3EXAA

Crystal structure of the full-length trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
303
Chain Sequence
KEKLVAIVGPTAVGKTKTSVMLAKRLNGEVISGDSMQVYRGMDIGTAKITAEEMDGVPHHLIDIKDPSESFSVADFQDLATPLITEIHERGRLPFLVGGTGLYVNAVIHQFNLGDIRADEDYRHELEAFVNSYGVQALHDKLSKIDPKAAAAIHPNNYRRVIRALEIIKLTGSPYNLVMIGLTMERDVLYDRINRRVDQMVEEGLIDEAKKLYDRGIRDCQSVQAIGYKEMYDYLDGNVTLEEAIDTLKRNSRRYAKRQLTWFRNKANVTWFDMTDVDFDKKIMEIHNFIAGKLEEKSKLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the full-length tRNA isopentenylpyrophosphate transferase (BH2366) from Bacillus halodurans, Northeast Structural Genomics Consortium target BhR41.
rcsb
source organism Bacillus halodurans
molecule tags Transferase
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
total genus 98
structure length 303
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.890 Mainly Alpha Orthogonal Bundle Helix Hairpins Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 3exaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3exaA01
3AF1A 3THWA 2R8RA 1J8YF 4Q4HB 1OW3B 3ZDQA 3L0PA 3EZ9A 1WMSA 4ZPXA 4M1MA 1Z8FA 3NBFA 5LD2B 3LY5A 5FPSA 5BYJA 1DBSA 2VF8A 4BE7B 1NG9A 3H4MA 5EXXA 4AURA 5B30A 1ESMA 3A58B 1P62B 3H2YA 1Q20A 5KOYA 3QPVA 4KYUA 4W5WA 1JR3E 1YRBA 3TJZA 2ZRNA 1N3BA 3RS4A 3EZ2A 3RC8A 3QENA 1E1RA 1XMJA 5CDFA 1VCMA 1AGRA 4IDPA 1FUKA 4O25A 4G5QA 5F98A 1Q1ZA 4B33A 2X1VA 5FTKA 4IXMA 1NVVQ 1CIPA 3RS5A 1DG1G 1OB2A 4PC3A 5DIFA 3GJ4A 3ZS8A 4KV9A 4P31A 3ZH9B 2CLDX 1UJ2A 4AKGA 1CJUC 5JJKA 1VG8A 3HR8A 5J40A 2C5LA 3BB3A 4P3YA 4A9AA 3BH6A 3F0TA 3FHCB 4BLTA 4BEBA 3FDIA 4LHYA 1GL9B 2A30A 3KKPA 2VRWA 4LJ6A 4YXWD 5JI3E 3QNUA 4IDOA 1Q44A 1N6IA 4XVUA 3CW2A 3PG5A 4PZLA 2PBRA 3JVVA 2VPPA 4LGMA 1SVIA 1W2GA 4HB3A 4Q7KA 4KXFB 4RSGA 4US1R 3R7WA 2H1LA 3I3SR 3KJIA 1RE0A 3CIOA 1FZQA 1JXMA 4NPHA 1Q12A 4LJ5A 4HLDA 4JSTA 5FL3A 5FUYA 1H8EA 3MLEA 4I99A 1FP6A 1KTVA 3PEUA 1Z0IA 1G21E 5EJEA 1YZGA 1GZSA 4OKSA 2G0TA 2JEOA 2H8KA 1GRQA 3AF3A 1L7VC 1Q3TA 2QSYA 2GHIA 1OLOA 4FMCF 3SHFA 3WY9A 1NBME 1NVWQ 3IO5A 4DLXA 2XXAB 1S3GA 2GVDC 3KTAA 4RD2A 4D0NA 3THYA 1D2NA 1E2NA 5GJBA 2FU5C 1HE8B 1AM4D 1VHLA 4CIDA 4LSGA 3W6PA 4MRVA 2VHUA 2VP0A 3RSLA 3VR2A 1JPNA 4JLAA 3K0SA 2G83A 4NCJA 1QDEA 4MYCA 2Q9CA 3NWJA 5DYGA 3LDAA 1VKJA 1KI4A 1IOZA 3EC1A 4LJ4A 1NP6A 1E2EA 4OHVA 4Q66C 4QGHA 3FFAA 1YZQA 1ZUHA 3UWOA 3ADBA 4HB4A 1IJEA 1KK3A 5BN3A 3ICQB 2OFXA 4DLRA 1PUJA 5ANRB 1AKYA 2ZAOA 3KXKA 4A8JC 2DFKB 3IEVA 3NIBA 1ZM3A 4RZ3A 3EWSA 3QVUA 1P9NA 3OAAD 4UNNA 4ASUD 4V0NA 1I4DD 1XPUA 2W2TA 1WP9A 1E1QA 2VP2A 4B3BA 4KFSA 1O3YA 1NVUQ 4HB2A 2B8TA 4PQYA 3PEWA 2ZE7A 5HE9A 1E2LA 4POAA 2XJ4A 3PVSA 2ODNA 4FI3C 2BMEA 1ZM2A 3K0CC 2QRNA 1BO6A 2QTHA 4LOAA 5FBQB 2AKAB 1QHHA 4RJLA 1YZLA 3FMFA 2NQ2C 1U99A 2QA5A 2BC9A 1CRPA 3UG7A 1ZD8A 2X8AA 2W58A 4A4DA 1S2MA 1G3QA 1X6VA 2HLDD 1G5RA 4EPXA 5FFMA 1NSFA 1AQUA 3RDPA 2HT6A 3E70C 1XCPA 1VMAA 1XEWY 1IM2A 3LX8A 5CDFE 2RGEA 1DTSA 1LY1A 2BIFA 4RKEA 2AX4A 1XEFA 4LRWA 1SXJA 1LB1B 1A1VA 5C4MA 4NTZA 2AKYA 1RJ9A 1Z6XA 1ZINA 2HV8A 4BASA 2ZRGA 3S1AB 4B3XA 1P4SA 2WPDA 3T1TA 1U8AA 1XXHE 3K9HA 2IT1A 2PZFA 4NYJR 4QM6A 4DC9A 2IXGA 4NU0A 3U3RA 5GJCA 2V8OA 2VHQA 4D4KA 2RGXA 2VYFA 4E5UA 5K8IA 2WAXA 1BMFD 2FWRA 3IHLA 5E7MA 4BFVA 4PAMA 1N6KA 3DZDA 4Q1DA 3ZD6A 1U9IC 5IF9A 1E9CA 4HB0A 4DIDA 1G6HA 3DL0A 4FMBB 2J9RA 4D6PA 1MO5A 1XBTA 1F2UA 4CT4B 1N6PA 4NH0A 1H8HA 4PXAA 3OEEA 2F7SA 3GLHE 3RS2A 2O8DA 4HLUC 2Q3HA 5E7IA 3GLFA 3AM1A 4QKQA 4AY2A 5JEEA 3QSYA 2EYQA 2OHFA 3ASYA 1P2VA 4QHYA 3CX6A 4LK2A 1W7AA 4L5BA 4PSVA 4B75A 4EFLA 5BXQC 2JLWA 2AXPA 1IN7A 4B6FA 1W0JA 4JLNA 1N5LA 5FTJA 2GTPA 4URWR 1MR3F 2FSIA 4V0OA 3TLXA 2J87A 2NTYC 2ZROA 2OSBA 1P9WA 3PUZA 3EZ7A 4V02A 4ZCLA 1D9XA 4C0KA 2IS6A 1BYIA 1AKEA 2X19A 1GIAA 2PMDA 4W5HA 1NIPA 1TU4A 1OKKA 4R98A 3EA5A 2FFHA 2R6GA 1FNNA 1DAEA 1JJVA 2GDJA 3KUDA 1ZUIA 2R62A 121PA 1T3SA 4OHXA 4GP6A 4M1KA 3SFZA 4C7OB 1LNZA 2GAOA 4AC9A 1T8UA 3L43A 4Q4JB 1R5OA 4K46A 2FE4A 3AUXA 3KFVA 3PEVA 2JIZA 4DB2A 2P67A 3MWJA 2RGAA 3KDSE 2YOHA 3T5DA 3T35A 4FCVA 1OE0A 4EQ6A 4PPGA 1Z0KA 4URUR 4B32A 4CZ2A 5IDVA 3QPUA 1NIJA 4JZKA 1DAMA 4UQOA 2IYTA 2GZDA 3R8CA 1TEXA 1DO0A 2BM1A 4KO8A 1M6NA 4LHWA 3WMEA 4OQNA 4LJYA 4A6PA 2F9MA 2IEZA 5AJXA 4BRUA 1S9DA 2QT1A 3RNLA 1NY6A 3WBKA 5JS7A 2C98A 1MO4A 3DVLA 3IIMA 1FL9A 3K0AB 5HE8A 1MABA 4N0DA 2IYVA 2C96A 4Z1MD 2R6AA 1ZNWA 3O47A 2FEOA 2ZVPX 3CPJB 4MKHA 4TYPA 3UIEA 1R7RA 4M9SA 3LBIA 4DZZA 4Q9LA 4XVRA 4XVQA 2OBMA 3TSOA 4IEIA 4IDHA 2ZREA 1SVKA 3EZ6A 1T0JB 1XPRA 1HTWA 5HCNA 1FX0A 1R5NA 3UMRA 4OK3A 3MD0A 4TT3D 2RAPA 3C8UA 3S1AA 2ZJ5A 1G64A 3DM9B 1G3RA 3IBYA 1ZD1A 2OUKA 1NNEA 1CBUA 2OBNA 3GEHA 3BERA 4R2HA 4GMXA 3DHWC 5JS8A 2A5FA 3U3KA 1Q1EA 1G9XA 2WICA 3BRWD 5HR5A 3LBHA 521PA 1CR0A 4NYIQ 4Q4LA 2G9NA 1ZC4A 3AV0B 1AQYA 4D4JA 5AUNB 2QNRA 3I1FA 3KQLA 3T1VA 3QXJA 4EJSB 5FPTA 3TK1A 2ZRAA 1KK0A 3D8BA 1Z47A 2OAQ1 2O8CB 3RS7A 1TF7A 2KWIA 2ZRKA 2BJWA 3IPXA 1CP2A 4ESHA 2A2ZA 1GTVA 3B60A 4IOJA 4M22A 2QP9X 1TU3A 2GXAA 2REOA 1ZBDA 3KKMA 2ERYA 3BFVA 2QUZA 3RYTC 2GESA 1TQ2A 2IUSA 2IYSA 1U2RA 1YQTA 5B58C 4HUQA 2A3RA 5JSZA 4Q1CA 3EG5A 3IDQA 1ONBA 5P21A 1US8A 3BD9A 3CZQA 3U7EB 2OM2A 1FX0B 3A6PC 1XCMA 3IHWA 3RRZA 5K8LA 1KGDA 3E1SA 2B21A 1E2QA 3RWOA 3ADCA 1YZTA 2E1RA 4JIMA 4D4MA 3AKDA 2WKQA 3B78A 4N3NA 4XWKA 2V9PA 1KKMA 2V3CC 4RZ2A 2OZEA 2BV3A 4MRPA 1ZYUA 2OEPA 3NH6A 4QRHA 4LCBA 4YXWA 5CIWA 2IA5A 4AIIA 3UMSA 1G8HA 2BEKA 2KBEA 4DWJA 4JBYA 1UPTA 3DM5A 2VEDA 1OXXK 3SDZA 2UVQA 3CH4B 3PCRB 4Q5IA 4KFUA 2Z83A 5CITA 2B7BA 3ZIAA 1PV4A 3AVPA 3SYKA 4CW7A 3QKUA 3I61A 2JGNA 3GJ0A 4ZKDA 2QGZA 3EAQA 4HAWA 5KO2A 3UMFA 1FTNA 2JA1A 1SVMA 1VIAA 2YWGA 4B73A 1G20E 2ZI7A 3AB3A 3GLGB 1GOTA 1HT1E 4M0LA 1EK0A 4NP6A 4A6XA 1YZNA 5KDOA 3PJRA 2DFTA 4JVMA 2PCLA 4IKEA 621PA 3VFDA 5JEDA 1QBKC 2QTFA 2ECKA 1ZP6A 2GK7A 1QHHB 3GFPA 3B9QA 4JVSB 4BECA 4MKIA 1XX6A 4YMTA 5FH9A 4LV8B 3ZQ6A 3NH9A 2QMUA 1N5KA 3Q7PA 4TN1A 4MDEA 2BOVA 3P26A 3B1ZA 1L8QA 1W0KA 3LH5A 4BEJA 3KKQA 1KJWA 2C77A 3IQWA 4G5OA 221PA 1XD9A 1XWIA 5DYIA 1XMSA 1KI7A 1Z5ZA 2W6ID 2A78A 5DI9A 4BRWA 1E96A 4DJTA 4II7A 4CEIB 2VP4A 2WOOA 3LLMA 4Q1EA 1WQ1R 1TTTA 3E2IA 4QGAA 3QJYA 1UM8A 2E9SA 1DAFA 4IOKA 4R7ZA 3UG6A 1OYYA 1G8PA 5M04A 3NDPA 3HYRA 3LNCA 3OEHA 4CEJB 1ZM4A 4MRSA 2IYYA 3GLFB 2ZSFA 3B1WA 3ZIAD 5JI2E 2WOJA 5JZVA 1VG1A 4CDGA 4C4PA 1JBKA 2CL7X 1G3MA 2G77B 2XZPA 3NBZC 4WXRA 4UNRA 1COWA 1KAOA 3CRVA 3MWYW 3PENA 4MGYR 4GT1A 3BBPA 4G3XA 5C46F 1XJQA 3ETLA 3U44A 4ITRC 2EVWX 3CNNA 2CCJA 1JEDA 4OJKA 5FBRB 1ZW6A 4TZ6A 1ZU4A 2A5YB 2CLSA 4NYMR 3QXSA 2H57A 2HLDA 1U8YA 2CCGA 1AGPA 1KK2A 3EW9A 4JJZA 4XD7A 4GSYA 1K5DA 4AYTA 1TX4B 1E98A 2FSHA 5FOUA 4ESVA 5JRJA 3WP0A 5EUQB 1NKTA 4DT1A 1KO8A 4LZZA 2ZEJA 1T5IA 4TTRA 2OXRA 1WXQA 2WMNB 2R9VA 1JI0A 1IAQA 5JCPA 3EASA 1MT0A 2B92A 4KI0A 4WAUA 3TUJC 3UWKA 4ERNA 4TYYA 3H84A 2YC2C 3B2EA 1UEJA 1E2FA 1G6OA 1LW7A 4H1VA 4A92A 2V55B 1U9IA 4Q7LA 3P27A 2WJIA 2J7PD 5EUMA 1FP7A 4NCHA 3P4YA 1U0JA 1UDXA 3CWQA 1W49A 1IY1A 2ZJ8A 1II0A 1OPXA 4Q1FA 1XZPA 3LA6A 3QKSB 3VX3A 4AG5A 1E0JA 1T9HA 3GCGA 421PA 3BK7A 1NLYA 4O2LA 4WOPA 5H68A 2EFHB 1M2OB 4Q9HA 3BH0A 3RS3A 1QHSA 3CF6R 3K70B 2R6CA 3JZAA 3MWKA 3JVUA 4KBFA 4XIGS 5FL7A 3K9LA 4MYHA 1R2QA 2NMVA 2GRJA 2ZSBA 2QAJA 1U94A 2DFNA 3LFUA 2QAGC 4NL4H 1UAAA 3F3YA 3TSWA 1R0YA 2QMHA 1JJ7A 4P32A 4Q9JA 3KQNA 2BCGY 2CJWA 3C7KA 4Z1MA 4IXNA 2ODEA 4ZDKA 1SGWA 2P5TB 2PLFA 1D8TA 2ZSDA 5B2ZA 1F2UB 1I4TD 3BJIC 1U81A 1UEIA 4MYUA 2JJ2A 2ZE6A 4MUAA 5DN6A 5AUPB 2J0UA 1G3IA 3VAAA 5HPYB 3U7FB 1HURA 4PC2A 3Q8XB 4DSTA 5KNCA 5BYKA 3TR0A 3X1DA 1M7HA 2XEXA 4JLMA 2P0EA 3GLFE 3B1XA 4C2UA 4ACAA 2CBZA 3FWYA 3CF2A 3AVTA 2PCJA 4LHXA 2N46A 4HATA 1Q0UA 3AEZA 1E2HA 1MRSA 3TUIC 2G88A 4QXAA 1JXOA 3NEYA 2P6UA 5KDLA 4I81A 3VQTA 4R71A 2Q3FA 4OQXA 2EW1A 1Z07A 4URXR 1E79A 2ZTSA 5TVKA 1GRRA 4WZ6A 2IHYA 2O8FA 3W5IA 3HP1A 3ADKA 4B76A 2BBWA 1XXHA 3KXLA 4TL6A 2O8CA 4BLOA 4QFMA 4IW3B 3W6OA 1NMXA 2ODBA 4KCGA 5FPHA 1B0UA 2VA8A 4B44A 4EDHA 1E4VA 5E7JA 2FMXA 2QP3A 4Q9KA 1LV7A 2AD1A 1IN4A 1R4AA 2H5EA 3DMNA 1XNJA 3WNDA 4GPTA 5JHGB 1NMYA 5HCIA 5H70A 3TNFA 5FOXA 4TT3A 3RRMA 4F4IA 1Z2CA 1VYUA 3U61B 1F48A 1G8FA 1T5LA 4NMMA 3O8RA 1C4OA 4F38A 3GD7A 2RMKA 2ODWA 1KIMA 2C04A 3ECCA 1N6RA 1G19A 1CKEA 3ZVNA 2YWFA 2WWFA 2F6RA 1AZTA 2WJJA 4ZKEA 5J4KA 1IY0A 5EZ6B 5SZJA 2BMDA 2ZIAA 3GQBA 3PITA 2JCSA 4B43A 3R7WB 2YNMA 1N6LA 4DDUA 2GK6A 1EWRA 3CX8A 1XTSA 2ZANA 1J2JA 2JLQA 2J7KA 4LX0A 4D82A 2OESA 1OSNA 3C5CA 2WKPA 1AS2A 4QJ3A 8OHMA 2H18A 2ZM5A 2NG1A 5AUQA 4KSCA 1IN8A 3P20A 1E0KA 2RGGA 4NE2A 3MG9A 4JS0A 1Z28A 3OFND 1EFUA 1E0SA 5GVRA 5BQ5A 1D2MA 4ACBA 3CPHA 4UKDA 1S8FA 2ZITA 4R9UC 3V4FA 2IYRA 3A1UA 1NJFA 4ZCMA 4KVGA 3F8TA 3SJZA 1UKZA 3AKYA 4O2RA 4RD6A 4DT1B 4UNPA 1JQLB 5KSZA 4DVGA 3DDCA 3RS0A 2VSFA 1SKQA 4AK9A 4ZIRA 4Z54A 4OQFA 3ZYCA 5GADl 4PTLA 4HLQB 4D4LA 4KVAA 1VYVA 1KY2A 2V6IA 3K0EA 1SXJC 2WPDD 5G41A 2R44A 4DB4A 3IQXA 3VKHA 4YMVA 4PAOA 2QROA 5DI3B 1E0AA 2IS2A 2RCNA 2QRZA 3DPUA 3IPYA 1Z0JA 4O0MA 2IYXA 4ZDWA 3CRRA 1Z63A 1E9EA 4C3ZA 2CHQA 2PT7A 5CJPA 4WA7A 3BIFA 1EESA 4GDFA 1KOFA 3W34A 2FOLA 3TVDA 4MGIR 3W6NA 5E95A 1RRCA 3FMOB 2QTVB 3RC3A 1Z29A 3OEED 3PV0A 3Q85A 4YQFA 5FOTA 4B2IA 5IHPA 2F1RA 4JVLA 1W4CA 2FF7A 2CL0X 1RW4A 2GJKA 5LB4A 5JWHA 4HUQB 5JSZB 2F3RA 1JR3D 1W4BA 4NDZA 4P4SA 4P4UA 2P2LA 3QBTA 4PPNA 5FR2A 1TL7C 1GNPA 3A8TA 2ZJZA 3DEFA 4OQMA 5KUTA 3NKVA 2F1IA 3B13B 1A2BA 5EXTA 5K8UA 4C0AC 4X8OA 5CLQA 4Y0AA 3A1TA 4M8NE 4FCWA 4ZV4A 1W4RA 4YLGA 4R2IA 4IFBA 1DPFA 4K81B 5FOWA 5BN5A 3AKCA 5EXSA 1N5JA 2KI5A 4OK6A 2EQBA 5F3WB 3I62A 1XMIA 4RFSA 2OCPA 2W6JA 1DELA 1E4YA 1E2PA 3HPQA 3LRPA 4YC7A 4AWXA 4EFMA 4MDFA 1XXHB 2VLIA 2VHJA 1ZUNB 4U00A 4NCKA 2HYDA 1XRJA 3FHTA 3NXSA 4GI7A 4DLVA 2W2XA 5FR1A 1ODFA 1RRPA 1IXSB 1NLFA 2HYIC 5JJIA 3K0FA 3IGFA 5BN4A 1E94E 5DNYB 3AVQA 2EU8A 5FPYA 3KJGA 4A1FA 2D74A 1RZ3A 2Z0MA 3UK6A 1T8TA 1MV5A 2J0QA 4QM7A 3SJBA 3V00A 1WF3A 4GZMA 4PQFA 4C0BA 3HWSA 1N0UA 3CWZA 3EPKA 3AUYA 1N6OA 1A82A 3CO5A 1NMZA 5DN6D 1YR7A 4XD7D 4LUCA 5CJ2A 4DLWA 2GCOA 4I4LA 4TYWA 4TMZA 1VG0B 3FVQA 1N6NA 2P5SA 2O0JA 1IBRA 1EG7A 2GF0A 2BBTA 2FJUA 2NO6A 2OFOA 4DCTA 3THYB 3AF2A 3M0EA 4A2QA 3U7HB 5EP3A 1SVLA 4NKRA 2J0UB 4OHWA 2ZRHA 2ZR9A 1E69A 1HEIA 2ZS9A 5TARA 4QGGA 3WRXC 4EPVA 4PSAA 3B8HA 1HH4A 2J5XA 2WM9B 3TSZA 1D9ZA 2ZPTX 2F55A 3TBKA 2VBCA 1XZQA 4Q7JB 1F2TA 1CXZA 3P32A 4MA4A 1CJKC 1W44A 2QORA 4P4TA 5B64A 1A2KC 3ZD7A 1EFHA 4IVRA 5H1YA 4ARZA 1DEKA 1H65A 4RD3A 2ZYWX 5JCZA 2CHGA 3KB2A 1Z6GA 2MMGA 1GILA 2YOGA 3ZGXA 3FHOA 2ZJYA 2PLRA 1Q22A 1G18A 2QY9A 3KKNA 4LPKA 3DMDA 4D80A 4DUGA 3K8YA 2A5JA 1OV4A 4TQ9A 4WXPA 1XF9A 2F43A 3M1IA 2WIBA 4Q00A 3KTAB 3SOPA 2ZJAA 3GJ5A 1ZM9A 5H8WA 5JJLA 2IWRA 4QNMA 1VDZA 4V0KA 3T5GA 4L4UA 1KNQA 2DY1A 5JHHB 1P5ZB 1XTKA 1T0HB 2EWVA 1YRAA 1TPZA 4QHSA 3SQXA 3QPWA 5DI3A 2GCNA 4MKGA 2BWJA 3Q5EA 1AS0A 1ELOA 1Z22A 4UXHA 1OF1A 1E2JA 3NC1C 1LF0A 1JQJC 4WIAA 1KMHB 4GZLA 5TV2A 2BDTA 3DKVA 1GDDA 2FPLA 2PX3A 1VYTA 5FBVB 4Y0VA 1KSFX 1RC8A 4CEHB 1G5PA 5L3SA 4QHTA 1TMKA 4PSKA 5LD2C 2WWIA 1M7BA 1VTKA 4RCYA 1RVDA 4TQAA 1LFDB 1J70A 2GCPA 1G7TA 5TXGA 3T12A 1JEEA 2A5GA 2O5VA 2W0SA 3N70A 3TE6A 1W36B 2N42A 2PJRA 3PEYA 2G6BA 2GVZC 2NPIA 1U90A 3BC1A 4FMCB 3RSOA 4KAXA 3U2QA 2IYQA 5KSOA 5KNDA 3A1WA 4HSEA 4M1OA 1E9FA 5JLJA 1M1YE 2F9LA 4PHHA 2NO7A 1KI3A 1WDTA 2CJWB 1ZNZA 3VR1A 1R0WA 2VTKA 2ZRFA 4RD0A 2XSZD 4HYYA 4B34A 3VKGA 2AXNA 4HDOB 1KSHA 1FTSA 4PANA 2O8BB 2GWHA 3IBGA 3TAUA 2DYKA 2FA9A 2X2FA 2YVUA 5TB5A 3TMKA 3CKLA 2RGCA 2AR7A 2GKSA 4HZUB 4WZAE 1OIXA 4BFYA 4U7DA 3D6TB 1L4UA 3FYHA 3FMPB 1KO4A 3MGCA 2JLXA 2UZIR 2YHSA 1K5GA 2X77A 2FFAA 4RCZA 4B74A 4EPRA 4PC6A 3PIRA 2R2AA 4CGZA 1E32A 4KFRA 2QEQA 5E4FA 1CJMA 1UKVY 5EE5B 2PH1A 1ZD9A 5EP1A 2VHTA 3T1QA 1N6HA 2BCJQ 2IK8A 3GJ6A 4US2R 3EIEA 5A0FA 6Q21A 3W3AA 2ZYTX 1BYUA 1QF9A 2QT0A 4S35A 1JAIA 2JASA 5IK2A 4A0GA 3OEHD 1G7CA 1T91A 4OHZA 4B6EA 4JBXA 3M4YA 4HAVA 4DDTA 4Q18A 4Z8XA 3THXA 4UXJA 1IHUA 1W0KD 3QXCA 3PUWA 3B85A 1NN1A 3QVVA 4G1UC 3LWNA 5L3QA 1S9HA 3QG5A 1FPMA 2WKRA 4PAQA 2KBFA 5AK0A 1RPZA 5HZHA 1KY3A 5HKKD 4ZDJA 4DCNA 5L8VA 2ZXUA 1K6MA 1JB1A 4Z51A 4DKXA 2I3BA 2BJVA 2O0HA 5DH9A 2HDNB 2IYLD 2YV5A 4H9GA 2ORVA 3LX5A 4NYJQ 2Y8EA 3R20A 4KHZA 5KPDA 4V0LA 3PUYA 1CULC 1US8B 2GJ8A 4XOIA 4BLPA 1Q1QA 2EFEB 3ZZTA 5JFGA 1GRNA 3ZQJA 1RYFA 4YDSA 2V7QD 5FUXA 1Z6TA 1S1CA 2D2FA 4JLJA 1XB2A 2FG5A 3CX7A 4GP7A 4PPQA 3VR4A 3FKSD 3A4NA 4JVNA 1R8SA 1UBGA 1YZKA 5EE3A 2GILA 2QSZA 1I2DA 2PEZA 5GVSA 4JKIA 3EC2A 4OI2A 2VO1A 5AR1A 3SFVA 4V0ME 4ZIRB 2J0VA 5LDDC 2AHOA 2DBYA 3VMFA 5FTLA 3BFKA 4QGFA 1WA5A 2ZRBA 4IEEA 5KNBA 1YJ5A 4RFVA 3CONA 3K9GA 5DISB 2JJ1D 1XJ0A 2GA8A 2AWNA 1HT2E 1S3SA 1Z0DA 3IEUA 4C0SA 4JLPA 2MSEB 2EYUA 3CRW1 1BH2A 5HZKA 2QM7A 4Q4JA 2RGNA 4C0QC 2GETA 4C0LA 2W2VA 2CXXA 4G0NA 3BWDD 1P73A 2CE7A 2VF7A 2ATVA 2A7QA 2NIPA 1JALA 3C16C 3N5CA 4TL8A 1JR6A 3MJHA 2P3SA 1DE0A 2RH5A 5FOVA 2Q9BA 1MRNA 1ZIPA 1P6XA 2W83A 2HXYA 4IHQA 5TY0A 1P60A 5JBQA 1CEEA 2FEMA 3CLVA 1VCIA 4KITB 3FOZA 4PO1A 4M9ZA 4TTQA 1JNYA 3WBJA 4I1OA 1SQ5A 3VU9B 4FN5A 1E99A 1W48A 4OQLA 2HT1A 1ZC3A 4PO8A 1S1MA 3A36A 1AZSC 3VR5A 1F2TB 4P0TA 1F3OA 4XJXA 2VP9A 2IBMA 2VSXA 4OL0A 3LBNA 4TTPA 2JJ2D 1MO6A 1E9RA 1JAHA 3NEJA 1YVDA 3SBDA 2W00A 3L8ZA 4BLQA 3H0KA 4JT2A 3W9YA 4F4CA 1R0ZA 3EWAA 4XTRA 1XU4A 3THWB 1W5SA 1Z0FA 4KODA 3QBVA 5KSYA 4OI0A 1DADA 3TIFA 1O87A 3I32A 2XAUA 2F43B 2ZVQX 2FH5B 1D5CA 1NBMA 4RD4A 5CYPA 3X1YA 4TYNA 1G7RA 3FMIA 1EXMA 2Q3MA 1A4RA 1KYIA 1IY2A 3VHLB 2ZU0C 3KJHA 4MITA 3NHAA 4BZQA 4E07A 1LTQA 4OHYA 4U5XA 1J8MF 3I4LA 2EFCB 4C9BA 4X8LA 1AS3A 2BMJA 1KO5A 3A1VA 3L0IB 3QXHA 2GEDA 4AG6A 3VR3A 1W2HA 5EZ5A 2RB4A 3B82A 4IVPA 5DHFA 4MKFA 4AD8A 5F9HA 2VQSA 2J46A 4ZCIA 4L15A 2C99A 4DCSA 1UF9A 3A4MA 3SI7A 1TUEA 3TAHA 3HJNA 2NZJA 3I5XA 3LLUA 4QL3A 4Q1AA 3OIYA 1Q21A 1XDBA 2CHVA 4EJSC 1CR2A 3H86A 3G0HA 1KDPA 4ON9A 3R9XA 2QPOA 4DSUA 1NVVR 1C9KA 4URYR 1YR9A 4FINA 2QMOA 2GCOB 1K8RA 2REBA 4KSBA 1CS4C 4MH0R 1NLZA 2G1JA 3QQ5A 2ZUBA 3O8DA 1GNRA 3ZZUA 3HDTA 2OO7A 1PLLA 4HLUA 1Y3AA 2NZ8A 4V03A 2PT5A 2OILA 3SC3A 4A8JA 2FSFA 4DRZA 4E22A 3BE4A 1F60A 3DZ8A 1GFIA 1QHNA 3LXRA 5TMPA 2ZRDA 3QE0A 3FE2A 1J99A 4JT4A 1WBDA 2XTNA 3CZPA 2GF9A 2QM8A 3BH7A 4OI1A 1OH6A 1XTIA 3CRMA 5HTKA 1SKYB 2PL3A 5J4LA 2ZJBA 2CE2X 4MRRA 1X8LA 2WWGA 1JPJA 4PQRA 3T1OA 1ZNXA 2QENA 2J59A 2J3EA 4ZDIA 3I8XA 4BUJA 2O8DB 1IQPA 2XXAA 1HYQA 3G5UA 3ZJYA 1TQDA 4FWTA 1DAHA 1W47A 1E2MA 1F6BA 4LYJA 3OIVA 4A82A 3HYTA 2QU8A 1E2DA 4DHEA 4DEYA 5KSPA 1MH1A 2ANCA 1X1RA 2QG6A 4YDHB 1R0XA 2WSSD 2XTZA 1TQ4A 4CEHA 1R10A 4D0LB 5DO9A 4EUNA 4LBZA 1M34E 1G4AE 1KI6A 2XZOA 2QAGB 2ONJA 3SYLA 3ZVMA 4TLAA 2GBLA 2O52A 1SKYE 4HDQB 2I1QA 3SU8A 1CTQA 3CB4A 4N1AA 4CYMA 3AVVA 2QPAA 3V4RA 1KI8A 3D7MA 2IW3A 3KUCA 4L9SA 3WHLA 2JIZD 4FW9A 5DHAA 1OJLA 4B48A 3D3QA 1Z0AA 1H8HD 4BLSA 3LW7A 1EWQA 1UDWA 4D26A 1UBEA 2AL7A 4BFWA 4PZYA 4XSGA 3LV8A 4AYXA 3B6EA 5FOSA 2DB3A 3BB4A 3T15A 2D7DA 1E2GA 2AK3A 3W8NA 2HCBA 1AJEA 4J0QA 4F93B 3IILA 4L16A 1KJYA 4EJSA 5J47A 3PFIA 4F92B 5FTNA 4TMVA 3W90A 4DIEA 4LWZA 2P6NA 3C4JA 2CDNA 2ZAMA 1C1YA 1KKLA 3HPRA 1KK1A 1QHYA 3T06B 3AP1A 1VCOA 2ERXA 4HDCA 4DLTA 3RLFA 2XOKA 1UADA 4TLDA 5CK4A 3V9PA 1E9DA 2PZEA 2VHCA 3TUZC 1KDOA 3OHMA 3AH8A 5DGXA 1QVRA 3RVBA 1KZ7B 4A0FA 2GJSA 2PX0A 3MAAC 2GEUA 3QUSA 3ZVLA 2IEYA 1KI6B 3GEEA 5AJWA 2CCKA 4TL9A 3RANA 3RRYA 4BFSA 4UXIA 1N25A 5B57C 4NCIA 1ZIOA 3REFA 1W4AA 4E09A 2JLRA 3J81k 2H7VA 3HR7A 1QHGA 1GL7A 3X2SA 3IIKA 3KX2A 4Q19A 5EXPA 3X1XA 3PUVA 4B3GA 3W8RA 2NGRA 2OAP1 3LVQE 3OAAA 4ASUA 3LQRA 1HUQA 2BEJA 1CJTC 4WVFA 1MABB 3FGNA 2K5UA 4WW0A 2DHRA 1J90A 2YJTD 3OIWA 1E6CA 4BQSA 1UKEA 2OLKA 3EPLA 1OXSC 1NRJB 1T4GA 2C9CA 3B5JA 2DCUA 5HKKA 1OFHA 3X1ZA 4PC1A 4QBHA 5J4HA 1SHKA 4Q01A 4I1VA 1HY3A 4PO9A 5A4JA 3THOA 3BORA 4TMKA 1SXJE 3SJAA 5CLLA 1Z06A 3L2OB 1Z3IX 4GOXA 5E3HA 2OLJA 4S2EA 4LBYA 3Q72A 3T61A 3WRYC 3ONWA 2D4HA 2R6FA 3CUEF 3UXMA 2HJGA 3GPLA 2EFDB 2CL6X 5FTMA 1Z6AA 4BFUA 4FD2A 3GLIB 1XTRA 1SZPA 1G41A 2FFQA 4HAYA 4CF7A 2KE5A 1EFCA 2UZ3A 2WWWA 2ZYVX 5KTYA 1TUIA 3QG1A 1X3SA 1I2MA 1OH8A 2ZUCA 3AGPA 4MGKR 1E9AA 2JATA 3C15C 3FFBA 5AJYA 2MSCB 2XNDD 3GLIE 4M4SA 3EX7C 4JJKA 1E9SA 1LF5A 1WRBA 1YHNA 2FPKA 1NN5A 5KDDA 2H92A 4M53A 3ZLJA 2C03A 2G0NA 2BM0A 5J4YA 4OI4A 2B8WA 3GLHB 4W7SA 2BMFA 3GJ7A 2RHDA 3PXGA 2YYZA 1TF2A 3FPAA 2ASEA 1FNMA 1XD8A 2DWQA 2YOFA 3ZS9A 4BPBA 1KAGA 2ZRJA 4M1TA 4Q4AB 2Z6VA 3WMGA 1W5TA 2ZE5A 1OIVA 4PZZA 1HV8A 2XGJA 4KFTA 2QP4A 3SJCA 5A5GA 1B23P 2KJQA 3EARA 4B71A 3P1JA 1EFRA 2IF0A 3K9NA 3QKSA 4H1UA 3C5HA 1II9A 1VIYA 3LAWA 4Q02A 2ZRPA 4RVCA 1KO1A 3NC0C 2WJHA 1NG1A 3AVUA 4JLOA 2WBLC 4A15A 3SNHA 1BOFA 3QF7A 5KU1A 1PLKA 4LV5B 3L82B 4M1SA 5GJVC 2IXFA 4G01B 2IL1A 3EPJA 4A2WA 1KSJA 4IOLA 5L3SB 3GLIA 3CH5A 3I5YA 3KFXA 3GFOA 4CEJA 1ZMXA 3SS8A 2BBOA 3R9WA 1NL3A 2ZYUX 4E03A 3QXXA 3O8CA 4Q9IA 4URVR 3QKRA 4LYHA 1KZGB 2V6JA 3OF5A 4A2PA 4LPSA 4LJ9A 3ICEA 4BFTA 3QKRB 1TF5A 3MJRA 2DR3A 4HAZA 4DSOA 2AN9A 2FGKA 1BS1A 1X86B 4L9WA 1GKYA 4DLUA 4EPYA 4LBWA 2O8EA 5BW8A 1TADA 3TW4A 5L3VA 5LPNA 1IN6A 1YR8A 1AK2A 2GJAA 4EIWA 3B1YA 3L0SA 1G8YA 4LHZA 1RIFA 3U4QB 4YMSA 2G3YA 4TMWA 4X8HA 2IS4A 2IS1A 1E3MA 1AIPA 3Q7QA 821PA 2JLYA 1DAGA 1XTQA 1WCV1 4XSHA 5G40A 4BFXA 5JECA 1WBBA 4OBEA 2J41A 2C78A 4WBSA 4DLZA 3W3ZB 3KQKA 3LW8A 4LC1A 4AYWA 4B2LA 2L0XA 3VTKA 1XEXB 1SHZA 4W9MC 1G291 2CK3A 4NZYA 2DFLA 2QN6A 2OFWA 1QVAA 4FWIB 1FQJA 5KPJA 3NBYC 5F9FA 3D31A 3O8BA 5BWMA 3Q3JB 2GXUA 4F7WA 2WTUA 4IOMA 2WWXA 1G1MA 2C9OA 2XNSA 2JJ8A 5F2EA 2ORWA 1KHTA 4DSNA 5EP2A 2QAGA 1RKBA 2LCFA 2QMEA 4X8MA 2NO0A 4EQ6B 2NO9A 3H1TA 5IT5A 2JDID 3LD9A 3U44B 2VP6A 4G5SA 4QC2A 1KNXA 4US0R 1EX7A 1P75A 2GAAA 3N2IA 3TH5A 1G16A 1EFTA 4A0RA 4KBGA 4C7OA 2IX3A 1LS1A 1ESNA 1D2EA 4Q47A 5EE9A 2GXSA 4JMPA 4OYHA 4JLKA 1F5NA 3QY0A 1KI9A 4Q7MB 4DLSA 1S96A 4ZI3A 4C2TA 3K0AA 3WMFA 2O8FB 3SR0A 1L2TA 1W46A 2YZ2A 1OB5A 1T3HA 2FX3A 2ZE8A 3K0CA 1M7GA 4M9QA 1QG2A 1NI3A 1R8QA 1OFIA 4DBLC 2DPXA 4GFDA 2LKDA 1BKDR 4BFZA 5FBWB 1E79D 2H16A 5C2JB 4W5JA 5DE3A 1G17A 1J7KA 1QHXA 4TZ0A 2GBLC 2OV2A 4M1YA 4LC0A 4A8JB 5C18A 1DG3A 3I73A 4XTCS 1ZAKA 1Q3HA 4ZO4A 2XITA 4UNSA 3OZXA 1ZNYA 3VNUA 2Q21A 4XH9B 3REGA 2WJVA 3MMPA 4RKFA 1XEWX 5JWOA 1ZCAA 3A37A 2XZLA 1SULA 1OFTA 3MUFA 5G3YA 2PMKA 4JL8A 3K0FB 1OXVA 2E87A 2WVJA 4OJQA 4G5GA 4UJ3A 4UNQA 4BWYA 4JL6A 5CM9C 4RFSB 3RAPR 3EIHA 3K70D 3VR6A 3NHBA 4PPFA 1P61B 1NF3A 2VP5A 2GZAA 3BB1A 4LDJA 5CYOA 2NOAA 1SVWA 4FCTA 2LKCA 3QKTA 5FI1B 2BVNA 3U6BA 4JKYA 2OE2A 2GNOA 5FUVA 3B7GA 2HCJB 3AGQA 3K70C 1Q57A 3ASZA 4WZBE 4CRWB 3DO6A 2JLUA 2QGNA 4TQUS 3TGPA 1GUAA 4HAXA 2CNWD 3WP1B 4ZI2A 1QG4A 2PEYA 1CR4A 5AJVB 2FNAA 1YZUA 1Z6YA 5CK5A 3U3MA 1FOEB 1II8A 2IYUA 4LYAA 2ZR7A 5ELXA 1KDTA 2V1UA 5IRCD 4C30A 2I4IA 2CMKA 3TQFA 1P9RA 4Q1BA 5TDHA 2ZI5A 2ZJOA 2R6DA 2VSOA 3BOSA 3U6KA 2B6HA 4K8OA 4HEJA 5EQTA 1HQYE 1NKSA 3QEOA 2GZHA 2F1JA 3FTQA 1YU9A 3QEJA 1XFAA 2F1HA 4LYFA 5UKDA 1N0WA 2RKOA 1KO7A 3QI2A 5G3ZA 3U4QA 4RD1A 2BHRA 4LHVA 3SQWA 1AN0A 1H8ED 3KKOA 1N5IA 1S0UA 4B3CA 4C0JA 1G5TA 4LJ8A 1QRAA 5C1BA 4JBWA 4TLEA 4JLVA 1KJZA 2ORIA 2RGBA 1XPOA 1UFQA 3L0OA 4RZXA 1YE8A 1COWD 1TAGA 3GEIA 4DUGD 4DDWA 3GP8A 4RY2A 4JLBA 3MSXA 4JYBA 5D3QA 2WWYA 1KI2A 1NBMD 1TQ6A 1OHHA 2CVFA 5CB8A 2AK2A 3WYGA 4B35A 4EPTA 3OIUA 4GNKA 4M21A 5C4GB 2WJGA 4EFNA 2WSMA 4URZR 4GMDA 4MGZR 5D3MB 1G4UR 5AWFC 3GJ3A 1PJRA 1DVRA 1GITA 4NYIR 2EFGA 1S4QA 4XWAA 3BS4A 1M8PA 4M2LA 2XOKD 1GG2A 1E1QD 4HZIA 4MQBA 1XMVA 5DSZA 3C41J 4TSFD 4DCUA 4FXPA 4IJMA 1EX6A 2FZ4A 2C8VA 1EGAA 2IHBA 1NJGA 3CR8A 2IF2A 4TMTA 4QNRA 4N0EA 3JZMA 5K8TA 1CJVC 1GP2A 1KI1A 3EIQA 2V1XA 1P7CA 1W1WA 3WHKA 5CB6A 1CLUA 2QQEA 2ZU6A 2CEAA 4A36A 4YMWA 1N0VC 1P2UA 2QQ0A 4NONA 1V43A 3NVAA 3SEAA 1ZM7A 3QF4B 2R65A 3QIAA 2P65A 2YINC 3MCAA 5AJZA 4IDQA 4DCVA 4PFSA 5CM8B 3SZRA 2GXQA 1CRQA 1EFRD 2V4ZA 3NG1A 2LWIA 4DXAA 2YKGA 3A1SA 2IWHA 1PZNA 3WNCA 4FIDA 2QE7D 4BLRA 2OT3B 1Z08A 5EP4A 1BMFA 2GJ9A 2PJZA 2RGNC 3BXZA 3AP2A 1N2CE 1OYWA 2DWOA 2Q0HA 5AUOB 1I4LD 1KMQA 2RGDA 1NSTA 1SVSA 2ZJ2A 2FFBA 3K1JA 4TLBA 1VCNA 1HE1C 4L8GA 4LI0A 5FBLB 2UKDA 2HF8A 1GKIA 1SXJD 3G82C 4QBIA 3KQHA 4TSFA 1ANKA 1NVXQ 2ZRIA 2ZRCA 2ZSAA 4G5RA 1KDRA 4LJAA 1CU1A 3NDBB 1LS6A 1XD2A 3RRNA 2WSSA 2VIIA 1SXJB 3TRFA 4QG7A 4JLDA 3VU9A 3UPUA 1YR6A 2IUTA 1ZVQA 2QI9C 4O3MA 3B1VA 4KLNA 2FN4A 4PC7A 3BAFA 2Z4RA 4JSYA 1TNDA 4CT5A 4HUTA 4M1WA 5SZHB 3GJXC 2AD5A 3I92A 1RYHA 3EA0A 3EZFA 3WXMA 1IONA 1JR3A 1OKKD 4LV6A 2HUPA 2OXCA 4D2IA 5FI0B 4RZUA 1FUUA 5KHOC 1E2KA 1OH5A 1RRGA 4B3FX 3AVOA 2V7QA 4FMDF 4NCNA 2XJ9A 5J5CA 3ZVRA 3R9IA 3UKDA 1LVGA 1GWNA 1W0JD 4UJ5A 4AI6A 1Y63A 4PHFA 3FKQA 4YMUA 4PHGA 4CVNA 1II8B 3ADDA 3T34A 3M6AA 3CM0A 3GFTA 1Q1BA 4JL5A 4Q4AA 4QJ5A 2B7CA 2ZI6A 3THXB 1RJ9B 2D2EA 2DWPA 1FFHA 4ARZB 1X8JA 2QL6A 3DOEA 2XX3A 1DAIA 2FPMA 1ZJ6A 2OG2A 4DEXA 1T6NA 5DLQC 2WZQA 4P4SB 4B47A 1E1RD 3KXIA 5EE1A 1CF4A 3U5ZB 3MRSA 3TQCA 2I1VB 4M9XA 3VHXA 2XB2A 2CK3D 2KSQA 3RHFA 1OXUA 3AVWA 1RFLA 4C0HA 3FKSA 1FMJA 3W5JA 4GL2A 2PZGA 1MKYA 2ZS8A 4HLCA 3NTUA 1KSGA 3SE0A 4BZXA 3K09A 1NN3A 4QBFA 3VX4A 4EKDA 3OFNA 1FQKA 1QZXA 3DKPA 2QBYB 3TR5A 5L3RA 2WMOB 2ZETA 4F91B 2VH5R 5G53C 1G8GA 3TKLA 2SHKA 1W36C 1D6JA 4TYQA 3LQQA 2O8BA 1GSIA 3GJ8A 1OIWA 3AKEA 2FZLA 2N1BA 2ZRMA 2JAQA 1UKYA 3I8SA 1XD2B 4IDNA 721PA 3CF0A 5FUWA 1P2TA 4U02A 1L4YA 4EAQA 2D62A 3AVYA 2A9KA 3WYAA 4I1UA 4B2PA 1FW6A 4HAUA 5JRZA 3U3JA 2QBYA 3AVXA 1R5BA 1TEVA 3B9PA 1A5TA 2F3TA 2WJYA 4QJ4A 3BGWA 1XCGB 4DLYA 5FPKA 1GKUB 3GLGE 4NBSA 3UATA 3OE7D 3TVTA 1QHIA 2ZUDA 3CR7A 5LBIA 1WB9A 5SZIA 2ZRLA 2J7PA 4D25A 4P33A 2AFHE 4TL7A 1VECA 3EXAA 1OHHD 1SVOA 3KB1A 3RWMB 3HU3A 4F4JA 4CEIA 1E9BA 2ZS7A 4YONB 3VNVA 1HA3A 2AWOA 3GMTA 4IFEA 2IYZA 1IXRC 1CR1A 2JLSA 3GLHA 3RABA 1MOZA 2Q9AA 3IKJA 5EE0A 1XTJA 4D0GA 4AKHA 1P3JA 3L8YA 5KYKA 2ZI9A 2EWWA 1HQCA 2C95A 4LBVA 1W36D 2TMKA 5FL7D 4GRAA 2CNWA 2W6JD 1GAJA 4EPWA 4BGDA 4AKEA 3EPHA 3U60B 2WIAA 5IK2D 3Q5DA 1A7JA 1OFUX 4TWZA 4V0MA 4IVQA 2HEIA 1PLJA 3DOFA 3X1WA 2YWEA 2D06A 2C2HA 2ONKA 3K53A 3KL4A 1IJFA 4NHOA 2FDCA 2XNDA 2OCYC 2MMCA 2O8EB 2WHXA 2OCBA 3HU1A 1U98A 4TLCA 4ILEA 4LJ7A 1DAKA 2Q6TA 4GBMA 3K09C 3TW8B 4Q03A 1OT3A 3IIJA 5JMTA 1G3UA 4DDVA 2WWHA 5D3MA 2J1LA 2JDIA 3CNLA 1U0HC 1FMLA 1U8ZA 2HXSA 1UBCA 1UBFA 2WAYA 1MO3A 4FMDB 2FSGA 2O0KA 2OBLA 2ATXA 4AKIA 3VKWA 4BZPA 3P4XA 2H17A 1VHTA 4PR0A 3KZ1E 3PQCA 5JWRA 1DOAA 3AP3A 3AQ4A 1U0LA 2RHMA 1DARA 1NY5A 3SBEA 3WYFA 3U3OA 2NO1A 1NN0A 2XSZA 5J4VA 2YC4C 3ND8A 1X8KA 4KLZA 3F5FA 1JECA 4GOJA 4B3DA 5LB2A 1ZU5A 3WNBA 4PHTA 2BKUA 2D7CA 2QE7A 4MYTA 1WE2A 4JYCA 5CIQA 1PVOA 2D3WA 2WV9A 2X2EA 3C14C 1GM5A 1VPLA 1OXTA 1OH7A 4HZUA 3IO3A 3SN6A 5L3QB 3R8FA 1T3LA 1XP8A 1YKSA 2XB4A 3NBXX 3BFXA 4Z8YA 2IYWA 4PX9A 1DO2A 2GEVA 2W6IA 3QOFA 2P6RA 4Q21A 3ND9A 3PUXA 4OK5A 1IN5A 4QOSA 3LXXA 4GOKA 4MUBA 2JJ1A 2J0SA 4Q48A 2ANBA 2Z43A 1GVNB 3CPEA 3N2EA 1RRFA 5SZKB 3KQUA 1V5WA 2CVHA 3QF4A 3HU2A 4HI0E 4NYMQ 4A0HA 4I1SA 3MFYA 4MRNA 2JLVA 2J45A 2ZI4A 4KU4A 4TMXA 1VG9B 2A5DA 1X1SA 1ZRHA 2YWHA 2IXEA 1XEXA 2HJVA 1E2IA 2XTMA 2IC5A 3CRQA 4XWOA 4KYIB 3KJEA 2NPFA 3OESA 1XJCA 2ZR0A 3PR1A 3IUYA 3E5HA 2ZQ5A 2JLZA 3A4LA 3ZZ0A 2W0MA 4D81A 1BIFA 1P72A 1Z83A 3CBQA 5GJWC 2MSDB 2HF9A 3LO5A 3I72A 1Z2AA 1G7SA 1M74A 1ZCBA 2G1KA 3CNOA 3MWLA 2QZ4A 2AFIE 1IXZA 3GLGA 3SHWA 2QPTA 2ZI3A 1KMHA 1R6BX 2V54A 1ETUA 2Z5FA 2FGJA 3OE7A 2C9YA 2CLCX 1DS6A 2FV8A 2KB0A 4QBGB 1GNQA 2IUUA 3LVRE 1GL6A 1AA9A 2VL7A 2OCAA 4KJZA 3UANA 4LY6A 1P2SA 3SYNA 2BKEA 3AF4A 3AF0A 4ABYA 1PUIA 4IRUB 2Z4SA 4Q4HA 3U7GA 2ZSEA 3Q9LA 2BBSA 2REXB 3FB4A
chains in the Genus database with same CATH superfamily
3FN4A 2XOKG 3DMTC 2DGDA 2JIRA 3AF1A 3PZRA 2UXBB 1RCUA 1JRLA 1OW3B 4BLVA 4QATA 1EKXA 5FUMA 3ZDQA 3T9DA 2X6AA 5FNVA 2J9XB 2VAVA 3WGMA 3T7CA 4ZPXA 4M1MA 4L87A 4B4DA 4UAGA 2P68A 1TJYA 1TW3A 3FTDA 5BYJA 3C3AA 3H4MA 3SVZA 3STVA 4DIUA 1J25A 4XA8A 1GYPA 5COBA 1P62B 1N2XA 4JI6B 4PBTA 2G40A 3ZXIA 4W5WA 1U7PA 1JR3E 1YRBA 2IDJA 4RLQA 5FULA 1GPH1 4A26A 1EBBA 2QTAA 4KO1S 2C2MA 5U4XA 2I4MA 2Q8QA 1E1RA 1LK5A 1AMNA 2RD2A 1N34B 3EEBA 1AGRA 5EIAA 3L4KA 2UUCO 4PLVA 2G5TA 4TUYA 1Q1ZA 2O2CA 3L02A 3DE2X 4IXMA 2V7TA 4PGFA 3RSSA 3ZJZA 4PA9A 3F7YC 1QIGA 1A9XB 4OPAA 1CIPA 2G8LA 1INLA 3T5BA 4RKWA 4UHEA 3T5TA 3WLJA 1QMGA 4B4KA 4OB6A 5DIFA 2GKGA 3JALA 3UCFA 2CFOA 4DYVA 1SG0A 1M2EA 2ZT9B 4Y1EA 1MX5A 1ABEA 1W9MA 3GYGA 2WTXA 1UJ2A 4OA8A 2X3FA 2D1YA 1EU1A 2F3PA 3DQPA 2GYUA 3FCYA 3F0TA 2WWVD 1OI4A 3R65A 1SAYA 1GPDG 4DA6A 4TYMA 2EJBA 3A6DA 1TZ2A 2ADQB 2HMAA 2ICAA 1QOPB 3W7SA 1Q44A 5DYYA 2OXEA 2QYOA 3BN3A 3INYA 3KBBA 3CW2A 2I65A 2V7VA 4HNSA 3JVVA 1OTYA 1D4AA 4GYYA 4PZLA 5DNEA 5K6RA 1W2GA 4RSGA 1FK8A 2WLSA 3R7WA 4DGSA 2H1LA 3WZ2A 1RE0A 4DWWA 5IC4A 3MT7A 1CY4A 4LJ5A 2XVXA 4YFVA 3W7VA 3WYEA 5C5IA 3CVVA 4U8GA 4OHRA 4KH0A 2TSYB 2C1ZA 3M6UA 4NATA 5EJEA 3BAAA 1YZGA 1MAHA 3MT8A 2X8LA 4OKSA 3S29A 3X1MA 1ZESA 1STOA 3V46A 1EVYA 1G4YB 5ADUS 1LR1A 1GRQA 4X6UA 3AF3A 4FMCF 1OLOA 3DS8A 2Q5LA 3WY9A 5C52B 4G2TA 4K28A 4PRZA 1SS3A 4ECEA 1M0SA 1S3GA 2X40A 2DJ5A 5CGZA 5CH8A 3RVLA 1D2NA 3SC6A 1ZG3A 2H3OA 4D0NA 5EIEA 5I7FA 2O05A 3TWOA 1J20A 4LNAA 4YI5A 2BEUB 1J5EB 3KHUA 4EGQA 3LQ1A 2ITCC 1HE8B 1TKRA 4EG5A 3QUCA 5I8WA 2VHUA 2VP0A 4G4SP 2ZULA 3W2HA 4DV7B 4O4JB 4LF9B 1H5NA 2Z5GA 3BTOA 1QFSA 1O9BA 5LQRA 4UBJA 3LDAA 2AG0A 4CKZA 2PMBA 3LC1O 5D00A 2QM4A 1FKAO 4MXDA 3LPCA 1Y1LA 2GX6A 1ZUHA 2AG8A 3WDSA 4JEHA 4UUJC 2PSEA 4HB4A 5J58A 3JR7A 1E5XA 1PW7A 3FMGA 2OFXA 1W8IA 2V7WA 5LN1A 1XUQA 1ZAYA 3ICQB 1FRNA 1PJQA 1Z4QA 4MQFA 5KTMA 2DFKB 1L7EA 5B4UA 4OX9Y 2QDKA 2Y2VA 1Z6PA 4PX3A 2R6ZA 1D2RA 3VOSA 1XRSB 3DZJA 2WA3A 3X2QC 3EWSA 3GFSA 3QVUA 4CU2A 1E5DA 2B1IA 1YS2X 3OAAD 1Y5IA 4ASUD 4D4IA 2HUNA 1B6SA 3BD8A 2VP2A 3O75A 4KFSA 1XDWA 2A58A 4IAOA 3GUCA 1SCQA 3RTBA 3PEWA 1FNBA 3VR5H 3O5AA 2FSSA 4B3MB 3PVSA 1PTJC 2ODNA 3GCDA 3QM1A 3GMIA 4FI3C 4MV7A 4RJIA 4LOAA 2Q6OA 4E15A 4BGUA 4XZ3A 5FBQB 4D3DA 1JW9B 2AKAB 2BHTA 2HRCA 3OQVA 4RJLA 4BO3A 3CCMV 1YZLA 5ICMA 1W2WB 4OH7A 4GGMX 3AK1A 1MABG 5BV7A 4XI9A 3O1HB 9LDBA 4EFEA 3U1BA 5GTHZ 4A4DA 5K3SA 3OUFA 3PF9A 1CUAA 1PVVA 2PL5A 1PYOA 1XYGA 3HA5A 4P81A 5CGQB 4AF7A 3TIGA 3E70C 2Q5CA 2QVGA 3IQIX 4D9GA 1IM2A 2AMVA 2W98A 4QJIA 5IDQA 1BRMA 3BJZA 2VWJA 1XEFA 4C4YA 1BQ0A 4G5FA 1R37A 1U0FA 2DWDC 3V1YA 3S27A 1V95A 1A1VA 4NTZA 2DULA 4RE6A 1RJ9A 1I7DA 4ZI5A 3S1AB 4YP9A 1P4SA 1LI4A 3BHJA 1Y6QA 1U8AA 5H4GA 4PS0A 3K9HA 1XZMA 3PWZA 2PZFA 2GTAA 1RFYA 1QP8A 2Y1GA 2ZT5A 3AESB 1RQPA 4MCAA 4GVPA 1F38A 4F6EA 4NABA 2J9GA 3U3RA 2BM9A 4OX9B 2V3WA 1RADA 2VHQA 5EJIA 4DMLA 3SYPA 2DRIA 2VYFA 3KSZO 3L1UA 1NVEA 4E5UA 4XYBA 1BMFD 4NVPA 4LF4O 1RKQA 5FNZA 4CMJA 3M6LA 1KOLA 2JIZG 5C1IA 5CD1A 1UJNA 4YCBA 2YIJA 1U9IC 4ZCPA 1NXWA 1GTMA 2LD4A 3UHFA 4DIDA 4LOJA 1VRVA 1G6HA 4N48A 3NASA 4LZJA 2IRWA 4CF5A 3MERA 4CS2A 1TA0A 4WGGA 1M57C 3DMRA 2COUA 5KYUA 4INAA 4DV1O 2JJYA 2GUGA 1X7DA 2QZZA 3FW1A 3GLFA 2O8DA 1C8BA 2GPAA 1E20A 3HYNA 1NI4B 1X7XA 1ZW1A 3ASYA 2ZCVA 2FPUA 4QHYA 3CX6A 3QSYA 2XDQB 2WYWA 1QCYA 3WKBA 3VYVA 1ZSVA 3EA4A 3KKLA 5KQGA 2GN0A 4EX7A 3C39A 1YB4A 3LCUA 3HRKA 3I6MA 1LLQA 3HCAA 2GTPA 1R12A 3M4NA 2B34A 1SELA 3IR5A 1A96A 3F5QA 2QRGA 2J87A 4R5MA 4WTOA 1Y8QA 1R4NB 1FPQA 2OSBA 2ZROA 1P9WA 4V02A 3Q8MA 1PX2A 2WHQA 4MVJG 4C0KA 3GPCA 3IUPA 1XNHA 1S3FA 4ZVQA 2CDCA 4WESA 1U7XA 2FK7A 5B55A 1CJBA 5HGJA 5EIFA 2SNIE 4W5HA 4QPNA 1TU4A 1RQ7A 5DJ5A 3RNOA 2G6TA 2UVPB 1AROP 3EA5A 1YB1A 2FFHA 1OLSB 2DQKA 4R98A 2FFJA 2MYPA 3RTDA 3E8MA 5AVWA 1DAEA 5IWAB 1GXSB 1JJVA 2GDJA 3F4KA 1ZUD1 3D8NA 4UM9D 1HFEL 1T3SA 1ADYA 3P2IA 3SMVA 2JARA 4V3CA 2NQTA 4V2IA 1GXSA 4B3JA 1YB6A 4C7KA 2QTSA 3PEVA 1D4FA 4Y2VA 4XFDA 4UE3S 4CLHA 2RGAA 3KDSE 3L6BA 2YOHA 3T5DA 1SWVA 1R6UA 5IUKC 2WFLB 4FCVA 1RRVA 4AX4A 3GVMA 3I05A 1AGNA 2PJDA 4EYSA 2JJ1G 3OTFA 2Q8PA 5BUCA 1M2FA 5JIBA 1H8HG 1NI8A 1NIJA 1ZVMA 2R1VB 1VBMA 4IQ8A 3KEMA 4HNAA 2IYTA 1ZITA 3JQFC 5HDBB 4BNVA 1W5BA 2I4LA 1W9HA 1DO0A 3HCCA 1C7ZA 3Q6IA 1I2BA 1RWOA 1MJGA 1UXIA 4X64O 2F9MA 3JRNA 4A6PA 1PFWA 3CGWA 1T5DX 4CKBB 5BV0A 5JNRA 5B3SC 2GF2A 4MTOA 1S9DA 5FNVB 2QT1A 1XRNA 1NY6A 1WZNA 2C4TA 3C24A 4JP3A 4FXOA 3RNLA 3WMRA 4ZA2A 2R3SA 2F95B 2VTEA 3FCCA 3FJ1A 3M5CA 4AJKA 1J8DA 1MABA 2IYVA 4QBTA 1X0VA 5KYUB 1TM5E 4B6OA 3UGJA 1QIDA 3MVEA 3GARA 1Q74A 3LKBA 3HVJA 1ZNWA 1BU8A 3DC7A 4FZVA 4MKHA 4A27A 2JZNA 1R7RA 2C84A 4M9SA 4DR1O 3EH2A 3TMYA 1DRVA 2YW9A 1KJQA 1HRDA 3G80A 4RHFA 4Q9LA 4D8YA 2QNIA 4C21A 4JBIA 4PWZA 3PFKA 4IEIA 3TSOA 5K4AA 5GGXA 1LBSA 1T0JB 1VLZA 1HTWA 5HCNA 4D9FA 4EELA 3KWMA 2IH3C 4R6XA 5EBMC 2B9EA 3UJ6A 4AZVA 2C2BA 2HJWA 3H01A 3FF4A 1DEAA 3VMMA 5HF8A 1VB5A 1VL6A 4TS1A 4DW1A 2YV3A 4E21A 5BQXA 4C06A 1BL8A 5HX7A 2ZDIC 3S1AA 2ZJ5A 3N7TA 1G64A 3AXSA 5WRFA 1LBHA 1VP3A 2OBNA 2W2KB 3UF0A 4BKUA 2NUBA 4R2HA 5K0ZA 5JS8A 2A5FA 4Y2HA 1Q1EA 4LRSB 1RQNA 2H8GA 2PZJA 5FWNA 1MORA 1E2BA 2GPWA 4Q4LA 1RSOB 5AUNB 1QKKA 3O2JA 1W5AA 2QNRA 2WLIB 1J2YA 3EISA 5DBIA 3KQLA 1K06A 3QXJA 1XTUA 3B6JA 3O2NA 4KWEA 1WSBA 2PQ0A 2AE1A 4DWOA 1ZHOA 2Q8NA 1KK0A 1A9TA 1NQUA 1UPGA 4OOEA 4PX2A 4MA0A 5IYZF 4ER5A 2O8CB 2Y1FA 1L5ZA 1N2EA 2R6JA 1M6EX 4LISA 2BMWA 4F6LA 1PL8A 3DZCA 4ESHA 3DXRA 4KN8A 1GTVA 2QKCA 4IOJA 2QP9X 3R5HA 1W52X 4Y6GB 4DG8A 2REOA 2NO4A 1ZBDA 2O7VA 4X0EA 1RBZA 3ROFA 2ERYA 4RGYA 1JDUA 2DECA 2EW8A 2AYZA 3KYDA 3NM6B 1TQ2A 2IUSA 4YGYA 3W7BA 2AMLA 4ILKA 1WVGA 2B4TO 2G63A 5JY1A 4PZDA 5KWJA 1P77A 4HUQA 5JSZA 1Z2NX 3CZQA 3U7EB 1MHTA 1PG0A 2X5OA 5IJXA 2AGAA 4KE7A 4EK9A 2FXVA 3RRZA 3GLQA 5K8LA 1KGDA 1YDFA 3RWOA 3T94A 3II6X 4JENA 1YZTA 4GKVA 2E1RA 2R79A 1LJUA 4D4MA 5LKRA 3KU4A 1T3GA 1C4XA 2XWJI 1G1AA 4F6RB 4KO4S 3V1UA 4D7AA 4W5QA 2CLMB 2J6HA 2B1RA 1R1DA 4KRYA 5HRCA 3EG9B 1KVQA 4IXWA 1ZYUA 1AXGA 2OEPA 3DJYA 3ME5A 4M87A 4YXWA 1SXPA 1B3QA 2IA5A 2SBTA 4R1UA 1DKQA 3T7AA 3DF7A 4AIIA 4CM9D 4II3A 5CAEB 2KBEA 1SUPA 5LHGA 1T36B 1XN1A 3T4EA 3DM5A 2VEDA 2Q67A 4CQMB 1OXXK 2UVQA 2JJQA 4WNIA 3B36A 2YW2A 4Q5IA 5CITA 3GG9A 2FRXA 5JS1A 4U6SA 5DHQA 1KJIA 2HBQA 4J2TA 4B4WA 3I5MA 2W2KA 1KEWA 3LCRA 2RBEA 5HW0A 4B3SO 2A88A 4ENPA 2ZDIA 2FPWA 4WF9V 3KV1A 3CLHA 1VQ5V 1SOMA 3AVPA 3NC4A 4NBWA 3FM9A 1E1MA 4UCQA 2JGNA 4J9YB 1NBWB 2WM2A 3GJ0A 2IYPA 1E62A 3M9XA 5TGTA 1RP7A 3A1FA 4Q3CA 1GUZA 1FFAA 4K5QA 4ZVRA 1QK3A 2PS1A 1JZTA 1Q1AA 2RHTA 3EMKA 3U0VA 3F5TA 3UMFA 4B73A 1D7AA 1G20E 2ZI7A 3AB3A 3OTOB 3M2PA 3USZA 3T2MA 4K03A 2JAXA 4F45A 4YR7A 1GOTA 4M0LA 1JWLA 1JIUA 1YZNA 2MYTA 1WZ2A 3AEKA 4WY5A 4YACA 5LOVA 2RI6A 3I0MA 3ND5A 1QBKC 3WQBA 3NAQA 2P2ZA 2OFPA 4Z5XA 1QHHB 1Y1PA 3B9QA 4BECA 2RC5A 1LSUA 1HI9A 4YMTA 2X23A 3E23A 1RJWA 2QMUA 3VISA 2W22A 1ZDMA 2Q1UA 3QVOA 4JY7A 3ZU5A 4NSNA 1AJNA 1EM8A 2I4TA 3P26A 1JBQA 2NADA 5TR9A 2E75B 1B4DA 1ONPA 5DGDA 3V2GA 4BEJA 4LZPA 1KJWA 2C77A 1QP7A 2R84A 1H0HA 2P4KA 4Q93A 2VWQA 4IIYA 4ZI7F 3GQBB 1THMA 1XWIA 1A4IA 1KBOA 1Z5ZA 2W6ID 4EEQA 1EB8A 4XWGA 3VYUB 5JNLA 5KHAA 3AQIA 1JR9A 1ZCFA 4II7A 1NC3A 3FZGA 1KS9A 2VP4A 2WOOA 3LLMA 1RYZA 3Q9SA 1WQ1R 2CVPA 3WZMA 4BV2A 5CVTA 2PYDA 3VSEA 3IELA 4C04A 2AFHB 2RNBA 1HR0O 2JIBA 2VYCA 3Q2IA 3QJYA 5G0VA 1OX4B 1UM8A 4IRXA 1BZYA 1KZ6A 4R7ZA 5IC5A 2Z2YA 3MEQA 6NULA 1PO7A 3MW8A 1PK9A 4ED9A 1SJ9A 1DJNA 3BVPA 3T1HO 1GZ7A 2AFIB 3BWMA 4MIKA 3GT3A 3LBYA 2Y4TA 4DK1A 1P4HA 2IYYA 3GLFB 2ZSFA 1AZLA 4DLLA 1R4ZA 2H1WA 3UHJA 4KDRA 1V1RA 3BICA 1LTKA 4C4PA 1I6KA 2XHBA 3GMSA 1M6YA 4L0MA 3NBZC 1FFSA 2EZPA 4AJNA 1A4UA 5KAFZ 2ZBEA 3QVSA 5I7AA 4GBGA 4XRGA 3A1EA 5JO9A 3ICVA 4ZCRA 1QR9A 2NU7A 4CV2A 5C8YB 1MG1A 1GN4A 5KMGA 2PH7A 2CFRA 2V65A 5EERA 5TMEA 3JVIA 4BIMA 1ZW6A 2VRNA 3AIOA 4PDVA 1SC3A 3IQZA 3NTQA 5HKLA 2HLDA 4EVQA 1VZ2A 2Q5HA 2XWPA 2JH9A 2R68A 4HJXA 4I1IA 3PHIA 4P8RA 3RQIA 3OZTA 3ZDZB 4JJZA 2WQ7A 1SUBA 4P5PA 4GSYA 4XD7A 4CTKA 4ZP1A 2FSHA 4ESVA 1GA4A 5U4QA 2HREA 1T2UA 1NKTA 3ZWCA 1U1EA 3EMDA 2CHUA 3CT6A 2YIBD 2X42A 1T5IA 3IMFA 1A77A 1T9DA 1XZGA 9GPBA 2R97A 2Z57A 1PK7A 2GZ1A 3C8HA 5DNAA 2AV6A 4NIMA 2BYTA 4MAFA 5TPZA 5J63A 3STXA 1DQPA 1NMSA 1WLYA 1QBZA 3C3CA 4KI0A 4RMJA 3TUJC 3UK6A 1K8XB 1WMAA 4ERNA 4HWGA 1FSGA 2GZ2A 1MPXA 2ZOSA 3FB1A 4DJAA 4TYYA 1G6OA 1Z5VA 2VAMA 5B1SA 3TSAA 3DE5X 4A92A 4EG8A 1U9IA 1PJSA 3U0BA 2E82A 2BFMA 4M46A 5I47A 2A57A 1UMCA 4NCHA 4JI1B 4HNGA 3P4YA 1U0JA 3QWFA 1ULHA 2HJHA 4ZVUA 3QKSB 1GM9A 4R9VA 2HOQA 421PA 3GCGA 1OZGA 1NLYA 1GZHB 2YN4A 1W0CA 2EFHB 4W9RA 5HUQA 1AUPA 3T38A 1HDEA 2RONA 2UYQA 3CX3A 3JW8A 3IAEA 3RIHA 1DHRA 2NT4A 2FRVA 3ZDFA 1N77A 2VATA 4KBFA 2QX6A 3WWZA 2VT6A 4IDAA 1GFZA 4A7PA 3E05A 3IJPA 2OQRA 1H5QA 2P22C 1U7TA 1ZSNA 2GRJA 2QR4A 1K4CC 1SC5B 2DFNA 3MMZA 5F1OA 2QAGC 3KUKA 3UNXA 3TSWA 4CCWA 1B8PA 1P8JA 1PR5A 2XDAA 4P32A 3U48A 1FFYA 2PXXA 3GP5A 4OQYA 1XNGA 3C7KA 3R0VA 4MQ4A 4NFYA 4JI6O 2J5KA 4IVNA 3TM5A 2QSJA 4MUIA 1SGWA 3HZOA 1KZHA 1D8TA 3E5NA 1IBKB 4Q6BA 3NR7A 1NWCA 4XGQA 5B2ZA 4AW9A 1DWUA 1UEIA 3FTCA 4CJXA 2BUBA 1IM8A 2JJ2A 1NQTA 2PQ6A 1A3CA 3IDSA 4ZV7A 3UGQA 3IDZA 4BP3A 2ZYRA 3DCIA 4IPTA 4PSUA 3U7FB 4ZYTA 4KUEA 4PC2A 2WT8A 2WY2D 5LBUA 1QIHA 5BYKA 4HXFB 4QASA 1U3FA 4JQOA 3ZDYB 2IJKA 2VK1A 2VNAA 3A2KA 4KKXB 4CS3A 1UWCA 1BMDA 1TPYA 1UMDB 3G5TA 4UUAA 1A8UA 2CBZA 2NVWA 3FWYA 1N0IA 2HMWA 3CE9A 4OATA 1G20B 3AVTA 4D8XA 4KOAA 4KO8A 5GWXA 3ROTA 4EYQA 1GTL1 4IXDA 1E2HA 4FFLA 4DLPA 3TUIC 2G88A 4QXAA 4Z4IA 1C0LA 4JI7B 5DULA 3WC4A 3NEYA 2GLUA 2P6UA 3G1WA 4U0JA 1SQSA 5DK4A 3VQTA 4OEHA 4AY5A 4D42A 3OECA 5AI6A 1GN3A 2Q3FA 3FVWA 4JJ6A 4QUHA 4XR4A 3T7IA 3RRXA 4URXR 3DXRB 5FL7G 4JOQA 2J3JA 2EHJA 4B76A 4CN9A 2BBWA 3CJQA 1XHFA 1XXHA 3ENZA 3N1UA 1R00A 3PDWA 4L9WA 5B53A 3TQRA 3TW8A 3ZE1B 3EOBI 2VZ0A 1UAYA 4DSAA 4FOSA 2UUBO 1OWPA 4OKNA 4PBRA 5DTIA 3W6OA 3W2TA 1NMXA 2ODBA 4ZANA 4TVSA 3FOFC 3L84A 4Q3AA 2AFVA 1WAMA 4GYWA 4BUZA 4B44A 4FDTA 2HDWA 4CMEC 3M7MX 4OQPA 2FMXA 2WLJA 4KC0A 2AD1A 1JIXA 2GBGA 2HR1A 1L1RA 1XBLA 3ZX6A 3WNDA 2Q7EA 3DT9A 5AD1A 1U5BA 1BNCA 3ICCA 1KAMA 5F1YA 5H70A 5HCIA 3EZNA 4TT3A 3RRMA 3TNFA 5JHGB 2ZT8A 1XWWA 4FM9A 3U61B 4YDQA 1V8ZA 3QWBA 1SQXH 1ZRNA 3NUQA 5CFQA 2FW8A 2PUAA 3ZQ4A 4WADA 5KX5A 3C4QA 4A91A 1MJGM 1X2EA 3DBLB 2C04A 3AW8A 3O4FA 1N1MA 5ADWA 4FVTA 2HG5C 5EC2C 1BXRA 3L92A 4EO4A 4ZKEA 3RJ5A 4GPEA 5H3LA 1QIMA 1WY7A 2RG1A 4JI5B 2YIAA 2BMDA 3H9VA 1MNAA 4B43A 2Z04A 1V47A 1H5UA 1N6LA 1NHGA 5J9PC 4W4LA 1Q84A 2YDYA 4ZI7B 1RHJA 2ZANA 3TNLA 3PVCA 3C5CA 2WKPA 4QJ3A 4IGEA 2ZM5A 4JF3A 1NH2D 4N65A 2AJTA 4CL0A 5BWNA 1B8VA 4RQBA 2ZB3A 1S8OA 2NNWB 2OGZA 2D7JA 2RQ6A 4BX8A 1VE6A 2X4IA 4ZQIA 3EFOA 2OCKA 1D2MA 3FPLA 4Q3BA 3CN9A 5BQ5A 3VTAA 3WGZA 4ACBA 3P9QA 5CX1B 1O0BA 4BXOA 1RPRA 3Q10A 4OFZA 1SNYA 2HB6A 4ZCMA 2QTTA 3DLTA 2IH2A 4PLPA 5HSGA 3F8TA 3SJZA 4HZGA 2FCAA 4CKBA 3AKYA 3PSHA 3R24A 4DT1B 4RF2A 1E6MA 2IEIA 1XRMA 2YMMA 2ZB7A 2FMHA 4LXIA 4GKKO 4PY2A 2VSFA 1XI2A 3N8KA 3UA4A 3NANA 2I1WA 3IKVA 3KWLA 4ZV9A 3AHGA 4Z54A 4OQFA 3ZYCA 1MIOB 4JCCA 5GADl 4HLQB 4N76A 2ID8A 2WPDD 4KW7A 4WFBV 3VKHA 3G6EV 1P0IA 3OLQA 5ICSA 1USWA 1ISPA 3ZZ1A 2GD0A 2I0FA 4YMVA 2PUGA 2HA3A 1O6CA 3M6XA 3OT1B 2AOTB 1FS0G 3UT5B 1E3WA 1TIPA 3HXPA 3FAZA 4NF2A 2LV8A 2XAAA 3AERB 5KC9A 5FBKA 1KYWA 1E9EA 2ARHA 2GPSA 4DMCA 4KXRA 2CHQA 4HT3B 2PT7A 1Q0RA 4YROA 4NENA 4YRJA 5BP7A 1JFFB 2VS0A 4TV9B 3HPLC 1EESA 1IUPA 1M1UA 2SECE 1YQDA 2FOLA 3UCXA 4ARUA 3TVDA 3EIOA 4LTMA 5E95A 1P1KA 4WCDA 4KR3A 3CMCO 1QV9A 3D6AA 3WIVA 2IELA 2O3UA 2EW2A 1TZMA 2P77A 3UAYA 1W5EA 3Q85A 5BSVA 4NDAA 5H80A 4YQFA 5SY9A 1VPWA 2GFIA 3V6LA 2VC2B 4JVLA 1W4CA 4ESOA 3G8AA 2X6CA 1RW4A 4MNTA 2F3RA 4PPNA 3TZ6A 4P4SA 3QBTA 1YEWA 4K9PA 1SHJA 2DOKA 3I2YX 3A8TA 1E89A 2ZJZA 2WLNA 4WOBA 4FLZA 2DBVO 5KUTA 4K6MA 4HEHA 3R0IA 2DZDA 1WF6A 3AFGA 4TTJA 5EXTA 3SY8A 3U81A 4BNTA 4CUJA 4QPZA 4CLRA 5A0VA 3OCXA 1H0SA 1GN2A 3IV6A 1RHRA 2B4YA 2IHZA 4XFKA 3T7JA 4X24A 2IVZA 2DTEA 3LJKA 4D3ZA 4EKEA 4IFBA 4K81B 1PFGA 5BN5A 4FZJA 5FOQA 3T5CA 5EXSA 1XG5A 1TVKA 2P4SA 3D4NA 2GKOA 3FNEA 1XMIA 2PFSA 1GLGA 3N0VA 3Q15C 3SF8A 1TYZA 1YFJA 3HPQA 1DJOA 2K2QB 3LRPA 4MYDA 1SXQA 1G9TA 3OMIB 1JAYA 3UEOA 4EFMA 5IYZB 3G49A 1ZUNB 1V16B 2V1DA 3LQYA 1MH9A 1T29A 1XMOB 2YS6A 3E48A 1CHDA 1BHAA 1XRJA 2HYDA 2R6HA 3NXSA 1N32B 3AR2A 4NOJA 1FFXA 3A6EA 5AVKA 1KMNA 3GUVA 4Y9RA 4DLVA 1JFVA 2W2XA 5FR1A 10MHA 2QLMA 3A4IA 3HSYA 4YJ2B 2ZWMA 3RYFB 3KSDO 3IGFA 2V7QG 1E94E 2ZFUA 2XKKA 2O2IA 4K1XA 5DRYA 1WS6A 3AVQA 1M8JA 4KPUB 2EU8A 2CTWA 3SJQC 3EN0A 5HMMA 1G60A 1N75A 1V7PC 3PNVA 4O59O 1WSDA 4S0XA 4F4UA 3LQKA 1J5EO 3JWGA 5JNUA 1BCSA 4RMHA 4YRAA 1MV5A 4WZAB 2OP0A 2P2GA 4A0SA 4BV9A 4FBLA 4QM7A 1TM1E 1L4FA 1ZY2A 2HQBA 3BQMB 4C0BA 3OETA 4LC9A 3CWZA 5KVQA 2IIBA 1LUWA 5JSFA 5KYXB 3EPKA 2IXTA 1Y66A 4GWKA 3M7IA 5ICEA 5EFOA 2OCCB 3RN4A 4FNGA 1YR7A 1YRHA 4XD7D 2B5UA 3HACA 1Q91A 2GCOA 2AJLI 4TMZA 1COWG 1VG0B 1N6NA 3BXXA 4XLLA 4JEUA 3H5WA 5A2QA 4BVGA 1EG7A 1ESCA 4J1SA 2B83A 2BBTA 4YJ3B 5IU6A 2NV0A 1O54A 2ABWA 3TYXA 2CLIB 1I6MA 4YPVA 3EGIA 3QA9A 2F67A 5FQNA 1CUXA 1B15A 2CLHB 2FMTA 1HEIA 3FAVB 5LIRA 4QGGA 3UY4A 3WRXC 3WLKX 4CHTA 3GPBA 1EHYA 4PSAA 3TIIA 1Q14A 1X14A 3THWA 1QVFU 2WM9B 1RQGA 2ISSD 3OQJA 5CX4A 2F55A 2G5CA 3EGXB 4Q7JB 2FUEA 3HCWA 4YRMA 1Y7IA 2XT0A 1OZFA 4HQ6A 1CJKC 1W44A 2QORA 5DCWA 2UXCB 2DT8A 3HCPA 4LDRA 4ZU1X 4F7DA 1VQKV 1GUBA 1HNWO 1HYBA 3K0HA 3ZD7A 3BUSA 4F3NA 2QRVB 5H1YA 2PZ8A 5SYAA 4ARZA 3HXOA 4RO0A 2FUCA 4RIGA 5GONF 4PX5A 4C4SA 2FLWA 1Z7BA 2CHGA 4BB5A 3R41A 3R5SA 3ZGXA 1RPNA 4PXYA 2MSLA 3K20A 2ZJYA 2ACWA 4OGWA 1G18A 2I67A 4D80A 2AN4A 4LNHA 4DUGA 5DX0A 1VF7A 4BAGA 1LC3A 1V2HE 3IX7A 4OHOA 4XLTA 4EHAA 1XF9A 3L0BA 3UA3A 1F17A 1Z4MA 2J9YB 3KTAB 1OHHG 3SOPA 1KAQA 1N2HA 1PI3A 2NV6A 1BQ4A 1ZL2A 1N7HA 2ZJAA 1JHDA 3AHFA 3GGJA 5CVVA 5AKEA 4RVNA 1XKLA 2PI4A 3IESA 4MLCA 3OD4A 2BFAA 1M56B 2OHXA 2XTJA 2ZSKA 3GFBA 2D0DA 4G2NA 4OFBA 1CQIA 3JQBC 4OXNA 1P5ZB 1XTKA 4COKA 5BSEA 5JASA 3G0DA 4LF4B 3QPWA 4ALJA 3DAGA 1I2ZA 5F78A 3LZCA 2RH4A 2XYGA 4UXHA 2PGDA 1E2JA 2F90A 1IDOA 1SQ6A 2G70A 1JQJC 2X4LA 5JD3A 1KMHB 2I76A 4A5SA 2FB9A 2NNLD 2BDTA 4BOYA 1ZEMA 2C1EA 1IJKA 5DASA 2FPLA 4L72A 1BSMA 1KIFA 1NM5C 3L05A 1RC8A 4CEHB 3BZUA 1PD3A 1G5PA 3CG0A 1QTNA 1TMKA 1Z68A 1CD5A 4ZVLA 1XHEA 2W6PA 3C87A 5I7UA 1PGOA 2ZVJA 3DZFA 1QPGA 1VTKA 1YOBA 4RCYA 1QG0A 1RVDA 2OZLA 4UVIA 2UVDA 4K8ZA 4EG0A 1CQJB 1GL3A 2QT9A 2A5GA 2GSDA 3OZGA 3N3BC 2G6BA 1LDEA 3HEBA 3O4RA 4KE8A 4M60A 5A7HA 1VLHA 2EJVA 1BOOA 2DUWA 4KAXA 2B2CA 2IYQA 4JI4B 1JN0A 4MLDA 3F9CA 1DC7A 1H0KA 4RVHA 2AC2A 5ELMA 5JXHA 3GLKA 3K5NA 2GWRA 1QDLB 4M1OA 4RX1A 1JTFA 1E1CA 5BWOA 4GPZA 4CLOA 5JLJA 1S2OA 2F9LA 1TCAA 1JA0A 2BN4A 3I12A 2MSWA 4FMPA 4IO1A 1WDTA 2CXOA 4XVHA 1FDOA 3E7WA 1ZNZA 5EJ6A 3OQBA 4GOMD 3E8BA 5AXAA 4ARAA 2ZRFA 3C74A 4JOCA 1LDMA 2RH9B 3VKGA 4J0JA 3R23A 2VOEA 4NH4A 4HDOB 3FLAA 4CL8A 2F8TA 4COOA 4OB8A 3IFXA 5CDGA 5EZYA 4PANA 2O8BB 1YCFA 4DA7A 2JA2A 4HBGA 5JISA 1CY1A 2YCBA 4FGZA 4ND8A 2DYKA 1C0KA 1SCUB 3U26A 3DTUB 4FQ5A 4YHBA 3TMKA 1I2CA 3CKLA 3G0IA 4YWHA 4HZUB 2AR7A 2FCRA 2GKSA 2GBPA 4BU0A 5IVIA 3D6TB 4HRYA 3CF4A 4XKJA 3GT0A 3PWTA 1DIHA 1LW6E 4PONA 2H4YA 3GFVA 3TPZA 3MGCA 3IE1A 3VPAA 2QL9A 1IQ0A 2X77A 1B6TA 3O94A 5JQWA 2FFAA 3GCWA 1RYMA 1M54A 3B7WA 4B74A 1C3EA 1RMTA 1FAFA 3L8MA 3K6JA 4CGZA 1YT5A 3H19A 4KFRA 1U4SA 2QEQA 2FPPB 2ZCUA 4MRMB 4V2UA 2ZJ3A 1KJJA 2BFDA 2PH1A 5TQ2B 5EP1A 2VHTA 2ZKLA 3NW9A 3WAKA 2NAPA 3VJRA 4US2R 3LHFA 2QSAA 4KHPB 2ZYGA 5BQPA 4J9ZB 1O94C 1DUIA 1BYUA 4R1PA 4S35A 3ZMSA 2AZ4A 2NXCA 3SEZA 4DDKA 1YS7A 4HH1A 1QGYA 3SZMA 2B99A 3LSUA 1KXJA 3SSAA 4IJWA 1X4TA 5I5GA 1JDSA 3BMNA 1OV6A 5L3DA 2XD4A 4V0RA 1NJ2A 2F17A 2QAIA 2FPIB 4UXJA 1DDGA 1W0KD 3C98A 4QTTB 2Y1OA 3U4IA 2A9FA 1U2DA 3VVBA 3C1UA 3QVVA 4G1UC 1FZTA 2EILC 3TD2A 1W94A 5GINE 2BUAA 5AK0A 4GNRA 1K6XA 1SD5A 3MNFA 4EHBA 1Y3CE 4ER3A 1ID1A 3DHEA 3PNPA 3U80A 4D9NA 2QVZX 1K6MA 5JJNB 2M9MA 1O96B 1JB1A 2VTVA 3PI6A 4L85A 4DB2A 3FNGA 5ICCA 1I0HA 2YICA 3EDQA 4EFBA 2HDNB 2IYLD 3OPQA 3INNA 2QDXA 3LX5A 2F8LA 2Y8EA 2WVHA 2HGSA 5B66Z 1V8BA 2IDZA 4KHZA 5BYAA 5K3OA 2YTZA 5AVSA 1HORA 1CERA 3C3MA 1A2OA 5LQSA 4TWRA 2HU8A 4C6TB 4GX2A 4G4IA 2FQWA 4KGVA 3ZQJA 1RYFA 2BTOA 2RAUA 4J0KA 4RWEA 1V37A 1A7UA 4YDSA 3D1VA 1JT2A 4PPQA 4MUXA 4Y2XA 3T3EA 3A4NA 3AJDA 1R8SA 4HXYA 4JI3O 1UBGA 3RROA 5JW6A 5EE3A 1P7GA 3L74H 1YJNV 4U4AA 5EIBC 3NP9A 3NALA 3F71A 4DFDA 5CPBA 1I2DA 2NYRA 3CEAA 5HJ5A 5L4NA 4JKIA 1KC1A 3SFVA 2JHFA 4NBKA 4UJ3A 3JATB 1EDDA 3ROZA 1Q5OA 1NAIA 2LBPA 2EXXA 3PXUA 5LVAA 3VMFA 3A0UA 3FWKA 1RXYA 4Q7EA 3A1DA 1NOKA 3TKYA 1WA5A 3QLJA 5FTLA 5A5DA 2EERA 2B5OA 1YJ5A 4PG7A 3K9GA 2JJ1D 2GBCA 1U5BB 1XJ0A 2GA8A 2ZATA 1M8GA 4RH0A 5DPMA 4ND4A 5ALKA 5FI3A 5BSUA 4L50A 2P9FA 1EA7A 2EYUA 5K4HA 3SPJA 1YUBA 1BH2A 2NP7A 2QVBA 1MPTA 3G85A 4Y7CA 2RGNA 4L8JA 2JFWA 5B6PA 2W2VA 1JEJA 3GY0A 2C0CA 4IS3A 4I6EA 1VPTA 4MZDA 5E9AA 1MN6A 2ATVA 2NIPA 3UK7A 2BL4A 3N5CA 4X1KA 1Y4MA 1EVZA 4EJ2A 2RH5A 2LGWA 2J3KA 3UB4A 5CDHA 3TDKA 3CVOA 2Q9BA 1ZIPA 2HAEA 3NTVA 5CVEA 4FJ0A 1BVYF 5DM0A 1QFMA 4JB8A 1VCIA 3ETJA 4HQFA 5JTUA 4FHCA 2I2CA 3FOZA 5T4HA 4DR4B 3MRTA 3U3XA 3PI7A 4NCBA 4HKTA 1PFQA 3ENNA 4I1OA 1SQ5A 2AH5A 5JUWA 4NQRA 2C7OA 3L5OA 2I2BA 1QIFA 1QQ6A 1S1MA 2P6JA 1XL0A 1ZGBA 2R7AA 1A8PA 2XIQA 3NKFA 4PIMA 1ZK4A 4XJXA 3ZD9A 4E2LA 2FHPA 2V98A 1TEHA 1EN6A 3T06B 4PCUA 4KLRA 4ZOBA 4BNHA 2PUCA 1JAHA 1HE2A 4E33A 4F4FA 2XB8A 4X97A 4XCXA 1UXHA 3M34A 2PR2A 3H0KA 3W9YA 4RJKA 2D1FA 1ZFNA 4XTRA 1WA8B 1XU4A 4G85A 1P8AA 1Z0FA 5J9FA 4OI0A 1UODA 4BCBA 4MGEA 4MS4B 2F43B 4UDXX 2QKSA 5KKCA 1U80A 4GYKA 3ZWYA 1D5CA 2E5FA 2QLTA 4WOKA 3A4VA 1E77A 4LQ4A 1NBMA 3NJ4A 3GV0A 4RD4A 3X1YA 4DM3A 3EDYA 2D0OB 1EXMA 2WQZA 2V0GA 2F23A 1CIVA 3URMA 4YEDA 5FHRA 1E3TA 1E7WA 2FWPA 3G2PA 2P40A 5GAJA 5ES4B 4MITA 4OIMA 2F4VO 1PWHA 4N6NA 4KPYA