2ZXWB

Bovine heart cytochrome c oxidase at the fully oxidized state (1-s x-ray exposure dataset)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zxwB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zxwB02
1BYPA 2XX1A 1L9OA 5TK4A 4A2GA 2AVFA 2UXTA 4P5RA 1SF5A 2TSBA 2QPEB 3PAVA 3NJFA 5D4HA 1AZRA 2PPCA 1L9PA 1A4BA 3S8FB 4Q8BA 4KNTA 5I5IA 1KGYE 3DTUB 1FWXA 2Y1AA 2FQEA 3D12B 1MZYA 1T5KA 2YEVB 4G70B 2AFNA 3S3DB 1BYOA 4AKPA 2EIMB 4Q89A 1IUZA 3CZUB 1N70A 1WA0X 1VLXA 1SJMA 2EIJB 2VW7A 2HX8A 3ABGA 1OCZB 2J55A 3NP4A 3AG1B 2AANA 4DP1X 3ABLB 4HCIA 1ET5A 3WG7B 1OCRB 5PAZA 3TASA 1A4CA 3AG4B 3DIVA 1SHXA 5I6PA 4BXSV 4DP2X 2PPFA 4KO5A 4E9QA 4DPBX 4G7QB 4BWTA 2CCWA 2YQBA 2BZCA 4DP7X 4E9XA 2FQFA 3EH5B 1L9SA 4AX3A 1NIFA 1JXFA 2YAPA 1SDDB 4A2EA 5AZUA 3V9CA 3IBOA 4DPAX 2DYRB 1BXVA 3GDCA 1IBZA 1KBWA 1L9RA 4KOCA 3TU6A 1RKRA 4PCYA 3EF4A 4NERA 3FPXA 1YLBB 4G71B 4DP4X 4HZ1A 2BP8B 4E9TA 1XMEB 2AZAA 4E9VA 3EH3B 3KW7A 2YXWA 2ZXWB 1W6WA 3FSZA 1CYXA 2IDTA 2FJSA 4DP8X 1L9QA 1CC3A 3X1FA 4A2DA 2I7SA 2XU9A 3TBBA 1E65A 3X1EA 1MZZA 2VN3A 3RYMA 4AKOA 2MRYA 2DV6A 1NZRA 4BXVA 3N55A 1V55B 3FU7A 2UX7A 4W1TA 4YSAA 1OOWA 8PAZA 3ABMB 3ASNB 2YAQA 5I5JA 2IWFA 2H5UA 1A4AA 1XB3A 3CVDA 3QJSB 3JT2A 1TEGA 2UX6A 1GS7A 5ANHA 4GP4B 3T6WA 5B1JC 3FU9A 4P5SA 4A67A 1L9TA 3T71A 1ZIBA 2MTAA 4PAZA 4HCFA 1R1CA 2FNWA 3T9WA 3AY2A 1W8EA 4AI7A 1ETJA 1AQ8A 1SFDA 4ZK8A 3AG3B 3T6XA 2A3TA 1DZ0A 4YSRA 2Q5BA 2UXGA 4UANA 3QQXA 2XX0A 2J56A 1ASPA 2HRHA 2IH8A 3QPKA 4E9WA 3FQYA 2YARA 1GSKA 2XXGA 3NJHA 1KDIA 2EINB 3UAEA 5I6LA 1QLEB 1X9RA 3JTBA 2GB2A 4BWUA 3OM3B 2BZ7A 2PPDA 3NJKA 3FSAA 1A65A 3EHBB 1PZBA 2BWIA 1JZEA 2J5WA 2P80D 2YAMA 6PAZA 2CUAA 2QDWA 1AS7A 5I6NA 1HAWA 4RH4A 4GP5B 1ZDQA 2OV0A 2R7EB 2HRGA 3ERXA 1NWOA 3HEIB 5AKRA 4BDVB 2CAKA 1OCOB 5A7EA 3NSDA 6PCYA 1PZCA 2IDSA 3PLYA 1BQKA 3QJTB 3FPYA 4G7RB 1JZFA 2UXFA 2PP8A 1J5CA 1ASQA 7PAZA 1AANA 1E5YA 4QLWA 3PAZA 3OMNB 4A68A 5LDUA 5B1AB 1EHKB 1AZUA 3NJMA 4HALA 3ZBMA 2GHZA 1M57B 5B1BB 2OCCB 1BQ5A 1FFTB 3NJIA 2PCFA 1PLCA 1SFHA 1ZPUA 4FAAB 4YSUA 2Q9OA 3S8GB 1URIA 3AW5A 2I85A 3SBQA 1QHQA 4KOBA 4YSSA 2E86A 1MG2C 4GYBA 2DY2A 5B1JA 4WKXA 1GW0A 4F7KA 1HAUA 5TK2A 3OQRA 1WS8A 3WKQA 2ZONA 5I28A 1WAEA 2H3XC 2X88A 2CALA 1CYWA 1JVLA 4X4KA 3HB3B 3TA4D 3ZDWA 2B3IA 2BO0A 3NT0A 4HAKA 1NIDA 4E9SA 1AZCA 3N2JA 2FT7A 1ET8A 2BP8A 1A8ZA 3IEAA 4WTQA 1PZAA 4KO7A 4YSEA 2I7OA 1BXUA 3G5WA 2H47C 1ID2A 4YSDA 4G7SB 3H56A 2FTAA 1ZDSA 4QKTA 1PY0A 1JXDA 4YSQA 1CURA 1OV8A 2IH9A 2W88A 2BP0B 3UADA 1PNCA 2DYSB 1SNRA 1KBVA 1JZGA 5I6OA 4YVNA 4JKNA 2QT6A 3NSFA 1RZQA 1GR7A 1GY1A 3ABKB 2HZHA 2XLLA 4JHUA 3L45A 2IDFA 1NICA 4YSCA 3NP3A 2PLTA 1AACA 4A2FA 1J9QA 3CDZB 2BWDA 3H4FA 3FQ1A 1PMYA 2CJ3A 3ZIYA 3QJVB 3T6ZA 2FT6A 4G72B 1GS6X 4ENZA 4GY4A 4EF3A 4BWWA 2OJ1A 3UAAA 2DWTA 1AS6A 2WO3B 3OD3A 4KNUA 2WSDA 4HIPA 5B7MA 1NDTA 4AZUA 2GI0A 5B3SB 9PCYA 2CBPA 2X87A 3X2QB 2EILB 3AG2B 3C75A 2HX7A 2IDUA 1JVOA 3QJRB 1OE2A 3CVBA 3SBPA 1SHWA 2DWSA 5B1KA 1CUOA 3IN2A 5B7FA 2TSAA 2GIMA 1NPJA 2FT8A 3TBCA 3PPSA 1NIEA 2VMJA 4CSZA 5IY5B 3GXUB 4KO6A 1B3IA 5D4IA 2FQGA 1PF3A 3FT0A 3NJGA 1I53A 2YAEA 3WNIA 4BDVA 2PPAA 3WIAA 1ILUA 3OMIB 1OE1A 1GYCA 1W6LA 4N4YB 2XUWA 4E9RA 1GS8A 1KV7A 4N8UA 1EZLA 1FA4A 3EH4B 2XWZA 1AOZA 1PLAA 2UXVA 7PCYA 1WA1X 2EIKB 1IBYA 1ASOA 1MDAA 3NSYA 1RCYA 2XYBA 1X9UA 3FQ2A 2XVBA 2VSKB 4UAHA 1DYZA 1HFUA 2HXAA 4DP0X 4A66A 1KCWA 3FU8A 2RACA 1IKOP 3X1GA 3IN0A 2FQDA 3CVCA 5F7BA 2VSMB 3FSWA 1J9TA 2XV3A 1PNDA 4L0PB 1AIZA 3UGEA 3V9EA 2JXMA 1TU2A 4KNSA 3MX0B 1ILSA 1ZIAA 2PP9A 1SDDA 4AKQA 4YSOA 3FS9A 4NAJA 4HCGA 1OCCB 3SQRA 1UATA 2IDQA 1NTDA 2QPDB 4GXFA 5FC9A 3X1BA 1OE3A 4DPCX 4F2FA 2P80A 5I5MA 3ASOB 1BXAA 1WA2X 2QDVA 5PCYA 4F2EA 2IWEA 1M9WA 2BHFA 3SBRA 3BVDB 2YAOA 2YAHA 1NPNA 1MG3C 5I26A 1XB6A 3QJQB 4NB7A 1AG6A 1AAJA 4K9JA 3U25A 1V54B 4DP5X 2GBAA 1QNIA 1J9SA 5EHFA 1OF0A 2BW4A 4MFHA 2BP0A 5I6MA 3PXLA 3KW8A 4KO9A 1AR1B 4W9ZA 4JHVA 3FYIB 1JOIA 4DP6X 3S3BB 1AZNA 1PCSA 3MBWB 4YL4A 1NIAA 2N0MA 1SF3A 2GC4C 3PCYA 4CSPA 2VW4A 1JERA 1J9RA 1JZIA 2HLEB 5D4JA 3BQVA 2FWLB 1PAZA 3IE9A 3NSCA 1J5DA 2WO2B 3CDZA 4A2HA 2JKWA 1AZBA 4DP9X 2YXVA 1BAWA 4BK5C 1BQRA 5B7EA 1PLBA 3PAUA 3T6VA 3UACA 1ZV2A 1RZPA 2HX9A 1F56A 2W8CA 2NRDA 2VM4A 1AS8A 3H4HA 1E67A 3FSVA 2JFCA 1GY2A 2PCYA 1NWPA 1A3ZA 3NJJA 4HHGA 1V10A 3FU7B 1JZJA 2XV2A 5AFAA 1BEXA 2VW6A 3NJLA 4YSTA 5I6KA 4TXVB 1E5ZA 3WNJA 3DKHA 1ET7A 3ZX1A 1KDJA 4M3HA 3WI9A 1AG0A 3NYKA 1JXGA 1E30A 1N68A 4E9YA 1TEFA 5F7AA 3UABA 2IAAC 2XV0A 3NJNA 1WS7A 4UF7C 2AZUA 2IWKA 4HHWA 1NINA 2R7EA 5E9NA 2PP7A 3WKPA 3FYEB 3OMAB 1KCBA 2B08A 1IC0A 1JZHA 4M4RB 4FA7B 2LLNA 4YVUA 1M56B 2GC7C 3QJUB 3CG8A 1KYAA 2Y69B 1ADWA 4YSPA 2YAFA 4GP8B 1NIBA 3X1NA 2ZOOA 2PPEA 3AZUA 3GYRA 2BW5A 1XB8A 2GSMB 2ZWNA 2XXFA 3S3CB 2J57A 1TKWA 2VM3A
chains in the Genus database with same CATH superfamily
1I5XA 4UVAA 2I32A 1Z0NA 1NCWH 3O9WA 4PQXA 4OZIA 4MQ7B 3LIUA 3VXUB 3WTSA 1DQTA 2YQ2A 2TSBA 5CINH 5BV7C 4PJAE 3PAVA 4KKCC 4ZMTA 1RPOA 2ZUYA 3FCSA 4JO2L 3QPXL 4NP9A 3SE6A 3J8F7 4O9HL 4W9FC 5I1DB 2IBBA 3QH3A 3AWEA 1M1XB 1NFAA 1AMYA 4XNYH 2YXYA 5FECA 2CG9X 4U3JA 1R4XA 4G5ZL 5BVPH 4CH4A 3WKMH 4OZFH 1KIUA 4I55B 1KGXA 1T66C 2OXHA 3R18A 4PTUA 1RK1B 4C4KO 5IJKC 4JYYA 1K33A 5AALA 1JNNL 4X62O 4ANKA 5J4MA 1RSFA 3QIUC 1GMEA 3B6SA 3HUJB 4G1MB 2WA3A 1OB0A 1SQMA 4IRJB 4I48A 3CGTA 3B1UA 1ZSPA 3ORJA 4NM4L 4TQDA 2HLFD 2HT2C 3ZMVA 3B2VL 3KYKH 1XIWB 3C60B 1ZLSH 3P9LA 4NIYE 3HNSL 5J0BA 1JGLL 2BDNH 3M86A 4K0OA 4B6ZA 3DX9B 1O5DT 4YR6B 4A7GF 2VDOH 5M95B 1BZ7B 1HOCA 1ZA3B 2FEEL 2H3NA 4GKSA 3OG6B 3NJXA 4XE5B 4XPBH 4XN8A 4FP8H 3L4ZA 3IU4L 3JASB 4G8IA 5CXPA 3Q3GB 2FAUA 2I9LA 2UY6A 1BQ0A 1RKRA 3MJGX 1SPDA 2DQDH 3EFFB 3N50A 3N5AA 4G8GD 5J12C 5IJBC 1PG7W 4IRSA 5TQ2L 2EE2A 4XPHH 1EHXA 5E1AB 1IXMA 3QUMB 4EN3D 4L8JA 5BO0D 1ES0B 4TOIA 2JJSA 4JFVA 4RA0C 2DL9A 4JFZH 1MW1A 4D8PA 3MREA 1CF1A 2UY7B 1WZLA 1L6ZA 2VZTA 1KKDA 1BF5A 2EECA 3D85A 4PJIB 1Q90A 3ILQC 4XXWC 5IB1A 1U8QB 2A9ML 1T1WA 4WCYH 5D7JC 3VFPA 4JI1B 2F66C 1RURH 5E2UH 1N5AB 3K6IA 2VYRE 4M61A 4JN2B 5I1CH 1YZZA 1R0AL 1FGNL 3AQDA 2AV7A 4X6CF 3GMLB 5ENWB 4B3EA 2KH2B 4RGNC 4E5XG 5EIBD 4LF5B 4PV8B 1TMQA 2UVEA 3L4UA 2DBLL 2NY3B 3W82A 1VGEH 1DQJA 4WEEA 1CL7L 3A0RA 2OMBA 4DUYB 3H53A 1IJNA 3BAIA 3E22B 1PVHA 4NFDA 5JMOC 1FGVH 5IBUB 1E4XL 1OOAA 4WTXA 2CKBA 3BMVA 4GSRA 1F4YL 4HWEH 4XNZC 2DQEL 1TA8A 1R1CA 3RYFA 3MXWL 4JM2F 3AY2A 4JY6B 1I9JH 3CXDH 5T1KD 3ZZ1A 2XFGB 3SPHA 5KSVB 1AQ8A 3GI8H 1DANT 5CZXC 5H4YA 1H9VA 4YQXL 5IBTL 2F19L 1J1XL 5BPPA 3HNTH 1THZA 2NXZC 1GJWA 4FQIL 2YPVA 3LH8A 3ML9A 4K55A 4F8PA 2DLEA 3FZUC 3MR9A 3Q01A 4HS3B 4K15A 1CDUA 2D4DA 4J7RA 4OIAA 5CA1B 3ZMRA 4BZ1A 5EUOA 4ZMPA 5IT2L 4KH2A 4CH5A 4G8GE 1K5NB 2Y36L 1Y07A 1CF8H 3D3IA 3UYPB 3UCSC 2FGWH 2OZ4A 1UXMA 5ERWA 2N1KA 1ZS8A 3PQYD 4IKJA 5D2NE 4AJ0A 3EHBB 3HB3D 4KVCL 2AQTA 3LKPB 4MQ7A 2QBWA 3JWOC 2F54D 3VXUA 1P1ZB 3GBDA 4B9FA 3K5OA 1C7SA 2RNBA 1LO0H 2IOIA 2QSCL 2QDWA 2VO5A 4ZBMA 2KQXA 1SVCP 4KKPA 5DK0B 5I1DA 1UB5B 5L3GA 1AJ7H 3ASNC 2WVVB 4K94H 4GAYB 4UQCA 3E8UH 4Q4IA 2HLAB 1PPJH 1RK1A 4JX0A 3IGFA 3CZNA 4F4LA 4KZEH 4PS4H 4XB8A 2D8KA 3EO9L 3CZEA 5DK2B 3WFZA 2B1GA 2W81C 3HUJA 1G9MH 1U8PB 2Y06L 2VDRH 4IRJA 5F9OH 3RZCB 3AG3C 5KZCD 4QLWA 3HI5L 4LF8O 3T4ZA 4B9PA 5C71A 2OMUB 3T3PB 1MQKL 2COQA 1AC0A 1XIWA 3C60A 4X4ZA 3PS6A 3ZMNA 1A1NB 1A7OH 2BY2A 4JI3O 4M5ZH 2PW1B 3RAJL 1FPTH 4YR6A 3H55A 3KL0A 4FFZA 2EINC 4N0CD 1BZ7A 1I8UA 1XFPA 3OAUH 4IBUA 1OGAB 1UM6L 1ZA3A 3NRFA 1FAIL 2F8IA 3WKQA 5AW4B 2P8MB 3X13B 2DE0X 4E4EA 2N74A 2X88A 3JASA 3LSQA 4MT8A 4HIIA 3Q3GA 4DV7O 4FK5C 4FPPA 5HDQL 1KP3A 5GTHZ 1MFCL 2PKDA 1JPSL 4PPTA 5J56B 3EFFA 5I2IB 4DKTA 3IYLW 1ZTMA 3HPLC 1E6OH 4Y4KD 1KN4H 5DJXB 5H35B 5E1AA 3QUMA 3QAZC 5AKTA 1KBBA 4TTGA 1ES0A 2GY5A 3PQYE 5EA0H 1ET8A 4Y9FA 2BS8A 4XN1A 4NX0A 3ABTA 3CXFA 4D7PA 3P9MB 3H9SE 4FLRA 4PJIA 1OSPL 3H6JA 2WC7A 2C34A 2CPUA 3HN5A 1U8QA 3BKMH 2Q2EB 5JPNC 3OT7A 2PETA 4X1IB 1NH2D 1N5AA 1CE6B 4V33A 2EUWA 3V6OA 1DEDA 1UT2A 4LAQL 3RY5A 4JN2A 1TZHB 1AH1A 1UA7A 2IH9A 3RIKA 2W88A 4GX1A 1FC1A 1M53A 1OD7A 1J8HE 3GMLA 5ENWA 5CBAB 2PI5A 5AW8B 1PIFA 2NY4D 4PV8A 1I1FB 3BPOB 2W0PA 3QUHA 1BQHB 2IG2H 2O5ZH 4U0QB 3WAJA 1QVOB 4Z8FL 3MV9B 3E22A 4GI9A 3AG4C 1N32O 3EJSA 1AACA 1GA2A 4NC0B 1OEZW 2J8UF 3LDDA 4JY6A 5KSVA 4E68A 5LMNO 5F9WC 1P4LB 4PGCB 5J9PB 2R0ZH 1RIUL 3S37L 2W9DH 2Z6FA 4EF3A 1WA8A 1KTBA 1T03H 3LZRA 3CZJA 1Q9OB 2PYLA 4BE5A 1UHVA 4HS3A 1U2HA 3D0LB 4HAMA 3QC5X 3JSNA 4FNRA 5CA1A 5JYMA 3KE0A 1BFOB 1H3UA 1BZDA 1JPTL 4UILL 3GS0A 1K5NA 3TN0B 5I1AB 3X2QB 3ICXA 3FN9A 4M93C 3GT6A 4ONGL 5KVGE 1PKXA 1OE2A 3T1YO 3UTQA 1NBVH 1S7UB 4HC1A 3UYPA 4WI6A 2EYTB 3LRMA 5J6GB 5T3ZE 1I85C 3L3JB 2ARHA 2AQNA 3I3EA 1FI8C 3ARGD 3LKPA 4U1MB 4ORGB 1R73A 4YY3B 2ZD9A 2C4FT 4P4KD 1P1ZA 1TMCB 3CFQA 1HE8A 3P4MB 3ULUE 4D3CH 2ATKC 1OW0A 5BS0E 3FQUB 5I8OL 5L6YH 3KVPA 1JJUA 3WNOA 3WEOA 5DK0A 4ABWA 1QO3B 3CRCA 3WSQH 1UB5A 5I82A 5AEAA 1RPQA 4GAYA 4UVBA 3SR2C 2ZXQA 4G6KL 5AW6B 1AY1L 2DLFL 3OAWA 5E08L 2EXWD 5GGQL 4HG4J 2HLAA 3AB0C 1E5BA 5F2FA 1MSWD 1RXLA 4DV1O 2FHCA 4KX8A 5DK2A 5EU6D 3RZCA 4PEEA 3WFDL 2ZNJA 1U8PA 2YXLA 1VFMA 3AXIA 4PJFB 5D1QD 3F83A 1NT2B 3S88L 4UAHA 1PL0A 1DYZA 1KYDA 1BQLH 2APWA 4A66A 5ICUA 1JV2B 2HKFH 3JVGA 2OMUA 2OR9H 1C08B 4CBPA 1A1NA 2GKIA 1I8AA 1KFAH 3GXPA 5GRYA 3ZTEA 2E76C 2PW1A 2J5LB 4HBCL 1YIJV 4P46B 5FHAH 5LGYA 3WO4C 2R2EB 4AMKH 1PM9A 4KUMA 3OKOB 4QXGH 1MJ7H 1OGAA 1ZXKA 4C4UA 4EBQH 4G27B 3CFKB 2P8MA 3X13A 4DGIH 3JAWB 1BCIA 1P4BH 4FG2A 4O58L 2CXGA 4UT6L 3TO4C 1Z6JT 2F8XC 5C86A 4LOEA 5H94B 1AOHA 4GXUM 1XILA 5I2IA 2WBJC 4JR9L 5B21A 4ATTA 1R3LB 1OTTD 5DJXA 1EFQA 5H35A 2R4SH 4M8VA 4KBPA 2O6CA 2Q67A 5DHVH 2KLRA 4MA8H 1FN4B 3ZMTA 1YSOA 2YKLL 3MV01 4XNBA 5AOMA 1XX9C 3A6OA 2F68X 4LMQE 4X2UA 3P9MA 2AK1H 4GQ9H 4PJEE 2R72A 1E9QB 3DSFL 3RY4A 3GK8H 5KBKA 2UUDH 3CB2A 4X64B 2EABA 2OTUB 2ZCKL 3OLIA 1AG6A 3QRBA 1YEGL 7FABH 1QUPA 4K9JA 3SY0B 3U6XS 4X1IA 5AAWC 4FZ0A 4YDLB 1CE6A 3UZEC 2QM4A 1SF9A 1UPGA 1TZHA 4M5TA 4X50A 1JMKC 4AQZA 2P4KA 5CBAA 3KM2A 2V8MA 4IKIA 5CR8A 1TJGL 1I1FA 4TQ8A 2GQHA 5B1AC 5DHYB 2UUCO 1KNOB 5FYJD 1BQHA 2JKJA 5EU6E 3U2JA 1QVOA 3MV9A 3WFCL 5D1QE 5IHUH 1T1XB 5A2FA 3RVXC 2JTYA 4FFBB 5C0BB 2X28A 4JRXE 1EO8H 5JR1H 3ZRSA 2BIIA 2WKGA 4TV3A 3W38A 3O9OA 4X7TB 5FO8B 2K8MA 1AZBA 1UM4L 3ABUA 1S7RB 2G3NA 2VLJD 1C5BL 3GWJA 1EFXD 4M3KB 1PLBA 1S5IL 3T6VA 2RCSL 3WELA 4AE0A 3HRPA 1WRFA 3QCTL 1P4LA 3FTZA 4PGCA 5J9PA 2E46A 4HFUH 2EDYA 5AW2B 2E0PA 5CEZE 1AD0B 1Q9OA 2VLME 3GSRB 4OUUB 4YHNB 5C0ND 3MXVH 4AGPA 1NWPA 2BRQA 1R5IB 1DBKH 3NJJA 1BFOA 5TE4L 2ZF9A 1S7SB 3TN0A 1MWAH 3INUH 5I1AA 3K06A 1JDDA 3BA8A 1MLCB 4HZ3A 2FLBT 3QT2A 4WW2F 1BEXA 4NPJA 3NJLA 5E8DL 1S7UA 5EU5B 4OF3A 5J2TB 4AENB 2EYTA 4K4KA 5J6GA 3L3JA 1N0JA 1C5CH 3ZHRA 2KZ1B 4TL5A 2R23B 1UGKA 3NCMA 4U1MA 1LO3L 2VWKA 1OGPA 3OF6D 4ORGA 1EMTL 5CFHA 2EXTA 3W9DB 3P4MA 1E30A 3V79C 2WGXA 4X8CA 4JAAA 1YMMB 4WTZA 2CE6A 3K2MC 3FQUA 2ZR2A 4P30A 2ERJC 3NJNA 5T5FL 1TENA 3AC0A 1QO3A 1S9YB 3D05A 2F7OA 3L9RB 4QRBA 4F27A 1X9LA 3WN5B 4FFVD 3F7LA 3EYVB 5CBEB 2Q4PA 2FBJH 3KYOB 2HVKB 3L3IB 3N9GH 1MPAL 3REVB 1G7LB 4POYA 1S5LZ 5FYJE 4GOSA 3GYRA 4X7DC 3VYOA 1NCTA 3WDIA 1PSKH 1YNLL 2C8NA 4PJFA 4X6EB 3HG3A 2IPKB 4KTEL 1JV2A 3BMWA 5TK4A 3TYFB 1D6VH 3UC2A 1C08A 1NAKH 5GZND 1DK1A 1NFDE 5F70A 3H1LH 3CWGA 4P46A 2YGVA 2DW4A 2DPKA 3OUFA 2FLMA 2R2EA 5JA9A 5BXZA 2H6PB 4XP4L 5HD8D 2LR4A 2JLLA 3OKOA 4GRWB 5GJTL 3VYNA 4GIOA 1K73W 2WQ8A 3CFKA 5K39A 3V0JA 5DC9B 2YK1L 4OF0A 3JAWA 1P7QB 4JI1O 3NUKA 4AK1A 1RUQH 3ARDC 5IYZB 2P5EE 1YVWA 4IJ3B 1KB9F 3U1QA 1BYOA 3W0WE 4JNXA 5H94A 3ELQA 2FL4A 4JFFB 1R3LA 3MUUA 1SJMA 3ZE2B 4YLBA 1PD1A 4LF5O 5TPWH 1NKGA 4KKLC 3AG1B 2AANA 2QKIC 1FN4A 1EV2E 3D25B 4HCIA 3JD0A 4NOBA 3WG7B 4OIFA 4QJFB 4PJXF 1H2LA 2J3SA 1E9QA 3F8UB 4DK3A 4FQ1H 2OTUA 1V7NH 3HAEH 3EIFA 2DQTH 3SY0A 4KI5D 3K8MA 2AAVA 1TITA 3NTCL 3W7TA 2J88L 2YAPA 4TQEL 4LRIA 5D2LF 2EC9T 5JH7B 5I1GH 5JW3L 2BSSB 4MMZB 1SM3H 1MWOA 1CFNB 3EADA 3GLAA 1H8HG 4JDZB 3KLSA 1F58H 1YQ2A 4LARH 2VRQA 1KNOA 4GS7C 4WZ9A 3BSHA 4QOKD 2ZXDA 4QYOA 5ETUB 1T1XA 1AROP 5AW3B 4FFBA 4DK0A 1TZGH 2Z8RA 5C0BA 4KV5E 2RJZA 3RWEB 2AKRB 1CE1L 1X5LA 2ICEB 3UTSB 4X7TA 4FNLH 4L4TD 1W59A 1S7RA 3MUY1 1L0XA 4AIXA 1RUAH 4N2MA 1X9QA 1GMGA 2OM5A 2X7RB 2HYMA 3INOA 2FJSA 5GS1B 3VWJC 3ZTCC 1R17A 1JZ7A 1JWSB 1AD0A 4HMCA 1J0KA 4YXKL 3GSRA 4OUUA 2R69L 2HFEC 4YHNA 5T1MB 3I3BA 2AW2A 4M1CC 5IYCO 2E59A 2VR9A 5HFMA 1D5AA 1S7SA 2UX7A 4M00A 1ZAGA 5FPIA 4ZI8A 1MLCA 4F37K 5L9DH 1FZMB 4AENA 5EU5A 4NZJA 4WF7A 5J2TA 1WIUA 1I7RB 2R56L 3GQFA 1MMMA 2DBJA 2R23A 3FCGA 2MQ0A 4JG1H 4PAZA 3UC0H 3T9WA 3W9DA 4AI7A 1X7QB 1ETJA 2DIEA 3U0PB 1YMMA 4H8UA 5ID0B 1JTPA 2ZX8A 4NT6B 4AGNA 4KI5E 4TS6A 1NGZB 4JGSA 1S0VA 1DE4B 2A77L 2VMFA 2AEWA 3ZGHA 3SYPA 1NJ9B 1S9YA 3CLEH 3IJ7A 1R3IH 1ASPA 3L9RA 2Q8BL 3GBML 3CBRA 5TE7H 2JIXB 3UPCA 3ZTNH 2IPTH 2YIDA 3S35H 3NACH 1LWJA 4UTAH 2P8LB 3EYVA 4JM2D 5CBEA 3KYOA 3REVA 3L3IA 2HVKA 3H42L 3NJHA 4HP5A 3AM8C 3QIBD 4WHYG 4Z0BL 1ZLUH 5ADPH 2WSSG 5GS2H 4YBLC 1IAIM 1QLRB 4XT1C 2ZE7A 4N8CH 4K94C 2X2IA 4QOKE 5JIIA 1FPOA 2X0LA 3OC8A 1MREH 1Q7YW 4X6EA 2IPKA 3PP3H 4NBXB 4X9GA 5C7XH 4PJ5D 4OV6F 3GB7B 1GM7A 2OW7A 3TYFA 3L5WB 5I8CB 3AQXA 5ELIA 4L4TE 2WQVA 1XZ0B 1IU1A 1VFBB 3NH7H 4J28A 4AYBA 1G9MC 4ZRGA 3PP4H 2H6PA 4LO9A 3KDPB 5D5MF 3DYOA 1K5WA 4A1RA 3STZA 1ZDQA 4K3DL 4WNQB 3HEIB 4KK8C 5A7EA 4HOZA 5KA5A 1LHZA 3HS0B 4RFOL 2QPSA 3T3MF 1P7QA 5HGGS 1G9NL 3N44F 1WH0A 2B0SH 5IYZA 2DQCL 1KUMA 4H8PA 1U8OB 2ZJSL 3HBGA 4WKZA 3DO4A 4PJ9C 4R0LB 3DTXB 1JZFA 4JFFA 3EJTA 1P6WA 2X9XA 2YLKA 3VRJB 2YI9A 3RWRD 2UUAB 4A68A 3U36B 3APOA 1FJGO 2MSPA 1UWYA 3D25A 4LF3B 1KKCA 3OR7B 4NNYB 4TRPH 4B27A 1BEYL 3DPDA 3NRPA 1MFDH 3IDIB 1XCTB 4XWGH 4IM8A 4Y19E 4AHCA 2F8OA 1N34B 2NYYC 3PFQA 3FTWA 3SKJH 4UAOB 4URTB 5HDBF 5EG6C 3V4PL 4MTOA 2IMNA 4ANXA 4L3AA 2F6AA 2EUXA 4BA0A 2HAZA 5JH7A 3G7TA 3GXDA 3KD4A 4PJ8C 2BSSA 2GHYA 4MMZA 3WYRA 1AO7E 5IJ9B 2APSA 3OKNB 3OSKA 1CFNA 4ABQA 3BHBB 3QEQB 4MS6A 4JDZA 2AJXL 4KHXL 1DVUA 2O6PA 3OKYA 4QEGA 3O8XB 3Q6GL 2M26A 1GVIA 3PE9A 4WI9A 5F9AC 3VFGH 3NJVA 4HUNB 4D7TA 4P9HH 5ETUA 3RNQB 1Y76B 2H0EA 1TFPA 1UB6B 4PJ5E 4JZGA 3RWEA 1EEUA 4JS7A 1GH6A 2AKRA 4GG8B 3WXWH 2ICEA 3UTSA 4UT6A 2FL5B 1JRHL 2O72A 1FRGL 1BD2D 2VJ8A 3PWNB 3ALPA 3ZTJH 1NUGA 4GG6F 5GS1A 4W93A 4G7SB 3P73B 4YY3O 1DN2A 1FNSL 5C6TH 1JWSA 4M43H 2FTAA 3OJ2C 2K7QA 4ABUA 2CRYA 3HN3A 3ZBHA 3B2PA 4EQ2A 4NQSB 4DK1A 3CN2A 5JDJA 4X4XB 2E74C 3SD5A 4APQB 5I6OA 4AZ8B 1ZWIB 5DLLA 1CBVL 4FHBD 4TUJB 5IP4A 1FZMA 4YXHL 3VRLE 5I0XA 1ZT1B 3CN3A 5C09D 4IBWA 4B0MB 1I7RA 3JZYA 1IGTB 3F65A 5AVXB 3RIAK 4ELME 4MA1C 3WXVL 1DQQB 4GKNB 4AQEB 4WI7A 3SOTA 1IBGH 1X7QA 2WLZA 4NT6A 4HKZB 4J3OC 1DE4A 1IT9L 1NTMH 1MG1A 3RDTC 1NJ9A 1U3YA 1TJHL 2OJ1A 3C5XA 5L2KD 3UP6A 3REWB 5KYNA 2JIXA 3BABA 35C8H 3O6KL 3MFGB 2CUGA 2IJKA 2P8LA 4L8BB 1F51A 2WVSA 3MLWL 3LMJL 4AEIL 4QRRB 3GLDA 3AG2B 1QLRA 4OCWL 3NQKA 1SYSB 1SQGA 2QHRL 3K6DA 3MLSL 3NN8B 4KJWD 4UUJC 4PY7B 4J11A 1P4IH 3MGAA 1HE7A 5MERB 2MW2B 2MHAB 4NQDD 1BFSA 3L5WA 3VFSB 3ZE1E 5I8CA 4OD1H 2QPFA 2YMOA 4AV0A 4NJ9L 3VACA 1XZ0A 1VFBA 1BD2E 2K8QA 1GGIL 4HCRH 2O5NA 4Y16C 2FD6H 1T4WA 3G6AB 4JKLA 2X5PA 4MASA 4LOUD 2VC2B 2XRAL 4WNQA 4GBXD 1JSYA 2D7NA 1U0QA 4X64O 1OE1A 2F53B 3N1QC 1YC7A 3F00A 3QULB 1MCEA 3MLZL 4MD4B 3HS0A 3WENA 1DFBL 1F3RB 2IJIA 1KTCA 2Z7UA 1EZLA 5K9OB 4KH9A 3FRPB 3IPBA 2VN6A 1AOZA 1I1YB 2H32B 5LMUB 4R0LA 3DTXA 4GMSL 2A83B 1TR7A 1O9HA 1ROCA 3DYMA 3VRJA 4F9PC 5HYIA 4R8CA 2X89A 4W4NA 5T5FA 1QR9A 4WUKH 2FEDD 3U36A 5B39B 5I16B 3BPNC 3R4DA 3MZTA 1KELH 3B77A 4LF3A 3KLKA 3OR7A 1TUPA 3IDIA 1XCTA 2LGWA 3CJJA 1P84J 2DMBA 4RMRA 1BBJB 3FFDB 3TCLA 4CC5A 2KB1A 4IGBC 1RLWA 4Z95H 5A3ID 3MX0B 1IZKA 2AW9A 2ZWSA 4X4ME 3HZYB 2IAND 2CMRL 1OLLA 1SDDA 2NNFA 4UCVA 4Y4FB 4NAJA 3OKNA 5C7ZA 3SQRA 3BHBA 3QEQA 3BAJA 3KBEA 2JCCE 4GH7B 3RKDD 1KTJA 3O8XA 2F18A 4M1GL 3U0WL 4APXB 1YUHB 4OPAA 1ICTA 6FABH 1CGSH 3RNQA 1Y76A 3C8DA 4LVNB 5EZJB 1LP9E 1RH8A 1UB6A 1Y6KR 4CS4A 2BHFA 4GG8A 3GNML 2W91A 2YAOA 1EK3A 1DDTA 2JMRA 4JY5L 5K9KB 3M7OA 2FL5A 2FDBP 3PWNA 4YJZL 1F90H 2ARJB 3CHRA 4JPRA 3P73A 3QS3A 3HZMB 4RAUB 3THML 2F7RA 3K4DA 4J7ZA 4FNPA 1WFOA 4NQSA 1HINH 3IPFA 3D4CA 1FIEA 2AQ1A 3MYZA 4ZOBA 2EVGA 4AZ8A 3MN8A 3VD0A 1ZWIA 4H40A 1ACXA 4WWKB 2EH8H 4TUJA 2G60L 4OLWH 5LCVH 4QIRA 4G59C 4N5ED 1ZVSB 1DL7H 2VW4A 1WBYB 1ZT1A 4L48A 5D4JA 2F43G 2VAJA 2FWLB 1NKRA 1IGTA 4ZUSB 4A2HA 1DQQA 1S7TB 4GKNA 4AQEA 3ECWA 4J8QA 1QLEL 1S5HC 1BQRA 3K4AA 4JZJB 2X40A 4NIKB 2NR6D 4HIXH 3NIFF 4HKZA 5EEXA 3FFCA 3JCZA 1OXYA 1FLTX 1U8IB 4C8XA 2I5YH 1THAA 4WRLA 3VD3A 4WFGD 4FQXB 2PZSA 5I1IL 1R9FA 1E5CA 3GFUA 2F58H 3REWA 1TVHB 4CU7A 3MODL 2JFCA 2Y6SD 1MFVA 1UZ8B 4L8BA 2Z4TA 3BP6B 5JQIB 3BAAA 1A3ZA 2APXA 3CSXA 2HSIA 4QRRA 4ZFOL 2X1OA 3NN8A 1Z2KA 4PY7A 3WNJA 5A2KH 5MERA 4EI5B 4ZFGL 1IARB 1EJOL 1CIUA 2MHAA 3VFSA 1QPPA 2WZAA 1G87A 2K4WA 4UT7H 4DFIA 2H0JA 2IM9A 3G6AA 3KL5A 3U30C 2C9XA 2DKSA 4YDVB 3I3DA 5KSUB 1ACZA 4DAGH 2HTLD 3ZL2A 3QULA 4MD4A 2F53A 1I9RH 1N7MH 1Q1JH 3EH1A 3VI3F 5I0VA 1SY6H 3LS5H 4JB9H 5K9OA 1G84A 4JK0D 3FRPA 5HDWA 3S0PA 1AQKL 4KKZA 1I1YA 1WHOA 2H32A 3EFDL 4NZTH 4YFLF 3WFBH 5HHPB 2A83A 3O3DB 2XZCH 4XHQA 4P5TC 1KMGA 5EU7E 2FJUB 2BW5A 2MPAL 4L8SC 2EDNA 2WWMD 5A40E 1WEJH 1SQXH 5FAAA 2WUBH 5B39A 2AERT 2JELH 4FQLL 5I16A 4B0MM 5L8KB 1MF2L 1MFBH 1CIDA 1FSKB 1E28B 2AVFA 3BWZA 4MAUH 3APCA 3MCLH 4JTAB 4C56B 4R2GD 2EDDA 1OK8A 4OCYL 1AZRA 5KSAC 3PJSK 1ZL8B 1BBJA 3FFDA 4GIPD 2XZQH 1JMXA 1KYOF 3L70H 1QSVA 2V7QG 4OJCA 1M5IA 3MX0A 3K1DA 4JN1L 4LDCA 1VFAA 2GJJA 3HZYA 2XN2A 1AZVA 1U3ZA 4A7TA 4B5ZA 4Y4FA 1ORQB 2ROYA 3P77A 1GRJA 1FLRH 3S3DB 3H2QA 5JXED 1SOSA 1FXKC 1K34A 4F1ZA 2FRGP 3N42B 4PLKC 5D1ZB 4APXA 1YUHA 1OZ0A 3BN9D 5C6WH 2ARJQ 3MBEC 5EMYA 5EU4B 5EZJA 5TF1L 4KKCD 3LPGA 3MU3A 4DW2L 2F95B 2YWYA 3ZDZF 4ODSL 1DQDL 2KHAA 4N8VB 2OYQA 5K9KA 2WTOA 3SYOA 4JW3A 1NZ6A 1T7YA 1WAPA 4KO5A 2WJ7A 1R3JB 1B2WL 4PREA 4YHPB 1TTAA 2ARJA 5GGTH 1QNZH 1XEQA 2YGQA 3HZMA 4RAUA 3SGIA 3V9CA 3FO9B 4X66B 4ANUA 3BVVA 1M9NA 3QIUD 5E9DB 1IVSA 1DBML 1OPGL 1QSED 3ESMA 4XE0A 4ES8A 5J7CC 2NY1C 2BNRD 4LF9B 3EF4A 3SOBH 5IB5B 5I1HL 1KEGL 1NCCL 3GSXB 3GSUB 1QA9B 3F7YB 4WWKA 4PA9A 1SOQA 4QY8B 3RHWF 1Y6NR 1ZVSA 5AW7B 1SXBA 3P30L 3V4PA 5AG9A 1PZ5A 1PD3A 2JKIS 2BCMA 5E7FA 5TGBB 4ZUSA 1XMEB 2UXNA 4NZDA 1G1XB 2UXXA 4DR4B 1L7TH 1S7TA 2WCGA 5HHVH 1QQCA 4K8RD 4XI5D 4NBYB 4JZJA 1MCWW 2QQKH 3IT8D 2EIMC 1U8IA 4NLAA 2OI9C 4NM8H 3QUXD 4W9LC 4FQXA 3M8AA 3D4ZA 2AABL 4QKXB 2JLPA 4R90L 1NGWA 3VGHA 2XG4B 1TVHA 3KLQA 4KZDL 3SPCA 4WHTB 4N2KA 1INEH 4Z3JA 4YDMA 4D6TH 1UZ8A 3BP6A 4PP1C 3HS8A 1N19A 5SWSD 4YSAA 1RSOB 1IAMA 1FVEB 1UWFA 1NANI 1R3IC 3MRDB 4L3CB 5DD5H 2RMNA 1EN4A 5I5JA 1ZGLB 4ZTPL 4YUEH 1ZD6A 2P42B 4X7SL 5ICXB 1VPOL 2A4ZA 2G5RA 1TEGA 4GXVH 4EI5A 1LEGA 1P6FA 3GEFA 5KW9L 3FN0L 3TXAA 3FU9A 3T71A 1MW2A 2FNWA 3PWPD 3K5MA 1OLZA 1W8EA 3NIGE 3LEXB 1DF5A 2X0VA 3RBSA 2UUAO 4BCXA 4CVXB 4S1RH 2DM3A 4PV1C 4NCC2 3FULA 4PN6A 3JCUZ 2C3XA 3FUDA 4YSRA 5AAMC 5KSUA 3QDAA 4KVPA 4LP8A 4MMYB 3IAYA 2V9TA 4LLQB 4YGVB 1KWKA 5ALCH 1N34O 2R0WL 1XH0A 2DH3A 2P7TC 1OL0A 4RO2A 2NQCA 3IFOB 3KPNB 4HYTB 2VQFB 4PJXE 4ZXBC 3ZL4L 3K58A 1QLEB 1YEFH 5HHPA 3OM3B 3O3DA 2R8SH 4CGTA 3TA3D 5H37A 2YZ1A 2L7JA 3JYCA 4UCOA 1JFHA 2Z3YA 4EE2A 5D2LE 1PLGL 3BJLA 1SOKA 1L8DA 2VDNH 2HUEA 5KSBB 3IDJB 1NOFA 1IGJB 1E28A 2OMVB 2QGEA 5FWQA 5JZ7D 1GYUA 2NY0B 2K78A 4XBEH 1MCDA 2NXZD 2HFFB 2WIMA 1LDPL 2KUTA 5E95B 1K4DC 1XMQB 1ZL8A 1TYRA 3F01A 3P02A 3CFCL 4G6JL 5CA3A 1G7IB 1OTSD 3IXTB 4UOW1 4ZFOB 3QFJD 1NWOA 3ABMC 4XVJL 4DO6A 2ZCLL 1EIBA 1IBHA 1ED3B 3IAPA 3LPWA 3PGFH 5FK9B 1ORQA 3BH8B 3BDYL 2WQWA 2EEXA 4XP1L 4DEWA 1F4HA 3VDBA 1HIML 3QIWD 3C6LD 5D1ZA 2P06A 1KGUA 3OWEA 1AANA 3LQAL 4IOFD 5EU4A 4ZS7H 3RWCB 4XRCB 5GPRA 3BUBA 4HPYL 2HB0A 4PWHA 3V0WL 1IAKB 4N8VA 2AEOA 4BCYA 5C8JB 3PWPE 4HCRL 3V4LA 1WWCA 4HXBL 4P9HC 3VA6A 4DR6B 3S8GB 3UTPD 4EIGB 1R3JA 4MBOA 3B9EA 4P8QA 4YHPA 4XP6H 1B9ZA 2E86A 3TBVB 5E1IA 4J6RL 3WDHA 3T1WA 1OARH 3N1MC 3L1OL 4F9LC 3X3GL 4J3OG 2Y2YA 3FO9A 5DECA 1RPRA 4N90D 4OM1L 4OGYH 5I28A 5E9DA 4O5LH 1B4TA 4U6VH 3PL6B 4HAGA 4XCFL 1AI1L 4XCCL 5IB5A 2B3IA 3NT0A 4RFNB 4AEEA 1J10A 1QA9A 3F7YA 3GSUA 3HMXL 4HU2A 4JHAH 2O61A 1KN2H 1AKJD 1ECZA 4QY8A 2DTSA 2NUTB 5IW6B 5MI0B 1Q81W 4NKIL 3IFPB 5TGBA 3ZR5A 4PRID 2MQ3A 3BVNB 2I25N 4FXGB 2A9NH 1JMZA 3IS0X 4PJGB 3UERA 3O4LD 3SO3B 1CFQA 2HP4A 5I9QB 5JJNB 4U1IB 2OTWB 3QFJE 1L1FA 4LHUB 3VG0H 5F7FA 4QCIB 3S2CA 3RUGF 2IXQB 1HNFA 1ND0B 2XG4A 2Q3XA 1QUNB 3EOBB 3F05A 4WHTA 3D2UB 2ODIA 1JZGA 1ZRUA 1A8JH 3JTSB 3QHTC 1YRKA 2NQ3A 1RSOA 4OZIF 1FVEA 3MRDA 4L3CA 4LFBB 3VMNA 1OCRC 5E5UB 2Y7NA 5DWPA 1ZGLA 1KXTB 4EUPB 3D36A 4N2EA 4XN5A 4ZNEA 3STLC 1W0WB 2FE0A 1J7VR 1OAZL 3APMA 5LMUO 3F5WB 5IVXE 4LHJB 5CILH 3QHZH 3ZHDA 5CZKA 2O6EA 2CLVB 2I07B 3FUKA 4OB5H 1SEBB 4M9PA 2DYPD 3LEXA 3WAKA 1H3XA 4CVXA 3UTPE 4G72B 4MDRA 5TE6L 3UJJH 1GS6X 3DHMA 4DKAA 1IL1B 2OMZB 1ZHLB 4IIJB 3Q1SL 4MMYA 4LLQA 4N90E 1NR7A 4YGVA 4AV4A 3ZU8A 2WLIB 4FZ8H 3RTQB 5D93C 3O3BB 4GFTB 1OCWL 1FE8H 3IFOA 4W4LA 3KPNA 4ZQKB 4TTDC 4M6OL 2VERN 1JZ8A 1M2OA 5AB9A 4PRHD 5D96B 3QJRB 2Q0OC 1OHQA 3BFWA 1EEQA 3ZKXB 1XMOB 4KL1A 4P3CL 5B1KA 4ZW7A 3Q6FB 5KSBA 3IDJA 4TUOB 1IGJA 2OMVA 3TK1A 3WD5H 2DQJL 1D5IL 3OSVA 2HFFA 5ACMA 1PNMA 2AQRA 2MH4A 2QSQA 4RCAA 2IV8A 2XJLA 3RB5A 4UXNA 1G7IA 4ZFOA 3IXTA 3WIFB 1NCDL 2CHNA 3MLYH 1V55C 2K1MA 1ED3A 5FK9A 1IAOB 4KUZL 2VISB 2P4AB 3BH8A 3EH4B 5KHJA 4L9LB 3IMWA 3I2CH 3ULSB 2UXVA 4CJ0A 4OI9A 1JS4A 2XBZA 4QXTB 7PCYA 3MSPA 4D9LH 4PJAB 5CAYB 5FPRA 2O5YL 3QJZA 5LN8A 1II4E 1XTLA 4DV3O 2R9HC 3BWUC 1ZGLM 3BQUC 3RWCA 4XRCA 1ULVA 4HETA 3I50H 1KCWA 1A3RH 2BE3A 3CMAV 1IAKA 1D7BA 2LVCA 5C8JA 1I1AD 3SKNB 3APDA 4MYPA 1B6QA 2P5WD 2NY5C 4KDWA 4QHUB 2MOGA 5DD0L 5DMIH 3TURA 1IC7L 3QRLA 3WMSA 3I9PA 3MJ7B 1UASA 4IL6Z 1AIZA 4L0PB 3TBVA 3L73H 3CXHK 1NC4B 4WI0A 3UQ8A 1D9KB 3HRZB 1NGQH 5CLWA 3SDAB 2WIIB 1R5WB 1BQZA 5BRZD 4ZOCA 4ZD3H 1BF2A 3L3OC 3PL6A 4N85A 4LL9A 3B2MA 4WO0A 5TDPB 4F93B 4HLZG 4PR5B 4S1QL 2P6JA 2R2BB 1U3HD 3FT1A 4KQ3H 5IW6A 1PL4A 3LY6A 3MA9H 4G1EB 5HYJE 1QACA 4M7JH 4ODTL 3BVNA 3U4KA 2CGRH 4NQTA 4IOSA 1KP2A 2C1OB 4FXGA 4ZMYA 4KRMB 4PJGA 1U58B 2XTJD 4OGAD 2E7MA 4K73A 4XNUL 2AZ0A 2OTWA 3D50A 4DP5X 1E43A 1ZVYA 4LHUA 1OAXL 5EUOF 1J5OH 4QCIA 4H13C 2IXQA 2PABA 1ND0A 1QUNA 1S7XB 2ZUSA 3EOBA 3D2UA 4I2XE 5EF0A 3IB4A 2IH1A 4LPYA 3JTSA 1MIEL 2PYED 4ZTOH 2BJML 5D7SH 2ITCC 3HG1E 5BQ7B 1KXTA 4RGOH 4EUPA 3KLHC 2QE7G 2EYRB 4PS3A 4PD4F 1W0WA 1WBXB 3L08A 3F5WA 3H54A 5T3ZL 3S2AA 5ABAA 3UFIA 1HDJA 1DBJH 3T1HB 2CLVA 2I07A 4BK5C 2N05A 1HVXA 2P5WE 4N25A 4CU8A 2C3HA 3N1FC 4B9KC 4FFYL 4M29A 1MFEL 3ULUL 2A0LD 1OB1A 1IL1A 4FA6A 2OMZA 3OEEG 1ZHLA 2XVKA 3AREC 2ZCEA 4IIJA 4HPOL 4MMXB 3P30A 3CHPA 1GZPB 2WLIA 1I3RA 4LC1A 5BRZE 4H4NA 2C1PB 3BOVA 3RTQA 2Z92B 2QJ1A 2PCYA 3O3BA 3O6ML 4Z3GA 3HUJF 4AQ8C 5CSZB 4LSUH 2FTKA 5E2VH 4HH8A 2ZNWA 4QHKI 4IBVA 5JNYB 1URLA 1R3KB 1R75A 5IK3B 4CC0A 5K69A 2XA3A 1KF9B 4OGZA 4P06A 3Q6FA 4AEHL 4TUOA 2Q86B 4NXSA 1RHHA 4FLQA 2AGJH 5FW7A 4PHZA 2XTJE 1UCTA 3SPJA 3DARA 5IREA 2D9QB 2H41A 1WHPA 4NGHL 4G8GB 1LILA 1L0NH 2CM5A 3WIFA 1NVPD 2VUYA 4UF7C 2X6BA 5KMGB 3LNHA 3S6CA 3ZE0E 4EN3B 2RB8A 1DBAL 3O65A 4L37B 1HP8A 1IAOA 1N59B 4GQQA 2VISA 3RRQA 4XNMB 3UDWA 5D2NB 1TVKB 3QO7A 5IT9N 3F12B 5BMFH 4TNFA 4L9LA 3RDJA 4U31A 3WOVA 1MW3A 5ERWB 1I75A 3ULSA 4FXKC 4QXTA 4X66O 4BCZA 4PJAA 4MYWB 5T1JA 1E8WA 4PJIF 3IS1X 4LF9O 4A2GA 3WKNA 5AVUB 4FJYA 3UTZB 5CR1A 5I0DA 3SKNA 2J6EL 2H1XA 3ZKQD 1SJHB 4QHUA 2QELA 4ZFFB 1EEZB 1KFGA 5D4HA 3CPWU 5IGXH 2FECI 2MCMA 3AS0A 4RX4D 3P0YH 3WY2A 1O6VA 4JPKH 3MJ7A 2XAHA 1D7CA 2XNAB 3QDHA 4WCEV 4DR4O 3HVDA 1NC4A 3WFEL 1D9KA 3HRZA 4KNTA 1CFVH 1J1OH 3SDAA 1R5WA 2RCVA 1Z9OA 4GAGH 1HNGA 3VFRB 4EZKA 2ZWYA 5T1KB 3L81A 4PS7A 1TGOA 1TOXA 3QZOA 2ADPA 2BS9A 1CWVA 3UGXA 5KTEH 4IT5A 4PR5A 1K85A 3BESR 5IHZB 3MV8D 2R2BA 2BM3A 3HR0A 4F7CB 5HGDB 2BSRB 3D06A 4G1EA 3F3HA 3BEHA 5KVFL 5BO1H 5BW7A 1Z3GH 1A4CA 2C1OA 4DNLA 3U9WA 1G1KA 1U58A 1H6UA 1AMXA 3QFGA 1UT1A 2R2CA 5EIQA 3TEYA 2Z8SA 3ARDD 3QUYB 4ENED 3OZ9H 4ALAL 4K7PH 5IQLA 3VM5A 3PQYB 1A2YB 5CEZL 2VH5L 1S7XA 3CPLB 5G4OA 1IGIH 4KOCA 4G3YL 1ETA1 4ODVH 5DFAA 3H9SB 4S1SH 1C16B 5CEXB 3DX4A 3FTYA 1BX2B 3GC3A 5CJOH 1EZVY 2DL2A 2V0AA 1TYJA 2QGNA 4N9OB 5KANI 2Q9LA 5BQ7A 5LWYH 4P0DA 2EYRA 5DMKB 4H88L 4HZ1A 2Z65C 3ZKNC 1UWXH 3LOWA 1JVKA 3NA9L 2A74B 1H2NA 3GD1C 1YNKL 5DURD 4RISH 1IGFL 1M7XA 1J8HB 2ZAIA 3B8NA 4PGDB 4R7NB 1RSYA 1SBBA 3HMXA 2UXDB 1CEZA 5IBLD 4MMXA 4TULL 3N40F 1JTOA 1GZPA 2EE3A 1BQHG 4LKXB 2WLHA 1KY6A 4OUOA 4ZJ9A 5KZCB 2C1PA 5DWUL 1XMQO 2BNQE 3QEUB 4KXBA 5F7KC 1AVMA 3UGUA 1XF3B 1NS1A 2AXGB 2ZNXA 2GV9A 4ZX5A 4CMHB 5FM4A 3T3PF 5JNYA 3MV8E 2H5UA 1R3KA 4JHZA 5ALBL 5ANHA 4A67A 4P5SA 2HCZX 3SJVD 2Q86A 5FLXN 1OM3L 2J73A 3H1ZA 3Q8EA 5CWSB 5AVVB 4I5BB 4JO3H 1L7IH 1KC5H 1U8NB 1YO4A 1RP9A 5LGHL 4TNVK 3KNBB 3PHQB 4G8GA 2UXGA 4PWIA 5KMGA 1LD9B 1VQ5V 3RY6C 2G2RB 5C0IB 4DR6O 4L37A 3QHFL 1N59A 1T3FB 5HYEA 3SJCC 2AP2A 2K70A 3HR5B 3NFSH 4XNMA 1TVKA 1PS3A 3F12A 4EOWL 4LU5L 5CKGA 4JGNA 2OW6A 2ZICA 4LEBA 3JTBA 2NXYD 5HHMD 4GMTL 1E9OB 3VXQB 4ES9A 4PHXA 2GVYA 3GJFB 5BS0B 1OP4A 1FF5A 4Z3HA 4Z1MG 2W1NA 1PG7X 2B77A 2LU3A 3FB5C 5HI3C 2PW2B 5C0RH 3GBNL 2DWEC 2D4FA 2QWOB 1H3PL 3TC9A 1MOEA 3UTZA 4ERSL 2DKUA 3BC9A 2CUAA 4OJAA 2EXYD 1B0GB 1SJHA 4DH2A 4ZFFA 3TS8A 1EEZA 1PPIA 5B1NA 3SDLA 2NY4B 4HFWB 5HJ3B 2Q7NA 1Q5OA 4ZUTA 3RGVD 4LEEA 5I6NA 2FH8A 1DVXA 4C59B 6TAAA 4OZ4B 3QQ9D 3HKBB 4AC4A 2X2HA 3QNFA 2GW5A 4J4PC 3J81N 1RZKH 3LDBB 3SYAA 1Q72H 4I18B 1GMIA 3VFRA 2YQGA 3CLFL 4A63A 5T1KA 2GUOB 2VXTL 1Z3RA 3JWDL 3NCWA 5T5NG 2KG7B 5IHZA 5JUEL 3Q8AA 3GINA 1NL0L 4NFBA 4F7CA 3K5LA 4GIAA 1AZUA 2X2UA 2BSRA 2KLTA 1GTOA 5HGDA 1HS6A 3LZOA 3T0AA 1BQ5A 5F44A 3A0BZ 5J3HC 5GRUH 4KK8D 1MEXL 1SFHA 1BYNA 4L1BA 3MACH 2VDKL 2XQBH 4YH6A 4F8LA 2WLMA 2WHVA 3R8QA 4KPHL 1RULH 3QUYA 1YYML 2WYTA 3B40A 4EFBA 3MLVL 3TWCH 2H3XC 2EDQA 3PQYA 1A2YA 3CPLA 4R4BB 4R7LA 5C0FA 1CYWA 3ARGB 1AQDB 3GHPA 3A2FA 3GHBH 2ORBH 3H9SA 4X4KA 1C16A 1HHKA 2IGTA 4P4KB 4PJEB 1BX2A 1RZIB 4ADGA 5CEXA 5JW5B 4E9SA 4XX1E 4MXVE 4Y0GA 2Z31B 5DMKA 4W9KC 1T7WA 2HA1A 5CJXC 2E7LA 4BZ1H 3CD6V 3KBPA 2NYYD 4Z7WE 1WZKA 4UOW0 2FWOA 2A74A 2JJTC 3RWFB 4TUKL 1P5UB 3OB0K 1J8HA 3SODB 4O4YH 4PGDA 3OC5A 4R7NA 2VN7A 1F3DH 4XBMA 3G5WA 2Q87A 2H47C 3SGDI 3P3NA 2WANA 2QKSA 1DDHB 4H0IA 4LFHG 3RIFK 4NN7C 3QJFB 5EU6B 5K1VA 5CGTA 1CURA 5D1QB 1KB5H 2EH7H 4LKXA 3SDDD 3UADA 3QEUA 1QHOA 2OMWB 4JRXB 4WEBH 3DX1A 4PJFF 1XF3A 2ICWJ 1QVGU 2J8HA 1G7QB 4Y2DC 5IKCB 1EVUA 4MD0B 4ZW3A 1YSCA 4RIRB 5FA3B 1U9KA 3CFDB 4OQTH 1SC5B 5IMLB 3A21A 1KLGB 2BSED 5MEND 5DD1L 5J57B 5TH2B 3RA7H 2WZ0A 5AW5B 2OX5B 4DKFL 1W0VB 3L4YA 4YE4H 1HQRB 3U2IA 5CWSA 4WBNB 4I5BA 1C7TA 2PO6C 3QXTA 4JAVA 3BSZH 2KQMA 3O9WD 3DWTA 3KPQB 4ZPTB 4KITB 1Y6XA 3PHQA 2CA4A 2L4OA 4IBZA 3SQOL 2CHWA 4OFQA 1LD9A 1FIGL 1X5IA 3RURA 3WGVB 2G2RA 3W1ZA 5C0IA 1SLXA 2CTPA 5B7MA 1T3FA 2FATH 3FMGH 2OKMA 3HR5A 1E8YA 2PXYB 2GI0A 1QW9A 1YNTB 5CF3A 5KBPA 3VXQA 1T2QL 3E83A 1E9OA 1FNGB 2WSPA 1RFDL 2Y1YA 4FFYA 1IVLA 1J18A 2DJSA 2VZ3A 5FDYA 3MC0A 1NLBH 2DICA 4IS6B 4GUQA 5CJ5A 5BS0A 3CCMV 2Z8WC 1COWG 2FX9L 1ZLVH 4I3RL 3E6FB 1CUOA 4WWID 3HHRB 2IMMA 2PW2A 15C8L 2VZSA 1HU8A 4J3OD 1K7DA 5T33H 3SBWC 2ZD0A 2CJUH 3QUGA 2WWNA 5SX4H 1S2EA 3GIZH 1K4CC 1J5IA 3CH8A 1B0GA 4FZEL 4HFWA 5FWRA 5HJ3A 2YOAA 1M42A 4K9EH 3BUQA 4OZ4A 3FT0A 3CP1A 3HKBA 4I9QA 1S5JA 3DROB 1WFUA 2YKKA 2Q7AA 3ABKC 3ZRFC 4N86A 4U05A 4G9FE 4KK9C 2F4VB 2FHBA 1O9ZA 2LFSA 2X38A 3FONA 3ETTA 4LGRB 1O7SA 2XWZA 3JD4A 4ZZKA 4I18A 5DEGB 1NFDB 1EFXB 4KZ0A 2GUOA 1GYWA 4ABVA 1AR1D 5SV4A 2KG7A 2YQ3A 3ATDA 4RETB 4X8XA 5KBDA 4UOQA 3E9UA 3MLRL 5D1XC 4Y16D 5FOBB 4IRSD 2K3TA 1A7PH 1BLIA 2C9QA 2WMPB 2EDEA 3CVCA 3FF7A 1WG3A 4LLDB 4JF3A 4HUXB 3E86A 3KPPA 4QHLB 3IDNB 4M5YL 3HOGA 2DMCA 2P5EB 4ODXB 4HEPA 3W0WB 2F23A 3T1HO 4GAAA 4U1GC 5T1DL 3LHPL 3D85D 1Q90D 1TQUA 3IAGC 1KCSH 3DSNB 3QG6B 4YSOA 4BQBA 5LG6A 4RLDA 1GHFH 4R4BA 5DEFB 3VJ6B 1OCCB 2HJDA 3ARGA 1AQDA 5K9QG 5F6HI 1CDCA 2J6EA 2C9AA 3X1BA 4PJEA 3TEWA 1RZIA 1N5YH 1UWEL 5JW5A 3S4SG 5K1NA 3L4WA 2A9DA 3ASOB 1BXAA 2Z31A 4ZW8A 1F7YA 4UM9D 2X3AA 2IH3B 3ARBA 3RWFA 3WU1A 1NPNA 1UJ3C 1P5UA 3CAFA 3GMRA 4IGBD 3B8MA 1URZA 2WVTA 4QJ5B 5J06A 1T5WB 4K3JL 1NA8A 1JR9A 2K7PA 4BFOA 3CC7V 1GL4B 1DDHA 2HFTA 4NUJB 4YIQB 4B41A 4UOZA 5I66B 3D18B 3QJFA 5EU6A 4ONFL 2DWDC 5D1QA 4NN5C 2Q8AL 4TV8B 4CBCA 2XWXA 2OMWA 4LRNH 2Y6TE 4JRXA 4OCXL 4Q6IB 1IGCH 1S7QB 4DP6X 1G7QA 3CXHJ 3NVQA 2VWEC 3BX7C 5IKCA 4MD0A 1PX3A 1GAXA 2N0MA 4PRDB 4RIRA 5EO0B 3LEVL 2PF4E 1JERA 5IMLA 1KLGA 1K6QL 3IWVA 4NRZB 3QUZB 5KBLA 1MCIA 4CADB 1PD0A 3UROR 1YUKB 3NSCA 1YG9A 3TH2T 1AGDB 2GFBB 2OX5A 3IGAB 4NHCH 1W0VA 1DTOA 1GSMA 3KDMB 2VITB 4WBNA 2HVJC 3BVOA 2ZF8A 1DLFH 1ZV5A 2HJLA 1BVKB 1WISA 3KPQA 4ZPTA 4B50A 4NZRL 1W8NA 1JHLL 1TCRB 5CN2A 1BAFH 3O6LH 4QWWD 4NNPL 1GY2A 1IFHL 2B1HH 3APNA 2JNZA 2PXYA 1Q0XH 3VD9A 3ZE2F 2Y07H 3N43B 2O30A 3MPCA 3HNVL 5FXCH 2DKMA 3D3QA 4Z7QE 3QGVA 1FNGA 3QDJE 1GN2A 3RI5K 4M3JA 2LQRA 2JQZA 5EN2B 3ATAA 4IS6A 4ZAKC 2J25A 4K5MA 1L9MA 2D0GA 2CD0A 2HKHL 3E6FA 4I0CC 4JZNB 1ET7A 4LNVA 5LJYH 5T3XH 2ETWA 2ADQB 3WI9A 5KVDL 3M1OA 2C5DC 4JHBA 3AJ7A 4BSWB 4WUUE 4MCYB 2DEWX 4O9HH 1TEFA 4BFFA 2XTAA 2ATAA 1CU4L 2XYCA 2XV0A 2GEEA 5LO7A 2QADC 1XIWD 4H8HA 1TQBB 3F7VC 3DROA 4QOKB 1YYLL 1CDIA 3L5XH 5E9NA 1N4XL 3WKPA 4JCWA 2E5EA 3DHPA 2F1BA 4ZT1A 3VTMA 5DEJA 3LH2L 3LVTA 5HGBB 2Q6AA 4G2AA 4JQVA 1SQ2N 1ZPLA 4HSAC 5DEGA 4L4TB 4X6BB 4DN3L 1NFDA 4G6MH 3AZUA 4XMLL 5AQ0A 3QNEA 3VGFA 4PVNA 2NW2B 3B2VH 1NAMB 3ZMSA 1VACB 5C0DB 3L4TA 1U42A 2HP8A 5FOBA 3AS3A 4FLTA 4J10A 2WMPA 5F9JB 4MVUA 1ZANL 4H25B 4PYGA 4HV8B 4LLDA 3NAAL 4QHLA 3EDFA 4HUXA 3GRBA 1UZGA 4JPVH 4PGEB 3IDNA 1GTNA 2P5EA 3QNZB 1QMUA 4ODXA 1I7FA 1WD9A 1E90A 1WTLA 3DJSA 4XMPH 3W0WA 1TTUA 1MCHA 3SEPA 4RRPG 4Q8BA 3S36X 5KA6A 3DSNA 1AFVH 1BVLB 3QG6A 1UURA 2YEVB 3FTSA 2Z9TA 3QG7L 4G70B 4HISA 4XH2B 2QVKA 1HHGB 4Q89A 3FCBA 2F93B 1ACYH 4OF8A 3CZUB 2VR8A 2YUVA 4GYCB 2QQLL 1SOXA 2OMTB 1L0YA 3HI6H 1SDYA 1ADQL 2CTQA 4L1HA 1I08A 4Y19B 4G28B 3RFRA 2VMDA 5C07D 4CSSA 4DP1X 3TJHC 3M1BB 5SWQB 1VQ8V 2NY3D 5GW7A 5HI5D 2IH3A 4BRJA 3ATFA 4N1HB 2ZUQB 1AO7B 3CZKA 4HK3J 2W80C 3CS5A 1T5WA 4GCZA 1TLKA 3ZIAG 2AITA 1KJMB 4OIIH 4YIQA 4NUJA 1L3NA 4ZOEA 4KXZH 5I66A 3D18A 3H3KA 4JI4B 2ZT9C 4I87A 4PLKD 3IMBA 4TV8A 4XPAH 4Q6IA 4PJ5B 2XIDA 3MBED 5JJJB 1S7QA 3BP4B 4MB3A 4N2CA 1R6KA 3OKMB 3UAJC 2M8XA 4PRDA 1YLBB 1E4XH 4JAMB 4NXMB 4GLXA 5EO0A 2AHIA 2E7DA 2WCPA 3QVAA 3DK0A 3D5OF 3KZIZ 3QUZA 4NRZA 5K1JA 3CFMA 4CADA 3LSUA 3FKUS 2LAAA 5E2TH 4MS8C 1AGDA 2GFBA 4FL4C 2HG5B 3IGAA 5FYKH 1J86A 1TTFA 3KDMA 2F0CA 5EEWA 2VITA 2OR7A 2P49B 2GAZB 3FC8A 2NNAB 2ZXWB 2X44D 4U3XA 3EHBD 1BVKA 1LE5B 2F19H 1FDLL 4MB4A 3BRGC 4FM0A 1TCRA 5CGYC 4XOCA 5E8PB 4HJGB 5KOVC 5EO1B 3ABLC 4XWOD 2YXHA 3A6BL 4ELMB 5EF3A 3HE7B 5CMAB 5IB4B 3D39A 8PAZA 3V4UL 3KAAA 4E5XB 2A6DB 1RIHH 3TESA 3CC4V 4YC2C 5EN2A 5IFJB 4TSBH 2E27L 3CVDA 5AOZA 2AJYH 5C07E 2QV4A 1WLEA 4JZNA 2IPUK 1RJYB 4OF7A 5EBLB 1PG7L 1BM3H 5B1JC 1A3LH 2ITFA 3KGTA 5FYLD 2MTAA 1H2GA 3RZCD 2DH2A 2DQHL 4BSWA 4MCYA 5AYUH 1SFDA 1S78C 4WW1B 4P23C 1UOLA 2CK0L 4HULB 1BWWA 1UOWA 3MRCB 1NH6A 5ACLA 4U0RB 1AP6A 3T8MA 1U6AH 2ED9A 3BKYH 1F4WH 3GSNB 5CLYA 3GDBA 1YEEH 2H1PL 4O4JB 3QPKA 5LQBL 1ZHNB 2Y1VA 4U6XB 2D3VA 2B7DT 4OSUH 1RUMH 1M2VB 5HGBA 2YPLA 1IV8A 2ZZUT 3LXUX 3ZE1B 3FTGB 4NO5B 4L4TA 4X6BA 5HPMB 4LNUB 2YD7A 5IB2B 4LGSB 1T2XA 1BD2B 1EAOA 4XVUD 5E70A 4LB8A 1RZKC 4S11A 2NW2A 3FL7A 3NJKA 4KWUA 4MXQD 1VACA 2G5UA 4OM0L 1IAIH 5F1SA 5F0MB 4LQFH 5F9JA 4H25A 5D71L 1IEAB 6PAZA 3QZMA 3C3SA 1QR4A 4HV8A 3C90A 4PGEA 1N3NB 3IJ8A 3DECA 5GS0L 4TVPH 3QNZA 3SQBB 1HAWA 4POUB 3O45B 4OLZH 3ETEA 3LRGA 1OCOB 1PZDA 4K3AA 1BE3H 4PB0L 3DIFB 4QRSA 4Y1AD 2YEVA 2IDSA 1COBA 2E9GA 2YRBA 4KXZI 4JI8B 3H7BB 3UEZA 5EORH 4XH2A 4F2ME 1HHGA 2N04A 1KTRL 2QFRA 5JIPA 2LLGA 3II2A 1MH5B 1OY3B 4G8EB 4YDVA 1ETB1 2QDOA 1GGCL 1LK3H 2OMTA 1CL7I 2OTPA 2BOBB 4Q52A 4Y19A 1WPBA 5SWQA 3M1BA 2E3CA 4XAKD 3GZKA 3KS0H 4Q2ZB 4KK6C 1E4XI 5DMJB 25C8L 4JL2A 1E5AA 5LKNA 5DC2A 3MRKA 3MV9D 3EO0B 3J07A 1G4MA 3EJCA 3B9VA 4TOYL 1EHLH 1AO7A 1LVEA 3AMLA 2XN9D 4AGQA 3BPCB 3E35A 5CUSL 3SBQA 3HCVB 4KOBA 1HXMB 1KJMA 2JCCB 2UWEE 2X70B 2H2PC 2YC0A 3UZQB 4ZUUB 2D3JA 1LP9B 2EIDA 4ZTEA 2CALA 4PJ5A 2AHZA 2BTQB 3BP4A 3HKZA 3L6FB 3OZLA 3JAKB 4LEXL 4TSAH 3F62A 1UGNA 1OTUC 4NKMB 5IR1B 4Z8FH 3OKMA 4LKCB 3DBXB 4JAMA 1QFWH 3E3QE 3BYYA 4JQXC 3TN0D 4GBXB 5SX5K 3U4EB 4UCTA 4EZMA 5BV7L 4HZAA 2HG5A 4OTXL 4B3TB 2UZIL 3ETBJ 4KO7A 2BY1A 2GAZA 2NNAA 5I1JL 2KS0A 1LE5A 2AEQH 4BM7A 5JHAA 4HS6B 5AVSB 5E8PA 2VXVL 5EULV 5LAPA 4HJGA 4OCRH 4Y1AE 1I8IB 1PNCA 3RP1A 4G82A 2WVUA 5EO1A 3QARA 2V37A 2DQIH 5IQNA 4ELMA 1M6UA 4XMXA 3HE7A 5CMAA 4CNIA 4U7NA 5IB4A 1YXBA 3GMOB 4GRWH 4QHNB 3B7YA 5LHHA 1GY1A 1EGJH 4E5XA 2A6DA 3II1A 2F4VO 4W4OA 1PEWA 5A43C 1U95A 2VQTA 2E3VA 4FVMA 5IFJA 5ECGA 2QGCA 4XAKE 1RJYA 5EBLA 4BGDA 2IAMC 3T4AC 1JHTB 4M62L 5JHDE 2AJUH 4HUCA 1WZ1H 2OL3H 2XN9E 4JE0A 4R8WH 2R0LH 4BFKA 1IAII 2JQAA 2OLDA 4MA3B 2Q0AA 4WW1A 1XREA 1NLDH 4NUMA 3MRCA 2VDMB 4GY4A 3GSNA 4IMLB 5F0JB 4YZFE 2WO3B 4O4JA 1AY1H 4I3SH 4P46D 4XMKH 1ZHNA 4Q74A 4TVSa 3D2TA 3ZCCA 1NDTA 1P5VB 2YMTA 1BT8A 4NZUL 1M2VA 4KFZC 3R65A 3TZVC 2VLLB 4N68A 1ZTEA 3FTGA 3O81A 4NO5A 5HPMA 5IB2A 4LNUA 1I7TB 1BD2A 1MCQA 4UV8A 2EO1A 3LQAC 3K5RA 4EI0A 1XD0A 4O2AB 5A16B 4XNAA 1DTUA 5T1LA 4HWNA 1NFIB 4HBCH 2EXSA 1DJHA 1IM9D 5K33A 2E75B 5EOCH 1IEAA 2WLNA 1B06A 1TUEB 2GJ6A 1N3NA 3OAZH 3SQBA 3MLXL 5ABZA 1TF4A 2ZYHA 3O45A 2WWWA 5A2CA 4LH6A 2PPAA 4C7UA 1IBLB 4IK6A 4PUBH 3CCVV 2RJMA 4O58H 4U2ZA 2XUWA 4UT6H 1Y18B 5H37G 1RP8A 3DIFA 3ULAB 5HHQB 3R7QA 2ADIB 3H7BA 1A6UH 4U4BA 3VM7A 3MDJA 2EBOA 1F8TL 5AZ2H 3ULVH 2EIKB 1MH5A 3HVNA 4G8EA 4X80H 5C0DA 4HNAB 4QPJA 5L3BA 1HX0A 2BOBA 1H6FA 3TM6A 2VZVA 5GRZA 2FWSA 1MHEB 4Q2ZA 3UPAA 1NCOA 4ICXA 3FU8A 1T0PB 1OP5K 3F5TA 5EDSA 2BP3A 3EO0A 1YEGH 4X4MA 4LOVA 1T89A 4MJ6B 3E8GA 3WS6A 5C0BD 1MIML 1J9TA 2VDQB 3BPCA 5K1XA 1MN4A 3P0VH 3HCVA 1NU1H 4BE6A 2AXWA 1HXMA 2JCCA 3CBKB 2X70A 2EILC 1DQVA 3KGUA 1BV8A 4R4FH 4TMPA 1J0ZA 1PFCA 3NABL 3UZQA 1HNWB 1T6BX 2H7WA 4KVNH 4ZUUA 3DI3B 1LP9A 2DLHA 2X12A 3CC1A 4P2YA 1LK2B 4JFOB 2BTQA 1VGKB 3L6FA 4PWGA 4Q97A 3AGVA 3JAKA 1JK9B 1UVQB 3BQUD 5D70H 1MLBB 5AKSA 4NKMA 5FC9A 5IR1A 5JDSB 3MQIA 1B4JL 5IY5C 1VQNV 3DBXA 4LKCA 2IGLA 3JWOL 3RPKA 4D9RD 1E8ZA 3NR7A 4GBXA 5IQ7H 4R6UA 1A1MB 3IJ9A 3DV4B 1S5IH 2VQEB 4OZGE 1FKAO 1YA5A 5LYJB 2VSDA 3DI2B 3QCTH 4NB7A 4R97B 1DJZA 3QXVA 1OAKL 1M93A 3L9DA 3DVIA 5BZDB 2GBAA 1IBKO 1DVZA 1HEHC 5ID1B 4HS6A 1GIGL 4OBRA 3MMEB 1OWRM 1ACCA 1ZT7B 5FDWB 3VSQA 3MKGA 2OP4H 3ZDXE 1I8IA 2ZPKH 5K5YA 4W9ZA 4FLVA 2FO8A 2BRRH 4JI7B 4DQAA 1QBML 1YJDH 4OXSA 3S3BB 3GMOA 3GM8A 4QHNA 3VFUB 4BBWA 4R2GB 1SBSL 4Z7OE 2KZWA 3ARUA 3QQ3B 3EYQC 1X4XA 2XASA 2CNZA 2HLEB 2ICWB 5F9DC 1EMTH 2N01B 5JA8B 1EN6A 1DUZB 1JHTA 3GXFA 2Q3AA 3F7RA 4S1DC 3IKCB 4PA4A 4P2RD 1NM4A 3PJLA 4MA3A 3VD1A 3RPIB 2BIMA 2CXKA 5MP6L 5J1TC 1F5WA 1F56A 2CK3G 2VM4A 4IMLA 1UWGH 4Q14A 3H4HA 4WGKA 5BV7B 5DUMH 3VNZA 2VAAB 3FSVA 4LSRL 1YEJH 2WXRA 4KRPC 1P5VA 3KLHD 1QI5A 1E8XA 1V10A 2VLLA 1TNNA 3Q48A 4XDJA 2VMEA 1I7TA 2QWQB 2OXGB 3C5ZC 3NIGB 3K59A 5KBMA 1P7QD 4FXLA 4LSDA 1R5VB 1MVUB 3P40A 3X11B 4D9RE 4ZG1A 3L9YA 5A16A 3NCJH 1NFIA 4HIJB 1WP7A 3QIUB 3GRGA 1AI7A 1A1OB 1ECYA 4PJXB 1V3LA 1A9VA 5E6YA 1YF2A 1BHGA 5I19H 3R7RA 3UABA 4TSCH 4CC1A 3RYHB 1HHJA 2QPUA 2EIBA 4P9OA 4HHWA 1AE6L 3BPOC 5AL0A 4HZLB 3U83A 2HWZH 5HHQA 5D2LB 3FYEB 2Y23A 1Y18A 2V5RA 2ZXGA 4JM4L 4ODHL 1JZHA 2W0XA 3S36L 5B3JF 1B4RA 4YVUA 2ADIA 2GC7C 2YHGA 4IBYA 4CC4A 4JI4O 2ZOOA 4OLVL 1WAZA 3BKJH 4HNAA 2NR6A 4UCRA 3E0GA 1G94A 2GHWB 2BOCC 1MHEA 4UTBL 4XC3L 4AW4A 4N2LA 4DV2B 1F0LA 3MJ9L 4XX5A 5D6CB 5AYTA 5KOMC 5J12B 3F7PC 4NXMO 3ETGA 5E1HB 3PGDB 4MJ6A 4PS8A 1X5ZA 4P2RE 1LUWA 2A9CA 5JXAL 1UM5H 3KMDA 4TQEH 1RJCA 3UTSD 1IC1A 2GJZB 2IWGA 4B7LA 2D2CC 4PI2A 2XKSA 3FBQA 4UQ9A 1C5DB 3X2QC 2EQDA 5ISZD 2NY7L 1HHIB 1RUPL 3B3IB 4JFTA 2K9PA 4XHJD 5AL8A 2D3OW 1TETH 2A6JB 1LK2A 1UXLA 5D7JB 4JFOA 1JGVL 1VGKA 4QI3A 4Y5YB 4HF5L 1JK9A 1UVQA 2GIYA 4P2QD 1MLBA 1V3KA 3PWPB 1MVFA 5CIPB 5JDSA 3DDFA 3V95A 2VCOA 1VLXA 2HX8A 2LTQC 4AVHA 3L3HA 3OLEA 2F5BH 4GKKB 1S3RA 1A1MA 4OFIA 2EAEA 4L29B 4PYHA 4QTFA 1D5XB 5PAZA 5B5EZ 3PHOB 1HL8A 1IILE 5LYJA 1A6VH 1PZSA 3WJLA 2NMSA 4O02B 3BE1H 1CLZH 1LO4L 3DX0A 1RMFL 5CJ8A 1BPLB 5BZDA 5DMYA 3VQLA 5KN5B 1KCRL 4AILC 2IQAB 1KB9K 2JKNA 5ID1A 4XNZB 4MSWC 4CDGC 3MMEA 1SUJA 1ZT7A 5FDWA 3DHJA 4IIQC 1M90W 3CSYA 3FUEA 1KV3A 2CTRA 3APFA 3CEIA 4ZKIA 2DM2A 4R50A 5I18L 5HSFA 3RJQB 4NKOB 3VFUA 2VC2H 4XN4A 2X4TB 2EZ0D 5E0QA 2NXZB 5KSBF 3TBWB 3QQ3A 1DVFC 1G6VK 2A1WH 3T2NL 4DV6B 2NCMA 1T20A 2ICWA 3CSPA 5DRZB 3QFJB 3ZT6A 2CLZB 4OD3H 3DO7B 1G6RB 1ZA6B 3AT8A 3BSGA 4JQIH 4FC3E 4PLJC 1DUZA 1R1BA 1GW6A 4BINA 5FUOL 5IWAB 1OSYA 3IKCA 3NZUA 3CFJB 4XN7A 5CP7B 5FO9B 1IQWL 2R1XB 2EIZB 1T04B 5C97A 4WI8A 3RPIA 1UD4A 5JIHA 1A22B 1BFTA 2CDEB 3C08L 4LDEB 1WSST 3BCCH 2OMYA 3KHOA 5E8NB 2KC0A 4CW1B 5ISZE 3DMMC 3O2DL 3U11A 2L0DA 4YK4C 4Z0BH 2VAAA 5AUMB 1I7UB 4HOXA 4EUPG 3TJEH 2MRYA 4MAYC 5IVXB 1X5FA 3N55A 4BXVA 4Y4HC 4P2QE 3ZKND 1K8IB 3ASNB 2OXGA 3QQDA 2OYPA 4JFWA 2C9PA 2X6VA 1R5VA 1IXBA 4JI8O 4LF4B 2C26A 3SKMB 4M7ZC 5CLZA 4LVOC 3X11A 4AQAA 2HTKD 1QTSA 3CCSV 5IJKA 4X5PA 3KR3H 4UB0L 4HIJA 1OAQL 3QIUA 1BQSA 1OAUL 2X89D 5A7BA 1A1OA 1BECA 5H9CA 3AG3B 4YNYB 1JF1B 4UINL 4J23A 4F92B 3RYHA 4AUJA 3H0TB 2VJXA 5HTSA 4EZJA 2ZE6A 3CCLV 4HZLA 1MCCA 1AKJB 4L8CB 5D2LA 1BGYH 4Z1VA 4HHAB 2YARA 1GSKA 3UMTA 2EINB 1CJYA 5DDHB 1F97A 1X9RA 3OEHG 4ZFZB 1RIVH 4M7LH 5LB1A 3TP4A 1AI4A 3ASWA 3WIIH 3P54A 3LYRA 3NIDE 3QR2A 2A06H 4PJGF 1A65A 1WC7B 2OJEB 3SE4C 4AJWA 2Y7QB 1KTDB 2Y5QA 2F8VA 5D6CA 4FYQA 1J9CT 1GXEA 3HPLB 3PGDA 4NUQA 3MRRB 4OY9A 3QAZB 5TDOA 1VB9A 3RVZA 6CGTA 3GPEA 4ACTA 1L5GB 5CA0B 4EFEA 4JHWH 4K71B 2GJZA 1FV1B 4B3TO 2HRGA 3KLDA 4HXAL 4LSVL 2OT5A 4ZUWB 1C5DA 3NSDA 5HHOD 1HHIA 3B3IA 3I74A 4XXWA 3CE1A 3L95B 3RVTC 4CN6A 3LNGA 2A6JA 5D7JA 3MHZA 2XHBA 4HQQL 4G7RB 5BNXD 5JPNB 1QR8A 1W16A 4N20A 3P11H 2PP8A 3PWPA 4M6ML 3A24A 4NWTH 1MNUH 2RIKA 2GCYB 1RZFL 3J7HA 3QWRD 2NT0A 1N0NA 2CA3A 2WAQA 3QYNA 1DCEA 5I30H 4V11A 4M1DL 4N9GB 4L29A 5E1GA 4F8OA 1D5XA 1A14L 4LAJH 5L3EA 1QTYT 3PHOA 3UBHA 2SODB 2NZ9C 1P7GA 1NCWL 3PNRB 4O02A 2VQUA 3WN5C 3LQZA 1FNSH 3Q5TA 3HHSB 4Q20A 4D9QD 4UT9A 5KN5A 2JXMB 1UFUA 1S9XB 3D34A 1HAUA 4NP4H 5GRVK 3RWHA 5KEZA 5C0CE 5C08E 5L8LB 3FFCD 5LUMA 5J13C 2WZ5A 4XNYL 5HYJB 1AR2A 3WNMA 5BZBA 5BVPL 4NKOA 3WKML 3K04A 2X4TA 3VG9C 2BINA 2Z35B 3CLWA 5E5RB 4K8ZA 1JPXA 4B9CA 3TBWA 4MZ2A 5LGUA 5E4OA 3VGGA 3OWRA 5DRZA 3QFJA 3U79A 3MRGA 3QCUH 1F45A 2C3WA 2CLZA 1SQVH 1G6RA 1Y7VA 4QF1B 4YHIB 2Q76B 4I2XB 4X7CC 4N0YH 3CFJA 5CP7A 5FO9A 3KYKL 2R1XA 2EIZA 5EFIB 4LCUC 1T04A 1ZLSL 3ZN1A 3V8CA 3WLBB 3B2DC 4UM8B 2BDNL 4TLSA 4ODBD 3SDCC 2E6QA 3NRQA 2LU5A 2CDEA 5E8NA 4CW1A 2VDOL 5IF0B 5HHOE 3HG1B 1GPOH 4KMTL 2KDYA 2CBOA 3CRAA 5A2BA 5AUMA 2ATKB 3BD3A 1I7UA 4PJAF 4I7ZC 3SGEI 3G5VB 4PIRF 2WP3T 5HGAB 3ZTDC 1S76D 1M4KA 5IVXA 4XPBL 3QUKB 1P1VA 4I0KA 4FP8L 3U7WL 1IBLO 1K8IA 2F53D 4QRUB 1MCPH 1MXDA 2P5WB 5GSVB 1B0IA 1XBRA 5HHNB 5FB8B 1PX4A 3L45A 2DQDL 3SKMA 1IBDA 3EBHA 1UFIA 1JBJA 3IFNL 4I1NB 4XPHL 4DGVH 5F7EH 3AB0B 4KFMA 1JGDB 2ZE5A 3CDZB 2JV6A 5C70A 1SVZA 3ZIYA 5BRZB 3QJVB 4JFZL 1QPKA 2WUCH 4I89A 4K7FB 3LKQB 4YNYA 3EOYG 1JF1A 4DSYA 4KROC 4D9QE 3H0TA 1TTRA 2R2HB 1MCKA 4PSPA 2BFVH 2OSYA 4WCYL 4DW1A 1UA3A 3KWXA 2HHHB 4Y2DD 4AQ1B 1RURL 2E76B 3FFCE 3KXFE 5E2UL 3JWNH 3WO4B 4PDRA 3A47A 3BO8B 3PRZA 4HHAA 5I1CL 2V9UA 1HL9A 5DDHA 2VKXA 3UO1H 4ZFZA 4H37A 1F2XK 4LFCB 2A99A 1FCCA 1VFUA 2XTJB 4ILDA 5DO8A 2C3GA 2VXUH 3VSVA 3FK3A 1VGEL 2NNXA 4NO0B 1U2CA 1WC7A 2OJEA 2WWKT 4GQRA 1VERA 3ZE0B 5DSCB 2Y7QA 1KTDA 3AT0A 4JDEB 3ULVC 1BMGA 1FGVL 4ZMXA 3HPLA 3ISYA 3GF8A 3AK3A 3MRRA 3SE8H 4HWEL 1PV0A 4P3WA 5D4IA 1S72V 1PF3A 1L5GA 5CA0A 4Y5XC 2GITB 1I9JL 3CXDL 3O2VH 4GO8A 1FV1A 4NDMA 3U7AA 4DGYL 2VQEO 1G0YR 1QZNA 3BAEH 3GI8L 4ZUWA 1VF7A 2ZNIA 2VABB 4WNSA 4P07A 1GS8A 1KV7A 2E7HA 3BDBA 3DIDA 3IC9A 4MVMA 1I1RA 3GM0A 3HNTL 3L95A 4PJCE 5CZRA 2OYKA 3FO0H 3X3FH 5JPNA 1SESA 2DWYA 1WA1X 3BPLC 1ASOA 1XSJA 1XHZA 3ABZA 1A7NL 4UV7H 4Y8DC 2GCYA 4XOEA 2QFPA 4DP0X 1CF8L 5GRJH 2R1YB 2DF3A 4N9GA 4WWKD 4E2OA 5I71C 5CJQH 2PWHA 1MW0A 3JV4B 5HPOA 2ODMA 3ML0A 2FQDA 1AP5A 2V9QA 2Z1PA 4TQHA 5FKPB 4ZX3A 5FUZH 5JOPD 1USZA 2XSKA 3HHSA 3OLDA 3US9A 5DJAB 1CK0H 3WHE1 2DOCA 1LO0L 2JXMA 3PDOB 1S9XA 1Q82W 5LBSH 2JQMA 1MCFA 4UTBA 3CX5F 3MOQA 3MJ9A 4OFDA 3UTTE 1AJ7L