1GTOA

High resolution structure of a hyperstable helical bundle protein mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
62
structure length
62
Chain Sequence
GTKQEKTALNMARFIRSQTLTLLEKLNELGADEQADICESLHDHADELYRSCLARFGDDGEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ROP
publication title Amino-acid substitutions in a surface turn modulate protein stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
total genus 28
structure length 62
sequence length 62
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1996-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1gtoA00
1PD3A 1RPRA 2IJKA 2IJIA 1F4NA 2GHYA 2IJHA 1GTOA 1F4MA 2IJJA 3K79A 1GMGA 1NKDA 4DO2A 1B6QA 1RPOA 1ROPA
chains in the Genus database with same CATH superfamily
1FFXA 1NQTA 2Q6AA 2GSMB 5HFLA 1OCCB 2RNBA 1PNMA 1GN3A 2HLDG 4PI2A 4MW3A 3ABUA 1K92A 2DYSC 1SERA 4EB6B 3JALA 1XOUA 1SQGA 1QVFU 4N23A 3FAVA 2CDYA 2CAZC 1TAEA 1IX9A 1GO3F 5IDJA 3H1KH 3R66A 1IBMO 1N32O 4DYLA 5KHKA 1YEWA 5JVDB 1KB9F 1S76D 1QCEA 3ZMZA 3CMAV 2ZNIA 2RDCA 1GM9A 2C2AA 4IHJB 3Q4HB 2QM8A 4DV7O 1N33B 4FM0A 2QGNA 2P22C 3LDEA 2Y0PA 3BRCA 1V55B 2LFRA 2EZPA 3HB3B 2H8PC 5EIBC 3CXCU 4DXWA 5IYCO 4PDMA 2DWDC 1QU7A 2IJKA 4MVOA 5GTHZ 1S3JA 2P7TC 4DV6O 1MA1A 1HP8A 1PKXA 2OCCC 4U7NA 1M56B 1Z5WA 1WA8A 2XT9A 4MVSA 3VQYA 4QJFB 2ZM6B 1F51A 2ZCEA 1QR9A 2UXXA 4MTXA 1FD9A 3O65A 2ZNJA 4JI2B 1N8RW 1QLEB 4LFAB 2A7WA 2PTMA 5CA3A 1H2KA 4K8ZA 5KX5A 3JARA 4LF7O 1RP3B 3SYCA 4DV0B 1VQ9V 3LSUA 4X1KA 4UVBA 3HPLC 4DR2O 4O2AA 1HNXO 5IJ9A 2XASA 3OM3B 5JH7B 2R72A 4PHZA 4MVMA 5ITZB 3H1JH 1HNWO 1R6TA 1F7YA 1NR7A 2X7RB 3EXAA 4PA9A 4PDLA 4U3FH 4FIPC 1SRYA 2L6LA 1YTFD 4J41A 3BA9A 1Q3EA 1AI7A 3ZRWB 1SA0A 4JTCB 1VQ5V 1FXKB 2CH7A 3ZHRA 2UUAO 1M93A 2FYUH 4WFEA 4DW0A 1K5QA 1FYJA 5CBGA 1OCOB 3FFQA 1BQ0A 3MHSC 4JF3A 4UVAA 1K34A 5BR8B 3HKBB 1M90W 4DR1O 2N74A 4G28B 3ZRXA 3CXHF 4J7KA 4OX9O 1R3LC 2PY5A 1AJNA 3OMNB 3X2QB 3P32A 2BOCC 4XDKA 1GN4A 1YITV 1LR1A 3N2KA 2GTSA 1VQKV 3EFFK 2QWPB 2AHZA 4EKWA 4BW5A 4YIPA 1GMGA 1Y67A 5B1OA 4BWAA 5IY5B 2MW2B 4YY3O 2YDEA 3ASOC 1ROPA 4KHPO 1IXBA 3J80N 2QR4A 1NH2B 1FJGO 3CCLV 4JI5B 2JS3A 1D2DA 3AEIA 4DR6O 1H8EG 4KP4A 4PDVA 3OD4A 1PNLA 1AR5A 4LF9O 4AHCA 4DUYO 3JAWB 1EBOA 3QTCA 3WB1A 4X20A 2Y0IA 5IYZB 1YJ9V 2E75B 3ETDA 3T1HO 1T5EA 1THZA 1SZXA 1RFYA 2PYLA 4JYCA 3ZHSA 3UQ8A 1ZLZA 5B1BB 5L3BA 3DSQA 1XMQB 1AR1B 3AG4B 2AGAA 4JI0B 4TUYA 3OEEG 1SQFA 1SS3A 2EILB 3L71H 4WFGA 2Q9LA 3AG3B 1IDSA 4YIOA 4MT8A 1ZL8A 3MAQA 4K0KB 4JI7O 1TUBA 3HKCA 5CA0B 3K9AA 4BAYA 5KMGA 4X64O 4J11A 4TV9A 1UJWB 4IGGA 1VEWA 3LDDA 3ETGA 1XL6A 4H33A 3UT5A 1RM1C 4P9PA 2A0LA 1MMMA 4LNUA 1Q8IA 3S3XA 4QIWF 1Y76B 3DXRA 3I56V 1D5NA 1RSOA 4WFFA 5IJ0B 3ZS8C 2JGDB 4CS4A 4X1YA 4I9WA 3CCMV 1KBHA 5CBHA 4IT5A 5JQGB 5K1XA 3ETQA 1SZTA 2OWOA 1H2MA 4F6RA 5F2VO 2JVDA 4I55A 1Q86W 1QQCA 3AG7A 3D36C 2PYJA 1TA8A 2WSSG 4O4HB 3ZIAG 1N32B 1FFXB 4P9OA 1IBMB 2PI4A 1JR9A 3K0DA 4Z1MG 2XAGA 1XNQO 5BY1A 4GKKO 3CCJV 1XILA 1F4MA 4DV7B 2XAQA 4JAUA 3JALB 1VQ7V 2GV9A 1V9PA 1OJHA 1NKDA 3FAVB 3SJAC 4I9QA 2ODMA 3K0GA 2QSAA 3F5TA 3GVMA 3I5DA 4PD4F 2YI9A 1SKVA 3E35A 4KXRA 3F5WC 4DV6B 1YF2A 4GLXA 1DTOA 4YXWG 4O2BA 2ILMA 1S5JA 3IC7A 2ETNA 2GUZB 2EZOA 4DV4O 2F93B 4PA7A 3E8BA 3JYCA 3ICXA 5B5EZ 2HVKC 4FZ0A 2PGGA 3JASA 5H9CA 4HNAA 4NTXA 4O4IA 2NN4A 1SESA 2JS5A 3MHHC 4LF7B 4K35A 4J10A 4XDJA 1CPYA 1FPOA 1WA8B 4B3RO 2OYQA 3SJQC 4DR2B 1HNXB 1SQVH 2ZR2A 1SQBH 1HNWB 1G1XB 1GN6A 4GKJO 3DGEA 3SYQA 1LNQA 4DR3O 5DECA 1KECA 1Q6UA 4YJ3B 5KX5B 3JARB 2EINC 3JD2A 1S0VA 4X1KB 2ADQB 5IJ9B 4DW1A 3HKEA 3T1YO 1L0LH 3AG1B 2KQXA 2LFSA 2IW5A 3OR7C 3WG7C 4U7OA 1O9HA 4RUEA 5IWAO 4LF5O 2Z3YA 4DR1B 3W7XA 1I08A 2KB1A 1M57B 3ASNB 4LCUC 4OX9B 1PD3A 2XAFA 4ICGA 1XHZA 2EIKC 2MK3A 1VQMV 4CH5A 1SA0B 1AI4A 1EZJA 1AROP 2CH7B 5JCOA 3IC9A 2Y69B 2OT5A 3D8CA 5B1AC 3IGAC 5LXTA 3SR2C 3SJCC 4NTWA 2ZE5A 1GN2A 5EZYA 1HWYA 2ZDIA 3H01A 1S77D 4P30A 2CTQA 2EX3A 2EIJB 2QM4A 2WLKA 2DYRB 2LP7A 4W4KA 3IAYA 4YY3B 1SC5B 1VQLV 1R1BA 4KHPB 1BCCH 2AHYA 5B3SB 4JYAO 1FJGB 5LP6C 1PPJH 2DW4A 1Y6XA 4DR6B 1N0NA 1OCZC 4LF9B 1S5HC 4DUYB 2KG7A 2JEXA 1KU9A 2IU0A 1CEZA 1B6QA 1Y4MA 2YC0A 2WAMA 2OTJV 4X65O 4FFKA 3JAMN 1OCCC 4OPAA 2AZ2A 3G71V 1IXMA 4ZI7A 3CRMA 3A0RA 4P2ZA 3K79A 2WWWA 2PI5A 3E8HA 1QNMA 4NKGB 3K5OA 4GX0A 2G38A 2BCCH 4O4LA 2ZE7A 4X20B 2JJ2G 4B3SO 4RUFA 2D2CB 4JI7B 1Q7YW 1G4YB 1M4UA 1GKFA 2FMLA 4BIZA 1K33A 1OHHG 4FLWA 1PM9A 5LGUA 3FYEB 3SYPA 1V55C 1UFIA 1X4TA 3OTFA 4X64B 4MTGA 3BA8A 1IBLO 4J42A 4QPKA 5KHJA 4X1IA 1XBLA 4TUYB 4R6ZA 4UCRA 2EIMB 5FNVA 2UXDO 2QM7A 3K3WA 3OUSA 2D3OW 3JSNA 1ZL8B 2XOKG 2Z5UA 2HEPA 2LGQA 3QO5A 1W2BU 1TUBB 3ZBHA 3LSQA 3K5MA 1WJZA 5KMGB 2OCHA 1EN4A 3RYIA 2CE4A 1QHTA 5K1PA 1QLEC 1R73A 1M9NA 3FX7A 2UXCB 2ZXWB 1HW7A 4UVCA 3UT5B 5EBWC 1KC8W 5GONA 1VF5B 4LNUB 3CC2V 4RQFA 4CZZA 2UXBO 3K59A 4UXNA 3FB6C 3L9DA 1K3EA 1G6UA 1MABG 3DXRB 3VQWA 5BZBA 1ZSPA 1YZBA 3CD6V 1RSOB 2XAHA 4EFBA 2ZINA 4I7ZB 1FFTB 4GZRB 1KUQA 3CPWU 4X1YB 3RW0A 2PUSA 4Z1VA 1XNQB 4GKKB 3G6EV 4LF6O 1QBZA 4JYYA 3OGCC 4MVQA 1VIBA 1VMGA 2YIBD 1L1FA 4U3JB 4EEQA 4F6RB 2QTOA 1FXKC 4I55B 2RQ6A 2YI8A 4PELA 4LH6A 1VQ6V 1PNKA 2M7WA 1TVKA 2WPDG 1OCOC 2FB5A 2WLIA 4B3TO 3AG2B 1VQ8V 4DV1O 2QE7G 4ZHQA 3SYOA 1BQZA 1DK1A 2P4KA 3D3QA 4QGPA 4DV4B 3X2QC 4JGSA 3TK1A 3IJ4A 3H1HH 3CYOA 1IBKO 3ABKB 4ZIBA 5GW7A 1GH6A 5BXZA 1K9MW 5KHHA 2V7QG 2VQEO 3RBZA 1FAFA 1ZUQA 5L3GA 1GK9A 3B77A 1JCHA 1BE3H 1BHBA 1YTFB 3L74H 1XQ8A 3SPCA 3RYFA 3K08A 5IY5C 3TGUH 4TSFG 2YSUB 4FM1A 2YXYA 3JASB 2ZE8A 3N2GA 4HNAB 4FFBA 5J2UA 4O4IB 5EIBD 1ZAUA 4GKJB 1D5AA 4DR3B 1JX9A 1Z5VA 3L75H 4FLZA 3RFRA 2R9RB 2R9IA 3CHXA 2F4VO 4BR6A 1PL4A 3M99B 3I55V 3K06A 4GT1A 1EFRG 3T1YB 1I7FA 3U11A 1BZKA 2GBOA 3QF7A 1CP9A 4GUNA 4X8AA 2HHHO 2UXNA 1N0JA 3QO8A 1B06A 5IWAB 1N36O 2Q4PA 4LF5B 2IU3A 5B1BC 2CUGA 1GRJA 5L3DA 1M1KW 3AG4C 2ITCC 3VBBA 2EILC 2LGWA 1MZFA 3HKEB 3AG3C 2P4VA 2JJ1G 2QA4V 1V54B 4E2LA 1A32A 1U96A 3LNMB 5CB4A 2P67A 1YCIA 1KQSU 3JCZA 5BMVA 1Q43A 5LOVA 2LJ2A 3C90A 1XNRO 1BSMA 4JAAA 1H2GA 3WU2Z 2QKCA 3ZRVA 1O9GA 3JATB 1GM7A 4K8XA 2B1GA 3BABA 2Y48A 3KG2A 3P3PA 4I4TA 5H6QA 2WLMA 5LXTB 4JYAB 4MVRA 5J9PC 4DV3O 4HYOA 2YS8A 4UCVA 1YI2V 5EZYB 2W0XA 1AR4A 5CBFA 2ADPA 3OT7A 1R3JC 4X65B 4BW9A 2IH1C 3JAKA 1MSDA 4ZOLA 1VQNV 2FL4A 3OAAG 1W0KG 1H2SB 5D5PA 3E8GA 2DOSA 4WFHA 2XHBA 3MDSA 1OZ0A 1OV9A 2VS0A 4JZ2A 4J7JA 3N27A 2XUMA 2KG7B 2Q68A 4FMTA 3ZMUA 3OR6C 4OPHA 4B3SB 2EJRA 5IE9A 3TXQA 1CXZB 3NXSA 4IIJB 3HKDA 4H0LB 4UCTA 4WFAV 5EC2C 4ZI7B 5C8YA 2YXLA 1M5IA 1NS1A 3ASOB 3D3IA 2DJVA 5LMNO 2JGUA 1SQPH 4PA6A 2EJ7A 1VF6A 1IBLB 2KKWA 3TCUA 3RYCA 3VQXA 4H44B 2IJJA 4FM2A 2Q67A 1GM8A 4UCUA 4DK1A 3RYHB 4JAVA 1PV0A 3T2MA 5LA6A 2UXDB 1MOFA 2ZR3A 3IFXA 2BSKA 5H5NA 4CS2A 2LQTA 2UUBO 1LUVA 2F23A 3ZCCA 3Q4HA 2YIBA 1QVGU 4WF9V 5FLXN 1P7GA 3K5NA 4X1IB 1VP7A 4PA3A 1I94O 2H94A 2R9AA 5FNVB 3T4DA 4BIUA 3K9SA 2GDSA 4LC1A 3L70H 5L3EA 5IYDO 1K4CC 3SJBC 4J7ZA 2UXBB 1QLNA 4TQFA 3CCUV 1XEQA 2UUCO 2YUAA 3M7MX 4FLVA 2Q0OC 3ZN1A 1FS0G 3RYIB 3LNNA 4JI3O 3HR0A 3E86A 3SPIA 3APQA 4LFCO 5KAIZ 2ZIMA 4R7CA 2JEUA 1E1QG 4H13B 5DEDA 3W7WA 4LF6B 4UCSA 4HAMA 1P4RA 2YEVA 3A0BZ 2Q73A 5B1NA 1H2LA 2F1MA 4MS2A 3K03A 3BHPA 4C7UA 5ITZA 1H8HG 4B3TB 2DMXA 1L8DA 3A2FA 3CCEV 4DV1B 3NR7A 1M57C 3ASNC 1MZEA 5KHIA 4JI4O 5H6RA 3UO3A 5A9GA 2HR3A 1IBKB 2NNUA 4I50A 2Y69C 4LF8O 3ABMB 1TVKB 1WB8A 1X59A 4I5SA 2WLIB 3W7TA 5J2TA 2Q5ZA 3RN4A 3QG5A 1BS3A 4ZHQB 2EIJC 1HDJA 4CC5A 2DYRC 4RWUA 4UV9A 4NXNO 3QVNA 2GTAA 2Q0AA 4LF4O 2DQ3A 4ASUG 4FVMA 1NJIW 4AI8A 3OE7G 4LH7A 3U10A 2HKOA 4O2AB 4R50A 5B3SC 1IURA 4LBEC 2HJFC 1WLEA 2UUAB 3DC6A 3OEHG 4A5UB 2ZKOA 4NTYA 4LR3A 1US6A 5BR8O 3KCXA 3BY6A 4LFBO 1Q90D 2JRIA 2F4VB 1B04A 3CX5F 3TETA 2IJIA 2WA4A 3RYFB 2WLHA 5JJJB 1MG1A 3EHBB 2VWJA 3N2GB 2HHHB 4FFBB 5J2UB 4D6TH 3J7AU 3G4SV 2AZ0A 1N36B 1XHXA 3FB5C 3ZHTA 5EYPA 2WLLA 1YVWA 2JIZG 2BTQA 4CH3A 2CTWA 3MD0A 2WLNA 3CJHA 3GWKC 5DN6G 3B2EE 4X62O 3SDLA 2AXTZ 1HNZO 4JI6O 1K73W 3N2KB 4NXMO 1XNRB 1Y74A 1URFA 3OGIB 2YICA 2VQFO 2EIMC 3STLC 1AJQA 4FLYA 2AW9A 4DV2O 4BIOA 4B7EA 3T1HB 2EULA 1K4DC 5CB4B 4B3MO 1HR0O 4DV3B 5BMVB 1S72V 3WG7B 5LOVB 1OCRB 3BCCH 2Z0AA 4DRXA 1DF4A 4MVUA 2QKAA 5CA1A 3E2EA 1NBMG 2ZXWC 3FYIB 3ZN0A 1VQPV 2X6BA 3G67A 3H1IH 4TT3G 1WPBA 4I4TB 3BPZA 4YJ2A 3ABLB 4UCOA 3SPHA 3UCSC 3BVOA 1PL0A 2N05A 2P90A 4K0KO 2P06A 3ETEA 3E22A 1KP2A 1TGOA 1GTOA 3CSXA 1ZWIC 2HG5C 1YJWV 3FB8C 3B40A 1YXBA 1Q81W 1NVPD 3JAKB 4ZOLB 4AILC 4W4LA 4WFBV 4AQYO 1M56C 1W59A 1EM1A 5LGNA 5LMNB 3OTOO 3ABTA 1NTZH 4NR1A 4Z2WA 4XDLA 4IYHA 1NTKH 3HKCB 4D7TA 4IYIA 4CS3A 4LWSA 3ZX6A 2HP8A 3CRRA 3P30A 5KUKA 4TV9B 3HKDB 5LYJA 3AG2C 2BTOA 5AG2A 5C8YB 5IYBO 4XBFA 3OW2U 5KHGA 2UUBB 2JDIG 1H2NA 3CRAA 5LL6Y 1XMOO 5LHHA 3ABKC 2X6AA 1W0JG 4JZGA 3RYCB 1ORQC 4OGQB 1I94B 3LDCA 1PP9H 5LA6B 4G2KA 5JJEB 2ZE6A 2BSKB 1SF9A 3R65A 1WN7A 2W6IG 1IVSA 2H3OA 1YSCA 4B08A 1NU1H 4DR4O 2UUCB 2GUZA 5D5QA 4JPRA 4O4JA 5H2FZ 2ZQMA 1N34O 2GHYA 3A0HZ 3UM7A 3STZC 4JI3B 3ZJZA 4LFCB 3D36A 2IBZH 1FXHA 5DM6V 5KUMA 3A8TA 4DR7O 3FD9A 3L73H 2DYSB 3GWOA 1K5SA 4JASA 4WBNA 3WB2A 1JA8A 1R3KC 2Q7GA 4RQEA 2QWRB 3GB7C 4JI4B 2OTLV 4YJ3A 4D7SA 4O2BB 3CEIA 2YEVB 4B3RB 1F23A 2IM9A 3E8FA 4K3AA 1V54C 5LMUO 4LF8B 5TISZ 5E79Z 4RO2A 4NB5A 4WCEV 5A2QN 2BE3A 3LSSA 2QJ1A 1J95A 1SQQH 2N04A 4UUJC 4NXNB 1Z2GA 3KCYA 4J9ZB 4LF4B 3QNEA 1AI5A 2OCCB 3ZHVA 5JCOC 2A79B 4I50B 3EVKA 2Q8VA 3JSLA 2Y4TA 1NZ6A 4TOIA 1AI6A 5KAFZ 2XAJA 4EFEA 4E4EA 5J2TB 1F4NA 1N4CA 4OXSA 2ZDIC 2M6YA 2RMKB 4LFBB 1TUEB 3SGIA 3ZHQA 2YIAA 1JFFA 3JD0A 4DV5O 1P49A 2QWQB 4GYCB 2ZIOA 1COWG 4YHHO 1J5EO 2CGOA 2CTPA 4X66O 2NLJC 3RWRD 2F95B 4PJ0Z 5JWPA 1AP5A 4FLUA 1AP6A 5KA5A 3JD4A 3RT3C 5B66Z 4JI1O 3THOA 4I0XA 3CC4V 3J81N 2B1IA 1BHAA 1Q5OA 4RAIA 4X62B 3UO2A 3VQVA 2ATKC 2ARHA 4JV5O 3CRQA 1P84F 4L87A 2KSDA 1HNZB 2YIDA 1KKDA 4JI6B 3OUFA 1LUWA 4JTAB 1VQOV 5EYPB 2RCVA 1NH2D 4NXMB 4NYKA 2WLLB 4DR5O 3CC7V 2BTQB 1U97A 4B7KA 4JI8O 1KMIZ 1P7BA 2K1EA 2VQFB 3CJHB 1R6NA 4DUZO 4X9QA 1WB7A 1YJNV 1VARA 5HFMA 2QTSA 4KFMA 4DV2B 3CCRV 3OFNG 1KD1W 3U0ZA 4FK5C 1BT8A 3W7SA 4B3MB 1HR0B 2UU9O 4UFZA 4MW8A 4TV8A 2CTRA 3P3NA 2IH3C 3K58A 5FPRA 1Y74B 4ZKIA 3CE2A 5LP6A 5L3CA 5FPOA 2LW1A 3ZEDA 5IT9N 3ZHUA 4HBNA 2QDOA 2YXHA 3RYHA 2B9ZA 3B8NA 3ZMSA 3RVYA 1KYOF 1FXVA 3DTUB 2DN9A 5KA6A 2WLJA 2E5LO 4EB6A 4GCZA 2Q7EA 2E3CA 4FJCC 4DRXB 5CA1B 3LUTB 1IZ3A 2QEXV 1Q6IA 3JD1A 2RJZA 4O4LB 1EZVH 1WP7A 5LGTA 1K7DA 1R6KA 4YJ2B 4PDRA 4AQYB 4F6EA 1WP8A 2LO1A 5JVDA 1NT2B 3OTOB 5EBMC 3E22B 1JMKC 2Y4UA 3CWBH 4J80A 4H37A 3FKSG 4IHJA 3PJSK 1JJ2U 3AK3A 4PI0A 5LHGA 4PV1B 1ZTEA 3CS5A 3OMIB 5KLVH 3RVZA 2UXCO 2K9PA 1H38A 4Q20A 3OMAB 4PA4A 2XTAA 4X88A 5LBQA 2JK5C 5E1AC 1YIJV 5GTIZ 2Q69A 4G27B 4UB8Z 3B09A 1AJPA 1XMOB 1VF7A 4U3JA 1BGYH 3H1LH 1N33O 3ABMC 1WNSA 4LWSB 4DK0A 2F66C 1Q6HA 3AK1A 5LYJB 4QNHB 3ZMTA 4JTDB 4TWKA 1R3IC 3JD3A 1BMFG 2CGNA 1UPGA 3C3SA 3ML0A 3TJTA 5GONB 1RM1B 1K97A 1KP3A 3T4ZA 2HJDA 4DR4B 1L0NH 2LW7A 1N34B 4FLTA 4QPJA 1B3QA 1DGSA 3WFVA 5LHIA 4CH6A 2ZM6O 3AG1C 3M8AA 1XL4A 5JJNB 1Q82W 5JH7A 1NR1A 4JI2O 2VWKA 1AILA 3F7YC 4LFAO 3BFRA 3FB7C 2V1DA 1JVMA 1BL8A 4DR7B 5CN0A 4DV0O 1JOYA 4O4JB 1XI1A 3ZRWA 1JJOA 2A3QA 1RPRA 5EC1C 1FXKA 1ZX3A 4CC6A 1AVMA 2VQEB 3E83A 3WB0A 2F43G 3K57A 3HKBA 4ZBMA 4NVPA 4ABMA 2WA3A 2X6CA 3CMEV 4KL1A 5LMUB 4L8JA 5FL7G 3K04A 3UKMA 2A06H 4WBNB 3W7UA 5CMUA 1EN6A 4KUMA 2DWEC 4Q6GA 4TQDA 1EN5A 4DO2A 4FPPA 1DF5A 2E76B 2ITDC 2IJHA 3H9VA 3L72H 2FTKA 1I5XA 4R8CA 1DLBA 3O9OA 1SQXH 2B5UA 2HVJC 3TXSA 4MTOA 4JYBA 3E89A 3SPJA 4FLXA 2E74B 4IL6Z 1OCRC 1WAZA 2W6JG 1S5LZ 1K8AW 2OIEA 4MVZA 2QWOB 4DV5B 4MTFA 4QE7A 2QWNB 3JAWA 3JATA 1SETA 4YHHB 3ABLC 1XREA 1J5EB 2EBOA 5IYZA 4X66B 3CB2A 1XUQA 2P6JA 2FKXA 3BAAA 1AB3A 3VOUA 3K5LA 3B8MA 2ZT9B 3F7VC 4JI1B 1YHQV 4CBCA 3T1CA 2QKSA 4JI5O 3SYAA 2ZD9A 3PN1A 1JFFB 2PZSA 2P5OA 1FKAO 5EBLC 2R70A 3KKYA 1NTMH 2EINB 2V4DA 4JV5B 3ZMVA 2RN9A 1WPXA 2HFEC 4FZ1A 4HZ3A 4GX5A 5EK0A 3CP1A 1G8MA 4GX2A 2NR5A 2CK3G 1E1RG 3APOA 1E79G 3C3TA 2OIGA 2VRZA 4DR5B 4I0XB 2BOBC 4UV8A 3SPGA 2W0FC 4JI8B 1I5YA 5CA0A 4DUZB 3JCUZ 1XMQO 4IIJA 3CRCA 4JI0O 3KZIZ 5C93A 3CCQV 2EIKB 1YDXA 3DC5A 2DE0X 1QR8A 2UU9B 4QE9A 1MNGA 4N21A 4X89A 1JQ0A 2DQ0A 1VF6C 4J9YB 3S3WA 1KKCA 1NI8A 5B1AB 1XDCA 3CCSV 1Y66A 3AK2A 5L3FA 3QO7A 1Y76A 2A9HA 2O57A 5IJ0A 3RGBA 1NVPB 2L35A 4UB6Z 3B4SA 1GAXA 2X0LA 2JGDA 1MSWD 4MSWC 3CCVV 3G80A 3G6BA 4F4LA 5JQGA 1ENVA 4TV8B 2PF4E 2E5LB 1RPOA 2XNDG 4LP8A 5LP6B 1VQ4V 1OCZB 4GX1A 4CH4A 1JPXA 3BEHA 4O4HA 1I0HA 2Q7HA 3ZRSA
chains in the Genus database with same CATH topology
2IW5A 1NQTA 2Q6AA 2XAJA 3IFXA 3OR7C 3WG7C 1F4NA 4U7OA 2GSMB 5HFLA 4OXSA 2ZDIC 1OCCB 4RUEA 1PNMA 2HLDG 4MW3A 3ABUA 1K92A 2Z3YA 2DYSC 1TUEB 3ZCCA 3W7XA 1SERA 2KB1A 1M57B 3JD0A 3ASNB 4LCUC 1QVGU 1PD3A 4WF9V 2XAFA 1COWG 2EIKC 1QVFU 2MK3A 4N23A 1VQMV 1AI4A 4PA3A 1EZJA 1AROP 1GO3F 2H94A 5IDJA 2NLJC 3T4DA 4BIUA 2Y69B 2OT5A 5B1AC 3IGAC 4LC1A 5KA5A 5L3EA 5IYDO 1S76D 1QCEA 3JD4A 1K4CC 3ZMZA 3CMAV 1QLNA 1GM9A 1HWYA 2C2AA 2ZDIA 3H01A 4P30A 3CCUV 2QM8A 3CC4V 1S77D 2EIJB 2B1IA 1BHAA 2WLKA 3LDEA 2DYRB 1V55B 2LFRA 2EZPA 2LP7A 3HB3B 3ZN1A 1FS0G 4RAIA 2H8PC 3CXCU 4DXWA 2ATKC 5IYCO 4PDMA 3E86A 3SPIA 1VQLV 2DWDC 4L87A 2AHYA 5B3SB 2IJKA 4R7CA 1KKDA 2JEUA 4MVOA 1E1QG 3OUFA 4JTAB 1S3JA 1VQOV 2P7TC 3W7WA 1NH2D 2DW4A 1PKXA 2OCCC 2WLLB 1OCZC 4U7NA 4HAMA 1M56B 3CC7V 1P4RA 2YEVA 1P7BA 1S5HC 2K1EA 4MVSA 2JEXA 2IU0A 5B1NA 4QJFB 1R6NA 1F51A 1CEZA 4MS2A 1QR9A 1B6QA 1Y4MA 2UXXA 2WAMA 3K03A 1YJNV 4MTXA 5HFMA 2OTJV 4KFMA 3CCRV 3OFNG 1KD1W 1OCCC 4FK5C 1H8HG 3G71V 1N8RW 1IXMA 3A0RA 3W7SA 1QLEB 4P2ZA 4MW8A 5CA3A 3CCEV 3K79A 1M57C 2WWWA 2PI5A 3ASNC 3E8HA 5H6RA 2IH3C 4GX0A 3SYCA 1VQ9V 4ZKIA 4UVBA 3HPLC 5L3CA 2HR3A 2JJ2G 2NNUA 2Y69C 2XASA 3ABMB 3OM3B 4I5SA 4MVMA 4RUFA 2WLIB 3W7TA 3B8NA 3ZMSA 3RVYA 1Q7YW 1G4YB 1NR7A 1FXVA 2X7RB 2EIJC 1GKFA 3DTUB 4BIZA 1K33A 4PA9A 1OHHG 5KA6A 2WLJA 4PDLA 2DYRC 4FIPC 3FYEB 4GCZA 3SYPA 1V55C 4FJCC 5LGUA 4UV9A 1SRYA 3LUTB 1YTFD 2QEXV 2DQ3A 3JD1A 4ASUG 1NJIW 4MTGA 3OE7G 4QPKA 1AI7A 3ZRWB 4JTCB 2HKOA 4R50A 5B3SC 5LGTA 1VQ5V 4LBEC 1FXKB 1K7DA 1R6KA 1WLEA 2HJFC 4R6ZA 2EIMB 4PDRA 4WFEA 1K5QA 2QM7A 3K3WA 3OUSA 3OEHG 2D3OW 5CBGA 1OCOB 2XOKG 2Z5UA 3MHSC 4JF3A 4UVAA 5EBMC 1K34A 3BY6A 3QO5A 1M90W 4G28B 4H37A 1W2BU 3FKSG 3PJSK 3ZRXA 1JJ2U 3LSQA 3TETA 2IJIA 1R3LC 2WLHA 1AJNA 5LHGA 3OMNB 1MG1A 3OMIB 1QLEC 1R73A 3EHBB 3RVZA 1M9NA 3X2QB 2ZXWB 3P32A 4UVCA 1H38A 4Q20A 3OMAB 2BOCC 4PA4A 5EBWC 4X88A 4XDKA 2JK5C 5E1AC 5LBQA 1YIJV 1YITV 3G4SV 1KC8W 2Q69A 4G27B 3FB5C 3CC2V 1AJPA 1VQKV 2WLLA 4RQFA 4CZZA 3EFFK 4UXNA 2JIZG 3FB6C 2AHZA 4EKWA 1K3EA 3MD0A 1MABG 3ABMC 5BZBA 4BW5A 2WLNA 3CD6V 2XAHA 1GMGA 5B1OA 5DN6G 1FFTB 5IY5B 4QNHB 3ZMTA 3CPWU 3ASOC 4JTDB 4TWKA 1R3IC 1ROPA 3RW0A 3JD3A 1BMFG 3ML0A 1K73W 1NH2B 1RM1B 3G6EV 1KP3A 1K97A 1QBZA 3T4ZA 3CCLV 3AEIA 3OGCC 1H8EG 4KP4A 4MVQA 4PDVA 1PNLA 1L1FA 2QTOA 1FXKC 4QPJA 1EBOA 3WFVA 5LHIA 2EIMC 3STLC 3AG1C 4PELA 1AJQA 1VQ6V 1PNKA 1XL4A 2M7WA 1Q82W 1YJ9V 2WPDG 1OCOC 1NR1A 3ETDA 2WLIA 1K4DC 1THZA 3F7YC 3FB7C 3AG2B 1VQ8V 2V1DA 1JVMA 2QE7G 3SYOA 3WG7B 1S72V 1BL8A 1OCRB 4JYCA 1DF4A 4MVUA 5CN0A 3E2EA 1JOYA 1NBMG 3X2QC 5B1BB 2ZXWC 5L3BA 3FYIB 3ZN0A 1AR1B 2X6BA 4JGSA 1VQPV 3TK1A 3ZRWA 3CYOA 3AG4B 3ABKB 1RPRA 5GW7A 5EC1C 1FXKA 3OEEG 4TT3G 1K9MW 3ABLB 3SPHA 2EILB 4WFGA 2V7QG 3AG3B 3RBZA 1PL0A 3E83A 4MT8A 2P90A 5L3GA 1GK9A 3ETEA 2F43G 3B77A 1KP2A 1JCHA 4ZBMA 1BHBA 1GTOA 1YTFB 1ZWIC 2X6CA 3SPCA 3CMEV 3K08A 5IY5C 3K9AA 2HG5C 4BAYA 1YJWV 4TSFG 2YSUB 3FB8C 3K04A 5FL7G 3UKMA 3W7UA 5CMUA 1UJWB 1Q81W 4KUMA 1NVPD 2DWEC 3LDDA 3ETGA 1XL6A 4H33A 4DO2A 1RM1C 4FPPA 4P9PA 1DF5A 4WFBV 2A0LA 2ITDC 2IJHA 1M56C 5LGNA 3ABTA 1JX9A 2FTKA 1I5XA 4XDLA 2R9RB 4QIWF 1DLBA 4R8CA 2R9IA 3I56V 3M99B 3I55V 3K06A 2B5UA 2HVJC 4GT1A 4WFFA 4MTOA 1EFRG 3P30A 5KUKA 4JYBA 3AG2C 1CP9A 3E89A 4X8AA 3SPJA 4I9WA 3CCMV 2UXNA 3QO8A 1OCRC 5CBHA 5IYBO 2W6JG 4XBFA 3OW2U 1K8AW 2JDIG 1SZTA 4MVZA 2IU3A 5B1BC 5L3DA 1M1KW 5LHHA 3AG4C 2ITCC 3ABKC 4MTFA 2X6AA 4QE7A 3VBBA 1W0JG 1SETA 1Q86W 3ABLC 2EILC 1ORQC 2EBOA 3AG3C 2JJ1G 3LDCA 2QA4V 1V54B 4E2LA 2P6JA 4G2KA 2WSSG 3LNMB 3ZIAG 4P9OA 3VOUA 2PI4A 3B8MA 3R65A 2P67A 2W6IG 1KQSU 3K0DA 3F7VC 3JCZA 4Z1MG 1YHQV 4CBCA 2XAGA 3T1CA 1YSCA 2QKSA 3CCJV 3SYAA 2ZD9A 1F4MA 1H2GA 2XAQA 4JPRA 3ZRVA 2ZQMA 4JAUA 5EBLC 1VQ7V 2GHYA 1GM7A 1NKDA 2B1GA 3UM7A 3STZC 2EINB 2Y48A 3KG2A 3K0GA 3ZMVA 3ZJZA 1WPXA 2HFEC 4HZ3A 4GX5A 5H6QA 3D36A 5EK0A 2WLMA 1G8MA 3CP1A 3E35A 4GX2A 3F5WC 4MVRA 5J9PC 4HYOA 2CK3G 1E1RG 1E79G 1YI2V 1FXHA 1DTOA 4YXWG 5DM6V 5KUMA 5CBFA 2BOBC 4UV8A 3SPGA 2W0FC 3IC7A 1I5YA 2DYSB 3GWOA 1K5SA 2EZOA 1R3JC 4PA7A 4JASA 3E8BA 3JYCA 2HVKC 5C93A 3CCQV 2EIKB 2IH1C 5H9CA 1VQNV 1R3KC 1QR8A 3OAAG 4RQEA 4QE9A 1W0KG 4N21A 4X89A 1JQ0A 2DQ0A 3GB7C 1SESA 3E8GA 4J9YB 3MHHC 4WFHA 2OTLV 5B1AB 3CCSV 1OZ0A 1Y66A 5L3FA 4XDJA 3QO7A 2YEVB 1CPYA 1F23A 3E8FA 3SJQC 2Q68A 1V54C 2A9HA 4FMTA 3ZMUA 3OR6C 2EJRA 4RO2A 3NXSA 1NVPB 2X0LA 4WFAV 4WCEV 1MSWD 2ZR2A 4MSWC 5EC2C 3CCVV 3LSSA 1J95A 4F4LA 1ENVA 3ASOB 3DGEA 3SYQA 1LNQA 3D3IA 4UUJC 1KECA 4PA6A 1RPOA 4J9ZB 2EINC 2XNDG 4LP8A 3JD2A 3QNEA 1AI5A 1S0VA 2OCCB 3TCUA 1VQ4V 1OCZB 2IJJA 2Q67A 1GM8A 4GX1A 2A79B 1JPXA 4JAVA 3T2MA 3BEHA 1MOFA 3AG1B 1AI6A 2LFSA 2ZR3A 3ZRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PD3 A;  1RPR A;  2IJK A;  2IJI A;  1F4N A;  2GHY A;  2IJH A;  1GTO A;  1F4M A;  2IJJ A;  3K79 A;  1GMG A;  1NKD A;  4DO2 A;  1B6Q A;  1RPO A;  1ROP A; 
#chains in the Genus database with same CATH topology
 1FFX A;  1NQT A;  2Q6A A;  2GSM B;  5HFL A;  1OCC B;  2RNB A;  1PNM A;  1GN3 A;  2HLD G;  4PI2 A;  4MW3 A;  3ABU A;  1K92 A;  2DYS C;  1SER A;  4EB6 B;  3JAL A;  1XOU A;  1SQG A;  1QVF U;  4N23 A;  3FAV A;  2CDY A;  2CAZ C;  1TAE A;  1IX9 A;  1GO3 F;  5IDJ A;  3H1K H;  3R66 A;  1IBM O;  1N32 O;  4DYL A;  5KHK A;  1YEW A;  5JVD B;  1KB9 F;  1S76 D;  1QCE A;  3ZMZ A;  3CMA V;  2ZNI A;  2RDC A;  1GM9 A;  2C2A A;  4IHJ B;  3Q4H B;  2QM8 A;  4DV7 O;  1N33 B;  4FM0 A;  2QGN A;  2P22 C;  3LDE A;  2Y0P A;  3BRC A;  1V55 B;  2LFR A;  2EZP A;  3HB3 B;  2H8P C;  5EIB C;  3CXC U;  4DXW A;  5IYC O;  4PDM A;  2DWD C;  1QU7 A;  2IJK A;  4MVO A;  5GTH Z;  1S3J A;  2P7T C;  4DV6 O;  1MA1 A;  1HP8 A;  1PKX A;  2OCC C;  4U7N A;  1M56 B;  1Z5W A;  1WA8 A;  2XT9 A;  4MVS A;  3VQY A;  4QJF B;  2ZM6 B;  1F51 A;  2ZCE A;  1QR9 A;  2UXX A;  4MTX A;  1FD9 A;  3O65 A;  2ZNJ A;  4JI2 B;  1N8R W;  1QLE B;  4LFA B;  2A7W A;  2PTM A;  5CA3 A;  1H2K A;  4K8Z A;  5KX5 A;  3JAR A;  4LF7 O;  1RP3 B;  3SYC A;  4DV0 B;  1VQ9 V;  3LSU A;  4X1K A;  4UVB A;  3HPL C;  4DR2 O;  4O2A A;  1HNX O;  5IJ9 A;  2XAS A;  3OM3 B;  5JH7 B;  2R72 A;  4PHZ A;  4MVM A;  5ITZ B;  3H1J H;  1HNW O;  1R6T A;  1F7Y A;  1NR7 A;  2X7R B;  3EXA A;  4PA9 A;  4PDL A;  4U3F H;  4FIP C;  1SRY A;  2L6L A;  1YTF D;  4J41 A;  3BA9 A;  1Q3E A;  1AI7 A;  3ZRW B;  1SA0 A;  4JTC B;  1VQ5 V;  1FXK B;  2CH7 A;  3ZHR A;  2UUA O;  1M93 A;  2FYU H;  4WFE A;  4DW0 A;  1K5Q A;  1FYJ A;  5CBG A;  1OCO B;  3FFQ A;  1BQ0 A;  3MHS C;  4JF3 A;  4UVA A;  1K34 A;  5BR8 B;  3HKB B;  1M90 W;  4DR1 O;  2N74 A;  4G28 B;  3ZRX A;  3CXH F;  4J7K A;  4OX9 O;  1R3L C;  2PY5 A;  1AJN A;  3OMN B;  3X2Q B;  3P32 A;  2BOC C;  4XDK A;  1GN4 A;  1YIT V;  1LR1 A;  3N2K A;  2GTS A;  1VQK V;  3EFF K;  2QWP B;  2AHZ A;  4EKW A;  4BW5 A;  4YIP A;  1GMG A;  1Y67 A;  5B1O A;  4BWA A;  5IY5 B;  2MW2 B;  4YY3 O;  2YDE A;  3ASO C;  1ROP A;  4KHP O;  1IXB A;  3J80 N;  2QR4 A;  1NH2 B;  1FJG O;  3CCL V;  4JI5 B;  2JS3 A;  1D2D A;  3AEI A;  4DR6 O;  1H8E G;  4KP4 A;  4PDV A;  3OD4 A;  1PNL A;  1AR5 A;  4LF9 O;  4AHC A;  4DUY O;  3JAW B;  1EBO A;  3QTC A;  3WB1 A;  4X20 A;  2Y0I A;  5IYZ B;  1YJ9 V;  2E75 B;  3ETD A;  3T1H O;  1T5E A;  1THZ A;  1SZX A;  1RFY A;  2PYL A;  4JYC A;  3ZHS A;  3UQ8 A;  1ZLZ A;  5B1B B;  5L3B A;  3DSQ A;  1XMQ B;  1AR1 B;  3AG4 B;  2AGA A;  4JI0 B;  4TUY A;  3OEE G;  1SQF A;  1SS3 A;  2EIL B;  3L71 H;  4WFG A;  2Q9L A;  3AG3 B;  1IDS A;  4YIO A;  4MT8 A;  1ZL8 A;  3MAQ A;  4K0K B;  4JI7 O;  1TUB A;  3HKC A;  5CA0 B;  3K9A A;  4BAY A;  5KMG A;  4X64 O;  4J11 A;  4TV9 A;  1UJW B;  4IGG A;  1VEW A;  3LDD A;  3ETG A;  1XL6 A;  4H33 A;  3UT5 A;  1RM1 C;  4P9P A;  2A0L A;  1MMM A;  4LNU A;  1Q8I A;  3S3X A;  4QIW F;  1Y76 B;  3DXR A;  3I56 V;  1D5N A;  1RSO A;  4WFF A;  5IJ0 B;  3ZS8 C;  2JGD B;  4CS4 A;  4X1Y A;  4I9W A;  3CCM V;  1KBH A;  5CBH A;  4IT5 A;  5JQG B;  5K1X A;  3ETQ A;  1SZT A;  2OWO A;  1H2M A;  4F6R A;  5F2V O;  2JVD A;  4I55 A;  1Q86 W;  1QQC A;  3AG7 A;  3D36 C;  2PYJ A;  1TA8 A;  2WSS G;  4O4H B;  3ZIA G;  1N32 B;  1FFX B;  4P9O A;  1IBM B;  2PI4 A;  1JR9 A;  3K0D A;  4Z1M G;  2XAG A;  1XNQ O;  5BY1 A;  4GKK O;  3CCJ V;  1XIL A;  1F4M A;  4DV7 B;  2XAQ A;  4JAU A;  3JAL B;  1VQ7 V;  2GV9 A;  1V9P A;  1OJH A;  1NKD A;  3FAV B;  3SJA C;  4I9Q A;  2ODM A;  3K0G A;  2QSA A;  3F5T A;  3GVM A;  3I5D A;  4PD4 F;  2YI9 A;  1SKV A;  3E35 A;  4KXR A;  3F5W C;  4DV6 B;  1YF2 A;  4GLX A;  1DTO A;  4YXW G;  4O2B A;  2ILM A;  1S5J A;  3IC7 A;  2ETN A;  2GUZ B;  2EZO A;  4DV4 O;  2F93 B;  4PA7 A;  3E8B A;  3JYC A;  3ICX A;  5B5E Z;  2HVK C;  4FZ0 A;  2PGG A;  3JAS A;  5H9C A;  4HNA A;  4NTX A;  4O4I A;  2NN4 A;  1SES A;  2JS5 A;  3MHH C;  4LF7 B;  4K35 A;  4J10 A;  4XDJ A;  1CPY A;  1FPO A;  1WA8 B;  4B3R O;  2OYQ A;  3SJQ C;  4DR2 B;  1HNX B;  1SQV H;  2ZR2 A;  1SQB H;  1HNW B;  1G1X B;  1GN6 A;  4GKJ O;  3DGE A;  3SYQ A;  1LNQ A;  4DR3 O;  5DEC A;  1KEC A;  1Q6U A;  4YJ3 B;  5KX5 B;  3JAR B;  2EIN C;  3JD2 A;  1S0V A;  4X1K B;  2ADQ B;  5IJ9 B;  4DW1 A;  3HKE A;  3T1Y O;  1L0L H;  3AG1 B;  2KQX A;  2LFS A;  2IW5 A;  3OR7 C;  3WG7 C;  4U7O A;  1O9H A;  4RUE A;  5IWA O;  4LF5 O;  2Z3Y A;  4DR1 B;  3W7X A;  1I08 A;  2KB1 A;  1M57 B;  3ASN B;  4LCU C;  4OX9 B;  1PD3 A;  2XAF A;  4ICG A;  1XHZ A;  2EIK C;  2MK3 A;  1VQM V;  4CH5 A;  1SA0 B;  1AI4 A;  1EZJ A;  1ARO P;  2CH7 B;  5JCO A;  3IC9 A;  2Y69 B;  2OT5 A;  3D8C A;  5B1A C;  3IGA C;  5LXT A;  3SR2 C;  3SJC C;  4NTW A;  2ZE5 A;  1GN2 A;  5EZY A;  1HWY A;  2ZDI A;  3H01 A;  1S77 D;  4P30 A;  2CTQ A;  2EX3 A;  2EIJ B;  2QM4 A;  2WLK A;  2DYR B;  2LP7 A;  4W4K A;  3IAY A;  4YY3 B;  1SC5 B;  1VQL V;  1R1B A;  4KHP B;  1BCC H;  2AHY A;  5B3S B;  4JYA O;  1FJG B;  5LP6 C;  1PPJ H;  2DW4 A;  1Y6X A;  4DR6 B;  1N0N A;  1OCZ C;  4LF9 B;  1S5H C;  4DUY B;  2KG7 A;  2JEX A;  1KU9 A;  2IU0 A;  1CEZ A;  1B6Q A;  1Y4M A;  2YC0 A;  2WAM A;  2OTJ V;  4X65 O;  4FFK A;  3JAM N;  1OCC C;  4OPA A;  2AZ2 A;  3G71 V;  1IXM A;  4ZI7 A;  3CRM A;  3A0R A;  4P2Z A;  3K79 A;  2WWW A;  2PI5 A;  3E8H A;  1QNM A;  4NKG B;  3K5O A;  4GX0 A;  2G38 A;  2BCC H;  4O4L A;  2ZE7 A;  4X20 B;  2JJ2 G;  4B3S O;  4RUF A;  2D2C B;  4JI7 B;  1Q7Y W;  1G4Y B;  1M4U A;  1GKF A;  2FML A;  4BIZ A;  1K33 A;  1OHH G;  4FLW A;  1PM9 A;  5LGU A;  3FYE B;  3SYP A;  1V55 C;  1UFI A;  1X4T A;  3OTF A;  4X64 B;  4MTG A;  3BA8 A;  1IBL O;  4J42 A;  4QPK A;  5KHJ A;  4X1I A;  1XBL A;  4TUY B;  4R6Z A;  4UCR A;  2EIM B;  5FNV A;  2UXD O;  2QM7 A;  3K3W A;  3OUS A;  2D3O W;  3JSN A;  1ZL8 B;  2XOK G;  2Z5U A;  2HEP A;  2LGQ A;  3QO5 A;  1W2B U;  1TUB B;  3ZBH A;  3LSQ A;  3K5M A;  1WJZ A;  5KMG B;  2OCH A;  1EN4 A;  3RYI A;  2CE4 A;  1QHT A;  5K1P A;  1QLE C;  1R73 A;  1M9N A;  3FX7 A;  2UXC B;  2ZXW B;  1HW7 A;  4UVC A;  3UT5 B;  5EBW C;  1KC8 W;  5GON A;  1VF5 B;  4LNU B;  3CC2 V;  4RQF A;  4CZZ A;  2UXB O;  3K59 A;  4UXN A;  3FB6 C;  3L9D A;  1K3E A;  1G6U A;  1MAB G;  3DXR B;  3VQW A;  5BZB A;  1ZSP A;  1YZB A;  3CD6 V;  1RSO B;  2XAH A;  4EFB A;  2ZIN A;  4I7Z B;  1FFT B;  4GZR B;  1KUQ A;  3CPW U;  4X1Y B;  3RW0 A;  2PUS A;  4Z1V A;  1XNQ B;  4GKK B;  3G6E V;  4LF6 O;  1QBZ A;  4JYY A;  3OGC C;  4MVQ A;  1VIB A;  1VMG A;  2YIB D;  1L1F A;  4U3J B;  4EEQ A;  4F6R B;  2QTO A;  1FXK C;  4I55 B;  2RQ6 A;  2YI8 A;  4PEL A;  4LH6 A;  1VQ6 V;  1PNK A;  2M7W A;  1TVK A;  2WPD G;  1OCO C;  2FB5 A;  2WLI A;  4B3T O;  3AG2 B;  1VQ8 V;  4DV1 O;  2QE7 G;  4ZHQ A;  3SYO A;  1BQZ A;  1DK1 A;  2P4K A;  3D3Q A;  4QGP A;  4DV4 B;  3X2Q C;  4JGS A;  3TK1 A;  3IJ4 A;  3H1H H;  3CYO A;  1IBK O;  3ABK B;  4ZIB A;  5GW7 A;  1GH6 A;  5BXZ A;  1K9M W;  5KHH A;  2V7Q G;  2VQE O;  3RBZ A;  1FAF A;  1ZUQ A;  5L3G A;  1GK9 A;  3B77 A;  1JCH A;  1BE3 H;  1BHB A;  1YTF B;  3L74 H;  1XQ8 A;  3SPC A;  3RYF A;  3K08 A;  5IY5 C;  3TGU H;  4TSF G;  2YSU B;  4FM1 A;  2YXY A;  3JAS B;  2ZE8 A;  3N2G A;  4HNA B;  4FFB A;  5J2U A;  4O4I B;  5EIB D;  1ZAU A;  4GKJ B;  1D5A A;  4DR3 B;  1JX9 A;  1Z5V A;  3L75 H;  4FLZ A;  3RFR A;  2R9R B;  2R9I A;  3CHX A;  2F4V O;  4BR6 A;  1PL4 A;  3M99 B;  3I55 V;  3K06 A;  4GT1 A;  1EFR G;  3T1Y B;  1I7F A;  3U11 A;  1BZK A;  2GBO A;  3QF7 A;  1CP9 A;  4GUN A;  4X8A A;  2HHH O;  2UXN A;  1N0J A;  3QO8 A;  1B06 A;  5IWA B;  1N36 O;  2Q4P A;  4LF5 B;  2IU3 A;  5B1B C;  2CUG A;  1GRJ A;  5L3D A;  1M1K W;  3AG4 C;  2ITC C;  3VBB A;  2EIL C;  2LGW A;  1MZF A;  3HKE B;  3AG3 C;  2P4V A;  2JJ1 G;  2QA4 V;  1V54 B;  4E2L A;  1A32 A;  1U96 A;  3LNM B;  5CB4 A;  2P67 A;  1YCI A;  1KQS U;  3JCZ A;  5BMV A;  1Q43 A;  5LOV A;  2LJ2 A;  3C90 A;  1XNR O;  1BSM A;  4JAA A;  1H2G A;  3WU2 Z;  2QKC A;  3ZRV A;  1O9G A;  3JAT B;  1GM7 A;  4K8X A;  2B1G A;  3BAB A;  2Y48 A;  3KG2 A;  3P3P A;  4I4T A;  5H6Q A;  2WLM A;  5LXT B;  4JYA B;  4MVR A;  5J9P C;  4DV3 O;  4HYO A;  2YS8 A;  4UCV A;  1YI2 V;  5EZY B;  2W0X A;  1AR4 A;  5CBF A;  2ADP A;  3OT7 A;  1R3J C;  4X65 B;  4BW9 A;  2IH1 C;  3JAK A;  1MSD A;  4ZOL A;  1VQN V;  2FL4 A;  3OAA G;  1W0K G;  1H2S B;  5D5P A;  3E8G A;  2DOS A;  4WFH A;  2XHB A;  3MDS A;  1OZ0 A;  1OV9 A;  2VS0 A;  4JZ2 A;  4J7J A;  3N27 A;  2XUM A;  2KG7 B;  2Q68 A;  4FMT A;  3ZMU A;  3OR6 C;  4OPH A;  4B3S B;  2EJR A;  5IE9 A;  3TXQ A;  1CXZ B;  3NXS A;  4IIJ B;  3HKD A;  4H0L B;  4UCT A;  4WFA V;  5EC2 C;  4ZI7 B;  5C8Y A;  2YXL A;  1M5I A;  1NS1 A;  3ASO B;  3D3I A;  2DJV A;  5LMN O;  2JGU A;  1SQP H;  4PA6 A;  2EJ7 A;  1VF6 A;  1IBL B;  2KKW A;  3TCU A;  3RYC A;  3VQX A;  4H44 B;  2IJJ A;  4FM2 A;  2Q67 A;  1GM8 A;  4UCU A;  4DK1 A;  3RYH B;  4JAV A;  1PV0 A;  3T2M A;  5LA6 A;  2UXD B;  1MOF A;  2ZR3 A;  3IFX A;  2BSK A;  5H5N A;  4CS2 A;  2LQT A;  2UUB O;  1LUV A;  2F23 A;  3ZCC A;  3Q4H A;  2YIB A;  1QVG U;  4WF9 V;  5FLX N;  1P7G A;  3K5N A;  4X1I B;  1VP7 A;  4PA3 A;  1I94 O;  2H94 A;  2R9A A;  5FNV B;  3T4D A;  4BIU A;  3K9S A;  2GDS A;  4LC1 A;  3L70 H;  5L3E A;  5IYD O;  1K4C C;  3SJB C;  4J7Z A;  2UXB B;  1QLN A;  4TQF A;  3CCU V;  1XEQ A;  2UUC O;  2YUA A;  3M7M X;  4FLV A;  2Q0O C;  3ZN1 A;  1FS0 G;  3RYI B;  3LNN A;  4JI3 O;  3HR0 A;  3E86 A;  3SPI A;  3APQ A;  4LFC O;  5KAI Z;  2ZIM A;  4R7C A;  2JEU A;  1E1Q G;  4H13 B;  5DED A;  3W7W A;  4LF6 B;  4UCS A;  4HAM A;  1P4R A;  2YEV A;  3A0B Z;  2Q73 A;  5B1N A;  1H2L A;  2F1M A;  4MS2 A;  3K03 A;  3BHP A;  4C7U A;  5ITZ A;  1H8H G;  4B3T B;  2DMX A;  1L8D A;  3A2F A;  3CCE V;  4DV1 B;  3NR7 A;  1M57 C;  3ASN C;  1MZE A;  5KHI A;  4JI4 O;  5H6R A;  3UO3 A;  5A9G A;  2HR3 A;  1IBK B;  2NNU A;  4I50 A;  2Y69 C;  4LF8 O;  3ABM B;  1TVK B;  1WB8 A;  1X59 A;  4I5S A;  2WLI B;  3W7T A;  5J2T A;  2Q5Z A;  3RN4 A;  3QG5 A;  1BS3 A;  4ZHQ B;  2EIJ C;  1HDJ A;  4CC5 A;  2DYR C;  4RWU A;  4UV9 A;  4NXN O;  3QVN A;  2GTA A;  2Q0A A;  4LF4 O;  2DQ3 A;  4ASU G;  4FVM A;  1NJI W;  4AI8 A;  3OE7 G;  4LH7 A;  3U10 A;  2HKO A;  4O2A B;  4R50 A;  5B3S C;  1IUR A;  4LBE C;  2HJF C;  1WLE A;  2UUA B;  3DC6 A;  3OEH G;  4A5U B;  2ZKO A;  4NTY A;  4LR3 A;  1US6 A;  5BR8 O;  3KCX A;  3BY6 A;  4LFB O;  1Q90 D;  2JRI A;  2F4V B;  1B04 A;  3CX5 F;  3TET A;  2IJI A;  2WA4 A;  3RYF B;  2WLH A;  5JJJ B;  1MG1 A;  3EHB B;  2VWJ A;  3N2G B;  2HHH B;  4FFB B;  5J2U B;  4D6T H;  3J7A U;  3G4S V;  2AZ0 A;  1N36 B;  1XHX A;  3FB5 C;  3ZHT A;  5EYP A;  2WLL A;  1YVW A;  2JIZ G;  2BTQ A;  4CH3 A;  2CTW A;  3MD0 A;  2WLN A;  3CJH A;  3GWK C;  5DN6 G;  3B2E E;  4X62 O;  3SDL A;  2AXT Z;  1HNZ O;  4JI6 O;  1K73 W;  3N2K B;  4NXM O;  1XNR B;  1Y74 A;  1URF A;  3OGI B;  2YIC A;  2VQF O;  2EIM C;  3STL C;  1AJQ A;  4FLY A;  2AW9 A;  4DV2 O;  4BIO A;  4B7E A;  3T1H B;  2EUL A;  1K4D C;  5CB4 B;  4B3M O;  1HR0 O;  4DV3 B;  5BMV B;  1S72 V;  3WG7 B;  5LOV B;  1OCR B;  3BCC H;  2Z0A A;  4DRX A;  1DF4 A;  4MVU A;  2QKA A;  5CA1 A;  3E2E A;  1NBM G;  2ZXW C;  3FYI B;  3ZN0 A;  1VQP V;  2X6B A;  3G67 A;  3H1I H;  4TT3 G;  1WPB A;  4I4T B;  3BPZ A;  4YJ2 A;  3ABL B;  4UCO A;  3SPH A;  3UCS C;  3BVO A;  1PL0 A;  2N05 A;  2P90 A;  4K0K O;  2P06 A;  3ETE A;  3E22 A;  1KP2 A;  1TGO A;  1GTO A;  3CSX A;  1ZWI C;  2HG5 C;  1YJW V;  3FB8 C;  3B40 A;  1YXB A;  1Q81 W;  1NVP D;  3JAK B;  4ZOL B;  4AIL C;  4W4L A;  4WFB V;  4AQY O;  1M56 C;  1W59 A;  1EM1 A;  5LGN A;  5LMN B;  3OTO O;  3ABT A;  1NTZ H;  4NR1 A;  4Z2W A;  4XDL A;  4IYH A;  1NTK H;  3HKC B;  4D7T A;  4IYI A;  4CS3 A;  4LWS A;  3ZX6 A;  2HP8 A;  3CRR A;  3P30 A;  5KUK A;  4TV9 B;  3HKD B;  5LYJ A;  3AG2 C;  2BTO A;  5AG2 A;  5C8Y B;  5IYB O;  4XBF A;  3OW2 U;  5KHG A;  2UUB B;  2JDI G;  1H2N A;  3CRA A;  5LL6 Y;  1XMO O;  5LHH A;  3ABK C;  2X6A A;  1W0J G;  4JZG A;  3RYC B;  1ORQ C;  4OGQ B;  1I94 B;  3LDC A;  1PP9 H;  5LA6 B;  4G2K A;  5JJE B;  2ZE6 A;  2BSK B;  1SF9 A;  3R65 A;  1WN7 A;  2W6I G;  1IVS A;  2H3O A;  1YSC A;  4B08 A;  1NU1 H;  4DR4 O;  2UUC B;  2GUZ A;  5D5Q A;  4JPR A;  4O4J A;  5H2F Z;  2ZQM A;  1N34 O;  2GHY A;  3A0H Z;  3UM7 A;  3STZ C;  4JI3 B;  3ZJZ A;  4LFC B;  3D36 A;  2IBZ H;  1FXH A;  5DM6 V;  5KUM A;  3A8T A;  4DR7 O;  3FD9 A;  3L73 H;  2DYS B;  3GWO A;  1K5S A;  4JAS A;  4WBN A;  3WB2 A;  1JA8 A;  1R3K C;  2Q7G A;  4RQE A;  2QWR B;  3GB7 C;  4JI4 B;  2OTL V;  4YJ3 A;  4D7S A;  4O2B B;  3CEI A;  2YEV B;  4B3R B;  1F23 A;  2IM9 A;  3E8F A;  4K3A A;  1V54 C;  5LMU O;  4LF8 B;  5TIS Z;  5E79 Z;  4RO2 A;  4NB5 A;  4WCE V;  5A2Q N;  2BE3 A;  3LSS A;  2QJ1 A;  1J95 A;  1SQQ H;  2N04 A;  4UUJ C;  4NXN B;  1Z2G A;  3KCY A;  4J9Z B;  4LF4 B;  3QNE A;  1AI5 A;  2OCC B;  3ZHV A;  5JCO C;  2A79 B;  4I50 B;  3EVK A;  2Q8V A;  3JSL A;  2Y4T A;  1NZ6 A;  4TOI A;  1AI6 A;  5KAF Z;  2XAJ A;  4EFE A;  4E4E A;  5J2T B;  1F4N A;  1N4C A;  4OXS A;  2ZDI C;  2M6Y A;  2RMK B;  4LFB B;  1TUE B;  3SGI A;  3ZHQ A;  2YIA A;  1JFF A;  3JD0 A;  4DV5 O;  1P49 A;  2QWQ B;  4GYC B;  2ZIO A;  1COW G;  4YHH O;  1J5E O;  2CGO A;  2CTP A;  4X66 O;  2NLJ C;  3RWR D;  2F95 B;  4PJ0 Z;  5JWP A;  1AP5 A;  4FLU A;  1AP6 A;  5KA5 A;  3JD4 A;  3RT3 C;  5B66 Z;  4JI1 O;  3THO A;  4I0X A;  3CC4 V;  3J81 N;  2B1I A;  1BHA A;  1Q5O A;  4RAI A;  4X62 B;  3UO2 A;  3VQV A;  2ATK C;  2ARH A;  4JV5 O;  3CRQ A;  1P84 F;  4L87 A;  2KSD A;  1HNZ B;  2YID A;  1KKD A;  4JI6 B;  3OUF A;  1LUW A;  4JTA B;  1VQO V;  5EYP B;  2RCV A;  1NH2 D;  4NXM B;  4NYK A;  2WLL B;  4DR5 O;  3CC7 V;  2BTQ B;  1U97 A;  4B7K A;  4JI8 O;  1KMI Z;  1P7B A;  2K1E A;  2VQF B;  3CJH B;  1R6N A;  4DUZ O;  4X9Q A;  1WB7 A;  1YJN V;  1VAR A;  5HFM A;  2QTS A;  4KFM A;  4DV2 B;  3CCR V;  3OFN G;  1KD1 W;  3U0Z A;  4FK5 C;  1BT8 A;  3W7S A;  4B3M B;  1HR0 B;  2UU9 O;  4UFZ A;  4MW8 A;  4TV8 A;  2CTR A;  3P3N A;  2IH3 C;  3K58 A;  5FPR A;  1Y74 B;  4ZKI A;  3CE2 A;  5LP6 A;  5L3C A;  5FPO A;  2LW1 A;  3ZED A;  5IT9 N;  3ZHU A;  4HBN A;  2QDO A;  2YXH A;  3RYH A;  2B9Z A;  3B8N A;  3ZMS A;  3RVY A;  1KYO F;  1FXV A;  3DTU B;  2DN9 A;  5KA6 A;  2WLJ A;  2E5L O;  4EB6 A;  4GCZ A;  2Q7E A;  2E3C A;  4FJC C;  4DRX B;  5CA1 B;  3LUT B;  1IZ3 A;  2QEX V;  1Q6I A;  3JD1 A;  2RJZ A;  4O4L B;  1EZV H;  1WP7 A;  5LGT A;  1K7D A;  1R6K A;  4YJ2 B;  4PDR A;  4AQY B;  4F6E A;  1WP8 A;  2LO1 A;  5JVD A;  1NT2 B;  3OTO B;  5EBM C;  3E22 B;  1JMK C;  2Y4U A;  3CWB H;  4J80 A;  4H37 A;  3FKS G;  4IHJ A;  3PJS K;  1JJ2 U;  3AK3 A;  4PI0 A;  5LHG A;  4PV1 B;  1ZTE A;  3CS5 A;  3OMI B;  5KLV H;  3RVZ A;  2UXC O;  2K9P A;  1H38 A;  4Q20 A;  3OMA B;  4PA4 A;  2XTA A;  4X88 A;  5LBQ A;  2JK5 C;  5E1A C;  1YIJ V;  5GTI Z;  2Q69 A;  4G27 B;  4UB8 Z;  3B09 A;  1AJP A;  1XMO B;  1VF7 A;  4U3J A;  1BGY H;  3H1L H;  1N33 O;  3ABM C;  1WNS A;  4LWS B;  4DK0 A;  2F66 C;  1Q6H A;  3AK1 A;  5LYJ B;  4QNH B;  3ZMT A;  4JTD B;  4TWK A;  1R3I C;  3JD3 A;  1BMF G;  2CGN A;  1UPG A;  3C3S A;  3ML0 A;  3TJT A;  5GON B;  1RM1 B;  1K97 A;  1KP3 A;  3T4Z A;  2HJD A;  4DR4 B;  1L0N H;  2LW7 A;  1N34 B;  4FLT A;  4QPJ A;  1B3Q A;  1DGS A;  3WFV A;  5LHI A;  4CH6 A;  2ZM6 O;  3AG1 C;  3M8A A;  1XL4 A;  5JJN B;  1Q82 W;  5JH7 A;  1NR1 A;  4JI2 O;  2VWK A;  1AIL A;  3F7Y C;  4LFA O;  3BFR A;  3FB7 C;  2V1D A;  1JVM A;  1BL8 A;  4DR7 B;  5CN0 A;  4DV0 O;  1JOY A;  4O4J B;  1XI1 A;  3ZRW A;  1JJO A;  2A3Q A;  1RPR A;  5EC1 C;  1FXK A;  1ZX3 A;  4CC6 A;  1AVM A;  2VQE B;  3E83 A;  3WB0 A;  2F43 G;  3K57 A;  3HKB A;  4ZBM A;  4NVP A;  4ABM A;  2WA3 A;  2X6C A;  3CME V;  4KL1 A;  5LMU B;  4L8J A;  5FL7 G;  3K04 A;  3UKM A;  2A06 H;  4WBN B;  3W7U A;  5CMU A;  1EN6 A;  4KUM A;  2DWE C;  4Q6G A;  4TQD A;  1EN5 A;  4DO2 A;  4FPP A;  1DF5 A;  2E76 B;  2ITD C;  2IJH A;  3H9V A;  3L72 H;  2FTK A;  1I5X A;  4R8C A;  1DLB A;  3O9O A;  1SQX H;  2B5U A;  2HVJ C;  3TXS A;  4MTO A;  4JYB A;  3E89 A;  3SPJ A;  4FLX A;  2E74 B;  4IL6 Z;  1OCR C;  1WAZ A;  2W6J G;  1S5L Z;  1K8A W;  2OIE A;  4MVZ A;  2QWO B;  4DV5 B;  4MTF A;  4QE7 A;  2QWN B;  3JAW A;  3JAT A;  1SET A;  4YHH B;  3ABL C;  1XRE A;  1J5E B;  2EBO A;  5IYZ A;  4X66 B;  3CB2 A;  1XUQ A;  2P6J A;  2FKX A;  3BAA A;  1AB3 A;  3VOU A;  3K5L A;  3B8M A;  2ZT9 B;  3F7V C;  4JI1 B;  1YHQ V;  4CBC A;  3T1C A;  2QKS A;  4JI5 O;  3SYA A;  2ZD9 A;  3PN1 A;  1JFF B;  2PZS A;  2P5O A;  1FKA O;  5EBL C;  2R70 A;  3KKY A;  1NTM H;  2EIN B;  2V4D A;  4JV5 B;  3ZMV A;  2RN9 A;  1WPX A;  2HFE C;  4FZ1 A;  4HZ3 A;  4GX5 A;  5EK0 A;  3CP1 A;  1G8M A;  4GX2 A;  2NR5 A;  2CK3 G;  1E1R G;  3APO A;  1E79 G;  3C3T A;  2OIG A;  2VRZ A;  4DR5 B;  4I0X B;  2BOB C;  4UV8 A;  3SPG A;  2W0F C;  4JI8 B;  1I5Y A;  5CA0 A;  4DUZ B;  3JCU Z;  1XMQ O;  4IIJ A;  3CRC A;  4JI0 O;  3KZI Z;  5C93 A;  3CCQ V;  2EIK B;  1YDX A;  3DC5 A;  2DE0 X;  1QR8 A;  2UU9 B;  4QE9 A;  1MNG A;  4N21 A;  4X89 A;  1JQ0 A;  2DQ0 A;  1VF6 C;  4J9Y B;  3S3W A;  1KKC A;  1NI8 A;  5B1A B;  1XDC A;  3CCS V;  1Y66 A;  3AK2 A;  5L3F A;  3QO7 A;  1Y76 A;  2A9H A;  2O57 A;  5IJ0 A;  3RGB A;  1NVP B;  2L35 A;  4UB6 Z;  3B4S A;  1GAX A;  2X0L A;  2JGD A;  1MSW D;  4MSW C;  3CCV V;  3G80 A;  3G6B A;  4F4L A;  5JQG A;  1ENV A;  4TV8 B;  2PF4 E;  2E5L B;  1RPO A;  2XND G;  4LP8 A;  5LP6 B;  1VQ4 V;  1OCZ B;  4GX1 A;  4CH4 A;  1JPX A;  3BEH A;  4O4H A;  1I0H A;  2Q7H A;  3ZRS A; 
#chains in the Genus database with same CATH homology
 2IW5 A;  1NQT A;  2Q6A A;  2XAJ A;  3IFX A;  3OR7 C;  3WG7 C;  1F4N A;  4U7O A;  2GSM B;  5HFL A;  4OXS A;  2ZDI C;  1OCC B;  4RUE A;  1PNM A;  2HLD G;  4MW3 A;  3ABU A;  1K92 A;  2Z3Y A;  2DYS C;  1TUE B;  3ZCC A;  3W7X A;  1SER A;  2KB1 A;  1M57 B;  3JD0 A;  3ASN B;  4LCU C;  1QVG U;  1PD3 A;  4WF9 V;  2XAF A;  1COW G;  2EIK C;  1QVF U;  2MK3 A;  4N23 A;  1VQM V;  1AI4 A;  4PA3 A;  1EZJ A;  1ARO P;  1GO3 F;  2H94 A;  5IDJ A;  2NLJ C;  3T4D A;  4BIU A;  2Y69 B;  2OT5 A;  5B1A C;  3IGA C;  4LC1 A;  5KA5 A;  5L3E A;  5IYD O;  1S76 D;  1QCE A;  3JD4 A;  1K4C C;  3ZMZ A;  3CMA V;  1QLN A;  1GM9 A;  1HWY A;  2C2A A;  2ZDI A;  3H01 A;  4P30 A;  3CCU V;  2QM8 A;  3CC4 V;  1S77 D;  2EIJ B;  2B1I A;  1BHA A;  2WLK A;  3LDE A;  2DYR B;  1V55 B;  2LFR A;  2EZP A;  2LP7 A;  3HB3 B;  3ZN1 A;  1FS0 G;  4RAI A;  2H8P C;  3CXC U;  4DXW A;  2ATK C;  5IYC O;  4PDM A;  3E86 A;  3SPI A;  1VQL V;  2DWD C;  4L87 A;  2AHY A;  5B3S B;  2IJK A;  4R7C A;  1KKD A;  2JEU A;  4MVO A;  1E1Q G;  3OUF A;  4JTA B;  1S3J A;  1VQO V;  2P7T C;  3W7W A;  1NH2 D;  2DW4 A;  1PKX A;  2OCC C;  2WLL B;  1OCZ C;  4U7N A;  4HAM A;  1M56 B;  3CC7 V;  1P4R A;  2YEV A;  1P7B A;  1S5H C;  2K1E A;  4MVS A;  2JEX A;  2IU0 A;  5B1N A;  4QJF B;  1R6N A;  1F51 A;  1CEZ A;  4MS2 A;  1QR9 A;  1B6Q A;  1Y4M A;  2UXX A;  2WAM A;  3K03 A;  1YJN V;  4MTX A;  5HFM A;  2OTJ V;  4KFM A;  3CCR V;  3OFN G;  1KD1 W;  1OCC C;  4FK5 C;  1H8H G;  3G71 V;  1N8R W;  1IXM A;  3A0R A;  3W7S A;  1QLE B;  4P2Z A;  4MW8 A;  5CA3 A;  3CCE V;  3K79 A;  1M57 C;  2WWW A;  2PI5 A;  3ASN C;  3E8H A;  5H6R A;  2IH3 C;  4GX0 A;  3SYC A;  1VQ9 V;  4ZKI A;  4UVB A;  3HPL C;  5L3C A;  2HR3 A;  2JJ2 G;  2NNU A;  2Y69 C;  2XAS A;  3ABM B;  3OM3 B;  4I5S A;  4MVM A;  4RUF A;  2WLI B;  3W7T A;  3B8N A;  3ZMS A;  3RVY A;  1Q7Y W;  1G4Y B;  1NR7 A;  1FXV A;  2X7R B;  2EIJ C;  1GKF A;  3DTU B;  4BIZ A;  1K33 A;  4PA9 A;  1OHH G;  5KA6 A;  2WLJ A;  4PDL A;  2DYR C;  4FIP C;  3FYE B;  4GCZ A;  3SYP A;  1V55 C;  4FJC C;  5LGU A;  4UV9 A;  1SRY A;  3LUT B;  1YTF D;  2QEX V;  2DQ3 A;  3JD1 A;  4ASU G;  1NJI W;  4MTG A;  3OE7 G;  4QPK A;  1AI7 A;  3ZRW B;  4JTC B;  2HKO A;  4R50 A;  5B3S C;  5LGT A;  1VQ5 V;  4LBE C;  1FXK B;  1K7D A;  1R6K A;  1WLE A;  2HJF C;  4R6Z A;  2EIM B;  4PDR A;  4WFE A;  1K5Q A;  2QM7 A;  3K3W A;  3OUS A;  3OEH G;  2D3O W;  5CBG A;  1OCO B;  2XOK G;  2Z5U A;  3MHS C;  4JF3 A;  4UVA A;  5EBM C;  1K34 A;  3BY6 A;  3QO5 A;  1M90 W;  4G28 B;  4H37 A;  1W2B U;  3FKS G;  3PJS K;  3ZRX A;  1JJ2 U;  3LSQ A;  3TET A;  2IJI A;  1R3L C;  2WLH A;  1AJN A;  5LHG A;  3OMN B;  1MG1 A;  3OMI B;  1QLE C;  1R73 A;  3EHB B;  3RVZ A;  1M9N A;  3X2Q B;  2ZXW B;  3P32 A;  4UVC A;  1H38 A;  4Q20 A;  3OMA B;  2BOC C;  4PA4 A;  5EBW C;  4X88 A;  4XDK A;  2JK5 C;  5E1A C;  5LBQ A;  1YIJ V;  1YIT V;  3G4S V;  1KC8 W;  2Q69 A;  4G27 B;  3FB5 C;  3CC2 V;  1AJP A;  1VQK V;  2WLL A;  4RQF A;  4CZZ A;  3EFF K;  4UXN A;  2JIZ G;  3FB6 C;  2AHZ A;  4EKW A;  1K3E A;  3MD0 A;  1MAB G;  3ABM C;  5BZB A;  4BW5 A;  2WLN A;  3CD6 V;  2XAH A;  1GMG A;  5B1O A;  5DN6 G;  1FFT B;  5IY5 B;  4QNH B;  3ZMT A;  3CPW U;  3ASO C;  4JTD B;  4TWK A;  1R3I C;  1ROP A;  3RW0 A;  3JD3 A;  1BMF G;  3ML0 A;  1K73 W;  1NH2 B;  1RM1 B;  3G6E V;  1KP3 A;  1K97 A;  1QBZ A;  3T4Z A;  3CCL V;  3AEI A;  3OGC C;  1H8E G;  4KP4 A;  4MVQ A;  4PDV A;  1PNL A;  1L1F A;  2QTO A;  1FXK C;  4QPJ A;  1EBO A;  3WFV A;  5LHI A;  2EIM C;  3STL C;  3AG1 C;  4PEL A;  1AJQ A;  1VQ6 V;  1PNK A;  1XL4 A;  2M7W A;  1Q82 W;  1YJ9 V;  2WPD G;  1OCO C;  1NR1 A;  3ETD A;  2WLI A;  1K4D C;  1THZ A;  3F7Y C;  3FB7 C;  3AG2 B;  1VQ8 V;  2V1D A;  1JVM A;  2QE7 G;  3SYO A;  3WG7 B;  1S72 V;  1BL8 A;  1OCR B;  4JYC A;  1DF4 A;  4MVU A;  5CN0 A;  3E2E A;  1JOY A;  1NBM G;  3X2Q C;  5B1B B;  2ZXW C;  5L3B A;  3FYI B;  3ZN0 A;  1AR1 B;  2X6B A;  4JGS A;  1VQP V;  3TK1 A;  3ZRW A;  3CYO A;  3AG4 B;  3ABK B;  1RPR A;  5GW7 A;  5EC1 C;  1FXK A;  3OEE G;  4TT3 G;  1K9M W;  3ABL B;  3SPH A;  2EIL B;  4WFG A;  2V7Q G;  3AG3 B;  3RBZ A;  1PL0 A;  3E83 A;  4MT8 A;  2P90 A;  5L3G A;  1GK9 A;  3ETE A;  2F43 G;  3B77 A;  1KP2 A;  1JCH A;  4ZBM A;  1BHB A;  1GTO A;  1YTF B;  1ZWI C;  2X6C A;  3SPC A;  3CME V;  3K08 A;  5IY5 C;  3K9A A;  2HG5 C;  4BAY A;  1YJW V;  4TSF G;  2YSU B;  3FB8 C;  3K04 A;  5FL7 G;  3UKM A;  3W7U A;  5CMU A;  1UJW B;  1Q81 W;  4KUM A;  1NVP D;  2DWE C;  3LDD A;  3ETG A;  1XL6 A;  4H33 A;  4DO2 A;  1RM1 C;  4FPP A;  4P9P A;  1DF5 A;  4WFB V;  2A0L A;  2ITD C;  2IJH A;  1M56 C;  5LGN A;  3ABT A;  1JX9 A;  2FTK A;  1I5X A;  4XDL A;  2R9R B;  4QIW F;  1DLB A;  4R8C A;  2R9I A;  3I56 V;  3M99 B;  3I55 V;  3K06 A;  2B5U A;  2HVJ C;  4GT1 A;  4WFF A;  4MTO A;  1EFR G;  3P30 A;  5KUK A;  4JYB A;  3AG2 C;  1CP9 A;  3E89 A;  4X8A A;  3SPJ A;  4I9W A;  3CCM V;  2UXN A;  3QO8 A;  1OCR C;  5CBH A;  5IYB O;  2W6J G;  4XBF A;  3OW2 U;  1K8A W;  2JDI G;  1SZT A;  4MVZ A;  2IU3 A;  5B1B C;  5L3D A;  1M1K W;  5LHH A;  3AG4 C;  2ITC C;  3ABK C;  4MTF A;  2X6A A;  4QE7 A;  3VBB A;  1W0J G;  1SET A;  1Q86 W;  3ABL C;  2EIL C;  1ORQ C;  2EBO A;  3AG3 C;  2JJ1 G;  3LDC A;  2QA4 V;  1V54 B;  4E2L A;  2P6J A;  4G2K A;  2WSS G;  3LNM B;  3ZIA G;  4P9O A;  3VOU A;  2PI4 A;  3B8M A;  3R65 A;  2P67 A;  2W6I G;  1KQS U;  3K0D A;  3F7V C;  3JCZ A;  4Z1M G;  1YHQ V;  4CBC A;  2XAG A;  3T1C A;  1YSC A;  2QKS A;  3CCJ V;  3SYA A;  2ZD9 A;  1F4M A;  1H2G A;  2XAQ A;  4JPR A;  3ZRV A;  2ZQM A;  4JAU A;  5EBL C;  1VQ7 V;  2GHY A;  1GM7 A;  1NKD A;  2B1G A;  3UM7 A;  3STZ C;  2EIN B;  2Y48 A;  3KG2 A;  3K0G A;  3ZMV A;  3ZJZ A;  1WPX A;  2HFE C;  4HZ3 A;  4GX5 A;  5H6Q A;  3D36 A;  5EK0 A;  2WLM A;  1G8M A;  3CP1 A;  3E35 A;  4GX2 A;  3F5W C;  4MVR A;  5J9P C;  4HYO A;  2CK3 G;  1E1R G;  1E79 G;  1YI2 V;  1FXH A;  1DTO A;  4YXW G;  5DM6 V;  5KUM A;  5CBF A;  2BOB C;  4UV8 A;  3SPG A;  2W0F C;  3IC7 A;  1I5Y A;  2DYS B;  3GWO A;  1K5S A;  2EZO A;  1R3J C;  4PA7 A;  4JAS A;  3E8B A;  3JYC A;  2HVK C;  5C93 A;  3CCQ V;  2EIK B;  2IH1 C;  5H9C A;  1VQN V;  1R3K C;  1QR8 A;  3OAA G;  4RQE A;  4QE9 A;  1W0K G;  4N21 A;  4X89 A;  1JQ0 A;  2DQ0 A;  3GB7 C;  1SES A;  3E8G A;  4J9Y B;  3MHH C;  4WFH A;  2OTL V;  5B1A B;  3CCS V;  1OZ0 A;  1Y66 A;  5L3F A;  4XDJ A;  3QO7 A;  2YEV B;  1CPY A;  1F23 A;  3E8F A;  3SJQ C;  2Q68 A;  1V54 C;  2A9H A;  4FMT A;  3ZMU A;  3OR6 C;  2EJR A;  4RO2 A;  3NXS A;  1NVP B;  2X0L A;  4WFA V;  4WCE V;  1MSW D;  2ZR2 A;  4MSW C;  5EC2 C;  3CCV V;  3LSS A;  1J95 A;  4F4L A;  1ENV A;  3ASO B;  3DGE A;  3SYQ A;  1LNQ A;  3D3I A;  4UUJ C;  1KEC A;  4PA6 A;  1RPO A;  4J9Z B;  2EIN C;  2XND G;  4LP8 A;  3JD2 A;  3QNE A;  1AI5 A;  1S0V A;  2OCC B;  3TCU A;  1VQ4 V;  1OCZ B;  2IJJ A;  2Q67 A;  1GM8 A;  4GX1 A;  2A79 B;  1JPX A;  4JAV A;  3T2M A;  3BEH A;  1MOF A;  3AG1 B;  1AI6 A;  2LFS A;  2ZR3 A;  3ZRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...