3EXAA

Crystal structure of the full-length trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
317
structure length
303
Chain Sequence
KEKLVAIVGPTAVGKTKTSVMLAKRLNGEVISGDSMQVYRGMDIGTAKITAEEMDGVPHHLIDIKDPSESFSVADFQDLATPLITEIHERGRLPFLVGGTGLYVNAVIHQFNLGDIRADEDYRHELEAFVNSYGVQALHDKLSKIDPKAAAAIHPNNYRRVIRALEIIKLTGSPYNLVMIGLTMERDVLYDRINRRVDQMVEEGLIDEAKKLYDRGIRDCQSVQAIGYKEMYDYLDGNVTLEEAIDTLKRNSRRYAKRQLTWFRNKANVTWFDMTDVDFDKKIMEIHNFIAGKLEEKSKLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA delta(2)-isopentenylpyrophosphate transferase
publication title Crystal structure of the full-length tRNA isopentenylpyrophosphate transferase (BH2366) from Bacillus halodurans, Northeast Structural Genomics Consortium target BhR41.
rcsb
source organism Bacillus halodurans
molecule tags Transferase
total genus 98
structure length 303
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.75: tRNA dimethylallyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01715 IPPT IPP transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.890 Mainly Alpha Orthogonal Bundle Helix Hairpins Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 3exaA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3exaA01
1YZQA 2GETA 2O8BA 2HF8A 2JLWA 1KSFX 2GVDC 2JJ8A 1WE2A 4GP7A 4P3YA 4B48A 5FH9A 1DELA 2W6JD 1G5PA 4FCWA 2Z5FA 1GRNA 2DB3A 1HEIA 1R8SA 3GEHA 1CEEA 5AUOB 2DFNA 3X1XA 2ZPTX 1SHKA 2BCGY 4NCJA 5DH9A 2V9PA 3UK6A 3PG5A 1Q44A 4YC7A 3B1ZA 5FL7D 3IO5A 5EUMA 2ZR9A 5EXTA 2PX0A 1QG2A 3A8TA 1L7VC 2ZI5A 3CONA 1G18A 1KJYA 3CM0A 2IXEA 3W3AA 4LHWA 1QVRA 1RPZA 2Q9BA 2RKOA 2WIBA 4P33A 2PT7A 4M1OA 4AC9A 4F4JA 2J0VA 3PUWA 1NMYA 3PEVA 3QIAA 4EFNA 4TL8A 4HZUB 1OT3A 4XH9B 4D4LA 3A1SA 4I1SA 2X1VA 3NHBA 5BQ5A 3ZZ0A 1WB9A 2JLRA 4BLRA 2DWOA 2ZJAA 2O8FB 2BMEA 4PO9A 1G3UA 1UKVY 1N0UA 2FJUA 1B0UA 1MO4A 1U8YA 4L9WA 5KOYA 1VPLA 3KQUA 1F2UA 4JYCA 1E2IA 4M4SA 4D6PA 3LRPA 2L0XA 5FUVA 2FEOA 3THWA 2J9RA 3NVAA 4TQUS 2N1BA 2QSYA 3EXAA 1X8KA 3U7EB 1N5KA 4ASUA 1N6RA 4I81A 4B44A 4C0HA 3U4QB 4V0MA 2R62A 3KJGA 1WCV1 1OKKD 4MUAA 3BAFA 1E4VA 4OQNA 4KV9A 5B57C 1KZGB 4OQXA 3H1TA 4B6EA 3CO5A 5KPDA 5JJLA 1VG8A 1D8TA 2PMKA 1W1WA 2OFOA 1NVXQ 3QF7A 4JLOA 4PC7A 3U61B 1M7GA 3KKPA 1J70A 1ZAKA 1ZM9A 1L8QA 3VMFA 4V0OA 4TLBA 1U9IA 2GF0A 2ZITA 1ODFA 1II0A 2EW1A 4EJSA 4DHEA 1H8HD 4XVUA 1A2KC 1TF2A 2GXUA 4GP6A 5AJYA 1QDEA 1W4BA 4Q4AB 2ODBA 1QHIA 1N5LA 4LHVA 2IHBA 4EKDA 1P6XA 1EFRD 1PZNA 2F1IA 3I8XA 4OQMA 3C15C 1M2OB 1WMSA 3NBYC 3U3JA 2GTPA 1G7CA 1S8FA 1VYVA 1XPOA 5TY0A 3TNFA 4EDHA 4ERNA 1Z0KA 1AZSC 1RRPA 3KB1A 4IFEA 4ZO4A 1YHNA 1ZBDA 3TIFA 2CL7X 2H17A 3GLGE 3FFAA 4LX0A 4LYAA 3NIBA 2EFGA 1V5WA 2OLKA 3WRYC 5SZHB 4F92B 1UBGA 1TU3A 3RRZA 2BKEA 5BXQC 4G5RA 1D2MA 1AIPA 3EIEA 2R44A 4KAXA 4JVMA 1KDOA 1OFHA 2ANBA 1FX0B 4A6XA 2XNSA 1F5NA 2WWIA 2JLXA 5FR1A 3V00A 1NY5A 1Z22A 4OI2A 5FUYA 1GSIA 3KXKA 3ZD6A 1MABA 2AD5A 2W2XA 1E32A 5K8LA 3CB4A 5JS7A 1G6OA 5HKKA 2C78A 1C9KA 4OL0A 2YV5A 3SQWA 3ZLJA 2ZUCA 1N6LA 2HF9A 1XB2A 2ZRKA 3BD9A 4KBFA 2VH5R 4M9SA 5FOXA 3E2IA 4RZXA 2QM7A 1GKUB 1YJ5A 3P4XA 1D5CA 1ZIOA 3CPEA 2VHQA 2ODEA 4U02A 4CEHA 1IN8A 1TQDA 4GPTA 4Q03A 4ARZB 3OIYA 3CW2A 4ZKEA 1QF9A 2WZQA 4HSEA 3QKRA 1GAJA 4OHXA 1EWRA 4C0AC 4LHYA 2O8EA 4Q9IA 2H1LA 1OYYA 2BJWA 5AJWA 1S1CA 2GILA 2HT6A 4NKRA 1E2DA 2O8CB 1N0VC 3VU9A 2HV8A 5J47A 4NZYA 3WXMA 1OE0A 2W6ID 4IHQA 2R6DA 3V9PA 4XSGA 2ZJZA 4B75A 1NN3A 3GEEA 4UNNA 4ZKDA 1P61B 4HI0E 3GLFE 1A5TA 1ZMXA 5J4VA 4HLUA 1R0ZA 2FU5C 4KU4A 2UZ3A 5JWOA 1WXQA 4E09A 4E03A 1F3OA 1YZTA 3S1AA 2EWVA 3KJEA 2XSZD 4Q1EA 1VTKA 1WQ1R 2GEVA 1CR4A 2VO1A 3CZPA 4GOXA 4Q1AA 4U7DA 1Z6GA 1VMAA 3BB4A 3D7MA 4CEIA 2IS4A 1CP2A 4LYFA 1XEXB 3SFVA 2W0MA 4I4LA 2GCPA 1P2VA 1ANKA 1Q3HA 1G16A 2IL1A 2K5UA 2XB4A 3GJ6A 3I61A 1OIXA 1FP7A 1G20E 2JEOA 1FOEB 5DN6A 4YMUA 4HB0A 4F93B 4LWZA 4C3ZA 4PO1A 3OE7D 2G1JA 4IDNA 3RABA 2QPAA 2GBLC 4OBEA 1NN1A 4BGDA 1E3MA 4FCVA 1AS2A 2CMKA 1AKEA 3CNLA 3KB2A 3QBVA 4MRVA 1ONBA 3OIVA 2W0SA 2NOAA 1ZM7A 1J90A 3CNNA 1DAKA 2P67A 3FMOB 1O87A 3PIRA 1SVOA 4JS0A 4N3NA 4RFSA 4BECA 3DOFA 1U99A 4DIEA 2NGRA 2WMOB 4Y0VA 4OI0A 1OB2A 5C18A 4PZZA 3ADCA 2E87A 4BWYA 1EFCA 4JIMA 1Q22A 3OEHD 1QZXA 3EX7C 2NQ2C 1GL6A 3PFIA 3FKQA 4NYIQ 1GZSA 2ZAMA 5LB2A 1KI4A 1JECA 1KI3A 4R2IA 1IJFA 4UNPA 3AGQA 2B6HA 4QM7A 3L82B 3AVOA 3IEUA 1OXSC 1NBME 4FWIB 2JLQA 3KZ1E 4AY2A 1ZU5A 5F9FA 3KKOA 4NCKA 3SEAA 4TYNA 1N6HA 4PC6A 3TRFA 5G40A 4BFWA 1VCMA 2R8RA 2GJSA 2ZYWX 1Z0DA 1NLFA 3M0EA 2QROA 5TV2A 1KSHA 3C5CA 5AR1A 4CYMA 4M53A 4EFMA 3ETLA 1MRNA 1RRFA 4P4TA 2ZJ5A 2HEIA 3QVVA 2W58A 1E2FA 1E98A 4DZZA 1WDTA 4PANA 4CRWB 2QBYB 1BOFA 2FSIA 4A8JA 4RSGA 4AWXA 1SVLA 3KKMA 4TLAA 1DPFA 4DSTA 3VR3A 2QRNA 5JRJA 5EXSA 4DLYA 1KO1A 4F7WA 4B3DA 2JLYA 3K09A 1ELOA 4LYHA 4QGFA 4QM6A 5E95A 4OHWA 1IXSB 3I32A 1R7RA 2VEDA 3GLHB 3AVUA 3EPHA 2D2EA 3EC1A 5BYJA 1P9NA 2ZIAA 2QMHA 2JGNA 4TYWA 2HLDD 4X8HA 1G6HA 1RW4A 4Q47A 4KFTA 4JKYA 1TTTA 1QRAA 3P1JA 1JEDA 4GRAA 1JPNA 3B9QA 1XDBA 4MGIR 1P3JA 1XTJA 1ZUHA 1U81A 5F9HA 4RD6A 4EPWA 3IKJA 4XWKA 1XMSA 3X2SA 4QBHA 3R9WA 4AYWA 2FFQA 3AVYA 2Z6VA 1DS6A 1QVAA 3ZIAD 1IN6A 3IBGA 1PLJA 5DO9A 2CDNA 4XTCS 5H68A 1JJVA 2V1UA 3SYNA 4PZLA 1E9FA 2BEKA 4BFTA 5HPYB 3GJ0A 1WBBA 4UXJA 3EC2A 2QPOA 4D26A 3LQQA 5HE9A 1P72A 4Q9KA 1FW6A 3EIQA 4WVFA 5LD2C 1TAGA 3A1WA 4FINA 2F43B 2N42A 4CEJB 3CX8A 3WNBA 2NPFA 1F6BA 3DKPA 1S4QA 1ZNWA 2VHJA 4W9MC 2E9SA 3GMTA 4C7OB 4JJZA 2I3BA 2G6BA 3IGFA 3NXSA 4PAOA 1SVKA 5CLQA 2D2FA 4QGHA 2YZ2A 1SXJC 3OAAD 3HU2A 2O8BB 3AVWA 1FUUA 1T3SA 4IOMA 4TZ6A 1IQPA 2YHSA 4B3XA 3LQRA 1S0UA 3DHWC 1M74A 1TADA 4IOKA 2ONJA 2FZ4A 4RKEA 3HYTA 5EE5B 3WHLA 2ZEJA 3EARA 2RHMA 1ZRHA 1DTSA 4PQFA 4DDTA 2QP4A 4RD3A 3CH5A 1EFRA 4G5OA 1E9BA 1X3SA 1YU9A 2MSCB 3M1IA 2ZUDA 3RS7A 3BXZA 2ASEA 2KBFA 1XEWX 3CUEF 1GDDA 1U8ZA 1E2HA 4Q66C 4BFYA 2CEAA 4BUJA 1SXJD 3GP8A 3K70B 2QEQA 5HZKA 2JLSA 1JR3E 2ZJYA 4JVLA 4E22A 3L0OA 4Q01A 3WYGA 3THYA 2BV3A 4OK3A 1XCMA 3PUZA 2CCKA 1XWIA 2ZUBA 1IJEA 4TYQA 5E7MA 4C0QC 2A5FA 2BCJQ 4UJ3A 4A0HA 1K5GA 2MSDB 4FIDA 1S96A 3B1XA 2AWNA 3B6EA 2J0QA 2J3EA 3TH5A 1Z0IA 1F2UB 4NHOA 2ORVA 5CM9C 1F2TB 3LFUA 1RRGA 4LDJA 2PT5A 2J87A 4JJKA 2Q0HA 5CDFA 3RLFA 3QXHA 4N0DA 4QKQA 3THWB 4DCUA 3N2EA 4B2LA 3IHWA 3KQKA 3LH5A 4B3GA 1M6NA 3ND9A 4DT1A 5JBQA 2VHTA 2OXRA 1RJ9A 4NCNA 3AUXA 2OXCA 2YWGA 421PA 1BO6A 2WKRA 1KDTA 3EPKA 4I1UA 1YR7A 3NBFA 1NN5A 4LI0A 4AIIA 2CE7A 1G19A 2ZS7A 3AVXA 2OBNA 3KKQA 2J5XA 3U7GA 2FA9A 2EU8A 3A1VA 2DFTA 1P7CA 4DLXA 4DEYA 2RGDA 1T8UA 3P26A 2V7QD 2O8CA 4US2R 1KY2A 1ZM2A 2A78A 4JYBA 3AUYA 2FX3A 3UWOA 4DSUA 5DHAA 2LWIA 3LA6A 4EJSB 2A5JA 4D0GA 3ICQB 3KXLA 4GSYA 1Z0JA 4MRPA 1A7JA 5BN5A 4IVRA 2QG6A 4RJLA 4OJKA 2R6FA 4MDFA 3HP1A 4PX9A 3QBTA 1Z6YA 2XZLA 1C1YA 3FDIA 4U00A 3X1ZA 5EE3A 2JLZA 1XPRA 2G0TA 3KFXA 4AYXA 4HDQB 5FPSA 1PVOA 1W36B 2XSZA 5G3ZA 1GG2A 5JWRA 1T91A 1VIAA 4IXMA 4BFSA 1E2MA 3X1DA 2X77A 3EIHA 1WRBA 4KBGA 3QOFA 1ZJ6A 2ZRAA 4MQBA 1W44A 5BN4A 1Z08A 2MSEB 4ILEA 4TMVA 1IXZA 3IHLA 3GLHE 821PA 2Q6TA 3KKNA 4B47A 2C2HA 4G5QA 1KNXA 1ZINA 2ONKA 2KWIA 1LF5A 3B2EA 4B3CA 3IDQA 1E2GA 4E5UA 1RIFA 3LBNA 4Q02A 1GIAA 1EK0A 2Z43A 2PMDA 3BFKA 1MABB 3F3YA 3WHKA 3ADDA 4S35A 3R7WA 1VHLA 2O8DA 4ESVA 2VSXA 3CR7A 4UNSA 1Z6TA 2PZFA 3BERA 1BS1A 2FWRA 2ZJ8A 1ZNZA 4V0KA 2CVFA 4NMMA 4OK6A 1OYWA 1VKJA 2XZOA 2G77B 2VP0A 3P32A 3UXMA 3WBKA 2JASA 3FE2A 2P5TB 5FBLB 1X1SA 4R71A 1XTSA 2GAAA 1XX6A 2JIZD 4LGMA 4P31A 4PPFA 3SJAA 1FQKA 4A82A 2IYYA 4TSFA 2PLFA 1OH7A 4CEHB 1FQJA 3CPHA 1R8QA 1UKZA 3B1WA 2WIAA 5DHFA 5ANRB 1CR0A 1YVDA 3I3SR 3QKRB 4BFUA 3MWKA 3OEHA 4BRUA 1NMZA 3EG5A 2KI5A 2O8EB 4D0NA 3R9XA 1Z29A 5B30A 3VU9B 1MO5A 2QT1A 1P2UA 4YLGA 1EXMA 3PEUA 3MWJA 2JJ1D 2GBLA 3H4MA 1ESMA 5GJCA 3HWSA 1E9DA 3MUFA 4LJ4A 3CX7A 4NP6A 1DADA 2ZRJA 3FMPB 4Q18A 2A5GA 2OV2A 4PAQA 1GKYA 4IEEA 4TTRA 4MH0R 4KI0A 3LWNA 2J7PD 5E7JA 3VNUA 2R6GA 3F5FA 5H70A 3S1AB 1ZVQA 2D7CA 1E9CA 2R9VA 3THXA 4XWOA 1SVSA 1VG1A 3PCRB 3FGNA 1Q20A 2DCUA 3NKVA 3ZVNA 2WWFA 1BKDR 1N0WA 3D31A 4IOJA 2WMNB 1IN7A 4CEIB 5FUXA 2F1HA 2CXXA 1Z2CA 1GNRA 3ZD7A 1BMFA 4Q4JA 2HUPA 2FEMA 4LV6A 2IYRA 4ZCMA 4WAUA 4LZZA 4A2PA 4ZIRA 2REOA 1VIYA 5SZKB 1R4AA 4DDWA 4LBWA 4F4IA 3K9LA 1E2JA 2XB2A 3TW8B 4DKXA 4A0FA 2IWHA 1IAQA 1XD2A 2A3RA 4OK5A 4JLVA 2FGJA 3QG1A 4XVQA 1Z0FA 4LCBA 4PSVA 3QEJA 3QF4A 3E5HA 5TDHA 5K8UA 2CE2X 2OFWA 3LD9A 1W5SA 1D2NA 1IY2A 5B2ZA 3AQ4A 4DLZA 1TPZA 4KXFB 1U0HC 2J7KA 4RFSB 2ZXUA 2OCYC 1H65A 2Q9AA 2C9CA 2QMOA 1N6IA 3PR1A 4C0KA 4Q00A 2GESA 2WWGA 5FTJA 2BBWA 3ZIAA 3HDTA 3Q72A 2ATVA 1NNEA 2JA1A 4LJ6A 4WZAE 2B7CA 3JVVA 4NTZA 3NEYA 3SOPA 4JBYA 2QGZA 2IYSA 1Q57A 2QTHA 5H1YA 2WKPA 1KY3A 3VR4A 1YR9A 4TTQA 2XXAA 1NKSA 5FBRB 2P0EA 4DBLC 3MG9A 1E0JA 4UNRA 4NCIA 1FTNA 3Q3JB 4V0ME 5DISB 4QHSA 3VX3A 2A5YB 5KNCA 4EIWA 1OV4A 3K9HA 2HCJB 2ZAOA 4R9UC 3SR0A 3O47A 1Z83A 3ZDQA 3AKDA 1DO2A 2QNRA 2FPLA 1TQ2A 1T0HB 4Q48A 1HUQA 1XFAA 3CRMA 1N5IA 5KNDA 2BC9A 5EXPA 5H8WA 3D3QA 2Q3MA 4JSTA 1CBUA 2IYVA 3JVUA 4QJ5A 4A8JB 3OFNA 4A4DA 3QY0A 5LBIA 2F3RA 3BS4A 5EP1A 3MAAC 4TT3D 1QHHA 1BYUA 3FHOA 2ERYA 2OAQ1 2VP2A 1KIMA 1IHUA 2OEPA 1UADA 2FSHA 5HR5A 1DEKA 2YJTD 5A4JA 4H1VA 4LYJA 1E1QA 4HUQA 4V03A 1TU4A 3W5IA 2ERXA 2DWPA 3SJBA 2QU8A 2WPDD 2H57A 4Q1CA 5DYIA 1G4AE 3IUYA 3SNHA 5ELXA 2YNMA 5FOTA 3CRQA 1U98A 2BMDA 3KTAB 1NP6A 3V4RA 3O8RA 3A1UA 1BH2A 1Z3IX 4II7A 2NTYC 3TGPA 4D4KA 2X2FA 1X8JA 2ZRMA 4GOKA 3FFBA 2CK3A 4MKGA 3KJIA 4CF7A 1LB1B 5IF9A 3OESA 3GD7A 2CHVA 3TAHA 4HAZA 2WKQA 1UPTA 4C0LA 3T12A 4WOPA 1GILA 1KDRA 4K8OA 4BLTA 1I2DA 3GFTA 3FTQA 3BWDD 4WW0A 2QAJA 5BYKA 1PUIA 3BJIC 2DFKB 3K8YA 3UWKA 2AXPA 2VF7A 2EFHB 2RAPA 2GKSA 1F2TA 3QXJA 4TL6A 2WVJA 4HB4A 3OZXA 4PPNA 2HXYA 5K8TA 1KI2A 2VSFA 4HEJA 2VP6A 5B64A 2IYWA 221PA 4Q21A 3K0EA 2CL0X 3OIWA 1K6MA 1QG4A 5UKDA 3VX4A 4DUGD 1NSFA 4MYUA 3NC0C 2OBLA 2QAGA 2OZEA 2J45A 3GJ7A 4URWR 3RNLA 1KJZA 4UXIA 4Z8YA 1D9ZA 2VF8A 1OJLA 5EZ6B 1W0JA 4Q9JA 1L2TA 1DG3A 4PHHA 3RS3A 1CRPA 1U94A 3Q7PA 2XEXA 2HCBA 4BE7B 2C5LA 1CU1A 4JL8A 2TMKA 4IXNA 2FFBA 1KI6A 1NBMD 2JDIA 3AKYA 4W5JA 2AN9A 2PEZA 2BBSA 4MYHA 5IK2D 3CRW1 4I1VA 4L16A 1KZ7B 4QGAA 4QBGB 5D3QA 4V02A 3TBKA 4DLSA 3FYHA 1XMJA 3BOSA 1KMHA 3RS2A 2OT3B 1P62B 4LHZA 4PO8A 2ZE5A 2XITA 4G5SA 4GMDA 4U5XA 1E2KA 2EFDB 4K81B 3GCGA 2QZ4A 2PJRA 1JPJA 4LHXA 3AH8A 4M22A 2ORWA 4Q7MB 5L3VA 3WRXC 1Z63A 2OM2A 2F1JA 2C77A 2GXQA 3DPUA 1GUAA 4KITB 4O3MA 1XTRA 2KB0A 4TYPA 1YKSA 3THYB 2O0JA 3I73A 4M0LA 2H92A 4G01B 4DC9A 3N70A 4YXWD 2QE7A 1P73A 1V43A 3C7KA 1JXOA 1OSNA 4OHZA 2YC2C 2O5VA 2ZSDA 2BOVA 4IDOA 4XWAA 4DCVA 1OW3B 1XF9A 4QG7A 3ZJYA 1HV8A 2LKDA 2YYZA 4LC1A 2X19A 2BKUA 2EFEB 1L4UA 4DT1B 3B1YA 2AHOA 1RJ9B 3VAAA 3QXSA 1LFDB 3Q8XB 3FWYA 1NF3A 1OHHA 3E1SA 4HB2A 4R7ZA 3B13B 1XU4A 2DFLA 5FTLA 1IY0A 4XSHA 4MGYR 1E2EA 4NYJR 1AA9A 2V4ZA 2VL7A 4RCYA 3OEED 3RRMA 1IBRA 1Q1QA 2QT0A 2EYUA 4YMVA 1UFQA 2OG2A 3B7GA 4YMSA 1G3RA 3DKVA 4XD7A 3W5JA 2JJ1A 1E1RD 2ANCA 3A4MA 3I72A 1OIWA 2B8WA 4HLCA 4L5BA 2QI9C 3L8ZA 1YRAA 3MRSA 1G41A 1SHZA 5CIQA 1MR3F 5JJKA 2BJVA 4DDUA 4EAQA 5SZJA 1ZNYA 2HDNB 4US1R 1G4UR 4URYR 3C5HA 3MMPA 4NBSA 4A15A 3LVRE 2ZI6A 4AURA 3FKSA 3WP1B 4HDCA 3RS0A 2RGAA 4RD1A 4NONA 3T35A 1SULA 2AD1A 5CIWA 6Q21A 1G1MA 1E94E 3AF3A 1ZD9A 2F55A 2GZAA 721PA 1OF1A 4URXR 4URZR 1RFLA 3RRNA 3LNCA 4JLMA 3PVSA 1U90A 3KFVA 3BGWA 2ZETA 1E79A 3W3ZB 2C9YA 5JCPA 2EVWX 2FV8A 1P75A 2QGNA 4FMDF 1LVGA 4M1MA 3WP0A 3QUSA 2QPTA 3D8BA 1T9HA 1Q1EA 1YRBA 4TL7A 5AJZA 4NDZA 3VTKA 5JI2E 1YR8A 3R7WB 2O8DB 1XD9A 2CNWD 1KI7A 3T5DA 3ZZTA 3SJZA 5JFGA 4QGGA 1M1YE 1KK2A 1LW7A 1I4DD 3QXCA 2WAYA 2WWXA 1S2MA 4M9QA 1N2CE 1EG7A 1UBEA 2GJAA 2CLDX 5E4FA 1JR3D 4FN5A 3P27A 1P4SA 5FUWA 5G3YA 3DOEA 3U3RA 5CK5A 4NCHA 3ZVMA 2ZTSA 2I1QA 1GP2A 4V0LA 3WMGA 4CT5A 1Q0UA 2PCJA 1HE1C 2PCLA 3A36A 4QRHA 1KI8A 3THOA 3UPUA 5FL3A 2QSZA 4IJMA 4G1UC 3L43A 5J40A 4FWTA 5FOSA 1GRQA 4OHYA 5IDVA 2CVHA 1UEJA 3T5GA 4BEBA 4QC2A 1COWD 2C96A 2PX3A 3RC8A 2OCBA 3MSXA 2VHUA 4RKFA 4ZDKA 2FFAA 3QENA 2G0NA 2Z4SA 2B8TA 5JJIA 3BRWD 1F60A 1AS0A 5F3WB 1US8A 3BFVA 3EAQA 1N25A 4Z1MA 2ZRNA 1FUKA 3IPYA 3THXB 1T6NA 1H8EA 3ZQ6A 3MGCA 3U3KA 4P0TA 1OH8A 3EZ2A 1WP9A 1W4CA 4GOJA 4WA7A 5AJVB 4LV8B 5FI0B 2W6JA 4TQAA 2IA5A 4XIGS 2WWYA 4TT3A 1HH4A 5C2JB 4C2UA 2AR7A 4Q4JB 2HYIC 2QA5A 4LUCA 3CWQA 4A6PA 4BLPA 2PH1A 1IN4A 4MKIA 1OLOA 1W48A 4ZIRB 1VYUA 4G5GA 3P4YA 3CX6A 5FL7A 3AVQA 2GA8A 4PAMA 3X1WA 1YZGA 1XD2B 4HYYA 1VCNA 4TMXA 4AKHA 5CLLA 4BZQA 3KTAA 3EZFA 3PV0A 3EW9A 4R2HA 3QF4B 5EE9A 3LBIA 3BIFA 2ZI9A 2NPIA 4PPGA 2F9LA 1QHYA 3UG6A 3K0FA 3I5YA 1Z2AA 3A6PC 4MGZR 2CJWA 2YOFA 4DLUA 4LJ7A 1WF3A 2CL6X 3WMFA 1YE8A 2FFHA 3A58B 3CPJB 3QKTA 2G3YA 2A5DA 2AKAB 1HY3A 1ZM3A 3NH6A 2P6RA 4HAXA 3TR5A 2O0KA 2IC5A 2QP3A 3V4FA 1ZCAA 3NH9A 5CDFE 2O52A 3MCAA 1CJVC 5DGXA 2XXAB 3TLXA 3EPJA 4PXAA 2QMEA 4IVQA 4TMKA 4Q9LA 4XVRA 5AK0A 4ZV4A 4NU0A 3TUIC 4HLQB 1AGRA 4JLAA 3A4LA 4JZKA 4JL6A 4W7SA 2FGKA 2HJVA 4BRWA 3TQCA 1OKKA 3AVPA 2JLVA 1GFIA 4G0NA 1X8LA 5TARA 5DI9A 1T5IA 2GRJA 1RZ3A 3CIOA 1XP8A 3SYKA 3TUJC 1XCPA 1R6BX 1NIPA 2RHDA 1GWNA 1II8A 3KDSE 1X86B 4JL5A 1OH5A 5JZVA 1QHSA 5FOUA 2XTZA 2IYTA 4RFVA 1QHHB 1SZPA 3JZAA 4PC2A 5FBQB 4AYTA 3FMIA 4EFLA 3ADBA 2GCOA 3RS5A 2J41A 4PPQA 2G9NA 1H8HA 3GQBA 1KO4A 3UIEA 1F48A 2J0UA 3HR8A 5C46F 5A0FA 5JRZA 4HUQB 2D4HA 1HA3A 2IBMA 3RRYA 2WJVA 1TQ4A 5EUQB 2DY1A 3QE0A 2V8OA 1YZUA 2BVNA 4LY6A 4WBSA 1E2NA 4OKSA 2GK6A 1IY1A 2JAQA 3I92A 2WBLC 1MV5A 4HAUA 1EGAA 4PC3A 1R0YA 2YWFA 4QJ4A 2WJGA 1XTIA 4TWZA 4UQOA 2GCNA 1T5LA 3KL4A 2FH5B 3T1TA 4JLBA 2JLUA 3CR8A 1KO8A 1EX7A 5LB4A 3C16C 4GDFA 3Q85A 2FSFA 3W90A 3GJXC 4QHYA 2ZANA 3I4LA 3Q5EA 2QL6A 3KXIA 3K70D 1P9WA 4JBXA 2KJQA 4HLDA 2YWEA 1CJKC 5TB5A 3A1TA 4Z51A 2VP4A 1ZD1A 3K1JA 3OIUA 1M7HA 4JKIA 4MYTA 2F7SA 3UMRA 5JS8A 3LXXA 2D7DA 2QAGB 1JQLB 1U9IC 2IWRA 2F6RA 4FXPA 3TK1A 1OXTA 3H2YA 2XNDD 3IIMA 3BORA 3D6TB 3HPRA 1R2QA 3IBYA 3PENA 3K9GA 4LRWA 4PHTA 1HT1E 1XBTA 4BZXA 1T3HA 3AB3A 4CW7A 2ZR7A 3SFZA 2W6IA 1E9EA 2VLIA 2ZRHA 1KI6B 3IQXA 4GFDA 2P3SA 4IDPA 1W36C 4KSCA 3MD0A 2YVUA 3L0PA 4NYJQ 1XXHA 1X1RA 3LLMA 1G21E 4MKFA 2RGGA 4TMTA 1HYQA 1E2LA 5EZ5A 4AI6A 4OQLA 2WTUA 1KMHB 4G3XA 3K0AA 5JLJA 1NY6A 4HAWA 2X8AA 4LJAA 3SYLA 5BWMA 1DO0A 1NJGA 2IT1A 2P65A 2FNAA 2IYLD 2QP9X 3M4YA 5JEDA 1D6JA 2F9MA 5DLQC 3QNUA 1UDWA 3U7FB 2GK7A 2W2VA 2DR3A 3IILA 3U2QA 1I2MA 5GADl 4JBWA 2IEZA 3B60A 3DVLA 1AKYA 3TSZA 1SVWA 2SHKA 2CLCX 4DB4A 4FW9A 5DSZA 1DAIA 1KJWA 1ZUNB 2P6NA 2IEYA 3ZVRA 3KUDA 1Z28A 1W36D 1B23P 1Y63A 4D4MA 2KBEA 1UF9A 4Z54A 3OE7A 2IYXA 1CTQA 3RSOA 1HQYE 3L0SA 2V6IA 4EPRA 4EPTA 5KSZA 2CNWA 2V54A 1NSTA 4A36A 1ZNXA 2HJGA 5EE0A 4GL2A 2JATA 5FPHA 1OH6A 1UBFA 3T06B 3W6NA 2WOJA 2HT1A 4DRZA 2WJJA 4LOAA 3EASA 4KFSA 1M34E 5L8VA 3ASZA 2RCNA 4IEIA 1GITA 3U44A 1RE0A 1LF0A 3W34A 4DWJA 2EYQA 3T1VA 1QHGA 1AS3A 1G3IA 3PUYA 2AXNA 2VIIA 1KK3A 2IK8A 2DHRA 2Q3HA 1W2GA 1W46A 2ATXA 4KVAA 1N3BA 1E69A 1EWQA 1NG1A 1W2HA 1T4GA 3GFPA 2WSMA 1OXVA 1S1MA 1COWA 1FMJA 1UKEA 4AK9A 1IOZA 2VRWA 4YMWA 2GZDA 3SBDA 1ZC4A 1CR1A 4MKHA 1U8AA 5L3SA 1OFIA 2RH5A 2Q21A 4M1SA 5JSZA 3VHLB 4AKGA 4WXRA 3ONWA 4DLWA 1RYFA 1EFTA 5M04A 3AP2A 1XMIA 3EWAA 1AM4D 1Z0AA 4M8NE 1HT2E 2YWHA 3G0HA 3E70C 1NVUQ 1NL3A 2NO1A 2ZRCA 4JMPA 1NIJA 1CXZA 2PL3A 5GJWC 3PXGA 4D4JA 5JEEA 1MKYA 2BBTA 2VQSA 2VA8A 3RSLA 5C4MA 1BYIA 1PUJA 2VP5A 1KYIA 3AKEA 1NJFA 1CJMA 3CF0A 4BEJA 3AF2A 3PITA 3W6OA 2G1KA 5L3RA 2HLDA 4LK2A 4DCNA 1ZU4A 2AFIE 2OBMA 1PLKA 3DMNA 1Q21A 4KODA 3WNDA 4DVGA 4PHFA 4JLNA 3L2OB 4TL9A 3GJ4A 3EZ7A 2PEYA 4B3BA 3BC1A 4B6FA 3ICEA 2ZR0A 1QHXA 5DN6D 2ZVQX 1XEWY 3WY9A 5KDDA 2QRZA 1T3LA 3QI2A 4POAA 4IOLA 1A4RA 2CCGA 5AJXA 5FTMA 4AG6A 2ODNA 1DBSA 4D25A 2IXFA 3VR6A 2R6CA 4JSYA 5HCIA 3EA5A 1G291 5KUTA 2ZRPA 1A2BA 2O0HA 1EX6A 2ZSFA 2PJZA 2QQEA 4KO8A 5C1BA 3GLIA 4Q4HA 1E9SA 1AGPA 2GHIA 1FMLA 4IW3B 2C99A 4HAVA 3ZZUA 2AX4A 4GMXA 4BPBA 2J59A 2ZS8A 4MYCA 1P5ZB 5AUPB 3LX5A 1C4OA 2Q3FA 3QQ5A 3R20A 2RGEA 1R10A 2ZQ5A 2Y8EA 2NO7A 121PA 1US8B 5L3QA 1M8PA 1TEXA 4PQRA 2BEJA 2AK2A 2WOOA 2FZLA 3OAAA 3WYAA 1FZQA 3DL0A 3TR0A 1UBCA 3LLUA 1S9HA 3H86A 1IN5A 3RAPR 3SI7A 2GXAA 1JBKA 3DZ8A 1VG9B 3ADKA 4MRSA 2IS2A 5P21A 4B74A 2UZIR 5KHOC 4JT4A 1K5DA 3B8HA 3VR1A 2QENA 3PUXA 1G8PA 4GI7A 2RGNC 4M1YA 4Q1DA 4R98A 1JR6A 2ZJOA 2ZRIA 2LKCA 4PHGA 3W8RA 4LJ5A 3I5XA 2YOHA 2GAOA 3SE0A 1LNZA 3KX2A 4BLSA 1OFUX 2IX3A 3ND8A 4ZDJA 3AF1A 2ZYUX 1VG0B 1YR6A 1E6CA 1G7TA 4ZDIA 3B1VA 1OXXK 2BBOA 2NO0A 2WAXA 2X2EA 3K0FB 1DOAA 1SXJA 521PA 2ZYTX 2CJWB 4OJQA 4B34A 2VP9A 2KE5A 3EWSA 5GJVC 1FTSA 1E0AA 1I4TD 2PZEA 2WSSD 1P2TA 2V6JA 3RWMB 4BFVA 1G3QA 2REBA 2W83A 2WJHA 4WIAA 5JHHB 2G83A 4MDEA 3EPLA 4NE2A 2AKYA 5CM8B 4EPYA 2IUTA 3UMSA 2JJ2D 2C04A 2ZREA 4KLZA 4LBVA 3AF0A 1KK0A 5BN3A 4L9SA 4Q1FA 2BDTA 2WICA 5IHPA 3NWJA 3RVBA 5DNYB 1OXUA 4H1UA 1ZCBA 2RB4A 2VHCA 3Q5DA 3UMFA 2IYZA 3FVQA 2ZVPX 3KUCA 4EUNA 4C0SA 2XTNA 4MITA 2G88A 4B2IA 3OF5A 1JEEA 4KLNA 4FMCF 5FBWB 3PEYA 4BASA 1D2EA 2V55B 3U6BA 1GL9B 1TNDA 4AG5A 1S3SA 1KK1A 4RD2A 1MO3A 1Z6XA 2XNDA 5FTKA 3BBPA 1SKYB 2ZSAA 5F98A 2ZSBA 2V7QA 1OIVA 3NC1C 1II8B 5AUNB 5J5CA 3TUZC 4C0JA 1Q1BA 4JVNA 1RYHA 2H5EA 1AZTA 5JWHA 4YQFA 2Z0MA 3K9NA 3TAUA 2GCOB 3CKLA 5F2EA 1CRQA 2J0UB 4PTLA 1T8TA 4A2QA 4BLQA 1TF7A 2P5SA 3LV8A 2XTMA 1G8YA 1ZYUA 1E2QA 2C03A 3ZS9A 5KO2A 4PSAA 2WJIA 1TX4B 1W0KD 1NVVR 1JNYA 2HXSA 2LCFA 2XZPA 1CJUC 3DM9B 4PC1A 1G5RA 3TSWA 2QM8A 2C98A 2GXSA 4DIDA 4HB3A 3ZVLA 2ORIA 1R5BA 4OQFA 5FPTA 4BLOA 1CULC 2R6AA 4ZPXA 2FN4A 2QN6A 4M1WA 4QOSA 1Y3AA 2NZ8A 1CS4C 2ZYVX 4RZUA 1N6OA 4QXAA 5CYOA 2QY9A 4TQ9A 1PJRA 3PQCA 3C41J 4JT2A 4BFZA 5CB6A 3SC3A 4US0R 1NVWQ 4RD0A 2DYKA 3NBXX 1W7AA 3F8TA 5KSYA 3HPQA 5K8IA 3FOZA 3AP3A 4NYMR 1GOTA 4M9ZA 4RCZA 5TMPA 3QVUA 1U2RA 5KPJA 1TQ6A 1CKEA 1N6KA 1DARA 2VYFA 4TLEA 5KDOA 4FMDB 1DAGA 2IHYA 3DO6A 2FG5A 4CVNA 4A2WA 5JECA 4JLJA 4LJYA 4MRNA 4UJ5A 2JIZA 3NBZC 3FB4A 1KOFA 1KAGA 3ZYCA 2QTFA 2W2TA 2BM0A 4A92A 2BWJA 3SN6A 4H9GA 1G7RA 1KKMA 4C9BA 3T15A 1J99A 1U0LA 3CF6R 2IUSA 4NPHA 1KO7A 1T0JB 2Z4RA 4JVSB 2NZJA 4KVGA 4JLKA 5DI3A 1G8HA 2FF7A 2ZJ2A 3VHXA 2A2ZA 5FTNA 3CWZA 1Z47A 2YINC 2DPXA 3LXRA 3VKGA 1EFHA 1G9XA 3QKSA 2Z83A 5EXXA 1OB5A 1XXHB 3UKDA 4X8OA 1RC8A 3KQHA 3A4NA 4EPXA 5EE1A 2J7PA 2EFCB 3K0AB 3ASYA 4QL3A 1XRJA 4LC0A 3PJRA 3UG7A 3LO5A 4PZYA 3TW4A 2FSGA 3BH7A 1KGDA 1JB1A 4Y0AA 2E1RA 5KYKA 1E4YA 4PSKA 1WA5A 2GWHA 4IFBA 4D82A 5FPKA 3IQWA 4IDQA 2NO6A 2IW3A 1W4RA 1KAOA 2XGJA 5EQTA 1RVDA 2IF0A 4L15A 4B71A 4E07A 2VBCA 2ZE8A 2BIFA 1Z6AA 1E0KA 1AQUA 5J4KA 3K53A 3G5UA 4W5HA 1CR2A 4LBYA 1DAHA 5D3MA 4ABYA 4CIDA 2MMCA 4TMWA 1HTWA 1CF4A 2P2LA 4L4UA 2OAP1 4IRUB 1XTKA 3G82C 2ZU6A 4FD2A 2ZRLA 2OHFA 4P4UA 1U0JA 2A9KA 3GLGA 621PA 4K46A 4B35A 4GZLA 1D9XA 3J81k 2QUZA 3LY5A 4UXHA 4GNKA 1J8YF 4O2RA 4A0RA 3LDAA 3U44B 2XJ4A 1QBKC 5E7IA 5JMTA 4TLDA 3DDCA 4DXAA 4CDGA 3DM5A 3QPWA 1GNQA 4D2IA 4AKEA 4DLTA 5CB8A 2VSOA 1DE0A 4JLPA 4Q9HA 1TEVA 4KJZA 1HQCA 2EWWA 2ZROA 1XD8A 4AD8A 1XTQA 2WWHA 1FFHA 4EQ6A 4F4CA 1HURA 1W5TA 2CBZA 2NG1A 4TSFD 4Z8XA 1FL9A 2XOKD 3K0CC 1G7SA 3MWLA 2D74A 2IF2A 1S9DA 3REFA 5IT5A 2GEDA 1Z07A 1ZP6A 3CRVA 4KCGA 3VQTA 5L3SB 3B78A 1SKYE 2ZRGA 1P9RA 1E9RA 2VTKA 3I8SA 2ZU0C 5JSZB 4DB2A 4P4SA 2BMJA 2IYUA 2R65A 3TKLA 3SQXA 1GRRA 5FFMA 1IXRC 4HZIA 4JLDA 5KSOA 4CZ2A 4OHVA 4DCTA 2RGCA 3U3OA 1NG9A 4Q7JB 1SVIA 3VFDA 2GJKA 5KDLA 1R5NA 2FPKA 4B3FX 1KI1A 4GBMA 2V3CC 4HDOB 3ZS8A 4LPKA 2YC4C 4QFMA 3BE4A 4PQYA 2GVZC 3F0TA 4XTRA 3C14C 1MOZA 3NTUA 3GLFA 2R2AA 3BH0A 4Q7KA 1E0SA 2WPDA 4MUBA 3GPLA 3ECCA 3ZGXA 1VDZA 2BMFA 3CH4B 1M7BA 1JAHA 1MRSA 1YZLA 5FOVA 1RRCA 4ZCLA 3U5ZB 4DLRA 4N0EA 1JQJC 3B9PA 3DMDA 4TLCA 1BMFD 1ESNA 4RD4A 4ACBA 2P6UA 1IM2A 2C95A 1FPMA 1VECA 1YZNA 2CHQA 1JJ7A 3DZDA 3AM1A 2B21A 1FNNA 2EQBA 2BM1A 3EA0A 4KYIB 1WBDA 3O8DA 2WSSA 3T34A 2GJ9A 1E9AA 5JI3E 5E3HA 4UNQA 4O2LA 1DAMA 2IS1A 1AK2A 2RGNA 1W4AA 4IDHA 1S3GA 3GJ3A 3TVDA 1Z8FA 3AV0B 4Q4HB 4B2PA 3SHFA 5A5GA 2JJ2A 3GLIB 2H8KA 4HATA 1JAIA 4I99A 1A82A 2ZSEA 1OFTA 4HZUA 4DJTA 2KSQA 5DYGA 3BB3A 2ZI7A 2ODWA 3CBQA 4Q19A 4DDVA 3T1QA 1YQTA 2ZE7A 1A1VA 3W9YA 2O8FA 4DUGA 2WJYA 3QXXA 5L3QB 1RKBA 3QJYA 5HTKA 2B92A 3AVTA 4Q7LA 1NRJB 2QQ0A 5TVKA 3PUVA 5CITA 1YZKA 2OSBA 3TJZA 4C30A 1SKQA 1E99A 4YMTA 3WMEA 3BFXA 3P20A 4QJ3A 3U60B 1MO6A 2AL7A 4LJ9A 4TTPA 1L4YA 1XXHE 4YDHB 2I1VB 1KI9A 4QBIA 3U4QA 1NBMA 1XNJA 4LJ8A 3FPAA 4RZ3A 2GDJA 4P32A 5LD2B 1Z06A 5IK2A 5KSPA 3HR7A 3T1OA 2PZGA 3RS4A 5HE8A 1CIPA 1JALA 1R0XA 4LV5B 2FE4A 3CNOA 4FI3C 2D62A 3N5CA 3K70C 2UKDA 4BQSA 3H0KA 3VKWA 3VKHA 4ESHA 1GM5A 1W0KA 2IS6A 1KO5A 3OFND 5DIFA 3SDZA 3SS8A 4N1AA 2ECKA 1KSJA 2DBYA 4ON9A 5LPNA 4V0NA 3X1YA 4TN1A 1KHTA 4PR0A 4HUTA 2PLRA 1SXJB 3NG1A 4Q1BA 4L8GA 1Z5ZA 4Q4AA 1E1QD 2J0SA 1R0WA 1XEFA 2OE2A 2REXB 4O0MA 1N6NA 1NVVQ 3AP1A 4M9XA 5CK4A 4D81A 4TZ0A 2Q9CA 3SBEA 4Q4LA 4FMBB 4LSGA 3GFOA 2AK3A 3U6KA 1VCIA 4YXWA 1O3YA 2ZM5A 3MWYW 3Q7QA 3L0IB 4KHZA 4MA4A 5FR2A 3SJCA 5LDDC 3M6AA 4DLVA 4TYYA 2RGXA 1W49A 1XZQA 2CK3D 5J4HA 1G5TA 4IKEA 5DE3A 2QAGC 1KSGA 5BW8A 2J1LA 2PBRA 5GVRA 1I4LD 1FX0A 2XJ9A 2CHGA 3EZ9A 3SU8A 1KKLA 3ZQJA 4CT4B 3IPXA 4QHTA 4NYMQ 1XJCA 4BFXA 2NO9A 4S2EA 1LS1A 5CJPA 2D3WA 3B82A 1TUEA 5G41A 3T61A 1AQYA 3LX8A 3WBJA 4EJSC 2AWOA 5EP2A 1ZW6A 1ZUIA 3IEVA 1GVNB 3L8YA 3CRRA 2C8VA 3UATA 4YDSA 1AJEA 3I62A 2VPPA 3AF4A 4I1OA 4QNMA 3OEEA 2B7BA 4RZ2A 1GTVA 2IYQA 4WZ6A 4O25A 2QORA 2WV9A 1NMXA 4IVPA 1II9A 1NI3A 1JI0A 1XJ0A 4OI1A 4ASUD 5EJEA 4ZI3A 3TVTA 5FOWA 4BZPA 1IONA 2WHXA 5GVSA 4A9AA 1E1RA 2OO7A 3GJ8A 4KFRA 3AGPA 4PFSA 5KNBA 4ARZA 4DSOA 2ZRBA 2GEUA 5KU1A 2ZJBA 4GZMA 3RWOA 1LY1A 1KTVA 2H16A 4UKDA 1SGWA 1W0JD 3B5JA 4DCSA 3B85A 3CLVA 4AKIA 2F1RA 3UANA 1X6VA 1CLUA 3SZRA 2JDID 2ZE6A 2OCAA 4M21A 5EP4A 1UKYA 1N6PA 3EZ6A 3BB1A 1UDXA 4KSBA 4A0GA 1G64A 4B33A 2A30A 3IIKA 3FHTA 1KNQA 2H7VA 1J7KA 4M1TA 2AFHE 3WYFA 1MH1A 4D0LB 5SZIA 3MJRA 4LPSA 2GF9A 3FMFA 1W47A 4B73A 3DEFA 1TUIA 1VHTA 3HU3A 2OUKA 3VR2A 5GJBA 1JXMA 3QG5A 2GNOA 3TSOA 3R8FA 1TMKA 1ZIPA 1ZM4A 3QKUA 1NLZA 1E2PA 1XEXA 2NIPA 5IRCD 3GEIA 4KYUA 1P60A 1SVMA 2QE7D 8OHMA 1JR3A 2D06A 4XJXA 1EFUA 3CZQA 4MRRA 2JCSA 1XCGB 2FMXA 4QNRA 4B32A 5HKKD 3GLIE 3MLEA 3K0SA 2WWWA 3AEZA 1LTQA 4OI4A 1DAFA 1DG1G 2ZI4A 3LBHA 2C9OA 2YKGA 3KQNA 4HLUC 5DI3B 2HYDA 2A7QA 3AKCA 2OILA 2ZS9A 4YONB 5KTYA 3U3MA 3QKSB 1OHHD 2CCJA 2XOKA 4EPVA 1P2SA 1XPUA 5FPYA 3GJ5A 1GL7A 1HE8B 4LBZA 5AUQA 2WM9B 4MGKR 3QEOA 3ZH9B 4DEXA 3R9IA 4NL4H 4RVCA 1Q3TA 4J0QA 3RHFA 1XJQA 2FDCA 4FCTA 1ETUA 1SQ5A 3CF2A 3HJNA 4URUR 5TXGA 1NKTA 1K8RA 2YOGA 1GKIA 1VYTA 4X8LA 1PLLA 4QBFA 3C8UA 4XD7D 1LS6A 1NN0A 3IIJA 3N2IA 5C4GB 3NEJA 5B58C 3NHAA 2IUUA 3VR5A 4HAYA 5AWFC 1ZC3A 4ZI2A 2GZHA 3TE6A 3LW7A 1UEIA 2OESA 3W6PA 1G17A 3O8CA 1Q12A 1N5JA 3FKSD 3K0CA 1XMVA 3BH6A 5D3MB 1BIFA 4Q5IA 2QMUA 4ZCIA 5HCNA 1UM8A 2RMKA 4F91B 3R8CA 3HYRA 3O8BA 3PEWA 4WXPA 3RC3A 3TMKA 2QBYA 2ZRDA 4C2TA 4XOIA 1KDPA 1SXJE 1VCOA 2FPMA 1R5OA 5FI1B 4X8MA 4ACAA 2V1XA 4DSNA 2DWQA 2W00A 4NH0A 3WNCA 1E79D 1DAEA 3HU1A 3JZMA 3RDPA 3GLGB 1TL7C 2H18A 1CJTC 4M2LA 2ZI3A 3GLHA 1FNMA 4W5WA 2IXGA 3KJHA 3OHMA 5JCZA 1G3MA 3QSYA 3FHCB 1G8GA 3U7HB 3SHWA 3Q9LA 2BHRA 1TF5A 2J46A 4F38A 1E96A 1J8MF 1J2JA 4GT1A 5JHGB 2GJ8A 2OLJA 3LVQE 4NYIR 3AVVA 5J4YA 1GNPA 1KMQA 2N46A 3QPUA 2OCPA 3MJHA 3NDBB 3C4JA 4EQ6B 5EP3A 3I1FA 3KQLA 1G8FA 3RYTC 4A1FA 2NMVA 1ZD8A 4CGZA 4C4PA 4B76A 3IO3A 3MFYA 3RANA 4ITRC 2I4IA 4A8JC 1XZPA 4C0BA 1QHNA 3QPVA 3W8NA 2ZRFA 5G53C 1MT0A 5J4LA 1UJ2A 1OPXA 2QTVB 4P4SB 4B43A 1PV4A 2UVQA 2FOLA 3K09C 3REGA 2F3TA 1UAAA 2XX3A 3A37A 4CEJA 2F43A 4M1KA 2CLSA 1DVRA 4WZBE 4TMZA 3LW8A 4FMCB 2OFXA 3LAWA 5HZHA 1NLYA 2RGBA 2XAUA 1EESA 4RY2A 3NDPA 4OYHA 5FBVB 3VNVA 4C7OA 4URVR 1Q1ZA 3TQFA 1FP6A 3BK7A 3H84A 4KFUA 4Z1MD 4ZDWA 2MMGA 3GLFB 5CYPA 1H8ED 4D80A 1AN0A 1LV7A 5CJ2A
chains in the Genus database with same CATH superfamily
1BJKA 4ID3A 1KSFX 4CLDA 4HX5A 4NU6A 4ZANA 3VJKA 2VKQA 3F8WA 1QP4A 1P1RA 1XHFA 4Q7QA 2IXEA 4MS4B 2I9KA 4XCVA 3RAJA 3TL6A 1MQ8B 4MTOA 2V7QG 4JQYA 4JJ7A 4MIOA 2MYUA 2EP5A 5J59A 1B0UA 1VPLA 4DAOA 3UWPA 1FZTA 2J9RA 1CQIB 3MJ4A 1WW3A 1UPBA 1VI6A 4BMZA 3RC7A 5H80A 1QIKA 2P2SA 1RAAA 2NUPA 4UAGA 3LY7A 1G38A 1RJGA 2ZIVB 1JKJB 3M6MD 2NN3C 2Z0AA 2I2WA 4CXMA 4N3AA 2XASA 1BRTA 5K0GA 3PDIA 1M1ZA 1XPOA 1MX9A 3QVMA 4JIGA 1AZSC 2EBUA 3KB1A 1K3FA 3QLUA 1VPVA 2CL7X 1DCKA 3KETA 2EFGA 4F92B 1QO0D 1AH2A 1JSCA 1KS2A 3TXYA 2W2XA 2W6OA 1E8DA 2YICA 5C8VA 2Y05A 2ZUCA 3BD9A 4M9SA 4RZXA 1D5CA 4J3NA 2ODEA 4CEHA 1PM9A 3F4BA 4IIDA 3UWDA 1ORTA 1EWRA 1J49A 4RMJA 2M1ZA 2GILA 3HM9A 3WDKA 4IHQA 1JX9A 3D3NA 5DTRA 3SP1A 4JENA 4BNDA 4ZKDA 1VIBA 3S1AA 3DMFA 5HM6A 2C0QA 1KEUA 4K8XA 1SKUA 3NJ4A 2VO1A 4B8YA 1B6SA 3RIHA 4BQRA 4O4JA 2WU1A 1JDJA 3BZWA 4GM1A 2GCPA 1MTOA 4OG2A 1WPBA 3CZ5A 2Z2JA 1XDZA 4F93B 3V1NA 3RABA 3IUSA 1W6UA 4UOQA 2X6AA 3ABZA 4BWGA 2E4XA 3CNNA 5C80A 2ZIFA 4OI0A 4QLAA 2VDUE 1Y9AA 1TZBA 2ZP1A 4JJ4A 5FNVF 3ICWA 1IJFA 1E60A 3IEUA 5K8JB 1ZQ9A 4TYNA 3N6RA 4N48A 3MBOA 1P77A 3JVEA 1D8AA 2E49A 3IAS6 1E98A 4OP1A 1TRHA 2WD9A 1KO1A 3WLRA 4GLXA 5E95A 1IXSB 2R0QC 2QNBA 3EC1A 4PSCA 3PQEA 2M7WA 1EBFA 2RH8A 1NQUA 4EJ0A 1ZUHA 4I9WA 5E6SA 2WAOA 4RE5A 4B0OA 1QVAA 2IHJA 4L27A 1PLJA 3GA0A 5FUQA 4RA6B 2ISCA 1N8KA 3MM4A 1V11A 1AI5A 4WVFA 5LD2C 4MTXA 4Z9BA 4LZLA 4EWLA 3AZQA 4JJZA 1KY4A 5DPMA 2X5JO 1UK7A 3AUUA 4R16A 4DR3B 5DHSA 3LK7A 2VS0A 4J7XA 3D4IA 4IOKA 1OLUA 4PA7A 5EE5B 1ODCA 2ZEJA 5K6TA 4P34A 4UMEA 9LDBA 4GOOD 4DDKA 4Q39A 2HKIA 5CLGA 3QLTA 3C8HA 4GM4A 3HCCA 1E2HA 2H3OA 4OJMX 4E22A 4HNGA 4ZGBA 2NV2B 4ITVA 1I7QB 1P3DA 3HCPA 2J3EA 4IJUA 4YA6A 1NYLA 2JL1A 4LH6A 2MINB 4MVXA 3RLFA 1HTBA 5K0LA 4IDGA 3GYGA 4O1HA 2H08A 1ID1A 3DD1A 3ESQA 2X7XA 4BE9A 1T8UA 4N0QA 3E7XA 4DSUA 1J07A 4GLOA 1Z0JA 2HJWA 2QG6A 1JKMA 2V4MA 3QBTA 4N4AA 1RACA 3L6RA 4BNHA 4HFNA 3R74A 1W36B 3USCS 3OT1B 2VTBB 1A2QA 1W44A 1PD1A 3BXGA 3GLHE 1VI2A 1LV8A 4ZZ1A 4GLLA 3ZVKA 3KEQA 1E2GA 3I5UA 3SPHA 3GLSA 1BS1A 3ITEA 1VKJA 1M10A 2AI2A 4C87A 2I6FA 3WBKA 3TD2A 1CVRA 4P31A 5B4TA 3OEWA 5C7LO 4LZWA 3R0JA 1QRTA 3DE4X 5ANRB 1U96A 3MWKA 1UFKA 3R9XA 5G0TA 4WESB 3GNTA 3CA8A 1SCDA 1A5AB 4PRKA 3MUFA 1GO3F 2J7PD 5E7JA 1GPBA 5EJ5A 1X74A 4NU8X 1VG1A 4M46A 1XZMA 3X43A 3HFGA 4EVQA 3IFSA 1N0WA 5BQXA 3PK0A 3OCYA 2F1HA 3I9FA 4LBWA 5E6UA 1ZA1A 2F90A 4TS4A 3ANNA 3EK2A 3NT2A 3O3OB 5A3SA 1PT5A 3HKCA 3K03A 2K4MA 1B4DA 1RBYA 2QMOA 1Y5IA 1Q7GA 4QQ8A 1Z4JA 1I5RA 1UMCB 4QGBA 3MWFA 3OCJA 4JBYA 5ALHA 3E8GA 3WLOA 2X40A 3L0BA 1Q57A 3O2JA 5FBRB 4D8VA 2OFFA 1YMVA 5SYAA 4R9UC 1CETA 3UUFA 2G07A 4UC0A 4J6EA 2PMEA 2COKA 1B04A 3ZX6A 1WLYA 1E7SA 3A9RA 3FHOA 1DRUA 2VP2A 1AMUA 3H2IA 5KX5A 2FSHA 4MA5A 3IR5A 5A4JA 3QO8A 2QN1A 4ZZIA 4KN5A 4GQAA 3NJRA 2C1ZA 4UATA 2H3EA 3BHNA 1M1YB 4WDRA 1RWKA 5IF9A 1I30A 4LDZA 3TAHA 3V33A 4L9RA 4JB8A 2OT5A 4CLRA 2IUEA 2EG5A 3ZDDA 3COJA 4WDQA 3UK2A 4D5GA 2O07A 3LPNA 4YLEA 1KVUA 1KJZA 1U2EA 3R6DA 4KO3S 5KYWB 4ENPA 3OGCC 4JL8A 1NW6A 3DBIA 3K1AB 3EAGA 3MTGA 5A0VA 3FYHA 4KMOA 3I30X 2B83A 3ROKA 3PWSA 4F2WA 2G09A 4LNUB 3K9WA 3W79A 3HXLA 4O3MA 1D1PA 1TW3A 4KMMA 2BH9A 5AXDA 2QE7A 4RTMA 1H2BA 4RLFA 1OW3B 4ETMA 2YI9A 2EFEB 2WABA 2RHLA 3WL7A 4B87A 2BM9A 3RYIB 3SG0A 2GASA 1U8TA 1FDVA 2O4CA 2Y1DA 4A27A 1LGYA 4KV7A 1XWWA 2QT0A 2Q2VA 4UVBA 2G82A 1G3RA 3RR2A 3I72A 5FNVB 4TYMA 3DBHA 3L8ZA 4UEOA 1SHZA 1MR3F 4U3JA 4DR2B 5EXEA 4AW9A 4DDUA 2XR1A 4EAQA 4B6JA 1EM1A 4NBSA 1FNSA 3T35A 4PA4A 3JVIA 1Q90D 3NTXA 1YI2V 2A92A 5CFZA 3ITDA 3DBLB 3K9QO 1IBSA 1YRBA 3IR7A 3OE5A 5DASA 2BCEA 3QKIA 1ZLZA 2AXTZ 2J3DA 4MV1A 1EG7A 4CIYA 1P4SA 4OX9O 3X2EA 1TCBA 4IDFA 2XE6A 4MI3A 3PD1A 1SN7A 3LCMA 1HDJA 1GRQA 4BEBA 1AOXA 1YKFA 2NP6A 1KL7A 1F6WA 1JXAA 3CP1A 5AIBA 3G17A 3ZWYA 4TPKA 2JC3A 2HFKA 4E70A 2AR7A 3SBXA 4HYTA 1U3VA 4ZIRB 2FMIA 4GI2A 2TECE 3LCJA 2HAEA 3H6HA 1MAHA 3SSMA 3LNMB 5ENZA 2NPIA 3C43A 3FRJA 2YOFA 3M6VA 3BULA 5FBZA 4QULA 3TN7A 1GAWA 4CG2A 3R5TA 3MCAA 3NZEA 4YHBA 3SC4A 5K99A 4XX0B 4TMKA 4K40A 3FH0A 1LX7A 2P7HA 1JEQB 3TL3A 3AVPA 2OCDA 1X8LA 3AZPA 3REQA 2AC4A 4QYMA 4JI2O 2YQ4A 3E27A 5FOUA 3EMVA 1IUNA 2PXXA 1KO4A 5JRZA 3QFFA 1Z34A 5TF4A 1CUZA 1RAEA 2V8OA 3LCCA 2GK6A 1N77A 4HAUA 2C3MA 1W2WB 2JK1A 4UEKA 3AEYA 4JI8B 3UMJA 5LGTA 4DQ0A 5IJAA 2EX3A 4XM0A 1KBQA 1WMAA 2ESRA 3W3AD 4JOCA 3LP5A 3MINB 1P4HA 3QE3A 4R8MA 2PMCA 3HSKA 4FC6A 1CDOA 2FPGA 4WWHA 3HVRA 4PVCA 1U9IC 4FXPA 4N7BA 4LRWA 3RUEA 2UUCB 1O96B 3APQA 3V7YA 1PR6A 2R7MA 1GZ3A 2YHUA 1CUUA 4FK8A 2YWJA 4K3UA 2ZT6A 4LJAA 3UMMA 3CW9A 4ZVOA 4BO4A 2ILVA 3KXDA 1JTVA 1NU8A 1YQWA 5EMJA 4F9FA 3SICE 2PAAA 4AN1A 4UFOA 5H7XA 4CF4A 2ILMA 3IILA 4ND3A 2HR1A 3DVLA 1AKYA 1BHJA 2CV1A 4ZALA 3LL4A 3OZRA 1XQ9A 4EPRA 1ZNXA 4YB8A 4KGZA 4PNEA 2ZD9A 5K3CA 1OX6A 3W6NA 3PNKA 1SZCA 1T4CB 4IEIA 1KQPA 3NHSA 5DK6A 3CUTA 4GKKB 1EB9A 5C8YA 3ID6C 5ALNA 5BURA 4XOUA 3JR3A 1B3BA 2J9GA 3IE0A 3O4JA 2ATCA 3OOSA 2WHPA 4NX2A 3CKYA 1CS0A 5LJIA 1XMIA 1AM4D 4DLWA 2H06A 2Y76A 2ZRCA 1NIJA 1PX0A 2OUIA 4RQEA 2BBTA 2RHOA 4XJSA 4XQ9A 4BNUA 1SK9A 2AFHA 4GMFA 5MF6A 4K9OA 4NR0A 3WNDA 2SBTA 3JQFC 1E7WA 2ZR0A 3EAFA 3ZLUA 2PWAA 3DE1X 3SS7X 3G5AA 3V4ZA 3QVGA 1P17A 1H9CA 2H2IA 5L45A 3ZNNA 1A2BA 2O0HA 1DCTA 3HP4A 3VU1A 2P77A 3PC7A 1PKXA 2LFRA 3R09A 4MYCA 1H0RA 3LX5A 2RGEA 121PA 3DDHA 4H7JA 1M8PA 2FZLA 2JAWA 3GY0A 4MHSA 3SVZA 3SIPA 1OASA 1UBCA 3LLUA 1E63A 3ADKA 1HSZA 5TPZA 3WKCA 1F38A 4KR3A 3GZTB 2Q7HA 3OOWA 2RGNC 1BWSA 5EK0A 2CK3G 1N32O 1LNQA 2WB4A 3L74H 3BQ9A 3E2MA 3BE5A 5IKXA 4HD8A 3DMTC 3AETA 2CJWB 3C8DA 4FSHA 1RPRA 3TJRA 5I9LA 3D0OA 3RHSA 5JHHB 4CS2A 3TF5A 4BHTA 3ZV4A 2JBWA 4QYIA 4RO0A 1V7PC 2AKYA 2OVFA 4YS6A 1HC7A 2V9ZA 3FOFC 1IBKB 5BN3A 1Q7CA 4L95C 2HPVA 2PPLA 4NESA 3GBPA 1YFJA 3U39A 4I6GA 4B7KA 3RRBA 4CKEB 1A0OA 3MCZA 3NLLA 1KK1A 1NX9A 1MMFB 5F98A 1MGPA 2RE8A 2V7UA 2P4EA 2FWJA 1PNTA 2P5SA 2OV8A 4PSAA 2C7PA 1XZFA 5LQJA 4QOSA 2PXHA 1V5EA 3E83A 1TFUA 1JDZA 1NJ1A 3ZU5A 2H85A 3GGOA 5KSYA 3MTQA 4UM8B 1TGYA 3F7TA 1CKEA 1OHHG 1C7FA 2R5FA 3DXYA 4BNKA 4XEHA 1UM9A 3R66A 1XR3A 2BWJA 3JYQA 3OMLA 3TKAA 1G7RA 1C4XA 1R4NA 2CZGA 3U4AA 3UQZA 4KP4A 5KQMA 3RU2A 3UY4A 1RWBA 2NZJA 1YCGA 1CVLA 4UHCA 2A2ZA 3NW9A 1CSEE 4ALJA 3A4NA 4C7MA 1E79G 4LC0A 4IXDA 3LO5A 4LYEA 4Q6BA 1A3CA 5JDIC 2FAXA 3UOAB 1E4YA 2JHGA 3JWPA 2XGJA 3UEOA 2VBCA 1ZWIC 2ZE8A 1SC4A 3O03A 4OF4A 2IP1A 3OTIA 3M6FA 3HHPA 6GPBA 3KB8A 4K46A 2Y3IA 1AB3A 3AYZB 1XGKA 4B40A 5IAOA 5JMTA 2R70A 4MB0A 3UJ9A 4AP9A 4AD8A 1HURA 1H8EG 1FL9A 3MWLA 2IF2A 4OSEA 3HY3A 3BJMA 2YV3A 1GA6A 3ZK8A 1BSMA 4Q3EA 3TKLA 3SX0A 2HWWA 3JD3A 3VFDA 1QRUA 1SB8A 2FPKA 2VTDA 3BL6A 3GRPA 3IV9A 2DF8A 2BF7A 4IYIA 1GM9A 5BSHA 2WPDA 3D2CA 4EYKA 3ZGXA 2GK4A 1IZ7A 1JQJC 2AUTA 3HU5A 4G4GA 4ACBA 4Y1RA 2Q45A 3A31A 4X5OA 1FNNA 2ZYDA 2ONZA 2HREA 3QMMA 3LCRA 2IS1A 1AK2A 3SOZA 3FYUA 3RUHA 4HATA 2O4UX 2KSQA 3OU2A 5AJUA 1LK7A 4OPMA 3STHA 2QTAA 4DUGA 3VR5H 4IGAA 3KZVA 1YZKA 1E99A 4YMTA 3IAEA 3P94A 2QUKA 4KQHA 5LD2B 3AF6A 1K4DC 5IK2A 4AB1A 4YMLA 3O0TA 4FS8A 5JJEB 1LKZA 3R3YA 3X0DA 5LPNA 3RYFB 4LN1A 5HQTA 4FYHA 3KLOA 3HN6A 1SWVA 3GFOA 4JQSA 3V4VB 2BSKB 3QVLA 5ALKA 1UZLA 3ZE1B 5HF9A 2BY4A 4CT0A 2KLHA 5DE3A 4MQ4A 2R1UA 5AM1A 2J1LA 1Y82A 3CLKA 4TOIA 2BGLA 5IT9N 3SQNA 5DW3A 3DD5A 3LX8A 4ZT2A 3UATA 5JVDF 4DR1B 5IJ0B 2IODA 4EF4A 4RZ2A 4O25A 1EJBA 1DB3A 4ZI3A 1AR1B 9GPBA 2QJRA 5AM3A 3K6RA 4IDCA 3CLVA 4K35A 4Y1GA 1SS3A 5F2KA 1PG2A 2OB1A 2ZR8A 4K6MA 1MW8X 4JEMA 4L3OA 1W1UA 3IIKA 3MS2A 3O3CA 3WGYA 3FOAA 2WKSA 5EI5A 4RTOA 2Y67A 4JV5B 1L4HA 4MLDA 3KPWA 4E5VA 3MWDB 1XEXA 2I91A 1EGMB 4KZPA 3RGGA 3Q3EA 1JEJA 5BXZA 1VQ1A 2IKSA 1DRWA 2ZVDA 3QEMB 5BSKA 5LHHA 3O1IC 4HL6A 4W4KA 3LC0A 3CS3A 2G9QA 4CM9A 5TR9A 1E7RA 3KQWA 1HR0O 3BUSA 5JPIA 3CUSA 4DEXA 1PEYA 3CN9A 2FDCA 4JXKA 4FCTA 4EQZA 1B43A 2YOGA 1WCIB 4R8RA 1UWCA 3QW2A 3TE6A 4M0MA 2CNDA 2ATIA 1V9CA 3U5TA 2RH4A 3O8BA 4Q12A 2ZUUA 4EZBA 1U65A 1TQ8A 3FMVA 1VMEA 4ZHSA 1OVMA 1T0IA 5FAXA 2WP8J 2H1WA 1DIBA 1GAXA 3GGCA 1GADO 3MUEA 2DBVO 4MV8A 2VQ6A 4GT1A 1N2SA 3AVVA 3EZNA 3BMOB 3OFVA 2H1RA 3QPUA 5JD6A 4J7KA 2H1FA 3SHQA 1XL0A 1ZD8A 5ITVA 4AZ0A 3IO3A 3MFYA 3BD8A 1LDNA 5J4LA 4YRGA 3L92A 3REGA 5EQDA 5IU6A 2PNFA 2X0DA 4G9EA 2OCKA 4QE3A 1H2RS 3L49A 3NDPA 4I55F 3E35A 1ULZA 5LNK6 2CJFA 2GETA 3ZZMA 1I36A 1JFRA 2XNHA 3UJPA 3GEHA 4CM8A 1SZTA 1G1XB 4C01A 3FMGA 4OGQB 2WK1A 3KP1A 4E5YA 3FLMA 3ESAA 3Q6MA 2C3YA 1JE0A 3WIOA 3T1HB 4UFZA 2RFLA 1QVRA 5HK9A 2ZG6A 1M1NA 2PT7A 4BMDA 4RZQA 4YCMA 4TL8A 4HVTA 3GOQA 3UH0A 3RKUA 3ZZ0A 1N3LA 3C3EA 2P4QA 3WWYA 2FJUA 1E9VA 3AEUB 1U8YA 5KOYA 4E31A 3M9LA 1E2IA 2WLMA 3LK6A 4NK4A 2BYTA 1AKVA 3PIIA 3WAGA 4OQNA 3OECA 3DEKA 2NADA 3DHYA 4FPPA 1MJNA 5DNVA 5EFZA 3GN2A 4QYXA 5IY5C 3C15C 2FRXA 1J24A 4B7ZA 1XQ6A 1V1MA 1W581 4W1PA 5JNRA 2GHQA 2ZBFA 4UAVA 3LIPA 2H17A 3FFAA 1TU3A 3RTGA 4KAXA 4JVMA 4I9HA 1E32A 2YS6A 2V98A 2VOJA 1XVLA 1GXSA 3TI9A 2HMUA 1S5LZ 1GKUB 3P4XA 4DRYA 2VBIA 2D1TA 1N8RW 3AEQA 5FOQA 4C0AC 4Q9IA 1S1CA 2F9FA 1IBLO 1IXKA 5JQGA 5B3JC 2RD2A 1UC4B 3GLRA 3MBIA 1DSSG 1NOIA 1B8NA 4DA6A 2QRKA 3CB2A 2IS4A 3U1TA 4LYFA 4LRUA 4EHKA 2GWRA 1HNZB 1QYRA 2W4IA 1ML3A 4ZJZA 3C3MA 2VAMA 3ABTA 1E6LA 4ZA2A 2GBLC 4BGDA 2XTAA 4NE7A 4R3NA 1PJ4A 2YHIB 1OZ0A 2XT6A 4QO7A 4DIEA 2MOKA 3LSSA 4BN5A 2A88A 1K5SA 1OVGA 1VCHA 4KE7A 1T2AA 3NX4A 3L82B 1XTTA 2OZKA 3QNMA 3GXBA 2JLQA 3H6KA 4NCKA 3TRFA 1BE1A 4M49A 1QLNA 2AOUA 5L3BA 5LQNA 4CL0A 3AESA 4FDMA 4B08A 2JI9A 4CCYA 1J0DA 1RPNA 4FUQA 5EY5B 4DZZA 1WDTA 1SVLA 4DW1A 3EOZA 5GTIZ 2JJQA 4DLYA 1WEKA 2JLYA 4B3DA 2X0RA 1HNXB 4B3MB 1D09A 4J7UA 1K06A 1NASA 1PJTA 1B41A 2G7MC 4NZNA 2PSEA 4HC4A 3I6QA 1TTTA 4ISBA 3WMXA 2HA3A 4LXTA 3LP8A 3H1KH 3L70H 5F9HA 3LWDA 2HIHA 1N2CA 3OX4A 1DTWB 1D2GA 1U3CA 1UWLA 1H1LB 1NX6A 1JA0A 1J06A 4YHHB 4K6HA 5HE9A 1Q74A 5K0ZA 4JDUA 4ZJYA 2N42A 4KAJA 4U0KA 4MR9B 2WYOA 5JVDB 3KQYA 3EQ7A 2QAIA 4XYEA 3IGFA 1J0BA 1PDOA 5JUWA 4UBOA 4OEHA 3UJ6A 3K96A 1QOQB 4NZ9A 4RA9B 3SVLA 4NTXA 5D01A 3UCXA 4C29A 4FSDA 2EW8A 4P86A 2GZ1A 4WCEV 5CGQB 4C3VA 1WXIA 2P6OA 3EVAA 5LGUA 1YMQA 3K70B 1A9RA 3O8QB 4JVLA 4Q01A 3OA0A 1XCMA 4PG4A 1VIMA 3DDUA 4F3YA 3TH5A 4MK4A 4ZJPA 1TVEA 3LUKA 1XQXA 4MIKA 4JI7O 1M6NA 4NCNA 4Y6RA 4FT4A 3QVXA 2FA9A 1SHJA 4MB2A 4CF5A 2PUHA 3OZCA 3L4BC 3LA6A 4EJSB 3LPCA 1IHPA 2GKGA 1KPGA 4MQ6A 4NICA 4I9FA 5G3ZA 4TKUA 3ZDBA 3ZK7A 2MSEB 1CP3A 2E55A 3AXSA 3WL8A 4G5QA 1M67A 4BOYA 2Z43A 4MXDA 3W5HA 2O8DA 4OQZA 3M2PA 1RZUA 4LOHA 3SSOA 2ZJ8A 4ZVKA 3DDSA 1UBRS 2XZOA 2CFRA 2QW8A 2Q2QA 2IYYA 3DAPA 1UH5A 2QN9A 4UE2A 1UKZA 4CDNA 2F1OA 3HKBB 4MARA 5B30A 2GO1A 3VTZA 1R9GA 4XGRA 3HKDB 3VDNB 3Q3GE 2NUAB 1JJIA 2FN8A 3E03A 2ZRJA 2OV2A 1GKYA 4XSVA 2MJLA 3FUXA 1N9GA 4WERA 1U9JA 4XWOA 1NI4B 4I55B 4H3SA 4EI2A 4DYLA 3DT9A 4M7OA 2FEMA 5JG7A 4OSPA 1CYDA 4I1RA 2A3RA 2VVTA 2B7LA 1WMFA 1EVJA 1NVGA 4G1MB 1Z5OA 3Q0TA 1FBNA 1FYDA 1ZCJA 2XIJA 4DA7A 2BP7A 1SQQH 1I94B 3Q72A 4FEEA 1SIOA 3H9VA 3SFTA 3AERB 1XYVA 1XKLA 2IJIA 4JP3A 2R47A 5LXTA 3SR0A 1GL3A 2V6MA 3OC0A 3DLPX 4WL0A 1KE2A 2FZKA 5L9AA 1AXEA 1CBUA 3GEPA 3QY0A 4XIFA 3WLAA 4X41A 2Z5LA 2H1CA 4CLXA 4V03A 2KB1A 5U4XA 4RTQA 4YN3A 3VGJA 3OQIB 3VQXA 1CDEA 5K0JA 1UC8A 3Q2OA 2DY0A 4C0LA 3I6BA 3BWDD 1VJGA 2ID8A 4QASA 4RLHA 1PR5A 2POQX 4HEJA 3K7EA 4Q21A 3WGZA 5B58T 1HQDA 1QG4A 4MYUA 1GT6A 2F67A 4E3ZA 2GTAA 2X0EA 2G6TA 4IIYA 1OJLA 5EZ6B 1W0JA 4B6QA 4BNIA 2GBOA 4WLFA 3WDMA 4C06A 2JZCA 3TXSA 5KYYA 1C3OB 3AHCA 5CX1A 4KQMA 3BOSA 3CGWA 3QMVA 1GNSA 3DKKA 2XAGA 2PUCA 3WRXC 4RJKA 2XPCA 1NJ2A 1QR6A 3C5WP 5I5GA 4JODA 2PY6A 4P0QB 1Q15A 1QG6A 4KPGA 3L6EA 4RUEA 1QH8A 4XARA 5C93A 4NTYA 4IJQA 1XVTA 4B5LA 4HFJA 1IHOA 1WTAA 3RVYA 5DTJA 1J8VA 1NBEA 4D8TA 3CUUA 3D8CA 3CCSV 2FRDC 5EIBC 3JWEA 3GGJA 4P30A 4G8DA 4R7ZA 3COYA 3RIMA 4TS1A 2FP4B 3IQIX 1BEEA 3LQ1A 4RE6A 4OXQA 1EXNA 3Q4HA 3INGA 3NTRA 4CPDA 4RD1A 1YRHA 1QB8A 3TOCA 5DN6G 4PDVA 1RSOB 2UXXA 1E2BA 4FDUA 3UYLA 3D6JA 5B1AB 4ROTA 2FV8A 1M5RA 2L82A 1T9HA 1YR8A 3WKAA 5C7YA 4O4HF 2VNAA 1I4DD 3CNBA 1WCXA 1Z37A 2WWXA 2CLDX 1JR3D 4PZEA 4KLAA 1GTMA 4FLXA 4QXRA 3HZZA 3UJDA 5J40A 1YTLA 4G8JA 4QC2A 1XZAA 2OCBA 1T29A 1E6WA 5H9CA 3PA6A 1RPOA 4XM1A 5BPFA 1VMIA 1F0YA 4R2MA 4NOMA 4FMPA 5AJVB 1ODTC 2WTXA 3CH7A 4BP1A 2QI9F 3TO5A 2WJPA 3MS7A 3KQQA 4G5GA 1I7FA 2JJ2G 4O3FA 1BU5A 1Z13A 3CX6A 5MDHA 3F1KA 5JMWA 3QVNA 4BKMA 4TV9A 2R751 1Y6QA 3K2QA 1ECFA 2XVXA 2II6A 1HY3A 4IUYA 4R05A 4HAXA 2IC5A 5JFOA 1HZZA 3DC7A 1CJVC 2XXAB 3DAOA 4IVQA 4KX3A 2W93A 2H8GA 2HSEA 5C8DA 4FK5C 4JZKA 2HJVA 4G0UA 1JQ3A 1GFIA 4QUBA 3KV1A 3N75A 1H9AA 4H1WA 3WGQA 4JI3O 4YY3B 1GWNA 4FOOA 4EFLA 5FBQB 3CCMV 4X94A 3SZMA 2Y1CA 3ZWOA 4YFYA 3AJDA 4UBKA 1HA3A 2QRMA 5JS1A 2AVDA 3SDLA 1RP3B 4HHEA 4ZXPA 3V8BA 1Y1QA 4IIBA 2JLUA 4OQYA 4WHMA 3E48A 3JWGA 4Y9SA 1T6XA 1Y6ZA 1PV2A 1TKRA 2ID4A 3KXIA 3BHPA 2YWEA 4Z51A 1RT9A 3B8MA 3A1FA 3N2KA 3BA1A 4MYTA 3WRYA 3R76A 1RC1A 4K6FA 2O5EA 1UP4A 1ZL8B 4TRNA 2PL1A 4HRYA 2JBHA 2VZEA 3PENA 3HJUA 5TJ9A 4PHTA 1Q91A 3H0EA 1E9EA 1Q1AA 4WLOA 3LLMA 5FFFA 2VNKA 5HDBB 3M3PA 4HAWA 5BWMA 3HXPA 1R73A 2P65A 3RUCA 4M9CA 1A2OA 1T2EA 1QIMA 4KXNA 2GK7A 3U80A 3WFIA 1VBNA 2N47A 3H5LA 1AX9A 1X1TA 4WLNA 2XVZA 1OY1A 4IFTA 4MJLA 2JVKA 3BWCA 4GL2A 1HYGA 3CEIA 2FPIB 5ESXA 2GEKA 2CUNA 3RSHA 1ITZA 1PX2A 2WYHA 2B37A 3HDYA 5LLSA 4IMIB 1A8UA 4LF8O 5H5JA 4ZT6A 4PWZA 3WK8A 5JC8A 4QD3A 3L4EA 2JZNA 4HAOA 1TCCA 1ZL2A 2H59A 4HDNB 4AKGA 1WB8A 4RMGA 3VAZA 5AK4A 5KUMA 1Z36A 2JZOA 5GJWC 1FFSA 4GWGA 2VQSA 5DHRA 3EN0A 1MVNA 5C4MA 3E15A 4HEQA 4GAEA 1KYIA 1GCIA 5KJEA 3AF2A 5J23A 2W6MA 3OW2U 3ODGA 4H60A 3I01M 2WUFA 5KA6A 3MCVA 1SXIA 4OQPA 4BN4A 3ICEA 1WPXA 2W8BB 5AJXA 2ODNA 2WPNA 1QCZA 5KUTA 3ZS8C 5KIAA 2QQEA 1T9GS 3ZI4A 4F86A 2XHZA 1AR4A 3U17A 4F6CA 3MIIA 3OQNA 1C8BA 5FLKA 1P7WA 2RK4A 1M3SA 3G2HA 1OYVA 2EP8A 5LQRA 2XUQA 3KB6A 3WBBA 1XXLA 4MWCA 2VG8A 3GPIA 3JYCA 1JR9A 1C7IA 2VTEA 4LWPA 3H01A 3NKFA 4B74A 4BDSA 4HNAB 3ESBA 3ZMVA 4MRMB 4Q1DA 4R98A 4EDFA 4LJ5A 4PZPA 3ZMZA 3I55V 1SKVA 5L3ZA 4AY5A 4CN8A 3UWSA 5CX4A 3ANTA 1XQ1A 3VBCA 4PRLA 3FUUA 2ZGVA 5G0WA 3AG5A 2NU6A 4DUZO 3T3GA 4NULA 1A88A 3UFXB 3V3KA 4P22A 2QVYX 2J9YB 1W5EA 3OLYA 2G88A 4DJ5X 4UHFA 3U6BA 5L4LA 2P40A 2V7QA 3VZQA 2P6JA 3TUZC 3G6BA 2C7BA 4WZBA 5L6LB 4ZV7A 4PTLA 4BRSA 2EJBA 1R88A 2E6KA 3JWIA 2XZPA 3QBDA 2CXPA 1QYIA 4IICA 4B3JA 3H11A 1R5BA 3G5MA 4ZPXA 4U7JA 2QN6A 1Y9JA 1ZWLA 3BWXA 5IKPA 1A7KA 2Y93A 2EL7A 1KEEA 5LHGA 2FG5A 4KR9A 4O4HB 2CXUA 2PUAA 4ND1A 4UNIA 2XDYA 3H5IA 3MGKA 4R8KA 4N9WA 3O2QB 1J99A 4QO8A 4Q3BA 4LWSB 2XZDA 3WV5A 4JVSB 5CXXA 1SOAA 1A32A 1ECLA 2DPXA 1SIBE 3KG2A 3QKWA 3ZRWB 3HWRA 1RC8A 2CLHB 4LRYA 3TVYA 2JI4A 1HE5A 3MMSA 4P3PA 1AGNA 2PZLA 3EGIA 3NIWA 2H4JA 1AGXA 3I83A 4XGQA 4BCCA 5A2GA 1L7MA 4PLFA 2OAP1 5ERXA 2XY4A 5F4BA 3Q12A 3GLGA 1BDMA 2HNAA 3OM3B 3RV4A 3PXUA 1WPGA 2X9LA 1AP6A 2Y1KA 1KKUA 3DQZA 3ED5A 3SPXA 3UQYS 3NRCA 1C3XA 2W6JG 4PG7A 1SKYE 3OMIB 2O7QA 2DWCA 4MV6A 1K33A 3C3XA 5KSOA 4CZ2A 4YCNA 3R44A 3C6QA 4CQMB 4UTPA 4K9MA 3ZDZB 4GBMA 4RWZA 3D7KA 4EMTA 2E7ZA 1D2HA 2O7NA 3GPLA 3AOGA 3D36A 1BMFD 3EXEB 3RSQA 3I9V6 1AC5A 5EHZA 1D4OA 1R3LC 3FSEA 2C4NA 4B6OA 3TIXB 2C5EA 3C3AA 3UM7A 5E3HA 4MUXA 2QJFA 1T0PA 4IV5A 1RQLA 5FIUA 1O6FA 2YJGA 4MR8A 3S55A 2I80A 1A82A 4I99A 2ZSEA 4TUYF 4DJTA 3CJTA 4FP9A 4JXJA 2ZYIA 3TS1A 3QTCA 4YRTA 2GNPA 2D5LA 3PNOA 2QIPA 3NATA 1O97C 2ZM6B 3MUNA 4J42A 1XKTA 4O5OA 4PPYA 4NIMA 1IHDA 4QBIA 2YNMC 2F66C 1L8LA 5ALQA 4H4CA 4P32A 4MCHA 1SUIA 5JNLA 4BQSA 1CZOA 3JSLA 3QUBA 4BY9E 1LCIA 3CEMA 3GWGA 2EXXA 3C3PA 4O0MA 4D9HA 3NO4A 3W9UA 2AK3A 4WPGA 1LPNA 2Q5LA 3OR6C 2W6PA 3MWYW 4ND6A 3HEAA 2XKJE 1IQ0A 2KHZA 2CFIA 2QAGC 1KSGA 3WS7A 5JYCA 1FX0A 2CHGA 2EKPA 4NYMQ 3TNYA 3EXFA 1OT5A 3WBJA 5J1TB 3AL2A 4S1WA 1X7DA 2CXOA 3NWBA 3KU4A 2D5AA 3E4DA 4P80A 1KTVA 2CTQA 2TYSB 3B5JA 4FKMA 3SIRA 4P9NA 3NGMA 3M4ZA 5K7SA 1UDXA 5KVSA 4A0GA 4ZYZA 3IIEA 2NQ8A 3KQPA 4P2GA 5HOQA 5IAAA 2XUOA 4M0UA 5ITZA 4DR4B 1W47A 5DBHX 3OUZA 1VM6A 1D0VA 1SOUA 3IP5A 1JXMA 2XCSB 1ZM4A 2PA0A 3HDQA 1XROA 1SMKA 4XJXA 4MTGA 4Y3UA 4ZZ2A 4RJTA 3MLEA 2O2HA 3B1FA 2GA9A 2C9OA 5DI3B 3VV3A 3D0KA 1NKVA 1LWNA 3PTAA 1IBMO 1VP7A 2RJ3A 3G9XA 4MI1A 4E4TA 2C82A 2EJCA 4XYGA 1IOWA 1ETUA 1NKTA 2WYVA 1E61A 2HCRA 2C7GA 4D9JA 2DPLA 1WA8A 4LVOA 4UUNA 4UTVA 3JQQA 1XOIA 4E3WA 4JI0O 4BV2A 3W6PA 1G17A 1VQ7V 2ET6A 3WR5A 2N75A 3RC3A 1T3ZA 4CH4A 5CT5A 4X8MA 3VH4A 4ACAA 5B5SA 3RDPA 4WSOA 5JLAA 2B0JA 7MHTA 2QUIA 2LD4A 2L35A 1GGEA 2VSNA 3W2IA 3SYPA 3JALA 1EFDN 3AHEA 4F38A 3CMEV 1V9SA 3WQBA 5A03A 4EW2A 1VE7A 5FEMA 4JBGA 1WVGA 5DF1A 2NM0A 3A6HA 4OA5A 3ETCA 1GK9A 1Y37A 3K1YA 3CCEV 4DMLA 1KJIA 2ZRFA 4P4SB 1WXGA 4JFRA 4ZVPA 3KT8A 2D0DA 3NHKA 3NHWA 3S68A 4JAAA 3MK31 3BYZA 1KQFA 3CVOA 5I7OA 4HRAA 3VSAA 1UQTA 1CDDA 4JZYA 2IM9A 5AUOB 4PRZA 3LUAA 5K01A 4BNYA 2JFYA 5KYUB 3V8NA 1X94A 3CZRA 1SC1A 5U1PA 2P30A 5KHGA 4F3NA 1KYWA 2HBRA 2XMCA 4RGBA 1BE8A 3ZKWA 4IGIA 2YRFA 4BKPA 3KQUA 5CA3A 5I9MA 2CL5A 3DGEC 3QBEA 3WGKA 4EA6A 4UUOA 3U7EB 3BSYA 3RG8A 3CN7A 3T3IA 3BWMA 1QZTA 1E4VA 3ZX5A 4UCRA 2B1IA 5CAEB 4U7WA 1YR1A 1BGVA 3R3VA 4ES6A 4XVUA 2GXUA 1V6CA 4X7MA 4Q4AB 3AC0A 1I2AA 4AO8A 4DBZA 3BZUA 5KTSA 2YXHA 1OBVA 5KYXA 1M2HA 4KUGA 2VYQA 1OFHA 2FEKA 3ZI0A 3ROQA 1F5NA 2WWIA 1W52X 2RHBA 3QO5A 3S1LA 5JTTA 4I9NA 1UBHS 1TB4A 5CLFA 4U7NA 1UC5B 4ZT3A 3D4PA 2YS8A 2F4NA 1YGYA 3CWCA 4BBZA 2VPZA 1X9IA 5AJWA 3HJGA 1E2DA 1SETA 1P7ZA 1UKAA 4XSGA 1RM0A 1PTJC 3KK0A 1DFGA 3GLFE 5J4VA 2UZ3A 2XQKA 1NYRA 2NU8B 1VTKA 1Q7RA 2PKWA 4J76A 3H1AA 5CVDA 2P5UA 4YRNA 3C3CA 3BDAA 1GN9A 1UXIA 3P4UA 3EA4A 3VBBA 1OIXA 4I0XA 5DNAA 4YMUA 1JFFB 4XUDA 2WDZA 3GVPA 4IV8A 1VQ4V 1RWXA 1NVDA 2P2GA 4Z1MG 1AK9A 3ZJVA 2OXEA 5H4GA 2G28A 4BWYA 1I0HA 1ADCA 4RGYA 4OYYA 2EBHX 2JRIA 1GL6A 1E62A 2C00A 3GP3A 3L71H 3SX2A 4TUYB 4R2IA 4OAQA 3LUFA 1OXSC 3DVAA 1FXUA 3KSDO 1NRIA 5MN4A 5DX8A 2ECPA 2UXDO 2BEVB 1KY5A 4N40A 1EM6A 1IEQA 2ZJ5A 2HEIA 1KBHA 1T8RA 1ZUD1 4EENA 4CRWB 4C4XA 2JK5C 1TJYA 4TLAA 5HSGA