1ACCA 5LOVA 2R9RB 3J7MA 1FNZA 5K7PA 4FPEA 3D36A 2C9KA 5EC2C 3ZRVA 3HB3B 3UT5A 3FN9A 3ES1A 3ZYPA 1JJ2U 2HVJC 1YTFD 1A34A 5FK8A 1ZZ7A 2ZXQA 1VBB1 1RUD1 2E32A 3STLC 4NIHA 3ZR5A 1JZ3A 4Z1MG 4ZS3A 3KB5A 3FFQA 1IS4A 1PIV1 5KXBA 3R4DB 5FJHA 3UGGA 4EN0A 3LEGA 3R4UA 2D6PA 2ARCA 4SBVA 3ZN1A 5FAXA 1JFFA 4R6ZA 4CEWB 3S5QA 1WCUA 5F8PA 4GX0A 4KHPB 4B08A 3W7WA 3QBQA 5JVDB 5H6QA 1R1A2 1NT2B 1M9NA 4UOJA 4K1YA 3MFAA 3LEIA 1AJNA 1OA3A 4I0XB 4Q0QA 3WNXA 3RN4A 2F23A 3OEEG 4RR3A 4GULA 3QACA 4MVZA 5CFDB 1AR1B 5BYNA 5BZBA 1X7NA 4UAPA 1FFXA 2ZM6B 4QQPA 3KHBA 4RFT0 3IBMA 1TUEB 5FPXA 3RVHA 1UZZA 4XZUG 2BDRA 3BRCA 1S3JA 2Q68A 1R3IC 5LASA 5JSOA 3HEIA 4YVSA 1BCXA 1CZSA 4D6RA 1CESA 1EUTA 4AYUA 1W03A 3BEHA 5JI7A 3WF1A 5LWBA 4J9ZB 1JW6A 1Y7BA 3THPA 1LB2A 2UUBO 2IBZH 2E31A 4HFSA 3DPRC 1POV0 1QJY2 5FK7A 1GN3A 1GM8A 4NPLA 5L9BA 2A6ZA 1YZBA 2FZ2A 2Y33A 3OEHG 2JVDA 3A0KA 2KKWA 3MIHA 5DZEA 1V6IA 1VALA 1XOYA 5IVFA 3VBHB 5HCFA 2JXAA 2W68A 2PHTA 1BK1A 1XQNA 4NAOA 4IETA 4U36A 3VBOA 3CCLV 1BBT1 4QDQA 4J1WA 3P1IA 3CX5F 3OGRA 4Y22B 5F5CA 1JYVA 3T2PA 5FZBA 2RNBA 1UOFA 3LWCA 4Q4Y3 3A0HZ 4YW6A 5JI9A 2W87A 3OMNB 1CIYA 2Q8CA 3U75A 1LUVA 2Q5ZA 2D3RA 5J3UA 4LO8A 2DYRC 3FBYA 2DCZA 3PJQA 4AHXA 4YGBA 1HKDA 1V55B 1MNGA 4Q4W2 1G9CA 1JN2P 3VHOA 3ETPA 2BYVE 1K5MA 1FD9A 4LUKA 4EN9B 2X5IB 1JMUB 4FXGB 4CRQA 1QJU1 1UN1A 2XPJA 2VD7A 2IXHA 1AR92 4WFGA 2RM23 2JG8A 2OTLV 4C7UA 3K4ZA 4JYAO 4PDWA 3MIGA 4XJZA 1K42A 5JMOA 3T1YB 5HV4A 4XFHA 2Y69C 4TN7A 4CS3A 5KBFA 3LDEA 3A2FA 2ZPXA 4X64O 3NNGA 1KQSU 3BGAA 1MS4A 4W50A 1QDCA 5CNAA 4AGRA 5B1AB 5EBWC 4DS0A 3MZHA 4MVQA 3AG7A 1HLCA 5LRRA 2P34A 3MV01 5A3LA 3EBRA 1UU6A 3CYOA 4TTGA 1RVF2 5F5IA 2WNUA 3MDSA 2ZKLA 3I2KA 5GJ6A 3JAMN 2WWWA 2J1EA 4N53C 4TSFG 3RYFB 2EXIA 1VQ5V 4LO7A 3RYCB 4AEJA 1EUUA 4MGIE 4CDUA 2OT5A 2CTPA 2XUMA 2VMFA 3GHMA 1L0LH 3MIFA 1AP5A 1XNQO 1FXHA 1NTKH 2B8MA 2HEPA 3AG1C 3ACIA 4OX9B 5BNPA 2XONA 2DMXA 2L35A 1O4ZA 2D43A 3O0VA 3QH6A 2WQZC 5DG2A 1PNMA 4X1KA 4AFCA 2BSKB 3PN1A 4JDMA 5K0UC 2HJFC 1K33A 3OG2A 4INDA 5AVPA 4LORA 1BVVA 2UWBA 5D5QA 3BCCH 3B40A 1HRI2 1TMF1 2HWC2 4LMFA 1OHHG 4JHTA 3JARA 5C3QA 1V54C 2AEZA 4UF0A 4IGGA 4MHUA 2ZX0A 5IVBA 4NXMO 1N34O 4Q6GA 5IK7A 2D6NA 3N9OA 3DKQA 5A7QA 2ES3A 1UF2C 1W8UA 4QPKA 5FLXN 3K4DA 5IAXA 5D21A 3ABKB 3U11A 4U2AA 3AG3C 1SEFA 3T2TA 2Y6GA 4UCOA 1U97A 4IEPA 2Q8VA 3TGUH 3K79A 4IYHA 1YC61 4Q0UA 4KH9A 1MZFA 1W2UA 2V4DA 1XNCA 3VKMA 4B3SB 1AR62 1DGRA 2QQIA 3AEIA 2CTVA 2BTQA 5L3CA 4K8ZA 1Q86W 3UYJA 2Y48A 4DR5O 2DJVA 1ND2B 1UQXA 2A1XA 1MS1A 3NNJA 4ET7A 1GV9A 1GLHA 1FXKB 1HNWO 5JXIA 4BAYA 4N8MA 1KC8W 3A8TA 4M01A 1KMIZ 3ST7A 4LF6O 4C0HA 4XILA 1ROPA 1YITV 3GGLA 2ZNJA 4MGTA 1W0OA 2VUDA 3WUDA 4EQVA 1SLCA 2CTWA 4R52A 4BCUA 3DTUB 3J8F3 4XTMA 4RQPB 1WJZA 2VQ0A 5EK0A 1OUSA 2A75A 4QGLA 1M56C 4P9PA 4NR1A 1ENXA 3ML0A 1GO3F 3RI9A 1M4WA 3SJBC 4HG6B 5DAVA 3EJKA 5A6YA 5FMCA 2P6HA 1QLEB 4OHWA 2IXKA 3K08A 1W59A 4PQ9A 1QR9A 2ITCC 1OMIA 3RYHB 5FZ9A 2F93B 1C28A 2WZR3 5E16A 3WNNA 4DOUA 1UW8A 5KHJA 2N04A 2WS92 4LHKA 4ZZ8A 2Y6FA 4CP9B 3E22A 1KBHA 2L6LA 1LOBA 4R8CA 4PBOA 1NUKA 1M93A 2QR4A 2PQQA 1HRV3 1KFUL 1QVFU 2ORXA 1P84F 4KHPO 2WT2A 1B35B 1TNRA 3J81N 1AX2A 1GQHA 5KMGB 1ONAA 5J48A 4B4QA 2XL9A 1SACA 3NRUA 4Z92B 1VRH3 4BQ1A 1JBCA 4LWSA 3ROUA 3ZFEA 1CGPA 3ZYIB 1ENSA 4IEYA 1PGSA 3N7KA 4EN7B 2IJIA 4FPYA 2P3IA 2ZM6O 4G27B 3WX5A 4AF9A 2E51A 2JG9A 2LGQA 5FY4A 4K0KB 4P9LA 4IE7A 3APOA 1F2NA 2EILC 5JH7B 4CUBA 2DU1A 1ZLZA 2TNFA 1ZA7A 2VTFA 5IYDO 4URTA 2WT1A 2QVSB 1RP3B 3G6EV 1UU5A 4RD7A 4CU9A 2CV6A 3K9SA 1R091 1WW7A 5DQ0A 4AEDB 1FKAO 4YXWG 3VQXA 4NHMA 4X8PA 2CTQA 3LA3A 4CP2A 4JI6B 5GONA 4UFMA 4GT1A 4XZPA 2A5ZA 3RMYA 4CCLA 5CFCA 1VQNV 1UMHA 2R042 1SLTA 4HPKB 4JASA 4ZKTB 4CCNA 2P4EA 4K8FA 1XDCA 4CC6A 5LATA 3U37A 1N33B 4YZ3A 4IEXA 1ULEA 3H1IH 4FZ0A 4RYDA 2B45X 2LJ2A 3WUCA 3QLQA 5I8SA 3S57A 1QH6A 1C8M3 2R30A 4NXNB 4AI9A 3WSOA 5AC93 3DXTA 1D2SA 1N8RW 1OQ1A 2RDQA 4G3YC 5ANNA 1YI7A 3AVRA 3WG3A 3OYWB 4WFHA 2KM2A 2EVXA 2ADDA 3ABMC 2XQXA 1XMQO 2RVAA 5APAA 2RCVA 3B8NA 5A3TA 4ZHNA 3TXSA 4I3GA 2NMNA 1PMIA 1BHBA 5T3NA 4AI0A 1PKXA 3ZHVA 4JI5B 3S3WA 2ZEXA 4PIZA 5IJ0B 4DXTA 3H9AA 1HP8A 5A70A 2CYFA 3VBSB 2WFPA 3GBFA 3ZHRA 3T1YO 1P7GA 3HKEB 2XASA 3VBOC 1RUNA 3WDVA 3LDRA 2KG7B 2B1IA 1NAEA 4RQFA 2X53S 1UX6A 1I6XA 5DAWA 2B9UA 1SHWB 4Q0PA 3O5SA 4LLFA 1DZTA 1NT0A 2VUCA 2WNOA 2ZEWA 1CAVB 3T0AA 1ZZ9A 1R1A1 3C3TA 2YXSA 4J7ZA 1JOYA 2BGPA 2Y38A 3OPWA 4X1IA 4XFFA 1WUVA 3NO8A 4F6EA 2V09A 5K8SA 2JG8C 4AI8A 2FL4A 4EZ4A 2XAQA 1SMVA 3AP9A 1R6TA 4N43A 2WT0A 4OX9O 5L3DA 1TGOA 3DGEA 2ARBA 1U0AA 1Y66A 5J9PC 1LUWA 1E5RA 4V2VA 3OPZA 4CDWC 3LF7A 4A7ZA 3SEEA 4PBPA 3CP1A 1UY2A 1KP3A 1OPMA 1QY4A 2DE0X 4B7KA 2X10A 1QJY1 2FQPA 2VPVA 3SKJE 3J7HA 2WAAA 4P5YA 4DZGA 2HJIA 3VZMA 3SHRA 2ET7A 2PTMA 5EBMC 1OCOC 2OQ7A 4XUPA 5ITZB 1I9RA 4MOAA 5C8CA 3LSDA 5BV6A 4TLGA 2WIIB 5DXDA 3HBKA 3VOUA 2FTKA 3SEPA 3BU7A 3W7UA 3M3CA 3TNPB 3LFIA 2YXHA 2DF7A 1M57B 4DV4O 4FO9A 4B3SO 1HR0B 5JSPA 1NZ6A 3BABA 1L7RA 1QDOA 4J25A 2DBIA 3K5MA 1MZ5A 3WCRA 4W8JA 5IY5C 1KU9A 1Y3TA 1H9WA 5IVVA 1VBD3 1WPBA 2XJRA 5JQGA 1LHNA 4JVAA 4JDOA 3CF6E 3U4XA 4S2HA 1WP7A 1LCLA 1EZJA 3FB8C 1AL23 5IVYA 2VRZA 2F6BA 5FZ7A 1RSOB 3HNMA 2OVUA 4AFMA 2R16A 4IE6A 1WD3A 3ZN6A 3A7QA 5A9GA 2ZS6B 3OMAB 4O7XA 3LPFA 4MSWC 2AH2A 5LBEA 3CLPA 4Y20A 1ZBE3 3RZZA 2FDKA 4JTNA 2QFEA 4FM2A 2JD9A 3RZJA 1QQCA 5FP4A 5I0SA 4HNAB 5A3WA 3VB9A 5IT6A 4Q0VA 1O5LA 2D3SA 1RVF1 1RFYA 5FOBB 5GTHZ 1UYZA 5FKBA 2VOTA 2BGOA 4EE2A 2QQVA 4I0AA 4XABA 1ZRFA 3JB4C 5CADA 4OYUA 4CDQA 3A22A 4CPBA 2YB7A 5EPAA 4AK3A 4FOQA 2ARAA 4DO2A 2I07B 4CTEA 1Q90D 3IMMA 2KD7A 1YXBA 4U3FH 3ZRWB 2JJ6A 4NKGB 2HWF3 5EYXA 4DK0A 1AYM2 1OH4A 3R65A 1YJLA 2JWPA 1FYUA 1RUG2 1A8MA 1PNFA 1H8TA 3FMGA 1XJAA 4MXVA 3LOBA 5JXJA 2JIJA 3KT7A 3VQYA 4BDVB 3FC0A 4COVA 3SPCA 3JCZA 1WMDA 2DCYA 2UYBA 3QO7A 4EKWA 3BN6A 4XJ9A 2FDIA 1HRI1 5DAXA 4DINB 1RTVA 3GZTB 4PA4A 2WLQA 2YBSA 2CGNA 4S2GA 3K5OA 3ETDA 4FFBA 4WM7C 4OI2A 2G9ZA 3SXWA 4FPPA 2ATFA 5A2QN 4K0KO 4FVVA 1FAYA 3PUAA 5HPOA 5IATA 1NQJA 4FPOB 5I0RA 3AL5A 1TUBB 4YJ2B 4LFAB 2Y26A 2QGNA 4DQAA 4N90A 2ZJCA 2HWB3 3HKDB 2QDOA 4JV4A 1S0EA 3NJXA 3RG0A 1TVKB 2ORZA 3H8XA 1AR61 5LGNA 2CAVA 3CQOA 1WA8A 1QU0A 4EV0A 4C91A 1NLRA 2VW1A 4JI6O 2Z5WA 3NWKA 5BNOC 4DY5A 4RGKA 2YFUA 2RHPA 2B46X 4ZHQA 3CEIA 4YFWA 2FMYA 2P90A 5LYJA 4GB33 3NXSA 4LK6A 1JOPA 4Q4Y1 3L75H 3IWZA 5GLZA 3THCA 3ZFEC 4FM1A 1N33O 5FL7G 5CA1A 3WW3A 3OUJA 3RQ0A 2E7QA 4JQTA 4JGZC 3DF0A 1OVPA 3JATA 3JASB 3JUUA 2IU0A 2BCCH 2JG9C 1C4RA 1YJ9V 4DUXA 4GWMA 3WY6A 1A32A 5IE9A 2X05A 2WN3A 1MQTB 3IB3A 3WD5A 4G28B 3ZYHA 4YY3B 4CYDA 3MF9A 3M3EA 1VIWB 2NNUA 4H44B 4X20A 4QT6A 4GUNA 2EAAA 2MEV3 4FLVA 4GKYA 4YM2A 3BY6A 4JI5O 3ASOB 1EZVH 4O65A 2BVBA 4D7TA 4DR2B 2X6BA 1UO9A 4IW3A 4RHV2 1NA1B 2ILMA 4PA3A 1GZ9A 5A3MA 1WMXA 2WS91 2Q1FA 3M2MA 1THZA 4F6RB 3LEMA 2ZAAA 4CP0A 3USUA 1WLEA 5FCCA 1CZTA 4RL7A 3D82A 2KXLA 2W95A 4QM8A 2Q8DA 4UW5A 2CGPA 1TE1B 4HETA 3KMHA 3NSTA 1Y43B 2BFUL 2RDSA 1PK6B 4AQSA 4CE8A 4HVRA 1CAUA 4MTOA 1XNAA 2A79B 3ZXFA 5IYZB 3C7EA 4JGYB 1UOJA 1X59A 3A0RA 5EZYA 2Y60A 5FZ0A 4GH4C 3D3IA 3WV6A 5FLJA 1ND3A 3HKBA 4C90A 1WCSA 3P5BA 2AEYA 1B09A 4NVPA 5KC6A 4CH6A 1VBA3 4XE9A 4OMCA 3T0BA 1C1FA 5C4WB 3FLPA 1GWKA 2KB1A 4YW1A 4XBQA 3UK9A 3L72H 2VE1A 1RUF2 4UWDA 2RS32 1WLWA 1E57A 1JS9A 1PM4A 2ITDC 5BR8B 1XNTA 5KC5A 4LF4B 3H1WA 1EV13 2XR4A 4F3JA 3HQUA 1L1FA 2P6CA 5ACA3 1W6QB 1OOPB 3VD3A 1IPSA 2AGSA 4XW3A 1RUJ2 3LAGA 2RMU2 2JECA 2VTXA 2ZKNA 1RUI2 2R041 2PZSA 3JD73 4A4AA 2XKPA 4ASKA 5EXOA 3AKSA 1JYWA 3FHAA 1KDKA 1Y76A 3ZHQA 5FYUA 1WCDJ 3WF0A 5C71A 3D8CA 5F3GA 1MEC3 4N43C 1QNMA 1PZ8A 1SQXH 4CA9A 5B4NA 3JD0A 4LBJA 3WB0A 3N7MA 2ZKOA 2YG0A 2F17A 1IS6A 2OCHA 4CS4A 1FT9A 2Z2SB 3I54A 4ZU4A 3NQHA 2VVFA 4B8EA 1UJWB 1HX6A 3B3QE 3ILFA 2JS3A 3WG7C 5A3OA 2OYZA 2P3YA 3UJOA 4QMAA 5IK4A 2E74B 4GWJA 1OPOA 1UY4A 3B2EE 2BEOA 1SS3A 3MW4A 4QB6A 4CH5A 5GLWA 4JV5B 4V1PA 2WQ4A 4L97A 3T2QA 2PHLA 3AMHA 1LGBA 3AP5A 3MIEA 5ANQA 3VN4A 3RZKA 2DWRA 3RZLA 4YVWA 1RITA 1H8EG 1VR3A 1QHTA 2VNRA 3CMGA 3U0ZA 1X8EA 2QQJA 1Q56A 1AJOA 4LBQB 2BBAA 4IV1B 5FY7A 1QOOA 4X89A 1RB8G 4AQTA 4B1MA 2QWPB 3E6BA 1JYNA 4Q5OA 3G80A 1NLQA 5EIBD 1DGWX 1EBOA 1VQ4V 4QHOA 3LSQA 3HQRA 3ABUA 2HWE2 4TV9B 1NU1H 3BTAA 1JYTA 4I9WA 2QQLA 1PM9A 4P30A 1VF6C 1JU3A 2ZD9A 4QKBA 3DSQA 1J83A 4XJAA 3QCWA 3OBAA 3FUQA 2O14A 1AYN3 3CBNA 4NE9A 4QXCA 3O65A 4E8CA 5JUVA 3W59A 3MEPA 4SLIA 4AG4A 1MS5A 1QR8A 5JJNB 2LQTA 2IVJA 1VQPV 4TLFA 4CZSA 3ZIAG 3GWKC 3BU0A 3L9JT 2V73A 5HFLA 4XACA 3H3ZA 3UKMA 3CIHA 3VV1A 2A7AA 1Y74B 4YZ4A 1VBC3 4IIJB 2W0FC 1S76D 2DN9A 2YU1A 1SZBA 3V64A 1WAZA 1XU2A 4IEUA 4ORFA 3X2QC 2ZT9B 3RYPA 1KS4A 2R9AA 2XLAA 3MBWA 5JCOC 4AOCA 4CCMA 4IEOA 2DYRB 3M99B 1BHGA 1NBMG 1UY1A 5G05L 4CEWC 3SCHA 1W6NB 3NAPA 4Q1PA 3L74H 1SA0B 4HL0A 3V0AA 2CDOA 1OH3A 4NWVA 2AYHA 2WN2A 4UFJA 1BEV3 4Q8LA 5LK5A 1N1YA 1KKDA 4B3NA 1I5ZA 2OUJA 3G71V 2EZPA 1UIJA 4OI0A 1ZREA 2CGOA 2E26A 1FOD2 1U5YA 3SJAC 1NZIA 3OPTA 3ZLIA 1W6PA 3FB5C 2Y69B 4HN1A 1C8M1 1F4HA 1LOFA 4GX1A 2WFF3 5AC91 5JJJB 4I4TA 1VARA 2WZEA 3HAGA 3SYPA 1WB7A 1YRZA 2UXNA 3OOXA 4LLOA 3N7LA 2WLIA 5I93A 1RUE2 2VZPA 2CH7A 5KHGA 4FFKA 3SPHA 3PUIA 2PI4A 2QQNA 2W9XA 4N53B 5GZDA 2Y34A 1L7LA 3VZJA 3PHMA 1IQAA 1HQWA 2OX0A 4QQOA 2VQUA 1ULFA 1G6NA 3AYCA 3DYPA 5B5EZ 4BISA 1LEMA 1N3OA 1MVEA 2GN7A 2Y0OA 3VBHC 5DPNA 3LDDA 3D0SA 3MGUA 2VQEB 4LQRA 4JF3A 2EICA 4DR2O 5H9SA 4AVTA 1GYKA 2EZOA 1JTZX 1VP7A 2DUOA 3PTYA 2WSSG 4CEYA 3L71H 3MLJA 1UWWA 1RINA 4QGNA 2LW8A 1I0HA 5K0UB 1K45A 4P9OA 1TNFA 4DUZB 3VBUA 1ENQA 5BPXA 5FYSA 3IC9A 1V0AA 4JYYA 4RS5A 1W0KG 1V54B 3QVNA 1V55C 1AYM1 4H37A 3AK2A 5B1BC 5IFTA 1TZOA 3UO3A 1RUG1 3WU2Z 4BYYA 1GOHA 2X5IC 2FMDA 2BBVA 4U7NA 1XILA 3AG3B 2I74A 3RBZA 4AHYA 4O4IA 4XDQA 5DUUA 3UO2A 4P9IA 4FJCC 2PAKA 2HG5C 1S0GA 1ZX3A 3MUZ1 3NV1A 4K8RB 1EPWA 5HXVA 3TWIA 2UXXA 3JSLA 3ZRXA 1AI6A 1OV9A 1AR72 3T09A 4NROA 1RMU2 1I3HA 5B1AC 1AR4A 1SG3A 2EAKA 1W3VA 3MFCA 1GICA 5LEJA 3JAKB 2WWSA 5H9RA 5F37A 5CA0B 4LF4O 4GX2A 2W46A 2WLNA 3I2IA 3APQA 5K4LA 2ZOEB 5GKAC 1Z7S2 4UFIA 1YQ6A 2D5HA 3WP4A 1OSGA 5J7MA 1M56B 4FPJA 2KR2A 2QQOA 1MG1A 5B3SC 4AW7A 4IGPA 4DRXA 5CG8A 1OFNA 3VGIA 4LHLA 2C6SA 2K0GA 4RO2A 3OY8A 5IFPA 2QE7G 2FD8A 3CS5A 1KS5A 5J09A 4CCJA 3ZRSA 4YHHB 4UI9L 4E4DX 1NVPD 1JODA 1TAEA 3ZXKA 5C7GA 3CL1A 4YW2A 3CJIC 3OEAA 4LPLA 4DXRA 1LKNA 2O1QA 3ILNA 1CZVA 1OCZC 4H7LA 4LT5A 1NJIW 1Q8IA 1EN6A 3BYWA 1BJQA 2VZRA 3ZXLA 2WQ8A 3PVBB 2H8PC 2HWD3 4MV2A 1CIWA 2ZGQA 2GUZA 2X29A 1KFXL 3ABKC 4JV5O 3K77A 1F9KA 4HZFA 5ABJC 3ZYBA 4BH9A 1Q6HA 1FYJA 4HZ3A 1RUC3 2RS13 4YFZA 1UCXA 1P8JA 2CAUA 4RHV1 1ZBE1 2OIEA 1K5JA 4AI3A 4MUVA 2VQFO 2RDRA 1CWPA 3SQOA 4LUMA 2BNMA 2BJSA 5FZ4A 3UGFA 2E6VA 3UT5B 2Z42A 2O57A 4DV5B 1N3PA 3HQXA 4OZXA 4JI3B 1LECA 2M6YA 1H2SB 4BE3A 1ND2C 2NQYA 1UY3A 1TQ5A 4Q29A 1W2OA 1RUD3 2C2AA 4IT5A 1K73W 1UPIA 1BYHA 2PN5A 1PIV3 2EILB 3SPGA 2VS0A 3AZXA 2YY1A 2DVBA 2HWF1 3TYJA 2LS6A 3IAPA 5IJRA 3VKOA 1OA2A 4R50A 1PNKA 4MW8A 2JENA 2PQSA 2NYYA 1HNXB 2GNDA 4D6TH 4AVSA 3UL2A 1GM7A 4DR1O 2XAFA 3N2KA 2RDNA 1GZTA 1XE0A 2QTOA 1H8HG 2E5LB 1QLEC 4XCAA 1H1AA 3TEWA 2K9ZA 4PIYA 4XIKA 1H2MA 3E35A 1JXNA 1CJPA 5J98B 1FFXB 2WKKA 1KDMA 4JI7B 3WHTA 3KV9A 4QPGA 5GW7A 5KHKA 1VQ6V 1SBDA 1F5FA 4C0BA 4GMP3 1WPXA 3FAVB 1RUJ1 5KAIZ 5A7SA 1JMKC 2BRTA 3VDCA 1RUI1 4FM0A 3ABMB 3ETEA 3JD1A 1WD4A 1AJKA 4FIPC 1QEXA 2VCBA 3NKGA 4DUVA 1SQFA 3ZMTA 4GCZA 3CRQA 4JI8B 5I0UA 4K3AA 1C57A 1OLQA 2EIJC 5FPUA 4X8NA 2QE3A 2YXLA 2YU2A 1FI2A 3EXUA 4JYCA 3ZN0A 4G2KA 2RQ6A 1H9PA 2F43G 4NPRA 2GNTA 3ZSEA 5KHHA 1EP0A 2QWQB 1XE8A 2LP7A 4IYIA 3HVDA 3ZKUA 3CRRA 3VBOB 1PGW2 2CTRA 2JD4A 2PYJA 2GP3A 4BB3A 1BBT3 5FPRA 5H2FZ 3JBG3 5C3OA 3KKYA 1FFTB 5C70A 4UW4A 4QQLA 4NRQA 2HEYF 2GALA 1WNSA 1W39A 2EIKC 1NCQA 5IWAB 4P9XA 5D1IA 2VCCA 5JPMB 4OI1A 5AVAA 2SBAA 1IBLB 5T5LA 1IKQA 3TN92 3A0BZ 1KD1W 3B9IA 2JEXA 1OLMA 1DLCA 3GZEA 4P9WA 2V4VA 1O9HA 2HLDG 4LITA 1K5MB 1SFYA 3ZFFC 1VPHA 1TME2 3FE5A 3JALB 5JVDA 2JG8B 1QJU3 3M7MX 3SYCA 2VTXJ 2EIEA 2F1MA 4PELA 4HK8A 1QJEA 1BQPA 4W6YA 2JRIA 2R0FA 5LRSA 4PDWB 3IIAA 4I0XA 4XF9A 3WXPA 1HV0A 2G38A 2W6JG 3EVKA 3LDCA 2VQEO 1VEWA 4QM9A 2B39A 4GWIA 5CFDA 4CDWB 5F2SA 4CH3A 1LOFC 1UYPA 2LGWA 3E83A 3KV4A 2MHFA 2OIGA 4DUZO 2YGLA 1JYXA 1C5IA 4XVHA 1DQ2A 5FY0A 4JRAA 4HONA 1IG3A 4LKEA 4ES8A 1US3A 4UBGA 1N3QA 4TXWA 4FXKB 1WMFA 1JYIA 2UWCA 1D4M2 1K5QA 1UXZA 1OCOB 4P5HA 1LGNA 5I91A 3ZR6A 4CDUB 4TWTA 1NKGA 1N4CA 1W0PA 3OSDA 3HPLC 1OKQA 1PMHX 4CH4A 2OW4A 4XFCA 2FZ1A 5F9TA 3CXCU 1PVC2 2ZCWA 3IZOA 5BNPB 4LF9B 5C3RA 3Q8AA 4DR3B 1F5JA 3I2FA 1AR82 2EIGA 2JDYA 5E1RA 5FXVA 3ITQA 4Y22A 4EFBA 4COZA 4I7ZB 4X1KB 1T6BX 5ACA1 3FYIB 2C24A 2YYOA 5CVRA 3WB2A 4YM0A 3VD7A 2E9QA 2ZHNA 2PI5A 4DB5A 4EWEA 2ODMA 4KWUA 1Y67A 3JARB 4B3TB 4LO4B 4GAZA 5CKNA 1J5EO 3CMAV 4UF0B 4XFAA 2ZE8A 3ETQA 2Y6KA 1I7FA 2D2CB 1PO22 1FOD1 4BR6A 3AFKA 5DDJ3 3ON7A 1N1TA 2OCCC 4I30A 2XHKA 3LDKA 3NV4A 3VDAA 1WW5A 2VZVA 2PAMA 2GAUA 4OPHA 3B8MA 3GVMA 1W8NA 5TSWA 2QM8A 2J1UA 3LA2A 1JUHA 3DXUA 2N74A 1J1LA 2YZ4A 1XU1A 4MGZE 3RZGA 4YHHO 1BZKA 4X8AA 2BTQB 4AFBA 3K58A 1RUE1 3IJ4A 5LA6A 2LROA 1PHMA 3K3WA 2Q4SA 1W9TA 5J36A 2DVGA 2ZBJA 2F4PA 1J95A 2OA2A 2YUEA 2A3QA 5GZFA 1PGL1 3OEBA 4LKSA 4Y4YA 1QJFA 4BK5A 1IBMB 1M1KW 1Q82W 4LF5B 1BGYH 4UVBA 1HQNA 3RYFA 1LJ7A 2R7EB 3RYCA 4TQDA 4J6GA 1LR5A 3DL3A 1UFIA 2B5UA 3PIJA 1B3QA 2QJ1A 2OPKA 1XNKA 3AB0A 1V6KA 4Y1UA 4MVMA 4NIGA 2IVIB 1GWLA 4WVMB 5HFMA 4P2ZA 4UUJC 1MACA 3RGBA 3CRCA 4DV5O 1R3JC 1EYBA 4AAXA 1VB4A 5HCBA 4WM7B 3UKVA 2DYSB 4F7ZA 1W8FA 2JDAA 2FYUH 3GBWA 1QCEA 3E22B 2P37A 2MPFA 1V9U2 5KA5A 1KD7A 1DLBA 3JAWA 2HJDA 1CPMA 5HBAA 3R05A 4QJFB 5EIYB 2UXDB 1IBKB 5SV8A 1HB1A 4O61A 3RYIB 3NMBA 2BU9A 1H2KA 2Y64A 3G6JB 1QJZA 1OUXA 2EALA 4CDXA 4NWWA 1CEZA 4FLYA 4JTAB 2XQRA 3HN1A 1LULA 3N4MA 2E5LO 4LWSB 4RSUA 3ZFEB 4EN6B 4D8MA 1CPYA 3V0BA 4R7CA 1KQRA 3TNQA 2Q8EA 3MO4A 1UL9A 2JIZG 1LNQA 1CX4A 4JGZB 2RJLA 2VECA 4JI7O 1FXKA 2IFRA 2JG9B 5FXZA 2VWKA 3VHRA 4WCEV 3IDBB 3VBFC 1PV0A 2UUBB 2PHUA 1S77D 2O8OA 1WW6A 4YGCA 2IH3C 1IS3A 2HHHB 3AFGA 2YC4A 4IV3C 4PD4F 2Q7EA 1OA4A 4JI8O 2CU5A 3FX3A 1GWMA 3FD9A 2XHNA 1R093 3UETA 1O6UA 4IEVA 3NNLA 5GONB 3AMPA 4A6SA 5CFCB 3VQVA 4QX8A 5CZKA 1ZRDA 1MVQA 3PURA 2B9VA 2J7MA 3PNAA 2GNBA 3CCEV 3HKCA 4UCVA 2YROA 4OPAA 5J37A 5L36A 4BIZA 4AVVA 2J1TA 4DR4O 4Z8BA 3WP5A 4GKKB 3ZMVA 1FS0G 3RZMA 1EN5A 4YM3A 2XGXA 3AL6A 2JDMA 2YIBD 2D93A 2VAUA 3RWKX 3AKPA 1GN2A 3IDAA 2JGDB 4BZ4A 3M3IA 2XBO2 3CWBH 4FFIA 3IDCB 4FP3A 5CEHA 1SBFA 2YIAA 4BPZA 1B35A 4K21A 4AHCA 4GH4B 4E2GA 4N7UA 4O4JB 5CU1A 3KWVA 1CXZB 2WZPP 1AXYA 1ZL8A 2B1GA 3KF3A 2AZ0A 1GU3A 3N9PA 1DLLA 2W91A 1R082 4AQ2A 2QKSA 5LA2A 2YMZA 1N1SA 2ZQMA 4FLWA 5IWFA 2GC3A 4A41A 2DFBA 5LA0A 1NOVA 1PO12 3F5TA 1X4TA 1MOFA 1ORQC 2OIIA 2K1EA 2RS52 2W3JA 5JH7A 3CC7V 2ZGUA 3GWOA 4ASUG 3NR7A 2CAZC 3MICA 3WOGA 3W58A 5CA3A 3RVYA 2AUYA 3ZBHA 4AEDA 1GZCA 1R1A3 4JI2B 2GSMB 1YCIA 1DQ0A 3ZXDA 3ASOC 2LFRA 3R4SA 2C4XA 3O1OA 2DCJA 1ASJ2 3WG2A 1E1QG 3KT1A 1NKDA 5LY1A 1DZQA 3OD4A 4N43B 3PDQA 3RWRD 3C90A 4LF9O 1YWKA 4DR3O 5CKQA 3OGSA 1K9MW 3AM2A 2AC1A 3T2MA 1JZ4A 3LUTB 4OGQB 2DBNA 1UPGA 1X36A 3FYEB 4ZI7A 5GALA 2QKAA 3WG7B 1YJKA 4NXMB 2P5OA 4AEKA 1F8VA 3T0DA 2XNDG 1LTEA 4XF3A 4ES9A 5L3GA 4YZ2A 5LBFA 5FPLA 4KWJA 4DFSA 1GZWB 4EFEA 2J1AA 4OLLA 3U1XA 4B3TO 4XUTA 3UQ8A 1QJY3 4QE7A 2EIBA 2KQXA 3GDBA 1WBFA 2A71A 5LK7B 3ZKYA 2ZX3A 4IERA 5C8CB 3FZ3A 4P9YA 5FKCA 3UM7A 1PGW1 1COV2 2VMIA 3T1CA 4WFEA 1OHFA 3ZIWA 2VOVA 1K4CC 5BNNC 4MSVA 3IN9A 3N9NA 4H7MA 1VB2A 1UMZA 3BIWE 2JICA 5DUXA 1HNWB 2YBKA 2WLMA 5DUVA 3VKNA 1XNBA 1B06A 5L3BA 4J7JA 2HWD1 1G9FA 4LF6B 3U14A 4FLTA 1XI1A 2FHRA 4M3CE 3TN91 1HWYA 3RJ2X 1X82A 2ZE5A 4BU2A 1CONA 1URXA 3HT2A 1UKRA 3ACLA 1JZ5A 4Q4W3 3NJVA 3OBRA 2ET1A 1QJX2 1TME1 3CKHA 1IBMO 3QG5A 1RUC1 1CAVA 3W20A 5JQGB 4H0LB 4XQWA 4LF5O 1AR93 1V6OA 4NPMA 4OQ8A 1S5JA 1XSQA 3OGIB 4PV1B 1E1RG 4BJ0A 2ZNIA 2DUQA 4YWAA 5FXXA 4UFKA 3ZN6B 4CCKA 4PDRA 4LE3A 3BOWA 2PELA 3CJXA 2EINC 1K4DC 1WCQA 4P9GA 3ABLC 5JLVA 2A6VA 4Y20B 2PAEA 3B77A 3ZO0B 3SYOA 1RYYA 2YPJA 4Y24A 2XHBA 2VOKA 1QH7A 5LHHA 5IW0A 1AHSA 1RC6A 2BNOA 3X2QB 2CSGA 3ATGA 2J1SA 1RVF3 5FO7B 2W0XA 5EQUA 3S7EA 5FYTA 3PL0A 3T4DA 2AHYA 1NZCA 1KITA 3NNMA 4BLIA 1H2GA 2VVDA 3D5OA 3MLLA 1QLNA 5FRAA 1QNWA 2LO1A 4FFGA 5IJ9A 1I94B 5BY1A 2ID4A 4WM8A 1DBNA 3ZS8C 1PL0A 1PVC1 3OAAG 1SRYA 2UXDO 1I5PA 1UZVA 1IBKO 1PZ7A 1JA8A 5EC1C 1AR81 4TZDA 1PPJH 1H8TB 3IDEA 3VKFC 3J80N 4OHVA 2Y8KA 2FCUA 2GNMA 1HN1A 4IV1C 1MS9A 3VL9A 1CAXA 3ZYFA 3N9LA 4PF1A 2GU9A 4XFBA 4GMP1 2QWRB 2V5DA 5JAXA 1LOCA 4DV7B 3K06A 1HRI3 3WR0A 2K9PA 2CDYA 2HWC3 4P14A 5T52A 1RIRA 4FFBB 2QDNA 1HDKA 3SCFA 3AP6A 4QIWF 4MT8A 5CKMA 1JUIA 4AAPA 2JDZA 2TBVA 4WZCA 3R66A 2HHHO 4C1WA 4J10A 1HXS2 1RXFA 3ZFGA 4ZXKA 3U10A 3W7XA 1WW4A 4JI1B 1W06A 3FJSA 3T1MA 2R49A 3AG4B 2GSYA 1VBE2 1AR63 4X1YA 1CQ9A 2FDJA 2XLFA 5HCHA 2OUHA 1V6LA 1MS8A 3JBG1 1JZ6A 1U96A 5D8AC 5FTTC 4CDXC 4ZHQB 4HNAA 4JTCB 3DECA 4X62B 4E4HA 3PVEA 3EHBB 1C8NA 4AL9A 1OBNA 1BK0A 3H42B 3CCQV 5IYYA 4GKKO 4AQ6A 2IWGB 5FY8A 3JATB 3VZLA 5EHDA 1XMQB 1S5LZ 3KLSA 1MMMA 1XREA 3WF3A 2Q73A 1DCSA 1SC5B 5B1BB 5T5JA 3DKWA 4O2AB 2JDUA 5A3PA 3LGRA 1S2EA 3KVBA 4OZOA 1R1BA 3C7HA 4PDLA 4CU6A 1AP6A 4LF7B 4X20B 1XUQA 4AILC 2AR6A 1SQPH 3VDBA 1WA6X 5FY9A 4QB2A 3ZDVA 2GTSA 2WLLA 4UB8Z 1ZM1A 1SESA 3Q8BA 1JZ7A 5FUPA 2WS93 3RNSA 3E97A 5JWPA 1T5EA 3VBRA 4ZU7A 4QPIC 3P32A 3NV2A 5FBZA 1RJ8A 4GZRB 3H1YA 3KSCA 5FZ3A 1NE4A 3LDBA 1GTOA 4OVEA 3T4HB 3LSSA 4FMTA 2UURA 1CAUB 4TSVA 1YTFB 4N9HA 3UESA 4Q1RA 1Z5VA 4XDOA 2DU0A 3KCXA 1F31A 5B3SB 2A6YA 4LP8A 4X6QB 1TVKA 3OUSA 3IFXA 4JI2O 5EZYB 4BMBA 2AENA 4UVCA 1ZX5A 3J7NA 3W5MA 2UYAA 5FMOL 3HPNA 4CCEA 2W1QA 5TISZ 5E6HA 3AP4A 2ZACA 3CJIB 2EIDA 3POBA 1QQP2 4O4HA 3QF7A 5FYHA 2ZGTA 1OCZB 3DC5A 4AI2A 2WLJA 3JASA 2VY0A 5FZKA 4ZY9A 1HB4A 1DQ4A 1O4TA 4QU2A 4XF0A 3GALA 4D6QA 1HJGA 2P2KA 5DDJ1 1MQTA 2R9IA 2V7QG 3JU9A 4BIFA 1R1ZA 4QPJA 5ABJB 1KKCA 3K59A 4GA9A 4R9DA 5LGTA 1BZWA 2QZ3A 2R043 3F95A 3RZHA 1RPRA 2Q1ZB 1XHZA 5F5QA 1Z2GA 2ADPA 4DV4B 5FOJB 4KNCA 1Y76B 1QF3A 1W90A 5EIBC 1BMFG 1LEDA 2CY6A 1S0CA 4ZOLA 4NYKA 4XJWA 3VHPA 5GTIZ 1O3QA 1XE7A 3BAAA 2G1MA 4K20A 3T3YA 3OGJA 1M06G 1JQ0A 4QD2A 2JDNA 1S2KA 2PMWB 5FLHA 3X29B 1S0JA 2XBO1 1VBB2 1LOAA 3DXRB 2XJUA 1J3RA 5A32A 4Q4V2 4TOIA 1QU7A 2BQPA 3B94A 3MAQA 4GJYA 1DQ6A 3WNLA 1NH2B 1E5HA 1AB3A 1G9DA 5IYZA 2PUSA 4JGYA 2ZHKA 2RJZA 3NJYA 1AI7A 1CX1A 3WEZA 2W47A 2YGMA 1R081 3VD5A 2M7WA 4JYBA 2XVGA 2PF4E 3CCMV 3BA8A 2IXJA 4U7OA 5C4WA 1GR3A 3I3EA 2RS51 4EJRA 4P9JA 4XDLA 1POV1 3IAYA 1NCRA 2EJRA 5J96B 2HEVF 1FMD2 3ZEDA 3B9CA 5FV3A 4NTWA 3H1LH 4DY3A 5L7OA 2BTOA 4JAUA 5C93A 5JMCA 4XC9A 2Q30A 3O0WA 3JZVA 1S0VA 5F3CA 3URFA 2EIJB 1F4MA 3DUIA 1ASJ1 3E1F1 2QQKA 2FBEA 1I94O 3K46A 1EAH2 1G1XB 3I55V 1VF7A 2DV9A 2QUOA 4L2NA 3MF6A 5BNQA 1CJDA 3AC0A 1IPJA 3LQCA 3MV11 3U4SA 3OJBA 3D36C 1N1VA 3MD0A 4LE4A 5DUWA 2GH2A 5LGUA 5L3FA 5LBBA 1NTZH 2ZGMA 4EB6B 1Z78A 1IDSA 2KSDA 5JZGA 1URFA 3ELNA 4FP2A 3BVOA 3H0OA 2VMEA 5BMVB 5LBCA 3SH3A 4DV7O 3AZYA 4UYBA 2EIKB 2GV9A 2Q7GA 3K0DA 1G4YB 4MZUA 2DVAA 4HAMA 1GFF2 4NHLA 3FHIB 2VH9A 3PUQA 1G6UA 1MR5A 4Y1YA 1SQGA 5DMYA 2PXJA 4M4RA 3V0AB 4UW3A 3O1VA 3ZFFB 3DV8A 3SJQC 2GC0A 2OQ6A 2ZGLA 1COV1 2RE9A 1Y4MA 2D6KA 5FZAA 1VAMA 2VVEA 4XEZA 4ZS2A 4JPRA 1LODA 4JKMA 3EB7A 4WVZA 1HJFA 1IXBA 3WDYA 1SLLA 4JI1O 1POQA 4D6SA 4Y1XA 5JOYA 4H13B 2EBOA 3CNAA 2R062 2GP5A 5JOWA 1W6PB 4RR3C 2PA7A 4LULA 1O8PA 3GNEA 5LBQA 4HK9A 4UFLA 3J7AU 4YG3A 1K92A 4X62O 1YQ2A 1ZNPA 4OXSA 5DN6G 3F7YC 4LBLA 2ERFA 1FPN2 5BXZA 1CN1A 1G8WA 4YVSC 3RS6A 2WLIB 1RHI2 2DQ3A 1APNA 1ZBA2 4HLTA 5JCTA 2FKXA 1RUH2 3JD3A 5JXHA 4CCOA 3RW0A 4BQ4A 3DPRA 2P1BA 4F8AA 3WHUA 1F4NA 1UZWA 1VAKA 3IT8A 1DU3D 1DGRN 4V2WA 1E79G 2GTAA 2ZHLA 2FDFA 2QWOB 1UU4A 4LF7O 3CCSV 2Q0AA 1KUQA 3C7GA 1O8SA 4FPCA 4K6BA 3J9SA 4BW9A 1Y74A 5LHIA 1OURA 3WW1A 4DNYA 3POJA 4OI4A 1W6OB 4IIJA 5EYPA 3GZAA 5KUMA 1XYPA 3AP7A 2XT9A 2QWNB 2DWEC 2VM9A 3ZN4A 2CDPA 5A7WB 4MXWA 2EJ7A
chains in the Genus database with same CATH topology
1RMU1 2CWMA 4AI3A 2D6OX 4MUVA 2R1BA 2D3RA 5J3UA 4NN0A 4M0HA 4LO8A 1FXZA 3FBYA 4LUMA 2BNMA 2DCZA 3PJQA 1WCKA 4AHXA 2E6VA 4FBFA 4YGBA 1HKDA 2BFUS 3KCCA 4Q4X2 4Q4W2 3UJQA 2Z42A 1G9CA 1JN2P 1IZ3A 2ENRA 2C5DA 3VHOA 3AMNA 1N3PA 3HQXA 4XXPA 2BYVE 4OZXA 1AYM3 1SDWA 1K5MA 1LECA 4LUKA 2H6CA 4GB32 4EN9B 1K5MC 2X5IB 1ND2A 3UV9A 1NQDA 4FXGB 4CRQA 1TMF2 4BE3A 1ND2C 1QJU1 1UN1A 2XPJA 2IXHA 1RUG3 1AR92 2RM23 2NQYA 2JG8A 1XYNA 1TQ5A 5JZGB 4Q29A 1RUD3 4M0NA 1H4HA 1PNGA 4OFGA 4AHWA 1UPIA 1BYHA 1Z7S1 2PN5A 2WBOA 1PIV3 3OGGA 4PDWA 1G9BA 1PZ9A 3MIGA 4QXKA 4PDWC 4XJZA 3AZXA 2YY1A 4Y0EA 2XJSA 2DVBA 2HWF1 3NL1A 4YSFA 1OS7A 1QXRA 3TYJA 4DMIA 3VKOA 3J8F1 1OA2A 1SLBA 4XFHA 5IUQA 5KBFA 2JENA 3RI8A 2C1FA 2R072 2ZPXA 2IXLA 4BGKA 4RQPA 5CIRA 2NYYA 4XTPA 4GQ7A 4Q8KA 1DF0A 1DYPA 2GNDA 1MS4A 1QDCA 1A78A 4LO6B 4AVSA 3UL2A 4WVWA 5CNAA 4AGRA 2W39A 2ZMNA 4DS0A 3MZHA 5LRRA 1HLCA 3RJRA 3H3UA 1KXGA 5AFBA 4GIQA 2WNVA 2P34A 4KGQA 3VDDC 1COV3 5A3LA 3EBRA 1VAVA 2MEV2 1UU6A 3WG1A 1RVF2 3VBRC 2QNKA 2WA4A 2WNUA 4LA3A 2WNUC 3O0XA 4Q2FA 2H0VA 2ZKLA 3B7MA 5GJ6A 3OBTA 4I09A 4KG0A 3L2HA 1NG0A 1VLNA 4N53A 1H1AA 1O3SA 4N53C 3Q9OA 2K9ZA 2EXIA 1RJ7A 2E63A 4R9BA 3SWTA 1AX1A 4LO7A 4PIYA 2WZR1 4XIKA 4A7KA 1C5HA 4AEJA 1H2MA 4DXZA 4MGIE 1JXNA 4CDUA 4GMP0 1CJPA 4CDUC 5J98B 2BPA2 1WLDA 2WKKA 1VBE1 1KDMA 2XUMA 3WHTA 3GHMA 4D7YA 3MIFA 4QPGA 5KHKA 4QPGC 1QMJA 2XLGA 1SBDA 2LM3A 1F5FA 3ES4A 4GMP3 4C0BA 2B8MA 4KWLA 1X50A 1SLAA 1RUJ1 4AE2A 1O3TA 4K7JA 1QJX3 4ATEA 5BNPA 5GZCA 1RUI1 5BNPC 1HRV1 1NXD1 1O4ZA 1GSLA 2D43A 3O0VA 3QH6A 1WD4A 2WQZC 1AJKA 5DG2A 4R9AA 3NKGA 2G9FA 3ASIA 1OIKA 4LEJA 4AFCA 1MZ6A 2ZA9A 5I0UA 1C57A 1OLQA 4JDMA 5K0UA 3MW2A 5K0UC 3DPRB 4Q4W1 4INDA 5AVPA 4X8NA 2QE3A 1BVVA 2UWBA 1FI2A 1SQ4A 3EXUA 3I2DA 4JQRA 4B4RA 1VRH1 3WDWA 4C1XA 3ZSLA 3DN7A 3WZ1A 1HRI2 1TMF1 1S55A 2HWC2 1H9PA 3CU7A 1AR91 4NPRA 2GNTA 3ZSEA 4JAAA 3C2UA 3HWJA 1EP0A 5KHHA 2ZX0A 1XE8A 5C6CA 3H50A 3POWA 3ILRA 2ETEA 5IK7A 1VBA2 1FATA 2D6NA 3VBOB 1PGW2 1WA4A 2ES3A 1UF2C 2JD4A 2EXKA 1VZ5A 2ZGKA 1BBT3 3JBG3 3U11A 4U2AA 1SEFA 3T2TA 4COWA 2I45A 4QQLA 4UW4A 4ATFA 1S0BA 4KWKA 1Q8PA 4IEPA 2HEYF 3WP6A 4EWDA 2GALA 2GH8A 4FPLA 4R8HA 1W39A 4MXWB 4Q0UA 4RHV3 4KH9A 1NCQA 3PVNA 3ZYJB 4P9XA 1NCQC 2EF6A 5D1IA 1MZFA 1EV12 1W2UA 1C3HA 1UD1A 5JPMB 1H1MA 2VW2A 4OI1A 2C0ZA 2WINB 2SBAA 2TEPA 5AVAA 1XNCA 5ACA2 3VKMA 4FTBA 1AR62 4MX3A 1DGRA