4B3RO

Crystal structure of the 30s ribosome in complex with compound 30
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 35
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4b3rO00
3T1YO 1N34O 4DUZO 4LFBO 4DR1O 4LF4O 4JYAO 3R66A 1HNXO 1G1XB 5BR8O 1N36O 4DV6O 5IT9N 1AB3A 4JI6O 1IBLO 1X59A 4DR2O 4OX9O 2DOSA 2ZM6O 2HHHO 4JV5O 1DK1A 4AQYO 1R6TA 1NS1A 2ZKOA 4DV7O 1XNRO 4GKJO 4OPHA 4YHHO 2UXDO 4DR4O 4B3RO 4X66O 1HR0O 1IBMO 4NXMO 1FKAO 3J80N 4B3SO 4DR6O 4DV3O 1N32O 3JAMN 4JI8O 4JI0O 4B3MO 5H5NA 1YZBA 4A5UB 2UXCO 2Z0AA 1HNZO 2F4VO 2DJVA 4JI7O 5LL6Y 1N33O 4DR7O 4X64O 4GKKO 2UUBO 2UUCO 3T1HO 3RT3C 4DV4O 4DR3O 2N74A 1XNQO 4KHPO 4DV0O 4JI4O 4DV2O 1F7YA 2UXBO 4YY3O 1XMOO 5BY1A 1J5EO 2JRIA 4X62O 4LF6O 1KUQA 3J7AU 2FKXA 4LFCO 5A2QN 4X65O 3M8AA 1IBKO 5LMUO 2UUAO 4DUYO 4JI5O 4NXNO 2VQEO 4LFAO 4OPAA 3F5TA 4B3TO 4JI3O 4DV1O 4K0KO 5LMNO 4LF7O 3SDLA 1AILA 3J81N 5FLXN 4JI1O 3O65A 1HNWO 3OTOO 1XEQA 2UU9O 1R1BA 4JI2O 4LF8O 2LW7A 4DV5O 4DR5O 2VQFO 4LF5O 2AGAA 1XMQO 1I94O 1FJGO 1A32A 5IWAO 1D2DA 5BXZA 4LF9O 1FYJA 2E5LO
chains in the Genus database with same CATH superfamily
3TXSA 1NZ6A 3HB3B 5BR8O 4R50A 1M9NA 4N21A 4UCOA 1ZLZA 1KB9F 1PD3A 4KUMA 5D5QA 4X20B 4HNAA 5GTIZ 1FXKB 1R6TA 3BRCA 4BIUA 4Z1MG 1K33A 2X6CA 1JR9A 4QNHB 1YIJV 3ABKC 2YC0A 4YJ2B 5LXTA 2CUGA 3CCRV 5IE9A 1SQXH 4J10A 3LNMB 1IXBA 1E1RG 4B3MO 5KLVH 4LH7A 2DJVA 1N33O 4JI6B 2LGWA 1IVSA 1PNKA 4JV5B 3CCSV 4L87A 2YIBD 4WFFA 4NVPA 3ASOC 2ZQMA 1EBOA 5BMVB 4ZBMA 3ETGA 1K34A 3ZMVA 2L6LA 1SQBH 1YHQV 2ZDIC 4P9PA 3UT5A 4PV1B 5CBFA 1HNZB 3B8MA 1NQTA 1GKFA 3K9SA 4UCUA 3CRQA 2EZPA 1FS0G 2UUAB 5EZYA 1BHAA 4DV1O 3T1HB 5K1PA 4TT3G 2HJDA 2JGDB 4DR3B 1R73A 3P32A 1QCEA 4IL6Z 1XMOB 2N05A 3DTUB 4LF6B 2FMLA 3FKSG 4U7NA 2Q4PA 3GWKC 5CA0B 5IWAO 2LP7A 2QWQB 2XAHA 4K35A 3E8HA 2QJ1A 2F66C 3CJHA 4MVQA 2V4DA 4B3TB 4LF4B 3FYEB 3BFRA 2HHHO 2YEVB 4Z1VA 2CTPA 2EIKB 4UFZA 2IM9A 5A9GA 3TGUH 3OMIB 3JD4A 3JD3A 3JARA 2ZR2A 3E89A 4RUEA 2ZR3A 3SJQC 3RYHB 3X2QC 2IJKA 1MZFA 2Z0AA 5LL6Y 2WLKA 1N36B 5KHHA 5DM6V 1HW7A 3T4ZA 3CP1A 2OTLV 2DWDC 4PA9A 2OCHA 1ROPA 2JIZG 1YJWV 1QBZA 2X6BA 1SZXA 4J7ZA 4JAVA 5B1OA 1S3JA 3JSNA 4O4IB 1OCRB 5J9PC 2NNUA 2EBOA 4EEQA 2WPDG 1LNQA 3LSSA 1S76D 1Q6UA 1QR8A 3AK2A 2OT5A 4QPKA 2UUBB 3LSUA 3CCEV 2C2AA 3APOA 3VQVA 2EZOA 2MW2B 1NVPD 3OEHG 2VS0A 2RJZA 4I50A 3P3NA 5IJ0B 1OCZC 4FFBB 2M7WA 3D8CA 3JALB 1N8RW 4H0LB 4PA3A 2ITCC 3CCVV 4IHJB 3T1YO 2BOCC 1NH2D 1SA0A 3OGCC 2BTQA 3WU2Z 1VF6A 1N34B 2XHBA 2E76B 1E79G 1TUBA 3N2KA 5DN6G 2P4VA 1H2MA 1VIBA 1VF5B 4DK0A 1GK9A 1I5XA 4JGSA 4LF5B 3H1LH 3J80N 3AG2C 4J42A 4JI8O 3K0GA 1Q82W 5CMUA 1RM1B 1Y76A 4DR1B 3CYOA 1V55C 2YIAA 3N2GA 3K06A 4MSWC 1VEWA 4DW1A 4ZHQB 4K8ZA 3JD0A 2QKCA 1MNGA 3JATA 4FM2A 1YCIA 2UUCO 2DYSC 2P4KA 2N74A 4G2KA 4J9YB 5J2TA 3BPZA 4KHPO 1HP8A 1VQ5V 3ZIAG 4FPPA 4YHHB 2EILC 5B1BC 3F7VC 4J80A 1IBMB 2F1MA 2XAFA 1Q3EA 3RYFB 1QVGU 3E83A 2V1DA 3THOA 3QO8A 2UUAO 5EC2C 2CTRA 1UJWB 2FL4A 3LNNA 3CRAA 3T1CA 5LMUB 5IYCO 3F5TA 3UCSC 5LMNO 1IURA 1AILA 5EBWC 3K5LA 4JI4B 4X1IA 1N4CA 4BW5A 2ZNIA 2HFEC 3DSQA 3CXHF 3G71V 4X1KA 3QTCA 4TUYB 2ITDC 4BWAA 1IBKB 1NI8A 4R7CA 4DRXB 3ABKB 3SPGA 4O2BB 4LF4O 4NXNB 3E8BA 4JTCB 3OW2U 2YXLA 1P49A 2YS8A 1HNXB 3SYAA 3JD2A 2JVDA 5L3CA 4MVMA 1AR5A 2OWOA 4CS3A 1FPOA 2DN9A 4I4TA 4TOIA 1GH6A 2UU9B 2QSAA 5CN0A 1LUWA 2BTOA 4TV8A 1ZX3A 3JD1A 4DR6O 2L35A 3ASOB 4ZKIA 1MABG 1NR7A 2ATKC 4CZZA 4WFEA 1YZBA 2WLNA 4CS2A 4MVZA 2P22C 4DV3B 4K8XA 2Y69C 2Q69A 2FYUH 1SETA 1AP6A 1XQ8A 3QF7A 3RT3C 1Q7YW 4RQFA 3BHPA 2R9IA 2ADQB 2N04A 4YY3O 3ZCCA 3WB0A 3ZEDA 2Y0PA 4D7SA 3AG3C 2W0XA 3GWOA 3M8AA 4B3MB 2ILMA 2XOKG 4GYCB 3K5MA 5FPRA 1VP7A 4X1YA 3LDDA 5ITZB 1Y6XA 1N33B 1R3JC 1AVMA 2CE4A 4HAMA 3JASB 3RYIA 2QGNA 2PYLA 1GN6A 1GN2A 5DEDA 3ABUA 4JYBA 1B04A 4ZOLB 2YUAA 5FLXN 1H2SB 3H01A 2WLLA 2NLJC 2A79B 1XHXA 4IIJA 2CTQA 3ZJZA 3TK1A 2DQ0A 1GM8A 4LF8B 4B7EA 4NKGB 1WB8A 1N34O 1YSCA 4LP8A 1GAXA 4JYAO 1BQ0A 2PTMA 1VQ8V 3P30A 1VARA 2QR4A 1RPOA 3X2QB 3W7XA 1NS1A 1YEWA 3CC4V 4DK1A 2ZT9B 4X66O 1FFXB 2F93B 1Y67A 1NT2B 5KMGA 5IWAB 3CEIA 1P7BA 2X7RB 1K9MW 5H2FZ 1GO3F 4RWUA 5H5NA 2W6IG 1X4TA 4FLWA 5FNVB 4FK5C 2ZE5A 4FLVA 1AR4A 4ICGA 1K5QA 3PN1A 5CB4B 5JVDB 2YICA 3DC6A 2BSKB 2HHHB 2A06H 1JJ2U 2Y48A 4KP4A 2CH7A 2QTOA 1MSDA 2A7WA 5IJ9B 2PY5A 1WP8A 2O57A 5D5PA 3ETDA 1K73W 1CEZA 1R6NA 4C7UA 1VQ4V 1YITV 3G4SV 5LMUO 1S0VA 4NTXA 1OCZB 4Q6GA 4LH6A 1YTFB 1ZWIC 3JAWB 4G27B 1ZAUA 2P90A 4RUFA 1SRYA 1ORQC 1B06A 4MVUA 3SDLA 1XBLA 1AR1B 1K3EA 3U10A 3LUTB 4IGGA 2OIEA 4CC6A 2GUZA 5FPOA 2F95B 3OM3B 2EIMC 1A32A 3UKMA 2YIBA 2E75B 3MHSC 1G6UA 2BCCH 4J11A 2XASA 3FB6C 2KG7A 1R3IC 1HNXO 4PDMA 3NR7A 1PNLA 2OTJV 1WN7A 4I0XA 2AW9A 3AG2B 1X59A 2P7TC 2PGGA 3C90A 3I56V 3HKEA 1V55B 3OAAG 3W7TA 4B3RO 2LJ2A 4PI2A 5JQGA 3ZRXA 4UV8A 4D6TH 2OYQA 5CBHA 4DV3O 1N32O 3HKDA 4LWSA 3T1YB 3BA9A 2UXCO 5JCOA 2EILB 5B1BB 2F4VO 3KKYA 4ZI7B 4PDVA 1WB7A 5LYJB 1VF6C 3BA8A 3CMEV 1CP9A 2E3CA 4PA6A 3SPCA 1NTMH 3FAVB 2P67A 4FM1A 2EX3A 2Q7EA 2R70A 1Z5WA 3KCXA 1JA8A 1FAFA 2QKSA 2WA3A 4O4LA 1PM9A 3OD4A 1AJPA 4HBNA 3K58A 3OT7A 1G8MA 1P7GA 4X65O 4JI8B 2AZ2A 5L3DA 1PV0A 1P84F 3AG4C 3FB7C 5LOVB 4I9QA 3ZS8C 3H1IH 1WA8B 4OPAA 1EN5A 4DUYB 3VBBA 4F6RA 2UUCB 3A0BZ 1DGSA 5EBMC 4WBNB 4WCEV 3CCUV 4KHPB 1FD9A 4JPRA 3J81N 4JI1O 1JJOA 1Y74A 1AI5A 3JAKB 3RVZA 1TVKB 3OUFA 1Q5OA 4GCZA 3IC7A 4LF8O 2IU0A 2XAGA 1WLEA 3C3TA 1MOFA 3DXRB 4FLTA 3N27A 4XDJA 3CB2A 1WNSA 1AP5A 1BT8A 1NTKH 3RW0A 1S77D 1DLBA 1SS3A 3HKBA 4TV9B 2JS3A 3LSQA 4W4KA 4GLXA 4PJ0Z 5LMNB 3JYCA 4O2AB 1M4UA 2Y69B 2IJJA 5KHIA 2PYJA 1OZ0A 1S5HC 1XNRO 4I7ZB 4OPHA 4QJFB 2OIGA 3P3PA 4HNAB 2WWWA 4MTXA 3FFQA 1IX9A 2AZ0A 3JCUZ 1VQ7V 1KD1W 4CH5A 1H2LA 4JI7O 2F43G 4DR7O 5LXTB 1V54C 2KB1A 3BCCH 3AG3B 3AG1B 3AK3A 2RN9A 3OR6C 2P6JA 2DWEC 2WLJA 2ZCEA 2LQTA 1L0LH 1EN4A 2XAQA 3F5WC 4DV2O 1F7YA 4X88A 1SQFA 2DYRC 3KG2A 4FZ1A 5BY1A 3ABLC 3M7MX 4PD4F 2X6AA 4FLYA 4KFMA 3FB8C 4DR6B 1U97A 4UUJC 3I5DA 2IJHA 2Q6AA 1XUQA 4YJ3A 1F4MA 3E8GA 3K03A 3T2MA 4LFAO 1D5AA 3CWBH 4K0KO 3OMAB 3UT5B 3L74H 1AI4A 1SZTA 2ZXWC 1Q8IA 4YY3B 2YXYA 5EZYB 4CH6A 2Q0AA 1VQ9V 2XAJA 4IYHA 3G67A 2QWOB 3W7SA 3R66A 4MW8A 1AJNA 5IDJA 4HYOA 1GRJA 3B8NA 1NU1H 5F2VO 5B3SB 1EZVH 1QNMA 4QE7A 2ZKOA 1NVPB 2Y4UA 1HDJA 4MVSA 3CJHB 1RSOA 3LDCA 4AQYB 4EFEA 1IZ3A 3BY6A 1TUEB 3ZRWA 3OEEG 1M1KW 1XHZA 2ZNJA 3JARB 1NH2B 4JYAB 2JDIG 4CC5A 5KUKA 5LGUA 4X64O 1WAZA 2PZSA 1M56C 2KKWA 1XOUA 3PJSK 2QEXV 1TAEA 2EJ7A 5KHJA 3Q4HA 3ZMUA 2HP8A 1IXMA 2Q73A 1IDSA 2Q5ZA 2ZINA 1K4DC 1DF4A 4TUYA 1PL0A 4X9QA 4X66B 2RDCA 5C8YA 1GM9A 4R8CA 2JJ1G 4LFCB 2CGOA 1KECA 4UB8Z 4DUYO 4FMTA 4JI5O 5JJEB 3RFRA 3L9DA 2EIMB 3AK1A 5LHHA 1DF5A 4MT8A 1MZEA 3D36A 4ASUG 5B66Z 3CD6V 4JYCA 1Q90D 3ABTA 2PF4E 3K59A 2LGQA 4BIOA 3WG7C 4DR5O 3CC2V 2XTAA 4W4LA 2UXNA 1FYJA 4X89A 4Z2WA 3ZHVA 4I50B 2Y0IA 3E8FA 1F4NA 4LFBO 3ZHTA 5KA5A 3OTFA 5KUMA 4DV6O 4UVAA 1AB3A 2KQXA 2OCCB 4DXWA 2LFRA 4OGQB 5KHGA 2DOSA 2ZM6O 1T5EA 3UQ8A 3B09A 1DK1A 3ABMC 1QR9A 3E22A 3E86A 1SA0B 4I9WA 5E79Z 2BTQB 4WF9V 5LA6A 4DV7O 4GKJO 1SQGA 3AG7A 4EB6A 1TUBB 3N2KB 1B6QA 2PI5A 3ZX6A 3ASNC 4ZIBA 4RAIA 1ZL8A 2YIDA 5JH7A 1R3KC 5J2UA 3K5OA 3R65A 1NKDA 5EIBD 3RGBA 4GKKO 1D5NA 4YIPA 3AG4B 5KAFZ 1Y76B 3OE7G 3OGIB 2HKOA 3N2GB 1SKVA 3RYCA 3D3QA 2QWPB 3JATB 4B3RB 3BAAA 2H3OA 3SYCA 5A2QN 5J2TB 3STZC 3CCQV 1N32B 2DW4A 4I55A 3UM7A 3K04A 2B1IA 2HLDG 2RMKB 2UXCB 5LP6A 5B1NA 2F4VB 1ZTEA 5JCOC 2H8PC 2JGUA 1QU7A 2AHZA 4UXNA 2VQEO 1MA1A 1BCCH 2ETNA 2K9PA 3CCMV 4FLXA 4UCTA 1K92A 1RP3B 2WLHA 3RBZA 2W6JG 3IGAC 5GONA 2LO1A 1BL8A 5EK0A 2V7QG 1W0KG 4J41A 5KAIZ 4H33A 2CTWA 4GX1A 3L75H 1R1BA 1YXBA 4XBFA 3AG1C 1LUVA 1K97A 1JMKC 2VQFO 2GTAA 4X65B 3MAQA 4TWKA 1SC5B 3B77A 3F7YC 4X1IB 1QLNA 2E5LO 1ZUQA 5KHKA 3CRCA 1Y66A 2A9HA 3IC9A 3CXCU 5L3FA 5IT9N 4X1KB 2R9RB 4KL1A 4OX9O 3KZIZ 3ICXA 4AQYO 3HKCA 1Z5VA 1JFFA 4JI1B 4WFAV 1EFRG 4F6EA 1V54B 2UXXA 5CA1A 2W0FC 1BZKA 4DR4O 3K57A 2IJIA 2XT9A 5KX5A 1I5YA 5IYZA 1ZSPA 3MD0A 4I4TB 5LHGA 2DYRB 3L70H 4FLZA 3CHXA 4U3JA 3ABLB 2XUMA 4TV8B 4TQDA 4JI0B 4J7JA 5EYPA 2LW1A 3VOUA 4CH3A 3ETQA 1XNQO 2PUSA 2NN4A 4O4JA 2M6YA 3D3IA 1XNRB 5K1XA 4PA4A 1NR1A 1S5JA 2WLMA 1OV9A 5B3SC 4YXWG 4LFCO 2H94A 4WFGA 2Q67A 1JVMA 1BSMA 2B5UA 4QE9A 1VQOV 2ZXWB 5AG2A 4LNUA 1THZA 2Y4TA 3UO2A 1VQPV 1V9PA 4JI7B 4DR7B 1XILA 3OMNB 4KXRA 3A0RA 4X1YB 3L73H 2WLIA 1OCOC 1YJNV 4DV2B 4XDLA 1HNWO 3OTOO 4UVCA 1GM7A 2HG5C 3GB7C 5GTHZ 4JI2O 3RYIB 2GV9A 4GUNA 3CCJV 4Q20A 3EFFK 3T4DA 2FTKA 4PDRA 4X20A 2GDSA 2WLLB 4DUZO 1FXKA 4RO2A 1G1XB 3RWRD 3NXSA 4LFAB 4G28B 2VWKA 4L8JA 5FL7G 4IIJB 4P30A 5LGNA 4K0KB 4FLUA 4DR2O 3EXAA 3RVYA 3TCUA 4YJ2A 4NTWA 4GX5A 2IW5A 1MSWD 1M56B 2EINC 3ZMZA 4UCVA 1HR0O 5LHIA 1AI7A 3CRRA 1VQMV 4J7KA 2ZE6A 4GT1A 4JF3A 3MDSA 3TETA 1WPBA 1W59A 5BMVA 5KMGB 1XL4A 1P4RA 1Q86W 2F23A 5B1AC 3IJ4A 1G4YB 1QLEC 1H8HG 3OR7C 2K1EA 4NYKA 1GN3A 2OCCC 4ABMA 2XNDG 3A8TA 4JTDB 1CXZB 2JRIA 2CH7B 2UXBB 3STLC 3OUSA 5GW7A 2IBZH 1FXVA 1LR1A 2JGDA 4NB5A 2D3OW 2JEUA 3WG7B 1Q6HA 4X64B 3ZHQA 5TISZ 3FD9A 4WFHA 4LF7O 5C93A 3K9AA 5CA0A 1K7DA 3M99B 2YDEA 1UPGA 3FB5C 3H9VA 4TSFG 3ABMB 1I94O 1FJGO 3CRMA 2QWNB 5EIBC 1OCCC 4LF9O 2YEVA 1K8AW 1R6KA 3O9OA 2RQ6A 4JI5B 2GUZB 2GSMB 1IBLO 1HWYA 1WPXA 2IH3C 1UFIA 3ASNB 3D36C 3ZRVA 1L8DA 5L3GA 2KG7B 3RYHA 1WP7A 1I7FA 3KCYA 3SJBC 1YVWA 4I0XB 5BZBA 2Q7HA 4DR5B 4O4HB 4NXMO 3HKEB 4JTAB 2QA4V 4B3SO 4RQEA 4E2LA 4JI0O 3TJTA 1Q43A 3ZHUA 4LFBB 1JOYA 4DV6B 5JQGB 3ZMSA 1KU9A 3CC7V 1TA8A 2HJFC 3SPIA 3HKDB 2ZM6B 5JWPA 2ZIMA 4O4IA 3JSLA 4LWSB 4DV4O 1VQKV 3U0ZA 2HVJC 1WJZA 4U7OA 3LDEA 4DV7B 2A3QA 3I55V 2QM4A 4GKJB 1K5SA 1E1QG 3QNEA 1KMIZ 1J5EO 4X62O 1VMGA 5H9CA 2VRZA 2EIJC 1JCHA 1PL4A 1S72V 1JX9A 3IAYA 4PELA 4O4LB 3CSXA 5IY5C 2BOBC 4GKKB 5IJ0A 4LC1A 4JI3O 4FFBA 2CK3G 4MTFA 4YIOA 1R3LC 3CE2A 3JALA 4X8AA 1SQQH 4H44B 4QIWF 4IHJA 1PKXA 4FFKA 4DO2A 5HFMA 5L3BA 1MG1A 4F6RB 3H1KH 2AGAA 4NR1A 2B1GA 1XMQO 2HEPA 5CBGA 2QDOA 4DV5B 1YI2V 1Y74B 2Q8VA 4JYYA 5H6QA 2GHYA 5LP6C 1BQZA 1N0NA 1YDXA 2VQEB 2Q68A 4JZGA 3VQYA 1SERA 4UCRA 2JS5A 2KSDA 3HKBB 1QVFU 3ZMTA 2P06A 1H38A 3S3WA 4EFBA 2QKAA 2UXDO 3ML0A 1RFYA 4UVBA 2VQFB 1M5IA 4ZHQA 1FKAO 3BEHA 1FFTB 2EJRA 2E5LB 3FX7A 3WB1A 4U3FH 2ZIOA 5H6RA 1EZJA 3ZN0A 4B7KA 2AHYA 3AEIA 1SQPH 4OX9B 1L0NH 1H2KA 1BE3H 3E2EA 3RYFA 1VQNV 3HR0A 4DV0O 4PDLA 2JEXA 2DE0X 2UXBO 3K08A 4OXSA 1M57C 2A0LA 4DR4B 3C3SA 4MS2A 2FKXA 1AJQA 4UCSA 4WFBV 2IU3A 1OCOB 3VQXA 3SYOA 3OFNG 3WFVA 2WSSG 4H13B 1PNMA 4CBCA 2Q7GA 1NTZH 2CAZC 1KP3A 4FVMA 1URFA 5CA3A 4YJ3B 1XNQB 4EKWA 1OJHA 3O65A 1NBMG 3CS5A 4DRXA 3VQWA 4O2BA 3B40A 1GMGA 4JAUA 1AI6A 1DTOA 4DW0A 1BMFG 3APQA 5L3EA 4P9OA 2EINB 4FZ0A 1O9HA 3CCLV 3L72H 4JI6O 4F4LA 1COWG 2RNBA 1RPRA 4R6ZA 4JV5O 2GBOA 4AILC 5EC1C 2IH1C 1HNWB 4HZ3A 3OTOB 3H1HH 1TGOA 2ZE8A 3ZBHA 5JJNB 2BE3A 3G6EV 4JI2B 5B1AB 3SR2C 4J9ZB 1QLEB 2ZE7A 2ZDIA 4B08A 1RSOB 5IYDO 4DUZB 2WAMA 1HNZO 1FXKC 1OHHG 3A2FA 3ZRWB 2DQ3A 5IYBO 4DR2B 2ODMA 4MVOA 2WA4A 3T1HO 4DR3O 1SF9A 2D2CB 1KKCA 2FB5A 4AI8A 1XMOO 5ITZA 1JQ0A 1HR0B 2YI8A 4LF6O 3J7AU 3JASA 3Q4HB 4GX2A 1Y4MA 4ZOLA 3A0HZ 1OCCB 5C8YB 4B3TO 3DGEA 1Q6IA 1KYOF 3K0DA 4PHZA 3B4SA 2LW7A 4DV5O 1Q81W 2NR5A 3FYIB 4JASA 2QE7G 3W7WA 5B5EZ 1D2DA 4N23A 4FIPC 5BXZA 4E4EA 4BW9A 5LGTA 4LCUC 3W7UA 4TQFA 1N36O 1I0HA 3RN4A 2CGNA 3HPLC 1QQCA 3UO3A 3CMAV 4QPJA 4UV9A 1L1FA 5BR8B 1FFXA 2ADPA 1YF2A 4LF7B 3SGIA 1N0JA 1I08A 1VF7A 5FNVA 4D7TA 4BIZA 4QGPA 3E22B 5CB4A 1I94B 5JVDA 1FJGB 2P5OA 4LBEC 2BSKA 3G80A 5E1AC 4LF9B 4IT5A 3QG5A 2EULA 5DECA 5LA6B 3K5NA 1SESA 4A5UB 2DMXA 1W0JG 3SJAC 1BHBA 5IJ9A 2EIKC 2HVKC 4JAAA 4EB6B 2EIJB 1IBLB 3U11A 2UUBO 1XDCA 2PI4A 1ZL8B 2X0LA 4BR6A 5JH7B 1H2NA 5J2UB 5IY5B 5HFLA 2GTSA 4LR3A 4CS4A 3ZHRA 2YXHA 3EHBB 5LBQA 2R72A 3SPHA 3QVNA 1KUQA 4NXMB 1B3QA 2ARHA 3IFXA 3TXQA 4B3SB 3B2EE 3JAWA 1NJIW 2MK3A 3RYCB 4XDKA 1XL6A 1BS3A 4GX0A 4K3AA 2ZD9A 1BGYH 2R9AA 1F23A 1S5LZ 4I55B 4DV4B 1OCRC 4MW3A 3E35A 1F51A 5LP6B 1XI1A 4DV1B 1YJ9V 1JPXA 2QWRB 1J95A 1O9GA 3CX5F 5JJJB 2RCVA 3SJCC 4H37A 1J5EB 1EM1A 5KA6A 4X62B 4LF5O 5GONB 4CH4A 2B9ZA 2AXTZ 2CDYA 2QM8A 4GZRB 4DR1O 1M90W 3H1JH 3ZRSA 2VWJA 3BABA 2Q9LA 4JI3B 2G38A 3QO7A 5EBLC 2E74B 4PA7A 4FJCC 3SPJA 1KBHA 1Z2GA 1KC8W 4BAYA 1MMMA 4YHHO 2QTSA 4ZI7A 1IBMO 1XMQB 5LYJA 1GN4A 1K4CC 2JK5C 3HKCB 1EN6A 1JFFB 1XREA 3JAMN 2YSUB 3QO5A 3FAVA 5CA1B 1U96A 1M57B 4MVRA 1M93A 1QHTA 5KX5B 5IYZB 3S3XA 1W2BU 1YTFD 4JZ2A 4P2ZA 1GTOA 1H2GA 2YI9A 1KP2A 1VQ6V 4U3JB 4IYIA 4JI4O 3ETEA 4PI0A 5LOVA 3K3WA 1RM1C 5EYPB 2UXDB 3EVKA 2Z5UA 1WA8A 4DYLA 3SYQA 2Q0OC 1FXHA 3G6BA 2Z3YA 4I5SA 4O4JB 3ZN1A 1IBKO 1KQSU 4WBNA 1CPYA 3SYPA 3DC5A 4NXNO 4AHCA 3JAKA 2QM7A 4MTGA 4UB6Z 1TVKA 4FM0A 2HR3A 3BVOA 3ZHSA 2JJ2G 1US6A 2LFSA 4LNUB 1VQLV 3CPWU 1SQVH 3DXRA 4DV0B 3K79A 1KKDA 3GVMA 4O4HA 1PP9H 4MTOA 1PPJH 3L71H 1H8EG 1XEQA 2UU9O 3MHHC 4TV9A 1AROP 3JCZA 1ENVA 4NTYA 2WLIB 4O2AA 2DYSB 3WB2A
chains in the Genus database with same CATH topology
3T1YO 1N34O 4DUZO 4LFBO 4DR1O 4LF4O 4JYAO 3R66A 1HNXO 1G1XB 5BR8O 1N36O 4DV6O 5IT9N 1AB3A 4JI6O 1IBLO 1X59A 4DR2O 4OX9O 2DOSA 2ZM6O 2HHHO 4JV5O 1DK1A 4AQYO 1R6TA 1NS1A 2ZKOA 4DV7O 1XNRO 4GKJO 4OPHA 4YHHO 2UXDO 4DR4O 4B3RO 4X66O 1HR0O 1IBMO 4NXMO 1FKAO 3J80N 4B3SO 4DR6O 4DV3O 1N32O 3JAMN 4JI8O 4JI0O 4B3MO 5H5NA 1YZBA 4A5UB 2UXCO 2Z0AA 1HNZO 2F4VO 2DJVA 4JI7O 5LL6Y 1N33O 4DR7O 4X64O 4GKKO 2UUBO 2UUCO 3T1HO 3RT3C 4DV4O 4DR3O 2N74A 1XNQO 4KHPO 4DV0O 4JI4O 4DV2O 1F7YA 2UXBO 4YY3O 1XMOO 5BY1A 1J5EO 2JRIA 4X62O 4LF6O 1KUQA 3J7AU 2FKXA 4LFCO 5A2QN 4X65O 3M8AA 1IBKO 5LMUO 2UUAO 4DUYO 4JI5O 4NXNO 2VQEO 4LFAO 4OPAA 3F5TA 4B3TO 4JI3O 4DV1O 4K0KO 5LMNO 4LF7O 3SDLA 1AILA 3J81N 5FLXN 4JI1O 3O65A 1HNWO 3OTOO 1XEQA 2UU9O 1R1BA 4JI2O 4LF8O 2LW7A 4DV5O 4DR5O 2VQFO 4LF5O 2AGAA 1XMQO 1I94O 1FJGO 1A32A 5IWAO 1D2DA 5BXZA 4LF9O 1FYJA 2E5LO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y O;  1N34 O;  4DUZ O;  4LFB O;  4DR1 O;  4LF4 O;  4JYA O;  3R66 A;  1HNX O;  1G1X B;  5BR8 O;  1N36 O;  4DV6 O;  5IT9 N;  1AB3 A;  4JI6 O;  1IBL O;  1X59 A;  4DR2 O;  4OX9 O;  2DOS A;  2ZM6 O;  2HHH O;  4JV5 O;  1DK1 A;  4AQY O;  1R6T A;  1NS1 A;  2ZKO A;  4DV7 O;  1XNR O;  4GKJ O;  4OPH A;  4YHH O;  2UXD O;  4DR4 O;  4B3R O;  4X66 O;  1HR0 O;  1IBM O;  4NXM O;  1FKA O;  3J80 N;  4B3S O;  4DR6 O;  4DV3 O;  1N32 O;  3JAM N;  4JI8 O;  4JI0 O;  4B3M O;  5H5N A;  1YZB A;  4A5U B;  2UXC O;  2Z0A A;  1HNZ O;  2F4V O;  2DJV A;  4JI7 O;  5LL6 Y;  1N33 O;  4DR7 O;  4X64 O;  4GKK O;  2UUB O;  2UUC O;  3T1H O;  3RT3 C;  4DV4 O;  4DR3 O;  2N74 A;  1XNQ O;  4KHP O;  4DV0 O;  4JI4 O;  4DV2 O;  1F7Y A;  2UXB O;  4YY3 O;  1XMO O;  5BY1 A;  1J5E O;  2JRI A;  4X62 O;  4LF6 O;  1KUQ A;  3J7A U;  2FKX A;  4LFC O;  5A2Q N;  4X65 O;  3M8A A;  1IBK O;  5LMU O;  2UUA O;  4DUY O;  4JI5 O;  4NXN O;  2VQE O;  4LFA O;  4OPA A;  3F5T A;  4B3T O;  4JI3 O;  4DV1 O;  4K0K O;  5LMN O;  4LF7 O;  3SDL A;  1AIL A;  3J81 N;  5FLX N;  4JI1 O;  3O65 A;  1HNW O;  3OTO O;  1XEQ A;  2UU9 O;  1R1B A;  4JI2 O;  4LF8 O;  2LW7 A;  4DV5 O;  4DR5 O;  2VQF O;  4LF5 O;  2AGA A;  1XMQ O;  1I94 O;  1FJG O;  1A32 A;  5IWA O;  1D2D A;  5BXZ A;  4LF9 O;  1FYJ A;  2E5L O; 
#chains in the Genus database with same CATH topology
 3TXS A;  1NZ6 A;  3HB3 B;  5BR8 O;  4R50 A;  1M9N A;  4N21 A;  4UCO A;  1ZLZ A;  1KB9 F;  1PD3 A;  4KUM A;  5D5Q A;  4X20 B;  4HNA A;  5GTI Z;  1FXK B;  1R6T A;  3BRC A;  4BIU A;  4Z1M G;  1K33 A;  2X6C A;  1JR9 A;  4QNH B;  1YIJ V;  3ABK C;  2YC0 A;  4YJ2 B;  5LXT A;  2CUG A;  3CCR V;  5IE9 A;  1SQX H;  4J10 A;  3LNM B;  1IXB A;  1E1R G;  4B3M O;  5KLV H;  4LH7 A;  2DJV A;  1N33 O;  4JI6 B;  2LGW A;  1IVS A;  1PNK A;  4JV5 B;  3CCS V;  4L87 A;  2YIB D;  4WFF A;  4NVP A;  3ASO C;  2ZQM A;  1EBO A;  5BMV B;  4ZBM A;  3ETG A;  1K34 A;  3ZMV A;  2L6L A;  1SQB H;  1YHQ V;  2ZDI C;  4P9P A;  3UT5 A;  4PV1 B;  5CBF A;  1HNZ B;  3B8M A;  1NQT A;  1GKF A;  3K9S A;  4UCU A;  3CRQ A;  2EZP A;  1FS0 G;  2UUA B;  5EZY A;  1BHA A;  4DV1 O;  3T1H B;  5K1P A;  4TT3 G;  2HJD A;  2JGD B;  4DR3 B;  1R73 A;  3P32 A;  1QCE A;  4IL6 Z;  1XMO B;  2N05 A;  3DTU B;  4LF6 B;  2FML A;  3FKS G;  4U7N A;  2Q4P A;  3GWK C;  5CA0 B;  5IWA O;  2LP7 A;  2QWQ B;  2XAH A;  4K35 A;  3E8H A;  2QJ1 A;  2F66 C;  3CJH A;  4MVQ A;  2V4D A;  4B3T B;  4LF4 B;  3FYE B;  3BFR A;  2HHH O;  2YEV B;  4Z1V A;  2CTP A;  2EIK B;  4UFZ A;  2IM9 A;  5A9G A;  3TGU H;  3OMI B;  3JD4 A;  3JD3 A;  3JAR A;  2ZR2 A;  3E89 A;  4RUE A;  2ZR3 A;  3SJQ C;  3RYH B;  3X2Q C;  2IJK A;  1MZF A;  2Z0A A;  5LL6 Y;  2WLK A;  1N36 B;  5KHH A;  5DM6 V;  1HW7 A;  3T4Z A;  3CP1 A;  2OTL V;  2DWD C;  4PA9 A;  2OCH A;  1ROP A;  2JIZ G;  1YJW V;  1QBZ A;  2X6B A;  1SZX A;  4J7Z A;  4JAV A;  5B1O A;  1S3J A;  3JSN A;  4O4I B;  1OCR B;  5J9P C;  2NNU A;  2EBO A;  4EEQ A;  2WPD G;  1LNQ A;  3LSS A;  1S76 D;  1Q6U A;  1QR8 A;  3AK2 A;  2OT5 A;  4QPK A;  2UUB B;  3LSU A;  3CCE V;  2C2A A;  3APO A;  3VQV A;  2EZO A;  2MW2 B;  1NVP D;  3OEH G;  2VS0 A;  2RJZ A;  4I50 A;  3P3N A;  5IJ0 B;  1OCZ C;  4FFB B;  2M7W A;  3D8C A;  3JAL B;  1N8R W;  4H0L B;  4PA3 A;  2ITC C;  3CCV V;  4IHJ B;  3T1Y O;  2BOC C;  1NH2 D;  1SA0 A;  3OGC C;  2BTQ A;  3WU2 Z;  1VF6 A;  1N34 B;  2XHB A;  2E76 B;  1E79 G;  1TUB A;  3N2K A;  5DN6 G;  2P4V A;  1H2M A;  1VIB A;  1VF5 B;  4DK0 A;  1GK9 A;  1I5X A;  4JGS A;  4LF5 B;  3H1L H;  3J80 N;  3AG2 C;  4J42 A;  4JI8 O;  3K0G A;  1Q82 W;  5CMU A;  1RM1 B;  1Y76 A;  4DR1 B;  3CYO A;  1V55 C;  2YIA A;  3N2G A;  3K06 A;  4MSW C;  1VEW A;  4DW1 A;  4ZHQ B;  4K8Z A;  3JD0 A;  2QKC A;  1MNG A;  3JAT A;  4FM2 A;  1YCI A;  2UUC O;  2DYS C;  2P4K A;  2N74 A;  4G2K A;  4J9Y B;  5J2T A;  3BPZ A;  4KHP O;  1HP8 A;  1VQ5 V;  3ZIA G;  4FPP A;  4YHH B;  2EIL C;  5B1B C;  3F7V C;  4J80 A;  1IBM B;  2F1M A;  2XAF A;  1Q3E A;  3RYF B;  1QVG U;  3E83 A;  2V1D A;  3THO A;  3QO8 A;  2UUA O;  5EC2 C;  2CTR A;  1UJW B;  2FL4 A;  3LNN A;  3CRA A;  3T1C A;  5LMU B;  5IYC O;  3F5T A;  3UCS C;  5LMN O;  1IUR A;  1AIL A;  5EBW C;  3K5L A;  4JI4 B;  4X1I A;  1N4C A;  4BW5 A;  2ZNI A;  2HFE C;  3DSQ A;  3CXH F;  3G71 V;  4X1K A;  3QTC A;  4TUY B;  2ITD C;  4BWA A;  1IBK B;  1NI8 A;  4R7C A;  4DRX B;  3ABK B;  3SPG A;  4O2B B;  4LF4 O;  4NXN B;  3E8B A;  4JTC B;  3OW2 U;  2YXL A;  1P49 A;  2YS8 A;  1HNX B;  3SYA A;  3JD2 A;  2JVD A;  5L3C A;  4MVM A;  1AR5 A;  2OWO A;  4CS3 A;  1FPO A;  2DN9 A;  4I4T A;  4TOI A;  1GH6 A;  2UU9 B;  2QSA A;  5CN0 A;  1LUW A;  2BTO A;  4TV8 A;  1ZX3 A;  3JD1 A;  4DR6 O;  2L35 A;  3ASO B;  4ZKI A;  1MAB G;  1NR7 A;  2ATK C;  4CZZ A;  4WFE A;  1YZB A;  2WLN A;  4CS2 A;  4MVZ A;  2P22 C;  4DV3 B;  4K8X A;  2Y69 C;  2Q69 A;  2FYU H;  1SET A;  1AP6 A;  1XQ8 A;  3QF7 A;  3RT3 C;  1Q7Y W;  4RQF A;  3BHP A;  2R9I A;  2ADQ B;  2N04 A;  4YY3 O;  3ZCC A;  3WB0 A;  3ZED A;  2Y0P A;  4D7S A;  3AG3 C;  2W0X A;  3GWO A;  3M8A A;  4B3M B;  2ILM A;  2XOK G;  4GYC B;  3K5M A;  5FPR A;  1VP7 A;  4X1Y A;  3LDD A;  5ITZ B;  1Y6X A;  1N33 B;  1R3J C;  1AVM A;  2CE4 A;  4HAM A;  3JAS B;  3RYI A;  2QGN A;  2PYL A;  1GN6 A;  1GN2 A;  5DED A;  3ABU A;  4JYB A;  1B04 A;  4ZOL B;  2YUA A;  5FLX N;  1H2S B;  3H01 A;  2WLL A;  2NLJ C;  2A79 B;  1XHX A;  4IIJ A;  2CTQ A;  3ZJZ A;  3TK1 A;  2DQ0 A;  1GM8 A;  4LF8 B;  4B7E A;  4NKG B;  1WB8 A;  1N34 O;  1YSC A;  4LP8 A;  1GAX A;  4JYA O;  1BQ0 A;  2PTM A;  1VQ8 V;  3P30 A;  1VAR A;  2QR4 A;  1RPO A;  3X2Q B;  3W7X A;  1NS1 A;  1YEW A;  3CC4 V;  4DK1 A;  2ZT9 B;  4X66 O;  1FFX B;  2F93 B;  1Y67 A;  1NT2 B;  5KMG A;  5IWA B;  3CEI A;  1P7B A;  2X7R B;  1K9M W;  5H2F Z;  1GO3 F;  4RWU A;  5H5N A;  2W6I G;  1X4T A;  4FLW A;  5FNV B;  4FK5 C;  2ZE5 A;  4FLV A;  1AR4 A;  4ICG A;  1K5Q A;  3PN1 A;  5CB4 B;  5JVD B;  2YIC A;  3DC6 A;  2BSK B;  2HHH B;  2A06 H;  1JJ2 U;  2Y48 A;  4KP4 A;  2CH7 A;  2QTO A;  1MSD A;  2A7W A;  5IJ9 B;  2PY5 A;  1WP8 A;  2O57 A;  5D5P A;  3ETD A;  1K73 W;  1CEZ A;  1R6N A;  4C7U A;  1VQ4 V;  1YIT V;  3G4S V;  5LMU O;  1S0V A;  4NTX A;  1OCZ B;  4Q6G A;  4LH6 A;  1YTF B;  1ZWI C;  3JAW B;  4G27 B;  1ZAU A;  2P90 A;  4RUF A;  1SRY A;  1ORQ C;  1B06 A;  4MVU A;  3SDL A;  1XBL A;  1AR1 B;  1K3E A;  3U10 A;  3LUT B;  4IGG A;  2OIE A;  4CC6 A;  2GUZ A;  5FPO A;  2F95 B;  3OM3 B;  2EIM C;  1A32 A;  3UKM A;  2YIB A;  2E75 B;  3MHS C;  1G6U A;  2BCC H;  4J11 A;  2XAS A;  3FB6 C;  2KG7 A;  1R3I C;  1HNX O;  4PDM A;  3NR7 A;  1PNL A;  2OTJ V;  1WN7 A;  4I0X A;  2AW9 A;  3AG2 B;  1X59 A;  2P7T C;  2PGG A;  3C90 A;  3I56 V;  3HKE A;  1V55 B;  3OAA G;  3W7T A;  4B3R O;  2LJ2 A;  4PI2 A;  5JQG A;  3ZRX A;  4UV8 A;  4D6T H;  2OYQ A;  5CBH A;  4DV3 O;  1N32 O;  3HKD A;  4LWS A;  3T1Y B;  3BA9 A;  2UXC O;  5JCO A;  2EIL B;  5B1B B;  2F4V O;  3KKY A;  4ZI7 B;  4PDV A;  1WB7 A;  5LYJ B;  1VF6 C;  3BA8 A;  3CME V;  1CP9 A;  2E3C A;  4PA6 A;  3SPC A;  1NTM H;  3FAV B;  2P67 A;  4FM1 A;  2EX3 A;  2Q7E A;  2R70 A;  1Z5W A;  3KCX A;  1JA8 A;  1FAF A;  2QKS A;  2WA3 A;  4O4L A;  1PM9 A;  3OD4 A;  1AJP A;  4HBN A;  3K58 A;  3OT7 A;  1G8M A;  1P7G A;  4X65 O;  4JI8 B;  2AZ2 A;  5L3D A;  1PV0 A;  1P84 F;  3AG4 C;  3FB7 C;  5LOV B;  4I9Q A;  3ZS8 C;  3H1I H;  1WA8 B;  4OPA A;  1EN5 A;  4DUY B;  3VBB A;  4F6R A;  2UUC B;  3A0B Z;  1DGS A;  5EBM C;  4WBN B;  4WCE V;  3CCU V;  4KHP B;  1FD9 A;  4JPR A;  3J81 N;  4JI1 O;  1JJO A;  1Y74 A;  1AI5 A;  3JAK B;  3RVZ A;  1TVK B;  3OUF A;  1Q5O A;  4GCZ A;  3IC7 A;  4LF8 O;  2IU0 A;  2XAG A;  1WLE A;  3C3T A;  1MOF A;  3DXR B;  4FLT A;  3N27 A;  4XDJ A;  3CB2 A;  1WNS A;  1AP5 A;  1BT8 A;  1NTK H;  3RW0 A;  1S77 D;  1DLB A;  1SS3 A;  3HKB A;  4TV9 B;  2JS3 A;  3LSQ A;  4W4K A;  4GLX A;  4PJ0 Z;  5LMN B;  3JYC A;  4O2A B;  1M4U A;  2Y69 B;  2IJJ A;  5KHI A;  2PYJ A;  1OZ0 A;  1S5H C;  1XNR O;  4I7Z B;  4OPH A;  4QJF B;  2OIG A;  3P3P A;  4HNA B;  2WWW A;  4MTX A;  3FFQ A;  1IX9 A;  2AZ0 A;  3JCU Z;  1VQ7 V;  1KD1 W;  4CH5 A;  1H2L A;  4JI7 O;  2F43 G;  4DR7 O;  5LXT B;  1V54 C;  2KB1 A;  3BCC H;  3AG3 B;  3AG1 B;  3AK3 A;  2RN9 A;  3OR6 C;  2P6J A;  2DWE C;  2WLJ A;  2ZCE A;  2LQT A;  1L0L H;  1EN4 A;  2XAQ A;  3F5W C;  4DV2 O;  1F7Y A;  4X88 A;  1SQF A;  2DYR C;  3KG2 A;  4FZ1 A;  5BY1 A;  3ABL C;  3M7M X;  4PD4 F;  2X6A A;  4FLY A;  4KFM A;  3FB8 C;  4DR6 B;  1U97 A;  4UUJ C;  3I5D A;  2IJH A;  2Q6A A;  1XUQ A;  4YJ3 A;  1F4M A;  3E8G A;  3K03 A;  3T2M A;  4LFA O;  1D5A A;  3CWB H;  4K0K O;  3OMA B;  3UT5 B;  3L74 H;  1AI4 A;  1SZT A;  2ZXW C;  1Q8I A;  4YY3 B;  2YXY A;  5EZY B;  4CH6 A;  2Q0A A;  1VQ9 V;  2XAJ A;  4IYH A;  3G67 A;  2QWO B;  3W7S A;  3R66 A;  4MW8 A;  1AJN A;  5IDJ A;  4HYO A;  1GRJ A;  3B8N A;  1NU1 H;  5F2V O;  5B3S B;  1EZV H;  1QNM A;  4QE7 A;  2ZKO A;  1NVP B;  2Y4U A;  1HDJ A;  4MVS A;  3CJH B;  1RSO A;  3LDC A;  4AQY B;  4EFE A;  1IZ3 A;  3BY6 A;  1TUE B;  3ZRW A;  3OEE G;  1M1K W;  1XHZ A;  2ZNJ A;  3JAR B;  1NH2 B;  4JYA B;  2JDI G;  4CC5 A;  5KUK A;  5LGU A;  4X64 O;  1WAZ A;  2PZS A;  1M56 C;  2KKW A;  1XOU A;  3PJS K;  2QEX V;  1TAE A;  2EJ7 A;  5KHJ A;  3Q4H A;  3ZMU A;  2HP8 A;  1IXM A;  2Q73 A;  1IDS A;  2Q5Z A;  2ZIN A;  1K4D C;  1DF4 A;  4TUY A;  1PL0 A;  4X9Q A;  4X66 B;  2RDC A;  5C8Y A;  1GM9 A;  4R8C A;  2JJ1 G;  4LFC B;  2CGO A;  1KEC A;  4UB8 Z;  4DUY O;  4FMT A;  4JI5 O;  5JJE B;  3RFR A;  3L9D A;  2EIM B;  3AK1 A;  5LHH A;  1DF5 A;  4MT8 A;  1MZE A;  3D36 A;  4ASU G;  5B66 Z;  3CD6 V;  4JYC A;  1Q90 D;  3ABT A;  2PF4 E;  3K59 A;  2LGQ A;  4BIO A;  3WG7 C;  4DR5 O;  3CC2 V;  2XTA A;  4W4L A;  2UXN A;  1FYJ A;  4X89 A;  4Z2W A;  3ZHV A;  4I50 B;  2Y0I A;  3E8F A;  1F4N A;  4LFB O;  3ZHT A;  5KA5 A;  3OTF A;  5KUM A;  4DV6 O;  4UVA A;  1AB3 A;  2KQX A;  2OCC B;  4DXW A;  2LFR A;  4OGQ B;  5KHG A;  2DOS A;  2ZM6 O;  1T5E A;  3UQ8 A;  3B09 A;  1DK1 A;  3ABM C;  1QR9 A;  3E22 A;  3E86 A;  1SA0 B;  4I9W A;  5E79 Z;  2BTQ B;  4WF9 V;  5LA6 A;  4DV7 O;  4GKJ O;  1SQG A;  3AG7 A;  4EB6 A;  1TUB B;  3N2K B;  1B6Q A;  2PI5 A;  3ZX6 A;  3ASN C;  4ZIB A;  4RAI A;  1ZL8 A;  2YID A;  5JH7 A;  1R3K C;  5J2U A;  3K5O A;  3R65 A;  1NKD A;  5EIB D;  3RGB A;  4GKK O;  1D5N A;  4YIP A;  3AG4 B;  5KAF Z;  1Y76 B;  3OE7 G;  3OGI B;  2HKO A;  3N2G B;  1SKV A;  3RYC A;  3D3Q A;  2QWP B;  3JAT B;  4B3R B;  3BAA A;  2H3O A;  3SYC A;  5A2Q N;  5J2T B;  3STZ C;  3CCQ V;  1N32 B;  2DW4 A;  4I55 A;  3UM7 A;  3K04 A;  2B1I A;  2HLD G;  2RMK B;  2UXC B;  5LP6 A;  5B1N A;  2F4V B;  1ZTE A;  5JCO C;  2H8P C;  2JGU A;  1QU7 A;  2AHZ A;  4UXN A;  2VQE O;  1MA1 A;  1BCC H;  2ETN A;  2K9P A;  3CCM V;  4FLX A;  4UCT A;  1K92 A;  1RP3 B;  2WLH A;  3RBZ A;  2W6J G;  3IGA C;  5GON A;  2LO1 A;  1BL8 A;  5EK0 A;  2V7Q G;  1W0K G;  4J41 A;  5KAI Z;  4H33 A;  2CTW A;  4GX1 A;  3L75 H;  1R1B A;  1YXB A;  4XBF A;  3AG1 C;  1LUV A;  1K97 A;  1JMK C;  2VQF O;  2GTA A;  4X65 B;  3MAQ A;  4TWK A;  1SC5 B;  3B77 A;  3F7Y C;  4X1I B;  1QLN A;  2E5L O;  1ZUQ A;  5KHK A;  3CRC A;  1Y66 A;  2A9H A;  3IC9 A;  3CXC U;  5L3F A;  5IT9 N;  4X1K B;  2R9R B;  4KL1 A;  4OX9 O;  3KZI Z;  3ICX A;  4AQY O;  3HKC A;  1Z5V A;  1JFF A;  4JI1 B;  4WFA V;  1EFR G;  4F6E A;  1V54 B;  2UXX A;  5CA1 A;  2W0F C;  1BZK A;  4DR4 O;  3K57 A;  2IJI A;  2XT9 A;  5KX5 A;  1I5Y A;  5IYZ A;  1ZSP A;  3MD0 A;  4I4T B;  5LHG A;  2DYR B;  3L70 H;  4FLZ A;  3CHX A;  4U3J A;  3ABL B;  2XUM A;  4TV8 B;  4TQD A;  4JI0 B;  4J7J A;  5EYP A;  2LW1 A;  3VOU A;  4CH3 A;  3ETQ A;  1XNQ O;  2PUS A;  2NN4 A;  4O4J A;  2M6Y A;  3D3I A;  1XNR B;  5K1X A;  4PA4 A;  1NR1 A;  1S5J A;  2WLM A;  1OV9 A;  5B3S C;  4YXW G;  4LFC O;  2H94 A;  4WFG A;  2Q67 A;  1JVM A;  1BSM A;  2B5U A;  4QE9 A;  1VQO V;  2ZXW B;  5AG2 A;  4LNU A;  1THZ A;  2Y4T A;  3UO2 A;  1VQP V;  1V9P A;  4JI7 B;  4DR7 B;  1XIL A;  3OMN B;  4KXR A;  3A0R A;  4X1Y B;  3L73 H;  2WLI A;  1OCO C;  1YJN V;  4DV2 B;  4XDL A;  1HNW O;  3OTO O;  4UVC A;  1GM7 A;  2HG5 C;  3GB7 C;  5GTH Z;  4JI2 O;  3RYI B;  2GV9 A;  4GUN A;  3CCJ V;  4Q20 A;  3EFF K;  3T4D A;  2FTK A;  4PDR A;  4X20 A;  2GDS A;  2WLL B;  4DUZ O;  1FXK A;  4RO2 A;  1G1X B;  3RWR D;  3NXS A;  4LFA B;  4G28 B;  2VWK A;  4L8J A;  5FL7 G;  4IIJ B;  4P30 A;  5LGN A;  4K0K B;  4FLU A;  4DR2 O;  3EXA A;  3RVY A;  3TCU A;  4YJ2 A;  4NTW A;  4GX5 A;  2IW5 A;  1MSW D;  1M56 B;  2EIN C;  3ZMZ A;  4UCV A;  1HR0 O;  5LHI A;  1AI7 A;  3CRR A;  1VQM V;  4J7K A;  2ZE6 A;  4GT1 A;  4JF3 A;  3MDS A;  3TET A;  1WPB A;  1W59 A;  5BMV A;  5KMG B;  1XL4 A;  1P4R A;  1Q86 W;  2F23 A;  5B1A C;  3IJ4 A;  1G4Y B;  1QLE C;  1H8H G;  3OR7 C;  2K1E A;  4NYK A;  1GN3 A;  2OCC C;  4ABM A;  2XND G;  3A8T A;  4JTD B;  1CXZ B;  2JRI A;  2CH7 B;  2UXB B;  3STL C;  3OUS A;  5GW7 A;  2IBZ H;  1FXV A;  1LR1 A;  2JGD A;  4NB5 A;  2D3O W;  2JEU A;  3WG7 B;  1Q6H A;  4X64 B;  3ZHQ A;  5TIS Z;  3FD9 A;  4WFH A;  4LF7 O;  5C93 A;  3K9A A;  5CA0 A;  1K7D A;  3M99 B;  2YDE A;  1UPG A;  3FB5 C;  3H9V A;  4TSF G;  3ABM B;  1I94 O;  1FJG O;  3CRM A;  2QWN B;  5EIB C;  1OCC C;  4LF9 O;  2YEV A;  1K8A W;  1R6K A;  3O9O A;  2RQ6 A;  4JI5 B;  2GUZ B;  2GSM B;  1IBL O;  1HWY A;  1WPX A;  2IH3 C;  1UFI A;  3ASN B;  3D36 C;  3ZRV A;  1L8D A;  5L3G A;  2KG7 B;  3RYH A;  1WP7 A;  1I7F A;  3KCY A;  3SJB C;  1YVW A;  4I0X B;  5BZB A;  2Q7H A;  4DR5 B;  4O4H B;  4NXM O;  3HKE B;  4JTA B;  2QA4 V;  4B3S O;  4RQE A;  4E2L A;  4JI0 O;  3TJT A;  1Q43 A;  3ZHU A;  4LFB B;  1JOY A;  4DV6 B;  5JQG B;  3ZMS A;  1KU9 A;  3CC7 V;  1TA8 A;  2HJF C;  3SPI A;  3HKD B;  2ZM6 B;  5JWP A;  2ZIM A;  4O4I A;  3JSL A;  4LWS B;  4DV4 O;  1VQK V;  3U0Z A;  2HVJ C;  1WJZ A;  4U7O A;  3LDE A;  4DV7 B;  2A3Q A;  3I55 V;  2QM4 A;  4GKJ B;  1K5S A;  1E1Q G;  3QNE A;  1KMI Z;  1J5E O;  4X62 O;  1VMG A;  5H9C A;  2VRZ A;  2EIJ C;  1JCH A;  1PL4 A;  1S72 V;  1JX9 A;  3IAY A;  4PEL A;  4O4L B;  3CSX A;  5IY5 C;  2BOB C;  4GKK B;  5IJ0 A;  4LC1 A;  4JI3 O;  4FFB A;  2CK3 G;  4MTF A;  4YIO A;  1R3L C;  3CE2 A;  3JAL A;  4X8A A;  1SQQ H;  4H44 B;  4QIW F;  4IHJ A;  1PKX A;  4FFK A;  4DO2 A;  5HFM A;  5L3B A;  1MG1 A;  4F6R B;  3H1K H;  2AGA A;  4NR1 A;  2B1G A;  1XMQ O;  2HEP A;  5CBG A;  2QDO A;  4DV5 B;  1YI2 V;  1Y74 B;  2Q8V A;  4JYY A;  5H6Q A;  2GHY A;  5LP6 C;  1BQZ A;  1N0N A;  1YDX A;  2VQE B;  2Q68 A;  4JZG A;  3VQY A;  1SER A;  4UCR A;  2JS5 A;  2KSD A;  3HKB B;  1QVF U;  3ZMT A;  2P06 A;  1H38 A;  3S3W A;  4EFB A;  2QKA A;  2UXD O;  3ML0 A;  1RFY A;  4UVB A;  2VQF B;  1M5I A;  4ZHQ A;  1FKA O;  3BEH A;  1FFT B;  2EJR A;  2E5L B;  3FX7 A;  3WB1 A;  4U3F H;  2ZIO A;  5H6R A;  1EZJ A;  3ZN0 A;  4B7K A;  2AHY A;  3AEI A;  1SQP H;  4OX9 B;  1L0N H;  1H2K A;  1BE3 H;  3E2E A;  3RYF A;  1VQN V;  3HR0 A;  4DV0 O;  4PDL A;  2JEX A;  2DE0 X;  2UXB O;  3K08 A;  4OXS A;  1M57 C;  2A0L A;  4DR4 B;  3C3S A;  4MS2 A;  2FKX A;  1AJQ A;  4UCS A;  4WFB V;  2IU3 A;  1OCO B;  3VQX A;  3SYO A;  3OFN G;  3WFV A;  2WSS G;  4H13 B;  1PNM A;  4CBC A;  2Q7G A;  1NTZ H;  2CAZ C;  1KP3 A;  4FVM A;  1URF A;  5CA3 A;  4YJ3 B;  1XNQ B;  4EKW A;  1OJH A;  3O65 A;  1NBM G;  3CS5 A;  4DRX A;  3VQW A;  4O2B A;  3B40 A;  1GMG A;  4JAU A;  1AI6 A;  1DTO A;  4DW0 A;  1BMF G;  3APQ A;  5L3E A;  4P9O A;  2EIN B;  4FZ0 A;  1O9H A;  3CCL V;  3L72 H;  4JI6 O;  4F4L A;  1COW G;  2RNB A;  1RPR A;  4R6Z A;  4JV5 O;  2GBO A;  4AIL C;  5EC1 C;  2IH1 C;  1HNW B;  4HZ3 A;  3OTO B;  3H1H H;  1TGO A;  2ZE8 A;  3ZBH A;  5JJN B;  2BE3 A;  3G6E V;  4JI2 B;  5B1A B;  3SR2 C;  4J9Z B;  1QLE B;  2ZE7 A;  2ZDI A;  4B08 A;  1RSO B;  5IYD O;  4DUZ B;  2WAM A;  1HNZ O;  1FXK C;  1OHH G;  3A2F A;  3ZRW B;  2DQ3 A;  5IYB O;  4DR2 B;  2ODM A;  4MVO A;  2WA4 A;  3T1H O;  4DR3 O;  1SF9 A;  2D2C B;  1KKC A;  2FB5 A;  4AI8 A;  1XMO O;  5ITZ A;  1JQ0 A;  1HR0 B;  2YI8 A;  4LF6 O;  3J7A U;  3JAS A;  3Q4H B;  4GX2 A;  1Y4M A;  4ZOL A;  3A0H Z;  1OCC B;  5C8Y B;  4B3T O;  3DGE A;  1Q6I A;  1KYO F;  3K0D A;  4PHZ A;  3B4S A;  2LW7 A;  4DV5 O;  1Q81 W;  2NR5 A;  3FYI B;  4JAS A;  2QE7 G;  3W7W A;  5B5E Z;  1D2D A;  4N23 A;  4FIP C;  5BXZ A;  4E4E A;  4BW9 A;  5LGT A;  4LCU C;  3W7U A;  4TQF A;  1N36 O;  1I0H A;  3RN4 A;  2CGN A;  3HPL C;  1QQC A;  3UO3 A;  3CMA V;  4QPJ A;  4UV9 A;  1L1F A;  5BR8 B;  1FFX A;  2ADP A;  1YF2 A;  4LF7 B;  3SGI A;  1N0J A;  1I08 A;  1VF7 A;  5FNV A;  4D7T A;  4BIZ A;  4QGP A;  3E22 B;  5CB4 A;  1I94 B;  5JVD A;  1FJG B;  2P5O A;  4LBE C;  2BSK A;  3G80 A;  5E1A C;  4LF9 B;  4IT5 A;  3QG5 A;  2EUL A;  5DEC A;  5LA6 B;  3K5N A;  1SES A;  4A5U B;  2DMX A;  1W0J G;  3SJA C;  1BHB A;  5IJ9 A;  2EIK C;  2HVK C;  4JAA A;  4EB6 B;  2EIJ B;  1IBL B;  3U11 A;  2UUB O;  1XDC A;  2PI4 A;  1ZL8 B;  2X0L A;  4BR6 A;  5JH7 B;  1H2N A;  5J2U B;  5IY5 B;  5HFL A;  2GTS A;  4LR3 A;  4CS4 A;  3ZHR A;  2YXH A;  3EHB B;  5LBQ A;  2R72 A;  3SPH A;  3QVN A;  1KUQ A;  4NXM B;  1B3Q A;  2ARH A;  3IFX A;  3TXQ A;  4B3S B;  3B2E E;  3JAW A;  1NJI W;  2MK3 A;  3RYC B;  4XDK A;  1XL6 A;  1BS3 A;  4GX0 A;  4K3A A;  2ZD9 A;  1BGY H;  2R9A A;  1F23 A;  1S5L Z;  4I55 B;  4DV4 B;  1OCR C;  4MW3 A;  3E35 A;  1F51 A;  5LP6 B;  1XI1 A;  4DV1 B;  1YJ9 V;  1JPX A;  2QWR B;  1J95 A;  1O9G A;  3CX5 F;  5JJJ B;  2RCV A;  3SJC C;  4H37 A;  1J5E B;  1EM1 A;  5KA6 A;  4X62 B;  4LF5 O;  5GON B;  4CH4 A;  2B9Z A;  2AXT Z;  2CDY A;  2QM8 A;  4GZR B;  4DR1 O;  1M90 W;  3H1J H;  3ZRS A;  2VWJ A;  3BAB A;  2Q9L A;  4JI3 B;  2G38 A;  3QO7 A;  5EBL C;  2E74 B;  4PA7 A;  4FJC C;  3SPJ A;  1KBH A;  1Z2G A;  1KC8 W;  4BAY A;  1MMM A;  4YHH O;  2QTS A;  4ZI7 A;  1IBM O;  1XMQ B;  5LYJ A;  1GN4 A;  1K4C C;  2JK5 C;  3HKC B;  1EN6 A;  1JFF B;  1XRE A;  3JAM N;  2YSU B;  3QO5 A;  3FAV A;  5CA1 B;  1U96 A;  1M57 B;  4MVR A;  1M93 A;  1QHT A;  5KX5 B;  5IYZ B;  3S3X A;  1W2B U;  1YTF D;  4JZ2 A;  4P2Z A;  1GTO A;  1H2G A;  2YI9 A;  1KP2 A;  1VQ6 V;  4U3J B;  4IYI A;  4JI4 O;  3ETE A;  4PI0 A;  5LOV A;  3K3W A;  1RM1 C;  5EYP B;  2UXD B;  3EVK A;  2Z5U A;  1WA8 A;  4DYL A;  3SYQ A;  2Q0O C;  1FXH A;  3G6B A;  2Z3Y A;  4I5S A;  4O4J B;  3ZN1 A;  1IBK O;  1KQS U;  4WBN A;  1CPY A;  3SYP A;  3DC5 A;  4NXN O;  4AHC A;  3JAK A;  2QM7 A;  4MTG A;  4UB6 Z;  1TVK A;  4FM0 A;  2HR3 A;  3BVO A;  3ZHS A;  2JJ2 G;  1US6 A;  2LFS A;  4LNU B;  1VQL V;  3CPW U;  1SQV H;  3DXR A;  4DV0 B;  3K79 A;  1KKD A;  3GVM A;  4O4H A;  1PP9 H;  4MTO A;  1PPJ H;  3L71 H;  1H8E G;  1XEQ A;  2UU9 O;  3MHH C;  4TV9 A;  1ARO P;  3JCZ A;  1ENV A;  4NTY A;  2WLI B;  4O2A A;  2DYS B;  3WB2 A; 
#chains in the Genus database with same CATH homology
 3T1Y O;  1N34 O;  4DUZ O;  4LFB O;  4DR1 O;  4LF4 O;  4JYA O;  3R66 A;  1HNX O;  1G1X B;  5BR8 O;  1N36 O;  4DV6 O;  5IT9 N;  1AB3 A;  4JI6 O;  1IBL O;  1X59 A;  4DR2 O;  4OX9 O;  2DOS A;  2ZM6 O;  2HHH O;  4JV5 O;  1DK1 A;  4AQY O;  1R6T A;  1NS1 A;  2ZKO A;  4DV7 O;  1XNR O;  4GKJ O;  4OPH A;  4YHH O;  2UXD O;  4DR4 O;  4B3R O;  4X66 O;  1HR0 O;  1IBM O;  4NXM O;  1FKA O;  3J80 N;  4B3S O;  4DR6 O;  4DV3 O;  1N32 O;  3JAM N;  4JI8 O;  4JI0 O;  4B3M O;  5H5N A;  1YZB A;  4A5U B;  2UXC O;  2Z0A A;  1HNZ O;  2F4V O;  2DJV A;  4JI7 O;  5LL6 Y;  1N33 O;  4DR7 O;  4X64 O;  4GKK O;  2UUB O;  2UUC O;  3T1H O;  3RT3 C;  4DV4 O;  4DR3 O;  2N74 A;  1XNQ O;  4KHP O;  4DV0 O;  4JI4 O;  4DV2 O;  1F7Y A;  2UXB O;  4YY3 O;  1XMO O;  5BY1 A;  1J5E O;  2JRI A;  4X62 O;  4LF6 O;  1KUQ A;  3J7A U;  2FKX A;  4LFC O;  5A2Q N;  4X65 O;  3M8A A;  1IBK O;  5LMU O;  2UUA O;  4DUY O;  4JI5 O;  4NXN O;  2VQE O;  4LFA O;  4OPA A;  3F5T A;  4B3T O;  4JI3 O;  4DV1 O;  4K0K O;  5LMN O;  4LF7 O;  3SDL A;  1AIL A;  3J81 N;  5FLX N;  4JI1 O;  3O65 A;  1HNW O;  3OTO O;  1XEQ A;  2UU9 O;  1R1B A;  4JI2 O;  4LF8 O;  2LW7 A;  4DV5 O;  4DR5 O;  2VQF O;  4LF5 O;  2AGA A;  1XMQ O;  1I94 O;  1FJG O;  1A32 A;  5IWA O;  1D2D A;  5BXZ A;  4LF9 O;  1FYJ A;  2E5L O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...