3OD4A

Crystal structure of factor inhibiting hif-1 alpha complexed with inhibitor
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
342
structure length
342
Chain Sequence
b'AVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxia-inducible factor 1-alpha inhibitor
publication title Crystal Structure of Factor Inhibiting HIF-1 Alpha Complexed with Inhibitor
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 105
structure length 342
sequence length 342
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 3od4A02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3od4A01
1MZEA 2WA3A 2W0XA 2ILMA 4NR1A 4JAAA 3D8CA 3OD4A 4Z2WA 4AI8A 1MZFA 2Y0IA 1H2LA 2CGOA 4B7KA 1IZ3A 4B7EA 1YCIA 2YC0A 2CGNA 2XUMA 2WA4A 2YDEA 1H2NA 4QU2A 1H2KA 4BIOA 3P3PA 5JWPA 4Z1VA 3KCYA 1H2MA 3KCXA 3P3NA
chains in the Genus database with same CATH superfamily
5CU1A 1W0KG 1EP0A 5C6CA 4QJFB 1QNWA 2JRIA 2PY5A 1DLCA 4UWDA 3SKJE 3MV01 2VZRA 3AK3A 1RFYA 1Y74B 1OOPA 2WZR1 2HWE2 1RUG3 1D0HA 1FNZA 4QKDA 2AEZA 3HB3B 3U78A 1HRI3 1RUC1 1XE0A 5F3IA 5DQ0A 3JU9A 4OQ8A 1R1BA 4YGDA 4L87A 1F2NA 2EIBA 3OGRA 2B5HA 1S0FA 1SDDB 1WGPA 1BZKA 5EBWC 3BB6A 1I6XA 2PAKA 4B3TB 3IMNA 3JXSA 2Q73A 5IYYA 2VGDA 4BB3A 3NMBA 1DGRN 1JOJA 3DXRB 2GALA 3MUZ1 3E89A 2GDFA 2WZ8A 4I9QA 1SPPB 1VBC3 2OIEA 1UKRA 3T1CA 4J80A 4HNAB 2RVAA 4JI8O 5FZFA 1SERA 2ZNIA 3M2MA 2H0BA 3VDDA 5FMCA 4LF9O 5JXIA 4I3GA 4EJRA 1NU1H 1URXA 4N9HA 1NUKA 4XAEA 3Q4HA 1BS3A 1OCOB 1HV1A 2JE7A 4OZOA 3NSTA 1K34A 1DFQA 2ADQB 4LBQB 1GH6A 1SESA 1EAH1 4TSFG 4QHOA 2RS12 1KFUL 1WB8A 4OXSA 2W47A 3T0AA 5BXXA 4LFBO 1GFF2 2DYRC 1JZ6A 3IJ4A 5EYPA 4OX9B 3OT7A 5EPAA 3U4SA 2L6LA 5FZ1A 2WKKA 1VBE1 1IZ3A 2DDUA 4Y4RA 3I2OA 3JSNA 4MOAA 4YY3B 4LOSA 2YDEA 1DIWA 2ARXA 3FBYA 3T1YB 2AR6A 1LGNA 3K4AA 5A3PA 3CQOA 1K5MA 4J25A 3J8F1 1BK0A 1JFFB 3KV5A 3B4SA 2P17A 1FFXA 4UBGA 5GZEA 4YNIA 1O5LA 1FATA 3TBDA 3H9AA 1OMIA 3ABKB 4P9XA 5CA3A 4B3RB 2WO1A 4M00A 4PCRA 2JGDB 1GZCA 4TN7A 3B5LB 1QBZA 1SC5B 2WSSG 4WFHA 2WZEA 3USSA 5DDJ3 5IYZB 1KJLA 1VQKV 5KHGA 2X6CA 3HWJA 2ODMA 3MIHA 1RUF1 4PDWA 1AI7A 2W1QA 3VGIA 1OH4A 3HNYM 1YVWA 4DUXA 4UV9A 4KWLA 5H9RA 3K5MA 2QQPA 5FP7A 3FX3A 4LITA 2CU5A 2BBVA 2WPDG 1D5NA 1XU2A 1VBD3 1WPXA 3CL1A 1UNBA 3ACFA 4BQ2A 1VF6A 2JIZG 4ASLA 2X8KA 5FBZA 4JDMA 5FIXA 2CY6A 3LDEA 5D8AC 2RM22 4QPJA 1ENRA 3NKTA 4NMIA 4R4XA 4AK3A 4HKWA 3H8OA 1S0BA 1V70A 1Q8QA 1U5XA 2JIJA 2ZACA 1NCRA 1OA4A 3U10A 1GANA 1LJ7A 1CX1A 2VRZA 2UYBA 4NO4A 2QDRA 2F4LA 1GP5A 4AFBA 1KRIA 3OSDA 2PYLA 2JS3A 3PJQA 4MTFA 3ZMTA 2AUYA 2XOMA 2YXHA 5LK5A 1ODNA 4D0QA 2VQ0A 4LF5O 5DECA 1E5RA 2VMHA 3F5WC 2P5BA 4ARXA 4MVQA 4LKSA 4FM1A 4URTA 4Y1YA 3MHHC 2XJQA 4J9ZB 3VDBA 2E53A 4FFFA 4JC1A 4AEMA 4LH6A 1NI8A 4CXWA 1RUG2 4CH6A 1MS0A 1V0AA 2HWD1 3H8UA 3DPRC 3T2PA 3V64A 4AQTA 1JZ5A 1LB2A 1M56B 3WNOA 3IC7A 1IS6A 3KF3A 1C4RA 4QPIB 4R52A 1XOUA 4QGMA 1NR1A 1GV9A 4P9JA 5A9GA 4RWUA 1LESA 2WLKA 3JAWB 3BHPA 4JAAA 5EQUA 4WBNB 1DZRA 4UCOA 1KFXL 5LA0A 2XKPA 4A7YA 3LKJA 3K3WA 4FPLA 1JZ8A 2P2KA 1VBC2 1ZWIC 2P3JA 4JI6O 1A78A 1AR5A 5F6KA 2WLMA 1WUVA 1W6NA 3I3QA 2B8MA 4COZA 4MVSA 3QOPA 2D3PA 4K35A 5KUMA 1H2NA 1YQ6A 1QDCA 1J95A 4N43B 5BNNB 2DVAA 3GM8A 1MQTC 3HBZA 4B3SB 3WUCA 1SQQH 4KG0A 4CUGA 2Q67A 4W8JA 2GNMA 4BDVB 5FQ0B 4FOQA 4YFZA 4YZ5A 4B3MB 3UESA 5DM6V 3ABLC 3IDCB 1O3QA 2MW2B 1IXMA 2W0XA 5KHIA 4HN1A 4MTOA 1LODA 2WWSA 1PV0A 3ENRA 1UKGA 1UPSA 1SFNA 2WLIB 4IEOA 1GO3F 5JCOC 1GOFA 4IIJA 1H6YA 5FO7B 2JG8B 1WW7A 5FMOL 4IERA 3WD5A 2EAKA 1ND3B 4U2AA 4PBPA 2ETNA 2W94A 2VG9A 3WDTA 2MNGA 1BXHA 4UCVA 3ZR5A 4CRQA 2GH2A 4Y20A 1JOPA 1DYPA 2JDAA 5G04L 4JYAO 4B4PA 3VD5A 5E89A 5FZHA 1NE6A 3POYA 3HKCB 2D3SA 5L9VA 1JS9A 1VBA3 1C5IA 4KFMA 4GULA 5CFCA 4UFHA 2E26A 4FFBA 4YVWB 2R49A 4CVUA 2P3YA 3VBUB 2DCTA 1XNQO 3B77A 4EKWA 5F5AA 4KI5M 1W0OA 5LWBA 2B1GA 3SCFA 5L3DA 1WD3A 3RI8A 2PHLA 4BHPA 4L8JA 1JYXA 4F6RA 4O9GA 2YIDA 5EC1C 4GKYA 4BOWA 4ARYA 4D6QA 1TA8A 2Q8VA 3OYWB 4BH9A 3JCZA 3VZNA 4OUMA 4Q20A 4Q4V1 1SETA 2PFWA 1UW8A 4Q4W1 3W7SA 1GZWB 2IW5A 3ABTA 5LBFA 1SQVH 1DG6A 4U7NA 4DV3B 3BPSA 1AL23 3I55V 1YI7A 1GMMA 5D8AA 5LBQA 5BR8B 1KJRA 4GMP1 1FKAO 5T55A 4DR2B 4Y22B 2CH7A 2IZWA 5A3WA 1BEV3 4WM7A 2XBO3 4GB32 1T2XA 1X4TA 4BQWA 2CE4A 3F5TA 3PL0A 1ZX3A 4LO4B 4OVEA 4LA3A 4I50B 4NB5A 3N9MA 5DUVA 3W58A 4FXGB 1OPOA 5C8CC 4CEYC 5J48A 1L1FA 2Q4SA 3VDAA 3FHAA 4DR5B 1EV11 4GA9A 1Y6XA 2PLV2 1FPN3 2GAUA 3UKMA 2WLQA 4OPHA 4MGYE 1UZWA 1POV0 2OKXA 5LBEA 4QIWF 1XUQA 1LOGA 2F4PA 2KSDA 1DQ0A 1HWYA 4O2AB 4YJ2A 3JUUA 3JB8A 1GM8A 4KHPO 1J84A 4MT8A 3I59A 2YEVB 3P5BA 4LTAA 4JI4O 5LGUA 4DXSA 2D5FA 4FQ4A 4DQAA 4EV0A 4J6GA 2HEPA 3L75H 4DV2B 2V5YA 4HOOA 2CDYA 1VIBA 2E9QA 1KDKA 4B4QA 3LSQA 2QTWB 3WQ7A 2VXRA 1NT0A 4P08A 2Q1FA 3RW0A 1YJNV 2UUAB 1HX6A 5JLVA 4YM2A 1COWG 4QGLA 4XFFA 1NCQB 3ABZA 3OOXA 2Q69A 3ZVXA 5IK7A 2EIJB 1ZZ6A 2DVGA 4KUMA 1V6JA 5FPRA 1RUJ3 4BXSV 4RA0A 3VBSB 3ZEDA 1DF5A 4BQYA 4Y26A 2Y6FA 1MQTA 1K42A 1NTMH 1XBLA 5IATA 1OUXA 4P5HA 5A3NA 3P3NA 5FBJA 4EN8B 4YARA 4QPYA 1M4UA 3QF7A 1FT9A 1XMQB 5IJ9B 2RMU1 4JGYC 5JWPA 1BQPA 1YITV 2WABA 2L35A 3FBMA 5HXMA 2P4KA 1YHQV 1WW6A 4ES9A 1HN1A 1U12A 2WZR3 2QQLA 1K3EA 5GLUA 3WW4A 1IBLB 3PUQA 3SCHA 3DN7A 5CBLA 1NE4A 1LUVA 4GZ9A 5L3CA 5CKNA 1EPWA 4P30A 3K3NA 4XAAA 4CDUC 1JODA 4AVCA 1VB4A 1H8TB 4CP9B 4JASA 4EN0A 4DZGA 2RQ6A 1DDLA 3DCQA 3FHIB 2YHJA 4XZUG 2PAEA 3V0BA 1MEC1 4L8QA 4U3FH 3NR7A 2J1UA 3FL7A 3B2EE 1FMD1 4BQ4A 3RT3C 2R061 2DQ0A 4IEWA 1VBA2 3S7EA 5I8YA 1BQ0A 2YFUA 3I4IA 4N53C 4LNUA 3O14A 4YIPA 4AI8A 3R05A 5DG1A 1RL3A 4BQ1A 5GLTA 4OUEA 4KWJA 2UXCB 2UY9A 4QQHA 2Z3YA 3JBG2 1DGWX 4JTNA 2PHXA 4QKNA 4QKBA 4YRDA 3MYXA 2V4DA 2NMNA 2WYSA 2QQUA 4MVUA 3S3XA 4JGZC 4FLWA 2VE1A 3KS7A 3VLBB 4EWDA 1OH3A 2ZR3A 2Q1MA 1R3KC 3E8FA 2R041 1P7GA 1JZ3A 4QX8A 2XJSA 1BZWA 1OF3A 1GQHA 2YROA 1Q6HA 3VQYA 4NRQA 4BU2A 4A2UA 5JJNB 3JD0A 4DV7O 1R092 2IU3A 1AL22 4UFJA 5F5IA 2EIMB 4GWNA 3I2DA 2WL1A 2VOXA 3ZHQA 4YW1A 3RYCB 2PQQA 3HVDA 1BEV2 1VBE3 2PQSA 3P1IA 3PVEA 2WWUA 2GDSA 1N33B 4HKLA 1W6MB 4CH3A 3APOA 1QHTA 2PAMA 2FL4A 2JDYA 2ZE8A 4CBCA 1FPN2 3H1YA 3IT8A 4FOWA 3O1MA 3ZYGA 2KD7A 4NIHA 1ZZBA 1J59A 1ZUQA 2J1SA 5LGTA 3KQ4B 4IV3C 5LBBA 1H2GA 1YXWA 2VXJA 5GLZA 2XHKA 4CU9A 4O4JB 3VBFA 1I94O 4EN6B 4J10A 4LLFA 3BIEA 1NVPD 2XAJA 2OT7A 4AEJA 2D5HA 2IXHA 4O7XA 1S0IA 1XI1A 1Z5VA 3PNAA 3EFFK 4A6SA 4EEQA 3AMNA 4K40A 4AF9A 4ZXEA 4Q8LA 1FS0G 4QU2A 4BMEA 2N7GA 3LZZA 2R16A 4AHCA 4XF9A 2ID4A 4XQWA 3OR6C 4IEPA 3VBHC 3JD1A 1ORQC 1WLTA 2EAAA 2JB4A 4DS0A 2CV6A 2AYHA 3SGIA 5A70A 1SLBA 1UF2C 1O9GA 4FLXA 5EIYB 4QMAA 4YJ3B 2XQRA 3U75A 5L7OB 4BXFA 3LEIA 3B3QE 4WBBA 1RUJ2 1ULDA 4BIUA 5L19A 4C8DA 3RYIA 3M3QA 4PIYA 1PK6C 5FZ9A 2GNDA 3POSA 2GMPA 1NH2D 2ZGLA 4DV1B 4B3NA 4IL7A 1QGLA 5B1BC 3AB0A 1D0GA 3V0AB 1ACCA 4JPRA 3RZJA 4IESA 2WZR2 1W6OB 1SEFA 3JASA 4C7UA 3K5LA 1XPWA 1RUC2 2UU9O 3AP9A 5SV5A 1ND2C 3WU2Z 3TEWA 5FYBA 4JI1B 4AFCA 1RINA 1THZA 4QX0A 1WN7A 3E35A 4CDUA 3VOUA 1W6QB 5KWRA 1YRZA 2E51A 5FJHA 4E8CA 3EB7A 4DRVA 4H55A 4QNHB 3VQWA 3CEWA 1NT2B 4L9BA 1VRBA 3OUFA 4BZ4A 2CTPA 1W9FA 4FPGA 4YSFA 5KC5A 2NP0A 3JATB 2DN9A 4CCJA 1DLLA 4UW6A 3K79A 2HHHO 2WNVA 1RUE3 2Z5WA 2RS51 2Y8KA 2OA2A 4XFCA 2OW4A 4CCCA 3JALB 4BQ5A 2W1UA 3W7UA 4TV9A 3WINE 4MVOA 4GKJB 2DYRB 1CESA 1KKCA 4O2BA 1XYNA 2QQVA 1UOBA 4IEQA 5CG8A 3UGFA 5J2TA 4HXCA 4QXCA 1EAH2 5FAXA 4E2GA 5FXWA 2E74B 3LPFA 5FZ0A 2DVDA 4CCLA 1LR5A 2VS0A 3ZKYA 5BY5A 1ZRDA 2RDSA 4H7MA 5ABJC 3WG4A 1Q6UA 4JGSA 2ZM6B 4ORFA 3N2KA 1VBE2 2ADDA 2X05A 4XDOA 1YHFA 1MG1A 3HKEA 1XQ8A 3LCPA 3QH6A 2C6SA 3VZMA 3AMQA 1AILA 3J8F2 4SLIA 5DAVA 4GYCB 2IJKA 4P9LA 3USUA 3RYFA 4PELA 3AMHA 2M7WA 3E1F1 5FZCA 4JTDB 4FO9A 3LFMA 4AFMA 3KKYA 2HYXA 2R1DA 1VQ6V 5FUIA 4DW0A 2JG9C 2WLPA 2DVBA 1LKNA 1SQFA 2F66C 3LUTB 1B35A 3OM3B 1W0NA 5F2VO 2OZ6A 2YG0A 4AQ2A 3X2QC 3K04A 1SF9A 3WG2A 3DGTA 1PZ7A 3NAPC 5FY4A 1REEA 2CH7B 1UCXA 1QU7A 2ZX3A 1CX4A 4B7KA 2CAUA 5A7WB 4UF0B 2Y26A 2B39A 5HV4A 1OQ1A 2Q6AA 4Q4W3 1H0BA 1JJ2U 3H1HH 3M70A 2ZNJA 1DU3D 3ON7A 4DINB 2BNNA 2YC2A 1CVNA 4O4HB 3VKMA 2WO3A 2BBAA 1UZVA 1W04A 4ZS3A 4FP3A 3B7MA 3MBWA 3STLC 2RDNA 1PO23 4MGIE 2XASA 1P84F 1O3RA 1Y3TA 5FPUA 4WVWA 3CD6V 2VWKA 3DPRB 3CJHB 1YTFD 1MNGA 1HQWA 2D6MA 3JAKB 1PK6A 3KD4A 3VZOA 2V4VA 4LFAB 2LGWA 1OFNA 1EV13 4R9AA 4YW4A 4Y1VA 4J1XA 3OMNB 1RUI1 2D43A 2HWD2 2X10A 4Y33A 1V6NA 2BEOA 1J3PA 3PVNA 2Q8DA 1RMU1 3SYOA 1Q8OA 4LUKA 3VZJA 4J7JA 4FLVA 3AKRA 4X1YB 1P7BA 3KCYA 1S2KA 3OEEG 4EROA 2ZGNA 1AYM1 3ZIAG 4DXTA 4XDKA 5FP9A 2KM2A 5LASA 3NWKA 5K0UC 1G9FA 4K8FA 5LZ6A 4RO2A 4Q4Y1 2JJ2G 5KHJA 2ZTNA 3MIGA 1AI5A 2XWBB 3ETQA 2XL9A 5F5CA 2EINC 3OEHG 4K6BA 1TVKB 3LEMA 5TISZ 4IUGA 3K46A 1V6KA 3PLQA 1BKZA 1XSQA 3E22B 3ABLB 4LO8A 5KR7A 5FREA 4BWOA 4LF8B 4UW5A 3D82A 2W0FC 5A6XA 3OG2A 5ISLA 3ZBHA 2ARAA 1M57C 1EUUA 1X50A 5CADA 5EJZB 1COV1 3I2GA 3HKBB 5IVVA 4ICGA 5A3MA 1AB3A 4DEQA 5EWSA 4PI0A 2LRPA 2BU9A 3FMGA 5J09A 4DY3A 5JIUA 3CMGA 2RMU3 5FMBA 5FPBA 1RPOA 5T3NA 4M3CE 2NQYA 2ZX0A 1RM1C 5FXZA 5DEDA 1J5EB 4BYYA 4FPFA 2FMYA 2OX0A 4JTCB 1ENQA 2ZR2A 1JI6A 5ABJA 4FM2A 2LFRA 1MZEA 1QJX1 2EALA 5IYBO 1ZRRA 4P2ZA 5FZ7A 3ZFGA 2L9LA 1W3XA 3CXHF 2WJSA 3BVOA 1YI9A 2RCVA 4PQQA 3WZ1A 3FKSG 1UX7A 3CKHA 2VBBA 3BOWA 2R30A 2GMEA 5DAXA 4E4DX 3VKFC 3JYCA 1W0JG 1I0HA 5HPOA 1R73A 1FMD3 2R063 4AILC 5IAXA 1ZNPA 1PD3A 4W50A 2F93B 1OPMA 4FPYA 3WB2A 2HP8A 1LEDA 1HXS3 4QQOA 1VF5B 1S72V 1O7FA 1N36O 4I55A 2LJ2A 4X6QB 3B9CA 4GCZA 4UFZA 3VKLA 2OS2A 2WO2A 2WLNA 3G7DA 1QLNA 4Y5Z0 4Q4V2 3ZFEA 4Q4W2 2VNOA 4I0WB 4NHYA 4DUYB 1JU4A 4UB8Z 4AEDC 1YQ2A 3RPQA 2FZ2A 1VP7A 3IC9A 4QWNA 4RGGA 1TVGA 2E3CA 5A2QN 2JXAA 3R6SA 4GD4A 1J83A 2XLAA 4RQFA 2HJDA 2A3WA 3IPVA 3ACHA 1VARA 3D3QA 5C8CB 4CEYB 3AK1A 1PO22 1NZCA 3C7GA 2RJKA 3WNKA 3GZEA 4GQ7A 3DSQA 3GBFA 3BIWE 2VW2A 1RJ8A 3KMHA 1ENVA 3POJA 3CRRA 1UN1A 1W2BU 1Y76A 5L3BA 2NZ9A 3HN1A 4X20B 1EV12 5H9CA 4RFRB 3LDRA 1IBKB 4O61A 2D44A 2KG7A 2BGPA 3ASNB 1AVBA 3K2OA 5A80A 3RJRA 1V9U3 2R0HA 4HVOA 2XMLA 5EBLC 3RMYA 2G4IA 1JHNA 3RWRD 4IE0A 3OTOB 1QIQA 2JIGA 2JD4A 1GR3A 1LU1A 5LP6A 3MF9A 1F5FA 4DR4O 4K0KB 3FAVB 3SLIA 3ZHUA 3PUHA 3OFNG 4YFWA 2ES3A 5F32A 5K0UA 1QJY1 5KA6A 1R3IC 2F17A 4I4TB 2VJXA 2GBOA 3O9OA 3TEZA 4J7ZA 1QXPA 2LGQA 5AC93 2R071 3WDUA 1W9WA 2O14A 2GUZA 5IK8A 1L8DA 2CGNA 3ZMVA 5IWAB 4JGYB 3JASB 2JDZA 2PA7A 4GAZA 3N7KA 1WBLA 2IVIB 1EY2A 1HP8A 1S1AA 3ETPA 3NNLA 4DR1B 1ULEA 2IM9A 5DAQA 4GT1A 1PNFA 4LF6B 2XUMA 1VQ8V 1OSGA 1Q8VA 2R9IA 2RMU2 4ZZ8A 4GX1A 3VDCA 3UO3A 2HEWF 3ZLIA 4OUSA 1IBMO 2DURA 1CPYA 4AVSA 4WCEV 3M1HA 4ZZ5A 1UL9A 4YG6A 2K1EA 1KXGA 1BHGA 3AG4B 1OKQA 1S4CA 1S0JA 3TGUH 2ZPXA 2WNUA 1ULCA 1SCRA 4IW3A 4N53B 4AI3A 1DGRA 4LK6A 3VV1A 2IC1A 5KMGA 2DVFA 1MEC2 1PGSA 1QH6A 3PVOA 3RZHA 3GVMA 5A7PA 1FMD2 2R062 1H8VA 1XC6A 2K9ZA 1O91A 3VHNA 4GX5A 2VOKA 4O2BB 4QGNA 4CCOA 5J36A 2O1QA 1ZL8A 1G9AA 1W9TA 2QQJA 2OTLV 5IVBA 2YXSA 5IK4A 4JGZB 1HXS2 3ZMOA 1W39A 4YW3A 1ZAUA 3WG3A 1UFIA 1VLNA 1TMF1 3AYAA 4COVA 2CUGA 3GCXA 5EV7A 4JF3A 2A6ZA 2Y4UA 4JRLA 1JXNA 1US6A 3THOA 4LIUA 2UXDB 3MLLA 3HNMA 3WHUA 5FZ8A 2LTNA 1AR4A 3ILRA 1SBDA 1N47A 4CS2A 5LA9A 3EHBB 1OT5A 4HPKA 1UU6A 2EVXA 3DYPA 3TJTA 2FDHA 2UU8A 2B4KA 3EXUA 1GWKA 1OCCC 1RHI1 4INDA 5FLIA 4Q0PA 5FZAA 2V09A 5C3SA 3A21A 2LW8A 1JHJA 1KYOF 4CDQC 1KU9A 2B45X 1UY0A 4RR3B 1Y7BA 1XNBA 5C8YB 4IV3B 2YMZA 4GWJA 4H14A 3UJQA 2QDNA 5KUKA 1ULFA 4XCBA 1ALYA 2Q8CA 4I30A 5FOBB 4JI0B 3MFCA 4ES8A 3P32A 1OURA 1A8MA 4H44B 2ORZA 4QU1A 3KGLA 3RQ0A 3B02A 3POFA 1POV1 5D21A 3ZXJA 4AOCA 3VBHB 2WQZC 1X82A 1DZTA 3AFKA 3BCWA 5EJ1B 4LBNA 1TG7A 2YPJA 1HRV3 1W8NA 3WNMA 4A5UB 2UYAA 4E9KA 4W4ZA 3NV2A 4B8EA 1OD3A 3E5XA 3LDBA 4HSJA 1RUD1 1Y9GA 2N04A 3IIAA 4RL7A 5E8AA 5C33A 1IG0A 2C1FA 4I09A 3WEZA 2FQPA 3AP5A 3ZSEA 4KU8A 4JI7B 2XHBA 3ZMUA 5FY5A 4GZRB 4HK8A 4Z92B 4LWSB 4ZY9A 1PK6B 2P5OA 4OLLA 5BNOC 4UCSA 4JKMA 4K20A 4JYBA 5JZGA 1KITA 1WCKA 5CA1B 2P6HA 1XSRA 3WF1A 2VCAA 5B1BB 1N4CA 4NTYA 3K4DA 5IJ0B 2PGGA 3L73H 3ECQA 1PO13 1SQXH 3OUIA 4XDQA 5JR2A 1W3VA 4TV8A 1TAEA 3KHCA 3UJOA 4PLOA 4ITCA 1G9CA 5FYCA 4Q6GA 5LATA 3CCUV 1ND2B 5TSWA 4M01A 3TK1A 2PUSA 4LBMA 2VQTA 1RTVA 1MOFA 1UO9A 2JEUA 5J9PC 1RMU3 3S30A 1DLBA 4EFEA 3AXDA 1DGSA 2OPKA 2ZGKA 2H8PC 4A4AA 4D8MA 1YJ9V 2CHHA 1AYM3 1UY2A 5EFUA 4GIQA 2JEMA 3SKVA 2WFF3 3W5NA 1HNZB 4L0PA 1P8JA 3RGBA 1XXNA 4Q4Y3 2EA7A 4FCAA 3JSLA 3O1UA 2UUBO 3MW4A 2HVJC 4WM8C 4A41A 4ZXKA 2GP3A 1UYYA 5FNVA 3KCCA 3SYCA 3OAAG 3DC6A 3ZSJA 1S0CA 2BVVA 1N1VA 1UZ0A 1B06A 1XJAA 3AX4A 3I3EA 5CA0A 4TTGA 2ZKLA 2RS52 3DKWA 4CEWC 4DV5O 4KGQA 2RS11 1ST8A 2WT1A 2R70A 4A44A 5LHHA 4DV4B 2KA3A 2V72A 4E27A 4TWKA 4PF5A 2ZAAA 5ACA1 4CC6A 2NYYA 1SKVA 4YZ1A 3VBBA 4O65A 3RJ2X 4IGGA 3I3MA 1FJGB 1Y4WA 4C0HA 2X5IA 5JIAA 3PJYA 5FV3A 5HCBA 2X0LA 4P9OA 5FOJB 2BVBA 1IGOA 3ZYBA 3SDLA 1G4YB 3OD0A 3ZR6A 5H5NA 2E5LO 1G6NA 2IXLA 4LBKA 3RVHA 4R7CA 1HJFA 4FOYA 4MG2A 3I3BA 4FVVA 3E6CC 4GH4C 2X7RB 4PA3A 2QKDA 4IDZA 3OGJA 4QQLA 1LOEA 3GWOA 4CDQA 4YG0A 2GTAA 5LMNB 2JG9B 2AGAA 4WFGA 4LF5B 4EFBA 2UUCB 1XBFA 4NAOA 3EBRA 3ETGA 1YO8A 1O3SA 1W8UA 1KBHA 3F95A 2ETEA 3C3SA 4CUBA 3L71H 5A3TA 2JDHA 1K4CC 3OD4A 1XREA 3NAPB 1DF0A 3FLTA 5FLXN 3S3WA 5IDJA 1YYNA 3ZN1A 4U7OA 4JV5O 1M90W 3VBOC 4CDWA 2E7AA 4NIGA 2NN4A 2RM21 2VZOA 2XVLA 4C1XA 1L3JA 4QPGA 3SPHA 4PD4F 2OXBA 3UL2A 2VU9A 1EN6A 3FYEB 4XILA 3SITA 1W0PA 4NVPA 3TEXA 1EZJA 1AJNA 1PNKA 4MSWC 5LK7B 4ISQA 2Q7HA 3H1MA 4JQTA 2VOTA 1W99A 3ES1A 2W91A 3ES4A 4HG6B 4ISRA 4LULA 1LOBA 4FK5C 3AL5A 2TNFA 4EQVA 4IEXA 3M99B 4R50A 4CDXC 2VMEA 2LW7A 1K73W 5I0TA 4HVQA 2C26A 2HH9A 4FFGA 4KH9A 1RUG1 3LEGA 4B4RA 4QXKA 4XOGA 4XHBA 2QE7G 1HRI1 4IGPA 5A6YA 4HAMA 3FN9A 5ITZA 2VM9A 2VD7A 1XU1A 4RS5C 4LF4B 4FIPC 4D7YA 4B3TO 1RUI2 4H13B 2QBXA 3WB0A 3TCUA 1SBFA 4ZHQA 3NNFA 5K0UB 1RMU2 1HDJA 2P6JA 2E7TA 1PVC1 3LDDA 3SJAC 1C8M1 1DYOA 1VBC1 1AYM2 4MVZA 1A6CA 4FMTA 2D7FA 1LNQA 1N32B 2YGMA 4DXWA 3VD7A 4P9GA 2C5DA 2EINB 4DOUA 4U36A 2IXCA 4Q8KA 4Q4Y2 4SBVA 3CF6E 4ZOLA 1D4M3 2DCZA 5K1XA 5FZ6A 4JYAB 2YUEA 3GJBA 4JI2B 1O4TA 1LOCA 4HONA 1KQRA 4O4IB 1SA0B 5FZ3A 3WF2A 1M57B 1U96A 3HBKA 2W46A 3KWVA 1YIPA 1JUHA 5B66Z 3ZFFA 1PZ9A 5JI9A 5H6QA 3CCLV 3LSDA 2XPJA 2G1MA 3AC0A 2Z5UA 1VMHA 1LAJA 2BRTA 5IK5A 1W2AX 1LHWA 4OX9O 4IV1A 4IEYA 2B42B 1AF9A 1COV2 1YWKA 2QWPB 4YY3O 5JQGB 3IDAA 1RSOB 5FYYA 2UURA 1SZTA 5J96B 1O5UA 3AG2C 4AGGA 1AROP 1YUDA 4DXRA 3EJKA 2MK3A 3T1YO 3LSEA 4J9YB 5B3SC 4MVMA 4NJ4A 3TN93 1LCLA 4YVSA 1F4NA 3ZMSA 1ASJ3 5FMDA 3BOPA 4B3RO 2KR2A 3W21A 4YGCA 1RPRA 1QQCA 2IH1C 2EIEA 1QJX2 2CL2A 2EXHA 1DP0A 4JAUA 3D5OA 3QCWA 2XT9A 1OKOA 2D6NA 3WNPA 4DV6B 2WN3A 4GH4A 5DDJ1 1NOVA 5CFDA 1FYJA 4KXRA 2BNMA 1SQBH 1AR71 5EZYB 1L0NH 4ZI7B 4LKEA 1WPBA 3KQRA 3BABA 1XRUA 1AXYA 4YGBA 1OFSA 3RWKX 5AFEA 4JYYA 5FYMA 1VBD1 1W2OA 2RR13 4XBQA 2OQ7A 1RUH1 5CAZA 4AEDB 3ORJA 4KHPB 2YYOA 2ATFA 4PJ0Z 3FUOA 2RE9A 2ARHA 3SR2C 4M3CB 1UMZA 4TUYB 2VQUA 2GNBA 1PM9A 1UD1A 1HR0B 5BXZA 1KD1W 1FXHA 2VWJA 5BMVA 2NN8A 3OY8A 4MZUA 5T5PA 2YB7A 4XF1A 5FY1A 3WUDA 1RUNA 1UOFA 4QB1A 4RYDA 4K1ZA 1EFRG 5GONB 3B01A 2OQ6A 1GLHA 2EICA 4DB5A 1WB7A 4O4LB 5APAA 4CDXA 3AFGA 5C3PA 1MA1A 1BMV2 4LFCB 1NLSA 1VRH1 1J1LA 4MVRA 4FQZA 2JB8A 4NOTA 3J7HA 3ELNA 4LHSA 4XBLA 5F5QA 3P3PA 1XL4A 3HT2A 3RDIA 1IQAA 4IEVA 4I0XA 2VPVA 3HMYA 1POV3 5DG2A 2MEV3 1C28A 2LW1A 4OQ9A 3HNBM 1BMFG 4K3UA 3CXCU 5LCWL 3H1KH 1GM7A 1UIKA 1GWLA 1CPNA 1UXXX 3AYCA 2G9FA 1IDSA 4B3SO 2DCYA 1QOOA 5L73A 1QJY2 3I49A 1NR7A 1OHFA 3JAMN 3WDYA 3ZDSA 1UZZA 2QQOA 3IAPA 2E6VA 4B3MO 1XB9A 4QDSA 4J7KA 3ZRSA 1WLDA 1R6TA 2ORXA 1BLZA 2ZGQA 2R072 4X9QA 3EQEA 3SPGA 3HKDA 1BVP1 3R4DB 1NBMG 1DCSA 3I54A 1NA1C 4F83A 5C9AA 2OUHA 1H4GA 5E88A 1WLEA 2G19A 1EPZA 1Q86W 4HBNA 5BZBA 3D8CA 4UYBA 1SFYA 3DXUA 1H2LA 4AQYB 1CIWA 4XC9A 1N0NA 5LA6B 2O57A 4NHLA 3RNSA 5BNPA 4KBZA 3WOGA 1S77D 1Q56A 3MZHA 4Y24A 2O0OA 2GN3A 1ASJ2 3NL1A 3ZDVA 4QGPA 1U5ZA 3LNNA 3CNAA 1G9BA 2H0VA 4R6ZA 4XF4A 1X8MA 1NZIA 2CWSA 2FDFA 1SBEA 4TLFA 3IFXA 2WNEA 3DUIA 4F3JA 3MO4A 1AX0A 1GN2A 3VDDC 3FE5A 3H7YA 3BUCA 4AXOA 2ZIOA 3PUIA 2J1RA 5EP9A 4K7JA 2UWAA 1REDA 1D2QA 1M4WA 4UT5A 2QWRB 1K92A 2XGXA 4DRXB 3O1SA 5CBGA 5EXOA 1Y66A 4CCKA 3MUY1 4EB6A 4ZONA 4D7TA 4IYIA 2C9AA 1NQJA 5FZOA 1TMF2 3S5AA 2UXBB 4DV3O 2WSUA 4EN7B 2QEXV 2ZKOA 3KLSA 2JDUA 2VC9A 2VTFA 4Z8BA 2WQ4A 5CNAA 5BR8O 4ZKIA 4ATFA 2WAMA 1RB8G 4DR2O 1OCCB 4PBOA 2Y38A 2HLDG 3S57A 5LXTA 3OGSA 1K5QA 3JD2A 2XBO1 1GP6A 4KGGA 1K5MC 1N34B 1F4HA 1YIJV 3RYHB 4AE2A 2HWB1 3MD0A 5JH7A 2BDRA 1NZ6A 1NY72 4DR5O 3BU0A 5JVDA 5BV6A 4DV0B 5K1PA 3H3ZA 1JYCA 2CK3G 4TOIA 4FPKA 4PDWC 3NQHA 2WIIB 3WCRA 5HCHA 3VD3A 1C5HA 1PL4A 1I9RA 2RJLA 4IGOA 5I0RA 3UT5A 3ROUA 4BCUA 1YFYA 3WDVA 2JDKA 4W6WA 3JARA 2R1BA 3FHQA 3JCUZ 1QR9A 4F7ZA 4DV2O 3EVKA 3CX5F 3G6JB 5E79Z 3MI8A 3FFQA 1V6IA 2AENA 1XNDA 4YWAA 3ZN6B 2UUAO 2DTYA 1DGLA 1CXZB 4AI1A 2XLGA 1F15A 1VQ9V 5HV0A 5C93A 1ULPA 1NTKH 4YM1A 2ZE7A 3K48A 1NCRC 1RUD2 1KD7A 2LFSA 2FB5A 4XW3A 5BNOB 2FYUH 3GCWA 2VZ3A 2PMWB 1UY1A 1D5AA 1RP3B 4X1KB 5A32B 2DW4A 2XJTA 3BTAA 2DBIA 2I07B 1WA8B 2H3OA 5CZKA 2IU0A 4FPHA 2BPA2 1W9YA 4DY5A 3I3DA 4XJZA 1XMQO 1EM1A 2JEXA 1JQ0A 4IE5A 3WLUA 2GZWA 4IHJB 3KZ4C 2D6LX 3FC0A 3BTXA 2UY8A 4AGVA 3I7DA 1IBLO 2O8OA 2ZE5A 3BPZA 4XPVA 1NA1A 1UAIA 4LPLA 3A0BZ 2ZCEA 3H3UA 3IBMA 2VUCA 4XFBA 3CS5A 4CC5A 2A9HA 1BCXA 4QXBA 4NRMA 4X66B 3LPGA 1CAVA 3MLKA 3PMSA 3C90A 5ANNA 5C4WA 4NWWA 1XOYA 4A45A 4ZOLB 4LF7B 4V2WA 3SPJA 4AYUA 4AHXA 2F1MA 2WS93 1AR83 3ZKUA 3GGLA 1BJQA 1XMOB 2UXXA 1PVC3 1PZ8A 2ILMA 1RXGA 1WKYA 3G6EV 3TXQA 4XVHA 1C8M3 4U3JA 4WM8B 2UXCO 1BBT3 5GW7A 1OQDA 4NHKA 1PP9H 2I2SA 1IXBA 1W2TA 3M4FA 5JSOA 4FZ0A 3RZLA 4UXAA 1UJWB 1JA8A 3UCSC 4CEWB 4FLUA 3CEIA 3WG1A 2D3OW 1OA2A 1ZSPA 4Q0SA 2CWMA 5FXXA 4TQFA 3LGRA 3MGUA 1V6MA 3T2TA 2Y60A 1LENA 1RC6A 3IB3A 1N8RW 2A3XA 1C1LA 4AAPA 1DBNA 1IPJA 4M4RA 4BW9A 4RD7A 5DZFA 5HCAA 2FMLA 5ACA2 3E97A 5IWFA 1MS5A 1OC1A 3ZHVA 3ETDA 1AP5A 1C8NA 1MPXA 2TUNA 1N33O 4Q4X3 4KL1A 1I5PA 2XWJB 5F8PA 5GZDA 2QJVA 3BTZA 3QG5A 5CISA 3KT1A 4MGZE 1H4HA 3Q8CA 1H2MA 2ZINA 2VVDA 1IQDC 4FVMA 4BPZA 4CU7A 4KQ7A 4R9DA 1AJQA 2W68A 5CFCC 3CO2A 3RMXA 2H6BA 5B1NA 2ARBA 3A0NA 2WNOA 4G3YC 1LU2A 4QX2A 5DUUA 1GUIA 5DN2A 1AR73 2XTAA 4AW7A 1AYN1 4MHUA 4AEKA 4JKLA 3N27A 4E2QA 3VBOB 1CP9A 1CN1A 2ZKNA 1WA4A 5LY2A 2ZHNA 4J11A 1Q8SA 4X1IA 1L7QA 5CB4B 4JV4A 1FXKC 4DK1A 1IPSA 1V9PA 1RUH3 5JMOA 5T5LA 1IKPA 1YLLA 2YPDA 1KP2A 4WVMA 4G2KA 2P90A 3IN9A 1MZFA 4C91A 5C70A 4WM7C 1UIJA 3SXWA 5LMUB 1WW4A 1SLCA 3ZSKA 4FT8A 3MIDA 2XHNA 4Q0QA 2FKXA 1JOBA 3O0XA 2HWF3 2ZIMA 4DV1O 4K8XA 3C7HA 1T5EA 1JR9A 2J42A 3ZCCA 3GNEA 5GTHZ 4GX0A 5EK0A 2N05A 4XZPA 2AH2A 5EC2C 5F2WA 3ZX7A 3ICXA 1TUBA 2EIKC 3QNEA 4RS5B 3A23A 3NJZA 5HI0A 5I8TA 5FZBA 5A33B 5C3RA 4CUCA 4DR3O 3Q8BA 5J2UA 2WO7A 4P02B 2WLJA 1IPKA 1MACA 3HAGA 1HRI2 5DABA 4UW3A 1VRH3 2OIIA 5IY5B 3H1IH 3T1HB 3URFA 5KA5A 2IXJA 1NH2B 1X59A 1W06A 5FJKA 4OMCA 4MADA 3ZRWB 3J7NA 1GOGA 1G6UA 1Z0HA 4CS3A 1PVC2 4IE4A 2DE0X 1NQDA 3OUSA 4MGSA 1C8M2 1FX5A 1B3QA 5LOVA 3RYPA 3AEIA 2HWC3 3APQA 4XFGA 4F4LA 2XVGA 2VNVA 4CCMA 2OCCB 3HQUA 3TOJA 5GALA 1SHWB 2QNKA 3R0RA 2K46A 3LOBA 1RUE1 3KF5A 1QF3A 4GKJO 4YW6A 4QKFA 1UZYA 1YEWA 2WN2A 4I5SA 3WG7C 4MSVA 1G8WA 5T52A 3I97A 1QWRA 1IS3A 4IXLA 3CHXA 4G27B 3OF1A 3AG2B 2I45A 5EJ3A 4LKFA 4FBFA 3HPNA 4ZHNA 4AI9A 3LWCA 2ZM6O 3SC7X 5GJ6A 2BTQB 5B3SB 4OI2A 2Y6HA 1N1TA 2GSMB 4HETA 1VQOV 4FXKB 3CRCA 2WR9A 4JTAB 2JJ6A 2BQPA 3VD9A 3ZXGA 3KVAA 4P9PA 2D40A 1CAWA 4X64B 2CGOA 1F7YA 3I2FA 2BFUS 3HN3A 4FLTA 1CR7A 4CCEA 1W8ZA 5J37A 3OE7G 4QB6A 1CAXB 3FB5C 4MXWB 3CPWU 1AJKA 2VZVA 2CTWA 5C71A 5B4NA 2ZEXA 2B46X 4CSWA 5DDJ2 3ZHTA 1NX9A 5FZOB 1VB2A 5JPMB 4K8RB 4N90A 1AR72 2DFBA 4BLIA 4X8NA 1M5IA 4N21A 1CEZA 3LAGA 1ZBE1 4KP4A 2Y64A 1BHBA 1Y74A 1ZA7A 1MVQA 4OI1A 3P30A 3MPBA 1VBD2 2SLIA 1Z7S1 2VZ1A 2C9KA 1GNZA 1CZSA 4Z07A 2RJ2A 1RUH2 2PN5A 3G71V 5D5PA 1CAUB 1I7FA 3O7OA 4Q27A 1FXKA 2Z42A 5JI7A 3DECA 1XE7A 3ZX6A 1PX4A 5FP4A 1K7DA 1BHAA 4AI0A 1YJWV 4BM8A 2IJIA 1S0VA 1ZX5A 4KWUA 3J80N 3WCSA 3RZKA 1PO21 2GSYA 1SPPA 4FLZA 1FOD3 3OEAA 2HWB3 5A6ZA 4JZ2A 3OUJA 1ZBA3 4J1WA 4LFAO 5BNNC 4OGQB 2A70A 1MMMA 3CE2A 3SH5A 5FDBA 3SJQC 4OFGA 1UPIA 1W6PB 2ZQMA 4E2SA 2ZX1A 3ZYJB 3E8HA 4TYSA 3PIGA 1BT8A 3NNGA 2YIBA 2GNTA 1DHKB 4CH5A 1NLQA 1C1FA 3VBFC 3A7QA 5J98B 3ZXDA 1VRH2 4YM0A 4GLXA 3WX5A 5KXDA 4QM9A 3BKZA 5LYJB 2FMDA 3X29B 3O1RA 4KU7A 3W7TA 5BY1A 4HVRA 3CRMA 4QD2A 4OHZA 2VTXA 4XABA 5H6RA 2OUJA 4NXNB 4FFKA 1HNWB 4XCAA 5IVCA 2WLLB 3LE0A 3RZMA 4MW8A 1ND3C 3T4VA 5HFMA 3ZMZA 4XEZA 3SEPA 4XJWA 4XQDA 3M8AA 2Y6GA 4UBHA 3HEIA 4WZCA 1VPHA 4XFHA 5JXHA 1LECA 2HEVF 2HJIA 3WF4A 4RQPB 1R083 3MIEA 4LF8O 5L3EA 4PLNA 1XNRB 1WMFA 1JFFA 4B08A 2XQXA 3NKGA 4XDLA 5I0UA 1GNHA 5DXDA 4CP1A 1GQPA 4XFAA 3HPLC 1OOPB 1Q8PA 1OUSA 3G80A 4WFAV 1UYZA 1VBB3 4YVWC 1K3IA 2JGDA 1B6QA 2D97A 4GJYA 4OCTA 5FZIA 4UFLA 4OYUA 1W05A 5IYZA 1HB3A 3SH4A 3IDEA 5FZEA 3KV9A 3J7AU 4K8ZA 1J5EO 2FD8A 1V55C 1Q6IA 3HQRA 3PN1A 1I08A 2OT5A 4XJUA 4F8AA 2PZSA 2EBOA 2A71A 2CDOA 4BAYA 1FFTB 2DU0A 5GLWA 4DR7B 4NXMB 5L9BA 4X65B 1R1A3 3HOBA 3ZXFA 3ETEA 1S55A 3VDDB 1OXCA 5BYNA 2WC2A 3WXPA 1GP4A 3OR7C 1LHVA 3IGAC 1U5IA 2A5ZA 4D69A 2JK5C 2WDBA 2XAHA 3OGVA 3RYRA 2B9UA 2UWCA 2ATKC 3GZTB 3BALA 3Q4HB 1PHMA 1YJKA 3N7LA 2QR4A 3NV4A 2XKOA 4YHHB 2ZX4A 2WNVC 2ZXQA 3D3IA 1Q8IA 4RGAA 4GKKB 1HXS1 4K9SA 1QQP3 1WP8A 3K58A 1TNFA 3CMEV 5BNQA 3ACLA 2FBEA 4TQDA 2F6BA 4BK5A 3MIFA 2EILB 5EYPB 5IT9N 4PJYA 3NV1A 1QJFA 1Q43A 2OPWA 4DUYO 3Q8AA 1F31A 4UI9L 4E4HA 1AJOA 4QPIA 2HBUA 3N7JA 2VVEA 3K5OA 3JAWA 4EZ4A 2VMIA 1VQMV 1K5MB 1ONAA 2GHYA 1Q7YW 3ZPYA 4WBNA 1Z2GA 1W59A 1ZLZA 1FFXB 4LCUC 3G4SV 5FYIA 5EYXA 4E4SA 3NJXA 2PTMA 4S2HA 4P00B 2XH6A 5E1RA 4W6YA 2J1EA 1HB4A 3VQXA 1HKDA 2XBO2 2QGNA 1OD5A 3AK2A 4PQ9A 3M7MX 2HWB2 2YZ4A 1GN3A 2GH8A 1ODMA 2IUWA 1LRHA 2VTXJ 4Q1PA 1APNA 4L99A 2DFCA 2ZE6A 3T1MA 5DUXA 1AZDA 4PDWB 1XL6A 1IBKO 2Z79A 1NKDA 5FZDA 5LEJA 3H0OA 4N43A 1HNXB 5BNNA 4O9EA 1CD3G 1GYKA 2ZHLA 1PIV3 4ZPIA 5FL7G 4GUNA 1WAZA 3FZ3A 4JZGA 1QOSA 3GB7C 5FQ0A 1V9U1 1B35C 3OTOO 2DOSA 4X88A 5A1AA 1U5YA 4LBEC 3GDBA 4AVVA 3KM5A 2PHTA 1BVVA 3AP6A 1AYN3 1FYUA 3IIIA 2QFEA 5G05L 1QVGU 5D2AA 5GTIZ 4K0KO 1DQ6A 2FZ1A 3BAAA 3AP7A 1NCRB 2J7MA 2RV9A 2JG8A 2JICA 4QX1A 4YGEA 3B40A 1ND3A 5E1AC 4AQSA 4PI2A 1QXRA 1CONA 5BPXA 4FFIA 5JUVA 5FZLA 2WFPA 1DQ1A 3RVZA 4DXZA 2D2CB 5AC91 1G86A 5F6LB 3KV4A 2YGLA 2JDPA 5IWAO 2VCCA 1SLAA 3CJIC 2BOCC 1PM7A 3O1VA 4BQXA 1UOGA 3HKCA 3AG1C 4ZIBA 5EZWA 1MS3A 4DR1O 1AI4A 1SLLA 2N74A 4LF6O 3ZXAC 3F7YC 4UAPA 3O0VA 4YVWA 3R4SA 3ASIA 1GKBA 3VBUA 3UNPA 2BCCH 3PHMA 3L9DA 1F9KA 4YW2A 3K5NA 2ITCC 2BOIA 2GU9A 4CZSA 3MFAA 1QNMA 3F7VC 2G9ZA 2BWCA 2J1VA 4IYHA 3OYWA 4ZKTB 1H2SB 4PDMA 1H1MA 4MH0E 2OZJA 2R6QA 1TME1 1W6NB 1GZWA 2VW0A 4EN9B 1YZBA 1A32A 2BSKA 4M0HA 2JECA 1GSLA 5FO9B 1XNCA 4LXLA 3O0WA 4GJZA 3J26N 4AFDA 4Y22A 1US3A 4JDNA 3OPTA 3LIHA 2A7WA 2Q5ZA 2PHDA 3CMAV 2ZMNA 2W1WA 4I50A 4FM0A 2WWJA 1E57A 1QQP2 1PMHX 3H1JH 1ZTEA 3KT7A 3BGAA 2VO5A 1VQ4V 4Y3OA 1PX3A 1POQA 2UXDO 4DYLA 3TWIA 5DZEA 1SLTA 1QOTA 4IIJB 2DUPA 3HIFA 2X6BA 1QY4A 3OBTA 1H1AA 5FZMA 3OBAA 1R6KA 1LULA 4NWVA 5F1RA 1J58A 3FJSA 1S76D 4Z82A 3D36C 4O2AA 1GKFA 3BODA 4Y20B 1YFXA 2VQFO 2YEVA 4MX3A 1WD4A 2EXKA 1WBFA 4LH7A 3ZYRA 2PYJA 4X6RB 2YU1A 5LB6A 4D7SA 4BA6A 1CIYA 1SFPA 3ZFGC 2P37A 1O8SA 1K45A 2VZPA 1D2DA 1P49A 2DCKA 1EZVH 5CFCB 2E63A 3KVBA 4EYUA 2IVJA 4FFBB 2XOKG 2FTKA 2HR3A 5JXJA 3DGEA 1SZBA 1E5HA 1TQ5A 3ILNA 4V1PA 4JI0O 5L7OC 3LFIA 3B94A 1I5XA 2Z0AA 3ILFA 3OBZA 1NCQA 5IFPA 3UETA 1QEXA 4EWAA 2AW9A 4F6RB 2E76B 2Y6KA 1PIV2 3APBA 1FI2A 4NE9A 2QQMA 3VBSA 5LY1A 5A1LA 1IS5A 2P1BA 5FY7A 2WA3A 1FV3A 1HW7A 4EWEA 3FX7A 3UO2A 1E1QG 5H9SA 1AJPA 1FXKB 1AYN2 3M3OA 1ZBE3 2CDPA 2Q9LA 4LJHA 5IJ9A 4H37A 1GBGA 1HRV1 2E7QA 3ZFEC 5D8AB 1M1KW 4WV8A 4JI7O 1UY3A 4JZRA 3QO5A 2QQNA 3WQBA 5IW0A 3T2OA 1Z7S3 3L2YA 4WM7B 2NR5A 2F23A 3O12A 1LOFA 4PLMA 4MLOA 4AR2A 2WAOA 3WNLA 5FK7A 3C7OA 4A6OA 5FWEA 3LA3A 4XBFA 1H8TA 4CP9A 1WWYA 3NW4A 2QZ3A 2XB6C 4N8MA 5JOWA 4N7UA 2PELA 1GZ9A 3M7AA 1KECA 5A3LA 2Q7GA 3H3LA 2EIKB 4A7KA 4XF0A 1QJZA 1JMUB 1W8OA 3WW1A 3CJIA 1PO11 4HZFA 1UPGA 2YXLA 2WAAA 1SQ4A 3SEEA 1I5ZA 4CTEA 4LBLA 2JWPA 1H8HG 3KSCA 2ZGUA 1FD9A 4YJ2B 4XACA 4R4ZA 4NAMA 3I59B 5FYZA 2QWQB 2E75B 3ZHRA 1QDOA 3U1XA 4NIDA 2PXJA 3CCRV 1X33A 3CDZB 4BQ3A 4RN5A 2IH3C 3NRUA 4LO7A 2A6YA 1TGOA 4CYDA 1VMFA 4YW7A 1HNZO 4X8AA 5LP6C 3PMEA 3CP1A 3DC5A 3N7MA 4P9YA 2WFF1 3VKNA 2HFEC 3VL9A 4RFT0 2W9XA 1P4RA 3RYCA 3VHOA 1VAKA 1AI6A 3R66A 2QCSB 1MQTB 1H9PA 3CCEV 4MTXA 1LR1A 4QHZA 1MZ5A 1K12A 4E4EA 3WG7B 1DK1A 1ENSA 5KAIZ 3TB0A 1PGW1 1W6MA 4LOTA 4PIZA 1W8TA 4R8HA 1AX1A 1RUE2 1JX9A 4RSUA 4DV4O 2Y48A 1VQNV 3RSJA 5L36A 3R4UA 2RDCA 2B9ZA 3WY6A 1HV0A 4K3AA 2GN7A 1D7PM 2DTWA 4H33A 4RUEA 1FJGO 3BTYA 4O4JA 4CCDA 5KHHA 4DIQA 4XMAA 5JSPA 1Y4MA 3PIJA 2KB1A 5HFLA 3D36A 3V65A 4X62B 3V0BB 3POWA 2QE3A 2XXZA 3K0DA 1U97A 4DUZB 1BCCH 3E2EA 2WQ8A 2JJ1G 2WNUC 5C3OA 4DUVA 1TZOA 3D0JA 1ENXA 1WMEA 4LNUB 3M3EA 4GB33 4WFEA 5LMNO 4LQRA 4IE7A 4N7IA 5F2SA 2UUCO 4CCNA 4LO5B 2R0FA 2VZQA 2ERFA 1VJ2A 1CPMA 3UKNA 4YJ3A 5L7OA 4MV2A 5T5JA 3I8TA 2PLV3 1STMA 1AP6A 1QKQA 4Y1ZA 3CWBH 2YBSA 2PHFA 4DR6O 4YYOA 4QDRA 2QKAA 5LRSA 2OWOA 1C57A 1B09A 2P6CA 1ZBE2 1YJLA 2EX3A 3I2IA 1JYTA 2YICA 4JTOA 3V0AA 3AKSA 4WF9V 5LW9A 5KX5A 4Q0UA 1W6OA 4URAA 2VQEB 1HB1A 2J1AA 4XXPA 1Z7S2 2RN9A 2WYFA 3POGA 2DCJA 3OJBA 4S2GA 4H2AA 3SJBC 5FUPA 5K8SA 1HLCA 3CB2A 4XTMA 4QE7A 5C5UA 3SNMA 4OMDA 5FYVA 1JVMA 4FAHA 1W6QA 3FB6C 2CYFA 2W87A 4I3PA 3GHNA 1S2EA 3H9VA 2H94A 1AUYA 2ARCA 3U4XA 5FYSA 5JJEB 4JI5B 3SHRA 3IWZA 3UGHA 1QJU1 2B5UA 3VBFB 1T6GC 3CZUA 3JZVA 1BMV1 5FLJA 3JATA 4LF4O 3RS6A 1DTOA 4R9CA 5H9QA 4ONUA 1FNYA 2Y0IA 1VMJA 1XDCA 3AKTA 1H38A 1WCSA 5DAWA 3WDWA 1PVXA 4XXAA 1VAVA 3JALA 1N3PA 2XDVA 3W7XA 3CC7V 3EHKA 3JD4A 4XQ4A 3JCIA 1N32O 1O6UA 3SPIA 3UKVA 2VOVA 3ACIA 3IM0A 4HSLA 1WP7A 4NIIA 4PA4A 3POEA 4P14A 3T08A 3WFVA 4LLOA 1US2A 1F23A 1O9HA 1KKDA 3UV9A 4JI2O 2Y6LA 1D4M1 2QTSA 2QZ2A 2QM4A 1IURA 4HLTA 2PF4E 4JI3O 3AG3C 4LR4A 3RYIB 2BP6A 4Q2FA 4LBJA 3D4KA 2ZZJA 1OZ0A 5FR3A 5JZGC 4HT1T 5B1AC 1MS8A 3JBG3 5FTTC 3L70H 1V55B 1IKQA 1X8EA 2BTVC 1B04A 2M6YA 1J3QA 2W95A 2ZZQA 1N1YA 2JDMA 1S0DA 4QQ2A 4GWMA 2P22C 4CDUB 2Q8OA 4XURA 5F7UA 2BSKB 1R093 2EF6A 2F95B 2RG4A 3TN91 5DUWA 4Y1XA 2JVDA 2AEYA 2IFRA 1ASJ1 3FLRA 1RIRA 1WCDJ 1CJPA 5A7WA 4UF0A 3N3HA 5LA1A 4DV6O 4D94A 2W3JA 1TME3 3THPA 3GWKC 2Q7EA 1YFWA 5IT6A 3Q9OA 1EN5A 4CXYA 3U11A 2AGSA 3KT4A 4O4HA 2WNVB 1RVF1 1KGYA 4JDOA 2CTQA 4X89A 4DFSA 4HK9A 1Y9MA 4TV9B 4MYEA 3WHTA 4KMQA 3TYJA 4AHZA 2HJFC 1XE8A 2VCBA 2F4VB 2RS31 3DPRA 5J2TB 2W92A 3CJHA 5EIBD 4OHXA 5FKCA 2RR11 2Y33A 3JAKA 1AR63 3WP6A 3ASNC 3WT3A 5FUNA 4UVAA 4FPEA 4DO0A 4RAIA 5I91A 3ZSMA 1YFUA 3N2KB 5FO8B 5KXBA 1QHDA 4YM3A 2VBPA 5CVRA 3HKEB 5A7OA 5J7MA 3EMRA 1C3HA 2X5IC 1HR0O 2FDKA 4X1YA 1CZTA 2Y69C 3FLPA 4DNYA 3TRSB 3USUB 4C1WA 2DWDC 3RYFB 3IAYA 2CSGA 1NY71 3W20A 5E6HA 2ZEZA 4CS4A 3EYPA 5IYDO 3UQ8A 4LFCO 1WMDA 1PM4A 1VALA 2CAZC 3AZWA 5A7NA 1TVKA 1HN0A 4J42A 1B35B 2BUKA 2BV4A 1DYKA 5FPZA 3E22A 3J7MA 5D1IA 5DN6G 3ZXEA 2LS6A 1QXJA 3ZYHA 1K8AW 2WINB 5KHKA 1V9U2 5JOXA 5JCOA 1RUC3 3HKBA 5FPAA 4CE8A 2MEV1 2QDOA 2VMCA 3CRAA 4CDWC 5B2GB 3GZUC 3BRCA 5AVPA 1KQSU 1QMJA 5I8SA 4IEUA 2LQTA 4QPGC 3AKPA 1URFA 4LHKA 4XUQA 2YIBD 1WCQA 2NPIA 5FY8A 3Q8EA 3AG4C 1D4VB 3MHSC 2BFUL 3N4MA 3CJIB 2CTVA 3GYDA 3ALQA 2XR4A 4UVCA 2YBPA 1R64A 4LBQD 1WNSA 3FYIB 3AG1B 1YQ8A 1S5JA 5AC92 2ADPA 2LO1A 1E5IA 2VQAA 4JI8B 2K9PA 2NNUA 1RGSA 3HR0A 1KB9F 3AZYA 4LF9B 5JXGA 4OPAA 4LE3A 4QXHA 1GU3A 4AQYO 3QO8A 2IFWA 3HR9A 4OHVA 2K2SA 1SZXA 4LEJA 1GICA 3S5QA 3ZN4A 4HKOA 1LHUA 5L3GA 2VBDA 1EAH3 4AVAA 4COYA 1DQ4A 2WLHA 3ASOC 1O4ZA 2YV8A 1PNLA 3ZYPA 4NROA 2W08A 1YSCA 1T6BX 4YG3A 2E32A 3BYWA 2QTOA 5DAPA 5CIRA 4LFBB 1OLME 4COWA 3VKOA 1Q90D 3O1PA 1YNAA 1MS9A 3SJCC 3OMAB 1Y9QA 1TME2 1SS3A 2EZPA 4CH4A 4JX0A 4NHXA 1Q5OA 2XAQA 2V5DA 1VQ7V 2BE3A 3LDKA 3J8F3 1KDMA 4XJ9A 4JHZA 1QVFU 4KBBA 3OW2U 1S5LZ 5C8CA 3MW2A 4CEYA 1VQ5V 4RR3C 4LBOA 5A7SA 3M3IA 5LEKA 4MTGA 1X9PA 1JN2P 5FLHA 1PMIA 3RG0A 1DZQA 4K21A 5FPXA 2VOWA 3ZFFC 2P7TC 1OI6A 2UXBO 4IQPA 4NPMA 1RUF3 1AR62 3B8MA 3NXSA 1SG3A 4IV1C 4QQPA 5LBCA 4X20A 4CPBA 4UFIA 2BYVE 1F35A 3N9LA 2DF7A 4KWKA 5F9TA 2PHUA 2KXLA 2VVFA 4LR3A 2IXIA 2ZT9B 3I5DA 5ABJB 4OZXA 3G67A 2BGOA 2DU1A 1VAMA 1N34O 4NPRA 3ZFGB 2G38A 1S0GA 4D6RA 4CP0A 3GBGA 4YVSC 2WA4A 4ABMA 4FAGA 4ZS2A 3MEPA 4DV0O 2XJRA 4W6XA 3FAVA 3I2HA 5I0SA 3N9PA 3PTYA 2BZDA 1UU5A 4WVZA 4I4TA 5CFDC 3W7WA 4AHWA 1FXVA 2ZX2A 3WP3A 2PYTA 3IMMA 4LC1A 3DXTA 4I55B 3MHZA 3CBNA 1V54C 2AACA 4A42A 3GF6A 1ZM1A 1SACA 1ZZ9A 1BSMA 1GTOA 1L7RA 5KX5B 2WSVA 2HWD3 5L3FA 5CB7A 4JGYA 3ZFEB 3X2QB 4AFAA 3VD4A 2GV9A 3KCXA 3AM2A 1MSWD 2BOJA 3ZOIA 2MHFA 2XVKA 4DR3B 3LA7A 1TEIA 2DYSC 4LK7A 4META 1HRV2 4JAVA 2JKXA 2C24A 3CLPA 1ZRIA 2LROA 3W9AA 2AHZA 3IPVB 1FAYA 1F8VA 3LB9A 4XDPA 1OVPA 5KXCA 3I56V 4CP2A 3T09A 3QD6A 1U0AA 2NMOA 3CCQV 4NKGB 4AI2A 1L7LA 2QVSB 2QSAA 3CC4V 3THTA 4JI6B 4WFFA 3ZPOA 3ZHSA 4N53A 3B09A 1R1ZA 1Y76B 3AZZA 1JOYA 1KS5A 5B4XA 5F3CA 4QDQA 2KG7B 2A6VA 3OPWA 1LGCA 4B1MA 4XBNA 5IHRA 1PO12 5GLVA 4X66O 1QJU3 3CZJA 1LUWA 1OF4A 3K77A 4JGZA 2YS8A 1N3QA 5JOYA 3RYKA 4XTPA 5FYTA 4LHNA 2FCUA 4LF7O 3E8BA 4BLJA 3CSXA 2A79B 5KLVH 5FFOC 5LP6B 2DQ3A 2BJSA 5JAXA 3SMHA 1XMOO 4COUA 1GN6A 4LKDA 2WS91 2B9VA 2GTSA 1AR81 4HYOA 4E4ZA 4E2LA 2D6OX 3SPCA 4P5YA 3CU7A 1AVMA 3JQXA 1BBT1 2WT0A 4UFKA 4DK0A 1F4AA 2R32A 2WFF2 2GUZB 3FB7C 3U0ZA 3J81N 4CXXA 2X29A 4QT6A 4AG4A 4FLYA 1YC61 2EIDA 3HJRA 5IVEA 3OB8A 3S6PA 4G4FA 1NXD1 3B8NA 4MGQA 1PGW2 2ZGPA 4RR3A 2CGPA 5HCFA 4XE9A 3ABMC 1RUF2 1YQ5A 5C8YA 4IV3A 2TEPA 4GKXA 5LA2A 4WFBV 2HKXA 3NJYA 5C9AC 1XNQB 3MIBA 3CCMV 3LQCA 1O3TA 2QWOB 5JMCA 1UXZA 4Q4V3 1RM1B 1NXMA 3WNNA 2ZXWC 5BNPC 2WNUB 2TBVA 2XJVA 1YDXA 4Q4X1 2VZTA 4A7ZA 3VBHA 1HQNA 4AZZA 3JB4C 1JTZX 1G9DA 1X7NA 5KMGB 5T5OA 5IUQA 4BR6A 1YCIA 3WQ1A 2JD9A 3ZJZA 2HLEA 4GMP3 5CBHA 2W6JG 4BIZA 3FFZA 4AVBA 5EBMC 3QBQA 1ZL8B 4AVTA 5CYYA 3RVYA 1VMGA 1M93A 1BL8A 2OCHA 3VBRC 3DYMA 1OLMA 4LWSA 3WDXA 3K51A 1IS4A 1RVF3 3T0DA 1REFA 2ZDIC 1LEMA 3ZXLA 4HMZA 1RXFA 2FDGA 4XUNA 5CA1A 2VNGA 4XHXA 3AXEA 5IJ0A 5LHGA 4CUAA 1MABG 1XYOA 1UMIA 3WP5A 2RS33 4HPKB 3K06A 1ND2A 4QPKA 4Y5TA 2VZUA 2Q4PA 3MAQA 3OGIB 2IXKA 3H1LH 2QQKA 3RRDA 5JPNB 3OMIB 1XQNA 5LMUO 1DGWA 4GWIA 1GRJA 2FCVA 4XIOA 1Y67A 4JI4B 2EJRA 1UYXA 1O59A 4M4PA 2P06A 1L0LH 1O4YA 4BWAA 3NJVA 5H2FZ 2BGCA 1HDKA 4B7EA 2HWF1 1K4DC 4OI0A 2P34A 3UT0A 4YZ3A 5LGNA 1A34A 4BIFA 1WCUA 3S7IA 4XDJA 2QM7A 1LHOA 1NQTA 2Q0OC 1W9SA 5K9YA 5KC6A 3L72H 4FPJA 3ZSLA 5I0DA 3CC2V 2YI9A 2Z4FA 3U14A 3L74H 2EULA 3Q8FA 1QJU2 2ZGMA 5J3UA 3T1HO 4XUPA 2CTRA 4RUFA 1QLEC 3ZM8A 5GZFA 3TETA 1NAEA 1PGL1 3O1OA 3WV6A 5LRRA 3T0BA 1PMJX 4UW4A 4MGKE 4YXWG 2OYQA 5JJJB 5JOZA 2NLJC 1AXKA 3E6DA 1XHZA 3K08A 3AG3B 3G6BA 4W4KA 1UMHA 2HWC1 1A8DA 3DKQA 1CWPA 1MEC3 5JZGB 1D4M2 1K33A 2VZSA 5B1AB 2JE9A 3ZN0A 2RHPA 4AQ6A 2JENA 1ZZ7A 3ATGA 5C3QA 1KC8W 3LIGA 4MHRA 4TV8B 3QACA 5GZGA 3NO8A 1E5SA 3E5UA 2JG9A 2Q0AA 4BMBA 3IDBB 1ZRCA 1BE3H 2VL4A 2ADEA 2VUDA 3C7FA 2HVKC 3CCSV 2HEYF 2R043 2GP5A 2YU2A 3NAPA 1SRYA 2EJ7A 5C4WC 4X64O 3S0MA 3BA8A 1XEQA 2ZCWA 4W4LA 3M8LA 3VHRA 2ZJCA 4JCKA 3ZRVA 3TN92 2Q1ZB 3N36A 1G7YA 1GWMA 3OTFA 3N9OA 4JHTA 4DV7B 3I2KA 3OGCC 1W28A 3UM7A 2RNBA 3TNQA 2SBAA 2OTJV 1SQGA 2A06H 1TNRA 2DV9A 5FNVB 1V00A 5JDBA 5C8WA 2ENRA 3A22A 2KKWA 1RVF2 3CJXA 2LM3A 1GQGA 5CA0B 2YC4A 1JW6A 4CU6A 3VBRA 3THDA 1HJGA 2VUAA 2ZEYA 4R8CA 5K4LA 1E79G 1PNGA 3K9AA 2ZDIA 2EZOA 3QTCA 1AR1B 2WZPP 4A3XA 2ZGTA 4DW1A 2D93A 2RS32 4PF1A 4BE3A 3SYPA 3T4DA 2RR12 1GZTA 3N2GA 2X5IB 2LP7A 1I94B 2W39A 2Y69B 1Q3EA 4RQEA 5CKQA 1S0EA 1NJIW 1YQCA 1JPXA 4DMIA 4L2NA 1DF4A 3BFRA 1YXBA 4H7LA 3VHPA 3ZMNA 3EO6A 3VL8A 3ZS8C 5D5QA 4CDQB 1JYNA 3HD8B 4HANA 4IL6Z 3RN4A 3SQOA 1FOD1 2QWNB 1OCRC 3JD71 5IAVA 1ZBA1 5LHIA 2JDNA 4PT6A 2ZA9A 2ET7A 3AKQA 5AFBA 5J1XA 5F39A 3AP4A 3WNXA 2VW1A 2ZGOA 4XUTA 1V6LA 3AYEA 2DYCA 4RHV1 4O4IA 1EYBA 1SA0A 1A3KA 4H0LB 4S2FA 5A3OA 4FTBA 3TNPB 1VF7A 2JKBA 1S2BA 1OCZC 2V1DA 2HYKA 4CDWB 4NXNO 1I3HA 1HNWO 3UYJA 3TAYA 2V7QG 3AVSA 5FPLA 3WSOA 3MV11 3BEHA 3NVCA 4QPGB 1K5SA 5B1OA 3KV6A 2AXTZ 2WT2A 5JQGA 1RSOA 1ZVFA 2MEV2 1JYIA 4AWDA 3BU7A 3W5MA 5IJRA 2UU9B 3GZAA 3O5SA 4P9WA 1H1IA 4FTEA 1XNRO 3POBA 1EUTA 4EE2A 2C0ZA 1R081 4GX2A 3E83A 4CU8A 4JRAA 4QX7A 3KGZA 1NLRA 3A4UA 3IAQA 1NKGA 5JVVA 2ZHKA 5KAFZ 2WBKA 1HQLA 1VBB1 3IKWA 3IZOA 1W8WA 2LALA 4KG8A 5JSRA 2ZS6B 2Q8EA 2JE8A 5ITZB 4AAXA 4NN0A 3ZRXA 4QB2A 2RS53 1DQ5A 5EZYA 2HHHB 1VEWA 3ASOB 3AK0A 5M0TA 4ZI7A 1NTZH 5FXVA 2VMFA 3MDSA 4ZHQB 1WLWA 4MGTA 2GC3A 4OI4A 4FZ1A 2R042 4NXMO 4DR7O 3N9QA 4X65O 4N9IA 3B9IA 4P9IA 1OBNA 4G9SB 4DUWA 1CZVA 1FV2A 4XF3A 1R1A1 4LT5A 2YFZA 4ASKA 3AG7A 5EHDA 4D3WA 3N9NA 2XJPA 4AEDA 4L11A 3H50A 3K0GA 1SMVA 4AGRA 2A0LA 2VQFB 4GXLA 3PU3A 3POIA 3DF0A 4JVAA 3LOIA 2MPFA 4NRPA 4M3CA 4FJCC 2ZABA 4TUYA 4YHHO 3LEKA 2X6AA 2XAFA 3T1LA 4GKKO 3ZFFB 1W2NA 3ZIXA 3F2ZA 1X9TA 1JUIA 1N0JA 4IGQA 1GM9A 1QQP1 4PDLA 3UGGA 4IV1B 1YIFA 3WF0A 5GONA 4UB6Z 3FWEA 2FHRA 2R9AA 2FDJA 3H42B 3UK9A 4O4LA 1TE1B 1UWWA 5CKMA 3WP4A 3B00A 3LNMB 3FB8C 2YBKA 1DQ2A 1ZRFA 2YI8A 1FPOA 2PHRA 1H30A 5FMOS 2W1SA 4YVSB 4YW5A 1JJOA 1K9MW 3MICA 1XILA 1MVEA 1SCSA 2A6WA 1OV9A 4IE6A 4NPLA 1AR91 2F43G 4RGKA 2JGUA 4AHYA 1VP6A 5HBAA 3V56A 3C3VA 2RDQA 4GH4B 5FY0A 2DWEC 5EIBC 1RYYA 2VR4A 2VMDA 3E86A 5CFDB 3SCGA 1HNXO 1XNKA 2LUWA 4HZ3A 2ET1A 1W8FA 4CA9A 2XJUA 1V54B 1EBOA 1W2UA 2BNOA 5HXVA 1ZYBA 3KZIZ 1AXZA 1PIV1 1HB2A 3PUSA 4GALA 2HWE1 1SLIA 5FCCA 1X36A 1M9NA 2KQXA 1VQPV 3AMMA 3RZZA 3WR0A 2P4VA 3MPPG 3LF7A 5F3EA 2IJJA 2DYSB 4JYCA 3A0RA 1RUI3 3L9JT 3VN4A 5K7PA 2QQIA 2ZOEB 3GHMA 4XIKA 4NTWA 1R3LC 3TXSA 1ULOA 4V2VA 4I2OA 4LA2A 3AMPA 5FY9A 2Q30A 5LA6A 5IFTA 1V6OA 4QPWA 1ROPA 4XUOA 4C90A 5BMVB 2GC1A 3BN6A 3OY8B 1N3OA 5A3UA 3JD3A 3OEBA 5B5EZ 1NVPB 3BVCA 1MS1A 2Z2SB 5C7GA 2PHWA 3NV3A 2XAGA 2O8QA 4LUMA 2XLFA 4CDXB 1OJHA 3K9SA 4XFIA 5FZ4A 4MO3M 2EIGA 4QE9A 4JKKA 4BK4A 1NG0A 1K5JA 4PIXA 2P4EA 2VCMA 4ZBMA 4UVBA 4UCUA 5KBFA 3GALA 3W59A 3PTRB 4UV8A 2W52A 4JQRA 1RUOA 3B69A 1FAFA 3AVRA 3I2JA 2VY0A 1LTEA 5A7QA 1OCOC 4DRXA 1BYHA 1COV3 4I0XB 3SYQA 4ASMB 4BJ0A 4JI1O 2DUQA 2YC0A 3AZXA 1KP3A 3GXUA 2B1IA 1MS4A 4H3WA 4ZU4A 1QH7A 4UOJA 3OUHA 3C8XA 3AJYA 2WS92 1I5YA 1AR82 2G9GA 4Z2AA 5C5TA 5I93A 1GAXA 1QJX3 3T4HB 2A7AA 4MW3A 3WW3A 2VAUA 1BBT2 1LNSA 4NR1A 4ASUG 3HT1A 5FK8A 3RYHA 1MZ6A 3OPZA 3HKDB 4W65A 3ABMB 2B7YA 5FYUA 5JR7B 3ZN5A 3ABKC 2IWGB 4FPCA 5C9AB 3D3AA 3ACGA 4CZZA 4HL0A 1SDWA 5IVFA 1WW5A 2XL7A 5AG2A 2Q68A 1Z5WA 2H6CA 2P67A 4TLGA 5A6QA 3PVBB 4NIAA 1IVSA 2ZXWB 2UWBA 2A3QA 5BNPB 4DR6B 4ET7A 1RJ7A 3A8TA 2ZHMA 1N36B 3H01A 4GMP0 1UX6A 2RJZA 2K0GA 3ST7A 3VB9A 4YZ2A 5ERLA 4UFMA 2EXJA 4Q0VA 2XUEA 4Q4X2 4LORA 4N23A 3PJSK 4NYKA 1JBCA 2QUOA 2W5FA 3ZN6A 3LSSA 3A0HZ 3C7EA 2X53S 4CPBD 4YZ4A 1QU0A 3L2HA 1OLRA 3VBRB 2XONA 1I1EA 2W6IG 1W03A 2J1TA 1ULGA 2J22A 3AJZA 2Y6JA 4LMFA 1HIXA 5BNOA 5F37A 2BERA 2VULA 1MR5A 2C4XA 3ME2A 4EB6B 4X1KA 3PURA 5FPVA 5A32A 2PI4A 1WA8A 3E5QA 3CYOA 3N2GB 5GZCA 3ZO0B 4K1YA 3OCPA 1BGYH 4LNVA 4WVVA 4FSJA 1YF2A 4OHYA 4IHJA 3LD8A 1Z78A 3CCVV 1M56C 5CEHA 2AZ5A 3VUOA 4QPIC 1WJZA 5LXTB 5IY5C 1J3RA 4Z1VA 3KB5A 4NTXA 1KEXA 3AL6A 3ITQA 2I74A 5JH7B 2RMKB 3ML0A 4FP2A 4S2DA 2CNAA 3H8XA 4XYXA 5JVDB 4UCRA 4ZU5A 1PKXA 2PI5A 4Y4YA 1QJY3 3E6BA 4WZFA 1F51A 1AL0G 4DR4B 4XETA 3DXRA 2ZBJA 4X8PA 4LP8A 1GMGA 3STZC 1D2SA 4JI3B 3GJAA 1YI2V 2HWF2 4HFSA 3U07A 2E31A 2OCCC 2NM1A 4WM8A 2JX9A 4YLZA 3J7LA 3JD73 4HNAA 3QO7A 2R073 5DMYA 2BOBC 4LHLA 3UT5B 4N43C 2GC2A 4Q29A 3INAA 3DEMA 1GNYA 1QLEB 4A3ZA 3JARB 2VMGA 2GC0A 3DL3A 4EZHA 4ATEA 4CEWA 1PL0A 4RHV3 3T3YA 1AX2A 1Q81W 1W8HA 1OQEA 4Q5OA 1PGL2 1OA3A 4XMIA 1BK1A 2XNDG 2DWRA 5FRAA 4Z2WA 4LBQA 3OGGA 1GOHA 4LO6B 1YTFB 3UKTA 1J1TA 4FPOB 3CRQA 2JG8C 3GBWA 1IBMB 3WW2A 3AZVA 2AHYA 4TT3G 1JCHA 1AHSA 2JS5A 5F3GA 3SISA 4Z1MG 1HW5A 4DO2A 2HWC2 2CAVA 2ZAHA 4LE4A 1EN4A 5H9PA 5GM0A 2WUHA 2FCTA 4PA6A 2OVUA 4QM8A 2Y4TA 4PHZA 4YPJA 5GKAC 4UXNA 2VECA 2Y0OA 3T2MA 2OYZA 2BTOA 2V73A 1JU3A 3SH3A 4M3CF 1UY4A 1NA1B 5FP3A 1S5HC 1UU4A 2HG5C 2AZ0A 1RITA 3VBUC 3VQVA 5FP8A 4BISA 4I01A 4F6EA 3K57A 2ZGRA 1CAVB 2ZD9A 5IVJA 3DV8A 4FOVA 2R72A 1H9WA 1LHNA 1TMF3 3O1TA 5C4WB 4B1LA 3LSUA 4X62O 5FKBA 4HN0A 3BCCH 2VNRA 1JYWA 4DUZO 5CMUA 4BIOA 2Y0PA 2YSUB 1W90A 3VBOA 4I9WA 1SQPH 1UYPA 2D3RA 3H8RA 1VE0A 5KXEA 3PUAA 1UOJA 5DZGA 2DUOA 2NLRA 4U3JB 4UUJC 5CB4A 2WRAA 4NHMA 3NNMA 4GB31 3R65A 1JYVA 1ZA4A 4I02A 2OIGA 4TXWA 5FPOA 3N35A 1RHI3 3D0SA 3HQXA 4FTSA 4YIOA 2A75A 1JZ7A 3WB1A 5DPNA 1E1RG 2D6PA 2QQWA 2P3IA 1IX9A 3LDCA 3THCA 4I7ZB 2DMXA 2PLV1 2YXYA 2YY1A 2E33A 2C2AA 1F4MA 4Y5SA 4XJAA 5L9RA 3T30A 3ZYIB 2YUAA 2A73B 4Q1RA 4D6SA 4L92A 3H7JA 1NYWA 1G1XB 4PDVA 4D6TH 4PA7A 1OLQA 3P6BA 4RS5A 3K59A 2VH9A 2VQEO 3ZYFA 4QX3A 4B29A 2FDIA 5A33A 5FWJA 4DRRA 5IYCO 1UQXA 3MF6A 1WMXA 2BW8A 4DPNA 4LIVA 2IBZH 2Y34A 4G28B 1IHMA 2HKOA 3BI3A 4PDRA 2XG3A 1OCRB 5E16A 2W2IA 1RUD3 5BUVA 1KUQA 3ZRWA 4TSVA 2ZGSA 3ZIWA 2QKSA 3J9SA 4JI5O 1AR93 5AVAA 1MSDA 3M3CA 4BW5A 2AZ2A 3RWNA 4RQPC 3K4ZA 1H8EG 1FOD2 4E8DA 3JD72 4OULA 1ZBA2 1G8MA 2VUJA 4L97A 1NCQC 3C3TA 1N1SA 4NUBA 2EIJC 2ZMKA 3CIHA 2D98A 2Z69A 1BQZA 3VBSC 1OOPC 1OCZB 1XHXA 3RZGA 4MXVA 4RHV2 5ANQA 1IG3A 2A3YA 2Q5TA 4R9BA 2HWE3 4X1IB 2ITDC 2QM8A 2DJVA 2YIAA 4FI9A 4MUVA 3MLJA 4WVMB 5T50A 4FPPA 3FD9A 3NNJA 2AREA 1PNMA 1QNYA 2BTQA 1GK9A 2WLIA 4XJ8A 4C0BA 1LOFC 4TZDA 1QJEA 3WF3A 3MDPA 4I0BA 1CJDA 1H8TC 1WA6X 3EXAA 1VBA1 3ABUA 3BY6A 3J4UH 5CN0A 1O8PA 3C2UA 1CGPA 3U37A 3LA2A 3TEYA 2IJHA 4Q26A 1R082 5CA6A 1VIWB 4OHWA 2JDIG 5T54A 1H2KA 4I0AA 2RDRA 5IE9A 1CAXA 1JZ2A 1TUBB 3JBG1 4MXWA 3ZXKA 4PV1B 1XNTA 4MVTA 1VR3A 1VBB2 3RBZA 5J2UB 2UUBB 2R7EB 5FZGA 4QX5A 1K97A 5CG9A 3DTUB 3O65A 3VZKA 3K3OA 1KMIZ 4DEVA 3A2FA 3H1WA 2AC1A 2BWAA 1LOAA 2EILC 2RS13 3VZLA 4MS2A 1CQ9A 3JQWA 1JH5A 3WVJA 3K75B 1R091 4QHBA 1AL21 5A1FA 3CCJV 1KS4A 4QAWA 4DV5B 5ACA3 4KNCA 3QH7A 2D6KA 4ZU7A 3DYOA 1M06G 5FYHA 3RI9A 1BEV1 3KG2A 5LOVB 3D6EA 4Y1UA 1QCEA 1R1A2 1ZZ8A 1JZ4A 2ZMLA 1WLCA 1CAUA 2EIMC 1RHI2 1FXZA 5SV8A 5FZKA 2QA4V 2P3KA 3T4ZA 1QR8A 4FFHA 4IETA 3BA9A 3PU8A 2DBNA 2WWWA 1GN4A 5EYYA 2E5LB 5CBFA 1FPN1 2A1XA 2F4VO 1LGBA 3QVNA 1ZZCA 1PPJH 2QKCA 3PDQA 1XYPA 3T2QA 1TUEB 4IEZA 1IOAA 2ZEWA 2V4AA 2QJ1A 1WZXA 1AR61 4IT5A 1XNAA 1ZREA 2HBTA 2GMMA 1W6PA 1JMKC 1VF6C 4TWTA 3KHBA 1R3JC 3OBRA 1Y43B 3A0KA 4M0NA 5JCTA 5LL6Y 1CAWB 5LYJA 2X09A 3MW3A 1VQLV 1H6XA 3QLQA 4PA9A 3AYDA 4JV5B 2A6XA 3B93A 2RM23 1S3JA 3E8GA 1R6NA 2R9RB 2UXNA 2EXIA 3FUQA 2WLLA 3SYAA 5IVYA 1AR92 1RUJ1 1Q82W 4UCTA 1NS1A 3K03A 1OVSA 4AL9A 1F5JA 4RQPA 3WQ0A 4J41A 1OHHG 3RFRA
chains in the Genus database with same CATH topology
5CU1A 5J36A 2O1QA 5FDBA 1G9AA 4OFGA 1EP0A 5C6CA 1QNWA 1PGW2 2ZGPA 4RR3A 2CGPA 5HCFA 2YXSA 5IK4A 1UPIA 4JGZB 1W6PB 4XE9A 1HXS2 1RUF2 4E2SA 4IV3A 2ZX1A 3ZYJB 3ZMOA 1W39A 4TYSA 2TEPA 4GKXA 2HKXA 4YW3A 3WG3A 1OOPA 2GNTA 1VLNA 2HWE2 2WZR1 1RUG3 1DHKB 5C9AC 1D0HA 1FNZA 1TMF1 3AYAA 4COVA 1C1FA 3VBFC 3MIBA 5J98B 5EV7A 3ZXDA 1VRH2 4YM0A 1HRI3 1RUC1 2A6ZA 3WX5A 1O3TA 5KXDA 4JRLA 3JU9A 1JXNA 4QM9A 4YGDA 2FMDA 1F2NA 3X29B 4KU7A 3MLLA 2B5HA 3WHUA 5JMCA 1S0FA 4Q4V3 4HVRA 1NXMA 4QD2A 4OHZA 2LTNA 5BNPC 3ILRA 3MS5A 1WGPA 1SBDA 1N47A 2WNUB 2OUJA 3BB6A 2TBVA 2XJVA 4Q4X1 1I6XA 2PAKA 3IMNA 4A7ZA 3VBHA 1HQNA 2VGDA 4HPKA 1DGRN 1UU6A 2EVXA 1JOJA 1ND3C 3JB4C 2GALA 1JTZX 1G9DA 1X7NA 2UU8A 4XEZA 4XJWA 4XQDA 3EXUA 5T5OA 1RHI1 2GDFA 4UBHA 5IUQA 4WZCA 1VBC3 1YCIA 4INDA 3WQ1A 1UKRA 4XFHA 5FLIA 2WBQA 4Q0PA 3V15A 4GMP3 1LECA 2HEVF 2HJIA 2V09A 1OIJB 4RQPB 4M25A 3M2MA 2H0BA 1R083 3MIEA 3VDDA 3FFZA 4AVBA 4CDQC 3QBQA 2B45X 4PLNA 4AVTA 1WMFA 4I3GA 4RR3B 4EJRA 4N9HA 1URXA 4M26A 3NKGA 5I0UA 3VBRC 1Y7BA 1XNBA 4IV3B 1GNHA 5DXDA 2YMZA 4CP1A 4XFAA 4H14A 3WDXA 3UJQA 1OOPB 1Q8PA 3K51A 2QDNA 1IS4A 1RVF3 1ULFA 1VBB3 4YVWC 1ALYA 1REFA 2D97A 1LEMA 3ZXLA 4I30A 1HV1A 4HMZA 5FOBB 3MFCA 2JE7A 3NSTA 4ES8A 1DFQA 4LBQB 3SH4A 1A8MA 3IDEA 2VNGA 4XHXA 3AXEA 1EAH1 3KGLA 3RQ0A 2RS12 1XYOA 3B02A 1KFUL 3WP5A 2RS33 1POV1 5BXXA 3ZXJA 1GFF2 3VBHB 3O2GA 2WQZC 1X82A 4HPKB 1DZTA 4XJUA 1ND2A 3AFKA 3BCWA 4F8AA 4LBNA 2YPJA 1HRV3 2A71A 2WKKA 2IXKA 1VBE1 2UYAA 1IZ3A 3RRDA 4E9KA 2DU0A 5JPNB 3NV2A 5GLWA 4B8EA 1XQNA 2YDEA 1R1A3 3E5XA 1DGWA 4HSJA 1DIWA 3ZXFA 1RUD1 4RL7A 1S55A 3IIAA 4XIOA 5E8AA 2ARXA 3FBYA 5C33A 2C1FA 4I09A 3VDDB 5BYNA 2FQPA 2AR6A 3AP5A 1LGNA 4KU8A 3ZSEA 2WC2A 1O4YA 1K5MA 3J8F1 3WXPA 2P17A 1LHVA 2BGCA 4HK8A 1HDKA 1U5IA 2A5ZA 4UBGA 4D69A 5GZEA 4B7EA 4YNIA 2HWF1 1O5LA 4Z92B 1FATA 4OI0A 2P34A 3TBDA 3H9AA 1OMIA 1PK6B 4YZ3A 3RYRA 4BIFA 4P9XA 2B9UA 4OLLA 2UWCA 3GZTB 4M00A 3BALA 1PHMA 4PCRA 3S7IA 5BNOC 1LHOA 1GZCA 1YJKA 3B5LB 3N7LA 4K20A 5K9YA 5JZGA 1KITA 5KC6A 1WCKA 3USSA 5DDJ3 3NV4A 4FPJA 1KJLA 3ZSLA 2XKOA 2ZX4A 2WNVC 5KHGA 3HWJA 3MIHA 3ECQA 4RGAA 1HXS1 1PO13 1RUF1 4K9SA 1QQP3 4PDWA 1TNFA 4XDQA 5BNQA 1QJU2 3VGIA 3ACLA 2ZGMA 2FBEA 5HSXA 5J3UA 3UJOA 4PLOA 2F6BA 4ITCA 3MIFA 5GZFA 4KWLA 1G9CA 5H9RA 1PGL1 4PJYA 2QQPA 3NV1A 1ND2B 3FX3A 5TSWA 1Q43A 2BBVA 1F31A 1XU2A 3WV6A 4M01A 1AJOA 1VBD3 4Y0EA