1GTOA

High resolution structure of a hyperstable helical bundle protein mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
62
structure length
62
Chain Sequence
GTKQEKTALNMARFIRSQTLTLLEKLNELGADEQADICESLHDHADELYRSCLARFGDDGEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Amino-acid substitutions in a surface turn modulate protein stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
molecule keywords ROP
total genus 28
structure length 62
sequence length 62
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1996-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1gtoA00
2IJIA 1GMGA 1PD3A 2IJJA 1RPOA 1ROPA 2IJKA 1F4MA 4DO2A 1RPRA 1NKDA 1F4NA 1B6QA 2GHYA 3K79A 2IJHA 1GTOA
chains in the Genus database with same CATH superfamily
4LH7A 4GUNA 4XDLA 4MW8A 3RVYA 5B1AC 3BABA 5EK0A 2E5LB 5IYDO 3E35A 1OCOB 1QU7A 1SQBH 1T5EA 5EZYB 4TV9B 3Q4HA 2JGDB 3ETGA 3OW2U 3F5TA 1VF5B 4MVZA 4DV6O 5BXZA 1F51A 5LHIA 4MVRA 4BR6A 3DXRB 3F7VC 3K06A 4JAAA 5CMUA 2EINC 1YDXA 4DUYB 1AR1B 1R6NA 5JH7A 1XBLA 3OMIB 3JASA 2YEVB 1OCCB 5EC2C 2MW2B 3ZHTA 3RYFB 4I7ZB 1L1FA 3FX7A 3CX5F 2N74A 4ABMA 5BR8O 4FFBB 1NZ6A 4U3JA 1IBLO 3P32A 2JEXA 1N32B 2PTMA 1NH2D 4R50A 3RYIB 1DGSA 1QR9A 2IH1C 5EBWC 4DR7B 1WJZA 5FNVB 4HYOA 3H01A 2P4VA 1G8MA 4BAYA 3RYCA 1EZVH 4YHHB 5LMUO 4YY3B 1YCIA 2UUCB 1SS3A 3N2GA 1K4CC 3RVZA 1VF6A 1LR1A 1QVFU 4DK0A 3RWRD 4LFAB 1IDSA 4OPHA 1D2DA 1WPBA 5J9PC 4DV3B 1JOYA 1HNWB 4DV4B 2GTAA 3BPZA 1K9MW 4LF7B 4RWUA 2Q5ZA 4DUZB 4TUYB 1MSDA 2QM4A 4OX9O 5LHHA 4UCOA 5C8YB 4PI0A 1GM8A 1AR4A 2ATKC 1RSOA 1YIJV 2NR5A 2EULA 3A8TA 1R3KC 4Z2WA 2QSAA 2JJ1G 2E5LO 4X62B 3GWOA 2ITCC 2PI5A 1WP8A 4H13B 1VMGA 1KU9A 4XDJA 2W6IG 3W7XA 2WLIB 5JWPA 1SQXH 1BL8A 4AILC 2Z3YA 2GSMB 2L35A 3H1JH 4LCUC 3CYOA 4D6TH 4B3MO 4QGPA 5KUKA 1Y76A 2UXCB 2G38A 4EB6B 1H2SB 2BSKA 2XOKG 3SYCA 1XMQO 4UVAA 4O2AB 4P9OA 4NXMO 1EZJA 3JYCA 3OGCC 2W0XA 1FAFA 1N34B 4I55B 4LF4B 2YIBA 2QKCA 1FJGB 4GKKO 2AW9A 4DV6B 5JCOC 5LYJB 5CA0B 1ZLZA 3L70H 1FXKC 4CC5A 3JATA 1AVMA 4X20B 2IJIA 3CE2A 4DV7O 2OCHA 3CMAV 3VOUA 4RO2A 2IJHA 2Q69A 2ILMA 1OHHG 2HFEC 4K35A 4LNUB 1G1XB 5EIBC 4AHCA 4FM2A 3L73H 3LSUA 4PDVA 5J2TA 2KQXA 2R9IA 4X64O 1XI1A 1F4NA 3O9OA 3LSSA 2AHYA 3FYEB 4IT5A 2H94A 4YHHO 5EYPA 3E22B 4GX5A 3FB8C 4UB6Z 5B1NA 3UKMA 3ZRWA 3AEIA 4X66B 4CC6A 3CP1A 3JAWB 3E8HA 5BMVB 3PN1A 4JI8B 1WLEA 2PYLA 1PPJH 4R6ZA 2B1IA 2FMLA 4IIJB 2E75B 2X7RB 4UVCA 3SPJA 2Q67A 2WLLB 5DN6G 4OGQB 2GUZA 1VF6C 1K73W 2V4DA 1D5NA 3K03A 4JI2B 4I4TA 2ZR2A 4JI0O 1E1RG 4JAVA 2P5OA 1I0HA 3E2EA 3P3PA 4DR5B 4EFEA 1IZ3A 1JFFB 4DW1A 2UXCO 2DW4A 1N36O 1AI7A 3AG7A 5TISZ 4O4LA 3CEIA 1GRJA 1NT2B 2HG5C 2QWOB 4UB8Z 4PDLA 1HR0B 1FPOA 3SJBC 4DR2B 4CH6A 2QWPB 2QE7G 4ZBMA 5H6RA 3KG2A 5BR8B 3K79A 3RW0A 1VIBA 3QVNA 2DWDC 3HKCA 3VQYA 3DC5A 1B6QA 1TUBB 2IW5A 1QLNA 2DYRB 4GX2A 5B66Z 3TK1A 4WF9V 4B3SO 4NXMB 1IBKB 3HKEB 1Z2GA 1BE3H 1JQ0A 3AG2B 2B1GA 1XNQB 2IU0A 3KKYA 3CC7V 3B8NA 4NB5A 3SPHA 5KLVH 3F7YC 4B7KA 3QO7A 4GLXA 3K58A 2R9AA 1EN5A 1RFYA 1AJNA 3QO8A 1NR7A 1S76D 2LFSA 2DQ3A 1MNGA 1YJWV 3RYHB 1P4RA 1I5XA 1FXHA 1QVGU 3ASNB 5LP6C 3DTUB 1BSMA 2RDCA 3T1HB 2UXBO 4PA3A 1JPXA 3ABMB 4B3SB 3OTOO 3FB7C 4Z1VA 3MDSA 4UV9A 3CD6V 2HEPA 5B3SB 2B5UA 4JI5B 1XEQA 5IYZB 1LUVA 5BY1A 1W59A 4LF6O 2BTQA 1WP7A 1VQKV 4MSWC 2VWKA 2ZDIC 1V54B 2Q73A 3CHXA 1H2NA 3UO2A 3UT5A 5JCOA 4R7CA 2D2CB 3BHPA 3TGUH 4WCEV 5IWAB 1OCRB 3CC2V 1Q86W 3JARA 2Y0IA 2CAZC 3THOA 4LF8B 3OR7C 2NN4A 3ZS8C 5FPRA 1FFTB 2ZM6B 1SRYA 4FMTA 1GN2A 1Q90D 1IX9A 1ZSPA 3WB2A 2Q7GA 5IJ9A 1M5IA 4I0XB 5IT9N 2NNUA 1WB7A 1KMIZ 3T1HO 2UXBB 2LGWA 3G6EV 2P67A 3UCSC 1VF7A 3CCEV 4I50A 4YXWG 1JJ2U 3ASOB 3K5LA 3OT7A 3RFRA 3ZMVA 3OAAG 3I55V 2PZSA 1ZL8A 3FFQA 1K4DC 4X1YA 4WBNB 2ODMA 4WFBV 3MAQA 1Y66A 1EN6A 1VQMV 2OYQA 1HNZO 5LMNO 3ETDA 4DRXB 2EIMB 2WAMA 2GV9A 4W4LA 4JV5B 4X1IB 4F6RB 3CPWU 1KECA 3T2MA 1W2BU 3F5WC 1WB8A 2XAGA 3T4DA 1HDJA 5CA1B 5DECA 4J9YB 2YXHA 3AK3A 3WG7C 3SJQC 3QF7A 4Z1MG 1DLBA 5CB4A 3SYQA 1VQ9V 4LF6B 5JJEB 1TVKB 4FLVA 3UM7A 1J5EB 1SQVH 2Z5UA 1KKCA 1N33B 4UV8A 5IYBO 2WWWA 4JYAO 3EHBB 4Q20A 3AG3C 2XNDG 3TETA 1XHZA 2QJ1A 3CJHA 3PJSK 3ZHUA 1I5YA 3FYIB 4RUEA 5J2UA 3CXCU 1VQNV 1SESA 3ZHSA 4K8ZA 2ZM6O 1PM9A 4H33A 3KCYA 1KC8W 5EIBD 4LWSA 5JQGB 4PA6A 4IHJA 4MVQA 2UXXA 5KX5B 1XNRO 1YEWA 3S3XA 4DV4O 3ZN1A 2ARHA 4P9PA 2CK3G 3J7AU 1DK1A 1Q6HA 3CCLV 3DSQA 4JYYA 2ZIOA 3N2KB 1K33A 3NR7A 4CBCA 4UCSA 2UUBO 4FVMA 4ZOLB 2JS5A 2Q7EA 1KD1W 4LFAO 1N32O 3L71H 3FB6C 4QPJA 4TV8B 5ITZB 4JTAB 2F93B 1JA8A 2DE0X 4JTDB 5E1AC 4DUYO 1KP3A 4MW3A 4CZZA 4DR2O 2QR4A 4O2BB 4KHPB 3D8CA 4ZI7B 2BTOA 5IY5C 2WA4A 1AJQA 2ZE5A 4O4JA 4CS3A 2VS0A 1NU1H 4PELA 1MA1A 2F95B 2EIJC 1RM1B 2H8PC 2YSUB 1AR5A 4LFCO 4UXNA 1N4CA 5B3SC 4UUJC 5JVDB 4WFGA 1N34O 2OIEA 2Y4UA 4N21A 2CGNA 2C2AA 2DJVA 1A32A 5H5NA 1BQZA 2P06A 1D5AA 4EEQA 4JI6O 2O57A 4B08A 5D5PA 3MHSC 3G4SV 2JGDA 3BAAA 3K5MA 2A3QA 5IJ0B 4DV2B 3CWBH 3ZX6A 1H2MA 3C90A 1VQLV 2OTLV 2OT5A 1H2LA 2L6LA 1SQGA 1SQQH 4U7NA 2PF4E 5HFMA 3M7MX 2AXTZ 1SZTA 2GBOA 5JJNB 2YICA 1NTKH 3A0BZ 4QE9A 2R70A 3CMEV 5KMGA 4Q6GA 2NLJC 4YIPA 4O4HB 1OJHA 4JAUA 3CCUV 4YY3O 4JZ2A 3AG4C 3ZEDA 2Y48A 4AI8A 4QIWF 4LF8O 1YJ9V 2LP7A 4K3AA 3E89A 4HZ3A 4H44B 2V7QG 3W7TA 2ZINA 4E4EA 3APOA 3JAKA 4LF9O 4DV1O 3WU2Z 3TXQA 3ZMSA 2XT9A 3BA9A 3SYPA 4H0LB 1VARA 5C93A 3OE7G 4PA4A 1XNQO 1VQ5V 3RT3C 1M1KW 2ZNIA 4DR4B 1NQTA 2OCCC 4KHPO 2UU9O 4DYLA 1AB3A 5L3EA 1K7DA 3ABLC 1FS0G 1I08A 1Y67A 1R3IC 2OCCB 4X1KA 2IJJA 1XMOO 2QWRB 1FD9A 3CC4V 3HKBB 1BGYH 2RJZA 1AI4A 2HLDG 3OTFA 3SR2C 3UQ8A 4DUZO 4AQYB 2ZE7A 2KG7A 2X6BA 2R9RB 4DR6O 3EVKA 4CS2A 4FLYA 4CH3A 1Q7YW 3OM3B 3RGBA 3ABUA 2IJKA 4JI8O 3IJ4A 3U11A 1Z5WA 1TAEA 4MVMA 4X66O 4G27B 1VP7A 5LP6B 2Q7HA 1GN3A 1MSWD 3QTCA 2CTPA 3K5OA 5LA6B 1SZXA 3SGIA 4CH4A 3OFNG 3JCUZ 2HJFC 2LQTA 1WA8A 3RBZA 4FM0A 2GTSA 4ZHQA 1XQ8A 3GB7C 1Q82W 1UFIA 4LBEC 2JDIG 1GK9A 1WPXA 3CRCA 2KKWA 1MOFA 2X6AA 2ADPA 3B2EE 3TCUA 3E83A 1OCOC 1Q8IA 4JYCA 1NVPD 3G71V 1YSCA 1AJPA 3Q4HB 1FXVA 3H9VA 1HP8A 5LBQA 1SA0B 1TA8A 2HVJC 3LUTB 2B9ZA 1KBHA 4J80A 1ZTEA 3KZIZ 3SJAC 2A0LA 5J2TB 2YXLA 1F23A 4LC1A 1YZBA 3JD4A 3IC9A 3LDDA 5HFLA 1IBMO 3JASB 4LR3A 1OCCC 5LOVB 2JGUA 1EBOA 1XOUA 3LNNA 2CTRA 3BY6A 3RYFA 4B3TB 1L0LH 1UPGA 2Q6AA 2PGGA 5LMUB 1K5QA 2CH7A 2VRZA 1PNLA 1SQPH 1M90W 2UXNA 5EBLC 3BVOA 3K08A 4I5SA 1PP9H 5FNVA 4NTYA 3JAMN 4BW9A 3ZJZA 2QA4V 4IIJA 4BWAA 1KP2A 2HVKC 2D3OW 1FJGO 1RPRA 3AG2C 1K3EA 3JD1A 4MVUA 4OX9B 2GUZB 2ZNJA 1W0JG 4TQFA 2LJ2A 4ASUG 2EZPA 1WNSA 3FAVA 1H8EG 4LF5B 3TJTA 2XAHA 2PYJA 3ASOC 4WFEA 4O4IA 4RUFA 3DC6A 5GTIZ 4PA9A 5GTHZ 5L3DA 3JALB 3OR6C 4FK5C 1I94B 4TOIA 1UJWB 1NTZH 5EBMC 3TXSA 4GZRB 4UCVA 4JGSA 3C3SA 4PA7A 4H37A 1IVSA 1AP6A 3VQWA 2UXDO 3WFVA 4HNAA 5F2VO 3G80A 2WLJA 3HKCB 2E3CA 3J81N 1MMMA 2MK3A 3E86A 1XHXA 3H1KH 1P84F 2F66C 1JMKC 4JI0B 2DYRC 1FXKA 1FFXB 2XASA 3I56V 5L3FA 4JYAB 4TSFG 1Z5VA 2EIKC 3AG1C 1QNMA 4I55A 3CXHF 2JIZG 2Q9LA 3HKDA 1O9GA 4FM1A 3N27A 4EFBA 5LYJA 3ZCCA 4TT3G 2RQ6A 1PL0A 4QPKA 4FLZA 4JV5O 2E76B 2F4VO 2K1EA 4X20A 3JSLA 5GONB 1E1QG 2M6YA 1M4UA 5LL6Y 1PNMA 1ZX3A 5KHJA 5EZYA 4TV9A 2ZXWC 4XDKA 5LXTB 4BIUA 2HJDA 1G4YB 1YTFD 1XILA 3L72H 2A9HA 1EFRG 2QWNB 4MTXA 3CRQA 4GCZA 3NXSA 3W7WA 1YVWA 2AZ2A 2HR3A 3DXRA 1QHTA 4B7EA 1ZAUA 1BHAA 1X4TA 1AI6A 3AG4B 4X62O 1GM9A 5JH7B 4X89A 2YUAA 1CPYA 4L87A 3U0ZA 1I94O 1OCZB 2Q0AA 1I7FA 4PDMA 2XUMA 4P2ZA 1WN7A 2EX3A 4BIOA 3R65A 5EYPB 4W4KA 3ZRWB 4DO2A 3EFFK 1H2KA 2FL4A 2F43G 4PHZA 4FFBA 4BW5A 2R72A 4MTGA 5FL7G 4YJ3B 4FLWA 1AI5A 4NTXA 1G6UA 2WLHA 4GX0A 3RYCB 3SDLA 2DYSB 4WFHA 1Q43A 2ADQB 2DOSA 3QG5A 1Y4MA 2Q0OC 2QTOA 5KHGA 3K04A 1GTOA 3WB0A 3ZRVA 4GKJO 3CCJV 5B5EZ 4YJ2B 1K34A 4GKJB 3A0HZ 1GMGA 3JD3A 3OEHG 4HAMA 4YIOA 4TUYA 1Y74A 5IY5B 1JFFA 2F23A 2YI9A 5C8YA 1IXBA 1PL4A 2CUGA 2YC0A 1K5SA 4RAIA 3STZC 1DTOA 1YI2V 2DN9A 4DV1B 2E74B 4QE7A 1RPOA 2WLMA 1DF5A 4ZIBA 2WLIA 3AK2A 4J7JA 2YDEA 2A06H 2CGOA 4LP8A 2P4KA 1GKFA 2QM8A 2P7TC 2CE4A 4LF4O 3RN4A 3C3TA 3ZRXA 4JI3B 2ZR3A 3BEHA 3LNMB 3A0RA 3T1YB 4OPAA 4UCUA 4DV5B 3LDCA 1JX9A 1AROP 5KAFZ 5CB4B 4MVSA 1K92A 4NYKA 4L8JA 4B3RO 5FLXN 1VQ7V 1ZUQA 4I9WA 1OV9A 1SKVA 1MABG 4X65B 2JRIA 3JATB 1NKDA 2HP8A 2WPDG 2ZQMA 2P22C 1OCZC 3IAYA 4LH6A 1M93A 2QM7A 1OCRC 5DEDA 2QDOA 4NR1A 3RYHA 3K59A 4MT8A 1HW7A 1N36B 3IFXA 5J2UB 1VQOV 3OGIB 2EIMC 1KQSU 5L3CA 4JI7B 1XL4A 1CP9A 4TQDA 3JSNA 3ICXA 4U7OA 5KHHA 1BCCH 1GN4A 4BIZA 4DR4O 2ETNA 4DK1A 3BCCH 5LGNA 2YEVA 5LGUA 4JI2O 2YIAA 1XMOB 2BOCC 3APQA 3ETEA 1Q6IA 4K8XA 4JF3A 4RQEA 5IWAO 2JK5C 2EJRA 5IYZA 3N2KA 2KSDA 1BT8A 5BMVA 1N0JA 4U3JB 3W7SA 4KP4A 3CCRV 3ABLB 3D3QA 3T1CA 1YJNV 3UT5B 3RYIA 3HB3B 4FPPA 2FB5A 3AG1B 3HR0A 1M57C 5K1PA 2EIJB 4JI1O 4C7UA 1H8HG 2V1DA 5ITZA 3OD4A 3FD9A 4KL1A 3SPGA 1V9PA 3N2GB 3ZMUA 3OMNB 2OTJV 1Q3EA 1YHQV 4I0XA 3B77A 4DR1O 4MVOA 1XL6A 3STLC 2FYUH 1N8RW 4JTCB 1SF9A 1NBMG 4I50B 4KUMA 3OUFA 1RSOB 1PNKA 4LFBO 4O4LB 2PI4A 1NTMH 2ZT9B 4GT1A 2EJ7A 4JI1B 2EBOA 4IYHA 1HNZB 3J80N 3BA8A 4LF9B 3K0DA 3OUSA 4JZGA 2XHBA 4X1YB 4WBNA 1Q6UA 5E79Z 4CS4A 1NVPB 1HR0O 1IBKO 4UVBA 3U10A 4E2LA 1KYOF 5IE9A 1Y76B 5JVDA 1TUBA 1VQ8V 4EB6A 2BSKB 2QKSA 5CA1A 2JEUA 2IM9A 1THZA 2KB1A 3W7UA 4O2AA 3ABKB 2PY5A 1IBMB 1HNXO 3HKEA 2QKAA 2VQEB 2RCVA 3VBBA 2VWJA 1BHBA 3M8AA 1TUEB 5KUMA 2LFRA 4JYBA 4NVPA 1EN4A 3I5DA 1YF2A 2FKXA 4F6EA 3SYOA 4MS2A 2XAFA 5CA0A 3P3NA 4J42A 1QCEA 3JD0A 4MTFA 3B40A 1V55C 2CTWA 3ZN0A 1HWYA 4JASA 4FZ0A 3AG3B 5KMGB 4O4HA 3ASNC 2AGAA 4LNUA 2W6JG 2K9PA 5IDJA 4OXSA 1M56B 2IU3A 5JQGA 4UFZA 5KX5A 2Q68A 4FLUA 1R1BA 3ZHQA 1Q81W 2HKOA 1QBZA 2ZE8A 1COWG 4DV7B 1GO3F 1NR1A 1GN6A 2UUBB 3JAKB 3K3WA 4CH5A 5A9GA 2UUCO 1US6A 4DR3O 1GM7A 3ZMZA 3E22A 4GKKB 3IGAC 2ZE6A 3ZIAG 3JAWA 1LNQA 2HHHO 4WFAV 5KA5A 1ROPA 2LO1A 2BTQB 3CRAA 4IYIA 4NKGB 4LF7O 4QNHB 3ABKC 1W0KG 4NXNO 2QWQB 4ZOLA 3CSXA 3E8BA 4J7KA 5JJJB 3JARB 1P7BA 4TV8A 4X1KB 2P90A 2WLLA 3R66A 1VQPV 3L9DA 1B06A 2Z0AA 2AHZA 4FFKA 3ABMC 3D36A 3CCVV 2IBZH 2LGQA 2Q4PA 1BS3A 2BOBC 4DR7O 1S5LZ 3H1IH 3K9AA 1PV0A 4DV5O 4KFMA 1K97A 4I4TB 2N05A 5LGTA 4J7ZA 2QGNA 4X8AA 5IYCO 2EILB 4I9QA 3T4ZA 3VQVA 1VQ4V 2DWEC 4DV2O 1ORQC 1QLEB 5CN0A 5LP6A 5H9CA 2ZIMA 2YI8A 3LSQA 1VQ6V 1J5EO 1ZL8B 5AG2A 1WAZA 2DMXA 4DV3O 1HNXB 4G2KA 2ZKOA 1JR9A 2LW7A 4ZHQB 2PUSA 4DRXA 2WLNA 3GWKC 4B3TO 2LW1A 4RQFA 4ZKIA 1ENVA 5LMNB 2WA3A 1KKDA 3VQXA 2CDYA 5H6QA 4JI4O 4DW0A 4IL6Z 1IBLB 1CEZA 2ZXWB 1TVKA 2Y0PA 1F7YA 1SA0A 5KHIA 5IJ0A 5D5QA 2A7WA 2UUAB 1S72V 1X59A 2JJ2G 4QJFB 3ZBHA 4HBNA 2YIDA 5BZBA 2DYSC 1CXZB 1V54C 1MG1A 2XTAA 2Y69B 2UU9B 1ZWIC 3IC7A 4KXRA 4DXWA 4DV0B 5H2FZ 3CJHB 5LOVA 2VQFB 1NS1A 3ZMTA 3D3IA 3CB2A 3QNEA 4D7SA 1K8AW 1SQFA 2WSSG 2Y69C 1PKXA 1RP3B 5B1BC 4IHJB 3B4SA 3L75H 5KA6A 3K57A 3OTOB 1FKAO 4NXNB 3S3WA 1GH6A 4DR1B 1YITV 1LUWA 4R8CA 2XAJA 5B1BB 3FB5C 4MTOA 1E79G 1JCHA 1DF4A 3SJCC 4FJCC 1KUQA 3GVMA 5CBGA 4X9QA 4J11A 1B3QA 3MHHC 3OMAB 5KAIZ 2WLKA 2YXYA 4FIPC 4ICGA 4JI6B 2QEXV 1FYJA 2H3OA 4NTWA 1XMQB 4DR6B 4EKWA 3FKSG 3B8MA 1SETA 4AQYO 2AZ0A 3SYAA 1URFA 3LDEA 3CCSV 1QLEC 5LHGA 4LFCB 5KHKA 5IJ9B 1SERA 2EILC 5FPOA 3SPCA 2X6CA 4WFFA 4X88A 1JVMA 4A5UB 4JPRA 5K1XA 4JI7O 4X65O 4B3RB 4JI5O 2P6JA 1NJIW 2F1MA 1H2GA 1XDCA 3O65A 5CA3A 1FFXA 1Q5OA 3CS5A 1R3LC 1N0NA 3JCZA 3K5NA 4PJ0Z 1XREA 3CCQV 4X64B 3JD2A 1AP5A 4FLXA 3UO3A 2JVDA 3HKDB 4PD4F 4X1IA 1S77D 4F6RA 1AILA 3BRCA 4DR5O 3CCMV 3ML0A 3SPIA 2BCCH 4PDRA 3E8FA 5GONA 4F4LA 1F4MA 5A2QN 3HPLC 5EC1C 1IXMA 1L8DA 1S5JA 3DGEA 5LXTA 2F4VB 1M56C 2X0LA 4LFBB 3D36C 3P30A 4B3MB 2ITDC 4PI2A 2A79B 2EZOA 1BQ0A 1GAXA 1P49A 1QQCA 3E8GA 3ETQA 2N04A 2QTSA 4UCRA 1BMFG 3BFRA 3M99B 2DQ0A 1M9NA 4IGGA 1EM1A 1YXBA 4LF5O 2EIKB 2BE3A 4J41A 5L3GA 1MZEA 1S0VA 1Y6XA 1YTFB 1PD3A 3ZHRA 1S5HC 5DM6V 2RN9A 5L3BA 1TGOA 3CRRA 5B1OA 2Q8VA 2ZDIA 4U3FH 4LWSB 1BZKA 4J10A 1R73A 1B04A 2CH7B 1HNWO 3MD0A 3K0GA 3KCXA 3ZHVA 4YJ3A 2ZD9A 4FZ1A 1S3JA 3K9SA 4GX1A 1QR8A 1U97A 1L0NH 3A2FA 1M57B 2YS8A 2YIBD 1SC5B 5GW7A 2IH3C 3H1LH 3OEEG 4DR3B 2JS3A 1KB9F 1IURA 2VQFO 2OIGA 4UCTA 4D7TA 1U96A 1R6KA 3FAVB 3H1HH 5CBFA 4YJ2A 1NI8A 3QO5A 2W0FC 2ZCEA 1J95A 4O4IB 4G28B 1Y74B 1VEWA 4TWKA 2GHYA 3JALA 3HKBA 3WB1A 1N33O 5CBHA 2UXDB 1V55B 2KG7B 4K0KO 3WG7B 3EXAA 3X2QC 4DV0O 4GYCB 2EINB 2FTKA 1NH2B 2RMKB 4O2BA 3ABTA 3G67A 3L74H 2VQEO 4HNAB 4ZI7A 3B09A 2HHHB 3AK1A 4PV1B 1JJOA 4J9ZB 4O4JB 2Y4TA 2OWOA 3X2QB 1O9HA 1R6TA 1H38A 1FXKB 2XAQA 2M7WA 5LA6A 4P30A 1XUQA 5B1AB 1RM1C 1OZ0A 4JI4B 4JI3O 1WA8B 4K0KB 2CTQA 4N23A 2RNBA 3T1YO 1XNRB 3CRMA 1MZFA 1P7GA 2GDSA 4FLTA 3ZRSA 1R3JC 4XBFA 2UUAO 3G6BA
chains in the Genus database with same CATH topology
2IU3A 1W0JG 3ZMVA 3OAAG 3I55V 2Q68A 4ASUG 4XDLA 4MW8A 3RVYA 2EZPA 5B1AC 1Q81W 2HKOA 5EK0A 1K4DC 1QBZA 1COWG 1GO3F 1H8EG 1NR1A 5IYDO 2XAHA 3E35A 1OCOB 4WFBV 3K3WA 1Y66A 3ASOC 1VQMV 4WFEA 4RUFA 4PA9A 3ETGA 3OW2U 1GM7A 3ETDA 2EIMB 2WAMA 3ZMZA 5L3DA 4MVZA 3IGAC 3CPWU 1KECA 1F51A 3T2MA 3ZIAG 1LNQA 3OR6C 4FK5C 4MVRA 5LHIA 4WFAV 5KA5A 1W2BU 1UJWB 1ROPA 3F5WC 2XAGA 3T4DA 5EBMC 3F7VC 3K06A 5CMUA 4QNHB 3ABKC 4J9YB 1W0KG 4JGSA 4PA7A 2EINC 4H37A 3WG7C 3SJQC 4Z1MG 1DLBA 1AR1B 1R6NA 3OMIB 3E8BA 2YEVB 3SYQA 1VQ9V 3WFVA 1OCCB 5EC2C 3UM7A 1P7BA 2Z5UA 2WLJA 2MK3A 2P90A 3E86A 2WLLA 1L1FA 1VQPV 4UV8A 2AHZA 3ABMC 3D36A 2DYRC 1FXKA 5IYBO 3CCVV 3P32A 2XASA 2JEXA 3I56V 5L3FA 2BOBC 1NH2D 2WWWA 4R50A 4TSFG 3K9AA 2EIKC 1QR9A 4KFMA 1K97A 2IH1C 5EBWC 3AG1C 3EHBB 4Q20A 3AG3C 4HYOA 4X8AA 5LGTA 3H01A 2XNDG 3TETA 5IYCO 2EILB 3T4ZA 1G8MA 3PJSK 4BAYA 1VQ4V 1I5YA 3FYIB 4RUEA 3CXCU 2JIZG 1VQNV 1SESA 2DWEC 1ORQC 1QLEB 4H33A 5CN0A 1KC8W 3ZCCA 5H9CA 4TT3G 4QPKA 1PL0A 3LSQA 1K4CC 4PA6A 3RVZA 1VQ6V 4MVQA 2UXXA 1QVFU 2K1EA 4G2KA 1E1QG 3ZN1A 5J9PC 1JOYA 1PNMA 4P9PA 1K9MW 2CK3G 2ZXWC 4XDKA 4BIUA 1G4YB 1YTFD 2WLNA 3CCLV 2A9HA 5LHHA 1GM8A 1EFRG 2ATKC 1YIJV 4MTXA 4GCZA 1R3KC 3NXSA 1K33A 3W7WA 4RQFA 4ZKIA 4CBCA 1ENVA 2HR3A 2JJ1G 1KKDA 3GWOA 2ITCC 2PI5A 1BHAA 1AI6A 3AG4B 5H6QA 4XDJA 1GM9A 2W6IG 3W7XA 2WLIB 4X89A 4L87A 1BL8A 1CPYA 2Z3YA 2GSMB 4LCUC 1KD1W 1OCZB 3CYOA 2ZXWB 1CEZA 3FB6C 4PDMA 4QPJA 4P2ZA 3R65A 5KUKA 4JTAB 3ZRWB 1S72V 4DO2A 2JJ2G 3EFFK 4QJFB 5BZBA 2XOKG 2DYSC 2F43G 4JTDB 1V54C 5E1AC 4BW5A 3SYCA 4MTGA 1KP3A 4UVAA 4MW3A 5FL7G 4P9OA 4CZZA 1MG1A 1EZJA 1AI5A 3JYCA 2Y69B 3OGCC 1ZWIC 3IC7A 2WLHA 4DXWA 4GX0A 3ZMTA 2DYSB 5IY5C 3D3IA 3QNEA 4WFHA 1K8AW 1AJQA 2WSSG 2Y69C 1PKXA 1FXKC 5B1BC 1Y4MA 5KA6A 2QTOA 4PELA 3K04A 1GTOA 2IJIA 3ZRVA 3CMAV 3CCJV 1YITV 2EIJC 3VOUA 1K34A 1RM1B 4RO2A 2H8PC 2IJHA 2YSUB 4R8CA 2XAJA 5B1BB 3FB5C 1GMGA 3JD3A 3OEHG 4MTOA 4HAMA 1E79G 2Q69A 1JCHA 1DF4A 1OHHG 2HFEC 4UXNA 5B3SC 4FJCC 5IY5B 4UUJC 5CBGA 4WFGA 1K5SA 3MHHC 3OMAB 2WLKA 4N21A 4RAIA 3STZC 1DTOA 1YI2V 2C2AA 4FIPC 4PDVA 5IDJA 2R9IA 2QEXV 4QE7A 1RPOA 2WLMA 1DF5A 1F4NA 2WLIA 3LSSA 2AHYA 3MHSC 4EKWA 3FKSG 3FYEB 3G4SV 3B8MA 1SETA 4LP8A 2H94A 3SYAA 1GKFA 3LDEA 2QM8A 4GX5A 3FB8C 5B1NA 3UKMA 3ZRWA 2P7TC 3AEIA 1VQLV 3CCSV 2OTLV 2OT5A 1QLEC 3CP1A 5LHGA 3E8HA 3ZRXA 2ZR3A 3BEHA 3LNMB 3A0RA 1SERA 2EILC 4U7NA 5HFMA 1WLEA 1SZTA 3LDCA 1JX9A 2X6CA 3SPCA 4WFFA 1AROP 4X88A 1JVMA 4MVSA 4JPRA 1K92A 4QE9A 4R6ZA 3CMEV 2NLJC 2B1IA 4JAUA 3CCUV 2X7RB 3AG4C 4UVCA 2Y48A 1VQ7V 4I9WA 3SPJA 2Q67A 2WLLB 5DN6G 4QIWF 1MABG 2P6JA 1NJIW 1K73W 1H2GA 1YJ9V 2LP7A 3K03A 1NKDA 2WPDG 2ZQMA 3E89A 4HZ3A 5CA3A 1OCZC 2V7QG 3W7TA 1R3LC 3JCZA 2QM7A 2ZR2A 3CCQV 3JD2A 1OCRC 1E1RG 3ZMSA 4JAVA 4MT8A 3E2EA 3IFXA 1VQOV 1S77D 2DW4A 3SYPA 2EIMC 1AI7A 1KQSU 5C93A 5L3CA 1XL4A 3OE7G 3CCMV 3ML0A 2HG5C 3SPIA 4PA4A 1CP9A 4PDLA 4U7OA 1VQ5V 1M1KW 4PDRA 1NQTA 4BIZA 3E8FA 2OCCC 4F4LA 1F4MA 3HPLC 2QE7G 4ZBMA 5EC1C 1IXMA 5LGNA 3DGEA 2YEVA 5H6RA 5L3EA 5LGUA 1K7DA 1M56C 2X0LA 1FS0G 3ABLC 3KG2A 3K79A 2BOCC 3P30A 3RW0A 2ITDC 2A79B 2EZOA 1R3IC 3ETEA 2DWDC 2OCCB 2IJJA 4JF3A 4RQEA 2JK5C 2EJRA 3E8GA 1B6QA 2IW5A 3CC4V 1BMFG 1AI4A 1QLNA 2HLDG 2DYRB 4GX2A 3M99B 3W7SA 2DQ0A 2X6BA 3TK1A 4WF9V 2R9RB 1M9NA 4KP4A 3CCRV 3ABLB 1YJNV 3T1CA 3HB3B 4FPPA 1JQ0A 3AG1B 3AG2B 1Q7YW 2B1GA 2EIKB 2IU0A 3OM3B 1M57C 5L3GA 3ABUA 2IJKA 3CC7V 1S0VA 1YTFB 1PD3A 2EIJB 3B8NA 3SPHA 1S5HC 1H8HG 2V1DA 4MVMA 5DM6V 3F7YC 5L3BA 3QO7A 5B1OA 4G27B 2ZDIA 3SPGA 1R73A 1MSWD 3ZMUA 3OMNB 1AJNA 2OTJV 3MD0A 1YHQV 3B77A 3K0GA 2ZD9A 4MVOA 3QO8A 1NR7A 1XL6A 3OFNG 1S3JA 3STLC 2HJFC 4GX1A 1S76D 1QR8A 2LFSA 2DQ3A 1N8RW 4JTCB 3RBZA 1M57B 1YJWV 1NBMG 1P4RA 1I5XA 1FXHA 1QVGU 3GB7C 5GW7A 3ASNB 1Q82W 2IH3C 3OEEG 4KUMA 3OUFA 4LBEC 1PNKA 2PI4A 4GT1A 2JDIG 3DTUB 2EBOA 1GK9A 1WPXA 4PA3A 1MOFA 2X6AA 1R6KA 3K0DA 3OUSA 3TCUA 3E83A 5CBFA 1JPXA 1OCOC 3ABMB 4JYCA 1NVPB 3QO5A 1NVPD 2W0FC 3G71V 1J95A 1YSCA 1AJPA 4G28B 1FXVA 3FB7C 4UV9A 5LBQA 3CD6V 4UVBA 5B3SB 2HVJC 3LUTB 2B5UA 4TWKA 4E2LA 2GHYA 1VQ8V 5CBHA 2QKSA 1V55B 2A0LA 2JEUA 2KB1A 1THZA 3WG7B 1VQKV 4MSWC 3X2QC 3W7UA 3ABKB 2ZDIC 1V54B 1F23A 2EINB 2FTKA 4LC1A 1NH2B 3JD4A 3VBBA 3ABTA 1BHBA 3LDDA 5HFLA 1TUEB 5KUMA 4R7CA 2LFRA 4JYBA 4WCEV 1OCCC 1OCRB 3CC2V 1Q86W 1EBOA 3SYOA 4MS2A 3BY6A 3OR7C 2XAFA 4J9ZB 2Q6AA 1FFTB 1QCEA 3JD0A 1K5QA 1SRYA 4MTFA 4FMTA 3X2QB 1H38A 1V55C 1FXKB 2XAQA 2M7WA 3ZN0A 1HWYA 1PNLA 4OXSA 4P30A 2NNUA 4JASA 1M90W 2UXNA 5EBLC 5B1AB 1RM1C 1OZ0A 3K08A 4I5SA 3AG3B 3G6EV 2P67A 4N23A 3ZJZA 2QA4V 3ASNC 3CCEV 4YXWG 1KP2A 1JJ2U 2HVKC 3ASOB 3ZRSA 1R3JC 2D3OW 4XBFA 1RPRA 3AG2C 1K3EA 2W6JG 3JD1A 4MVUA 1M56B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IJI A;  1GMG A;  1PD3 A;  2IJJ A;  1RPO A;  1ROP A;  2IJK A;  1F4M A;  4DO2 A;  1RPR A;  1NKD A;  1F4N A;  1B6Q A;  2GHY A;  3K79 A;  2IJH A;  1GTO A; 
#chains in the Genus database with same CATH topology
 4LH7 A;  4GUN A;  4XDL A;  4MW8 A;  3RVY A;  5B1A C;  3BAB A;  5EK0 A;  2E5L B;  5IYD O;  3E35 A;  1OCO B;  1QU7 A;  1SQB H;  1T5E A;  5EZY B;  4TV9 B;  3Q4H A;  2JGD B;  3ETG A;  3OW2 U;  3F5T A;  1VF5 B;  4MVZ A;  4DV6 O;  5BXZ A;  1F51 A;  5LHI A;  4MVR A;  4BR6 A;  3DXR B;  3F7V C;  3K06 A;  4JAA A;  5CMU A;  2EIN C;  1YDX A;  4DUY B;  1AR1 B;  1R6N A;  5JH7 A;  1XBL A;  3OMI B;  3JAS A;  2YEV B;  1OCC B;  5EC2 C;  2MW2 B;  3ZHT A;  3RYF B;  4I7Z B;  1L1F A;  3FX7 A;  3CX5 F;  2N74 A;  4ABM A;  5BR8 O;  4FFB B;  1NZ6 A;  4U3J A;  1IBL O;  3P32 A;  2JEX A;  1N32 B;  2PTM A;  1NH2 D;  4R50 A;  3RYI B;  1DGS A;  1QR9 A;  2IH1 C;  5EBW C;  4DR7 B;  1WJZ A;  5FNV B;  4HYO A;  3H01 A;  2P4V A;  1G8M A;  4BAY A;  3RYC A;  1EZV H;  4YHH B;  5LMU O;  4YY3 B;  1YCI A;  2UUC B;  1SS3 A;  3N2G A;  1K4C C;  3RVZ A;  1VF6 A;  1LR1 A;  1QVF U;  4DK0 A;  3RWR D;  4LFA B;  1IDS A;  4OPH A;  1D2D A;  1WPB A;  5J9P C;  4DV3 B;  1JOY A;  1HNW B;  4DV4 B;  2GTA A;  3BPZ A;  1K9M W;  4LF7 B;  4RWU A;  2Q5Z A;  4DUZ B;  4TUY B;  1MSD A;  2QM4 A;  4OX9 O;  5LHH A;  4UCO A;  5C8Y B;  4PI0 A;  1GM8 A;  1AR4 A;  2ATK C;  1RSO A;  1YIJ V;  2NR5 A;  2EUL A;  3A8T A;  1R3K C;  4Z2W A;  2QSA A;  2JJ1 G;  2E5L O;  4X62 B;  3GWO A;  2ITC C;  2PI5 A;  1WP8 A;  4H13 B;  1VMG A;  1KU9 A;  4XDJ A;  2W6I G;  3W7X A;  2WLI B;  5JWP A;  1SQX H;  1BL8 A;  4AIL C;  2Z3Y A;  2GSM B;  2L35 A;  3H1J H;  4LCU C;  3CYO A;  4D6T H;  4B3M O;  4QGP A;  5KUK A;  1Y76 A;  2UXC B;  2G38 A;  4EB6 B;  1H2S B;  2BSK A;  2XOK G;  3SYC A;  1XMQ O;  4UVA A;  4O2A B;  4P9O A;  4NXM O;  1EZJ A;  3JYC A;  3OGC C;  2W0X A;  1FAF A;  1N34 B;  4I55 B;  4LF4 B;  2YIB A;  2QKC A;  1FJG B;  4GKK O;  2AW9 A;  4DV6 B;  5JCO C;  5LYJ B;  5CA0 B;  1ZLZ A;  3L70 H;  1FXK C;  4CC5 A;  3JAT A;  1AVM A;  4X20 B;  2IJI A;  3CE2 A;  4DV7 O;  2OCH A;  3CMA V;  3VOU A;  4RO2 A;  2IJH A;  2Q69 A;  2ILM A;  1OHH G;  2HFE C;  4K35 A;  4LNU B;  1G1X B;  5EIB C;  4AHC A;  4FM2 A;  3L73 H;  3LSU A;  4PDV A;  5J2T A;  2KQX A;  2R9I A;  4X64 O;  1XI1 A;  1F4N A;  3O9O A;  3LSS A;  2AHY A;  3FYE B;  4IT5 A;  2H94 A;  4YHH O;  5EYP A;  3E22 B;  4GX5 A;  3FB8 C;  4UB6 Z;  5B1N A;  3UKM A;  3ZRW A;  3AEI A;  4X66 B;  4CC6 A;  3CP1 A;  3JAW B;  3E8H A;  5BMV B;  3PN1 A;  4JI8 B;  1WLE A;  2PYL A;  1PPJ H;  4R6Z A;  2B1I A;  2FML A;  4IIJ B;  2E75 B;  2X7R B;  4UVC A;  3SPJ A;  2Q67 A;  2WLL B;  5DN6 G;  4OGQ B;  2GUZ A;  1VF6 C;  1K73 W;  2V4D A;  1D5N A;  3K03 A;  4JI2 B;  4I4T A;  2ZR2 A;  4JI0 O;  1E1R G;  4JAV A;  2P5O A;  1I0H A;  3E2E A;  3P3P A;  4DR5 B;  4EFE A;  1IZ3 A;  1JFF B;  4DW1 A;  2UXC O;  2DW4 A;  1N36 O;  1AI7 A;  3AG7 A;  5TIS Z;  4O4L A;  3CEI A;  1GRJ A;  1NT2 B;  2HG5 C;  2QWO B;  4UB8 Z;  4PDL A;  1HR0 B;  1FPO A;  3SJB C;  4DR2 B;  4CH6 A;  2QWP B;  2QE7 G;  4ZBM A;  5H6R A;  3KG2 A;  5BR8 B;  3K79 A;  3RW0 A;  1VIB A;  3QVN A;  2DWD C;  3HKC A;  3VQY A;  3DC5 A;  1B6Q A;  1TUB B;  2IW5 A;  1QLN A;  2DYR B;  4GX2 A;  5B66 Z;  3TK1 A;  4WF9 V;  4B3S O;  4NXM B;  1IBK B;  3HKE B;  1Z2G A;  1BE3 H;  1JQ0 A;  3AG2 B;  2B1G A;  1XNQ B;  2IU0 A;  3KKY A;  3CC7 V;  3B8N A;  4NB5 A;  3SPH A;  5KLV H;  3F7Y C;  4B7K A;  3QO7 A;  4GLX A;  3K58 A;  2R9A A;  1EN5 A;  1RFY A;  1AJN A;  3QO8 A;  1NR7 A;  1S76 D;  2LFS A;  2DQ3 A;  1MNG A;  1YJW V;  3RYH B;  1P4R A;  1I5X A;  1FXH A;  1QVG U;  3ASN B;  5LP6 C;  3DTU B;  1BSM A;  2RDC A;  3T1H B;  2UXB O;  4PA3 A;  1JPX A;  3ABM B;  4B3S B;  3OTO O;  3FB7 C;  4Z1V A;  3MDS A;  4UV9 A;  3CD6 V;  2HEP A;  5B3S B;  2B5U A;  4JI5 B;  1XEQ A;  5IYZ B;  1LUV A;  5BY1 A;  1W59 A;  4LF6 O;  2BTQ A;  1WP7 A;  1VQK V;  4MSW C;  2VWK A;  2ZDI C;  1V54 B;  2Q73 A;  3CHX A;  1H2N A;  3UO2 A;  3UT5 A;  5JCO A;  4R7C A;  2D2C B;  3BHP A;  3TGU H;  4WCE V;  5IWA B;  1OCR B;  3CC2 V;  1Q86 W;  3JAR A;  2Y0I A;  2CAZ C;  3THO A;  4LF8 B;  3OR7 C;  2NN4 A;  3ZS8 C;  5FPR A;  1FFT B;  2ZM6 B;  1SRY A;  4FMT A;  1GN2 A;  1Q90 D;  1IX9 A;  1ZSP A;  3WB2 A;  2Q7G A;  5IJ9 A;  1M5I A;  4I0X B;  5IT9 N;  2NNU A;  1WB7 A;  1KMI Z;  3T1H O;  2UXB B;  2LGW A;  3G6E V;  2P67 A;  3UCS C;  1VF7 A;  3CCE V;  4I50 A;  4YXW G;  1JJ2 U;  3ASO B;  3K5L A;  3OT7 A;  3RFR A;  3ZMV A;  3OAA G;  3I55 V;  2PZS A;  1ZL8 A;  3FFQ A;  1K4D C;  4X1Y A;  4WBN B;  2ODM A;  4WFB V;  3MAQ A;  1Y66 A;  1EN6 A;  1VQM V;  2OYQ A;  1HNZ O;  5LMN O;  3ETD A;  4DRX B;  2EIM B;  2WAM A;  2GV9 A;  4W4L A;  4JV5 B;  4X1I B;  4F6R B;  3CPW U;  1KEC A;  3T2M A;  1W2B U;  3F5W C;  1WB8 A;  2XAG A;  3T4D A;  1HDJ A;  5CA1 B;  5DEC A;  4J9Y B;  2YXH A;  3AK3 A;  3WG7 C;  3SJQ C;  3QF7 A;  4Z1M G;  1DLB A;  5CB4 A;  3SYQ A;  1VQ9 V;  4LF6 B;  5JJE B;  1TVK B;  4FLV A;  3UM7 A;  1J5E B;  1SQV H;  2Z5U A;  1KKC A;  1N33 B;  4UV8 A;  5IYB O;  2WWW A;  4JYA O;  3EHB B;  4Q20 A;  3AG3 C;  2XND G;  3TET A;  1XHZ A;  2QJ1 A;  3CJH A;  3PJS K;  3ZHU A;  1I5Y A;  3FYI B;  4RUE A;  5J2U A;  3CXC U;  1VQN V;  1SES A;  3ZHS A;  4K8Z A;  2ZM6 O;  1PM9 A;  4H33 A;  3KCY A;  1KC8 W;  5EIB D;  4LWS A;  5JQG B;  4PA6 A;  4IHJ A;  4MVQ A;  2UXX A;  5KX5 B;  1XNR O;  1YEW A;  3S3X A;  4DV4 O;  3ZN1 A;  2ARH A;  4P9P A;  2CK3 G;  3J7A U;  1DK1 A;  1Q6H A;  3CCL V;  3DSQ A;  4JYY A;  2ZIO A;  3N2K B;  1K33 A;  3NR7 A;  4CBC A;  4UCS A;  2UUB O;  4FVM A;  4ZOL B;  2JS5 A;  2Q7E A;  1KD1 W;  4LFA O;  1N32 O;  3L71 H;  3FB6 C;  4QPJ A;  4TV8 B;  5ITZ B;  4JTA B;  2F93 B;  1JA8 A;  2DE0 X;  4JTD B;  5E1A C;  4DUY O;  1KP3 A;  4MW3 A;  4CZZ A;  4DR2 O;  2QR4 A;  4O2B B;  4KHP B;  3D8C A;  4ZI7 B;  2BTO A;  5IY5 C;  2WA4 A;  1AJQ A;  2ZE5 A;  4O4J A;  4CS3 A;  2VS0 A;  1NU1 H;  4PEL A;  1MA1 A;  2F95 B;  2EIJ C;  1RM1 B;  2H8P C;  2YSU B;  1AR5 A;  4LFC O;  4UXN A;  1N4C A;  5B3S C;  4UUJ C;  5JVD B;  4WFG A;  1N34 O;  2OIE A;  2Y4U A;  4N21 A;  2CGN A;  2C2A A;  2DJV A;  1A32 A;  5H5N A;  1BQZ A;  2P06 A;  1D5A A;  4EEQ A;  4JI6 O;  2O57 A;  4B08 A;  5D5P A;  3MHS C;  3G4S V;  2JGD A;  3BAA A;  3K5M A;  2A3Q A;  5IJ0 B;  4DV2 B;  3CWB H;  3ZX6 A;  1H2M A;  3C90 A;  1VQL V;  2OTL V;  2OT5 A;  1H2L A;  2L6L A;  1SQG A;  1SQQ H;  4U7N A;  2PF4 E;  5HFM A;  3M7M X;  2AXT Z;  1SZT A;  2GBO A;  5JJN B;  2YIC A;  1NTK H;  3A0B Z;  4QE9 A;  2R70 A;  3CME V;  5KMG A;  4Q6G A;  2NLJ C;  4YIP A;  4O4H B;  1OJH A;  4JAU A;  3CCU V;  4YY3 O;  4JZ2 A;  3AG4 C;  3ZED A;  2Y48 A;  4AI8 A;  4QIW F;  4LF8 O;  1YJ9 V;  2LP7 A;  4K3A A;  3E89 A;  4HZ3 A;  4H44 B;  2V7Q G;  3W7T A;  2ZIN A;  4E4E A;  3APO A;  3JAK A;  4LF9 O;  4DV1 O;  3WU2 Z;  3TXQ A;  3ZMS A;  2XT9 A;  3BA9 A;  3SYP A;  4H0L B;  1VAR A;  5C93 A;  3OE7 G;  4PA4 A;  1XNQ O;  1VQ5 V;  3RT3 C;  1M1K W;  2ZNI A;  4DR4 B;  1NQT A;  2OCC C;  4KHP O;  2UU9 O;  4DYL A;  1AB3 A;  5L3E A;  1K7D A;  3ABL C;  1FS0 G;  1I08 A;  1Y67 A;  1R3I C;  2OCC B;  4X1K A;  2IJJ A;  1XMO O;  2QWR B;  1FD9 A;  3CC4 V;  3HKB B;  1BGY H;  2RJZ A;  1AI4 A;  2HLD G;  3OTF A;  3SR2 C;  3UQ8 A;  4DUZ O;  4AQY B;  2ZE7 A;  2KG7 A;  2X6B A;  2R9R B;  4DR6 O;  3EVK A;  4CS2 A;  4FLY A;  4CH3 A;  1Q7Y W;  3OM3 B;  3RGB A;  3ABU A;  2IJK A;  4JI8 O;  3IJ4 A;  3U11 A;  1Z5W A;  1TAE A;  4MVM A;  4X66 O;  4G27 B;  1VP7 A;  5LP6 B;  2Q7H A;  1GN3 A;  1MSW D;  3QTC A;  2CTP A;  3K5O A;  5LA6 B;  1SZX A;  3SGI A;  4CH4 A;  3OFN G;  3JCU Z;  2HJF C;  2LQT A;  1WA8 A;  3RBZ A;  4FM0 A;  2GTS A;  4ZHQ A;  1XQ8 A;  3GB7 C;  1Q82 W;  1UFI A;  4LBE C;  2JDI G;  1GK9 A;  1WPX A;  3CRC A;  2KKW A;  1MOF A;  2X6A A;  2ADP A;  3B2E E;  3TCU A;  3E83 A;  1OCO C;  1Q8I A;  4JYC A;  1NVP D;  3G71 V;  1YSC A;  1AJP A;  3Q4H B;  1FXV A;  3H9V A;  1HP8 A;  5LBQ A;  1SA0 B;  1TA8 A;  2HVJ C;  3LUT B;  2B9Z A;  1KBH A;  4J80 A;  1ZTE A;  3KZI Z;  3SJA C;  2A0L A;  5J2T B;  2YXL A;  1F23 A;  4LC1 A;  1YZB A;  3JD4 A;  3IC9 A;  3LDD A;  5HFL A;  1IBM O;  3JAS B;  4LR3 A;  1OCC C;  5LOV B;  2JGU A;  1EBO A;  1XOU A;  3LNN A;  2CTR A;  3BY6 A;  3RYF A;  4B3T B;  1L0L H;  1UPG A;  2Q6A A;  2PGG A;  5LMU B;  1K5Q A;  2CH7 A;  2VRZ A;  1PNL A;  1SQP H;  1M90 W;  2UXN A;  5EBL C;  3BVO A;  3K08 A;  4I5S A;  1PP9 H;  5FNV A;  4NTY A;  3JAM N;  4BW9 A;  3ZJZ A;  2QA4 V;  4IIJ A;  4BWA A;  1KP2 A;  2HVK C;  2D3O W;  1FJG O;  1RPR A;  3AG2 C;  1K3E A;  3JD1 A;  4MVU A;  4OX9 B;  2GUZ B;  2ZNJ A;  1W0J G;  4TQF A;  2LJ2 A;  4ASU G;  2EZP A;  1WNS A;  3FAV A;  1H8E G;  4LF5 B;  3TJT A;  2XAH A;  2PYJ A;  3ASO C;  4WFE A;  4O4I A;  4RUF A;  3DC6 A;  5GTI Z;  4PA9 A;  5GTH Z;  5L3D A;  3JAL B;  3OR6 C;  4FK5 C;  1I94 B;  4TOI A;  1UJW B;  1NTZ H;  5EBM C;  3TXS A;  4GZR B;  4UCV A;  4JGS A;  3C3S A;  4PA7 A;  4H37 A;  1IVS A;  1AP6 A;  3VQW A;  2UXD O;  3WFV A;  4HNA A;  5F2V O;  3G80 A;  2WLJ A;  3HKC B;  2E3C A;  3J81 N;  1MMM A;  2MK3 A;  3E86 A;  1XHX A;  3H1K H;  1P84 F;  2F66 C;  1JMK C;  4JI0 B;  2DYR C;  1FXK A;  1FFX B;  2XAS A;  3I56 V;  5L3F A;  4JYA B;  4TSF G;  1Z5V A;  2EIK C;  3AG1 C;  1QNM A;  4I55 A;  3CXH F;  2JIZ G;  2Q9L A;  3HKD A;  1O9G A;  4FM1 A;  3N27 A;  4EFB A;  5LYJ A;  3ZCC A;  4TT3 G;  2RQ6 A;  1PL0 A;  4QPK A;  4FLZ A;  4JV5 O;  2E76 B;  2F4V O;  2K1E A;  4X20 A;  3JSL A;  5GON B;  1E1Q G;  2M6Y A;  1M4U A;  5LL6 Y;  1PNM A;  1ZX3 A;  5KHJ A;  5EZY A;  4TV9 A;  2ZXW C;  4XDK A;  5LXT B;  4BIU A;  2HJD A;  1G4Y B;  1YTF D;  1XIL A;  3L72 H;  2A9H A;  1EFR G;  2QWN B;  4MTX A;  3CRQ A;  4GCZ A;  3NXS A;  3W7W A;  1YVW A;  2AZ2 A;  2HR3 A;  3DXR A;  1QHT A;  4B7E A;  1ZAU A;  1BHA A;  1X4T A;  1AI6 A;  3AG4 B;  4X62 O;  1GM9 A;  5JH7 B;  4X89 A;  2YUA A;  1CPY A;  4L87 A;  3U0Z A;  1I94 O;  1OCZ B;  2Q0A A;  1I7F A;  4PDM A;  2XUM A;  4P2Z A;  1WN7 A;  2EX3 A;  4BIO A;  3R65 A;  5EYP B;  4W4K A;  3ZRW B;  4DO2 A;  3EFF K;  1H2K A;  2FL4 A;  2F43 G;  4PHZ A;  4FFB A;  4BW5 A;  2R72 A;  4MTG A;  5FL7 G;  4YJ3 B;  4FLW A;  1AI5 A;  4NTX A;  1G6U A;  2WLH A;  4GX0 A;  3RYC B;  3SDL A;  2DYS B;  4WFH A;  1Q43 A;  2ADQ B;  2DOS A;  3QG5 A;  1Y4M A;  2Q0O C;  2QTO A;  5KHG A;  3K04 A;  1GTO A;  3WB0 A;  3ZRV A;  4GKJ O;  3CCJ V;  5B5E Z;  4YJ2 B;  1K34 A;  4GKJ B;  3A0H Z;  1GMG A;  3JD3 A;  3OEH G;  4HAM A;  4YIO A;  4TUY A;  1Y74 A;  5IY5 B;  1JFF A;  2F23 A;  2YI9 A;  5C8Y A;  1IXB A;  1PL4 A;  2CUG A;  2YC0 A;  1K5S A;  4RAI A;  3STZ C;  1DTO A;  1YI2 V;  2DN9 A;  4DV1 B;  2E74 B;  4QE7 A;  1RPO A;  2WLM A;  1DF5 A;  4ZIB A;  2WLI A;  3AK2 A;  4J7J A;  2YDE A;  2A06 H;  2CGO A;  4LP8 A;  2P4K A;  1GKF A;  2QM8 A;  2P7T C;  2CE4 A;  4LF4 O;  3RN4 A;  3C3T A;  3ZRX A;  4JI3 B;  2ZR3 A;  3BEH A;  3LNM B;  3A0R A;  3T1Y B;  4OPA A;  4UCU A;  4DV5 B;  3LDC A;  1JX9 A;  1ARO P;  5KAF Z;  5CB4 B;  4MVS A;  1K92 A;  4NYK A;  4L8J A;  4B3R O;  5FLX N;  1VQ7 V;  1ZUQ A;  4I9W A;  1OV9 A;  1SKV A;  1MAB G;  4X65 B;  2JRI A;  3JAT B;  1NKD A;  2HP8 A;  2WPD G;  2ZQM A;  2P22 C;  1OCZ C;  3IAY A;  4LH6 A;  1M93 A;  2QM7 A;  1OCR C;  5DED A;  2QDO A;  4NR1 A;  3RYH A;  3K59 A;  4MT8 A;  1HW7 A;  1N36 B;  3IFX A;  5J2U B;  1VQO V;  3OGI B;  2EIM C;  1KQS U;  5L3C A;  4JI7 B;  1XL4 A;  1CP9 A;  4TQD A;  3JSN A;  3ICX A;  4U7O A;  5KHH A;  1BCC H;  1GN4 A;  4BIZ A;  4DR4 O;  2ETN A;  4DK1 A;  3BCC H;  5LGN A;  2YEV A;  5LGU A;  4JI2 O;  2YIA A;  1XMO B;  2BOC C;  3APQ A;  3ETE A;  1Q6I A;  4K8X A;  4JF3 A;  4RQE A;  5IWA O;  2JK5 C;  2EJR A;  5IYZ A;  3N2K A;  2KSD A;  1BT8 A;  5BMV A;  1N0J A;  4U3J B;  3W7S A;  4KP4 A;  3CCR V;  3ABL B;  3D3Q A;  3T1C A;  1YJN V;  3UT5 B;  3RYI A;  3HB3 B;  4FPP A;  2FB5 A;  3AG1 B;  3HR0 A;  1M57 C;  5K1P A;  2EIJ B;  4JI1 O;  4C7U A;  1H8H G;  2V1D A;  5ITZ A;  3OD4 A;  3FD9 A;  4KL1 A;  3SPG A;  1V9P A;  3N2G B;  3ZMU A;  3OMN B;  2OTJ V;  1Q3E A;  1YHQ V;  4I0X A;  3B77 A;  4DR1 O;  4MVO A;  1XL6 A;  3STL C;  2FYU H;  1N8R W;  4JTC B;  1SF9 A;  1NBM G;  4I50 B;  4KUM A;  3OUF A;  1RSO B;  1PNK A;  4LFB O;  4O4L B;  2PI4 A;  1NTM H;  2ZT9 B;  4GT1 A;  2EJ7 A;  4JI1 B;  2EBO A;  4IYH A;  1HNZ B;  3J80 N;  3BA8 A;  4LF9 B;  3K0D A;  3OUS A;  4JZG A;  2XHB A;  4X1Y B;  4WBN A;  1Q6U A;  5E79 Z;  4CS4 A;  1NVP B;  1HR0 O;  1IBK O;  4UVB A;  3U10 A;  4E2L A;  1KYO F;  5IE9 A;  1Y76 B;  5JVD A;  1TUB A;  1VQ8 V;  4EB6 A;  2BSK B;  2QKS A;  5CA1 A;  2JEU A;  2IM9 A;  1THZ A;  2KB1 A;  3W7U A;  4O2A A;  3ABK B;  2PY5 A;  1IBM B;  1HNX O;  3HKE A;  2QKA A;  2VQE B;  2RCV A;  3VBB A;  2VWJ A;  1BHB A;  3M8A A;  1TUE B;  5KUM A;  2LFR A;  4JYB A;  4NVP A;  1EN4 A;  3I5D A;  1YF2 A;  2FKX A;  4F6E A;  3SYO A;  4MS2 A;  2XAF A;  5CA0 A;  3P3N A;  4J42 A;  1QCE A;  3JD0 A;  4MTF A;  3B40 A;  1V55 C;  2CTW A;  3ZN0 A;  1HWY A;  4JAS A;  4FZ0 A;  3AG3 B;  5KMG B;  4O4H A;  3ASN C;  2AGA A;  4LNU A;  2W6J G;  2K9P A;  5IDJ A;  4OXS A;  1M56 B;  2IU3 A;  5JQG A;  4UFZ A;  5KX5 A;  2Q68 A;  4FLU A;  1R1B A;  3ZHQ A;  1Q81 W;  2HKO A;  1QBZ A;  2ZE8 A;  1COW G;  4DV7 B;  1GO3 F;  1NR1 A;  1GN6 A;  2UUB B;  3JAK B;  3K3W A;  4CH5 A;  5A9G A;  2UUC O;  1US6 A;  4DR3 O;  1GM7 A;  3ZMZ A;  3E22 A;  4GKK B;  3IGA C;  2ZE6 A;  3ZIA G;  3JAW A;  1LNQ A;  2HHH O;  4WFA V;  5KA5 A;  1ROP A;  2LO1 A;  2BTQ B;  3CRA A;  4IYI A;  4NKG B;  4LF7 O;  4QNH B;  3ABK C;  1W0K G;  4NXN O;  2QWQ B;  4ZOL A;  3CSX A;  3E8B A;  4J7K A;  5JJJ B;  3JAR B;  1P7B A;  4TV8 A;  4X1K B;  2P90 A;  2WLL A;  3R66 A;  1VQP V;  3L9D A;  1B06 A;  2Z0A A;  2AHZ A;  4FFK A;  3ABM C;  3D36 A;  3CCV V;  2IBZ H;  2LGQ A;  2Q4P A;  1BS3 A;  2BOB C;  4DR7 O;  1S5L Z;  3H1I H;  3K9A A;  1PV0 A;  4DV5 O;  4KFM A;  1K97 A;  4I4T B;  2N05 A;  5LGT A;  4J7Z A;  2QGN A;  4X8A A;  5IYC O;  2EIL B;  4I9Q A;  3T4Z A;  3VQV A;  1VQ4 V;  2DWE C;  4DV2 O;  1ORQ C;  1QLE B;  5CN0 A;  5LP6 A;  5H9C A;  2ZIM A;  2YI8 A;  3LSQ A;  1VQ6 V;  1J5E O;  1ZL8 B;  5AG2 A;  1WAZ A;  2DMX A;  4DV3 O;  1HNX B;  4G2K A;  2ZKO A;  1JR9 A;  2LW7 A;  4ZHQ B;  2PUS A;  4DRX A;  2WLN A;  3GWK C;  4B3T O;  2LW1 A;  4RQF A;  4ZKI A;  1ENV A;  5LMN B;  2WA3 A;  1KKD A;  3VQX A;  2CDY A;  5H6Q A;  4JI4 O;  4DW0 A;  4IL6 Z;  1IBL B;  1CEZ A;  2ZXW B;  1TVK A;  2Y0P A;  1F7Y A;  1SA0 A;  5KHI A;  5IJ0 A;  5D5Q A;  2A7W A;  2UUA B;  1S72 V;  1X59 A;  2JJ2 G;  4QJF B;  3ZBH A;  4HBN A;  2YID A;  5BZB A;  2DYS C;  1CXZ B;  1V54 C;  1MG1 A;  2XTA A;  2Y69 B;  2UU9 B;  1ZWI C;  3IC7 A;  4KXR A;  4DXW A;  4DV0 B;  5H2F Z;  3CJH B;  5LOV A;  2VQF B;  1NS1 A;  3ZMT A;  3D3I A;  3CB2 A;  3QNE A;  4D7S A;  1K8A W;  1SQF A;  2WSS G;  2Y69 C;  1PKX A;  1RP3 B;  5B1B C;  4IHJ B;  3B4S A;  3L75 H;  5KA6 A;  3K57 A;  3OTO B;  1FKA O;  4NXN B;  3S3W A;  1GH6 A;  4DR1 B;  1YIT V;  1LUW A;  4R8C A;  2XAJ A;  5B1B B;  3FB5 C;  4MTO A;  1E79 G;  1JCH A;  1DF4 A;  3SJC C;  4FJC C;  1KUQ A;  3GVM A;  5CBG A;  4X9Q A;  4J11 A;  1B3Q A;  3MHH C;  3OMA B;  5KAI Z;  2WLK A;  2YXY A;  4FIP C;  4ICG A;  4JI6 B;  2QEX V;  1FYJ A;  2H3O A;  4NTW A;  1XMQ B;  4DR6 B;  4EKW A;  3FKS G;  3B8M A;  1SET A;  4AQY O;  2AZ0 A;  3SYA A;  1URF A;  3LDE A;  3CCS V;  1QLE C;  5LHG A;  4LFC B;  5KHK A;  5IJ9 B;  1SER A;  2EIL C;  5FPO A;  3SPC A;  2X6C A;  4WFF A;  4X88 A;  1JVM A;  4A5U B;  4JPR A;  5K1X A;  4JI7 O;  4X65 O;  4B3R B;  4JI5 O;  2P6J A;  1NJI W;  2F1M A;  1H2G A;  1XDC A;  3O65 A;  5CA3 A;  1FFX A;  1Q5O A;  3CS5 A;  1R3L C;  1N0N A;  3JCZ A;  3K5N A;  4PJ0 Z;  1XRE A;  3CCQ V;  4X64 B;  3JD2 A;  1AP5 A;  4FLX A;  3UO3 A;  2JVD A;  3HKD B;  4PD4 F;  4X1I A;  1S77 D;  4F6R A;  1AIL A;  3BRC A;  4DR5 O;  3CCM V;  3ML0 A;  3SPI A;  2BCC H;  4PDR A;  3E8F A;  5GON A;  4F4L A;  1F4M A;  5A2Q N;  3HPL C;  5EC1 C;  1IXM A;  1L8D A;  1S5J A;  3DGE A;  5LXT A;  2F4V B;  1M56 C;  2X0L A;  4LFB B;  3D36 C;  3P30 A;  4B3M B;  2ITD C;  4PI2 A;  2A79 B;  2EZO A;  1BQ0 A;  1GAX A;  1P49 A;  1QQC A;  3E8G A;  3ETQ A;  2N04 A;  2QTS A;  4UCR A;  1BMF G;  3BFR A;  3M99 B;  2DQ0 A;  1M9N A;  4IGG A;  1EM1 A;  1YXB A;  4LF5 O;  2EIK B;  2BE3 A;  4J41 A;  5L3G A;  1MZE A;  1S0V A;  1Y6X A;  1YTF B;  1PD3 A;  3ZHR A;  1S5H C;  5DM6 V;  2RN9 A;  5L3B A;  1TGO A;  3CRR A;  5B1O A;  2Q8V A;  2ZDI A;  4U3F H;  4LWS B;  1BZK A;  4J10 A;  1R73 A;  1B04 A;  2CH7 B;  1HNW O;  3MD0 A;  3K0G A;  3KCX A;  3ZHV A;  4YJ3 A;  2ZD9 A;  4FZ1 A;  1S3J A;  3K9S A;  4GX1 A;  1QR8 A;  1U97 A;  1L0N H;  3A2F A;  1M57 B;  2YS8 A;  2YIB D;  1SC5 B;  5GW7 A;  2IH3 C;  3H1L H;  3OEE G;  4DR3 B;  2JS3 A;  1KB9 F;  1IUR A;  2VQF O;  2OIG A;  4UCT A;  4D7T A;  1U96 A;  1R6K A;  3FAV B;  3H1H H;  5CBF A;  4YJ2 A;  1NI8 A;  3QO5 A;  2W0F C;  2ZCE A;  1J95 A;  4O4I B;  4G28 B;  1Y74 B;  1VEW A;  4TWK A;  2GHY A;  3JAL A;  3HKB A;  3WB1 A;  1N33 O;  5CBH A;  2UXD B;  1V55 B;  2KG7 B;  4K0K O;  3WG7 B;  3EXA A;  3X2Q C;  4DV0 O;  4GYC B;  2EIN B;  2FTK A;  1NH2 B;  2RMK B;  4O2B A;  3ABT A;  3G67 A;  3L74 H;  2VQE O;  4HNA B;  4ZI7 A;  3B09 A;  2HHH B;  3AK1 A;  4PV1 B;  1JJO A;  4J9Z B;  4O4J B;  2Y4T A;  2OWO A;  3X2Q B;  1O9H A;  1R6T A;  1H38 A;  1FXK B;  2XAQ A;  2M7W A;  5LA6 A;  4P30 A;  1XUQ A;  5B1A B;  1RM1 C;  1OZ0 A;  4JI4 B;  4JI3 O;  1WA8 B;  4K0K B;  2CTQ A;  4N23 A;  2RNB A;  3T1Y O;  1XNR B;  3CRM A;  1MZF A;  1P7G A;  2GDS A;  4FLT A;  3ZRS A;  1R3J C;  4XBF A;  2UUA O;  3G6B A; 
#chains in the Genus database with same CATH homology
 2IU3 A;  1W0J G;  3ZMV A;  3OAA G;  3I55 V;  2Q68 A;  4ASU G;  4XDL A;  4MW8 A;  3RVY A;  2EZP A;  5B1A C;  1Q81 W;  2HKO A;  5EK0 A;  1K4D C;  1QBZ A;  1COW G;  1GO3 F;  1H8E G;  1NR1 A;  5IYD O;  2XAH A;  3E35 A;  1OCO B;  4WFB V;  3K3W A;  1Y66 A;  3ASO C;  1VQM V;  4WFE A;  4RUF A;  4PA9 A;  3ETG A;  3OW2 U;  1GM7 A;  3ETD A;  2EIM B;  2WAM A;  3ZMZ A;  5L3D A;  4MVZ A;  3IGA C;  3CPW U;  1KEC A;  1F51 A;  3T2M A;  3ZIA G;  1LNQ A;  3OR6 C;  4FK5 C;  4MVR A;  5LHI A;  4WFA V;  5KA5 A;  1W2B U;  1UJW B;  1ROP A;  3F5W C;  2XAG A;  3T4D A;  5EBM C;  3F7V C;  3K06 A;  5CMU A;  4QNH B;  3ABK C;  4J9Y B;  1W0K G;  4JGS A;  4PA7 A;  2EIN C;  4H37 A;  3WG7 C;  3SJQ C;  4Z1M G;  1DLB A;  1AR1 B;  1R6N A;  3OMI B;  3E8B A;  2YEV B;  3SYQ A;  1VQ9 V;  3WFV A;  1OCC B;  5EC2 C;  3UM7 A;  1P7B A;  2Z5U A;  2WLJ A;  2MK3 A;  2P90 A;  3E86 A;  2WLL A;  1L1F A;  1VQP V;  4UV8 A;  2AHZ A;  3ABM C;  3D36 A;  2DYR C;  1FXK A;  5IYB O;  3CCV V;  3P32 A;  2XAS A;  2JEX A;  3I56 V;  5L3F A;  2BOB C;  1NH2 D;  2WWW A;  4R50 A;  4TSF G;  3K9A A;  2EIK C;  1QR9 A;  4KFM A;  1K97 A;  2IH1 C;  5EBW C;  3AG1 C;  3EHB B;  4Q20 A;  3AG3 C;  4HYO A;  4X8A A;  5LGT A;  3H01 A;  2XND G;  3TET A;  5IYC O;  2EIL B;  3T4Z A;  1G8M A;  3PJS K;  4BAY A;  1VQ4 V;  1I5Y A;  3FYI B;  4RUE A;  3CXC U;  2JIZ G;  1VQN V;  1SES A;  2DWE C;  1ORQ C;  1QLE B;  4H33 A;  5CN0 A;  1KC8 W;  3ZCC A;  5H9C A;  4TT3 G;  4QPK A;  1PL0 A;  3LSQ A;  1K4C C;  4PA6 A;  3RVZ A;  1VQ6 V;  4MVQ A;  2UXX A;  1QVF U;  2K1E A;  4G2K A;  1E1Q G;  3ZN1 A;  5J9P C;  1JOY A;  1PNM A;  4P9P A;  1K9M W;  2CK3 G;  2ZXW C;  4XDK A;  4BIU A;  1G4Y B;  1YTF D;  2WLN A;  3CCL V;  2A9H A;  5LHH A;  1GM8 A;  1EFR G;  2ATK C;  1YIJ V;  4MTX A;  4GCZ A;  1R3K C;  3NXS A;  1K33 A;  3W7W A;  4RQF A;  4ZKI A;  4CBC A;  1ENV A;  2HR3 A;  2JJ1 G;  1KKD A;  3GWO A;  2ITC C;  2PI5 A;  1BHA A;  1AI6 A;  3AG4 B;  5H6Q A;  4XDJ A;  1GM9 A;  2W6I G;  3W7X A;  2WLI B;  4X89 A;  4L87 A;  1BL8 A;  1CPY A;  2Z3Y A;  2GSM B;  4LCU C;  1KD1 W;  1OCZ B;  3CYO A;  2ZXW B;  1CEZ A;  3FB6 C;  4PDM A;  4QPJ A;  4P2Z A;  3R65 A;  5KUK A;  4JTA B;  3ZRW B;  1S72 V;  4DO2 A;  2JJ2 G;  3EFF K;  4QJF B;  5BZB A;  2XOK G;  2DYS C;  2F43 G;  4JTD B;  1V54 C;  5E1A C;  4BW5 A;  3SYC A;  4MTG A;  1KP3 A;  4UVA A;  4MW3 A;  5FL7 G;  4P9O A;  4CZZ A;  1MG1 A;  1EZJ A;  1AI5 A;  3JYC A;  2Y69 B;  3OGC C;  1ZWI C;  3IC7 A;  2WLH A;  4DXW A;  4GX0 A;  3ZMT A;  2DYS B;  5IY5 C;  3D3I A;  3QNE A;  4WFH A;  1K8A W;  1AJQ A;  2WSS G;  2Y69 C;  1PKX A;  1FXK C;  5B1B C;  1Y4M A;  5KA6 A;  2QTO A;  4PEL A;  3K04 A;  1GTO A;  2IJI A;  3ZRV A;  3CMA V;  3CCJ V;  1YIT V;  2EIJ C;  3VOU A;  1K34 A;  1RM1 B;  4RO2 A;  2H8P C;  2IJH A;  2YSU B;  4R8C A;  2XAJ A;  5B1B B;  3FB5 C;  1GMG A;  3JD3 A;  3OEH G;  4MTO A;  4HAM A;  1E79 G;  2Q69 A;  1JCH A;  1DF4 A;  1OHH G;  2HFE C;  4UXN A;  5B3S C;  4FJC C;  5IY5 B;  4UUJ C;  5CBG A;  4WFG A;  1K5S A;  3MHH C;  3OMA B;  2WLK A;  4N21 A;  4RAI A;  3STZ C;  1DTO A;  1YI2 V;  2C2A A;  4FIP C;  4PDV A;  5IDJ A;  2R9I A;  2QEX V;  4QE7 A;  1RPO A;  2WLM A;  1DF5 A;  1F4N A;  2WLI A;  3LSS A;  2AHY A;  3MHS C;  4EKW A;  3FKS G;  3FYE B;  3G4S V;  3B8M A;  1SET A;  4LP8 A;  2H94 A;  3SYA A;  1GKF A;  3LDE A;  2QM8 A;  4GX5 A;  3FB8 C;  5B1N A;  3UKM A;  3ZRW A;  2P7T C;  3AEI A;  1VQL V;  3CCS V;  2OTL V;  2OT5 A;  1QLE C;  3CP1 A;  5LHG A;  3E8H A;  3ZRX A;  2ZR3 A;  3BEH A;  3LNM B;  3A0R A;  1SER A;  2EIL C;  4U7N A;  5HFM A;  1WLE A;  1SZT A;  3LDC A;  1JX9 A;  2X6C A;  3SPC A;  4WFF A;  1ARO P;  4X88 A;  1JVM A;  4MVS A;  4JPR A;  1K92 A;  4QE9 A;  4R6Z A;  3CME V;  2NLJ C;  2B1I A;  4JAU A;  3CCU V;  2X7R B;  3AG4 C;  4UVC A;  2Y48 A;  1VQ7 V;  4I9W A;  3SPJ A;  2Q67 A;  2WLL B;  5DN6 G;  4QIW F;  1MAB G;  2P6J A;  1NJI W;  1K73 W;  1H2G A;  1YJ9 V;  2LP7 A;  3K03 A;  1NKD A;  2WPD G;  2ZQM A;  3E89 A;  4HZ3 A;  5CA3 A;  1OCZ C;  2V7Q G;  3W7T A;  1R3L C;  3JCZ A;  2QM7 A;  2ZR2 A;  3CCQ V;  3JD2 A;  1OCR C;  1E1R G;  3ZMS A;  4JAV A;  4MT8 A;  3E2E A;  3IFX A;  1VQO V;  1S77 D;  2DW4 A;  3SYP A;  2EIM C;  1AI7 A;  1KQS U;  5C93 A;  5L3C A;  1XL4 A;  3OE7 G;  3CCM V;  3ML0 A;  2HG5 C;  3SPI A;  4PA4 A;  1CP9 A;  4PDL A;  4U7O A;  1VQ5 V;  1M1K W;  4PDR A;  1NQT A;  4BIZ A;  3E8F A;  2OCC C;  4F4L A;  1F4M A;  3HPL C;  2QE7 G;  4ZBM A;  5EC1 C;  1IXM A;  5LGN A;  3DGE A;  2YEV A;  5H6R A;  5L3E A;  5LGU A;  1K7D A;  1M56 C;  2X0L A;  1FS0 G;  3ABL C;  3KG2 A;  3K79 A;  2BOC C;  3P30 A;  3RW0 A;  2ITD C;  2A79 B;  2EZO A;  1R3I C;  3ETE A;  2DWD C;  2OCC B;  2IJJ A;  4JF3 A;  4RQE A;  2JK5 C;  2EJR A;  3E8G A;  1B6Q A;  2IW5 A;  3CC4 V;  1BMF G;  1AI4 A;  1QLN A;  2HLD G;  2DYR B;  4GX2 A;  3M99 B;  3W7S A;  2DQ0 A;  2X6B A;  3TK1 A;  4WF9 V;  2R9R B;  1M9N A;  4KP4 A;  3CCR V;  3ABL B;  1YJN V;  3T1C A;  3HB3 B;  4FPP A;  1JQ0 A;  3AG1 B;  3AG2 B;  1Q7Y W;  2B1G A;  2EIK B;  2IU0 A;  3OM3 B;  1M57 C;  5L3G A;  3ABU A;  2IJK A;  3CC7 V;  1S0V A;  1YTF B;  1PD3 A;  2EIJ B;  3B8N A;  3SPH A;  1S5H C;  1H8H G;  2V1D A;  4MVM A;  5DM6 V;  3F7Y C;  5L3B A;  3QO7 A;  5B1O A;  4G27 B;  2ZDI A;  3SPG A;  1R73 A;  1MSW D;  3ZMU A;  3OMN B;  1AJN A;  2OTJ V;  3MD0 A;  1YHQ V;  3B77 A;  3K0G A;  2ZD9 A;  4MVO A;  3QO8 A;  1NR7 A;  1XL6 A;  3OFN G;  1S3J A;  3STL C;  2HJF C;  4GX1 A;  1S76 D;  1QR8 A;  2LFS A;  2DQ3 A;  1N8R W;  4JTC B;  3RBZ A;  1M57 B;  1YJW V;  1NBM G;  1P4R A;  1I5X A;  1FXH A;  1QVG U;  3GB7 C;  5GW7 A;  3ASN B;  1Q82 W;  2IH3 C;  3OEE G;  4KUM A;  3OUF A;  4LBE C;  1PNK A;  2PI4 A;  4GT1 A;  2JDI G;  3DTU B;  2EBO A;  1GK9 A;  1WPX A;  4PA3 A;  1MOF A;  2X6A A;  1R6K A;  3K0D A;  3OUS A;  3TCU A;  3E83 A;  5CBF A;  1JPX A;  1OCO C;  3ABM B;  4JYC A;  1NVP B;  3QO5 A;  1NVP D;  2W0F C;  3G71 V;  1J95 A;  1YSC A;  1AJP A;  4G28 B;  1FXV A;  3FB7 C;  4UV9 A;  5LBQ A;  3CD6 V;  4UVB A;  5B3S B;  2HVJ C;  3LUT B;  2B5U A;  4TWK A;  4E2L A;  2GHY A;  1VQ8 V;  5CBH A;  2QKS A;  1V55 B;  2A0L A;  2JEU A;  2KB1 A;  1THZ A;  3WG7 B;  1VQK V;  4MSW C;  3X2Q C;  3W7U A;  3ABK B;  2ZDI C;  1V54 B;  1F23 A;  2EIN B;  2FTK A;  4LC1 A;  1NH2 B;  3JD4 A;  3VBB A;  3ABT A;  1BHB A;  3LDD A;  5HFL A;  1TUE B;  5KUM A;  4R7C A;  2LFR A;  4JYB A;  4WCE V;  1OCC C;  1OCR B;  3CC2 V;  1Q86 W;  1EBO A;  3SYO A;  4MS2 A;  3BY6 A;  3OR7 C;  2XAF A;  4J9Z B;  2Q6A A;  1FFT B;  1QCE A;  3JD0 A;  1K5Q A;  1SRY A;  4MTF A;  4FMT A;  3X2Q B;  1H38 A;  1V55 C;  1FXK B;  2XAQ A;  2M7W A;  3ZN0 A;  1HWY A;  1PNL A;  4OXS A;  4P30 A;  2NNU A;  4JAS A;  1M90 W;  2UXN A;  5EBL C;  5B1A B;  1RM1 C;  1OZ0 A;  3K08 A;  4I5S A;  3AG3 B;  3G6E V;  2P67 A;  4N23 A;  3ZJZ A;  2QA4 V;  3ASN C;  3CCE V;  4YXW G;  1KP2 A;  1JJ2 U;  2HVK C;  3ASO B;  3ZRS A;  1R3J C;  2D3O W;  4XBF A;  1RPR A;  3AG2 C;  1K3E A;  2W6J G;  3JD1 A;  4MVU A;  1M56 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...