5JJEB

Structure of the srii/htrii complex in i212121 space group ("u" shape)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
MGAVFIFVGALTVLFGAIAYGEVTAAAATGDAAAVQEAAVSAILGLIILLGINLGLVAATLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensory rhodopsin-2
publication title New Insights on Signal Propagation by Sensory Rhodopsin II/Transducer Complex.
pubmed doi rcsb
source organism Natronomonas pharaonis
molecule tags Signaling protein
total genus 28
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2016-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00672 HAMP HAMP domain
B PF17909 Htr2 Htr2 transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jjeB00
2F93B 3LNNA 4L8JA 1T5EA 5D5PA 3WB0A 5D5QA 3WB2A 2F95B 3WB1A 4DK0A 1H2SB 5JJJB 4GYCB 4DK1A 1RSOA 5JJNB 3BRCA 2V4DA 5JJEB 1VF7A 2F1MA
chains in the Genus database with same CATH superfamily
1ZL8B 3P30A 4RWUA 2XAGA 2YIBA 2N74A 4G2KA 1FXHA 4LF6B 3X2QC 1NT2B 1JJ2U 1VQ5V 2EULA 1M56B 1AROP 1R3JC 1XBLA 1IDSA 2OT5A 3JYCA 4H44B 1WA8A 5A9GA 3J80N 1THZA 3I56V 3P3NA 1KKDA 3OR6C 4JI2O 2FKXA 1PNKA 4ICGA 4MT8A 3Q4HA 4RQFA 3CXHF 3ABKC 3E89A 1MSDA 1Q90D 2V4DA 2WWWA 1V9PA 3FD9A 2UXDB 3KCXA 4LF9B 2ETNA 3A2FA 2F1MA 4PDRA 3SJAC 4DV2B 2YS8A 4OX9B 4GX0A 5B1BB 3UCSC 1PNMA 3E8BA 1YIJV 4J41A 5FPRA 2YEVB 5GTIZ 4FK5C 3RYHB 1D5NA 1VF6A 4O4LB 2R9IA 3OUFA 4ZKIA 5EZYA 1K5QA 1OCZB 5EIBC 1YDXA 4YIPA 3CCRV 1ZWIC 1TUBB 3CRCA 1XQ8A 2R72A 4LCUC 4B3SB 2LW1A 4IYHA 2PYJA 1FJGB 1HNWB 1XMQO 5EBWC 1FXKA 4JYAO 3ASOC 1K4CC 4YJ3A 1HNZO 1IBKO 3CCMV 4K0KO 3VBBA 4CBCA 5BMVA 5KLVH 3RYCA 4QNHB 1Y74A 3O65A 4L8JA 4JI4B 1FYJA 4PA4A 4R6ZA 4QE7A 1QHTA 3IAYA 1PM9A 2D2CB 4LNUA 1VQLV 3E8GA 1KBHA 1G8MA 2A06H 5LOVB 1KUQA 2B1IA 2JK5C 2RN9A 4JI3O 3L9DA 3A0BZ 4KP4A 5LMUB 4FLVA 1GO3F 2IJHA 2P7TC 1K97A 2Y0IA 3JATB 4JF3A 2EJ7A 2F95B 3D36C 4B3SO 3ASNB 1WAZA 3P32A 4I55A 3OGCC 4P9OA 4NTYA 2EILB 5B3SB 4DV6B 3AG3B 3OE7G 1H2LA 4EEQA 3STZC 1BT8A 2LFSA 2ODMA 4I0XA 2RCVA 3GWKC 2KQXA 4U3JA 5LGTA 2XT9A 3CC2V 4UCOA 2DMXA 2UUBB 3WB0A 1TVKB 1HP8A 1FXVA 1NTMH 1SESA 1KECA 4LFBB 4TT3G 4BWAA 1IBMO 4DUZB 5JJEB 1VIBA 1AR5A 1ORQC 2CTWA 1M57C 1VQ6V 4X62O 3ZHVA 3SPIA 2F23A 1I94O 2KB1A 1GN2A 1V54C 3AG2C 2EIMB 3B8MA 4GKJB 2DN9A 3L72H 2GTSA 5ITZA 4WFEA 4X66B 3CCSV 3BPZA 2P90A 3CB2A 2BE3A 5JCOC 3MDSA 5LYJB 1MABG 1Z2GA 1F4NA 1VARA 2IU0A 2JRIA 5CA1A 1QNMA 3ZMUA 4TQFA 2ADPA 4FM1A 3FYIB 4MVOA 2JIZG 1S5JA 3N2GA 2UUBO 3APOA 4ZOLB 4GKKB 3EVKA 2UXBB 4B7KA 1P7GA 1M4UA 4LWSB 4BW5A 4DR2O 2X6CA 1JCHA 4PA7A 3ETQA 2F4VB 2Q8VA 5J2TB 4GX2A 4DR5B 2IH3C 1RM1C 4D6TH 5LA6B 2HEPA 1AP5A 2X7RB 1SERA 1I5XA 2Q7HA 2IW5A 3CJHA 1AJPA 4JPRA 1ZL8A 1O9GA 3CRRA 4JZGA 1I0HA 2DJVA 1B6QA 1NR1A 3AEIA 1FFXA 3KKYA 3OFNG 1KKCA 4QE9A 3EHBB 3CRAA 4MVSA 5E1AC 4MTXA 2DWDC 3UQ8A 4JI1O 3FX7A 5KA5A 1COWG 3P3PA 4KHPB 1I7FA 1XOUA 4QPJA 4X1KB 4MVZA 1P7BA 2BCCH 1R3KC 4CC5A 1OCOC 2Y48A 1OCCC 1Y76B 3I55V 1H8EG 1XI1A 1L0LH 4F6RA 4JI7B 3ZHRA 1J5EO 1HWYA 1RSOB 3KZIZ 1AILA 3QO5A 1K34A 2QJ1A 2XNDG 1S76D 4J10A 1LNQA 3E8FA 2EZOA 1N36B 2QWOB 2GTAA 3WB2A 5IDJA 4DV0B 2A79B 3L71H 2YEVA 3S3XA 5LP6B 4JYCA 4O4LA 1K9MW 1LUVA 4DV1B 2VWKA 4PHZA 2WAMA 3QVNA 5LXTA 2EIKC 3SPGA 4DR3B 2LFRA 4DR7B 4PDMA 4DR1B 1TUBA 1I08A 3WFVA 4PA9A 3RWRD 4XDKA 2CAZC 3SYAA 1ENVA 2UUCO 4TQDA 4LFCO 3DTUB 1QU7A 4JI7O 3J7AU 5JJNB 4UVBA 2IM9A 1QQCA 2DYSC 3W7TA 4K8XA 2Q68A 3K03A 4CC6A 4HAMA 1OCRC 3IGAC 3ZRSA 4QGPA 4N21A 2VQEO 3JD3A 3QF7A 4BIOA 5BR8B 2CE4A 4J7JA 1YJNV 4G28B 3ZRXA 4P9PA 2QM7A 4Z1VA 2EJRA 5LOVA 2ZNJA 3SYOA 1PKXA 5GONB 4LFAO 1ROPA 2BOBC 3JARB 1IX9A 1X59A 1SQXH 5L3DA 3SJCC 4DR3O 4TSFG 2BSKB 2GHYA 3JATA 4I9WA 1DTOA 2DW4A 2JEXA 4WCEV 1K73W 3CRMA 2RMKB 5IWAB 3K5MA 4UV8A 3W7WA 2CTRA 4WFGA 4TUYB 3PN1A 2Z3YA 3ZRVA 1PPJH 2Q9LA 3CCUV 1W59A 2B1GA 3OR7C 5BY1A 4FM0A 1TVKA 3JAWB 4RQEA 4X9QA 5CB4B 3F7VC 1YJ9V 1N0NA 5LL6Y 4WF9V 2NNUA 3KG2A 2HLDG 5FNVB 3T1YB 5EBMC 4FM2A 5B1AC 5BMVB 2VS0A 4AI8A 2ATKC 4FZ1A 4FLZA 3THOA 5K1PA 4K8ZA 1XILA 3H9VA 1GM8A 2LO1A 1WPBA 5F2VO 2OYQA 1M9NA 4XDJA 2ZE8A 3T1CA 3AG4C 2QWRB 4NB5A 5LYJA 3M8AA 1XL6A 3E2EA 2LGWA 4O4IA 4X8AA 5IJ9B 3OMNB 4IGGA 3E86A 1H2NA 5K1XA 4ZOLA 4J80A 1XNRB 3AG1B 4LWSA 2GUZB 5E79Z 5CBHA 3BHPA 3ABTA 2QSAA 4I4TB 5J2TA 1IZ3A 3A0RA 3AG7A 3R65A 4NTWA 2Q69A 3G67A 4YXWG 4NR1A 4J7KA 3ABLB 1BGYH 1GN3A 2PUSA 3JD2A 1A32A 4FLTA 4ZI7B 2OTLV 1GRJA 4UCVA 4JI8B 4FLYA 1AI7A 3OM3B 3DSQA 3E22B 5CBFA 4B3MO 2KG7B 4X1KA 4UFZA 3CX5F 4DYLA 1Y76A 3ZEDA 2OWOA 3CS5A 2YXYA 1LR1A 3TXQA 2JGDB 1JMKC 5CBGA 4IL6Z 1RSOA 4W4KA 2Q6AA 4JTCB 4JASA 3MHHC 2YICA 1Q82W 1YTFD 3CYOA 3ZHUA 2PZSA 3SPCA 1QCEA 4BIZA 1VQOV 2A7WA 3F5TA 4E4EA 1EN5A 2UU9O 2UUAB 2RQ6A 1S3JA 4Q20A 5LP6A 2ZE6A 2PF4E 4MS2A 5B1OA 5JVDB 1IBLB 4U7NA 3B8NA 1MMMA 2YDEA 1VF6C 3CC7V 4JV5O 4JAUA 1R73A 4R50A 1JQ0A 1XMOO 3ZS8C 1QR9A 2GBOA 5HFMA 2OCCC 1YTFB 4EFBA 2EX3A 4B3TO 1FFXB 5JJJB 4FPPA 3T4DA 2H94A 2W0FC 2HJDA 1US6A 2OIGA 3JCZA 4FFBB 5CMUA 2YXHA 1ZUQA 2UXXA 3CSXA 2WLMA 1Z5VA 2W6IG 4P2ZA 4LH6A 1QVFU 5D5QA 4JI6B 4LF5B 3ZCCA 3HR0A 4F6RB 1JA8A 4P30A 3A0HZ 2P67A 4OGQB 1K5SA 2VQFO 2WLNA 2ILMA 4FZ0A 1IBLO 1MSWD 4J11A 5GONA 3SPJA 4AILC 1V55C 3JASB 4B3RB 1SQGA 2KSDA 3B09A 2ZKOA 3JARA 3D8CA 2F43G 2Y69C 4UCRA 3LDCA 4PI0A 4DXWA 1YI2V 2BSKA 4PD4F 2D3OW 3IC7A 1KB9F 2EIJB 4LF6O 3H1JH 1AJQA 3C3TA 1YCIA 3BVOA 2QKAA 5FPOA 1PV0A 2B9ZA 1N33B 4DW1A 5H6QA 4TUYA 4D7SA 4QIWF 4DW0A 1AI6A 5H2FZ 1M90W 1PL0A 1F23A 5LXTB 5LGNA 4K3AA 5C8YB 2G38A 1NI8A 5LHHA 3N2KB 3K5OA 1RM1B 1RPRA 3JAWA 4JI6O 2P4KA 5CB4A 4MVUA 4DO2A 1KD1W 5B5EZ 2ZDIA 1KP3A 5FNVA 2QM8A 4J9YB 4I7ZB 5LHIA 2YUAA 2UXDO 2XTAA 2CDYA 2OTJV 4R7CA 4LF9O 5H6RA 4NYKA 3OT7A 4ASUG 2ZT9B 3D3IA 4DV2O 2YIDA 2Q7GA 1BMFG 2E74B 4OX9O 2E5LB 3K57A 3ABMC 2PTMA 2QA4V 4MVMA 3SYCA 3OTFA 4EB6B 5IJ0B 3FKSG 3K9SA 5IJ9A 2DYRC 2Z0AA 4MTFA 4WFHA 1Q86W 2GDSA 5IY5C 1Q3EA 1QLEC 3CCEV 2A9HA 4DV7B 1FKAO 2XAQA 1L0NH 4CS4A 5C93A 1J95A 1VEWA 2GUZA 2CK3G 3ZHQA 1HNWO 1FJGO 4DK1A 1ZAUA 4I4TA 4PDVA 1VQMV 4QJFB 5IT9N 2WLHA 3K5NA 5LMNB 1H8HG 4LBEC 1DK1A 4ZI7A 4L87A 3GB7C 1AI5A 3RT3C 2AW9A 1VQ7V 4JI4O 5KHIA 5LHGA 5KHJA 1PL4A 4GLXA 4I9QA 3HB3B 2BOCC 1UJWB 1VQ8V 3OTOB 3H1HH 1D2DA 3E22A 4X88A 2KG7A 3FB6C 1H38A 1U97A 3ZX6A 1X4TA 3K08A 1AVMA 4DV7O 2JVDA 3K0DA 5LMUO 1GTOA 1W0JG 2IBZH 2JGDA 3CC4V 1I5YA 4LF4B 1ZLZA 4O4IB 4J7ZA 2X6AA 5LMNO 4DV6O 2YI9A 1XNQB 2ARHA 4K35A 1DLBA 1Y4MA 2Q0OC 3LSQA 1NS1A 3L70H 5JH7B 4TV9B 3IC9A 1XREA 5B1BC 2P06A 3ZMTA 1M1KW 4X89A 4LFBO 5JVDA 4JGSA 3BA9A 4O4JB 4DUZO 2ZR3A 3SJBC 5KUKA 5B66Z 5KAFZ 1Q43A 4CS3A 2JS3A 4J9ZB 4JTDB 1FD9A 1OCZC 2VWJA 4EKWA 2LP7A 4GKJO 3OGIB 4X66O 1WNSA 3CCJV 4FJCC 1WJZA 1DF5A 4YY3B 4I50B 1GH6A 2AHYA 2MK3A 1R1BA 2JGUA 1M5IA 2Y4UA 3OD4A 2O57A 1K4DC 3DC5A 3L74H 1WP8A 3APQA 3CE2A 5J2UA 4FFBA 4JAAA 3ICXA 1H2GA 3QNEA 2UXNA 1XL4A 2E3CA 3UM7A 5TISZ 2HHHB 4BW9A 1U96A 4GKKO 3FB5C 2UXBO 4LF8B 4H37A 3MAQA 1EZJA 2HVKC 4X1IB 2QTOA 2F4VO 4DR5O 1Q5OA 3EFFK 4UCSA 4UB8Z 2ZIMA 3JASA 3WG7B 4H33A 4IT5A 3KCYA 2HP8A 3SR2C 4A5UB 3JAMN 4N23A 5JCOA 2ZXWB 3T4ZA 4Z2WA 3D3QA 3TK1A 2VRZA 2R70A 4JTAB 1ZTEA 1JVMA 3ZHSA 3IFXA 2YIBD 3ZMSA 2XOKG 1JFFB 1AP6A 3AK1A 1HW7A 1NTKH 3ASNC 3JSNA 3FAVB 4KHPO 1N34B 4PV1B 4QPKA 2EILC 3W7SA 3VQVA 4C7UA 3AG3C 5C8YA 3H1IH 2CGOA 3N2KA 4WBNB 3JD1A 1NKDA 4FIPC 3W7XA 2M7WA 3HKEB 1BSMA 2NN4A 5IYZB 1ZX3A 5IE9A 5L3BA 4PJ0Z 2Y4TA 1TGOA 4AHCA 3UKMA 1N36O 1G6UA 4DV0O 3GWOA 1KP2A 2EIMC 5L3FA 2HFEC 2YI8A 1MZFA 1CP9A 1PD3A 4EB6A 1DGSA 1SRYA 5IJ0A 3RGBA 4NTXA 3FYEB 4DV1O 1N34O 1HNXB 2EZPA 1NU1H 3K79A 3G4SV 2QM4A 4DR7O 4MTGA 4DR1O 1T5EA 5L3EA 4E2LA 3JALB 3T1HB 1H2MA 2YIAA 4JI5B 2CTPA 3FB7C 2IU3A 5CA0B 3CXCU 1GM7A 2AGAA 3JSLA 3K0GA 1G4YB 4ZIBA 3K3WA 4JZ2A 1NVPD 1N32B 1AI4A 5KA6A 1NQTA 4NXNB 2EINB 1F4MA 2Q73A 2ITCC 2QGNA 4BIUA 5BR8O 4JI0B 4O2AB 1LUWA 3RBZA 2DE0X 3BEHA 5IYCO 1K33A 4NKGB 1KQSU 2HKOA 2JS5A 1K3EA 2RJZA 1MNGA 1XDCA 5KHHA 3K5LA 3HKCA 4FLUA 4UVAA 3TETA 5FLXN 2UXCB 3ETGA 3B40A 4I5SA 3X2QB 1B3QA 3S3WA 4NXMB 3H01A 3UO2A 4MTOA 1Z5WA 4GX1A 4NVPA 5KAIZ 3VOUA 1SQPH 1VQ9V 3T1HO 2IH1C 4IHJA 1NVPB 1H2SB 1SQFA 5IWAO 3LNMB 1S5HC 5KUMA 4R8CA 4X20B 2JDIG 4X65B 1VMGA 2QWQB 4DRXA 3HKDB 3GVMA 2JJ2G 4CH6A 3B2EE 1WLEA 1PP9H 5EIBD 4FVMA 2NLJC 3ABKB 1Q7YW 2CGNA 5JH7A 3E35A 2FYUH 5J9PC 3CHXA 1L1FA 4TV9A 4XDLA 1V55B 1D5AA 3CEIA 2FL4A 2Q4PA 5DEDA 2LGQA 4O4JA 5LP6C 2WLIB 3T1YO 4HNAB 3CCVV 4X1YB 3DC6A 1SQBH 4D7TA 4U7OA 4H13B 3DXRB 3RW0A 2XAHA 2ZCEA 5IYBO 1YEWA 3OMIB 3BCCH 4I50A 3CD6V 2QKCA 3BA8A 2Q67A 4BR6A 2ADQB 1SETA 5KMGB 4LC1A 4DUYB 2OIEA 3F7YC 3U11A 3ASOB 1R6NA 1BS3A 1XUQA 3ZJZA 3ZHTA 3J81N 1XNRO 4F4LA 2Q7EA 4X1IA 4O4HB 3BRCA 1BCCH 1BQ0A 3LUTB 4MVRA 3QO8A 2WSSG 2WLKA 4GZRB 1Q6IA 1NTZH 5JQGB 3MHSC 4JI8O 1NBMG 1S5LZ 1JFFA 1NJIW 1CPYA 2FMLA 3NR7A 1YSCA 3FAVA 1RPOA 4DUYO 2Z5UA 1QVGU 4Z1MG 3L75H 4UB6Z 4JI2B 4WBNA 2ZR2A 2NR5A 3TJTA 3FB8C 2X6BA 3HKEA 4DV4B 1VQKV 1VP7A 3U10A 1FS0G 2N04A 5IYZA 3K9AA 1FXKC 2ZDIC 4LH7A 1FFTB 3JD0A 5J2UB 1SA0B 3G6EV 1GN4A 3BFRA 2UUAO 2QTSA 1YHQV 1Q8IA 5EC2C 4ZHQB 1OV9A 1SC5B 1IURA 1WB8A 2LW7A 1M57B 1WP7A 1URFA 3PJSK 2CH7A 5FL7G 4RAIA 3BY6A 5KX5B 1V54B 5H5NA 3AG2B 4OPHA 5L3CA 1N8RW 5LBQA 3ETDA 4MVQA 1AB3A 3CPWU 2BTOA 2K1EA 3STLC 3OEEG 3JALA 1XMQB 2X0LA 4JYAB 3VQWA 2BTQB 3RYIB 1BHBA 1HNZB 4DV4O 1IBKB 5CA0A 4YJ2B 3ZN0A 3AG1C 3ZRWA 2OCHA 2ZE7A 4K0KB 2HR3A 4MW8A 4FLXA 1BQZA 3C3SA 2DWEC 1H2KA 3QG5A 1UPGA 1S77D 3ABLC 4PI2A 3LSSA 3RVYA 3K06A 1M93A 2DQ0A 2P5OA 4O2AA 3T2MA 2PI4A 1S72V 4LF5O 2AZ2A 4MW3A 3I5DA 5BXZA 1OHHG 4JYBA 3ZMVA 1EN4A 4WFBV 4UCUA 2WLLA 4WFFA 4JI3B 3CMEV 4B3RO 3AK3A 3DGEA 2WPDG 2Q5ZA 2H3OA 2XAFA 1JOYA 5B1NA 3OMAB 1WN7A 2HJFC 3OW2U 1Q6HA 4X20A 1OCOB 4LP8A 3O9OA 5AG2A 1N33O 1JR9A 1OCCB 3HKDA 5JWPA 3CMAV 1E1QG 5DN6G 2QR4A 1EM1A 3RFRA 2V7QG 4FMTA 1RP3B 3LDEA 2A0LA 2QWNB 1IBMB 1KC8W 2E76B 3CRQA 4RUEA 3JCUZ 2WLIA 4X62B 3QO7A 4HNAA 4X1YA 3QTCA 1I94B 1L8DA 3DXRA 4DV3B 2ZD9A 1EZVH 1MA1A 3E83A 1N0JA 2L6LA 4DR4B 1XHXA 5EBLC 3G80A 4B08A 2E5LO 3K04A 2P22C 1W2BU 2EIKB 1VQPV 5EK0A 1M56C 2E75B 3ZIAG 3CP1A 3HKCB 5KMGA 1TA8A 3JD4A 1CXZB 3LSUA 1VF5B 1GKFA 1EFRG 1QBZA 4O2BB 4DR2B 5BZBA 5L3GA 2DYSB 4IHJB 4GCZA 2CUGA 4OXSA 1JJOA 1XHZA 1OCRB 2FTKA 3B77A 2YSUB 4O4HA 5GW7A 3SDLA 2ITDC 4DRXB 4IIJB 3UT5A 4RO2A 2AZ0A 2QE7G 4UUJC 4DV3O 1S0VA 1VQ4V 4DR4O 1K8AW 1OZ0A 4EFEA 5GTHZ 1F7YA 1QLNA 1JPXA 5JQGA 2EIJC 2WA4A 4JI1B 3OTOO 4DR6B 1XEQA 1B06A 2MW2B 1RFYA 4CH4A 2XAJA 1VF7A 3D36A 5CN0A 4Q6GA 3AK2A 3F5WC 3M99B 3SYPA 1MOFA 2IJKA 1G1XB 3G6BA 1J5EB 2WA3A 3EXAA 3OUSA 4GYCB 3K58A 1YJWV 4IYIA 4LF4O 1KYOF 3TXSA 2XASA 1E1RG 4PELA 2GV9A 4RUFA 4BAYA 1FAFA 1B04A 3ZN1A 1XNQO 1SA0A 3HKBB 3L73H 5D5PA 4PDLA 1FPOA 1W0KG 1NH2D 4ZHQA 3C90A 5LGUA 5B1AB 1SKVA 2ZNIA 4X64B 3R66A 5KX5A 2QWPB 1R6TA 4TV8B 4DR6O 4YIOA 1R3IC 1NZ6A 2A3QA 2CTQA 3AG4B 3MD0A 1JX9A 5EYPB 2RNBA 2AXTZ 2KKWA 2UUCB 1EN6A 4PA6A 4LFCB 1O9HA 3B4SA 3JAKB 4YY3O 2BTQA 3RYIA 3OAAG 3ZBHA 1Q6UA 3H1LH 4YJ2A 4LF7B 2ZINA 1E79G 2LQTA 1IXMA 1SZTA 3RN4A 1NH2B 1HR0B 2VQEB 3RYFB 1EBOA 3CCQV 5B3SC 1QR8A 1Q81W 3UO3A 2QEXV 2HHHO 3HPLC 4HBNA 2Q0AA 3RYHA 1IXBA 1YVWA 4LF8O 1K92A 2RDCA 1K7DA 4LFAB 3K59A 1YITV 4X64O 4OPAA 2EBOA 3FFQA 3VQXA 2ZE5A 4H0LB 5KHGA 1NR7A 1PNLA 1P84F 4JAVA 4LF7O 1WA8B 2CH7B 4WFAV 2P6JA 3NXSA 4LR3A 5DECA 1AJNA 2V1DA 1HR0O 2ZIOA 1SQQH 5H9CA 5A2QN 2W0XA 4GX5A 4CS2A 3LDDA 3WB1A 2PGGA 1MZEA 3ML0A 3Q4HB 4AQYB 2Y0PA 2IJJA 3ZRWB 2DQ3A 1OJHA 2YC0A 4YHHB 3CCLV 2WLJA 2F93B 3ETEA 2B5UA 3LNNA 1UFIA 3U0ZA 2HVJC 1WB7A 1GM9A 1HDJA 4GUNA 4FFKA 4ZBMA 5EZYB 4W4LA 3CWBH 4UCTA 2PYLA 1SS3A 2WLLB 2C2AA 4GT1A 4TOIA 2OCCB 3BAAA 4HYOA 1HNXO 2LJ2A 4KL1A 3ZMZA 4O2BA 1CEZA 3N27A 1AR4A 3SJQC 1FXKB 1BE3H 1GK9A 4AQYO 4JI5O 2YXLA 4G27B 4YJ3B 1GMGA 4KUMA 4UVCA 1R6KA 4CH3A 2L35A 4IIJA 3OEHG 1BZKA 5EC1C 1IVSA 3RYCB 1ZSPA 1N32O 1Y74B 4YHHO 3WU2Z 4J42A 3M7MX 3WG7C 5KHKA 3BABA 4NXNO 3A8TA 3ABUA 3TGUH 2R9RB 2M6YA 4LNUB 4XBFA 2W6JG 4JI0O 2ZM6B 2ZXWC 1F51A 1N4CA 2DOSA 4TWKA 2Y69B 2HG5C 4B3MB 2JJ1G 4ABMA 2QDOA 1Y6XA 1SF9A 1YF2A 5HFLA 2UXCO 4F6EA 2JEUA 4NXMO 1GAXA 1TAEA 2K9PA 2ZQMA 4DK0A 4I55B 4KXRA 2N05A 3RVZA 5LA6A 3IJ4A 2PI5A 4X65O 1DF4A 1P4RA 4I0XB 2FB5A 3HKBA 4UXNA 2UU9B 4U3JB 1Y66A 2AHZA 1R3LC 1MG1A 4CZZA 2R9AA 2ZM6O 4U3FH 2PY5A 2F66C 4HZ3A 5CA3A 4PA3A 4DV5B 4TV8A 1TUEB 1BHAA 3SYQA 1YZBA 4UV9A 4JV5B 3UT5B 3TCUA 1GN6A 4JYYA 1XMOB 3ABMB 2QKSA 5ITZB 5EYPA 1KMIZ 1SZXA 4CH5A 4B3TB 2IJIA 2DYRB 3JAKA 1WPXA 4MSWC 5IY5B 1VQNV 3SGIA 1QLEB 5CA1B 4B7EA 2P4VA 1SQVH 1P49A 4KFMA 3RYFA 2GSMB 1Y67A 3G71V 2H8PC 3N2GB 1BL8A 2XUMA 5DM6V 1YXBA 2XHBA 5IYDO 2EINC 3H1KH 3E8HA 1KU9A 3SPHA 2VQFB 3W7UA 1AR1B 4DV5O 3VQYA 4FLWA 3CJHB
chains in the Genus database with same CATH topology
4FLZA 3THOA 5K1PA 4K8ZA 5JCOA 4DV3B 2YIBA 4LF6B 1WPBA 2OYQA 1XHXA 4DR4B 1NT2B 2R70A 5LYJA 4B08A 2P22C 4O4IA 2YIBD 5IJ9B 1JFFB 1HW7A 3JSNA 3HKCB 5KMGA 1N34B 1TA8A 3VQVA 5C8YA 3N2KA 4WBNB 5K1XA 4ZOLA 4DR2B 4O2BB 1XNRB 4IHJB 3HKEB 3BHPA 1JJOA 1XHZA 4I4TB 5J2TA 4O4HA 5IYZB 2V4DA 1V9PA 2UXDB 4DRXB 4IIJB 4LF9B 2PUSA 3UT5A 3A2FA 4FLTA 2F1MA 1TGOA 4ZI7B 3SJAC 4AHCA 4DV2B 4OX9B 1G6UA 5FPRA 4EFEA 4UCVA 2YI8A 5JQGA 4JI8B 4EB6A 3RYHB 4O4LB 4FLYA 1DGSA 5IJ0A 4JI1B 5EZYA 3DSQA 4DR6B 3E22B 3RGBA 5EIBC 4X1KA 4UFZA 4CH4A 1HNXB 1VF7A 1TUBB 4Q6GA 2QM4A 1T5EA 3ZEDA 1XQ8A 2R72A 3JALB 4B3SB 3T1HB 2OWOA 2YIAA 2PYJA 1HNWB 1FJGB 4JI5B 1J5EB 4GYCB 3K58A 1JMKC 5CA0B 4YJ3A 1RSOA 3JSLA 2GV9A 4ZIBA 5BMVA 1N32B 1B04A 2PZSA 3RYCA 3HKBB 1SA0A 4NXNB 4L8JA 4JI4B 2UUAB 2RQ6A 5D5PA 1QHTA 3IAYA 4JI0B 4O2AB 4LNUA 4ZHQA 5LP6A 5JVDB 2JS5A 5LOVB 1IBLB 2RJZA 1SKVA 2ZNIA 4X64B 5KHHA 5KX5A 3K5LA 3HKCA 4TV8B 4FLUA 2UXCB 5LMUB 4FLVA 4NXMB 3JATB 5EYPB 1Z5WA 4NVPA 3ZS8C 2KKWA 2UUCB 2F95B 4EFBA 2EX3A 4LFCB 4IHJA 1O9HA 3JAKB 1H2SB 1SQFA 2BTQA 1FFXB 3RYIA 5JJJB 4I55A 4YJ2A 4LF7B 2ZINA 4X20B 4X65B 4DV6B 4DRXA 4EEQA 3HKDB 4FFBB 1HR0B 2VQEB 4CH6A 3RYFB 3B2EE 3CSXA 5EIBD 4U3JA 4FVMA 1Z5VA 4UCOA 2UUBB 4LH6A 3WB0A 5D5QA 1TVKB 5JH7A 4JI6B 4LF5B 3CHXA 4HBNA 2Q0AA 4TV9A 1D5AA 3RYHA 4LFBB 4F6RB 4BWAA 4DUZB 4LFAB 4O4JA 5JJEB 3K59A 5LP6C 5GONA 4AILC 4B3RB 3JASB 1SQGA 4HNAB 3FFQA 3JARA 4X1YB 3VQXA 4D7TA 4UCRA 4PI0A 4GKJB 5ITZA 4X66B 5KHGA 2ZCEA 1YEWA 3BPZA 4I50A 3CB2A 5JCOC 5LYJB 5FPOA 3BA8A 5CA1A 1N33B 4TQFA 4TUYA 4D7SA 4LR3A 5KMGB 4FM1A 4DUYB 5LXTB 2ZIOA 5C8YB 3U11A 1S5JA 3N2GA 3K5OA 3N2KB 4ZOLB 4GKKB 3JAWA 4CS2A 2UXBB 1M4UA 3WB1A 2PGGA 5CB4A 4AQYB 2Q7EA 3ETQA 2F4VB 5J2TB 4X1IA 4O4HB 4DR5B 3BRCA 5FNVA 5LA6B 2HEPA 2Q7HA 4YHHB 1O9GA 2F93B 3LNNA 2Q7GA 3U0ZA 2E5LB 1FFXA 3K57A 2PTMA 5JQGB 4EB6B 3OTFA 5IJ0B 5IJ9A 1JFFA 3UQ8A 5EZYB 4UCTA 2PYLA 4KHPB 1I7FA 4X1KB 1Q3EA 4TOIA 4CC5A 3BAAA 4DV7B 4KL1A 4JI2B 4CS4A 4WBNA 4O2BA 1XI1A 3HKEA 4DV4B 4F6RA 4JI7B 4DK1A 1ZAUA 2YXLA 4I4TA 4YJ3B 3U10A 5IYZA 3K5NA 5LMNB 2QJ1A 4CH3A 4LH7A 4IIJA 5J2UB 3RYCB 1SA0B 4ZI7A 3M7MX 5KHKA 3BABA 1N36B 5KHIA 3WB2A 4DV0B 5KHJA 1Q8IA 4LNUB 4ZHQB 2ZM6B 4GLXA 4I9QA 5LP6B 4O4LA 3OTOB 5KX5B 4DV1B 4B3MB 3E22A 2VWKA 4PHZA 5LXTA 4DR3B 4DR7B 1X4TA 4DR1B 1TUBA 2JVDA 3RWRD 2BTOA 2CAZC 3JALA 1TAEA 1XMQB 4JYAB 4TQDA 3VQWA 4DK0A 2BTQB 3RYIB 1HNZB 4I55B 4LF4B 1IBKB 5CA0A 4YJ2B 5JJNB 4O4IB 5LA6A 4K0KB 2IM9A 1QQCA 4K8XA 4CC6A 2YI9A 1XNQB 4FLXA 3HKBA 2UU9B 3QG5A 4U3JB 3QF7A 5BR8B 4PI2A 5JH7B 1M93A 2P5OA 4O2AA 4TV9B 2R9AA 2PY5A 2F66C 5JVDA 5LOVA 2ZNJA 4DV5B 4O4JB 3BA9A 5GONB 4TV8A 3SJBC 4UCUA 4JI3B 3JARB 1Q43A 4CS3A 4JV5B 3UT5B 3SJCC 1XMOB 2VWJA 5ITZB 3JATA 5EYPA 1KMIZ 1WNSA 4CH5A 4B3TB 4YY3B 4I50B 3JAKA 5IWAB 1WN7A 2JGUA 3K5MA 1M5IA 4X20A 3SGIA 5CA1B 4TUYB 3PN1A 3HKDA 5J2UA 4FFBA 3ICXA 1P49A 3RYFA 2E3CA 3RFRA 3N2GB 2HHHB 4FM0A 1TVKA 3JAWB 4BW9A 2XHBA 5CB4B 4LF8B 1KU9A 3MAQA 1IBMB 4X1IB 2VQFB 5FNVB 1Q5OA 3T1YB 4UCSA 4FM2A 2ZIMA 3JASA 4X62B 4HNAA 3VQYA 4X1YA 3QTCA 4FLWA 1I94B 5BMVB 3SR2C 1L8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F93 B;  3LNN A;  4L8J A;  1T5E A;  5D5P A;  3WB0 A;  5D5Q A;  3WB2 A;  2F95 B;  3WB1 A;  4DK0 A;  1H2S B;  5JJJ B;  4GYC B;  4DK1 A;  1RSO A;  5JJN B;  3BRC A;  2V4D A;  5JJE B;  1VF7 A;  2F1M A; 
#chains in the Genus database with same CATH topology
 1ZL8 B;  3P30 A;  4RWU A;  2XAG A;  2YIB A;  2N74 A;  4G2K A;  1FXH A;  4LF6 B;  3X2Q C;  1NT2 B;  1JJ2 U;  1VQ5 V;  2EUL A;  1M56 B;  1ARO P;  1R3J C;  1XBL A;  1IDS A;  2OT5 A;  3JYC A;  4H44 B;  1WA8 A;  5A9G A;  3J80 N;  1THZ A;  3I56 V;  3P3N A;  1KKD A;  3OR6 C;  4JI2 O;  2FKX A;  1PNK A;  4ICG A;  4MT8 A;  3Q4H A;  4RQF A;  3CXH F;  3ABK C;  3E89 A;  1MSD A;  1Q90 D;  2V4D A;  2WWW A;  1V9P A;  3FD9 A;  2UXD B;  3KCX A;  4LF9 B;  2ETN A;  3A2F A;  2F1M A;  4PDR A;  3SJA C;  4DV2 B;  2YS8 A;  4OX9 B;  4GX0 A;  5B1B B;  3UCS C;  1PNM A;  3E8B A;  1YIJ V;  4J41 A;  5FPR A;  2YEV B;  5GTI Z;  4FK5 C;  3RYH B;  1D5N A;  1VF6 A;  4O4L B;  2R9I A;  3OUF A;  4ZKI A;  5EZY A;  1K5Q A;  1OCZ B;  5EIB C;  1YDX A;  4YIP A;  3CCR V;  1ZWI C;  1TUB B;  3CRC A;  1XQ8 A;  2R72 A;  4LCU C;  4B3S B;  2LW1 A;  4IYH A;  2PYJ A;  1FJG B;  1HNW B;  1XMQ O;  5EBW C;  1FXK A;  4JYA O;  3ASO C;  1K4C C;  4YJ3 A;  1HNZ O;  1IBK O;  3CCM V;  4K0K O;  3VBB A;  4CBC A;  5BMV A;  5KLV H;  3RYC A;  4QNH B;  1Y74 A;  3O65 A;  4L8J A;  4JI4 B;  1FYJ A;  4PA4 A;  4R6Z A;  4QE7 A;  1QHT A;  3IAY A;  1PM9 A;  2D2C B;  4LNU A;  1VQL V;  3E8G A;  1KBH A;  1G8M A;  2A06 H;  5LOV B;  1KUQ A;  2B1I A;  2JK5 C;  2RN9 A;  4JI3 O;  3L9D A;  3A0B Z;  4KP4 A;  5LMU B;  4FLV A;  1GO3 F;  2IJH A;  2P7T C;  1K97 A;  2Y0I A;  3JAT B;  4JF3 A;  2EJ7 A;  2F95 B;  3D36 C;  4B3S O;  3ASN B;  1WAZ A;  3P32 A;  4I55 A;  3OGC C;  4P9O A;  4NTY A;  2EIL B;  5B3S B;  4DV6 B;  3AG3 B;  3OE7 G;  1H2L A;  4EEQ A;  3STZ C;  1BT8 A;  2LFS A;  2ODM A;  4I0X A;  2RCV A;  3GWK C;  2KQX A;  4U3J A;  5LGT A;  2XT9 A;  3CC2 V;  4UCO A;  2DMX A;  2UUB B;  3WB0 A;  1TVK B;  1HP8 A;  1FXV A;  1NTM H;  1SES A;  1KEC A;  4LFB B;  4TT3 G;  4BWA A;  1IBM O;  4DUZ B;  5JJE B;  1VIB A;  1AR5 A;  1ORQ C;  2CTW A;  1M57 C;  1VQ6 V;  4X62 O;  3ZHV A;  3SPI A;  2F23 A;  1I94 O;  2KB1 A;  1GN2 A;  1V54 C;  3AG2 C;  2EIM B;  3B8M A;  4GKJ B;  2DN9 A;  3L72 H;  2GTS A;  5ITZ A;  4WFE A;  4X66 B;  3CCS V;  3BPZ A;  2P90 A;  3CB2 A;  2BE3 A;  5JCO C;  3MDS A;  5LYJ B;  1MAB G;  1Z2G A;  1F4N A;  1VAR A;  2IU0 A;  2JRI A;  5CA1 A;  1QNM A;  3ZMU A;  4TQF A;  2ADP A;  4FM1 A;  3FYI B;  4MVO A;  2JIZ G;  1S5J A;  3N2G A;  2UUB O;  3APO A;  4ZOL B;  4GKK B;  3EVK A;  2UXB B;  4B7K A;  1P7G A;  1M4U A;  4LWS B;  4BW5 A;  4DR2 O;  2X6C A;  1JCH A;  4PA7 A;  3ETQ A;  2F4V B;  2Q8V A;  5J2T B;  4GX2 A;  4DR5 B;  2IH3 C;  1RM1 C;  4D6T H;  5LA6 B;  2HEP A;  1AP5 A;  2X7R B;  1SER A;  1I5X A;  2Q7H A;  2IW5 A;  3CJH A;  1AJP A;  4JPR A;  1ZL8 A;  1O9G A;  3CRR A;  4JZG A;  1I0H A;  2DJV A;  1B6Q A;  1NR1 A;  3AEI A;  1FFX A;  3KKY A;  3OFN G;  1KKC A;  4QE9 A;  3EHB B;  3CRA A;  4MVS A;  5E1A C;  4MTX A;  2DWD C;  3UQ8 A;  4JI1 O;  3FX7 A;  5KA5 A;  1COW G;  3P3P A;  4KHP B;  1I7F A;  1XOU A;  4QPJ A;  4X1K B;  4MVZ A;  1P7B A;  2BCC H;  1R3K C;  4CC5 A;  1OCO C;  2Y48 A;  1OCC C;  1Y76 B;  3I55 V;  1H8E G;  1XI1 A;  1L0L H;  4F6R A;  4JI7 B;  3ZHR A;  1J5E O;  1HWY A;  1RSO B;  3KZI Z;  1AIL A;  3QO5 A;  1K34 A;  2QJ1 A;  2XND G;  1S76 D;  4J10 A;  1LNQ A;  3E8F A;  2EZO A;  1N36 B;  2QWO B;  2GTA A;  3WB2 A;  5IDJ A;  4DV0 B;  2A79 B;  3L71 H;  2YEV A;  3S3X A;  5LP6 B;  4JYC A;  4O4L A;  1K9M W;  1LUV A;  4DV1 B;  2VWK A;  4PHZ A;  2WAM A;  3QVN A;  5LXT A;  2EIK C;  3SPG A;  4DR3 B;  2LFR A;  4DR7 B;  4PDM A;  4DR1 B;  1TUB A;  1I08 A;  3WFV A;  4PA9 A;  3RWR D;  4XDK A;  2CAZ C;  3SYA A;  1ENV A;  2UUC O;  4TQD A;  4LFC O;  3DTU B;  1QU7 A;  4JI7 O;  3J7A U;  5JJN B;  4UVB A;  2IM9 A;  1QQC A;  2DYS C;  3W7T A;  4K8X A;  2Q68 A;  3K03 A;  4CC6 A;  4HAM A;  1OCR C;  3IGA C;  3ZRS A;  4QGP A;  4N21 A;  2VQE O;  3JD3 A;  3QF7 A;  4BIO A;  5BR8 B;  2CE4 A;  4J7J A;  1YJN V;  4G28 B;  3ZRX A;  4P9P A;  2QM7 A;  4Z1V A;  2EJR A;  5LOV A;  2ZNJ A;  3SYO A;  1PKX A;  5GON B;  4LFA O;  1ROP A;  2BOB C;  3JAR B;  1IX9 A;  1X59 A;  1SQX H;  5L3D A;  3SJC C;  4DR3 O;  4TSF G;  2BSK B;  2GHY A;  3JAT A;  4I9W A;  1DTO A;  2DW4 A;  2JEX A;  4WCE V;  1K73 W;  3CRM A;  2RMK B;  5IWA B;  3K5M A;  4UV8 A;  3W7W A;  2CTR A;  4WFG A;  4TUY B;  3PN1 A;  2Z3Y A;  3ZRV A;  1PPJ H;  2Q9L A;  3CCU V;  1W59 A;  2B1G A;  3OR7 C;  5BY1 A;  4FM0 A;  1TVK A;  3JAW B;  4RQE A;  4X9Q A;  5CB4 B;  3F7V C;  1YJ9 V;  1N0N A;  5LL6 Y;  4WF9 V;  2NNU A;  3KG2 A;  2HLD G;  5FNV B;  3T1Y B;  5EBM C;  4FM2 A;  5B1A C;  5BMV B;  2VS0 A;  4AI8 A;  2ATK C;  4FZ1 A;  4FLZ A;  3THO A;  5K1P A;  4K8Z A;  1XIL A;  3H9V A;  1GM8 A;  2LO1 A;  1WPB A;  5F2V O;  2OYQ A;  1M9N A;  4XDJ A;  2ZE8 A;  3T1C A;  3AG4 C;  2QWR B;  4NB5 A;  5LYJ A;  3M8A A;  1XL6 A;  3E2E A;  2LGW A;  4O4I A;  4X8A A;  5IJ9 B;  3OMN B;  4IGG A;  3E86 A;  1H2N A;  5K1X A;  4ZOL A;  4J80 A;  1XNR B;  3AG1 B;  4LWS A;  2GUZ B;  5E79 Z;  5CBH A;  3BHP A;  3ABT A;  2QSA A;  4I4T B;  5J2T A;  1IZ3 A;  3A0R A;  3AG7 A;  3R65 A;  4NTW A;  2Q69 A;  3G67 A;  4YXW G;  4NR1 A;  4J7K A;  3ABL B;  1BGY H;  1GN3 A;  2PUS A;  3JD2 A;  1A32 A;  4FLT A;  4ZI7 B;  2OTL V;  1GRJ A;  4UCV A;  4JI8 B;  4FLY A;  1AI7 A;  3OM3 B;  3DSQ A;  3E22 B;  5CBF A;  4B3M O;  2KG7 B;  4X1K A;  4UFZ A;  3CX5 F;  4DYL A;  1Y76 A;  3ZED A;  2OWO A;  3CS5 A;  2YXY A;  1LR1 A;  3TXQ A;  2JGD B;  1JMK C;  5CBG A;  4IL6 Z;  1RSO A;  4W4K A;  2Q6A A;  4JTC B;  4JAS A;  3MHH C;  2YIC A;  1Q82 W;  1YTF D;  3CYO A;  3ZHU A;  2PZS A;  3SPC A;  1QCE A;  4BIZ A;  1VQO V;  2A7W A;  3F5T A;  4E4E A;  1EN5 A;  2UU9 O;  2UUA B;  2RQ6 A;  1S3J A;  4Q20 A;  5LP6 A;  2ZE6 A;  2PF4 E;  4MS2 A;  5B1O A;  5JVD B;  1IBL B;  4U7N A;  3B8N A;  1MMM A;  2YDE A;  1VF6 C;  3CC7 V;  4JV5 O;  4JAU A;  1R73 A;  4R50 A;  1JQ0 A;  1XMO O;  3ZS8 C;  1QR9 A;  2GBO A;  5HFM A;  2OCC C;  1YTF B;  4EFB A;  2EX3 A;  4B3T O;  1FFX B;  5JJJ B;  4FPP A;  3T4D A;  2H94 A;  2W0F C;  2HJD A;  1US6 A;  2OIG A;  3JCZ A;  4FFB B;  5CMU A;  2YXH A;  1ZUQ A;  2UXX A;  3CSX A;  2WLM A;  1Z5V A;  2W6I G;  4P2Z A;  4LH6 A;  1QVF U;  5D5Q A;  4JI6 B;  4LF5 B;  3ZCC A;  3HR0 A;  4F6R B;  1JA8 A;  4P30 A;  3A0H Z;  2P67 A;  4OGQ B;  1K5S A;  2VQF O;  2WLN A;  2ILM A;  4FZ0 A;  1IBL O;  1MSW D;  4J11 A;  5GON A;  3SPJ A;  4AIL C;  1V55 C;  3JAS B;  4B3R B;  1SQG A;  2KSD A;  3B09 A;  2ZKO A;  3JAR A;  3D8C A;  2F43 G;  2Y69 C;  4UCR A;  3LDC A;  4PI0 A;  4DXW A;  1YI2 V;  2BSK A;  4PD4 F;  2D3O W;  3IC7 A;  1KB9 F;  2EIJ B;  4LF6 O;  3H1J H;  1AJQ A;  3C3T A;  1YCI A;  3BVO A;  2QKA A;  5FPO A;  1PV0 A;  2B9Z A;  1N33 B;  4DW1 A;  5H6Q A;  4TUY A;  4D7S A;  4QIW F;  4DW0 A;  1AI6 A;  5H2F Z;  1M90 W;  1PL0 A;  1F23 A;  5LXT B;  5LGN A;  4K3A A;  5C8Y B;  2G38 A;  1NI8 A;  5LHH A;  3N2K B;  3K5O A;  1RM1 B;  1RPR A;  3JAW A;  4JI6 O;  2P4K A;  5CB4 A;  4MVU A;  4DO2 A;  1KD1 W;  5B5E Z;  2ZDI A;  1KP3 A;  5FNV A;  2QM8 A;  4J9Y B;  4I7Z B;  5LHI A;  2YUA A;  2UXD O;  2XTA A;  2CDY A;  2OTJ V;  4R7C A;  4LF9 O;  5H6R A;  4NYK A;  3OT7 A;  4ASU G;  2ZT9 B;  3D3I A;  4DV2 O;  2YID A;  2Q7G A;  1BMF G;  2E74 B;  4OX9 O;  2E5L B;  3K57 A;  3ABM C;  2PTM A;  2QA4 V;  4MVM A;  3SYC A;  3OTF A;  4EB6 B;  5IJ0 B;  3FKS G;  3K9S A;  5IJ9 A;  2DYR C;  2Z0A A;  4MTF A;  4WFH A;  1Q86 W;  2GDS A;  5IY5 C;  1Q3E A;  1QLE C;  3CCE V;  2A9H A;  4DV7 B;  1FKA O;  2XAQ A;  1L0N H;  4CS4 A;  5C93 A;  1J95 A;  1VEW A;  2GUZ A;  2CK3 G;  3ZHQ A;  1HNW O;  1FJG O;  4DK1 A;  1ZAU A;  4I4T A;  4PDV A;  1VQM V;  4QJF B;  5IT9 N;  2WLH A;  3K5N A;  5LMN B;  1H8H G;  4LBE C;  1DK1 A;  4ZI7 A;  4L87 A;  3GB7 C;  1AI5 A;  3RT3 C;  2AW9 A;  1VQ7 V;  4JI4 O;  5KHI A;  5LHG A;  5KHJ A;  1PL4 A;  4GLX A;  4I9Q A;  3HB3 B;  2BOC C;  1UJW B;  1VQ8 V;  3OTO B;  3H1H H;  1D2D A;  3E22 A;  4X88 A;  2KG7 A;  3FB6 C;  1H38 A;  1U97 A;  3ZX6 A;  1X4T A;  3K08 A;  1AVM A;  4DV7 O;  2JVD A;  3K0D A;  5LMU O;  1GTO A;  1W0J G;  2IBZ H;  2JGD A;  3CC4 V;  1I5Y A;  4LF4 B;  1ZLZ A;  4O4I B;  4J7Z A;  2X6A A;  5LMN O;  4DV6 O;  2YI9 A;  1XNQ B;  2ARH A;  4K35 A;  1DLB A;  1Y4M A;  2Q0O C;  3LSQ A;  1NS1 A;  3L70 H;  5JH7 B;  4TV9 B;  3IC9 A;  1XRE A;  5B1B C;  2P06 A;  3ZMT A;  1M1K W;  4X89 A;  4LFB O;  5JVD A;  4JGS A;  3BA9 A;  4O4J B;  4DUZ O;  2ZR3 A;  3SJB C;  5KUK A;  5B66 Z;  5KAF Z;  1Q43 A;  4CS3 A;  2JS3 A;  4J9Z B;  4JTD B;  1FD9 A;  1OCZ C;  2VWJ A;  4EKW A;  2LP7 A;  4GKJ O;  3OGI B;  4X66 O;  1WNS A;  3CCJ V;  4FJC C;  1WJZ A;  1DF5 A;  4YY3 B;  4I50 B;  1GH6 A;  2AHY A;  2MK3 A;  1R1B A;  2JGU A;  1M5I A;  2Y4U A;  3OD4 A;  2O57 A;  1K4D C;  3DC5 A;  3L74 H;  1WP8 A;  3APQ A;  3CE2 A;  5J2U A;  4FFB A;  4JAA A;  3ICX A;  1H2G A;  3QNE A;  2UXN A;  1XL4 A;  2E3C A;  3UM7 A;  5TIS Z;  2HHH B;  4BW9 A;  1U96 A;  4GKK O;  3FB5 C;  2UXB O;  4LF8 B;  4H37 A;  3MAQ A;  1EZJ A;  2HVK C;  4X1I B;  2QTO A;  2F4V O;  4DR5 O;  1Q5O A;  3EFF K;  4UCS A;  4UB8 Z;  2ZIM A;  3JAS A;  3WG7 B;  4H33 A;  4IT5 A;  3KCY A;  2HP8 A;  3SR2 C;  4A5U B;  3JAM N;  4N23 A;  5JCO A;  2ZXW B;  3T4Z A;  4Z2W A;  3D3Q A;  3TK1 A;  2VRZ A;  2R70 A;  4JTA B;  1ZTE A;  1JVM A;  3ZHS A;  3IFX A;  2YIB D;  3ZMS A;  2XOK G;  1JFF B;  1AP6 A;  3AK1 A;  1HW7 A;  1NTK H;  3ASN C;  3JSN A;  3FAV B;  4KHP O;  1N34 B;  4PV1 B;  4QPK A;  2EIL C;  3W7S A;  3VQV A;  4C7U A;  3AG3 C;  5C8Y A;  3H1I H;  2CGO A;  3N2K A;  4WBN B;  3JD1 A;  1NKD A;  4FIP C;  3W7X A;  2M7W A;  3HKE B;  1BSM A;  2NN4 A;  5IYZ B;  1ZX3 A;  5IE9 A;  5L3B A;  4PJ0 Z;  2Y4T A;  1TGO A;  4AHC A;  3UKM A;  1N36 O;  1G6U A;  4DV0 O;  3GWO A;  1KP2 A;  2EIM C;  5L3F A;  2HFE C;  2YI8 A;  1MZF A;  1CP9 A;  1PD3 A;  4EB6 A;  1DGS A;  1SRY A;  5IJ0 A;  3RGB A;  4NTX A;  3FYE B;  4DV1 O;  1N34 O;  1HNX B;  2EZP A;  1NU1 H;  3K79 A;  3G4S V;  2QM4 A;  4DR7 O;  4MTG A;  4DR1 O;  1T5E A;  5L3E A;  4E2L A;  3JAL B;  3T1H B;  1H2M A;  2YIA A;  4JI5 B;  2CTP A;  3FB7 C;  2IU3 A;  5CA0 B;  3CXC U;  1GM7 A;  2AGA A;  3JSL A;  3K0G A;  1G4Y B;  4ZIB A;  3K3W A;  4JZ2 A;  1NVP D;  1N32 B;  1AI4 A;  5KA6 A;  1NQT A;  4NXN B;  2EIN B;  1F4M A;  2Q73 A;  2ITC C;  2QGN A;  4BIU A;  5BR8 O;  4JI0 B;  4O2A B;  1LUW A;  3RBZ A;  2DE0 X;  3BEH A;  5IYC O;  1K33 A;  4NKG B;  1KQS U;  2HKO A;  2JS5 A;  1K3E A;  2RJZ A;  1MNG A;  1XDC A;  5KHH A;  3K5L A;  3HKC A;  4FLU A;  4UVA A;  3TET A;  5FLX N;  2UXC B;  3ETG A;  3B40 A;  4I5S A;  3X2Q B;  1B3Q A;  3S3W A;  4NXM B;  3H01 A;  3UO2 A;  4MTO A;  1Z5W A;  4GX1 A;  4NVP A;  5KAI Z;  3VOU A;  1SQP H;  1VQ9 V;  3T1H O;  2IH1 C;  4IHJ A;  1NVP B;  1H2S B;  1SQF A;  5IWA O;  3LNM B;  1S5H C;  5KUM A;  4R8C A;  4X20 B;  2JDI G;  4X65 B;  1VMG A;  2QWQ B;  4DRX A;  3HKD B;  3GVM A;  2JJ2 G;  4CH6 A;  3B2E E;  1WLE A;  1PP9 H;  5EIB D;  4FVM A;  2NLJ C;  3ABK B;  1Q7Y W;  2CGN A;  5JH7 A;  3E35 A;  2FYU H;  5J9P C;  3CHX A;  1L1F A;  4TV9 A;  4XDL A;  1V55 B;  1D5A A;  3CEI A;  2FL4 A;  2Q4P A;  5DED A;  2LGQ A;  4O4J A;  5LP6 C;  2WLI B;  3T1Y O;  4HNA B;  3CCV V;  4X1Y B;  3DC6 A;  1SQB H;  4D7T A;  4U7O A;  4H13 B;  3DXR B;  3RW0 A;  2XAH A;  2ZCE A;  5IYB O;  1YEW A;  3OMI B;  3BCC H;  4I50 A;  3CD6 V;  2QKC A;  3BA8 A;  2Q67 A;  4BR6 A;  2ADQ B;  1SET A;  5KMG B;  4LC1 A;  4DUY B;  2OIE A;  3F7Y C;  3U11 A;  3ASO B;  1R6N A;  1BS3 A;  1XUQ A;  3ZJZ A;  3ZHT A;  3J81 N;  1XNR O;  4F4L A;  2Q7E A;  4X1I A;  4O4H B;  3BRC A;  1BCC H;  1BQ0 A;  3LUT B;  4MVR A;  3QO8 A;  2WSS G;  2WLK A;  4GZR B;  1Q6I A;  1NTZ H;  5JQG B;  3MHS C;  4JI8 O;  1NBM G;  1S5L Z;  1JFF A;  1NJI W;  1CPY A;  2FML A;  3NR7 A;  1YSC A;  3FAV A;  1RPO A;  4DUY O;  2Z5U A;  1QVG U;  4Z1M G;  3L75 H;  4UB6 Z;  4JI2 B;  4WBN A;  2ZR2 A;  2NR5 A;  3TJT A;  3FB8 C;  2X6B A;  3HKE A;  4DV4 B;  1VQK V;  1VP7 A;  3U10 A;  1FS0 G;  2N04 A;  5IYZ A;  3K9A A;  1FXK C;  2ZDI C;  4LH7 A;  1FFT B;  3JD0 A;  5J2U B;  1SA0 B;  3G6E V;  1GN4 A;  3BFR A;  2UUA O;  2QTS A;  1YHQ V;  1Q8I A;  5EC2 C;  4ZHQ B;  1OV9 A;  1SC5 B;  1IUR A;  1WB8 A;  2LW7 A;  1M57 B;  1WP7 A;  1URF A;  3PJS K;  2CH7 A;  5FL7 G;  4RAI A;  3BY6 A;  5KX5 B;  1V54 B;  5H5N A;  3AG2 B;  4OPH A;  5L3C A;  1N8R W;  5LBQ A;  3ETD A;  4MVQ A;  1AB3 A;  3CPW U;  2BTO A;  2K1E A;  3STL C;  3OEE G;  3JAL A;  1XMQ B;  2X0L A;  4JYA B;  3VQW A;  2BTQ B;  3RYI B;  1BHB A;  1HNZ B;  4DV4 O;  1IBK B;  5CA0 A;  4YJ2 B;  3ZN0 A;  3AG1 C;  3ZRW A;  2OCH A;  2ZE7 A;  4K0K B;  2HR3 A;  4MW8 A;  4FLX A;  1BQZ A;  3C3S A;  2DWE C;  1H2K A;  3QG5 A;  1UPG A;  1S77 D;  3ABL C;  4PI2 A;  3LSS A;  3RVY A;  3K06 A;  1M93 A;  2DQ0 A;  2P5O A;  4O2A A;  3T2M A;  2PI4 A;  1S72 V;  4LF5 O;  2AZ2 A;  4MW3 A;  3I5D A;  5BXZ A;  1OHH G;  4JYB A;  3ZMV A;  1EN4 A;  4WFB V;  4UCU A;  2WLL A;  4WFF A;  4JI3 B;  3CME V;  4B3R O;  3AK3 A;  3DGE A;  2WPD G;  2Q5Z A;  2H3O A;  2XAF A;  1JOY A;  5B1N A;  3OMA B;  1WN7 A;  2HJF C;  3OW2 U;  1Q6H A;  4X20 A;  1OCO B;  4LP8 A;  3O9O A;  5AG2 A;  1N33 O;  1JR9 A;  1OCC B;  3HKD A;  5JWP A;  3CMA V;  1E1Q G;  5DN6 G;  2QR4 A;  1EM1 A;  3RFR A;  2V7Q G;  4FMT A;  1RP3 B;  3LDE A;  2A0L A;  2QWN B;  1IBM B;  1KC8 W;  2E76 B;  3CRQ A;  4RUE A;  3JCU Z;  2WLI A;  4X62 B;  3QO7 A;  4HNA A;  4X1Y A;  3QTC A;  1I94 B;  1L8D A;  3DXR A;  4DV3 B;  2ZD9 A;  1EZV H;  1MA1 A;  3E83 A;  1N0J A;  2L6L A;  4DR4 B;  1XHX A;  5EBL C;  3G80 A;  4B08 A;  2E5L O;  3K04 A;  2P22 C;  1W2B U;  2EIK B;  1VQP V;  5EK0 A;  1M56 C;  2E75 B;  3ZIA G;  3CP1 A;  3HKC B;  5KMG A;  1TA8 A;  3JD4 A;  1CXZ B;  3LSU A;  1VF5 B;  1GKF A;  1EFR G;  1QBZ A;  4O2B B;  4DR2 B;  5BZB A;  5L3G A;  2DYS B;  4IHJ B;  4GCZ A;  2CUG A;  4OXS A;  1JJO A;  1XHZ A;  1OCR B;  2FTK A;  3B77 A;  2YSU B;  4O4H A;  5GW7 A;  3SDL A;  2ITD C;  4DRX B;  4IIJ B;  3UT5 A;  4RO2 A;  2AZ0 A;  2QE7 G;  4UUJ C;  4DV3 O;  1S0V A;  1VQ4 V;  4DR4 O;  1K8A W;  1OZ0 A;  4EFE A;  5GTH Z;  1F7Y A;  1QLN A;  1JPX A;  5JQG A;  2EIJ C;  2WA4 A;  4JI1 B;  3OTO O;  4DR6 B;  1XEQ A;  1B06 A;  2MW2 B;  1RFY A;  4CH4 A;  2XAJ A;  1VF7 A;  3D36 A;  5CN0 A;  4Q6G A;  3AK2 A;  3F5W C;  3M99 B;  3SYP A;  1MOF A;  2IJK A;  1G1X B;  3G6B A;  1J5E B;  2WA3 A;  3EXA A;  3OUS A;  4GYC B;  3K58 A;  1YJW V;  4IYI A;  4LF4 O;  1KYO F;  3TXS A;  2XAS A;  1E1R G;  4PEL A;  2GV9 A;  4RUF A;  4BAY A;  1FAF A;  1B04 A;  3ZN1 A;  1XNQ O;  1SA0 A;  3HKB B;  3L73 H;  5D5P A;  4PDL A;  1FPO A;  1W0K G;  1NH2 D;  4ZHQ A;  3C90 A;  5LGU A;  5B1A B;  1SKV A;  2ZNI A;  4X64 B;  3R66 A;  5KX5 A;  2QWP B;  1R6T A;  4TV8 B;  4DR6 O;  4YIO A;  1R3I C;  1NZ6 A;  2A3Q A;  2CTQ A;  3AG4 B;  3MD0 A;  1JX9 A;  5EYP B;  2RNB A;  2AXT Z;  2KKW A;  2UUC B;  1EN6 A;  4PA6 A;  4LFC B;  1O9H A;  3B4S A;  3JAK B;  4YY3 O;  2BTQ A;  3RYI A;  3OAA G;  3ZBH A;  1Q6U A;  3H1L H;  4YJ2 A;  4LF7 B;  2ZIN A;  1E79 G;  2LQT A;  1IXM A;  1SZT A;  3RN4 A;  1NH2 B;  1HR0 B;  2VQE B;  3RYF B;  1EBO A;  3CCQ V;  5B3S C;  1QR8 A;  1Q81 W;  3UO3 A;  2QEX V;  2HHH O;  3HPL C;  4HBN A;  2Q0A A;  3RYH A;  1IXB A;  1YVW A;  4LF8 O;  1K92 A;  2RDC A;  1K7D A;  4LFA B;  3K59 A;  1YIT V;  4X64 O;  4OPA A;  2EBO A;  3FFQ A;  3VQX A;  2ZE5 A;  4H0L B;  5KHG A;  1NR7 A;  1PNL A;  1P84 F;  4JAV A;  4LF7 O;  1WA8 B;  2CH7 B;  4WFA V;  2P6J A;  3NXS A;  4LR3 A;  5DEC A;  1AJN A;  2V1D A;  1HR0 O;  2ZIO A;  1SQQ H;  5H9C A;  5A2Q N;  2W0X A;  4GX5 A;  4CS2 A;  3LDD A;  3WB1 A;  2PGG A;  1MZE A;  3ML0 A;  3Q4H B;  4AQY B;  2Y0P A;  2IJJ A;  3ZRW B;  2DQ3 A;  1OJH A;  2YC0 A;  4YHH B;  3CCL V;  2WLJ A;  2F93 B;  3ETE A;  2B5U A;  3LNN A;  1UFI A;  3U0Z A;  2HVJ C;  1WB7 A;  1GM9 A;  1HDJ A;  4GUN A;  4FFK A;  4ZBM A;  5EZY B;  4W4L A;  3CWB H;  4UCT A;  2PYL A;  1SS3 A;  2WLL B;  2C2A A;  4GT1 A;  4TOI A;  2OCC B;  3BAA A;  4HYO A;  1HNX O;  2LJ2 A;  4KL1 A;  3ZMZ A;  4O2B A;  1CEZ A;  3N27 A;  1AR4 A;  3SJQ C;  1FXK B;  1BE3 H;  1GK9 A;  4AQY O;  4JI5 O;  2YXL A;  4G27 B;  4YJ3 B;  1GMG A;  4KUM A;  4UVC A;  1R6K A;  4CH3 A;  2L35 A;  4IIJ A;  3OEH G;  1BZK A;  5EC1 C;  1IVS A;  3RYC B;  1ZSP A;  1N32 O;  1Y74 B;  4YHH O;  3WU2 Z;  4J42 A;  3M7M X;  3WG7 C;  5KHK A;  3BAB A;  4NXN O;  3A8T A;  3ABU A;  3TGU H;  2R9R B;  2M6Y A;  4LNU B;  4XBF A;  2W6J G;  4JI0 O;  2ZM6 B;  2ZXW C;  1F51 A;  1N4C A;  2DOS A;  4TWK A;  2Y69 B;  2HG5 C;  4B3M B;  2JJ1 G;  4ABM A;  2QDO A;  1Y6X A;  1SF9 A;  1YF2 A;  5HFL A;  2UXC O;  4F6E A;  2JEU A;  4NXM O;  1GAX A;  1TAE A;  2K9P A;  2ZQM A;  4DK0 A;  4I55 B;  4KXR A;  2N05 A;  3RVZ A;  5LA6 A;  3IJ4 A;  2PI5 A;  4X65 O;  1DF4 A;  1P4R A;  4I0X B;  2FB5 A;  3HKB A;  4UXN A;  2UU9 B;  4U3J B;  1Y66 A;  2AHZ A;  1R3L C;  1MG1 A;  4CZZ A;  2R9A A;  2ZM6 O;  4U3F H;  2PY5 A;  2F66 C;  4HZ3 A;  5CA3 A;  4PA3 A;  4DV5 B;  4TV8 A;  1TUE B;  1BHA A;  3SYQ A;  1YZB A;  4UV9 A;  4JV5 B;  3UT5 B;  3TCU A;  1GN6 A;  4JYY A;  1XMO B;  3ABM B;  2QKS A;  5ITZ B;  5EYP A;  1KMI Z;  1SZX A;  4CH5 A;  4B3T B;  2IJI A;  2DYR B;  3JAK A;  1WPX A;  4MSW C;  5IY5 B;  1VQN V;  3SGI A;  1QLE B;  5CA1 B;  4B7E A;  2P4V A;  1SQV H;  1P49 A;  4KFM A;  3RYF A;  2GSM B;  1Y67 A;  3G71 V;  2H8P C;  3N2G B;  1BL8 A;  2XUM A;  5DM6 V;  1YXB A;  2XHB A;  5IYD O;  2EIN C;  3H1K H;  3E8H A;  1KU9 A;  3SPH A;  2VQF B;  3W7U A;  1AR1 B;  4DV5 O;  3VQY A;  4FLW A;  3CJH B; 
#chains in the Genus database with same CATH homology
 4FLZ A;  3THO A;  5K1P A;  4K8Z A;  5JCO A;  4DV3 B;  2YIB A;  4LF6 B;  1WPB A;  2OYQ A;  1XHX A;  4DR4 B;  1NT2 B;  2R70 A;  5LYJ A;  4B08 A;  2P22 C;  4O4I A;  2YIB D;  5IJ9 B;  1JFF B;  1HW7 A;  3JSN A;  3HKC B;  5KMG A;  1N34 B;  1TA8 A;  3VQV A;  5C8Y A;  3N2K A;  4WBN B;  5K1X A;  4ZOL A;  4DR2 B;  4O2B B;  1XNR B;  4IHJ B;  3HKE B;  3BHP A;  1JJO A;  1XHZ A;  4I4T B;  5J2T A;  4O4H A;  5IYZ B;  2V4D A;  1V9P A;  2UXD B;  4DRX B;  4IIJ B;  4LF9 B;  2PUS A;  3UT5 A;  3A2F A;  4FLT A;  2F1M A;  1TGO A;  4ZI7 B;  3SJA C;  4AHC A;  4DV2 B;  4OX9 B;  1G6U A;  5FPR A;  4EFE A;  4UCV A;  2YI8 A;  5JQG A;  4JI8 B;  4EB6 A;  3RYH B;  4O4L B;  4FLY A;  1DGS A;  5IJ0 A;  4JI1 B;  5EZY A;  3DSQ A;  4DR6 B;  3E22 B;  3RGB A;  5EIB C;  4X1K A;  4UFZ A;  4CH4 A;  1HNX B;  1VF7 A;  1TUB B;  4Q6G A;  2QM4 A;  1T5E A;  3ZED A;  1XQ8 A;  2R72 A;  3JAL B;  4B3S B;  3T1H B;  2OWO A;  2YIA A;  2PYJ A;  1HNW B;  1FJG B;  4JI5 B;  1J5E B;  4GYC B;  3K58 A;  1JMK C;  5CA0 B;  4YJ3 A;  1RSO A;  3JSL A;  2GV9 A;  4ZIB A;  5BMV A;  1N32 B;  1B04 A;  2PZS A;  3RYC A;  3HKB B;  1SA0 A;  4NXN B;  4L8J A;  4JI4 B;  2UUA B;  2RQ6 A;  5D5P A;  1QHT A;  3IAY A;  4JI0 B;  4O2A B;  4LNU A;  4ZHQ A;  5LP6 A;  5JVD B;  2JS5 A;  5LOV B;  1IBL B;  2RJZ A;  1SKV A;  2ZNI A;  4X64 B;  5KHH A;  5KX5 A;  3K5L A;  3HKC A;  4TV8 B;  4FLU A;  2UXC B;  5LMU B;  4FLV A;  4NXM B;  3JAT B;  5EYP B;  1Z5W A;  4NVP A;  3ZS8 C;  2KKW A;  2UUC B;  2F95 B;  4EFB A;  2EX3 A;  4LFC B;  4IHJ A;  1O9H A;  3JAK B;  1H2S B;  1SQF A;  2BTQ A;  1FFX B;  3RYI A;  5JJJ B;  4I55 A;  4YJ2 A;  4LF7 B;  2ZIN A;  4X20 B;  4X65 B;  4DV6 B;  4DRX A;  4EEQ A;  3HKD B;  4FFB B;  1HR0 B;  2VQE B;  4CH6 A;  3RYF B;  3B2E E;  3CSX A;  5EIB D;  4U3J A;  4FVM A;  1Z5V A;  4UCO A;  2UUB B;  4LH6 A;  3WB0 A;  5D5Q A;  1TVK B;  5JH7 A;  4JI6 B;  4LF5 B;  3CHX A;  4HBN A;  2Q0A A;  4TV9 A;  1D5A A;  3RYH A;  4LFB B;  4F6R B;  4BWA A;  4DUZ B;  4LFA B;  4O4J A;  5JJE B;  3K59 A;  5LP6 C;  5GON A;  4AIL C;  4B3R B;  3JAS B;  1SQG A;  4HNA B;  3FFQ A;  3JAR A;  4X1Y B;  3VQX A;  4D7T A;  4UCR A;  4PI0 A;  4GKJ B;  5ITZ A;  4X66 B;  5KHG A;  2ZCE A;  1YEW A;  3BPZ A;  4I50 A;  3CB2 A;  5JCO C;  5LYJ B;  5FPO A;  3BA8 A;  5CA1 A;  1N33 B;  4TQF A;  4TUY A;  4D7S A;  4LR3 A;  5KMG B;  4FM1 A;  4DUY B;  5LXT B;  2ZIO A;  5C8Y B;  3U11 A;  1S5J A;  3N2G A;  3K5O A;  3N2K B;  4ZOL B;  4GKK B;  3JAW A;  4CS2 A;  2UXB B;  1M4U A;  3WB1 A;  2PGG A;  5CB4 A;  4AQY B;  2Q7E A;  3ETQ A;  2F4V B;  5J2T B;  4X1I A;  4O4H B;  4DR5 B;  3BRC A;  5FNV A;  5LA6 B;  2HEP A;  2Q7H A;  4YHH B;  1O9G A;  2F93 B;  3LNN A;  2Q7G A;  3U0Z A;  2E5L B;  1FFX A;  3K57 A;  2PTM A;  5JQG B;  4EB6 B;  3OTF A;  5IJ0 B;  5IJ9 A;  1JFF A;  3UQ8 A;  5EZY B;  4UCT A;  2PYL A;  4KHP B;  1I7F A;  4X1K B;  1Q3E A;  4TOI A;  4CC5 A;  3BAA A;  4DV7 B;  4KL1 A;  4JI2 B;  4CS4 A;  4WBN A;  4O2B A;  1XI1 A;  3HKE A;  4DV4 B;  4F6R A;  4JI7 B;  4DK1 A;  1ZAU A;  2YXL A;  4I4T A;  4YJ3 B;  3U10 A;  5IYZ A;  3K5N A;  5LMN B;  2QJ1 A;  4CH3 A;  4LH7 A;  4IIJ A;  5J2U B;  3RYC B;  1SA0 B;  4ZI7 A;  3M7M X;  5KHK A;  3BAB A;  1N36 B;  5KHI A;  3WB2 A;  4DV0 B;  5KHJ A;  1Q8I A;  4LNU B;  4ZHQ B;  2ZM6 B;  4GLX A;  4I9Q A;  5LP6 B;  4O4L A;  3OTO B;  5KX5 B;  4DV1 B;  4B3M B;  3E22 A;  2VWK A;  4PHZ A;  5LXT A;  4DR3 B;  4DR7 B;  1X4T A;  4DR1 B;  1TUB A;  2JVD A;  3RWR D;  2BTO A;  2CAZ C;  3JAL A;  1TAE A;  1XMQ B;  4JYA B;  4TQD A;  3VQW A;  4DK0 A;  2BTQ B;  3RYI B;  1HNZ B;  4I55 B;  4LF4 B;  1IBK B;  5CA0 A;  4YJ2 B;  5JJN B;  4O4I B;  5LA6 A;  4K0K B;  2IM9 A;  1QQC A;  4K8X A;  4CC6 A;  2YI9 A;  1XNQ B;  4FLX A;  3HKB A;  2UU9 B;  3QG5 A;  4U3J B;  3QF7 A;  5BR8 B;  4PI2 A;  5JH7 B;  1M93 A;  2P5O A;  4O2A A;  4TV9 B;  2R9A A;  2PY5 A;  2F66 C;  5JVD A;  5LOV A;  2ZNJ A;  4DV5 B;  4O4J B;  3BA9 A;  5GON B;  4TV8 A;  3SJB C;  4UCU A;  4JI3 B;  3JAR B;  1Q43 A;  4CS3 A;  4JV5 B;  3UT5 B;  3SJC C;  1XMO B;  2VWJ A;  5ITZ B;  3JAT A;  5EYP A;  1KMI Z;  1WNS A;  4CH5 A;  4B3T B;  4YY3 B;  4I50 B;  3JAK A;  5IWA B;  1WN7 A;  2JGU A;  3K5M A;  1M5I A;  4X20 A;  3SGI A;  5CA1 B;  4TUY B;  3PN1 A;  3HKD A;  5J2U A;  4FFB A;  3ICX A;  1P49 A;  3RYF A;  2E3C A;  3RFR A;  3N2G B;  2HHH B;  4FM0 A;  1TVK A;  3JAW B;  4BW9 A;  2XHB A;  5CB4 B;  4LF8 B;  1KU9 A;  3MAQ A;  1IBM B;  4X1I B;  2VQF B;  5FNV B;  1Q5O A;  3T1Y B;  4UCS A;  4FM2 A;  2ZIM A;  3JAS A;  4X62 B;  4HNA A;  3VQY A;  4X1Y A;  3QTC A;  4FLW A;  1I94 B;  5BMV B;  3SR2 C;  1L8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...