1GTOA

High resolution structure of a hyperstable helical bundle protein mutant
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
62
structure length
62
Chain Sequence
b'GTKQEKTALNMARFIRSQTLTLLEKLNELGADEQADICESLHDHADELYRSCLARFGDDGEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ROP
publication title Amino-acid substitutions in a surface turn modulate protein stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulation
total genus 28
structure length 62
sequence length 62
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1996-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.230 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1gtoA00
1RPOA 1B6QA 1GMGA 1GTOA 1RPRA 4DO2A 1ROPA 2IJHA 2IJIA 3K79A 1F4MA 2IJKA 1PD3A 2GHYA 2IJJA 1F4NA 1NKDA
chains in the Genus database with same CATH superfamily
1PNMA 3G80A 1OCOC 5EC2C 3CRQA 1HNXB 3RYHA 1GM9A 2R70A 1FFXB 5FLXN 1O9HA 3QO5A 4ZOLB 3UM7A 3K04A 4TT3G 2HVJC 1OCOB 3TXSA 3ZHSA 2EIKC 2WA4A 4IIJA 2QE7G 1V9PA 2EIKB 2FYUH 3JD1A 1Q6HA 4WFGA 5IWAB 2Q73A 1KUQA 4LH6A 3OM3B 1V55C 2UXBB 4HAMA 3NXSA 1NT2B 2PYLA 3HKEB 4TV9A 3HR0A 4NKGB 4UB8Z 4WFHA 1IVSA 5KLVH 1V55B 2YXLA 3BPZA 4LR3A 3A0BZ 4YHHB 2GTAA 4WBNA 2BE3A 3CX5F 4LWSB 1I0HA 1EFRG 1QR8A 1PP9H 1YDXA 2VQEO 1RM1B 4JI0O 4BW9A 3ZMVA 1GN6A 1M56C 4I5SA 4MW8A 1YEWA 1GM8A 3ABKB 4KHPO 4PJ0Z 1WAZA 1MZFA 5B1BC 4JZ2A 1Q81W 3JAKA 1M56B 1AILA 1SQQH 4LFCB 4B7KA 3ZCCA 3FKSG 1MOFA 4IL6Z 3K5OA 1L1FA 1VIBA 5B1BB 4N23A 4NTWA 4CH5A 2Q7GA 4WFEA 3K3WA 3WFVA 5J2UA 4OXSA 3OMAB 1WA8A 2EULA 2JJ1G 4FLTA 1ZLZA 4CZZA 1AI5A 4DR5O 4JI3B 1S72V 1N33O 2Q6AA 2JEUA 2IU3A 4TOIA 1IBLO 5GTHZ 5KUMA 4JYAB 2JK5C 1M5IA 1GRJA 2DN9A 3RT3C 2P4KA 3OD4A 2FL4A 3DC6A 2Q0AA 3K59A 4O2AA 3SPCA 1AB3A 3JCUZ 5FPOA 4DV6B 3LNMB 3FAVB 4WF9V 3E2EA 2DYSC 5LHIA 5BR8O 2XAJA 3WG7C 1SESA 1VF7A 2DYSB 3OTFA 4EFBA 3E8BA 1SETA 3BAAA 1KC8W 4JI6O 3WG7B 1Z5WA 2W6JG 4ZI7A 1VQLV 5C8YB 1TAEA 5H6QA 2QTOA 4JTDB 2DW4A 1NVPB 1U97A 4K3AA 3TCUA 2D2CB 3CC2V 1VF6C 1FFXA 1YJNV 2YEVB 3ZRWB 1Q8IA 1KQSU 4ZOLA 1XNRO 4OX9O 1FKAO 2LP7A 4PDMA 1N4CA 5FPRA 3SGIA 1XMQB 1YTFD 2MW2B 2K1EA 2DJVA 3K9AA 4LF5B 4LF7O 3B4SA 3JSNA 2HR3A 3T1YO 3ETGA 1YF2A 2OCCC 4DR7B 1E1QG 1ROPA 1Q90D 4OPAA 5H6RA 4XBFA 2Y0IA 4LF8O 3JD4A 3CCEV 4NXNB 2YXHA 4WFAV 1Q7YW 3HKEA 4JV5O 1BCCH 4MVMA 4FLUA 1IZ3A 5AG2A 2A06H 1BT8A 2R72A 3CSXA 4QPKA 1YXBA 1PNLA 1IDSA 4LWSA 4PDRA 3OE7G 1W0KG 2Y0PA 1XMOO 4GLXA 1P84F 3K9SA 1H2NA 3D36A 2P22C 1K9MW 1NH2B 4CS3A 2QWQB 2WLJA 2X6CA 3Q4HA 5KUKA 2AGAA 1F7YA 4JTCB 3SYAA 2DQ3A 4AILC 1XREA 5EBMC 2XTAA 2YXYA 1XI1A 2YIBD 3W7XA 3ETQA 3OAAG 4B3MB 4PDLA 1OJHA 3SJCC 4R6ZA 2Q7EA 3CRAA 1PNKA 1XNQB 4JAVA 3RGBA 1HWYA 1WP8A 2E5LB 3HKCB 1QVFU 2ZNJA 2WPDG 3ZRVA 4MVQA 3S3WA 2HKOA 4UV8A 4ZHQB 5KHHA 5LXTB 1Y74B 1K97A 3QNEA 4U3JB 2HG5C 4JI5B 3E86A 2CUGA 2DQ0A 1J5EO 3FAVA 5FL7G 1WLEA 3UKMA 3QG5A 1G1XB 4WFFA 1GM7A 4GT1A 5IYZB 1BGYH 1B6QA 2P4VA 4EB6B 3AG1C 1JA8A 1SF9A 3FX7A 5IE9A 4N21A 2F93B 2FB5A 2UU9O 1K34A 4C7UA 3AG1B 3WB2A 3K79A 1PL4A 2QWRB 4Z1VA 4JPRA 2QWPB 2ARHA 2YEVA 3ZRWA 5JH7B 2AHYA 2UUAB 1B04A 5EYPB 4WFBV 4B3TB 3SJQC 3E83A 4DW1A 1AR4A 1VF6A 1GKFA 1BL8A 1K7DA 4DXWA 4XDLA 3UO2A 1K33A 1KP2A 4K8XA 4R7CA 3OR7C 3ZX6A 4X64O 2B1GA 2UUBO 3CS5A 5JCOC 1WB7A 4UVCA 3U10A 4G28B 1YVWA 4QE9A 1EZVH 2N74A 2QSAA 3ABLB 2Q9LA 1XL4A 3WB1A 3WB0A 5CBGA 1K8AW 5A2QN 4FLZA 3CE2A 3H01A 1Q6IA 3LNNA 4RQFA 5F2VO 4PELA 5ITZB 1HNWO 1VARA 3CCLV 3QO7A 1Y66A 2IW5A 1M93A 5KA6A 2F95B 1S0VA 4QPJA 1SZTA 2EZPA 2Q7HA 2ZIOA 3ETDA 4MVRA 2B1IA 4LFAB 2N04A 2F43G 4FVMA 3ETEA 3STZC 2JGUA 1JCHA 3K0DA 2VWKA 4DV1O 2A7WA 1BQZA 4I4TB 1B06A 2BOBC 3M8AA 2W0XA 2VQFO 2DE0X 1VQOV 1QQCA 1H2MA 2D3OW 2XOKG 4R8CA 1QHTA 3ASNC 4RUFA 2ZNIA 4B7EA 2GTSA 4X1IB 3SYCA 4X8AA 1G6UA 3B2EE 4E4EA 2UXCB 3ZS8C 1P4RA 5LHHA 3THOA 1Q6UA 4FLYA 3BFRA 3CRCA 5KAIZ 5H2FZ 2LGQA 1NZ6A 2PI5A 2CAZC 3BA9A 4LH7A 3LSSA 4ZHQA 3IAYA 5LXTA 3K57A 3AG3C 1Y74A 5KHGA 1M4UA 4JI4B 1GH6A 1H2GA 1VQ9V 2HJDA 1Q3EA 4TQDA 1HP8A 4Q6GA 1JVMA 1NR7A 4KL1A 1Q82W 4X9QA 3X2QC 2JDIG 4JI7O 5IYZA 2QWOB 2XNDG 4WCEV 3IFXA 1PV0A 1N36O 4EB6A 3E35A 1DTOA 1OCCB 3JAMN 3CCQV 2YI8A 2CH7B 4NXMO 2FMLA 2YI9A 4F4LA 2ADQB 4NYKA 1GTOA 1ZAUA 4GX2A 3F5WC 3K08A 3RYFA 2P06A 5EIBC 1R3LC 1IBMB 1MSDA 1KD1W 2XAFA 1AVMA 1SQVH 1Q43A 3H9VA 2XAQA 4U7NA 2E3CA 5LA6B 2HEPA 1EN6A 4LF9O 3FB7C 1EZJA 5JH7A 1BHBA 4PA3A 5EYPA 4BIZA 3CWBH 4PI2A 4RAIA 1XDCA 3ZHRA 3ZHUA 2BTOA 4GKKO 4F6RB 1OV9A 1WN7A 2NR5A 4MW3A 1WPBA 3VQWA 2VQEB 1HNZO 4JI0B 2ZQMA 2KSDA 5JQGB 2X6AA 3T4ZA 1EN4A 4KHPB 3SR2C 5JCOA 1CP9A 3OFNG 5JJJB 1H38A 4MSWC 3I5DA 3MHHC 1Q86W 4H33A 2HP8A 3JCZA 3K0GA 1M9NA 4HYOA 4UCTA 5LOVB 4AQYO 3N2KB 2B9ZA 3P30A 5B1NA 3RW0A 3UO3A 3M7MX 1Q5OA 5B1AB 4GX1A 3TGUH 2AZ2A 3FB8C 4DR5B 3EFFK 1RP3B 2EJ7A 1IBLB 2R9AA 1G4YB 5KHIA 3AG4C 2AHZA 3PN1A 3A0RA 3FD9A 2YS8A 3R66A 2IU0A 4OGQB 3AG4B 3QO8A 2WWWA 2ZCEA 2B5UA 2OTLV 1VQ8V 3SPIA 5E79Z 4I4TA 3ZMTA 3ML0A 4NR1A 1MSWD 2ITDC 1IBKO 1AJPA 2IJHA 3JD0A 3MDSA 1NJIW 4NTXA 3OR6C 4I55B 4X1IA 4X1KB 1TUEB 2QWNB 5CA0B 5K1XA 4GZRB 1RPRA 3AG7A 1NQTA 2LW7A 4JI6B 2RCVA 3MD0A 2H3OA 2BCCH 5GW7A 1YJ9V 3ZMZA 1JR9A 4JI2O 1NR1A 5B66Z 1RM1C 2QGNA 5EZYB 2ODMA 3D36C 4G2KA 4QGPA 4LCUC 1FXKC 5DN6G 3ABKC 1I94O 4IYHA 4AHCA 1XNRB 4OX9B 5DM6V 1VQ6V 5IYDO 5D5PA 1FXKB 1BSMA 2XASA 3OEEG 4KFMA 4J9ZB 2A0LA 1KKDA 2QKSA 1IX9A 3CC4V 4LF7B 3LSQA 3T1HO 4KP4A 3T1YB 1MABG 2CH7A 1XBLA 3EHBB 3ICXA 5GONA 3OMNB 4MT8A 1FXHA 3CMEV 3W7WA 4TQFA 1WNSA 1J95A 4JV5B 2KQXA 3R65A 2AXTZ 1UPGA 1XOUA 1R3JC 5LA6A 1RSOB 4NTYA 2RDCA 1Y6XA 4TV8B 4O4LB 2QM7A 4YJ3B 1N34O 2UUCO 4UUJC 4F6RA 3RYCB 4EFEA 1YCIA 1XMOB 5JQGA 1JFFB 3BHPA 1KP3A 4FFBB 2GSMB 3JALB 4BWAA 3H1JH 1JPXA 1ZSPA 2BTQA 1NTKH 3MAQA 3LDCA 3HKDB 4IGGA 4KXRA 4L8JA 4CH3A 4DR1O 3JARB 2HVKC 3B09A 2RMKB 1S5HC 1Z5VA 1BHAA 1VQPV 4DR6B 4RWUA 2CK3G 1KECA 2Q68A 4P30A 1VQNV 1S5LZ 5L3DA 1TGOA 1XHXA 3D3QA 1ZTEA 3G71V 5CBHA 4JTAB 5LGNA 4DUZO 1P7GA 4UCVA 4DV5O 1IXMA 3E8HA 2CE4A 2YIAA 3ZHVA 3UQ8A 1PM9A 1MG1A 1QLNA 1J5EB 4B3RO 2EJRA 3CD6V 5HFMA 4O2BB 3U11A 1OCZC 3W7UA 4I55A 1W2BU 4X1KA 1YI2V 2ZT9B 3L9DA 2F66C 3AK2A 1XL6A 5CA0A 4AI8A 4D7TA 1K4CC 1OCZB 5EBLC 3KCYA 1YTFB 4DV3B 1ENVA 2UU9B 3CCVV 3MHSC 2BSKB 1FD9A 4ICGA 1UJWB 3AK1A 4CH6A 4LF4O 5EZYA 2NN4A 4UCSA 2LFRA 3A8TA 3SYOA 3BVOA 4PHZA 4QIWF 3B40A 1ZL8B 3RVYA 2BOCC 2YIDA 1FXKA 4ZIBA 5CB4B 4UVAA 1B3QA 3IC7A 2FKXA 4I0XB 4W4KA 1ZWIC 4K8ZA 3TK1A 4DR2O 4X62O 2EILC 1NBMG 4X64B 2UUBB 1XUQA 3GWKC 3D8CA 1JMKC 3APOA 4H37A 1HW7A 2EILB 4CS2A 4FMTA 1QLEC 5EC1C 2IJKA 5HFLA 1TUBB 2A79B 3E89A 4CC5A 4MTFA 5KA5A 5LP6B 3W7TA 1N32O 3RVZA 1FJGB 1QLEB 4BW5A 1RSOA 4R50A 4Z1MG 3P3NA 1SQGA 2H8PC 4CH4A 2ZXWC 4O4LA 3HKBB 4TV8A 3SPHA 4YJ3A 3ZHTA 1EBOA 4EKWA 2PTMA 1R6TA 2X7RB 1K4DC 2CDYA 1HNWB 1WPXA 3RYCA 3FYIB 2ZXWB 2QA4V 4ZKIA 1XILA 1I5XA 3G4SV 1ZUQA 3L75H 4X65O 4YIPA 5L3GA 1JFFA 2ZE5A 4K0KO 4FFBA 5JVDB 3JALA 3ZJZA 4LNUB 3LSUA 2JJ2G 1PPJH 4RO2A 2LW1A 3HKDA 4FZ1A 1V54C 2Z5UA 4X20B 1H2LA 2ZE6A 3RYIB 3BCCH 4FPPA 2A3QA 3JARA 3CP1A 4DV1B 2ZM6O 1V54B 2JRIA 2VQFB 5C8YA 1BE3H 2UXDO 2Q67A 1K73W 5L3CA 3KZIZ 1KB9F 4FM2A 4X88A 4LC1A 1P49A 2JS5A 3AG2B 2GDSA 1F51A 1SERA 2QKAA 3DC5A 4TUYB 3K5NA 1R6NA 3VOUA 3ZMUA 3DTUB 2NNUA 1O9GA 2O57A 2R9RB 3SYPA 4HNAB 1MZEA 3CCMV 1R6KA 1SQBH 2OCHA 4NB5A 3KCXA 1N8RW 3E22B 4JYCA 3CRRA 4QNHB 3H1HH 3ABLC 4O2BA 4PI0A 2JGDB 1YHQV 3W7SA 3OTOO 4JYBA 4JI7B 1L0LH 2VRZA 2OYQA 1H8EG 2Q0OC 3CCJV 5IJ9B 4JI8O 4D7SA 4NXMB 2ZDIC 1QVGU 2N05A 2BSKA 3HPLC 5LMUO 2EX3A 5KHKA 2WLIB 1KMIZ 4GUNA 5DECA 2P7TC 4UFZA 4DRXB 1S76D 1K3EA 3SPJA 5LYJB 1IXBA 4UCOA 2MK3A 1XNQO 3C90A 1N0JA 2QJ1A 4LF9B 2OTJV 1ZL8A 1I7FA 1JOYA 4PV1B 4PA6A 2OIGA 2WLNA 4J10A 2XUMA 1BS3A 4I0XA 2KB1A 2EIJC 5J2TB 3VQVA 3APQA 2LQTA 2QDOA 1JJOA 3CJHB 2YUAA 1DF4A 2JIZG 4DUYO 1HNZB 2EIJB 1COWG 1R3KC 2X6BA 3TXQA 4B3SO 4XDKA 4O4IB 4MVOA 4RUEA 3JD2A 2L6LA 1RPOA 1TUBA 5LP6A 1GN2A 1CEZA 1FAFA 2QTSA 5IYCO 4DW0A 3GB7C 4HZ3A 1R1BA 5B3SB 4X66O 2ZKOA 2LFSA 3HKCA 3HKBA 4AQYB 1M57C 4GYCB 2GUZB 1H8HG 1SRYA 1QU7A 3SJBC 5H5NA 5LHGA 2XAGA 2F4VO 4OPHA 1WJZA 2RQ6A 1LUVA 2G38A 1Y67A 3DGEA 4MVUA 1M57B 1VQKV 4PD4F 1W0JG 1D5AA 3KKYA 4U3JA 2YIBA 5IJ0B 2Q5ZA 2PYJA 5JVDA 2IH1C 4YXWG 4LNUA 4DV2O 5LGUA 1OCCC 2PF4E 3CRMA 2QM8A 3LUTB 3ZN0A 4X20A 2JVDA 4JAAA 3RYIA 1FFTB 2F1MA 3CC7V 2IH3C 3U0ZA 1SC5B 1QNMA 2H94A 1BQ0A 3BRCA 2XHBA 4UV9A 1IBKB 4LF6O 4DYLA 3RN4A 3JD3A 3F7VC 4W4LA 2Y48A 3H1IH 1QR9A 1AP5A 4LBEC 3AK3A 5KMGB 2GHYA 2HFEC 4B08A 4P9OA 3IGAC 1YITV 4TUYA 4DV4O 1GN3A 3ABTA 1E1RG 1WP7A 4BIOA 4NVPA 4FM1A 4HNAA 3CXCU 3JSLA 3LDEA 2P6JA 4U3FH 3ZIAG 1SA0B 1X59A 4JI1O 1I94B 3E22A 2WAMA 1VQ5V 2WLHA 2JGDA 2VS0A 2HHHO 2Y4TA 1HR0O 1AR5A 2P90A 5E1AC 2ILMA 5IJ9A 5B1AC 1SZXA 1LNQA 5LMNO 1HDJA 1LR1A 3OUFA 5ITZA 4DRXA 3DXRB 2ZDIA 5LYJA 3E8FA 1N33B 4H13B 1I5YA 4BIUA 5TISZ 3JYCA 1VP7A 2PI4A 4DR4O 1FXVA 3K03A 1L8DA 3AEIA 1URFA 4UB6Z 3RFRA 1M1KW 1N34B 4LFBO 4J11A 2UUCB 5J2TA 5CN0A 4DV0O 3CJHA 3OUSA 4DV7O 4DR3O 3FB5C 5K1PA 4O4IA 3JASB 3B8NA 5BR8B 5L3BA 4IYIA 1S77D 1H2KA 3KG2A 3IC9A 1GK9A 4DR1B 3ZEDA 1F4NA 4QJFB 3JATB 2KG7B 4PA7A 3G6BA 2GUZA 1SQPH 3FYEB 4GX5A 2IJJA 2RNBA 4JAUA 5L3FA 1IBMO 4GKJO 2PY5A 2KKWA 5IJ0A 3ZRSA 4J80A 2OT5A 4DUZB 1CPYA 1JX9A 4DV5B 1FS0G 2ATKC 3EXAA 4MTXA 2YSUB 3G6EV 3K5LA 1OCRC 4FJCC 1G8MA 1CXZB 3CPWU 4JZGA 1THZA 1OCRB 4B3RB 2E75B 2LJ2A 2OWOA 3OEHG 3OW2U 1EN5A 4LF8B 1AJQA 1I08A 1D5NA 4UXNA 5H9CA 4YY3O 3RWRD 3Q4HB 1ZX3A 3RBZA 1PD3A 5KMGA 4RQEA 4BAYA 4IHJB 3WU2Z 4X89A 2QR4A 1N0NA 2WA3A 4I7ZB 5A9GA 4DO2A 2AZ0A 4LF4B 2M6YA 1E79G 2Z0AA 3C3TA 2P67A 1XHZA 1AP6A 3OGCC 5BY1A 1SA0A 3OGIB 4L87A 5BMVB 3C3SA 4LP8A 5KAFZ 2LGWA 3ZMSA 1DK1A 5DEDA 2V7QG 1HNXO 1PL0A 2CTWA 5IDJA 4FLVA 3CEIA 4YIOA 5BXZA 4Z2WA 4DR2B 4X62B 2Y4UA 1KBHA 5LOVA 3N2KA 3H1LH 1NVPD 4EEQA 5IWAO 2F23A 2WLLB 1P7BA 3DXRA 1T5EA 1VQMV 4O4HB 5J9PC 2UXBO 4FFKA 5EK0A 1N32B 5CA1B 2E76B 2A9HA 3QVNA 1SKVA 2R9IA 4J9YB 3CCRV 4CS4A 3VQXA 1TVKB 3SPGA 4FM0A 1IURA 1OZ0A 4YHHO 1R73A 2UXNA 5CA3A 4X65B 4GX0A 3JASA 4H44B 3EVKA 4K0KB 3N27A 4XDJA 3TETA 3QTCA 1SQFA 1AR1B 3O9OA 1BMFG 3ASOC 2ZE8A 3GVMA 3F5TA 4MVSA 1JQ0A 4LFCO 2Z3YA 3ASOB 3JATA 2KG7A 3LDDA 2ZM6B 1LUWA 2UXDB 1NS1A 2RN9A 4ABMA 4TWKA 2OCCB 4HBNA 3L73H 3N2GB 3ZBHA 4JI3O 2PGGA 4F6EA 1NH2D 5LL6Y 3CHXA 4O4JB 2IJIA 4JYAO 3J81N 5B5EZ 4PA9A 2L35A 2M7WA 1EM1A 4JF3A 4BR6A 1K92A 4JGSA 4J7ZA 1SQXH 5IT9N 4JASA 1MA1A 3O65A 3HB3B 3M99B 3S3XA 2XT9A 5LP6C 4DV6O 1GAXA 1Y76B 3FB6C 1GN4A 3OTOB 4MTGA 2V1DA 3QF7A 5D5QA 3ABMC 4I9WA 3BA8A 4IHJA 3CXHF 4JI8B 4TSFG 3ABMB 5LMUB 2XAHA 1SS3A 1H2SB 4X1YB 2EZOA 4CBCA 3CCSV 4DR6O 2YDEA 3D3IA 3UT5B 5BMVA 2W0FC 5IY5C 4ZBMA 2DWDC 2DMXA 3P32A 2OIEA 1GMGA 1VEWA 5IY5B 3BY6A 1Z2GA 5IYBO 1XMQO 2QKCA 2CTRA 4FLXA 1A32A 2GBOA 4LF5O 1US6A 2DYRC 4DK1A 2ADPA 4DUYB 5L3EA 4ASUG 2JEXA 4DR7O 4B3SB 2ZR3A 3H1KH 3B8MA 2RJZA 3L70H 4P2ZA 2DYRB 2WLLA 1XQ8A 4O4HA 1NTMH 3AG2C 3CCUV 4MVZA 4NXNO 4FLWA 4GCZA 1JJ2U 3JAWB 5CA1A 3L72H 4J7JA 4X66B 1F23A 4YJ2B 3ABUA 1U96A 4DV3O 2LO1A 1YIJV 1M90W 4FZ0A 1KU9A 1TVKA 1PKXA 2F4VB 3L71H 3RYFB 4UCRA 1BZKA 2CTPA 3STLC 3G67A 5CBFA 2EIMC 3CB2A 2UXXA 1F4MA 4H0LB 1OHHG 1VMGA 1VQ4V 3OT7A 4DV2B 2EIMB 5FNVB 4D6TH 3PJSK 4K35A 1W59A 2HLDG 3L74H 5B1OA 1N36B 4CC6A 4J42A 1DF5A 1DGSA 3CMAV 4MS2A 1FYJA 4LF6B 2ITCC 3ZN1A 3BEHA 2ZR2A 3ZRXA 3FFQA 2DWEC 2WSSG 4UVBA 4B3MO 3N2GA 4E2LA 3T4DA 5JJNB 1L0NH 1FJGO 4O4JA 2K9PA 1MNGA 2GV9A 1VF5B 4FIPC 3VBBA 2E5LO 1X4TA 1UFIA 3IJ4A 4DV4B 4I50B 3ZHQA 5CB4A 4PDVA 2WLMA 4GKKB 3E8GA 3SDLA 2ZD9A 1NTZH 1K5SA 5BZBA 5JWPA 4JI1B 1FPOA 4JI5O 3SJAC 2Q4PA 4I9QA 5KX5B 1DLBA 2Q69A 1Y76A 3RYHB 5B3SC 3VQYA 5C93A 3I56V 3DSQA 2HHHB 1HR0B 1KYOF 3SYQA 4PA4A 1NI8A 2IBZH 4IIJB 3T2MA 1VQ7V 5LMNB 1R3IC 4X1YA 2W6IG 3K06A 4KUMA 4UCUA 3UT5A 5EBWC 4TV9B 5KHJA 1AI6A 3GWOA 2ETNA 3ASNB 3T1CA 4DR4B 4P9PA 2ZINA 4J7KA 3K5MA 2UUAO 4A5UB 4B3TO 4LFBB 4IT5A 2HJFC 1YJWV 2QM4A 4WBNB 4DV0B 2NLJC 4DV7B 3J80N 4DR3B 2PUSA 3AG3B 4QE7A 5EIBD 5GTIZ 3I55V 1GO3F 3JAWA 3JAKB 4YJ2A 4J41A 3X2QB 4U7OA 4JYYA 5JJEB 1S3JA 2QEXV 2EINC 4DK0A 5GONB 4JI2B 2IM9A 4Q20A 1XEQA 2P5OA 5J2UB 4GKJB 1WA8B 2CGOA 5LGTA 2EINB 2ZE7A 3OMIB 2X0LA 2E74B 4FK5C 2EBOA 4G27B 2JS3A 5FNVA 2FTKA 1K5QA 2C2AA 1AJNA 2Q8VA 1AI7A 1NKDA 1WB8A 4LFAO 1YZBA 3K58A 3UCSC 1Y4MA 3T1HB 2V4DA 4O2AB 3TJTA 1RFYA 2AW9A 3NR7A 2WLIA 2Y69C 5CMUA 2YICA 3A0HZ 3J7AU 1MMMA 1AROP 1S5JA 1YSCA 1AI4A 2YC0A 4YY3B 2CGNA 1D2DA 2BTQB 2Y69B 1QBZA 1KKCA 1NU1H 2UXCO 3F7YC 5LBQA 2VWJA 2CTQA 4I50A 4ZI7B 2WLKA 2ZIMA 2PZSA 1QCEA 3CYOA 3P3PA 2DOSA 4MTOA 4JI4O 3BABA 1ORQC 3A2FA 3B77A 5KX5A 1TA8A
chains in the Genus database with same CATH topology
1PNMA 3ASNC 1OCOC 5EC2C 4RUFA 5J9PC 5L3GA 3SYCA 5EK0A 1GM9A 3ZJZA 4X8AA 3QO5A 3UM7A 2JJ2G 2A9HA 1P4RA 3K04A 4RO2A 5LHHA 4TT3G 2HVJC 1OCOB 2R9IA 4J9YB 1V54C 2Z5UA 3CCRV 2EIKC 4FPPA 3SPGA 2PI5A 3CP1A 1OZ0A 2QE7G 3LSSA 1R73A 3AG3C 2UXNA 1V54B 5CA3A 2EIKB 3JD1A 4WFGA 2Q67A 1K73W 1H2GA 5L3CA 1VQ9V 4GX0A 1JVMA 1NR7A 1V55C 3OM3B 4HAMA 3NXSA 4XDJA 3TETA 4X88A 4LC1A 1AR1B 1Q82W 3X2QC 2JDIG 4WFHA 1BMFG 3AG2B 3ASOC 1F51A 1V55B 2XNDG 1SERA 4WCEV 4MVSA 3IFXA 1JQ0A 3E35A 1R6NA 1DTOA 3VOUA 3ZMUA 1OCCB 2Z3YA 3ASOB 3DTUB 2NNUA 2R9RB 3SYPA 3CCQV 3LDDA 4F4LA 1GTOA 1EFRG 3CCMV 1QR8A 1R6KA 4GX2A 3F5WC 4TWKA 3K08A 1R3LC 1N8RW 1RM1B 2OCCB 4JYCA 4QNHB 3ZMVA 3ABLC 1NH2D 1M56C 1KD1W 4I5SA 4MW8A 2XAFA 1YHQV 3W7SA 1GM8A 2XAQA 3ABKB 4U7NA 2IJIA 4JYBA 1H8EG 3FB7C 1EZJA 4PA9A 5B1BC 1Q81W 1BHBA 4PA3A 1M56B 4BIZA 2M7WA 3ZCCA 3FKSG 3CCJV 4JF3A 1K92A 4JGSA 1MOFA 4RAIA 1L1FA 2ZDIC 1QVGU 3HPLC 5B1BB 2WLIB 4N23A 4JASA 4WFEA 4MW3A 3K3WA 3HB3B 3WFVA 2P7TC 3M99B 4OXSA 3OMAB 2JJ1G 1S76D 1K3EA 3SPJA 4CZZA 2ZQMA 1AI5A 1S72V 2X6AA 2Q6AA 3FB6C 3T4ZA 2JEUA 2IU3A 4MTGA 2MK3A 2V1DA 5KUMA 1CP9A 3ABMC 3OFNG 1H38A 4MSWC 2OTJV 2JK5C 1JOYA 3MHHC 1Q86W 4I9WA 4H33A 4PA6A 2WLNA 3JCZA 3K0GA 4TSFG 3ABMB 2KB1A 2EIJC 1M9NA 4HYOA 2XAHA 5B1NA 3P30A 1DF4A 3RW0A 3SPCA 2EZOA 2JIZG 4CBCA 5B1AB 4GX1A 2EIJB 1COWG 1R3KC 3CCSV 3FB8C 2X6BA 3D3IA 4XDKA 3LNMB 3EFFK 4WF9V 3E2EA 2W0FC 2DYSC 5IY5C 4MVOA 4ZBMA 4RUEA 2DWDC 1G4YB 3JD2A 1RPOA 5LHIA 3AG4C 3P32A 2XAJA 3WG7C 1SESA 1CEZA 2AHZA 5IYCO 3A0RA 1GMGA 2DYSB 3GB7C 4HZ3A 5B3SB 5IY5B 3BY6A 3E8BA 1SETA 2IU0A 1KC8W 5IYBO 3AG4B 3QO8A 2LFSA 3WG7B 2WWWA 2W6JG 1M57C 2B5UA 1VQLV 2DYRC 2OTLV 1H8HG 1SRYA 1VQ8V 5H6QA 2QTOA 4JTDB 3SPIA 5LHGA 2XAGA 2DW4A 5L3EA 4ASUG 3ZMTA 3ML0A 2JEXA 3DGEA 1MSWD 4MVUA 2ZR3A 2ITDC 1M57B 1VQKV 1NVPB 3B8MA 1W0JG 4P2ZA 2DYRB 1AJPA 2WLLA 2IJHA 3JD0A 3TCUA 3CCUV 3AG2C 4MVZA 1NJIW 3OR6C 4GCZA 1JJ2U 3CC2V 1TUEB 2IH1C 4YXWG 1YJNV 2YEVB 3ZRWB 1KQSU 2LP7A 4PDMA 5LGUA 1F23A 1OCCC 1RPRA 1NQTA 3ABUA 2QM8A 3LUTB 3ZN0A 1YTFD 3MD0A 1YIJV 5GW7A 1FFTB 2K1EA 1YJ9V 1M90W 3K9AA 3CC7V 3ZMZA 2IH3C 2HR3A 1NR1A 1PKXA 2H94A 3ETGA 1RM1C 2OCCC 1E1QG 1ROPA 4UV9A 3STLC 4G2KA 5H6RA 4XBFA 4LCUC 2EIMC 5CBFA 3JD3A 1FXKC 5DN6G 3ABKC 2UXXA 3F7VC 3JD4A 1F4MA 2Y48A 3CCEV 1OHHG 4WFAV 1VQ4V 1QR9A 1Q7YW 2EIMB 5DM6V 4LBEC 1VQ6V 4MVMA 5IYDO 1FXKB 3PJSK 2GHYA 2XASA 2HFEC 2HLDG 5B1OA 3OEEG 4KFMA 4J9ZB 2A0LA 1KKDA 2QKSA 4P9OA 3IGAC 1YITV 3CC4V 3LSQA 4KP4A 3ABTA 1DF5A 1MABG 1E1RG 4QPKA 3CMAV 1PNLA 4MS2A 3EHBB 3CXCU 3LDEA 2ITCC 3ZN1A 4PDRA 2P6JA 3OE7G 3OMNB 1W0KG 3BEHA 4MT8A 2ZR2A 3ZIAG 3ZRXA 1FXHA 3CMEV 3W7WA 2DWEC 2WAMA 2WSSG 1J95A 3D36A 4UVBA 4E2LA 1K9MW 1VQ5V 3T4DA 2WLHA 1NH2B 3R65A 1R3JC 2WLJA 2X6CA 4FIPC 2P90A 3VBBA 5KUKA 5E1AC 4JTCB 3SYAA 2QM7A 4PDVA 5B1AC 4UUJC 2DQ3A 2WLMA 1LNQA 5EBMC 3E8GA 2ZD9A 1K5SA 5BZBA 3OUFA 2ZDIA 3W7XA 3OAAG 1DLBA 4PDLA 2Q69A 3E8FA 1KP3A 4R6ZA 2GSMB 5B3SC 5C93A 1I5YA 1PNKA 3I56V 4JAVA 1JPXA 4BIUA 3SYQA 1HWYA 4PA4A 3JYCA 3LDCA 2PI4A 1FXVA 3K03A 3AEIA 1M1KW 1QVFU 2WPDG 3ZRVA 4MVQA 2HKOA 3T2MA 4UV8A 2HVKC 1VQ7V 5CN0A 1R3IC 3OUSA 1S5HC 2W6IG 1BHAA 1K97A 3QNEA 3K06A 4KUMA 1VQPV 2HG5C 3E86A 2DQ0A 2CK3G 1KECA 3FB5C 2Q68A 4P30A 5FL7G 3B8NA 1VQNV 5L3DA 5EBWC 1WLEA 3UKMA 1AI6A 3GWOA 3G71V 4WFFA 5L3BA 1GM7A 3ASNB 3T1CA 5CBHA 4GT1A 4JTAB 5LGNA 1S77D 3KG2A 1GK9A 4P9PA 1B6QA 1IXMA 1YJWV 2HJFC 3AG1C 1F4NA 4QJFB 3E8HA 4N21A 4PA7A 2NLJC 1K34A 3FYEB 4GX5A 2IJJA 1MG1A 1QLNA 3AG1B 4JAUA 5L3FA 3K79A 3AG3B 2EJRA 3CD6V 4JPRA 5HFMA 4QE7A 1OCZC 3ZRSA 3I55V 1GO3F 2OT5A 3W7UA 1W2BU 1YI2V 2YEVA 3ZRWA 2AHYA 1CPYA 1XL6A 1JX9A 4WFBV 1FS0G 1K4CC 1OCZB 3SJQC 3X2QB 2ATKC 5EBLC 3E83A 2YSUB 4MTXA 4U7OA 3G6EV 1OCRC 1YTFB 1ENVA 1S3JA 1GKFA 1K7DA 1BL8A 4DXWA 3CCVV 4FJCC 3MHSC 1G8MA 2EINC 4XDLA 1K33A 2QEXV 1KP2A 1UJWB 3CPWU 4R7CA 3OR7C 1THZA 4Q20A 2B1GA 1OCRB 4UVCA 3OEHG 3OW2U 5LGTA 2EINB 2LFRA 3OMIB 2X0LA 3SYOA 1AJQA 4FK5C 2EBOA 4G28B 4QE9A 4QIWF 4UXNA 5H9CA 4G27B 3ABLB 3RVYA 3RBZA 2BOCC 2FTKA 1XL4A 1FXKA 1PD3A 1K5QA 4RQEA 4BAYA 2C2AA 1AJNA 5CBGA 1K8AW 1AI7A 1NKDA 4X89A 4UVAA 3IC7A 1ZWIC 1Y4MA 3H01A 3TK1A 2EILC 1NBMG 4DO2A 4RQFA 4PELA 1E79G 2WLIA 2P67A 3CCLV 3QO7A 1Y66A 2Y69C 3OGCC 2EILB 4H37A 2IW5A 5CMUA 4FMTA 4L87A 1QLEC 5KA6A 4LP8A 5EC1C 2IJKA 1S0VA 4QPJA 1AROP 1SZTA 5HFLA 2A79B 1YSCA 1AI4A 3E89A 3ZMSA 2V7QG 4MTFA 2EZPA 4MVRA 2Y69B 1PL0A 3ETDA 5KA5A 3W7TA 3RVZA 5IDJA 1QLEB 2B1IA 1QBZA 4BW5A 4R50A 4Z1MG 2F43G 3F7YC 2H8PC 2ZXWC 3ETEA 3STZC 5LBQA 3SPHA 1EBOA 1JCHA 4EKWA 2WLKA 3K0DA 1QCEA 2X7RB 3CYOA 1K4DC 1WPXA 2BOBC 3FYIB 2ZXWB 2QA4V 1NVPD 1VQOV 4ZKIA 3G4SV 1I5XA 4MTOA 1ORQC 2WLLB 1P7BA 3B77A 2D3OW 1VQMV 2XOKG 4R8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RPO A;  1B6Q A;  1GMG A;  1GTO A;  1RPR A;  4DO2 A;  1ROP A;  2IJH A;  2IJI A;  3K79 A;  1F4M A;  2IJK A;  1PD3 A;  2GHY A;  2IJJ A;  1F4N A;  1NKD A; 
#chains in the Genus database with same CATH topology
 1PNM A;  3G80 A;  1OCO C;  5EC2 C;  3CRQ A;  1HNX B;  3RYH A;  1GM9 A;  2R70 A;  1FFX B;  5FLX N;  1O9H A;  3QO5 A;  4ZOL B;  3UM7 A;  3K04 A;  4TT3 G;  2HVJ C;  1OCO B;  3TXS A;  3ZHS A;  2EIK C;  2WA4 A;  4IIJ A;  2QE7 G;  1V9P A;  2EIK B;  2FYU H;  3JD1 A;  1Q6H A;  4WFG A;  5IWA B;  2Q73 A;  1KUQ A;  4LH6 A;  3OM3 B;  1V55 C;  2UXB B;  4HAM A;  3NXS A;  1NT2 B;  2PYL A;  3HKE B;  4TV9 A;  3HR0 A;  4NKG B;  4UB8 Z;  4WFH A;  1IVS A;  5KLV H;  1V55 B;  2YXL A;  3BPZ A;  4LR3 A;  3A0B Z;  4YHH B;  2GTA A;  4WBN A;  2BE3 A;  3CX5 F;  4LWS B;  1I0H A;  1EFR G;  1QR8 A;  1PP9 H;  1YDX A;  2VQE O;  1RM1 B;  4JI0 O;  4BW9 A;  3ZMV A;  1GN6 A;  1M56 C;  4I5S A;  4MW8 A;  1YEW A;  1GM8 A;  3ABK B;  4KHP O;  4PJ0 Z;  1WAZ A;  1MZF A;  5B1B C;  4JZ2 A;  1Q81 W;  3JAK A;  1M56 B;  1AIL A;  1SQQ H;  4LFC B;  4B7K A;  3ZCC A;  3FKS G;  1MOF A;  4IL6 Z;  3K5O A;  1L1F A;  1VIB A;  5B1B B;  4N23 A;  4NTW A;  4CH5 A;  2Q7G A;  4WFE A;  3K3W A;  3WFV A;  5J2U A;  4OXS A;  3OMA B;  1WA8 A;  2EUL A;  2JJ1 G;  4FLT A;  1ZLZ A;  4CZZ A;  1AI5 A;  4DR5 O;  4JI3 B;  1S72 V;  1N33 O;  2Q6A A;  2JEU A;  2IU3 A;  4TOI A;  1IBL O;  5GTH Z;  5KUM A;  4JYA B;  2JK5 C;  1M5I A;  1GRJ A;  2DN9 A;  3RT3 C;  2P4K A;  3OD4 A;  2FL4 A;  3DC6 A;  2Q0A A;  3K59 A;  4O2A A;  3SPC A;  1AB3 A;  3JCU Z;  5FPO A;  4DV6 B;  3LNM B;  3FAV B;  4WF9 V;  3E2E A;  2DYS C;  5LHI A;  5BR8 O;  2XAJ A;  3WG7 C;  1SES A;  1VF7 A;  2DYS B;  3OTF A;  4EFB A;  3E8B A;  1SET A;  3BAA A;  1KC8 W;  4JI6 O;  3WG7 B;  1Z5W A;  2W6J G;  4ZI7 A;  1VQL V;  5C8Y B;  1TAE A;  5H6Q A;  2QTO A;  4JTD B;  2DW4 A;  1NVP B;  1U97 A;  4K3A A;  3TCU A;  2D2C B;  3CC2 V;  1VF6 C;  1FFX A;  1YJN V;  2YEV B;  3ZRW B;  1Q8I A;  1KQS U;  4ZOL A;  1XNR O;  4OX9 O;  1FKA O;  2LP7 A;  4PDM A;  1N4C A;  5FPR A;  3SGI A;  1XMQ B;  1YTF D;  2MW2 B;  2K1E A;  2DJV A;  3K9A A;  4LF5 B;  4LF7 O;  3B4S A;  3JSN A;  2HR3 A;  3T1Y O;  3ETG A;  1YF2 A;  2OCC C;  4DR7 B;  1E1Q G;  1ROP A;  1Q90 D;  4OPA A;  5H6R A;  4XBF A;  2Y0I A;  4LF8 O;  3JD4 A;  3CCE V;  4NXN B;  2YXH A;  4WFA V;  1Q7Y W;  3HKE A;  4JV5 O;  1BCC H;  4MVM A;  4FLU A;  1IZ3 A;  5AG2 A;  2A06 H;  1BT8 A;  2R72 A;  3CSX A;  4QPK A;  1YXB A;  1PNL A;  1IDS A;  4LWS A;  4PDR A;  3OE7 G;  1W0K G;  2Y0P A;  1XMO O;  4GLX A;  1P84 F;  3K9S A;  1H2N A;  3D36 A;  2P22 C;  1K9M W;  1NH2 B;  4CS3 A;  2QWQ B;  2WLJ A;  2X6C A;  3Q4H A;  5KUK A;  2AGA A;  1F7Y A;  4JTC B;  3SYA A;  2DQ3 A;  4AIL C;  1XRE A;  5EBM C;  2XTA A;  2YXY A;  1XI1 A;  2YIB D;  3W7X A;  3ETQ A;  3OAA G;  4B3M B;  4PDL A;  1OJH A;  3SJC C;  4R6Z A;  2Q7E A;  3CRA A;  1PNK A;  1XNQ B;  4JAV A;  3RGB A;  1HWY A;  1WP8 A;  2E5L B;  3HKC B;  1QVF U;  2ZNJ A;  2WPD G;  3ZRV A;  4MVQ A;  3S3W A;  2HKO A;  4UV8 A;  4ZHQ B;  5KHH A;  5LXT B;  1Y74 B;  1K97 A;  3QNE A;  4U3J B;  2HG5 C;  4JI5 B;  3E86 A;  2CUG A;  2DQ0 A;  1J5E O;  3FAV A;  5FL7 G;  1WLE A;  3UKM A;  3QG5 A;  1G1X B;  4WFF A;  1GM7 A;  4GT1 A;  5IYZ B;  1BGY H;  1B6Q A;  2P4V A;  4EB6 B;  3AG1 C;  1JA8 A;  1SF9 A;  3FX7 A;  5IE9 A;  4N21 A;  2F93 B;  2FB5 A;  2UU9 O;  1K34 A;  4C7U A;  3AG1 B;  3WB2 A;  3K79 A;  1PL4 A;  2QWR B;  4Z1V A;  4JPR A;  2QWP B;  2ARH A;  2YEV A;  3ZRW A;  5JH7 B;  2AHY A;  2UUA B;  1B04 A;  5EYP B;  4WFB V;  4B3T B;  3SJQ C;  3E83 A;  4DW1 A;  1AR4 A;  1VF6 A;  1GKF A;  1BL8 A;  1K7D A;  4DXW A;  4XDL A;  3UO2 A;  1K33 A;  1KP2 A;  4K8X A;  4R7C A;  3OR7 C;  3ZX6 A;  4X64 O;  2B1G A;  2UUB O;  3CS5 A;  5JCO C;  1WB7 A;  4UVC A;  3U10 A;  4G28 B;  1YVW A;  4QE9 A;  1EZV H;  2N74 A;  2QSA A;  3ABL B;  2Q9L A;  1XL4 A;  3WB1 A;  3WB0 A;  5CBG A;  1K8A W;  5A2Q N;  4FLZ A;  3CE2 A;  3H01 A;  1Q6I A;  3LNN A;  4RQF A;  5F2V O;  4PEL A;  5ITZ B;  1HNW O;  1VAR A;  3CCL V;  3QO7 A;  1Y66 A;  2IW5 A;  1M93 A;  5KA6 A;  2F95 B;  1S0V A;  4QPJ A;  1SZT A;  2EZP A;  2Q7H A;  2ZIO A;  3ETD A;  4MVR A;  2B1I A;  4LFA B;  2N04 A;  2F43 G;  4FVM A;  3ETE A;  3STZ C;  2JGU A;  1JCH A;  3K0D A;  2VWK A;  4DV1 O;  2A7W A;  1BQZ A;  4I4T B;  1B06 A;  2BOB C;  3M8A A;  2W0X A;  2VQF O;  2DE0 X;  1VQO V;  1QQC A;  1H2M A;  2D3O W;  2XOK G;  4R8C A;  1QHT A;  3ASN C;  4RUF A;  2ZNI A;  4B7E A;  2GTS A;  4X1I B;  3SYC A;  4X8A A;  1G6U A;  3B2E E;  4E4E A;  2UXC B;  3ZS8 C;  1P4R A;  5LHH A;  3THO A;  1Q6U A;  4FLY A;  3BFR A;  3CRC A;  5KAI Z;  5H2F Z;  2LGQ A;  1NZ6 A;  2PI5 A;  2CAZ C;  3BA9 A;  4LH7 A;  3LSS A;  4ZHQ A;  3IAY A;  5LXT A;  3K57 A;  3AG3 C;  1Y74 A;  5KHG A;  1M4U A;  4JI4 B;  1GH6 A;  1H2G A;  1VQ9 V;  2HJD A;  1Q3E A;  4TQD A;  1HP8 A;  4Q6G A;  1JVM A;  1NR7 A;  4KL1 A;  1Q82 W;  4X9Q A;  3X2Q C;  2JDI G;  4JI7 O;  5IYZ A;  2QWO B;  2XND G;  4WCE V;  3IFX A;  1PV0 A;  1N36 O;  4EB6 A;  3E35 A;  1DTO A;  1OCC B;  3JAM N;  3CCQ V;  2YI8 A;  2CH7 B;  4NXM O;  2FML A;  2YI9 A;  4F4L A;  2ADQ B;  4NYK A;  1GTO A;  1ZAU A;  4GX2 A;  3F5W C;  3K08 A;  3RYF A;  2P06 A;  5EIB C;  1R3L C;  1IBM B;  1MSD A;  1KD1 W;  2XAF A;  1AVM A;  1SQV H;  1Q43 A;  3H9V A;  2XAQ A;  4U7N A;  2E3C A;  5LA6 B;  2HEP A;  1EN6 A;  4LF9 O;  3FB7 C;  1EZJ A;  5JH7 A;  1BHB A;  4PA3 A;  5EYP A;  4BIZ A;  3CWB H;  4PI2 A;  4RAI A;  1XDC A;  3ZHR A;  3ZHU A;  2BTO A;  4GKK O;  4F6R B;  1OV9 A;  1WN7 A;  2NR5 A;  4MW3 A;  1WPB A;  3VQW A;  2VQE B;  1HNZ O;  4JI0 B;  2ZQM A;  2KSD A;  5JQG B;  2X6A A;  3T4Z A;  1EN4 A;  4KHP B;  3SR2 C;  5JCO A;  1CP9 A;  3OFN G;  5JJJ B;  1H38 A;  4MSW C;  3I5D A;  3MHH C;  1Q86 W;  4H33 A;  2HP8 A;  3JCZ A;  3K0G A;  1M9N A;  4HYO A;  4UCT A;  5LOV B;  4AQY O;  3N2K B;  2B9Z A;  3P30 A;  5B1N A;  3RW0 A;  3UO3 A;  3M7M X;  1Q5O A;  5B1A B;  4GX1 A;  3TGU H;  2AZ2 A;  3FB8 C;  4DR5 B;  3EFF K;  1RP3 B;  2EJ7 A;  1IBL B;  2R9A A;  1G4Y B;  5KHI A;  3AG4 C;  2AHZ A;  3PN1 A;  3A0R A;  3FD9 A;  2YS8 A;  3R66 A;  2IU0 A;  4OGQ B;  3AG4 B;  3QO8 A;  2WWW A;  2ZCE A;  2B5U A;  2OTL V;  1VQ8 V;  3SPI A;  5E79 Z;  4I4T A;  3ZMT A;  3ML0 A;  4NR1 A;  1MSW D;  2ITD C;  1IBK O;  1AJP A;  2IJH A;  3JD0 A;  3MDS A;  1NJI W;  4NTX A;  3OR6 C;  4I55 B;  4X1I A;  4X1K B;  1TUE B;  2QWN B;  5CA0 B;  5K1X A;  4GZR B;  1RPR A;  3AG7 A;  1NQT A;  2LW7 A;  4JI6 B;  2RCV A;  3MD0 A;  2H3O A;  2BCC H;  5GW7 A;  1YJ9 V;  3ZMZ A;  1JR9 A;  4JI2 O;  1NR1 A;  5B66 Z;  1RM1 C;  2QGN A;  5EZY B;  2ODM A;  3D36 C;  4G2K A;  4QGP A;  4LCU C;  1FXK C;  5DN6 G;  3ABK C;  1I94 O;  4IYH A;  4AHC A;  1XNR B;  4OX9 B;  5DM6 V;  1VQ6 V;  5IYD O;  5D5P A;  1FXK B;  1BSM A;  2XAS A;  3OEE G;  4KFM A;  4J9Z B;  2A0L A;  1KKD A;  2QKS A;  1IX9 A;  3CC4 V;  4LF7 B;  3LSQ A;  3T1H O;  4KP4 A;  3T1Y B;  1MAB G;  2CH7 A;  1XBL A;  3EHB B;  3ICX A;  5GON A;  3OMN B;  4MT8 A;  1FXH A;  3CME V;  3W7W A;  4TQF A;  1WNS A;  1J95 A;  4JV5 B;  2KQX A;  3R65 A;  2AXT Z;  1UPG A;  1XOU A;  1R3J C;  5LA6 A;  1RSO B;  4NTY A;  2RDC A;  1Y6X A;  4TV8 B;  4O4L B;  2QM7 A;  4YJ3 B;  1N34 O;  2UUC O;  4UUJ C;  4F6R A;  3RYC B;  4EFE A;  1YCI A;  1XMO B;  5JQG A;  1JFF B;  3BHP A;  1KP3 A;  4FFB B;  2GSM B;  3JAL B;  4BWA A;  3H1J H;  1JPX A;  1ZSP A;  2BTQ A;  1NTK H;  3MAQ A;  3LDC A;  3HKD B;  4IGG A;  4KXR A;  4L8J A;  4CH3 A;  4DR1 O;  3JAR B;  2HVK C;  3B09 A;  2RMK B;  1S5H C;  1Z5V A;  1BHA A;  1VQP V;  4DR6 B;  4RWU A;  2CK3 G;  1KEC A;  2Q68 A;  4P30 A;  1VQN V;  1S5L Z;  5L3D A;  1TGO A;  1XHX A;  3D3Q A;  1ZTE A;  3G71 V;  5CBH A;  4JTA B;  5LGN A;  4DUZ O;  1P7G A;  4UCV A;  4DV5 O;  1IXM A;  3E8H A;  2CE4 A;  2YIA A;  3ZHV A;  3UQ8 A;  1PM9 A;  1MG1 A;  1QLN A;  1J5E B;  4B3R O;  2EJR A;  3CD6 V;  5HFM A;  4O2B B;  3U11 A;  1OCZ C;  3W7U A;  4I55 A;  1W2B U;  4X1K A;  1YI2 V;  2ZT9 B;  3L9D A;  2F66 C;  3AK2 A;  1XL6 A;  5CA0 A;  4AI8 A;  4D7T A;  1K4C C;  1OCZ B;  5EBL C;  3KCY A;  1YTF B;  4DV3 B;  1ENV A;  2UU9 B;  3CCV V;  3MHS C;  2BSK B;  1FD9 A;  4ICG A;  1UJW B;  3AK1 A;  4CH6 A;  4LF4 O;  5EZY A;  2NN4 A;  4UCS A;  2LFR A;  3A8T A;  3SYO A;  3BVO A;  4PHZ A;  4QIW F;  3B40 A;  1ZL8 B;  3RVY A;  2BOC C;  2YID A;  1FXK A;  4ZIB A;  5CB4 B;  4UVA A;  1B3Q A;  3IC7 A;  2FKX A;  4I0X B;  4W4K A;  1ZWI C;  4K8Z A;  3TK1 A;  4DR2 O;  4X62 O;  2EIL C;  1NBM G;  4X64 B;  2UUB B;  1XUQ A;  3GWK C;  3D8C A;  1JMK C;  3APO A;  4H37 A;  1HW7 A;  2EIL B;  4CS2 A;  4FMT A;  1QLE C;  5EC1 C;  2IJK A;  5HFL A;  1TUB B;  2A79 B;  3E89 A;  4CC5 A;  4MTF A;  5KA5 A;  5LP6 B;  3W7T A;  1N32 O;  3RVZ A;  1FJG B;  1QLE B;  4BW5 A;  1RSO A;  4R50 A;  4Z1M G;  3P3N A;  1SQG A;  2H8P C;  4CH4 A;  2ZXW C;  4O4L A;  3HKB B;  4TV8 A;  3SPH A;  4YJ3 A;  3ZHT A;  1EBO A;  4EKW A;  2PTM A;  1R6T A;  2X7R B;  1K4D C;  2CDY A;  1HNW B;  1WPX A;  3RYC A;  3FYI B;  2ZXW B;  2QA4 V;  4ZKI A;  1XIL A;  1I5X A;  3G4S V;  1ZUQ A;  3L75 H;  4X65 O;  4YIP A;  5L3G A;  1JFF A;  2ZE5 A;  4K0K O;  4FFB A;  5JVD B;  3JAL A;  3ZJZ A;  4LNU B;  3LSU A;  2JJ2 G;  1PPJ H;  4RO2 A;  2LW1 A;  3HKD A;  4FZ1 A;  1V54 C;  2Z5U A;  4X20 B;  1H2L A;  2ZE6 A;  3RYI B;  3BCC H;  4FPP A;  2A3Q A;  3JAR A;  3CP1 A;  4DV1 B;  2ZM6 O;  1V54 B;  2JRI A;  2VQF B;  5C8Y A;  1BE3 H;  2UXD O;  2Q67 A;  1K73 W;  5L3C A;  3KZI Z;  1KB9 F;  4FM2 A;  4X88 A;  4LC1 A;  1P49 A;  2JS5 A;  3AG2 B;  2GDS A;  1F51 A;  1SER A;  2QKA A;  3DC5 A;  4TUY B;  3K5N A;  1R6N A;  3VOU A;  3ZMU A;  3DTU B;  2NNU A;  1O9G A;  2O57 A;  2R9R B;  3SYP A;  4HNA B;  1MZE A;  3CCM V;  1R6K A;  1SQB H;  2OCH A;  4NB5 A;  3KCX A;  1N8R W;  3E22 B;  4JYC A;  3CRR A;  4QNH B;  3H1H H;  3ABL C;  4O2B A;  4PI0 A;  2JGD B;  1YHQ V;  3W7S A;  3OTO O;  4JYB A;  4JI7 B;  1L0L H;  2VRZ A;  2OYQ A;  1H8E G;  2Q0O C;  3CCJ V;  5IJ9 B;  4JI8 O;  4D7S A;  4NXM B;  2ZDI C;  1QVG U;  2N05 A;  2BSK A;  3HPL C;  5LMU O;  2EX3 A;  5KHK A;  2WLI B;  1KMI Z;  4GUN A;  5DEC A;  2P7T C;  4UFZ A;  4DRX B;  1S76 D;  1K3E A;  3SPJ A;  5LYJ B;  1IXB A;  4UCO A;  2MK3 A;  1XNQ O;  3C90 A;  1N0J A;  2QJ1 A;  4LF9 B;  2OTJ V;  1ZL8 A;  1I7F A;  1JOY A;  4PV1 B;  4PA6 A;  2OIG A;  2WLN A;  4J10 A;  2XUM A;  1BS3 A;  4I0X A;  2KB1 A;  2EIJ C;  5J2T B;  3VQV A;  3APQ A;  2LQT A;  2QDO A;  1JJO A;  3CJH B;  2YUA A;  1DF4 A;  2JIZ G;  4DUY O;  1HNZ B;  2EIJ B;  1COW G;  1R3K C;  2X6B A;  3TXQ A;  4B3S O;  4XDK A;  4O4I B;  4MVO A;  4RUE A;  3JD2 A;  2L6L A;  1RPO A;  1TUB A;  5LP6 A;  1GN2 A;  1CEZ A;  1FAF A;  2QTS A;  5IYC O;  4DW0 A;  3GB7 C;  4HZ3 A;  1R1B A;  5B3S B;  4X66 O;  2ZKO A;  2LFS A;  3HKC A;  3HKB A;  4AQY B;  1M57 C;  4GYC B;  2GUZ B;  1H8H G;  1SRY A;  1QU7 A;  3SJB C;  5H5N A;  5LHG A;  2XAG A;  2F4V O;  4OPH A;  1WJZ A;  2RQ6 A;  1LUV A;  2G38 A;  1Y67 A;  3DGE A;  4MVU A;  1M57 B;  1VQK V;  4PD4 F;  1W0J G;  1D5A A;  3KKY A;  4U3J A;  2YIB A;  5IJ0 B;  2Q5Z A;  2PYJ A;  5JVD A;  2IH1 C;  4YXW G;  4LNU A;  4DV2 O;  5LGU A;  1OCC C;  2PF4 E;  3CRM A;  2QM8 A;  3LUT B;  3ZN0 A;  4X20 A;  2JVD A;  4JAA A;  3RYI A;  1FFT B;  2F1M A;  3CC7 V;  2IH3 C;  3U0Z A;  1SC5 B;  1QNM A;  2H94 A;  1BQ0 A;  3BRC A;  2XHB A;  4UV9 A;  1IBK B;  4LF6 O;  4DYL A;  3RN4 A;  3JD3 A;  3F7V C;  4W4L A;  2Y48 A;  3H1I H;  1QR9 A;  1AP5 A;  4LBE C;  3AK3 A;  5KMG B;  2GHY A;  2HFE C;  4B08 A;  4P9O A;  3IGA C;  1YIT V;  4TUY A;  4DV4 O;  1GN3 A;  3ABT A;  1E1R G;  1WP7 A;  4BIO A;  4NVP A;  4FM1 A;  4HNA A;  3CXC U;  3JSL A;  3LDE A;  2P6J A;  4U3F H;  3ZIA G;  1SA0 B;  1X59 A;  4JI1 O;  1I94 B;  3E22 A;  2WAM A;  1VQ5 V;  2WLH A;  2JGD A;  2VS0 A;  2HHH O;  2Y4T A;  1HR0 O;  1AR5 A;  2P90 A;  5E1A C;  2ILM A;  5IJ9 A;  5B1A C;  1SZX A;  1LNQ A;  5LMN O;  1HDJ A;  1LR1 A;  3OUF A;  5ITZ A;  4DRX A;  3DXR B;  2ZDI A;  5LYJ A;  3E8F A;  1N33 B;  4H13 B;  1I5Y A;  4BIU A;  5TIS Z;  3JYC A;  1VP7 A;  2PI4 A;  4DR4 O;  1FXV A;  3K03 A;  1L8D A;  3AEI A;  1URF A;  4UB6 Z;  3RFR A;  1M1K W;  1N34 B;  4LFB O;  4J11 A;  2UUC B;  5J2T A;  5CN0 A;  4DV0 O;  3CJH A;  3OUS A;  4DV7 O;  4DR3 O;  3FB5 C;  5K1P A;  4O4I A;  3JAS B;  3B8N A;  5BR8 B;  5L3B A;  4IYI A;  1S77 D;  1H2K A;  3KG2 A;  3IC9 A;  1GK9 A;  4DR1 B;  3ZED A;  1F4N A;  4QJF B;  3JAT B;  2KG7 B;  4PA7 A;  3G6B A;  2GUZ A;  1SQP H;  3FYE B;  4GX5 A;  2IJJ A;  2RNB A;  4JAU A;  5L3F A;  1IBM O;  4GKJ O;  2PY5 A;  2KKW A;  5IJ0 A;  3ZRS A;  4J80 A;  2OT5 A;  4DUZ B;  1CPY A;  1JX9 A;  4DV5 B;  1FS0 G;  2ATK C;  3EXA A;  4MTX A;  2YSU B;  3G6E V;  3K5L A;  1OCR C;  4FJC C;  1G8M A;  1CXZ B;  3CPW U;  4JZG A;  1THZ A;  1OCR B;  4B3R B;  2E75 B;  2LJ2 A;  2OWO A;  3OEH G;  3OW2 U;  1EN5 A;  4LF8 B;  1AJQ A;  1I08 A;  1D5N A;  4UXN A;  5H9C A;  4YY3 O;  3RWR D;  3Q4H B;  1ZX3 A;  3RBZ A;  1PD3 A;  5KMG A;  4RQE A;  4BAY A;  4IHJ B;  3WU2 Z;  4X89 A;  2QR4 A;  1N0N A;  2WA3 A;  4I7Z B;  5A9G A;  4DO2 A;  2AZ0 A;  4LF4 B;  2M6Y A;  1E79 G;  2Z0A A;  3C3T A;  2P67 A;  1XHZ A;  1AP6 A;  3OGC C;  5BY1 A;  1SA0 A;  3OGI B;  4L87 A;  5BMV B;  3C3S A;  4LP8 A;  5KAF Z;  2LGW A;  3ZMS A;  1DK1 A;  5DED A;  2V7Q G;  1HNX O;  1PL0 A;  2CTW A;  5IDJ A;  4FLV A;  3CEI A;  4YIO A;  5BXZ A;  4Z2W A;  4DR2 B;  4X62 B;  2Y4U A;  1KBH A;  5LOV A;  3N2K A;  3H1L H;  1NVP D;  4EEQ A;  5IWA O;  2F23 A;  2WLL B;  1P7B A;  3DXR A;  1T5E A;  1VQM V;  4O4H B;  5J9P C;  2UXB O;  4FFK A;  5EK0 A;  1N32 B;  5CA1 B;  2E76 B;  2A9H A;  3QVN A;  1SKV A;  2R9I A;  4J9Y B;  3CCR V;  4CS4 A;  3VQX A;  1TVK B;  3SPG A;  4FM0 A;  1IUR A;  1OZ0 A;  4YHH O;  1R73 A;  2UXN A;  5CA3 A;  4X65 B;  4GX0 A;  3JAS A;  4H44 B;  3EVK A;  4K0K B;  3N27 A;  4XDJ A;  3TET A;  3QTC A;  1SQF A;  1AR1 B;  3O9O A;  1BMF G;  3ASO C;  2ZE8 A;  3GVM A;  3F5T A;  4MVS A;  1JQ0 A;  4LFC O;  2Z3Y A;  3ASO B;  3JAT A;  2KG7 A;  3LDD A;  2ZM6 B;  1LUW A;  2UXD B;  1NS1 A;  2RN9 A;  4ABM A;  4TWK A;  2OCC B;  4HBN A;  3L73 H;  3N2G B;  3ZBH A;  4JI3 O;  2PGG A;  4F6E A;  1NH2 D;  5LL6 Y;  3CHX A;  4O4J B;  2IJI A;  4JYA O;  3J81 N;  5B5E Z;  4PA9 A;  2L35 A;  2M7W A;  1EM1 A;  4JF3 A;  4BR6 A;  1K92 A;  4JGS A;  4J7Z A;  1SQX H;  5IT9 N;  4JAS A;  1MA1 A;  3O65 A;  3HB3 B;  3M99 B;  3S3X A;  2XT9 A;  5LP6 C;  4DV6 O;  1GAX A;  1Y76 B;  3FB6 C;  1GN4 A;  3OTO B;  4MTG A;  2V1D A;  3QF7 A;  5D5Q A;  3ABM C;  4I9W A;  3BA8 A;  4IHJ A;  3CXH F;  4JI8 B;  4TSF G;  3ABM B;  5LMU B;  2XAH A;  1SS3 A;  1H2S B;  4X1Y B;  2EZO A;  4CBC A;  3CCS V;  4DR6 O;  2YDE A;  3D3I A;  3UT5 B;  5BMV A;  2W0F C;  5IY5 C;  4ZBM A;  2DWD C;  2DMX A;  3P32 A;  2OIE A;  1GMG A;  1VEW A;  5IY5 B;  3BY6 A;  1Z2G A;  5IYB O;  1XMQ O;  2QKC A;  2CTR A;  4FLX A;  1A32 A;  2GBO A;  4LF5 O;  1US6 A;  2DYR C;  4DK1 A;  2ADP A;  4DUY B;  5L3E A;  4ASU G;  2JEX A;  4DR7 O;  4B3S B;  2ZR3 A;  3H1K H;  3B8M A;  2RJZ A;  3L70 H;  4P2Z A;  2DYR B;  2WLL A;  1XQ8 A;  4O4H A;  1NTM H;  3AG2 C;  3CCU V;  4MVZ A;  4NXN O;  4FLW A;  4GCZ A;  1JJ2 U;  3JAW B;  5CA1 A;  3L72 H;  4J7J A;  4X66 B;  1F23 A;  4YJ2 B;  3ABU A;  1U96 A;  4DV3 O;  2LO1 A;  1YIJ V;  1M90 W;  4FZ0 A;  1KU9 A;  1TVK A;  1PKX A;  2F4V B;  3L71 H;  3RYF B;  4UCR A;  1BZK A;  2CTP A;  3STL C;  3G67 A;  5CBF A;  2EIM C;  3CB2 A;  2UXX A;  1F4M A;  4H0L B;  1OHH G;  1VMG A;  1VQ4 V;  3OT7 A;  4DV2 B;  2EIM B;  5FNV B;  4D6T H;  3PJS K;  4K35 A;  1W59 A;  2HLD G;  3L74 H;  5B1O A;  1N36 B;  4CC6 A;  4J42 A;  1DF5 A;  1DGS A;  3CMA V;  4MS2 A;  1FYJ A;  4LF6 B;  2ITC C;  3ZN1 A;  3BEH A;  2ZR2 A;  3ZRX A;  3FFQ A;  2DWE C;  2WSS G;  4UVB A;  4B3M O;  3N2G A;  4E2L A;  3T4D A;  5JJN B;  1L0N H;  1FJG O;  4O4J A;  2K9P A;  1MNG A;  2GV9 A;  1VF5 B;  4FIP C;  3VBB A;  2E5L O;  1X4T A;  1UFI A;  3IJ4 A;  4DV4 B;  4I50 B;  3ZHQ A;  5CB4 A;  4PDV A;  2WLM A;  4GKK B;  3E8G A;  3SDL A;  2ZD9 A;  1NTZ H;  1K5S A;  5BZB A;  5JWP A;  4JI1 B;  1FPO A;  4JI5 O;  3SJA C;  2Q4P A;  4I9Q A;  5KX5 B;  1DLB A;  2Q69 A;  1Y76 A;  3RYH B;  5B3S C;  3VQY A;  5C93 A;  3I56 V;  3DSQ A;  2HHH B;  1HR0 B;  1KYO F;  3SYQ A;  4PA4 A;  1NI8 A;  2IBZ H;  4IIJ B;  3T2M A;  1VQ7 V;  5LMN B;  1R3I C;  4X1Y A;  2W6I G;  3K06 A;  4KUM A;  4UCU A;  3UT5 A;  5EBW C;  4TV9 B;  5KHJ A;  1AI6 A;  3GWO A;  2ETN A;  3ASN B;  3T1C A;  4DR4 B;  4P9P A;  2ZIN A;  4J7K A;  3K5M A;  2UUA O;  4A5U B;  4B3T O;  4LFB B;  4IT5 A;  2HJF C;  1YJW V;  2QM4 A;  4WBN B;  4DV0 B;  2NLJ C;  4DV7 B;  3J80 N;  4DR3 B;  2PUS A;  3AG3 B;  4QE7 A;  5EIB D;  5GTI Z;  3I55 V;  1GO3 F;  3JAW A;  3JAK B;  4YJ2 A;  4J41 A;  3X2Q B;  4U7O A;  4JYY A;  5JJE B;  1S3J A;  2QEX V;  2EIN C;  4DK0 A;  5GON B;  4JI2 B;  2IM9 A;  4Q20 A;  1XEQ A;  2P5O A;  5J2U B;  4GKJ B;  1WA8 B;  2CGO A;  5LGT A;  2EIN B;  2ZE7 A;  3OMI B;  2X0L A;  2E74 B;  4FK5 C;  2EBO A;  4G27 B;  2JS3 A;  5FNV A;  2FTK A;  1K5Q A;  2C2A A;  1AJN A;  2Q8V A;  1AI7 A;  1NKD A;  1WB8 A;  4LFA O;  1YZB A;  3K58 A;  3UCS C;  1Y4M A;  3T1H B;  2V4D A;  4O2A B;  3TJT A;  1RFY A;  2AW9 A;  3NR7 A;  2WLI A;  2Y69 C;  5CMU A;  2YIC A;  3A0H Z;  3J7A U;  1MMM A;  1ARO P;  1S5J A;  1YSC A;  1AI4 A;  2YC0 A;  4YY3 B;  2CGN A;  1D2D A;  2BTQ B;  2Y69 B;  1QBZ A;  1KKC A;  1NU1 H;  2UXC O;  3F7Y C;  5LBQ A;  2VWJ A;  2CTQ A;  4I50 A;  4ZI7 B;  2WLK A;  2ZIM A;  2PZS A;  1QCE A;  3CYO A;  3P3P A;  2DOS A;  4MTO A;  4JI4 O;  3BAB A;  1ORQ C;  3A2F A;  3B77 A;  5KX5 A;  1TA8 A; 
#chains in the Genus database with same CATH homology
 1PNM A;  3ASN C;  1OCO C;  5EC2 C;  4RUF A;  5J9P C;  5L3G A;  3SYC A;  5EK0 A;  1GM9 A;  3ZJZ A;  4X8A A;  3QO5 A;  3UM7 A;  2JJ2 G;  2A9H A;  1P4R A;  3K04 A;  4RO2 A;  5LHH A;  4TT3 G;  2HVJ C;  1OCO B;  2R9I A;  4J9Y B;  1V54 C;  2Z5U A;  3CCR V;  2EIK C;  4FPP A;  3SPG A;  2PI5 A;  3CP1 A;  1OZ0 A;  2QE7 G;  3LSS A;  1R73 A;  3AG3 C;  2UXN A;  1V54 B;  5CA3 A;  2EIK B;  3JD1 A;  4WFG A;  2Q67 A;  1K73 W;  1H2G A;  5L3C A;  1VQ9 V;  4GX0 A;  1JVM A;  1NR7 A;  1V55 C;  3OM3 B;  4HAM A;  3NXS A;  4XDJ A;  3TET A;  4X88 A;  4LC1 A;  1AR1 B;  1Q82 W;  3X2Q C;  2JDI G;  4WFH A;  1BMF G;  3AG2 B;  3ASO C;  1F51 A;  1V55 B;  2XND G;  1SER A;  4WCE V;  4MVS A;  3IFX A;  1JQ0 A;  3E35 A;  1R6N A;  1DTO A;  3VOU A;  3ZMU A;  1OCC B;  2Z3Y A;  3ASO B;  3DTU B;  2NNU A;  2R9R B;  3SYP A;  3CCQ V;  3LDD A;  4F4L A;  1GTO A;  1EFR G;  3CCM V;  1QR8 A;  1R6K A;  4GX2 A;  3F5W C;  4TWK A;  3K08 A;  1R3L C;  1N8R W;  1RM1 B;  2OCC B;  4JYC A;  4QNH B;  3ZMV A;  3ABL C;  1NH2 D;  1M56 C;  1KD1 W;  4I5S A;  4MW8 A;  2XAF A;  1YHQ V;  3W7S A;  1GM8 A;  2XAQ A;  3ABK B;  4U7N A;  2IJI A;  4JYB A;  1H8E G;  3FB7 C;  1EZJ A;  4PA9 A;  5B1B C;  1Q81 W;  1BHB A;  4PA3 A;  1M56 B;  4BIZ A;  2M7W A;  3ZCC A;  3FKS G;  3CCJ V;  4JF3 A;  1K92 A;  4JGS A;  1MOF A;  4RAI A;  1L1F A;  2ZDI C;  1QVG U;  3HPL C;  5B1B B;  2WLI B;  4N23 A;  4JAS A;  4WFE A;  4MW3 A;  3K3W A;  3HB3 B;  3WFV A;  2P7T C;  3M99 B;  4OXS A;  3OMA B;  2JJ1 G;  1S76 D;  1K3E A;  3SPJ A;  4CZZ A;  2ZQM A;  1AI5 A;  1S72 V;  2X6A A;  2Q6A A;  3FB6 C;  3T4Z A;  2JEU A;  2IU3 A;  4MTG A;  2MK3 A;  2V1D A;  5KUM A;  1CP9 A;  3ABM C;  3OFN G;  1H38 A;  4MSW C;  2OTJ V;  2JK5 C;  1JOY A;  3MHH C;  1Q86 W;  4I9W A;  4H33 A;  4PA6 A;  2WLN A;  3JCZ A;  3K0G A;  4TSF G;  3ABM B;  2KB1 A;  2EIJ C;  1M9N A;  4HYO A;  2XAH A;  5B1N A;  3P30 A;  1DF4 A;  3RW0 A;  3SPC A;  2EZO A;  2JIZ G;  4CBC A;  5B1A B;  4GX1 A;  2EIJ B;  1COW G;  1R3K C;  3CCS V;  3FB8 C;  2X6B A;  3D3I A;  4XDK A;  3LNM B;  3EFF K;  4WF9 V;  3E2E A;  2W0F C;  2DYS C;  5IY5 C;  4MVO A;  4ZBM A;  4RUE A;  2DWD C;  1G4Y B;  3JD2 A;  1RPO A;  5LHI A;  3AG4 C;  3P32 A;  2XAJ A;  3WG7 C;  1SES A;  1CEZ A;  2AHZ A;  5IYC O;  3A0R A;  1GMG A;  2DYS B;  3GB7 C;  4HZ3 A;  5B3S B;  5IY5 B;  3BY6 A;  3E8B A;  1SET A;  2IU0 A;  1KC8 W;  5IYB O;  3AG4 B;  3QO8 A;  2LFS A;  3WG7 B;  2WWW A;  2W6J G;  1M57 C;  2B5U A;  1VQL V;  2DYR C;  2OTL V;  1H8H G;  1SRY A;  1VQ8 V;  5H6Q A;  2QTO A;  4JTD B;  3SPI A;  5LHG A;  2XAG A;  2DW4 A;  5L3E A;  4ASU G;  3ZMT A;  3ML0 A;  2JEX A;  3DGE A;  1MSW D;  4MVU A;  2ZR3 A;  2ITD C;  1M57 B;  1VQK V;  1NVP B;  3B8M A;  1W0J G;  4P2Z A;  2DYR B;  1AJP A;  2WLL A;  2IJH A;  3JD0 A;  3TCU A;  3CCU V;  3AG2 C;  4MVZ A;  1NJI W;  3OR6 C;  4GCZ A;  1JJ2 U;  3CC2 V;  1TUE B;  2IH1 C;  4YXW G;  1YJN V;  2YEV B;  3ZRW B;  1KQS U;  2LP7 A;  4PDM A;  5LGU A;  1F23 A;  1OCC C;  1RPR A;  1NQT A;  3ABU A;  2QM8 A;  3LUT B;  3ZN0 A;  1YTF D;  3MD0 A;  1YIJ V;  5GW7 A;  1FFT B;  2K1E A;  1YJ9 V;  1M90 W;  3K9A A;  3CC7 V;  3ZMZ A;  2IH3 C;  2HR3 A;  1NR1 A;  1PKX A;  2H94 A;  3ETG A;  1RM1 C;  2OCC C;  1E1Q G;  1ROP A;  4UV9 A;  3STL C;  4G2K A;  5H6R A;  4XBF A;  4LCU C;  2EIM C;  5CBF A;  3JD3 A;  1FXK C;  5DN6 G;  3ABK C;  2UXX A;  3F7V C;  3JD4 A;  1F4M A;  2Y48 A;  3CCE V;  1OHH G;  4WFA V;  1VQ4 V;  1QR9 A;  1Q7Y W;  2EIM B;  5DM6 V;  4LBE C;  1VQ6 V;  4MVM A;  5IYD O;  1FXK B;  3PJS K;  2GHY A;  2XAS A;  2HFE C;  2HLD G;  5B1O A;  3OEE G;  4KFM A;  4J9Z B;  2A0L A;  1KKD A;  2QKS A;  4P9O A;  3IGA C;  1YIT V;  3CC4 V;  3LSQ A;  4KP4 A;  3ABT A;  1DF5 A;  1MAB G;  1E1R G;  4QPK A;  3CMA V;  1PNL A;  4MS2 A;  3EHB B;  3CXC U;  3LDE A;  2ITC C;  3ZN1 A;  4PDR A;  2P6J A;  3OE7 G;  3OMN B;  1W0K G;  3BEH A;  4MT8 A;  2ZR2 A;  3ZIA G;  3ZRX A;  1FXH A;  3CME V;  3W7W A;  2DWE C;  2WAM A;  2WSS G;  1J95 A;  3D36 A;  4UVB A;  4E2L A;  1K9M W;  1VQ5 V;  3T4D A;  2WLH A;  1NH2 B;  3R65 A;  1R3J C;  2WLJ A;  2X6C A;  4FIP C;  2P90 A;  3VBB A;  5KUK A;  5E1A C;  4JTC B;  3SYA A;  2QM7 A;  4PDV A;  5B1A C;  4UUJ C;  2DQ3 A;  2WLM A;  1LNQ A;  5EBM C;  3E8G A;  2ZD9 A;  1K5S A;  5BZB A;  3OUF A;  2ZDI A;  3W7X A;  3OAA G;  1DLB A;  4PDL A;  2Q69 A;  3E8F A;  1KP3 A;  4R6Z A;  2GSM B;  5B3S C;  5C93 A;  1I5Y A;  1PNK A;  3I56 V;  4JAV A;  1JPX A;  4BIU A;  3SYQ A;  1HWY A;  4PA4 A;  3JYC A;  3LDC A;  2PI4 A;  1FXV A;  3K03 A;  3AEI A;  1M1K W;  1QVF U;  2WPD G;  3ZRV A;  4MVQ A;  2HKO A;  3T2M A;  4UV8 A;  2HVK C;  1VQ7 V;  5CN0 A;  1R3I C;  3OUS A;  1S5H C;  2W6I G;  1BHA A;  1K97 A;  3QNE A;  3K06 A;  4KUM A;  1VQP V;  2HG5 C;  3E86 A;  2DQ0 A;  2CK3 G;  1KEC A;  3FB5 C;  2Q68 A;  4P30 A;  5FL7 G;  3B8N A;  1VQN V;  5L3D A;  5EBW C;  1WLE A;  3UKM A;  1AI6 A;  3GWO A;  3G71 V;  4WFF A;  5L3B A;  1GM7 A;  3ASN B;  3T1C A;  5CBH A;  4GT1 A;  4JTA B;  5LGN A;  1S77 D;  3KG2 A;  1GK9 A;  4P9P A;  1B6Q A;  1IXM A;  1YJW V;  2HJF C;  3AG1 C;  1F4N A;  4QJF B;  3E8H A;  4N21 A;  4PA7 A;  2NLJ C;  1K34 A;  3FYE B;  4GX5 A;  2IJJ A;  1MG1 A;  1QLN A;  3AG1 B;  4JAU A;  5L3F A;  3K79 A;  3AG3 B;  2EJR A;  3CD6 V;  4JPR A;  5HFM A;  4QE7 A;  1OCZ C;  3ZRS A;  3I55 V;  1GO3 F;  2OT5 A;  3W7U A;  1W2B U;  1YI2 V;  2YEV A;  3ZRW A;  2AHY A;  1CPY A;  1XL6 A;  1JX9 A;  4WFB V;  1FS0 G;  1K4C C;  1OCZ B;  3SJQ C;  3X2Q B;  2ATK C;  5EBL C;  3E83 A;  2YSU B;  4MTX A;  4U7O A;  3G6E V;  1OCR C;  1YTF B;  1ENV A;  1S3J A;  1GKF A;  1K7D A;  1BL8 A;  4DXW A;  3CCV V;  4FJC C;  3MHS C;  1G8M A;  2EIN C;  4XDL A;  1K33 A;  2QEX V;  1KP2 A;  1UJW B;  3CPW U;  4R7C A;  3OR7 C;  1THZ A;  4Q20 A;  2B1G A;  1OCR B;  4UVC A;  3OEH G;  3OW2 U;  5LGT A;  2EIN B;  2LFR A;  3OMI B;  2X0L A;  3SYO A;  1AJQ A;  4FK5 C;  2EBO A;  4G28 B;  4QE9 A;  4QIW F;  4UXN A;  5H9C A;  4G27 B;  3ABL B;  3RVY A;  3RBZ A;  2BOC C;  2FTK A;  1XL4 A;  1FXK A;  1PD3 A;  1K5Q A;  4RQE A;  4BAY A;  2C2A A;  1AJN A;  5CBG A;  1K8A W;  1AI7 A;  1NKD A;  4X89 A;  4UVA A;  3IC7 A;  1ZWI C;  1Y4M A;  3H01 A;  3TK1 A;  2EIL C;  1NBM G;  4DO2 A;  4RQF A;  4PEL A;  1E79 G;  2WLI A;  2P67 A;  3CCL V;  3QO7 A;  1Y66 A;  2Y69 C;  3OGC C;  2EIL B;  4H37 A;  2IW5 A;  5CMU A;  4FMT A;  4L87 A;  1QLE C;  5KA6 A;  4LP8 A;  5EC1 C;  2IJK A;  1S0V A;  4QPJ A;  1ARO P;  1SZT A;  5HFL A;  2A79 B;  1YSC A;  1AI4 A;  3E89 A;  3ZMS A;  2V7Q G;  4MTF A;  2EZP A;  4MVR A;  2Y69 B;  1PL0 A;  3ETD A;  5KA5 A;  3W7T A;  3RVZ A;  5IDJ A;  1QLE B;  2B1I A;  1QBZ A;  4BW5 A;  4R50 A;  4Z1M G;  2F43 G;  3F7Y C;  2H8P C;  2ZXW C;  3ETE A;  3STZ C;  5LBQ A;  3SPH A;  1EBO A;  1JCH A;  4EKW A;  2WLK A;  3K0D A;  1QCE A;  2X7R B;  3CYO A;  1K4D C;  1WPX A;  2BOB C;  3FYI B;  2ZXW B;  2QA4 V;  1NVP D;  1VQO V;  4ZKI A;  3G4S V;  1I5X A;  4MTO A;  1ORQ C;  2WLL B;  1P7B A;  3B77 A;  2D3O W;  1VQM V;  2XOK G;  4R8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...