3EXAA

Crystal structure of the full-length trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
303
Chain Sequence
KEKLVAIVGPTAVGKTKTSVMLAKRLNGEVISGDSMQVYRGMDIGTAKITAEEMDGVPHHLIDIKDPSESFSVADFQDLATPLITEIHERGRLPFLVGGTGLYVNAVIHQFNLGDIRADEDYRHELEAFVNSYGVQALHDKLSKIDPKAAAAIHPNNYRRVIRALEIIKLTGSPYNLVMIGLTMERDVLYDRINRRVDQMVEEGLIDEAKKLYDRGIRDCQSVQAIGYKEMYDYLDGNVTLEEAIDTLKRNSRRYAKRQLTWFRNKANVTWFDMTDVDFDKKIMEIHNFIAGKLEEKSKLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title Crystal structure of the full-length tRNA isopentenylpyrophosphate transferase (BH2366) from Bacillus halodurans, Northeast Structural Genomics Consortium target BhR41.
rcsb
source organism Bacillus halodurans
total genus 98
structure length 303
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.890 Mainly Alpha Orthogonal Bundle Helix Hairpins Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 3exaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3exaA01
2ZI5A 2EFCB 2QEQA 2QPOA 4HUQA 2FA9A 4IOMA 4DB2A 1EFTA 1L2TA 1MV5A 4HLCA 2W2VA 4KLNA 4HZIA 4M1MA 4Q1DA 4EJSA 1VHLA 2OCYC 1UAAA 2FFHA 3TUIC 4HDCA 1WCV1 2OZEA 2OE2A 4Q9LA 2BBOA 3GP8A 4C2UA 2HDNB 1UDWA 1KZ7B 3W9YA 4PO9A 4XIGS 1VKJA 4DSOA 3K1JA 2C9CA 3KB2A 4E07A 4QHYA 4GOJA 4DCVA 2PCJA 3DOEA 3IILA 2ZJZA 4CDGA 4LYAA 4A6PA 4LBVA 1U98A 4B35A 1YZTA 4MGYR 1II0A 2Q3HA 2JGNA 3Q8XB 5DYIA 1UKYA 4C3ZA 3KJHA 1XWIA 3CKLA 3QKUA 5C46F 1SKYE 1Z28A 1EK0A 3E5HA 5FTJA 4IVQA 1N5JA 1BYIA 2HF9A 3VAAA 4MKFA 1AGPA 5KSZA 2GVDC 4R9UC 4YLGA 1VMAA 1JQLB 1U0LA 3FHCB 5JSZB 1XCMA 2VP9A 3QG5A 2RMKA 4A8JC 4BZPA 1OH8A 2ZRDA 2FH5B 1RJ9A 4IFBA 4Q01A 4RCZA 4NYMQ 1XMSA 1ZM4A 4W7SA 4Y0AA 5CYOA 3VR6A 4A2QA 5KDOA 4M0LA 3HR8A 4A1FA 1UBEA 3FWYA 4BQSA 3NC1C 5G3YA 3W3ZB 4EPWA 2RGDA 3G0HA 3JZAA 3WHKA 3AP2A 2DFTA 3SJBA 1GWNA 3WNDA 5B2ZA 2B21A 4DT1A 3GLFE 1VG9B 4R7ZA 2YVUA 1Z0FA 2WOJA 5EUQB 4HAUA 1G3UA 1KIMA 4QBIA 2QT0A 1KI4A 4AURA 4I1VA 3L0IB 3KKQA 4HB0A 1KI2A 1T8TA 3RWMB 3GJ7A 2QMOA 2G9NA 1OH5A 3GLGA 4RJLA 4V0ME 3QIAA 5FL7A 2QGZA 1SKQA 2R6AA 3B82A 4JIMA 3ZQ6A 1E6CA 2AX4A 3FKSA 3AUXA 2NOAA 3D8BA 3OE7D 3D3QA 1U2RA 2R44A 1V43A 2VHQA 5FR2A 3B9PA 4D81A 5TVKA 3H4MA 1O3YA 5J4KA 3K53A 3AVUA 2GCNA 3IPYA 3B1ZA 4URUR 3H1TA 4MGIR 1ZM9A 2V6IA 3CM0A 4RD1A 3Q85A 4D0LB 1NSTA 3GQBA 3RS2A 3T12A 2YWHA 3OIVA 1CXZA 1NSFA 3I5YA 1NL3A 4URVR 3OEHD 1T5LA 5ANRB 3T1OA 2LWIA 1EXMA 3WP1B 1XZQA 1KNXA 3PG5A 2GBLA 3R7WA 1A1VA 3I62A 4HAVA 1NVXQ 4OQNA 5JJKA 3L8ZA 2QP4A 3NDBB 2GJ8A 1DAHA 4OYHA 1QRAA 2EQBA 2KB0A 3ECCA 1R0WA 4JL6A 2AL7A 1IY1A 4Z8XA 2J45A 5FOXA 4QM6A 3EZFA 4Q48A 2BEJA 2FE4A 3K0FA 2ZSEA 1AN0A 2NZ8A 2P67A 2ZI9A 1R7RA 3PUVA 1MOZA 1QBKC 4JLKA 4TLDA 3LXRA 3FFBA 2JLWA 2CJWA 2AFHE 4TTRA 2YWGA 4TQ9A 3UG6A 2FG5A 1OV4A 2QE7A 2ZE5A 1XRJA 1XEXB 2FGKA 5LBIA 1ZJ6A 2IUSA 4GMXA 3A1WA 3BAFA 5L3QB 3ZH9B 2CL0X 1IQPA 2XJ9A 3OAAD 5L3RA 2IS2A 3PFIA 3ZQJA 4RD4A 1CJKC 1DAIA 3QY0A 4TLAA 3C16C 4EPTA 3ZJYA 1XCGB 1J8YF 4PZLA 3SHFA 1G7TA 3B2EA 1GRRA 1CIPA 4PQFA 1CR4A 4BFSA 2OUKA 2IYLD 4IFEA 2F55A 4UNRA 1ZNYA 2ZI6A 2AD1A 3MD0A 1P73A 1MO6A 2IF2A 2GEDA 5EE1A 4NBSA 1LNZA 3KXLA 2F3RA 3GLHE 5DN6A 2CNWA 1RKBA 2VTKA 2JJ1D 3I61A 2W2TA 3FMOB 5BW8A 1XXHA 2NGRA 5TXGA 1J70A 4DLSA 3N2EA 2V1UA 4MA4A 2CE2X 1YR8A 5FUXA 2CMKA 4D0NA 3TK1A 1VCIA 3ASYA 1VHTA 3LRPA 1Q3HA 3GJ8A 4JLMA 4LBWA 1FQKA 2OILA 3LX5A 3MWLA 4TYWA 1RC8A 1C9KA 3ZD6A 2WOOA 3KFXA 2I1VB 1RPZA 5TDHA 4IHQA 1X1SA 1Q1EA 1ZCBA 2PBRA 2WICA 2FEOA 3LVQE 5DI9A 3T1VA 4JMPA 2C77A 2EWVA 3SHWA 4HEJA 3TIFA 2YC4C 4BLTA 1XD2B 1MABA 2D3WA 3LNCA 1ESMA 1QHHA 4C0KA 5FH9A 1IXZA 3AVTA 5FOUA 1OSNA 4C0JA 2VO1A 4BFTA 1QHNA 2XXAA 3C5HA 3A1SA 3KTAB 3QXJA 1HE8B 1GTVA 3L0PA 1PLJA 3JZMA 1OIXA 3RDPA 4BLRA 3FOZA 4ZI3A 4NP6A 4ZCMA 3AVYA 2VLIA 1E0AA 5GADl 5B57C 4Y0VA 2YV5A 4O25A 4DEYA 2DPXA 3FTQA 4PPNA 1O87A 2D06A 1LVGA 3DO6A 4Q5IA 1MO4A 4JT4A 2GZAA 4YMUA 1NIJA 1G3RA 3VU9A 1UM8A 2HJGA 2J7PD 1CJMA 3KQLA 1JR3D 4LJ4A 1UEIA 2WIBA 4EKDA 3LBNA 3UKDA 4PFSA 2IXFA 5KSYA 1XTRA 4Q4AA 4O2LA 3GJ3A 2ZVQX 4WBSA 1VG8A 3ZVMA 1ESNA 5SZHB 3KQNA 3U3MA 5FBLB 1SVIA 1ZAKA 4EPXA 1AA9A 3MUFA 5H8WA 3P1JA 4FWIB 1UF9A 2YOHA 5F9HA 2Z5FA 2W0MA 4FMBB 6Q21A 1UKVY 2Z6VA 4MGZR 4P33A 3SEAA 2OCBA 3BB3A 4Q02A 5HTKA 4WVFA 2W0SA 1OFTA 5CLQA 2BV3A 3PUWA 4CT4B 1QHXA 4M9QA 521PA 5C4GB 3SNHA 3FPAA 1SVKA 4QOSA 2ZITA 3C14C 3FFAA 4PZZA 4B76A 1E2LA 4QNMA 4BZXA 2FNAA 2WBLC 2WKRA 3AP3A 4ZIRA 4RFSA 2FSGA 2QM8A 4UNNA 2CHGA 3KZ1E 5DISB 1ODFA 1YZQA 1G7SA 4JLOA 3PEUA 4P4TA 3AKCA 3KJGA 3NG1A 1KDRA 5CDFE 3IIKA 4WXRA 2UZ3A 1W0KD 4MRNA 2ERYA 5D3MA 1W49A 1KJZA 4ITRC 1Q3TA 1QG2A 4ASUD 1DVRA 2P65A 4NCJA 4CIDA 1XMIA 1NLFA 1KKLA 1E0JA 2A3RA 3EZ2A 2YNMA 1G6HA 1F6BA 1XMJA 1OW3B 1P9RA 1UEJA 1UBGA 5FBWB 4G1UC 3W6OA 2VQSA 2VHUA 3DKVA 3WYGA 4IRUB 4W5JA 4AI6A 1DS6A 4BASA 1XTKA 3GLIB 2O0JA 1XTQA 2ZPTX 3CPJB 1VDZA 1Z2CA 3MWKA 3V4RA 1WBDA 1NVWQ 1GL6A 1E1RD 1RRGA 4LPKA 2NO9A 4ZDKA 3AF4A 4LYFA 3BH0A 3CWQA 3KKNA 3KL4A 2NO7A 1E96A 1YR9A 3FMPB 5DHAA 5AJYA 5L3SB 1G1MA 1G7CA 2NZJA 2J0UB 3CUEF 3F0TA 5DI3A 3B85A 1UKEA 3I72A 1D9ZA 2WAXA 3NBXX 3PEWA 1VCOA 4QHTA 5G3ZA 1GNQA 3FHTA 5J47A 1ZP6A 1QHSA 4UXJA 2O8FB 1NVVQ 5DE3A 1KDOA 4RKEA 4AK9A 4AY2A 2PCLA 1DELA 3CX8A 1OFUX 4JVNA 5HKKD 4B32A 4WZAE 4TT3D 3R8CA 3MRSA 2FDCA 5DYGA 1FX0A 2V55B 1S3GA 5E7JA 1E9SA 1SHKA 4YMVA 3U7HB 1FNMA 3Q7QA 1E4VA 1AK2A 5A0FA 3ZGXA 3WNBA 1VYTA 3EZ9A 2CK3D 4AKIA 2GCPA 4ESHA 1KMQA 1U9IC 1XB2A 2WJYA 4PO8A 5J5CA 4NCIA 1OXSC 1E1QA 1JPNA 4QGHA 4DCTA 1ZBDA 1W4BA 1GRQA 1TQ4A 1P2UA 2N42A 5ELXA 3BD9A 2C04A 4Q9HA 4B47A 2WWXA 1N2CE 3CW2A 3I4LA 2BIFA 2MMCA 3C8UA 4DBLC 4OHYA 1T6NA 2IK8A 5GJBA 3K70D 5BWMA 5HPYB 2OAP1 1JR3E 1ZINA 2FOLA 4K46A 5HZKA 5DGXA 1MO3A 4DJTA 4HLUA 3W6PA 4RD0A 5IK2A 2F7SA 4C0BA 2F1RA 5EXTA 1GVNB 1IY0A 1NKTA 1E9DA 3LBIA 3THWA 4B34A 4A6XA 4DUGD 3P4XA 3RHFA 2IS6A 1PJRA 3VNUA 5SZIA 3AKYA 2A2ZA 5A5GA 5TV2A 1E9FA 4OQFA 4W9MC 2O8BB 3A1VA 3QBVA 4B75A 1U99A 5FUWA 4BE7B 2XNDA 2JLSA 4A15A 5UKDA 4JLJA 2HCBA 3EPJA 1Z8FA 3THYB 4O3MA 1BH2A 2VP5A 2P5SA 1D2MA 2PL3A 3W5JA 1ELOA 2OEPA 2J1LA 2JLQA 5JCZA 1U0HC 5CIWA 1OB2A 2MMGA 2XNSA 4A0HA 1AS0A 4D82A 3U4QA 4WXPA 1E0KA 1G8PA 1XJ0A 1EWRA 5EXXA 2IW3A 3BC1A 4UQOA 4GZLA 1AGRA 2JIZD 5HZHA 1CS4C 4CGZA 3TKLA 2IX3A 121PA 5C18A 4EQ6A 4EFLA 1DAFA 4AD8A 2JASA 1LF0A 1R0ZA 4LBZA 1QZXA 4QJ4A 2Q3FA 3MJHA 3H2YA 3QEJA 4HB3A 3R9IA 2GTPA 4UNQA 2D7DA 1Z0DA 2Z0MA 1LF5A 1Q1ZA 3I8XA 2QUZA 2GETA 2WJJA 2OESA 2C95A 2IUTA 1DE0A 1II8B 2OXCA 3UWKA 2ZJBA 4MGKR 5CIQA 5G41A 1AZTA 1JAIA 1G5PA 2EFEB 2UVQA 5FFMA 2GHIA 4EPYA 4YONB 4B71A 2RGEA 4HDQB 4UKDA 4MUBA 4RZXA 2BMFA 4OQXA 3ND8A 3BH6A 3VHLB 3AVXA 2V1XA 1YZKA 4RCYA 1JALA 2IS4A 1K6MA 1G19A 3RNLA 2KE5A 2QROA 2UZIR 2BWJA 4JLAA 3HR7A 4IDHA 4JBXA 2O8EB 1WE2A 1DPFA 3CLVA 2OCPA 1TNDA 3A37A 4Q4LA 1KI6B 3FYHA 2ZYUX 4JKYA 4E03A 1IN5A 2IXEA 2GXUA 1JXOA 2X8AA 2QENA 1TU4A 4C7OB 1NJGA 2JJ1A 1VPLA 2V3CC 1XTIA 3BXZA 2WSMA 2ZR9A 1SHZA 3AGQA 4B6EA 3QJYA 1R8QA 2XSZD 3BE4A 2ZTSA 2W6JA 2WJGA 1XJQA 1YE8A 3J81k 2IWHA 4URWR 1QHYA 2IYVA 3BS4A 3K9HA 2O0KA 3RS5A 3ONWA 3DHWC 2DYKA 3C7KA 1GITA 1XEWY 1F2TA 4L16A 3PEVA 4KSCA 2BM0A 3IIJA 2ZSDA 3ZYCA 1VIYA 1L8QA 1Q0UA 1VG0B 1G4UR 5JI2E 2D74A 2ZU0C 3U5ZB 2ZRMA 2V9PA 1FMLA 3B13B 4MYCA 2VSFA 3RRZA 1MT0A 1OIVA 3G5UA 2J0SA 1E2NA 4HUQB 1PV4A 3K9GA 2HJVA 8OHMA 2V4ZA 2ZJOA 1KAGA 4KHZA 2PEZA 1JJVA 4LJ6A 4EJSB 1JQJC 2FN4A 2IYXA 2BDTA 3TE6A 5A4JA 4NKRA 2B8WA 1Q21A 3S1AA 3SC3A 3QE0A 2PH1A 4CEIA 721PA 1KTVA 2A30A 1ZMXA 5JJIA 2O8CA 1E98A 1OFIA 1TEXA 3ZVLA 4IKEA 4CEJB 3V9PA 1AKEA 1SVSA 3NHBA 1HA3A 1A82A 2CLSA 2XEXA 1SXJE 2H57A 3L8YA 1F5NA 2QAJA 4M9SA 2WM9B 4POAA 5EE3A 5FBVB 2XB2A 1EWQA 1J7KA 3E1SA 5AJZA 1HV8A 1T3HA 1Z6XA 2RGXA 2YJTD 4HB2A 1U90A 2DFKB 2ATVA 4G0NA 2HEIA 2DFLA 1GM5A 4BEBA 4WOPA 4C4PA 1E99A 1P9NA 1WMSA 2KI5A 1GKYA 1ZUNB 1LS6A 1N5KA 5HCNA 1RJ9B 2R6CA 3K0AA 4NCHA 1Z0IA 4Z8YA 2WHXA 1G3IA 1NJFA 1NY5A 4GI7A 2IYSA 1T91A 3LVRE 4L15A 2OBMA 1XDBA 2JDID 1Z2AA 5DSZA 2IC5A 4JLBA 1I4DD 3MSXA 3UPUA 4DT1B 5JHHB 1CULC 4Q7LA 5C1BA 1Z07A 4GT1A 1H8ED 2PMDA 1ZUIA 2RAPA 3LDAA 4YQFA 3A4LA 1H8HA 4IXMA 4XVQA 2O5VA 2LCFA 1D5CA 1RRFA 1GG2A 5JRJA 4OK3A 4C0QC 4XD7D 1Q12A 1Z0JA 4Q1CA 4X8MA 2P0EA 2BHRA 2WAYA 2ZI3A 3T06B 4ASUA 1KY3A 4X8LA 4IOLA 1TMKA 5E7MA 1ANKA 3DM5A 1A2KC 2QAGC 3GJ5A 1Q1QA 1T0HB 3DOFA 3EAQA 3BH7A 1TUIA 3BFVA 4NYMR 4AKEA 1XD9A 2QTFA 5KTYA 5BN5A 2RGNC 4HI0E 1Z3IX 2IYZA 1ZW6A 1YQTA 2ERXA 2Q9BA 5EP1A 4TMKA 3HJNA 1GNPA 3V00A 1G8FA 1E1RA 4JSYA 5JJLA 2GWHA 3QXHA 1XTSA 4LJYA 2F43A 2GJSA 3QEOA 1KI9A 1HH4A 1WA5A 1G291 5GVSA 2JA1A 3N5CA 1W48A 3U61B 4LV8B 2J0QA 1SVWA 1IXRC 2CEAA 3I1FA 1FP7A 3CRRA 2Y8EA 4Q4HA 4K81B 3EIHA 1RE0A 2O0HA 3PQCA 2ZSAA 2ZR7A 3QF7A 4IEIA 4LYHA 4MYHA 3TRFA 2GKSA 1GFIA 1CEEA 1BS1A 2I4IA 5F98A 3ADDA 1XZPA 1OLOA 3I32A 1ZC4A 2X2EA 5FTKA 3K0FB 4DCSA 4LJ7A 3SFVA 3K9NA 2QSYA 1P2VA 4A0FA 1OKKD 5B30A 2VA8A 5HKKA 4PQRA 4RY2A 4D4LA 2WPDA 3K09C 1T0JB 2CJWB 4YDHB 3AEZA 1TF5A 1UADA 1GAJA 4FI3C 1CP2A 3NVAA 5GJVC 1R2QA 4A8JA 1MRSA 1BOFA 2PZEA 3KDSE 3X2SA 4KFRA 4M9XA 1KO4A 1T4GA 4DCNA 2XZOA 1U81A 2B7CA 3R9WA 3CPEA 4GSYA 1KMHA 3ICQB 2DY1A 2NIPA 5JECA 5JFGA 3LAWA 4LV5B 4V0KA 1KK0A 1GIAA 5EE5B 4X8HA 3LW7A 3A4NA 2GJAA 4EUNA 4RZ2A 2CL7X 1Z63A 4TMZA 4BZQA 3SJAA 4M1WA 2W6IA 3PVSA 1XX6A 3SU8A 3CZPA 1YZLA 3U3OA 4FCWA 3AV0B 2NO0A 4ZDWA 1CTQA 4MRSA 1VECA 4PSVA 4JVMA 4Q4JA 3QI2A 3MAAC 3FB4A 2IWRA 5KSPA 1W5TA 4TL9A 4LK2A 4DUGA 4F7WA 1KO5A 1XXHB 3K70C 1EGAA 3RC3A 2NTYC 5LPNA 5LDDC 4AYTA 1TQ2A 2ZUDA 1YKSA 2QY9A 2BEKA 1SVLA 5FPYA 1NN1A 3SFZA 1IONA 3M0EA 4WAUA 1F3OA 5F3WB 1Z0AA 2V54A 1DAKA 4TLCA 4ABYA 5KUTA 4B3FX 2AHOA 1XPRA 2AN9A 5FI0B 3BRWD 3IEVA 2OBLA 4FCVA 2QGNA 5G40A 4G5QA 4NTZA 5KO2A 3FVQA 2IF0A 1NMXA 2IXGA 4OJKA 4D0GA 2MSCB 1XPUA 2X77A 4US2R 1TQ6A 4HLQB 3ZIAA 4DRZA 1MABB 1QHHB 1KSGA 3BB1A 3LH5A 5CB6A 4WZ6A 1NI3A 2QP3A 3U60B 3GFTA 3KUDA 4NYIQ 3CWZA 4D4KA 1CR2A 1SGWA 2QZ4A 2ZRJA 3B1YA 2JLZA 4A82A 4CEHB 1KI3A 1SXJC 5FTMA 2R6FA 2QP9X 1NRJB 4YXWA 3UMRA 3SYLA 3B1VA 2EFGA 2XOKD 2ZM5A 4MDEA 3BWDD 4B44A 2J7KA 3SBEA 5GJWC 1F2UA 3X1DA 3Q5DA 3IQXA 1P9WA 3VU9B 2ZRIA 4FW9A 4HYYA 4B33A 1N0WA 2NG1A 3U44A 1KNQA 3LO5A 4PX9A 3A1TA 2DR3A 4TL6A 3VQTA 5KNCA 2XZLA 2JJ8A 1Q57A 3OF5A 3QF4A 4LPSA 1N6HA 4BGDA 5CJ2A 4D6PA 2B92A 1NBMD 4Q4AB 4DC9A 4MRRA 4DB4A 1F60A 2REOA 2EYQA 4QM7A 5L8VA 1OB5A 2P6NA 3SBDA 4PPFA 4JT2A 2ORIA 2IHBA 4H9GA 2HYDA 1Y3AA 2KJQA 4MYUA 4BFUA 4MITA 1D2EA 3RAPR 1KO8A 3A8TA 1P60A 1P2TA 2RHMA 1SVMA 4KCGA 2FX3A 1N6PA 2CXXA 4KYIB 4LGMA 1C4OA 1FUUA 1HEIA 1RFLA 4LV6A 4W5WA 1G8HA 2JATA 2DBYA 4RFSB 1BMFD 3ZVNA 1W7AA 1K8RA 1S8FA 4Q7KA 5CM9C 4JJZA 4D4JA 3CNLA 3RS4A 2GVZC 3ZLJA 4IJMA 4OKSA 1FP6A 1VIAA 3LV8A 5D3MB 2RKOA 4FMDB 1XPOA 1PVOA 3QXXA 1OHHD 1NF3A 2N46A 4P4SA 1IAQA 1OE0A 2E87A 2IEZA 4LHWA 3W3AA 5CLLA 4G5GA 2P5TB 2ZSBA 3IGFA 1LS1A 4KXFB 1G17A 4F4JA 5BXQC 1N5IA 1Z83A 3NWJA 1IN6A 3VKWA 3GFOA 3UMSA 1NVUQ 3SJZA 1DBSA 4B2LA 5L3VA 4L8GA 4PAQA 2VYFA 4F92B 2BMDA 4D4MA 2BBSA 3QKRA 1HURA 2DFNA 1YU9A 3L0OA 1DAEA 3TSWA 3W8RA 4EIWA 2OFWA 4ZV4A 2YC2C 4L9WA 1CR1A 3WHLA 4HAYA 2B7BA 1JECA 2AXNA 1N6IA 2ZJAA 3NIBA 4WZBE 4PC6A 1A5TA 2GF9A 1PZNA 4OI2A 3QVVA 1X8LA 2FSFA 4TSFD 3IO3A 4RZ3A 2B6HA 1ZU4A 1G4AE 3EG5A 5KU1A 3F5FA 1XTJA 2OAQ1 5FPHA 4ZI2A 1DO0A 1W5SA 5DI3B 3B1WA 5IRCD 2H18A 4OHZA 4DLXA 3CF0A 2VHTA 5JEDA 2HT6A 3EZ7A 3UANA 1S9DA 2QMEA 2BCJQ 3ASZA 2QRZA 2QG6A 4C0SA 2Q3MA 2YWEA 2XZPA 4FMCF 4R71A 3ADBA 5LD2B 2QBYA 2K5UA 1J8MF 2OM2A 1FX0B 5KOYA 2DWOA 1KO1A 2IA5A 3NHAA 4EFNA 1PLKA 2REXB 4JLVA 3BIFA 1CRQA 4EDHA 4XWKA 3GLFA 3B60A 1I4LD 4TYQA 1QDEA 1R0XA 1A4RA 3TR5A 1P4SA 1EFRD 1YR6A 2A7QA 3B8HA 3ZZTA 1OH6A 4NYJQ 4NMMA 2ORWA 5TB5A 5KDDA 1M2OB 4PO1A 3BERA 3I5XA 2W83A 4ACBA 3DMNA 1TL7C 5EZ5A 3K0SA 3LLMA 2NMVA 4PHFA 2C03A 3SQXA 2BVNA 4V0MA 1MO5A 3VHXA 2QMHA 3CNNA 4TLEA 3CX7A 5E7IA 3DPUA 2F1HA 2WSSD 3VR5A 2OV2A 1I2DA 1NVVR 1DARA 1E2EA 1W0JA 3DMDA 2F1JA 1H8EA 3HP1A 3NTUA 2LKCA 1FW6A 3LQRA 4KSBA 2R9VA 4HAZA 3GLIE 3QXSA 1NBME 1UBFA 1Y63A 2VP0A 3THWB 1J90A 2GESA 1P72A 3QG1A 1S4QA 2IYYA 2PLFA 2ZR0A 1JJ7A 3MMPA 5TARA 3TAHA 3TMKA 4MYTA 4Q1FA 4E22A 3NH6A 1D9XA 2IYRA 2X1VA 1Z29A 4RD6A 2XTNA 3O8RA 4QJ5A 1J2JA 1P5ZB 4PPGA 1S2MA 4Z51A 2OLJA 5TMPA 5DLQC 2FSIA 3PV0A 2CBZA 2YHSA 2ZE8A 1KK1A 1NLYA 3LA6A 1G3MA 4PAMA 2P6UA 2N1BA 3K0CC 5JS8A 1Q44A 2PJZA 1KK3A 4BUJA 2BJVA 5DIFA 2AD5A 3ZZ0A 4IDNA 2G6BA 1E79A 2R6GA 4Q1EA 3IBYA 3THOA 2KBEA 2YZ2A 3KXIA 4H1UA 4B3BA 4BLOA 3U4QB 3CRW1 4Q1AA 4ZO4A 3BORA 1LFDB 3OEHA 5KPJA 3JVUA 1ZNZA 3T15A 1X8JA 3DVLA 3PUYA 3ADKA 1G64A 5G53C 2J41A 5AJXA 1WRBA 1ZIPA 1W4AA 3AVQA 1E2DA 3OEED 4EQ6B 4OHXA 1I4TD 2ZRGA 2A5FA 1HQCA 3RSLA 3RS0A 3UXMA 4GFDA 2PZFA 1QHGA 4P4UA 4M9ZA 3M6AA 3HYTA 1N25A 1N6OA 2H1LA 1W46A 2V7QD 1MR3F 5DH9A 3OFND 5CYPA 1GL7A 1W2GA 2CL6X 3B9QA 4LRWA 4URYR 1PLLA 2RHDA 3BFXA 4G5OA 3C5CA 2NQ2C 1U9IA 5LB2A 4M21A 4CZ2A 5FOSA 2OFOA 3OIUA 2JLRA 4CRWB 2FFAA 1X6VA 2G0TA 1SULA 3GLHA 3T1QA 3WYAA 5FUVA 2ZUCA 4TTQA 5AJWA 1N6RA 3DL0A 3P32A 2VH5R 3ZVRA 4QRHA 4A2WA 3TH5A 1HT1E 2ZJ2A 3IIMA 4XOIA 1EFCA 2OXRA 3CRMA 1KJYA 4FWTA 4MH0R 3NDPA 2OHFA 3TJZA 2YINC 4EAQA 2VIIA 4IOJA 3WXMA 1XEWX 4LCBA 1FPMA 4JBYA 3U7EB 5IF9A 4DDWA 2GXSA 2VRWA 4ZKEA 3TNFA 1JEDA 1TUEA 4OI1A 3KQKA 4UXHA 3T34A 3WP0A 4LJAA 3THXA 1NN0A 5M04A 2ZS7A 3EC2A 2QPTA 4PPQA 4ON9A 5EUMA 5JZVA 2W2XA 3WYFA 1E2IA 3CRVA 2QL6A 4LJ8A 3O8CA 2AKAB 2HYIC 3OESA 1DAGA 5JWOA 4UJ5A 1US8A 2EWWA 4R2IA 3OE7A 4LC1A 2HLDD 5FBQB 1SQ5A 3VFDA 4B2IA 1E94E 2PLRA 2VP6A 4NL4H 2CCKA 2OG2A 2ZROA 2EFDB 2ANBA 3AGPA 4V03A 1E32A 3K9LA 2YWFA 1DADA 1T3SA 2P3SA 1CRPA 4PANA 2L0XA 1R5NA 1GRNA 3KJIA 3P26A 4S35A 3QUSA 2ODNA 4GP6A 1SXJD 4LHVA 1GDDA 4IVPA 821PA 3M1IA 1CF4A 3REFA 3IKJA 2WMNB 4U7DA 1NMZA 3AVPA 3S1AB 3EX7C 4CEIB 1RRCA 4QXAA 1OIWA 2A5JA 1AS2A 2BKUA 1P6XA 2O8CB 3TUJC 2WWWA 3EA0A 4UXIA 2AWNA 4O2RA 3QSYA 4JSTA 3VTKA 3DZ8A 2F9MA 3KX2A 3BB4A 4TQUS 1E2PA 3GJ0A 1ZYUA 4B2PA 1L4UA 4AYWA 2QTHA 2G77B 1JBKA 1E9EA 4NU0A 1G7RA 1NBMA 4C30A 1KY2A 2FF7A 1LY1A 2HCJB 1GP2A 1W2HA 2D4HA 1FNNA 1Q20A 4L5BA 3PJRA 3H84A 1IXSB 4JLPA 4OI0A 3E2IA 3I92A 3O47A 3K8YA 1UFQA 2CHVA 4JL5A 2ZYVX 3REGA 5CITA 1KK2A 3K0AB 1KOFA 2A5DA 3OAAA 4PSKA 2ZE7A 3EWAA 4AWXA 5E95A 4NE2A 2GCOA 2OBNA 1JNYA 4M1OA 4XSHA 2FEMA 4LX0A 2O52A 3EC1A 2REBA 1GKUB 4AIIA 3WBKA 3JVVA 4I4LA 1YRBA 2GZDA 3QENA 4PHTA 2GEVA 1HTWA 2ZU6A 2JCSA 3QBTA 1ZM7A 1KI8A 4LHYA 4QG7A 2ZRFA 2X19A 1XP8A 3MJRA 3TLXA 3RLFA 3D6TB 1QG4A 5JWHA 5P21A 4AC9A 3VKGA 2FZLA 3RYTC 3SN6A 2F1IA 1SVOA 2FZ4A 4F38A 2KWIA 4YMWA 5KDLA 5FPSA 3ADCA 2QE7D 2PEYA 4LUCA 1ZD1A 2JLVA 4ARZA 3D7MA 1W36B 4EPVA 3FGNA 3DM9B 3T5GA 3C15C 5KNBA 4DDVA 4Q1BA 3HPQA 1G21E 4Q7JB 4XH9B 2C9YA 4GOKA 2NO6A 5EP3A 4BFYA 4FN5A 1K5GA 4M22A 3QKSA 3TW8B 4IDPA 4KFUA 4OQLA 3HWSA 3QPVA 3RWOA 1EFHA 2ZEJA 4PAOA 3GJXC 2ZRHA 2F43B 3WNCA 2H16A 5DN6D 1J99A 1P75A 1PUIA 5F2EA 2CNWD 4RZUA 2J59A 5H1YA 1XD8A 1RVDA 5DNYB 1G20E 2EYUA 4KFTA 4QC2A 3SZRA 2CLCX 4QGGA 2FJUA 2WJIA 3LWNA 2QQEA 4Q4HB 1YHNA 4LSGA 2ZSFA 4Q21A 4C0HA 1M6NA 1L4YA 3BK7A 2ZRKA 1WQ1R 2X2FA 1WP9A 3B5JA 4MRVA 2IUUA 3VR4A 3EARA 3BOSA 2C8VA 4R2HA 3CZQA 5J4LA 2SHKA 4LHXA 2ZI7A 2GA8A 1VYVA 2J7PA 5TY0A 5AR1A 1JR3A 3ETLA 4H1VA 1N6LA 1G3QA 1OF1A 2D2FA 2WWFA 4A9AA 1BYUA 4A8JB 3PCRB 1IJFA 1EFRA 3UATA 3AF1A 2CE7A 4FD2A 1XMVA 1HE1C 1E3MA 1Z6TA 1L7VC 1Z6GA 2IBMA 1KMHB 2GZHA 2R8RA 1G5RA 2FV8A 2DB3A 4D2IA 2FMXA 4O0MA 2CCGA 2JJ2D 2WSSA 2JEOA 3NEJA 3WRXC 2Q0HA 2XTZA 4G5RA 1R6BX 1G41A 5F9FA 4DKXA 4Q4JB 4JYBA 2FFBA 2OLKA 3SYKA 1G8YA 4B3CA 5BYJA 3TSZA 4DSUA 1COWD 4IDOA 5J4HA 1NN5A 3U7FB 3I73A 4D26A 2QAGA 3DKPA 3WMFA 2ZIAA 3TW4A 3IBGA 2IYUA 1W0KA 5EE9A 4MRPA 2F3TA 2RGNA 2YKGA 1N0VC 5C2JB 3CRQA 1FL9A 4FXPA 2BBTA 1KSJA 3U6KA 3GLGB 1ZM2A 3UK6A 3CH5A 2VF7A 2GXQA 4PC2A 4DDTA 3ZS8A 1QVAA 4ZDJA 5FPTA 4N0DA 4MKGA 3Q3JB 1IN4A 1JR6A 4QGAA 5AWFC 1RYFA 1YR7A 3Q72A 4M1SA 2GEUA 1IY2A 421PA 4DSTA 2ZYTX 3EPKA 1XNJA 3AH8A 3Q9LA 4DLWA 4LWZA 2GK7A 2ZYWX 3VR2A 2EW1A 1HY3A 1X3SA 2PX0A 5GJCA 2ZQ5A 2VP4A 3HU2A 2OT3B 5JS7A 1HUQA 2A9KA 2ORVA 3EASA 2C99A 1DTSA 3FMIA 2O8DA 2PJRA 2I3BA 4A2PA 2D62A 5KNDA 4KYUA 1EX6A 3K09A 4JYCA 3R7WB 1F2UB 3LXXA 3D31A 3P27A 2ZRCA 4GP7A 1YZGA 2HUPA 2RGGA 3U44B 1E2KA 1K5DA 3KUCA 4I81A 4NCNA 4RSGA 1W36C 1S1MA 1IN8A 5H70A 4HUTA 4ERNA 2E1RA 3T1TA 1OFHA 1XBTA 1AJEA 4TT3A 3QKTA 4CVNA 3PITA 1CJVC 3BJIC 4NYIR 1OPXA 3KQUA 1E2QA 1XXHE 4NDZA 1KDTA 1YVDA 2JAQA 2ODWA 4PR0A 2CK3A 3RRNA 3ZZUA 1ZD8A 1KSHA 3EXAA 1EFUA 5E4FA 1X8KA 3AKEA 1JXMA 1RYHA 2DWQA 3B7GA 2IYQA 1FTNA 1MH1A 3EWSA 4BFVA 2WWYA 2BKEA 2BJWA 2ZJ8A 1GNRA 1KI7A 1ZUHA 4G3XA 1RRPA 4CEJA 1IBRA 1NG1A 2RGCA 1CJUC 3EIQA 4HLDA 4LYJA 4EJSC 2FFQA 3T5DA 4DDUA 1T3LA 1FTSA 3VR1A 1H65A 1NKSA 2XAUA 1ETUA 3MWJA 1OXXK 4Z54A 1ZC3A 2QRNA 2R62A 4GOXA 2CVFA 1CKEA 5HE8A 3X1XA 3B1XA 1D8TA 4XWOA 2IS1A 3PR1A 3VX3A 4P4SB 3QPUA 4OQMA 3WMGA 5FPKA 4Q66C 2ONJA 4JVLA 1IOZA 3CR8A 2Q9CA 3IDQA 1C1YA 4IVRA 1R5OA 4U00A 3H0KA 4MKIA 1E1QD 2W00A 2HLDA 3LY5A 3OZXA 1GUAA 3A4MA 3CX6A 3VX4A 4ZKDA 2GDJA 4QHSA 4IDQA 3QKRB 3HPRA 5EP2A 2QTVB 2OSBA 4S2EA 5EE0A 4LHZA 1OXUA 4HB4A 4M1YA 3SJCA 1SXJA 2VSOA 3P4YA 5IK2D 1KSFX 3WBJA 1AS3A 3LQQA 4RKFA 1SKYB 2JIZA 2PX3A 5KSOA 5HE9A 2XXAB 4IXNA 5LB4A 4YDSA 2ZAOA 1NLZA 2GILA 3FHOA 4HZUA 2H5EA 2KSQA 4PTLA 4BLSA 4PXAA 2J9RA 1P3JA 2JLYA 1R5BA 2XNDD 1JAHA 5D3QA 2GXAA 3CF6R 3TVDA 1G9XA 1NIPA 4Q7MB 2QBYB 2A5YB 1E2JA 2OO7A 4YMTA 4JKIA 1TTTA 5K8IA 1II9A 1G18A 1OJLA 1ZU5A 2VBCA 3LW8A 4GPTA 4GL2A 1XCPA 5CK5A 2IHYA 5JWRA 1M7HA 2R6DA 4OL0A 3O8DA 1WDTA 3B6EA 3RRMA 4ACAA 5E3HA 3GLFB 1IJEA 4KITB 3AP1A 4N1AA 4B3XA 4LI0A 1E9CA 3NKVA 4NONA 4UNSA 1IN7A 2O8EA 4TMWA 3QVUA 2ZRPA 4PHHA 4F4IA 1QVRA 3U3RA 4D80A 1WBBA 4BLQA 3AVOA 5FI1B 1AM4D 3QQ5A 3LFUA 1ZNWA 5JRZA 4DHEA 2A5GA 2Z4RA 2Z43A 3NH9A 1ZD9A 4RD2A 4Z1MD 5KHOC 3RVBA 5BYKA 4DCUA 1R8SA 1U8ZA 3MGCA 4N3NA 1PUJA 3RC8A 1B23P 1P61B 4Q9IA 4Q9KA 3WY9A 4V0NA 4V0OA 5BN3A 4IW3B 1XJCA 3BGWA 4DLUA 4OK6A 2GBLC 3H86A 4FIDA 4GRAA 4ZIRB 2ZJ5A 1MRNA 3AKDA 2XSZA 2CCJA 2BOVA 3MWYW 4BWYA 4ZCLA 5JHGB 2QSZA 4NYJR 1E9BA 1EX7A 4KI0A 1GZSA 4LBYA 1QHIA 1TX4B 3W6NA 1XEFA 2BMEA 4A92A 4DLVA 1M7BA 4XTRA 2AXPA 2QI9C 4K8OA 2R65A 5JSZA 2I1QA 5JCPA 2WWHA 4B6FA 2WJHA 4CF7A 1FQJA 1UDXA 4OI4A 3GPLA 4HSEA 4GMDA 3FE2A 2BCGY 4C0AC 5IT5A 3UWOA 4L9SA 5C4MA 3AF3A 4FINA 4PC3A 4E09A 2A78A 2WZQA 4N0EA 4KU4A 2H8KA 4W5HA 4F4CA 2G83A 4YMSA 2J3EA 1GL9B 1A2BA 4HAXA 4DVGA 2W6JD 4Q9JA 4OK5A 2QU8A 5K8LA 2G3YA 2AWOA 2DHRA 4KODA 4DIEA 1JI0A 1OXVA 4OHVA 1WF3A 3N2IA 2RGAA 1VCNA 4BRWA 3R9XA 3TVTA 2IT1A 1NY6A 4QBHA 4BECA 2ZJYA 3PUXA 3IPXA 2TMKA 3WRYC 2ZXUA 2HT1A 5AUOB 1BKDR 3DDCA 4WW0A 5JEEA 4QBFA 3L82B 2IL1A 1CLUA 2GRJA 3MFYA 2Q6TA 3NXSA 3GLHB 5FUYA 4EPRA 3F8TA 3U6BA 4DLYA 1U0JA 4URXR 5DHFA 5HR5A 4G01B 4CEHA 5EJEA 2JJ2A 1CBUA 4II7A 1LV7A 1FFHA 1KGDA 4B73A 1VYUA 2V6JA 2ECKA 4UNPA 5B64A 3EPLA 2JDIA 1U94A 3EA5A 5AK0A 1COWA 3U7GA 1S3SA 3TBKA 1T5IA 4JBWA 1S1CA 4I1UA 3A6PC 3GEHA 3THXB 2HF8A 3L43A 1DG1G 3I3SR 3UG7A 1F48A 4PC7A 3TR0A 4XD7A 4XSGA 1KDPA 3K0CA 1A7JA 3A58B 4OJQA 5BN4A 2IYWA 2FWRA 3W34A 2VSXA 1XEXA 1AKYA 1IHUA 2HV8A 4OHWA 5AUNB 1US8B 2WIAA 4I99A 5DO9A 4AYXA 4HATA 5EQTA 5L3QA 4NHOA 5K8UA 1M8PA 3VR3A 1TPZA 2FPLA 2VHCA 3TQCA 1TAGA 4KVAA 3B78A 3KKPA 3N70A 1FMJA 2BM1A 1TF2A 2QA5A 2XGJA 3GFPA 4HDOB 4PC1A 2ZE6A 4B48A 2GAAA 2H7VA 4TTPA 1SZPA 5SZKB 4JLNA 2ANCA 3X1WA 4DSNA 3SYNA 1S0UA 3LLUA 4Q03A 2ZS8A 2GNOA 3AF2A 2PT7A 2XX3A 1H8HD 4QBGB 4KFSA 4XWAA 4XTCS 5GVRA 3K0EA 3HYRA 4NH0A 3VKHA 2ONKA 5HCIA 1YRAA 2GK6A 2YOFA 4OBEA 2RB4A 3GMTA 5K8TA 2P6RA 3IHWA 3RABA 2J0VA 2AR7A 3M4YA 4I1OA 4P32A 3T61A 1WB9A 2WWIA 1GSIA 1E0SA 4QL3A 1W36D 2C78A 4ZPXA 3MLEA 2JLXA 3AM1A 1DAMA 1TEVA 2YOGA 2RGBA 4MDFA 3DEFA 1FZQA 4KV9A 1KAOA 1LW7A 5FTLA 1OKKA 3SQWA 2GJKA 4URZR 1NMYA 2WMOB 1KJWA 1OYWA 3PENA 4US0R 1TADA 2F9LA 3PEYA 3X1YA 1XD2A 2G0NA 4AKGA 4KVGA 2VF8A 4P0TA 4KBGA 1G5TA 1BO6A 1E9AA 1W4CA 1G8GA 1ONBA 4QKQA 1W1WA 5JMTA 3OIWA 2ZRNA 3CIOA 3GCGA 1FOEB 2GCOB 3KTAA 4M53A 4P31A 4Q18A 4BLPA 2DWPA 1Z6YA 2EU8A 1E2FA 1I2MA 1GILA 5EZ6B 3TAUA 3IO5A 4DIDA 4QGFA 2EFHB 2R2AA 3U2QA 4WA7A 2J46A 4B43A 2BBWA 4AG5A 4JLDA 4GDFA 4CYMA 5FOWA 4B3DA 3CO5A 2RCNA 2Z83A 3TQFA 2WPDD 2P2LA 2FU5C 1UJ2A 1KI1A 4GNKA 3W5IA 4A36A 3L0SA 2IYTA 1HT2E 3KB1A 2FSHA 3QPWA 3KXKA 4TMXA 3U3JA 3SI7A 4ARZB 2ODBA 4ILEA 2NO1A 3RRYA 3MCAA 2ASEA 1HQYE 2V8OA 5LD2C 3FKQA 4LC0A 1D2NA 4DXAA 2H17A 4BRUA 3GEEA 4DLTA 1F2TB 3O8BA 4TWZA 1GOTA 1Z22A 2FPMA 4PSAA 5CM8B 3IEUA 2KBFA 4V0LA 1TQDA 3QKSB 3CH4B 1AZSC 2UKDA 1R4AA 1NNEA 4JJKA 4PQYA 2W6ID 5FBRB 4C2TA 2XB4A 1W47A 1KKMA 3CPHA 3ICEA 5FTNA 5FOVA 4P3YA 3CR7A 3RSOA 1P62B 1N6NA 3NBYC 2C5LA 3RANA 4BPBA 1TF7A 4AG6A 4LZZA 2XJ4A 2HXSA 1CJTC 2QORA 2QMUA 3LX8A 1BIFA 2WVJA 4NZYA 3PUZA 4HLUC 5CJPA 2CVHA 2VP2A 4PHGA 1S96A 4TYYA 2NPIA 1VG1A 4RVCA 2XOKA 4JS0A 3W8NA 3ZDQA 1LB1B 3GJ4A 2LKDA 5J40A 3R8FA 5AUPB 1QF9A 3QXCA 1Z5ZA 4NPHA 5EP4A 5FL7D 4TL8A 2CLDX 2D7CA 1EESA 3BBPA 3FKSD 4AKHA 4IOKA 1CU1A 2FPKA 4CW7A 1ZCAA 1N5LA 5H68A 1UBCA 4M4SA 3ZIAD 3HDTA 2B8TA 3CNOA 1E2HA 2HXYA 5IHPA 2J87A 4D25A 3GLIA 2C2HA 4C0LA 5IDVA 1UPTA 2ODEA 2AK2A 2WTUA 1DG3A 1M74A 2MSEB 5J4VA 3NEYA 3QOFA 2VL7A 1JEEA 3VMFA 2QNRA 1JB1A 3EPHA 3R20A 1R0YA 4HAWA 4LOAA 3A1UA 1OT3A 3FMFA 2ZAMA 1Q1BA 1MKYA 1AIPA 4Z1MA 5L3SA 1KHTA 2GJ9A 4QJ3A 3EIEA 4YXWD 3GD7A 5CK4A 1OH7A 2QN6A 3LBHA 4WIAA 1Q22A 2J0UA 1EG7A 5FOTA 4UJ3A 2PMKA 3WMEA 2AFIE 2C98A 5FR1A 4J0QA 2O8FA 4LY6A 1V5WA 1ZRHA 3KJEA 1P2SA 1BMFA 4TZ6A 1E9RA 2QAGB 3I8SA 4DLZA 1N6KA 1B0UA 4KO8A 1KYIA 1VTKA 4LJ9A 2XITA 3UIEA 4Q19A 3A36A 2ZI4A 2G1JA 2G88A 2W58A 1OHHA 2VHJA 4XVRA 1XU4A 1T9HA 2Z4SA 3NBFA 621PA 5JBQA 1KZGB 2CHQA 1ZM3A 3KKMA 5EXPA 2ZRLA 3C4JA 4KJZA 1N0UA 3CONA 3QNUA 4LJ5A 1S9HA 3AVVA 1X86B 2PT5A 3CBQA 1G16A 3SE0A 3ZS9A 4TN1A 2ATXA 3LD9A 4DLRA 3SDZA 2IEYA 3NC0C 4RFVA 3G82C 1ZNXA 3TGPA 2E9SA 1NP6A 4IEEA 5EXSA 3AF0A 1P7CA 4M1TA 4FMDF 1M34E 4MUAA 4TSFA 3AQ4A 4GBMA 2ZETA 3IHLA 4DWJA 1W44A 3BFKA 2O8DB 3GJ6A 4U02A 1RW4A 5AUQA 221PA 3VNVA 4M8NE 1AQUA 4EFMA 5BQ5A 4QFMA 4V02A 4M2LA 2WKQA 4BFXA 2YYZA 2O8BA 4XVUA 5B58C 1YJ5A 4JVSB 4X8OA 4QNRA 1Z08A 4TL7A 2CDNA 3SR0A 2AKYA 4BEJA 3C41J 4Q00A 1E69A 1YZNA 4BFZA 3AVWA 1Z47A 3THYA 4C9BA 3OHMA 4JL8A 4Q47A 4FMCB 2BC9A 2NPFA 2F6RA 1TU3A 1Z06A 1DO2A 1ZVQA 1UKZA 3FDIA 1D6JA 1W4RA 1X1RA 2ZRBA 2AK3A 2BMJA 4PZYA 4NCKA 3EZ6A 3F3YA 1N3BA 2QM7A 3SS8A 4DZZA 2WJVA 3P20A 3DZDA 4TYPA 3V4FA 1XF9A 2GAOA 3Q5EA 3GLGE 1WXQA 5CDFA 2FGJA 4I1SA 1M7GA 1LTQA 3ND9A 3K70B 3X1ZA 2QPAA 3UMFA 2ZREA 5FL3A 3MG9A 1OXTA 4MQBA 1YZUA 1M1YE 4YC7A 3SOPA 5AJVB 4ESVA 4KBFA 2VPPA 1II8A 1VCMA 2WKPA 3KQHA 2ZUBA 3E70C 2QQ0A 4L4UA 1IM2A 3AB3A 2D2EA 2ZS9A 5KPDA 2VEDA 1RZ3A 1JPJA 3W90A 3TSOA 3CB4A 2OFXA 4XJXA 2ZANA 2J5XA 3AUYA 3RS3A 2Q9AA 4GZMA 3PXGA 3Q7PA 4TYNA 4R98A 2GF0A 1DOAA 5JI3E 2QT1A 3GEIA 3L2OB 4B3GA 2WV9A 1U8YA 2RH5A 4TMTA 4TZ0A 4B74A 4M1KA 5J4YA 3T35A 3PIRA 2C9OA 4MKHA 1SXJB 1KI6A 1W0JD 1Z0KA 4CT5A 4A4DA 3HU3A 2Q21A 3U3KA 1FUKA 1OYYA 4C7OA 5KYKA 2MSDB 4BFWA 4KAXA 3IUYA 1XFAA 2DCUA 3EW9A 3OEEA 4F93B 4HZUB 2ZVPX 3HU1A 4JZKA 1DEKA 4ZCIA 1Z6AA 1G6OA 1NG9A 2XTMA 4A0RA 3ZD7A 2PZGA 4E5UA 4ZDIA 2V7QA 1CR0A 4KLZA 1KO7A 5SZJA 1E2GA 1AQYA 1HYQA 1R10A 2ZRAA 3IQWA 3KKOA 3OFNA 1RIFA 4G5SA 4US1R 4F91B 3CF2A 3NBZC 1T8UA 3TUZC 1ZIOA 2JLUA 4DEXA 5JLJA 1GKIA 4TMVA 3KFVA 4TQAA 2G1KA 2EVWX 1U8AA 1E79D 2H92A 2WWGA 3OIYA 4RD3A 4TLBA 4U5XA 5CB8A 1E4YA 3RS7A 4LDJA 3QF4B 2C96A 4A0GA 1NN3A 1E2MA 2OCAA 4FCTA
chains in the Genus database with same CATH superfamily
2ZI5A 2XT6A 5BUCA 2BLLA 1EFTA 1MC4A 3QXGA 1YJ8A 2FFHA 3ESCA 3FI9A 2E5WA 4OHOA 2DQ3A 2FVYA 3EC7A 3KB2A 1VF5B 5ER9A 4E07A 5K3SA 4CDGA 2Y9MB 1DKNA 3IA7A 3T5PA 5FFNA 2CD7A 2G0AA 3BSYA 4H0CA 2VDPB 1F3LA 2VAPA 3FUCA 2XTJA 5JUWA 3G0HA 4DV6O 3SJBA 3T5CA 2BTQA 3WNDA 1A1SA 4QATA 4R7ZA 1KL7A 3A31A 2O3UA 2W6NA 2GBCA 4HB0A 3I09A 5IDWA 4IL5A 2GLXA 2ZDGA 2F8LA 4FS8A 2DN9A 4GMGA 3ROPA 5KA5A 2IDJA 1CY7A 4A2CA 2XVXA 4RACA 1GNTA 4KXUA 3WB9A 3LKZA 1C3LA 4HFRA 3ZDFA 4CLRA 2UUAB 1T5LA 4TXJA 1UCFA 3FUWA 3DV0B 3HDJA 4XEHA 2TYSB 1ADFA 1VSTA 5DASA 1Q7BA 4O4IA 1EB9A 4Q48A 4FDVA 1XKTA 4TLDA 3UMJA 3JAMA 3FUXA 3UHJA 5D1HA 5KMGA 1BWSA 3A9VA 4QEKA 4J4TA 3OP1A 3PRYA 4DAOA 4TM7A 1XEXB 1U3WA 2IUSA 4JGBA 1YRQA 5C8DA 3ZU3A 3RK4A 3SGLA 1EPUA 1KZHA 4EI8A 2AD1A 2NVWA 4NBSA 1LNZA 1EEXB 1N8NA 2XUPA 2VTKA 1C7FA 2OENG 1KUQA 1FS5A 1YR8A 2BUAA 2XVAA 1VHTA 3GJ8A 1KOJA 1IBKO 2HK8A 1QRSA 2TECE 4IHQA 1X1SA 1Q1EA 1ZWIC 2H0RA 4AMGA 1XD2B 2NSYA 3MJTA 5ES4B 1BVHA 2C4TA 5B4UA 5BQOA 5JROA 3PNPA 3V2HA 1XMOB 5LBUA 1YCHA 2IP2A 5T3UA 3VBBA 4Q5IA 1E7SA 2J7PD 3LC0A 1F0KA 3HVHA 4YLEA 2R7AA 2A0LA 5TMBA 4O2LA 3PGJA 4IGAA 1SVIA 2YHBA 1ZAKA 1T1SA 3O84A 2Z5FA 4FMBB 3X44A 3RRFA 4YP0A 1LQUA 5JNUA 1OX4A 2XCRB 4DYHA 4O4LA 2QZ9A 3DE6X 5IEJA 1RLOA 1X94A 4A16A 3CGGA 5E1DA 4OU4A 1OFGA 1LNQA 3I6IA 1XMJA 2GGSA 1FU4A 1RWPA 1TKAA 3GDOA 3T5BA 2O0JA 3FZYA 2VQ3A 3MOSA 2IBSA 2OUIA 5FP0A 4YHHO 5I51A 1FYXA 5AJYA 1ZWKA 1G7CA 1X7YA 3CX5F 1OTXA 2XH8A 4FKBA 1EQAA 4OG2A 5AVJA 3PEWA 3U4MA 1F2VA 3LBAA 1KDOA 3CX8A 1LR1A 1Z0ZA 4NEQA 4B32A 3LF2A 4N76A 4WNAA 4L0DA 2Q0XA 1ZN9A 5JDIA 1AK2A 3X2FA 3BGOS 5AM5A 2Q28A 3AVWA 3CSDA 2OD9A 4PZPA 2X5JO 3ZI0A 5GJBA 3BA9A 1ZINA 4PNPA 5HZKA 1XLWA 2VDJA 4RO2A 1T9DA 1X7ZB 1PJRA 5CTAA 2IUFA 4BVGA 3A1VA 1U99A 4ZVRA 2ICAA 2JJYA 1DV1A 2HBYA 5L3GA 4FOTA 2ILMA 2FEXA 4PBSA 4NCBA 3ZHYA 3U4GA 4DK0A 3QPBA 4XLTA 4DIOA 1RJDA 1HZZC 4OM8A 1Z5VA 1BGVA 4PXYA 5K3CA 3ESZA 4YY3O 3LSUA 3RSQA 5HVNA 2DR0A 2Z0MA 2JH9A 3I9MA 2HJRA 2JBAA 1C5KA 2PBFA 1H1TA 2P9ZA 3KHKA 4EJ6A 1XREA 4FKMA 3RNLA 1UZLA 3WS7A 3DBHA 4JLSA 4WJLA 1T1GA 1ISRA 3KLMX 3EGVA 1X38A 1XROA 2VTDA 2C2OA 3TZHA 1F38A 4RQFA 2KX7A 2R8ZA 4M1QA 3NT2A 1YHQV 3C7KA 3PE3A 4JJ4A 3EXHA 4KSCA 3IIJA 2DPGA 2YDEA 5I7RA 3U5ZB 5DZSA 3KOYA 1GHTA 1BC5A 2ZJOA 3CJHB 3BWEA 2NT3A 4IQ8A 2WJ3A 2PKRA 3CCLV 3HJCA 1K4DC 3EFHA 4EX7A 2GUWA 1WLYA 1SETA 4ZAYA 3QWFA 3SM9A 1SVSA 1KORA 5IAJA 3ZTYA 4P7FA 1ZMBA 3ICOA 5D85A 3GP5A 4W82A 1FLNA 5B7NA 3U26A 5B7GA 4JLBA 1I4DD 1JQ3A 3EIOA 3E22A 2JCXA 1JHXA 4QRIA 1RRFA 2I2DA 2P0EA 3IUSA 1TMKA 2XZTA 5H3HA 3P52A 1XHXA 1PQUA 4FOSA 1TUIA 3BFVA 3AB7A 2RGNC 3KR0A 4DA6A 1ZW6A 1PZEA 2JRLA 3V00A 4JSYA 1XTSA 4D3ZA 3U61B 5F5XA 1EAYA 1M9NA 4O29A 2LDBA 2EW2A 1VE7A 1WV1A 1GFIA 3E82A 2I6FA 1OLOA 3I32A 3D9QX 3RVDA 4IM7A 4M0DA 1TF5A 5DLPA 1H8HG 1JJBA 5FLXA 1KO4A 2XRFA 2C2BA 3ER8A 3LW7A 5GIOE 4RZ2A 3OFVA 1I5YA 2YUAA 3INYA 5DTRA 5ALPA 1FSGA 2NTYC 3STVA 1IZ3A 4MMXB 2WTXA 5FPYA 3SFZA 1T2CA 4UHDA 1DAKA 3BAAA 4MCAA 2CXNA 2IXGA 5K8JB 3N6XA 2PX8A 3C4QA 1QH8B 4QT0A 2WTMA 1MOPA 4U2GA 4NYIQ 1GM8A 2PL5A 3OEYA 3IIEA 1XAGA 2PQ0A 2G80A 1LLQA 2I8CA 3N0RA 4J76A 5IJ9B 5LYJF 2W6PA 1QLJA 1NDQA 3G0IA 5GJWC 3O8LA 3Q5DA 3AG3B 2C4UA 1N0WA 5E6UA 3U44A 2IZ0A 3A1TA 1JLKA 1T10A 4D6PA 3H2SA 3HYSA 2YVQA 4MRRA 1F60A 2MWMA 3LCVB 2P6NA 2V7TA 3NVMB 1DU4A 2JGFA 4YMLA 2WG1A 3UYKA 2DBZA 3ZR4B 5HNKA 2CXXA 1FUUA 5J2UA 4W5WA 5LBTA 4RTMA 3R7AA 2A4KA 3A0UA 3FW1A 4Y6GB 2RKOA 4RUEA 1PBNA 5DM1A 2HMVA 1SCBA 5JALA 5E2AA 4PVDA 3FWNA 2BSQA 4I9UA 3RVJA 4B2LA 5JMOA 2ZKOA 3F4LA 2H65A 3AC0A 3EMKA 2VRCA 3IO3A 2HHJA 1ABEA 5FAKA 3VVMA 2X9NA 2QKAA 2XMDA 1QRTA 1I2CA 1Z2OX 3BWVA 5ESRA 2X5XA 1XVVA 2FMIA 2J3KA 1NC1A 5A4KA 3D3NA 1N1DA 3VMMA 2ETXA 3WIUA 3J7AC 5TB5A 2C0CA 3LLMA 4BYGA 4WPGA 2XAQA 1PK9A 1JP7A 3HP1A 1GN4A 4FFBB 1G59A 3U3XA 2WB2A 3VPBA 2JHAA 1A9ZA 2ZD9A 1OV6A 4QYTA 3O8RA 2GNAA 1S5JA 1Y8CA 4AMUA 4TX1A 1KK3A 2AD5A 3G1UA 3HB4X 4H1UA 1Y8QB 3DMYA 3G71V 5BOVA 2DHQA 2QLMA 4OHXA 3LSSA 2P68A 4GFDA 4X1IB 1QHGA 4X6LA 1I0ZA 1GL7A 2IH2A 1L7PA 5LB2A 4G5OA 2JLRA 1GA1A 5AQEA 4A2WA 1AKWA 3UW1A 1Q7EA 3IIMA 3K15A 5HXAA 1EFCA 3VH3A 1KJYA 2WHPA 5AVQA 1JBEA 4FZ1A 5E2IA 4FYJA 3IOCA 2VRWA 5IDJA 1E1MA 1KYXA 1OYVA 5ED0A 2XDYA 1E5QA 4RM3A 4ARCA 4H4DA 4ZEVA 1D04A 1RXVA 1QLHA 2L0XA 3GT3A 2WAMA 3M6WA 3M1IA 3S1AB 5EOVA 2HU8A 1R0RE 3DZ8A 5BNTA 2VZ8A 4I19A 4U2KA 1NQUA 4TTAA 3EN0A 1ZOLA 1I2ZA 2QYSA 3FAVB 1NQ5A 3NP9A 1OU0A 4MVOA 3M8AA 3CPSA 2L19A 1DFHA 5I9BA 2DFVA 5DGDA 2D59A 3KKYA 1KE1A 2JGDB 2Z3WA 2JCSA 3QBTA 2J3QA 4KAJA 3QVWA 4DPLA 3HR0A 1ETHA 2F1IA 2IQIA 2NZVG 5KDLA 1P7BA 1PL6A 2C94A 5KNDH 1ZD1A 3DT6A 1LBHA 3FCCA 1H1LA 4XH9B 1WPXA 2E7ZA 3SC6A 3WQSB 3ENKA 5CFRA 4ROTA 1XRPA 2CNWD 4RZUA 1WABA 2CLCX 4LY3A 3UCFA 3R6WA 4R1QA 4C0HA 1L4YA 3KLNA 1HSZA 4X44A 4UEQA 2NW6A 2XNHA 3EVTA 3JSXA 3ABIA 1VJTA 2SHKA 4LHXA 3TDKA 4LOHA 4A8JB 3W2FA 4CV0A 5GTHZ 4QU8A 2D5AA 3BQ9A 3NDIA 1JG3A 2J31A 1XUOA 4QQKA 4H60A 1Q0SA 2EJRA 4ZBMA 3AR8A 4JOSA 3LE8A 4DKXA 4JYBA 1UOQA 2OLKA 4FD3A 1PGOA 1SUFA 4DSUA 1RYZA 5E1OA 2W2LD 2VYND 4F1KA 1Z68A 3A6LA 3H5RA 1MAUA 5AK3A 2HEPA 1VIVA 3SLKA 3PZBA 4BTLA 3DDSA 2Q8QA 3RBAA 4V39A 2VF7A 4FGSA 2YZ7A 3CVYA 5AWFC 4PNEA 3IVAA 3Q72A 3EPKA 3UGJA 2FN7A 1PR2A 3Q9LA 5AI6A 3VR2A 2NZ2A 2EW1A 4X61A 2I3BA 4A2PA 1AY0A 5KNDA 4KYUA 1T34A 3R7WB 3ZLVA 5EZYA 1H0HA 4K1XA 1W36C 5IWAO 1OFHA 3BF8A 3NLLA 4CVNA 3U5TA 4JQOA 4HQNA 1YVDA 3NO4A 3N87A 2X8JA 5DIZA 1M5IA 2PZ8A 1EZJA 1FTNA 3GLUA 4BFVA 5DTEA 2XMRA 4O5OA 1QYCA 3IP6A 4N47A 3PPYA 4GSKA 3QH4A 4DDUA 4UVCA 3KJFA 4JUFA 1ETUA 1JG1A 3D2BA 3QPUA 1IHOA 1IOZA 4MMYB 5HZMA 2O6LA 3LY5A 1Y4DE 1XDUA 3GRZA 4UVIA 2F1MA 4BRSA 4X84A 2VUHB 1KD1W 1ECBA 3L4BA 2C4WA 3FFTA 3N53A 3N8IA 3SWWA 1GM7A 1BU5A 2OORA 3ISJA 3OUZA 1CUAA 2P2ZA 5HTOA 5D3QA 4O0LA 2FWAA 1CEXA 1JR9A 2YJNA 4UNSA 3QVUA 3BK1A 5AOAA 3JQ7A 1EA5A 1JFRA 2CTPA 2R7LA 3Q2IA 2AJLI 3BGWA 1J9GA 3P2YA 1Y4UA 1JAXA 4BO5A 1ULUA 5D5HA 2C00A 1ZJYA 1GZSA 3M83A 2DJ5A 5P8WA 2QI9C 1JIVA 1FXUA 3L9XA 1K92A 4F8EA 4F6CA 4H77A 5MN4A 3RRXA 3H2JA 3G8AA 1FMCA 1EN5A 1EU1A 5ALMA 2FR0A 4XX0B 3TAXA 1NVDA 2FZVA 3H8WA 5IVDA 3GGPA 1WUKS 3RTCA 1GN2A 1NQTA 2P7IA 1TFUA 4LXXA 2WU0A 3UV6A 5EJ8A 2Z3VA 3U6BA 2NV2B 1LNSA 2WF6A 5HR5A 4CEHA 5EJEA 5ERYA 2YFKA 1NKDA 3UAZA 5AI9A 5B64A 2R11A 2H2AA 1Z9BA 9ATCA 4X62O 3KSBC 1T5IA 4JBWA 1F6WA 4QVIA 2G4LA 4MX8A 4BMNA 3GV0A 2XOEA 1DJLA 2DUJA 3AUUA 2HV8A 1AKYA 1IHUA 2FY8A 3HJFA 1YCFA 3BHPA 3DF9A 2BM1A 1PEDA 3KUXA 3NHRA 1J5EO 4DSNA 1GAEO 1WUTA 3FOWA 4RF5A 1MV8A 2IU6A 2RFLA 2WEKA 3M4YA 3QFCA 3U4HA 4EG7A 5GM1A 1GFSA 1FSPA 4WN3A 5CXUA 2FMFA 2JFOA 2B37A 3SCZA 3QVLA 7MDHA 3ZCTA 1KJWA 2HU5A 4C08A 3X1YA 3Q3IA 4P0TA 2J6BA 2ZAGA 3PX2A 1Z25A 4RC9A 5JMTA 3D4NA 1T36A 3KTAA 3LYAA 4JCCA 3S2SA 4F9EA 4O8CA 4ISCA 4E46A 4YCJA 2VPWA 2Z83A 1QCDA 5IAAA 3RD5A 3SYRA 3IE0A 4ILEA 3S8YA 4M0KA 3MCAA 3I01A 3PNQA 1A7UA 3ZU5A 1IIBA 4PSAA 1U2DA 3N86A 3RVZA 1T9AA 1QIHA 2CKDA 4CC5A 3ICEA 1ZOOA 2EF0A 4UULA 4LFCB 2AG6A 3GRAA 4PHGA 4RVCA 3R8FA 4KYTA 5H5JA 1XZJA 1A50B 2E4ZA 4MP3A 4QXOA 1V71A 2HXYA 4KL8S 1LUWA 1EJ2A 2RJZA 1Z38A 2D5CA 3TW0A 4NIMA 5DM4A 2CLKB 4MR8B 2II6A 4UARA 2IOFA 1EIZA 3TSAA 4P9NA 4ZCRA 4G4IA 1N4CA 4MROA 2H7YA 3GMDA 4C6RA 4TZ6A 4CF6A 4G5HA 4RQAA 3PS9A 1LRLA 5EQDA 4N41A 1OHHA 4S2UA 5ICSA 4H33A 3R66A 4AMZA 3BY6A 1PYOA 2CHQA 3KKMA 2ZRLA 1S9HA 4QECA 4CL8A 1Z33A 5EC8A 4OXYA 1HNZB 1Q2UA 5EJ4A 3F5MA 2RHTA 3OT1A 2Q7GA 1GD1O 3KDAA 2FX5A 3AQ4A 3VYSB 5ED4A 3VNVA 1WNTA 4M2LA 3ND7A 3F6YA 3D6MA 3ZBQA 3TRDA 1QIFA 2X0FA 4QFDA 3HB5X 1P4GA 3IAS1 3SX2A 4LY0A 3QMMA 2VEOA 1Z06A 3FDIA 4RZSA 3HFJA 3VUFA 4FFKA 5C8YA 4PI0A 5JBIA 2YXYA 3A70A 2BZ1A 3C3PA 2GAOA 3KJQA 2FRVA 2QJWA 2P77A 2GPSA 2VBGA 4MQBA 5AJVB 4KBFA 4N18A 3SPIA 3GGCA 3ECSA 5DX0A 3DDUA 4UOZA 4H4CA 3IDFA 2OFXA 2AUMA 2J5XA 1P0FA 1SCUB 1SQBH 3I2YX 1U8YA 2X0LA 2V74B 3T35A 1JDZA 2RCYA 2Z6UA 4NE7A 1VFPA 3KHSA 4MKZA 1FUKA 1OYYA 2PYDA 1QNLA 4YCBA 5K6AA 2ZVPX 4EGCB 5D01A 1U4NA 1N8RW 4M8SA 1NG9A 1NW4A 2V7QA 3VV3A 1HYQA 1YBAA 1ZIOA 3IAS6 3MAGA 2XUOA 4Q3NA 2RAVA 1NWCA 2EFCB 2QEQA 2QPOA 2H4JA 3OMLA 3SJ7A 5DNAA 2WINI 4LE0A 2OGWA 2BFBA 3A3KA 1Z39A 1ZISA 1P39A 2FPXA 4N8SA 3I83A 4ZMBA 1VKJA 1XBLA 2C9CA 3ANSA 1MJGM 3DKRA 4CNBA 4LYAA 5IJZA 1Z16A 1II0A 2XASA 5REQB 2VOJA 1R16A 2YRXA 4R9UC 3FGZA 4OCZA 1Y48E 2ZRDA 3OFNG 3NDRA 1ZAUA 1PS0A 4W7SA 3EUEA 3BT7A 4C6HA 2JGKA 4MVCA 3WIOA 1P4RA 4XGKA 3L0CA 2H94A 1KIMA 1J09A 4LECA 4AZ0B 2XKBA 3TW6A 3AR3A 4JYAB 5AVRA 1EUDA 3B82A 1JLLA 4REMA 2VHQA 4DV2B 4KQHA 1J1UA 2YMPA 3H5NA 4ZRMA 3FDZA 1NSTA 3LSYA 3RO7A 3OIVA 3AHCA 2E4XA 2QR4A 3V7FA 2GJ8A 2QNIA 1QRAA 2EQBA 1R0WA 1T9GS 2P7HA 1ID8A 1KA9H 4QUHA 2AZ4A 3EVGA 1R7RA 3A0HZ 2CJWA 1EFDN 3TFQA 3TLZA 1VL0A 2FGKA 5LBIA 2L35A 4IX1A 3BAFA 5L3QB 2XDAA 3MB8A 2VNIA 1OC4A 4F6EA 2QXUA 3ESDA 3SHFA 4EJMA 5ER6A 1CR4A 3GLTA 2BHLA 1J25A 3QPCA 4FGZA 3HKEA 3HGMA 2MYNA 4D0NA 3ZHXA 1E58A 1Q3HA 2YI8A 4LBWA 2OYCA 1AXRA 3FKJA 4FQ8A 4QWMA 1LEHA 3VH2A 2L69A 1E7MA 4HEJA 3TIFA 2WABA 5IAOA 2VO1A 3AV3A 5KTOA 4ZCMA 5IC6A 3HA3A 2AG1A 4XYLA 5F33A 1K97A 5C1IA 1G3RA 4QLAA 1O08A 1P7YA 3Q87B 1YACA 4FONA 3ZX6A 5TS2A 4ZO6A 3DTVB 5DT9A 2VUIB 4PA3A 4X3CA 2YOHA 3FN4A 1WDLA 1WU7A 4LOLA 3SKVA 2BV3A 4CT4B 1M0EA 1QGUB 4KUGA 1E2LA 3N9IA 4ZMSA 2O07A 3KJGA 4WECA 1W0KD 2JJ2G 1L7XA 4OGQB 2BTEA 3ZJTA 1DVRA 4CIDA 4GOOD 5JXWA 1E0JA 4E3ZA 1JEQB 1CEYA 5E2BA 1ZSVA 4UC0A 2P41A 4UDXX 5C53B 4C87A 4IYIA 4Y7CA 4LOIA 1PR3A 4X54A 1UDAA 1J5PA 1UOPA 2J0UB 4BMYA 3FDFA 5G3ZA 1DDIA 1ZP6A 4FHGA 1AZLA 2G76A 4AY2A 1KR2A 2N74A 3TTUA 2YW9A 3F97A 5F23A 2ODQA 1FYFA 5ALOA 4EJ2A 1QX4A 3D2AA 5K3FB 4AKIA 2WJYA 4PO8A 1AKMA 3G2JA 4OEHA 3ENWA 4ARIA 1V95A 1QTQA 2YHIA 2MMCA 4DBLC 4RVUA 3I58A 1CY8A 5BWMA 4U4AA 4K46A 1NWHA 3QX8A 1SD5A 4QQRA 3L6RA 2ITDC 4Z5XA 2HCRA 5C7YA 4PYRA 3RHFA 1ILEA 1R6XA 4WSOA 4AMVA 1Y37A 3D0QA 3H3FA 5F52A 5TF0A 4UB6Z 4JLJA 4IH1A 2JKZA 4CLXA 2IPXA 4L4XA 4TROA 5JATA 2CGNA 2J1LA 1E5XA 3TGWA 1T4CB 4E08A 4NDAA 4F3RA 3F7OA 1G8AA 2JASA 2ID9A 2R66A 3MJHA 2OESA 2P9FA 1IOVA 2EJTA 3CKMA 1DEAA 4D79A 1EBBA 3HABA 3WK5A 4OQXA 3SDLA 2MR6A 3BH6A 3VHLB 3AVXA 1YZKA 4RYLA 3T7DA 5K8VA 3CUWA 4NAHA 1K8YB 4MUHA 3S7ZA 2QENA 1CUZA 4HDNB 2XSZD 3RS5A 4P86A 5CM2Z 4L0CA 3JRXA 4RPLA 2Q4BA 1KYWA 1UJMA 1N3LA 2GT1A 5CDTA 2V9PA 1EUCA 5ITVA 3G5UA 2J0SA 5ITSA 4HUQB 3MW8A 3WRVA 1Y82A 1XNQB 3QE0A 1KTVA 4KHPB 5JJIA 1ADJA 5FHQA 3L8DA 1HA3A 2CJPA 3DEAA 1UIRA 1OLXB 2I03A 4YK7A 2DERA 1B6QA 4G0NA 1F4MA 4J1TA 2EGGA 3ML1A 3QLUC 3A0RA 1R88A 5HCNA 3GVXA 3K0AA 3G2KA 1WXXA 1X92A 2Q73A 2WHXA 4BMZA 4L15A 3O90A 4D4HA 4LZJA 3CMEV 4O63O 5E3IA 1CULC 3T52A 1DXYA 3LDAA 2HMWA 5BQPA 2WU8A 2DYSC 3AZOA 4ZRDA 2IIBA 4X60A 4Q1CA 4AW9A 3ZDDA 5KVSA 3VC1A 4YRLA 5FFFA 3BH7A 5KTYA 4DR7B 1XD9A 4HI0E 2XCLA 2M2IA 5TGTA 1L1QA 1KC3A 1YMUA 2XE6A 4QG3A 1XZNA 3N5CA 1R6AA 3W4KA 4AWAA 3BXHA 3S2YA 4BP3A 3FJ1A 3JQAA 2PD4A 1CYEA 2Y8EA 1I5OA 3OIDA 3EIHA 4R8RA 3UC5A 3ADDA 4DR2O 1VL1A 1J2EA 3BMCB 2X2EA 3IMGA 5L7TA 4CCYA 2PMBA 4RY2A 3FHLA 2WPDA 1T0JB 2C07A 3KG2A 1WY7A 3R9WA 3F6BX 4GSYA 4LNHA 3SS9X 2ZXWC 1DOHA 2BW0A 3NGLA 4TZTA 3PL5A 3KIPA 2AJDA 4FCWA 3CRNA 4JVMA 1AJNA 1RI5A 4TTIA 2I54A 1G98A 3HP7A 3SOZA 4LNAA 1NBAA 1F1BA 1L1EA 3FVQA 4B6GA 1HXHA 5CVTA 2X77A 4DRZA 4UFZA 4X1KB 1VRVA 5A7FA 2QRVB 4X66B 4FB4A 4MUNA 4CQMA 2QP9X 4JJIA 3TCXB 3O83A 1QF7A 1O9BA 3K9QO 2GHYA 1LZKA 1PFWA 3TXQA 1QKJA 4MR9B 4I4IA 3RF6A 5CVUA 3MMNA 3UJBA 3M82A 3WU2Z 4G9GA 2WSLA 3BCHA 2DFPA 3I30X 4RU1A 4A8TA 3S44A 2ZTUA 1NW9B 4ZVNA 4KPFC 4EBBA 1IHYA 1VIAA 4CI0B 2F4VB 3N75A 4KXFB 5BXQC 2IHJA 3NWJA 3VNSA 1SBHA 2BM8A 1MEJA 4F2HA 2HJDA 4CM9D 3GBVA 4LZPA 3ZDBA 2PVPA 1PZNA 1W1IA 3HZHA 4I9QA 3O3OB 2LP4Y 1K7EB 3WG7B 4U2FA 2UUBB 1TA8A 3BE5A 1ICEA 2EG5A 3K9FC 3TLBA 3HJTA 4EHIA 1UK9A 2PUSA 4HFJA 2I29A 2DWOA 5HYVA 1E3TA 3PFWO 1CP3A 4MVJI 4TYQA 3EGDA 3B8HA 1JN0A 1RQPA 1U0EA 3PA8A 4ACBA 3UKMA 5EZ5A 3LZCA 3GUYA 3L49A 5E0OA 1GPUA 2YV2A 2JFBA 1EEHA 3D81A 2XE4A 3MMPA 1Q6UA 2GYYA 4EB6B 2IYRA 4IDAA 1J2JA 1VE9A 3I53A 4PNZA 5CYFA 5F21A 4U5QA 3L1HA 3WBBA 3NBMA 3T0FA 2RCVA 5EKUA 3RYHB 2YZ2A 3KXIA 4MW7A 4R7GA 4XUGB 3U4QB 3CRW1 4ZO4A 1T24A 3HA2A 4U1RA 1X7WB 5AJXA 1KJ9A 2YYAA 1VQ5V 2QVYX 1USVA 2P4EA 2ZRGA 3JWEA 3L74H 3M7MX 2OQVA 2OTCA 4PCLA 2QD5A 3GEMA 4D5EA 3QVKA 4MLCA 2OFOA 3GLHA 1RCTE 4NBUA 1RHRA 2NU9B 2I4TA 1NH2B 3DL0A 2PWBA 4K0KO 4DANA 5LBQA 1QH9A 4FWTA 4DLLA 3NTOA 1E64A 4LJKA 2R4UA 2RIPA 4AUKA 1NTMH 4OI1A 5FWXA 3UBTA 5M04A 1R6NA 4UCOA 3CRVA 4URHA 1GNLA 1VBFA 1SD2A 1E94E 1XVAA 2VP6A 1SBTA 3VNAA 4FPPA 3IXLA 4UZFA 1MNGA 1FBNA 4RTKA 4A0SA 821PA 2RBGA 5EXEA 3FCOA 2VDRB 4JI5O 3N39C 1DRVA 4QXAA 1DRKA 1S2DA 4IUDS 3EA0A 2BFOA 5EMLA 5DDIP 3BA8A 2BH9A 4B3MB 3NHJA 2PXCA 3E2PA 3F7TA 1W6UA 2QVXX 4UUPA 1ZRSA 4BGUA 4NJEA 4ZKIA 3O47A 2ZM6B 1G2QA 1EINA 1HEUA 2IPMA 1KOFA 3ESQA 2OK7A 4MULA 3OMXA 1FXSA 3A3OA 3DL4A 1UFIA 4GUDA 2HMYB 1SB9A 3RYTC 2FZ5A 3UO2A 4RAIA 4AJLA 2I80A 1ICIA 4EPVA 3C15C 3CZ9A 3WGMA 4ZK2A 2NO6A 5EP3A 7AT1A 4I0WB 3DAYA 2WLNA 3ABKB 3E9EA 1P75A 4WZAA 3OHSX 5H1YA 3SR3A 3SZRA 5ECYA 1YHNA 4MPJA 4OUDB 4AJ4A 4P53A 3BRSA 2X2FA 1PR0A 1WP9A 1XNGA 5KOIA 4H1WA 3QTLA 3VO2A 2EX0A 5EC1C 3TLYA 2BR4A 4NBRA 1Z6TA 1ODJA 2H5IA 2XE8A 2FV8A 1Z8NA 1IUKA 3RV3A 2YRWA 2D13A 3WRXC 3IBFA 5B3AA 1QIDA 5F9FA 1PFUA 4DWOA 1RQRA 5BYJA 2BP7A 1COWD 1CUEA 3ABMB 1X15A 4YAFA 4MRPA 4EX6A 2YKGA 3A9SA 5COBA 1GCIA 2P90A 4LJLA 1BE3H 3RYFB 5EJ9A 4LTNA 1XLUA 4X1OA 5EYPB 4JWTA 3PNLA 1JYFA 4LF5O 421PA 2QWQB 2EAUA 4ETWA 3W05A 3HCFA 4RPCA 2E2WA 2SKEA 1R6DA 1RBZA 1K3FA 2PKCA 5C8ZA 1SHLA 4ALMA 4LHEA 1YZGA 4R8LA 1HFWA 2E1RA 4D96A 2VJCA 3SY8A 3STZC 2H11A 3RSHA 1GSOA 4ZVOA 1UMCA 1JFLA 5EGNA 3UJPA 1QIEA 1V8DA 4FFRA 1TD1A 4G3XA 2SCUA 2X6CA 4YASA 4DCPA 5G0UA 5EINA 2WIKA 4Z0HO 4TQFA 4EFEA 2HHHO 4L4SA 1E1RG 3ELDA 3F6SA 3KYIB 1CKEA 3SC2B 1G20A 4XWOA 2IS1A 2Y66A 3WGTA 4OQMA 4IG4A 4MI3A 1H0RA 1NNI1 2ZYIA 3DE1X 4TKZA 3E2EA 4C14A 4RCVA 3H4TA 3UW3A 2DQZA 1OOEA 4IXNA 1AOXA 2IIVA 2O7QA 1G0OA 1XU7A 4U63A 2YIDA 1QYXA 1XUQA 4UPEA 1NSYA 3OPVA 1L1FA 4GL2A 2A9VA 3PPIA 3DDNA 4FT4A 4GHWA 2Z8YA 3RRMA 1HLPA 4HGRA 1C3EA 2HPHA 2C5SA 2O8EA 4LQLA 3AIMA 5EWLA 3IP3A 2XAJA 3U3RA 2C3PA 3KNZA 1T1JA 4R51A 2YIAA 4DIFA 4YUWA 2KYRA 2A5GA 2ADOA 1DPGA 2R7KA 1NTOA 4HH4A 3VSAA 4EHLA 5JS1A 3D3KA 5F5NA 4GRAA 3OD1A 2CCJA 2LXNA 4NYJR 4DMCA 5CFPA 2ZT5A 1OAOA 1O95A 4LBYA 3OT7A 5DRYA 1XK7A 2AXPA 3C2QA 1A4IA 4B6FA 4ZC1A 4HSEA 1MQ8B 1UINA 4MVRA 1SCJA 4PC3A 1NXOA 1J8FA 2H8KA 3D3JA 4DQXA 5EKSA 1GL9B 4Z7OB 4OHVA 1V39A 3QLVC 2RGAA 4HRYA 3W7AA 4QYWA 4ZO9A 3EIUA 1QFMA 3MJDA 4FHDA 4WFKA 1RP1A 2HIAA 5LQAA 4DR4O 2W2QA 4LR3A 4QOEA 4QBKA 1XG5A 4JOCA 4LRYA 2PX4A 1T2DA 3FPLA 3OD4A 3R3XA 4XXHA 4I9FA 4MS1B 3O0DA 4IXTA 3TBKA 2WDPA 5KOHB 3A6PC 4I8DA 2E74B 6GPBA 3AG3C 1LC3A 1IZ9A 3AIIA 2FWRA 3IEKA 3KVRA 3HKBA 2YUTA 3PICA 3APOA 3UMMA 3SYQA 3K2BA 4GZ6A 3B78A 3D5TA 1RI3A 3N74A 4CMCA 2ZJ4A 3J80A 4JLNA 3R44A 3LLUA 4C43A 1PV2A 4KXQA 5A06A 1S01A 1NVFA 1Q92A 1AP5A 2J0VA 4DR5O 2C9BA 1GSIA 2CH7A 1W36D 5DLEA 3AM1A 4MDFA 2FXIA 2XIQA 5U1PA 3T1HB 2GBFA 3ZDYB 4ZOBA 3MBKA 4G5XA 2H29A 1VSUA 3WL5A 2VNAA 5F1OA 4QIWF 3RASA 3ZIDA 4KKVA 5AXCA 3LG2A 1EFVB 2J5QA 1W1WA 4XGIA 3TWOA 5T6BA 2IH4A 2I4OA 3OO1A 1XAJA 1C0KA 4B43A 1EVEA 2ZR3A 4FLXA 4YRGA 3ENNA 5IJXA 1SCDA 3G2HA 3V7UA 2ODBA 2V8OA 4IGFA 2D4AA 1Y6XA 4IILA 4FT2A 1F2TB 4RS4A 5PGMA 4JJKA 4RTRA 3RR2A 4UU7A 3BABA 4LZZA 2GCIA 3I42A 2H2DA 1IXMA 3MWGA 3IESA 2XOKA 1L5HA 1LB1B 3RROA 5H3CA 3IQZA 4KQGA 4E2YA 1TM5E 3QXCA 1Z26A 2NAPA 2BELA 1LDBA 3O03A 1Q0LA 4EEXA 3OZCA 3HDTA 3DDZX 3I9LA 1ULTA 5HSGA 4IXWA 3C3BA 1Y9JA 4FQ5A 1ZVMA 2Q50A 4B46A 1G2PA 4PYOA 4Z1MA 4DV3O 2QN6A 1C1XA 3JALB 3B6KA 2AFIE 4J0QA 2O8FA 2OO5C 3I8SA 3IVMA 4L5AA 1N6KA 1F8GA 2HRRA 3UIEA 4JI4O 2FPWA 4RNDB 2ONYA 2H1CA 3K0KA 1XU4A 2O0LA 1MX9A 4JX8A 2WJ4A 4L74A 3R23A 5DHRA 3CONA 3FPGA 3LM8A 1X86B 3IP5A 1G8KA 1CPYA 3SXUB 4DLRA 5CNIA 1I7DA 1Z36A 2RI0A 1ZH2A 3DNFA 2JFVA 4ZWNA 4PGFA 4NG5A 221PA 1H2ZA 1CJCA 1BJRE 2EZTA 1RM1B 3KV3O 4U6QA 4JVSB 2NSDA 2AN4A 3C41J 3G2OA 4PLZA 2IPLA 3OHMA 2XADA 4JL8A 5HG0A 1EI9A 2RC6A 2XT9A 2ZRBA 2AK3A 4C7MA 2H1SA 3I04A 5I9LA 2H08A 2VWGA 3RT1A 4PHCA 4ZP1A 3IFXA 4TYPA 1WXQA 1LTQA 5LXTA 5FL3A 1VRWA 1OXTA 1NHWA 1B41A 2I7DA 2R97A 2WUGA 2ZUBA 3KQHA 2EFJA 1T29A 1RLJA 1JPJA 1DINA 3GMSA 4MEJA 3SSMA 3CVOA 1W30A 1ZK1A 4IYJA 2P6JA 4NJMB 3V34A 3F9RA 2X1HA 4QOFA 4CT5A 5H9CA 4IEFB 4YAEA 4ZV7A 2I2WA 1J2RA 4M9RA 2AF4C 3VBEA 2M32A 4LVUA 3IELA 5E1BA 1CR0A 1E2GA 3LMKA 1DIBA 1UBJS 5LA6A 4ROSA 1KBZA 2JLUA 1D0IA 4ALIA 2O05A 3OEHD 4FCTA 4G8JA 2BRUC 4MVXA 2FA9A 1J07A 4BL5A 1MV5A 1M2NA 2FMUA 4EJSA 4L4RA 3CYOA 3VU1A 4F86A 2JPDA 2GUZB 1GEGA 3EVCA 1SBQA 2HH9A 4PFQA 3VXKA 4FLTA 3ONVA 3GUVA 2GM4A 1X7DA 3NHMA 4MGYR 1EZVH 3SIRA 1N5JA 4ITVA 2G4VA 2PFKA 1VMAA 1JQLB 4A8JC 3VI4B 3IPRA 4IP0A 4KQIA 2PGIA 3AI3A 4IGGA 3VGPA 2JB9A 5DM2A 3PHLA 3Q3CA 5JZOA 2HMSA 3BILA 1V8FA 5FL7A 4Y2GA 4R68A 5IM4A 1QTNA 2J5KA 1ZH8A 4TKLA 5FR2A 3SIXA 3OPYA 1KBHA 3DOOA 4YWHA 2VJPA 2QVBA 1LH0A 4MVWA 4HGNA 3CCEV 1TYEB 1XMXA 3T12A 5A0VA 1FB5A 1U8UA 2VKTA 3QE3A 3BSFA 2YIBD 1QCYA 1DF4A 3IAHA 1A1VA 1YI0A 1OGJA 3RVQA 4R2JA 4IZOA 1MA1A 2W0XA 3FFBA 4CPDA 1OBHA 1ZL8B 3BCRA 4Z4HA 3UJCA 1TMGE 3Q9SA 1PWXA 4HDKA 4WNYA 4WLFA 3H7AA 1CJKC 2FLVA 4E31A 4PZLA 2OUKA 1M73E 2ODPA 3CUKA 2FPPA 1PAUA 2R8PA 1GPH1 3PGMA 5TXGA 4JI7O 3NGXA 4YIHA 3L3BA 1H4TA 2QRLA 3QZUA 4NU8X 4A73A 4QDXA 2PR7A 3PX7A 4KNWA 3IOEA 1CZRA 4YJ3A 1QHNA 4WCEV 3L0PA 3P0HA 1TGOA 4KIWA 1ZCZA 1Q0RA 3UM9A 5CCEA 5B57C 2P91A 4NKGB 3VR4D 2ZIOA 4GUNA 1TM4E 3DULA 4RA6A 5LUAA 5CURA 3WKBA 7REQB 4C1NA 1ISJA 4HNUA 5HWSA 2JLAA 1IBLO 1XAHA 2Z08A 1PWEA 3DS8A 1QZ3A 1FE8A 2QWRB 5L51A 1ZPDA 3KQPA 3SEAA 1IATA 3DEKA 3FPAA 3AHEA 4J94A 3V8VA 1XWFA 5JMWA 1BN7A 2IZZA 5LHIA 4TWAA 2ZB2A 4MRNA 2PF4E 4LSWA 3UXYA 3SG0A 3U1TA 1KOLA 1U7ZA 3ORYA 4H6VA 5KHKA 1NLFA 3EZ2A 1BE0A 3DUFB 4R7TA 4IRUB 3B40A 3D64A 3MWKA 1YDWA 5KS2A 2P9HA