1GTOA

High resolution structure of a hyperstable helical bundle protein mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
62
structure length
62
Chain Sequence
GTKQEKTALNMARFIRSQTLTLLEKLNELGADEQADICESLHDHADELYRSCLARFGDDGEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Amino-acid substitutions in a surface turn modulate protein stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
molecule keywords ROP
total genus 28
structure length 62
sequence length 62
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1996-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1gtoA00
1RPOA 2IJJA 2IJHA 2IJKA 1F4MA 1B6QA 1F4NA 1GMGA 1ROPA 1NKDA 1RPRA 2GHYA 2IJIA 1PD3A 1GTOA 3K79A 4DO2A
chains in the Genus database with same CATH superfamily
3CYOA 3NXSA 3ZS8C 4EB6A 3AEIA 1T5EA 2HP8A 3L9DA 2JIZG 3CX5F 1HNXB 2UUAO 1Q5OA 2WLJA 2F95B 1Y74A 4HNAA 1SETA 2AXTZ 3K9SA 1AI4A 2PZSA 4PV1B 4X64B 1TUBA 4MVSA 3CCRV 4LH7A 2YSUB 1IBKO 4X1KA 2N74A 1PL0A 1DK1A 4U7NA 4IYIA 2CE4A 2CTQA 3K0DA 1OCCC 5JCOA 4Z2WA 4FLVA 1LR1A 1SQFA 1BE3H 3Q4HB 3DXRA 1GK9A 1N4CA 5TISZ 4JI6B 4H13B 2IJJA 2FL4A 3C3TA 1HNZO 4UV9A 2OCCB 4DR3B 4O2BB 3HKBA 4DK0A 4JAAA 1K4DC 2Q7GA 4NXNB 1PP9H 2CTRA 2QJ1A 2HHHB 3ZRWA 5H9CA 2IBZH 4W4LA 5EIBD 4B3TO 4K0KO 5BMVA 1YF2A 4DUYO 1GM8A 4GKJO 2XAQA 4X1YA 2K1EA 4Z1MG 1Y66A 1VQOV 1BZKA 2JEXA 1JJOA 1FXKA 5L3BA 4DV3B 3ZEDA 1IXBA 3RYCB 1XUQA 4DR4B 1KKDA 1IBLB 1PNLA 3OFNG 1W2BU 3SPIA 4U3JB 4TQFA 4MTXA 5JJEB 4FIPC 4BW5A 1FD9A 3IGAC 4DV2B 4F4LA 4LWSA 1NKDA 2Y69B 4O2AA 3B8NA 4NKGB 2WLLB 4JI2O 4FLUA 3ZN0A 1OCRB 3CCSV 3SR2C 2IW5A 4GX2A 5IY5B 5DM6V 3CCLV 5GW7A 1X4TA 2BTOA 2DQ3A 2ZCEA 2HHHO 5LA6B 4JI0O 5K1XA 4DYLA 3ETQA 2PUSA 4ZI7A 5L3DA 3RYHB 3SPCA 4NXMO 4X20B 1G6UA 3HB3B 4BIZA 3HKCA 4K8XA 3JAWA 4NYKA 2Y4UA 5CB4A 4ZIBA 5B5EZ 4TV8B 4PDMA 4NTYA 1AB3A 1XBLA 3ABTA 1GM7A 2KG7B 5KUMA 1TUEB 5H6QA 4MTOA 4YHHO 3CEIA 3T1YO 1NI8A 3RYHA 1GN4A 4G27B 2UUCO 4JZ2A 3GVMA 2EINB 3DXRB 4FJCC 3OUFA 1TVKB 4DV6O 1AI7A 5B1AC 3ZMSA 3ABMB 4JYAO 5LYJB 1FFXB 4JI3O 4TOIA 4QNHB 3CJHB 2Q9LA 3SJQC 1EZVH 2HVJC 1RM1C 1SS3A 3E22B 1GTOA 3UT5A 1N32B 4LFAB 5BZBA 1MZFA 1IBMO 5E79Z 1I7FA 1VQ8V 3ZIAG 1H2LA 4DV1B 2YIBD 2LGQA 1V55C 1RP3B 5B1BC 4GCZA 2P4KA 3JAKA 4I55A 4U3FH 2NNUA 4A5UB 3QTCA 1WP7A 1F4NA 3T2MA 1Z5WA 3RBZA 3JCUZ 3P3NA 4PD4F 3STLC 1NR7A 1H2SB 5H5NA 2YUAA 3TGUH 2Y69C 2ZDIA 2ITCC 1DF4A 1OV9A 3O65A 4FFBB 1QVFU 4X65O 1AVMA 4BWAA 4K8ZA 1MSDA 3AK2A 2LW7A 4HZ3A 2XUMA 3RFRA 2HVKC 5KHGA 4JI8B 5B1OA 3CWBH 1L8DA 2E5LB 2QWNB 1H2MA 1AJNA 4FVMA 2IU3A 4Q20A 1R3IC 3A0RA 4DW1A 1N36O 2HEPA 5EC1C 3R65A 2FTKA 3W7WA 2MW2B 3AK3A 4JTCB 4WBNA 2JS5A 1YHQV 3JD3A 2PF4E 3ETGA 5IYDO 2BTQA 3TXQA 3N27A 2JEUA 5CBGA 1SQPH 3CXCU 3RYCA 2ILMA 1NTKH 1R1BA 2PI4A 1KB9F 1S5HC 3F7VC 1FXKC 1EFRG 4CS4A 1OCRC 5DECA 4BIUA 1MG1A 3CC7V 2NR5A 4MW8A 5D5PA 5EZYB 3SPHA 1Y76A 3SYPA 5JH7A 4X62B 3FAVB 3HR0A 1EN5A 3CCMV 2ARHA 3E89A 4DR6B 1MNGA 1NVPD 1OCZC 4X9QA 2YI8A 1VQ9V 4DR5B 4YJ2A 5H2FZ 4CZZA 1R6TA 3CCVV 4UB6Z 4I4TA 2GUZB 1VF6C 4K3AA 3SYAA 2HJFC 3JCZA 5CA1A 1L0NH 1J95A 3AG1B 3JD0A 2DOSA 4X66B 4BIOA 1NTZH 3ETEA 2DWDC 1Q90D 4O4JB 5L3FA 3KCXA 4TSFG 3K5MA 1XQ8A 4P9OA 2LGWA 5KA6A 1PM9A 2ZD9A 5EYPA 2QWOB 4NTWA 4H0LB 4LF6O 1XNQO 2R9RB 4YIPA 3A0HZ 3IFXA 1GKFA 4Q6GA 1I08A 1L0LH 4NXMB 2UXCO 3F7YC 2OT5A 1YTFD 1HP8A 2ITDC 1HDJA 1W0KG 2PYJA 5BY1A 3OT7A 4P9PA 3ABMC 1JJ2U 3CRRA 3SYCA 4EFEA 3AG4B 2W0XA 3K04A 4FLTA 5BR8O 4J41A 3ICXA 4DV0B 2A06H 5EBMC 2P5OA 2HG5C 2ZE7A 3E83A 1GN3A 1ZX3A 1QQCA 1VF6A 2F23A 4JI0B 3CC2V 5LL6Y 1O9HA 4X64O 1ENVA 4TT3G 1AR5A 3RVZA 1ROPA 2H94A 3CE2A 4PJ0Z 1I5XA 3AG1C 2UUBB 3OEHG 1Q6UA 4JYAB 2XAJA 2VQEO 2Z3YA 4X1IA 3JATA 4O4IA 4K35A 2P6JA 4R6ZA 5KUKA 3U11A 5FL7G 2Q68A 1FJGB 1WB7A 1AROP 2AGAA 1QCEA 2ZR2A 1YCIA 1IBMB 3BPZA 4UCUA 2DE0X 2ZNIA 1VQ7V 1A32A 2QKAA 4DR6O 3JAMN 4DV2O 4X65B 4I7ZB 4DV4O 4P2ZA 4JI5B 2AZ2A 5IDJA 4ZOLA 1D5NA 1SZXA 4BAYA 5LP6C 2P67A 3P3PA 5LP6B 5KMGB 1I94O 1N8RW 2YC0A 3BABA 4MT8A 1VQ6V 3AG2B 4PA9A 3VOUA 1EBOA 1HR0O 3ZMUA 1R73A 1V55B 4LF4O 3BVOA 2WWWA 4X8AA 4DUZO 2QWQB 1N33O 3D36A 1K33A 5B3SC 4LFCO 5IYZA 2ZE5A 4F6EA 1W0JG 3CSXA 4OPHA 2ZIMA 2CTPA 1I0HA 1S5JA 1FS0G 4PELA 1YEWA 1WPBA 4L87A 3EHBB 1K8AW 5KHIA 3B09A 3RYFB 2A0LA 4LBEC 2L6LA 3KCYA 3WB2A 3JAKB 4I55B 5JVDB 4UCSA 4UCRA 4X20A 5A9GA 1M9NA 3ASOC 1OCOC 4DR7O 4WFBV 1E1RG 1XMQB 4PI2A 2VQEB 1IBKB 1NQTA 4KHPO 2KG7A 1AJQA 3E22A 5JJNB 3RYFA 4JGSA 4G2KA 4LC1A 2FMLA 1XL6A 2KQXA 1RPRA 2RMKB 4E4EA 2QA4V 4GZRB 4WFGA 3X2QB 2XHBA 3A8TA 4DV6B 3OR7C 1ZSPA 5DN6G 3ZHUA 3GB7C 2R9IA 1GM9A 3WFVA 3E8FA 5C8YA 2QE7G 1COWG 4O4LB 4YY3O 3P32A 5KHHA 3CRMA 3DC6A 1K73W 3IC9A 2X7RB 2D3OW 2UXCB 1FPOA 2RCVA 1MABG 4I50A 2WLLA 1XHXA 2QGNA 4BR6A 3SPJA 5KX5A 3TETA 4IYHA 3L71H 2K9PA 3JAWB 1SKVA 4UVAA 2UXDB 3RYIA 5IWAO 4CH5A 4IHJB 2ZINA 2BSKA 1JR9A 2BOCC 4J7KA 1KD1W 2NN4A 4LF8O 4RUFA 2C2AA 2BSKB 3U0ZA 1LUWA 1FXKB 2W6JG 3ML0A 3LDDA 1Y67A 4O4JA 3CCUV 3MDSA 4H44B 1NR1A 1G8MA 4X1IB 3K9AA 1XNRO 2ZDIC 1XL4A 2Q7HA 5JVDA 1U96A 3G71V 5CA1B 1D5AA 4MVZA 4WFEA 1WLEA 2IJKA 3TXSA 1MZEA 1QLEB 3CCQV 2JGDA 4HAMA 5HFMA 3B40A 2IJIA 4FM2A 3JALA 2YS8A 5IE9A 2BE3A 4DR3O 3N2GA 2WAMA 1IXMA 1DF5A 1RM1B 1S0VA 4UCTA 1B3QA 4DR7B 4J11A 3MHHC 4J9ZB 3QO7A 5L3EA 2E3CA 2DYRB 3VQYA 5BMVB 2DYRC 4GKKO 2RJZA 1NJIW 2ZNJA 5BR8B 2DN9A 2JK5C 3HKEA 1TA8A 3SDLA 4JAUA 1VF7A 3ZBHA 2Q4PA 2QSAA 3QF7A 1M56B 1X59A 2BTQB 2UU9O 3R66A 5JJJB 4DR4O 2RN9A 2LFSA 2QTOA 4WBNB 1BQZA 5H6RA 4MTGA 4UVCA 1IVSA 2B1IA 2P90A 4PA6A 5CMUA 4UVBA 4JV5B 1VIBA 2YEVB 4CBCA 4DR5O 4DR1B 5IJ9A 3CHXA 3SJAC 1MA1A 2OIGA 1K9MW 1XHZA 3THOA 3ZJZA 1ZLZA 2GHYA 1LNQA 4GX5A 2ZXWB 4AHCA 4Z1VA 4H33A 3OTFA 4B7EA 5JWPA 1SQGA 1TUBB 3H1KH 5FPOA 1ZTEA 3ZHSA 5FNVB 3VQWA 4IIJB 1SERA 3KZIZ 4TV9B 1GAXA 3N2KB 1KYOF 4UUJC 1VARA 2GBOA 3RGBA 4R7CA 1M4UA 2WLIB 4OGQB 2UXDO 1XNRB 3G80A 3M99B 3W7XA 3HPLC 5J2UA 1HNWB 2NLJC 1OHHG 2UU9B 2ADQB 1GH6A 3T1YB 1EM1A 2M6YA 1S72V 5IYBO 2QR4A 5LXTB 4RAIA 4KXRA 3QO8A 1FXHA 1FFXA 2DJVA 4J80A 3JASA 4OX9O 1VF5B 1ORQC 3IAYA 1E79G 5DEDA 2CH7B 2ADPA 1NZ6A 2OTLV 3IC7A 4MVQA 1FKAO 5IYCO 2UUBO 5FNVA 4CC6A 3D3QA 2WSSG 3A2FA 4I9WA 3UO3A 1Q6IA 1K34A 1QR9A 1K5SA 2DW4A 1NH2B 5AG2A 1MOFA 3FAVA 2WLIA 5CA3A 5LOVB 1GRJA 3OTOO 1BMFG 4I0XB 3RW0A 2Q5ZA 4CS2A 2ZM6O 4QE7A 1E1QG 4GLXA 3FB7C 4IIJA 3ZHRA 2QWPB 1Y4MA 1Z2GA 2FYUH 2RNBA 2EULA 4DRXA 5D5QA 2JGDB 1JA8A 2LFRA 4LR3A 4RQFA 1YVWA 4B3MO 2EIKB 1UFIA 2IH1C 1MMMA 2YXHA 3K08A 3G67A 2KSDA 3JD1A 5KAFZ 3LDEA 5KHJA 2F93B 2O57A 2FB5A 2ZR3A 5BXZA 1CEZA 3E35A 1RSOB 1WJZA 4FLWA 4DV7B 2QM4A 3CCEV 2DQ0A 1U97A 2M7WA 4LF9B 4UXNA 3N2GB 1HWYA 1YSCA 4JI7O 4O4HB 1EN4A 3F5WC 3RVYA 1KUQA 2V4DA 2QTSA 1KQSU 1KP3A 1R6NA 2XT9A 4JTDB 4UV8A 2VS0A 1HNWO 2QKCA 3S3XA 5EIBC 1VQKV 3SPGA 1Q7YW 1TGOA 4OPAA 4FMTA 4FPPA 4LP8A 3SGIA 4ZKIA 1Y76B 4JYBA 1VQMV 4B3TB 3CP1A 5KX5B 3PJSK 4JYYA 1GMGA 5LMNB 2UXBB 3K79A 3JSLA 1QR8A 1AR1B 2V7QG 3EVKA 4D6TH 4ZI7B 1JQ0A 2PTMA 1R6KA 3AG7A 2ZE8A 4LF5B 2F66C 4DV3O 1G4YB 1SQBH 5IJ0A 4O4HA 4DV4B 1CP9A 5B1BB 4UCVA 3K3WA 4DUZB 4MVMA 1AR4A 2EILB 5LGTA 4JI4O 1V54C 4I5SA 3S3WA 2B1GA 3RYIB 4KL1A 4FM1A 2QEXV 1EN6A 4GX1A 4B7KA 4B08A 2EINC 4FLYA 2VQFB 3LSSA 3APOA 3X2QC 1YIJV 3OGCC 4DV0O 1ZWIC 5ITZB 5LHIA 2JDIG 5HFLA 2AHZA 1SF9A 3P30A 3K5LA 3ABLC 3LNNA 3DGEA 3CRQA 2B5UA 3L72H 5GONA 3BFRA 4JTAB 2Q0OC 2Q6AA 3LDCA 4NR1A 1PL4A 2VRZA 4QPKA 1FXVA 1PPJH 1QNMA 4C7UA 1B06A 2EIKC 4JV5O 3OD4A 4LCUC 3W7UA 2CTWA 4LF7B 1DLBA 5LBQA 1PNKA 4B3MB 2F4VO 2JS3A 3FB6C 4MSWC 4WF9V 2RDCA 3EFFK 1WNSA 1JMKC 5LGNA 4MVOA 4DK1A 3OMNB 4PDVA 1XEQA 4PHZA 2V1DA 1WP8A 2XTAA 5E1AC 3T4ZA 3ABKC 1QBZA 4IT5A 4I9QA 4IL6Z 1IURA 3AG3C 2WLKA 3K5NA 2JRIA 5KAIZ 4MVUA 2EILC 5GONB 3OW2U 4FLXA 2ZT9B 1RSOA 2CGOA 5J9PC 3ABUA 1SZTA 4QJFB 3K03A 1H2KA 3CCJV 2AW9A 1SQXH 4RQEA 1N32O 1YJNV 1QLNA 2XNDG 3K0GA 4FK5C 3QVNA 1OCOB 1BL8A 4QE9A 5J2UB 1N33B 5KA5A 2PY5A 4NTXA 3L74H 1D2DA 1UJWB 3TJTA 3BRCA 2OWOA 3KG2A 4LNUA 4AILC 3CPWU 4IGGA 5KHKA 1Q3EA 2OYQA 4JI4B 3OE7G 1XILA 3JATB 4O4IB 3MD0A 3CS5A 5LHHA 4X66O 4X1YB 4W4KA 3ZN1A 4RWUA 1HNXO 3FB8C 4OXSA 2EIMC 4FLZA 3B4SA 1SRYA 5C93A 5F2VO 2B9ZA 3ZRVA 4CH4A 1XDCA 3L73H 4UB8Z 2AZ0A 3UQ8A 4NB5A 4LF6B 1VQ4V 3CC4V 5LA6A 3M7MX 1KKCA 1K92A 3BCCH 4NVPA 4WFAV 1Q43A 3ASNB 1YITV 4QGPA 2WA4A 2ETNA 2LO1A 3SYQA 1K4CC 3VQVA 2DWEC 3WB1A 2HLDG 1NVPB 1J5EO 1VQLV 4DV5B 1XMQO 2UUAB 2CUGA 3FX7A 3D3IA 1Q82W 4CH3A 1BSMA 4X89A 1O9GA 5L3CA 1NH2D 4DW0A 3I56V 1K5QA 5EYPB 3ZCCA 3D36C 3ZRSA 2W6IG 5JH7B 1VEWA 3BEHA 3L75H 2GV9A 3WG7B 4GKKB 3BHPA 1ZL8A 1QVGU 4HBNA 1FFTB 1XI1A 1M57B 4CH6A 4JI5O 3SJBC 1IX9A 4MW3A 4EB6B 2MK3A 3RN4A 4K0KB 1F51A 1LUVA 4XDLA 1SA0B 4QIWF 2YXYA 4GKJB 2PYLA 1P84F 3C3SA 4FZ1A 1JPXA 4RUEA 2ZE6A 1AI5A 1IDSA 3CB2A 1SC5B 3QO5A 1DGSA 2N05A 3HKBB 4DV1O 2YIAA 3HKDA 1VQPV 4F6RA 4GX0A 1YTFB 1IBLO 1XNQB 2WA3A 1P7GA 5LMUO 3UO2A 4ZHQB 5CBHA 2H8PC 4PA7A 1K97A 5LGUA 3NR7A 4LFCB 2YEVA 3J81N 4D7TA 1S5LZ 4H37A 2UXBO 3WB0A 1JOYA 3ZHVA 4UCOA 1GN2A 2YI9A 3A0BZ 3O9OA 3FFQA 2IJHA 4LH6A 3CRAA 2GUZA 1SQVH 1F23A 3H1JH 4U7OA 2DMXA 2X0LA 1WAZA 3OMAB 3B2EE 3U10A 3UKMA 3WG7C 3H01A 4B3RB 2WPDG 1XMOO 1JFFB 5CA0A 4X1KB 3E8HA 2E75B 3GWKC 4J7JA 4DRXB 1H38A 3LSUA 3ABLB 1BT8A 2WLNA 1H2NA 4B3SB 4HNAB 1BQ0A 4R8CA 3SYOA 1H8HG 3K58A 1WB8A 2QM8A 4ABMA 5EK0A 4TUYB 3FB5C 4TWKA 1ZAUA 2IH3C 3ASOB 2YIBA 4RO2A 5IWAB 1OCCB 3RT3C 4F6RB 2ZIOA 5C8YB 1XMOB 3LSQA 3K59A 4YJ2B 1G1XB 4JAVA 4L8JA 4FFBA 1P7BA 1N0JA 3BA9A 4GT1A 3OMIB 3EXAA 2CGNA 1M56C 1K3EA 1R3LC 3BAAA 2Y4TA 5EZYA 4KHPB 5CBFA 1N36B 3ZMTA 1AI6A 4CS3A 4PDLA 2FKXA 1BS3A 4JI2B 1SQQH 3L70H 2VQFO 1TVKA 4WFFA 4LNUB 4JYCA 1TAEA 3SJCC 2DYSB 5EC2C 1Z5VA 2JVDA 5LXTA 3J80N 4B3RO 4FM0A 2X6CA 3ZRXA 4DR2B 1DTOA 1Q8IA 1Q6HA 1B6QA 5IY5C 2VWJA 2OCCC 5FPRA 4NXNO 5CN0A 1AJPA 3FKSG 1K7DA 3AG4C 3D8CA 1FAFA 3UT5B 3I5DA 4WFHA 1WN7A 3HKEB 1OJHA 3JD4A 3H1HH 4I50B 2ZXWC 3CJHA 1BHAA 2R9AA 4HYOA 4OX9B 2A9HA 5GTIZ 1M5IA 5IYZB 1VQNV 4G28B 1JVMA 1YZBA 4PDRA 5EBLC 2E74B 2EZPA 1JX9A 4TV9A 3KKYA 3B77A 1BCCH 2Y0PA 1AP6A 2EJRA 2LJ2A 1J5EB 1UPGA 3GWOA 4GYCB 3JALB 4PA4A 1FJGO 3CMAV 4XBFA 2A79B 4YJ3A 4EEQA 1R3KC 2F1MA 5GTHZ 1GO3F 3W7TA 2UXXA 4JI6O 2Q69A 3K57A 3VQXA 3JYCA 4N23A 2XAFA 3JARB 1KBHA 1W59A 3BY6A 2ATKC 2KKWA 5EBWC 5B1AB 2EJ7A 3OUSA 2BCCH 4FZ0A 1KC8W 3ETDA 4P30A 3AG2C 5IT9N 2BOBC 2IM9A 3TK1A 2Q67A 1FYJA 4U3JA 1KMIZ 1YXBA 4KFMA 5IJ0B 2EIJC 1RPOA 3E2EA 4D7SA 1PV0A 1N34O 1NU1H 4JI8O 1RFYA 5ITZA 2EZOA 1WA8B 1VP7A 2E5LO 3ZMVA 5LYJA 4DR2O 4GUNA 4O2AB 1HR0B 4JPRA 1NTMH 1CPYA 3ZMZA 4LFBO 5JQGA 5FLXN 4ICGA 3UM7A 3F5TA 1ZUQA 4AQYB 2R70A 1M93A 3LNMB 4XDJA 4MVRA 1NT2B 2Q0AA 3ZHQA 1HW7A 4ZBMA 2ZQMA 2WLHA 2W0FC 2L35A 4FFKA 3W7SA 1P4RA 2WLMA 3K06A 4JASA 2CAZC 4JI3B 2Z5UA 1WPXA 2YIDA 2XAGA 3H1IH 5KMGA 5LP6A 4TV8A 3IJ4A 2HKOA 1THZA 2HFEC 1OCZB 3OAAG 4BW9A 5CB4B 3CRCA 2F4VB 3HKCB 1WA8A 3M8AA 4TQDA 2JGUA 1EZJA 1CXZB 1PNMA 3STZC 2Q73A 1QU7A 3E86A 1V54B 1URFA 2Y0IA 1R3JC 2Q7EA 2JJ1G 1HNZB 3UCSC 4O2BA 3OR6C 5A2QN 3C90A 4EFBA 2G38A 2AHYA 2XAHA 3ABKB 3QG5A 2HJDA 4MTFA 4IHJA 1BGYH 4UFZA 3MAQA 5KLVH 2Q8VA 4B3SO 1BHBA 5L3GA 1M57C 1OZ0A 5B3SB 2X6BA 3APQA 3E8GA 3ZHTA 2P7TC 4CC5A 4DUYB 4LFBB 2CK3G 3JARA 3I55V 3ZRWB 4LWSB 4PI0A 4I4TB 2LQTA 4J10A 4ASUG 4J42A 2EX3A 3HKDB 1NBMG 4YHHB 1MSWD 1L1FA 1YJ9V 2CDYA 3WU2Z 5LHGA 4O4LA 3FYIB 4N21A 2EBOA 2JJ2G 4X88A 3H9VA 2E76B 1F4MA 3T1HO 1SA0A 3CMEV 2KB1A 4JI1B 3K5OA 3G6BA 1Q86W 3OTOB 2QDOA 5JQGB 2ZKOA 3Q4HA 5LMUB 1QHTA 2EIJB 2GTAA 4AQYO 3DTUB 3AG3B 3DSQA 2P4VA 4LF4B 5B66Z 4JZGA 3LUTB 4E2LA 3PN1A 2GDSA 4LF5O 2VWKA 3CD6V 4YY3B 4DV5O 3JD2A 2OIEA 2D2CB 3TCUA 2EIMB 3MHSC 1YJWV 2Y48A 2OTJV 4LF7O 4QPJA 3G6EV 1V9PA 1H2GA 4DV7O 1US6A 1XREA 5LOVA 2QKSA 4ZHQA 4YIOA 3BA8A 4J9YB 3QNEA 2OCHA 2F43G 3G4SV 2H3OA 2XOKG 2YXLA 1B04A 3FD9A 1XOUA 4YJ3B 1KP2A 3ASNC 4DO2A 2LW1A 1Q81W 5J2TA 2QM7A 4JI1O 3T4DA 1Y74B 2UXNA 3H1LH 1JCHA 3DC5A 3T1CA 1YDXA 2CH7A 3JSNA 1I5YA 5LMNO 1IZ3A 4I0XA 4MS2A 3JASB 3FYEB 4PA3A 2YDEA 1ZL8B 1P49A 2LP7A 1S77D 1H8EG 2N04A 1M90W 3OEEG 4TUYA 2GSMB 4DXWA 1I94B 2A3QA 3E8BA 4KUMA 1AP5A 4EKWA 2DYSC 2YICA 3AK1A 4ZOLB 4LFAO 2HR3A 3T1HB 4R50A 5J2TB 4JI7B 2GTSA 1AILA 1PKXA 1QLEC 1M1KW 1JFFA 5CA0B 2QWRB 2XASA 2P06A 1KECA 4LF8B 1SESA 1VMGA 3VBBA 1S3JA 3CXHF 2IU0A 4DR1O 1Y6XA 3ZX6A 4XDKA 3OM3B 1F7YA 1S76D 2P22C 1GN6A 5B1NA 4AI8A 5IJ9B 4WCEV 5JCOC 1KU9A 5K1PA 3N2KA 1NS1A 1N0NA 2A7WA 2ODMA 4LF9O 2UUCB 3RWRD 4J7ZA 4X62O 4KP4A 2ZM6B 2Z0AA 1VQ5V 4YXWG 2PI5A 1YI2V 1PD3A 3J7AU 1N34B 3B8MA 2RQ6A 4JF3A 3OGIB 2PGGA 2R72A 2X6AA
chains in the Genus database with same CATH topology
3CYOA 3NXSA 4JAVA 1BMFG 3AEIA 3RW0A 3CC2V 1P7BA 1ENVA 2JIZG 4GT1A 4TT3G 3RVZA 3OMIB 4QE7A 1ROPA 1E1QG 2WLJA 3FB7C 1M56C 1K3EA 1R3LC 2H94A 1I5XA 3AG1C 5CBFA 1Y4MA 1SETA 3OEHG 1AI4A 3ZMTA 2XAJA 1AI6A 2Z3YA 4PDLA 2P6JA 4MVSA 3CCRV 4R6ZA 2YSUB 5KUKA 1PL0A 2LFRA 4RQFA 4WFFA 4U7NA 5FL7G 2EIKB 4JYCA 2IH1C 2Q68A 2DYSB 1AROP 3K0DA 1OCCC 5EC2C 1QCEA 2ZR2A 3K08A 2X6CA 3ZRXA 3JD1A 3LDEA 1DTOA 1VQ7V 2ZR3A 1B6QA 1CEZA 3E35A 5IY5C 2OCCC 5CN0A 1AJPA 1GK9A 3FKSG 3CCEV 2DQ0A 4P2ZA 1K7DA 3AG4C 2M7WA 5IDJA 2IJJA 4UXNA 4BAYA 1HWYA 1YSCA 4WFHA 2P67A 3JD4A 3F5WC 3RVYA 2ZXWC 4UV9A 1N8RW 2OCCB 1KQSU 1KP3A 1R6NA 4JTDB 4UV8A 1BHAA 4MT8A 4HYOA 1VQ6V 3AG2B 2A9HA 1K4DC 1VQKV 4PA9A 3VOUA 3SPGA 1EBOA 1Q7YW 1VQNV 4G28B 3ZMUA 1JVMA 4FMTA 4PDRA 1R73A 1V55B 4FPPA 5EBLC 3ZRWA 4LP8A 2EZPA 1JX9A 4ZKIA 5H9CA 4JYBA 1VQMV 2WWWA 3B77A 3CP1A 4X8AA 2EJRA 3PJSK 3GWOA 1GM8A 1GMGA 2XAQA 2K1EA 3D36A 4Z1MG 4PA4A 1Y66A 3K79A 1AR1B 1QR8A 3CMAV 1VQOV 2JEXA 1K33A 2V7QG 4XBFA 5B3SC 2A79B 1W0JG 1JQ0A 1FXKA 1R3KC 1GO3F 5L3BA 1R6KA 3W7TA 2UXXA 1FS0G 2Q69A 4PELA 1G4YB 3JYCA 4L87A 1KKDA 3EHBB 1PNLA 4N23A 2XAFA 3OFNG 1K8AW 1W2BU 3SPIA 1CP9A 3BY6A 2A0LA 5B1BB 2ATKC 4LBEC 4MTXA 3K3WA 4MVMA 2EILB 4FIPC 5LGTA 4BW5A 1V54C 5EBWC 5B1AB 3IGAC 4I5SA 2B1GA 3OUSA 4F4LA 1KC8W 3ETDA 2QEXV 4GX1A 4P30A 3AG2C 2BOBC 3TK1A 1M9NA 2EINC 1NKDA 2Y69B 2Q67A 3ASOC 1OCOC 3B8NA 3LSSA 2WLLB 4KFMA 4WFBV 1E1RG 3X2QC 2EIJC 1YIJV 3OGCC 1RPOA 1ZWIC 3ZN0A 1NQTA 1OCRB 3E2EA 3CCSV 5LHIA 2JDIG 5HFLA 2AHZA 1AJQA 3P30A 2IW5A 4GX2A 5IY5B 3ABLC 5DM6V 4JGSA 2EZOA 3CCLV 5GW7A 4G2KA 3DGEA 4LC1A 2B5UA 3ZMVA 4JTAB 1XL6A 2Q6AA 2DQ3A 3LDCA 1RPRA 4QPKA 1FXVA 2QA4V 4JPRA 5L3DA 1CPYA 4WFGA 3SPCA 3X2QB 3ZMZA 2EIKC 3HB3B 4BIZA 3UM7A 4LCUC 3OR7C 5DN6G 3W7UA 3GB7C 2R9IA 1GM9A 3WFVA 1DLBA 3LNMB 5LBQA 4XDJA 3E8FA 1PNKA 4MVRA 2QE7G 4ZBMA 2ZQMA 4PDMA 1COWG 3FB6C 4MSWC 4WF9V 2WLHA 3P32A 3EFFK 2W0FC 5LGNA 3ABTA 1GM7A 5KUMA 3W7SA 1P4RA 1TUEB 4MVOA 5H6QA 2WLMA 4MTOA 3OMNB 4PDVA 3K06A 4JASA 2V1DA 1K73W 2X7RB 2Z5UA 1WPXA 5E1AC 3T4ZA 2XAGA 3ABKC 1QBZA 2D3OW 1MABG 2WLLA 3AG3C 2WLKA 2HKOA 3TETA 3SPJA 1THZA 4G27B 2HFEC 1OCZB 3OAAG 4MVUA 2EILC 4UVAA 3OW2U 2EINB 4FJCC 1EZJA 3OUFA 1PNMA 3STZC 5J9PC 1AI7A 3E86A 3ABUA 1V54B 5B1AC 3ZMSA 1R3JC 1SZTA 3ABMB 2JJ1G 4QNHB 2BOCC 4QJFB 3K03A 3OR6C 1KD1W 3CCJV 3SJQC 2HVJC 2AHYA 4RUFA 2XAHA 2C2AA 3ABKB 4RQEA 1RM1C 1GTOA 4MTFA 1FXKB 1YJNV 2W6JG 1QLNA 3ML0A 3LDDA 5BZBA 2XNDG 3CCUV 3K0GA 1BHBA 1NR1A 1G8MA 5L3GA 1M57C 3K9AA 4FK5C 1OCOB 1OZ0A 2ZDIC 2X6BA 5B3SB 1XL4A 3G71V 1BL8A 3E8GA 4QE9A 1VQ8V 3ZIAG 2P7TC 5KA5A 2CK3G 3I55V 4MVZA 3ZRWB 1UJWB 4WFEA 1WLEA 4ASUG 2IJKA 1V55C 5B1BC 1QLEB 1NBMG 3KG2A 4GCZA 1MSWD 2NNUA 3CPWU 3CCQV 1L1FA 1YJ9V 4HAMA 5HFMA 2IJIA 1F4NA 3OE7G 3T2MA 5LHGA 3MD0A 3FYIB 4N21A 5LHHA 2EBOA 3RBZA 2JJ2G 4X88A 3ZN1A 1F4MA 2WAMA 3FB8C 3STLC 4OXSA 2EIMC 1IXMA 1DF5A 1NR7A 1RM1B 3CMEV 2KB1A 1S0VA 1SRYA 2Y69C 5C93A 3MHHC 1Q86W 2ZDIA 2ITCC 4J9ZB 3ZRVA 3QO7A 5L3EA 1DF4A 1QVFU 2DYRB 1VQ4V 2EIJB 2DYRC 1NJIW 3CC4V 3DTUB 2JK5C 1K92A 4HZ3A 3AG3B 2HVKC 4JAUA 5B1OA 3LUTB 4E2LA 4WFAV 1M56B 3ASNB 1YITV 3CD6V 1AJNA 2LFSA 2QTOA 3SYQA 3JD2A 5H6RA 1K4CC 2IU3A 3TCUA 4Q20A 2EIMB 1R3IC 3MHSC 1YJWV 2Y48A 3A0RA 2DWEC 2OTJV 2HLDG 5EC1C 3R65A 4MTGA 4QPJA 2FTKA 4UVCA 3W7WA 2B1IA 2P90A 1NVPB 1VQLV 4JTCB 4PA6A 5CMUA 4UVBA 1YHQV 3JD3A 2YEVB 3ETGA 4CBCA 5IYDO 3G6EV 3D3IA 1Q82W 1H2GA 4X89A 2QKSA 2JEUA 1K9MW 5L3CA 3ZJZA 2GHYA 5CBGA 1NH2D 1LNQA 3I56V 1K5QA 3QNEA 4J9YB 3CXCU 4GX5A 2ZXWB 3ZCCA 3ZRSA 2W6IG 2F43G 3G4SV 3BEHA 2PI4A 2XOKG 3WG7B 1S5HC 1QVGU 3F7VC 1FXKC 1FFTB 1KP2A 1M57B 1EFRG 4H33A 3ASNC 1OCRC 4DO2A 4BIUA 1MG1A 3CC7V 1Q81W 4MW3A 4MW8A 2MK3A 2QM7A 3T4DA 1F51A 1SERA 4XDLA 2UXNA 4QIWF 3SPHA 1JCHA 3SYPA 3T1CA 3CCMV 3E89A 4UUJC 1I5YA 1JPXA 4RUEA 1NVPD 1AI5A 1OCZC 4MS2A 3FYEB 4R7CA 1VQ9V 4PA3A 3QO5A 2LP7A 1S77D 1H8EG 4CZZA 1M90W 1VQPV 2WLIB 3OEEG 2GSMB 4GX0A 3CCVV 4DXWA 1YTFB 3E8BA 3M99B 4KUMA 4EKWA 3SYAA 2DYSC 3W7XA 2HJFC 3HPLC 3JCZA 5CBHA 1J95A 2HR3A 2NLJC 3AG1B 1OHHG 2H8PC 3JD0A 4PA7A 4R50A 1K97A 5LGUA 2YEVA 4H37A 1JOYA 3ETEA 1PKXA 2DWDC 1QLEC 5L3FA 1M1KW 1S72V 5IYBO 4TSFG 2IJHA 2XASA 4P9OA 1KECA 5KA6A 4RAIA 1SESA 1F23A 2ZD9A 4U7OA 3VBBA 1S3JA 2X0LA 3QO8A 1FXHA 2IU0A 3OMAB 3UKMA 3WG7C 2R9RB 3H01A 2WPDG 4XDKA 3IFXA 1GKFA 3OM3B 3E8HA 1S76D 5B1NA 1ORQC 1E79G 1H38A 3ABLB 4WCEV 2WLNA 3F7YC 2OT5A 1YTFD 2ITDC 3IC7A 2OTLV 4MVQA 5IYCO 1W0KG 4R8CA 3SYOA 1H8HG 4P9PA 4KP4A 2QM8A 1VQ5V 3ABMC 2WSSG 5EK0A 3FB5C 4TWKA 4YXWG 1JJ2U 2PI5A 3SYCA 4I9WA 2IH3C 3AG4B 1YI2V 1PD3A 3B8MA 4JF3A 3ASOB 1K34A 3K04A 1QR9A 5EBMC 1K5SA 4RO2A 2DW4A 1OCCB 2HG5C 1NH2B 1MOFA 2WLIA 3E83A 5CA3A 3LSQA 2X6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RPO A;  2IJJ A;  2IJH A;  2IJK A;  1F4M A;  1B6Q A;  1F4N A;  1GMG A;  1ROP A;  1NKD A;  1RPR A;  2GHY A;  2IJI A;  1PD3 A;  1GTO A;  3K79 A;  4DO2 A; 
#chains in the Genus database with same CATH topology
 3CYO A;  3NXS A;  3ZS8 C;  4EB6 A;  3AEI A;  1T5E A;  2HP8 A;  3L9D A;  2JIZ G;  3CX5 F;  1HNX B;  2UUA O;  1Q5O A;  2WLJ A;  2F95 B;  1Y74 A;  4HNA A;  1SET A;  2AXT Z;  3K9S A;  1AI4 A;  2PZS A;  4PV1 B;  4X64 B;  1TUB A;  4MVS A;  3CCR V;  4LH7 A;  2YSU B;  1IBK O;  4X1K A;  2N74 A;  1PL0 A;  1DK1 A;  4U7N A;  4IYI A;  2CE4 A;  2CTQ A;  3K0D A;  1OCC C;  5JCO A;  4Z2W A;  4FLV A;  1LR1 A;  1SQF A;  1BE3 H;  3Q4H B;  3DXR A;  1GK9 A;  1N4C A;  5TIS Z;  4JI6 B;  4H13 B;  2IJJ A;  2FL4 A;  3C3T A;  1HNZ O;  4UV9 A;  2OCC B;  4DR3 B;  4O2B B;  3HKB A;  4DK0 A;  4JAA A;  1K4D C;  2Q7G A;  4NXN B;  1PP9 H;  2CTR A;  2QJ1 A;  2HHH B;  3ZRW A;  5H9C A;  2IBZ H;  4W4L A;  5EIB D;  4B3T O;  4K0K O;  5BMV A;  1YF2 A;  4DUY O;  1GM8 A;  4GKJ O;  2XAQ A;  4X1Y A;  2K1E A;  4Z1M G;  1Y66 A;  1VQO V;  1BZK A;  2JEX A;  1JJO A;  1FXK A;  5L3B A;  4DV3 B;  3ZED A;  1IXB A;  3RYC B;  1XUQ A;  4DR4 B;  1KKD A;  1IBL B;  1PNL A;  3OFN G;  1W2B U;  3SPI A;  4U3J B;  4TQF A;  4MTX A;  5JJE B;  4FIP C;  4BW5 A;  1FD9 A;  3IGA C;  4DV2 B;  4F4L A;  4LWS A;  1NKD A;  2Y69 B;  4O2A A;  3B8N A;  4NKG B;  2WLL B;  4JI2 O;  4FLU A;  3ZN0 A;  1OCR B;  3CCS V;  3SR2 C;  2IW5 A;  4GX2 A;  5IY5 B;  5DM6 V;  3CCL V;  5GW7 A;  1X4T A;  2BTO A;  2DQ3 A;  2ZCE A;  2HHH O;  5LA6 B;  4JI0 O;  5K1X A;  4DYL A;  3ETQ A;  2PUS A;  4ZI7 A;  5L3D A;  3RYH B;  3SPC A;  4NXM O;  4X20 B;  1G6U A;  3HB3 B;  4BIZ A;  3HKC A;  4K8X A;  3JAW A;  4NYK A;  2Y4U A;  5CB4 A;  4ZIB A;  5B5E Z;  4TV8 B;  4PDM A;  4NTY A;  1AB3 A;  1XBL A;  3ABT A;  1GM7 A;  2KG7 B;  5KUM A;  1TUE B;  5H6Q A;  4MTO A;  4YHH O;  3CEI A;  3T1Y O;  1NI8 A;  3RYH A;  1GN4 A;  4G27 B;  2UUC O;  4JZ2 A;  3GVM A;  2EIN B;  3DXR B;  4FJC C;  3OUF A;  1TVK B;  4DV6 O;  1AI7 A;  5B1A C;  3ZMS A;  3ABM B;  4JYA O;  5LYJ B;  1FFX B;  4JI3 O;  4TOI A;  4QNH B;  3CJH B;  2Q9L A;  3SJQ C;  1EZV H;  2HVJ C;  1RM1 C;  1SS3 A;  3E22 B;  1GTO A;  3UT5 A;  1N32 B;  4LFA B;  5BZB A;  1MZF A;  1IBM O;  5E79 Z;  1I7F A;  1VQ8 V;  3ZIA G;  1H2L A;  4DV1 B;  2YIB D;  2LGQ A;  1V55 C;  1RP3 B;  5B1B C;  4GCZ A;  2P4K A;  3JAK A;  4I55 A;  4U3F H;  2NNU A;  4A5U B;  3QTC A;  1WP7 A;  1F4N A;  3T2M A;  1Z5W A;  3RBZ A;  3JCU Z;  3P3N A;  4PD4 F;  3STL C;  1NR7 A;  1H2S B;  5H5N A;  2YUA A;  3TGU H;  2Y69 C;  2ZDI A;  2ITC C;  1DF4 A;  1OV9 A;  3O65 A;  4FFB B;  1QVF U;  4X65 O;  1AVM A;  4BWA A;  4K8Z A;  1MSD A;  3AK2 A;  2LW7 A;  4HZ3 A;  2XUM A;  3RFR A;  2HVK C;  5KHG A;  4JI8 B;  5B1O A;  3CWB H;  1L8D A;  2E5L B;  2QWN B;  1H2M A;  1AJN A;  4FVM A;  2IU3 A;  4Q20 A;  1R3I C;  3A0R A;  4DW1 A;  1N36 O;  2HEP A;  5EC1 C;  3R65 A;  2FTK A;  3W7W A;  2MW2 B;  3AK3 A;  4JTC B;  4WBN A;  2JS5 A;  1YHQ V;  3JD3 A;  2PF4 E;  3ETG A;  5IYD O;  2BTQ A;  3TXQ A;  3N27 A;  2JEU A;  5CBG A;  1SQP H;  3CXC U;  3RYC A;  2ILM A;  1NTK H;  1R1B A;  2PI4 A;  1KB9 F;  1S5H C;  3F7V C;  1FXK C;  1EFR G;  4CS4 A;  1OCR C;  5DEC A;  4BIU A;  1MG1 A;  3CC7 V;  2NR5 A;  4MW8 A;  5D5P A;  5EZY B;  3SPH A;  1Y76 A;  3SYP A;  5JH7 A;  4X62 B;  3FAV B;  3HR0 A;  1EN5 A;  3CCM V;  2ARH A;  3E89 A;  4DR6 B;  1MNG A;  1NVP D;  1OCZ C;  4X9Q A;  2YI8 A;  1VQ9 V;  4DR5 B;  4YJ2 A;  5H2F Z;  4CZZ A;  1R6T A;  3CCV V;  4UB6 Z;  4I4T A;  2GUZ B;  1VF6 C;  4K3A A;  3SYA A;  2HJF C;  3JCZ A;  5CA1 A;  1L0N H;  1J95 A;  3AG1 B;  3JD0 A;  2DOS A;  4X66 B;  4BIO A;  1NTZ H;  3ETE A;  2DWD C;  1Q90 D;  4O4J B;  5L3F A;  3KCX A;  4TSF G;  3K5M A;  1XQ8 A;  4P9O A;  2LGW A;  5KA6 A;  1PM9 A;  2ZD9 A;  5EYP A;  2QWO B;  4NTW A;  4H0L B;  4LF6 O;  1XNQ O;  2R9R B;  4YIP A;  3A0H Z;  3IFX A;  1GKF A;  4Q6G A;  1I08 A;  1L0L H;  4NXM B;  2UXC O;  3F7Y C;  2OT5 A;  1YTF D;  1HP8 A;  2ITD C;  1HDJ A;  1W0K G;  2PYJ A;  5BY1 A;  3OT7 A;  4P9P A;  3ABM C;  1JJ2 U;  3CRR A;  3SYC A;  4EFE A;  3AG4 B;  2W0X A;  3K04 A;  4FLT A;  5BR8 O;  4J41 A;  3ICX A;  4DV0 B;  2A06 H;  5EBM C;  2P5O A;  2HG5 C;  2ZE7 A;  3E83 A;  1GN3 A;  1ZX3 A;  1QQC A;  1VF6 A;  2F23 A;  4JI0 B;  3CC2 V;  5LL6 Y;  1O9H A;  4X64 O;  1ENV A;  4TT3 G;  1AR5 A;  3RVZ A;  1ROP A;  2H94 A;  3CE2 A;  4PJ0 Z;  1I5X A;  3AG1 C;  2UUB B;  3OEH G;  1Q6U A;  4JYA B;  2XAJ A;  2VQE O;  2Z3Y A;  4X1I A;  3JAT A;  4O4I A;  4K35 A;  2P6J A;  4R6Z A;  5KUK A;  3U11 A;  5FL7 G;  2Q68 A;  1FJG B;  1WB7 A;  1ARO P;  2AGA A;  1QCE A;  2ZR2 A;  1YCI A;  1IBM B;  3BPZ A;  4UCU A;  2DE0 X;  2ZNI A;  1VQ7 V;  1A32 A;  2QKA A;  4DR6 O;  3JAM N;  4DV2 O;  4X65 B;  4I7Z B;  4DV4 O;  4P2Z A;  4JI5 B;  2AZ2 A;  5IDJ A;  4ZOL A;  1D5N A;  1SZX A;  4BAY A;  5LP6 C;  2P67 A;  3P3P A;  5LP6 B;  5KMG B;  1I94 O;  1N8R W;  2YC0 A;  3BAB A;  4MT8 A;  1VQ6 V;  3AG2 B;  4PA9 A;  3VOU A;  1EBO A;  1HR0 O;  3ZMU A;  1R73 A;  1V55 B;  4LF4 O;  3BVO A;  2WWW A;  4X8A A;  4DUZ O;  2QWQ B;  1N33 O;  3D36 A;  1K33 A;  5B3S C;  4LFC O;  5IYZ A;  2ZE5 A;  4F6E A;  1W0J G;  3CSX A;  4OPH A;  2ZIM A;  2CTP A;  1I0H A;  1S5J A;  1FS0 G;  4PEL A;  1YEW A;  1WPB A;  4L87 A;  3EHB B;  1K8A W;  5KHI A;  3B09 A;  3RYF B;  2A0L A;  4LBE C;  2L6L A;  3KCY A;  3WB2 A;  3JAK B;  4I55 B;  5JVD B;  4UCS A;  4UCR A;  4X20 A;  5A9G A;  1M9N A;  3ASO C;  1OCO C;  4DR7 O;  4WFB V;  1E1R G;  1XMQ B;  4PI2 A;  2VQE B;  1IBK B;  1NQT A;  4KHP O;  2KG7 A;  1AJQ A;  3E22 A;  5JJN B;  3RYF A;  4JGS A;  4G2K A;  4LC1 A;  2FML A;  1XL6 A;  2KQX A;  1RPR A;  2RMK B;  4E4E A;  2QA4 V;  4GZR B;  4WFG A;  3X2Q B;  2XHB A;  3A8T A;  4DV6 B;  3OR7 C;  1ZSP A;  5DN6 G;  3ZHU A;  3GB7 C;  2R9I A;  1GM9 A;  3WFV A;  3E8F A;  5C8Y A;  2QE7 G;  1COW G;  4O4L B;  4YY3 O;  3P32 A;  5KHH A;  3CRM A;  3DC6 A;  1K73 W;  3IC9 A;  2X7R B;  2D3O W;  2UXC B;  1FPO A;  2RCV A;  1MAB G;  4I50 A;  2WLL A;  1XHX A;  2QGN A;  4BR6 A;  3SPJ A;  5KX5 A;  3TET A;  4IYH A;  3L71 H;  2K9P A;  3JAW B;  1SKV A;  4UVA A;  2UXD B;  3RYI A;  5IWA O;  4CH5 A;  4IHJ B;  2ZIN A;  2BSK A;  1JR9 A;  2BOC C;  4J7K A;  1KD1 W;  2NN4 A;  4LF8 O;  4RUF A;  2C2A A;  2BSK B;  3U0Z A;  1LUW A;  1FXK B;  2W6J G;  3ML0 A;  3LDD A;  1Y67 A;  4O4J A;  3CCU V;  3MDS A;  4H44 B;  1NR1 A;  1G8M A;  4X1I B;  3K9A A;  1XNR O;  2ZDI C;  1XL4 A;  2Q7H A;  5JVD A;  1U96 A;  3G71 V;  5CA1 B;  1D5A A;  4MVZ A;  4WFE A;  1WLE A;  2IJK A;  3TXS A;  1MZE A;  1QLE B;  3CCQ V;  2JGD A;  4HAM A;  5HFM A;  3B40 A;  2IJI A;  4FM2 A;  3JAL A;  2YS8 A;  5IE9 A;  2BE3 A;  4DR3 O;  3N2G A;  2WAM A;  1IXM A;  1DF5 A;  1RM1 B;  1S0V A;  4UCT A;  1B3Q A;  4DR7 B;  4J11 A;  3MHH C;  4J9Z B;  3QO7 A;  5L3E A;  2E3C A;  2DYR B;  3VQY A;  5BMV B;  2DYR C;  4GKK O;  2RJZ A;  1NJI W;  2ZNJ A;  5BR8 B;  2DN9 A;  2JK5 C;  3HKE A;  1TA8 A;  3SDL A;  4JAU A;  1VF7 A;  3ZBH A;  2Q4P A;  2QSA A;  3QF7 A;  1M56 B;  1X59 A;  2BTQ B;  2UU9 O;  3R66 A;  5JJJ B;  4DR4 O;  2RN9 A;  2LFS A;  2QTO A;  4WBN B;  1BQZ A;  5H6R A;  4MTG A;  4UVC A;  1IVS A;  2B1I A;  2P90 A;  4PA6 A;  5CMU A;  4UVB A;  4JV5 B;  1VIB A;  2YEV B;  4CBC A;  4DR5 O;  4DR1 B;  5IJ9 A;  3CHX A;  3SJA C;  1MA1 A;  2OIG A;  1K9M W;  1XHZ A;  3THO A;  3ZJZ A;  1ZLZ A;  2GHY A;  1LNQ A;  4GX5 A;  2ZXW B;  4AHC A;  4Z1V A;  4H33 A;  3OTF A;  4B7E A;  5JWP A;  1SQG A;  1TUB B;  3H1K H;  5FPO A;  1ZTE A;  3ZHS A;  5FNV B;  3VQW A;  4IIJ B;  1SER A;  3KZI Z;  4TV9 B;  1GAX A;  3N2K B;  1KYO F;  4UUJ C;  1VAR A;  2GBO A;  3RGB A;  4R7C A;  1M4U A;  2WLI B;  4OGQ B;  2UXD O;  1XNR B;  3G80 A;  3M99 B;  3W7X A;  3HPL C;  5J2U A;  1HNW B;  2NLJ C;  1OHH G;  2UU9 B;  2ADQ B;  1GH6 A;  3T1Y B;  1EM1 A;  2M6Y A;  1S72 V;  5IYB O;  2QR4 A;  5LXT B;  4RAI A;  4KXR A;  3QO8 A;  1FXH A;  1FFX A;  2DJV A;  4J80 A;  3JAS A;  4OX9 O;  1VF5 B;  1ORQ C;  3IAY A;  1E79 G;  5DED A;  2CH7 B;  2ADP A;  1NZ6 A;  2OTL V;  3IC7 A;  4MVQ A;  1FKA O;  5IYC O;  2UUB O;  5FNV A;  4CC6 A;  3D3Q A;  2WSS G;  3A2F A;  4I9W A;  3UO3 A;  1Q6I A;  1K34 A;  1QR9 A;  1K5S A;  2DW4 A;  1NH2 B;  5AG2 A;  1MOF A;  3FAV A;  2WLI A;  5CA3 A;  5LOV B;  1GRJ A;  3OTO O;  1BMF G;  4I0X B;  3RW0 A;  2Q5Z A;  4CS2 A;  2ZM6 O;  4QE7 A;  1E1Q G;  4GLX A;  3FB7 C;  4IIJ A;  3ZHR A;  2QWP B;  1Y4M A;  1Z2G A;  2FYU H;  2RNB A;  2EUL A;  4DRX A;  5D5Q A;  2JGD B;  1JA8 A;  2LFR A;  4LR3 A;  4RQF A;  1YVW A;  4B3M O;  2EIK B;  1UFI A;  2IH1 C;  1MMM A;  2YXH A;  3K08 A;  3G67 A;  2KSD A;  3JD1 A;  5KAF Z;  3LDE A;  5KHJ A;  2F93 B;  2O57 A;  2FB5 A;  2ZR3 A;  5BXZ A;  1CEZ A;  3E35 A;  1RSO B;  1WJZ A;  4FLW A;  4DV7 B;  2QM4 A;  3CCE V;  2DQ0 A;  1U97 A;  2M7W A;  4LF9 B;  4UXN A;  3N2G B;  1HWY A;  1YSC A;  4JI7 O;  4O4H B;  1EN4 A;  3F5W C;  3RVY A;  1KUQ A;  2V4D A;  2QTS A;  1KQS U;  1KP3 A;  1R6N A;  2XT9 A;  4JTD B;  4UV8 A;  2VS0 A;  1HNW O;  2QKC A;  3S3X A;  5EIB C;  1VQK V;  3SPG A;  1Q7Y W;  1TGO A;  4OPA A;  4FMT A;  4FPP A;  4LP8 A;  3SGI A;  4ZKI A;  1Y76 B;  4JYB A;  1VQM V;  4B3T B;  3CP1 A;  5KX5 B;  3PJS K;  4JYY A;  1GMG A;  5LMN B;  2UXB B;  3K79 A;  3JSL A;  1QR8 A;  1AR1 B;  2V7Q G;  3EVK A;  4D6T H;  4ZI7 B;  1JQ0 A;  2PTM A;  1R6K A;  3AG7 A;  2ZE8 A;  4LF5 B;  2F66 C;  4DV3 O;  1G4Y B;  1SQB H;  5IJ0 A;  4O4H A;  4DV4 B;  1CP9 A;  5B1B B;  4UCV A;  3K3W A;  4DUZ B;  4MVM A;  1AR4 A;  2EIL B;  5LGT A;  4JI4 O;  1V54 C;  4I5S A;  3S3W A;  2B1G A;  3RYI B;  4KL1 A;  4FM1 A;  2QEX V;  1EN6 A;  4GX1 A;  4B7K A;  4B08 A;  2EIN C;  4FLY A;  2VQF B;  3LSS A;  3APO A;  3X2Q C;  1YIJ V;  3OGC C;  4DV0 O;  1ZWI C;  5ITZ B;  5LHI A;  2JDI G;  5HFL A;  2AHZ A;  1SF9 A;  3P30 A;  3K5L A;  3ABL C;  3LNN A;  3DGE A;  3CRQ A;  2B5U A;  3L72 H;  5GON A;  3BFR A;  4JTA B;  2Q0O C;  2Q6A A;  3LDC A;  4NR1 A;  1PL4 A;  2VRZ A;  4QPK A;  1FXV A;  1PPJ H;  1QNM A;  4C7U A;  1B06 A;  2EIK C;  4JV5 O;  3OD4 A;  4LCU C;  3W7U A;  2CTW A;  4LF7 B;  1DLB A;  5LBQ A;  1PNK A;  4B3M B;  2F4V O;  2JS3 A;  3FB6 C;  4MSW C;  4WF9 V;  2RDC A;  3EFF K;  1WNS A;  1JMK C;  5LGN A;  4MVO A;  4DK1 A;  3OMN B;  4PDV A;  1XEQ A;  4PHZ A;  2V1D A;  1WP8 A;  2XTA A;  5E1A C;  3T4Z A;  3ABK C;  1QBZ A;  4IT5 A;  4I9Q A;  4IL6 Z;  1IUR A;  3AG3 C;  2WLK A;  3K5N A;  2JRI A;  5KAI Z;  4MVU A;  2EIL C;  5GON B;  3OW2 U;  4FLX A;  2ZT9 B;  1RSO A;  2CGO A;  5J9P C;  3ABU A;  1SZT A;  4QJF B;  3K03 A;  1H2K A;  3CCJ V;  2AW9 A;  1SQX H;  4RQE A;  1N32 O;  1YJN V;  1QLN A;  2XND G;  3K0G A;  4FK5 C;  3QVN A;  1OCO B;  1BL8 A;  4QE9 A;  5J2U B;  1N33 B;  5KA5 A;  2PY5 A;  4NTX A;  3L74 H;  1D2D A;  1UJW B;  3TJT A;  3BRC A;  2OWO A;  3KG2 A;  4LNU A;  4AIL C;  3CPW U;  4IGG A;  5KHK A;  1Q3E A;  2OYQ A;  4JI4 B;  3OE7 G;  1XIL A;  3JAT B;  4O4I B;  3MD0 A;  3CS5 A;  5LHH A;  4X66 O;  4X1Y B;  4W4K A;  3ZN1 A;  4RWU A;  1HNX O;  3FB8 C;  4OXS A;  2EIM C;  4FLZ A;  3B4S A;  1SRY A;  5C93 A;  5F2V O;  2B9Z A;  3ZRV A;  4CH4 A;  1XDC A;  3L73 H;  4UB8 Z;  2AZ0 A;  3UQ8 A;  4NB5 A;  4LF6 B;  1VQ4 V;  3CC4 V;  5LA6 A;  3M7M X;  1KKC A;  1K92 A;  3BCC H;  4NVP A;  4WFA V;  1Q43 A;  3ASN B;  1YIT V;  4QGP A;  2WA4 A;  2ETN A;  2LO1 A;  3SYQ A;  1K4C C;  3VQV A;  2DWE C;  3WB1 A;  2HLD G;  1NVP B;  1J5E O;  1VQL V;  4DV5 B;  1XMQ O;  2UUA B;  2CUG A;  3FX7 A;  3D3I A;  1Q82 W;  4CH3 A;  1BSM A;  4X89 A;  1O9G A;  5L3C A;  1NH2 D;  4DW0 A;  3I56 V;  1K5Q A;  5EYP B;  3ZCC A;  3D36 C;  3ZRS A;  2W6I G;  5JH7 B;  1VEW A;  3BEH A;  3L75 H;  2GV9 A;  3WG7 B;  4GKK B;  3BHP A;  1ZL8 A;  1QVG U;  4HBN A;  1FFT B;  1XI1 A;  1M57 B;  4CH6 A;  4JI5 O;  3SJB C;  1IX9 A;  4MW3 A;  4EB6 B;  2MK3 A;  3RN4 A;  4K0K B;  1F51 A;  1LUV A;  4XDL A;  1SA0 B;  4QIW F;  2YXY A;  4GKJ B;  2PYL A;  1P84 F;  3C3S A;  4FZ1 A;  1JPX A;  4RUE A;  2ZE6 A;  1AI5 A;  1IDS A;  3CB2 A;  1SC5 B;  3QO5 A;  1DGS A;  2N05 A;  3HKB B;  4DV1 O;  2YIA A;  3HKD A;  1VQP V;  4F6R A;  4GX0 A;  1YTF B;  1IBL O;  1XNQ B;  2WA3 A;  1P7G A;  5LMU O;  3UO2 A;  4ZHQ B;  5CBH A;  2H8P C;  4PA7 A;  1K97 A;  5LGU A;  3NR7 A;  4LFC B;  2YEV A;  3J81 N;  4D7T A;  1S5L Z;  4H37 A;  2UXB O;  3WB0 A;  1JOY A;  3ZHV A;  4UCO A;  1GN2 A;  2YI9 A;  3A0B Z;  3O9O A;  3FFQ A;  2IJH A;  4LH6 A;  3CRA A;  2GUZ A;  1SQV H;  1F23 A;  3H1J H;  4U7O A;  2DMX A;  2X0L A;  1WAZ A;  3OMA B;  3B2E E;  3U10 A;  3UKM A;  3WG7 C;  3H01 A;  4B3R B;  2WPD G;  1XMO O;  1JFF B;  5CA0 A;  4X1K B;  3E8H A;  2E75 B;  3GWK C;  4J7J A;  4DRX B;  1H38 A;  3LSU A;  3ABL B;  1BT8 A;  2WLN A;  1H2N A;  4B3S B;  4HNA B;  1BQ0 A;  4R8C A;  3SYO A;  1H8H G;  3K58 A;  1WB8 A;  2QM8 A;  4ABM A;  5EK0 A;  4TUY B;  3FB5 C;  4TWK A;  1ZAU A;  2IH3 C;  3ASO B;  2YIB A;  4RO2 A;  5IWA B;  1OCC B;  3RT3 C;  4F6R B;  2ZIO A;  5C8Y B;  1XMO B;  3LSQ A;  3K59 A;  4YJ2 B;  1G1X B;  4JAV A;  4L8J A;  4FFB A;  1P7B A;  1N0J A;  3BA9 A;  4GT1 A;  3OMI B;  3EXA A;  2CGN A;  1M56 C;  1K3E A;  1R3L C;  3BAA A;  2Y4T A;  5EZY A;  4KHP B;  5CBF A;  1N36 B;  3ZMT A;  1AI6 A;  4CS3 A;  4PDL A;  2FKX A;  1BS3 A;  4JI2 B;  1SQQ H;  3L70 H;  2VQF O;  1TVK A;  4WFF A;  4LNU B;  4JYC A;  1TAE A;  3SJC C;  2DYS B;  5EC2 C;  1Z5V A;  2JVD A;  5LXT A;  3J80 N;  4B3R O;  4FM0 A;  2X6C A;  3ZRX A;  4DR2 B;  1DTO A;  1Q8I A;  1Q6H A;  1B6Q A;  5IY5 C;  2VWJ A;  2OCC C;  5FPR A;  4NXN O;  5CN0 A;  1AJP A;  3FKS G;  1K7D A;  3AG4 C;  3D8C A;  1FAF A;  3UT5 B;  3I5D A;  4WFH A;  1WN7 A;  3HKE B;  1OJH A;  3JD4 A;  3H1H H;  4I50 B;  2ZXW C;  3CJH A;  1BHA A;  2R9A A;  4HYO A;  4OX9 B;  2A9H A;  5GTI Z;  1M5I A;  5IYZ B;  1VQN V;  4G28 B;  1JVM A;  1YZB A;  4PDR A;  5EBL C;  2E74 B;  2EZP A;  1JX9 A;  4TV9 A;  3KKY A;  3B77 A;  1BCC H;  2Y0P A;  1AP6 A;  2EJR A;  2LJ2 A;  1J5E B;  1UPG A;  3GWO A;  4GYC B;  3JAL B;  4PA4 A;  1FJG O;  3CMA V;  4XBF A;  2A79 B;  4YJ3 A;  4EEQ A;  1R3K C;  2F1M A;  5GTH Z;  1GO3 F;  3W7T A;  2UXX A;  4JI6 O;  2Q69 A;  3K57 A;  3VQX A;  3JYC A;  4N23 A;  2XAF A;  3JAR B;  1KBH A;  1W59 A;  3BY6 A;  2ATK C;  2KKW A;  5EBW C;  5B1A B;  2EJ7 A;  3OUS A;  2BCC H;  4FZ0 A;  1KC8 W;  3ETD A;  4P30 A;  3AG2 C;  5IT9 N;  2BOB C;  2IM9 A;  3TK1 A;  2Q67 A;  1FYJ A;  4U3J A;  1KMI Z;  1YXB A;  4KFM A;  5IJ0 B;  2EIJ C;  1RPO A;  3E2E A;  4D7S A;  1PV0 A;  1N34 O;  1NU1 H;  4JI8 O;  1RFY A;  5ITZ A;  2EZO A;  1WA8 B;  1VP7 A;  2E5L O;  3ZMV A;  5LYJ A;  4DR2 O;  4GUN A;  4O2A B;  1HR0 B;  4JPR A;  1NTM H;  1CPY A;  3ZMZ A;  4LFB O;  5JQG A;  5FLX N;  4ICG A;  3UM7 A;  3F5T A;  1ZUQ A;  4AQY B;  2R70 A;  1M93 A;  3LNM B;  4XDJ A;  4MVR A;  1NT2 B;  2Q0A A;  3ZHQ A;  1HW7 A;  4ZBM A;  2ZQM A;  2WLH A;  2W0F C;  2L35 A;  4FFK A;  3W7S A;  1P4R A;  2WLM A;  3K06 A;  4JAS A;  2CAZ C;  4JI3 B;  2Z5U A;  1WPX A;  2YID A;  2XAG A;  3H1I H;  5KMG A;  5LP6 A;  4TV8 A;  3IJ4 A;  2HKO A;  1THZ A;  2HFE C;  1OCZ B;  3OAA G;  4BW9 A;  5CB4 B;  3CRC A;  2F4V B;  3HKC B;  1WA8 A;  3M8A A;  4TQD A;  2JGU A;  1EZJ A;  1CXZ B;  1PNM A;  3STZ C;  2Q73 A;  1QU7 A;  3E86 A;  1V54 B;  1URF A;  2Y0I A;  1R3J C;  2Q7E A;  2JJ1 G;  1HNZ B;  3UCS C;  4O2B A;  3OR6 C;  5A2Q N;  3C90 A;  4EFB A;  2G38 A;  2AHY A;  2XAH A;  3ABK B;  3QG5 A;  2HJD A;  4MTF A;  4IHJ A;  1BGY H;  4UFZ A;  3MAQ A;  5KLV H;  2Q8V A;  4B3S O;  1BHB A;  5L3G A;  1M57 C;  1OZ0 A;  5B3S B;  2X6B A;  3APQ A;  3E8G A;  3ZHT A;  2P7T C;  4CC5 A;  4DUY B;  4LFB B;  2CK3 G;  3JAR A;  3I55 V;  3ZRW B;  4LWS B;  4PI0 A;  4I4T B;  2LQT A;  4J10 A;  4ASU G;  4J42 A;  2EX3 A;  3HKD B;  1NBM G;  4YHH B;  1MSW D;  1L1F A;  1YJ9 V;  2CDY A;  3WU2 Z;  5LHG A;  4O4L A;  3FYI B;  4N21 A;  2EBO A;  2JJ2 G;  4X88 A;  3H9V A;  2E76 B;  1F4M A;  3T1H O;  1SA0 A;  3CME V;  2KB1 A;  4JI1 B;  3K5O A;  3G6B A;  1Q86 W;  3OTO B;  2QDO A;  5JQG B;  2ZKO A;  3Q4H A;  5LMU B;  1QHT A;  2EIJ B;  2GTA A;  4AQY O;  3DTU B;  3AG3 B;  3DSQ A;  2P4V A;  4LF4 B;  5B66 Z;  4JZG A;  3LUT B;  4E2L A;  3PN1 A;  2GDS A;  4LF5 O;  2VWK A;  3CD6 V;  4YY3 B;  4DV5 O;  3JD2 A;  2OIE A;  2D2C B;  3TCU A;  2EIM B;  3MHS C;  1YJW V;  2Y48 A;  2OTJ V;  4LF7 O;  4QPJ A;  3G6E V;  1V9P A;  1H2G A;  4DV7 O;  1US6 A;  1XRE A;  5LOV A;  2QKS A;  4ZHQ A;  4YIO A;  3BA8 A;  4J9Y B;  3QNE A;  2OCH A;  2F43 G;  3G4S V;  2H3O A;  2XOK G;  2YXL A;  1B04 A;  3FD9 A;  1XOU A;  4YJ3 B;  1KP2 A;  3ASN C;  4DO2 A;  2LW1 A;  1Q81 W;  5J2T A;  2QM7 A;  4JI1 O;  3T4D A;  1Y74 B;  2UXN A;  3H1L H;  1JCH A;  3DC5 A;  3T1C A;  1YDX A;  2CH7 A;  3JSN A;  1I5Y A;  5LMN O;  1IZ3 A;  4I0X A;  4MS2 A;  3JAS B;  3FYE B;  4PA3 A;  2YDE A;  1ZL8 B;  1P49 A;  2LP7 A;  1S77 D;  1H8E G;  2N04 A;  1M90 W;  3OEE G;  4TUY A;  2GSM B;  4DXW A;  1I94 B;  2A3Q A;  3E8B A;  4KUM A;  1AP5 A;  4EKW A;  2DYS C;  2YIC A;  3AK1 A;  4ZOL B;  4LFA O;  2HR3 A;  3T1H B;  4R50 A;  5J2T B;  4JI7 B;  2GTS A;  1AIL A;  1PKX A;  1QLE C;  1M1K W;  1JFF A;  5CA0 B;  2QWR B;  2XAS A;  2P06 A;  1KEC A;  4LF8 B;  1SES A;  1VMG A;  3VBB A;  1S3J A;  3CXH F;  2IU0 A;  4DR1 O;  1Y6X A;  3ZX6 A;  4XDK A;  3OM3 B;  1F7Y A;  1S76 D;  2P22 C;  1GN6 A;  5B1N A;  4AI8 A;  5IJ9 B;  4WCE V;  5JCO C;  1KU9 A;  5K1P A;  3N2K A;  1NS1 A;  1N0N A;  2A7W A;  2ODM A;  4LF9 O;  2UUC B;  3RWR D;  4J7Z A;  4X62 O;  4KP4 A;  2ZM6 B;  2Z0A A;  1VQ5 V;  4YXW G;  2PI5 A;  1YI2 V;  1PD3 A;  3J7A U;  1N34 B;  3B8M A;  2RQ6 A;  4JF3 A;  3OGI B;  2PGG A;  2R72 A;  2X6A A; 
#chains in the Genus database with same CATH homology
 3CYO A;  3NXS A;  4JAV A;  1BMF G;  3AEI A;  3RW0 A;  3CC2 V;  1P7B A;  1ENV A;  2JIZ G;  4GT1 A;  4TT3 G;  3RVZ A;  3OMI B;  4QE7 A;  1ROP A;  1E1Q G;  2WLJ A;  3FB7 C;  1M56 C;  1K3E A;  1R3L C;  2H94 A;  1I5X A;  3AG1 C;  5CBF A;  1Y4M A;  1SET A;  3OEH G;  1AI4 A;  3ZMT A;  2XAJ A;  1AI6 A;  2Z3Y A;  4PDL A;  2P6J A;  4MVS A;  3CCR V;  4R6Z A;  2YSU B;  5KUK A;  1PL0 A;  2LFR A;  4RQF A;  4WFF A;  4U7N A;  5FL7 G;  2EIK B;  4JYC A;  2IH1 C;  2Q68 A;  2DYS B;  1ARO P;  3K0D A;  1OCC C;  5EC2 C;  1QCE A;  2ZR2 A;  3K08 A;  2X6C A;  3ZRX A;  3JD1 A;  3LDE A;  1DTO A;  1VQ7 V;  2ZR3 A;  1B6Q A;  1CEZ A;  3E35 A;  5IY5 C;  2OCC C;  5CN0 A;  1AJP A;  1GK9 A;  3FKS G;  3CCE V;  2DQ0 A;  4P2Z A;  1K7D A;  3AG4 C;  2M7W A;  5IDJ A;  2IJJ A;  4UXN A;  4BAY A;  1HWY A;  1YSC A;  4WFH A;  2P67 A;  3JD4 A;  3F5W C;  3RVY A;  2ZXW C;  4UV9 A;  1N8R W;  2OCC B;  1KQS U;  1KP3 A;  1R6N A;  4JTD B;  4UV8 A;  1BHA A;  4MT8 A;  4HYO A;  1VQ6 V;  3AG2 B;  2A9H A;  1K4D C;  1VQK V;  4PA9 A;  3VOU A;  3SPG A;  1EBO A;  1Q7Y W;  1VQN V;  4G28 B;  3ZMU A;  1JVM A;  4FMT A;  4PDR A;  1R73 A;  1V55 B;  4FPP A;  5EBL C;  3ZRW A;  4LP8 A;  2EZP A;  1JX9 A;  4ZKI A;  5H9C A;  4JYB A;  1VQM V;  2WWW A;  3B77 A;  3CP1 A;  4X8A A;  2EJR A;  3PJS K;  3GWO A;  1GM8 A;  1GMG A;  2XAQ A;  2K1E A;  3D36 A;  4Z1M G;  4PA4 A;  1Y66 A;  3K79 A;  1AR1 B;  1QR8 A;  3CMA V;  1VQO V;  2JEX A;  1K33 A;  2V7Q G;  4XBF A;  5B3S C;  2A79 B;  1W0J G;  1JQ0 A;  1FXK A;  1R3K C;  1GO3 F;  5L3B A;  1R6K A;  3W7T A;  2UXX A;  1FS0 G;  2Q69 A;  4PEL A;  1G4Y B;  3JYC A;  4L87 A;  1KKD A;  3EHB B;  1PNL A;  4N23 A;  2XAF A;  3OFN G;  1K8A W;  1W2B U;  3SPI A;  1CP9 A;  3BY6 A;  2A0L A;  5B1B B;  2ATK C;  4LBE C;  4MTX A;  3K3W A;  4MVM A;  2EIL B;  4FIP C;  5LGT A;  4BW5 A;  1V54 C;  5EBW C;  5B1A B;  3IGA C;  4I5S A;  2B1G A;  3OUS A;  4F4L A;  1KC8 W;  3ETD A;  2QEX V;  4GX1 A;  4P30 A;  3AG2 C;  2BOB C;  3TK1 A;  1M9N A;  2EIN C;  1NKD A;  2Y69 B;  2Q67 A;  3ASO C;  1OCO C;  3B8N A;  3LSS A;  2WLL B;  4KFM A;  4WFB V;  1E1R G;  3X2Q C;  2EIJ C;  1YIJ V;  3OGC C;  1RPO A;  1ZWI C;  3ZN0 A;  1NQT A;  1OCR B;  3E2E A;  3CCS V;  5LHI A;  2JDI G;  5HFL A;  2AHZ A;  1AJQ A;  3P30 A;  2IW5 A;  4GX2 A;  5IY5 B;  3ABL C;  5DM6 V;  4JGS A;  2EZO A;  3CCL V;  5GW7 A;  4G2K A;  3DGE A;  4LC1 A;  2B5U A;  3ZMV A;  4JTA B;  1XL6 A;  2Q6A A;  2DQ3 A;  3LDC A;  1RPR A;  4QPK A;  1FXV A;  2QA4 V;  4JPR A;  5L3D A;  1CPY A;  4WFG A;  3SPC A;  3X2Q B;  3ZMZ A;  2EIK C;  3HB3 B;  4BIZ A;  3UM7 A;  4LCU C;  3OR7 C;  5DN6 G;  3W7U A;  3GB7 C;  2R9I A;  1GM9 A;  3WFV A;  1DLB A;  3LNM B;  5LBQ A;  4XDJ A;  3E8F A;  1PNK A;  4MVR A;  2QE7 G;  4ZBM A;  2ZQM A;  4PDM A;  1COW G;  3FB6 C;  4MSW C;  4WF9 V;  2WLH A;  3P32 A;  3EFF K;  2W0F C;  5LGN A;  3ABT A;  1GM7 A;  5KUM A;  3W7S A;  1P4R A;  1TUE B;  4MVO A;  5H6Q A;  2WLM A;  4MTO A;  3OMN B;  4PDV A;  3K06 A;  4JAS A;  2V1D A;  1K73 W;  2X7R B;  2Z5U A;  1WPX A;  5E1A C;  3T4Z A;  2XAG A;  3ABK C;  1QBZ A;  2D3O W;  1MAB G;  2WLL A;  3AG3 C;  2WLK A;  2HKO A;  3TET A;  3SPJ A;  1THZ A;  4G27 B;  2HFE C;  1OCZ B;  3OAA G;  4MVU A;  2EIL C;  4UVA A;  3OW2 U;  2EIN B;  4FJC C;  1EZJ A;  3OUF A;  1PNM A;  3STZ C;  5J9P C;  1AI7 A;  3E86 A;  3ABU A;  1V54 B;  5B1A C;  3ZMS A;  1R3J C;  1SZT A;  3ABM B;  2JJ1 G;  4QNH B;  2BOC C;  4QJF B;  3K03 A;  3OR6 C;  1KD1 W;  3CCJ V;  3SJQ C;  2HVJ C;  2AHY A;  4RUF A;  2XAH A;  2C2A A;  3ABK B;  4RQE A;  1RM1 C;  1GTO A;  4MTF A;  1FXK B;  1YJN V;  2W6J G;  1QLN A;  3ML0 A;  3LDD A;  5BZB A;  2XND G;  3CCU V;  3K0G A;  1BHB A;  1NR1 A;  1G8M A;  5L3G A;  1M57 C;  3K9A A;  4FK5 C;  1OCO B;  1OZ0 A;  2ZDI C;  2X6B A;  5B3S B;  1XL4 A;  3G71 V;  1BL8 A;  3E8G A;  4QE9 A;  1VQ8 V;  3ZIA G;  2P7T C;  5KA5 A;  2CK3 G;  3I55 V;  4MVZ A;  3ZRW B;  1UJW B;  4WFE A;  1WLE A;  4ASU G;  2IJK A;  1V55 C;  5B1B C;  1QLE B;  1NBM G;  3KG2 A;  4GCZ A;  1MSW D;  2NNU A;  3CPW U;  3CCQ V;  1L1F A;  1YJ9 V;  4HAM A;  5HFM A;  2IJI A;  1F4N A;  3OE7 G;  3T2M A;  5LHG A;  3MD0 A;  3FYI B;  4N21 A;  5LHH A;  2EBO A;  3RBZ A;  2JJ2 G;  4X88 A;  3ZN1 A;  1F4M A;  2WAM A;  3FB8 C;  3STL C;  4OXS A;  2EIM C;  1IXM A;  1DF5 A;  1NR7 A;  1RM1 B;  3CME V;  2KB1 A;  1S0V A;  1SRY A;  2Y69 C;  5C93 A;  3MHH C;  1Q86 W;  2ZDI A;  2ITC C;  4J9Z B;  3ZRV A;  3QO7 A;  5L3E A;  1DF4 A;  1QVF U;  2DYR B;  1VQ4 V;  2EIJ B;  2DYR C;  1NJI W;  3CC4 V;  3DTU B;  2JK5 C;  1K92 A;  4HZ3 A;  3AG3 B;  2HVK C;  4JAU A;  5B1O A;  3LUT B;  4E2L A;  4WFA V;  1M56 B;  3ASN B;  1YIT V;  3CD6 V;  1AJN A;  2LFS A;  2QTO A;  3SYQ A;  3JD2 A;  5H6R A;  1K4C C;  2IU3 A;  3TCU A;  4Q20 A;  2EIM B;  1R3I C;  3MHS C;  1YJW V;  2Y48 A;  3A0R A;  2DWE C;  2OTJ V;  2HLD G;  5EC1 C;  3R65 A;  4MTG A;  4QPJ A;  2FTK A;  4UVC A;  3W7W A;  2B1I A;  2P90 A;  1NVP B;  1VQL V;  4JTC B;  4PA6 A;  5CMU A;  4UVB A;  1YHQ V;  3JD3 A;  2YEV B;  3ETG A;  4CBC A;  5IYD O;  3G6E V;  3D3I A;  1Q82 W;  1H2G A;  4X89 A;  2QKS A;  2JEU A;  1K9M W;  5L3C A;  3ZJZ A;  2GHY A;  5CBG A;  1NH2 D;  1LNQ A;  3I56 V;  1K5Q A;  3QNE A;  4J9Y B;  3CXC U;  4GX5 A;  2ZXW B;  3ZCC A;  3ZRS A;  2W6I G;  2F43 G;  3G4S V;  3BEH A;  2PI4 A;  2XOK G;  3WG7 B;  1S5H C;  1QVG U;  3F7V C;  1FXK C;  1FFT B;  1KP2 A;  1M57 B;  1EFR G;  4H33 A;  3ASN C;  1OCR C;  4DO2 A;  4BIU A;  1MG1 A;  3CC7 V;  1Q81 W;  4MW3 A;  4MW8 A;  2MK3 A;  2QM7 A;  3T4D A;  1F51 A;  1SER A;  4XDL A;  2UXN A;  4QIW F;  3SPH A;  1JCH A;  3SYP A;  3T1C A;  3CCM V;  3E89 A;  4UUJ C;  1I5Y A;  1JPX A;  4RUE A;  1NVP D;  1AI5 A;  1OCZ C;  4MS2 A;  3FYE B;  4R7C A;  1VQ9 V;  4PA3 A;  3QO5 A;  2LP7 A;  1S77 D;  1H8E G;  4CZZ A;  1M90 W;  1VQP V;  2WLI B;  3OEE G;  2GSM B;  4GX0 A;  3CCV V;  4DXW A;  1YTF B;  3E8B A;  3M99 B;  4KUM A;  4EKW A;  3SYA A;  2DYS C;  3W7X A;  2HJF C;  3HPL C;  3JCZ A;  5CBH A;  1J95 A;  2HR3 A;  2NLJ C;  3AG1 B;  1OHH G;  2H8P C;  3JD0 A;  4PA7 A;  4R50 A;  1K97 A;  5LGU A;  2YEV A;  4H37 A;  1JOY A;  3ETE A;  1PKX A;  2DWD C;  1QLE C;  5L3F A;  1M1K W;  1S72 V;  5IYB O;  4TSF G;  2IJH A;  2XAS A;  4P9O A;  1KEC A;  5KA6 A;  4RAI A;  1SES A;  1F23 A;  2ZD9 A;  4U7O A;  3VBB A;  1S3J A;  2X0L A;  3QO8 A;  1FXH A;  2IU0 A;  3OMA B;  3UKM A;  3WG7 C;  2R9R B;  3H01 A;  2WPD G;  4XDK A;  3IFX A;  1GKF A;  3OM3 B;  3E8H A;  1S76 D;  5B1N A;  1ORQ C;  1E79 G;  1H38 A;  3ABL B;  4WCE V;  2WLN A;  3F7Y C;  2OT5 A;  1YTF D;  2ITD C;  3IC7 A;  2OTL V;  4MVQ A;  5IYC O;  1W0K G;  4R8C A;  3SYO A;  1H8H G;  4P9P A;  4KP4 A;  2QM8 A;  1VQ5 V;  3ABM C;  2WSS G;  5EK0 A;  3FB5 C;  4TWK A;  4YXW G;  1JJ2 U;  2PI5 A;  3SYC A;  4I9W A;  2IH3 C;  3AG4 B;  1YI2 V;  1PD3 A;  3B8M A;  4JF3 A;  3ASO B;  1K34 A;  3K04 A;  1QR9 A;  5EBM C;  1K5S A;  4RO2 A;  2DW4 A;  1OCC B;  2HG5 C;  1NH2 B;  1MOF A;  2WLI A;  3E83 A;  5CA3 A;  3LSQ A;  2X6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...