1GTOA

High resolution structure of a hyperstable helical bundle protein mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
62
structure length
62
Chain Sequence
GTKQEKTALNMARFIRSQTLTLLEKLNELGADEQADICESLHDHADELYRSCLARFGDDGEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords ROP
publication title Amino-acid substitutions in a surface turn modulate protein stability.
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 62
sequence length 62
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1996-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1gtoA00
1RPRA 2GHYA 2IJIA 2IJHA 1ROPA 2IJJA 4DO2A 1GMGA 1F4NA 1RPOA 1B6QA 3K79A 1GTOA 1NKDA 1F4MA 1PD3A 2IJKA
chains in the Genus database with same CATH superfamily
3ZHUA 3EHBB 4JI3O 4H13B 4J10A 3L73H 2ZNJA 3KZIZ 3CCRV 5FNVA 4YHHB 2EZPA 1Q81W 2Y0PA 4DV1B 4Z2WA 1XEQA 3E8FA 5B1BB 1IURA 3BRCA 4TQFA 1VEWA 2ADPA 3K5LA 1D5NA 4CBCA 4B3TB 1I08A 4UV9A 3ZJZA 2P4VA 3F5WC 5KX5A 1BHBA 3IC7A 1MZEA 5KHIA 1PL0A 3MHHC 4B08A 4HAMA 2AZ0A 2VS0A 2KB1A 1K3EA 2PI5A 4JTAB 2QDOA 4X66B 3OEEG 1M1KW 3ZMZA 1LR1A 1S3JA 2OTJV 1RM1B 4X20B 3SPCA 4WFFA 2UU9B 5BR8B 2EULA 1G1XB 1BQ0A 5LA6A 4B3MB 2YSUB 4X1YB 4GX5A 4G2KA 5KHJA 2JVDA 3VQWA 3U11A 1KU9A 2R9RB 1Z5VA 3R66A 2QTSA 1QLEB 1OHHG 3BHPA 2LP7A 2D2CB 4WCEV 2GTSA 3J80N 3JCZA 4IT5A 2WLKA 1PP9H 3BY6A 4A5UB 3S3XA 3HR0A 1TUEB 3J7AU 3MD0A 2VQEO 2HHHO 4DRXB 2ADQB 4IHJB 3ZHSA 3F7VC 1XMOO 1K5QA 1Q6UA 1S5LZ 4LNUB 4EFEA 4X65O 4DUYB 1E79G 4BIUA 2XAFA 4ZOLB 3T1YB 2DW4A 1NU1H 2P4KA 5CB4A 4FZ0A 1H8HG 4N21A 3K03A 2PF4E 5LHGA 4CH6A 4NXNB 1R3LC 4MVQA 4QE9A 2IH1C 2EINC 1US6A 2GSMB 2BTQB 3BPZA 3K5NA 3T1CA 2YEVB 1ENVA 1SQBH 2GDSA 4LH6A 2ZE5A 4GCZA 1GKFA 3OE7G 4YY3B 1OV9A 4J7KA 3N2KA 1KQSU 4YIPA 2LJ2A 4D6TH 4DV0O 2Q7HA 2ZKOA 3ZRXA 3CX5F 2YI9A 2QGNA 2QWQB 1BE3H 1XILA 1B3QA 1W59A 2GBOA 1Q3EA 4DV3O 3ZX6A 2Z5UA 3KCYA 4U3JB 5JCOA 4E2LA 3B8NA 4GKJO 5FLXN 2UXBB 4DR4B 3SYQA 5J2TA 2X6AA 2JGDA 3CJHA 3TGUH 2Y69C 2RJZA 3DXRB 1GN4A 2WLLA 4LF8B 4JASA 3SJAC 4JI2O 1SQXH 4JYYA 3OW2U 3CMEV 4FLUA 2B9ZA 4QIWF 2XUMA 1AB3A 1YDXA 2ZDIC 2NR5A 5CBHA 4DV4O 2F4VB 3B40A 2XOKG 3JAKA 3W7TA 1GK9A 4LF9O 5JWPA 2XAQA 3A2FA 3G6EV 1THZA 4AQYO 3HPLC 1XHXA 1URFA 2C2AA 4GLXA 2UUCO 4NTXA 3OMIB 4GYCB 4LF5O 3OGIB 1FJGB 5H6RA 1H2NA 1FFXB 1L0LH 2EINB 1CEZA 3BAAA 4PHZA 1TUBB 1BHAA 3JALB 2RDCA 5LGUA 3SGIA 1YVWA 1N34O 1BS3A 1Z2GA 2DYRC 1CPYA 5B5EZ 2VQFB 2K1EA 1BCCH 2E76B 2F66C 4I55B 4DV2B 3W7SA 3QF7A 2JDIG 4ZI7A 2GTAA 5E1AC 4JI7O 1YHQV 3K06A 4YHHO 3OTFA 1VP7A 4DV1O 3G6BA 1F23A 4J11A 3FB5C 4ZBMA 3VQVA 5EYPB 3FB8C 2YDEA 4B3TO 2G38A 4PDMA 1F7YA 2Y69B 3ZHQA 1FXKC 5KMGB 5EZYB 1AJNA 4G28B 2UXCB 1TGOA 4GX0A 1NTKH 4DO2A 4X66O 2FB5A 3K79A 1SQVH 3HB3B 3SDLA 1UJWB 2MK3A 4ABMA 2DOSA 3ABKC 5BMVB 3AK2A 5CMUA 1ZLZA 2UU9O 5BR8O 4UCUA 4FZ1A 3CCLV 3WB2A 4B3MO 3FB6C 1S72V 4TV8B 5GONA 3ETQA 2XAJA 2HKOA 1Y74A 2ITDC 1MNGA 4I9WA 1DTOA 1VF7A 5F2VO 4LBEC 4UB8Z 1V54C 4KP4A 1VF6A 1L8DA 3D36C 2P90A 3VBBA 4JAUA 3ICXA 3LDEA 2Q69A 2DYRB 1E1RG 5LOVB 2PTMA 2ZIMA 3HKBA 4JF3A 4O4IB 1H2GA 5LXTA 1TVKA 3RW0A 2A06H 3D8CA 4I50B 1G8MA 2RQ6A 4DW1A 2WLIA 4DUYO 2UUBB 2AZ2A 3JYCA 2A3QA 3RYHB 4BR6A 4NTWA 3T1YO 4IYHA 3OTOB 1IXBA 1F4NA 1W0KG 4EB6B 4F6EA 2ZCEA 5J2UA 4UV8A 4DUZO 2HFEC 4DR1B 2Y4UA 4LC1A 1FXKB 2ZINA 1EZVH 3ZIAG 2RNBA 1GRJA 1MG1A 2BE3A 1WB7A 1N33B 4TT3G 2F93B 1GMGA 1K4DC 2CE4A 1EN5A 1KKDA 3Q4HA 4UVBA 3ABKB 4YY3O 4RQEA 1JJOA 4FLXA 3N27A 2UXXA 2M6YA 3ZS8C 4AHCA 3W7WA 2E5LB 1DLBA 3ZMTA 4O2BA 4MVSA 4FPPA 3HKEA 3OM3B 3DTUB 4R7CA 4UCVA 4K8XA 2IJIA 4WFBV 3DC5A 3BA9A 1XQ8A 4D7TA 2H3OA 2ATKC 1Q6IA 2QTOA 4FM2A 1V54B 5JVDA 1EFRG 2R72A 3O9OA 5DN6G 3GB7C 5IYZA 1J95A 5CN0A 5LMUB 3TK1A 2UXBO 4DR4O 4FFBB 3T4ZA 1G4YB 4U7OA 1MSWD 3E22B 4J7JA 1Y6XA 5JQGB 1HNXB 2CGNA 3FYIB 3JD1A 3JCUZ 3MAQA 5EIBC 4FK5C 2XASA 3WB0A 2F4VO 4O4LB 1GTOA 4O2AA 5KUKA 4I9QA 3ZRSA 3S3WA 4X1KB 2K9PA 5LP6A 2H94A 4XDJA 1IDSA 3BFRA 3OMNB 1GO3F 1UFIA 3UKMA 1WAZA 1T5EA 4B3SB 4LFBB 2X0LA 3IFXA 3AG3C 3JARA 2KQXA 2WAMA 4HYOA 3CRCA 1OJHA 2YS8A 1RPRA 3SYCA 3SPGA 5CBGA 4Z1MG 2ZD9A 1D2DA 3RYCB 4DR3B 4DV6B 3C3SA 4F6RB 4UXNA 3J81N 4DR5B 5KHHA 1KECA 2VQFO 4Q6GA 1FKAO 3HKCA 4DV2O 1NTZH 4YIOA 4LF6B 1EN6A 2KKWA 1I94O 2Q0OC 3OAAG 1B06A 1R6NA 1YSCA 3K0DA 3BA8A 4PA9A 4YJ2B 4B3RO 3UO2A 3FAVB 2EX3A 3D3IA 3QO7A 1QQCA 5B3SC 2GV9A 3LDDA 3ASNC 5CA0A 2YIAA 1ZL8B 3IJ4A 2KG7A 3AG4C 3TXQA 1XL4A 4CC6A 3K3WA 5L3CA 2NN4A 4YJ3A 2IM9A 3CS5A 3JASA 1M56C 4DR6O 1O9GA 4JI1B 5LMNO 4EKWA 1X59A 4X62O 3D3QA 4O4HA 3K57A 1PNMA 4IL6Z 1NH2D 3ABTA 4B7EA 5BY1A 4X64O 1ZAUA 2HEPA 3CCJV 2HVKC 2QKCA 1N0NA 3AG3B 5EIBD 3JD2A 3H9VA 4R8CA 3OR7C 5LYJB 2UXNA 3CSXA 1Y76A 2A0LA 3RFRA 4EEQA 3K59A 2DE0X 2CUGA 2CH7A 1JX9A 5IY5B 2BOBC 4X89A 4UCOA 2IH3C 5LBQA 2JJ1G 2JS3A 1R6TA 2W0XA 2ZIOA 3CCMV 1P49A 3WFVA 2UXDB 4WFGA 3N2GB 1XNQB 4JI5B 1DF5A 5EBWC 1BZKA 5CA1A 1XMQB 2RCVA 4FM0A 3CCSV 3PN1A 1R3IC 2P7TC 5CBFA 3E2EA 3TXSA 4C7UA 1M4UA 3A0RA 4GKKB 3CB2A 2Z3YA 1JFFB 1JA8A 3L72H 5B3SB 1YXBA 1YZBA 1YIJV 4UB6Z 4E4EA 3ASNB 3RYIB 4DR1O 3STLC 4KUMA 1WA8A 4PD4F 3QTCA 3AG4B 4ZKIA 3ZRWA 3RYFB 1N33O 3QO8A 2ZM6B 2WLJA 1A32A 5LHIA 4KFMA 4H33A 3WG7C 1VQ5V 3RWRD 5IDJA 1M56B 4K8ZA 1QHTA 5LGTA 1S5HC 2EIMC 2IU3A 4DR2B 1N32B 2AXTZ 5ITZA 3H1KH 3U0ZA 2QR4A 4MW8A 5TISZ 2ZT9B 3IC9A 4U3FH 4O4JB 1YCIA 5J9PC 4X9QA 3AG7A 2UUAB 4JI6O 2JIZG 4FLZA 3ETEA 5LMUO 1SQPH 1PNKA 4X88A 4CH4A 3OGCC 4N23A 3SPHA 3STZC 4J7ZA 1VQ7V 2Q9LA 1OCZC 2HP8A 1ZUQA 3BEHA 3IAYA 4MVUA 2HVJC 1WPXA 2R9AA 1XBLA 1E1QG 4LCUC 4UUJC 2Y0IA 1XDCA 5JJNB 2EIJC 1D5AA 4X20A 3UT5B 2R70A 2VRZA 4U7NA 4FIPC 4W4LA 4NXMB 1EM1A 2ARHA 1BSMA 4L87A 5AG2A 1N36O 4X1YA 1M9NA 1RSOB 2QWNB 3TETA 4B3SO 1N0JA 2EJRA 3JATB 4LFBO 4PA3A 3A8TA 1WN7A 2QKAA 1QR9A 3ETDA 4DV5B 5D5PA 1O9HA 2PGGA 1SF9A 2XAHA 4WBNB 2X6BA 3FX7A 5GTHZ 1NTMH 4DR3O 3WG7B 2QWPB 1AP6A 1AR1B 4DV6O 3UCSC 1HR0B 3G4SV 1U97A 3K9SA 3ABLB 2A9HA 2YICA 2EIMB 4QPKA 1JJ2U 2QWOB 5KHKA 5H6QA 4BW5A 4H44B 4DR5O 2QSAA 4R6ZA 4DRXA 1KUQA 2KSDA 3OT7A 1SERA 2BSKB 4FLWA 3CCQV 4UCTA 4LNUA 4OXSA 4MTXA 2ILMA 5A2QN 1RP3B 2QM8A 4Z1VA 4ZOLA 1NBMG 2HR3A 1VQNV 3GWKC 2HLDG 2CTWA 3ASOC 3SJQC 2QE7G 1Y66A 4FLVA 1FXVA 2JJ2G 1OCZB 1K8AW 2BTQA 1WP7A 2PYJA 5IJ9A 2PI4A 1IBLO 2YEVA 4Q20A 3JAWB 4JAVA 4X8AA 1H2MA 4JYAB 2EIJB 1U96A 4ASUG 5L3BA 1DF4A 3H1IH 4UCSA 4CH3A 3K9AA 4JI1O 3B77A 3T4DA 3B8MA 2PY5A 1FFTB 2YI8A 4CH5A 4KXRA 4RO2A 1P84F 4X1IB 5H9CA 3JD0A 4LWSB 2WLHA 3T2MA 3T1HB 5JJEB 1FD9A 1B6QA 4JI4B 1Y74B 4LF4B 3P3PA 1ZTEA 3H1HH 4U3JA 2RN9A 1VQ9V 3RBZA 4D7SA 1GH6A 2JEUA 1DGSA 3MHSC 1GM7A 3SPIA 5K1PA 5B1OA 3OR6C 3AG1C 4NTYA 2OIEA 1N4CA 4DV7B 1NZ6A 1WLEA 2UXDO 3SR2C 3W7UA 1XNQO 4JI5O 3QNEA 1XMQO 3HKDA 3LDCA 3CRRA 1I5YA 3ABMC 2Q73A 5LXTB 1IX9A 4ZHQB 2ETNA 4I4TB 1H2LA 1OCRC 1RPOA 1Q86W 3OFNG 4JI8B 1VQ6V 1S0VA 1PL4A 3CEIA 3ASOB 2N05A 4PELA 4JTDB 1H38A 2RMKB 3FB7C 1FFXA 3K5OA 3THOA 1EZJA 5DM6V 2DQ0A 4HZ3A 2CGOA 2EILC 1K7DA 1TUBA 5IYDO 5DECA 2EIKC 3JALA 4NB5A 1OCCC 3AK3A 2ZM6O 2ZR2A 1JR9A 2GUZB 1ZWIC 1WJZA 3CRQA 4TV9A 5L3DA 4MSWC 1M90W 1I0HA 2BCCH 4DR2O 3ZHVA 1KC8W 1N32O 4IIJB 1IBMB 4O2BB 3CMAV 4I55A 2QWRB 3WB1A 1KMIZ 4JI3B 5IJ0B 1Q8IA 3C90A 5CA3A 2XHBA 4HBNA 3JSLA 3CC7V 2QEXV 4I7ZB 3CWBH 2UUAO 3CE2A 1EN4A 5DEDA 3L75H 4ZIBA 5EYPA 3G67A 4YXWG 4JAAA 3ZBHA 5IE9A 1QU7A 4WFEA 1JMKC 1WP8A 3AG1B 4FM1A 2LFRA 3APQA 3L71H 5B1AC 3PJSK 5HFLA 4R50A 2W6IG 4QJFB 5KMGA 4NXNO 2AW9A 5EZYA 2E75B 4TUYB 4GZRB 2ZDIA 3UQ8A 4OX9B 4QPJA 5IT9N 3ABMB 2AGAA 2IBZH 4HNAB 3CD6V 5BMVA 3OMAB 3ZMVA 1CXZB 4PI2A 3ZHTA 1Q82W 4CS4A 2P06A 1OCRB 1LNQA 3CC2V 4K0KB 2WLNA 3AG2C 1PV0A 4I0XB 4TV8A 2A79B 2B1GA 2EILB 2EIKB 1OCCB 1XUQA 3FKSG 2Q4PA 4JPRA 1VQPV 1S5JA 3X2QC 4F4LA 3TCUA 5IYBO 1NR7A 1HR0O 2ZNIA 4FLYA 2W6JG 5LOVA 2IJJA 2P22C 2ZXWC 1JVMA 4QGPA 3SYPA 1AI7A 4LF8O 1BL8A 3DSQA 1W2BU 1AJPA 4O4IA 4I50A 2XTAA 4IYIA 4X65B 5JH7B 2HJFC 2IJHA 4TWKA 4CS2A 2ZE6A 2OCCC 4EB6A 1NQTA 3CHXA 3UO3A 3RN4A 3K08A 5B1AB 5FPOA 1FXKA 1FJGO 2BOCC 2ZE7A 2YIBD 3LNMB 1HDJA 1Z5WA 3I56V 5C8YB 1SA0B 2OWOA 4BIOA 4NVPA 4JYAO 3ML0A 2YC0A 4P9PA 2DQ3A 5IY5C 3DC6A 2B5UA 5B66Z 1JOYA 4DV0B 2MW2B 4DW0A 2NLJC 4GX1A 2ITCC 1Q7YW 3CRAA 1QBZA 3CYOA 3AG2B 3C3TA 4BAYA 4JYCA 2Q8VA 1Q90D 4MTGA 3FFQA 1ORQC 3A0HZ 2O57A 4LF4O 4MW3A 1KP2A 2D3OW 5FNVB 4KHPB 1OCOC 4GKJB 2Q7EA 1Q43A 3GWOA 4FFBA 3X2QB 3D36A 2N74A 4UVAA 2QA4V 1QNMA 1N8RW 3E22A 4DV7O 1K34A 5JQGA 1FAFA 4L8JA 1NH2B 5KX5B 2ZXWB 2Q7GA 3CP1A 5C93A 1JPXA 5CA1B 5EBLC 5B1NA 3OEHG 2UXCO 2LW1A 4O4LA 4XDLA 3R65A 3I5DA 4X1KA 1YI2V 4AQYB 3IGAC 2OCCB 1QVGU 5KAIZ 4JI8O 3RVYA 4NKGB 5KAFZ 3E86A 1AR4A 1NKDA 1YJNV 5LA6B 3SYAA 4BW9A 1FXHA 2DMXA 1P7GA 3SYOA 4P30A 5H2FZ 4P2ZA 3H1LH 2H8PC 1FYJA 2LGWA 5KA6A 3CPWU 1BT8A 1JQ0A 1HNWB 3RYCA 2WSSG 2R9IA 5JCOC 1S77D 1GN6A 3L74H 3MDSA 1YEWA 4G27B 4F6RA 3M99B 2F95B 4J80A 1IBMO 3ZHRA 5KHGA 3LUTB 1XOUA 1ZX3A 4JI7B 5EC1C 3LSUA 5IYCO 2ZR3A 4YJ2A 2ZQMA 1F51A 3FAVA 4FVMA 1WPBA 1OCOB 2UUBO 1UPGA 4LFAB 2Q0AA 2ODMA 5LL6Y 2YXHA 1SZXA 3E8BA 5CB4B 3OTOO 1YJWV 2F43G 1LUVA 1ZL8A 1MA1A 3QO5A 1K4CC 1ZSPA 4WF9V 1VQOV 2WA3A 4OX9O 4K35A 2QKSA 5KUMA 2OCHA 1W0JG 4DXWA 1BQZA 3U10A 4B7KA 1QLNA 4NR1A 2B1IA 2A7WA 3N2KB 4K0KO 3CRMA 3ABLC 4LR3A 1Q5OA 2DYSC 5BZBA 2L6LA 2LFSA 2E5LO 2DN9A 1P4RA 1HNZB 5KA5A 5E79Z 1SKVA 3TJTA 1K5SA 5L3GA 3K5MA 1J5EB 4GUNA 2FMLA 5LYJA 3B4SA 4W4KA 1PM9A 3K0GA 4WFAV 1ROPA 4CZZA 4NYKA 1NT2B 5J2TB 2JGDB 3CJHB 1RFYA 3N2GA 4GX2A 4GT1A 3BABA 2WLLB 4P9OA 1FPOA 2OIGA 1HNXO 2OT5A 1BMFG 5HFMA 2CTRA 1YF2A 3JAKB 3VQYA 3EVKA 4LFCB 2M7WA 1M57C 2FYUH 2XAGA 1NJIW 4JV5B 4H37A 1JFFA 2V1DA 1P7BA 4JZGA 3BVOA 4DUZB 3L70H 3RT3C 2PZSA 3RYIA 2LQTA 2QM4A 3VOUA 5JJJB 2BTOA 3E83A 4MTOA 5IJ9B 3NXSA 3RYFA 1R3JC 1TA8A 1GM8A 4PA4A 3P3NA 1IXMA 4QNHB 3APOA 1PKXA 1DK1A 2CTPA 4JTCB 1VF6C 1GN2A 4MVZA 1PD3A 3E8HA 1MMMA 1XNRB 1SETA 1I5XA 1G6UA 1V9PA 2DYSB 4O4JA 2Z0AA 1LUWA 1R3KC 4IHJA 4LF6O 1Y67A 3I55V 4ZI7B 5D5QA 3QVNA 1Y4MA 3H1JH 4IGGA 4KHPO 1VQLV 2E3CA 4CS3A 1IBKB 4MS2A 2AHZA 5LGNA 3O65A 4XDKA 2X7RB 1VQ4V 1VARA 1VF5B 3ZMSA 4XBFA 2IJKA 1PPJH 3VQXA 3HKDB 1AR5A 1SQQH 4LH7A 4J42A 3ZRVA 3F7YC 3AEIA 2JK5C 3UT5A 3A0BZ 2QJ1A 2V4DA 4J9YB 1AILA 1MZFA 3UM7A 5H5NA 1OZ0A 2EJ7A 1M57B 2AHYA 2JS5A 1Q6HA 3FYEB 1RSOA 1SS3A 4LF7B 3JATA 3W7XA 2OTLV 3CXCU 5GONB 4AI8A 3B2EE 4WBNA 4PJ0Z 2OYQA 1FS0G 1HNWO 4RAIA 3ZEDA 4TV9B 2WLMA 1XI1A 4DYLA 4FLTA 3ABUA 3JSNA 2ZE8A 3EXAA 1YJ9V 1AJQA 1GN3A 3DXRA 3WU2Z 2BSKA 1I94B 4PV1B 3LNNA 2LO1A 3HKBB 2W0FC 1MSDA 1M93A 4FJCC 4B3RB 1TVKB 2WLIB 5LP6C 3ZN1A 4GKKO 2WA4A 1VQ8V 4MVRA 4LFAO 2YXLA 4MVMA 1AI6A 5J2UB 1AP5A 4RQFA 1COWG 4DR7B 5IWAB 3JAWA 3ZN0A 5K1XA 1S76D 4PDRA 5LHHA 4BWAA 3P30A 4DR6B 1YTFB 5LMNB 3GVMA 2JGUA 4X62B 3P32A 1AVMA 3SJBC 3Q4HB 4X1IA 2WWWA 4ICGA 4JI0B 3DGEA 4LWSA 1NI8A 3K04A 2QM7A 1KP3A 4X64B 4DK1A 4JYBA 1WNSA 1M5IA 1HNZO 3HKEB 2P67A 1MABG 5L3EA 2VWJA 1J5EO 1EBOA 4TOIA 1K33A 1MOFA 1SC5B 4OPHA 1KB9F 1YTFD 3FD9A 5JVDB 4PA7A 3JD4A 5IYZB 3JAMN 3CCUV 2PYLA 3SPJA 5FL7G 1V55C 1JCHA 4JGSA 1QR8A 3LSQA 3OUSA 2DWEC 4OPAA 1XREA 4JZ2A 4ZHQA 2L35A 2F23A 4I4TA 2Q5ZA 3OD4A 4WFHA 2Y48A 4O2AB 4LFCO 1NVPB 4KL1A 4JV5O 1KKCA 3QG5A 5LP6B 3E35A 3LSSA 2CDYA 2IW5A 2P6JA 4NXMO 4DK0A 3RVZA 5FPRA 2YIDA 4J9ZB 4UVCA 3KCXA 2XNDG 1CP9A 3JARB 4I5SA 4DV5O 2GUZA 4PI0A 4TSFG 1NVPD 2EZOA 4OGQB 2XT9A 4UFZA 2Q6AA 1H2SB 1XNRO 4RUFA 4IIJA 4MVOA 5EK0A 3KKYA 1H8EG 1KBHA 1AROP 3E8GA 5IJ0A 2PUSA 4LP8A 1R1BA 4H0LB 2VQEB 2HHHB 3HKCB 4CC5A 1YITV 1BGYH 1AI4A 3G80A 4JI6B 1XMOB 2FTKA 1QVFU 2P5OA 2X6CA 4FMTA 3RYHA 1QCEA 2LW7A 2YXYA 1WB8A 1IBKO 4FFKA 1VQKV 2DWDC 5L3FA 5EC2C 1B04A 2N04A 4UCRA 1V55B 5GW7A 3K58A 1AI5A 4TUYA 1HW7A 1K92A 5CA0B 3B09A 2CAZC 2KG7B 4HNAA 3SJCC 1IZ3A 1X4TA 4YJ3B 2GHYA 3CCEV 3CC4V 3JASB 3L9DA 1K9MW 2FKXA 4MTFA 3OUFA 2Q68A 4PA6A 4TQDA 1N36B 4O4HB 4I0XA 3F5TA 4EFBA 1R73A 4LF7O 3AK1A 3NR7A 1K73W 4PDLA 1F4MA 2F1MA 3T1HO 2HJDA 4BIZA 4JI4O 1KD1W 3RGBA 4DV3B 3ZCCA 1L1FA 2LGQA 1H2KA 2JEXA 3JD3A 3CCVV 4K3AA 1SQFA 1Y76B 5B1BC 2CH7B 2E74B 2JRIA 2YUAA 1VIBA 4J41A 5KLVH 1XL6A 1L0NH 3EFFK 4JI2B 2V7QG 5BXZA 4AILC 2YIBA 2VWKA 2Y4TA 1XHZA 1VQMV 4RUEA 5EBMC 3CXHF 1I7FA 1HWYA 4DV4B 1NR1A 1RM1C 4QE7A 5JH7A 2FL4A 4LF9B 1GAXA 1TAEA 1NS1A 2EBOA 1PNLA 2UUCB 1R6KA 2DJVA 2CTQA 2NNUA 1SZTA 4MT8A 1VMGA 3G71V 2CK3G 3BCCH 4LF5B 2Q67A 4PDVA 1IVSA 3KG2A 3E89A 1IBLB 3M7MX 1SA0A 5C8YA 2IU0A 3ZMUA 5GTIZ 5IWAO 4DR7O 2WPDG 1WA8B 1QLEC 3ZRWB 3H01A 2HG5C 4RWUA 1K97A 1KYOF 1SRYA 1HP8A 3ETGA 1N34B 5A9GA 1SQGA 4JI0O 1GM9A 5ITZB 1SESA 3M8AA
chains in the Genus database with same CATH topology
1PKXA 4U7OA 3EHBB 1MSWD 1OCRC 1RPOA 1Q86W 3OFNG 4JTCB 1VQ6V 1S0VA 3FYIB 3JD1A 3CCRV 3ASOB 4MVZA 4PELA 4JTDB 1H38A 2EZPA 1PD3A 1Q81W 3FB7C 3E8HA 4FK5C 2XASA 1EZJA 5DM6V 2DQ0A 1SETA 4HZ3A 3E8FA 2EILC 1GTOA 5B1BB 1K7DA 5KUKA 1I5XA 5IYDO 3ZRSA 4CBCA 2EIKC 2DYSB 1OCCC 2ZR2A 2H94A 4UV9A 3ZJZA 3F5WC 4XDJA 1BHBA 3IC7A 1R3KC 3OMNB 1ZWIC 1GO3F 5L3DA 1PL0A 3MHHC 3I55V 3UKMA 4HAMA 4QNHB 1Y4MA 4MSWC 2KB1A 1M90W 1K3EA 2PI5A 4JTAB 1VQLV 2X0LA 1KC8W 3IFXA 3OEEG 1M1KW 3ZMZA 3AG3C 1S3JA 4MS2A 2OTJV 3CMAV 2AHZA 5LGNA 2WAMA 1RM1B 4HYOA 4XDKA 2X7RB 1VQ4V 1RPRA 3SPCA 4WFFA 3SYCA 3SPGA 5CBGA 4Z1MG 2ZD9A 3ZMSA 4XBFA 5CA3A 2IJKA 3CC7V 2QEXV 2YSUB 4GX5A 4G2KA 3ZRVA 4YXWG 3F7YC 3AEIA 4UXNA 2JK5C 4J9YB 2R9RB 1KECA 3UM7A 4WFEA 3AG1B 2LFRA 1OZ0A 5B1AC 1M57B 2AHYA 3PJSK 1QLEB 1OHHG 5HFLA 3FYEB 4R50A 2W6IG 4QJFB 3OAAG 2LP7A 4WCEV 1R6NA 1YSCA 3K0DA 4PA9A 3W7XA 2OTLV 2ZDIA 4QPJA 3JCZA 3ABMB 3CXCU 3CD6V 2WLKA 3BY6A 3D3IA 3OMAB 3QO7A 1TUEB 3ZMVA 5B3SC 3MD0A 1FS0G 3LDDA 1Q82W 3ASNC 1OCRB 1LNQA 4RAIA 3CC2V 3F7VC 1K5QA 2WLNA 3AG2C 2WLMA 3AG4C 1XL4A 3ABUA 5L3CA 3K3WA 1E79G 1YJ9V 1AJQA 2A79B 4BIUA 2XAFA 2B1GA 2DW4A 2EILB 1H8HG 4N21A 1M56C 3K03A 2EIKB 5LHGA 1OCCB 3FKSG 4EKWA 4JPRA 1VQPV 2W0FC 1R3LC 4MVQA 3X2QC 4QE9A 4F4LA 2IH1C 1PNMA 2EINC 3TCUA 1NH2D 3ABTA 4FJCC 5IYBO 2GSMB 1NR7A 2W6JG 3T1CA 2WLIB 2YEVB 3ZN1A 1ENVA 1VQ8V 4MVRA 2IJJA 3CCJV 2HVKC 3AG3B 2ZXWC 1JVMA 3JD2A 4R8CA 3OR7C 1AI7A 4GCZA 3SYPA 1GKFA 4MVMA 3OE7G 1AI6A 1BL8A 1W2BU 1AJPA 2UXNA 1KQSU 2A0LA 1JX9A 5IY5B 4RQFA 2BOBC 1COWG 4X89A 2IH3C 5LBQA 3ZRXA 2JJ1G 3ZN0A 2HJFC 2IJHA 1S76D 4TWKA 4PDRA 2OCCC 5LHHA 3CCMV 3P30A 3WFVA 4WFGA 1NQTA 1YTFB 1DF5A 3K08A 3P32A 5EBWC 5B1AB 2Z5UA 2WWWA 3CCSV 1R3IC 4E2LA 2P7TC 5CBFA 1FXKA 2BOCC 3B8NA 3DGEA 3E2EA 3LNMB 3K04A 2QM7A 3I56V 1KP3A 3SYQA 4JYBA 3A0RA 2X6AA 2Y69C 2Z3YA 2P67A 2WLLA 1MABG 4JASA 5L3EA 1EBOA 3ML0A 4P9PA 3OW2U 2DQ3A 3CMEV 1K33A 5IY5C 4QIWF 5B3SB 1MOFA 1YIJV 2B5UA 1JOYA 2ZDIC 3ASNB 1YTFD 2NLJC 4GX1A 5CBHA 2ITCC 3STLC 4PA7A 2XOKG 1Q7YW 1QBZA 3JD4A 3CYOA 4KUMA 3AG2B 3W7TA 1GK9A 3CCUV 3AG4B 4ZKIA 3ZRWA 2XAQA 3SPJA 4BAYA 1THZA 3QO8A 5FL7G 3G6EV 4JYCA 1V55C 3HPLC 2C2AA 2WLJA 1JCHA 4MTGA 1ORQC 4JGSA 1QR8A 3LSQA 4KFMA 5LHIA 4H33A 3OUSA 3WG7C 4MW3A 1VQ5V 3OMIB 2DWEC 5IDJA 1M56B 1KP2A 2D3OW 5LGTA 1S5HC 2EIMC 5H6RA 1OCOC 2IU3A 3GWOA 3X2QB 3D36A 2EINB 1CEZA 4UVAA 2QA4V 4MW8A 4WFHA 2Y48A 1N8RW 1NVPB 1BHAA 1K34A 3E35A 3LSSA 5LGUA 1NH2B 2IW5A 5J9PC 2P6JA 2ZXWB 3CP1A 5C93A 3RVZA 1JPXA 5EBLC 2JIZG 5B1NA 4J9ZB 3ETEA 3OEHG 4XDLA 3R65A 2DYRC 1CPYA 4UVCA 2XNDG 1CP9A 1PNKA 4X88A 1YI2V 2K1EA 3OGCC 4I5SA 4N23A 3IGAC 3SPHA 3W7SA 3STZC 2OCCB 1VQ7V 1QVGU 1OCZC 2JDIG 4TSFG 3RVYA 1NVPD 2EZOA 3BEHA 5E1AC 3E86A 4MVUA 2HVJC 1NKDA 1WPXA 1YJNV 1YHQV 3K06A 1E1QG 3SYAA 2Q6AA 4LCUC 1FXHA 4UUJC 1F23A 4RUFA 3SYOA 4MVOA 4P30A 2EIJC 5EK0A 1H8EG 3FB5C 4ZBMA 1AROP 3E8GA 4P2ZA 3FB8C 2H8PC 5KA6A 4LP8A 4PDMA 3CPWU 4U7NA 4FIPC 1JQ0A 2Y69B 1YITV 2WSSG 2R9IA 1S77D 1AI4A 1FXKC 4L87A 1M9NA 2FTKA 4G27B 1QVFU 1AJNA 4G28B 3M99B 3TETA 4GX0A 2EJRA 2X6CA 4PA3A 4DO2A 4FMTA 1QCEA 3K79A 3HB3B 1VQKV 1QR9A 3ETDA 1UJWB 2MK3A 3ABKC 2DWDC 5CMUA 5L3FA 5EC2C 3LUTB 2XAHA 5GW7A 1V55B 4PA4A 2X6BA 5EC1C 1AI5A 1K92A 3CCLV 5IYCO 3WG7B 2ZR3A 1AR1B 3FB6C 2ZQMA 3G4SV 1F51A 1S72V 3ABLB 2A9HA 2EIMB 4QPKA 1JJ2U 1OCOB 5H6QA 2GHYA 4BW5A 2XAJA 2HKOA 3CCEV 4R6ZA 2ITDC 3E8BA 4I9WA 3CC4V 1DTOA 1K9MW 4MTFA 3OUFA 1SERA 1YJWV 2Q68A 4LBEC 1V54C 2F43G 4PA6A 4KP4A 3CCQV 4OXSA 4MTXA 3QO5A 1K4CC 1R73A 2P90A 2QM8A 3VBBA 4JAUA 4WF9V 1VQOV 4PDLA 1K73W 1F4MA 3LDEA 2QKSA 1NBMG 2Q69A 2DYRB 1E1RG 2HR3A 1VQNV 5KUMA 4BIZA 2HLDG 1W0JG 4DXWA 3ASOC 1KD1W 3SJQC 2QE7G 1QLNA 3ZCCA 1L1FA 2JEXA 1Y66A 2B1IA 4JF3A 3JD3A 1FXVA 3CCVV 2JJ2G 3ABLC 1OCZB 5B1BC 1K8AW 1H2GA 3RW0A 2PI4A 1G8MA 2DYSC 5BZBA 2LFSA 2WLIA 2YEVA 4Q20A 1P4RA 4JAVA 3JYCA 4X8AA 5KA5A 1XL6A 2EIJB 1K5SA 3EFFK 5L3GA 4ASUG 5L3BA 2V7QG 1F4NA 1DF4A 1W0KG 4UV8A 3K9AA 3B77A 1VQMV 4RUEA 5EBMC 3T4DA 3B8MA 1FFTB 2HFEC 3K0GA 4RO2A 4WFAV 1HWYA 5H9CA 4LC1A 1ROPA 1FXKB 1NR1A 4CZZA 3JD0A 1RM1C 4QE7A 3ZIAG 2WLHA 1MG1A 3T2MA 4TT3G 1GMGA 2EBOA 1B6QA 1K4DC 4GX2A 1PNLA 4GT1A 4P9OA 2WLLB 1R6KA 1KKDA 2NNUA 4UVBA 1SZTA 3ABKB 4RQEA 4MT8A 2OT5A 3G71V 2CK3G 1VQ9V 2Q67A 1BMFG 3RBZA 4PDVA 2JEUA 2UXXA 3KG2A 3MHSC 1GM7A 5HFMA 3E89A 3W7WA 3SPIA 1DLBA 3ZMTA 2IU0A 3ZMUA 5B1OA 4MVSA 3OR6C 3AG1C 4FPPA 2WPDG 3OM3B 2M7WA 1M57C 3DTUB 4R7CA 1QLEC 2XAGA 3ZRWB 1NJIW 3H01A 4H37A 2HG5C 1WLEA 2IJIA 1K97A 4WFBV 2V1DA 1P7BA 3W7UA 1SRYA 3ETGA 2ATKC 3QNEA 3LDCA 2QTOA 3VOUA 1V54B 1I5YA 3ABMC 1EFRG 1GM9A 5DN6G 3GB7C 3E83A 1J95A 4MTOA 5CN0A 3NXSA 3TK1A 3T4ZA 1R3JC 1G4YB 1GM8A 1SESA 1IXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RPR A;  2GHY A;  2IJI A;  2IJH A;  1ROP A;  2IJJ A;  4DO2 A;  1GMG A;  1F4N A;  1RPO A;  1B6Q A;  3K79 A;  1GTO A;  1NKD A;  1F4M A;  1PD3 A;  2IJK A; 
#chains in the Genus database with same CATH topology
 3ZHU A;  3EHB B;  4JI3 O;  4H13 B;  4J10 A;  3L73 H;  2ZNJ A;  3KZI Z;  3CCR V;  5FNV A;  4YHH B;  2EZP A;  1Q81 W;  2Y0P A;  4DV1 B;  4Z2W A;  1XEQ A;  3E8F A;  5B1B B;  1IUR A;  3BRC A;  4TQF A;  1VEW A;  2ADP A;  3K5L A;  1D5N A;  4CBC A;  4B3T B;  1I08 A;  4UV9 A;  3ZJZ A;  2P4V A;  3F5W C;  5KX5 A;  1BHB A;  3IC7 A;  1MZE A;  5KHI A;  1PL0 A;  3MHH C;  4B08 A;  4HAM A;  2AZ0 A;  2VS0 A;  2KB1 A;  1K3E A;  2PI5 A;  4JTA B;  2QDO A;  4X66 B;  3OEE G;  1M1K W;  3ZMZ A;  1LR1 A;  1S3J A;  2OTJ V;  1RM1 B;  4X20 B;  3SPC A;  4WFF A;  2UU9 B;  5BR8 B;  2EUL A;  1G1X B;  1BQ0 A;  5LA6 A;  4B3M B;  2YSU B;  4X1Y B;  4GX5 A;  4G2K A;  5KHJ A;  2JVD A;  3VQW A;  3U11 A;  1KU9 A;  2R9R B;  1Z5V A;  3R66 A;  2QTS A;  1QLE B;  1OHH G;  3BHP A;  2LP7 A;  2D2C B;  4WCE V;  2GTS A;  3J80 N;  3JCZ A;  4IT5 A;  2WLK A;  1PP9 H;  3BY6 A;  4A5U B;  3S3X A;  3HR0 A;  1TUE B;  3J7A U;  3MD0 A;  2VQE O;  2HHH O;  4DRX B;  2ADQ B;  4IHJ B;  3ZHS A;  3F7V C;  1XMO O;  1K5Q A;  1Q6U A;  1S5L Z;  4LNU B;  4EFE A;  4X65 O;  4DUY B;  1E79 G;  4BIU A;  2XAF A;  4ZOL B;  3T1Y B;  2DW4 A;  1NU1 H;  2P4K A;  5CB4 A;  4FZ0 A;  1H8H G;  4N21 A;  3K03 A;  2PF4 E;  5LHG A;  4CH6 A;  4NXN B;  1R3L C;  4MVQ A;  4QE9 A;  2IH1 C;  2EIN C;  1US6 A;  2GSM B;  2BTQ B;  3BPZ A;  3K5N A;  3T1C A;  2YEV B;  1ENV A;  1SQB H;  2GDS A;  4LH6 A;  2ZE5 A;  4GCZ A;  1GKF A;  3OE7 G;  4YY3 B;  1OV9 A;  4J7K A;  3N2K A;  1KQS U;  4YIP A;  2LJ2 A;  4D6T H;  4DV0 O;  2Q7H A;  2ZKO A;  3ZRX A;  3CX5 F;  2YI9 A;  2QGN A;  2QWQ B;  1BE3 H;  1XIL A;  1B3Q A;  1W59 A;  2GBO A;  1Q3E A;  4DV3 O;  3ZX6 A;  2Z5U A;  3KCY A;  4U3J B;  5JCO A;  4E2L A;  3B8N A;  4GKJ O;  5FLX N;  2UXB B;  4DR4 B;  3SYQ A;  5J2T A;  2X6A A;  2JGD A;  3CJH A;  3TGU H;  2Y69 C;  2RJZ A;  3DXR B;  1GN4 A;  2WLL A;  4LF8 B;  4JAS A;  3SJA C;  4JI2 O;  1SQX H;  4JYY A;  3OW2 U;  3CME V;  4FLU A;  2B9Z A;  4QIW F;  2XUM A;  1AB3 A;  1YDX A;  2ZDI C;  2NR5 A;  5CBH A;  4DV4 O;  2F4V B;  3B40 A;  2XOK G;  3JAK A;  3W7T A;  1GK9 A;  4LF9 O;  5JWP A;  2XAQ A;  3A2F A;  3G6E V;  1THZ A;  4AQY O;  3HPL C;  1XHX A;  1URF A;  2C2A A;  4GLX A;  2UUC O;  4NTX A;  3OMI B;  4GYC B;  4LF5 O;  3OGI B;  1FJG B;  5H6R A;  1H2N A;  1FFX B;  1L0L H;  2EIN B;  1CEZ A;  3BAA A;  4PHZ A;  1TUB B;  1BHA A;  3JAL B;  2RDC A;  5LGU A;  3SGI A;  1YVW A;  1N34 O;  1BS3 A;  1Z2G A;  2DYR C;  1CPY A;  5B5E Z;  2VQF B;  2K1E A;  1BCC H;  2E76 B;  2F66 C;  4I55 B;  4DV2 B;  3W7S A;  3QF7 A;  2JDI G;  4ZI7 A;  2GTA A;  5E1A C;  4JI7 O;  1YHQ V;  3K06 A;  4YHH O;  3OTF A;  1VP7 A;  4DV1 O;  3G6B A;  1F23 A;  4J11 A;  3FB5 C;  4ZBM A;  3VQV A;  5EYP B;  3FB8 C;  2YDE A;  4B3T O;  2G38 A;  4PDM A;  1F7Y A;  2Y69 B;  3ZHQ A;  1FXK C;  5KMG B;  5EZY B;  1AJN A;  4G28 B;  2UXC B;  1TGO A;  4GX0 A;  1NTK H;  4DO2 A;  4X66 O;  2FB5 A;  3K79 A;  1SQV H;  3HB3 B;  3SDL A;  1UJW B;  2MK3 A;  4ABM A;  2DOS A;  3ABK C;  5BMV B;  3AK2 A;  5CMU A;  1ZLZ A;  2UU9 O;  5BR8 O;  4UCU A;  4FZ1 A;  3CCL V;  3WB2 A;  4B3M O;  3FB6 C;  1S72 V;  4TV8 B;  5GON A;  3ETQ A;  2XAJ A;  2HKO A;  1Y74 A;  2ITD C;  1MNG A;  4I9W A;  1DTO A;  1VF7 A;  5F2V O;  4LBE C;  4UB8 Z;  1V54 C;  4KP4 A;  1VF6 A;  1L8D A;  3D36 C;  2P90 A;  3VBB A;  4JAU A;  3ICX A;  3LDE A;  2Q69 A;  2DYR B;  1E1R G;  5LOV B;  2PTM A;  2ZIM A;  3HKB A;  4JF3 A;  4O4I B;  1H2G A;  5LXT A;  1TVK A;  3RW0 A;  2A06 H;  3D8C A;  4I50 B;  1G8M A;  2RQ6 A;  4DW1 A;  2WLI A;  4DUY O;  2UUB B;  2AZ2 A;  3JYC A;  2A3Q A;  3RYH B;  4BR6 A;  4NTW A;  3T1Y O;  4IYH A;  3OTO B;  1IXB A;  1F4N A;  1W0K G;  4EB6 B;  4F6E A;  2ZCE A;  5J2U A;  4UV8 A;  4DUZ O;  2HFE C;  4DR1 B;  2Y4U A;  4LC1 A;  1FXK B;  2ZIN A;  1EZV H;  3ZIA G;  2RNB A;  1GRJ A;  1MG1 A;  2BE3 A;  1WB7 A;  1N33 B;  4TT3 G;  2F93 B;  1GMG A;  1K4D C;  2CE4 A;  1EN5 A;  1KKD A;  3Q4H A;  4UVB A;  3ABK B;  4YY3 O;  4RQE A;  1JJO A;  4FLX A;  3N27 A;  2UXX A;  2M6Y A;  3ZS8 C;  4AHC A;  3W7W A;  2E5L B;  1DLB A;  3ZMT A;  4O2B A;  4MVS A;  4FPP A;  3HKE A;  3OM3 B;  3DTU B;  4R7C A;  4UCV A;  4K8X A;  2IJI A;  4WFB V;  3DC5 A;  3BA9 A;  1XQ8 A;  4D7T A;  2H3O A;  2ATK C;  1Q6I A;  2QTO A;  4FM2 A;  1V54 B;  5JVD A;  1EFR G;  2R72 A;  3O9O A;  5DN6 G;  3GB7 C;  5IYZ A;  1J95 A;  5CN0 A;  5LMU B;  3TK1 A;  2UXB O;  4DR4 O;  4FFB B;  3T4Z A;  1G4Y B;  4U7O A;  1MSW D;  3E22 B;  4J7J A;  1Y6X A;  5JQG B;  1HNX B;  2CGN A;  3FYI B;  3JD1 A;  3JCU Z;  3MAQ A;  5EIB C;  4FK5 C;  2XAS A;  3WB0 A;  2F4V O;  4O4L B;  1GTO A;  4O2A A;  5KUK A;  4I9Q A;  3ZRS A;  3S3W A;  4X1K B;  2K9P A;  5LP6 A;  2H94 A;  4XDJ A;  1IDS A;  3BFR A;  3OMN B;  1GO3 F;  1UFI A;  3UKM A;  1WAZ A;  1T5E A;  4B3S B;  4LFB B;  2X0L A;  3IFX A;  3AG3 C;  3JAR A;  2KQX A;  2WAM A;  4HYO A;  3CRC A;  1OJH A;  2YS8 A;  1RPR A;  3SYC A;  3SPG A;  5CBG A;  4Z1M G;  2ZD9 A;  1D2D A;  3RYC B;  4DR3 B;  4DV6 B;  3C3S A;  4F6R B;  4UXN A;  3J81 N;  4DR5 B;  5KHH A;  1KEC A;  2VQF O;  4Q6G A;  1FKA O;  3HKC A;  4DV2 O;  1NTZ H;  4YIO A;  4LF6 B;  1EN6 A;  2KKW A;  1I94 O;  2Q0O C;  3OAA G;  1B06 A;  1R6N A;  1YSC A;  3K0D A;  3BA8 A;  4PA9 A;  4YJ2 B;  4B3R O;  3UO2 A;  3FAV B;  2EX3 A;  3D3I A;  3QO7 A;  1QQC A;  5B3S C;  2GV9 A;  3LDD A;  3ASN C;  5CA0 A;  2YIA A;  1ZL8 B;  3IJ4 A;  2KG7 A;  3AG4 C;  3TXQ A;  1XL4 A;  4CC6 A;  3K3W A;  5L3C A;  2NN4 A;  4YJ3 A;  2IM9 A;  3CS5 A;  3JAS A;  1M56 C;  4DR6 O;  1O9G A;  4JI1 B;  5LMN O;  4EKW A;  1X59 A;  4X62 O;  3D3Q A;  4O4H A;  3K57 A;  1PNM A;  4IL6 Z;  1NH2 D;  3ABT A;  4B7E A;  5BY1 A;  4X64 O;  1ZAU A;  2HEP A;  3CCJ V;  2HVK C;  2QKC A;  1N0N A;  3AG3 B;  5EIB D;  3JD2 A;  3H9V A;  4R8C A;  3OR7 C;  5LYJ B;  2UXN A;  3CSX A;  1Y76 A;  2A0L A;  3RFR A;  4EEQ A;  3K59 A;  2DE0 X;  2CUG A;  2CH7 A;  1JX9 A;  5IY5 B;  2BOB C;  4X89 A;  4UCO A;  2IH3 C;  5LBQ A;  2JJ1 G;  2JS3 A;  1R6T A;  2W0X A;  2ZIO A;  3CCM V;  1P49 A;  3WFV A;  2UXD B;  4WFG A;  3N2G B;  1XNQ B;  4JI5 B;  1DF5 A;  5EBW C;  1BZK A;  5CA1 A;  1XMQ B;  2RCV A;  4FM0 A;  3CCS V;  3PN1 A;  1R3I C;  2P7T C;  5CBF A;  3E2E A;  3TXS A;  4C7U A;  1M4U A;  3A0R A;  4GKK B;  3CB2 A;  2Z3Y A;  1JFF B;  1JA8 A;  3L72 H;  5B3S B;  1YXB A;  1YZB A;  1YIJ V;  4UB6 Z;  4E4E A;  3ASN B;  3RYI B;  4DR1 O;  3STL C;  4KUM A;  1WA8 A;  4PD4 F;  3QTC A;  3AG4 B;  4ZKI A;  3ZRW A;  3RYF B;  1N33 O;  3QO8 A;  2ZM6 B;  2WLJ A;  1A32 A;  5LHI A;  4KFM A;  4H33 A;  3WG7 C;  1VQ5 V;  3RWR D;  5IDJ A;  1M56 B;  4K8Z A;  1QHT A;  5LGT A;  1S5H C;  2EIM C;  2IU3 A;  4DR2 B;  1N32 B;  2AXT Z;  5ITZ A;  3H1K H;  3U0Z A;  2QR4 A;  4MW8 A;  5TIS Z;  2ZT9 B;  3IC9 A;  4U3F H;  4O4J B;  1YCI A;  5J9P C;  4X9Q A;  3AG7 A;  2UUA B;  4JI6 O;  2JIZ G;  4FLZ A;  3ETE A;  5LMU O;  1SQP H;  1PNK A;  4X88 A;  4CH4 A;  3OGC C;  4N23 A;  3SPH A;  3STZ C;  4J7Z A;  1VQ7 V;  2Q9L A;  1OCZ C;  2HP8 A;  1ZUQ A;  3BEH A;  3IAY A;  4MVU A;  2HVJ C;  1WPX A;  2R9A A;  1XBL A;  1E1Q G;  4LCU C;  4UUJ C;  2Y0I A;  1XDC A;  5JJN B;  2EIJ C;  1D5A A;  4X20 A;  3UT5 B;  2R70 A;  2VRZ A;  4U7N A;  4FIP C;  4W4L A;  4NXM B;  1EM1 A;  2ARH A;  1BSM A;  4L87 A;  5AG2 A;  1N36 O;  4X1Y A;  1M9N A;  1RSO B;  2QWN B;  3TET A;  4B3S O;  1N0J A;  2EJR A;  3JAT B;  4LFB O;  4PA3 A;  3A8T A;  1WN7 A;  2QKA A;  1QR9 A;  3ETD A;  4DV5 B;  5D5P A;  1O9H A;  2PGG A;  1SF9 A;  2XAH A;  4WBN B;  2X6B A;  3FX7 A;  5GTH Z;  1NTM H;  4DR3 O;  3WG7 B;  2QWP B;  1AP6 A;  1AR1 B;  4DV6 O;  3UCS C;  1HR0 B;  3G4S V;  1U97 A;  3K9S A;  3ABL B;  2A9H A;  2YIC A;  2EIM B;  4QPK A;  1JJ2 U;  2QWO B;  5KHK A;  5H6Q A;  4BW5 A;  4H44 B;  4DR5 O;  2QSA A;  4R6Z A;  4DRX A;  1KUQ A;  2KSD A;  3OT7 A;  1SER A;  2BSK B;  4FLW A;  3CCQ V;  4UCT A;  4LNU A;  4OXS A;  4MTX A;  2ILM A;  5A2Q N;  1RP3 B;  2QM8 A;  4Z1V A;  4ZOL A;  1NBM G;  2HR3 A;  1VQN V;  3GWK C;  2HLD G;  2CTW A;  3ASO C;  3SJQ C;  2QE7 G;  1Y66 A;  4FLV A;  1FXV A;  2JJ2 G;  1OCZ B;  1K8A W;  2BTQ A;  1WP7 A;  2PYJ A;  5IJ9 A;  2PI4 A;  1IBL O;  2YEV A;  4Q20 A;  3JAW B;  4JAV A;  4X8A A;  1H2M A;  4JYA B;  2EIJ B;  1U96 A;  4ASU G;  5L3B A;  1DF4 A;  3H1I H;  4UCS A;  4CH3 A;  3K9A A;  4JI1 O;  3B77 A;  3T4D A;  3B8M A;  2PY5 A;  1FFT B;  2YI8 A;  4CH5 A;  4KXR A;  4RO2 A;  1P84 F;  4X1I B;  5H9C A;  3JD0 A;  4LWS B;  2WLH A;  3T2M A;  3T1H B;  5JJE B;  1FD9 A;  1B6Q A;  4JI4 B;  1Y74 B;  4LF4 B;  3P3P A;  1ZTE A;  3H1H H;  4U3J A;  2RN9 A;  1VQ9 V;  3RBZ A;  4D7S A;  1GH6 A;  2JEU A;  1DGS A;  3MHS C;  1GM7 A;  3SPI A;  5K1P A;  5B1O A;  3OR6 C;  3AG1 C;  4NTY A;  2OIE A;  1N4C A;  4DV7 B;  1NZ6 A;  1WLE A;  2UXD O;  3SR2 C;  3W7U A;  1XNQ O;  4JI5 O;  3QNE A;  1XMQ O;  3HKD A;  3LDC A;  3CRR A;  1I5Y A;  3ABM C;  2Q73 A;  5LXT B;  1IX9 A;  4ZHQ B;  2ETN A;  4I4T B;  1H2L A;  1OCR C;  1RPO A;  1Q86 W;  3OFN G;  4JI8 B;  1VQ6 V;  1S0V A;  1PL4 A;  3CEI A;  3ASO B;  2N05 A;  4PEL A;  4JTD B;  1H38 A;  2RMK B;  3FB7 C;  1FFX A;  3K5O A;  3THO A;  1EZJ A;  5DM6 V;  2DQ0 A;  4HZ3 A;  2CGO A;  2EIL C;  1K7D A;  1TUB A;  5IYD O;  5DEC A;  2EIK C;  3JAL A;  4NB5 A;  1OCC C;  3AK3 A;  2ZM6 O;  2ZR2 A;  1JR9 A;  2GUZ B;  1ZWI C;  1WJZ A;  3CRQ A;  4TV9 A;  5L3D A;  4MSW C;  1M90 W;  1I0H A;  2BCC H;  4DR2 O;  3ZHV A;  1KC8 W;  1N32 O;  4IIJ B;  1IBM B;  4O2B B;  3CMA V;  4I55 A;  2QWR B;  3WB1 A;  1KMI Z;  4JI3 B;  5IJ0 B;  1Q8I A;  3C90 A;  5CA3 A;  2XHB A;  4HBN A;  3JSL A;  3CC7 V;  2QEX V;  4I7Z B;  3CWB H;  2UUA O;  3CE2 A;  1EN4 A;  5DED A;  3L75 H;  4ZIB A;  5EYP A;  3G67 A;  4YXW G;  4JAA A;  3ZBH A;  5IE9 A;  1QU7 A;  4WFE A;  1JMK C;  1WP8 A;  3AG1 B;  4FM1 A;  2LFR A;  3APQ A;  3L71 H;  5B1A C;  3PJS K;  5HFL A;  4R50 A;  2W6I G;  4QJF B;  5KMG A;  4NXN O;  2AW9 A;  5EZY A;  2E75 B;  4TUY B;  4GZR B;  2ZDI A;  3UQ8 A;  4OX9 B;  4QPJ A;  5IT9 N;  3ABM B;  2AGA A;  2IBZ H;  4HNA B;  3CD6 V;  5BMV A;  3OMA B;  3ZMV A;  1CXZ B;  4PI2 A;  3ZHT A;  1Q82 W;  4CS4 A;  2P06 A;  1OCR B;  1LNQ A;  3CC2 V;  4K0K B;  2WLN A;  3AG2 C;  1PV0 A;  4I0X B;  4TV8 A;  2A79 B;  2B1G A;  2EIL B;  2EIK B;  1OCC B;  1XUQ A;  3FKS G;  2Q4P A;  4JPR A;  1VQP V;  1S5J A;  3X2Q C;  4F4L A;  3TCU A;  5IYB O;  1NR7 A;  1HR0 O;  2ZNI A;  4FLY A;  2W6J G;  5LOV A;  2IJJ A;  2P22 C;  2ZXW C;  1JVM A;  4QGP A;  3SYP A;  1AI7 A;  4LF8 O;  1BL8 A;  3DSQ A;  1W2B U;  1AJP A;  4O4I A;  4I50 A;  2XTA A;  4IYI A;  4X65 B;  5JH7 B;  2HJF C;  2IJH A;  4TWK A;  4CS2 A;  2ZE6 A;  2OCC C;  4EB6 A;  1NQT A;  3CHX A;  3UO3 A;  3RN4 A;  3K08 A;  5B1A B;  5FPO A;  1FXK A;  1FJG O;  2BOC C;  2ZE7 A;  2YIB D;  3LNM B;  1HDJ A;  1Z5W A;  3I56 V;  5C8Y B;  1SA0 B;  2OWO A;  4BIO A;  4NVP A;  4JYA O;  3ML0 A;  2YC0 A;  4P9P A;  2DQ3 A;  5IY5 C;  3DC6 A;  2B5U A;  5B66 Z;  1JOY A;  4DV0 B;  2MW2 B;  4DW0 A;  2NLJ C;  4GX1 A;  2ITC C;  1Q7Y W;  3CRA A;  1QBZ A;  3CYO A;  3AG2 B;  3C3T A;  4BAY A;  4JYC A;  2Q8V A;  1Q90 D;  4MTG A;  3FFQ A;  1ORQ C;  3A0H Z;  2O57 A;  4LF4 O;  4MW3 A;  1KP2 A;  2D3O W;  5FNV B;  4KHP B;  1OCO C;  4GKJ B;  2Q7E A;  1Q43 A;  3GWO A;  4FFB A;  3X2Q B;  3D36 A;  2N74 A;  4UVA A;  2QA4 V;  1QNM A;  1N8R W;  3E22 A;  4DV7 O;  1K34 A;  5JQG A;  1FAF A;  4L8J A;  1NH2 B;  5KX5 B;  2ZXW B;  2Q7G A;  3CP1 A;  5C93 A;  1JPX A;  5CA1 B;  5EBL C;  5B1N A;  3OEH G;  2UXC O;  2LW1 A;  4O4L A;  4XDL A;  3R65 A;  3I5D A;  4X1K A;  1YI2 V;  4AQY B;  3IGA C;  2OCC B;  1QVG U;  5KAI Z;  4JI8 O;  3RVY A;  4NKG B;  5KAF Z;  3E86 A;  1AR4 A;  1NKD A;  1YJN V;  5LA6 B;  3SYA A;  4BW9 A;  1FXH A;  2DMX A;  1P7G A;  3SYO A;  4P30 A;  5H2F Z;  4P2Z A;  3H1L H;  2H8P C;  1FYJ A;  2LGW A;  5KA6 A;  3CPW U;  1BT8 A;  1JQ0 A;  1HNW B;  3RYC A;  2WSS G;  2R9I A;  5JCO C;  1S77 D;  1GN6 A;  3L74 H;  3MDS A;  1YEW A;  4G27 B;  4F6R A;  3M99 B;  2F95 B;  4J80 A;  1IBM O;  3ZHR A;  5KHG A;  3LUT B;  1XOU A;  1ZX3 A;  4JI7 B;  5EC1 C;  3LSU A;  5IYC O;  2ZR3 A;  4YJ2 A;  2ZQM A;  1F51 A;  3FAV A;  4FVM A;  1WPB A;  1OCO B;  2UUB O;  1UPG A;  4LFA B;  2Q0A A;  2ODM A;  5LL6 Y;  2YXH A;  1SZX A;  3E8B A;  5CB4 B;  3OTO O;  1YJW V;  2F43 G;  1LUV A;  1ZL8 A;  1MA1 A;  3QO5 A;  1K4C C;  1ZSP A;  4WF9 V;  1VQO V;  2WA3 A;  4OX9 O;  4K35 A;  2QKS A;  5KUM A;  2OCH A;  1W0J G;  4DXW A;  1BQZ A;  3U10 A;  4B7K A;  1QLN A;  4NR1 A;  2B1I A;  2A7W A;  3N2K B;  4K0K O;  3CRM A;  3ABL C;  4LR3 A;  1Q5O A;  2DYS C;  5BZB A;  2L6L A;  2LFS A;  2E5L O;  2DN9 A;  1P4R A;  1HNZ B;  5KA5 A;  5E79 Z;  1SKV A;  3TJT A;  1K5S A;  5L3G A;  3K5M A;  1J5E B;  4GUN A;  2FML A;  5LYJ A;  3B4S A;  4W4K A;  1PM9 A;  3K0G A;  4WFA V;  1ROP A;  4CZZ A;  4NYK A;  1NT2 B;  5J2T B;  2JGD B;  3CJH B;  1RFY A;  3N2G A;  4GX2 A;  4GT1 A;  3BAB A;  2WLL B;  4P9O A;  1FPO A;  2OIG A;  1HNX O;  2OT5 A;  1BMF G;  5HFM A;  2CTR A;  1YF2 A;  3JAK B;  3VQY A;  3EVK A;  4LFC B;  2M7W A;  1M57 C;  2FYU H;  2XAG A;  1NJI W;  4JV5 B;  4H37 A;  1JFF A;  2V1D A;  1P7B A;  4JZG A;  3BVO A;  4DUZ B;  3L70 H;  3RT3 C;  2PZS A;  3RYI A;  2LQT A;  2QM4 A;  3VOU A;  5JJJ B;  2BTO A;  3E83 A;  4MTO A;  5IJ9 B;  3NXS A;  3RYF A;  1R3J C;  1TA8 A;  1GM8 A;  4PA4 A;  3P3N A;  1IXM A;  4QNH B;  3APO A;  1PKX A;  1DK1 A;  2CTP A;  4JTC B;  1VF6 C;  1GN2 A;  4MVZ A;  1PD3 A;  3E8H A;  1MMM A;  1XNR B;  1SET A;  1I5X A;  1G6U A;  1V9P A;  2DYS B;  4O4J A;  2Z0A A;  1LUW A;  1R3K C;  4IHJ A;  4LF6 O;  1Y67 A;  3I55 V;  4ZI7 B;  5D5Q A;  3QVN A;  1Y4M A;  3H1J H;  4IGG A;  4KHP O;  1VQL V;  2E3C A;  4CS3 A;  1IBK B;  4MS2 A;  2AHZ A;  5LGN A;  3O65 A;  4XDK A;  2X7R B;  1VQ4 V;  1VAR A;  1VF5 B;  3ZMS A;  4XBF A;  2IJK A;  1PPJ H;  3VQX A;  3HKD B;  1AR5 A;  1SQQ H;  4LH7 A;  4J42 A;  3ZRV A;  3F7Y C;  3AEI A;  2JK5 C;  3UT5 A;  3A0B Z;  2QJ1 A;  2V4D A;  4J9Y B;  1AIL A;  1MZF A;  3UM7 A;  5H5N A;  1OZ0 A;  2EJ7 A;  1M57 B;  2AHY A;  2JS5 A;  1Q6H A;  3FYE B;  1RSO A;  1SS3 A;  4LF7 B;  3JAT A;  3W7X A;  2OTL V;  3CXC U;  5GON B;  4AI8 A;  3B2E E;  4WBN A;  4PJ0 Z;  2OYQ A;  1FS0 G;  1HNW O;  4RAI A;  3ZED A;  4TV9 B;  2WLM A;  1XI1 A;  4DYL A;  4FLT A;  3ABU A;  3JSN A;  2ZE8 A;  3EXA A;  1YJ9 V;  1AJQ A;  1GN3 A;  3DXR A;  3WU2 Z;  2BSK A;  1I94 B;  4PV1 B;  3LNN A;  2LO1 A;  3HKB B;  2W0F C;  1MSD A;  1M93 A;  4FJC C;  4B3R B;  1TVK B;  2WLI B;  5LP6 C;  3ZN1 A;  4GKK O;  2WA4 A;  1VQ8 V;  4MVR A;  4LFA O;  2YXL A;  4MVM A;  1AI6 A;  5J2U B;  1AP5 A;  4RQF A;  1COW G;  4DR7 B;  5IWA B;  3JAW A;  3ZN0 A;  5K1X A;  1S76 D;  4PDR A;  5LHH A;  4BWA A;  3P30 A;  4DR6 B;  1YTF B;  5LMN B;  3GVM A;  2JGU A;  4X62 B;  3P32 A;  1AVM A;  3SJB C;  3Q4H B;  4X1I A;  2WWW A;  4ICG A;  4JI0 B;  3DGE A;  4LWS A;  1NI8 A;  3K04 A;  2QM7 A;  1KP3 A;  4X64 B;  4DK1 A;  4JYB A;  1WNS A;  1M5I A;  1HNZ O;  3HKE B;  2P67 A;  1MAB G;  5L3E A;  2VWJ A;  1J5E O;  1EBO A;  4TOI A;  1K33 A;  1MOF A;  1SC5 B;  4OPH A;  1KB9 F;  1YTF D;  3FD9 A;  5JVD B;  4PA7 A;  3JD4 A;  5IYZ B;  3JAM N;  3CCU V;  2PYL A;  3SPJ A;  5FL7 G;  1V55 C;  1JCH A;  4JGS A;  1QR8 A;  3LSQ A;  3OUS A;  2DWE C;  4OPA A;  1XRE A;  4JZ2 A;  4ZHQ A;  2L35 A;  2F23 A;  4I4T A;  2Q5Z A;  3OD4 A;  4WFH A;  2Y48 A;  4O2A B;  4LFC O;  1NVP B;  4KL1 A;  4JV5 O;  1KKC A;  3QG5 A;  5LP6 B;  3E35 A;  3LSS A;  2CDY A;  2IW5 A;  2P6J A;  4NXM O;  4DK0 A;  3RVZ A;  5FPR A;  2YID A;  4J9Z B;  4UVC A;  3KCX A;  2XND G;  1CP9 A;  3JAR B;  4I5S A;  4DV5 O;  2GUZ A;  4PI0 A;  4TSF G;  1NVP D;  2EZO A;  4OGQ B;  2XT9 A;  4UFZ A;  2Q6A A;  1H2S B;  1XNR O;  4RUF A;  4IIJ A;  4MVO A;  5EK0 A;  3KKY A;  1H8E G;  1KBH A;  1ARO P;  3E8G A;  5IJ0 A;  2PUS A;  4LP8 A;  1R1B A;  4H0L B;  2VQE B;  2HHH B;  3HKC B;  4CC5 A;  1YIT V;  1BGY H;  1AI4 A;  3G80 A;  4JI6 B;  1XMO B;  2FTK A;  1QVF U;  2P5O A;  2X6C A;  4FMT A;  3RYH A;  1QCE A;  2LW7 A;  2YXY A;  1WB8 A;  1IBK O;  4FFK A;  1VQK V;  2DWD C;  5L3F A;  5EC2 C;  1B04 A;  2N04 A;  4UCR A;  1V55 B;  5GW7 A;  3K58 A;  1AI5 A;  4TUY A;  1HW7 A;  1K92 A;  5CA0 B;  3B09 A;  2CAZ C;  2KG7 B;  4HNA A;  3SJC C;  1IZ3 A;  1X4T A;  4YJ3 B;  2GHY A;  3CCE V;  3CC4 V;  3JAS B;  3L9D A;  1K9M W;  2FKX A;  4MTF A;  3OUF A;  2Q68 A;  4PA6 A;  4TQD A;  1N36 B;  4O4H B;  4I0X A;  3F5T A;  4EFB A;  1R73 A;  4LF7 O;  3AK1 A;  3NR7 A;  1K73 W;  4PDL A;  1F4M A;  2F1M A;  3T1H O;  2HJD A;  4BIZ A;  4JI4 O;  1KD1 W;  3RGB A;  4DV3 B;  3ZCC A;  1L1F A;  2LGQ A;  1H2K A;  2JEX A;  3JD3 A;  3CCV V;  4K3A A;  1SQF A;  1Y76 B;  5B1B C;  2CH7 B;  2E74 B;  2JRI A;  2YUA A;  1VIB A;  4J41 A;  5KLV H;  1XL6 A;  1L0N H;  3EFF K;  4JI2 B;  2V7Q G;  5BXZ A;  4AIL C;  2YIB A;  2VWK A;  2Y4T A;  1XHZ A;  1VQM V;  4RUE A;  5EBM C;  3CXH F;  1I7F A;  1HWY A;  4DV4 B;  1NR1 A;  1RM1 C;  4QE7 A;  5JH7 A;  2FL4 A;  4LF9 B;  1GAX A;  1TAE A;  1NS1 A;  2EBO A;  1PNL A;  2UUC B;  1R6K A;  2DJV A;  2CTQ A;  2NNU A;  1SZT A;  4MT8 A;  1VMG A;  3G71 V;  2CK3 G;  3BCC H;  4LF5 B;  2Q67 A;  4PDV A;  1IVS A;  3KG2 A;  3E89 A;  1IBL B;  3M7M X;  1SA0 A;  5C8Y A;  2IU0 A;  3ZMU A;  5GTI Z;  5IWA O;  4DR7 O;  2WPD G;  1WA8 B;  1QLE C;  3ZRW B;  3H01 A;  2HG5 C;  4RWU A;  1K97 A;  1KYO F;  1SRY A;  1HP8 A;  3ETG A;  1N34 B;  5A9G A;  1SQG A;  4JI0 O;  1GM9 A;  5ITZ B;  1SES A;  3M8A A; 
#chains in the Genus database with same CATH homology
 1PKX A;  4U7O A;  3EHB B;  1MSW D;  1OCR C;  1RPO A;  1Q86 W;  3OFN G;  4JTC B;  1VQ6 V;  1S0V A;  3FYI B;  3JD1 A;  3CCR V;  3ASO B;  4MVZ A;  4PEL A;  4JTD B;  1H38 A;  2EZP A;  1PD3 A;  1Q81 W;  3FB7 C;  3E8H A;  4FK5 C;  2XAS A;  1EZJ A;  5DM6 V;  2DQ0 A;  1SET A;  4HZ3 A;  3E8F A;  2EIL C;  1GTO A;  5B1B B;  1K7D A;  5KUK A;  1I5X A;  5IYD O;  3ZRS A;  4CBC A;  2EIK C;  2DYS B;  1OCC C;  2ZR2 A;  2H94 A;  4UV9 A;  3ZJZ A;  3F5W C;  4XDJ A;  1BHB A;  3IC7 A;  1R3K C;  3OMN B;  1ZWI C;  1GO3 F;  5L3D A;  1PL0 A;  3MHH C;  3I55 V;  3UKM A;  4HAM A;  4QNH B;  1Y4M A;  4MSW C;  2KB1 A;  1M90 W;  1K3E A;  2PI5 A;  4JTA B;  1VQL V;  2X0L A;  1KC8 W;  3IFX A;  3OEE G;  1M1K W;  3ZMZ A;  3AG3 C;  1S3J A;  4MS2 A;  2OTJ V;  3CMA V;  2AHZ A;  5LGN A;  2WAM A;  1RM1 B;  4HYO A;  4XDK A;  2X7R B;  1VQ4 V;  1RPR A;  3SPC A;  4WFF A;  3SYC A;  3SPG A;  5CBG A;  4Z1M G;  2ZD9 A;  3ZMS A;  4XBF A;  5CA3 A;  2IJK A;  3CC7 V;  2QEX V;  2YSU B;  4GX5 A;  4G2K A;  3ZRV A;  4YXW G;  3F7Y C;  3AEI A;  4UXN A;  2JK5 C;  4J9Y B;  2R9R B;  1KEC A;  3UM7 A;  4WFE A;  3AG1 B;  2LFR A;  1OZ0 A;  5B1A C;  1M57 B;  2AHY A;  3PJS K;  1QLE B;  1OHH G;  5HFL A;  3FYE B;  4R50 A;  2W6I G;  4QJF B;  3OAA G;  2LP7 A;  4WCE V;  1R6N A;  1YSC A;  3K0D A;  4PA9 A;  3W7X A;  2OTL V;  2ZDI A;  4QPJ A;  3JCZ A;  3ABM B;  3CXC U;  3CD6 V;  2WLK A;  3BY6 A;  3D3I A;  3OMA B;  3QO7 A;  1TUE B;  3ZMV A;  5B3S C;  3MD0 A;  1FS0 G;  3LDD A;  1Q82 W;  3ASN C;  1OCR B;  1LNQ A;  4RAI A;  3CC2 V;  3F7V C;  1K5Q A;  2WLN A;  3AG2 C;  2WLM A;  3AG4 C;  1XL4 A;  3ABU A;  5L3C A;  3K3W A;  1E79 G;  1YJ9 V;  1AJQ A;  2A79 B;  4BIU A;  2XAF A;  2B1G A;  2DW4 A;  2EIL B;  1H8H G;  4N21 A;  1M56 C;  3K03 A;  2EIK B;  5LHG A;  1OCC B;  3FKS G;  4EKW A;  4JPR A;  1VQP V;  2W0F C;  1R3L C;  4MVQ A;  3X2Q C;  4QE9 A;  4F4L A;  2IH1 C;  1PNM A;  2EIN C;  3TCU A;  1NH2 D;  3ABT A;  4FJC C;  5IYB O;  2GSM B;  1NR7 A;  2W6J G;  3T1C A;  2WLI B;  2YEV B;  3ZN1 A;  1ENV A;  1VQ8 V;  4MVR A;  2IJJ A;  3CCJ V;  2HVK C;  3AG3 B;  2ZXW C;  1JVM A;  3JD2 A;  4R8C A;  3OR7 C;  1AI7 A;  4GCZ A;  3SYP A;  1GKF A;  4MVM A;  3OE7 G;  1AI6 A;  1BL8 A;  1W2B U;  1AJP A;  2UXN A;  1KQS U;  2A0L A;  1JX9 A;  5IY5 B;  4RQF A;  2BOB C;  1COW G;  4X89 A;  2IH3 C;  5LBQ A;  3ZRX A;  2JJ1 G;  3ZN0 A;  2HJF C;  2IJH A;  1S76 D;  4TWK A;  4PDR A;  2OCC C;  5LHH A;  3CCM V;  3P30 A;  3WFV A;  4WFG A;  1NQT A;  1YTF B;  1DF5 A;  3K08 A;  3P32 A;  5EBW C;  5B1A B;  2Z5U A;  2WWW A;  3CCS V;  1R3I C;  4E2L A;  2P7T C;  5CBF A;  1FXK A;  2BOC C;  3B8N A;  3DGE A;  3E2E A;  3LNM B;  3K04 A;  2QM7 A;  3I56 V;  1KP3 A;  3SYQ A;  4JYB A;  3A0R A;  2X6A A;  2Y69 C;  2Z3Y A;  2P67 A;  2WLL A;  1MAB G;  4JAS A;  5L3E A;  1EBO A;  3ML0 A;  4P9P A;  3OW2 U;  2DQ3 A;  3CME V;  1K33 A;  5IY5 C;  4QIW F;  5B3S B;  1MOF A;  1YIJ V;  2B5U A;  1JOY A;  2ZDI C;  3ASN B;  1YTF D;  2NLJ C;  4GX1 A;  5CBH A;  2ITC C;  3STL C;  4PA7 A;  2XOK G;  1Q7Y W;  1QBZ A;  3JD4 A;  3CYO A;  4KUM A;  3AG2 B;  3W7T A;  1GK9 A;  3CCU V;  3AG4 B;  4ZKI A;  3ZRW A;  2XAQ A;  3SPJ A;  4BAY A;  1THZ A;  3QO8 A;  5FL7 G;  3G6E V;  4JYC A;  1V55 C;  3HPL C;  2C2A A;  2WLJ A;  1JCH A;  4MTG A;  1ORQ C;  4JGS A;  1QR8 A;  3LSQ A;  4KFM A;  5LHI A;  4H33 A;  3OUS A;  3WG7 C;  4MW3 A;  1VQ5 V;  3OMI B;  2DWE C;  5IDJ A;  1M56 B;  1KP2 A;  2D3O W;  5LGT A;  1S5H C;  2EIM C;  5H6R A;  1OCO C;  2IU3 A;  3GWO A;  3X2Q B;  3D36 A;  2EIN B;  1CEZ A;  4UVA A;  2QA4 V;  4MW8 A;  4WFH A;  2Y48 A;  1N8R W;  1NVP B;  1BHA A;  1K34 A;  3E35 A;  3LSS A;  5LGU A;  1NH2 B;  2IW5 A;  5J9P C;  2P6J A;  2ZXW B;  3CP1 A;  5C93 A;  3RVZ A;  1JPX A;  5EBL C;  2JIZ G;  5B1N A;  4J9Z B;  3ETE A;  3OEH G;  4XDL A;  3R65 A;  2DYR C;  1CPY A;  4UVC A;  2XND G;  1CP9 A;  1PNK A;  4X88 A;  1YI2 V;  2K1E A;  3OGC C;  4I5S A;  4N23 A;  3IGA C;  3SPH A;  3W7S A;  3STZ C;  2OCC B;  1VQ7 V;  1QVG U;  1OCZ C;  2JDI G;  4TSF G;  3RVY A;  1NVP D;  2EZO A;  3BEH A;  5E1A C;  3E86 A;  4MVU A;  2HVJ C;  1NKD A;  1WPX A;  1YJN V;  1YHQ V;  3K06 A;  1E1Q G;  3SYA A;  2Q6A A;  4LCU C;  1FXH A;  4UUJ C;  1F23 A;  4RUF A;  3SYO A;  4MVO A;  4P30 A;  2EIJ C;  5EK0 A;  1H8E G;  3FB5 C;  4ZBM A;  1ARO P;  3E8G A;  4P2Z A;  3FB8 C;  2H8P C;  5KA6 A;  4LP8 A;  4PDM A;  3CPW U;  4U7N A;  4FIP C;  1JQ0 A;  2Y69 B;  1YIT V;  2WSS G;  2R9I A;  1S77 D;  1AI4 A;  1FXK C;  4L87 A;  1M9N A;  2FTK A;  4G27 B;  1QVF U;  1AJN A;  4G28 B;  3M99 B;  3TET A;  4GX0 A;  2EJR A;  2X6C A;  4PA3 A;  4DO2 A;  4FMT A;  1QCE A;  3K79 A;  3HB3 B;  1VQK V;  1QR9 A;  3ETD A;  1UJW B;  2MK3 A;  3ABK C;  2DWD C;  5CMU A;  5L3F A;  5EC2 C;  3LUT B;  2XAH A;  5GW7 A;  1V55 B;  4PA4 A;  2X6B A;  5EC1 C;  1AI5 A;  1K92 A;  3CCL V;  5IYC O;  3WG7 B;  2ZR3 A;  1AR1 B;  3FB6 C;  2ZQM A;  3G4S V;  1F51 A;  1S72 V;  3ABL B;  2A9H A;  2EIM B;  4QPK A;  1JJ2 U;  1OCO B;  5H6Q A;  2GHY A;  4BW5 A;  2XAJ A;  2HKO A;  3CCE V;  4R6Z A;  2ITD C;  3E8B A;  4I9W A;  3CC4 V;  1DTO A;  1K9M W;  4MTF A;  3OUF A;  1SER A;  1YJW V;  2Q68 A;  4LBE C;  1V54 C;  2F43 G;  4PA6 A;  4KP4 A;  3CCQ V;  4OXS A;  4MTX A;  3QO5 A;  1K4C C;  1R73 A;  2P90 A;  2QM8 A;  3VBB A;  4JAU A;  4WF9 V;  1VQO V;  4PDL A;  1K73 W;  1F4M A;  3LDE A;  2QKS A;  1NBM G;  2Q69 A;  2DYR B;  1E1R G;  2HR3 A;  1VQN V;  5KUM A;  4BIZ A;  2HLD G;  1W0J G;  4DXW A;  3ASO C;  1KD1 W;  3SJQ C;  2QE7 G;  1QLN A;  3ZCC A;  1L1F A;  2JEX A;  1Y66 A;  2B1I A;  4JF3 A;  3JD3 A;  1FXV A;  3CCV V;  2JJ2 G;  3ABL C;  1OCZ B;  5B1B C;  1K8A W;  1H2G A;  3RW0 A;  2PI4 A;  1G8M A;  2DYS C;  5BZB A;  2LFS A;  2WLI A;  2YEV A;  4Q20 A;  1P4R A;  4JAV A;  3JYC A;  4X8A A;  5KA5 A;  1XL6 A;  2EIJ B;  1K5S A;  3EFF K;  5L3G A;  4ASU G;  5L3B A;  2V7Q G;  1F4N A;  1DF4 A;  1W0K G;  4UV8 A;  3K9A A;  3B77 A;  1VQM V;  4RUE A;  5EBM C;  3T4D A;  3B8M A;  1FFT B;  2HFE C;  3K0G A;  4RO2 A;  4WFA V;  1HWY A;  5H9C A;  4LC1 A;  1ROP A;  1FXK B;  1NR1 A;  4CZZ A;  3JD0 A;  1RM1 C;  4QE7 A;  3ZIA G;  2WLH A;  1MG1 A;  3T2M A;  4TT3 G;  1GMG A;  2EBO A;  1B6Q A;  1K4D C;  4GX2 A;  1PNL A;  4GT1 A;  4P9O A;  2WLL B;  1R6K A;  1KKD A;  2NNU A;  4UVB A;  1SZT A;  3ABK B;  4RQE A;  4MT8 A;  2OT5 A;  3G71 V;  2CK3 G;  1VQ9 V;  2Q67 A;  1BMF G;  3RBZ A;  4PDV A;  2JEU A;  2UXX A;  3KG2 A;  3MHS C;  1GM7 A;  5HFM A;  3E89 A;  3W7W A;  3SPI A;  1DLB A;  3ZMT A;  2IU0 A;  3ZMU A;  5B1O A;  4MVS A;  3OR6 C;  3AG1 C;  4FPP A;  2WPD G;  3OM3 B;  2M7W A;  1M57 C;  3DTU B;  4R7C A;  1QLE C;  2XAG A;  3ZRW B;  1NJI W;  3H01 A;  4H37 A;  2HG5 C;  1WLE A;  2IJI A;  1K97 A;  4WFB V;  2V1D A;  1P7B A;  3W7U A;  1SRY A;  3ETG A;  2ATK C;  3QNE A;  3LDC A;  2QTO A;  3VOU A;  1V54 B;  1I5Y A;  3ABM C;  1EFR G;  1GM9 A;  5DN6 G;  3GB7 C;  3E83 A;  1J95 A;  4MTO A;  5CN0 A;  3NXS A;  3TK1 A;  3T4Z A;  1R3J C;  1G4Y B;  1GM8 A;  1SES A;  1IXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...