3EXAA

Crystal structure of the full-length trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
303
Chain Sequence
b'KEKLVAIVGPTAVGKTKTSVMLAKRLNGEVISGDSMQVYRGMDIGTAKITAEEMDGVPHHLIDIKDPSESFSVADFQDLATPLITEIHERGRLPFLVGGTGLYVNAVIHQFNLGDIRADEDYRHELEAFVNSYGVQALHDKLSKIDPKAAAAIHPNNYRRVIRALEIIKLTGSPYNLVMIGLTMERDVLYDRINRRVDQMVEEGLIDEAKKLYDRGIRDCQSVQAIGYKEMYDYLDGNVTLEEAIDTLKRNSRRYAKRQLTWFRNKANVTWFDMTDVDFDKKIMEIHNFIAGKLEEKSKLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title Crystal structure of the full-length tRNA isopentenylpyrophosphate transferase (BH2366) from Bacillus halodurans, Northeast Structural Genomics Consortium target BhR41.
rcsb
source organism Bacillus halodurans
molecule tags Transferase
total genus 98
structure length 303
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.890 Mainly Alpha Orthogonal Bundle Helix Hairpins Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 3exaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3exaA01
4NYIR 5JLJA 4AD8A 4FMDB 4TQUS 5JJIA 2VF7A 3IUYA 3SN6A 1M7BA 4NZYA 2FFHA 3WBJA 4B74A 1NN1A 3SR0A 2GAAA 3IDQA 4IOMA 3VR5A 3QKTA 3PQCA 1IY2A 2ZE6A 1R8QA 1G3QA 3IIMA 2HCBA 1NNEA 4OHZA 1JQLB 2ZITA 5EE0A 1NSFA 4QFMA 4KYUA 3D3QA 3MJHA 3KQLA 1RFLA 4XTRA 2PZGA 4OHVA 1G18A 3LD9A 1SKYE 4ZDJA 2DFKB 1OFIA 3TSOA 2WJGA 3S1AA 4NL4H 1TQ6A 1R0XA 3GJ5A 2RGGA 1XJQA 1OLOA 5GADl 3WHLA 4A92A 5C46F 5FL3A 4AYTA 1G8HA 2VHUA 2KSQA 4JMPA 1TL7C 2Q3FA 3H4MA 4JVSB 2PZEA 1I2DA 2YOFA 2ORWA 1VIAA 4U7DA 1Z0IA 2ZUBA 3CRVA 3EA5A 5FBVB 2QT0A 3AKEA 3VHLB 4J0QA 3AQ4A 1M8PA 3I32A 3QEJA 3WNBA 2HEIA 4JVLA 4PPGA 1E2EA 1R4AA 1S0UA 2ZU0C 4BFXA 1W5SA 4IXMA 1XMIA 3SS8A 3ZDQA 2DR3A 2PEZA 5GVRA 1NBME 4YXWA 4L8GA 4M9XA 2V3CC 1SVMA 3O47A 3IQWA 5L3VA 4B3DA 4O2RA 3PEYA 5E4FA 1RPZA 4LHZA 1KK1A 1U9IA 2BEJA 1IN6A 1FTSA 4JLBA 4PC3A 4Q9JA 5CDFA 5FOTA 2B21A 2F7SA 1QHHA 1Z6GA 1DAHA 2FMXA 4YXWD 3PIRA 4A1FA 2V55B 1G19A 1OXUA 1VIYA 3GEHA 1NN5A 3A4MA 4OQFA 2ERYA 1Z5ZA 2ZREA 1DOAA 1XCMA 5EXXA 4BLQA 3LLUA 3AF4A 4L4UA 4DDTA 3F3YA 2VLIA 2N42A 3QF7A 2B7BA 3VR4A 1E9BA 3GJ0A 5JSZB 4Q1AA 4KLNA 3QY0A 4FW9A 4Q7JB 3CB4A 3UATA 1OH5A 3LBHA 1E9CA 3BGWA 3ADDA 4O3MA 1KI2A 2Q21A 2ZRGA 4DWJA 4HLDA 4LV8B 3GJ8A 5JS7A 2A78A 5KPJA 1DG1G 3HPRA 2D62A 2EVWX 2R62A 1G8GA 2B6HA 2QL6A 1MABA 1N6IA 2ZANA 3BB4A 4CRWB 3NBYC 2VP4A 4EPWA 2OAP1 5K8IA 3KQNA 3VKWA 2CXXA 1LB1B 1NMYA 2QQEA 1BOFA 1KI6A 1WE2A 1E98A 2QQ0A 4NYJR 4TMVA 5EJEA 1QHSA 2ZQ5A 1TMKA 4LC1A 4LYAA 4TMTA 1U9IC 2AFHE 4QG7A 2NMVA 4IDPA 3K0FB 1CR4A 4GOXA 4PSAA 4RFSA 2WTUA 4MYHA 2GRJA 2V7QA 1AS2A 1II8A 3EC1A 1E2HA 4AI6A 721PA 4AC9A 5BYJA 4KAXA 1N3BA 2YWGA 2BIFA 4RZUA 3CH4B 4W7SA 5C1BA 2JLSA 1ZM2A 1IXZA 2RHMA 2VP9A 3FKSA 4UKDA 1XD9A 3K0SA 4UNQA 2W6IA 1F3OA 3QPWA 1R6BX 3AH8A 3CBQA 3FTQA 2HF9A 2V7QD 3JVUA 3L2OB 3TJZA 3EX7C 1DADA 5JWOA 3X1DA 2GCOB 2W83A 5FUWA 4CEHB 4L15A 1VYUA 2IYSA 1TQ4A 4OK6A 2O5VA 5KUTA 4NDZA 5AUQA 1QBKC 1M2OB 3NG1A 4URWR 3GCGA 2W6ID 2KBFA 1XJCA 3Q5EA 2FWRA 2VEDA 3A4NA 1J99A 2FN4A 2JLQA 3GJ7A 2CVFA 3OFND 1W4RA 3GD7A 1F48A 4PZYA 4EPYA 1M7HA 4A2QA 3O8BA 3AV0B 1TUEA 4IVRA 1UEIA 2O8DB 4IVPA 4G5GA 2JCSA 5FTKA 1OIXA 3PV0A 1N5KA 1AIPA 4TL8A 4AKGA 2YVUA 5AJWA 2PLFA 3THXA 3C5CA 1E4YA 5FPKA 3THWA 5LB2A 3T61A 1DAFA 2WIAA 1KNQA 2O52A 1TF2A 2V1XA 3AF1A 4Z54A 2P65A 2JLZA 2A5FA 3UIEA 2QAJA 1CULC 1G3UA 3K9LA 3WP0A 3KQUA 4O2LA 3ZQ6A 3BC1A 1GUAA 3THYB 1YHNA 1FOEB 4EIWA 1G291 5FPSA 5EP2A 2VL7A 3R7WB 1P60A 1Q12A 1BO6A 4QJ3A 3BXZA 1A4RA 4JLPA 4CEJA 2FU5C 4QNRA 3N70A 2C98A 3NIBA 1ZNZA 2F1JA 4X8MA 1NVXQ 2ZJYA 1I4LD 4H1UA 4V03A 3THOA 1GOTA 4OHXA 4B2LA 1E2KA 4B6FA 4GOKA 2HDNB 4QGAA 2YWHA 4PAOA 4UQOA 5H70A 1T4GA 3N2IA 4TLCA 3B1ZA 1JR3A 2ZUCA 1UF9A 3QNUA 4B32A 2F1HA 2WJVA 4RD4A 5DH9A 4LHWA 5B57C 5FOSA 2O0HA 2CE2X 4KODA 4DT1B 1T0HB 2Z6VA 3C15C 3G5UA 2Q0HA 2O8EB 1WA5A 1NF3A 1XTIA 3M4YA 4ZPXA 1JR3D 3M6AA 5AJYA 5FOUA 4EPXA 1KMQA 1NVVQ 1ZCBA 3I62A 3Q9LA 3KKPA 2RGDA 2QTFA 4MUBA 4KBGA 3K9GA 1PVOA 5FH9A 1PJRA 3UG6A 3QKUA 3A1SA 1CJTC 5FI0B 1X1SA 1IY0A 3SJZA 4W5WA 5DIFA 1DARA 2IL1A 1ZVQA 4Q48A 5EZ6B 5JHHB 2WWYA 3UMSA 5J4YA 3R20A 3QKRA 2CBZA 2VYFA 4CEIA 4TL9A 3TBKA 3LDAA 1OXSC 4Q5IA 1RYFA 4E03A 3FGNA 2VBCA 3ZVLA 2OSBA 2GDJA 3QSYA 1HQCA 1TEXA 1UBGA 2WICA 1A5TA 3VR2A 4JVNA 1R2QA 1QF9A 4A8JB 1E9RA 2KI5A 5HKKA 2IWRA 2ASEA 1US8B 5SZKB 2YC4C 2IF0A 3R8CA 3RYTC 1FTNA 2BWJA 3QXCA 1Z6XA 4KCGA 1XWIA 4JYCA 3ZD6A 1RKBA 3AVOA 2VP6A 5DYGA 1P3JA 3WNCA 2XNSA 2RKOA 2J59A 1EWQA 5LD2B 2FOLA 4CT5A 3CWZA 5HKKD 4LJ9A 2NO0A 3U4QA 2RGXA 4PAMA 3CH5A 5EE1A 5JFGA 1KO4A 3ZLJA 1XMVA 2D06A 1G8PA 1G21E 4WVFA 2JJ2A 5DSZA 5FBLB 5JJKA 1GNPA 3TAUA 1GKIA 1E2IA 3CNLA 2XJ9A 4B71A 3H0KA 3RRNA 1QRAA 3AM1A 1UFQA 2XB2A 2HUPA 2QA5A 2UVQA 3VR3A 3EASA 5CK5A 1VG0B 4MYCA 4DLTA 2IXFA 2Q9AA 1SXJE 2CJWB 2FZ4A 5TDHA 2XEXA 4TMWA 4UXJA 2J0SA 2JJ2D 4PHTA 4GOJA 2ZRBA 3TH5A 1UKEA 3CRMA 2CNWA 2BKEA 2IYXA 2EFHB 4Q1CA 4P31A 1B23P 1N0UA 1YQTA 4TYPA 4URXR 1MR3F 2AX4A 2O8FA 4D4LA 3I3SR 2C77A 3GLFB 2HJGA 1KJZA 3DKVA 3LFUA 3FHTA 1UM8A 4GBMA 4M1MA 1ZU4A 5B30A 1VDZA 3FPAA 1HE8B 2Z4RA 2XNDA 5CM8B 4JSYA 4B35A 3CF2A 2OM2A 3CRRA 2FNAA 3U5ZB 2VTKA 2XXAA 1KDOA 3DMDA 2XSZA 2P5SA 1JBKA 2E9SA 1XTRA 4X8LA 4E22A 4Q9KA 1E2PA 2W6JA 1E4VA 4PQYA 4WZ6A 4MKIA 4HB4A 4LBZA 2FEMA 1Z6YA 2AXNA 3RWOA 2YKGA 1G20E 3SQWA 2JJ8A 1X3SA 4BE7B 2A9KA 4IW3B 1VCIA 2VSXA 2BM1A 3SDZA 3RRYA 1K5DA 4V0KA 2B7CA 2CHGA 2XSZD 3FFBA 4KFSA 3UK6A 1R8SA 4V0ME 1W46A 4TL6A 2W6JD 4KITB 5P21A 4Q9HA 4MGZR 4D4MA 5DGXA 3CONA 3EIHA 1DAEA 5KU1A 1KDPA 1N25A 4WOPA 2IUUA 2ZE7A 3RABA 2G88A 1NJGA 3EPHA 5KNBA 4PC1A 1WBDA 1G4UR 1N6NA 4AG5A 2QMEA 3AF0A 3D31A 3U4QB 4YMWA 4ZDIA 2P6UA 1MO6A 4RD2A 3KJHA 2X19A 2ZJZA 4QHSA 4NE2A 3PFIA 4TT3D 1C9KA 1HT1E 1FNMA 1QHNA 1Q1QA 1X1RA 3B60A 4M22A 4HUQA 4DLUA 2BV3A 4DCSA 5DISB 4EPVA 3K0CA 3UG7A 5AUOB 4DB4A 2A3RA 2ZYUX 1IN7A 1R7RA 2BM0A 2FFBA 4OK3A 3UANA 1OKKD 5DNYB 4EJSC 1BH2A 1P75A 1WDTA 1KO7A 2FEOA 5EP3A 1U2RA 1JXMA 1E2JA 2IYVA 2PMDA 3O8DA 2IS4A 3QOFA 3FMPB 2IBMA 4FWIB 3KKNA 2OCBA 4JLAA 2XOKA 3UMRA 1AA9A 1DPFA 5H68A 3GJ4A 3C14C 1Z08A 4TSFA 4XJXA 4U00A 5HE9A 4EFNA 2REXB 2J7PA 4TZ0A 3GP8A 3I4LA 2QPOA 3SYLA 3A4LA 3K70D 4L9WA 4KSCA 2ZAOA 1DAMA 1YU9A 1E0SA 4KVGA 2J87A 2G6BA 2OFOA 4QKQA 4PQRA 1YZUA 4K81B 1FX0A 4TSFD 1CU1A 2J9RA 3E2IA 1Y63A 4JZKA 2AR7A 2J7PD 5CYPA 1ZP6A 3CNOA 3FB4A 1X8KA 1ZUNB 2ZR0A 2ONJA 4QM7A 1XDBA 5DLQC 4HZIA 5L3QA 3K0EA 4GZLA 2Q6TA 3QKSA 1GP2A 2FDCA 2K5UA 4M8NE 3GLHA 4OI0A 2AHOA 3MWJA 4NCKA 3K0CC 3F5FA 2HF8A 4PR0A 3PITA 5FL7D 4AK9A 2MSEB 4JT4A 5JBQA 5LB4A 4ESHA 1AZSC 1Z28A 4RFVA 4KFUA 3E70C 1S9HA 3LQRA 3FWYA 3WHKA 5EQTA 3PUYA 4FN5A 3MAAC 2GJ9A 4HEJA 3DMNA 1RJ9B 1N0VC 4Q4AB 2QPAA 2BMFA 3NVAA 3VHXA 1OXVA 1MOZA 1RE0A 4R9UC 1W36C 3I61A 3TGPA 4OI4A 4NYJQ 4DSOA 3KUDA 4FMCF 1Q21A 5FR2A 1XF9A 1ZIPA 4D81A 1SGWA 4PQFA 1RC8A 3BH0A 2GJSA 5CB8A 3SEAA 4DCVA 3VX3A 2QRZA 2J3EA 1AM4D 2GF0A 1JR6A 1XEWY 4BFUA 1FZQA 3SC3A 1XEWX 4TMZA 1YE8A 1BYIA 3TMKA 4DLYA 1KY3A 5KDOA 1XPRA 1AZTA 5JWHA 3K70B 3HYRA 1OYWA 1E79A 2IYLD 1F2UA 2WAYA 2O8BA 1GL6A 3B9PA 2FZLA 3TQCA 2GEDA 2RAPA 1G5PA 1NLZA 2PJZA 4ZO4A 5C4GB 3TR0A 1V5WA 2XJ4A 1Z2CA 1XNJA 3A36A 3UXMA 4ABYA 4B3XA 5DN6D 4Q7LA 3TW8B 5HR5A 2G1JA 1MKYA 4OQXA 1U81A 4GPTA 1WB9A 1W0JA 1FUKA 4DLRA 4EFLA 4LJ7A 1ANKA 3GLGB 2A5DA 1ZW6A 2WIBA 1XD2A 4B47A 5TB5A 4O25A 5IK2A 4Q18A 3UMFA 4BLRA 2OE2A 3REGA 1QG4A 4AYWA 5J4KA 1KI4A 3TVDA 4MITA 3RS4A 2WJYA 1CXZA 1GNQA 5IK2D 2RB4A 4HI0E 3P4XA 3QUSA 1E69A 4PHGA 4A0RA 3I5XA 4EQ6A 1FMJA 3ZGXA 2W00A 3WY9A 1Q0UA 3GMTA 3LO5A 3HPQA 3HU1A 4BPBA 5EE3A 4F93B 1FL9A 1R5NA 3AP1A 3CIOA 4EUNA 1ZNWA 1D5CA 1E2GA 3BB1A 5AK0A 4TQAA 2GXQA 3FKQA 2ZM5A 4ZIRA 5IDVA 2CK3A 2EWVA 4IDNA 4JLMA 5IT5A 3NDPA 3GLIB 2CL7X 3SFZA 1DAKA 5JJLA 4S2EA 1KGDA 4C0KA 1IN5A 3Q85A 4FMDF 4F38A 121PA 1AGPA 1QVAA 1KKMA 1U0LA 3MUFA 4DDUA 3BWDD 4G3XA 4ZV4A 2WJJA 4U5XA 2J45A 5AJZA 4I1UA 1GL7A 1ESMA 2VHJA 3TUJC 2IS2A 1KTVA 1G17A 1TEVA 1XBTA 2WMOB 2G9NA 1F2UB 3KKQA 3FHCB 2O8BB 5KYKA 1CJMA 2VSOA 2IX3A 2IHBA 2VHCA 1Z3IX 4M1OA 3AVQA 3C7KA 5AR1A 4BFTA 3W6NA 2BMJA 4PHFA 1RW4A 1L7VC 2ZI6A 4W9MC 2HYDA 2WWHA 4LHXA 5HE8A 1KK3A 5FBQB 4JKIA 2N46A 1W2HA 1Q20A 2SHKA 3KFVA 1S1MA 4LCBA 1JAIA 3SYNA 2J1LA 4QBGB 3EZ2A 1NLFA 4I81A 4BQSA 5TMPA 2ZI7A 3V4FA 4K46A 2Q3MA 1KSFX 1S96A 2QG6A 4WXPA 1IOZA 3ADKA 2JJ1D 1NL3A 2FSIA 3MJRA 4YC7A 6Q21A 3L8ZA 3KJIA 2VPPA 3MLEA 1ONBA 2OILA 4S35A 4B33A 3EA0A 4A9AA 1CRPA 2ZS7A 5FUVA 2WJIA 4P4SB 4YDSA 2ZTSA 1GITA 5F9FA 3B2EA 1OSNA 2C78A 5JMTA 1UKVY 2OEPA 3QG5A 1EG7A 2QTHA 4QC2A 4RD1A 1W48A 4BRWA 2ZS9A 2J0UB 2BJWA 4TLEA 1HQYE 4DCTA 2OBLA 3E1SA 5DI3B 4BLPA 1KI3A 3QXJA 1U0HC 2CLSA 4LV5B 1XMSA 4GMXA 1OXXK 3LW8A 2IWHA 4IVQA 3I8SA 4TQ9A 4DCNA 3U44A 2H16A 5GVSA 1FFHA 5J4VA 3NC0C 1ODFA 3T34A 4MDEA 2GTPA 2QGZA 1HEIA 3CPHA 1QHYA 2D3WA 2EYQA 3LRPA 3MFYA 3ZVRA 4ZIRB 4QGFA 3GEIA 4M2LA 5EUQB 3KTAA 1MT0A 1Z0FA 3C16C 2RCNA 3K0AA 1H65A 3IO3A 2OCPA 3VMFA 1NBMA 4XH9B 2BHRA 1S4QA 2BEKA 2R6FA 2A30A 1SVKA 2J7KA 2H18A 3TE6A 3NBZC 1IN8A 1JNYA 2LWIA 3WYFA 4BFYA 5FTJA 2ZI4A 1KK0A 4CIDA 4YDHB 4BZXA 2A7QA 2YWEA 3GEEA 1JXOA 1NBMD 4LJAA 4OBEA 2QEQA 4NYMR 1Z63A 4V0LA 2HXYA 1KI9A 1N5JA 3LA6A 1U8ZA 2D7CA 2KJQA 3KXKA 4MGIR 1F6BA 2O8CA 2WMNB 1T6NA 2C9CA 3AEZA 1R0ZA 2QM8A 4WBSA 3H84A 2JATA 3HU3A 3FE2A 1TU3A 1Z0AA 1WBBA 1W49A 1X8LA 1HE1C 1UEJA 1EGAA 3I72A 4MYUA 3IHWA 1CJUC 1XMJA 2NIPA 4WA7A 2ZIAA 3MWLA 2BVNA 2FF7A 4GRAA 3RS3A 2ZR7A 3T35A 2AKAB 1UDWA 4M0LA 1OW3B 1R10A 3ZJYA 1EESA 3H2YA 1P9NA 2GK7A 1OF1A 1DBSA 1DVRA 2R6GA 3RANA 1GAJA 3O8CA 3VQTA 1UBEA 4MGYR 2CCJA 1ZC4A 2ZI3A 4RZXA 2QBYA 3WBKA 1LS6A 3KUCA 4TMKA 5EP1A 4EAQA 2IXEA 4PFSA 4Q00A 4FCVA 1P62B 5B2ZA 2WKRA 3KZ1E 3A6PC 3S1AB 4A6XA 4PPFA 1X6VA 3B6EA 5FFMA 3U6KA 3SU8A 1VKJA 2C5LA 1M6NA 3CM0A 4M1SA 4QGHA 4XWKA 2MSCB 2AWOA 4PAQA 5CB6A 2GWHA 2ZYTX 2X77A 2GILA 2OG2A 3PEVA 3U7HB 3W90A 2NPFA 2Z0MA 4TN1A 3SJCA 1OFHA 1G16A 2P5TB 2QAGA 3NHBA 1T8TA 1OFUX 2VP2A 3AP3A 5HPYB 1QG2A 1KI7A 2IYWA 1XCPA 1NN3A 5JCPA 1NI3A 1P5ZB 5JI3E 1JAHA 1XD8A 4LRWA 1OFTA 4C2TA 5EUMA 1DS6A 1DTSA 2FSGA 2CL0X 4Q1DA 1EFRA 3LVQE 4QM6A 4DIEA 3LX8A 2VF8A 8OHMA 2ZI9A 1KK2A 5KOYA 4IDQA 4IFBA 1IY1A 4KXFB 4LDJA 2GESA 2OFWA 1E9DA 2EFCB 2R65A 4MRVA 3BH6A 2FFAA 2TMKA 3B78A 3FKSD 1EFRD 1TTTA 3K8YA 2BJVA 1QHHB 4GMDA 4LYJA 5ANRB 3IEVA 4R7ZA 1D2EA 1UAAA 3T1QA 1Z2AA 2PX0A 4FD2A 4DBLC 4DDWA 2W0SA 2OCYC 4DLVA 4PSKA 5EE9A 3QVUA 1I4DD 1NIJA 2NO1A 3IILA 3P1JA 3I5YA 4P4TA 1SVWA 3LV8A 3CNNA 1GDDA 3OESA 2GEVA 5JI2E 1P2UA 3AVUA 4ASUA 3T5DA 2KWIA 2GNOA 2V6JA 3C4JA 4ON9A 521PA 4U02A 2QAGC 2DY1A 3U3KA 4PXAA 1ZM3A 4I99A 3LX5A 1KYIA 4URUR 2BCGY 2RHDA 1UJ2A 4DJTA 4URZR 2PMKA 4M1KA 1CP2A 4MRNA 2RGBA 4ASUD 1MABB 3G0HA 4Q19A 5TARA 4RJLA 3BAFA 4H1VA 3RS2A 1W0KA 1KI6B 4FCWA 2VIIA 2AKYA 1XZQA 4Q02A 1NSTA 3KDSE 4X8HA 4ESVA 2VP5A 1AKYA 1A2BA 3L43A 4RFSB 1K8RA 1QDEA 3Q72A 4Z8XA 1II8B 3DL0A 2A5JA 2RMKA 2V4ZA 3OIYA 3O8RA 3DZ8A 4ERNA 1JALA 1ZIOA 1ZINA 1SVOA 4G5RA 3ETLA 3CUEF 3W34A 5FOWA 1LNZA 1TPZA 2YC2C 1IJEA 2ZSBA 1HTWA 2V54A 4NCNA 4LYFA 4XSGA 4NKRA 4BLOA 4C0SA 3DO6A 2UZ3A 4OQNA 1Q57A 5A5GA 3HR8A 3R9XA 5JRZA 4BASA 1E9FA 4LBWA 3VU9A 2BOVA 3PUWA 4E5UA 1W47A 3BS4A 1GKYA 3SJBA 3BORA 3NEJA 4KLZA 3T06B 1QHGA 1D9XA 2ZRNA 2G0TA 3RSLA 2GETA 3SNHA 2YNMA 4OHYA 2D4HA 1HV8A 3OHMA 3OE7A 1K6MA 3U7EB 1CLUA 3BE4A 4WW0A 2GXAA 3HDTA 5GJWC 2H1LA 4TMXA 4I1VA 2R6DA 4QGGA 3RAPR 2IS1A 3TRFA 1BYUA 1B0UA 1YR8A 4W5HA 2OFXA 2ORIA 2WWIA 2WPDA 4JLDA 2C96A 1XEXA 1ZM7A 2ZRPA 1VYVA 2PH1A 2J5XA 2ZJ8A 1NN0A 2AFIE 4K8OA 4POAA 1U0JA 4QBHA 1IJFA 1SVSA 3H86A 1SVLA 1ZM4A 4D4KA 2ZE8A 4IDOA 2HLDA 3EG5A 1GKUB 3GLFE 2FPMA 4XD7A 2AN9A 3C5HA 3HP1A 1KDRA 3THXB 2H57A 2IYYA 3CPEA 4D2IA 4C2UA 3THWB 4C7OA 1K5GA 1KI8A 3HYTA 1G41A 1KI1A 2ODNA 2P2LA 2JLRA 2PLRA 2WKQA 3UPUA 1E94E 3DM5A 4JLNA 1E2DA 5G40A 2YINC 2GK6A 1G9XA 1MO4A 4MGKR 2HLDD 2ZSEA 2ZS8A 4XD7D 4AG6A 1P61B 1Z0JA 3I1FA 5DO9A 4NCHA 1Z47A 2ODBA 3QXXA 4Q9LA 4V02A 3RLFA 4CEJB 1GRNA 5HZHA 4LUCA 2WWGA 4JKYA 1P72A 2P6NA 3TQFA 3BOSA 5L3SA 1LTQA 1S3GA 2DWQA 2JEOA 1HUQA 1OJLA 1YR6A 3EWSA 4QHYA 1SXJA 4PO9A 1HT2E 4JIMA 1KMHA 2NQ2C 2YZ2A 3QF4A 4AKHA 3NDBB 4LHYA 1UKZA 4MDFA 1ZD1A 3BERA 5JWRA 1N6OA 3L8YA 5TXGA 2VA8A 3X1WA 1BS1A 3KL4A 3NBFA 2P3SA 4CYMA 1N6HA 4PPQA 1WRBA 4XWAA 1MH1A 1SXJD 2I3BA 2WOOA 1LF5A 2F43A 4MKGA 5D3MA 3WMFA 4IXNA 1XX6A 2D2EA 2WWFA 3P4YA 3BJIC 2UZIR 3SI7A 3T1OA 2PJRA 4Q21A 3AGQA 3IPXA 4CVNA 1IBRA 2D7DA 4I1OA 4BECA 2JA1A 2GVZC 1JI0A 2XZLA 1IHUA 1EFUA 4MRPA 2OUKA 4LJ5A 3CWQA 3WMGA 2KE5A 3WRXC 1S9DA 3X1ZA 2CNWD 3IBYA 2XITA 5FUXA 4AIIA 4KYIB 3TR5A 1E2MA 2IYUA 3BH7A 3PXGA 1Q22A 1G8YA 4IOKA 4LSGA 3EW9A 2PBRA 3TKLA 4D80A 3EC2A 3QKRB 4EJSA 4PO8A 4CEIB 3CKLA 2J46A 3W6OA 2XNDD 1F2TA 4CF7A 2EW1A 3B7GA 3IBGA 2XZOA 3X1XA 4D25A 2C99A 3W6PA 3LBNA 4V0MA 1CJKC 2ZJ5A 3SBDA 4A6PA 1GTVA 4Q4JA 1NRJB 3QENA 1SXJC 3GJ3A 4NBSA 2OBNA 3EPLA 4MUAA 4HAXA 2Q9BA 2R8RA 1OH7A 2IHYA 2YWFA 4PSVA 3OIVA 4C7OB 1RYHA 3QEOA 4TLBA 1GM5A 1TX4B 1U8AA 3GJ6A 3U61B 4ARZA 1FPMA 3P20A 4P32A 3K53A 2IXGA 4Q1FA 3ZS8A 2O0KA 3LXXA 1EXMA 2QMHA 2IT1A 1II0A 4OI1A 4DEXA 3DEFA 4BEJA 1D2MA 3HR7A 5CLLA 4OL0A 1W4AA 3REFA 2CDNA 2JDIA 4HSEA 3K1JA 1NMZA 2QE7A 1OT3A 5L3SB 1E2QA 4R98A 3D8BA 1YRAA 1H8HA 1P7CA 1ETUA 1OIWA 1VCOA 1ZD9A 2WSSA 4HUTA 1P73A 4ZI2A 3ADCA 1N6KA 1NJFA 3RNLA 2XTZA 3LNCA 2ZRCA 2A5GA 2C2HA 2EFGA 1KNXA 4R71A 4PZZA 1EX6A 2JDID 4HZUA 4BFWA 2H8KA 2QE7D 3IEUA 3IO5A 5SZIA 2ZSFA 5CJ2A 3M0EA 5CITA 2WSSD 1D9ZA 1KHTA 2F43B 1PZNA 3CF6R 3L82B 1JJVA 2O8FB 4ZCLA 2AD1A 4XOIA 5JECA 1ZJ6A 2AL7A 1WMSA 5G3YA 3AF2A 2ZUDA 2ZXUA 1I4TD 4HAWA 5KO2A 1L4UA 1VG8A 2Q9CA 3G82C 4NU0A 4M53A 5AWFC 3AUYA 4NYMQ 4JBYA 2XXAB 1KSJA 3KXIA 2XOKD 4XWOA 3X1YA 1FUUA 5AJVB 2HCJB 4EJSB 1QHIA 3CW2A 2HV8A 2FPKA 1W36D 4OQLA 4B43A 1WP9A 2Z43A 1U94A 4A4DA 1GRQA 1ZU5A 3KFXA 4FCTA 4TL7A 1O87A 1ZNXA 1X86B 3M1IA 2G1KA 1KIMA 3K09A 3IIJA 5KPDA 3CX7A 1G3IA 2ZRHA 4JLJA 3L0PA 4ZDWA 3VKHA 1HURA 4BFVA 3CRQA 4A0HA 1WF3A 4UXHA 2WVJA 2QMUA 1EFCA 2OXRA 1N6LA 2IYTA 1LS1A 3A1WA 5DHAA 3GLGE 3PEUA 2V9PA 3MG9A 3ZIAA 3NC1C 3DOEA 2FPLA 5JZVA 1DAGA 3R8FA 3QJYA 4FWTA 1N0WA 2IYRA 1XXHA 2XZPA 1G7CA 4A2PA 1TADA 3QI2A 4BLSA 4Z51A 1G7TA 1S2MA 1E1RA 2JLYA 3NBXX 1CRQA 1J90A 1E96A 1OV4A 4HUQB 1OH8A 1ZD8A 2IUSA 2NZJA 2HT6A 2WAXA 5EXPA 5J4LA 3AGPA 2Q3HA 1MRNA 2KBEA 4G5SA 4HB3A 1PUIA 3W3ZB 4EPTA 4YMVA 1KO1A 2LKDA 1RVDA 5JCZA 5F9HA 3EPKA 1J70A 4HZUB 5DYIA 1RRCA 4JBWA 4TYWA 2J41A 1ZM9A 5BN4A 3U7FB 1D6JA 3SZRA 5FBWB 3CF0A 5BWMA 2ZJOA 5IRCD 1Q1EA 3QQ5A 4N0EA 4WIAA 1NIPA 2B8WA 3K09C 3TSZA 3PEWA 1E2FA 5KSZA 4RZ3A 3OAAA 3GFPA 1W36B 1VECA 3MD0A 4HAUA 4URYR 5M04A 1NY6A 1PLJA 1YJ5A 2BCJQ 2X2FA 3GLIE 1P4SA 1TF7A 4LJYA 4I4LA 1E79D 4IKEA 4RVCA 2DPXA 4QRHA 2GZHA 3CX8A 2YHSA 4B76A 1ZUHA 1FX0B 3OAAD 1LFDB 2I4IA 4BFSA 3ICQB 1Q1ZA 1AS3A 1AKEA 4MQBA 4LZZA 3SHFA 2OO7A 2GKSA 2G0NA 2V6IA 4Q4HA 3ZZ0A 5L3QB 3VKGA 4HYYA 4YONB 1W0JD 1JPJA 3QKSB 5BN5A 3DHWC 3U6BA 5KSOA 3GLHB 3MGCA 4JBXA 3L0IB 1E2LA 4LX0A 4TLAA 1T9HA 2ZJAA 1FMLA 1WQ1R 4HDCA 4BWYA 4PTLA 4F4IA 3VR1A 2YJTD 1KSHA 2P67A 1VG1A 1GVNB 5G41A 4CDGA 4CT4B 4UNPA 1KO8A 4M1YA 1OIVA 3I8XA 4A82A 2OCAA 2G3YA 4DC9A 1GILA 1XXHB 4Q7MB 4LHVA 4KBFA 3HWSA 4R2IA 4DSNA 5FI1B 4B73A 1OH6A 1G3MA 1EX7A 4KJZA 2JIZA 1VHLA 4OYHA 4GL2A 2XTNA 3DPUA 1LY1A 1RRPA 3AVXA 1NY5A 4OKSA 3VX4A 4EFMA 1ZYUA 4PHHA 1T91A 1NG1A 3TIFA 5L8VA 1KO5A 2ZRMA 4M9ZA 821PA 2W2VA 1XP8A 3FDIA 4XSHA 1OHHA 1XRJA 2JAQA 5AUNB 2DB3A 1N5LA 1S1CA 2CK3D 3CR8A 1N2CE 4IJMA 4JLOA 1Z22A 2NG1A 5FTMA 2YOHA 2RGNA 1S3SA 1CKEA 2C03A 4WXRA 3NKVA 2WV9A 3Q7QA 2R9VA 2FJUA 4KV9A 2NTYC 2ONKA 3W8NA 2QTVB 4YMUA 3U2QA 5HCIA 3U3JA 2DCUA 4F7WA 3P32A 2ZETA 3Q3JB 4TTQA 3V9PA 1LV7A 4FI3C 2Z5FA 3ICEA 4G01B 1EK0A 4RCZA 1XD2B 3OIUA 2RGCA 3U3MA 1TQ2A 2Z83A 3ZS9A 4N1AA 3KQHA 1P9WA 2W2TA 4LI0A 2EFDB 1D8TA 4NCIA 4TTRA 4Q4HB 3L0OA 1G5RA 1ZUIA 5BXQC 1YZLA 2EU8A 4C0AC 1T0JB 1G8FA 3U3RA 4B3FX 3OZXA 2QP9X 4D0LB 4ZKDA 4R2HA 1TU4A 3NH6A 1SQ5A 2JGNA 2BMEA 3QXHA 5E95A 4WAUA 2ZE5A 4UJ3A 2GCPA 3J81k 1KZ7B 4EQ6B 5A4JA 1G1MA 2Z4SA 2FV8A 3WMEA 4HDQB 4DHEA 3FFAA 4HAZA 5JSZA 3OEEA 1SHZA 2RGNC 1G3RA 1DG3A 2IUTA 5G3ZA 1E99A 2CVHA 4A0FA 4JS0A 3A58B 2JLVA 4BZQA 4QXAA 1G64A 1E6CA 5LPNA 2VH5R 4UXIA 3LQQA 3BRWD 3TW4A 2QENA 2N1BA 1O3YA 1MV5A 4RZ2A 3P26A 1TAGA 1UKYA 3CZQA 4XVRA 3WNDA 1A1VA 3AF3A 4NPHA 2QORA 3OEED 3RSOA 1GNRA 1CS4C 3DM9B 1OE0A 1VCNA 2E87A 3K9HA 4P4UA 2PT7A 1LW7A 3NTUA 3ZD7A 5J4HA 3WP1B 2MSDB 5E3HA 3K0FA 1AQUA 1N5IA 2QROA 3AVVA 2PT5A 1RRGA 4QBFA 3LAWA 3WYAA 4DZZA 4PANA 1ZBDA 1F60A 1R0WA 3LH5A 5UKDA 3B1WA 2X1VA 4NMMA 3BIFA 4FXPA 3TLXA 4B48A 5E7MA 2QU8A 2ZRKA 1R0YA 2DWPA 4UJ5A 3UKDA 1H8EA 3RRZA 5LBIA 2QM7A 1IQPA 5J47A 1SHKA 3MWKA 4YMTA 1E9EA 4AY2A 2GCOA 4HATA 4V0NA 4L5BA 2XX3A 1Z0DA 2BBOA 1PLLA 1Z07A 2A5YB 1KJWA 2ECKA 2XAUA 4CEHA 1LVGA 2FSHA 4C0HA 4A15A 4GP7A 1H8ED 1S8FA 3GFOA 2CEAA 1OYYA 5IF9A 5E7JA 4B6EA 4Q1EA 1DELA 3QBTA 5J40A 3V4RA 5KTYA 4YMSA 3V00A 3NEYA 4F4CA 3TK1A 4TZ6A 1TNDA 2H5EA 4DDVA 3TNFA 5CDFE 2GHIA 4KVAA 3B8HA 4QOSA 4BRUA 1SKYB 2JASA 4GSYA 3JZMA 2WJHA 3QXSA 2O8DA 2GAOA 2OV2A 1Z06A 4DRZA 4M21A 4LK2A 1OB5A 2IEYA 2QP3A 2ZSDA 4M1WA 2W2XA 4B2IA 3U44B 2VHQA 2NZ8A 3OF5A 1W4BA 4QJ5A 2XGJA 4LY6A 2F3TA 2PEYA 1VHTA 1UADA 2QI9C 1VPLA 5H1YA 3FHOA 4P3YA 4DLWA 1NLYA 4KI0A 3THYA 421PA 2PZFA 1P6XA 1KDTA 3QE0A 1YRBA 3R7WA 1BMFA 3KTAB 5KDLA 3B1YA 3FMFA 3K0AB 4IHQA 1L8QA 2D74A 4URVR 5FTLA 3B1XA 2ZSAA 3PUXA 4JYBA 3PUZA 3B5JA 4Q4LA 1W5TA 1CIPA 4TLDA 3CZPA 1IAQA 3VNUA 5IHPA 4F4JA 1A82A 1BMFD 1MO3A 1ZNYA 5G53C 1G7RA 5KHOC 4B3BA 2GJ8A 1DAIA 1NP6A 4HAVA 1ESNA 5TV2A 4Q1BA 2ERXA 1M34E 1HYQA 1AS0A 4DT1A 5K8TA 3WYGA 1PV4A 3SYKA 4JLVA 3ZQJA 3L0SA 2O8EA 2O8CB 1D2NA 2BMDA 2LKCA 2P0EA 2OZEA 3NXSA 1VCMA 3KXLA 4RCYA 4DLXA 2FGKA 4LV6A 3OFNA 3QBVA 1KAGA 2GA8A 4JVMA 4IOLA 3GPLA 4D0GA 3VNVA 2HYIC 3PCRB 2NO9A 1OPXA 4WZBE 4QL3A 2RGEA 4BGDA 2RH5A 2C9YA 3T1VA 1IXRC 1G6HA 3EIQA 4A2WA 4OQMA 4DKXA 1E0AA 1J7KA 3CO5A 3MCAA 3W8RA 2DFLA 1CR2A 2WOJA 4D4JA 1DO0A 2H17A 1P9RA 1NVUQ 1T3SA 3QIAA 4LJ8A 4MKHA 5F2EA 1FP6A 2L0XA 3AVWA 1IM2A 2MMCA 5HCNA 4D6PA 3MWYW 4PPNA 2VO1A 5DE3A 2ZRLA 5BW8A 1IXSB 1QHXA 2QBYB 4B34A 3EPJA 4ZDKA 5FPHA 1IONA 3A1UA 4P33A 1CF4A 1SULA 2FE4A 3W5JA 3AP2A 5LDDC 2GF9A 2HJVA 4YQFA 4US2R 4A8JA 4Q01A 2GBLA 4OK5A 2QRNA 1US8A 4GZMA 1G7SA 3LWNA 2C95A 4KFRA 3ZYCA 1KOFA 3TAHA 1XEFA 5KDDA 2F6RA 1JEDA 2I1QA 5B64A 1XJ0A 2QAGB 4PC6A 2CCGA 1G4AE 2BC9A 1W0KD 2X8AA 3IHLA 1RIFA 4LPSA 3LBIA 2R6CA 4PZLA 1GIAA 1YR9A 1GG2A 1YZNA 5J5CA 1CEEA 1L4YA 4NHOA 1I2MA 3VAAA 1HY3A 2IYQA 1G6OA 3A1VA 2GXUA 2P6RA 5KSYA 4PC2A 3KX2A 2F55A 1NKTA 2QMOA 3CR7A 1YZGA 4X8OA 1U98A 1Z6TA 2IYZA 4XVUA 2VSFA 2GJKA 1VG9B 1E0JA 1GWNA 2OAQ1 4XTCS 4IEEA 5CM9C 2MMGA 5FOVA 5FOXA 3WXMA 3RRMA 2CCKA 2CJWA 1JQJC 2ZYWX 4AKIA 2B8TA 2DHRA 3IQXA 1W2GA 1ELOA 2ZRFA 2AXPA 1JR3E 2WSMA 4GFDA 4PX9A 1AK2A 5HZKA 3BBPA 4BEBA 2DFNA 1GFIA 1R5BA 2Y8EA 4V0OA 1VMAA 3PG5A 4OI2A 4ILEA 2ODEA 3OE7D 2WWXA 1SZPA 1ZCAA 3GLFA 4GP6A 3B13B 4FMBB 3SOPA 2IS6A 1A2KC 2VQSA 2YYZA 4A8JC 2GBLC 1PUJA 2B92A 3KJGA 2X2EA 1RZ3A 1Q3HA 1AN0A 5AUPB 4XVQA 3FVQA 1UDXA 1TF5A 1U99A 1E2NA 3GFTA 4IFEA 2OLJA 1HA3A 5HTKA 3OEHA 1Q44A 1V43A 3KKMA 2FX3A 3EZ6A 3LXRA 2WPDD 4A0GA 1FQKA 2GZAA 2R44A 2AK3A 4GT1A 5LD2C 5SZJA 2D2FA 2YV5A 3TSWA 2QGNA 3FMOB 3KB1A 3TUIC 3ZVNA 2CLCX 2V8OA 1ZMXA 1DE0A 3UWKA 1J8MF 1XFAA 4MA4A 2A2ZA 5TVKA 2OBMA 2OLKA 2IEZA 3OEHD 4EPRA 4TYQA 5KNDA 3A8TA 3LVRE 3QPUA 2ZRJA 4PC7A 3RS7A 2ZYVX 3T5GA 4C0LA 3CLVA 5JHGB 4C9BA 1AGRA 2QY9A 4C4PA 5EZ5A 4G1UC 4M4SA 5C2JB 1YZQA 4ZI3A 2QPTA 4OJQA 5GJBA 1HH4A 1E1QA 1R5OA 4ZCMA 1P2SA 3EZ9A 2REBA 3PUVA 1BIFA 3AKYA 3AUXA 1SKQA 2JLXA 2AD5A 1ZRHA 4M9SA 1FW6A 4JJKA 3EZ7A 5K8LA 4W5JA 2F9LA 1X8JA 3ZZUA 2ZRAA 3ZH9B 1XTKA 2QP4A 3VU9B 3PJRA 1E1QD 1LF0A 4FIDA 2F3RA 2VHTA 3C41J 1NMXA 1E9SA 4Z8YA 2V1UA 2WM9B 4JSTA 4RD3A 1W1WA 2WKPA 1Y3AA 4KHZA 2W58A 4GDFA 3IIKA 2ZEJA 4E07A 2CMKA 3R9IA 2HXSA 4UNRA 1IN4A 3DDCA 3LW7A 4QNMA 1M7GA 1YKSA 1XTSA 4BLTA 1AQYA 1CJVC 1Z83A 3RS0A 3FYHA 3QVVA 3VR6A 1XEXB 2HT1A 4LPKA 4EKDA 1KY2A 2NO7A 4US0R 2IK8A 2ZJBA 5JS8A 1UPTA 4AYXA 4Y0AA 1CBUA 4L9SA 2H92A 5C18A 3E5HA 3A37A 1T5LA 4OHWA 3JZAA 1XU4A 2WZQA 2ZI5A 3DKPA 5CJPA 1EFHA 1JJ7A 3CPJB 4FINA 4IEIA 2JLUA 2C8VA 1YVDA 4B2PA 3C8UA 3EAQA 3KKOA 2F1IA 1WXQA 3ONWA 2IF2A 3ASZA 4N0DA 1XPUA 1KSGA 4NYIQ 2CL6X 1GRRA 2ANCA 1J8YF 2WWWA 2ZRIA 1U8YA 3SHWA 2ATVA 3MSXA 4KFTA 1J2JA 1Z29A 4US1R 2BBTA 2NO6A 3P27A 1SXJB 4C30A 4L16A 2DYKA 4LJ4A 4ACAA 3ZVMA 4TYNA 1KMHB 4H9GA 3QF4B 1XB2A 2CHVA 4TT3A 3N2EA 5F98A 3A1TA 1KKLA 1F5NA 2E1RA 4NONA 5CIWA 4WZAE 1E32A 2C9OA 4GNKA 1RJ9A 2RGAA 4DSUA 2DFTA 4Q4AA 1JPNA 3CRW1 1H8HD 3IPYA 3WRYC 1OKKA 5D3MB 2PCLA 2WBLC 1C4OA 4IOJA 3U3OA 4D26A 4Q7KA 4DCUA 3EXAA 4G5QA 1YR7A 1GL9B 5DI9A 3B9QA 2IC5A 3ND9A 4B3GA 3ADBA 2QZ4A 5EP4A 2YOGA 2ZVQX 2QN6A 4KU4A 621PA 4II7A 1SVIA 4DB2A 4B3CA 4RSGA 1T3LA 2UKDA 2ANBA 1AJEA 1GZSA 1CR1A 3LLMA 1KJYA 4C0BA 5AJXA 3F0TA 4DLSA 4BZPA 3VTKA 3RDPA 1F2TB 3IKJA 2CE7A 4HB0A 2FH5B 3OIWA 3RS5A 2EYUA 3TVTA 4NP6A 3U7GA 1E3MA 2EQBA 5GJCA 4LC0A 4Q4JB 3BFKA 1UBFA 1GSIA 2ATXA 3HJNA 3U60B 3FOZA 4DLZA 4DXAA 4CW7A 2FSFA 3T1TA 3H1TA 3GLGA 4ARZB 2C04A 4JL6A 5FPTA 1Q1BA 4LGMA 5FBRB 4JJZA 5FL7A 4LOAA 1NG9A 5ELXA 2KB0A 2REOA 4HLUA 2BKUA 1YZKA 4ZKEA 3I73A 3RHFA 4UNSA 3MRSA 5KSPA 2QT1A 2VP0A 4TWZA 2NPIA 1EFTA 3QPVA 2AWNA 3PENA 4MRSA 4RKEA 2BDTA 4B44A 2VRWA 2XB4A 3W9YA 5BYKA 4DSTA 2LCFA 3RC8A 4HLQB 3ZIAD 3TUZC 3GLHE 4NH0A 1VTKA 2BBSA 2OHFA 1OXTA 1COWA 4OJKA 2F1RA 3VFDA 4AURA 2H7VA 5TY0A 3SJAA 3K70C 3AKDA 1JEEA 1XZPA 5CYOA 3IGFA 4ACBA 5BN3A 3KQKA 1M74A 1E1RD 4KO8A 1ZAKA 1JECA 5BQ5A 3R9WA 3NH9A 1Z0KA 4O0MA 3MMPA 3Q8XB 2G77B 3ASYA 1BKDR 1COWD 1DEKA 5EE5B 3D7MA 4AKEA 2PX3A 1XXHE 4I1SA 2ZRDA 3BB3A 1FP7A 3GLIA 4LBYA 2GCNA 2I1VB 3CX6A 3SBEA 4EDHA 3F8TA 2CHQA 1N6RA 4IDHA 4C0JA 1NVWQ 2DWOA 2ZROA 1U90A 3RWMB 4B75A 5FTNA 2AK2A 2ZPTX 2PCJA 1TQDA 1G5TA 2ORVA 4TTPA 3LY5A 4HLUC 2IA5A 1C1YA 4Z1MA 1NVVR 5DN6A 3BFVA 4MYTA 1E0KA 4M1TA 2J0QA 1P2TA 5GJVC 1P2VA 3GQBA 1CR0A 5JEEA 1L2TA 2R2AA 5FR1A 3EWAA 3PVSA 2GJAA 1OB2A 4E09A 2GEUA 4JT2A 1M1YE 3ND8A 1NKSA 2FGJA 4ITRC 2W0MA 4Z1MD 2JLWA 3UWOA 4Q9IA 1KAOA 2ZVPX 1W4CA 4FMCB 4DEYA 5B58C 3DOFA 4RD6A 4TYYA 3KB2A 2GZDA 1FQJA 5FUYA 1FNNA 2J0VA 3AVPA 2FA9A 4NCJA 5K8UA 1WCV1 2XTMA 3EIEA 1DO2A 4QHTA 5C4MA 2QUZA 3Q7PA 2ZJ2A 5FPYA 2CLDX 4D0NA 1CTQA 4P0TA 4G0NA 3B85A 4LJ6A 1N6PA 4GI7A 2BBWA 1T3HA 2FG5A 5CLQA 5A0FA 3RC3A 1A7JA 4QBIA 2GXSA 3SQXA 3DZDA 5JEDA 3SFVA 1MO5A 1YZTA 1E9AA 1Q3TA 4M9QA 1XTQA 4P4SA 5D3QA 5EXTA 4DVGA 1W7AA 3KJEA 2NGRA 3GJXC 3BK7A 4HLCA 4LBVA 1Z8FA 5E7IA 3I92A 2J0UA 1QVRA 2GVDC 4MKFA 5DI3A 3X2SA 2EWWA 2WHXA 3N5CA 4RY2A 1Z6AA 1XPOA 1T8UA 4D82A 2DBYA 4A36A 3HU2A 3W3AA 2PL3A 3D6TB 221PA 4IRUB 5JRJA 2QSZA 1W44A 4JLKA 2JIZD 3ECCA 4C3ZA 3AVTA 4C0QC 3DVLA 4AWXA 1VYTA 2OT3B 3AB3A 4RD0A 4DIDA 3W5IA 3B1VA 4Q66C 3NWJA 3NHAA 1RRFA 4MRRA 2EFEB 2OESA 4JL8A 3ZZTA 5F3WB 4XIGS 2IW3A 5CIQA 1OHHD 4YLGA 3JVVA 5H8WA 4KSBA 5EXSA 1II9A 3QG1A 1T5IA 2NOAA 1JB1A 1XTJA 2F9MA 5SZHB 3T15A 3K9NA 2QNRA 4F91B 4NTZA 3T12A 4HAYA 1XCGB 3BD9A 3Q5DA 4F92B 4CGZA 4LWZA 4LYHA 4G5OA 1MRSA 4HB2A 4QJ4A 4BUJA 4ZCIA 4PO1A 3BFXA 4DUGA 2QSYA 1ZC3A 2ZU6A 3AKCA 4Q03A 1UBCA 4Q47A 4JL5A 4RKFA 4UNNA 4Y0VA 5KNCA 2ZR9A 5CK4A 2ZAMA 1PLKA 3B82A 3EZFA 4MH0R 3SE0A 3EARA 2OXCA 3RVBA 3AVYA 5L3RA 4CZ2A 2O0JA 2G83A 1QZXA 4N3NA 2JJ1A 3PR1A 4HDOB 5DHFA 4BFZA 2ODWA 3FMIA 1EWRA 1KZGB 2FFQA 4DUGD 1TUIA 2R6AA
chains in the Genus database with same CATH superfamily
1YVEI 2YFYA 1GUBA 4EJ6A 3K35A 3T4UA 1YAHA 1KE1A 1VRVA 3G6KA 5EY5B 1XALA 2Y4UA 1H3EA 4XTRA 4XQGA 1MZVA 4J90A 3D3EA 4RQTA 2DYSC 4S0ZA 1XJQA 4X3OA 3MLAA 4A92A 3WGLA 3DXXA 1TTQB 3L07A 5A0VA 1V3QE 3GRRA 1IDOA 4EDFA 3AKEA 4EEKA 3GD5A 3L4EA 3RUAA 1S0UA 5E6UA 1SHLA 1JR9A 1NRIA 1A95A 3PJSK 2V3CC 5DNUA 2J8ZA 2VK2A 4Q9JA 2ZVJA 3PXAA 4R1LA 5IKOA 1F0YA 4KXWA 3DEJA 3MFQA 1HOTA 1X13A 3TPCA 3TR6A 2FMXA 2AE2A 3A70A 2CWDA 1TT7A 1Z5ZA 1PZHA 4X3CA 3IV9A 4ZT5A 4RIHA 1XHXA 2HLNA 3DTVB 4LVCA 1W0CA 3GWZA 2IDJA 3QY0A 1OH5A 3UATA 4WFIA 3ADDA 2C7GA 2A78A 1DG1G 3JWGA 5L3CA 4C03A 2DOSA 1MABA 2G6TA 4S12A 1GM8A 5AT1A 3G0OA 1YMVA 3L4KA 4GI1A 4NHEA 2I4NA 3DWEX 4Y0NA 2A9RA 3QXGA 2ZP1A 1EQAA 5A4AA 2FLKA 5AO9A 3QRWA 1Q6YA 2VP9A 2EP7A 3P9KA 4BO1A 3TJZA 3GAAA 2GM9A 4WZBA 4KXMA 4L15A 2IYSA 2EXXA 1S8AA 4RIIA 1QBKC 4URWR 3L4BC 4P5DA 4L3WA 2C8KA 2NV6A 4R83A 4EBBA 2EZTA 4PZYA 3H2IA 3E2PA 1M7HA 2J3MA 2JCGA 2MINB 3RUIA 2Q2VA 2X0DA 1KEVA 2Q3BA 4K3VA 3VQYA 2BGWA 2G38A 1XNRO 3JX9A 3KQUA 5CFLA 1OX5A 2DHEA 2NUAB 1RYEA 5FPSA 1P60A 2Y0IA 4WNAA 1A4RA 4CEJA 2FU5C 3AX6A 3R0IA 1TA4A 4H6VA 3NBMA 2W4IA 2AR0A 1JR3A 2WD8A 2WJVA 2X7XA 1MXHA 1NDHA 1EFKA 3PJFA 4LNAA 4ENSA 4QE7A 2OECA 2XRZA 4K26A 4M46A 2DMRA 2HJDA 4E5MA 4LDAA 3SJZA 2DAPA 4ESOA 2AT1A 4FYVA 4QUAA 2JW5A 1Q3KA 2AGVA 2P90A 1DC4A 3PCTA 1E5DA 4TV9B 1NRWA 3ZVLA 5AKYA 4WFHA 3TB4A 3DZKA 4C6TA 4JCOA 1QF6A 4HEA1 2J59A 5G1NA 4MWTA 3TNLA 2A7XA 2DMXA 2HLPA 1AILA 5JJKA 4XWGA 3OWHA 2AOVA 3NI2A 3L7LA 4FC6A 1GL3A 2X3YA 2CJWB 5FBKA 4LDZA 3N8NA 3AERA 1F7UA 2ST1A 1TKAA 4Z99A 4XFDA 3TH5A 5CHEA 2FEWB 4BO9A 3JPWA 4URXR 1BQ3A 5FPRA 2C77A 1UPGA 1VQPV 3VR3D 5TGTA 3A2MA 4W5OA 3OZSA 3PUIA 3DO5A 2WLHA 1KZ4A 3IULA 5DCYA 4Q9KA 4S04A 3C8HA 4MVSA 1J5EO 4MKIA 1GY8A 4KX3A 4OX9Y 1BXRB 2VSXA 1IPEA 3SDZA 1C0LA 2GBPA 1YIDA 3D8SA 3KVYA 4DUZO 5KNBA 3JQRA 5C7IO 3PP8A 3D31A 1NXTA 3NS7A 3GWGA 4NXMB 4CM9D 2QK4A 2HR3A 4GVLA 4DCSA 5CBGA 5AUOB 4DB4A 1R7RA 2FFBA 1C50A 3UPTA 2QD4A 4NMHA 4RGYA 4BYMA 5HJ2A 4PDLA 2DLNA 1XL1A 3COYA 3RW0A 2BE7A 1BJTA 2EJVA 4I55A 2C1XA 4HH0A 4XUDA 3OOJA 3S7ZA 1P45A 2AR7A 2ZR0A 1P7GA 1ZUNB 4XIIA 4QU0A 5L3QA 2B1QA 4BJ3A 1NW8A 4OI0A 1QH1A 3MWJA 2EIMB 3PITA 1N4DA 4NBVA 1SCAA 4DLPA 3WGUA 3WLPA 1AKUA 2OXIA 4JLUA 2IUFA 4G07A 4G09A 3H3XA 3OT1A 3PDUA 4OI4A 1THGA 4RABA 4RKYA 4PQFA 1IJBA 1P2BA 1A32A 2GJSA 4WVLA 3QLTA 4O4HF 3F6EX 3T99A 4W9RA 5I8PA 2WM2A 2AJTA 1OX4A 5KDOA 3HRKA 1I9GA 1QQ6A 3L84A 1GL6A 4FYKA 1GH6A 2PJZA 2BY4A 2F9FA 2YH2A 4X89A 4ABYA 4E88A 3M1LA 1MKYA 5DIZA 1W0JA 3O90A 3D6AA 5KUMA 4GNRA 5CCBA 4YJ3A 4CLOA 1OFUA 5AXDA 1RLMA 4G65A 1M83A 4LC9A 5EE3A 2IHKA 3OVMA 3FKQA 4UCTA 4F06A 2BTOA 5JR3A 3FTCA 5DM60 5SICE 1XL4A 4J7AA 2OPBA 1DAKA 5JJLA 3HFGA 2PD4A 1BGXT 5FI5A 2BFCA 4FNAA 4RGQA 3TUJC 1I80A 3FHCB 2VSOA 1UJ6A 2WKSA 4D3YA 4PLHA 4OLFA 5FFNA 1XN1A 4K1LA 1YMUA 4JKIA 3FCSB 3TE7A 2Q4DA 1BDJA 5GP1A 4ND4A 2Q5LA 2QE7G 3OOEA 2BMAA 1AQ6A 1NL3A 3JRNA 4OAQA 5JDCC 2WJIA 2WAOA 1VBMA 4LF7O 2PZMA 1V71A 3HJFA 1R6TA 3DR5A 1U2ZA 2CBXA 1U0HC 1TCVA 4XWTA 1V8OA 4MDEA 3O8QA 3IPRA 1TO2E 1K86A 1ZUWA 1K0UA 1MB3A 1Z0FA 4LH6A 3RKSA 2A57A 1RKXA 1NBMA 1LLFA 5B1DA 3T9AA 3NV9A 3UXYA 2G5CA 5CLIA 3FDZA 3L72H 4YDHB 5TQ2A 3DE4X 3E82A 1R4NB 1RYMA 2QEQA 1YRHA 2PQMA 5AJTA 3GA5A 4EHBA 5EMLA 3IL2A 4Z5XA 1LR1A 3LF1A 1A72A 4ZCSA 2QM8A 1SHUX 4K8RB 3OZ7A 4RVSA 5CM2Z 2XWQA 2JL1A 3I72A 4R5MA 3L06A 2EKLA 4CPDA 1OF1A 1DBSA 2HSEA 2XAFA 4O4JF 2ORYA 2W48A 1LS6A 3KUCA 1FP4B 2F4VB 4FCVA 1P62B 4LY3A 1TI7A 4RPHA 4B6RA 1QFJA 5JAMA 5A9GA 2XBUA 2D8MA 3W90A 3EE6A 4TN1A 2YUTA 2FPSA 2G9RA 3SYQA 5HPYB 4EG0A 2XMCA 1JAHA 1F9AA 4ECEA 1LLQA 5TC4A 4C2TA 3R41A 4GZRB 4RH3A 1IM8A 2DUMA 5EC1C 2O6HA 4IDFA 5KTTA 5KOYA 2C2KA 2COEA 4MRVA 2MK3A 1KFEB 1GQRA 4B3SB 3D6UA 1L7BA 1RNLA 1UAAA 1ZI9A 3MS2A 2W0SA 4N0QA 2OCYC 2I62A 4OHRA 2ITDC 4XUGB 4X24A 4TXLA 4NU5A 5CW1A 1E58A 1IUKA 2NNUA 3A31A 1CFJA 5TPZD 2HGSA 5JC1A 1M6WA 3AY3A 2B9VA 5KWSA 4OQEA 3KKKA 5E1AC 4DQXA 1PNMA 1YL5A 2WUGA 2PLAA 3KDSE 3ZE0B 2X5XA 2FHPA 3R76A 1SBTA 2OOSA 2VXCA 3O8RA 5CA1B 3CUYA 2EBHX 3CUEF 5FOWA 2YC2C 4BB9A 1HTWA 4MKXA 5H83A 4RJJA 1I5YA 3HR8A 2CHFA 3CPSA 4E5UA 4FOPA 3LKZA 3PJEA 3TXYA 2C2GA 2GXAA 2RCVA 1AUOA 1NVTA 3KUXA 6YASA 4B3TB 4R9SA 4RW0A 2AFIE 3AG3C 4D4KA 1GKUB 2O23A 2XCOA 5FYDA 3HP1A 3KAJA 3VJLA 1MVOA 3F2VA 2ODNA 2WKQA 4JLNA 2KS6A 3NHMA 1Z47A 1IBMO 1EZVH 3IXMA 2ZZKA 1UPXA 4TWJA 4PCLA 2XE4A 2JEOA 2H4HA 3EWSA 3LYAA 4JIMA 5CDTA 5KYYA 3NDBB 3GGSA 1N6OA 1QKIA 3Q41A 2HO4A 3C8MA 1NF9A 5C1DA 2F3SA 3G0BA 1MH1A 1JLLA 2WWFA 2PJRA 4BQFA 2XZLA 5HQTA 2C61A 5EOVA 3JSNA 3WHIA 3IEMA 3C3MA 2KG7B 1UC9A 3HK2A 4J1NA 4MMYB 3PRJA 2J46A 3WMRA 3HM9A 3B7GA 4RF3A 3W6PA 1JHDA 4C4ZA 4HAXA 2BCEA 2IHYA 3KYJB 1HLGA 1SOAA 4WZAA 2IXGA 3MTBA 1VL6A 2VQEO 5BWLA 2QL9A 3NX4A 5A06A 1ZIYA 3WQQA 1IOWA 2WSYB 5CLLA 4XM0A 2QE7A 3ZRVA 3BVPA 4Q3BA 4HGQA 3LO8A 1NR7A 1I5XA 1ZKMA 3PL5A 4WKOA 5E3IA 3VZSA 4ND2A 4HKTA 3IO5A 3QKIA 2GYYA 1R8YA 3HEMA 4YJFB 4J9ZB 5ESWA 2F8SA 4UEKA 2AL7A 3EEQA 4QFBA 3HR4A 3G82C 2WT8A 3EUAA 2VRZA 3Q40A 3EXG1 3CW2A 4HPXB 1KPGA 2Z43A 3URMA 1VMGA 4OHUA 1HEYA 1V26A 3M1IA 3QHQA 4LCEA 4JP2A 3NNNA 4JJ8A 4B6PA 1OZ0A 5DHAA 1PJ2A 2FPLA 1GXSB 1N2BA 1S2MA 4PNPA 2J5KA 3IP9A 5J4LA 3W3ZB 4HZUB 5BRNA 1MNQA 4AXBA 1FSSA 4B8YA 3SZRA 2F1MA 4E32A 1Y7LA 2WUFA 4V2UA 1UXKA 1ICEA 4K8ZA 3MD0A 3GLIE 3WGIA 4I4TF 3A10A 3FIUA 5IC5A 1WD7A 3DBIA 1A88A 4D5GA 4LZZA 3ZRWA 2D1YA 3DBLA 5IJ9A 2X9NA 1GA6A 3CCLV 1PDOA 4FYWA 3OZGA 1IULA 4DIBA 1OIVA 1ECGA 4W1SA 4H59A 3FD8A 2R6HA 3LQYA 3M3PA 2FEKA 3FRHA 3H2KA 3EVEA 1P7PA 2ZRMA 2GFHA 1AK1A 5LZ8A 2I71A 1U2GA 2WZBA 3FRIA 2A9PA 2YOHA 2RGNA 1CKEA 2FXVA 2YYSA 3N0RA 3DR3A 2XWBF 5AICA 2C7OA 1GUFA 4INAA 3P32A 4L02A 4TTSA 1YVWA 1LV7A 2FVXA 3QX7A 4IKOA 3KU4A 2YXEA 1FC0A 1ZUIA 2P75A 1FRNA 1JLHA 2GHTA 1KD1W 3IKTA 5E95A 3MTIA 1CETA 2Q6OA 1U2GC 1SHZA 2RGNC 1GTRA 5BW4A 5AESA 2JLVA 3AILA 5LGUA 2LGJA 3TW4A 3TTYA 1MV5A 2O2JA 3LUGA 3ET4A 1GNRA 5TEVA 3R77A 4MLDA 5E3HA 2PNJA 2Z2KA 3RVYA 1M2HA 4E4EA 3WGOA 4Q24A 4B48A 3F5MA 2QU8A 2DWPA 1U2SA 2NXJA 3FNQA 1H8ED 1I0IA 5GIOE 1TU0A 4G41A 4FOOA 1G6Q1 4GUDA 2X4IA 1TNDA 2E82A 3ENNA 1HR0B 2OBXA 3HYCA 4B87A 3IT2A 4I7EA 4DRZA 2PH3A 4RH0A 4B2IA 3M8AA 1SKBA 1TYZA 1FUYB 1VSUA 4KH0A 4G1BA 1JT9A 1NM5C 3RO7A 1J2EA 3KDAA 2XE7A 4PLCA 4TVKA 3BCCH 1IAQA 2Q50A 4RTLA 1OQAA 1DAIA 1WV0A 5TV2A 4EITA 3NPMA 1YQUA 4JLVA 3ZQJA 1VL8A 3FXAA 1PD3A 2FGKA 2PX6A 3BSYA 4L8WB 2Q3EA 5LKAA 2P4QA 4D0GA 3N0TA 3TETA 1H2YA 4EKWA 1BFUA 1RP3B 2OYSA 3TO5A 2Q5HA 3FYEB 4IH9A 2DH6A 5I4CA 1PP4A 4D9KA 4X8AA 3VI3B 1BVUA 3TM4A 1VMEA 3LBIA 4PZLA 3MTJA 2AV6A 5CPBA 3UOGA 2R1VA 3OUZA 2E89A 2JI7A 2DWEC 2CFOA 1GWNA 3OEWA 4JI3O 5K0NA 3BAZA 1ZVMA 4KL1A 2FG7C 4PX9A 4HJXA 2GSMB 3DOJA 1GFIA 1Z5PA 2XIQA 5BY2A 3M1AA 1VDMA 1HQKA 2G8LA 1M67A 4Z3OA 5DU2A 4L5CA 4HMQA 4P83A 3TLJA 4M0CA 3AFHA 4A0GA 1FQKA 1Q5OA 4BIIA 2Y27A 2O3RA 2NZVG 1JEOA 2G5PA 3NBAA 5COBA 5B3JA 1VRWA 4MVQA 4DQVA 4C0LA 4KQWA 2EFYA 2CZGA 1V11B 1XYVA 4A8PA 1CLEA 4OJQA 2H85A 3GWKC 4RC9A 5I7OA 2PRJA 3QLVA 1I1QB 3AUXA 4C21A 5K8LA 1X8JA 4C1NA 4HDAA 1ZK0A 3U7QA 3K05A 4FIDA 2FWMX 2VHTA 1IRXA 1C0EA 2RBGA 3VU1A 3MZ0A 1XXLA 5K1XA 1OT5A 2IZ0A 1DRKA 2QTWB 2WKPA 2B25A 3ZE9A 1RQNA 5B3JC 3OZRA 4BLTA 3FYHA 5LNK6 5DJ5A 1SF9A 1RKVA 3WRYA 3FX2A 1CUYA 3OOHA 4DG9A 2HMWA 3QLVC 2VJBA 1BMFG 3ONWA 3F4KA 1IE3A 4M1QA 2WWWA 2ZINA 1FLDA 1NLUA 3QVKA 1F5NA 1QQ5A 1W4ZA 2DFTA 3WRYC 3STLC 3M9LA 1QRUA 1NVBA 4FFOA 1JMVA 3WSWA 2EERA 3LYHA 1C30B 4KPUB 4AN4A 1U2QA 1JSXA 1T3LA 2P40A 4IXTA 4CCSA 1F2TB 2YZKA 2P22C 2UUAO 3R5SA 2YIJA 2P62A 3ANMA 3OH8A 4GP9A 4BVBA 3T1TA 4H15A 4G0UA 1G42A 3RC1A 4ENVA 3TLCA 2H1IA 1DKRA 1M2WA 1FUIA 1YJAA 4L9AA 4UNSA 1QXSA 1S2LA 4YROA 2AOXA 2I67A 1DWUA 2BDTA 4R2LA 4I55F 1DFGA 1FIUA 5BYKA 3BEHA 2WK1A 4E5VA 4AJHA 1D2CA 3K70C 3IGFA 1M74A 2W6CX 4YCDA 4GPEA 1YTFD 2QKAA 3V3TA 2PX2A 1OGIA 2ZIFA 3BB3A 1PDVA 4RY9A 3EOAI 1NVWQ 4TWAA 2DWOA 4IVNA 4B75A 4F72A 4TTPA 3LY5A 2IA5A 3CW8X 1NVVR 4IY1A 5DHUA 1YRQA 1QIDA 1E0KA 1VP7A 3GQBA 5JAPA 3OX4A 2YS7A 4BE4A 4WY2A 4P3NA 1FFWA 1HT3A 5C4MA 1YBFA 2ZJ2A 3GRFA 1GPH1 4WFEA 4P0TA 2ZULA 3ZWWA 3EVFA 2ZAYA 3L3BA 3Q0TA 1FTGA 1YZTA 1LNSA 1W7AA 3K3PA 2M2IA 3BK7A 4LBVA 1MA0A 3K9WA 2QSJA 1QVRA 5F2KA 4DMRA 5A7FA 4A36A 4B6JA 1VJ1A 3ZY2A 4YJ3F 2RGUA 3DMFA 3NHAA 2OESA 1FTYA 4GWLA 3WJAA 4GL4A 1D4ZA 2HNBA 3QKWA 4QJ4A 4ZCIA 3U26A 1DI0A 3CR3C 1J97A 4QOJA 3BFXA 3X1JA 5A3JA 4ZV9A 1UT6A 4TT3G 1KZGB 2W2MA 2RHBA 2AG8A 3K9SA 2Q4RA 4ZAYA 3IUYA 1WDKA 1GAWA 1T2CA 1XZKA 3PQCA 2H2HA 4QFMA 4XDJA 4IMIB 5EQJB 2DFKB 1R0XA 1MT3A 3GCWA 2EEPA 3MIIA 5D5HA 3WHLA 5H3LA 2ZIZA 3LBFA 4ZCRA 3DWIA 1UOPA 1QH8B 3GRZA 2F66C 1GGVA 1HNXO 3FCCA 3OJ0A 1IUPA 1WUYA 5TMDA 1C7FA 3AUSA 3O47A 1KK1A 4KE9A 3AR4A 3ZXSA 4GC9A 4R9RA 1J39A 3JAKB 2MYNA 1JXAA 3IVMA 2I1LA 3AHHA 3STTA 2EC5A 4XAQA 3LBYA 1NN5A 2CNLA 1ML4A 1X7XB 5EXXA 5C9ZA 2ZIXA 3GJ0A 1KYTA 5IVHA 4GUNA 1AP6A 1MX1A 3QPCA 1WCWA 4G0ZA 2XGMA 5M29A 1OFVA 2EKPA 5KPJA 3IJPA 2R62A 2WYVA 3DJFA 3BL6A 2EX3A 2YBDA 1I3NA 4HNVA 3VBCA 4Q3EA 3A05A 4P3KA 1CUWA 1OA1A 3H8JA 2OC9A 5BYJA 3IQIX 2QZPA 2E4XA 1IQ0A 4AMBA 1T9BA 2DRIA 3FKSA 1SUAA 2FPXA 1PT9A 1O95A 1GZ5A 3NWPA 2BSXA 3R5KA 3TTUA 3OGIB 4OK6A 1PZMA 1OA0A 2KBFA 4KRGA 1D04A 1PR6A 5G02A 3AXTA 4EW3A 4FJCC 1TUEA 3ZU6A 1JPXA 3PV0A 4RA9A 3KBOA 3LCUA 4X20A 1G3UA 3V1KA 4CHTA 2FPOA 4LF6B 5D6OA 4EEXA 4P82A 3IKMB 1Y1QA 4IDGA 1O95C 1FPOA 1S02A 3LLCA 2C98A 1NQAO 3W3AH 1WZCA 1T36A 2UZ1A 3C1OA 4B6FA 1Q16A 3N2IA 4ETIA 4N9QA 2QRPA 3CLRD 3DZCA 3OW2U 4ZOLA 1LQ2A 4FGZA 1Y8RA 1YITV 2O0HA 2CE2X 3C15C 1NWCA 2IQ5A 3M6AA 1TA8A 4P7GA 5J59A 3RT7A 3MELA 3RVDA 3E8GA 1VQ5V 3H1KH 3ZN2A 1ZVQA 2Q8QA 4HK4A 4RJ2A 1V5IA 5J4YA 1MZPA 3QKRA 2NZWA 3AB7A 3A7EA 1T1EA 2AC7A 4HDNA 2QV0A 3IC7A 3ZDXB 2JCBA 4CMCA 1U96A 3QXCA 3WLQA 2VP6A 1LI4A 2GNAA 5JNRA 1RQ7A 3IR7A 2HZ7A 1CIVA 4WVFA 3ZIDA 4UB8Z 1L5YA 4HVAA 2IPAB 1UFQA 5A3RA 2QA5A 2PD6A 3PDCA 4Y1RB 2IXFA 2Q9AA 1SXJE 3TNJA 1JQ3A 4GOJA 4HRVA 3FSJX 1EG2A 4OH7A 2O8FA 4BAZA 1E61A 1U97A 1SY7A 3K92A 4QQRA 5IG2A 2MR6A 3OCZA 4KQEA 4AWAA 4OLAA 2FNAA 2B5OA 2P5SA 1F6DA 3I9MA 4J0JA 4JC0A 4F5EA 4X88A 2ZBDA 5KVQA 2YZMA 4V0KA 5C8DA 4C5BA 3UK6A 5JNUA 3L8DA 1YI1A 5DGXA 1DAEA 4ZT6A 3V7YA 1KZ6A 2ZYHA 1QPGA 2ZJZA 4K9NA 1X1RA 1ZY2A 3RN4A 3LPCA 2ZYUX 2BM0A 4TRJA 4EJSC 4HNSA 2IYVA 2HHAA 4EG4A 4M9CA 1GZ4A 4Z2AA 3OU7A 3NTQA 4H33A 2DQSA 3WLOA 1J22A 4TLMB 1ZK2A 4P84A 1QV7A 5HE9A 4C2AA 2REXB 4NH4A 1ECPA 5GONA 1GRCA 4WOKA 4MUMA 1E0SA 4TKMA 2Z2ZA 2QUJA 4TSFD 2J9RA 2A0KA 5CYPA 3H4IA 5LOVA 1RKUA 2JNWA 3L93A 4NV1A 3P9RA 2AHOA 2D5LA 2SECE 1Z28A 2ZNJA 1HLFA 3TFQA 3CEJA 3GPBA 2PUEA 1WB4A 1SQ0A 4DR6O 1DX6A 2AEEA 2BMFA 2OGZA 3F6PA 4FMCF 1VE6A 3M2TA 4EB6B 4JBNA 4FFBA 4KBYA 5KAPA 5CLGA 4DGSA 1BSVA 4RYLA 4UUJC 5EWLB 4TMZA 2OWDA 3L7DA 4HFJA 2RGRA 1MAWA 1BGVA 1F2UA 4ZEXA 1D4AA 2O8BA 1J95A 2YR0A 2WFZA 4JZGA 1Z2CA 3UXMA 4CQNA 2RI6A 2G1JA 2E4VA 2BJHA 3IQDB 3UO8B 1ZW6A 5BQ3A 3S5UA 2WIBA 3GDWA 1CF2O 3O9VA 2W6OA 3BYZA 1X38A 3Q7RA 4NPAA 3TRDA 2WU1A 1QCZA 1SVNA 2YL2A 2BGRA 3RS4A 4KHPO 4ARIA 3DE0X 1GNQA 4DARA 4K9QA 3CEAA 4WK6A 3ZGXA 2W00A 1KUQA 3OT4A 3HPQA 2YV3A 4C4TA 5CXUA 2X0EA 2VDWA 5AKEA 1X7YA 5FLEX 1L5HA 2ONZA 2RCYA 3NDPA 1JTEA 4G37A 3ZDDA 1EAMA 1S3JA 2O4CA 1AN9A 4PNEA 4O02B 4DDUA 2F17A 1VBFA 1FS0G 5GTDA 4N18A 2YN4A 1BS9A 1GQ2A 1XTTA 5KYKA 2IHBA 1G60A 3OLWA 4Q20A 1A9ZA 1AJNA 3EEIA 2NV2B 2OO5A 3SYNA 4UBOA 3TEFA 3B3AA 5BT9A 3IV6A 5BRAA 1KSFX 4QDOA 3ENQA 4R16A 2OILA 1E6EA 3ANLA 2QLMA 7YASA 5INTA 2OEPA 2CXSA 1HQYE 3FYUB 3QXJA 2Y1FA 3N58A 3I8SA 2N05A 2VCHA 4IGGA 1DEHA 3C16C 2FWJA 2OO5C 1SZCA 2BHRA 4PO3X 3E9MA 4QPZA 3H75A 1KK0A 1ORQC 2YWEA 3NVKI 3ZE1B 3R5XA 2VT2A 5JMWA 3PR3A 3JAWA 3VJMA 1O9BA 3T3NA 4C7VA 4UXNA 2B0CA 4K6KA 2ZBQA 3NMUF 4EARA 4KPYA 1XMJA 2ZIAA 2J67A 3RS3A 1R37A 1QWOA 4GKKO 2VSQA 1ZPDA 2O4UX 1I94B 3PHLA 2PV7A 2D0OB 5E1OA 1MEOA 2JS7A 3H0CA 4ENPA 4WOBA 3UUEA 4F4DA 4IJVA 3R1IA 2VXYA 1WVMA 2RHRA 4I4NA 1FXKB 1BEZA 4Q1DA 3LVQE 4GOLD 8OHMA 1T3ZA 1H5QA 5IN5A 4RUEA 3KEGA 1Y34E 2CJPA 3E9RA 4V39A 2WQ7A 3DUFB 3KLMX 1K2VN 4RV4A 2X5NA 3OPMA 2XQFA 1GQOA 2E75B 2NO4A 3AR5A 2IIBA 2YCBA 3CNNA 1GDDA 1TFUA 2GNOA 3EAFA 3NM4A 4HWSA 2OVFA 4IIBA 2ZD9A 4Z0HO 5TF4A 1WZ2A 4PCUA 4DJTA 2O9JA 3SZ3A 2PMKA 4MRNA 3W6UA 4G4GA 1NR5A 1ZHHA 3I42A 2ODPA 5ALFA 3DL0A 2A5JA 4ERNA 1Z4MA 3RVRA 2QN8A 5HJEA 1JH8A 4IKPA 5ALLA 3ESDA 3T1HB 3EFOB 3ZGVA 4TMXA 3BK2A 2WYUA 3PK0A 4XX1A 5HF5A 4DYDA 5CHYA 3GV0A 1JJIA 1V1MB 5NLLA 4YECA 4CLRA 1SVLA 4R81A 5TRTA 2HLDA 2V6FA 2CLFB 4CMEA 1DC6A 4DC0A 3C3JA 4TS4A 1XQ1A 1E94E 1ZUD1 5G40A 3E9YA 1DBRA 1YH3A 4EZBA 4AL4A 1WSWA 1Q0LA 5HJ5A 1LUWA 5GM2A 1BQ4A 3VTZA 4QU9A 3GDGA 5JE8A 3T1YB 4X6UA 3CZMA 5D3ZA 2ONYA 2O1XA 3PTLA 1ROPA 5KU7A 2XITA 2YRXA 1WPXA 1S6YA 3E8BA 2CT8A 3OQJA 4W4TA 2ZR8A 4X1KB 3EC2A 2YI8A 4LE0A 3SSOA 2OCCC 4NBTA 4PSVA 3T94A 1ZQ9A 4P32A 3ZS8A 3G1UA 3OF2A 1R6KA 2D5IA 1IBKB 1AKWA 1MJHA 1WVIA 1V54C 4KMOA 1NUSA 5CUQA 3PGJA 3D8BA 1P7CA 1ETUA 4GX0A 2E1PA 4M1EA 5EPEA 3TZ6A 5BOSB 1KNXA 4R71A 4PZZA 1ZD5A 1GGFA 2XT6A 2ZSFA 2GTAA 3CF6R 3L82B 4EKIA 5J5AA 1BWSA 4F3RA 1MOQA 3ROEA 4K2HA 1QGUA 4Q3AA 3HCCA 3ZS8C 2P5UA 1ZOPA 4E2XA 2HMSA 4G1EB 2F4NA 3D8TA 2VEOA 5FHQA 3MAJA 1RZRD 1WP9A 1RWKA 4BB0A 1ZNXA 2G1KA 2PAAA 2D1RA 1D0SA 2NADA 2I6FA 2QW0X 2J08A 4FHCA 4B2YA 1F7YA 2C0CA 3GLGE 1LBTA 3NC1C 2IH5A 3ETHA 2VNKA 4AZ0B 3T4ZA 4A2PA 4R8CA 1TADA 1RHMA 4XLZA 1ISIA 1XLUA 4GR4A 1CUXA 3AV3A 5IU6A 1AKQA 3U4CA 2RB5A 2PS1A 3SPGA 5JCZA 4PYRA 3ODPA 5F23A 3LTNC 4OYRA 3BXHA 1Q1EA 3IUSA 4INPA 5K0JA 3P52A 4RZ3A 4TKUA 4HAUA 1LV8A 5KQLA 4PFKA 1PR0A 3R9KA 4I50B 4B3RB 2DW4A 2DPXA 3MMNA 4MVMA 5B3AA 5I5GA 2I4IA 3PXXA 6REQB 1C41A 3PFCA 3QU5A 3K1AA 3GLTA 2E4ZA 3QKSB 2FKNA 3OQMA 4BWYA 1G2PA 4PTLA 2GM4A 3VR1A 3FCAA 5DNWA 1H2FA 2ACWA 3CURA 1BU8A 4LHVA 4Y2QA 4II2A 1G3MA 1ZH6A 4GL2A 2E5FA 3U4IA 4EFMA 3ZV4A 5L8VA 1Z4OA 4B45A 3R74A 2A59A 3QTTA 4P22A 4MTCA 2HRZA 4I3FA 4CG3A 1AXRA 5B1BC 1DJNA 3HFJA 2A3QA 3SKYA 1AURA 4X61A 1GCIA 1A04A 1QIIA 1VSBA 3MUNA 4H6PA 1P9WA 1YA4A 4FZRA 4MPJA 3OU6A 3U3RA 4MW6A 4ZKDA 1EXVA 3FAVA 4OCZA 4PZ0A 1R66A 3MGAA 1FXVA 3NUQA 5MGBA 3L6OO 4DYHA 4I46A 3F9RA 3RFVA 3OWOA 3GGJA 2MR5A 1KS2A 4BTEA 4QQFA 2ID7A 5LPNA 3BRWD 4RZ2A 2X41A 3OEED 2G28A 1KMNA 4AI8A 2ERCA 4HNHA 4XQEA 1P4JA 2HRRA 2P2SA 2A06H 4E0BA 3LAWA 1NF2A 2WYWA 4CIXA 3R24A 1QANA 5AM5A 5LBIA 1W9MA 1AUQA 3QO8A 4R9NA 1Z0DA 2BBOA 2A5YB 1URPA 3H4TA 1S8FA 4TXHA 3ODGA 4ZO6A 4YMSA 3ABOB 2H5EA 1F2VA 3TM5A 1EVYA 5J1SB 3VPBA 1COWG 4Q4DA 4QOSA 2G4VA 2Z1MA 3V4SA 2H8GA 2Z4TA 4LK2A 2GTIA 1CPYA 3KWJA 2NZ8A 4QJ5A 4R6XA 3FGPA 4CJXA 1EJ6A 3UJ9A 1ZL2A 3JVEA 3RSQA 2QRQA 3ORRA 1P6XA 1UDAA 3FROA 1M2VB 4E21A 1YO6A 2CZQA 3B5JA 3TX6A 1FP1D 2AI3A 4R2MA 3WLAA 3LQ1A 2FN3A 3BWEA 1A97A 4JCCA 4Q1BA 3ISVA 1HYQA 5F33A 2XNJA 4Y9SA 4MVJG 2WABA 1E1CA 1PNVA 3QUBA 5I9NA 2D2XA 1UODA 1CJBA 4MV8A 3EIQA 1L9KA 1L8OA 1U2TA 1T3SA 2PRSA 3LP5A 3SBOA 1UT5A 3WYEA 4G0OA 4KZKA 4EVSA 4B34A 1OHHG 1PJ8A 5IEBA 1K4DC 3DMRA 2GBLA 5CXXA 1N2ZA 3G59A 3BIWA 3MBKA 4GZMA 2P9CA 4FM9A 4XDKA 2X8AA 4JLWA 1RIFA 2C7PA 1HBJA 1XHEA 3OTOO 1G6OA 3PNSA 4RTRA 3KX2A 1VRCA 3CR7A 1E0JA 3WXMA 1JQJC 2C4NA 2DHRA 3QBEA 2AG6A 1QGZA 1AK2A 3N05A 3KQTA 3KPWA 3ESCA 4AX4A 1G5QA 3GUUA 3PQEA 1YQXA 2GBLC 3P3NA 2EG9A 1RI5A 4XVQA 2OLEA 1XT6A 4L6CA 4ZOLF 3KKMA 2NZXA 3D7LA 5SZJA 4MIEA 4PAGA 3TUIC 2HREA 4CR6A 1KARA 3RWRD 3IBTA 1N2HA 3BTUA 2I8LA 1O58A 5ADVA 3A6JA 3LF2A 4QQKA 4G1UC 5C2JB 5GJBA 2OXEA 3WL4A 1G0NA 3RYIB 1YOBA 2ZQZA 2REBA 2UYHA 2HVJC 3O3MB 3D6NB 1P6QA 1ZGZA 4L73A 2DETA 1W5BA 2RDMA 1AHNA 1XZJA 1FUEA 2W5UA 3IIKA 1M75A 1IUNA 3LW7A 2B1JA 3BULA 3BIJA 3PRYA 3AL3A 3MBOA 5F2OA 1NWHA 5ITVA 1QU3A 3T4EA 3TRKA 5J3JA 4PQGA 5GQSA 2BL4A 5F2NA 4P5PA 4RTSA 1A2OA 1GG9A 1D3AA 2A7WA 1RDFA 2BHNA 1GQQA 2BFEA 4ABTA 1GR1A 2Q6LA 4CS2A 4TSKA 1V1JA 3P27A 2FUEA 4CM8B 4GX2A 5AQ1A 3N2EA 3S28A 4P3PA 2Z6UA 1R3DA 2YXYA 3PT9A 1H1DA 1O2DA 3SM9A 3QIVA 3L9DA 1XZEA 4DCUA 5HP4A 1EK2A 4BNNA 3K30A 3HXKA 3I23A 1VI5A 1JQKA 1SPBS 4HB0A 5GJCA 4Q4JB 2QPLA 1UBFA 1YZYA 3HJNA 2YTZA 1NR1A 2FSFA 4XYLA 3CSUA 3B8EA 4TSRA 1H6CA 2AWNA 3JSLA 2Z8YA 3D7SA 3AG7A 1DK1A 1SN7A 4YJHB 2JFZA 4GW3A 3ZV5A 4C4SA 2OHFA 1COWA 3UJBA 5DFAA 5CVTA 1LWOA 4P9PA 1E1RD 2IJJA 4IH4A 5LOVF 4RTPA 5IVIA 1PGPA 1FP7A 3AMVA 4IDHA 3T5CA 4C14A 3RYHA 2JGUA 1P44A 1GYPA 4R54A 4CQMA 4X0EA 1SQGA 5FR1A 5HUQA 3W7BA 3FW1A 3OP1A 4J9YB 1KAOA 4OM7A 4WJKB 2ZUVA 1G2OA 1H66A 2C88A 4NS4A 5JTUA 2QT9A 2ECOA 5F64A 2DWDC 2P11A 3AVPA 4O4HB 4OGGA 2H7CA 1N5RA 4EF5A 1QLHA 4GI7A 2BBWA 3CTMA 4R8RA 1CEXA 3W7UA 1BW9A 2XY4A 3WYBA 1ACMA 3E2EA 1Q7BA 1XTQA 2EZ9A 4YR9A 3D59A 4NJEB 2C29D 5E7IA 1FJGB 1OU4A 2W8ZA 1QC5A 1XPOA 5IN4A 3G2HA 3W3AA 5KOJB 4JLKA 1JJ2U 4D7SA 5BN4B 4ZMSA 1XRPA 5AW6A 3OZEA 2OZVA 2GHQA 1XI2A 1LPSA 3QWFA 2VF5X 1EUDA 3NJ4A 2EKQA 4R0MA 4CF5A 2HK8A 3Q5DA 1E3SA 2ARHA 1JDUA 1MRSA 4UCVA 1PV0A 3G7NA 3WAGA 1NXOA 1QKJA 5CK4A 1PL8A 5L3EA 3RVBA 4MRMA 3AVYA 5DHFA 4HDOB 3REOA 2RFLA 2FDRA 3HWRA 5EJ5A 4Y2GA 5L51A 1KH3A 5JLJA 2B2XA 1RSOA 4URFA 2XW6A 3MHSC 3OZWA 2QWQB 4EHNA 2WP8J 4OQPA 4J91A 2ZE6A 3IIMA 2NUBA 4CN9A 2VBGA 1NSFA 4XR9A 1YQDA 2CGOA 3ECSA 4ZDJA 5H6RA 4JD5A 3N6VA 3E3MA 1L7AA 1ULTA 3SAJA 3E9QA 2Z3VA 1GZVA 4UZFA 2OTJV 4YRAA 3TZCA 4J0QA 2VUTA 3I32A 2BMVA 5FL7G 4CWAA 2F48A 1XMIA 3ZDQA 2DR3A 3HB7A 1ZN2A 2WG0A 5AM0A 4EF4A 5E4FA 3N2KA 4HQLA 4EKEA 2DYRB 3LFTA 2ECQA 3BWCA 1LSSA 4U7FA 1SZDA 2FW1A 1Q6IA 1M90W 4ID3A 3X2QB 1CR6A 3FNEA 3KQSA 1H2ZA 1O77A 3BT7A 1MO2A 4MS4B 2IUYA 3GZNA 4N23A 4INZA 4LECA 3ZC3A 4J2HA 2BGJA 5LGTA 1KI2A 4ROSA 3LUTB 1QBGA 4JP5A 2L82A 2QQEA 1PHRA 3WL5A 2IBZH 1M34A 1MQ9A 4E51A 2OFFA 3NDJA 3BMOA 1GGJA 1T0PA 3FTQA 4O4JB 3ID6C 3Q6MA 5J2TA 4IMRA 4WLOA 2I87A 5CLFA 4ZCPA 4EFKA 5CVUA 2V4DA 1R8XA 3K5WA 6LDHA 2I76A 1AB5A 4ZRMA 5LQUA 1WCIB 1UEIA 3U19A 5J9PC 3W2EA 4KB5A 2V1XA 3K4PA 5DLDA 1XHFA 2HHHO 1HZZA 4HFRA 4X60A 1L5KA 4B9AA 4G4JA 1IFXA 1XR3A 1NVXQ 4V03A 5JS2A 1JDTA