5JJEB

Structure of the srii/htrii complex in i212121 space group ("u" shape)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
b'MGAVFIFVGALTVLFGAIAYGEVTAAAATGDAAAVQEAAVSAILGLIILLGINLGLVAATLGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensory rhodopsin-2
publication title New Insights on Signal Propagation by Sensory Rhodopsin II/Transducer Complex.
pubmed doi rcsb
source organism Natronomonas pharaonis
molecule tags Signaling protein
total genus 28
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2016-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00672 HAMP HAMP domain
B PF17909 Htr2 Htr2 transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5jjeB00
1T5EA 3WB2A 2V4DA 5JJEB 3WB0A 5D5QA 3LNNA 5JJNB 1VF7A 4GYCB 1RSOA 4DK0A 2F1MA 2F93B 4DK1A 5JJJB 3BRCA 1H2SB 3WB1A 4L8JA 5D5PA 2F95B
chains in the Genus database with same CATH superfamily
3ZHVA 1GAXA 4G27B 2KSDA 1L0NH 1XNQB 3NR7A 4JI0B 2FB5A 1WN7A 4NXMO 2DOSA 1H8EG 3ETQA 4CS3A 2XAFA 1KYOF 4TQFA 4DR3B 5C93A 2K9PA 4WFAV 2AZ2A 4CZZA 2Q7HA 1F7YA 2JJ2G 5H6QA 1QBZA 2N05A 1FFTB 3FAVB 4MSWC 3E35A 5BMVA 1R73A 1GTOA 4O4IA 2RQ6A 3CRAA 3Q4HA 1HDJA 3RVYA 1GM8A 2P22C 1NZ6A 3HKEA 4CH5A 4DR4B 3L71H 3S3WA 5CBGA 2QTSA 1UJWB 1KD1W 2B5UA 4MVSA 5EZYA 5H9CA 4JYAO 2UXBO 3RWRD 4UCSA 3WG7C 4WBNB 5FNVB 1OCRC 4FM2A 4LF6O 4DV5B 1H2GA 1M57C 4DV6B 2IJIA 2H3OA 1GN2A 4JI6B 1N4CA 4FLWA 2RDCA 5D5PA 4QPKA 4YJ3A 2Z5UA 2UXDO 3P3NA 1CEZA 2WLIA 4YY3B 2GSMB 4GKJB 1GN6A 1MOFA 2DMXA 3CCMV 3SYCA 1VEWA 3VQYA 2PYLA 5IWAO 1EBOA 1KU9A 4H33A 2ETNA 3HKCB 1NKDA 3H1LH 2R70A 1B04A 4YIPA 4LCUC 3OW2U 3OMIB 3RYFB 1SC5B 1GMGA 1AJQA 3E89A 1N0JA 4DXWA 4LH7A 3STLC 3CCRV 4D7SA 1Q8IA 1P49A 2CH7B 3LSSA 4I55B 4K0KO 1R1BA 2F4VB 1Q3EA 4FMTA 1SQFA 1S3JA 3JCUZ 3CJHA 3ZBHA 1CP9A 1QLEC 5IYCO 5B3SC 3CCUV 1QLNA 4PDVA 1JFFB 5CMUA 4C7UA 3C3SA 1NR7A 2FKXA 1HNZB 1R3KC 1ZSPA 3JSNA 4MW8A 2PI4A 2QKCA 4FLYA 1QVGU 3T4ZA 4MTGA 3AG4B 3DC5A 3CCEV 3F7VC 4JI7B 5BR8B 2VQEB 4BW9A 3ABLB 4UUJC 4FPPA 1VQ4V 1XNQO 4FK5C 2Q5ZA 4JI0O 4O4IB 1IDSA 2YICA 1ZAUA 5JCOC 4GUNA 2X7RB 1M1KW 4JF3A 2XAJA 3AK2A 2YC0A 1YZBA 4JV5B 1PL4A 2KG7B 5D5QA 3HKEB 1PD3A 3M8AA 3N2GA 5IY5B 4MT8A 4AI8A 2LGWA 3GVMA 3RYCA 4RQEA 1RPOA 4WF9V 4LP8A 5EZYB 4B3MB 4JPRA 1M9NA 4BW5A 3K0DA 1YITV 2ILMA 4IIJA 1KUQA 3AG3B 4ICGA 2JGDB 3A0BZ 4CS2A 2ZT9B 3OE7G 1XREA 2LFRA 1WP8A 1KECA 1WP7A 2YIAA 3E8HA 2KKWA 2JRIA 4DR4O 3MD0A 4JYCA 1S76D 4IGGA 4X1KA 5B1BC 2HHHO 3ETDA 3TK1A 3T2MA 4DK0A 1L8DA 2ZDIA 4YJ3B 1TUBA 3P30A 4DV5O 2BTOA 2DYSC 4GKKB 2HJDA 2WLIB 4DV6O 2ADPA 2Q7GA 2YXLA 2GTAA 2DYRB 2ZE5A 4JI6O 5B1OA 1NS1A 3SJCC 2X6CA 1XBLA 1Q43A 1GM7A 1UPGA 3FFQA 2YIBA 4O4LA 1U96A 4A5UB 2ZNIA 1ENVA 3A8TA 1VQMV 2F23A 3CE2A 4YY3O 2E3CA 3D3QA 4X64B 1TA8A 3DSQA 5B1AB 4GKJO 3JALA 3SJQC 2V1DA 3K79A 2YXYA 2Y0PA 4FM0A 1FJGB 1X4TA 4HNAA 1PNLA 1BS3A 3L73H 3RYHA 4XDKA 5EC2C 4OPHA 4JAUA 1Y76A 2Q0OC 3G80A 3K0GA 3CCVV 3OTOB 2LO1A 2P06A 3CJHB 1H2LA 2PTMA 1YCIA 5LA6B 1I7FA 3M7MX 2F4VO 4Z1VA 3QVNA 3THOA 4YIOA 3RVZA 4W4LA 5LOVA 3L9DA 3HPLC 3UQ8A 2E75B 1R3LC 1V54B 2VRZA 5F2VO 1FAFA 3ZHTA 1JX9A 1HNZO 3AEIA 4F6RA 1DTOA 3AG4C 2LW1A 4FIPC 3LSQA 4X66B 1NU1H 3N2KA 4UCVA 3B09A 4U3FH 2ZCEA 1S5JA 4JI7O 2VQEO 3BABA 2C2AA 2EZPA 3L70H 2PZSA 1FD9A 5BZBA 5A2QN 3ABTA 4JI2B 3RGBA 1BE3H 1XL6A 4DV0B 2X6AA 4GYCB 1SETA 5IY5C 5KUMA 4DV3B 4ZOLA 2NN4A 1OZ0A 3RT3C 2HFEC 3WU2Z 4JV5O 1G8MA 3BVOA 4PDMA 1MNGA 4GX0A 3AG3C 5KUKA 4WFGA 4B3MO 5BXZA 3ZHUA 2ITCC 2QE7G 1PNMA 2Q8VA 4LF8B 1FS0G 2ZXWC 4B3SB 3T1CA 1MG1A 4JZGA 4KL1A 1YI2V 3VQVA 1TUBB 2YIBD 4TWKA 5LMUB 3KKYA 3HB3B 2CGNA 4JI3B 2WA3A 4NR1A 1FPOA 2UXCB 2Y0IA 1FXKA 1URFA 3ZN1A 2YIDA 3EVKA 3W7SA 2IM9A 1SESA 2DJVA 4FLZA 2LGQA 4GKKO 3G4SV 4QPJA 1RSOA 2Y69B 2HVKC 4U7NA 2EIJB 2F1MA 1ZL8B 1I08A 3JALB 4DK1A 2YEVB 3QO7A 2W0FC 4UV9A 4HZ3A 3DXRB 1L1FA 2WA4A 1WA8A 2M6YA 4I4TB 5B1AC 4TV8A 1YTFD 4HNAB 3CCSV 4X64O 4P30A 4LWSA 2X0LA 1R6KA 3MAQA 5LP6A 1Y76B 2KQXA 3QO5A 1VQ9V 2OYQA 1EN6A 3FB6C 1YTFB 3B40A 5KMGB 1FJGO 1VF6A 1XMOB 5L3DA 2EIMB 2IBZH 4DR2B 4X65B 1S0VA 2Q4PA 3BHPA 4JYBA 4I50A 3OTOO 1N36B 2ZE8A 1W0KG 3SPJA 4FFBA 1ZLZA 1YVWA 4IHJB 3GWOA 2IJHA 4BR6A 1M90W 1P84F 1N33B 3WB1A 5FPRA 3ZRXA 4R6ZA 3IGAC 3P32A 1SQGA 2CGOA 3G67A 2K1EA 1H2KA 3AG7A 1BQZA 1V54C 2V4DA 4IT5A 1BSMA 3FYEB 3ZHQA 1WB7A 2ARHA 4DV2B 2DE0X 2UU9B 2UUCB 1US6A 3D3IA 4HYOA 1Y74A 2IW5A 1P7BA 4X66O 2P90A 1QCEA 3CRCA 4RUEA 5J9PC 4MTXA 3L75H 1SQQH 2EJRA 1LUVA 1O9HA 1JMKC 4UCUA 3UT5A 2LFSA 4MVMA 4JI2O 1SQPH 4IYHA 4DV0O 5LL6Y 1KKDA 4DV3O 2ADQB 1CPYA 2IH3C 1IZ3A 4J41A 4IL6Z 2EIKC 1AVMA 2RN9A 4WFFA 1MABG 1YXBA 3JAKA 1G1XB 3JYCA 3JATA 2ZKOA 1Z2GA 1HWYA 5IYBO 1FXKB 3GB7C 2EILB 3CP1A 5JH7A 5LXTB 5CA1A 4LF8O 3GWKC 4B3SO 5IJ0B 1Q5OA 3ML0A 2Q73A 4O2BA 5FLXN 1GO3F 3OUFA 2Y4UA 1K5SA 2GV9A 5LMUO 1BCCH 1NTZH 4JI3O 2EX3A 3WB2A 4NB5A 1I94B 2UXCO 4AILC 1XOUA 4J7ZA 4J9YB 3ZHRA 2Y69C 5EYPB 4BWAA 1K4CC 4TV8B 4R50A 1EM1A 2CUGA 3JAWB 4LF5B 3ZCCA 5J2TA 5KX5B 3ASOB 1SA0B 1PL0A 4CH6A 2XASA 5LGTA 1BL8A 4LC1A 3SPCA 2JEUA 1BMFG 3E83A 4NYKA 3H01A 1TVKB 5CBFA 4B3TB 1W0JG 2HLDG 4BIZA 1G6UA 4ZIBA 4MTFA 4UCRA 1JQ0A 4LFBO 1F51A 4NXNB 3CC2V 3B77A 4CC6A 2E76B 1GH6A 3OMAB 2M7WA 5LHHA 2JK5C 3CMAV 2BOCC 4RUFA 4F4LA 1XMOO 3J7AU 1TGOA 4PELA 4DR2O 3RYIA 4CH4A 4PD4F 2Q9LA 2Z0AA 4FLXA 4LNUA 2AZ0A 4OPAA 2GBOA 1N36O 2W0XA 4X1YB 1NQTA 2JDIG 4DV1B 4DR5B 2ZIOA 4O2AB 3B8MA 1M4UA 1N33O 2OWOA 5CA0A 4UCTA 1IBLB 1K33A 3C90A 4KXRA 4HAMA 3E22B 3JCZA 2ZM6B 4UB6Z 4DV2O 2QWQB 3O65A 2UU9O 1HR0B 2UUCO 1NTMH 1Q86W 1FXHA 5IJ9A 1OHHG 5CN0A 2F66C 2L35A 1D5NA 1H8HG 4OX9B 4DR1B 3T1HB 4OXSA 1BHBA 1AP6A 3JAKB 2Q6AA 4IYIA 3TJTA 1M56B 3OUSA 3CCLV 4FM1A 2N74A 2QDOA 2EZOA 5JH7B 5LBQA 4Q20A 5H5NA 2VWKA 1H2MA 1KBHA 3FB5C 2EILC 3S3XA 2NR5A 3OMNB 3LDCA 1O9GA 4U3JA 2Y48A 3CWBH 1T5EA 5FPOA 1YJWV 2QWRB 4BIUA 1AP5A 4XDJA 3CYOA 1VQNV 2HEPA 2YI8A 4H0LB 4ZI7A 3AG1B 5E79Z 4G2KA 1AJNA 1AI4A 1X59A 5HFLA 3QG5A 4PI2A 2LJ2A 4X1IA 3H9VA 1I94O 3IAYA 5BMVB 1WB8A 1DF5A 1YIJV 4WFHA 4D6TH 1AILA 3BAAA 4JI1B 5J2TB 3Q4HB 4DR3O 5E1AC 1K34A 2WLLA 3K58A 2OTLV 4O4HA 3ASOC 2BTQA 3ASNB 1KP2A 3X2QB 4YJ2A 4N23A 3CSXA 1IURA 3BA9A 4LF5O 3SJBC 4DR7B 2DWDC 1Y67A 1MMMA 4L8JA 3RW0A 2Q7EA 1YDXA 4G28B 1KB9F 4B3TO 2XTAA 3K5OA 2P5OA 1HW7A 1NR1A 5IT9N 4DW1A 2WWWA 4B08A 1KMIZ 1ZUQA 5LGNA 3RYIB 1OCZB 4NXNO 3SYAA 4LNUB 4RO2A 4K3AA 4MVUA 1L0LH 1RM1B 2Y4TA 1P4RA 1OCOB 3D36C 1JOYA 2CTPA 4JTDB 1NVPD 5B5EZ 4GZRB 4X20A 2XHBA 4DV4B 2RMKB 5CA0B 2PUSA 2HR3A 1XQ8A 4QNHB 1VF5B 5DEDA 1Q6UA 1YEWA 3VBBA 5B1NA 4DV1O 4DR5O 1NVPB 3ABKB 1AI6A 4TQDA 5JQGA 3KCXA 1W59A 4EEQA 3RBZA 2ITDC 3W7TA 2UUBB 3E8FA 1LUWA 5ITZA 1IBLO 3RN4A 3I56V 2QA4V 4GCZA 1AR5A 4ZHQA 4RQFA 2O57A 4AQYB 1Q6HA 1A32A 4LF4B 3IC7A 4YXWG 1Q90D 2EBOA 1EN5A 4PV1B 2ZE6A 4CH3A 1VQ6V 3OM3B 1ZTEA 3TETA 4GX1A 1H2SB 4OX9O 4DR1O 3T1HO 4MW3A 5EIBD 3SPIA 3FYIB 4TT3G 2DW4A 2CK3G 3BY6A 2HP8A 1AROP 5JJEB 1GM9A 4D7TA 1YF2A 4X8AA 1MZFA 1J5EB 2BSKA 4J11A 1CXZB 3SYOA 1XL4A 5LGUA 2HG5C 3ZN0A 2JVDA 1EFRG 4TUYA 2CAZC 2FL4A 1N34B 4I5SA 3FX7A 2ZIMA 4FFKA 3LDDA 3QF7A 1KP3A 2QKSA 4UVAA 3SGIA 1F4NA 2E5LB 2WPDG 3E8GA 1BQ0A 3C3TA 3A0RA 4GX2A 3OAAG 4NTYA 4EB6A 5A9GA 3AG1C 5J2UA 2P7TC 5LYJA 5EBLC 2F43G 1FFXA 1YHQV 2F93B 3ABLC 4DYLA 1XNRB 2IJKA 4FLUA 1EZJA 4DRXA 5BR8O 3H1JH 4DUYB 4DO2A 3N2GB 1SZTA 1GN4A 4YJ2B 2OIEA 2ZD9A 3LNNA 4JI1O 3RYCB 3ZEDA 1NH2D 4JYYA 3MDSA 4X9QA 1AR1B 4JI8B 2Q69A 3X2QC 4IIJB 2WAMA 3CC4V 4FLVA 2B9ZA 1SKVA 1WPXA 4WCEV 5IYZA 4JAVA 5L3EA 3ZMTA 4DR7O 4X1KB 1S5HC 3FD9A 2YS8A 4RAIA 4JTCB 1Y66A 1S77D 4UVBA 4B3RB 4OGQB 3KG2A 1OCOC 1R6TA 3IJ4A 3SPHA 4JGSA 4MVRA 2CE4A 2BOBC 2H8PC 1YJ9V 1IVSA 4I0XA 1UFIA 4MVZA 1N8RW 2DYRC 4O4LB 2A7WA 5JQGB 4DV4O 4KP4A 1GK9A 2D2CB 5ITZB 2Q68A 3ABKC 3T4DA 2DWEC 1GN3A 1AB3A 3OD4A 3UM7A 3CC7V 3HKDA 1ZX3A 3ZRWA 3K04A 1N0NA 2UUBO 3RYHB 1BGYH 1XUQA 2YDEA 3ETGA 2P67A 4AHCA 2GUZA 1RPRA 3ZIAG 4J80A 1V55B 2A9HA 4AQYO 2PYJA 5AG2A 2W6IG 1BZKA 3ZS8C 4DV7B 4PDLA 4LFAB 2L6LA 4GLXA 5JCOA 2BSKB 4CC5A 3QO8A 3FAVA 5KA5A 2Z3YA 4X88A 3CB2A 4PA9A 3CMEV 1QU7A 3J80N 4EFBA 2YUAA 5LOVB 3IC9A 3D8CA 1J5EO 3APOA 4Q6GA 1IBKB 2WLNA 4O4JA 1SRYA 2QWPB 4F6RB 4EB6B 2PI5A 1N34O 3FKSG 3W7XA 1MSDA 3ZMZA 1FKAO 5KAFZ 3LNMB 2YSUB 3N2KB 4KFMA 5FNVA 4WBNA 3L72H 2E5LO 4DRXB 1Z5VA 2FYUH 3UCSC 3DC6A 3ZMVA 3R65A 1AI7A 2WSSG 2F95B 1S72V 2QWNB 5KHKA 1XNRO 2DQ3A 1M93A 2FTKA 4J42A 5GTHZ 4Z2WA 2PF4E 2DN9A 4ZOLB 4BAYA 4PDRA 4DUYO 3PJSK 4UVCA 2LW7A 3K08A 3CX5F 5IYZB 3CD6V 1ORQC 4QIWF 4K8ZA 3ABMB 3K9SA 4JI8O 3TCUA 2YXHA 4PHZA 1K97A 4X62B 1THZA 1DF4A 2YI9A 1TAEA 3U10A 2V7QG 2WLHA 1VQLV 3RFRA 2ZDIC 3RYFA 3OEEG 4PA4A 5KA6A 1ZWIC 1XMQB 4QGPA 4ZKIA 3DTUB 4L87A 1BT8A 2B1IA 3APQA 1F23A 4B3RO 2LQTA 3KZIZ 1PP9H 4XBFA 1RSOB 5B3SB 3BEHA 3ICXA 2XOKG 1Z5WA 4H13B 1AI5A 2JS3A 3P3PA 4UFZA 5JJJB 4LF9B 1WA8B 3ZRWB 2EIJC 1JFFA 4PI0A 1JCHA 4J9ZB 3UO2A 2P4VA 4UB8Z 4LWSB 1NI8A 1W2BU 3K03A 2VQFB 4MVOA 2GUZB 4EKWA 2WLKA 3JASA 5LP6B 3SJAC 2QTOA 2QWOB 1JJ2U 4DUZB 3W7WA 1GKFA 1OV9A 2QJ1A 3TGUH 4LFCB 2CTWA 1V55C 3HR0A 3AK3A 2IJJA 3BRCA 1VQ5V 4JI4B 4LF7B 3SYPA 5KHJA 1I5YA 4I50B 3ZX6A 3F7YC 2EIMC 1V9PA 4FFBB 3J81N 4DV7O 2XAGA 2KB1A 4LFAO 2UXXA 5CB4A 1XDCA 2KG7A 5EK0A 4O4JB 3BFRA 2ZR3A 4X65O 1D5AA 1KKCA 2AHYA 3QTCA 1QHTA 2ZINA 1GRJA 1K4DC 2HHHB 1FXVA 3OGIB 4B7EA 2H94A 2JGDA 3EXAA 5B1BB 3LSUA 1IBKO 4DW0A 4JI5B 1S5LZ 2CTQA 3IFXA 4PA3A 3HKBA 3B4SA 1E79G 3OGCC 1Y74B 2QM4A 2LP7A 2BCCH 3FB8C 1XI1A 2DYSB 3L74H 5IDJA 2X6BA 5JVDA 3SPGA 3OR6C 3BCCH 2CTRA 4JTAB 4YHHB 1D2DA 1VMGA 5L3FA 2ATKC 3UT5B 1R6NA 4KHPB 4LBEC 1E1QG 1IBMB 3NXSA 1XHZA 1IXMA 2UUAB 5C8YA 3UO3A 3PN1A 1VQ7V 3JATB 3ABMC 1I0HA 1KQSU 1K92A 5IYDO 3JD0A 2AXTZ 4XDLA 1VARA 1E1RG 2MW2B 5CA1B 1H2NA 4CS4A 1JPXA 1YJNV 2WLMA 2ZNJA 4X62O 1KC8W 4BIOA 2HKOA 4ASUG 4O2BB 1FXKC 3F5TA 1MSWD 4DR6B 3I55V 4ZBMA 1J95A 4P9OA 1HNWB 1XMQO 5LHIA 1OCCB 5LHGA 3EHBB 4LH6A 5LMNB 5LA6A 2ZR2A 5KAIZ 3G6BA 3MHHC 3T1YB 3JD4A 3JASB 4R7CA 3JD3A 2JIZG 2FMLA 1JR9A 2ODMA 3E2EA 4KUMA 1B06A 4LF9O 1G4YB 5LP6C 5EBWC 1DK1A 3CRRA 2VQFO 3AG2B 4NTWA 2EINB 4DUZO 1JJOA 1VF6C 4FZ0A 3ABUA 3ZMSA 4LFCO 1K3EA 2OT5A 1QR8A 5CB4B 2HVJC 2D3OW 4JI4O 3B8NA 2R72A 4LF7O 4J7KA 4I9WA 3R66A 1QVFU 1QQCA 3SR2C 2ZQMA 2QM8A 1WPBA 5KHGA 3K5MA 4H37A 5GONA 5TISZ 2G38A 3JARA 1Q81W 5BY1A 3TXQA 1WJZA 4E2LA 1JA8A 3HKBB 2ZXWB 1NTKH 2W6JG 1K7DA 2QKAA 4F6EA 4JASA 5JVDB 2GDSA 3KCYA 2WLJA 1SF9A 4QE7A 4JI5O 2QEXV 3QNEA 3G71V 2A0LA 5IJ9B 2R9RB 3SYQA 2XT9A 3BA8A 1Q82W 1PNKA 4PA6A 2IU3A 2ZM6O 4NVPA 4TSFG 1COWG 4K8XA 4K35A 2XAHA 4PJ0Z 4UCOA 4MS2A 5C8YB 1HR0O 4YHHO 4P9PA 5L3BA 2QM7A 2QSAA 3CHXA 4KHPO 4PA7A 5DM6V 3W7UA 1IBMO 1ZL8A 2YEVA 1OJHA 1SERA 4JAAA 2UUAO 1N32B 1K73W 3DXRA 4NKGB 5DECA 1M56C 4I4TA 1NT2B 3H1HH 4H44B 2OCCB 3OFNG 1I5XA 1ROPA 3ETEA 1IX9A 3G6EV 4U3JB 2OIGA 2Q0AA 1H38A 1PKXA 1PPJH 5KMGA 4ZI7B 2Q67A 5KHHA 2E74B 2R9AA 3U0ZA 2NLJC 3VOUA 1VIBA 3AK1A 1M5IA 4X1IB 4DR6O 3K57A 1U97A 5CA3A 1R3JC 1OCCC 3OR7C 1HNWO 1SQBH 2PY5A 5K1PA 2A3QA 1DLBA 3N27A 4IHJA 3MHSC 4J7JA 2WLLB 5LMNO 3A2FA 4R8CA 3ZRSA 3CS5A 1MZEA 4O4HB 2BTQB 4I9QA 1WNSA 3T1YO 2GTSA 1RFYA 2HJFC 1AR4A 1SQVH 4QE9A 5GW7A 1Y4MA 3ASNC 3AG2C 2EINC 1K8AW 1BHAA 2QR4A 1VQ8V 3LDEA 4J10A 1NH2B 3CCJV 1EZVH 2XNDG 1YSCA 1Q7YW 5H2FZ 1IXBA 1VF7A 5GONB 4CBCA 5DN6G 3JARB 1OCZC 3O9OA 3FB7C 3WFVA 3A0HZ 4X20B 4MTOA 3ZMUA 1RM1C 3OEHG 4TV9A 2OTJV 5H6RA 1WAZA 2EJ7A 1HNXB 2EIKB 4JZ2A 3OT7A 3CXHF 4NTXA 3CPWU 3CEIA 1QR9A 3ZHSA 3H1IH 2RCVA 5GTIZ 4GT1A 4P2ZA 3STZC 1PV0A 2JEXA 4MVQA 1PM9A 1WLEA 1SZXA 3CXCU 4NXMB 3E8BA 4ABMA 4E4EA 4ZHQB 5LXTA 1SS3A 1VQOV 5IJ0A 1LR1A 5JWPA 4I7ZB 4EFEA 1MA1A 1HP8A 3LUTB 5CBHA 3JAMN 3K06A 4FZ1A 2AHZA 2OCHA 4X89A 3EFFK 4N21A 3CRMA 5EC1C 4LF4O 2AGAA 1LNQA 1FYJA 4B7KA 5KLVH 2DQ0A 5EYPA 4W4KA 2R9IA 3CCQV 1XHXA 1NBMG 3UKMA 2A06H 3JAWA 4Z1MG 2JS5A 3WB0A 1VQKV 4TUYB 5JJNB 1VQPV 2VWJA 5EBMC 2IH1C 4LR3A 4LFBB 1RP3B 2OCCC 3F5WC 5KX5A 4JYAB 1SA0A 1JVMA 4TOIA 2NNUA 1N32O 3OTFA 2UXBB 5IE9A 5EIBC 5B66Z 3JSLA 1TVKA 4LF6B 3JD1A 3K3WA 3I5DA 1B3QA 4RWUA 3WG7B 1R3IC 5J2UB 3ZJZA 1OCRB 3CRQA 5LYJB 1Y6XA 1FFXB 1M57B 2MK3A 2AW9A 2XUMA 2GHYA 2UXDB 4FVMA 5K1XA 3D36A 2ZE7A 3B2EE 2N04A 4X1YA 1B6QA 4WFEA 2UXNA 2RNBA 4WFBV 4FLTA 3K9AA 4O2AA 5IWAB 4QJFB 3ZRVA 5KHIA 3BPZA 1P7GA 5L3CA 1Q6IA 1XILA 1F4MA 3VQXA 5FL7G 3VQWA 4HBNA 3E22A 3DGEA 3JD2A 2IU0A 1NJIW 1AJPA 4UV8A 1SQXH 3HKCA 5L3GA 4TV9B 2B1GA 2JGUA 4K0KB 2VS0A 3M99B 3SDLA 1QNMA 4GX5A 3H1KH 2QGNA 4I0XB 3TXSA 2CDYA 4U7OA 2XAQA 1EN4A 2CH7A 3K5LA 4I55A 2A79B 3U11A 3E86A 1K9MW 2PGGA 1HNXO 1QLEB 3K59A 2EULA 1DGSA 2P4KA 5HFMA 3K5NA 1VP7A 1K5QA 1XEQA 4UXNA 2JJ1G 1TUEB 4FJCC 3HKDB 2BE3A 2P6JA 2RJZA
chains in the Genus database with same CATH topology
4I4TB 4DR6B 4TV8A 4HNAB 1HNWB 1XNQB 5JJEB 4JI0B 1WN7A 4D7TA 3MAQA 1J5EB 3ETQA 4CS3A 5LP6A 5LMNB 4LH6A 2JVDA 5LA6A 2OYQA 4TQFA 4DR3B 4TUYA 2CAZC 1N34B 2Q7HA 3T1YB 5KMGB 3JASB 2ZIMA 1XMOB 3QF7A 5BMVA 3SGIA 4O4IA 2E5LB 4DR2B 2RQ6A 4X65B 5LP6C 3BHPA 4I50A 5J2UA 4EB6A 1N36B 2P22C 5LYJA 4FFBA 1FFXA 4IHJB 3HKEA 2F93B 1XNRB 1JJOA 4CH5A 1N33B 4DR4B 4FLUA 3WB1A 5FPRA 4DRXA 5EZYA 4DUYB 1SQGA 3RWRD 3N2GB 4UCSA 4YJ2B 5CB4B 4WBNB 5FNVB 2V4DA 4FM2A 3LNNA 2R72A 3RYCB 3ZEDA 4DV5B 4DV2B 4DV6B 4JI8B 1QQCA 3SR2C 2UU9B 2UUCB 4IIJB 1WPBA 4JI6B 5KHGA 3K5MA 5GONA 4FLVA 1SKVA 3JARA 4FLWA 5D5PA 5IYZA 4YJ3A 3HKBB 4X1KB 4YY3B 1O9HA 1JMKC 4GKJB 4UCUA 3UT5A 5JVDB 4B3RB 3VQYA 2PYLA 1KU9A 5IJ9B 3BA8A 3HKCB 2R70A 3JAKA 1B04A 3JATA 4NVPA 4O4LB 4K8XA 5JQGB 3RYFB 4UCOA 5C8YB 5ITZB 5LXTB 5JH7A 4LH7A 5CA1A 4D7SA 3CHXA 1Q8IA 5IJ0B 1P49A 4I55B 1Q5OA 4O2BA 3HKDA 2F4VB 2GV9A 1Q3EA 1N32B 1SQFA 2EX3A 3WB2A 1I94B 4I4TA 3RYHB 4AILC 1NT2B 4AHCA 1JFFB 2PYJA 5EYPB 4U3JB 4BWAA 4TV8B 3ZS8C 1HNZB 2Q0AA 4DV7B 3JSNA 3JAWB 4FLYA 4LFAB 5KMGA 4ZI7B 5JCOA 4CC5A 4GLXA 4LF5B 5KHHA 2R9AA 3U0ZA 3CB2A 5J2TA 5KX5B 1SA0B 4CH6A 4JI7B 1M5IA 4X1IB 5BR8B 2VQEB 4BW9A 4EFBA 3K57A 5LOVB 1TVKB 4B3TB 2PY5A 5K1PA 4O4IB 1G6UA 4IHJA 4Q6GA 4ZIBA 1IBKB 4O4JA 1ZAUA 5JCOC 3A2FA 4UCRA 4NXNB 4F6RB 4EB6B 4CC6A 4O4HB 2BTQB 4I9QA 1WNSA 4JV5B 3HKEB 5D5QA 3N2GA 3N2KB 1TGOA 4WBNA 5FNVA 4DRXB 3RYCA 1Z5VA 3RYIA 4CH4A 4B3MB 5EZYB 4FLXA 4LNUA 4IIJA 4X1YB 2F95B 4CS2A 4DV1B 4DR5B 2ZIOA 4O2AB 5KHKA 2YIAA 2KKWA 1M4UA 1M93A 2OWOA 4ZOLB 5CA0A 4UCTA 4X1KA 1VF7A 1IBLB 5GONB 3JARB 3E22B 4DK0A 5IYZB 4X20B 2ZM6B 1L8DA 4TV9A 4YJ3B 1TUBA 4K8ZA 2BTOA 1HNXB 4GKKB 2Q7GA 4PHZA 1HR0B 2YXLA 5IJ9A 4X62B 3SJCC 2F66C 2YI9A 1Q43A 1TAEA 4OX9B 4DR1B 3T1HB 3U10A 3FFQA 2YIBA 4O4LA 2ZNIA 3RFRA 3RYFA 2E3CA 4X64B 1XMQB 3JAKB 1TA8A 4NXMB 4ZHQB 3DSQA 5LXTA 3JALA 5IJ0A 4EFEA 4FM0A 4FM1A 5JH7B 1X4TA 4HNAA 1FJGB 3ICXA 1Z5WA 3RYHA 2VWKA 4UFZA 5JJJB 4LF9B 1JFFA 4PI0A 5EYPA 1O9GA 3OTOB 4U3JA 1T5EA 5FPOA 2VQFB 1XHXA 2PTMA 5LP6B 3JASA 2HEPA 3SJAC 3JAWA 2YI8A 4DUZB 2JS5A 5LA6B 3WB0A 4ZI7A 1I7FA 4TUYB 5JJNB 3M7MX 2QJ1A 2VWJA 4LR3A 4LFBB 4JYAB 4LFCB 5KX5A 1SA0A 4TOIA 3QG5A 3THOA 3OTFA 4PI2A 2UXBB 4X1IA 3IAYA 5BMVB 5EIBC 3BRCA 3JSLA 5LOVA 1TVKA 4JI4B 4LF6B 3BAAA 4JI1B 4LF7B 5J2TB 5KHJA 3UQ8A 4I50B 5J2UB 5LYJB 1V9PA 4FFBB 3K58A 4F6RA 1FFXB 4O4HA 2BTQA 4YJ2A 4X66B 5CB4A 3CSXA 3BA9A 4O4JB 3N2KA 3SJBC 4DR7B 2UXDB 1D5AA 3QTCA 4UCVA 4FVMA 2ZCEA 1S5JA 1QHTA 4L8JA 2ZINA 3B2EE 5K1XA 3BABA 2HHHB 2Q7EA 2PZSA 4X1YA 3K5OA 2P5OA 1HW7A 4FLTA 4JI2B 3RGBA 4B08A 1KMIZ 4O2AA 4JI5B 4DV0B 3RYIB 5IWAB 3HKBA 4GYCB 4DV3B 4LNUB 5KHIA 4ZOLA 2QM4A 3BPZA 1XI1A 3VQXA 3VQWA 4HBNA 3E22A 5JVDA 4X20A 2XHBA 4DV4B 5CA0B 2PUSA 1XQ8A 4YHHB 3UT5B 4LF8B 4B3SB 1YEWA 4KHPB 3HKCA 1IBMB 4TV9B 2JGUA 4KL1A 4K0KB 3VQVA 1TUBB 2YIBD 1XHZA 4TQDA 5LMUB 5JQGA 2UUAB 4EEQA 4JI3B 5C8YA 2UUBB 2UXCB 3PN1A 5ITZA 3JATB 2IM9A 4ZHQA 3K5LA 4I55A 4AQYB 3U11A 4LF4B 4FLZA 2PGGA 3K59A 1DGSA 5CA1B 3K5NA 1RSOA 4CS4A 2ZNJA 4CH3A 2F1MA 3JALB 4DK1A 4O2BB 3HKDB 1H2SB 5EIBD 2RJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T5E A;  3WB2 A;  2V4D A;  5JJE B;  3WB0 A;  5D5Q A;  3LNN A;  5JJN B;  1VF7 A;  4GYC B;  1RSO A;  4DK0 A;  2F1M A;  2F93 B;  4DK1 A;  5JJJ B;  3BRC A;  1H2S B;  3WB1 A;  4L8J A;  5D5P A;  2F95 B; 
#chains in the Genus database with same CATH topology
 3ZHV A;  1GAX A;  4G27 B;  2KSD A;  1L0N H;  1XNQ B;  3NR7 A;  4JI0 B;  2FB5 A;  1WN7 A;  4NXM O;  2DOS A;  1H8E G;  3ETQ A;  4CS3 A;  2XAF A;  1KYO F;  4TQF A;  4DR3 B;  5C93 A;  2K9P A;  4WFA V;  2AZ2 A;  4CZZ A;  2Q7H A;  1F7Y A;  2JJ2 G;  5H6Q A;  1QBZ A;  2N05 A;  1FFT B;  3FAV B;  4MSW C;  3E35 A;  5BMV A;  1R73 A;  1GTO A;  4O4I A;  2RQ6 A;  3CRA A;  3Q4H A;  1HDJ A;  3RVY A;  1GM8 A;  2P22 C;  1NZ6 A;  3HKE A;  4CH5 A;  4DR4 B;  3L71 H;  3S3W A;  5CBG A;  2QTS A;  1UJW B;  1KD1 W;  2B5U A;  4MVS A;  5EZY A;  5H9C A;  4JYA O;  2UXB O;  3RWR D;  4UCS A;  3WG7 C;  4WBN B;  5FNV B;  1OCR C;  4FM2 A;  4LF6 O;  4DV5 B;  1H2G A;  1M57 C;  4DV6 B;  2IJI A;  2H3O A;  1GN2 A;  4JI6 B;  1N4C A;  4FLW A;  2RDC A;  5D5P A;  4QPK A;  4YJ3 A;  2Z5U A;  2UXD O;  3P3N A;  1CEZ A;  2WLI A;  4YY3 B;  2GSM B;  4GKJ B;  1GN6 A;  1MOF A;  2DMX A;  3CCM V;  3SYC A;  1VEW A;  3VQY A;  2PYL A;  5IWA O;  1EBO A;  1KU9 A;  4H33 A;  2ETN A;  3HKC B;  1NKD A;  3H1L H;  2R70 A;  1B04 A;  4YIP A;  4LCU C;  3OW2 U;  3OMI B;  3RYF B;  1SC5 B;  1GMG A;  1AJQ A;  3E89 A;  1N0J A;  4DXW A;  4LH7 A;  3STL C;  3CCR V;  4D7S A;  1Q8I A;  1P49 A;  2CH7 B;  3LSS A;  4I55 B;  4K0K O;  1R1B A;  2F4V B;  1Q3E A;  4FMT A;  1SQF A;  1S3J A;  3JCU Z;  3CJH A;  3ZBH A;  1CP9 A;  1QLE C;  5IYC O;  5B3S C;  3CCU V;  1QLN A;  4PDV A;  1JFF B;  5CMU A;  4C7U A;  3C3S A;  1NR7 A;  2FKX A;  1HNZ B;  1R3K C;  1ZSP A;  3JSN A;  4MW8 A;  2PI4 A;  2QKC A;  4FLY A;  1QVG U;  3T4Z A;  4MTG A;  3AG4 B;  3DC5 A;  3CCE V;  3F7V C;  4JI7 B;  5BR8 B;  2VQE B;  4BW9 A;  3ABL B;  4UUJ C;  4FPP A;  1VQ4 V;  1XNQ O;  4FK5 C;  2Q5Z A;  4JI0 O;  4O4I B;  1IDS A;  2YIC A;  1ZAU A;  5JCO C;  4GUN A;  2X7R B;  1M1K W;  4JF3 A;  2XAJ A;  3AK2 A;  2YC0 A;  1YZB A;  4JV5 B;  1PL4 A;  2KG7 B;  5D5Q A;  3HKE B;  1PD3 A;  3M8A A;  3N2G A;  5IY5 B;  4MT8 A;  4AI8 A;  2LGW A;  3GVM A;  3RYC A;  4RQE A;  1RPO A;  4WF9 V;  4LP8 A;  5EZY B;  4B3M B;  4JPR A;  1M9N A;  4BW5 A;  3K0D A;  1YIT V;  2ILM A;  4IIJ A;  1KUQ A;  3AG3 B;  4ICG A;  2JGD B;  3A0B Z;  4CS2 A;  2ZT9 B;  3OE7 G;  1XRE A;  2LFR A;  1WP8 A;  1KEC A;  1WP7 A;  2YIA A;  3E8H A;  2KKW A;  2JRI A;  4DR4 O;  3MD0 A;  4JYC A;  1S76 D;  4IGG A;  4X1K A;  5B1B C;  2HHH O;  3ETD A;  3TK1 A;  3T2M A;  4DK0 A;  1L8D A;  2ZDI A;  4YJ3 B;  1TUB A;  3P30 A;  4DV5 O;  2BTO A;  2DYS C;  4GKK B;  2HJD A;  2WLI B;  4DV6 O;  2ADP A;  2Q7G A;  2YXL A;  2GTA A;  2DYR B;  2ZE5 A;  4JI6 O;  5B1O A;  1NS1 A;  3SJC C;  2X6C A;  1XBL A;  1Q43 A;  1GM7 A;  1UPG A;  3FFQ A;  2YIB A;  4O4L A;  1U96 A;  4A5U B;  2ZNI A;  1ENV A;  3A8T A;  1VQM V;  2F23 A;  3CE2 A;  4YY3 O;  2E3C A;  3D3Q A;  4X64 B;  1TA8 A;  3DSQ A;  5B1A B;  4GKJ O;  3JAL A;  3SJQ C;  2V1D A;  3K79 A;  2YXY A;  2Y0P A;  4FM0 A;  1FJG B;  1X4T A;  4HNA A;  1PNL A;  1BS3 A;  3L73 H;  3RYH A;  4XDK A;  5EC2 C;  4OPH A;  4JAU A;  1Y76 A;  2Q0O C;  3G80 A;  3K0G A;  3CCV V;  3OTO B;  2LO1 A;  2P06 A;  3CJH B;  1H2L A;  2PTM A;  1YCI A;  5LA6 B;  1I7F A;  3M7M X;  2F4V O;  4Z1V A;  3QVN A;  3THO A;  4YIO A;  3RVZ A;  4W4L A;  5LOV A;  3L9D A;  3HPL C;  3UQ8 A;  2E75 B;  1R3L C;  1V54 B;  2VRZ A;  5F2V O;  1FAF A;  3ZHT A;  1JX9 A;  1HNZ O;  3AEI A;  4F6R A;  1DTO A;  3AG4 C;  2LW1 A;  4FIP C;  3LSQ A;  4X66 B;  1NU1 H;  3N2K A;  4UCV A;  3B09 A;  4U3F H;  2ZCE A;  1S5J A;  4JI7 O;  2VQE O;  3BAB A;  2C2A A;  2EZP A;  3L70 H;  2PZS A;  1FD9 A;  5BZB A;  5A2Q N;  3ABT A;  4JI2 B;  3RGB A;  1BE3 H;  1XL6 A;  4DV0 B;  2X6A A;  4GYC B;  1SET A;  5IY5 C;  5KUM A;  4DV3 B;  4ZOL A;  2NN4 A;  1OZ0 A;  3RT3 C;  2HFE C;  3WU2 Z;  4JV5 O;  1G8M A;  3BVO A;  4PDM A;  1MNG A;  4GX0 A;  3AG3 C;  5KUK A;  4WFG A;  4B3M O;  5BXZ A;  3ZHU A;  2ITC C;  2QE7 G;  1PNM A;  2Q8V A;  4LF8 B;  1FS0 G;  2ZXW C;  4B3S B;  3T1C A;  1MG1 A;  4JZG A;  4KL1 A;  1YI2 V;  3VQV A;  1TUB B;  2YIB D;  4TWK A;  5LMU B;  3KKY A;  3HB3 B;  2CGN A;  4JI3 B;  2WA3 A;  4NR1 A;  1FPO A;  2UXC B;  2Y0I A;  1FXK A;  1URF A;  3ZN1 A;  2YID A;  3EVK A;  3W7S A;  2IM9 A;  1SES A;  2DJV A;  4FLZ A;  2LGQ A;  4GKK O;  3G4S V;  4QPJ A;  1RSO A;  2Y69 B;  2HVK C;  4U7N A;  2EIJ B;  2F1M A;  1ZL8 B;  1I08 A;  3JAL B;  4DK1 A;  2YEV B;  3QO7 A;  2W0F C;  4UV9 A;  4HZ3 A;  3DXR B;  1L1F A;  2WA4 A;  1WA8 A;  2M6Y A;  4I4T B;  5B1A C;  4TV8 A;  1YTF D;  4HNA B;  3CCS V;  4X64 O;  4P30 A;  4LWS A;  2X0L A;  1R6K A;  3MAQ A;  5LP6 A;  1Y76 B;  2KQX A;  3QO5 A;  1VQ9 V;  2OYQ A;  1EN6 A;  3FB6 C;  1YTF B;  3B40 A;  5KMG B;  1FJG O;  1VF6 A;  1XMO B;  5L3D A;  2EIM B;  2IBZ H;  4DR2 B;  4X65 B;  1S0V A;  2Q4P A;  3BHP A;  4JYB A;  4I50 A;  3OTO O;  1N36 B;  2ZE8 A;  1W0K G;  3SPJ A;  4FFB A;  1ZLZ A;  1YVW A;  4IHJ B;  3GWO A;  2IJH A;  4BR6 A;  1M90 W;  1P84 F;  1N33 B;  3WB1 A;  5FPR A;  3ZRX A;  4R6Z A;  3IGA C;  3P32 A;  1SQG A;  2CGO A;  3G67 A;  2K1E A;  1H2K A;  3AG7 A;  1BQZ A;  1V54 C;  2V4D A;  4IT5 A;  1BSM A;  3FYE B;  3ZHQ A;  1WB7 A;  2ARH A;  4DV2 B;  2DE0 X;  2UU9 B;  2UUC B;  1US6 A;  3D3I A;  4HYO A;  1Y74 A;  2IW5 A;  1P7B A;  4X66 O;  2P90 A;  1QCE A;  3CRC A;  4RUE A;  5J9P C;  4MTX A;  3L75 H;  1SQQ H;  2EJR A;  1LUV A;  1O9H A;  1JMK C;  4UCU A;  3UT5 A;  2LFS A;  4MVM A;  4JI2 O;  1SQP H;  4IYH A;  4DV0 O;  5LL6 Y;  1KKD A;  4DV3 O;  2ADQ B;  1CPY A;  2IH3 C;  1IZ3 A;  4J41 A;  4IL6 Z;  2EIK C;  1AVM A;  2RN9 A;  4WFF A;  1MAB G;  1YXB A;  3JAK A;  1G1X B;  3JYC A;  3JAT A;  2ZKO A;  1Z2G A;  1HWY A;  5IYB O;  1FXK B;  3GB7 C;  2EIL B;  3CP1 A;  5JH7 A;  5LXT B;  5CA1 A;  4LF8 O;  3GWK C;  4B3S O;  5IJ0 B;  1Q5O A;  3ML0 A;  2Q73 A;  4O2B A;  5FLX N;  1GO3 F;  3OUF A;  2Y4U A;  1K5S A;  2GV9 A;  5LMU O;  1BCC H;  1NTZ H;  4JI3 O;  2EX3 A;  3WB2 A;  4NB5 A;  1I94 B;  2UXC O;  4AIL C;  1XOU A;  4J7Z A;  4J9Y B;  3ZHR A;  2Y69 C;  5EYP B;  4BWA A;  1K4C C;  4TV8 B;  4R50 A;  1EM1 A;  2CUG A;  3JAW B;  4LF5 B;  3ZCC A;  5J2T A;  5KX5 B;  3ASO B;  1SA0 B;  1PL0 A;  4CH6 A;  2XAS A;  5LGT A;  1BL8 A;  4LC1 A;  3SPC A;  2JEU A;  1BMF G;  3E83 A;  4NYK A;  3H01 A;  1TVK B;  5CBF A;  4B3T B;  1W0J G;  2HLD G;  4BIZ A;  1G6U A;  4ZIB A;  4MTF A;  4UCR A;  1JQ0 A;  4LFB O;  1F51 A;  4NXN B;  3CC2 V;  3B77 A;  4CC6 A;  2E76 B;  1GH6 A;  3OMA B;  2M7W A;  5LHH A;  2JK5 C;  3CMA V;  2BOC C;  4RUF A;  4F4L A;  1XMO O;  3J7A U;  1TGO A;  4PEL A;  4DR2 O;  3RYI A;  4CH4 A;  4PD4 F;  2Q9L A;  2Z0A A;  4FLX A;  4LNU A;  2AZ0 A;  4OPA A;  2GBO A;  1N36 O;  2W0X A;  4X1Y B;  1NQT A;  2JDI G;  4DV1 B;  4DR5 B;  2ZIO A;  4O2A B;  3B8M A;  1M4U A;  1N33 O;  2OWO A;  5CA0 A;  4UCT A;  1IBL B;  1K33 A;  3C90 A;  4KXR A;  4HAM A;  3E22 B;  3JCZ A;  2ZM6 B;  4UB6 Z;  4DV2 O;  2QWQ B;  3O65 A;  2UU9 O;  1HR0 B;  2UUC O;  1NTM H;  1Q86 W;  1FXH A;  5IJ9 A;  1OHH G;  5CN0 A;  2F66 C;  2L35 A;  1D5N A;  1H8H G;  4OX9 B;  4DR1 B;  3T1H B;  4OXS A;  1BHB A;  1AP6 A;  3JAK B;  2Q6A A;  4IYI A;  3TJT A;  1M56 B;  3OUS A;  3CCL V;  4FM1 A;  2N74 A;  2QDO A;  2EZO A;  5JH7 B;  5LBQ A;  4Q20 A;  5H5N A;  2VWK A;  1H2M A;  1KBH A;  3FB5 C;  2EIL C;  3S3X A;  2NR5 A;  3OMN B;  3LDC A;  1O9G A;  4U3J A;  2Y48 A;  3CWB H;  1T5E A;  5FPO A;  1YJW V;  2QWR B;  4BIU A;  1AP5 A;  4XDJ A;  3CYO A;  1VQN V;  2HEP A;  2YI8 A;  4H0L B;  4ZI7 A;  3AG1 B;  5E79 Z;  4G2K A;  1AJN A;  1AI4 A;  1X59 A;  5HFL A;  3QG5 A;  4PI2 A;  2LJ2 A;  4X1I A;  3H9V A;  1I94 O;  3IAY A;  5BMV B;  1WB8 A;  1DF5 A;  1YIJ V;  4WFH A;  4D6T H;  1AIL A;  3BAA A;  4JI1 B;  5J2T B;  3Q4H B;  4DR3 O;  5E1A C;  1K34 A;  2WLL A;  3K58 A;  2OTL V;  4O4H A;  3ASO C;  2BTQ A;  3ASN B;  1KP2 A;  3X2Q B;  4YJ2 A;  4N23 A;  3CSX A;  1IUR A;  3BA9 A;  4LF5 O;  3SJB C;  4DR7 B;  2DWD C;  1Y67 A;  1MMM A;  4L8J A;  3RW0 A;  2Q7E A;  1YDX A;  4G28 B;  1KB9 F;  4B3T O;  2XTA A;  3K5O A;  2P5O A;  1HW7 A;  1NR1 A;  5IT9 N;  4DW1 A;  2WWW A;  4B08 A;  1KMI Z;  1ZUQ A;  5LGN A;  3RYI B;  1OCZ B;  4NXN O;  3SYA A;  4LNU B;  4RO2 A;  4K3A A;  4MVU A;  1L0L H;  1RM1 B;  2Y4T A;  1P4R A;  1OCO B;  3D36 C;  1JOY A;  2CTP A;  4JTD B;  1NVP D;  5B5E Z;  4GZR B;  4X20 A;  2XHB A;  4DV4 B;  2RMK B;  5CA0 B;  2PUS A;  2HR3 A;  1XQ8 A;  4QNH B;  1VF5 B;  5DED A;  1Q6U A;  1YEW A;  3VBB A;  5B1N A;  4DV1 O;  4DR5 O;  1NVP B;  3ABK B;  1AI6 A;  4TQD A;  5JQG A;  3KCX A;  1W59 A;  4EEQ A;  3RBZ A;  2ITD C;  3W7T A;  2UUB B;  3E8F A;  1LUW A;  5ITZ A;  1IBL O;  3RN4 A;  3I56 V;  2QA4 V;  4GCZ A;  1AR5 A;  4ZHQ A;  4RQF A;  2O57 A;  4AQY B;  1Q6H A;  1A32 A;  4LF4 B;  3IC7 A;  4YXW G;  1Q90 D;  2EBO A;  1EN5 A;  4PV1 B;  2ZE6 A;  4CH3 A;  1VQ6 V;  3OM3 B;  1ZTE A;  3TET A;  4GX1 A;  1H2S B;  4OX9 O;  4DR1 O;  3T1H O;  4MW3 A;  5EIB D;  3SPI A;  3FYI B;  4TT3 G;  2DW4 A;  2CK3 G;  3BY6 A;  2HP8 A;  1ARO P;  5JJE B;  1GM9 A;  4D7T A;  1YF2 A;  4X8A A;  1MZF A;  1J5E B;  2BSK A;  4J11 A;  1CXZ B;  3SYO A;  1XL4 A;  5LGU A;  2HG5 C;  3ZN0 A;  2JVD A;  1EFR G;  4TUY A;  2CAZ C;  2FL4 A;  1N34 B;  4I5S A;  3FX7 A;  2ZIM A;  4FFK A;  3LDD A;  3QF7 A;  1KP3 A;  2QKS A;  4UVA A;  3SGI A;  1F4N A;  2E5L B;  2WPD G;  3E8G A;  1BQ0 A;  3C3T A;  3A0R A;  4GX2 A;  3OAA G;  4NTY A;  4EB6 A;  5A9G A;  3AG1 C;  5J2U A;  2P7T C;  5LYJ A;  5EBL C;  2F43 G;  1FFX A;  1YHQ V;  2F93 B;  3ABL C;  4DYL A;  1XNR B;  2IJK A;  4FLU A;  1EZJ A;  4DRX A;  5BR8 O;  3H1J H;  4DUY B;  4DO2 A;  3N2G B;  1SZT A;  1GN4 A;  4YJ2 B;  2OIE A;  2ZD9 A;  3LNN A;  4JI1 O;  3RYC B;  3ZED A;  1NH2 D;  4JYY A;  3MDS A;  4X9Q A;  1AR1 B;  4JI8 B;  2Q69 A;  3X2Q C;  4IIJ B;  2WAM A;  3CC4 V;  4FLV A;  2B9Z A;  1SKV A;  1WPX A;  4WCE V;  5IYZ A;  4JAV A;  5L3E A;  3ZMT A;  4DR7 O;  4X1K B;  1S5H C;  3FD9 A;  2YS8 A;  4RAI A;  4JTC B;  1Y66 A;  1S77 D;  4UVB A;  4B3R B;  4OGQ B;  3KG2 A;  1OCO C;  1R6T A;  3IJ4 A;  3SPH A;  4JGS A;  4MVR A;  2CE4 A;  2BOB C;  2H8P C;  1YJ9 V;  1IVS A;  4I0X A;  1UFI A;  4MVZ A;  1N8R W;  2DYR C;  4O4L B;  2A7W A;  5JQG B;  4DV4 O;  4KP4 A;  1GK9 A;  2D2C B;  5ITZ B;  2Q68 A;  3ABK C;  3T4D A;  2DWE C;  1GN3 A;  1AB3 A;  3OD4 A;  3UM7 A;  3CC7 V;  3HKD A;  1ZX3 A;  3ZRW A;  3K04 A;  1N0N A;  2UUB O;  3RYH B;  1BGY H;  1XUQ A;  2YDE A;  3ETG A;  2P67 A;  4AHC A;  2GUZ A;  1RPR A;  3ZIA G;  4J80 A;  1V55 B;  2A9H A;  4AQY O;  2PYJ A;  5AG2 A;  2W6I G;  1BZK A;  3ZS8 C;  4DV7 B;  4PDL A;  4LFA B;  2L6L A;  4GLX A;  5JCO A;  2BSK B;  4CC5 A;  3QO8 A;  3FAV A;  5KA5 A;  2Z3Y A;  4X88 A;  3CB2 A;  4PA9 A;  3CME V;  1QU7 A;  3J80 N;  4EFB A;  2YUA A;  5LOV B;  3IC9 A;  3D8C A;  1J5E O;  3APO A;  4Q6G A;  1IBK B;  2WLN A;  4O4J A;  1SRY A;  2QWP B;  4F6R B;  4EB6 B;  2PI5 A;  1N34 O;  3FKS G;  3W7X A;  1MSD A;  3ZMZ A;  1FKA O;  5KAF Z;  3LNM B;  2YSU B;  3N2K B;  4KFM A;  5FNV A;  4WBN A;  3L72 H;  2E5L O;  4DRX B;  1Z5V A;  2FYU H;  3UCS C;  3DC6 A;  3ZMV A;  3R65 A;  1AI7 A;  2WSS G;  2F95 B;  1S72 V;  2QWN B;  5KHK A;  1XNR O;  2DQ3 A;  1M93 A;  2FTK A;  4J42 A;  5GTH Z;  4Z2W A;  2PF4 E;  2DN9 A;  4ZOL B;  4BAY A;  4PDR A;  4DUY O;  3PJS K;  4UVC A;  2LW7 A;  3K08 A;  3CX5 F;  5IYZ B;  3CD6 V;  1ORQ C;  4QIW F;  4K8Z A;  3ABM B;  3K9S A;  4JI8 O;  3TCU A;  2YXH A;  4PHZ A;  1K97 A;  4X62 B;  1THZ A;  1DF4 A;  2YI9 A;  1TAE A;  3U10 A;  2V7Q G;  2WLH A;  1VQL V;  3RFR A;  2ZDI C;  3RYF A;  3OEE G;  4PA4 A;  5KA6 A;  1ZWI C;  1XMQ B;  4QGP A;  4ZKI A;  3DTU B;  4L87 A;  1BT8 A;  2B1I A;  3APQ A;  1F23 A;  4B3R O;  2LQT A;  3KZI Z;  1PP9 H;  4XBF A;  1RSO B;  5B3S B;  3BEH A;  3ICX A;  2XOK G;  1Z5W A;  4H13 B;  1AI5 A;  2JS3 A;  3P3P A;  4UFZ A;  5JJJ B;  4LF9 B;  1WA8 B;  3ZRW B;  2EIJ C;  1JFF A;  4PI0 A;  1JCH A;  4J9Z B;  3UO2 A;  2P4V A;  4UB8 Z;  4LWS B;  1NI8 A;  1W2B U;  3K03 A;  2VQF B;  4MVO A;  2GUZ B;  4EKW A;  2WLK A;  3JAS A;  5LP6 B;  3SJA C;  2QTO A;  2QWO B;  1JJ2 U;  4DUZ B;  3W7W A;  1GKF A;  1OV9 A;  2QJ1 A;  3TGU H;  4LFC B;  2CTW A;  1V55 C;  3HR0 A;  3AK3 A;  2IJJ A;  3BRC A;  1VQ5 V;  4JI4 B;  4LF7 B;  3SYP A;  5KHJ A;  1I5Y A;  4I50 B;  3ZX6 A;  3F7Y C;  2EIM C;  1V9P A;  4FFB B;  3J81 N;  4DV7 O;  2XAG A;  2KB1 A;  4LFA O;  2UXX A;  5CB4 A;  1XDC A;  2KG7 A;  5EK0 A;  4O4J B;  3BFR A;  2ZR3 A;  4X65 O;  1D5A A;  1KKC A;  2AHY A;  3QTC A;  1QHT A;  2ZIN A;  1GRJ A;  1K4D C;  2HHH B;  1FXV A;  3OGI B;  4B7E A;  2H94 A;  2JGD A;  3EXA A;  5B1B B;  3LSU A;  1IBK O;  4DW0 A;  4JI5 B;  1S5L Z;  2CTQ A;  3IFX A;  4PA3 A;  3HKB A;  3B4S A;  1E79 G;  3OGC C;  1Y74 B;  2QM4 A;  2LP7 A;  2BCC H;  3FB8 C;  1XI1 A;  2DYS B;  3L74 H;  5IDJ A;  2X6B A;  5JVD A;  3SPG A;  3OR6 C;  3BCC H;  2CTR A;  4JTA B;  4YHH B;  1D2D A;  1VMG A;  5L3F A;  2ATK C;  3UT5 B;  1R6N A;  4KHP B;  4LBE C;  1E1Q G;  1IBM B;  3NXS A;  1XHZ A;  1IXM A;  2UUA B;  5C8Y A;  3UO3 A;  3PN1 A;  1VQ7 V;  3JAT B;  3ABM C;  1I0H A;  1KQS U;  1K92 A;  5IYD O;  3JD0 A;  2AXT Z;  4XDL A;  1VAR A;  1E1R G;  2MW2 B;  5CA1 B;  1H2N A;  4CS4 A;  1JPX A;  1YJN V;  2WLM A;  2ZNJ A;  4X62 O;  1KC8 W;  4BIO A;  2HKO A;  4ASU G;  4O2B B;  1FXK C;  3F5T A;  1MSW D;  4DR6 B;  3I55 V;  4ZBM A;  1J95 A;  4P9O A;  1HNW B;  1XMQ O;  5LHI A;  1OCC B;  5LHG A;  3EHB B;  4LH6 A;  5LMN B;  5LA6 A;  2ZR2 A;  5KAI Z;  3G6B A;  3MHH C;  3T1Y B;  3JD4 A;  3JAS B;  4R7C A;  3JD3 A;  2JIZ G;  2FML A;  1JR9 A;  2ODM A;  3E2E A;  4KUM A;  1B06 A;  4LF9 O;  1G4Y B;  5LP6 C;  5EBW C;  1DK1 A;  3CRR A;  2VQF O;  3AG2 B;  4NTW A;  2EIN B;  4DUZ O;  1JJO A;  1VF6 C;  4FZ0 A;  3ABU A;  3ZMS A;  4LFC O;  1K3E A;  2OT5 A;  1QR8 A;  5CB4 B;  2HVJ C;  2D3O W;  4JI4 O;  3B8N A;  2R72 A;  4LF7 O;  4J7K A;  4I9W A;  3R66 A;  1QVF U;  1QQC A;  3SR2 C;  2ZQM A;  2QM8 A;  1WPB A;  5KHG A;  3K5M A;  4H37 A;  5GON A;  5TIS Z;  2G38 A;  3JAR A;  1Q81 W;  5BY1 A;  3TXQ A;  1WJZ A;  4E2L A;  1JA8 A;  3HKB B;  2ZXW B;  1NTK H;  2W6J G;  1K7D A;  2QKA A;  4F6E A;  4JAS A;  5JVD B;  2GDS A;  3KCY A;  2WLJ A;  1SF9 A;  4QE7 A;  4JI5 O;  2QEX V;  3QNE A;  3G71 V;  2A0L A;  5IJ9 B;  2R9R B;  3SYQ A;  2XT9 A;  3BA8 A;  1Q82 W;  1PNK A;  4PA6 A;  2IU3 A;  2ZM6 O;  4NVP A;  4TSF G;  1COW G;  4K8X A;  4K35 A;  2XAH A;  4PJ0 Z;  4UCO A;  4MS2 A;  5C8Y B;  1HR0 O;  4YHH O;  4P9P A;  5L3B A;  2QM7 A;  2QSA A;  3CHX A;  4KHP O;  4PA7 A;  5DM6 V;  3W7U A;  1IBM O;  1ZL8 A;  2YEV A;  1OJH A;  1SER A;  4JAA A;  2UUA O;  1N32 B;  1K73 W;  3DXR A;  4NKG B;  5DEC A;  1M56 C;  4I4T A;  1NT2 B;  3H1H H;  4H44 B;  2OCC B;  3OFN G;  1I5X A;  1ROP A;  3ETE A;  1IX9 A;  3G6E V;  4U3J B;  2OIG A;  2Q0A A;  1H38 A;  1PKX A;  1PPJ H;  5KMG A;  4ZI7 B;  2Q67 A;  5KHH A;  2E74 B;  2R9A A;  3U0Z A;  2NLJ C;  3VOU A;  1VIB A;  3AK1 A;  1M5I A;  4X1I B;  4DR6 O;  3K57 A;  1U97 A;  5CA3 A;  1R3J C;  1OCC C;  3OR7 C;  1HNW O;  1SQB H;  2PY5 A;  5K1P A;  2A3Q A;  1DLB A;  3N27 A;  4IHJ A;  3MHS C;  4J7J A;  2WLL B;  5LMN O;  3A2F A;  4R8C A;  3ZRS A;  3CS5 A;  1MZE A;  4O4H B;  2BTQ B;  4I9Q A;  1WNS A;  3T1Y O;  2GTS A;  1RFY A;  2HJF C;  1AR4 A;  1SQV H;  4QE9 A;  5GW7 A;  1Y4M A;  3ASN C;  3AG2 C;  2EIN C;  1K8A W;  1BHA A;  2QR4 A;  1VQ8 V;  3LDE A;  4J10 A;  1NH2 B;  3CCJ V;  1EZV H;  2XND G;  1YSC A;  1Q7Y W;  5H2F Z;  1IXB A;  1VF7 A;  5GON B;  4CBC A;  5DN6 G;  3JAR B;  1OCZ C;  3O9O A;  3FB7 C;  3WFV A;  3A0H Z;  4X20 B;  4MTO A;  3ZMU A;  1RM1 C;  3OEH G;  4TV9 A;  2OTJ V;  5H6R A;  1WAZ A;  2EJ7 A;  1HNX B;  2EIK B;  4JZ2 A;  3OT7 A;  3CXH F;  4NTX A;  3CPW U;  3CEI A;  1QR9 A;  3ZHS A;  3H1I H;  2RCV A;  5GTI Z;  4GT1 A;  4P2Z A;  3STZ C;  1PV0 A;  2JEX A;  4MVQ A;  1PM9 A;  1WLE A;  1SZX A;  3CXC U;  4NXM B;  3E8B A;  4ABM A;  4E4E A;  4ZHQ B;  5LXT A;  1SS3 A;  1VQO V;  5IJ0 A;  1LR1 A;  5JWP A;  4I7Z B;  4EFE A;  1MA1 A;  1HP8 A;  3LUT B;  5CBH A;  3JAM N;  3K06 A;  4FZ1 A;  2AHZ A;  2OCH A;  4X89 A;  3EFF K;  4N21 A;  3CRM A;  5EC1 C;  4LF4 O;  2AGA A;  1LNQ A;  1FYJ A;  4B7K A;  5KLV H;  2DQ0 A;  5EYP A;  4W4K A;  2R9I A;  3CCQ V;  1XHX A;  1NBM G;  3UKM A;  2A06 H;  3JAW A;  4Z1M G;  2JS5 A;  3WB0 A;  1VQK V;  4TUY B;  5JJN B;  1VQP V;  2VWJ A;  5EBM C;  2IH1 C;  4LR3 A;  4LFB B;  1RP3 B;  2OCC C;  3F5W C;  5KX5 A;  4JYA B;  1SA0 A;  1JVM A;  4TOI A;  2NNU A;  1N32 O;  3OTF A;  2UXB B;  5IE9 A;  5EIB C;  5B66 Z;  3JSL A;  1TVK A;  4LF6 B;  3JD1 A;  3K3W A;  3I5D A;  1B3Q A;  4RWU A;  3WG7 B;  1R3I C;  5J2U B;  3ZJZ A;  1OCR B;  3CRQ A;  5LYJ B;  1Y6X A;  1FFX B;  1M57 B;  2MK3 A;  2AW9 A;  2XUM A;  2GHY A;  2UXD B;  4FVM A;  5K1X A;  3D36 A;  2ZE7 A;  3B2E E;  2N04 A;  4X1Y A;  1B6Q A;  4WFE A;  2UXN A;  2RNB A;  4WFB V;  4FLT A;  3K9A A;  4O2A A;  5IWA B;  4QJF B;  3ZRV A;  5KHI A;  3BPZ A;  1P7G A;  5L3C A;  1Q6I A;  1XIL A;  1F4M A;  3VQX A;  5FL7 G;  3VQW A;  4HBN A;  3E22 A;  3DGE A;  3JD2 A;  2IU0 A;  1NJI W;  1AJP A;  4UV8 A;  1SQX H;  3HKC A;  5L3G A;  4TV9 B;  2B1G A;  2JGU A;  4K0K B;  2VS0 A;  3M99 B;  3SDL A;  1QNM A;  4GX5 A;  3H1K H;  2QGN A;  4I0X B;  3TXS A;  2CDY A;  4U7O A;  2XAQ A;  1EN4 A;  2CH7 A;  3K5L A;  4I55 A;  2A79 B;  3U11 A;  3E86 A;  1K9M W;  2PGG A;  1HNX O;  1QLE B;  3K59 A;  2EUL A;  1DGS A;  2P4K A;  5HFM A;  3K5N A;  1VP7 A;  1K5Q A;  1XEQ A;  4UXN A;  2JJ1 G;  1TUE B;  4FJC C;  3HKD B;  2BE3 A;  2P6J A;  2RJZ A; 
#chains in the Genus database with same CATH homology
 4I4T B;  4DR6 B;  4TV8 A;  4HNA B;  1HNW B;  1XNQ B;  5JJE B;  4JI0 B;  1WN7 A;  4D7T A;  3MAQ A;  1J5E B;  3ETQ A;  4CS3 A;  5LP6 A;  5LMN B;  4LH6 A;  2JVD A;  5LA6 A;  2OYQ A;  4TQF A;  4DR3 B;  4TUY A;  2CAZ C;  1N34 B;  2Q7H A;  3T1Y B;  5KMG B;  3JAS B;  2ZIM A;  1XMO B;  3QF7 A;  5BMV A;  3SGI A;  4O4I A;  2E5L B;  4DR2 B;  2RQ6 A;  4X65 B;  5LP6 C;  3BHP A;  4I50 A;  5J2U A;  4EB6 A;  1N36 B;  2P22 C;  5LYJ A;  4FFB A;  1FFX A;  4IHJ B;  3HKE A;  2F93 B;  1XNR B;  1JJO A;  4CH5 A;  1N33 B;  4DR4 B;  4FLU A;  3WB1 A;  5FPR A;  4DRX A;  5EZY A;  4DUY B;  1SQG A;  3RWR D;  3N2G B;  4UCS A;  4YJ2 B;  5CB4 B;  4WBN B;  5FNV B;  2V4D A;  4FM2 A;  3LNN A;  2R72 A;  3RYC B;  3ZED A;  4DV5 B;  4DV2 B;  4DV6 B;  4JI8 B;  1QQC A;  3SR2 C;  2UU9 B;  2UUC B;  4IIJ B;  1WPB A;  4JI6 B;  5KHG A;  3K5M A;  5GON A;  4FLV A;  1SKV A;  3JAR A;  4FLW A;  5D5P A;  5IYZ A;  4YJ3 A;  3HKB B;  4X1K B;  4YY3 B;  1O9H A;  1JMK C;  4GKJ B;  4UCU A;  3UT5 A;  5JVD B;  4B3R B;  3VQY A;  2PYL A;  1KU9 A;  5IJ9 B;  3BA8 A;  3HKC B;  2R70 A;  3JAK A;  1B04 A;  3JAT A;  4NVP A;  4O4L B;  4K8X A;  5JQG B;  3RYF B;  4UCO A;  5C8Y B;  5ITZ B;  5LXT B;  5JH7 A;  4LH7 A;  5CA1 A;  4D7S A;  3CHX A;  1Q8I A;  5IJ0 B;  1P49 A;  4I55 B;  1Q5O A;  4O2B A;  3HKD A;  2F4V B;  2GV9 A;  1Q3E A;  1N32 B;  1SQF A;  2EX3 A;  3WB2 A;  1I94 B;  4I4T A;  3RYH B;  4AIL C;  1NT2 B;  4AHC A;  1JFF B;  2PYJ A;  5EYP B;  4U3J B;  4BWA A;  4TV8 B;  3ZS8 C;  1HNZ B;  2Q0A A;  4DV7 B;  3JSN A;  3JAW B;  4FLY A;  4LFA B;  5KMG A;  4ZI7 B;  5JCO A;  4CC5 A;  4GLX A;  4LF5 B;  5KHH A;  2R9A A;  3U0Z A;  3CB2 A;  5J2T A;  5KX5 B;  1SA0 B;  4CH6 A;  4JI7 B;  1M5I A;  4X1I B;  5BR8 B;  2VQE B;  4BW9 A;  4EFB A;  3K57 A;  5LOV B;  1TVK B;  4B3T B;  2PY5 A;  5K1P A;  4O4I B;  1G6U A;  4IHJ A;  4Q6G A;  4ZIB A;  1IBK B;  4O4J A;  1ZAU A;  5JCO C;  3A2F A;  4UCR A;  4NXN B;  4F6R B;  4EB6 B;  4CC6 A;  4O4H B;  2BTQ B;  4I9Q A;  1WNS A;  4JV5 B;  3HKE B;  5D5Q A;  3N2G A;  3N2K B;  1TGO A;  4WBN A;  5FNV A;  4DRX B;  3RYC A;  1Z5V A;  3RYI A;  4CH4 A;  4B3M B;  5EZY B;  4FLX A;  4LNU A;  4IIJ A;  4X1Y B;  2F95 B;  4CS2 A;  4DV1 B;  4DR5 B;  2ZIO A;  4O2A B;  5KHK A;  2YIA A;  2KKW A;  1M4U A;  1M93 A;  2OWO A;  4ZOL B;  5CA0 A;  4UCT A;  4X1K A;  1VF7 A;  1IBL B;  5GON B;  3JAR B;  3E22 B;  4DK0 A;  5IYZ B;  4X20 B;  2ZM6 B;  1L8D A;  4TV9 A;  4YJ3 B;  1TUB A;  4K8Z A;  2BTO A;  1HNX B;  4GKK B;  2Q7G A;  4PHZ A;  1HR0 B;  2YXL A;  5IJ9 A;  4X62 B;  3SJC C;  2F66 C;  2YI9 A;  1Q43 A;  1TAE A;  4OX9 B;  4DR1 B;  3T1H B;  3U10 A;  3FFQ A;  2YIB A;  4O4L A;  2ZNI A;  3RFR A;  3RYF A;  2E3C A;  4X64 B;  1XMQ B;  3JAK B;  1TA8 A;  4NXM B;  4ZHQ B;  3DSQ A;  5LXT A;  3JAL A;  5IJ0 A;  4EFE A;  4FM0 A;  4FM1 A;  5JH7 B;  1X4T A;  4HNA A;  1FJG B;  3ICX A;  1Z5W A;  3RYH A;  2VWK A;  4UFZ A;  5JJJ B;  4LF9 B;  1JFF A;  4PI0 A;  5EYP A;  1O9G A;  3OTO B;  4U3J A;  1T5E A;  5FPO A;  2VQF B;  1XHX A;  2PTM A;  5LP6 B;  3JAS A;  2HEP A;  3SJA C;  3JAW A;  2YI8 A;  4DUZ B;  2JS5 A;  5LA6 B;  3WB0 A;  4ZI7 A;  1I7F A;  4TUY B;  5JJN B;  3M7M X;  2QJ1 A;  2VWJ A;  4LR3 A;  4LFB B;  4JYA B;  4LFC B;  5KX5 A;  1SA0 A;  4TOI A;  3QG5 A;  3THO A;  3OTF A;  4PI2 A;  2UXB B;  4X1I A;  3IAY A;  5BMV B;  5EIB C;  3BRC A;  3JSL A;  5LOV A;  1TVK A;  4JI4 B;  4LF6 B;  3BAA A;  4JI1 B;  4LF7 B;  5J2T B;  5KHJ A;  3UQ8 A;  4I50 B;  5J2U B;  5LYJ B;  1V9P A;  4FFB B;  3K58 A;  4F6R A;  1FFX B;  4O4H A;  2BTQ A;  4YJ2 A;  4X66 B;  5CB4 A;  3CSX A;  3BA9 A;  4O4J B;  3N2K A;  3SJB C;  4DR7 B;  2UXD B;  1D5A A;  3QTC A;  4UCV A;  4FVM A;  2ZCE A;  1S5J A;  1QHT A;  4L8J A;  2ZIN A;  3B2E E;  5K1X A;  3BAB A;  2HHH B;  2Q7E A;  2PZS A;  4X1Y A;  3K5O A;  2P5O A;  1HW7 A;  4FLT A;  4JI2 B;  3RGB A;  4B08 A;  1KMI Z;  4O2A A;  4JI5 B;  4DV0 B;  3RYI B;  5IWA B;  3HKB A;  4GYC B;  4DV3 B;  4LNU B;  5KHI A;  4ZOL A;  2QM4 A;  3BPZ A;  1XI1 A;  3VQX A;  3VQW A;  4HBN A;  3E22 A;  5JVD A;  4X20 A;  2XHB A;  4DV4 B;  5CA0 B;  2PUS A;  1XQ8 A;  4YHH B;  3UT5 B;  4LF8 B;  4B3S B;  1YEW A;  4KHP B;  3HKC A;  1IBM B;  4TV9 B;  2JGU A;  4KL1 A;  4K0K B;  3VQV A;  1TUB B;  2YIB D;  1XHZ A;  4TQD A;  5LMU B;  5JQG A;  2UUA B;  4EEQ A;  4JI3 B;  5C8Y A;  2UUB B;  2UXC B;  3PN1 A;  5ITZ A;  3JAT B;  2IM9 A;  4ZHQ A;  3K5L A;  4I55 A;  4AQY B;  3U11 A;  4LF4 B;  4FLZ A;  2PGG A;  3K59 A;  1DGS A;  5CA1 B;  3K5N A;  1RSO A;  4CS4 A;  2ZNJ A;  4CH3 A;  2F1M A;  3JAL B;  4DK1 A;  4O2B B;  3HKD B;  1H2S B;  5EIB D;  2RJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...