3EXAA

Crystal structure of the full-length trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
303
Chain Sequence
KEKLVAIVGPTAVGKTKTSVMLAKRLNGEVISGDSMQVYRGMDIGTAKITAEEMDGVPHHLIDIKDPSESFSVADFQDLATPLITEIHERGRLPFLVGGTGLYVNAVIHQFNLGDIRADEDYRHELEAFVNSYGVQALHDKLSKIDPKAAAAIHPNNYRRVIRALEIIKLTGSPYNLVMIGLTMERDVLYDRINRRVDQMVEEGLIDEAKKLYDRGIRDCQSVQAIGYKEMYDYLDGNVTLEEAIDTLKRNSRRYAKRQLTWFRNKANVTWFDMTDVDFDKKIMEIHNFIAGKLEEKSKLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title Crystal structure of the full-length tRNA isopentenylpyrophosphate transferase (BH2366) from Bacillus halodurans, Northeast Structural Genomics Consortium target BhR41.
rcsb
source organism Bacillus halodurans
molecule tags Transferase
total genus 98
structure length 303
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.890 Mainly Alpha Orthogonal Bundle Helix Hairpins Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 3exaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3exaA01
4ARZA 1G7CA 2BV3A 3FPAA 1VG0B 3EZ9A 5AR1A 3RAPR 5KNBA 4RZXA 5J4HA 4HAUA 5JHHB 1O87A 1SVMA 1IXRC 5TXGA 2JJ8A 3U4QB 2A5DA 2O0HA 3IEUA 1YR9A 2WVJA 1U90A 3LBNA 4B47A 2XB2A 2GESA 1HT2E 3IQWA 1IN7A 5BXQC 2ZETA 4URXR 4U5XA 2AFIE 2ZYVX 3IHLA 4Q4JA 1L8QA 1UBFA 3ECCA 4EPYA 2IYVA 1SVKA 1BMFD 1M6NA 5EE1A 3ZS9A 3U3KA 1FP6A 1SXJB 4Q00A 1OYWA 2WSSA 2G1KA 1W44A 4Q9JA 4IVQA 1NF3A 1WBBA 2R6FA 1G3IA 3BH6A 4AYXA 4D81A 4LJAA 1T5IA 3GJ3A 4JZKA 1XTJA 1YU9A 1W5SA 2D2FA 1KO8A 2HF8A 4XVQA 5EP4A 3V9PA 1UFQA 2FG5A 3LVRE 4JL5A 3CF6R 3SYLA 4G5OA 1N2CE 2IWHA 1BO6A 2GF9A 3GJ8A 1U8AA 1F6BA 4DVGA 3QXJA 2YC2C 4LPKA 2MMGA 1E2JA 2OCYC 2QAGC 5UKDA 4IVRA 1Z0FA 4QRHA 4B3DA 5TY0A 3QENA 4TYQA 3ZS8A 5JEDA 3GEIA 3WBJA 3T06B 1S1CA 4V02A 1W36B 1YHNA 1R5BA 1W4BA 3GD7A 1EX6A 2IA5A 2JGNA 3EXAA 1CR2A 1QHHA 1ZIOA 4PAMA 4ZDKA 3NC1C 2QMUA 3MMPA 3PUWA 2FV8A 4NPHA 4LSGA 5AJVB 5AJXA 3TVTA 3X1YA 3IHWA 3QG5A 4DCSA 2FGKA 1MO6A 3EARA 2ZE6A 2OE2A 3VFDA 1G1MA 4F93B 5L3SB 2PCJA 3AEZA 3OFNA 4MUAA 3VHXA 5JECA 2JLRA 2VP0A 2Z4RA 3CRQA 3GLIA 3TUZC 3TGPA 3H84A 1P7CA 2H17A 4LYAA 4PFSA 4AD8A 1OB2A 3KQKA 1S96A 3F5FA 1J99A 5KDLA 3WMGA 3AH8A 1QDEA 1GNPA 5B2ZA 5FFMA 5FH9A 2XJ4A 1C1YA 4E03A 3O8CA 1U8ZA 1XCPA 2BCJQ 4RD0A 5KOYA 2YOHA 4WBSA 2F43A 1E79A 3MG9A 4PAQA 5BQ5A 1DAHA 2ZSDA 2HF9A 2YYZA 3QF4A 4Q02A 5KNDA 5CB8A 3AVVA 3I4LA 1AJEA 2BBOA 4PHFA 4O25A 1NP6A 2OUKA 2V8OA 3ZIAA 5DYIA 2H57A 2RB4A 5L3VA 1F2TA 2GKSA 3NBYC 4TTQA 1ZM3A 2CNWA 1G5PA 4G5RA 3RS7A 3TSZA 1UAAA 2GXSA 3VR3A 3NIBA 3X1DA 4QM6A 5L3RA 1TPZA 2D7CA 2PZFA 1OSNA 3SJAA 4R71A 5CLLA 1HURA 3KXKA 1GTVA 1E2PA 1VDZA 1L4UA 4KXFB 4ZDWA 4B3GA 2H92A 3NC0C 1SVWA 4A0HA 1M8PA 4CEJB 5IRCD 3IO5A 2O8FB 4LI0A 4YMTA 1FP7A 1N5KA 1Z06A 3C4JA 4JBYA 2Z43A 2P6NA 2MSCB 4MRPA 4AURA 1TAGA 1XRJA 4NONA 1YE8A 1AS3A 2KBEA 5CYOA 2B21A 1T8TA 1UDXA 2VF8A 4GOJA 2QUZA 1OKKA 1TQ4A 3KJIA 3BFVA 2PEYA 3AGQA 5CK5A 3AVOA 1GM5A 8OHMA 1VG1A 1XTSA 2CNWD 2FEOA 2ZROA 1NLYA 3BIFA 3ZQ6A 2GEUA 4MQBA 2IUSA 2P0EA 4IOLA 1EFUA 5AUNB 4Z1MD 1XPRA 3EX7C 2RMKA 1DPFA 4V0MA 2F1HA 2VP5A 1XMJA 3SE0A 5EXPA 3T61A 4DXAA 1TEVA 3CW2A 1RIFA 3RSLA 3SYKA 1MRSA 1YR7A 4EJSB 2NIPA 4AK9A 5HKKA 1JQJC 1ZUNB 2R44A 4TN1A 1UBCA 4JL8A 4OI4A 1LTQA 2E1RA 3CNOA 1VECA 5H68A 2J1LA 1R0YA 2NO7A 1JB1A 1KI8A 2FZLA 2PZGA 4OHVA 4Q1CA 4X8HA 2CL6X 4KCGA 4NMMA 4Q4HA 3EPHA 2JLXA 2PLRA 4PQYA 1P72A 4DEXA 2RGCA 1YR8A 4PO8A 1RW4A 5EE0A 4LZZA 2VHCA 2ZRNA 5FTLA 3R9XA 3OESA 2XXAA 1XF9A 4ZCLA 3S1AA 3P32A 3ADCA 1Z47A 4LC0A 1OFTA 3B1XA 1J8YF 2WV9A 4IVPA 1D2NA 1YZGA 4JS0A 3TSWA 3L8YA 3IO3A 3TJZA 2GDJA 1J70A 4R9UC 1SULA 1NY6A 4A1FA 4HAVA 3DKVA 5K8LA 4HUTA 4Q01A 1A82A 1OXUA 1JXOA 2C5LA 2HLDD 2VQSA 4HB3A 1GAJA 2ZUCA 3V4FA 3W34A 2V54A 3RC8A 4RCZA 1TUIA 1BYUA 1XZQA 2BKUA 2OFWA 3CF2A 1W1WA 4CZ2A 1G7SA 1WDTA 2REOA 2H16A 1XEWY 3IPYA 2XXAB 1B0UA 3F8TA 4QOSA 1SHKA 3HR8A 4QC2A 3BWDD 2OILA 4BPBA 4B44A 1P73A 1VIAA 1QBKC 2YOFA 3NHBA 1X8JA 2IT1A 2V55B 4TQUS 1GNRA 1ZINA 2TMKA 4DLVA 4CEHA 3TQFA 2GTPA 4Q1FA 5TDHA 1XEXA 1H65A 5GJWC 1N6OA 1AK2A 2BJWA 2XSZA 4B2PA 4KI0A 1KI7A 5A4JA 4OK6A 4M9XA 1BS1A 3QVUA 3KUDA 4A8JB 3P20A 4AYWA 4C0SA 1XPOA 1WRBA 2D06A 5AJZA 1T91A 5FUXA 2QAJA 2ZSFA 4YXWD 4LJ5A 4LYJA 2Q9CA 4ZDIA 4PTLA 2G9NA 2QPTA 4RZ2A 1E0JA 1K5DA 3GLHE 1TNDA 3C16C 1D6JA 2FFBA 2X2FA 5CJPA 3SEAA 1M34E 1RJ9B 2VPPA 2YJTD 4R98A 5JJIA 3LLMA 2FDCA 4NU0A 1G8HA 2XX3A 4JLPA 4EFLA 4H9GA 1R2QA 1NN5A 2DWQA 4RD3A 2ATVA 2FSHA 4GP7A 4P4SB 2X19A 2NGRA 2G77B 5JI2E 2ZI3A 1PLJA 5H1YA 3GEEA 2ODNA 2YKGA 4MKGA 1II8B 2J59A 5EUMA 4CF7A 4AI6A 1JR3D 1MT0A 2V1UA 4CW7A 2EVWX 2F7SA 1FZQA 4A6XA 2O8EB 4KSBA 4RZ3A 3AVWA 4JVMA 2GBLC 5DO9A 5G41A 4DJTA 2RGNC 3LO5A 3NEJA 3U44B 3JVVA 2V7QA 4NCHA 5CIQA 3QKTA 4PC2A 1Z07A 2C96A 2CL0X 4FIDA 3IPXA 1KDRA 4G01B 5FBWB 2GA8A 4A0RA 4MYHA 3VNUA 2NTYC 1A4RA 1TU4A 2IEZA 4URZR 5KSZA 3CX6A 521PA 2J7PD 3EW9A 4TLDA 3HWSA 4UKDA 1D2MA 3O8DA 1I2MA 4W9MC 2ZAMA 5D3MA 3K0CA 4ZCIA 5AJYA 3FKQA 2AWOA 4M8NE 5C4MA 3H1TA 5FOTA 1WB9A 1YVDA 2ZJ2A 1XEFA 3BH0A 2OESA 4PR0A 3LX8A 2ZR0A 1VPLA 1U9IA 1T0HB 1E4YA 3LWNA 4HLQB 4AG6A 1GL7A 1P6XA 2QSZA 2LWIA 3DM9B 3KJEA 1M7BA 1A2BA 2VBCA 2HT6A 1L2TA 1ESMA 4LPSA 5JLJA 2J0UA 3TK1A 1N25A 1OW3B 1CULC 4GRAA 2V7QD 2JIZA 1S2MA 1OFUX 3MWKA 4BFVA 1EFRD 3QPWA 1DO2A 2GWHA 1G3QA 5FL7A 3AVQA 2XNDD 3DPUA 4Z8XA 2IX3A 1QHSA 1BOFA 1XJQA 4CIDA 2CLSA 2QE7D 5C4GB 1NN1A 2F3TA 2UZ3A 2QEQA 3MGCA 2QTHA 4US2R 4MGZR 4PC3A 2ZE7A 1KI6A 1Q3TA 3VAAA 2ZS7A 3NEYA 4QBIA 4QL3A 2WJVA 3PUYA 4URWR 4ZI3A 4A2QA 2D4HA 1Q21A 2HT1A 2IF0A 4R2HA 4B43A 3NBFA 2FF7A 2ZS8A 4M21A 4KJZA 4GL2A 3OIVA 3GJ7A 2BBWA 4TLCA 3T5DA 3W6NA 3NG1A 1KGDA 4PPFA 1KHTA 4D4LA 4ITRC 2NO6A 2BIFA 2IXFA 4L4UA 3MRSA 3MCAA 1NSFA 3V4RA 2QQ0A 4MGIR 3DO6A 2JIZD 2YC4C 2J0VA 2BMDA 3W5IA 2ORIA 2E87A 2QL6A 3D8BA 1VCNA 1IQPA 2ZI4A 4GBMA 4F7WA 5J4YA 4AC9A 1DAMA 3BB1A 2AR7A 1KK1A 1AS0A 4D25A 3PEUA 3VR5A 1TTTA 4Q7KA 4J0QA 2EFEB 4BQSA 2BWJA 5AJWA 4H1VA 4FINA 1UADA 3Q7PA 1NMYA 4NCNA 3QNUA 3FMFA 4KLZA 1JAIA 3C5HA 1D8TA 2QAGA 3NWJA 4RKFA 4BEBA 2OBLA 3A1VA 3C7KA 3SFVA 1ZMXA 2F6RA 2XZLA 4HZUB 2RGXA 3FKSD 5DISB 1JEDA 2R6CA 2PBRA 4OQMA 4PQFA 1E9FA 2B92A 4M4SA 1I4TD 3B1ZA 4EPRA 4EPTA 3FB4A 2FMXA 1NKSA 1FQKA 1KO7A 3P27A 1XMVA 4Q47A 1XWIA 1Z2CA 2PMKA 4KFTA 1JNYA 1LV7A 2C95A 4X8OA 4JJKA 4UXHA 2ZSEA 2JLUA 3NTUA 2EQBA 2OT3B 3RABA 1OH6A 4DLXA 1AZSC 1PLKA 1E0SA 5C18A 1NKTA 1QG2A 3K1JA 5FOUA 4ARZB 1OV4A 4CVNA 1G18A 1DBSA 3NDPA 1NSTA 1KSFX 1U99A 3GJXC 4JVLA 2XJ9A 3RC3A 1T8UA 4PPNA 3PEWA 1KNXA 5D3QA 1NBME 2AXPA 1OYYA 2QM8A 4MRVA 2WKPA 3PQCA 1PUJA 4LCBA 5EJEA 2QN6A 1TU3A 1EX7A 3SBEA 4C7OB 1II8A 1MO5A 1QF9A 3CRRA 3AVYA 1KMQA 3WY9A 3SS8A 1KSHA 3M6AA 2B7CA 1CJKC 2ZE8A 4K8OA 1Q1EA 5M04A 3BS4A 3T12A 5G53C 2OFXA 2WOOA 3VHLB 3KTAA 1W5TA 5C46F 4UNRA 1SKYE 4DKXA 1GRQA 3DMDA 3ND9A 2ZI6A 3SQWA 2KJQA 4MH0R 4Q4AA 2ZRBA 2WIAA 1NMZA 3AM1A 1DELA 5HZKA 1AA9A 3RVBA 4EQ6A 1T6NA 2H18A 1CXZA 3EASA 2RHDA 4OJKA 1X8LA 3GLGA 2ZREA 5SZHB 1R8QA 2HJVA 1B23P 1F48A 2RH5A 1Z08A 1N6KA 5DN6A 3A4MA 3SDZA 4D6PA 2P2LA 2DFNA 1Q44A 5L3QB 1EFCA 1BKDR 821PA 4GMXA 2MSDB 1NIPA 2ZPTX 1UBEA 4YDHB 4HB4A 5CDFE 3HU3A 3SFZA 2RGGA 4FWIB 3UWKA 2BMFA 1G8PA 2C98A 3IQXA 1QZXA 5B64A 4BLRA 1W4CA 1W4AA 2JJ2A 4B3XA 4BLSA 4C9BA 3R8FA 4WZBE 2ORWA 4XVUA 5AK0A 3T1QA 4TZ6A 1QHHB 4EAQA 1RRPA 2ZVPX 4MYTA 3U3RA 2GXQA 4MRRA 2O8BB 4ABYA 3ZVNA 3B85A 2P65A 4Q1EA 2AD5A 1XNJA 5TVKA 4S2EA 4TYPA 1I4LD 3I8SA 4DLYA 3PUVA 2PX0A 1R8SA 3HU2A 2NPFA 1WCV1 1FOEB 2GILA 2FX3A 2EFGA 5FTMA 3GLIE 2GXAA 3UK6A 1LNZA 1AKYA 3BB4A 3BXZA 2ECKA 1T0JB 2HUPA 4O3MA 1M1YE 5DHFA 3L8ZA 4MKHA 2OO7A 1W0KA 4MKIA 2JLYA 1J2JA 2J0SA 1OPXA 1S3SA 4OJQA 4HDQB 4LHZA 1JJ7A 2F43B 2YINC 4ZPXA 2OAQ1 1GZSA 1NMXA 1KI9A 1CU1A 1NI3A 3L82B 1E0AA 4XD7A 3THXA 2DPXA 3ICQB 1ZM4A 3D3QA 1XXHA 4AG5A 4N0EA 1F2TB 3WYAA 4JT4A 3QG1A 2C8VA 1GIAA 1XB2A 4C0HA 2QP9X 1LB1B 2FH5B 1VCOA 4IDPA 2N1BA 2IUUA 3UG6A 1ZM2A 3WRYC 5IK2A 5JJLA 2VO1A 3B9PA 1E0KA 1Z0KA 3ZD7A 4EIWA 1OE0A 4WOPA 1EESA 2DWPA 2ZTSA 3RS3A 1Q12A 3REGA 3GJ0A 2D74A 4TLBA 1F2UA 5LB4A 1TUEA 1GP2A 3W3AA 4Q5IA 4DDUA 3ZVMA 3E2IA 4RFSA 1NRJB 3BK7A 2FFQA 3VR4A 1ZJ6A 2IS1A 2VF7A 5E7IA 4N0DA 4ZI2A 2UZIR 1G9XA 1Z6GA 5EP2A 1IJFA 1BMFA 1Y3AA 2GJ8A 2JJ1A 5FPTA 1RC8A 1L7VC 2HYIC 2ZXUA 3GP8A 4MDFA 4YMSA 1DS6A 5JHGB 2QZ4A 3Q3JB 3DL0A 1GFIA 5EP3A 3SHWA 1U2RA 5IK2D 3BC1A 3LBIA 3ZZ0A 1U0LA 2OCPA 3AKDA 2J9RA 3PJRA 2IS6A 3QKUA 3QI2A 3VR6A 5LD2B 1S4QA 3C14C 2DY1A 4NCKA 5FI1B 1GRNA 3THOA 4PZZA 1D5CA 3U2QA 4POAA 5DIFA 1XMSA 5P21A 2OCBA 1E2KA 3THWA 5AUQA 1MKYA 2ONKA 1VYVA 1IN8A 2VSXA 3A58B 3GLFA 2NG1A 2W58A 3P1JA 1EFTA 4C7OA 1E9EA 3BH7A 3PFIA 4BGDA 3B13B 4DSUA 4OBEA 2V4ZA 4LV6A 4QM7A 3KQHA 4Q4HB 2O8DA 2FOLA 1D9ZA 4JVSB 4OQLA 3QIAA 3W6PA 2JJ1D 2KB0A 2ZI5A 1S1MA 3VTKA 1COWD 1ELOA 1N5LA 1SXJE 2ANCA 3CF0A 5KSOA 1G6HA 4PANA 2REXB 3KJHA 3ND8A 1YZTA 3U7GA 2GJAA 3S1AB 2GJ9A 2KBFA 3VQTA 5EZ5A 3LD9A 2ZM5A 3FHCB 3NKVA 2XTZA 2A5FA 2PMDA 2CE2X 1BYIA 1E69A 5JMTA 5F98A 1P2SA 4H1UA 3TSOA 2ZRPA 3MWYW 2GBLA 1XJCA 1Z6AA 3DOFA 3U6BA 5J47A 4TL8A 1E9AA 3R7WA 2RGNA 4DC9A 2VHUA 1OFHA 2ZJAA 3QY0A 4XSHA 5L3QA 5HE8A 3DZDA 3RNLA 3A1SA 4URUR 1JJVA 4V0OA 3CB4A 4LHXA 2CHQA 1II0A 1G6OA 4IDOA 1X86B 1XPUA 2JEOA 3KZ1E 4HLDA 1KAGA 4GZLA 4Q9IA 2ZRAA 2HJGA 5J40A 1E99A 1U0JA 4B34A 3QVVA 1FQJA 1DTSA 4CEHB 4JLOA 4RFVA 3J81k 2O8BA 1R5NA 3LDAA 1XEXB 4D4KA 2VSFA 4GPTA 3UG7A 1LS1A 5TARA 4GDFA 5DHAA 2GJSA 2RGAA 3KJGA 4FMCF 3WRXC 1CR4A 4RY2A 3U5ZB 3RSOA 4I1SA 3TAHA 2CHGA 2KI5A 4BFSA 2ERXA 3M4YA 5EE9A 3WP0A 5KSYA 3EC1A 1E2QA 4L9WA 3LVQE 2B7BA 4CEIA 1P9RA 2WWWA 3I5YA 4ZCMA 5BN3A 2ZJOA 1T5LA 2GEDA 1P2TA 5JCZA 1QHGA 4OQXA 1ZP6A 5LPNA 5GVSA 121PA 2OEPA 3QPUA 3SNHA 3TQCA 2FEMA 4Y0VA 1DAFA 3E1SA 2IS4A 5KDOA 3ADKA 2WMOB 2UVQA 1QHYA 1V5WA 3EIQA 3DM5A 3A1WA 1F5NA 1MRNA 1H8ED 2AK3A 1G8YA 3BRWD 2AX4A 5BYJA 3TMKA 3E70C 3NH9A 3Q5EA 3FMPB 5KPDA 2HEIA 1WXQA 4FN5A 2PT5A 4JLMA 3NH6A 1LFDB 2H8KA 1HTWA 2C78A 3L0SA 4R2IA 3RWMB 1SZPA 3RYTC 3PCRB 2P6UA 3AP1A 1YQTA 3IILA 2QRZA 4Z1MA 4M1MA 1TX4B 3H2YA 3I3SR 1VCIA 4GSYA 2J5XA 2WJJA 1EWQA 5F2EA 1HA3A 4JLVA 2ZANA 4K81B 5EXTA 4XWKA 4LHVA 4DUGD 1U0HC 1IN5A 4MYCA 3U3OA 4UJ3A 4IDNA 4BZQA 2WSMA 3P4YA 3T1TA 1UBGA 4DDTA 3HYTA 3BGWA 3CIOA 2WMNB 4Q21A 4RZUA 1KK0A 1US8A 4C2TA 5D3MB 2R2AA 3OEED 5KPJA 3D6TB 2Z6VA 3L0IB 1FNMA 1UKEA 5DGXA 3GJ4A 1XTKA 2MSEB 4QFMA 4BECA 3K09A 4HATA 3I32A 4BZPA 4B76A 2GZAA 3FHTA 1SGWA 5A0FA 4B2IA 1G291 4TTPA 2WWFA 3PITA 1XU4A 4E09A 1KI2A 4QBFA 3KFVA 4LV8B 5EP1A 3WXMA 1XD8A 2IXEA 4JVNA 1E3MA 2J0UB 1NNEA 1N0VC 5J5CA 4F4JA 3ETLA 5IDVA 3UXMA 1R0ZA 2C9CA 4YMWA 1G21E 2HLDA 4PHHA 2J45A 4LBWA 1CIPA 5DI3B 3MJHA 2G6BA 2D7DA 4L16A 5BN4A 1RYFA 3EPKA 2VH5R 1DO0A 4Z8YA 4A0GA 2WKQA 1UDWA 1E1QA 2CDNA 1M74A 3ZZUA 1NLFA 3K9LA 1IONA 1KI6B 2Q6TA 3L2OB 3RWOA 1E2FA 3N2IA 1XTQA 4LGMA 4TQ9A 4B75A 1G4AE 1KI4A 2ZRLA 4DT1A 5JJKA 2B6HA 2E9SA 5GADl 1UKYA 2VRWA 2YOGA 2J3EA 1LF0A 3NBZC 5E7JA 4KFSA 2PT7A 4DLSA 3F3YA 4RD4A 4TYYA 1H8HA 1VHLA 5DI9A 4QJ5A 4CT4B 4IFBA 4YXWA 1Q20A 4IW3B 1QVAA 3W8RA 4FD2A 4DSOA 1ZCAA 2IYXA 3NHAA 4ZKDA 3HP1A 2Q9AA 1M7HA 2WOJA 1KYIA 1GUAA 2PX3A 3MLEA 2DB3A 2WPDD 4B2LA 3AKCA 4JYCA 1OH5A 2RAPA 1OIVA 4JL6A 3CX7A 1NG9A 4OQNA 5JS8A 1E1QD 2WJHA 5FPYA 4CGZA 1W2GA 1N6NA 2N46A 1ZBDA 2PEZA 4DLUA 3RS2A 3DOEA 4Z51A 4IDQA 4JLNA 2QAGB 4C4PA 2D3WA 1Z8FA 4NKRA 3ZGXA 4PXAA 4TT3D 2X2EA 2DR3A 1JR3A 2YWFA 4XIGS 4IXMA 3KKQA 2QORA 1MH1A 1XTIA 3CR8A 5HR5A 3EC2A 3SHFA 1ZCBA 4Q7JB 2IS2A 2O8CA 4FCWA 1OLOA 4A4DA 1H8HD 4NDZA 1R7RA 1KDPA 2R6DA 1P61B 2AKAB 3AVXA 3E5HA 4BUJA 1JXMA 3I73A 4A2WA 1LW7A 5CIWA 3LRPA 2WWHA 3OF5A 3B1YA 1K6MA 4JLJA 4FMDF 2A9KA 3LW7A 1OIXA 3GQBA 1SXJD 4G3XA 4Y0AA 2EYQA 2IYUA 2KWIA 2R6GA 1YRAA 2J7PA 4NYIR 3OIYA 3Q8XB 4D0GA 3IEVA 3B60A 4V0LA 2EU8A 3LQRA 3VR1A 2L0XA 2D62A 2C2HA 4IRUB 3M1IA 2QM7A 4NP6A 5EQTA 3IBYA 4MDEA 2ZYTX 2XITA 4DCNA 3RS4A 3I92A 1Z6TA 1NVVQ 1ONBA 4U00A 4F4IA 4RJLA 4RD1A 4AIIA 3LA6A 2J0QA 1X1RA 2ZYUX 2VEDA 4DCVA 1KK2A 3TR5A 2GVDC 4QGAA 2W2VA 4BFYA 2ZU0C 4RCYA 3BJIC 3KTAB 3NVAA 5CYPA 3T35A 4KLNA 4DSNA 1UEIA 1GRRA 4BWYA 3AP2A 1XEWX 2F3RA 4EFNA 4Q4AB 5KU1A 4TLAA 5F9FA 1G3RA 2ZRHA 3SR0A 1EFRA 1VYUA 3U7EB 4EQ6B 5HPYB 2XNDA 1NVWQ 3GLGB 2VTKA 2QE7A 2ZRKA 2ZEJA 3SJZA 2JLZA 2OFOA 1G5RA 2JLVA 2WJIA 1IY0A 4ZIRB 1KKLA 3IIJA 4GOKA 2AHOA 4KITB 4YLGA 4WIAA 4A0FA 2QTFA 4C30A 4QBGB 4R7ZA 1K8RA 5A5GA 1Z5ZA 2Q3FA 2QPOA 1CJVC 3LFUA 4WXRA 2BM1A 5FOVA 1Q3HA 5JCPA 3C15C 3KQNA 2RGEA 2IUTA 2WICA 1ZUHA 3QXXA 2F9LA 2A7QA 1W4RA 4JLBA 2YHSA 2F1JA 1E2DA 3GJ6A 1VCMA 1G19A 3B5JA 4ILEA 3MUFA 2FU5C 4IOMA 1X8KA 2EWWA 5DI3A 2F1RA 3FWYA 1ZIPA 2LKCA 3IUYA 3LBHA 4RKEA 5EXXA 5DE3A 2A5GA 5JRZA 4YC7A 5ANRB 1Q1QA 2WJGA 1OB5A 5E95A 1CS4C 2QSYA 4MGYR 4B71A 1R5OA 4JKYA 3EZ6A 1NVXQ 3QJYA 3CH5A 3OAAA 4PX9A 2IEYA 3DEFA 3VR2A 4F4CA 3KQLA 1P2UA 2GETA 4OYHA 1BIFA 1DG3A 1RPZA 1ZYUA 3TH5A 4AKEA 4QGHA 3JZMA 3MAAC 2VHQA 4ERNA 5JFGA 1GDDA 2BMJA 4WXPA 5AUOB 4QHTA 4URYR 3B2EA 3PENA 3KKMA 1Y63A 2QT1A 1KO1A 1PJRA 3TNFA 3FKSA 3KQUA 3FFAA 4TL9A 4X8MA 4JBXA 2QI9C 4GMDA 2MMCA 1TQ2A 3THXB 4M1SA 4PO9A 4PZYA 3OZXA 3PUZA 1P3JA 3AGPA 1XXHB 1Q0UA 1NJFA 2W6ID 3VMFA 2WTUA 1UKVY 1Z0AA 3AVUA 2YWGA 2X77A 1RKBA 5FBLB 1KZGB 4A9AA 1Z83A 2PLFA 1DG1G 3AKYA 3HPRA 3G5UA 2JATA 2RCNA 3K70C 4GFDA 1ZM9A 2H1LA 3RRZA 3VKGA 1LVGA 4LBYA 4B35A 3ZD6A 3UANA 3U3MA 2ZSBA 3CRW1 3OAAD 3TUJC 3K9NA 1Q1ZA 3I61A 3G82C 1Z6XA 3CO5A 6Q21A 3WMFA 1F2UB 1DAKA 2QPAA 3TW8B 2C03A 2XTNA 4RFSB 2C77A 4HEJA 4HYYA 4LBVA 2DFKB 3TBKA 2ZITA 3EWAA 2AKYA 2GJKA 1JEEA 2O0KA 4GNKA 4JKIA 4IJMA 3TLXA 3RLFA 1KO4A 2NO0A 4L8GA 4B48A 2SHKA 5KHOC 1XBTA 2VP2A 4X8LA 3SC3A 4M1TA 1P5ZB 4I4LA 4XVRA 1G17A 2BC9A 2I1VB 2F9MA 4B6EA 2HXSA 4HDCA 1GKIA 1PZNA 1G8FA 5LDDC 1NL3A 3AKEA 3FMIA 3P4XA 4K46A 3W5JA 1IXZA 4A92A 2VP6A 4DDVA 3LAWA 4IHQA 1UPTA 2Q3HA 3LX5A 4QNMA 1PVOA 1GL9B 4M9ZA 3THWB 1E9RA 4HLUC 3T5GA 1DVRA 4OHYA 3GLFB 2YZ2A 1W46A 4E07A 3BFXA 2ZU6A 1T4GA 5J4VA 3GLHA 2OV2A 4DZZA 2CXXA 5TB5A 4DB2A 1XFAA 2WBLC 1Z0DA 4OI2A 4P33A 2O8DB 2P67A 2QENA 3QKSA 1DEKA 1XD9A 1GL6A 3SJCA 2BM0A 2QQEA 3X1XA 4IOKA 5FTJA 5F9HA 5LB2A 3SYNA 3KKOA 2XOKA 3EA0A 2G3YA 4AKHA 1KK3A 1SXJC 5TMPA 1L4YA 4BFUA 1KDTA 1IHUA 3BOSA 3CPEA 3RDPA 3EPJA 1TF5A 1XZPA 1KI1A 3QF7A 1Q1BA 1HQCA 1E2HA 1CTQA 1NLZA 2OLJA 4KYIB 1KOFA 5KO2A 4ZIRA 2ZUDA 4Q7LA 3R7WB 5FTKA 5KUTA 1FTSA 4Q9KA 2HYDA 1CRPA 1RFLA 3IKJA 2FZ4A 4PAOA 1DAIA 4Q03A 1HV8A 3UKDA 2ATXA 3HU1A 3C8UA 3LV8A 1AQYA 4F38A 1D2EA 1FUKA 1FUUA 3JZAA 4LUCA 1EFHA 3VX3A 5JZVA 3FDIA 2ZRDA 5JBQA 2J7KA 1W36C 1KAOA 3AUXA 2BMEA 2GXUA 4TSFD 3O8RA 5KNCA 4JLAA 5FBVB 3X1WA 1GNQA 1RVDA 2DYKA 1PV4A 3TUIC 1CJMA 1E2EA 2FN4A 2V6JA 2XOKD 4M22A 5JSZA 1TEXA 3K0EA 1GKYA 1X6VA 3FTQA 5FTNA 1XMIA 1UJ2A 4W5HA 2I1QA 1FNNA 3A4LA 1OXXK 5IHPA 2IYLD 4JLKA 4CEIB 4NE2A 2Z83A 5JWOA 3TIFA 4E22A 2BEJA 2R8RA 3AB3A 721PA 3EIEA 3ZLJA 4P31A 1P75A 1EWRA 2OZEA 4L9SA 3H86A 4DLRA 1ZRHA 2QY9A 4S35A 4IOJA 4KVAA 2CLCX 4BFWA 2QRNA 4LJ9A 1ZW6A 1MOZA 4Q48A 5CLQA 3ONWA 3W8NA 4OQFA 3KB1A 2FFAA 1E98A 2J46A 4XOIA 3EPLA 1CRQA 1S9HA 1ANKA 2Z5FA 4IKEA 3PIRA 2Z4SA 1E2IA 2ZS9A 1NIJA 4TYWA 4YONB 2CJWB 4C2UA 1GVNB 4FCTA 4D26A 5HCNA 3Q72A 4IXNA 2ZRFA 5H8WA 3KX2A 3OIWA 2XZOA 3HPQA 3I5XA 1KMHA 3KUCA 4BLPA 4TMXA 3SU8A 4HUQA 4XWOA 3QE0A 1JECA 1F60A 3AUYA 1AN0A 1JBKA 4LJ6A 1U81A 3C41J 5FR1A 4TTRA 4EKDA 1NVVR 5IF9A 3AF2A 3IBGA 3B78A 1E2NA 1CJTC 2XZPA 1KY3A 3IIMA 3AQ4A 1RE0A 2W0SA 4MYUA 4PSAA 4UJ5A 421PA 4A82A 1A1VA 4M1KA 4NYIQ 1US8B 1SKQA 4P32A 3WP1B 2FPLA 4URVR 3BBPA 1XD2A 1J7KA 1YZKA 1S9DA 4G5GA 3VKHA 1COWA 4LYFA 4N1AA 1VMAA 2IHBA 3D31A 4CDGA 4Q18A 1XCGB 2QMEA 5GJVC 1KSGA 3CR7A 2P3SA 4EDHA 1TF2A 3Q9LA 5G3YA 4D4MA 5K8UA 2JDID 4G0NA 1DOAA 4V0ME 2GAAA 4PC7A 5EXSA 2ZRGA 1RRGA 2PJZA 4AY2A 1GITA 5ELXA 1E1RD 2ODWA 2CK3A 2PL3A 3WYGA 3NDBB 1OH7A 3EIHA 1EG7A 1SVOA 5DNYB 4EJSC 1N0WA 1J90A 2F1IA 3IIKA 5KDDA 1C4OA 5EE5B 1CJUC 1KO5A 3QUSA 1Z63A 3WBKA 1N6LA 4OK5A 2OHFA 1OJLA 2VIIA 3TVDA 3UMRA 3IDQA 3VX4A 2WM9B 3AF4A 4O2RA 1CR1A 1X3SA 2FE4A 1W47A 3QEJA 2XTMA 4DT1B 1NBMA 3B9QA 5KYKA 1HE1C 5EE3A 3QXCA 2ZI9A 4Q9HA 1T3LA 4DHEA 2WAXA 2AD1A 3GEHA 4XSGA 2QA5A 3WYFA 4DDWA 4B74A 3CH4B 2IYZA 3U3JA 2NOAA 4PQRA 3PEVA 5EUQB 2G0NA 2ZR7A 3LXXA 4O0MA 2OCAA 4MUBA 1VHTA 4V0KA 5LBIA 3K9GA 4BZXA 2CK3D 4NH0A 2HDNB 1WQ1R 3AV0B 4G1UC 3UIEA 1E2GA 2WAYA 2FPMA 1HEIA 5FBRB 5F3WB 3QOFA 1W2HA 2NPIA 4KV9A 4ASUD 4ZO4A 4ZV4A 3K0AA 3QXHA 1H8EA 5KSPA 5CM8B 4NYJR 3REFA 1XCMA 2CLDX 2G83A 3HR7A 1JR6A 3MSXA 2H7VA 4MRSA 1UKZA 5K8IA 2A30A 1NBMD 1I4DD 3ZYCA 3AVTA 2C9OA 4HAYA 1P2VA 1QHNA 1JR3E 4DLZA 1Z6YA 5CDFA 2N42A 2BJVA 3UMFA 5L8VA 2C04A 1N5IA 2ZRMA 1VTKA 4QJ4A 4UNSA 2O8CB 2I3BA 1M2OB 1IN4A 1CBUA 1AZTA 1O3YA 1ZC4A 5AUPB 2GF0A 5HZHA 5J4KA 4MGKR 2OBMA 2GEVA 2DFLA 2ANBA 3KXIA 1GSIA 4A8JC 1CP2A 5TV2A 1HE8B 2FNAA 2RGBA 3O8BA 2GVZC 4JYBA 4DUGA 2CE7A 2CVFA 2FSFA 2WSSD 1RZ3A 1R0WA 5JWRA 3WHLA 1AM4D 2V3CC 3I1FA 3RRYA 2NMVA 1MO4A 1W7AA 2IYTA 3PUXA 1R6BX 1G3MA 2FPKA 3OEEA 2VSOA 2W83A 3B1VA 2CCGA 3B82A 3QPVA 4ACBA 4D0NA 2IYRA 3IGFA 4DCTA 4QGGA 1XJ0A 3H0KA 5KTYA 2BBSA 2EFCB 3UATA 1JAHA 3W9YA 1DE0A 1UM8A 3CBQA 2CJWA 2C9YA 4P4UA 1KI3A 4UQOA 4KYUA 4AWXA 1C9KA 5K8TA 3ZVLA 1V43A 2GHIA 3A6PC 3OIUA 4ESHA 3BFKA 3NXSA 4NBSA 3I72A 2G0TA 1J8MF 4C0BA 1ZNWA 2IHYA 3CONA 4D0LB 2WWYA 2WZQA 5FOWA 4YMUA 1PUIA 4DRZA 2Q0HA 3LW8A 1QRAA 1N0UA 1Z28A 2AXNA 4L5BA 1YZNA 3V00A 5HE9A 1JALA 1D9XA 3CNNA 4PPGA 3R9IA 2REBA 1N3BA 3OFND 4Q9LA 1K5GA 1YKSA 3Q7QA 3U61B 3U7HB 4TMTA 1HQYE 1G64A 1NVUQ 1E9CA 4U02A 2O5VA 4D2IA 3D7MA 1EGAA 3CM0A 2OXRA 1P60A 5EZ6B 4DSTA 4BLOA 2QMHA 4OI0A 1U98A 4JLDA 1N6RA 4RD6A 2JLWA 1JPJA 4C0LA 3K53A 2RKOA 4MKFA 4LRWA 5JRJA 3X1ZA 3A8TA 1E79D 3QKRA 3AF3A 1G3UA 4W5JA 5JI3E 1KSJA 3T1VA 1DAGA 1FMLA 1NG1A 3P26A 3T1OA 1YZQA 4A6PA 4MITA 2C99A 4TMZA 1FTNA 2JASA 4U7DA 1S8FA 4EFMA 1N6PA 1U8YA 3ZIAD 4BEJA 3ZZTA 3K70D 5C2JB 1U94A 4WZ6A 4DIEA 3THYB 2J41A 4QGFA 5E4FA 3WNBA 2B8WA 1MABA 4NL4H 3VU9A 2WPDA 3F0TA 3K0FB 2BKEA 4DCUA 3DKPA 3K8YA 3B8HA 3RRNA 2KE5A 3FYHA 4GP6A 4M9QA 4A36A 2XEXA 1FX0B 5BYKA 1OXSC 3TRFA 4C3ZA 1Z2AA 1Z29A 1ZD1A 2XNSA 4HLUA 3U4QA 1IXSB 1KTVA 4D80A 4F92B 1E6CA 2GAOA 2IBMA 4TT3A 5HTKA 3LNCA 2ZR9A 4PHGA 3KDSE 4UNQA 5SZJA 2FJUA 2JAQA 2GCPA 1N6IA 1E9BA 4LDJA 4BE7B 3TW4A 4US0R 3UPUA 1UF9A 1OKKD 3RHFA 2RHMA 5CITA 3WMEA 3N70A 2W2XA 1SXJA 3ADBA 1Q22A 1I2DA 3SJBA 5BN5A 2CBZA 5FUVA 4EPVA 2YVUA 2H5EA 4BLTA 5BW8A 1KJYA 3RS0A 3A37A 5BWMA 2QNRA 1KDOA 4KSCA 1CR0A 1ZD8A 4CYMA 1R4AA 1ZUIA 4P0TA 1KIMA 1OHHA 2ASEA 4PPQA 2EW1A 2IXGA 3LY5A 4UXJA 1WBDA 2WIBA 4M53A 5HKKD 4QHSA 3SI7A 3KB2A 1ZNZA 2IYSA 3B1WA 3R20A 1P9NA 2ZJ5A 1CKEA 3KXLA 2GK7A 4XH9B 1FFHA 2F55A 1TF7A 1OF1A 2OM2A 2W00A 1YJ5A 1ZU5A 4FW9A 5JWHA 4TYNA 3JVUA 1AGRA 2AN9A 3M0EA 4B73A 1UEJA 3K9HA 4JJZA 3ASYA 2EFDB 1F3OA 2BVNA 3CX8A 4NYMR 4XJXA 3L0PA 4TMWA 4HB0A 2XAUA 1KJZA 3HJNA 1CLUA 4Q1DA 2LCFA 2IWRA 4II7A 3AVPA 4HZIA 3MJRA 3U7FB 3W6OA 4DLTA 5C1BA 1CEEA 5DH9A 3I62A 4JBWA 2I4IA 2AK2A 5L3SA 1P9WA 4B3FX 1W0JA 2PCLA 2UKDA 2NZ8A 4I81A 3OHMA 4C0JA 2FSIA 1RYHA 1OHHD 2OXCA 1MV5A 2CMKA 3N5CA 4A15A 2DWOA 4WVFA 4OHZA 4LV5B 3KKNA 4V0NA 5FL3A 1PLLA 1DADA 1QHIA 2ERYA 3A1TA 3AF0A 1HY3A 1FL9A 2WHXA 4HLCA 3GFOA 3GLHB 4EPXA 2QP4A 2VP9A 4ESVA 2XGJA 3EAQA 4BFZA 4LHWA 5DLQC 4XWAA 3L0OA 4BFTA 2AFHE 3HYRA 1CF4A 4GT1A 1G7RA 3QKSB 3CPHA 1S0UA 2ONJA 2GK6A 1W36D 2Q3MA 4GOXA 2IYWA 2ZUBA 4LWZA 4NTZA 4Q7MB 3CZPA 2QP3A 4OHXA 1GKUB 3QXSA 4UNNA 5FUWA 4HI0E 4FXPA 2PZEA 3DHWC 3PR1A 5FOXA 4TL7A 2GCOB 2YV5A 2ZRCA 2JLSA 5J4LA 3CPJB 3GLGE 1NJGA 1VG8A 2XSZD 1JQLB 2BBTA 4YQFA 2BOVA 3DVLA 2X1VA 4NCIA 1W0JD 2YNMA 1RRFA 1ZAKA 4DIDA 1P4SA 1ZD9A 1BH2A 1IY1A 4Q4LA 2R9VA 5G3ZA 1G8GA 2CVHA 1OIWA 1LF5A 5B57C 621PA 4CEJA 1AKEA 2W6JA 2O8FA 4V03A 1FMJA 2R62A 3NBXX 2GZHA 4L15A 1E2LA 5FR2A 1FW6A 4M1WA 4KHZA 1P62B 4HAZA 1NY5A 4KODA 2BEKA 2W6IA 1E32A 2BHRA 3ZQJA 3FE2A 3QEOA 1AIPA 1SVLA 3DZ8A 4Q1AA 4PSVA 1GWNA 1VIYA 2VYFA 5JSZB 4YDSA 3THYA 2ZJYA 5DYGA 3CUEF 4P4TA 4RVCA 4TL6A 2KSQA 2WWIA 1OT3A 2ODEA 3K0FA 1N5JA 2QGNA 4DBLC 2EWVA 3ICEA 2ZVQX 5CK4A 2JLQA 4HSEA 3UMSA 3QSYA 1Z0JA 1FX0A 2ODBA 1AGPA 4NCJA 5B58C 5CB6A 4KU4A 1Z3IX 4C0QC 2P5SA 2A78A 4WA7A 3BD9A 3C5CA 2ZRJA 1ZNXA 2Q21A 4EJSA 2A5YB 2JCSA 2EFHB 2V1XA 3AF1A 4LHYA 4M1YA 4UXIA 3T15A 2W6JD 2NO9A 2OG2A 1TL7C 2NQ2C 4XTRA 3LLUA 1OXVA 4NYJQ 1VKJA 3O47A 3B6EA 3PXGA 5GVRA 3UWOA 2W0MA 1KKMA 1W48A 1XXHE 3FVQA 4C0AC 3GJ5A 4CT5A 3RANA 3ASZA 4HB2A 2HXYA 4JMPA 3U60B 1IBRA 3OE7A 4CRWB 1XDBA 3MFYA 2P6RA 1DAEA 1NN3A 4I1UA 4E5UA 1II9A 1KMHB 1GOTA 2PH1A 5SZIA 3LXRA 4FMCB 4HUQB 1E94E 4LJYA 1Q57A 3SBDA 2CHVA 2DBYA 4KFRA 4PHTA 4M9SA 1ZVQA 2AWNA 2FSGA 4OKSA 2WWGA 2ZSAA 3U6KA 2FFHA 4FCVA 2ORVA 2GZDA 2G88A 3CLVA 3TE6A 2CL7X 4HAXA 1Z0IA 4EUNA 1HYQA 1WF3A 4W5WA 4JIMA 1WMSA 2BDTA 4NZYA 1DARA 3CNLA 3FFBA 4NHOA 221PA 5FL7D 4US1R 1RRCA 3G0HA 3Q5DA 2D2EA 2WWXA 4KAXA 4WAUA 3PG5A 4LX0A 4B3CA 1VYTA 3GPLA 1XD2B 1AS2A 5G40A 1WE2A 1LY1A 4F91B 1G20E 2HCBA 3X2SA 2VL7A 2Y8EA 1OFIA 3K09C 4Q66C 3WHKA 1XTRA 2ZYWX 3EWSA 3OE7D 3FMOB 3I8XA 3DDCA 2WJYA 1EK0A 2FGJA 1ETUA 3HDTA 4LJ4A 5GJBA 4WZAE 2HCJB 3RS5A 3QBTA 3L43A 3WNDA 5JEEA 2ZJ8A 1ZNYA 4A8JA 5LD2C 2CEAA 4G5QA 4AYTA 2ZJZA 4TWZA 3N2EA 2QBYB 2IC5A 1A2KC 2XB4A 3SN6A 4B32A 4PO1A 2OBNA 3GLFE 3TR0A 4FWTA 1IN6A 1E2MA 1T9HA 4QXAA 4PC1A 2ZJBA 5FUYA 1IJEA 1GILA 4LC1A 4MA4A 2DFTA 1FPMA 1LS6A 4BASA 5CJ2A 3PEYA 2CCJA 1RJ9A 4IEIA 4QHYA 5FOSA 4DWJA 2A5JA 4WW0A 4UNPA 2A2ZA 4XTCS 5JS7A 3K0SA 4Q1BA 4IFEA 4TSFA 2O0JA 4ACAA 2K5UA 4P4SA 4RD2A 4DB4A 3QQ5A 2OLKA 4M1OA 4D82A 1HH4A 1WP9A 2B8TA 4JT2A 2GCOA 2YWHA 4LJ7A 1KNQA 2DCUA 4LJ8A 2HV8A 2ZI7A 3TAUA 1OXTA 3SOPA 1A5TA 4DLWA 4JSYA 4Q4JB 1TADA 1YZLA 3B7GA 4KO8A 3EZFA 4LK2A 1KJWA 2OAP1 2O8EA 4ON9A 2ZE5A 4OK3A 4TMVA 1SKYB 1HT1E 2J87A 2RGDA 4LBZA 4I1VA 1TMKA 5HCIA 2GCNA 3U44A 1SVSA 3W90A 2GRJA 2Q9BA 2IYQA 2QROA 1KY2A 3ADDA 2OSBA 1E96A 3EZ2A 4QJ3A 3K0AB 1NN0A 5SZKB 4TZ0A 4G5SA 3GCGA 4KFUA 3T34A 3VNVA 4LOAA 4HAWA 3BAFA 5FPSA 3FOZA 1AQUA 4N3NA 1QVRA 2P5TB 5E3HA 3A1UA 3W3ZB 1SVIA 3MD0A 3EZ7A 2V9PA 4B6FA 4C0KA 3R8CA 3WNCA 4OI1A 4QG7A 2G1JA 5FPHA 5E7MA 2QGZA 3BERA 2X8AA 3BE4A 2VLIA 4PZLA 1ZC3A 2O52A 2AL7A 4KBFA 1JI0A 2QG6A 3FGNA 1QHXA 3GFTA 1ZU4A 4B3BA 3FHOA 4TLEA 2BCGY 3KKPA 4QKQA 1TQDA 4EPWA 1G5TA 1X1SA 5CM9C 4O2LA 1SHZA 3EA5A 5AWFC 4IDHA 1E9DA 3OEHA 1KZ7B 3RRMA 1IOZA 2NO1A 3CRVA 4GI7A 4QNRA 5GJCA 3SQXA 1G7TA 2QMOA 4PC6A 4DEYA 2V6IA 3KL4A 3Q85A 4Q19A 5FI0B 2CCKA 2QTVB 3GLIB 1Z22A 3PVSA 2IYYA 1E4VA 2VA8A 1EXMA 2LKDA 1IY2A 5DN6D 4M0LA 3ZJYA 2Z0MA 3EG5A 3A4NA 4AKGA 4BRUA 4M2LA 3ZVRA 1YR6A 2ZIAA 2JDIA 2WKRA 3H4MA 3LH5A 1HUQA 2IK8A 3QF4B 4JSTA 1R10A 2ZAOA 2ZQ5A 4QBHA 4D4JA 1WA5A 3CKLA 5B30A 1XX6A 2W2TA 2JJ2D 3BB3A 4HDOB 2FA9A 1W49A 4I1OA 1OH8A 3ZDQA 2DHRA 4NYMQ 1E1RA 4A2PA 4BFXA 4TQAA 4AKIA 3BORA 1GG2A 3CZQA 3K70B 1SQ5A 3MWLA 3A36A 3OEHD 1E9SA 2YWEA 3DMNA 1ODFA 4RSGA 1XP8A 3ZH9B 4FMDB 4GZMA 2QU8A 4FMBB 3LQQA 2VHTA 4B33A 2IF2A 4BLQA 3SZRA 4ZKEA 2QT0A 3PV0A 4MRNA 4W7SA 4ZDJA 2IW3A 3TKLA 4PSKA 1A7JA 3CWQA 1G4UR 1MR3F 2R6AA 3GFPA 3K0CC 2VHJA 2PJRA 3R9WA 1IM2A 1QG4A 1ESNA 1MO3A 1ZM7A 4OL0A 1IAQA 3AP3A 2IL1A 1W0KD 5IT5A 1T3SA 1N6HA 1VG9B 1R0XA 1S3GA 1T3HA 1U9IC 1YZUA 4TMKA 4BRWA 2ZRIA 4KBGA 2GNOA 4HZUA 3QKRB 5H70A 2VP4A 2EYUA 3CWZA 5FBQB 4IEEA 1M7GA 2FWRA 5FPKA 1G16A 2A3RA 4XD7D 4FI3C 3KFXA 4Z54A 4P3YA 1G41A 4KVGA 3GMTA 4YMVA 2QBYA 1TQ6A 3MWJA 3CRMA 4I99A 3VKWA 4LY6A 3QBVA 5DSZA 4LYHA 1JPNA 1MABB 3VU9B 4ASUA 2JA1A 1YRBA 2R65A 4OHWA 2NZJA
chains in the Genus database with same CATH superfamily
1WPXA 2OGUA 1O87A 3QFFA 2ZXFA 1YR9A 1MGOA 1U90A 2GESA 1RKQA 3IDOA 5IAEA 3RS9A 1TK3A 3ECCA 1XDSA 4NNOA 1UPXA 3KB8A 4P7FA 2PD6A 4E2YA 1NF3A 3CNBA 2Z09A 2IQIA 4IUDS 4UDXX 4KXYA 5EP4A 5BWCA 5AOVA 3FVVA 3EEYA 1X38A 4OB7A 1WETA 3QMWA 5DX1A 2Q3EA 3GEIA 3P2KA 5AVWA 3KAJA 3KQSA 3HUEA 2R2GA 3X1YA 1GG5A 4GH5A 4HNHA 2JIQA 2DSTA 2AR9A 1FDIA 3IV9A 4YREA 1WZ2A 1L5LA 4C08A 1XCPA 5KOYA 2YOHA 3I83A 1GQ2A 2BI4A 2FZ5A 4O25A 3EMBA 5IBRA 2I6FA 4B6RA 3LE8A 4YRDA 3TSZA 3CLTC 1UAAA 1XDWA 3VR3A 1FLNA 3QLUA 4MMXB 4D0RA 4I0XA 1LPAB 4DBVO 1JIVA 4D3YA 4MVJP 2JCVA 1GGNA 3WTBA 4BFCA 2VYND 3AGQA 1TDJA 2JHFA 3ZH2A 4IGFA 3X43A 4DIOA 3VO8A 4IOLA 3EFBA 2C00A 4KPYA 1A5ZA 3VOTA 3CW2A 3I58A 1I3MA 2C4UA 1MRSA 2FP4A 1CY2A 1GAQA 1ZICA 4AK9A 4DM3A 3TW6A 4NE7A 1GCIA 1R0YA 1M2NA 2O57A 1LD3A 2JLXA 1QB8A 4HY3A 4B79A 5I5EA 1D2NA 2JBAB 2OK7A 1OLSB 2O8VA 4IUCS 3L8YA 3UHAA 3IO3A 3G9ZA 3SHVA 5LNK6 3QWHA 3U9LA 4JJFA 2WP8J 1B0UA 4EUHA 4V2UA 4BPBA 4DA6A 5ILGA 5CTAA 2EX0A 3M7IA 5D51S 3BSWA 3VOBA 1KI7A 3QVKA 1X39A 1GK9A 4HK4A 4CLDA 4YUAA 2VT3A 2ZSFA 4UHJA 4ZDIA 5KOJB 1FUEA 3KWJA 2CNDA 3AOEA 1M34E 2ZVJA 3IBTA 1EYZA 1A8SA 4AZ0B 1ZUWA 3VV3A 4AO7A 4D8YA 4XYEA 1QXSA 1O03A 3L6CA 4B7KA 4JR0A 2J6IA 3HI4A 5CIQA 1XTZA 1Z07A 3W2EA 3S2ZA 3LQKA 1A9ZA 4CR8A 4B6PA 4QUDA 3WFJA 4G9GA 1ORDA 3KJEA 3C8MA 1N1MA 2OCXA 3HCBA 1N25A 2F8SA 3ODGA 1TA4A 1X1AA 5ESRA 3MWKA 4ROSA 2I3GA 5GM1A 3BA1A 5CT9A 1X7ZB 2HK6A 2OZVA 4DZRA 4US2R 2CXUA 4PC3A 5LJIA 2V59A 2H07A 5FDFA 2AEMA 4MIEA 1N34B 4PN3A 2A84A 3FAKA 4PX5A 3WIDA 2R00C 3G7NA 1T5TA 3V80A 3I9NA 2YC4C 2FTKE 2J0VA 3C70A 3IESA 1RXYA 4GOOD 3PLNA 3JQEA 1FRZA 1OZHA 2UAGA 2PHZA 3C45A 1YZVA 1HQDA 4NCNA 3FMFA 3N8IA 3HO1A 1URPA 3FF1A 2XV1A 2CF6A 4RHXA 2CSUA 3FB4A 1D6MA 1Z2CA 4OL9A 1JNYA 2OHXA 3ISJA 4JJKA 4UHCA 4NAUA 3STYA 4FIPC 4XFDA 3RC3A 4X6UA 1VMDA 3BN3A 3D64A 2XDYA 5EBMC 1M57B 5TPZD 3CRRA 5G0TA 2ZE8A 4MRAA 5AVZA 1EVZA 3BE5A 3NM4A 4AY4A 3DEHA 2W0FC 1DELA 3CS3A 1X8LA 1AMUA 3NT5A 2ZYAA 2FRVA 1SUFA 5IAJA 5DN6A 1K7CA 4BU0A 3RW9A 3NFRA 4LZNA 3KT8A 2C98A 2X6QA 1QZXA 4BLRA 1W4AA 2X8BA 1YGPA 4BOYA 2GXQA 2FPRA 1H4VB 4MRMB 1FOEB 2GILA 2I7CA 3HP4A 1BXZA 1BQEA 3BB4A 3L93A 2W11A 3H9QA 1QMGA 2JGIA 4BO8A 3D6AA 2F43B 5KVAA 3RQIA 1QYDA 3F74A 2CXRA 3THRA 1LB1B 4TKUA 3R75A 4UUBA 1K73W 5JJLA 3OUTA 2PS9A 3HKEB 4C1BA 3A2MA 2HU8A 1P2FA 2H2IA 3K9CA 2JZCA 2VOJA 4UM7A 1ESCA 4Q3DA 2RJOA 4JI4B 4Q5IA 3OGCC 1QF7A 2V6MA 2H7XA 2P6PA 2V9CA 3BHPA 1JLKA 2IE0A 3E9YA 4WCVA 1N8RW 4FSHA 3L7JA 2JF0A 2WB4A 1XAJA 4K88A 2XD4A 3R2JA 3THOA 1DJOA 4TSFG 3DO5A 5K8VA 4UFOA 5BN4B 3ABLB 4MWCA 4LV6A 3TXAA 3I6IA 4BN0A 2JJ1D 4LXQA 4HWSA 2PR7A 1MVLA 5KA5A 2SCUB 1ND5A 1XVIA 2XTZA 3CKKA 4QU5A 5AYVA 2ZPAA 4LFBO 5AVUA 4DA4A 4URUR 3HEMA 2GPAA 1PP9H 4B34A 3QVVA 3Q7RA 2VSFA 3KJGA 1M8FA 3M4YA 4Y2PA 1RVV1 2WF7A 1JG2A 3WJAA 3KR0A 5LZ2A 3QY9A 2UVQA 3WMXA 1G8YA 5IJAA 5LBQA 2AX4A 4R0VA 1B8OA 2VYNA 1E60A 3QGMA 1ZJZA 3FMPB 3EGOA 2Y76A 4A8TA 4PRYA 1SZXA 3EQ7A 5SY6A 1JJIA 5LJLA 1JV2B 2B36A 3F96A 4YIHA 1M2VB 1SERA 3GG9A 1JHZA 4DDTA 3KUKA 4WFKA 4DMHA 4AF6A 1I2ZA 4TVKA 5FLKA 1FNMA 1F8XA 3RBVA 2WVAA 3MGKA 3RU3A 3THSA 5AQEA 4EHHA 1CV2A 4P36A 2QTGA 1XD8A 1KFJB 3HHEA 4R0MA 4PNPA 4K6FA 3UXMA 2TSYB 2M7WA 5DI3B 1WF6A 2QL9A 5JR3A 2VXCA 1WLSA 4JD5A 2PTHA 2RJNA 3WB0A 1RP3B 3FBGA 4G1MB 4FZ0A 1Q86W 3G1UA 1Q20A 3GFGA 1IQRA 4EW2A 1R1BA 3W9SA 1BQ3A 3CNQS 2ONCA 1QFZA 3CX7A 2Q8VA 3VPCA 1N6NA 5IDXA 3VHRA 2PEZA 2HNKA 3C0KA 4RVUA 5CDSA 3BCHA 3CR8A 5DF1A 4UQPA 4L57A 3BGDA 2HRZA 1U3CA 1D0SA 1R7RA 3EYAA 4RIFA 3LRPA 4G3XA 2ZBVA 3GAFA 1JJBA 4B3MO 4D0GA 3IEVA 4V0LA 3AG3B 5TT1A 2L0XA 4MDEA 4URFA 1NVVQ 4RD1A 1N2HA 1S2OA 4HOYA 2AFHB 4BFYA 4RCYA 3BJIC 3T35A 1PJAA 4KLNA 3R24A 2WSYB 3T7IA 1QO7A 3N6RA 1SKBA 5DB4A 2PX4A 3BMQA 3TFQA 2QLFA 4EQ6B 1HBJA 2CTQA 1TA9A 3OI7A 4MSUA 3NYWA 1IY0A 4R6ZA 3MB8A 3V8BA 1PT9A 4NNJA 2KB1A 3LFUA 1KP9A 3UGQA 5FKJA 4L8WB 3UCXA 1WPBA 4P08A 3G5TA 1U7UA 5FX2A 3KB6A 4WESB 3TRIA 5IJ0A 5EC1C 2UXBB 3ZHCA 3GT0A 2EWWA 3LBHA 5KHGA 3A27A 3HBJA 4MYDA 2ECQA 1ULTA 1H5QA 4OYHA 3T7EA 3KQOA 4IG4A 4I50A 1JSLA 4UBLA 3M99B 3JWJA 1EZ4A 2LD4A 3IC5A 2J6CA 3KYDB 3OZXA 5HP4A 4IIFA 4QDKA 1Q7BA 1FS5A 2PLFA 1OGYA 4GFDA 4LBYA 1JDPA 5BRNA 2DFPA 3OAAD 1Y89A 2GZ1A 1Q1ZA 2HDHA 3JS5A 2AYYA 4Y2TA 3I61A 3DKKA 2Q0XA 3ETGA 4LBVA 5TPZA 4Y6PA 5CXXA 1FFGA 1VRWA 5TRTA 5ELMA 1X13A 4KPFC 3TLBA 2BC9A 1SVUA 4PS0A 3KYCB 2J5QA 3G2HA 3IKMB 1N9GB 4G41A 2GM5A 3ZMZA 3OP1A 3K06A 1YQWA 4HT3B 1UPTA 4M9ZA 1WY7A 1BAPA 2V5UA 3GLFB 2A3QA 3BM5A 1NI5A 2GYYA 1FFYA 2OV2A 4H16A 5B36A 2O8DB 4NECA 1G5HA 3R5KA 2EQAA 2QQEA 4ZGWA 4NQZA 4P80A 4DA7A 5THQA 2V7QG 1EM8B 1KDTA 3BOSA 1K8XB 3LP8A 4ZOCA 2QE6A 1S2IA 2JS5A 5EERA 1M9NA 1JBEA 4UPEA 2FZ4A 1PJBA 2O59A 3C6BA 3T5BA 5JZVA 5TR9A 5JBQA 1N0NA 1KAOA 3AUXA 5DNDA 2VF5X 2FZCA 4EITA 3TUIC 1E2EA 5JSZA 3K0EA 4QDJA 4W5HA 3A4LA 3UUGA 3TIFA 4LNHA 1YAHA 2W71A 4YQEA 3WGNA 4MS4A 3A06A 4AY5A 4UCXA 1YVEI 3VTZA 3NEAA 3GLRA 4CLEA 3BK2A 1MRZA 2YXPX 1K7FB 1O08A 1E3JA 4DMMA 1CW2B 1NIJA 2CFOA 3LDCA 3TNLA 3FYUA 4MT8A 1PJ2A 4TMXA 3N2ZB 2Q5OA 3UO3A 1YDGA 3L0CA 1E2NA 3UQZA 1XIVA 1KY3A 4MYUA 4UJ5A 1E1DA 1NQUA 3BBPA 4S1PA 3S5UA 2GARA 1T9AA 1TF2A 1VB5A 1Z5VA 2XGGA 4LFBB 3VYUB 3DT8A 2BGGA 5EXSA 1RRGA 1EFPB 1R4NA 2C20A 5C8VA 1N0WA 3PPXA 4LOHA 5J2TF 4JJAA 3P0RA 4DYDA 4H4DA 2GPNA 5LC1A 4KR9A 4BWFB 1VOTA 1FDSA 4DW8A 3U49A 3IPAA 4LVNA 2POQX 5KNCH 2NVOA 4E5VA 1KEVA 3G8CA 2J3MA 4MUBA 1BWQA 4EHJA 5HIJA 4G1UC 3UIEA 5BN5B 3IC7A 4BV9A 5F52A 5KSPA 5JV5A 5FV4A 1SRQA 2HSEA 3MSXA 4NQRA 4LP8A 1HNXB 5JSHA 2X40A 2WF8A 1R1DA 4ND7A 4CIYA 3LDUA 1HE8B 3O8BA 2D2VA 1WCIB 4W5RA 1H0HA 3KLPX 3SPHA 3RRYA 1MO4A 3CLRC 1AB5A 1KMIY 5B58T 5SY9A 3T7DA 3C3AA 2B35A 2NO4A 2INGX 2E85A 1X0XA 4YTEA 4EWLA 4AWXA 3ZVLA 1B7GO 5GTDA 4TTJA 3TRHA 1QRAA 2YDXA 3V6LA 3LUAA 3KEQA 3L18A 1XNQO 3PPYA 1O8CA 4R69A 3HWX1 1T13A 4U9UA 2BFEB 3U61B 1T29A 2RGWA 3D7MA 3GCXA 4M7RA 1Q90D 4KIGA 1FMLA 4YY3B 3SG0A 2YW2A 4UFPA 5GV7A 1N6PA 2OCGA 3MQ2A 2WIGA 1YR3A 4ZQBA 4ZOLA 5E4FA 5IXSA 3SZOA 4H44B 3CUVA 4YA6A 4NV1A 1WJGA 3L07A 5BV8A 3FOCA 1GZ3A 1P5RA 2PMBA 3ZMVA 3G49A 1LWNA 1AGNA 1PWHA 3LY8A 5M7EA 3DOHA 4PHGA 5SZJA 3S99A 1QP4A 4HDKB 3A7DA 1JKMA 2A0FA 5ALXA 1EBFA 1OKKD 2G70A 4DRXB 1YHZA 4EVSA 4YJ3B 3DLPX 2H5EA 3F5WC 3GRCA 2OENG 1SUWA 3OMAB 1KIMA 2VWGA 2ASEA 4GX0A 2W2QA 5EQFA 1I14A 1T1GA 4I9NA 2IYPA 5AK5A 4M53A 1XP5A 2F8MA 3L4BC 1ZJJA 2FDXA 3P2OA 4FOPA 5JG7A 1G2QA 3HJNA 1APBA 4Q37A 3AWDA 4ALJA 1KZ1A 4PO3X 4D8TA 4IZHA 2AOUA 4J7UA 1EM6A 4K3VA 2VXOA 1AJQA 5ENVA 4L5JA 2VKTA 1RYHA 3O93A 1C1XB 2DWOA 4LV5B 4O33A 1PZGA 2XR1A 5DZSA 3GFOA 3RTBA 8MHTA 1OXBB 4BFTA 3BEDA 5GZ3A 2PIAA 5H83A 3I9OA 4G25A 5F76A 4GWKA 4X1IB 1SR8A 5L3FA 3DNPA 1DSSG 1ZVKA 3EDCA 4Q6GA 4DIKA 2UXCB 1ITZA 1IBCA 1P4JA 3Q2OA 1AKEA 2O8FA 5KB3A 1UQTA 2BGIA 2ZSIA 4M1WA 2YUIA 3F46A 3NIDB 1ZGGA 3Q3VA 4CH4A 1RLTA 4LYEA 3QEOA 1AIPA 3EWNA 3DZ8A 5JQGA 2ZJYA 1D1PA 4CQMD 5JPDA 5B58C 4UM5A 4P2ZA 4DABA 5JJ5A 4UXIA 3W7VA 2J09A 2DGDA 4EUSA 4BQFA 2Y0CA 4GD3Q 1K3UB 3WGQA 4FEGA 1K6JA 3U4GA 3QLEA 2EZPA 1UQUA 3QVGA 4IIXA 4I9HA 4KWHA 5DHSA 2BE9A 3PA8A 1A95A 1CUSA 4LJYA 4NK4A 2DBYA 4NCAA 4J4BA 1WF3A 1XMXA 3KM0A 1JG7A 1GAXA 3C3MA 5KCMA 1WE2A 3MS7A 4TKMA 5T5QA 2C58A 1M5RA 4YASA 2REQB 3L43A 1I30A 4G5QA 2FE1A 4HX2A 1IJEA 4MA4A 2DUNA 4BASA 5CJ2A 1O5OA 1MOPA 3N2GB 2C7PA 4LZJA 2OLKA 1CG6A 1PT8A 4CDMA 2QOEA 5FBKA 1R6KA 1VA4A 3ABUA 4C4OA 4C7MA 1XYGA 3D3JA 4DIFA 3KCNA 1TMKA 3AUJB 1N5OX 2QROA 2IYQA 5KMGB 2R11A 2ZDHA 4U1RA 2QN9A 3O4RA 1TJ5A 4AUKA 3W3ZB 5FPHA 3CCQV 2QGZA 3BERA 5LYJF 4M46A 3GA7A 4JP1A 1R6XA 5E6UB 4X62O 1SRRA 2JHGA 1NI4B 4LZWA 3VNRA 3CRVA 2Z0AA 2OBXA 3PQ5A 4MDHA 4UARA 5DBHX 4HNVA 4FFVA 4BRUA 3PT5A 5B30A 2JJ2D 2NV6A 4XZ3A 2BFDB 3JR7A 4NYMQ 1U2SA 1GG2A 1JDNA 3BRQA 5HJ2A 2YWEA 5IXYA 1U6KA 4GZMA 3HXLA 2ZIMA 1XRMA 4G97A 4LXGA 4F0JA 4CGYA 1YVWA 3GFPA 3R9WA 4NBTA 1ZM7A 4OL0A 3MWEA 1W0KD 3G2PA 3CEJA 1R3JC 4MZXA 5H81A 1Q0ZA 1M7GA 5FPKA 3CRMA 4CF5A 4LY6A 4JBHA 4YJFA 3LI2A 3CLSD 3LWDA 3N87A 3VYTB 3MRTA 5MN4A 5JW6A 4C29A 1D2RA 4KJXA 1LDBA 1JKFA 2CJYA 1QS0B 4R0NA 4C6TA 4OUKX 2NSYA 1VHDA 5C51B 4JI8O 3N8KA 2OCLA 1CZHA 3PLAE 2QTZA 2XXAB 1W44A 3P9IA 3VRHA 1Y81A 2XE8A 1UC5B 4ZOBA 3E7XA 2VN8A 3LVRE 1BO6A 3U62A 1O97C 4DVGA 1ZKDA 3QXJA 3OG9A 5UKDA 3CVXA 1Y80A 2GK4A 3CCVV 3RUFA 1ONPA 3R76A 4QQFA 1NW9B 4OM8A 3GD7A 2IA5A 3WV5A 4YECA 2E4YA 1RWQA 3TLJA 4U7JA 2RHOA 3MM4A 1G1MA 5AJHA 1FCJA 2J9FA 1W19A 2VDUE 2H85A 4BGUA 3MTAA 5B3SB 2WA4A 4Q02A 2PTMA 2P6JA 3FTNA 5HBGA 5NULA 4ZV9A 3HLYA 2DPLA 4GR5A 1ULAA 1CQIB 4MUYA 2CUTA 2BE7A 2WRZA 4ZVOA 1MNAA 4GYWA 3NHRA 2BISA 3IO5A 3ZDEA 1W88B 2FMTA 1USKA 2H4FA 4MRPA 5JQWA 3SVTA 1SUPA 2RHBA 4Y2VA 1OKKA 2FXIA 4Y9UA 5LOVB 3GRVA 1ID1A 3AVOA 2C2XA 2Y6UA 3A04A 1JI3A 2X1HA 2L19A 4JI6O 5ELLA 1CZKA 3E27A 1SC1A 2E3JA 3U4DA 1HYBA 1G21B 2OV1A 1QTIA 4NXMB 1N78A 2NZWA 3TTSA 1W30A 4A5UB 1ZH0A 3BWXA 2NO7A 4X8HA 2EJVA 3IT0A 1Z16A 5FTLA 1CB0A 1UAYA 1FQOA 1H6CA 2A59A 3ND7A 4WNCA 1T1SA 4EJ6A 3OZCA 3NRBA 3RASA 3FLAA 4F1KA 4HX5A 2GEKA 3PICA 2YS8A 3A9SA 1GFZA 1RE1A 1HNZB 1XI2A 2WG1A 2ZK7A 2DE0X 1N92A 4IUBS 1P73A 2WQ7A 1PL0A 1X8JA 1GNRA 1LBTA 2TMKA 5KNDH 3O90A 5EWLB 4XPIA 2D2CB 3S29A 4TX1A 4AYWA 4WINA 1JYSA 3VUFA 1Y6FA 2YS7A 5JS6A 4PTLA 4Z9AA 4ITUA 2X5JO 3UMVA 2ITDC 2X19A 3UWDA 2NAFA 4CQMA 2CV1A 3AG2C 5DTQA 1ADBA 3CYOA 4X1YA 1CUJA 2CYBA 5CHYA 1YITV 3ZJTA 4MS3B 2C96A 3BABA 3IUEA 2NTYC 1L4BA 5KKAA 1CZUA 2W2NA 5FOTA 5SICE 1WB9A 1K7EB 1GTMA 3SDBA 4RF3A 4QQ8A 1UFVA 4QPKA 4LPSA 1VE5A 3EXHB 1H3FA 1N2GA 1QDLB 2FUCA 1P7WA 4FUQA 3AU9A 5ERGB 4Z0TA 1BOFA 1YL7A 5B1BB 1NMSA 1A71A 1R6TA 4EO9A 3ZHBA 3NEYA 2IH2A 2WJVA 3LYUA 4URWR 4TTVA 1JA8A 2FF7A 4UDOA 4QATA 2H0AA 2WWRA 3BWVA 1Q6YA 2AOVA 1KJIA 4QLAA 2WW8A 1Z4JA 4M9RA 4X20B 3LZ6A 2OXEA 2PV0A 3ET5A 4IMJB 4BBJA 2BMDA 4ZTBA 1OZGA 2E87A 4YP1A 5ENDA 3OTOO 3GNLA 2FHPA 4EHIA 3Q7TA 1RPNA 3S7ZA 1KQNA 2FI1A 3OKCA 3AHCA 3RHZA 3ENVA 3JRNA 3NWJA 4E32A 1PI3A 5GM2A 1ZLYA 1F7VA 4Y30A 1FF9A 1LV7A 3WDMA 4XAQA 3R0IA 1E0SA 4E5KA 1DOZA 2XUQA 4G37A 3D3KA 4DGSA 1EXVA 4Y2HA 1I10A 1AV7A 4RK5A 2R47A 4NV0A 4RJ2A 3QEMB 1SS3A 3EF3A 2QB5A 1PT5A 3ZWXA 3MLBA 4FGUA 5HRUA 2OFXA 2WOOA 5B66Z 1HE5A 2O5RA 1YUNA 2MW2B 4W7HA 3LC2O 3W5VA 3VOSA 4OJKA 1L1EA 1JCHA 1NNUA 1A7UA 2F62A 3MTJA 2CUZA 4Q3EA 5DXFA 1Z68A 2RGGA 4ZT3A 1G8PA 2BHTA 4BLSA 1W4CA 2JJ2A 1Y8RB 3F5TA 3IJPA 1Y1LA 1MZVA 3TD6A 2C9BA 4ABYA 1YR2A 3LDDA 5I9SA 1NBEA 3MA0A 2IIVA 4O8ZA 5BN3B 1CY6A 2OO7A 1W0KA 3L6DA 2FFRA 4OJQA 5IT9A 3O8QA 4Y9SA 1ZEJA 2XRYA 4NU6A 3VOUA 2IUUA 1O95A 2HMWA 5AVKA 1OZAA 4IAOA 2FOXA 1RWBA 4MKXA 1Y1SA 5JCOA 4BU1A 2VATA 4KN5A 4LEIA 1XSEA 4TRJA 1DX9A 3E3NA 2I71A 1TUEA 2O2HA 3G13A 3MIZA 1KY4A 3DV9A 2G8NA 4LQDA 4E4EA 2GPTA 3FTEA 1SCDA 3DQQA 2YBDA 5EP2A 4DTIA 3L77A 1IBLO 1DS6A 4X44A 2RMKB 3U4HA 3SR2C 1B93A 3HFJA 5BVGB 1UOQA 1FRQA 4ZO7A 3O82A 4OU5A 1OCZC 4MPRA 3THWA 2LE0A 3A58B 3HJUA 3DEKA 3RIGA 3OT4A 3Q8MA 3BH7A 1DQRA 4OBEA 3HA5A 3MOSA 2EGHA 4UAVA 1XZDA 3UH1A 3Q8LA 3NUQA 2DH6A 1SU8A 1VP7A 3HPLC 1XZCA 5KSOA 3S1AB 2VS0A 3JQ7B 5E4JA 3W05A 1CS0B 1VJRA 1Z6AA 3X2EA 4CJXA 3TQRA 4XUGB 1JSRA 2ZJ4A 2NU7B 4X3OA 1B04A 4FBLA 4FMPA 4H33A 5JNLA 3KOYA 1R5NA 2RAVA 1Y7IA 2RGAA 4I1SA 5DWQA 3BJEA 1E2QA 2NXWA 3AHEA 3GQBB 2FEMA 2Y66A 3IAEA 1E18A 1KFBB 4OQDA 1SELA 2JDIG 4JXZA 1U7HA 3BKWA 3WQQA 3SJCC 1ECGA 2HEIA 3RYTC 5B7GA 1FIUA 1FP4B 1THZA 1M1UA 4DK0A 5A3SA 2A1IA 4J2OA 4GSYA 4ZQHA 4J8PA 4JLUA 1RSZA 1YRLA 4ITVA 1DXYA 4LDNA 1CY7A 3DTYA 3HYTA 3MLAA 1RYZA 2GPSA 1US8A 1ZI8A 4C2TA 4I4TB 3L0IB 4O02B 1U9JA 5HKAA 3E9CA 3VAYA 2IRWA 3D8NA 3PITA 3BREA 2IXEA 3Q2IA 1NNEA 2Z8XA 4YR7A 1L7RA 3E5RA 1RPTA 4LBWA 2Q6AA 3CNHA 3HZHA 5TNXA 3OIFA 5JIBA 1C3LA 1M6EX 2EIJB 2DETA 3C85A 1TT5B 4G81A 4DT1A 3KKZA 1IWOA 2B99A 1ZESA 3E2PA 2VXYA 1HX7A 5T8KC 2GKOA 4KE8A 2UUBB 2PS1A 4CT4B 3PR2B 1TCAA 2CVOA 2Q9AA 1T1JA 1GUAA 2FPUA 1O6CA 2B20A 2Q5ZA 3RAGA 1PJQA 4CGZA 2E4AA 2MR5A 4F72A 4C4PA 3G8YA 3VO9A 1DC3A 2JFWA 3KVRA 4S3MA 3Q6MA 3DZKA 1H8HD 3O2SB 1KDPA 1LSUA 2P0AA 4R1PA 1K6MA 2PI4A 2IHKA 4QRIA 3J81N 3C6YA 1K75A 3UY4A 3C90A 2C2HA 2QM7A 4RKQA 3KSRA 5KVQA 1YFJA 2YFHA 3ZDZB 3L0ZA 3L8DA 1VC2A 2IY9A 5HDQA 1AKMA 1J06A 1UEIA 1E1NA 1IDSA 2JGLA 1PZMA 2AFRA 4B87A 1H6DA 1T36A 1SCAA 1A5AB 3K9WA 5AK4A 3FB6C 1L5OA 5AXAA 2V0GA 1KMIZ 1ZUD1 5A5GA 2MR6A 3K58A 1Q3HA 1OJ7A 2ZLBA 4TMYA 1NVPD 1G19A 1V39A 1XAIA 4ES6A 2HWUA 4RA9A 3T6KA 4HTFA 3TAXA 4R8MA 5KTRA 2AUNA 2VDMB 5LGTA 3M5DA 2A57A 1ZA2A 3JARB 3H5LA 1QFMA 2G9UA 3B2EA 5IABA 3KQUA 4EKIA 1YIOA 1KP2A 1V4VA 1PR2A 3FDXA 1YVUA 1KE2A 3UO8B 3P4UA 3MJDA 2W22A 4UTOA 1YQQA 1OU0A 1O0SA 4MARA 2DT8A 2Z8YM 3LX6A 1EEHA 4BQNA 3U3MA 5L95A 2QPLA 2CKDA 3JQGA 3CO5A 1AR4A 1LK0A 2WHPA 2C03A 4O2AF 4Z2AA 3O1IC 4NX2A 1UUFA 1S77D 4B48A 1QK4A 2J9YB 1MZFA 2B8EA 3CE9A 5CFMA 3FFXA 5BR1A 1H2AS 3S1LA 1AVTA 1I5XA 3S2YA 4HDCA 3DBLA 2O0MA 5DYYA 1N34O 3DNMA 2MINB 1DVRA 3TB6A 3ZV7A 2VOEA 4RK4A 4YO8A 5J4VA 5A4MS 1Z2PX 4OI2A 1XILA 2XB9A 2VXBA 4X8AA 1YKFA 2QENA 3IUSA 4IKOA 3X1XA 5BXYA 2I7TA 2PYDA 1L4YA 2YWBA 4I1YA 3PC8C 3N2YA 1YIJV 1W29A 1BXRB 5ISMA 3QSGA 3TRDA 1HQCA 5FTKA 2ESRA 1ZI9A 3WIVA 1WABA 2QX8A 2D59A 3ZDAA 2PVPA 1FUUA 4WADA 4BR6A 1YJ9V 3GP5A 4DV3B 2GBIA 3L7MA 1GKYA 1X6VA 4DBLE 3A10A 2I1QA 2IYLD 4U7FA 3ZK8A 4AJNA 3EUWA 2QV7A 3V1KA 3M5CA 3SF0A 4BFWA 5K0EA 1XMOO 1IBLB 2QN1A 1ANKA 4FFKA 2Z4SA 3MC1A 5FWYB 3O94A 2D1QA 2HHAA 2PI5A 2DT5A 3KUCA 4KDRA 3KXPA 3AUYA 4LQLA 1ZLZA 3W77A 1XUQA 1S5HC 3AY6A 5CA1F 3SE7A 3ZXXA 1RE0A 5ICCA 2GN6A 1GLGA 2Q5FA 3WP1B 4PSUA 5EJ9A 2JI7A 2IHBA 1DJLA 4R2MA 1E7YA 4M76B 3AXSA 2FSVC 2OCKA 3W7TA 4A5OA 4REOA 1HSZA 3D8CA 3R3ZA 7YASA 2XE4A 4X66B 2XGMA 3ICCA 4QAQA 3GGJA 3QUSA 2OHFA 3OX4A 3HFSA 3CCMV 2XTMA 4YFYA 2AN1A 2AD1A 2C4NA 3GEHA 4WERA 1RTTA 4PQRA 4JI4O 4LCEA 5FI5A 2JVDA 2OCAA 4BZXA 4TPKA 2WU8A 3QE4A 1UDAA 4IJUA 4YHHB 3S70A 5FBRB 3QOFA 4HGOA 2GZ2A 3WLPA 2HO4A 5HSGA 4FC7A 2WE8A 3EIFA 2BAGA 5TC4A 4B4UA 2V1DA 2EC5A 3KK0A 4Q7EA 4HH3C 2WA3A 2ZATA 1BCSB 1V11A 1QONA 2DEUA 4DLZA 1Z74A 5L8VA 5EJAA 1NT2B 5H9VA 1COZA 2I4RA 3K3PA 1N3IA 4LTMA 5JWRA 2W6QA 4G4GA 1ZDMA 1G3MA 3A6ZA 4FKBA 2QTVA 1BZYA 3H0KA 2BBSA 1B15A 2WEKA 2CJWA 4CF6A 4HGZA 3OIUA 3GROA 4ADSG 3U26A 1Q1GA 3CONA 5EJ6A 1REQA 4Q3LA 2GHRA 4B46A 1YZNA 3HQ4O 2XTJA 2WIFA 3OF2A 4X61A 2IX9A 3W5SA 1K63A 2YVKA 5EZ6B 1SPXA 1JPJA 4C0LA 1E79D 1L4MA 1KSJA 3TXXA 5I5GA 3STVA 3GJZA 4BEJA 3UK0A 4MB6A 2WFMA 1WZUA 3PLRA 3C3BA 4ND6A 4QQKA 4K8XA 3R65A 3TRFA 4JI7B 2ZSKA 2G06A 3GLQA 1YWGO 2RAUA 3GVMA 3QW2A 3PJFA 4FYIA 4US0R 2FY8A 2VRBA 2VYCA 3WMEA 1XTVA 4RSHA 2I3ZA 1WDWB 3A37A 4HS9A 1R4AA 1NW4A 1ZUIA 4PYQA 5JXHA 3WAJA 5E1DA 3TLZA 4HEA6 3FOFC 2EW1A 2QV0A 3O75A 2A9RA 4CKCA 3A0RB 3R20A 2A9FA 2FAXA 3M0EA 3ASUA 1WKCA 3PJGA 1C30A 4IJVA 5IUNC 3AVPA 4D5GA 3I62A 1P9WA 3BGVA 1X70A 4XA8A 4I81A 4RW0A 2QS9A 5K7SA 4PX3A 4IYRA 2QJRA 4U7WA 2OWOA 2A1UA 1PLLA 3BTUA 4EPXA 1MX5A 1T2NA 2QP4A 3AR9A 1QR6A 4I9GA 5CYGA 3FW1A 1W36D 1W96A 3G5LA 4HDSA 4PYJA 2ARKA 1IK6A 2J3QA 2GCOB 4WHMA 5JAQA 2XVYA 4DA8A 4ENVA 1BX3A 2BSQA 4HYOA 1K98A 3AHHA 3DZCA 3KVVA 3UJ9A 2EJ7A 4Y6GB 3MK31 5IKEA 4UW9A 1H23A 3ODPA 4O2BB 4PI0A 4RVCA 2KSQA 3ICEA 1C7RA 4Q3CA 2Z04A 3QSYA 4KR3A 1PHPA 1EJ2A 3LDGA 1CZLA 3IAM1 4DS3A 3BULA 3WI7A 1KR5A 1T0UA 4KDCA 4KG7A 3FVQA 3R23A 1XHLA 1OX4B 5KQRA 2HXYA 2QIOA 3D6JA 3O4GA 4CRWB 3R0ZA 3W5CA 5EWMA 2FW7A 1IY8A 1DAEA 3HUDA 2Y4NA 3QLUC 2XXJA 3I1JA 4FCVA 4FNOA 2V6GA 2LIPA 4BO4A 5CCBA 1HYQA 3IVGA 3FFBA 3X2QB 2XEDA 2UXBO 3GPLA 4KVFA 3BA9A 4FLUA 1OFIA 1GN8A 1JTFA 3TFWA 3KSDO 4XJTA 4A8JA 5IVKA 4AJHA 4ZYTA 1RJFA 1Y3CE 3I30X 3MGBA 2HADA 5FUYA 2Q5IA 1FPMA 3FETA 4ISBA 5LGUA 2X2OA 3SC6A 4Z4HA 3FRIA 1W35A 3GVCA 3KHSA 4LK2A 1XMOB 3LCMA 3HE3A 1Q15A 1Z26A 3JWGA 4G5SA 1KQOA 2CGEA 4YP9A 1QVRA 3AJEA 3D0RA 1KYZA 4QG7A 4C04A 3JZDA 2IOFA 2PYZA 4NEQA 3KQPA 4PYKA 1E5XA 1PO7A 3ASOB 4AZVA 3V8RA 4Q12A 4ZEOA 1SG9A 1MZPA 5L45A 2FWBA 1KYTA 4WECA 3R7BA 3ZQ4A 5GJCA 4GW3A 5A4AA 3AOEC 5A4DA 2WVGA 3FUTA 3ZWKA 2LKDA 3FCUB 5BR7A 1BS3A 1EK1A 2Z9DA 3ITKA 4RV5A 4H7JA 4LK3A 3EG5A 3DBHA 4HN2A 2ZIAA 4H3VA 3BK1A 1SBNE 4IDDA 4HDOB 1W49A 1OWNA 1LZLA 1J97A 1SG0A 2Y1XA 4IX9A 2B37A 4UMDA 5D85A 1Z34A 2PMWB 3SVZA 4OIFA 1A7JA 3CWQA 1N4AA 1WUHS 5AIBA 3DA8A 1R0XA 3X1KA 2ZRIA 2QN2A 4FNGA 4HZUA 1WPGA 3SBOA 1V47A 1NURA 4Z54A 1IZ9A 3P9SA 2RH9B 3M3DA 2FWMX 4DCJA 5DSZA 4ZQFA 1ZUQA 5EPUA 1PD0A 2NZJA 4XW2A 2Q69A 1J2RA 5TXGA 4DIUA 5ITWA 1HT2E 1A9XB 5IDQA 3OZEA 3VTAA 1IUOA 2ZYHA 4R8VA 1BMFD 1M6NA 3ZS9A 2BL4A 3N76A 1FP6A 1OYWA 3H87A 3BH6A 3MT7A 3GJ3A 3OTIA 2R5FA 3VR6D 2EIKC 1B8UA 4PLWA 4FX5A 4IVRA 1KVUA 4I9UA 2ISQA 1EX6A 4ZDKA 1LLQA 5AJVB 4CLOB 2EZTA 3VXKA 5EVJA 3NWOA 1PNRA 4IF4A 4Z53A 3R3UA 2GM4A 4MUXA 4PFSA 4AP5A 1QFYA 4OLJA 5LQNA 4NVRA 3ZE6A 1H1TA 1E79A 4FTWA 5INTA 4ND5A 3KQVA 2BT4A 3AF6A 4DQUA 1LBEA 3H4TA 2HJ9A 2DW4A 5FPOA 5ALFA 4XDZA 2DMXA 1HNXO 4DG5A 3UK1A 1ZMTA 5IP5A 1VQLV 4A91A 1JEYA 3AFMA 2KKWA 1M8PA 4KTVE 4KQJA 4Y1RA 4G23A 1J1UA 1I24A 3PNPA 2IE8A 3RT9A 3NV7A 3OEWA 3MHHC 2CNBA 2BP7A 5CYOA 1F1BA 3FWZA 4PA9A 3LT4A 3KALA 3ZNOA 5B3LA 1SU4A 1U7ZA 3RW0A 1DKUA 1Z4PX 1OLXA 1QIJA 5EXPA 2ODQA 1HP8A 4NU8X 2R44A 3CNOA 2XCLA 4TM8A 4GOLD 4PQYA 1NI8A 1U0OC 4CMGA 4EMBA 5EVCA 5D6OA 2IHJA 2H1IA 1JVBA 1J70A 3RC1A 1NY6A 1OXUA 1MNQA 5FOQA 3N2NA 3H2JA 3IAUA 4PFQA 5IJ9B 4YY3O 3CF2A 1G7SA 3IPYA 5LM3A 4QOSA 2GT1A 1E2UA 3NCTA 1JQAA 5HMMA 1ATIA 3IUMA 3K0GA 4MPDA 1X1EA 1AXGA 1AK2A 1BVYF 1ZOOA 3O9VA 1WVIA 1XPOA 4EUEA 2PX6A 1VQ6V 1U6JA 4LYJA 1RU3A 3Q7IA 1U3VA 3C16C 2FFBA 2VPPA 1LH0A 5TQJA 2F3UA 4JLPA 2HIGA 2O48X 4P4SB 2IYEA 3EXFB 3S2IA 2A88A 3DW1X 3M6XA 5IC6A 2JAHA 2PUSA 2RI0A 5JSQA 2MYUA 1YAJA 1NTRA 3A2KA 4YWJA 2HPVA 4KXVA 3OCCA 4YAGA 5CVEA 3L1IA 1N1EA 1VZ2A 3MPOA 1PBNA 3KC2A 3L8MA 2X15A 4TTAA 2X8JA 3LWNA 5D3ZA 4XUEA 2J0UA 1OW3B 1EUCA 2Q8QA 3DSQA 2I87A 2EEPA 1OX6A 3KT3A 3QPWA 1QHSA 1ODTC 4UUMA 2XXBA 3H2KA 1FNCA 3LPNA 1F20A 1XK7A 4QL3A 4GM1A 3I2GA 4EATA 2CXSA 3W9UA