5JJEB

Structure of the srii/htrii complex in i212121 space group ("u" shape)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
MGAVFIFVGALTVLFGAIAYGEVTAAAATGDAAAVQEAAVSAILGLIILLGINLGLVAATLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Sensory rhodopsin-2
publication title New Insights on Signal Propagation by Sensory Rhodopsin II/Transducer Complex.
pubmed doi rcsb
source organism Natronomonas pharaonis
total genus 28
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2016-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00672 HAMP HAMP domain
B PF17909 Htr2 Htr2 transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jjeB00
1H2SB 5D5PA 3WB1A 2V4DA 5JJEB 4L8JA 5JJNB 1RSOA 5D5QA 1VF7A 2F93B 2F95B 4DK1A 1T5EA 3LNNA 3WB0A 4GYCB 3WB2A 2F1MA 4DK0A 5JJJB 3BRCA
chains in the Genus database with same CATH superfamily
2DWDC 5B1BB 3JALB 4TV8B 5KHHA 2NNUA 2PY5A 3CCUV 3NXSA 3AG3C 4P2ZA 4UB6Z 3I5DA 1BE3H 1L0LH 3AG1B 3RBZA 5LMUO 1TUEB 5BY1A 3ABKB 4LNUA 1KC8W 1AJQA 4TQFA 1IBLO 1DGSA 1HP8A 4DYLA 4AILC 1D5AA 3B4SA 1YJ9V 4GX1A 4AHCA 5EZYA 4X1IB 4TUYA 3X2QB 2VWKA 1GMGA 4JPRA 4LWSA 3SJAC 1QNMA 4OX9B 2H94A 3H1JH 2LJ2A 3CC7V 2ZINA 1IX9A 2PI4A 5JWPA 1KUQA 2QWPB 1DTOA 1E1QG 4LF9B 3ZX6A 1NJIW 3D36A 2EJRA 1VQ6V 1S5LZ 1Q6HA 3RYFA 1ZLZA 4GLXA 4O2BA 4DR3O 1PNKA 1GM9A 3OT7A 2DYRC 1H38A 3FFQA 2CTQA 4BWAA 4P30A 4JAAA 1US6A 2IW5A 1ZAUA 3BY6A 1WLEA 1S77D 1FFXA 4D6TH 1SS3A 5KX5B 2ZKOA 1ORQC 4FLTA 1IBKO 4U3JA 4JGSA 3J80N 2Q5ZA 5IT9N 1VQNV 5J2UB 1UPGA 2CTPA 2XOKG 3N2KA 4RO2A 1AR4A 5TISZ 2GV9A 1K8AW 3ZJZA 2EIJB 4YHHO 2QTOA 4DV1O 1K4CC 1M93A 1Q86W 5LBQA 5LGNA 2DWEC 4TT3G 4YJ2B 3OMNB 3K0GA 3U10A 1HNWO 3ZRWA 2HR3A 3JD0A 5CN0A 4X9QA 3JASA 3WB0A 1ZL8A 4CS3A 4IIJB 4PA7A 2P4KA 3K08A 3RGBA 3B40A 4DR1B 1X4TA 1PD3A 2VQFB 1JPXA 2D3OW 5EBLC 5D5PA 3W7UA 1QLNA 3SPIA 3JCUZ 1EZVH 3OE7G 1PM9A 1B04A 1KQSU 1F7YA 3K9SA 1JMKC 1OCZC 1SRYA 3WG7C 3ABLB 2HHHO 4GKKB 3TJTA 5KUMA 3JAKA 3VQVA 4EB6B 4JI7B 1AP6A 4CBCA 3OTOO 4JAUA 5LP6A 3C3TA 3M7MX 3P3NA 4JI3B 5DEDA 1XNRO 3HKEB 4B3RB 3RVYA 5KUKA 1NVPB 5K1PA 1Q81W 1WNSA 3FKSG 1WB7A 3CJHA 3CCJV 4DR7O 3CS5A 1G1XB 5GONB 4YXWG 3E8BA 3CCMV 2CUGA 2PYJA 5JQGA 1AI6A 4JI2O 5L3DA 3CB2A 1N0NA 1J5EB 4FFBA 2X6CA 5C8YA 3SYCA 1K92A 3M8AA 3ASNB 4ZHQB 3AK3A 1YXBA 5J2TB 3BCCH 1PPJH 4NXMB 3M99B 4I50B 3CCLV 1FJGB 1NTMH 3QO7A 2UXNA 3OUFA 1L8DA 2CGNA 1GM8A 2EX3A 2B1IA 3G80A 4LF9O 4DV0B 5GTIZ 2UUCB 2AXTZ 1TGOA 3VBBA 2A06H 4JASA 3F5WC 1XMQO 4UV8A 4NXNO 1M4UA 1SERA 2ADQB 3H1KH 4RUEA 4X64O 1VQKV 1AR5A 1BZKA 4LP8A 2YI9A 5EYPA 2BTQB 1RM1C 1S72V 3T4DA 1NI8A 4YIOA 4IHJA 1AI5A 1K5QA 1N32B 3LSUA 3K04A 5LXTA 3B8NA 5IY5B 4X1KB 1M56C 4X65O 1GM7A 4JYAO 4FLYA 4I9WA 1FKAO 4L8JA 3OGCC 2EINB 2YI8A 4FM0A 2WLIB 2ZE8A 4BW5A 1NVPD 2RNBA 1XEQA 3E22B 4GZRB 4ZI7B 1VQ7V 2PI5A 1G6UA 4Q6GA 4DV3O 3ASOB 4PHZA 5CA0B 4QE7A 1CXZB 4JI1B 3QTCA 2WLJA 1Q8IA 2Q0AA 4DR1O 1VP7A 2E75B 3CCEV 2Q6AA 3K5OA 1RSOA 3CP1A 3L71H 4J9ZB 3G4SV 5H6QA 2MW2B 3ETDA 1YITV 4LF8O 1SETA 4FVMA 3K59A 2LW7A 4FM1A 1GH6A 4B3SO 1SQPH 1PNLA 3RN4A 2WSSG 2R70A 4FLZA 1GAXA 1EN4A 2Q9LA 4J41A 1GN6A 2EBOA 1BGYH 2Y69C 3WFVA 3L72H 3W7WA 1YDXA 4DUZB 2QTSA 4JI7O 4QIWF 1SQGA 2YIAA 2ADPA 1JCHA 3RFRA 3FYEB 3UT5B 2RN9A 2DQ0A 4LF4O 1MSDA 4MVSA 4B3RO 4FLUA 4KHPB 5EC2C 2WLKA 2YS8A 4RQFA 2IU0A 3BA8A 3CCSV 1N8RW 2HFEC 3VQXA 4R7CA 1BHBA 1V54B 3D8CA 4GCZA 5FNVA 5LMNO 1FXVA 4TV9B 1I0HA 1D5NA 3HKDA 1R3KC 2ZR2A 4YY3B 2XASA 3CRCA 3MHSC 5JCOA 4FLVA 4LFAO 4P9PA 4JI4O 3DC6A 4DK0A 2DE0X 1VQLV 3AG7A 3K5LA 3QO5A 1WP8A 1VQOV 4NXMO 1FJGO 3S3XA 3QG5A 1FXKA 1FFTB 4BR6A 3T2MA 2FYUH 1Y4MA 2P6JA 3W7TA 5LA6B 3EVKA 1P49A 4GUNA 1NTKH 2Q7HA 1HR0B 3JAWB 3RYHA 4QE9A 5IJ0B 1GN4A 3FAVB 5LGTA 3VOUA 5JJJB 1YSCA 2QM4A 2RMKB 1RPRA 1V9PA 4DRXA 3RW0A 4B3MO 1OHHG 1P7BA 3AG3B 1YTFB 1W59A 1XHXA 1DF4A 5LMUB 3G71V 1N0JA 2OCHA 3GB7C 3K5NA 1YEWA 1IBLB 2CH7B 2JRIA 4TWKA 2ITDC 3B77A 5HFMA 2Q68A 3U11A 3KCYA 4I0XB 4J7KA 5EIBC 5CA1B 2RDCA 1WP7A 4PDLA 3RYCB 4B7EA 4QPJA 4UCRA 4ICGA 3SDLA 4MW3A 1I7FA 1EBOA 4UB8Z 1L0NH 4J80A 3SPJA 4CS4A 1Z5VA 3ZMSA 1M5IA 1VQMV 3DSQA 1NR1A 3E8HA 1WJZA 4Z1VA 1QCEA 2Y4TA 2WLMA 2Q73A 1M1KW 3JARA 4E4EA 2JGUA 5AG2A 1QHTA 1MSWD 3JD2A 3L9DA 2DYRB 2V1DA 5JH7A 2CTRA 4AQYB 2QM8A 4LFBO 4NB5A 4I55B 5LL6Y 1VF5B 3H9VA 4LFCB 1IZ3A 4CS2A 4I9QA 1IBKB 1SZXA 1B6QA 2HG5C 3ETGA 3ZMUA 4X88A 1VF6A 5ITZA 4Q20A 1R73A 4YHHB 1GTOA 4RWUA 4KHPO 4B08A 5CBHA 1YTFD 4DV1B 3CRQA 3HKCA 2ZIOA 3JCZA 1QLEC 4KUMA 1PNMA 3CC4V 1N33O 1FPOA 1JFFA 2GUZA 1J95A 1H2LA 2UXBO 1V55C 1KP3A 3ZN1A 4LF7O 5JCOC 1K3EA 4O2AB 4EFBA 5DN6G 1X59A 1FXHA 5H5NA 1IBMO 2UUAB 2XHBA 4I4TA 3SPGA 2Q69A 2AHYA 2AGAA 2OT5A 2P22C 4L87A 3WG7B 2HHHB 1HR0O 1YIJV 1SF9A 3CHXA 1GRJA 1K97A 4UCSA 1Q82W 3ABUA 3JD4A 5B1NA 4X62O 3OTOB 4DR5O 1S5JA 3D3QA 3H01A 3JYCA 3T1CA 2NR5A 4F6RB 2HKOA 1XNRB 1B06A 3N27A 2KB1A 5L3CA 3EXAA 3HPLC 2WPDG 3C90A 2ZM6B 1WPBA 3APQA 2QA4V 4X1YA 1YJNV 4TUYB 3OMAB 4DR7B 3WB1A 4E2LA 4LWSB 1ZTEA 4JI2B 4WBNB 1FAFA 5GTHZ 3JALA 4TV8A 4WFEA 2VWJA 3SYQA 2FL4A 2QKAA 1AJNA 3JAMN 2XUMA 2P4VA 3ZN0A 1SKVA 1NR7A 1E1RG 4I5SA 1TVKA 4XDKA 4X20B 2Q0OC 4X1IA 1ZX3A 2FB5A 2ZXWC 2QR4A 4HBNA 4BIOA 2VRZA 1XMQB 2ZT9B 4NXNB 3IJ4A 5E1AC 3ZBHA 1L1FA 4X64B 4AQYO 2FTKA 1WB8A 1OV9A 3GVMA 3T1YO 4K8XA 4LFCO 2QKCA 4FK5C 2HLDG 5D5QA 2QJ1A 1EN6A 2JK5C 1RM1B 2OTLV 1JR9A 3DC5A 2O57A 4H37A 3ICXA 3VQYA 3RT3C 4ZOLA 1VF6C 3CSXA 4CH5A 3HR0A 1Y76A 1R1BA 1M56B 4U3FH 4X65B 4JYAB 1K5SA 1R6TA 2YDEA 3ZMTA 4WFBV 3ZRWB 1YJWV 4MVQA 1XOUA 3JSNA 4DK1A 4NVPA 3JASB 1DLBA 1JA8A 4DV3B 3ZCCA 5J2UA 4CC6A 3WB2A 3BRCA 2PF4E 3HKBB 2E5LO 1R3IC 4YJ3B 5BMVB 1Z5WA 2UUAO 4LF8B 4XDLA 4D7SA 3AG4C 3OM3B 4B3SB 4YJ2A 2QE7G 1LNQA 5IYZA 1XNQO 4RAIA 3UO3A 2QM7A 4GYCB 1Y66A 4O4HB 2EIKC 2ODMA 5B5EZ 4R50A 3BABA 4GX0A 1XUQA 2V4DA 1K7DA 2Y69B 4ABMA 3SPCA 5IYCO 3ZS8C 3ZEDA 3PN1A 5FL7G 4UVAA 4BIZA 3SPHA 4ZBMA 1CP9A 4LBEC 2Y4UA 3ZRSA 4LF4B 3UQ8A 3CJHB 2M6YA 2ETNA 2FMLA 1XI1A 2ZE7A 4O4JB 1CPYA 1SESA 5JQGB 2ZM6O 2RQ6A 1VEWA 4FIPC 3B2EE 2A9HA 1O9HA 4FFBB 3RVZA 3FB6C 5DM6V 1NTZH 1NQTA 3K3WA 2OTJV 2P06A 2IBZH 2XAGA 5LMNB 4EB6A 1G4YB 3LDEA 2CK3G 2WLLB 5KA5A 2KG7A 4WFFA 3CRMA 2JEUA 4LFAB 4BIUA 4QPKA 3HKEA 4JI4B 1S5HC 3IC7A 1PKXA 2OYQA 3ABMC 1AI7A 1TUBB 5CB4A 3K58A 4DV7O 1RP3B 3D36C 1MG1A 5IJ9A 4FZ1A 4PA4A 2JJ1G 2D2CB 3SJBC 2NN4A 2KQXA 2UXXA 3SYPA 1I94B 4NTWA 5LOVB 2HVJC 3AK2A 4ZHQA 1H8EG 4GX5A 4DV4B 5J2TA 3P30A 4NYKA 4IHJB 4B3MB 4JYBA 4B7KA 2IJKA 4TSFG 2GSMB 1XILA 5LXTB 4MTGA 2CGOA 2XAJA 2PTMA 2Q7EA 2GDSA 2XAQA 4O4LB 2X0LA 4JYCA 2WLNA 2LO1A 1M57C 2PZSA 2QWOB 5GW7A 2JGDA 3ETQA 1IXBA 1XL6A 2WWWA 2BTQA 1OCRC 1S76D 3IAYA 3DXRA 1NZ6A 1D2DA 2F4VO 4OXSA 2GBOA 3OR6C 4DXWA 1QR8A 1WN7A 1NU1H 4X1KA 1NBMG 4O4IB 2N04A 1U96A 3SGIA 1I5XA 2WA4A 1NKDA 2LP7A 2CTWA 1Y74A 2A0LA 1UJWB 5CBGA 3ZRXA 3ZHTA 3CWBH 4FZ0A 4LFBB 1Q7YW 4UCVA 1KU9A 5FPOA 5H9CA 1BQ0A 2MK3A 4KL1A 4PA3A 5LHIA 1KECA 1SA0B 3FB7C 2HJFC 5LP6C 2NLJC 1NT2B 2ZDIA 1DF5A 4JI0O 1A32A 4U7OA 2IH1C 2YICA 4R6ZA 4RQEA 4KXRA 1PL0A 4WF9V 3AEIA 3ML0A 4X8AA 4J42A 1KD1W 5IYDO 2X7RB 3DTUB 3KG2A 5B3SC 1BL8A 1QLEB 1SQQH 2CE4A 5JJNB 3STZC 3FYIB 1N33B 3HKDB 2UXBB 3CMAV 3BHPA 3GWOA 2Y48A 4FM2A 4LF7B 3L73H 5EIBD 4N21A 4FLXA 5IDJA 1MNGA 4LH7A 5BZBA 4MTXA 2AZ0A 4BW9A 3J81N 1QQCA 1IBMB 4B3TO 1SQFA 3RYIA 4NR1A 5L3FA 3K0DA 3RYHB 1HWYA 4G2KA 1AB3A 1BCCH 4TV9A 1H2MA 1I94O 5K1XA 2PYLA 2BSKB 1N34O 1KKDA 2FKXA 3EHBB 3I56V 4DRXB 2ZNIA 1GK9A 1Q5OA 5LYJB 3G6EV 2HEPA 1RPOA 4J11A 4DV4O 3E2EA 4X62B 4DR5B 3HB3B 3DGEA 3SYOA 1EFRG 5B1AC 2UXDO 4UVCA 2L35A 2JVDA 4QJFB 2VS0A 5LA6A 2LQTA 4I7ZB 4DV5O 4MVZA 1XMOB 2F1MA 5KMGA 1K4DC 3O65A 3JAWA 5IJ0A 5BXZA 4UFZA 5DECA 3ETEA 3SJQC 1WPXA 1F23A 2YIBA 4UCOA 5J9PC 4HAMA 3N2GB 3ABTA 3ZIAG 4UUJC 2H3OA 2LGWA 3A2FA 2CH7A 3LDDA 2GTAA 2EINC 1QU7A 1Q6UA 2OCCC 4UCUA 4I0XA 5CA1A 3C3SA 2DMXA 3RYCA 2Z0AA 1MABG 2CDYA 1URFA 1KP2A 1R6NA 2BCCH 1I5YA 4WFGA 1K34A 4K8ZA 5EK0A 1QR9A 4PDMA 2LFRA 3T1YB 5E79Z 4IT5A 3BAAA 4JF3A 3TXQA 2Q8VA 5CA3A 2ZDIC 1HNXB 4W4LA 4CH6A 1OCCC 3U0ZA 1WA8B 3AG2C 5ITZB 4FPPA 5EC1C 1Z2GA 2BE3A 4DV6B 3ZMVA 1N36B 5EBMC 2YEVA 3HKCB 4UVBA 5A9GA 5KA6A 2XAHA 4F6EA 1XDCA 3CD6V 5FPRA 1K73W 1LUWA 2BOBC 4A5UB 2P90A 1IURA 2B1GA 3LSQA 1OJHA 5JVDA 1VQPV 3F5TA 4CZZA 3OTFA 1XQ8A 2E5LB 1H2NA 4NTXA 2EZOA 3CX5F 1FXKC 3CRAA 4D7TA 4HYOA 2F95B 1IDSA 1MZFA 3STLC 3JATA 1P4RA 3AG4B 3L74H 1K9MW 1VQ4V 1H2GA 2GTSA 4P9OA 1XNQB 1LR1A 2EIKB 2W0XA 1OCZB 1Q90D 4MTFA 1S3JA 4FJCC 2ZCEA 4DR6B 5CMUA 2AW9A 1MMMA 2ILMA 2XT9A 4HNAA 1PV0A 2ZNJA 4PD4F 4CC5A 4K0KO 1O9GA 3D3IA 4LNUB 4X1YB 1P84F 2N74A 1EM1A 1ZWIC 5EZYB 5LHGA 1XMOO 3IC9A 3BEHA 3UKMA 4PDVA 1VF7A 3SJCC 4IGGA 3Q4HA 2AHZA 3I55V 2W0FC 1I08A 1JVMA 1T5EA 1VARA 2Z3YA 1OCOC 4MVRA 5KLVH 2F43G 2Y0PA 4F6RA 2DYSC 4LF5O 3EFFK 2Y0IA 3THOA 3KCXA 1TVKB 1KB9F 3ABMB 2WA3A 5H6RA 1Y6XA 2VQEO 4DV7B 1ENVA 2F93B 1HNZO 1AILA 3RYFB 4LF6O 4O2BB 1VMGA 4WBNA 3CCQV 4PJ0Z 1Q3EA 2LFSA 4K35A 1XBLA 3W7SA 4X66O 2IJHA 4FMTA 2OIGA 4FFKA 2LW1A 3O9OA 1FFXB 1H2SB 3ZRVA 4U3JB 4ZKIA 4MW8A 2EILC 4ZOLB 2WAMA 1HNXO 4BAYA 4X20A 2QWRB 4PDRA 3CCVV 3QVNA 4OPAA 1Y76B 3N2KB 4IYIA 3TXSA 2R9AA 4DV6O 1N36O 1HDJA 1TA8A 4DR4O 2YXYA 4GX2A 2ZE5A 4GT1A 4JI6O 1KYOF 5JJEB 1YCIA 1M57B 5KAIZ 3IFXA 4MTOA 5KX5A 1ZL8B 1OCRB 3OEEG 2UUBO 1AVMA 4JZGA 1F51A 2F4VB 3MHHC 2H8PC 3OFNG 3A0HZ 5L3BA 4JI8O 1RFYA 3S3WA 2G38A 3E8GA 4KP4A 4JI5O 3FB8C 3H1IH 5B1OA 3T4ZA 4KFMA 5IYZB 2RCVA 2QWQB 2OIEA 4TOIA 1R3LC 3K9AA 1S0VA 4JAVA 2A3QA 2QKSA 4GKJO 1MZEA 4DUYO 3JAKB 4IIJA 1GO3F 1KMIZ 1MA1A 2R9IA 1JQ0A 4DR6O 4NTYA 1JJOA 2GHYA 1YF2A 3HKBA 5LP6B 4YJ3A 5BMVA 2C2AA 2EIMC 4JI0B 3OMIB 3ZHQA 1SQBH 3MAQA 4LR3A 3E89A 1VQ9V 2K1EA 1AR1B 1XREA 3FX7A 5B3SB 1UFIA 3K79A 1F4NA 4O4HA 4CH4A 4JTCB 2Z5UA 1OZ0A 5B1BC 5C8YB 3KKYA 2KG7B 3P3PA 4EEQA 4H33A 3OR7C 1BSMA 2XAFA 4ZIBA 3AG1C 5CBFA 5FLXN 3G67A 5CB4B 1VQ5V 3BA9A 3ABKC 2IU3A 1H2KA 1AROP 4HZ3A 1R3JC 5IJ9B 1FS0G 4O4JA 5IE9A 1BT8A 4B3TB 1BMFG 3MD0A 3BVOA 3X2QC 5GONA 2UU9B 1BQZA 4Z2WA 3B09A 5IWAB 3LDCA 1BHAA 4OX9O 3SR2C 1N34B 1EZJA 2Q4PA 3E8FA 2WLLA 2R72A 2X6AA 2K9PA 2DW4A 4LC1A 3JSLA 5EYPB 3E86A 3VQWA 5KHKA 3QO8A 4K3AA 2DOSA 3CPWU 1AP5A 1TUBA 3TCUA 4PELA 4I50A 4WFHA 5B1AB 2UXDB 2P7TC 1YVWA 2P5OA 3FD9A 4F4LA 1K33A 1Q43A 4FLWA 4DV5B 2A79B 4OPHA 1IXMA 5F2VO 4H0LB 3LUTB 3GWKC 3CXHF 4TQDA 5LOVA 2JGDB 1B3QA 3E35A 4DR2B 1KKCA 3LNMB 2KKWA 3OEHG 4JTDB 1WAZA 2UXCB 3DXRB 2QDOA 4MSWC 2L6LA 4EKWA 1H8HG 2JEXA 5LGUA 3KZIZ 2B9ZA 2PGGA 3JD1A 3UCSC 4J7ZA 4H44B 4DW1A 2QGNA 5L3EA 1RSOB 2EIJC 1XHZA 2OCCB 1TAEA 3E83A 1Y74B 4YIPA 5EBWC 4O4LA 3CEIA 4Z1MG 1PP9H 1KBHA 3CCRV 2IJIA 2WLIA 2KSDA 1YHQV 2YXLA 2W6IG 1Q6IA 3P32A 3E22A 4ZI7A 5KHGA 2ZD9A 4OGQB 3JD3A 4PI2A 2E74B 5CA0A 2VQFO 5KAFZ 2JDIG 4N23A 1GKFA 4CH3A 3UO2A 2B5UA 3RWRD 1VQ8V 3OUSA 4IYHA 1OCCB 2IH3C 5KHJA 5L3GA 3R66A 4O4IA 3AG2B 2W6JG 3L75H 3B8MA 2YSUB 1VIBA 3ZHSA 2BOCC 4G27B 5LHHA 1E79G 3R65A 4GKKO 4QGPA 4UXNA 3ABLC 4PI0A 1P7GA 4EFEA 1SQVH 2CAZC 1GN2A 2M7WA 4C7UA 5FNVB 3CMEV 3QNEA 1COWG 1ZSPA 2YIDA 1SA0A 1NS1A 1PL4A 1V55B 2RJZA 4XBFA 4JI3O 2E76B 2X6BA 4DW0A 4UCTA 2ZR3A 4MVOA 3UT5A 3AK1A 2JJ2G 4G28B 2XTAA 4QNHB 4JV5B 4UV9A 3K06A 1FXKB 3RYIB 1ZUQA 1M9NA 2OWOA 3ZHRA 2Q7GA 1HW7A 2R9RB 4PA9A 3ZHVA 3J7AU 1J5EO 2UU9O 2WLHA 4LCUC 1W0KG 5IWAO 3A8TA 2LGQA 3A0RA 4J10A 4LH6A 3ASNC 1GN3A 3FB5C 2EJ7A 1FYJA 4DV2B 1IVSA 3WU2Z 4WCEV 3T1HB 2ZE6A 4DV0O 2UUCO 2IJJA 2DJVA 2YXHA 4K0KB 5KMGB 3TETA 5BR8B 1G8MA 2BSKA 3W7XA 2ZQMA 1DK1A 1JX9A 3TGUH 3MDSA 3FAVA 4DR2O 5C93A 5LYJA 4U7NA 5B66Z 4IL6Z 3H1LH 2UXCO 3BPZA 1OCOB 3CRRA 2QWNB 2ATKC 3A0BZ 2DYSB 3APOA 4LF5B 1N32O 2QSAA 1QBZA 2ZIMA 3UM7A 2YC0A 3OAAG 2A7WA 2EZPA 5IY5C 4MVUA 3K57A 4NKGB 1W0JG 2VQEB 2E3CA 5KHIA 1HNZB 2HP8A 3JARB 4XDJA 1CEZA 4LF6B 1NH2B 2ZXWB 4X66B 5JH7B 1QVFU 4MS2A 4RUFA 3F7VC 1FD9A 3ASOC 1SQXH 4DO2A 5H2FZ 4JI1O 1XL4A 2P67A 1BS3A 2BTOA 4J7JA 3N2GA 1F4MA 4PA6A 3CC2V 4MVMA 2EILB 1YI2V 3CYOA 1R6KA 4MT8A 1W2BU 1U97A 2YEVB 4JYYA 4DR3B 3LNNA 2AZ2A 3L70H 1QVGU 3PJSK 1JOYA 1ROPA 1SC5B 2ITCC 3CXCU 4DR4B 3CE2A 4W4KA 4JI6B 1M90W 2ARHA 4I55A 1LUVA 4PV1B 4H13B 1JFFB 2YUAA 2GUZB 4DUZO 1AI4A 3K03A 1JJ2U 3SYAA 5JVDB 1Y67A 2UUBB 4R8CA 2QEXV 1WA8A 4JTAB 2F66C 2IM9A 2YIBD 4AI8A 4JI8B 2N05A 4I4TB 1AJPA 1N4CA 3G6BA 2JS3A 3JATB 4JI5B 4JV5O 2DN9A 3K5MA 3IGAC 2V7QG 1HNWB 2XNDG 1EN5A 1YZBA 3LSSA 4ASUG 3OW2U 3BFRA 1V54C 2HVKC 3H1HH 2EULA 2F23A 4YY3O 4WFAV 4GKJB 2PUSA 3OD4A 4DUYB 2DQ3A 4O2AA 1MOFA 2JS5A 4X89A 1NH2D 1SZTA 4JZ2A 1THZA 4J9YB 4HNAB 5HFLA 3QF7A 4DV2O 3ZHUA 5IYBO 2EIMB 3TK1A 3F7YC 2HJDA 2Q67A 3T1HO 3ZMZA 2JIZG 3OGIB 5A2QN 3NR7A 5BR8O 3Q4HB
chains in the Genus database with same CATH topology
3U11A 4IIJA 1KMIZ 4X1KA 5EIBC 5CA1B 1JJOA 4O4IB 5LP6B 3HKBA 3SGIA 3JALB 4TV8B 4YJ3A 5KHHA 5BMVA 3RYCB 4JI0B 2PY5A 4UCRA 1I7FA 3MAQA 4LR3A 4CS4A 1Z5VA 4LFBB 1M5IA 4LNUA 4TQFA 4UCVA 1KU9A 1DGSA 4AILC 5FPOA 1D5AA 3DSQA 4O4HA 4CH4A 4KL1A 4AHCA 5EZYA 1SA0B 4X1IB 4TUYA 5LP6C 5C8YB 2VWKA 1NT2B 3SJAC 4EEQA 3JARA 2JGUA 1QHTA 4OX9B 4ZIBA 2ZINA 5JH7A 4AQYB 5CB4B 4I55B 3BA9A 4LFCB 5IJ9B 5JJNB 4O4JA 4CS2A 4I9QA 4B3TB 1IBKB 1N33B 4LF9B 3HKDB 5GONA 2UU9B 2UXBB 3BHPA 5IWAB 4FM2A 4LF7B 5EIBD 3RYFA 4GLXA 4FLXA 4O2BA 3SR2C 4LH7A 1N34B 5ITZA 2R72A 4YHHB 3FFQA 4B08A 4BW9A 4BWAA 4DV1B 1QQCA 3JSLA 5EYPB 1IBMB 1ZAUA 3VQWA 3HKCA 2ZIOA 5KHKA 1FFXA 5KX5B 1TUBA 4FLTA 1SQFA 4U3JA 4I50A 3RYIA 1JFFA 2UXDB 3RYHB 2P5OA 5JCOC 5J2UB 4O2AB 4EFBA 3N2KA 4TV9A 1Q43A 4FLWA 5K1XA 2PYLA 4DV5B 2GV9A 4DRXB 2ZNIA 4TQDA 5LOVA 1Q5OA 5LYJB 2UUAB 2XHBA 1M93A 2HEPA 4DR2B 4I4TA 2KKWA 4X62B 4DR5B 4YJ2B 2UXCB 3U10A 2P22C 2JVDA 2PGGA 3JASA 3WB0A 4CS3A 4IIJB 5LA6A 3RGBA 4DR1B 1X4TA 1XMOB 2HHHB 2F1MA 5KMGA 2VQFB 1XHZA 3JAWA 5IJ0A 5D5PA 4UFZA 3CHXA 1TAEA 4UCSA 4O4LA 3OTOB 1S5JA 4F6RB 2YXLA 2YIBA 1B04A 1XNRB 4UCOA 3E22A 4ZI7A 5KHGA 3N2GB 4PI2A 1JMKC 2ZM6B 1WPBA 4GKKB 4X1YA 5CA0A 4TUYB 4DR7B 3A2FA 3WB1A 4CH3A 3JAKA 3RWRD 3VQVA 4EB6B 5KHJA 4UCUA 4JI7B 4JI2B 4WBNB 5CA1A 4O4IA 5LP6A 3M7MX 3JALA 4TV8A 3RYCA 4JI3B 2VWJA 3HKEB 4B3RB 5K1PA 1WNSA 4K8ZA 1SKVA 3T1YB 3BAAA 4PI0A 1TVKA 4EFEA 4X20B 5GONB 2CAZC 1HNXB 2PYJA 5FNVB 5JQGA 4CH6A 3U0ZA 3CB2A 1SA0A 4X1IA 1J5EB 4FFBA 2RJZA 5C8YA 5ITZB 4HBNA 4DV6B 1N36B 1XMQB 4NXNB 4ZHQB 4UCTA 3HKCB 3UT5A 4X64B 5J2TB 4JV5B 4NXMB 4K8XA 4I50B 3RYIB 1FJGB 5D5QA 2QJ1A 1L8DA 2EX3A 5FPRA 2OWOA 2Q7GA 1HW7A 4DV0B 2UUCB 3ICXA 3VQYA 1TGOA 4ZOLA 3CSXA 4CH5A 5JVDA 4LH6A 1M4UA 3OTFA 4X65B 4JYAB 1XQ8A 2E5LB 4DV2B 2YI9A 4D7TA 5EYPA 2F95B 3JSNA 2BTQB 3JATA 4DK1A 4NVPA 3T1HB 3JASB 4IHJA 4K0KB 4DV3B 1XNQB 5KMGB 1N32B 5LXTA 5J2UA 5BR8B 4X1KB 4CC6A 3WB2A 4FLYA 3BRCA 3HKBB 2ZCEA 4DR6B 4YJ3B 5BMVB 1Z5WA 4L8JA 2YI8A 4FM0A 5LYJA 4LF8B 4HNAA 3E22B 4ZI7B 2ZNJA 4D7SA 3BPZA 4CC5A 4B3SB 1G6UA 4Q6GA 4YJ2A 1O9GA 4LNUB 5IYZA 4PHZA 4LF5B 4X1YB 5CA0B 4JI1B 3QTCA 4GYCB 2ZIMA 1Q8IA 2Q0AA 4O4HB 5EZYB 3K57A 3BABA 2VQEB 2V4DA 2E3CA 3K5OA 5KHIA 1RSOA 1VF7A 3SJCC 1HNZB 3JARB 3ZS8C 3ZEDA 3PN1A 4LF6B 4FVMA 1T5EA 3K59A 4FM1A 4X66B 5JH7B 4LF4B 4F6RA 3UQ8A 3THOA 2R70A 1TVKB 4FLZA 1XI1A 4O4JB 2BTOA 3N2GA 5JQGB 2RQ6A 4DV7B 3B2EE 1O9HA 4FFBB 2F93B 4DUZB 1SQGA 3RYFB 5LMNB 4EB6A 4O2BB 2YIAA 4WBNA 4DR3B 1Q3EA 3LNNA 3RFRA 3UT5B 4LFAB 4FLUA 4KHPB 3HKEA 4JI4B 4DR4B 1FFXB 2OYQA 4JI6B 1H2SB 3BA8A 1TUBB 5CB4A 3K58A 4I55A 4U3JB 1JFFB 3VQXA 4ZOLB 4X20A 5IJ9A 3SJBC 5FNVA 5JVDB 3N2KB 4TV9B 2UUBB 3HKDA 2R9AA 1I94B 2F66C 2IM9A 4YY3B 5JCOA 4FLVA 2YIBD 5LOVB 1TA8A 4JI8B 4I4TB 4DK0A 4ZHQA 3K5LA 5JJEB 3JATB 4DV4B 5J2TA 4JI5B 4IHJB 4B3MB 3K5MA 3QG5A 1HNWB 5LXTB 5KX5A 5LA6B 2PTMA 1P49A 2F4VB 2Q7HA 4GKJB 1HR0B 3JAWB 3RYHA 5IJ0B 2PUSA 2Q7EA 4DUYB 4O2AA 2JS5A 5JJJB 4O4LB 2QM4A 4HNAB 3QF7A 1V9PA 4DRXA 2PZSA 3ETQA 5IYZB 1XHXA 2BTQA 4TOIA 3IAYA 5LMUB 3K5NA 1YEWA 1IBLB 3JAKB 1WN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H2S B;  5D5P A;  3WB1 A;  2V4D A;  5JJE B;  4L8J A;  5JJN B;  1RSO A;  5D5Q A;  1VF7 A;  2F93 B;  2F95 B;  4DK1 A;  1T5E A;  3LNN A;  3WB0 A;  4GYC B;  3WB2 A;  2F1M A;  4DK0 A;  5JJJ B;  3BRC A; 
#chains in the Genus database with same CATH topology
 2DWD C;  5B1B B;  3JAL B;  4TV8 B;  5KHH A;  2NNU A;  2PY5 A;  3CCU V;  3NXS A;  3AG3 C;  4P2Z A;  4UB6 Z;  3I5D A;  1BE3 H;  1L0L H;  3AG1 B;  3RBZ A;  5LMU O;  1TUE B;  5BY1 A;  3ABK B;  4LNU A;  1KC8 W;  1AJQ A;  4TQF A;  1IBL O;  1DGS A;  1HP8 A;  4DYL A;  4AIL C;  1D5A A;  3B4S A;  1YJ9 V;  4GX1 A;  4AHC A;  5EZY A;  4X1I B;  4TUY A;  3X2Q B;  2VWK A;  1GMG A;  4JPR A;  4LWS A;  3SJA C;  1QNM A;  4OX9 B;  2H94 A;  3H1J H;  2LJ2 A;  3CC7 V;  2ZIN A;  1IX9 A;  2PI4 A;  5JWP A;  1KUQ A;  2QWP B;  1DTO A;  1E1Q G;  4LF9 B;  3ZX6 A;  1NJI W;  3D36 A;  2EJR A;  1VQ6 V;  1S5L Z;  1Q6H A;  3RYF A;  1ZLZ A;  4GLX A;  4O2B A;  4DR3 O;  1PNK A;  1GM9 A;  3OT7 A;  2DYR C;  1H38 A;  3FFQ A;  2CTQ A;  4BWA A;  4P30 A;  4JAA A;  1US6 A;  2IW5 A;  1ZAU A;  3BY6 A;  1WLE A;  1S77 D;  1FFX A;  4D6T H;  1SS3 A;  5KX5 B;  2ZKO A;  1ORQ C;  4FLT A;  1IBK O;  4U3J A;  4JGS A;  3J80 N;  2Q5Z A;  5IT9 N;  1VQN V;  5J2U B;  1UPG A;  2CTP A;  2XOK G;  3N2K A;  4RO2 A;  1AR4 A;  5TIS Z;  2GV9 A;  1K8A W;  3ZJZ A;  2EIJ B;  4YHH O;  2QTO A;  4DV1 O;  1K4C C;  1M93 A;  1Q86 W;  5LBQ A;  5LGN A;  2DWE C;  4TT3 G;  4YJ2 B;  3OMN B;  3K0G A;  3U10 A;  1HNW O;  3ZRW A;  2HR3 A;  3JD0 A;  5CN0 A;  4X9Q A;  3JAS A;  3WB0 A;  1ZL8 A;  4CS3 A;  4IIJ B;  4PA7 A;  2P4K A;  3K08 A;  3RGB A;  3B40 A;  4DR1 B;  1X4T A;  1PD3 A;  2VQF B;  1JPX A;  2D3O W;  5EBL C;  5D5P A;  3W7U A;  1QLN A;  3SPI A;  3JCU Z;  1EZV H;  3OE7 G;  1PM9 A;  1B04 A;  1KQS U;  1F7Y A;  3K9S A;  1JMK C;  1OCZ C;  1SRY A;  3WG7 C;  3ABL B;  2HHH O;  4GKK B;  3TJT A;  5KUM A;  3JAK A;  3VQV A;  4EB6 B;  4JI7 B;  1AP6 A;  4CBC A;  3OTO O;  4JAU A;  5LP6 A;  3C3T A;  3M7M X;  3P3N A;  4JI3 B;  5DED A;  1XNR O;  3HKE B;  4B3R B;  3RVY A;  5KUK A;  1NVP B;  5K1P A;  1Q81 W;  1WNS A;  3FKS G;  1WB7 A;  3CJH A;  3CCJ V;  4DR7 O;  3CS5 A;  1G1X B;  5GON B;  4YXW G;  3E8B A;  3CCM V;  2CUG A;  2PYJ A;  5JQG A;  1AI6 A;  4JI2 O;  5L3D A;  3CB2 A;  1N0N A;  1J5E B;  4FFB A;  2X6C A;  5C8Y A;  3SYC A;  1K92 A;  3M8A A;  3ASN B;  4ZHQ B;  3AK3 A;  1YXB A;  5J2T B;  3BCC H;  1PPJ H;  4NXM B;  3M99 B;  4I50 B;  3CCL V;  1FJG B;  1NTM H;  3QO7 A;  2UXN A;  3OUF A;  1L8D A;  2CGN A;  1GM8 A;  2EX3 A;  2B1I A;  3G80 A;  4LF9 O;  4DV0 B;  5GTI Z;  2UUC B;  2AXT Z;  1TGO A;  3VBB A;  2A06 H;  4JAS A;  3F5W C;  1XMQ O;  4UV8 A;  4NXN O;  1M4U A;  1SER A;  2ADQ B;  3H1K H;  4RUE A;  4X64 O;  1VQK V;  1AR5 A;  1BZK A;  4LP8 A;  2YI9 A;  5EYP A;  2BTQ B;  1RM1 C;  1S72 V;  3T4D A;  1NI8 A;  4YIO A;  4IHJ A;  1AI5 A;  1K5Q A;  1N32 B;  3LSU A;  3K04 A;  5LXT A;  3B8N A;  5IY5 B;  4X1K B;  1M56 C;  4X65 O;  1GM7 A;  4JYA O;  4FLY A;  4I9W A;  1FKA O;  4L8J A;  3OGC C;  2EIN B;  2YI8 A;  4FM0 A;  2WLI B;  2ZE8 A;  4BW5 A;  1NVP D;  2RNB A;  1XEQ A;  3E22 B;  4GZR B;  4ZI7 B;  1VQ7 V;  2PI5 A;  1G6U A;  4Q6G A;  4DV3 O;  3ASO B;  4PHZ A;  5CA0 B;  4QE7 A;  1CXZ B;  4JI1 B;  3QTC A;  2WLJ A;  1Q8I A;  2Q0A A;  4DR1 O;  1VP7 A;  2E75 B;  3CCE V;  2Q6A A;  3K5O A;  1RSO A;  3CP1 A;  3L71 H;  4J9Z B;  3G4S V;  5H6Q A;  2MW2 B;  3ETD A;  1YIT V;  4LF8 O;  1SET A;  4FVM A;  3K59 A;  2LW7 A;  4FM1 A;  1GH6 A;  4B3S O;  1SQP H;  1PNL A;  3RN4 A;  2WSS G;  2R70 A;  4FLZ A;  1GAX A;  1EN4 A;  2Q9L A;  4J41 A;  1GN6 A;  2EBO A;  1BGY H;  2Y69 C;  3WFV A;  3L72 H;  3W7W A;  1YDX A;  4DUZ B;  2QTS A;  4JI7 O;  4QIW F;  1SQG A;  2YIA A;  2ADP A;  1JCH A;  3RFR A;  3FYE B;  3UT5 B;  2RN9 A;  2DQ0 A;  4LF4 O;  1MSD A;  4MVS A;  4B3R O;  4FLU A;  4KHP B;  5EC2 C;  2WLK A;  2YS8 A;  4RQF A;  2IU0 A;  3BA8 A;  3CCS V;  1N8R W;  2HFE C;  3VQX A;  4R7C A;  1BHB A;  1V54 B;  3D8C A;  4GCZ A;  5FNV A;  5LMN O;  1FXV A;  4TV9 B;  1I0H A;  1D5N A;  3HKD A;  1R3K C;  2ZR2 A;  4YY3 B;  2XAS A;  3CRC A;  3MHS C;  5JCO A;  4FLV A;  4LFA O;  4P9P A;  4JI4 O;  3DC6 A;  4DK0 A;  2DE0 X;  1VQL V;  3AG7 A;  3K5L A;  3QO5 A;  1WP8 A;  1VQO V;  4NXM O;  1FJG O;  3S3X A;  3QG5 A;  1FXK A;  1FFT B;  4BR6 A;  3T2M A;  2FYU H;  1Y4M A;  2P6J A;  3W7T A;  5LA6 B;  3EVK A;  1P49 A;  4GUN A;  1NTK H;  2Q7H A;  1HR0 B;  3JAW B;  3RYH A;  4QE9 A;  5IJ0 B;  1GN4 A;  3FAV B;  5LGT A;  3VOU A;  5JJJ B;  1YSC A;  2QM4 A;  2RMK B;  1RPR A;  1V9P A;  4DRX A;  3RW0 A;  4B3M O;  1OHH G;  1P7B A;  3AG3 B;  1YTF B;  1W59 A;  1XHX A;  1DF4 A;  5LMU B;  3G71 V;  1N0J A;  2OCH A;  3GB7 C;  3K5N A;  1YEW A;  1IBL B;  2CH7 B;  2JRI A;  4TWK A;  2ITD C;  3B77 A;  5HFM A;  2Q68 A;  3U11 A;  3KCY A;  4I0X B;  4J7K A;  5EIB C;  5CA1 B;  2RDC A;  1WP7 A;  4PDL A;  3RYC B;  4B7E A;  4QPJ A;  4UCR A;  4ICG A;  3SDL A;  4MW3 A;  1I7F A;  1EBO A;  4UB8 Z;  1L0N H;  4J80 A;  3SPJ A;  4CS4 A;  1Z5V A;  3ZMS A;  1M5I A;  1VQM V;  3DSQ A;  1NR1 A;  3E8H A;  1WJZ A;  4Z1V A;  1QCE A;  2Y4T A;  2WLM A;  2Q73 A;  1M1K W;  3JAR A;  4E4E A;  2JGU A;  5AG2 A;  1QHT A;  1MSW D;  3JD2 A;  3L9D A;  2DYR B;  2V1D A;  5JH7 A;  2CTR A;  4AQY B;  2QM8 A;  4LFB O;  4NB5 A;  4I55 B;  5LL6 Y;  1VF5 B;  3H9V A;  4LFC B;  1IZ3 A;  4CS2 A;  4I9Q A;  1IBK B;  1SZX A;  1B6Q A;  2HG5 C;  3ETG A;  3ZMU A;  4X88 A;  1VF6 A;  5ITZ A;  4Q20 A;  1R73 A;  4YHH B;  1GTO A;  4RWU A;  4KHP O;  4B08 A;  5CBH A;  1YTF D;  4DV1 B;  3CRQ A;  3HKC A;  2ZIO A;  3JCZ A;  1QLE C;  4KUM A;  1PNM A;  3CC4 V;  1N33 O;  1FPO A;  1JFF A;  2GUZ A;  1J95 A;  1H2L A;  2UXB O;  1V55 C;  1KP3 A;  3ZN1 A;  4LF7 O;  5JCO C;  1K3E A;  4O2A B;  4EFB A;  5DN6 G;  1X59 A;  1FXH A;  5H5N A;  1IBM O;  2UUA B;  2XHB A;  4I4T A;  3SPG A;  2Q69 A;  2AHY A;  2AGA A;  2OT5 A;  2P22 C;  4L87 A;  3WG7 B;  2HHH B;  1HR0 O;  1YIJ V;  1SF9 A;  3CHX A;  1GRJ A;  1K97 A;  4UCS A;  1Q82 W;  3ABU A;  3JD4 A;  5B1N A;  4X62 O;  3OTO B;  4DR5 O;  1S5J A;  3D3Q A;  3H01 A;  3JYC A;  3T1C A;  2NR5 A;  4F6R B;  2HKO A;  1XNR B;  1B06 A;  3N27 A;  2KB1 A;  5L3C A;  3EXA A;  3HPL C;  2WPD G;  3C90 A;  2ZM6 B;  1WPB A;  3APQ A;  2QA4 V;  4X1Y A;  1YJN V;  4TUY B;  3OMA B;  4DR7 B;  3WB1 A;  4E2L A;  4LWS B;  1ZTE A;  4JI2 B;  4WBN B;  1FAF A;  5GTH Z;  3JAL A;  4TV8 A;  4WFE A;  2VWJ A;  3SYQ A;  2FL4 A;  2QKA A;  1AJN A;  3JAM N;  2XUM A;  2P4V A;  3ZN0 A;  1SKV A;  1NR7 A;  1E1R G;  4I5S A;  1TVK A;  4XDK A;  4X20 B;  2Q0O C;  4X1I A;  1ZX3 A;  2FB5 A;  2ZXW C;  2QR4 A;  4HBN A;  4BIO A;  2VRZ A;  1XMQ B;  2ZT9 B;  4NXN B;  3IJ4 A;  5E1A C;  3ZBH A;  1L1F A;  4X64 B;  4AQY O;  2FTK A;  1WB8 A;  1OV9 A;  3GVM A;  3T1Y O;  4K8X A;  4LFC O;  2QKC A;  4FK5 C;  2HLD G;  5D5Q A;  2QJ1 A;  1EN6 A;  2JK5 C;  1RM1 B;  2OTL V;  1JR9 A;  3DC5 A;  2O57 A;  4H37 A;  3ICX A;  3VQY A;  3RT3 C;  4ZOL A;  1VF6 C;  3CSX A;  4CH5 A;  3HR0 A;  1Y76 A;  1R1B A;  1M56 B;  4U3F H;  4X65 B;  4JYA B;  1K5S A;  1R6T A;  2YDE A;  3ZMT A;  4WFB V;  3ZRW B;  1YJW V;  4MVQ A;  1XOU A;  3JSN A;  4DK1 A;  4NVP A;  3JAS B;  1DLB A;  1JA8 A;  4DV3 B;  3ZCC A;  5J2U A;  4CC6 A;  3WB2 A;  3BRC A;  2PF4 E;  3HKB B;  2E5L O;  1R3I C;  4YJ3 B;  5BMV B;  1Z5W A;  2UUA O;  4LF8 B;  4XDL A;  4D7S A;  3AG4 C;  3OM3 B;  4B3S B;  4YJ2 A;  2QE7 G;  1LNQ A;  5IYZ A;  1XNQ O;  4RAI A;  3UO3 A;  2QM7 A;  4GYC B;  1Y66 A;  4O4H B;  2EIK C;  2ODM A;  5B5E Z;  4R50 A;  3BAB A;  4GX0 A;  1XUQ A;  2V4D A;  1K7D A;  2Y69 B;  4ABM A;  3SPC A;  5IYC O;  3ZS8 C;  3ZED A;  3PN1 A;  5FL7 G;  4UVA A;  4BIZ A;  3SPH A;  4ZBM A;  1CP9 A;  4LBE C;  2Y4U A;  3ZRS A;  4LF4 B;  3UQ8 A;  3CJH B;  2M6Y A;  2ETN A;  2FML A;  1XI1 A;  2ZE7 A;  4O4J B;  1CPY A;  1SES A;  5JQG B;  2ZM6 O;  2RQ6 A;  1VEW A;  4FIP C;  3B2E E;  2A9H A;  1O9H A;  4FFB B;  3RVZ A;  3FB6 C;  5DM6 V;  1NTZ H;  1NQT A;  3K3W A;  2OTJ V;  2P06 A;  2IBZ H;  2XAG A;  5LMN B;  4EB6 A;  1G4Y B;  3LDE A;  2CK3 G;  2WLL B;  5KA5 A;  2KG7 A;  4WFF A;  3CRM A;  2JEU A;  4LFA B;  4BIU A;  4QPK A;  3HKE A;  4JI4 B;  1S5H C;  3IC7 A;  1PKX A;  2OYQ A;  3ABM C;  1AI7 A;  1TUB B;  5CB4 A;  3K58 A;  4DV7 O;  1RP3 B;  3D36 C;  1MG1 A;  5IJ9 A;  4FZ1 A;  4PA4 A;  2JJ1 G;  2D2C B;  3SJB C;  2NN4 A;  2KQX A;  2UXX A;  3SYP A;  1I94 B;  4NTW A;  5LOV B;  2HVJ C;  3AK2 A;  4ZHQ A;  1H8E G;  4GX5 A;  4DV4 B;  5J2T A;  3P30 A;  4NYK A;  4IHJ B;  4B3M B;  4JYB A;  4B7K A;  2IJK A;  4TSF G;  2GSM B;  1XIL A;  5LXT B;  4MTG A;  2CGO A;  2XAJ A;  2PTM A;  2Q7E A;  2GDS A;  2XAQ A;  4O4L B;  2X0L A;  4JYC A;  2WLN A;  2LO1 A;  1M57 C;  2PZS A;  2QWO B;  5GW7 A;  2JGD A;  3ETQ A;  1IXB A;  1XL6 A;  2WWW A;  2BTQ A;  1OCR C;  1S76 D;  3IAY A;  3DXR A;  1NZ6 A;  1D2D A;  2F4V O;  4OXS A;  2GBO A;  3OR6 C;  4DXW A;  1QR8 A;  1WN7 A;  1NU1 H;  4X1K A;  1NBM G;  4O4I B;  2N04 A;  1U96 A;  3SGI A;  1I5X A;  2WA4 A;  1NKD A;  2LP7 A;  2CTW A;  1Y74 A;  2A0L A;  1UJW B;  5CBG A;  3ZRX A;  3ZHT A;  3CWB H;  4FZ0 A;  4LFB B;  1Q7Y W;  4UCV A;  1KU9 A;  5FPO A;  5H9C A;  1BQ0 A;  2MK3 A;  4KL1 A;  4PA3 A;  5LHI A;  1KEC A;  1SA0 B;  3FB7 C;  2HJF C;  5LP6 C;  2NLJ C;  1NT2 B;  2ZDI A;  1DF5 A;  4JI0 O;  1A32 A;  4U7O A;  2IH1 C;  2YIC A;  4R6Z A;  4RQE A;  4KXR A;  1PL0 A;  4WF9 V;  3AEI A;  3ML0 A;  4X8A A;  4J42 A;  1KD1 W;  5IYD O;  2X7R B;  3DTU B;  3KG2 A;  5B3S C;  1BL8 A;  1QLE B;  1SQQ H;  2CE4 A;  5JJN B;  3STZ C;  3FYI B;  1N33 B;  3HKD B;  2UXB B;  3CMA V;  3BHP A;  3GWO A;  2Y48 A;  4FM2 A;  4LF7 B;  3L73 H;  5EIB D;  4N21 A;  4FLX A;  5IDJ A;  1MNG A;  4LH7 A;  5BZB A;  4MTX A;  2AZ0 A;  4BW9 A;  3J81 N;  1QQC A;  1IBM B;  4B3T O;  1SQF A;  3RYI A;  4NR1 A;  5L3F A;  3K0D A;  3RYH B;  1HWY A;  4G2K A;  1AB3 A;  1BCC H;  4TV9 A;  1H2M A;  1I94 O;  5K1X A;  2PYL A;  2BSK B;  1N34 O;  1KKD A;  2FKX A;  3EHB B;  3I56 V;  4DRX B;  2ZNI A;  1GK9 A;  1Q5O A;  5LYJ B;  3G6E V;  2HEP A;  1RPO A;  4J11 A;  4DV4 O;  3E2E A;  4X62 B;  4DR5 B;  3HB3 B;  3DGE A;  3SYO A;  1EFR G;  5B1A C;  2UXD O;  4UVC A;  2L35 A;  2JVD A;  4QJF B;  2VS0 A;  5LA6 A;  2LQT A;  4I7Z B;  4DV5 O;  4MVZ A;  1XMO B;  2F1M A;  5KMG A;  1K4D C;  3O65 A;  3JAW A;  5IJ0 A;  5BXZ A;  4UFZ A;  5DEC A;  3ETE A;  3SJQ C;  1WPX A;  1F23 A;  2YIB A;  4UCO A;  5J9P C;  4HAM A;  3N2G B;  3ABT A;  3ZIA G;  4UUJ C;  2H3O A;  2LGW A;  3A2F A;  2CH7 A;  3LDD A;  2GTA A;  2EIN C;  1QU7 A;  1Q6U A;  2OCC C;  4UCU A;  4I0X A;  5CA1 A;  3C3S A;  2DMX A;  3RYC A;  2Z0A A;  1MAB G;  2CDY A;  1URF A;  1KP2 A;  1R6N A;  2BCC H;  1I5Y A;  4WFG A;  1K34 A;  4K8Z A;  5EK0 A;  1QR9 A;  4PDM A;  2LFR A;  3T1Y B;  5E79 Z;  4IT5 A;  3BAA A;  4JF3 A;  3TXQ A;  2Q8V A;  5CA3 A;  2ZDI C;  1HNX B;  4W4L A;  4CH6 A;  1OCC C;  3U0Z A;  1WA8 B;  3AG2 C;  5ITZ B;  4FPP A;  5EC1 C;  1Z2G A;  2BE3 A;  4DV6 B;  3ZMV A;  1N36 B;  5EBM C;  2YEV A;  3HKC B;  4UVB A;  5A9G A;  5KA6 A;  2XAH A;  4F6E A;  1XDC A;  3CD6 V;  5FPR A;  1K73 W;  1LUW A;  2BOB C;  4A5U B;  2P90 A;  1IUR A;  2B1G A;  3LSQ A;  1OJH A;  5JVD A;  1VQP V;  3F5T A;  4CZZ A;  3OTF A;  1XQ8 A;  2E5L B;  1H2N A;  4NTX A;  2EZO A;  3CX5 F;  1FXK C;  3CRA A;  4D7T A;  4HYO A;  2F95 B;  1IDS A;  1MZF A;  3STL C;  3JAT A;  1P4R A;  3AG4 B;  3L74 H;  1K9M W;  1VQ4 V;  1H2G A;  2GTS A;  4P9O A;  1XNQ B;  1LR1 A;  2EIK B;  2W0X A;  1OCZ B;  1Q90 D;  4MTF A;  1S3J A;  4FJC C;  2ZCE A;  4DR6 B;  5CMU A;  2AW9 A;  1MMM A;  2ILM A;  2XT9 A;  4HNA A;  1PV0 A;  2ZNJ A;  4PD4 F;  4CC5 A;  4K0K O;  1O9G A;  3D3I A;  4LNU B;  4X1Y B;  1P84 F;  2N74 A;  1EM1 A;  1ZWI C;  5EZY B;  5LHG A;  1XMO O;  3IC9 A;  3BEH A;  3UKM A;  4PDV A;  1VF7 A;  3SJC C;  4IGG A;  3Q4H A;  2AHZ A;  3I55 V;  2W0F C;  1I08 A;  1JVM A;  1T5E A;  1VAR A;  2Z3Y A;  1OCO C;  4MVR A;  5KLV H;  2F43 G;  2Y0P A;  4F6R A;  2DYS C;  4LF5 O;  3EFF K;  2Y0I A;  3THO A;  3KCX A;  1TVK B;  1KB9 F;  3ABM B;  2WA3 A;  5H6R A;  1Y6X A;  2VQE O;  4DV7 B;  1ENV A;  2F93 B;  1HNZ O;  1AIL A;  3RYF B;  4LF6 O;  4O2B B;  1VMG A;  4WBN A;  3CCQ V;  4PJ0 Z;  1Q3E A;  2LFS A;  4K35 A;  1XBL A;  3W7S A;  4X66 O;  2IJH A;  4FMT A;  2OIG A;  4FFK A;  2LW1 A;  3O9O A;  1FFX B;  1H2S B;  3ZRV A;  4U3J B;  4ZKI A;  4MW8 A;  2EIL C;  4ZOL B;  2WAM A;  1HNX O;  4BAY A;  4X20 A;  2QWR B;  4PDR A;  3CCV V;  3QVN A;  4OPA A;  1Y76 B;  3N2K B;  4IYI A;  3TXS A;  2R9A A;  4DV6 O;  1N36 O;  1HDJ A;  1TA8 A;  4DR4 O;  2YXY A;  4GX2 A;  2ZE5 A;  4GT1 A;  4JI6 O;  1KYO F;  5JJE B;  1YCI A;  1M57 B;  5KAI Z;  3IFX A;  4MTO A;  5KX5 A;  1ZL8 B;  1OCR B;  3OEE G;  2UUB O;  1AVM A;  4JZG A;  1F51 A;  2F4V B;  3MHH C;  2H8P C;  3OFN G;  3A0H Z;  5L3B A;  4JI8 O;  1RFY A;  3S3W A;  2G38 A;  3E8G A;  4KP4 A;  4JI5 O;  3FB8 C;  3H1I H;  5B1O A;  3T4Z A;  4KFM A;  5IYZ B;  2RCV A;  2QWQ B;  2OIE A;  4TOI A;  1R3L C;  3K9A A;  1S0V A;  4JAV A;  2A3Q A;  2QKS A;  4GKJ O;  1MZE A;  4DUY O;  3JAK B;  4IIJ A;  1GO3 F;  1KMI Z;  1MA1 A;  2R9I A;  1JQ0 A;  4DR6 O;  4NTY A;  1JJO A;  2GHY A;  1YF2 A;  3HKB A;  5LP6 B;  4YJ3 A;  5BMV A;  2C2A A;  2EIM C;  4JI0 B;  3OMI B;  3ZHQ A;  1SQB H;  3MAQ A;  4LR3 A;  3E89 A;  1VQ9 V;  2K1E A;  1AR1 B;  1XRE A;  3FX7 A;  5B3S B;  1UFI A;  3K79 A;  1F4N A;  4O4H A;  4CH4 A;  4JTC B;  2Z5U A;  1OZ0 A;  5B1B C;  5C8Y B;  3KKY A;  2KG7 B;  3P3P A;  4EEQ A;  4H33 A;  3OR7 C;  1BSM A;  2XAF A;  4ZIB A;  3AG1 C;  5CBF A;  5FLX N;  3G67 A;  5CB4 B;  1VQ5 V;  3BA9 A;  3ABK C;  2IU3 A;  1H2K A;  1ARO P;  4HZ3 A;  1R3J C;  5IJ9 B;  1FS0 G;  4O4J A;  5IE9 A;  1BT8 A;  4B3T B;  1BMF G;  3MD0 A;  3BVO A;  3X2Q C;  5GON A;  2UU9 B;  1BQZ A;  4Z2W A;  3B09 A;  5IWA B;  3LDC A;  1BHA A;  4OX9 O;  3SR2 C;  1N34 B;  1EZJ A;  2Q4P A;  3E8F A;  2WLL A;  2R72 A;  2X6A A;  2K9P A;  2DW4 A;  4LC1 A;  3JSL A;  5EYP B;  3E86 A;  3VQW A;  5KHK A;  3QO8 A;  4K3A A;  2DOS A;  3CPW U;  1AP5 A;  1TUB A;  3TCU A;  4PEL A;  4I50 A;  4WFH A;  5B1A B;  2UXD B;  2P7T C;  1YVW A;  2P5O A;  3FD9 A;  4F4L A;  1K33 A;  1Q43 A;  4FLW A;  4DV5 B;  2A79 B;  4OPH A;  1IXM A;  5F2V O;  4H0L B;  3LUT B;  3GWK C;  3CXH F;  4TQD A;  5LOV A;  2JGD B;  1B3Q A;  3E35 A;  4DR2 B;  1KKC A;  3LNM B;  2KKW A;  3OEH G;  4JTD B;  1WAZ A;  2UXC B;  3DXR B;  2QDO A;  4MSW C;  2L6L A;  4EKW A;  1H8H G;  2JEX A;  5LGU A;  3KZI Z;  2B9Z A;  2PGG A;  3JD1 A;  3UCS C;  4J7Z A;  4H44 B;  4DW1 A;  2QGN A;  5L3E A;  1RSO B;  2EIJ C;  1XHZ A;  2OCC B;  1TAE A;  3E83 A;  1Y74 B;  4YIP A;  5EBW C;  4O4L A;  3CEI A;  4Z1M G;  1PP9 H;  1KBH A;  3CCR V;  2IJI A;  2WLI A;  2KSD A;  1YHQ V;  2YXL A;  2W6I G;  1Q6I A;  3P32 A;  3E22 A;  4ZI7 A;  5KHG A;  2ZD9 A;  4OGQ B;  3JD3 A;  4PI2 A;  2E74 B;  5CA0 A;  2VQF O;  5KAF Z;  2JDI G;  4N23 A;  1GKF A;  4CH3 A;  3UO2 A;  2B5U A;  3RWR D;  1VQ8 V;  3OUS A;  4IYH A;  1OCC B;  2IH3 C;  5KHJ A;  5L3G A;  3R66 A;  4O4I A;  3AG2 B;  2W6J G;  3L75 H;  3B8M A;  2YSU B;  1VIB A;  3ZHS A;  2BOC C;  4G27 B;  5LHH A;  1E79 G;  3R65 A;  4GKK O;  4QGP A;  4UXN A;  3ABL C;  4PI0 A;  1P7G A;  4EFE A;  1SQV H;  2CAZ C;  1GN2 A;  2M7W A;  4C7U A;  5FNV B;  3CME V;  3QNE A;  1COW G;  1ZSP A;  2YID A;  1SA0 A;  1NS1 A;  1PL4 A;  1V55 B;  2RJZ A;  4XBF A;  4JI3 O;  2E76 B;  2X6B A;  4DW0 A;  4UCT A;  2ZR3 A;  4MVO A;  3UT5 A;  3AK1 A;  2JJ2 G;  4G28 B;  2XTA A;  4QNH B;  4JV5 B;  4UV9 A;  3K06 A;  1FXK B;  3RYI B;  1ZUQ A;  1M9N A;  2OWO A;  3ZHR A;  2Q7G A;  1HW7 A;  2R9R B;  4PA9 A;  3ZHV A;  3J7A U;  1J5E O;  2UU9 O;  2WLH A;  4LCU C;  1W0K G;  5IWA O;  3A8T A;  2LGQ A;  3A0R A;  4J10 A;  4LH6 A;  3ASN C;  1GN3 A;  3FB5 C;  2EJ7 A;  1FYJ A;  4DV2 B;  1IVS A;  3WU2 Z;  4WCE V;  3T1H B;  2ZE6 A;  4DV0 O;  2UUC O;  2IJJ A;  2DJV A;  2YXH A;  4K0K B;  5KMG B;  3TET A;  5BR8 B;  1G8M A;  2BSK A;  3W7X A;  2ZQM A;  1DK1 A;  1JX9 A;  3TGU H;  3MDS A;  3FAV A;  4DR2 O;  5C93 A;  5LYJ A;  4U7N A;  5B66 Z;  4IL6 Z;  3H1L H;  2UXC O;  3BPZ A;  1OCO B;  3CRR A;  2QWN B;  2ATK C;  3A0B Z;  2DYS B;  3APO A;  4LF5 B;  1N32 O;  2QSA A;  1QBZ A;  2ZIM A;  3UM7 A;  2YC0 A;  3OAA G;  2A7W A;  2EZP A;  5IY5 C;  4MVU A;  3K57 A;  4NKG B;  1W0J G;  2VQE B;  2E3C A;  5KHI A;  1HNZ B;  2HP8 A;  3JAR B;  4XDJ A;  1CEZ A;  4LF6 B;  1NH2 B;  2ZXW B;  4X66 B;  5JH7 B;  1QVF U;  4MS2 A;  4RUF A;  3F7V C;  1FD9 A;  3ASO C;  1SQX H;  4DO2 A;  5H2F Z;  4JI1 O;  1XL4 A;  2P67 A;  1BS3 A;  2BTO A;  4J7J A;  3N2G A;  1F4M A;  4PA6 A;  3CC2 V;  4MVM A;  2EIL B;  1YI2 V;  3CYO A;  1R6K A;  4MT8 A;  1W2B U;  1U97 A;  2YEV B;  4JYY A;  4DR3 B;  3LNN A;  2AZ2 A;  3L70 H;  1QVG U;  3PJS K;  1JOY A;  1ROP A;  1SC5 B;  2ITC C;  3CXC U;  4DR4 B;  3CE2 A;  4W4K A;  4JI6 B;  1M90 W;  2ARH A;  4I55 A;  1LUV A;  4PV1 B;  4H13 B;  1JFF B;  2YUA A;  2GUZ B;  4DUZ O;  1AI4 A;  3K03 A;  1JJ2 U;  3SYA A;  5JVD B;  1Y67 A;  2UUB B;  4R8C A;  2QEX V;  1WA8 A;  4JTA B;  2F66 C;  2IM9 A;  2YIB D;  4AI8 A;  4JI8 B;  2N05 A;  4I4T B;  1AJP A;  1N4C A;  3G6B A;  2JS3 A;  3JAT B;  4JI5 B;  4JV5 O;  2DN9 A;  3K5M A;  3IGA C;  2V7Q G;  1HNW B;  2XND G;  1EN5 A;  1YZB A;  3LSS A;  4ASU G;  3OW2 U;  3BFR A;  1V54 C;  2HVK C;  3H1H H;  2EUL A;  2F23 A;  4YY3 O;  4WFA V;  4GKJ B;  2PUS A;  3OD4 A;  4DUY B;  2DQ3 A;  4O2A A;  1MOF A;  2JS5 A;  4X89 A;  1NH2 D;  1SZT A;  4JZ2 A;  1THZ A;  4J9Y B;  4HNA B;  5HFL A;  3QF7 A;  4DV2 O;  3ZHU A;  5IYB O;  2EIM B;  3TK1 A;  3F7Y C;  2HJD A;  2Q67 A;  3T1H O;  3ZMZ A;  2JIZ G;  3OGI B;  5A2Q N;  3NR7 A;  5BR8 O;  3Q4H B; 
#chains in the Genus database with same CATH homology
 3U11 A;  4IIJ A;  1KMI Z;  4X1K A;  5EIB C;  5CA1 B;  1JJO A;  4O4I B;  5LP6 B;  3HKB A;  3SGI A;  3JAL B;  4TV8 B;  4YJ3 A;  5KHH A;  5BMV A;  3RYC B;  4JI0 B;  2PY5 A;  4UCR A;  1I7F A;  3MAQ A;  4LR3 A;  4CS4 A;  1Z5V A;  4LFB B;  1M5I A;  4LNU A;  4TQF A;  4UCV A;  1KU9 A;  1DGS A;  4AIL C;  5FPO A;  1D5A A;  3DSQ A;  4O4H A;  4CH4 A;  4KL1 A;  4AHC A;  5EZY A;  1SA0 B;  4X1I B;  4TUY A;  5LP6 C;  5C8Y B;  2VWK A;  1NT2 B;  3SJA C;  4EEQ A;  3JAR A;  2JGU A;  1QHT A;  4OX9 B;  4ZIB A;  2ZIN A;  5JH7 A;  4AQY B;  5CB4 B;  4I55 B;  3BA9 A;  4LFC B;  5IJ9 B;  5JJN B;  4O4J A;  4CS2 A;  4I9Q A;  4B3T B;  1IBK B;  1N33 B;  4LF9 B;  3HKD B;  5GON A;  2UU9 B;  2UXB B;  3BHP A;  5IWA B;  4FM2 A;  4LF7 B;  5EIB D;  3RYF A;  4GLX A;  4FLX A;  4O2B A;  3SR2 C;  4LH7 A;  1N34 B;  5ITZ A;  2R72 A;  4YHH B;  3FFQ A;  4B08 A;  4BW9 A;  4BWA A;  4DV1 B;  1QQC A;  3JSL A;  5EYP B;  1IBM B;  1ZAU A;  3VQW A;  3HKC A;  2ZIO A;  5KHK A;  1FFX A;  5KX5 B;  1TUB A;  4FLT A;  1SQF A;  4U3J A;  4I50 A;  3RYI A;  1JFF A;  2UXD B;  3RYH B;  2P5O A;  5JCO C;  5J2U B;  4O2A B;  4EFB A;  3N2K A;  4TV9 A;  1Q43 A;  4FLW A;  5K1X A;  2PYL A;  4DV5 B;  2GV9 A;  4DRX B;  2ZNI A;  4TQD A;  5LOV A;  1Q5O A;  5LYJ B;  2UUA B;  2XHB A;  1M93 A;  2HEP A;  4DR2 B;  4I4T A;  2KKW A;  4X62 B;  4DR5 B;  4YJ2 B;  2UXC B;  3U10 A;  2P22 C;  2JVD A;  2PGG A;  3JAS A;  3WB0 A;  4CS3 A;  4IIJ B;  5LA6 A;  3RGB A;  4DR1 B;  1X4T A;  1XMO B;  2HHH B;  2F1M A;  5KMG A;  2VQF B;  1XHZ A;  3JAW A;  5IJ0 A;  5D5P A;  4UFZ A;  3CHX A;  1TAE A;  4UCS A;  4O4L A;  3OTO B;  1S5J A;  4F6R B;  2YXL A;  2YIB A;  1B04 A;  1XNR B;  4UCO A;  3E22 A;  4ZI7 A;  5KHG A;  3N2G B;  4PI2 A;  1JMK C;  2ZM6 B;  1WPB A;  4GKK B;  4X1Y A;  5CA0 A;  4TUY B;  4DR7 B;  3A2F A;  3WB1 A;  4CH3 A;  3JAK A;  3RWR D;  3VQV A;  4EB6 B;  5KHJ A;  4UCU A;  4JI7 B;  4JI2 B;  4WBN B;  5CA1 A;  4O4I A;  5LP6 A;  3M7M X;  3JAL A;  4TV8 A;  3RYC A;  4JI3 B;  2VWJ A;  3HKE B;  4B3R B;  5K1P A;  1WNS A;  4K8Z A;  1SKV A;  3T1Y B;  3BAA A;  4PI0 A;  1TVK A;  4EFE A;  4X20 B;  5GON B;  2CAZ C;  1HNX B;  2PYJ A;  5FNV B;  5JQG A;  4CH6 A;  3U0Z A;  3CB2 A;  1SA0 A;  4X1I A;  1J5E B;  4FFB A;  2RJZ A;  5C8Y A;  5ITZ B;  4HBN A;  4DV6 B;  1N36 B;  1XMQ B;  4NXN B;  4ZHQ B;  4UCT A;  3HKC B;  3UT5 A;  4X64 B;  5J2T B;  4JV5 B;  4NXM B;  4K8X A;  4I50 B;  3RYI B;  1FJG B;  5D5Q A;  2QJ1 A;  1L8D A;  2EX3 A;  5FPR A;  2OWO A;  2Q7G A;  1HW7 A;  4DV0 B;  2UUC B;  3ICX A;  3VQY A;  1TGO A;  4ZOL A;  3CSX A;  4CH5 A;  5JVD A;  4LH6 A;  1M4U A;  3OTF A;  4X65 B;  4JYA B;  1XQ8 A;  2E5L B;  4DV2 B;  2YI9 A;  4D7T A;  5EYP A;  2F95 B;  3JSN A;  2BTQ B;  3JAT A;  4DK1 A;  4NVP A;  3T1H B;  3JAS B;  4IHJ A;  4K0K B;  4DV3 B;  1XNQ B;  5KMG B;  1N32 B;  5LXT A;  5J2U A;  5BR8 B;  4X1K B;  4CC6 A;  3WB2 A;  4FLY A;  3BRC A;  3HKB B;  2ZCE A;  4DR6 B;  4YJ3 B;  5BMV B;  1Z5W A;  4L8J A;  2YI8 A;  4FM0 A;  5LYJ A;  4LF8 B;  4HNA A;  3E22 B;  4ZI7 B;  2ZNJ A;  4D7S A;  3BPZ A;  4CC5 A;  4B3S B;  1G6U A;  4Q6G A;  4YJ2 A;  1O9G A;  4LNU B;  5IYZ A;  4PHZ A;  4LF5 B;  4X1Y B;  5CA0 B;  4JI1 B;  3QTC A;  4GYC B;  2ZIM A;  1Q8I A;  2Q0A A;  4O4H B;  5EZY B;  3K57 A;  3BAB A;  2VQE B;  2V4D A;  2E3C A;  3K5O A;  5KHI A;  1RSO A;  1VF7 A;  3SJC C;  1HNZ B;  3JAR B;  3ZS8 C;  3ZED A;  3PN1 A;  4LF6 B;  4FVM A;  1T5E A;  3K59 A;  4FM1 A;  4X66 B;  5JH7 B;  4LF4 B;  4F6R A;  3UQ8 A;  3THO A;  2R70 A;  1TVK B;  4FLZ A;  1XI1 A;  4O4J B;  2BTO A;  3N2G A;  5JQG B;  2RQ6 A;  4DV7 B;  3B2E E;  1O9H A;  4FFB B;  2F93 B;  4DUZ B;  1SQG A;  3RYF B;  5LMN B;  4EB6 A;  4O2B B;  2YIA A;  4WBN A;  4DR3 B;  1Q3E A;  3LNN A;  3RFR A;  3UT5 B;  4LFA B;  4FLU A;  4KHP B;  3HKE A;  4JI4 B;  4DR4 B;  1FFX B;  2OYQ A;  4JI6 B;  1H2S B;  3BA8 A;  1TUB B;  5CB4 A;  3K58 A;  4I55 A;  4U3J B;  1JFF B;  3VQX A;  4ZOL B;  4X20 A;  5IJ9 A;  3SJB C;  5FNV A;  5JVD B;  3N2K B;  4TV9 B;  2UUB B;  3HKD A;  2R9A A;  1I94 B;  2F66 C;  2IM9 A;  4YY3 B;  5JCO A;  4FLV A;  2YIB D;  5LOV B;  1TA8 A;  4JI8 B;  4I4T B;  4DK0 A;  4ZHQ A;  3K5L A;  5JJE B;  3JAT B;  4DV4 B;  5J2T A;  4JI5 B;  4IHJ B;  4B3M B;  3K5M A;  3QG5 A;  1HNW B;  5LXT B;  5KX5 A;  5LA6 B;  2PTM A;  1P49 A;  2F4V B;  2Q7H A;  4GKJ B;  1HR0 B;  3JAW B;  3RYH A;  5IJ0 B;  2PUS A;  2Q7E A;  4DUY B;  4O2A A;  2JS5 A;  5JJJ B;  4O4L B;  2QM4 A;  4HNA B;  3QF7 A;  1V9P A;  4DRX A;  2PZS A;  3ETQ A;  5IYZ B;  1XHX A;  2BTQ A;  4TOI A;  3IAY A;  5LMU B;  3K5N A;  1YEW A;  1IBL B;  3JAK B;  1WN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...