2ZXWB

Bovine heart cytochrome c oxidase at the fully oxidized state (1-s x-ray exposure dataset)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zxwB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zxwB02
2OV0A 2XV0A 3OMNB 1J9SA 3X2QB 1DYZA 2GBAA 1BYPA 2H47C 5D4IA 2B08A 4YSPA 4YSQA 3PAZA 4EF3A 2UXFA 2TSBA 4TXVB 3ERXA 4PAZA 3TBCA 2YAMA 1AZUA 2QDWA 5B3SB 3JT2A 2YARA 2ZWNA 2FNWA 2J57A 2CBPA 4YSOA 2VSMB 5PAZA 3V9EA 1ZIBA 4A2GA 4MFHA 1SDDA 1SHXA 4DP0X 1B3IA 1RZPA 1JZHA 5AKRA 1ETJA 3FPYA 3TASA 4GXFA 2R7EA 2BZ7A 4A66A 3FYEB 3NSCA 1OE1A 5A7EA 4YL4A 1GR7A 3ABMB 2CAKA 2XV3A 3EF4A 2HX7A 2I85A 4Q89A 2ZXWB 2PP7A 1V55B 3SQRA 4HCGA 3SBPA 4AKPA 2DYRB 2BWIA 2LLNA 1MDAA 3SBRA 4E9SA 1A4CA 4G7RB 3WG7B 2AZUA 4P5SA 3EHBB 1PZBA 3BQVA 1OE3A 2XX0A 4JKNA 3S3CB 1NINA 4YVUA 2UX6A 4A2DA 4UAHA 2GHZA 2J56A 4FAAB 4YVNA 5I6OA 3T71A 2MTAA 5TK4A 4DP9X 1FA4A 1OOWA 4DP4X 3FU7A 2EIJB 3AY2A 1KDIA 2DY2A 3NJIA 2QPEB 1SNRA 3NJLA 1RCYA 1SFDA 2DWSA 2P80A 4UF7C 2IH8A 3U25A 2BZCA 3ABGA 3MX0B 1JXFA 1EZLA 3FSVA 1KCBA 3ZBMA 3T6WA 4AKOA 4AX3A 2VMJA 2XX1A 4G72B 3CZUB 1KBVA 1W8EA 3TBBA 1OCOB 3ASOB 4DPCX 5LDUA 2X88A 4KO9A 1PCSA 1KDJA 1SDDB 4YSRA 1T5KA 3WKQA 1JZJA 2IDQA 1IC0A 3FQYA 2CJ3A 4F2FA 4DP6X 2R7EB 1I53A 2AFNA 5B1BB 1PF3A 1SF3A 2VM3A 4NERA 2XV2A 1ET8A 1AZRA 5F7BA 2XUWA 1JVLA 1A4AA 3NJHA 3UAAA 4A2FA 2OCCB 4KNSA 1J5DA 3CDZB 4JHVA 2JFCA 1AZNA 3NJGA 2IH9A 3WI9A 4YSCA 2HRHA 1WS7A 4FA7B 3ABLB 1NIDA 2UXVA 4UANA 1WAEA 3DTUB 2P80D 2FJSA 4N8UA 3CVCA 2HZHA 3TA4D 3FU9A 1X9RA 4G7QB 5FC9A 1ZIAA 4QKTA 2QPDB 3BVDB 2XVBA 3EH4B 3X1EA 1HAUA 2XLLA 1J9RA 4E9YA 3QJRB 1JZIA 1ADWA 1AACA 2DWTA 4DP2X 3TU6A 3X1NA 3WNIA 2HLEB 2YXVA 1UATA 2BW4A 4X4KA 2EIMB 4YSTA 5E9NA 3X1BA 5B7MA 1SHWA 3NP3A 1NDTA 1ZPUA 1NWPA 1ET7A 3AG1B 3FQ1A 1VLXA 2GB2A 3CVBA 4E9RA 3FSAA 1TEFA 1XB6A 1XMEB 2IDFA 1TEGA 3WNJA 2PCYA 5PCYA 2YAHA 3GYRA 1SJMA 4HIPA 2Q5BA 1A3ZA 3GXUB 3SBQA 5B1JC 3QQXA 1IBYA 2FT8A 2VM4A 4NAJA 1OV8A 1L9PA 1AOZA 4A68A 3OD3A 2PPCA 4RH4A 5I28A 2UX7A 1KCWA 1KBWA 3S3BB 2WSDA 3FT0A 4KO6A 5B1KA 3PPSA 1QNIA 4E9QA 3WIAA 3PCYA 2ZONA 4DP5X 3S8GB 1JVOA 2EINB 1L9TA 4G71B 3PAVA 3UADA 3D12B 1AS7A 1FWXA 3KW7A 4ZK8A 2Q9OA 2BWDA 1PNDA 4YSSA 4YSUA 2JXMA 1JZGA 1CC3A 1GY2A 4CSZA 2IDUA 5F7AA 3UABA 2DYSB 2AZAA 2GI0A 7PAZA 4F7KA 5I5MA 3OM3B 3L45A 3T6VA 2Y69B 3X1GA 3NT0A 4GYBA 4BXSV 5AFAA 1DZ0A 2PLTA 3NSDA 2QDVA 3KW8A 1ASQA 3FSZA 3IN0A 4W1TA 5B7FA 5I6LA 4QLWA 1AS8A 2FT6A 3QJQB 2BW5A 4BWWA 4WTQA 4HZ1A 4BWUA 1GYCA 4KOBA 3DIVA 1FFTB 1AG6A 3T9WA 1A65A 3NYKA 1PLCA 3JTBA 5B7EA 3CG8A 1NPNA 1OCRB 2VW7A 1CURA 2BO0A 3PXLA 3QJUB 1BXAA 2FQFA 1RZQA 4HCIA 1BQRA 4YSEA 3IEAA 1V54B 8PAZA 2N0MA 2I7OA 3QJVB 1JOIA 5D4HA 6PCYA 1JZFA 2IWFA 2XXGA 2FQEA 3S3DB 6PAZA 1SFHA 1N68A 2W88A 1ID2A 1IBZA 3RYMA 4M4RB 3NJJA 1L9RA 2BP0A 1CUOA 2IWKA 2YAFA 1ASPA 1PNCA 2YAPA 2ZOOA 1AQ8A 2VW6A 1NIFA 2VN3A 2FT7A 4N4YB 3PAUA 4BWTA 1BXUA 1KGYE 1HFUA 3T6XA 3ZDWA 3FU7B 1QHQA 1BAWA 2CALA 4P5RA 2FQGA 1PZAA 1E65A 1MG3C 2A3TA 2PPAA 5I6KA 1KV7A 1L9SA 2BP8A 4HALA 1ILUA 4CSPA 4DP1X 2B3IA 4YSAA 2PP9A 2EILB 2DV6A 1AR1B 1BQKA 2XXFA 2HX8A 1MZZA 1R1CA 1E30A 3OMIB 2GC4C 4AKQA 3QJTB 2RACA 3G5WA 5ANHA 4W9ZA 2PP8A 3PLYA 1NICA 4NB7A 1AAJA 1JERA 3NJFA 2WO2B 4KNUA 1GY1A 4KOCA 1NIEA 2XU9A 2EIKB 4BDVA 1BYOA 4DPAX 3S8FB 4F2EA 3UGEA 2PPFA 4A67A 3V9CA 2FQDA 3NSYA 1KYAA 2PPEA 3N55A 5EHFA 5AZUA 3C75A 1AS6A 3OMAB 5B1JA 1TKWA 2VW4A 1PZCA 1NIAA 1X9UA 1IUZA 3FSWA 2PCFA 1ILSA 1BQ5A 1A8ZA 2H3XC 3H56A 4KO5A 5I6MA 1E5YA 3NJMA 4GP8B 4KNTA 1OE2A 4DP8X 2YXWA 1W6WA 5I5IA 2BP0B 2YEVB 2Y1AA 4GP5B 1J9TA 3AG2B 2JKWA 1JXDA 2YAQA 3EH3B 1WS8A 1WA0X 1J5CA 1OF0A 2OJ1A 3OQRA 4L0PB 2HXAA 2HX9A 1YLBB 4G70B 1BEXA 1GS8A 1ZDQA 1GW0A 1E5ZA 4WKXA 1XB8A 5I26A 3AW5A 3QPKA 5B1AB 5I6PA 1L9QA 1CYXA 5TK2A 3MBWB 9PCYA 2H5UA 1EHKB 2BHFA 3FU8A 2IWEA 2VSKB 2MRYA 2BP8B 2AVFA 4HHGA 2YAEA 1M56B 4G7SB 5I5JA 1NIBA 3CDZA 1GS6X 3UAEA 3ZX1A 4AZUA 2XWZA 2QT6A 3N2JA 1A4BA 3CVDA 4Q8BA 1M9WA 1AANA 2W8CA 1AG0A 4BDVB 2XYBA 3H4HA 4A2HA 3HB3B 2WO3B 1JZEA 3NP4A 1ZV2A 1XB3A 4K9JA 1URIA 3WKPA 1JXGA 4PCYA 3UACA 3IBOA 7PCYA 2FWLB 4A2EA 2GSMB 3HEIB 4AI7A 4ENZA 1L9OA 2I7SA 2IDTA 1TU2A 1MG2C 4M3HA 3FQ2A 1NTDA 2IDSA 1AZCA 1PY0A 3DKHA 2HRGA 1E67A 1QLEB 1ASOA 4YSDA 3T6ZA 5I6NA 2E86A 1ZDSA 1NPJA 2AANA 1OCCB 1PMYA 1PAZA 2YQBA 4E9WA 4HAKA 4HHWA 1NZRA 1GSKA 1RKRA 1M57B 3H4FA 5D4JA 3FYIB 4BXVA 4E9TA 3AG4B 2IAAC 4DP7X 1J9QA 1OCZB 1WA1X 2J5WA 1W6LA 1SF5A 1PLBA 3X1FA 4DPBX 3FPXA 4KO7A 1WA2X 1HAWA 1PLAA 4GP4B 4GY4A 2CCWA 3FS9A 1BXVA 2J55A 4JHUA 1GS7A 4BK5C 1ET5A 2NRDA 1NWOA 2GIMA 4E9VA 3NJKA 1MZYA 3IN2A 4HCFA 3NJNA 3ASNB 2X87A 3AZUA 1V10A 2GC7C 3ABKB 1N70A 2CUAA 3NSFA 5IY5B 1AZBA 3EH5B 2UXTA 2UXGA 1IKOP 4E9XA 2YAOA 3GDCA 2PPDA 3ZIYA 3AG3B 1F56A 3QJSB 2FTAA 3IE9A 1AIZA 2TSAA 1CYWA
chains in the Genus database with same CATH superfamily
1G5AA 2WP3T 1A1MB 2DQJL 3LNDA 3FHQA 4S0SD 4ZPVB 3V7AG 3VD4A 3ZMTA 4N3UA 3MFGB 4CA4A 2DLEA 3CZLA 2A6DA 2X2UA 3VRJB 1NGQL 4YSPA 3MRFA 3PAZA 5TPWH 4JI8O 2KMWA 3RB5A 3RY6A 2X3BA 4LF5O 4FM2A 1CVSC 2J4WL 4Y89A 1J05A 4XNMB 3U7YL 1QLRB 2OT5A 2QPUA 3GMRB 3HZMB 4B97A 5E51A 5J8OA 4KK5D 3MRMA 2MJWA 5IBUG 2VSMB 3FQ4A 2E9IA 5CEYA 1I3GL 4KTDL 1WT5C 4XHJC 4A2GA 4JRXE 3SJVE 1RUKL 4DR5O 1GAXA 1ACYH 4GAAA 4LLMB 3D69B 5EZLA 3P0VL 3RW0A 3KJ4C 2WXFA 4NXMB 4JEGB 4YPGB 3SDXE 4HUVA 4PJ8A 4NCC2 1MI5E 1X5LA 2B15A 5EIBC 3VXMA 1S77D 3WAJA 2NXYC 2GEEA 2ZQKA 3VFRB 2YD2A 3MV7E 1CGUA 3G80A 2UU9O 5E5UB 3RWCA 1M7DA 2FNBA 1GPOL 3PP4L 3SBRA 4FYRA 1HQ4A 1E4WH 4G7RB 1BF8A 5GZOC 3WNOA 2WOYA 1JXKA 4P2OA 5D8JH 4CVWA 3S9DB 4DV2O 4UQDA 5KSBF 1M71B 4UQ2B 1CD1B 4IGBC 3RTQA 1JA8A 5EU4B 2X0VA 1F4AA 2YLKA 4WK4B 4QHUA 4ISVB 5IT9N 3LKRA 4M48H 5D1ZI 4HKBA 2VLJE 2IPUG 1KECA 4OVVA 1XH1A 2HPTA 1F7YA 5LA6B 5CHNA 1ROWA 2MTAA 4KH9A 4FKHA 2V5MA 3LSOB 3AY2A 5F9WB 5KUMA 1KDIA 1BM3L 4UNUA 3CFKB 2VQTA 3CCUV 4N87A 1DQDH 1IILE 1SFDA 2ZWLT 5F9JA 3VGDA 3D85D 1WUNT 1XO8A 1D7BA 4HMCA 4AENA 2M2DA 3BYYA 1K3EA 1IURA 2FE0A 1R3LB 3BUBA 4PGCB 4S0HA 3EFFA 3H8NA 3QUXB 5L6YL 1W2BU 4NXNO 3A8TA 5HPMB 2CRZA 1L6ZA 4M4PA 4M7JH 4PJEA 3PL6A 4R83A 3WFCL 2FX8L 1PDKB 4GW5B 2V7NB 3E8VA 5JYMA 3FUEA 1AC6A 4JHZA 4YFLI 4HBQA 1C7SA 2Q7YA 4ODXB 3N9GL 2N04A 4OR1A 1F8TH 2X0UA 3ILDA 3CVIL 4MJJA 4P2OD 5B1BB 3VXQB 5EFIA 3KLHC 1MLBA 1TZIB 4MMYA 3LNEA 3PUCA 2A4ZA 3BO8A 2GTAA 3Q6GH 4K8RH 2B2XL 3JWOL 3RTQD 3ZTNH 2YXHA 4KK9C 4QI3A 2DIAA 4HCRL 5EF3A 3UAAA 5IBLD 4Q9RL 4C58B 1NDGA 5GRJL 3PFQA 4N0UA 4BFNA 5GS1A 4AH2A 2BC4A 4X80H 1F3JA 3VXRB 3PWJA 4UCSA 5BZDA 2K6WA 4P5TA 5ICXA 4QNPE 3DC0A 5D6DA 3SOBH 4ZMWA 1JFQL 4LF7O 3ZPDA 1YNTB 2AV7A 2KDGA 3UZEC 2VS0A 3UJJH 4GG6B 4RZKA 1PJ9A 1CTOA 4I0KA 1BVNT 2MKWA 1PD3A 2XQBH 5T1MB 1TJIH 4BK5A 4UOZA 3IDMB 3TBYB 4TNWF 4J3VA 4ANKA 1O7DE 1PIFA 4KNQA 3PL6D 4XP4L 5D7JB 2YQ3A 4XBPA 2I07B 4PW4A 3KPRE 4GINA 5D72H 2UY7A 1XCTB 3QWOA 2R2HB 1Z1WA 1IM3B 4JRYA 2IO5A 1UZ8B 1H6UA 4L37A 4YOKA 3NZUA 1RZKL 3ZR5A 5LVEA 3HCVB 4NQQA 2IANE 1KJVA 3RYCB 4U1KB 4Y1TA 4Z7QE 4E9RA 3MJ9H 4U1MB 1DTOA 4U33A 1XMEB 4LOFA 4ZMTA 3B5TA 5AD0A 2VXSL 2APFA 4V1DA 3VI4F 3UBHA 3EJSA 3UP1A 5GGUA 1XGRB 4JYAB 3BGAA 1ENVA 3ZDZF 3ATAA 3WDHA 1KBGH 4R90H 3UDWA 5G55A 5DD1H 4OFPA 1MHEB 3QQDA 1BQLH 1PX8A 2VM4A 3B3BA 4AUUA 1R3LC 2HFGL 3NFPA 1TYRA 5FDYA 5DQJB 4TVPD 1N8OE 3QQ9C 4X1YB 3BLPX 4P4RA 2Y1YA 4A6YH 3MRDA 4JPIB 5I1KH 3PF2A 3IMSA 3F7KA 4PP2A 5IFHL 1CR9L 1Q9WB 3IGKA 3QXWA 1QMUA 1RLBA 4HAMA 3HS0A 1QNIA 5IHUL 4GSDL 5LHIA 2RD0A 3BKML 1IGYA 1X5YA 1BZ8A 1D5NA 1N64H 1JVOA 4W9HC 3OLGA 3RVXC 1IGML 3SBWC 3N41B 3TO4B 5EWIH 2XQYK 5EZYB 2AEPL 3L2LA 4JRYD 1CT8B 1E27B 2JKIS 3GMPA 4LSQH 5D2LE 2CDEA 3TCUA 4FQCL 3TA3A 4DO4A 2JK5B 2UZXB 3HN3A 1JZGA 2K1MA 4F7PB 1FL3B 1WPXA 1NCWH 3UABA 1IGCL 3C08H 2F54B 2ZCLH 1S7WA 2GI0A 1SA0A 2ZX7A 4Q7DA 3F5TA 1HZKA 4PJ5D 4XVOA 3RWIA 3OM3B 2BH0A 3TT3L 3N43B 2FUQA 5DZOA 4DV1O 1F4NA 5DD5L 1AGBA 4X6DF 4AQZA 3DXRA 4OJCA 3MZGB 5BXFB 3KLAA 2XACC 3IJHB 5DEGB 1P7QD 3GJFA 2OMVB 5C07B 4RAHA 3ELQA 5B7FA 5JOFA 1BFVH 5I6LA 3MLZH 4LFHG 3VX1A 1FC2D 3QUMH 3AK2A 2J8HA 4UDUA 2ADIB 4PRIE 5KJRL 1MJ8H 4HLJA 1QEWA 4M7KL 5D7JC 2IBZX 3IFPA 4PQXA 3KYNA 5CILL 4XCEA 1X5ZA 3DGGB 3RNQB 2R69L 3IWVA 4Y2NA 4N2GA 4HMDA 1A65A 5J0BA 3G6JF 3CG8A 4WZ9A 4RISL 2E56A 3CFQA 3ULVL 3W37A 2O57A 1EVUA 5C0DB 1PZ2A 3X2QC 3EJJX 1X7QB 3PJSB 3TA3D 1HW7A 5DVOA 3IEAA 4WEUD 3FT4B 3DRTB 2AKRB 4UMSA 3ZE0B 4AGMA 1AR5A 4OCWH 2IEPA 4AL8H 1L7TL 3O3AB 3L9EA 1JOIA 4KXZI 2CKNA 2WXNA 3O11A 3QR1A 1S7VA 1BZ9A 2XXGA 3VYOA 2CK0H 3MRRA 2BNUA 3EFDH 1XR9A 2UXDO 5ESVB 3LNFA 2PI4A 1LO0L 5EMYA 4RMWA 3J7HA 4B3SB 2R2CA 1KN2L 5LL6Y 2ADFL 2MNWA 4NKMB 5DWUH 3WKMH 4WENB 3MBXL 4PV9B 4G27B 4GAGL 2RFXA 4XE5B 3A2FA 3WU1A 2Y7QA 3GINA 2PYEE 2IH3A 1T1ZA 2WD0A 5ENWA 3UJTH 4F80A 3OKOB 2D4FA 3WMQA 1BVKA 3TO4C 3SD5A 4UQ3B 4WK0B 4DESA 5LXTB 5CO1A 3EYQC 3FFDB 2X6BA 1WPCA 3FUDA 3MCKA 3IFOA 3P3NA 4HALA 5AENA 1B0IA 3OR6A 4GKOA 4M29A 2WLJA 4N2FA 4GZRB 5F0JB 3V6FB 5FF6B 1KV3A 2H6PA 2LLLA 2CDYA 1ZLUH 3CP1A 3T2PA 5IIEB 2P67A 3II2A 1FXKA 4GEIA 3GHBH 2ZR3A 4BDVA 4B3RO 1BYOA 1OAQH 3JUZA 3V6ZB 3VOUA 3GLEA 2Q4PA 2EDEA 4A67A 3GSWA 3L7EB 3MNMA 2FQDA 4FLSA 3IMTA 1CFQA 3ABZA 2M1KA 4B0MB 3BZ4B 1AXSB 2HUEA 1KXTB 3B2UC 4B7IA 3VQWA 1B3QA 2WW8A 1ZLEA 2VDNH 2W0KA 4HWBL 4OB5H 5E6SB 1EEYA 2YO3A 1K8DB 3REWA 2WUCL 1HWYA 1P7GA 4OV5A 5C1MB 1CYGA 1WP6A 3TZVB 1NKRA 1M4UA 2UZIL 3H56A 1RZ7H 1P7BA 2XOKG 4TQFA 1JPST 2YOCA 2FWUA 4DP8X 3VE0A 1YDXA 3IK2A 4MCZA 4R4FL 3D8CA 4TUYA 1BPLB 5EEWA 3IU4H 3I75A 2WLLB 1J8HE 3NZSA 3ULAB 1UACL 4HUMB 3ZHUA 2UUCB 4Z76B 4LF6B 1P4IL 3WXVL 2WNGA 2QWRB 2OX5A 1KACB 4HK3J 3ROOA 3CMEV 2JKRM 4R5TA 4F7CB 4I4TB 3FT9A 1WWCA 4UVBA 2NR6A 5TK2A 4AILC 4MJ6B 2FCBA 3CYOA 4UM9B 5ES4B 2E8ZA 4D9QD 1P5UB 1RZKC 5T1KB 5J1TC 1JFHA 2D9QB 2Z5UA 2R2EA 2YZ8A 3SDCD 2DQCH 5L4IA 1RUQH 5AL8A 3IDYC 3QDAA 1RSOA 3VD0A 1HNWB 2XT9A 4GSRA 1A6AB 1T2JA 2MPVA 5I74C 4QRPA 3ZTEA 4BV1A 3K0GA 1IQDA 5HDLA 4B5EA 2W8CA 4F58L 1KELL 4NQVB 4PJAE 5BO1L 4IS6B 2JE8A 3TT1L 3WIHA 4ZI8A 3H4HA 2VQFB 3IDXL 4NJ9L 4W9IC 3S7GA 4ZFOA 1LR1A 4FQ2H 4M8QA 1Z9LA 1JZEA 4F3FB 5K39B 4JL2A 1TZHA 3H54A 5E1GA 4HZLA 5KHJA 3V4VB 4Z78B 3DYPA 3DX6A 5IW1B 5K59F 4L8CA 1NCAH 2ZWYA 1HYRC 3GSRB 4M7LH 3CZEA 2WLIB 4A2EA 5TE7L 3MRHB 2AJYH 4PIRF 4N9OB 4DV0O 2MHAA 1MG2C 3BKJL 1U95B 4TV8A 2NR6D 1MIMH 2UXXA 2YPLD 4BFJA 3EDEA 1D9KA 5I1DB 3VWJA 4Z7UF 4HH9B 3ESOA 3JQOB 4DVBB 2J1WA 1F1GA 2GCYA 3CRAA 2ZM6B 1PAZA 1MNUH 3SKOB 4FABL 3J8F7 3VFVB 3T1HO 2HHHB 3VM7A 3SE9H 1A9EB 3MRBB 4YDNA 3IXAA 2QGBA 1M57B 4OJFH 3BAXA 5D2NB 1OSEA 5E8OB 3TZVC 3B8MA 1F18A 2AQ3A 4BEIA 2JMRA 1DR9A 1K5SA 1N0LB 1J9QA 4L4VD 3GI8H 4X7SL 1Q90D 2J5WA 1U33A 4U1LA 3CPUA 1WFOA 2BY3A 3CU1A 2VDLL 2HSIA 5HHNA 5D8JL 4GY4A 5T3ZE 4M9OA 4YQXH 1IGTA 5ANME 3T3MF 4ONOA 5LDSA 1BGYH 1AGFB 3FAXA 1YEDB 2H3NB 4OAWB 1NWOA 2GIMA 2O6CA 4JJOA 1KTBA 4R3SA 3AC0A 3OSVA 5TDNB 4N2HA 3CXHJ 5JHMA 1P5UC 2JKLA 3ULVC 1SYSB 1U93B 2QJDA 2X87A 1IGJA 2GC7C 5KAQF 1N70A 4YXWG 4AQYO 3AT0A 4KQ4L 1NQTA 3BSZL 1DQDL 4PSPA 3A6BL 2N05A 2ZXGA 4UIMA 4W9DC 3K8MA 3LB6C 2CR3A 1KMIZ 1JYWA 3RVTD 3ZN0A 3UTZB 3SPGA 1TVBA 4YR6A 3OJVC 3ZDYF 4Y5YC 5L2JB 4KZ0A 1FFNA 2FJUB 4LLDB 1UWXH 3QXAA 4MJIA 4BFEA 4M7JL 1RP9A 3IF1B 3IMRA 4W9EC 5F9AC 5GGSB 1OHQA 4FG4A 1HHHA 2E46A 2VR8A 5I1HH 1SYVB 1TSHA 4OZHF 2DLIA 4G8GD 2QDWA 3RX8A 3ZTCC 1VACB 1F8TL 3ZTDC 2ZWNA 3QGVA 4GMSH 4F6RA 4FFZL 3RZCD 4JFFD 5J56B 2OWOA 4LVHB 4ZX3A 4PIBA 1SDYA 4I89A 1SZNA 1ACZA 3BW9B 3O3DA 5L3BA 3I3EA 2FJHA 4G6JH 2YFNA 4OF7A 4P57B 1I8MB 1ZLWK 2QBWA 3LIZH 4PTUA 5EF2A 4X9IA 5GJTH 1AHWC 2WKGA 3BP5A 3TONA 3V0WH 3BABA 3QNXB 2ZE7A 3H85A 1UXMA 5MEQB 1N0XH 1PX3A 4KKNA 3SOBL 4L9LA 5IHBA 3HAEH 3SO5A 2VRZA 3RJDA 2FECL 1M57C 3RTLA 5D2NC 1I4FA 1OP3H 3S36X 2VDQH 4JFWA 3TXQA 3UJJL 3OAYH 3ES6B 1FZJB 1K8IA 2FK9A 2XN9B 1RZIB 4EUPG 3IVKA 2XQBL 1QQDB 1TJIL 4GQ9L 4MJID 2UUAO 4X6CB 4B9KC 5KSVB 1U8MB 4JPWL 5D70H 4L29A 4NO0D 3MCYA 1KGWA 5DZVA 4UAHA 1DN0A 2I5YL 5T3ZH 1WA8B 1OZTG 2VJ8A 1M2VA 3VD5A 5IJ0B 4H0HB 1D3CA 1NCUA 5J12B 5KSUB 3GIVA 2ZKWA 5CP7A 4XNAA 2GJ6E 4AMXA 2WZ5A 1K5WA 1XHZA 5EU6E 3MXVH 5KSBE 4PREA 1HDMA 3FOMB 1JIBA 2P80A 4OIIH 3O81A 3OXRA 2RCVA 2OTJV 2EDLA 4KROB 4DVRH 4UT7L 2VMJA 4MZIA 4R90L 2ZCEA 5DD1L 1EO8H 3EOAA 4IGGA 3SYQA 1ZHNA 2AK4B 1WC7A 3OAUH 1EEZA 1IB5A 3AB0B 3VNZA 4D94A 1IQWH 5GZND 2X4TA 2Z9TA 2K3TA 3RFZC 4A6YL 4JANA 3RYFB 3SPJA 1I53A 3P2DA 4KRNA 4PRBA 4HFUH 4X5XA 5DK2B 4FIPC 4OLUL 3SGDH 2VZTA 2KKWA 3VXSA 5FO2A 5DEFB 1T1YA 3I55V 2EO9A 1N64L 2CLVA 3MRIA 5E1IA 1EDHA 5I1AB 2G3MA 1ES0B 4AVHA 1KPRB 1OAUH 2OSLA 2VOTA 5E94B 1UB6B 3FN0H 3S5LA 2Q9LA 1WAPA 5E6ZA 1LLAA 1VENA 4LSQL 2OCCB 4ZT1A 4ONGH 5FUZH 4RFEB 5L7XH 5DHYB 5EU3A 5IMMB 3RY4A 2LU5A 3C08L 4R2GD 2HVKA 1I7RA 4EI5B 3DTUB 2P80D 2AF2A 1Q6HA 2X4SA 2BTOA 2EJ7A 2ZOTA 4XNUH 3CHSA 4ONFH 3MO1B 4F7TB 3HBZA 1P9MC 2WLHA 3WO4C 4DO6A 5ETUA 4BQ6A 5FC9A 5I6XC 1UM5L 3FW6A 3FTSA 5CR1A 2CK2A 4QE9A 2AJ3A 2H2SD 3ALXA 3LV3A 1GRJA 3CC1A 3L72H 4U7SA 5L4JA 2JCCA 1J9RA 1YYMH 3MLZL 2PMZA 6TAAA 4JPKH 5IFJA 1AGDB 1VERA 1AACA 4L8BB 5GIRA 4DP2X 4ZNEE 1GCFA 2A9HA 1E28B 4UTAA 3TESA 2C9UA 4NKDB 3F65A 3I6SA 2IJIA 4CBZA 2X6AA 4B5ZA 3SJVB 1AO7D 1Z5WA 1O9HA 2C3VA 2X4NB 3EYSH 3H53A 5HDQL 3ULUL 1EIBA 2K9UA 5A2KH 5IB1B 2IDFA 1N18A 3SDXB 3WFDH 1XF2B 1JAEA 3HMXH 1JVKA 2YJQA 3KYKH 5KG9B 3UBFA 2A7BA 1FVEB 3MA7B 1ZA6A 4M8RA 2IMMA 2HP4A 3MV7B 1DQVA 2X7LA 2OTLV 2QTVA 4OCWL 2DI8A 2W92A 5I0WA 1QHPA 5J6HB 1U21A 5E8PB 2WB1A 3P0YL 4KROC 4ZS7L 5DJ0A 3VI4E 4FQXC 1PW3A 2PPCA 3DJRA 1O9GA 2UX7A 3V0VA 3EFDL 3P32A 3ZDZE 4HUNB 2PTMA 2YSSB 3W82A 3AB0C 3HZ3A 3MC0A 1MNNA 5I0VA 2DM7A 3SJBC 1VGEH 3BPZA 3Q8EA 2VLJB 3QULB 4B08A 5DWUL 3ZHFA 2CO3A 4Q52A 3MROA 1HJCA 3LNNA 5HHOE 4CKVX 5CF3A 1WPBA 3BP7A 3D12B 4ALAH 1B88A 4XBEL 1H5BB 3P3YA 4NUJA 2FLBT 4HGMA 4LCUB 1Q72H 5I18L 3U9WA 4NRYA 4ABQA 5IB3B 1ZV9A 5KOMC 1ZAUA 1N3NA 3KEHA 4JREB 4RGOL 2O61B 1AILA 3IS1X 2OCCC 4NNPH 2V8MA 1F6AA 1OGAB 3U0ZA 5I2IB 5DN6G 4I1NB 2QSCH 3RL1A 4X66O 1IFGA 1YVLA 4NIKB 1Y74A 2VE6B 1FXHA 1FH2A 1HH9A 5DCCA 5FYKD 3ZU8A 3IGAB 2CDFB 3WS6C 3EXLA 1QQCA 2BW5A 5EPMA 4BFGA 4BWWA 2FD6L 2KLSA 2XY2A 3B3IA 1TITA 3CDGA 5CLWA 4QIRA 4J39A 5CP3H 1MLCB 2E74B 1P4BH 2EEFA 2EH8H 4BIZA 4X6DE 4XN8A 4KY1L 2WMPA 4K8RC 1JYVA 3VFTB 1ZGLP 3D39D 3MOBH 4N2KA 2ITCA 2PR9A 3RAJH 1RUMH 2BPBA 2VJXA 4XCCL 4DR7O 4L8SA 4NDMB 1GKEA 5E8NB 4OB5L 2X9ZA 3PXLA 1B4TA 1JHKH 2FQFA 5IQOA 4LWSA 3JVGC 2H0FA 3UP6A 4IMKC 2YKLH 3TK1A 1A6UH 2IADA 3MN8A 4R7DB 1FNEA 4NN7B 3BVWA 4O02H 5KLVH 1CLVA 3ECVA 5F0MB 5IROA 4CU6A 4JZOA 3G6JE 7TAAA 1LL1A 4LKCB 1JQ0A 4NQUA 3IU4L 4EBQH 6FABL 3L7FB 3ZTJH 1H8OA 3QUMB 1NI8A 2GUOB 3ARRA 1ZANL 2AJXH 2X4PA 4ELME 2E9WA 4WQOA 3NJJA 2ZT9B 2AMGA 3LNHA 3DOSB 3I02B 3JD4A 3B2VH 3BE1H 1G9NH 2ALAA 4KKPA 5B4MC 2AMUA 1KJMB 3HKEA 1ASPA 2YAPA 1QU7A 3VMOA 5LNDA 3F6LA 4N4YB 5D1QA 5C71A 1UD5A 3CC7V 4PJBA 1BMZA 2R27A 4WO4A 3WE6A 4Z7QB 1HFUA 2WQ8A 2DQCL 5MHSD 5IJVA 1YUHA 3QZWB 5DI8A 2B1GA 1AMYA 1H5BC 2CALA 4HPHA 4FZ8H 1K4CA 2GBVA 2QGEA 2FSDA 4PMEA 5AB0A 2CNZA 1FQ9C 5F1NB 1HH6A 2E75B 2OMYB 4JREC 2G5BA 4OD1L 4WKZA 4MZRA 3NRFA 1Q9OB 3BD3A 2RQ8A 4FQ2L 5ECGA 3QJTB 4JMNA 3MJGX 3P3PA 3GXPA 1ZPLA 3BXNA 3RVWC 4CILA 5IROD 1LE9A 4N2DA 3APNA 3I9GL 1N2RB 5JJJB 4GSUA 3ULSB 1T3FA 2EE2A 4F2EA 1NCAL 4ZMPA 3PQYB 1BZDA 5HYJE 1OV9A 1RK0B 3CEIA 1KYAA 4PRHA 3IGAC 2X0WA 5D5MB 4H37A 3KGUA 2MCMA 3ZGHA 1OM9A 2AJYL 3RWDA 5GSRB 2BLFA 2J73A 3E2HB 4JZJA 5H4ZA 3IXTA 5AVVB 3SDYH 2E74C 3CDYA 3GRGA 4G5ZH 4AW4A 1A7BA 2ZF8A 3OMAB 2H45A 1GK9A 4MQ7A 5B1JA 2EUWA 2B5IB 4WO4D 1EXUA 4NXMO 3FSWA 1ILSA 3OJ2C 5C08A 3UBGA 2H1PH 2P49B 3H9SD 4G42B 1USQA 2YSTA 5ITFB 5K9QG 4FN0A 1KJ2A 1W6WA 2YXWA 3SE9L 1U8NB 4JYYA 4XGZB 4MB4A 5INCA 1Y6MR 3VG0H 2JVDA 3K06A 4NZJA 3D36A 2LR4A 4MMZB 4LOUD 2CJUL 2HG5A 4HKJB 3MUUA 3UTSE 3T6QC 4RMVA 2BVOB 5FO8B 5IVNA 1U3HD 4AIZB 1QBAA 5J1SC 3GRWL 5IWLC 1QX1A 2XHBA 1VCAA 3AW5A 4LOVA 3LDCA 4PRIB 3NDZE 4WWID 4WGWB 1O7DC 2NTSP 2WWKT 3DK2A 3UTPE 3WKYA 3U36B 1QFPA 4FI7A 1XSIA 2YD3A 1KEML 4YL9A 2VDNB 5IEHA 2ZT9C 5FKPA 3TN0A 3BFQG 5CFHA 2CGRH 1XZ0A 4X0NA 1NIBA 1YDPA 4XNBA 1TQVA 5E2TL 5L0QB 2X0LA 3UAEA 1JXJA 2OK0L 1T20A 4NRZB 4AEHH 2R72A 2XWZA 5GRUH 2GTZB 2OI9B 5IT2H 1OGPA 3B9EA 3HKDA 1GL4B 3G9AB 2ED6A 3LQMA 4GBXB 4UQ9A 3WDJA 4FM1A 4AL8C 3B2EE 4FQIL 3HB3B 4AGLA 4GPVA 2E7BA 1GRWA 2ZX6A 4X4XB 2CBOA 1ODAA 3NP4A 1DJHA 2YEZA 4HUUB 4N2AA 2OA9A 3GVMA 3K9SA 1HHIB 1KXVA 3I2CL 3L95A 3H6AA 2GHWB 2J1XA 5I1HL 5F93C 2AEIT 2V7HB 3KPTA 1JWSA 1XDTT 4HV8A 3LH2L 3FCTA 3QRFM 3UT5A 2EECA 1WIPA 5IW6B 1HWHB 3ZQWA 4YHZH 4MS8D 4AVIA 4AZ8B 2OZNA 3WIIH 3EJTA 1ASOA 4MHHI 5K59E 1H2MA 3T6ZA 2VLRE 2IOMA 5LP6C 3WTYA 4FP8H 3HLAA 1ITCA 1D5IH 4L0ZA 5GTIZ 1JWUB 4G6JL 4H33A 2VZ1A 3QXDB 4M6MH 3I9AA 1T66C 3LIZL 1EDQA 2AJUH 1CZ8H 5GJTL 2Y5TB 3H4FA 3ZKQD 3V0WL 5EBGA 1W59A 35C8L 1N4XL 4DR1B 5T1LB 1I1AB 3T4AB 1DVFA 3US9A 1N0XL 3V2AR 4N2IA 2Z92A 3S34H 3DJSA 4UT9A 5DSCB 3RG1C 2R1XB 2WV3A 4JHWH 3UIYA 3NSJA 3ARGB 5A9GA 1IC4L 2VDQL 5HVWA 5EEZA 4OPHA 3TF7C 1GOHA 4P9PA 2F7PA 1LXMA 3BIBX 4NP4H 5IJCC 2CGNA 1JNLL 5D70L 3GXFA 4WUUE 4NTYA 1IEBA 3QZBA 4CJ0A 4U6HA 1QSFD 2FO4B 3M17A 3QISA 4FG6D 3SE4C 3CFJB 3JD1A 4HCFA 1FYTB 3N2KB 1NJ9A 4OZ4B 3ABKB 3IE4A 1MW0A 4AJ0A 1WF5A 3T3ME 1G84A 4WY7H 5J6SA 3HZKA 2GW5A 4PGBB 4JYAO 2RCSH 3VXOA 4MBOA 3LKOB 1NMCB 2OI9C 1OB1A 1U8HB 3PWVB 1F1DA 3GI9H 5AVTB 3GK8L 4KK8C 2GUZA 4LL4A 1XH2A 4GBXC 5AUMA 3VMNA 2BE3A 3KPSE 3HB3C 4DFHA 3OAUL 1DVFD 3X14B 1KGJA 1OT2A 2Z3FA 2XC8A 3S48A 2HMID 5IKCA 4YDKH 3FC8A 3ZDYE 1ECZA 4EDWH 1COWG 3ISRA 4PUBL 2FNWA 1GJIA 4OT1H 4YSOA 4BZ2A 1ZIBA 5CA1B 3F7YA 3EO1A 4CW1B 2YD7A 3WUWG 3KNBB 3S96B 2NW2B 1Y66A 1M7IB 3VSQA 3GJEA 5C0BD 4A04A 2XTJB 3O41B 4XXDB 1TCRA 3FN0L 3P3RA 2ICWA 1D5ZA 1J5OH 1OE1A 4OZHE 5B21A 3QPQC 5IB4A 5M94B 3SGIA 3A6CH 3OKKA 4YL4A 5E2JA 4ONGL 5L7XL 2Q2EB 4PJAB 3BPCB 3D08A 4WDIA 1QW9A 4A63A 4ETQB 5HD8C 2XZQH 3QNFA 4HEPA 3CH8A 4KAQH 5JW3H 2DYPA 4IK7A 4L1DA 4WSGA 4XNUL 4KXBA 2PABA 4LCVA 2EZOA 1Q94B 1MDAA 1W0VB 3LPFA 2ESVE 4P23D 1FNFA 2DW5A 2HKHH 25C8L 2NTFA 2CXKA 3BX7C 4RAVA 3P1VA 1PZBA 3D0VB 3T4AC 4Y19A 3CU7A 2XWDA 1X5KA 3J7AU 1TVDA 4TQDA 2GTWB 4JK0D 1CI5A 3QHFH 2J1ZA 4IU2B 1JPSH 1QVOA 3ARGC 1YYML 2NZ1A 4JPKL 3KWWB 2LU7A 1JF1A 1MWAH 1GA2A 1XGPB 2GHZA 3H0TB 4MRBA 4L4TE 4MX7A 5C0AA 3K59A 5CZXC 4A39A 1R75A 2Z0BA 1FA4A 3F5WA 2XG4B 2KLRA 4F57H 3NJIA 2PF4E 1N33B 1ITBB 3EYSL 3NJLA 4OD2A 5AKVA 5DUBB 3ARZA 2P06A 1A3RH 4IK6A 5FB8B 1S3KL 5I1CH 5T5FH 2P8MB 3P4OA 2IH8A 4CNIB 3TTSA 3U30B 1UURA 4G9FB 3KYKL 1NCCL 4MCMA 1AIFA 3HVDA 4JPQA 4CZZA 1NFDB 4KMTH 2VIRB 1BREA 2KT6A 4PHXA 1FHNA 2J88L 4K3HA 1G9EA 1RXLA 4P46B 5GGQL 1LE5A 1NMCC 2G0LA 1NGYB 3KJ6L 2W94A 1VGKA 1B06A 5JLZB 5LGTA 5FYJU 4FPPA 4TM9A 5FCUL 5HHMD 3W9DA 2O6PA 4R0LA 4B3SO 5ANMB 3KM1A 2P5WD 5LGKA 1BFOA 2XV2A 4H0LC 3FQTB 4Z7VA 1PYWA 2P1YA 1BZ7B 1IBGH 4UUJA 4NQEE 2XV6B 4Z8FH 3QJFA 4DNLA 5DC4B 3M46A 3R1GH 1XH0A 4ALAL 3ESMA 1SN0A 4N2LA 1P6FA 1Q72L 4JHVA 3B77A 2JFCA 4J4PA 3FRPA 3KLQA 4I55B 1HCZA 3NZHH 4YSCA 4LH7A 2YEVA 4JI1B 5SWSD 3B7SA 3H7LA 3MLUH 3NIGF 4G8AC 2FWOB 1XCWA 4XN5A 4NNPL 4PRPD 4RWYH 4NHCH 3EJPA 5BQ7B 1SQPH 5D71L 1QASA 4MQXD 1X9RA 3MNWB 4G7QB 3EYFB 4QKTA 4X6BA 2BSSB 1PKQA 1LD9A 2RMNA 1T7ZA 2ZKYA 1QSEE 4RGND 4H20H 3JSNA 4XAWH 3D3QA 5JZ7C 2FO1A 2NSQA 2N56A 2PO6C 1VQNV 5EEUA 3V0AC 5L2KE 3ENEA 3UMTA 5GS0D 3WENA 2EH8L 3BUDA 2UUDK 3PAYA 4LGSB 3VGEA 4ZFGH 1K5NB 5SWZA 2IU3A 32C2A 3BWAB 1OTUC 3EG9A 4YFEA 4TN9A 3TIEB 3BQUD 3CSFA 3RAJL 1XI1A 3PXJA 1T04A 2PN5A 4WTXA 3WY4A 4LHUB 4UZGA 4TWKA 2B3RA 1FNGA 1JRHL 1I8KB 5I1IL 1TIUA 1KBPA 4J4PD 1A6UL 2FSEA 3MGOA 4TSAH 2Z7ZA 1BCIA 3EDKA 4X4ME 5HHVH 4RQFA 2YXLA 3TOPA 4O02L 4NBYB 4S2SB 3U30C 5D7KE 5G4OA 1SXNA 4IRSB 4NQDD 1Y0LA 1TQCB 1FVDA 2R29A 2UUCO 3I6LE 1F6LL 4EBQL 4LF6O 3NOIA 4P46C 4EKXA 1IAKB 2ED8A 5ESAB 3D05A 4JKLA 1UB5A 3EGSA 4KFMA 3P30A 3BE1L 1G9NL 5CEZE 3FTGA 2EXWD 1NL0L 1IVLA 2J5LB 3Q13A 1ORSB 2I24N 3P77A 1DGSA 1U58B 2YA2A 4WWOA 4P59H 3TLRA 2YD6A 5KX5A 1RZFH 3CB2A 5EU6B 1XTMA 5A16A 5KSBB 4OZIA 4AHCA 1IX9A 4HMEA 4JQIA 3VMPA 5F88A 4EI6B 4J7JA 5C0JB 1PLGH 1HNWO 4AT6B 3O6ML 4U6XB 1IGIL 2NY3D 5DC2A 5DR5L 4FZ8L 1TTFA 4GO8A 1HYSC 4KJYA 3NFNB 3CFDA 4WSKA 5LG6A 3T6VA 3MLTB 1H3WM 3MCLL 4HU2A 5D7SH 4FA6A 5CB4A 3GSOA 1THZA 2VQFO 1R47A 3RILA 3ZGIA 4IGBA 2ID5A 3GMLB 3T65B 3CCSV 1H3PH 2Z0UA 1XF5A 1JE6A 1F3DJ 3AU1A 4BIKA 3FB8B 3RVUC 5GS3A 4WW2A 4ESKA 1CD8A 1NM4A 1Q1PA 3MRKB 3ZDXF 2NDFA 1KIPB 3EFOA 3MV8A 4PWHA 1XSKA 1NBVH 2L7EA 4YGAB 3TV3H 1A22B 5JMOC 3BZEA 3GMNB 4G5ZL 2VQUA 3OTFA 1GMGA 1UVQB 4X8GA 1ZGLM 1OK8A 2ZM6O 2K1EA 3LDDA 1UADC 4FFBA 1YPZA 2HHHO 4LPCA 3MKGA 4ZOCA 2H1PL 4BFIA 3SPVB 4O4YH 2CA4A 2ZAIA 4NO5A 4PVNA 3A4FA 1MAJA 3LVEA 3TVMB 3WL9B 4DQOH 4JFTA 3BWZA 1HCVA 3FOLA 3VG0L 1NAMH 1UCBH 3B5HA 4XNMA 1D5BB 1RM1B 1C16B 3GMRA 3O3BA 4IRSC 2RBLA 1QUNB 1TQCC 1ZJAA 4LIQE 4Y8DC 4WFFA 5DZPA 3FN3A 3MJ6A 1NBYB 4X0KB 3ZUCA 5F7DB 5DHVH 2VN3A 5TDOA 5CBAA 1PD1A 3JV0A 3PAUA 4LLMA 4QWWC 2LGNA 5CEZH 3GXNA 1TPXB 1WZMA 2HLAB 4PJ9D 3JWNG 2CGRL 2J5LC 3NCYS 3MV8D 1MF2H 4IDLA 3CSTA 2JCWA 4ZOBA 3BGMA 4D9LH 2HJKB 4O02B 3UZEA 1SUJA 2MQCA 1CMOA 4AEHL 4NQCA 5GRUL 2KERA 1EJOL 3M99B 3OW2U 3VFRA 1Y18B 4EVNA 2DOSA 3SDAD 1E9QB 3JAKA 2H2PD 1XEDA 3HRZB 3MRCB 2XXFA 2YRBA 1J8RA 3PY9A 3U46B 1BJ1J 1UJTA 3BPOB 2XXCB 2A0LD 4JR9H 3VI4B 1WG3A 1ETB1 1M71A 4ZYKA 1YQVH 3ZDZB 5EU4A 5IJDC 3OD4A 4CDHA 3QDJE 5C0RH 2KYIA 2JVUA 3VJ6B 1FO0A 1EERB 2WJ5A 3QNZA 2X1XR 2CR0A 5HHOB 3ARFD 5JNYB 3FB8C 4WFFD 2G2NA 3I9PA 4O2CA 2VLME 1MUJB 4P2RA 3FT1A 4OKVB 2HH0H 3DSNB 1IBLB 3CXHK 4YE4H 1I5XA 4I85A 4LF3A 3IJEA 1KWKA 2VKWA 3TTYA 1QHTA 3LEVH 1QRND 5EOTB 1NGWA 1OWWA 2YBRA 4ZSOB 1LNQA 4LSDA 3R4DA 2WQAA 2EYTB 4KNTA 1S7TB 3HKFA 4H7VA 5KHHA 2OMWB 4AEIH 2XQ0A 5HPMA 2AJUL 2Y1AA 2LVCA 1ZT4A 5HGHB 3ZZSA 1T0MB 2OR9H 1HP8A 1XXDC 2V7NA 5AVWB 4AYEC 1DJZA 1G7LB 3WAKA 4OFDA 2DQ0A 3QJXA 3OGIB 4JJ5B 1TJHH 4M6NH 4ODXA 5ESQB 1JD9A 3SBWA 5EYPA 4JHWL 1GS8A 1DANU 1XB8A 3HHMA 2V4DA 2V2XA 5JQHC 3B9KA 4OLEA 4LSSH 5DA0B 4X9HA 2IOIA 3VM5A 4X6DB 2QWNB 1KTDB 4AYDC 3DXAD 1I3UA 3IJSB 1QBML 1BQUA 1T7VA 1PX4A 3BAEH 1S9WB 3IMUA 4LIQH 3DO7A 4QHNA 2YC0A 1XDCA 2WVSA 5AAMC 1C08A 1HXYA 2VAAB 3T1FA 1M56B 4FNLH 4G7SB 4MA3B 2HT4C 5IEKA 2AXFB 4O58L 1JYXA 3INOA 5D9SB 4G1MB 3VXRA 3ASWA 5FGRA 4Q56A 4AZUA 1TPXC 1ZK9A 3E9UA 1B3JA 1A4BA 3GLZA 4GX2A 3THOA 1OD9A 3FQRA 2WLMA 1AANA 1CICD 3LRSA 1KYUA 2EKJA 2R4RL 4J1UA 3PWPA 2NQCA 4KKLD 4WY7L 4XVUD 2XYBA 4XMZA 5EUOB 3LN4B 1IVTA 1GYUA 2RCSL 4GG6A 1OAYL 3G6JB 4FQQA 3FT2A 4FLZA 4QYOA 5T1MA 1N5AA 4YHKH 5LXVA 2EIMC 3GI9L 4M03A 3DMMB 3HRZC 4K7FB 3B8NA 1V7NH 3FXIC 5D7HA 1NQBA 1R3KB 4BHUA 3CZFA 3AG1C 4I0PB 1MFBH 5CCGE 1KXQA 2FWLB 4F20A 1G9NC 3VYPA 3IDNB 4YJ2B 4HKZB 4OZFG 3B9KD 4FZEH 2XICA 5C3IA 2DTML 1W80A 4EDWL 5DZNA 3C60B 2DZEA 5F89B 1SOXA 4JQXC 3BKYH 1EHXA 3BPNB 4K94H 3V4LA 3GMOA 2VN5A 3BVXA 5C0IB 3WEBA 3F7QA 1N7MH 1XR8B 3MDSA 3BD4A 1NLDH 2DKSA 3KCPB 1XGRA 5FV1L 1TNMA 5F1IB 1WLHA 2XXMB 2X2JA 4XX5A 2FYYA 4BYHA 5A2IH 1J5OL 3A6CL 3UTTB 4BW5A 4WHCA 5F71A 3ZMNA 1E9OA 4HKXA 5EO1B 5FLVA 2XAFA 4XN7A 3WSQH 4RQEA 1JDAA 5DQJA 5F7WC 4BXVA 1S9XB 1QOKA 3PDOA 1TXKA 3APFA 1OZ0A 4F8TA 3NN8A 4QF1B 4E41D 4KAQL 5JW3L 2X89D 3FO1A 3FAVA 3PWPD 1NDMB 4U1IA 4DW2H 3QUKB 4CC4C 1QHOA 1BG1A 1WA1X 1IBFA 2VLKA 3MYZA 4HWEL 2Y0SA 2C5DC 2HKHL 2XZAH 1G7PB 3KLKA 3NTCH 3W2DH 4HS6B 5DZAA 1QLEL 2E3CA 4H44C 4F4LA 1XGYL 2KQXA 4YLQT 4K71B 1JPSL 1IKNA 4K35A 2BK8A 1CT8A 3A24A 4GI9A 5IMLB 3K6SB 1E27A 3AMKA 1HCYA 5DJZB 1UUNA 2BS9A 3PWUA 2Q3XA 5MERB 1EXHA 4N6RA 1BIHA 4PGEB 1AYRA 1E42A 4YDJB 5KYYA 5E2WH 4G8FB 5JQGA 4F57L 4XVSH 2XVLA 1M56C 2CUAA 3KLSA 1KIUA 5I82A 1JZ6A 1JR9A 3LEXB 1A3RL 1UG9A 2UXGA 3M1OA 5I1CL 5T5FL 3S4SA 3IJ4A 3HR5B 1BECA 2E7MA 1KT2A 3CXCU 1WHOA 2J44A 3F05A 1CDBA 3AY4A 1O9WA 1RD6A 1OSYA 3QIBA 4QTIH 3IJHA 4JO4H 4TKWA 5DEGA 1YEIH 2LGQA 3G3LA 4EDXB 2IJJA 2BIPA 1S78C 5A2CA 4DR4B 3C5ZD 4DO2A 4F5CA 2QKSA 2AJVH 3L54A 1SMDA 1J18A 3EOTH 4K73A 1MJ7L 3NCBB 3UTSB 3KL5A 1AOHA 3EYUL 5EN3A 1RPKA 4HCRA 3IKCB 4ODVL 3GIZH 2C3XA 1R3KC 2VLKD 4UILH 3VH8A 2LU4A 5LAXA 3IRZA 3UROR 4A37A 2LFRA 5HJGA 4I0PC 1P84F 1U8OA 2CBPA 2J57A 4C54A 3O6LL 3V9EA 3ZXAC 3O2WH 1GN2A 4H8QA 3HBPA 3VXUB 2APSA 2NQDA 4IKLA 3RDTB 3W81A 4GG8A 1DUZA 3MHZA 2CO6A 3SKMB 3LHAA 2ZCHL 4PD4F 5H37A 4Q4IA 3FT4A 1JGUH 1TYJA 2XV3A 2GSGB 3CPLB 3EF4A 4X83A 3O3AA 4MRCA 4S1RH 2GQHA 2W5PA 4RWHA 4HYTB 3VXTB 2L7UA 2QSVA 3DUHA 2P7TB 3NZHL 3KPPB 4WF7A 4L5FL 1XIWA 4BGDA 4JUSA 2R1WB 1FP5A 1DTUA 1EM1A 5CBGA 5ESVA 4B9IA 4NHCL 4RWYL 3H3BC 1UZGA 3HE7B 3QIBD 4DR2B 2ZIMA 3CMOL 2IW5A 3SGDI 2VZOA 1R3JB 4XP6L 1YEJH 1A6VH 4FNTA 4JPVL 2X53A 3OGOE 1XBLA 4HS8H 2BVQB 4JB9H 4H20L 4N0UE 3N42F 4PV9A 5DRZA 3V5KB 4CSSA 4JL1A 5LMUB 1M7XA 4XAWL 3S3WA 4MAZA 3CSGA 4AQAA 5MI0B 5MP6L 1PL4A 5F7NC 4P9ML 1KPUB 4TVPE 5E2VH 4K71C 1JWMA 4U7OA 3D2UD 2VLRB 2OKMA 1MRFH 2YHGA 1LDSA 3EOBB 3HKCA 4UQ3A 3Q44A 1YY9C 2L4OA 2VXUH 4JLRA 1U41A 1A0QL 1LNUB 3O3EA 2YK1L 5IP4A 3MX0B 4QR7A 1AQKL 3KL0A 3L3IB 4URTB 4TOIA 5C7XL 1LJMA 4KWUA 2BIOA 4MTGA 4PJCA 2AGAA 3BI9X 3OX8B 4PW9A 2UZPA 4Z7UB 5IV2B 4TSAL 4XMUA 3HI5H 2D0FA 4F8OA 2ENYA 2IAMB 3PJSK 3HC0B 3QIUB 4JRYE 5FFLA 1JPFA 4LC1A 1XIWD 3FFQA 3QQ4B 4N2MA 4IEFA 5LDUA 1BLIA 3V6ZA 4Z77A 1U4EA 1MWAB 1RULH 4PRDB 4YGVB 4K0KB 2WOBA 4XP5H 3BZ4A 4DK0A 3JBG7 2VUYA 1K5QA 4WUUB 1QKZH 4Z1VA 3LY6A 4JDZA 2DH3A 5AAPA 3VQMA 5I30H 2EDJA 4P05A 4XMVA 4QDGA 2H1LM 3KD4A 4JY5L 3K72A 1A4AA 2ZWKA 1CDYA 3C12A 4YX2H 1HKLH 2OYLA 5DRXA 1DE4A 1OANA 1RZFL 4KNSA 3TH4T 3T3MB 1OTTD 3TJEL 3RDTC 4Q9QH 3L16A 1PLGL 3FB6B 1I1CA 4E2LA 4N2EA 4GFTB 1J0HA 1DL7H 4XCFL 4XPTH 1I7ZB 1EBOA 2OP4H 1IE5A 1BVZA 3WJJC 4GQZA 4N8UA 2IQAB 4X8CA 5D7SL 2NUPA 2BJMH 2P7TC 1GGIH 3BAYA 3KPSB 4NLAA 2H6OA 1D6VH 5CJXC 2R69A 4ZFZB 5AYUH 2XVBA 5GGRY 4I4TA 1H3PL 3V9FA 1DZBA 4N25A 2WLYA 2HVJA 3QG6A 5H6QA 3NIGE 3ZDYB 1T22A 3Q0HA 1HSAB 1R3JC 1KFAL 2P8PB 5HGDB 4JDTL 1HNZB 1JK9A 2UXBB 4QRSA 3WJLC 5IOPA 2Q7HA 1S5LZ 1CFNA 1P1ZB 1NBVL 5MI0C 1TJGL 3TV3L 5C09D 4TVPH 1SXSA 1CE1H 4OZHB 4ZXBC 3WNJA 4Y5YA 2QR0A 3BEVB 2A1WH 2OXHA 4PRAA 5CBFA 5DJXB 4IS6A 3W0WA 2Q5BA 5DFTA 1QWNA 5GGTH 3KXFA 2WQVA 1H19A 1E6OL 5EBWB 2F5AL 2NY7H 2ZNWA 4F3FA 2G9HB 3V6OA 5DJ8B 3HI1B 4O4YL 3E22A 4DQOL 2K4AA 3MGTB 1FZOB 2WKOA 3WFBL 4ANXA 5I28A 1VESA 2IAMC 3QIUC 4KJPC 3GUTB 1JZ7A 2Z91B 1UCBL 3W7TA 1LM8V 1EGJA 5LKNA 1BJ8A 1B6DA 1UOLA 2Y6SC 4NNYA 4YAQB 3BT2L 3RUGB 4RAUB 4L4TB 3T5WA 1L9TA 5I1DA 4HNAB 1XF3B 3QG5A 2BVPB 1I82A 4DVBA 1AHWA 4FD0A 3SYAA 3EF7A 1PNDA 5L8KB 5DEZA 2JQMA 4AYID 4YNYB 3CD6V 2MK3A 3F12A 5C70A 3VFVA 4WWKA 5F7AA 4OM0H 3MMEB 2DYSB 1MF2L 1X7SA 2FIKA 3FZUC 3MRBA 5AOZA 3EJZD 4PJBF 4HJTA 4QRAA 5F3HB 4D9LL 5D2NA 4LFBB 5E8OA 1MMMA 2VISB 2W91A 4JUTA 2ZNIA 2E7HA 5HI5D 3W0WD 1ZHKA 1N0LA 3FB6C 2BSKA 2CO4A 5LLIC 1H8HG 3AUWB 2X6CA 2BIQA 2EZ0C 3G5VA 3KXFD 3OJDB 4PP1C 3SCMD 4Q6IB 2H9GB 2NX5A 2W07A 4OD3H 5L3FA 4QGPA 2BVUA 4JR9L 2VCOA 3IDGB 3KR3H 4KTEH 5DDHA 1QI4A 3FQUA 2AXJA 4HWBA 3QZMA 4HUXB 4WTQA 3GSXB 5IVXF 3UYPA 1YEDA 1DQQA 2E76B 4QIWF 4TT3G 3P9LA 5C0RL 5HHQB 1SVBA 3UPCA 3LSSA 1PL3A 1U8PA 4LQFL 2HN7A 2XKNB 4OCRL 5B7EA 3T2LA 1S4IA 1CURA 2F1MA 3UEQA 3NRPA 3GSNL 4HAFA 1VDGA 2W0FB 4XMPH 3QARA 1N36B 3OGCC 7CGTA 4CC0A 2MOVA 3LEVL 3ZDXE 1WIOA 4WWKD 1VMGA 3GJFH 2GAZB 3PUUA 4LLDA 3RFZA 2I7OA 1TUBA 3QIWD 4ZX5A 1VFAA 4Q20A 3KBEA 4PV1C 4DR1O 3RL2A 4A7UA 2R51A 5KBPA 2FQEA 2OR9L 3B6SA 3V7AE 1LEIA 3PWNA 2JJSC 3KYMB 1SYVA 1QSEB 5K9OB 1TJHL 2NX5D 2HTLD 5HSFA 2DD8L 4WV1A 5TD4A 1U8KB 2C9XA 4QRTA 4POZD 2FH6A 4GXVL 5L2KB 1J1OH 1NIFA 3N5AA 5AW2B 5IESL 4LNVA 4WEEA 3QPXL 4WHYG 4KITB 4K8XA 3OXSB 5B3JF 4G2KA 1FJ1B 2VSCA 4XXWA 1FCCA 4MT8A 4IKKA 4LSTH 3VA2C 1AQDB 2A6KA 1L7IH 2EEBA 4L3EA 2ZUYA 3HNSH 1FV1A 3RX9A 5CGBA 5CEXB 2BXYA 3T4ZA 1NAMB 3DI3B 3JASA 2W60A 4ZDHB 2ZG3A 5BZWA 3QDGA 3ZE1F 4W9JC 3TPUA 1FZJA 3NCXA 3ZZLA 2UZYB 1XAKA 1CFSA 1F4XH 4NB7A 1PPJH 1KUQA 1BW8A 4KOCA 3LN5B 1U8MA 1V7NL 5KJ4A 2CKBL 2VC2H 4WSJA 4XCNB 5DHVB 4Q6IC 2W9EL 4ZUSB 1MFBL 4NYLA 2ITFA 1CFTB 3KWTA 2PPEA 5IJ0A 1MVYA 5TQ2H 1X4ZA 3CLFH 1OSPH 4YFDB 2QV2A 2JIXB 4QPEA 2A73A 4H40A 3ZKXB 4AVJA 5CCKH 3ZEDA 3BA8A 4HA1A 4M5ZL 4B9GA 3D9AH 1Q9LB 4L4VE 4PS4H 5I0XA 3FOMA 2ADQB 3RWEA 1SBBA 5KA5A 3H2PA 4NZRL 3BKYL 1RHHB 3LRKA 4N6QA 3SO3C 5FM4A 4K3EL 1IAMA 1XNRB 1N7ML 1X9UA 1NLDL 1CI3M 3OPZH 5DJAA 3VGAB 3V8CA 3NJMA 2OSYA 4FQXA 3T0EC 2W0FC 1R6NA 2BP0B 4XI5D 4EZMA 3FQXA 3VD9A 3PV6B 3G5ZB 4UCFA 4N8VB 5JHAA 3CS5A 2ZXDA 4NUGH 4TSBH 2NUTA 2IPTH 1KTCA 1WH0A 4L3ED 2OBGA 2Z6FA 3SPHA 1OWRM 2IALA 1J5CA 1KB9F 3W7XA 3ZS8C 3QDGD 2N1KA 4UZUA 1NEZA 4DV3B 3GRBA 3EUUA 5FIEA 4JE4B 1BG9A 3AS0A 4AQ1B 2MIZA 5DGQA 4BJLA 1COBA 3BSZA 4CADB 3B83A 4P4KB 4Y2DB 4FLYA 3D7PA 4NEHB 2AVFA 2NYYD 3GSUB 3MUJA 3OC8A 3OKEA 4U1SB 4WU5A 4PLOB 2VKXA 4B3VA 5I5JA 1GW6A 2ZOKA 3AXHA 3EYOB 4LLUB 4Y4FD 1EBAA 4RFEA 3R0MA 2JKTM 2EE6A 5IMMA 1N33O 4MJ5B 1IFHH 2EXYD 1UGNA 4XVSL 3N2JA 1BS3A 4GAYA 4GO6B 3SE8H 4G8GE 2O5XL 3RKDC 1NLBH 4IOFD 4ZQTA 4NM8H 3Q6FA 1CDJA 3WS6A 3NGBB 2V17L 1A4KB 3SGJC 1MNGA 4JFFE 1VA9A 2PXYB 4IU3A 4JKPH 5IHZB 4QTIL 1ZLDA 4JO4L 1YEIL 1JHTA 1XB3A 1K92A 4FFZA 2CIKB 1URIA 4Y4HA 3B2XA 4MWFB 2AJVL 5HTSA 1JXGA 3EOTL 5KA6A 1JGEA 1WZKA 5TFSL 5KAIZ 2GG1A 2X1PA 1TKWB 1O6SB 3BHBA 3EUDA 2Y07L 1E8ZA 1LMIA 1Q43A 4IOIA 4UILL 4JRXA 4BA8A 3VFOA 3IPBA 3WY2A 1PY0A 4HISA 3W9EA 3JVGA 3FCSA 4IMKA 1PIGA 4U2ZA 3WHE0 1E3ZA 4PJ7A 5GGVY 1W72H 3GQFA 5GSVB 2UXNA 1MI5A 3ZKXC 1I7TB 3N2GB 2R9IA 4ICXA 1AVMA 4MJIE 1FVEA 1P2CA 3DUUB 2GIXA 5CD3B 5JW5A 3ZL1A 4M1DH 4DN4L 1JGUL 3WO3B 4JI1O 4ZAKC 5J6HA 1XV8A 4S1RL 3SB3A 3QDMB 2FR4A 1AR1D 5EZJB 4PM1A 3V7MA 5KW9L 1DVQA 4U4IA 1A5FL 2VABB 3FONB 1FGVH 1UWFA 5I16A 2YSSA 3DSFL 3TCXA 3FB5A 3H2WA 4OSUH 1NAKL 1NMBL 5K69A 4NBXB 1B2WL 3QDJB 2VJ0A 4DGWC 1PD0A 1A6VL 4Y4HD 3VCLB 1EJFA 4JB9L 5IFAL 1H5BA 4HGKC 3EYVA 4XNQB 4AQ1C 1FL5B 1EZJA 4P4KC 1A02N 5E2VL 2O61A 3O0RH 3SODB 1MRFL 1XF1A 3CJJA 2Y3AA 3U1SH 3BY6A 4NN6B 3ETBF 5D4QA 2QFRA 1EFXB 3MOQA 4LEOB 2C4FT 5MEND 4RQQB 3ZIYA 1F56A 3VI3A 4LLWB 4A6YA 1ZJBA 1S7SB 1PG7L 4LMQE 1FS0G 3HC4H 4Q0XH 1CYWA 4PYHA 3QUZA 1TU2B 1UXLA 4G7VL 4MNQD 1J9SA 2GTQA 4B9FA 3LPGA 3HI5L 4PEEA 2K8QA 5C0EA 5BUPA 3DBXA 3NGBC 1ROCA 2ENJA 1MH5B 1EXGA 2DQHH 2H47C 2Z93B 3D52A 3GMQB 3ZL4H 4C57C 4D0DB 3NBNA 1W9XA 2G30A 1NKOA 2NY4D 3CFBB 3TBCA 3Q05A 3BHPA 2NZIA 2VITB 4A1RA 2APVA 3VFTA 3H1ZA 2IBZY 3RY5A 4GKZA 1EAPA 4E42A 3VGBA 4OTXH 1ZXKA 3ARUA 4G3YL 4XP5L 1M4KA 3RBSA 1QKZL 1EFQA 4Z95L 3BESR 3W5MA 4GX0A 5AOMA 3RYHB 1B3IA 3Q4HB 3LS5L 4LLVB 5E8NA 5I30L 1SQGA 5TF1H 1MFDH 2V5RA 4NB5A 5JTWA 3QO1B 2FEJA 1VF5C 4RBPH 4Z7VF 1HKLL 1LP9F 1QFUH 2OTUB 5F7UA 4R7DA 1MFEH 3OHXB 1QI5A 4FXGB 2X2IA 4P2CG 1X9QA 2Y5EA 2GBTA 3H9YA 1DL7L 1X5AA 1DQLH 4XPTL 3LN9A 1PTZA 2OP4L 4W93A 3NIDF 1AO7E 5CUSH 1MREH 1BJMA 2YPVH 3QUMA 3ZMZA 1T5WB 2QQLH 5FUOH 1VPOH 3Q01A 1JPGB 4EKJA 3N1FC 3MI6A 3KPRA 3QUZD 1A32A 2Q67A 4B0MM 3DOSA 2JLPA 3QH3A 1EQWA 3VGHA 1P4LB 2XX0A 5AYUL 3HKZA 4HHAA 2WP3O 5E24E 4JM0A 4CBCA 1B4JL 4QRQA 2IANA 2Y5QA 1MHHA 1G1KA 3DURB 2IPKB 4GRMA 4DP9X 3MRLB 3ZKMD 4AMKH 2QM8A 2Z31A 1MCPH 4K94C 4X5PA 5A43C 2QPEB 3KDMB 2NNFA 2LFGA 2R56H 3WTUA 4R97B 1FJGB 2A6DB 2AZ2A 2BZCA 2CH8A 3ABGA 4H8WL 2J72A 2HTKC 3P40A 3MRFB 1U42A 2YN5A 4AX3A 4NN6C 1J05B 1YVWA 1EO7A 1Z9SA 2WTRA 5GGTL 1W0KG 3PRZA 1KBVA 1Q4NX 2CO7A 3FH7A 3W39A 3TBBA 3BPLB 3HI6H 1RK1A 3SDDA 5CEYB 2WWOA 5FEBA 1CQKA 4JBSA 4DV6B 1IKFL 3D85B 1LK2A 3U0TB 4KKCD 3ATFA 4MXWL 5EZLB 1MCEA 4ODUB 2QWPB 1BHAA 3BSGA 4HUVB 5LP6A 3B7RL 3TCTA 4JN1H 3ULUD 5GSRA 5DUPH 1DK1A 2ZKXA 2CHWA 1HHJA 3HIZA 5D2LA 3ELAT 4H8UA 4BE6A 4N5ED 4GLXA 2WQSA 3S35L 2KZWA 3SY6A 1GZPB 5ACLA 5ACZA 3RWCB 1E40A 1M7DB 5FYKE 2GY5A 4KZDH 4OX9B 4C83B 1BD2D 2OL3H 1HQ4B 2NY1D 2Z31D 4NHUA 1HWWA 5J2UB 1AZNA 4P2OB 3VQXA 1WO2A 4HXAL 4OM0L 4XGZA 4OZIF 3AK1A 5SX4H 1KU9A 4KU1A 4Y5VA 3RTQB 2FL4A 4HH8A 3B37A 3D39E 2AK1L 2PYFA 4QHUB 3LKRB 4HKBB 4YBLB 4J2QA 4KK5C 3ARXA 4AIZA 3ZRFC 3MD0A 7FABL 3L3JB 2P5OA 4PS7A 2VN6A 3OZ9H 4PRIA 1NOFA 3GLDA 3KR3L 4OLZH 3F83A 4X7TA 5EULV 5F9JB 1YIJV 1NCTA 1EBPA 4P9OA 1CN4A 3WNIA 1NFIB 1SJEA 2A06H 1T83C 1E1RG 2WQRA 1V3KA 2YUVA 2EEXA 2N7BA 3EFFB 3LEYL 2EO7A 1NCOA 1VLXA 1MXGA 4JFXA 4K7PY 5JPMA 3MQIA 2O5ZH 4NRZA 4FCAA 4WW2F 2WB7A 1HJBC 2Y06H 3LKSA 4PJEB 1IBLO 3PL6B 4LLYA 4HBNA 4AM0A 5BW7A 4ZD3H 2FEDD 1NCHA 2EVIA 4K2UH 1REIA 4HFWA 3SIKA 1U3NA 4XMPL 5H35A 2Q7YB 4QPJA 1YEWA 2B1HH 4R97C 2FB4H 4L48A 3L74H 2D31A 5EFIB 3T4YA 5HVHC 1MLBB 4NWTH 4MMYB 3GPSA 3BO8B 4KRPB 1YPZF 5FWQA 4Z1MG 5MHSE 3N40P 4UTAH 1MAMH 3EHBD 1KCWA 3DK0A 2IMNA 1X3DA 2B9ZA 3BPLC 1T4WA 2V7HA 3LX9A 2QVKA 4J5VA 1E7UA 1NDGB 1Q0YL 4N0UB 5GS1B 4AH2B 2BC4B 1Z9OA 4N9GA 1F3JB 3PWJB 4XXCA 2PYEA 3TXAA 5BZDB 1R5VA 4L18A 4P5TB 3I74A 5DMIH 1EVTC 4G71B 5ICXB 1J1OL 2EVFA 2DH2A 1NC4D 1TFPA 4FQ1H 3WY1A 4ODHH 2AV7B 2AXWA 5AYQA 1F97A 4HIEA 5EN2A 4EB6A 5FYKH 3ZHRA 2WBXA 2F43G 3L3HB 2QVFB 1WWWX 1IBHA 1WEJH 4FLHA 4WI7A 3THML 5I5MA 4XBPB 4LSTL 2HT3D 4UQEA 1MFAH 2UY7B 1G5GA 2NQ3A 1VIWA 3QR2A 3QRGH 3QWOB 4P2OC 3PS6A 4JRYB 2FLMA 4JO3H 3EGXB 3ARGA 1QNZH 3RTQC 3HLKA 4PJBE 1C5DA 4JZ2A 1KJVB 1HU8A 1UJWB 1KGCE 4PSRA 5IBLC 3KS0J 3BDYL 3RI5K 1VEPA 5AD0B 2MOGA 4V1DB 3H9SE 5IMKB 3EW3B 3CMAV 5GGUB 3DIVA 4OY9A 5I76A 2CPUA 3AG3C 1AHKA 5TQ2L 3T9WA 4TSFG 1OSPL 1TJXA 4DEWA 3SN6N 5CSGA 3S97C 3STZA 5KYXA 3MJ8A 3NFPB 1R24A 3D9AL 4PS4L 5IVXE 4HCIA 4P4RB 3MA9H 4FVMA 3WFEL 1TSRA 2RGSA 1DO5A 4XB8A 1QYGH 3VO0A 3PL6C 2VMDA 3OPZL 3TS8A 5EBMC 1MKFA 2RJZA 3GRWA 1J8HA 3HS0B 2NNRA 3K04A 2N0MA 4FTVD 1K3ZA 5DJ6A 2VR3A 5IBTL 4PY7A 1IGYB 1S3JA 1FNAA 2XIDA 4NGHL 3LXAA 3ZRWA 4NUGL 4TSBL 3X14A 2BY1A 1NTKH 1JGVH 4QRRA 2IPTL 1A6TA 1N68A 3VG9B 3GMPB 4QD2E 2CDEB 3TA3B 4RDBA 3NIGB 4U7KA 4XMXA 3J80N 5ILTH 5K9JL 5D1ZD 3PREA 4DKDC 5AWNL 4CW1A 2FT7A 2F61A 5GS1C 3NCCB 3CQPA 2ENQA 3HRPA 3LPWA 5HDOA 1Q81W 1AGBB 4PBDA 1HE7A 4P2QD 4P5TC 2DJMA 2AABH 3CUPA 3DXRB 1FIEA 3ZRCC 5A6LA 3CRRA 3KLAB 2J25A 3GJFB 4PJAA 3BPCA 5JOFB 1KV7A 1A14H 2BOLA 4X5QA 4X5RA 2IGFH 5E70A 3CN3A 4UDUB 2DV6A 1A7OH 1NLBL 2XN1A 4NM8L 5B3JE 4Y2OA 2F53A 1QEWB 3VVVA 5KYNA 4A7VA 1TQTA 3IFPB 4XPAL 3KYNB 2GC4C 4XCEB 4HXBL 2PO6A 4DR4O 4EXKA 4LVNB 2ZE5A 3MAQA 1JERA 4HETA 4JFOA 4KUCD 2XU9A 1OJHA 3UPRA 1G7HA 4QRRD 3EJCA 5KHGA 2PUQT 4S1SH 5IMOA 1G0YR 1XAUA 2A9CA 4BSWA 3ZE1E 4QXUL 4ZO7A 4NM4H 5ALCH 1KCLA 3M86A 5AL0A 3LIZA 2DJVA 1J1XH 2YUAA 5DUBA 4FQLH 1TZOA 1FGNH 2QV4A 5E99H 2CRMA 2QKAA 2P8MA 4RA3A 1S7VB 1BZ9B 5E23A 2R0KH 1W72L 4WGKA 1YCSA 1FKAO 1XGQA 3HAEA 3UO1L 1XR9B 3ZKND 3HUJF 3QJHB 3D34A 4KO5A 1V3LA 5I1EH 3RBZA 4C4UA 1UH4A 4H5SA 4M1DL 5K9QI 3WJMA 5DYOB 1J9TA 2EULA 2OLDA 1IRAY 1NGYA 1QSFE 3QHZH 4LFAB 3FO0H 4G6FD 4DKTA 2GY7B 3IYLW 5JLZA 2VC2B 2Y7QB 2ARJA 5ENWB 1T1ZB 2F53D 4D8PA 3F7VC 4ENED 4Z7IA 4DR2O 2WQWA 3L3DA 5MEOA 4OI7A 1GW0A 1BVKB 3DPBB 1NTMH 1ZV5A 3BIKA 2EE9A 3FQTA 3VG9C 5EF1A 3Q8AA 4N2OA 1BZ7A 3FH8A 3VFUB 3NK4A 3TA3C 1VFUA 2BHFA 4J27A 3MCKB 2G75A 5LMUO 2MRYA 4LPYA 4KX7A 1J0JA 2YAEA 1JVMA 5FFOA 1J5HA 2OS7A 1N4CA 3OR6B 1V27A 2P52A 2FGWL 3MLRH 4JO1H 1KJ2H 4NZTH 4OCYH 3O0RL 2H6PB 5DQ9A 5IDJA 4PN6A 3U1SL 4TOYH 5FGCE 3ZDXB 4J3XA 1S3RA 4BDVB 2ZUWA 1E6JL 3OT7A 3NFSH 3GSWB 3DX1A 1CFQB 2ZXBA 3SDCB 1BVLA 1QG3A 3HC4L 4Q0XL 1QZ1A 5AW5B 2JJ2G 5C0BE 3CSXA 2VMEA 2LAAA 3T3PF 1AVAA 1CB4A 3TC9A 2EH7L 5JMRA 4J7KA 1RZGB 1EEYB 4LEEA 3ZL4L 3REWB 7PCYA 5B39A 3OAYK 4R96A 2A6JA 4Y1AD 4OV5B 5JA8B 4K0KO 3N06B 2IDSA 3FT3A 4UV7L 4XNZC 1AGEA 3UO8B 3HJEA 4K3DH 3K8KA 4TLKA 3VE0B 3PYCA 2K4WA 2N7AA 4TUYB 5HGAA 1U36A 2BOCB 1GM8A 3HE6A 3A21A 3QNYA 3SDLA 1MFDL 3HVNA 5AAWC 1G7QA 3X3FH 5LXGL 2Z35A 2Q3AA 1F2QA 3B9DA 1QFUL 2OX5B 5I73B 1X4YA 2LTQB 3ROOB 4XNDA 1RVFH 5LGHH 3ZOAA 3CFMA 4X65B 2UYLB 4BELD 2ED7A 5T3XL 1WJZA 2H8PC 4P2ZA 2XWTB 1NSNH 3UC2A 5IUSA 2YPVL 1N6QH 2R2EB 2QQLL 4HX1A 4B50A 1VPOL 3GZPA 5ESAA 4Z3TA 3WTWA 3MUGA 5F8QC 4KHTL 5F7EL 3T08A 4JZGA 1UH3A 4I1RA 3OKMB 5HI3D 1GS7A 2DL9A 4QRPB 1XUQA 1IQDB 1W72B 3ARDD 2F74A 1PP9H 2GJ6A 4V2CB 1HNZO 3NJKA 1AQMA 2UXBO 1BX2A 4L4VB 4QAMB 4IBVA 3Q2VA 2Y4UA 5FO7A 4M8QB 4AMKL 1ZVYA 5KMGA 4U6XA 5DHXB 1MCPL 2P42B 1TZHB 3U48A 4M6AA 5HHME 3OR6C 2VNCA 3DYMA 3E38A 4HZLB 5D6CB 2IPUK 2R56L 1EN6A 3DX6B 4L8CB 1UGKA 1EHLH 1FUNA 2P5WE 4UT6H 5DS2A 2ETNA 3VW3H 4HIJA 1HSBA 4LH6A 3NCMA 3IE9A 1AIZA 2F1AA 2DM2A 2K9PA 3D3VD 3TBVB 5ISZA 1F23A 3OMNB 2MHAB 3IMBA 1HZLA 1PS3A 1L9MA 4F7EA 4ES8A 3TH2T 4PJCF 3HI6L 1AQHA 3SDCC 3E35A 3VWJB 1E0OB 4UCTA 1GIGL 1HOCA 3FB8A 2UVEA 5B66Z 2GCYB 5H37G 4IYHA 4MJ4A 3PWLA 5SWSE 3QNEA 1QR4A 1KIPA 2OJZH 3QDHA 1YJ9V 2Y9RT 4PRPE 1FYJA 4JN1L 4O9HH 1YYLH 4NSKB 1H2GA 5DECA 4NC1E 5J9PC 1SHXA 1RZPA 1RUPH 3ZE2E 5A40E 4H0GA 2BZ7A 1MFUA 4NCDA 1BF5A 3NEOA 4NPJA 1FN4A 5IQ9B 4YHLH 3NSCA 4GT1A 2XA3A 4RGNE 4KZDL 4DGVH 2OL3L 4U1LB 1TCMA 2W59A 1WLEA 1YF2A 2BOCC 4G8GB 3SZKC 4LFBO 3WL9A 3DPDA 2NZ9D 3RZCB 5HDRA 4LRIA 5DHMC 1IGTB 2JH2A 3WE1A 4JFFB 3SBPA 4FNPA 5LGUA 4R3SB 3US1A 4Z7VE 4YS4A 1JD7A 4GS7B 1LP9E 2NR6C 4QJ3B 3ZHNA 4P5SA 1XGZA 3F58H 2WVVA 4FZ1A 1IGJB 3PHQA 3OZ9L 3C3SA 4KXDA 2PWGA 3OVUB 3V4PH 2X4QB 4XHJD 5JQ6H 4OLZL 4HD5A 1FORH 1AI6A 3F6IA 1WAZA 1PQZB 4OLXH 4UIMB 3KWVA 4NOFA 5CIPH 4RLDA 4YVNA 5HJ3A 4ANVA 5KVDE 3E6HA 4U6VL 4TULL 3QBTB 1TVBB 1DJSA 4NQDE 4YR6B 3HS8A 2NOYA 4PI2A 1FFNB 4O02A 3LYRA 2O5ZL 4MJIB 1A25A 4NKGB 2BS71 3QXAB 3E7JA 2Y06L 5FL7G 3OLEA 1KCSL 4U3JB 3HRZA 4CH3A 1BVNP 1N36O 1HHHB 3EDDA 3ML9A 4K2UL 4PLKD 1R3HA 3T6WA 1KPVA 3L3GA 1G43A 2E6PA 4RDQG 1X7TA 4NJAH 4QNHB 4ZTOH 1F00I 2B1HL 1CGTA 2VXTL 1Q3EA 4F2MA 2A83B 2FB4L 4L1HA 1GJWA 3C8DA 4TVSa 4F6RB 4C7UA 2Y7OA 4NWTL 2XVKA 2RN9A 3CJHA 4KZEH 2EYRB 2B1IA 4Y16A 5ADOH 5AVSB 4IQHA 4PJGF 1MAML 3O3DB 2VMFA 3CC5B 1XH3B 3P9WB 4JQXA 4JGSA 2D7OA 2FJHB 4WI6A 5JIKA 3ZYOA 4PTUB 4PFEA 4X1KB 3BJLA 3U6RB 2Z7YA 4LGRB 3BP5B 3ZJAA 3L9RA 2XUWA 2WBWB 3D07A 4NKOA 4UIKL 3RVTC 1SXZA 2J1YA 5DMIL 3NJHA 4XAKD 4L9LB 3CRMA 4IOSA 3D33A 3GMMA 4YIPA 3HG4A 4ODHL 3KWUA 1BEYL 5BR8B 4F33A 2BOBA 1K8IB 1VFMA 3IVKB 1NM9A 1X6NA 5FYKL 3UTQA 4ZOEA 4CC4A 1NIDA 4TNWK 2UXVA 1VAHA 2ENSA 1Z0MA 2DQTL 4L29B 3L1FA 1DN0B 4HIQA 5HYSB 3QRGL 1M2VB 5GS0H 1SVZA 3RZCC 4JO3L 2VO5A 3QFGA 2BSTA 3GIVB 3GM8A 5CP7B 1FFOA 1HAUA 2V6HA 2Y4SA 3ZYZA 1KTDA 4OZIE 1WK0A 1HDMB 1U8LA 1IFRA 1S9WA 5C6PB 4Y16D 4TUKL 5T5NG 1URLA 4HPOH 5DHDA 4AGOA 12E8H 5FM8A 1SHWA 1SQVH 1Q0XH 3NP3A 1ESOA 1ZPUA 3GO1L 3QWRA 1ET7A 3ARBA 2OL3B 3VD2A 4G1MA 2F7IA 2WANA 4CMHB 5KVDH 3NCJL 1J1PH 3EOAB 1SOSA 3F85A 2F8IA 5JUEL 4HLEA 1KCVL 3G4SV 1WC7B 1EEZB 1AY1L 4S10A 2X4TB 4HIPA 1XNRO 4ADIA 1U4FA 1J8SA 1BQ0A 3LN4A 4JANB 2C9SA 4OVUA 5IHLB 2PNDA 1AJ7H 4PRBB 1CBVH 2X9WA 1QYGL 3QXVA 2O5NA 1D2DA 2WLZA 2VDPB 1A8JH 2XJKA 3VXSB 3SOTA 3E8UL 1AOZA 1R3KA 4F9PC 1ZVHA 5EB9A 4ELMA 3PHSA 4QHMA 1Q9KA 1TJMA 2CLVB 3MRIB 4GQPH 1SMAA 3MV8E 2GKIA 1JGVL 3K03A 2HKOA 1WTGT 3HW7A 3S3BB 2XAHA 3S5LB 5B1KA 2ILMA 4DV3O 3IB4A 3LXCA 3G6BA 1G6UA 4YHHB 2DLFH 3KAAA 1KLUA 4XMTA 3OTTA 1JSYA 5EU3B 4FM0A 4NP9A 2XBDA 2ODIA 2CBMA 3LPOA 3QCTH 3CHPA 4O4IA 1YPZE 2HVKB 4CN1A 1L0XA 1I7RB 3UOAB 5CJQH 2X4SB 5JVDB 4ELKA 4HIXH 3VD1A 2J6EL 2JXMA 5ETUB 3ARBD 3AWGA 3N42B 4CN6A 2AABL 1J8KA 1FE8L 1WFUA 3WTXA 1EHNA 4L9LC 4M1CD 4KH2A 5GZNC 2IG2H 2AJ3B 3N50A 3GBDA 2XASA 3QUXD 4LSPH 2JCCB 2Z64C 1A14L 1F11A 4D7SA 3L45A 4ZX6A 5IFJB 4FJCC 3DX9A 1NDMA 2IGFL 5GIRB 3JTSA 4WFFE 2D73A 1A7OL 3V10A 2CLZB 1FLTX 4IJTA 4G8IB 3FU5A 2C3VB 2WXPA 3P30H 4UFZA 2DQIL 5HYJA 1GKOA 1XGTA 3JZYA 1HINH 1I9RH 4LZKA 4QLWA 4DOHE 1QRNE 2DRUA 4DK5A 4HBCL 3AABA 3K6SA 5IMLA 1MCHA 4KOBA 3MLVH 2IGLA 4D9RD 4LSRL 1K85A 1VQ7V 1ZA6B 1AZZC 2Y0IA 3NACH 2X7LB 4PU2A 3CHRA 1NC2A 1D5RA 4N68A 1M6OA 2BO0A 1CF8L 2AJSH 4ZW3A 5DJ0B 3T0BA 4PB9H 4CMHC 1IBBA 2R0KL 2ZOLA 4FFYH 1Q38A 3A23A 5CS7A 5K1VA 3ZQXA 2H2SC 1TENA 5I8KL 5JCOA 1HNXB 4K07A 1BHGA 3L73H 3KPMB 3HTLX 2M8XA 4G9DA 5TE6H 1JTOA 1Z3GH 3E9TA 2O30A 3Q9PA 4MHHG 3TURA 3MROB 3DVNA 1SFHA 3QHZL 3BP7B 1EANA 1H6EA 3IKCA 4XN2A 1OVZA 3ZX6A 4NUJB 3D18A 4MKTA 4FFWD 4RIRB 4YHOH 2HT2D 5A2AA 2YAFA 1N3NB 1U92A 5GXBB 2COQA 4DGUA 1IM3D 1AQ8A 2FAUA 4O4LB 1CTNA 3RDTA 5FW8A 4N1CA 1F6AB 4I50B 1GAFL 2AZ0A 3TO2B 2JI1A 2YXYA 2HVKC 3BCFA 5LHGA 1B0RA 1K2DA 4MTMA 1WB7A 5E6IA 3RL1B 1Y74B 2CTPA 4ECNA 1NC2D 3MLRL 4JO1L 4NZTL 5FAAA 4OCYL 3KPPA 1TYEB 4JCLA 4K9EH 4UB6Z 2B3IA 4TOYL 5EPMB 2JS5A 3B3IB 3CDGB 3UERA 5FECB 4FRWA 1ZY9A 3DWTA 3NFSL 2H94A 1OLLA 4UYPA 2WMPB 5I1GH 3PP3K 4QHPA 1DBBH 1R3JA 3EZ8A 4N1HB 2ITCB 4O2FA 1NA8A 3KGRA 4KNUA 5ELIA 4E36A 5FA4A 4L8SB 2PPFA 3HKBA 1KTLA 1T03H 1UKTA 4LWSB 2GUYA 3VDBA 5TDPA 3T04D 4OF0A 4ZXBA 2IADB 1FNEB 5EHFA 1M1KW 4E41E 3PWPE 3S37H 1B6UA 4XX1E 5AZUA 3MRQB 4K3DL 4GXUM 3C5JA 2LO1A 2OIEA 1NPUA 2OXGA 2VW4A 5E4EB 4CH5A 3H1IH 4LGPB 1LO5A 1NEZG 5L4MA 3OX8A