2ZXWB

Bovine heart cytochrome c oxidase at the fully oxidized state (1-s x-ray exposure dataset)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
total genus 65
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2zxwB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2zxwB02
2BP8B 4M4RB 2BW5A 1GS8A 3FS9A 2UX6A 4G7QB 3H4HA 3AG3B 2FWLB 1T5KA 4NERA 1V54B 3IE9A 3TASA 3AZUA 4G70B 3GXUB 5FC9A 3CDZB 3CVDA 1CUOA 3T71A 1ID2A 1KBWA 4KNSA 1PF3A 2PCYA 1TEFA 2N0MA 1DZ0A 1JXDA 3IN2A 3N2JA 3QJRB 3TU6A 4JKNA 1E65A 3X1BA 2IAAC 5B1JA 4ZK8A 3SBQA 4YSUA 2XWZA 4KNUA 2B3IA 2XV2A 4YSDA 2NRDA 3FT0A 5B7EA 1JXGA 3FSAA 1AS6A 5B1BB 1SHWA 4HAKA 4AKOA 1ASPA 1A4CA 3DKHA 3MX0B 3WNIA 3ZDWA 3H56A 2QT6A 2HRGA 1OE3A 2DV6A 3EH3B 4YVUA 1FFTB 4ENZA 1WS7A 5B7MA 3UABA 4KO9A 1EHKB 4KOCA 4GP4B 2GHZA 3PAUA 4FAAB 3GDCA 5B7FA 2CUAA 4HCFA 1NPNA 3NP3A 3X1EA 1GS6X 3QQXA 2IWEA 2YQBA 3G5WA 2BO0A 1KCBA 2CAKA 3IEAA 3T6WA 3NJHA 3OMIB 3EH5B 2OJ1A 4DP9X 2MTAA 2YAFA 1HAWA 1OCOB 1IC0A 3ASNB 3WKQA 1PZAA 1NINA 1J9RA 1TEGA 1GSKA 2XXGA 1ADWA 4DP5X 3PAVA 1WA2X 1X9UA 2VSMB 3FU7B 5D4HA 2MRYA 2GSMB 1W8EA 2DYSB 3NSDA 2FJSA 2YXVA 1IBYA 1JZEA 2BWIA 3S8GB 3PAZA 2XX0A 3X1NA 1JXFA 2LLNA 2CCWA 4A66A 2PP8A 1ZIAA 5IY5B 1PNCA 4G7RB 4DP6X 2FQEA 1PZCA 2YAEA 5B1AB 2H3XC 3FYEB 5I5MA 4BWTA 4M3HA 3UGEA 5D4JA 4BDVB 1V10A 1IKOP 1NIEA 3WKPA 1AS8A 3FU8A 1JOIA 4A2DA 1NIDA 2QDVA 2X88A 3FU9A 3IBOA 4G71B 2P80A 1PZBA 3AG2B 1M57B 2IDUA 2VW6A 3CZUB 1L9QA 3ABGA 1ET8A 1ET7A 3HB3B 1W6LA 1J9QA 3X1GA 4X4KA 3OMNB 1R1CA 4YSAA 4W1TA 2IDQA 2DY2A 1SDDB 2HX9A 2JXMA 3NJNA 4KO6A 1PLCA 1PLBA 2AVFA 3UAAA 2QPEB 1N68A 4DPBX 4P5SA 4AKQA 3PXLA 2BP0A 4HIPA 2FT7A 4A68A 1WA1X 3NJIA 4YSQA 2VN3A 4NAJA 5ANHA 1A3ZA 4GY4A 4N4YB 2Y69B 3SQRA 1AG0A 1URIA 2GIMA 3FQYA 1GR7A 1WAEA 3NT0A 1BQRA 2AZUA 3NJJA 1ZIBA 3FPYA 4DPAX 2J55A 1AIZA 2P80D 3KW7A 2EIKB 2WO3B 2VSKB 3ZIYA 1RCYA 2FQGA 4AI7A 8PAZA 1GY2A 2IDFA 1ILSA 1KGYE 1AR1B 3V9EA 1L9RA 2FQFA 1RZQA 5I6MA 4BWWA 1M56B 2ZXWB 3FSVA 2GBAA 1QNIA 3NSYA 4DP4X 3JTBA 2EIMB 3MBWB 1OCRB 1AANA 2HRHA 2J56A 4E9QA 2PP7A 3S3CB 1BYPA 3EF4A 3ASOB 1DYZA 3NP4A 1E30A 3L45A 3TA4D 1J9SA 1E5ZA 4F2FA 1GS7A 1NTDA 1ETJA 3WI9A 4UF7C 2UXFA 4WTQA 1UATA 2Q9OA 4P5RA 5I6KA 1L9SA 1CYXA 3NJGA 3DIVA 4HHWA 5I6NA 3FQ2A 3WIAA 2YXWA 2XU9A 4E9XA 2B08A 1NIBA 2BZCA 5AKRA 3T9WA 1VLXA 5PCYA 4F7KA 2JFCA 2AANA 2X87A 3JT2A 2TSBA 3CVBA 1ZDQA 2J57A 3QPKA 5I6PA 4Q89A 4YSCA 1L9PA 4YL4A 3EHBB 2WSDA 4UANA 3S3DB 4YSOA 2XUWA 5B3SB 1PNDA 4KO5A 1JZHA 3WG7B 1AACA 3ZBMA 4K9JA 1A8ZA 1PAZA 3C75A 4PAZA 2OCCB 2UXTA 4UAHA 3AG4B 1AAJA 1I53A 4JHVA 4DP8X 4CSPA 4A2FA 3NJFA 1AZUA 1KYAA 4A2GA 3AY2A 1AZRA 2FT6A 2VM3A 1V55B 2H5UA 3FQ1A 1BXUA 1ASOA 4GYBA 5F7BA 4BXSV 1BXVA 2CJ3A 2VMJA 2XV0A 1TU2A 5LDUA 5B1JC 2IH9A 4G72B 2YEVB 1MDAA 9PCYA 1SFDA 6PAZA 1IBZA 3OD3A 1BEXA 3ABLB 3X2QB 2AFNA 3V9CA 7PCYA 1A65A 4KO7A 4BXVA 3PCYA 4E9WA 2I7SA 1OV8A 1OOWA 2IDTA 3IN0A 1OCCB 3HEIB 6PCYA 5F7AA 1AOZA 2UXGA 4AKPA 4DP1X 2XLLA 1SF5A 5I26A 4BK5C 2VM4A 1KBVA 1RZPA 1SHXA 4E9SA 1CURA 5AZUA 3SBPA 3T6VA 1BYOA 4G7SB 1KDIA 2BP0B 4KNTA 4L0PB 4YSPA 1BXAA 2DWTA 1PY0A 2YARA 1NDTA 3GYRA 3TBBA 3QJVB 4Q8BA 3BQVA 2GC7C 3EH4B 1BQKA 4AZUA 1EZLA 1PLAA 2A3TA 1XB6A 4CSZA 1OF0A 2R7EA 1JZJA 1GYCA 1ZDSA 1BAWA 4HCIA 5E9NA 2GI0A 2TSAA 1L9OA 2XVBA 1FWXA 3QJUB 3AW5A 4N8UA 1JERA 3FPXA 5I5JA 2YAPA 1AG6A 2RACA 2QDWA 2PCFA 4A2EA 4BWUA 2E86A 3OMAB 1NZRA 4DP7X 7PAZA 2VW4A 1ZPUA 3OQRA 2HX7A 1F56A 1XB8A 2DWSA 1M9WA 4HZ1A 2GB2A 4NB7A 3UAEA 2FT8A 1NPJA 2ZONA 3NJKA 1HFUA 4A67A 4E9VA 1AS7A 4EF3A 1IUZA 1SFHA 3T6ZA 2BP8A 3NYKA 1QLEB 1W6WA 1AZBA 2PP9A 1XB3A 2BW4A 1JZFA 2Q5BA 2PLTA 1OE2A 3PLYA 3FSWA 2XXFA 3WNJA 4RH4A 1SF3A 5TK2A 1AQ8A 1PMYA 1YLBB 3CDZA 4YSRA 2I7OA 2PPEA 4HCGA 5TK4A 4E9RA 3FYIB 1N70A 2FQDA 3S3BB 1JZGA 3N55A 4FA7B 1ILUA 1MG2C 2BZ7A 3RYMA 3U25A 5A7EA 4GXFA 3ABKB 2ZWNA 2HX8A 1CYWA 3ABMB 5D4IA 4QLWA 1J5DA 1BQ5A 4F2EA 1XMEB 4DP0X 3ERXA 3S8FB 3UADA 3NJLA 2BHFA 2VW7A 2CBPA 1QHQA 2UXVA 1CC3A 2EINB 1WA0X 1PCSA 3D12B 3FSZA 3ZX1A 2XV3A 2YAQA 2AZAA 1E67A 4PCYA 2XYBA 1GY1A 3DTUB 1TKWA 2IWKA 1JVLA 2CALA 4KOBA 1X9RA 1J5CA 4HHGA 1E5YA 5EHFA 3H4FA 2ZOOA 1KV7A 2QPDB 1A4BA 1GW0A 4E9TA 4YVNA 5I28A 1HAUA 2FNWA 1MZZA 1KDJA 2IWFA 2JKWA 2Y1AA 3CG8A 3T6XA 2HZHA 1NWPA 5B1KA 2W8CA 3OM3B 3FU7A 2DYRB 1AZCA 2OV0A 5I5IA 2J5WA 4GP8B 4TXVB 4YSSA 3UACA 1L9TA 1ZV2A 3NSCA 2UX7A 2HLEB 1ASQA 2FTAA 3QJQB 3QJSB 4YSEA 2XX1A 2I85A 2YAMA 3NJMA 2EIJB 1RKRA 4QKTA 4JHUA 1MZYA 1NIAA 3SBRA 4HALA 2BWDA 2EILB 1NWOA 5AFAA 4BDVA 1B3IA 2IDSA 2R7EB 5I6LA 3KW8A 1WS8A 2PPCA 3BVDB 1NIFA 3NSFA 1MG3C 1SNRA 2W88A 3X1FA 2PPDA 1A4AA 1AZNA 1FA4A 1OE1A 3PPSA 2YAHA 2WO2B 3QJTB 2HXAA 2PPFA 2PPAA 4E9YA 2IH8A 1SJMA 4GP5B 4MFHA 1JZIA 4DPCX 3CVCA 2GC4C 1SDDA 4AX3A 4W9ZA 4WKXA 3TBCA 1OCZB 2H47C 2YAOA 4DP2X 1ET5A 4A2HA 1NICA 3AG1B 4YSTA 1J9TA 5PAZA 1KCWA 1JVOA 5I6OA
chains in the Genus database with same CATH superfamily
3E6HA 3Q3GA 4NRYB 3ZKXB 3FS9A 3T2QA 5M94B 4O4IB 3SDCC 1T0NB 2W60B 1J1OL 3I74A 2KC0A 4MBRA 3SKJH 4FLVA 3TJHC 5E6IB 5BV7L 3CCUV 3EO1A 5GW7A 1S5HC 5IJBC 3CLWA 1CUOA 3OWEA 4G8AC 4PJGB 2WXPA 4PTTA 2VDQH 3KLAA 4KNSA 2ZNWA 2DQIH 1PF3A 4AW4A 1WISA 1TZHA 3QJRB 1OAZH 1UXWA 4R90L 4ZUWB 4TQ8A 2FGWH 4YHIA 5FLVA 1DE4B 4IGBA 4LVNC 1Z5YD 1N33O 3C60A 2FX7L 3Q1EA 5GGVL 5I75B 5EF0A 5LGHH 3I75B 4ZSOE 1JV2A 3K1KC 2OTLV 2XN9B 3OAYK 4OQ1A 5AOJA 3EYSH 3QCTH 4LNUA 2V3EA 1F8TH 3F01A 3LMJL 4FQHA 4XP1L 3V52L 2ITEA 4ALAH 4HUUB 2IJIA 5L2JA 3O9OA 2AJ3B 1RSOB 4PJ5D 4BCZA 1YG9A 3K04A 3S35H 4NXMB 3PGCB 4I9QA 2A6JB 3A0OA 4KO9A 3VG9C 3LQAL 3JV6A 4Y2OB 3V4PA 4R4FL 3N2KB 2NY6B 5KVGE 1GGBL 2GJ6B 3KMDA 1GA2A 1CDHA 2YMXL 4NQQA 3DC0A 4MA7H 4PJAA 4ZMNA 2FX8L 1MCOL 3FULA 3NGBB 4QYAA 3RI5F 5KSUA 1Y66A 4B5ZA 1NPNA 3SJVB 3UJTL 3DX0A 3RWGA 3MNZB 4PA7A 3GI8L 5F7EL 2BTQB 5LP6B 2JCCF 3BWUC 1K8IA 3HG1E 5BRZE 2CO6B 2QPSA 5F7UA 4Y4FD 4GMTL 1EHLH 4OFYA 5J2UB 3RW0A 4L4TD 4L1TA 3ULVE 5BR8B 1ROCA 3HAEH 1N8OE 2F7IA 4M48L 4CW1B 2IBZH 1ADWA 1UXMA 4ZQTA 5D5ME 1S9VB 2UZYB 1Z0NA 2RCSL 1OCZC 2AAAA 3ZRWB 1A7RH 1DFBH 3S88H 4TV8A 3PP4H 3CEIA 2CPUA 3RWDB 1E2WA 2ALAA 2EDHA 2Z64C 3BP5A 1CVRA 1E2VA 2XRAL 4EDWL 2R0ZH 1XCQA 1S9YB 4LCIL 4NWTH 2CGZA 5L0QB 3TF4A 2ATKA 2YA1A 3ESUF 2FJUB 4UTBA 1PD3A 5HXMA 4XP5H 3GT6A 2BSRB 3MBEB 1LE5B 1BHGA 5MP6H 5F6HI 4I3SL 4HZ3A 4M3KB 3RPKA 3M99B 4X6EB 4E36A 2JIXD 1IE4A 3C5ZA 4JAAA 1KJMA 2GUZB 3LEVL 3B2PA 3KCPA 1QA9A 3RPIA 1DBMH 3CMOL 4FIPC 2DYPD 1TCRB 2VDRB 1XSOA 2YEVA 2VRAA 3RIKA 1TTGA 2DQCL 3KDPB 3MLRH 2WQ8A 1KT2B 5TQ0L 3QWRA 4C56D 4F37F 3HI5L 1KZQA 1N0LB 2C4FU 3A6CL 4FTVE 4OLUH 4FXGA 4LPWA 3WY4A 1FG2A 4DW2L 1JTOA 1T66D 1FL3A 3W37A 4QRRD 4WU7B 5A2QN 1HC1A 1WFNA 3VQYA 3BFQG 4G6FB 1R75A 3Q43A 2FDBP 4H5SB 3QUGA 4F4LA 3FRUB 3MCKA 4QNPE 3OMNB 3ROLB 4B6ZA 5DXWA 4YSAA 4JM0A 4WEMB 4H8HA 1JCVA 2AQQA 4KXCA 4IMKA 1I7TB 1G0DA 1IGFL 2HKOA 2JSFA 4YIPA 3OZKA 3OBAA 5ILTL 3WGUB 3QCUH 3IDJA 2L3BA 2A9CA 1X5JA 2Y06L 4J3WA 4HIPA 4APQB 1JGLL 2YD4A 3NDZE 5B38G 5FO9A 4LSRH 4CL7A 4ZW3A 3QFJA 4LF9O 2OLDA 4PJ7A 4YWGH 1QSZA 1MQ8A 2EABA 1THAA 3RJQB 4I3RL 5KAIZ 1I7ZA 4TF4A 4R4BA 5C0BA 3CS5A 5TF0A 4OZHB 1HL8A 3OZLA 3KXFA 3QR1A 5AVUB 3O41B 4G80A 4ONOA 1FRGH 2KQXA 3N85H 4DKTA 3O9WC 4OV5B 2Z9TA 4U6HA 2R59A 1T0MB 2R1WB 2OTUB 4JHBA 4HIEB 3VG0L 1R17A 1BVOA 3FU0A 1MRCL 1E5UI 5IY5C 3WD5L 2YBRA 4U1NB 3IETA 5AZEL 2DQUL 1BT8A 2TRHA 2E74B 1QLRA 1H3TA 1I1RA 2G2NA 1BBDH 3C12A 1YNKH 2NY0C 2XAHA 3WTTA 3UH8A 3STLB 4WWOA 3Q2WA 4IYKA 2GPZA 4NO0A 1QX1A 3LNMB 3ZKSD 3D25A 4BKSC 1A14L 4KRPC 1CFBA 4P5RA 5IR1B 1OT1A 2LU7A 2ZP8A 3PF2A 1DFXA 4NZJA 4Y1SA 5FO8B 3IFPB 1BAFL 3TESA 5K93A 4G8GA 1GRJA 4L1SA 3S4SA 2XU9A 1FZJA 5EZIH 5I1DA 5H37A 2P67A 3ETDA 5AUMB 1JWSB 1KTKE 1R3JA 1Y74B 3U10A 3QPQC 4HKXB 2X2IA 4JM4L 4O58H 4X98B 1R73A 2Y6SD 1ROWA 5CP3H 5K69A 1N6QL 3BEVA 1L0QA 5BCAA 3DC5A 1NC4B 3FB8C 1XGUB 4QTIL 1XBDA 4PJDF 3ZZQA 4KTGA 1RM1C 2DWEA 3AITA 2MQ0A 4H26A 1RVFH 1US6A 4MDJA 3SDXE 1FI8C 3T0ED 3NPSC 4PRPA 4BAYA 5C0AA 2JCCB 3KL5A 1YPZA 3S2CA 2XWBB 2YD0A 1OOAA 4YHPA 4M3JA 1FPOA 2JB6B 4AH2A 1AIFA 4JHVA 1XOUA 1NMBH 1MHHB 5GGTL 3ZTEA 2VWKA 2NUPB 1RPUA 4F9LC 3MLVH 1KYAA 4BW9A 1I82A 5DJZB 2KH2B 3O3BA 4P5TD 5J6HA 2FHFA 5CD5C 5DJ0B 4DN3L 1PY9A 1VEMA 2HH0H 3UO8B 4L1DA 3VXMA 3WMPA 4JKMA 2OMZA 3CVIL 4I5BB 3QHFL 1SLXA 4PRHE 5FYLE 4IU2A 2FJHB 1IBMB 2WWKT 2ZWYA 2XZCH 4L29B 5HDWA 3TJEH 5KVGL 3WFCL 3WJJA 5E00B 3RDTA 5BV7B 3DX8A 5HD8D 1V7NL 1IBDA 1KELL 4B3MB 5E23A 3ESVF 3PWVA 4H1LH 3WCYA 3VFPB 4E9WA 3SOBH 3K59A 4XWGH 4MASA 3A2FA 3QUXC 1FDLL 1SYVB 6PCYA 2N7BA 4GXUM 1PQZB 4V1DA 3ULVL 4HUVA 2RQ6A 4FKEA 4DP1X 2WPDG 3ASOC 4LLWA 2WK2A 1SHXA 2J1ZA 4MDIA 2X9WA 3MJWA 3R0NA 2G30A 2WCPA 2B20A 5EG6C 2P52A 2GTZB 3H2PA 4YSPA 4GMSL 5DHEA 3ULAB 3U6RB 1UGKA 5DC4B 4NP9A 4DKDC 4UOZA 3E8HA 2CO7A 3QEQD 1VCAA 3HZ3A 5LAXB 4Q8BA 2E9WA 3BY6A 4NTXA 1S2EA 2H3KA 4ZUUA 3ZHDA 4AT6A 2LE9A 3NIGE 1BWWA 3GFUA 5FNVA 2UY6A 5L6YL 4LFBB 1AI1H 4YXLL 3AG7A 1RP8A 2CR0A 4K94H 1KENH 1A1NB 2WBKA 4W9HC 1XH2A 1A6TA 3GRWH 1EJFA 3H2QA 4NUMA 2EYSB 4HG4K 4FNUA 5CZRA 3CFQA 3QDMB 1CICB 1P5VB 1RJYB 4MZ3A 1M05A 1DEDA 1UWEL 3AY4A 3GNML 4XMZA 2N04A 1J9CT 1LEKB 4GAFB 5JORB 2FO4A 1QFUH 2BC4A 4BFJA 5KSVA 1SN5A 4G1MA 5E08H 1NUGA 5C0NC 7PAZA 5AD0B 5F7FA 1VQPV 2XPZA 3BPCB 5FS5A 3G5ZB 1JV5A 1MI5D 4WWID 1SM3L 3HHSA 1MXGA 1M9WA 5J9PB 1MRFH 1V55C 5IT9N 4OB5H 3DHJA 4WDIB 5IQ9A 4PGCB 4DV0B 1P7KA 5DUMH 5F9WC 3VRJB 2FBRA 4WW1B 4G7VH 1RUPH 4MA1B 3ZL1A 3ZSSA 3IJSA 3T6ZA 4RAHA 4GAJL 2NLJB 3BHBA 2H1XA 1MJ7H 3TVMC 2VLJA 1AZBA 2J4WH 1XGPB 4ZUVA 1SBSL 4CBPA 2F8XC 4PJ0Z 4KXDA 5FEBA 1UH2A 3A6BH 5F1IA 3RJDA 4U3CA 3AWEA 1SS3A 1AQ8A 3DX3A 1U0QA 5EZYA 2SEBB 2DQJH 2WXOA 4YBQD 1DTUA 2ADFH 4DT2A 5FW6A 4NR1A 1NKOA 4E9RA 2IFFH 1JZ4A 2AEWA 4PEEA 1Q6UA 1KBGL 1QWNA 2OQJA 4TVPH 1FXKB 3ULVF 2OP4H 1EO7A 1ZT4B 2YXHA 1LQSR 5H94B 3BISA 1ILUA 3D85D 1J5OH 3WGVB 2W9DL 1IGYB 3DVFA 4Y4KB 5D5MF 1K8DA 1YEWA 4OI9A 4CUCA 5DDHA 2B7DT 4XPBH 2J5LB 4CILA 3IFNL 2HX8A 3U9UB 4I50B 1YEGL 1YYML 3AT8A 5AL8A 3SPHA 5J6SA 2R2CA 1ORSA 2E5LB 2ITDB 5LXVA 3S8FB 2AQ3A 4B95C 4KZ0A 5HSFA 1NC2B 2AEIT 1G9NL 3L3HB 3IXTB 1IURA 2QWOB 4PJDB 3DJRA 2EINB 2WVUA 4U1GC 5D7LA 4KI5D 2DL9A 1JPFB 1XMOB 1J1OH 2XV3A 1HL4A 3BDXA 1Y6KR 4Z1VA 3U4EA 1Q9WB 3RY6A 5KS9E 5BV7H 3FSOA 4QD2E 5HBBA 2BVPA 3SKNA 3S5YA 5JIPA 4CNIB 3KYMA 3ECWA 3B2UC 4KOBA 1VPOL 1FHNA 2YS8A 2I9LB 5AAMA 1AE6H 5HHMD 4R90H 4YBLB 4HJGA 1KGCD 3D18A 1H2KA 1NDGB 2OL3A 4P5KA 2F23A 2CTPA 1BQLL 1E28A 2FX7H 3JT0A 3BGMA 5D1XC 1JPSL 5C07E 3MKGA 1MA1A 4QNPF 3BC9A 3TFKD 4DK5A 4CDHA 1DBKH 2XQYK 3LHPL 3MRRB 2R8SL 2R29A 3LMJH 3HZVA 3V52H 4X99B 3WNOA 1HDMB 3A47A 4HWBL 5C09B 4JI4O 4LR3A 1N3NA 1NAMA 1E9PB 2WPGA 5EUOE 1JS4A 1XSJA 3CDGB 1VKXB 1N2RA 3LQAH 2R4RH 1H5BA 1QZ1A 4XP6L 2I24N 3VSUA 1BECA 5L2KD 1GGBH 3V10A 2LW1A 4DR6B 2O30A 4PRAB 3E3QE 2YMXH 1BD2A 1MCOH 5IB5B 4LMQI 1I94O 3LQZB 3UJTH 4F92B 3GI8H 5F7EH 4S11A 2IV9A 5IBUG 2YD8A 3EBHA 4GMTH 5BUPA 5C9JA 5DJYB 3GB7A 2WXNA 3LRSA 3OEHG 2GDSA 4M48H 1X5GA 3TPKA 2J25A 5FYLL 2PCFB 4BSJA 1YXBA 2RCSH 4JPRA 1U36A 5ESQA 4RAUA 3TK1A 1QR9A 2CHWA 1AGCB 4RNRB 2NW2A 4R4NC 5EEYA 4UTCA 2R27A 2XRAH 3S5LB 4EDWH 4ZODA 4LCIH 4JGJA 2NUTA 4BA8A 1WRFA 2Q7HA 2BMKA 4HPOL 3TBCA 1N4XL 4MKTA 4B9KC 3K6DA 5CZVL 1WAPA 2LR4A 3G6JE 4Z7AA 3JV0A 5M7QA 1JVOA 1KIUB 1LO0L 2PW2B 4AGMA 5FHBL 3LH2L 4L37A 4P5MB 3GSNA 4I3SH 1BJMA 4Z7UE 1QLNA 3H4HA 1PKOA 4IIQA 4YIQB 1CLZH 5D6DC 2D7QA 3LPGA 4ZSOB 1RK0B 1AJPA 3ARPA 2ZUYA 2UZIH 3LEVH 4WI2A 4GJTB 3CDZB 1NCAL 3HC0A 3CMOH 4LSQL 5D7IA 3SCMA 3ZPDA 1CPUA 4QHUA 2VXTL 1IC7L 1Z6JT 1KBWA 1SUJA 3VXTB 2DQCH 5TQ0H 3K5NA 3JALB 1FN4A 1QD0A 2FAUA 3HI5H 5GGRA 4NZ8A 2IAAC 1T1YB 2Z7YA 1JZ8A 2WW8A 1N33B 3BP4A 1NCDL 4NDMB 1NI8A 5BJTB 4GIOA 2MMXA 2DW5A 1TLKA 5AVTB 4P8QA 3VXOA 3KGRA 5F7DB 3SDXF 5J6GA 5B1BB 4KUMA 2NNRA 5I8OL 1IGFH 5ALCL 2G60L 1CXFA 3HG1B 5BRZB 1UCTA 3K5MA 1HHHA 2YZ1A 2Y06H 3I6SA 2PR9A 4IHBA 5FA3A 5IQ7H 1P4LA 4X8JA 3KWVA 1JGLH 4GUOA 4Q6GA 2XY2A 1WF5A 3FO0H 1S78D 5D5MB 4W9DC 1AI4A 1KMGA 3SJAC 1EX0A 2GEEA 1TKWB 1MCLA 4UVCA 2CO2A 2FMLA 3LKRB 3MD0A 2FH6A 4I3RH 2KLTA 2DBJA 2ED8A 3VB8A 2C9XA 3WJLC 1VQ6V 3NCWA 3VX1A 1UEMA 1VEPA 4IBWA 1Z32X 4MS6A 3DYPA 4DP9X 5JPMB 2EE2A 4G83A 4WK0B 1NINA 1GSKA 1MCDA 3EDJA 3T4AC 3DYMA 2ZIOA 2ZICA 2Y7QB 3VG0H 2VISA 4AV4A 4FFYA 4S2SB 3ETEA 1XIWB 3BDBA 5DEJA 4GLRH 1MRCH 4EI5C 4JZNA 1B9ZA 4PJ9A 3UTTE 3WD5H 5AZEH 4W4NA 1JXFA 2DQUH 3T8VA 4HWEL 1E8WA 1IAOB 3T0AA 1DVFC 1QQCA 5CBAA 4FTVB 1W16A 5IG7A 5DC2A 5LHHA 4K94C 4DOHE 1H8NA 1TITA 4CBZA 1UZ8A 2PO6A 2XT9A 1CLYL 3NMEA 3NIGF 1A14H 3QDGA 4E68A 3OW2U 4EB6B 4QYOA 4PU2A 1SRDA 3IBEA 3ZMVA 4HGMA 3VGHA 1Y76A 1X4XA 2F2HA 5JCOC 4Y5XC 1BAFH 3GI9L 4B08A 5IWLC 3BEWB 5GZOD 1UASA 2P80A 4TUJB 1FCCA 1U8CA 1CGUA 3CE2A 3IT8D 4J8RA 1M2OA 2XWXA 3WXWH 3BIKA 3MNVB 2VDNL 4MA3A 2VW6A 4BHUA 5I76A 1N6QH 1KNOA 3V0GA 4QTIH 3KDMA 4K55A 4V33A 1K33A 4EIGB 1RZIB 2J8UE 3DUUA 3X1GA 3QRGL 2OAAA 2JTYA 5JOPD 3CIQA 3QORD 3NN8B 4OIIL 5CU5A 5FKPB 3JWNE 4QOKA 4FRWA 5D7IF 1GVIA 4ZKIA 1X7SA 5GGTH 1RQ5A 2H32A 2BE3A 2XNAB 3GLAA 4XPAH 5E8NA 1HNYA 2OR7A 3B9KD 4QEGA 4LF9B 4OI7A 4PD4J 4WHCA 4JKPL 3ARFC 2QHRL 1ZWIB 2AZUA 5CLTA 3CVIH 4OCLC 5H37H 5AVRB 3D4CA 3QHFH 4IS6A 1KYOK 2F8VA 3CN0A 3GJEA 5GSRB 1JPTL 4WZ9A 5KVGH 2Y25A 4PJ5E 3WFCH 3L4TA 3BI9X 4OKVB 5I1LA 1HHJA 4NHCL 5CGBA 1V7NH 4DEPB 1E4KA 4ZOBA 1KELH 4JG1L 3FQXA 3BWAA 2UUAO 5A2LH 3OAAG 5J8OA 4NCC2 3V9EA 1L9RA 5AVSB 1FDLH 3SE4A 4B3TO 4ZFQA 3ULVH 1HCFX 1TUBA 4ONFL 3V4VA 1HDJA 2GBAA 3NDYE 1XXFC 4LF3B 2KERA 3D0LA 3MUGB 3QUYD 5FLUA 2OTWB 4NB5A 1I5YA 4L4TE 3VRIB 3VWJB 2LLLA 4XCFL 3ZHRA 2P7TB 2Q73A 3C8DA 4ANVA 3RX5A 2XV6B 2C3VB 1ZLVK 4XNZB 3RN4A 5L6YH 5JDJA 4ZUSB 4YXLH 5DMKB 3B1TA 3SDXB 2UXFA 2X4RB 2YEZB 3CH1A 5KS9F 4HGWB 2C7UB 2WO4A 3NJGA 4EN2A 3HRZA 4FQCL 3RZCC 5L3EA 1CFTA 3CPWU 4LCWD 4PJ8B 1JCHA 4J23A 4P23C 3VQ1C 2VLKD 4L8SA 1OCWL 5IT2H 1YUKB 3K03A 2R9HC 4K7PL 2WLJA 2ZT9B 1PPIA 1UXSA 3WB2A 2NX5A 3GNMH 1FAFA 2CDGA 4NKMB 5FO2A 4TSFG 2A0LA 3OHXC 3S3DB 3V4VL 1PNDA 1Y6XA 1JZHA 3F65A 5EZLA 5HYQA 2TRYA 2YS4A 3RYFA 1A8ZA 3JWDL 3V6ZB 1SM3H 4PRHB 4RETB 4FABL 2QDOA 2VQEO 1F6AB 2HFGL 4LOUD 3D5OF 1I53A 4C56E 2H9GA 5F7YC 3KLHD 1YEDA 2YLKA 1EERB 1S9WB 4CSPA 5A7BA 1U8NA 1BZQK 4Q6YA 1S7XA 5IROA 1AZUA 4WKZA 5EUOF 3E8BA 4ZO7A 5FCSH 1KJ2L 2HLAB 5FDYA 3LPOA 4QRRE 4WJG3 1Q1PA 3WDIA 1J86A 1UUNA 2VM3A 4GAJH 4PJEE 4JCWA 2WKGA 4XCYB 3L9DA 4NN7C 1SBSH 3ML9A 4LPVA 1ZSHA 3IDUA 2IDCA 4IGBC 1QSFA 5LDUA 1FFRA 5EZPA 3C60C 1TIUA 4FFWC 4UTAL 4UBDC 2WWMC 4PJFA 4KBPA 3N1FC 5H2BA 3UTZA 6PAZA 1KBGH 2ICWB 4U1JA 3ABLB 2LQRA 3N1QC 4X6CE 3MRBA 5AVYB 3O6FA 1YJWV 1XTLA 4Y2NA 5H9CA 1M6OB 3NIGB 4FHKA 4MVBC 5DJ2B 1WBZB 5H35B 5D93C 5J5EA 1QBZA 2AQ1A 5E8PA 2JDIG 4EUPA 1X6NA 3IFNH 4OZIA 4J3OD 2VLRD 1VQKV 4LIQE 4XPFL 1YEGH 1WSST 2GCYB 1X5XA 5CGYC 4YJ2B 1EAJA 2R2EA 5F72S 5IK3A 5K5YA 1G8MA 2JJ2G 4G7SB 1A6ZA 1KDIA 5ISZA 3SE8L 3G6JF 2DJ4A 1FORH 4ODTL 2DWTA 5BOZG 5IW6A 1BAGA 4OZGE 1TNNA 2ZXGA 2DMGA 2G5BB 2FJFA 3CSTA 5IBLC 2WN3A 3DMMB 4Z7UF 5SV3A 1PX3A 4PSRA 4XVOA 5MERB 3NCMA 4JFUA 5HYIA 2ZUXA 2OCJA 3WUZA 3MYJA 4FG6C 1J5HA 4Y9FA 2ZIDA 3ZE1E 2A6IA 2QKIA 3A4FA 5B1CA 5EF1A 3L2NA 4X66O 1VPOH 3D0VB 3WB0A 4JO8A 1SEQL 1KYFA 1S46A 3MLTB 4OD1L 3WB1A 4KROB 3ZE2E 5TPWL 4N5EC 2BVQA 4WW2C 2J8HA 1KXVA 3UFIA 3DDGA 4AY0A 2ATKC 1BQLH 5SWZA 2C1OA 3KCXA 3QUZD 1GK9A 2E3VA 1N6VA 1U91A 4G6AC 3TN0A 3P0YL 4DR3O 1K3IA 1Y6MR 3RBGA 5IT2L 2HX7A 1E8YA 5F9JA 3LHPH 4R7DA 2R8SH 1D6EA 2J2ZA 1M1KW 2XPGB 3GHBL 4HWBH 5JDSB 4QY8A 3C5ZC 4H0IA 4XMLL 1DO6A 2F68X 4KZEL 2WVSA 2VN7A 1O9VA 2ZCZA 2X3AA 5IESL 4YDJA 3NYKA 4MQ7B 1DN0A 3BKYL 2Q5BA 2FWOA 1IGCL 3T0EE 3MPCA 3PN1A 3FFCA 3I9GL 4FXGC 4LFHD 1EIBA 3CFEB 2F54D 1BVZA 2LGQA 3GWOA 1MELA 5GS0C 2QELA 4P05A 1QNMA 1IXMA 2ZOLB 3V8OA 2UVEA 1UQSA 4FZ0A 3BCCH 1RI8A 3LD8B 4R5VA 5ACLA 3DX2A 2HJFB 1KIQB 4PJXE 5DMGC 1YN6A 2NSMA 4IMKC 1FVEA 2OMBA 3TEUA 2EDWA 4QE7A 4LNRB 5FYLH 3DHMA 2J1YA 2EDTA 2GT9A 3U1SL 5KYUB 5A7EA 5KS9B 4GXFA 3RL2A 3ZZ1A 3L5HA 5C0DB 2VDNB 3W56A 1NAMH 5I1GL 2PWFA 2FYVA 5JJJB 1JFQL 4N21A 2GY7B 1QMUA 1VFBB 2G38A 3PFUA 4HPOH 4O4LA 1DCLA 5CZVH 3ERXA 3M1BA 1DJGA 1JWUA 2D7PA 1YY9C 2GITB 3HMWL 1LGVA 1LO0H 1NQBA 3LH2H 5FHBH 1RV6X 1CC3A 4JI5O 2D9CA 4HX1A 2X4NA 1WA0X 3ZL2A 4GX0A 2BIOA 4Y7OC 4AIZA 1FO0A 3KWWA 3LNFA 2IM9A 1TETL 5D2NA 5C07B 4XXWA 5CWSA 4R6UA 4LEXL 1FJGO 4ZFGL 2OMWB 1OV9A 1KB9J 1NCAH 4LSQH 5DQ9A 5EO0A 2YOAA 4ZS7L 1J5CA 2VXTH 4M8VA 1D5RA 1IC7H 3ILQC 3MGAA 4LLUB 5LDSA 1G7HA 5EHFA 1WG3A 2J6WA 2ZOOA 3CB2A 3VTAA 3DJZA 1AP5A 2WAMA 5E79Z 2VDKB 2A5UA 3BVNA 3HJ0A 1HWGB 3PWUB 3QEQE 4HD9A 4QHMA 2EYRB 1UCBL 2BXYA 1WA8A 1D9KA 4FJYA 3SD2A 3UOAB 1NCDH 2VUOA 4PJCA 3CDCA 4KVNL 1F4XL 4UVAA 4G2AA 5E2JA 1BLNB 2J8UF 3FH5A 4NENA 1OARL 3KWXA 3DX7A 1HQRB 1JGUL 3S37L 3UACA 4UQ3B 2D8KA 4JPIA 1WICA 3H1ZA 4PP1D 4PLJC 5I8OH 5LJYH 2OMUA 5ALCH 2G60H 4JI4B 3PWJB 4GSUA 4HUCA 4IDJL 4X4YB 3K1DA 4YX2L 3RY5A 3VUAA 2DIEA 3MSPA 1F7YA 4FI7A 4Q6KA 1BZ7A 1HKFA 1ZLSL 2CLVB 1FYJA 1ZVSB 2MOQA 1H19A 1FG9C 3KLQA 4ZMLA 4NGHL 1LMKA 5IMKA 1R3JC 5IVXE 2EILB 4DK1A 3S34L 1MI5E 1I94B 1Y6NR 1FF5A 4HJIA 3F7VB 4ZQKA 1YJDL 2UXNA 4LF4O 1NCUA 4N1CA 4ZFFB 1YN7A 5GPRA 3ULUC 2G0LA 4JZJA 2DWEC 3G6JB 4PG9A 2IADA 4RGMC 2A4CA 4U6XA 4Y2DD 3WENA 4MVSA 2DZEA 1J1PL 1CF1A 2BOCA 4I2XA 3OJDA 5E94A 5FF6B 1OSYA 4OCNC 3CLEL 2VC2L 3L5XL 4Z7UB 4HV8B 2WMPA 3WLWC 2IO5A 3BH9B 2LABA 3HW7A 4UM9A 1RIVL 5F0PB 1R3KB 1LJMA 4K0OA 3EJYD 5JIHA 2R69A 4FFZA 4GI8A 1WLHA 2HJLB 3IU4L 4D7PA 1NBQA 3FQNB 3GJFK 4HWEH 1QWHA 1FP5A 2K45A 1HEJC 2G2PA 1EMTL 1MCBA 3V79C 2D0GA 4N0FB 1MOFA 1KTDB 4LIQL 4E5XG 4CRPA 3WTVA 4D0CA 3GMOB 5EBLA 4YQXL 4BFGA 3WJJC 5DVNA 4I0XB 1CLYH 3RDTC 3SE9L 2MJWA 1UFGA 3H1HH 4JQIA 4F80A 2JELH 4NRYA 3VXQB 1KJ2B 1W0JG 2YMOA 2OXGA 3QAQA 1KJ3L 2W60A 4OGQB 4WGWB 1A9EB 1OJHA 1WK0A 4WO4A 5DU7A 3GI9H 5B8CA 1QUNA 1TEFA 1C1EL 5C71A 4PHZA 2Q5ZA 1DZ0A 3MRGB 1PL3A 4UDTA 2BCCH 4F7MA 5CNHA 2VDNH 1JK8A 1Z5WA 4KI5E 5B1JA 1IQDA 3DIDA 1B0RA 4MMZB 5T1KD 3RX8A 3WUWG 4NM4L 4YSUA 5HPOA 2B3IA 4B3SB 4M1GL 2NYKA 4JRXD 4OAWA 1AHWA 3GBNL 3MZGB 3OZ9L 3O0RL 1DQIA 3QRGH 5F88B 3Q2LA 4DVRL 4NQED 5EZOL 4B27A 4MWFA 1WNSA 3WNIA 4OIIH 5KAQF 5HHME 1NMAL 1FGNL 1OE3A 2N7SA 3MBWA 4A6YA 2J1WA 1DANT 1VF6A 4D94A 5ESVB 1KGCE 3KLDA 5C08D 2MSPA 1EHKB 2ZIMA 4JKKA 1NGZA 5JWPA 3K6FA 4P9OA 3F5WA 5GS3A 5GS1A 3PAUA 4JQIL 5BQDA 4PJEF 3Q2VA 2JKXA 5I1IL 1KIRA 1OF2B 3C8HA 3CMEV 4JKPH 3L8QA 4Y16D 1QZNA 4NFCA 3VW3L 3GC3A 2IOIA 1EEYB 2QHRH 3L3GA 1FFPA 3AY4C 3UTTB 6CGTA 2YQBA 3QQ3B 3OD4A 3DGEA 2CK0L 2CAKA 3VFUB 1JPTH 5I0VA 4NKOA 4IOFC 4NHCH 1YMMA 3MRDA 3WKQA 4JG1H 2OMYB 2Y3AA 2RD0A 4X6CF 4UQBA 4DOHB 4NZRH 4AYBA 2ZF9A 3VTMA 5L2KE 2V8LA 4JFDA 1VQ8V 5I0WA 1OT2A 3ZRFC 3FQRA 3MV9D 5I9QC 3BT2H 4JY4A 1U3HA 4PWFA 3UCQA 1SQBH 3MCLL 5FYKE 2XTJD 1UKTA 4DYLA 4N1EA 4Y1TA 1Z3RA 3V0AC 3X1NA 5KYYA 2L7UA 2NY3D 1AQMA 4X6FA 1IC5L 5KMGA 3GF8A 4TNEA 1AJNA 2NYZA 1JWMA 3B9VA 1BMWA 3CC1A 4LL1A 4FZ1A 4LLAA 4PGZA 5LBSA 2XG4B 5E5LA 5JYMA 4OZGF 3B2EE 3CAFA 5CSGA 4IBUA 1MW3A 1XF1A 4NS0A 1OXYA 1BZ9B 2J8UB 2EE0A 5FYKU 1UGNA 5IB4A 4M3HA 4UQ2B 4F8LA 4F7EB 4HJJL 2HT2D 5DK2B 5CEXB 4LO9A 2FE0A 3DK2A 3VXPB 1OSPL 3ZE1F 2ZQMA 5LYJA 3P4MB 5K39B 3L73H 4FQCH 1ZE3C 1KC8W 2OW6A 3BYTA 3IMUA 5ID1B 1AGBA 1C12B 1NBYB 1XZWA 4PV8A 2D3JA 3IWUA 3AG2B 3D05A 3E83A 5C2UB 1OCWH 2A9AA 3IAYA 4GO8A 4ZPVB 5G5DB 3PDOA 4FXKB 3K0GA 3JATA 4U3FH 3EJJX 4Q2ZB 4P06A 1SZXA 3V4VH 2ZX5A 3FAWA 2XBDA 1IGMH 3P0VL 4I55A 2DY2A 5ICXA 2FEEL 2HHHO 3JWDH 5JVDB 3D4YA 3HBGA 5CP7B 2BNQD 3ENEA 3IKKA 4PWHA 3SZKC 2HFGH 4PJ5B 4JFTA 4WWKA 3RY6C 4UB0L 3X11A 3RVVD 3HVNA 3UTSA 3QARA 5MEPB 4I1NB 5CIPA 3UP6A 5JQHC 3DRQA 1H2SB 4I0PA 1KJ2H 2EE9A 1IE5A 3PDDA 5AAMC 5J4MA 1HK6A 1AD0A 4Z3EA 4AV5A 1P5UA 2JNZA 5LGNA 3ATDA 3RWHA 4ZHQA 3D52A 4Y4FB 1T7XA 5JJNB 3B3IB 7FABL 5I1KL 4L4TB 4BZ2L 4EIBA 3V6FB 4YDIL 4PJXF 3IMBA 4XRCB 4HKZB 2UUAB 4EPSA 2F1BA 4HIHB 1PZ5B 3SY0A 2F7PA 4W4LA 2OYQA 3D69B 1XL6A 4Z18A 1A7QL 3BP6A 2J43A 5KN5A 1WP6A 3J07A 3S5ZA 4MVOA 1MDTA 1S3KL 1T5EA 1H5BC 1KBPA 4XPFH 4WFAV 3KLSA 1AANA 2J56A 1H3PL 3T04D 3SE8H 4ELME 5F9OL 3C5SA 3QQDB 4ODTH 4RZCA 1T04B 5DZLA 2Q6WA 5IW1A 3IJEA 1UWYA 3ME0B 2YPKA 1E30A 3NP4A 5HJ3A 3V7MA 1FZMB 1OAKL 4WFHA 1H0DB 2PW1B 1J9SA 2ARWA 2DS4A 2JIXB 3MVSA 5IE9A 2F4VO 1F13A 3PREA 4LB8A 4X4XA 3BSGA 3RYHA 3GB7C 3PWNB 1D6VL 43CAB 4U2YA 3FCBA 3GXDA 4J3VA 3I55V 2DYPB 3ZHKA 3VBBA 4UUJB 2BSSA 2M83A 5HVHC 2K0RA 2OZ4L 4O9HL 3ZO9A 4C4UA 4DUYO 5HHOA 4B53A 4C56B 3RKDD 1SEQH 1JGDA 3L4XA 4OD1H 5JA8B 3OQ3B 3JTSB 1BFOA 3E6FA 4QRRB 4XNMA 3FUIA 1IBFA 4BINA 2Z31D 4PJEB 4JI0O 2Z8WC 1J0HA 5L8JB 3F7KA 2O61A 2Q7NA 3TCLA 3VFOB 3E2HC 3P0YH 1QO3A 4K9JA 1G6RA 1XGUA 3F7LA 4QLRA 2VC2B 3ETBJ 1BXXA 4PTUA 3WFEL 2I9TB 3LS5L 2VQEB 4I13B 4IIQC 3GHBH 4PDRA 3T1CA 4JI1B 2ADGA 2WSPA 5LAPA 4JFEA 4KY1L 5GQBA 4DP8X 4N0CD 4XMLH 2NZ9D 5BXFB 1EXHA 2QMJA 3OKEA 4KZEH 1U8JA 4TSAL 3SCMC 1ZA3A 2ZXEB 4X6CB 4DSYA 3EJZC 5IESH 1U9KA 4LQFL 2P3YA 2VRZA 1QFWI 3C6LC 3BKYH 3JWNH 1R0AL 5HHPB 1IGCH 3QTCA 3OX8A 5E6YA 2IMNA 2XAFA 3V9FA 3I9GH 3GIZL 2IF7A 1ZJAA 2B9AA 3KPRA 5JOPE 2ERJB 4KKBD 4JN2B 4G72B 4A63A 3RGHA 2WZ0A 3B56A 4JG9A 4JQVA 4Z9KB 9PCYA 5TF1L 5EEVA 2WGNB 3WTWA 3HR0A 1FE8H 2APXA 5KYWB 4OZGB 1Z66A 3OPUA 4KO7A 2ZXWC 1O5DT 4AUUA 1ZL8A 1OLZA 1DDTA 1IARB 2V3DA 3RWIB 3IE4A 3B34A 3HPJA 2EEFA 4J4PA 3U1SH 2X2HA 4XB8A 5IYZB 3AXLB 3EZ8A 3ZE1B 3A3YB 4HNAB 2ENPA 5I1GH 1JFQH 1CURA 4FQQA 4D9RD 5GRWA 1DJZA 3EG9A 1YDPB 4PR5B 4EIUA 3HMWH 3CRAA 3J7HA 3ZE2B 4IQHA 2YARA 1RZKL 5CS7A 5FYKL 3CDYA 1SQXH 3QJVB 4AL8C 3BQVA 1ITBB 1KQSU 3FB6B 5IJCC 1ZOXA 1TETH 1J8SA 2CDEA 2JTDA 5DD6A 5F7LB 1PKQE 4LEXH 4MYPA 3EXJA 3JTTA 1OF0A 5DHVA 3SEPA 4ZFGH 2R7EA 3NFPA 4G9FA 3P73A 4X66B 1SVZA 3L3KB 4HISA 2V5SA 1M3IA 3EHBC 2ZUUA 1PNLA 3CYOA 2YO3A 5ESAB 2XXCB 5EU4B 3LXCA 1SQVH 4PJ9C 5EIQA 1UCBH 4TPRL 1BE3H 1XHHA 4DCQB 5I1EH 2FR4B 3NRQA 1Y18A 3H3KA 2Y0SA 4KI5F 1F4XH 1XZ0B 3QQ4A 1EXGA 1MHCA 4JDEA 4KVNH 5L4MA 2CA4A 2Z5UA 3M17B 3OMAB 3T0EB 5FA4A 1P84J 1OARH 2WQWA 4DR3B 1JGUH 4OIAA 1NM4A 1UD3A 2EKSB 2OMTB 4G9DA 3S37H 4I3GA 4YE0A 4YH6A 4LCWE 5CBFA 2PO6C 2WB1A 3MOBH 2VLKE 2BIIA 2ZWKA 4J8QA 4WWPA 4YFLF 1HFUA 4YX2H 3T4ZA 1INQA 4PJXB 3VGEA 3GMLB 1FO0H 2PABA 4XX1G 1UOWA 4AYDC 4FQXA 4P5TB 4P2RD 5DRNB 5D1ZI 1YYLL 3KPSA 1SMDA 4M5YH 1P4UA 1XMQO 1KPRA 4NGHH 5JO5A 5D7EA 4WU5A 8FABA 4FXLA 3S34H 3RFZA 3U0PB 2WYTA 3BUYB 3UCSC 3VFTA 4I18A 3BKCL 1HZHL 2GJZB 2XFXB 3P4OA 3VI3A 1FD9A 4W4KA 3P4NB 5K9KB 4RFEB 3QO0B 2X05A 4JPWL 1J1PH 4QIRA 1IM3D 1BQHA 3FFDA 3ISRA 1T6WA 3GGWA 3HKEA 4H8PA 2EO7A 2VC2H 3L5XH 3TGXA 2CH7A 1MG2C 2R1YA 4PLKC 2D7TL 1N8ZA 1V27A 2UXCO 5JXEA 5EEWA 1RIVH 5J12B 3RFRA 4X7SL 3WAJA 4NLAA 2ZXBA 4FYSA 4XNQB 4IRJA 3QUMA 1WBYA 2BSTA 2D7MA 3IU4H 1XMEB 4WVRA 4A7SA 4PWJA 2WZPD 3TH2T 3RU8L 5FOBB 3ZGIA 1K72A 2H0EA 1T5WB 3WN5B 1WPCA 2HSIA 3QEQB 1EMTH 3IAQA 5J11C 1GYWA 3RGBA 3S35X 4JI5B 2JKNA 5J1SC 3ASWA 4LIQH 1F1GA 1HL5A 3BVXA 3MFFA 4FC3E 5EPMB 4IRSC 5F89A 1R5WA 3ZTJH 1JFFB 2EC8A 3GVMA 4LGPB 4MSWA 1FJGB 2LP7A 1FC1A 3SE9H 4TWKA 1E4KC 2VLRE 4R6ZA 2C4XA 1BIIA 1IMHC 2Q0AA 3DBXB 3NAAL 4QRAA 2ITCA 1KJ3H 2QSQA 3KG2A 2C1PB 1KBHA 5D2LA 3JAWA 1C1EH 1Q90A 2B16A 1KV7A 1JF6A 5HYJD 1EWHA 1TQTA 3QJFB 4O51B 4E9TA 1A8JH 2ZWLT 1KU9A 4HIJB 4HKJA 1KDJA 1EEZA 4NM4H 4YGVA 3T4YA 4WENB 4ZX4A 4KH2A 4M1GH 3QUML 5IVXB 1AZCA 2NY4C 4ADJA 4NEHB 1OTTC 3QULA 1MI5B 3GBNH 3OZ9H 4KMQA 1IFRA 4PRID 4TVSa 3AMLA 4EE2A 4RRPA 5EZOH 2N05A 2BVTA 3RYCB 3P3SA 3WHXB 3ARYA 4KKNA 4Q9RL 1NMAH 3GSXA 1FGNH 2FVNA 2WQVA 3ZOAA 2QWQB 4HS3B 3FTZA 3NJMA 5EZJB 3FOMB 5HGAB 4H0LB 3UZVA 3VVVA 5EU6D 3KYAA 3HRZC 4EN3A 5DJ6A 2D73A 3R8BB 4JQIH 3UTOA 4F8QA 1VFAB 1OPGL 5EUKA 5I1IH 4L8SC 3OF6D 1XHZA 4QT5A 1WJ3A 3VW3H 2M26A 3CC5B 4U7OA 4TOIA 4LF4B 3ARGD 4AQEB 5I1AB 4Y89A 4D7BA 3OAYH 2A0LC 3D3VD 2CK0H 4L4VA 5AVZB 1YIJV 4AGOA 3GWKC 4FLTA 1CQYA 1A4AA 4MD0B 1JRHI 5FUCC 3LKNB 3ABKC 3LZFL 3EVKA 3D85B 4L1BA 1LNQA 1G7JB 4NPYB 2AV7A 3D06A 3FUJA 3D36A 4F58L 4CADA 4ZX3A 3RVUD 5C8YA 1FL6B 1VGKB 3W9EA 4E9YA 4K8XA 5AW0B 2X6CA 5IROC 2F54E 3FOLA 3U7AA 1CFVL 1ZTXE 2NNXA 2WYIA 3MCLH 4CSSA 2YC0A 2Z4QB 1SZNA 4JFQA 3GZPA 4WKXA 4U05A 1IC5H 2H47C 3CFCH 1F58L 1DQQB 4XC1L 3LKSA 4YUEL 4DFIA 2AQNA 1RK1B 2A74B 3LY6A 4ELMF 3CCJV 3KGUA 3GSWB 2QFRA 5T5NG 3L72H 3Q6FA 4IL6Z 4GQZA 4U1KB 2H6PB 3OTTA 4EKWA 1R34A 4HLJA 4K8RD 1ZHNB 3K3QA 3MRJA 2CBMA 2WLKA 3BD4A 3LIZA 5I8CA 3LPFA 4HJJH 5A3IC 1V54B 1IEAB 2F8OA 3GRBA 3TWCL 5KYXA 2E8ZA 2ESVA 3BVOA 1UA6L 1OSPH 3O3AB 3GQFA 4P2OD 2OYKA 5EIIB 5HHMB 1BZOA 1XF4B 3ZKMD 1N6UA 4PRDA 2ZKXA 3V4UH 3VE0B 4U2ZA 5DO2D 2P9RA 3IF1A 5DJXA 4IIZA 1OKEA 2CR6A 5LGJA 2P8MA 1G0YR 3APOA 3HB3D 3PWLB 4FZ8L 5HYSA 4KFMA 3IFOA 3P0VH 4MCZB 4XCEA 2GSGB 1QU7A 5K1XA 4HAKA 5FGRA 2C3XA 3AM8A 3W9DB 3WBDA 1HXMA 3NA4A 5LBSH 2JKLA 4AQAB 4UB0H 1DUZA 3V55A 2I07A 5DZ9A 2QKIC 3TA3A 1AQDB 1MCWM 1MJUL 3KPQB 5DMIL 5FUZL 3SOTA 3HKZA 3M07A 3UL4A 3QRLA 3TYFA 3Q44A 5L2KB 2VRQA 4FAAB 2YIDA 1ZS2A 4N8VG 2ZX8A 1OTUC 3TBSA 3P30L 1KXVC 1YEIL 5BVJB 4MJ6A 2IOMA 1AKPA 2F1EA 1HH9B 3E38A 3L9RB 4GT7A 1KEMH 7FABH 5I1KH 4AMKL 4BZ2H 4ODWA 4HOXA 3TN0C 4YDIH 4PA6A 4G42A 1LEIA 4X20A 3ILPB 1LQBC 1C9SA 4L18A 3OKNA 1MXDA 3R66A 2W65B 4AEFA 4M7JL 4UIMB 1A7QH 4HUXA 3ZR5A 1QTYT 5KHHA 1T22A 3DURB 2XHBA 4NQVB 1WUNT 4YDNA 1S3KH 4HJTA 3BLBA 3EBGA 3SKOA 2FECL 1XR9B 3AG3C 2C9AA 3H0TB 1SBBA 3T08A 5DRZB 4MT8A 5F9OH 2D0HA 2X4UB 5GZNA 3L95B 4G7RB 5D7HA 1AXSB 3F7YB 2B3RA 4K7FB 4PLNC 4X64B 1OAKH 1BYNA 3OTFA 3F04A 1LO4L 1L0PA 4Q6IB 2EDMA 3BUQA 4KWUA 1D6VH 1RZJC 3SIKA 3OB8A 3UYPA 2IPUK 1K2DA 2BS71 3RYIB 1H8SA 4G8EA 3SODB 3C3TA 2QADC 5SX4I 4AM0Q 4O9HH 2WXHA 1ZGLB 5GGUB 3LRLA 3MV8D 2Q8BH 3G5VA 5EOTB 1MEXL 4LBAA 3U46B 3FQUA 4WI6A 1LTXA 3QI9D 5F1NB 3PL6A 3G9AB 1ET7A 4G11A 4XNAA 3VH8G 2X70B 4MTOA 1MVUB 4UNTA 4OI8A 3DUSB 2B1GA 1PFOA 2Q67A 3P9MB 4FD0A 2ZUVA 3ARDA 4GRMB 4RDQF 3UDWA 5IJDC 3WFEH 3IDMB 4GS7B 4HCRA 4PJBA 5ANMA 1L7IH 3OPZL 3OHMB 4MB4A 3NACL 4OLVL 4YN3A 5D2NC 4KY1H 1UOVA 2H3NB 2X2UA 4XXWC 3AU1A 2CGYA 5DVMA 4LRIA 4Z5RB 2Q76B 3QZWG 4TLSA 3NJIA 4JI6O 4LHUA 4TSAH 1DN2A 4JFFA 4AXWB 1A1MB 1NEPA 3D2UD 5C9KA 3BA9A 3SQRA 1HOCB 2WP3O 4LQFH 4JRXE 1WFMA 2Z8VC 3FQYA 2EC9U 1KWKA 4AM0A 4JFOB 5ETUA 1QR1B 4NQEE 4QNHB 5JOFB 1D9KC 1GGUA 2DLIA 5EU7E 5TF1H 1NZ6A 1HWHB 2I32A 4ELMB 1QPPA 4F27A 2Y7SA 3RTQA 5C08E 3SKUD 3FO1A 2CG9X 3SPJA 4ATTA 3EW3B 3HNTL 4UI2A 1RHHA 1OM3L 2J21A 3E1ZA 3HS8A 5DFWH 2BCKB 4AZ8A 4F93B 4WFFA 3WEMA 4KK9C 5JHMA 1R47A 2X1QA 4KXRA 2ZG2A 3V0VA 2X7LB 4HK0B 1EZSA 3GMPA 3VCLA 2XTLA 4F15C 4MJ5B 3NSYA 1KB5L 3F2LA 3GM8A 3NFSL 3QNFA 3THOA 2IBGA 2Q7AA 1NBZA 3ZR6A 4BFIA 1S7SB 4OF0A 4PGJA 4MJ4A 3CBRA 4XVJL 1M9SA 1OGTB 1ZTXL 4TVUA 2UZXB 4XGZB 1J0ZA 5FYKH 1RZKH 4OFQA 3IMVA 1FCGA 4JZJC 4LBEB 3QIUD 1SDYA 3MV9E 3BAIA 1MWOA 1OB1B 2BOCC 1JZ6A 1M3JA 3HZKB 2XTJE 1YY8B 3CN4A 3N41F 3QO1B 4J3OF 1BJ8A 5DQJB 1JTPA 1LK3L 2X7RB 4DUYB 2V3FA 4XBGA 4AQ8A 3OGCB 3BPNB 1T2XA 5E4EB 3K9AA 4P4KD 4ZBJA 1NDMB 5T33L 3JT2A 2DE0X 1I4FA 1NCTA 2AJZA 2J57A 4TPRH 4ZFZB 2R1XA 4Q89A 4YO0B 1VADB 5T5FA 2Q8AL 1F4AA 3BJ91 4JI0B 2XG5B 2XWRA 1LLAA 5D7JD 2FYYA 4E9LA 4OR1A 3CD6V 4U3SB 3R18A 4K5PA 5JQGB 1WP8A 2R0LL 5DMYA 3J7AU 3ZIAG 5EBLC 4R26L 2YK1L 4OTXL 2NW3A 4PAZA 5JR1L 2BOBB 1A25A 1SQMA 4CH5A 2ZZUT 2AXFA 3NJFA 4X1KB 3AFLA 3B9KB 1MJ8L 2ARJB 4HEMA 4N6RB 3SR2C 5DECA 4PRHA 3T1FB 5B8CC 4WO4C 1YYLH 3L16A 3IU3A 5DHVH 3EJQA 4U1IA 1I7RA 2RBLA 3HTLX 4LSPL 4YHML 4W68A 1MF2L 1RJCA 2OK0L 2BNQE 5DD5L 5B1JC 3BKCH 4GEIA 1DDHB 4FKKA 3HHMA 4H13B 5EU3B 5ITFA 3E22A 4NYKA 1AR1C 2QL1A 4MB5A 2HP8A 5CBEA 4PH8A 3MRLA 2YRPA 1AHWC 5B39G 5HI4C 4KX9A 1HN1A 4JFPB 4PW4A 3KAAA 3PFQA 2IJHA 3RNQA 2ZCKH 4K5OA 3N2GA 1PLGL 1NCJA 1U97A 1C5BL 1VF6C 4XN9A 4LCVA 1MH5A 3KNBB 4AKPA 1PKQB 4XMTA 4X7SH 4YDZA 2QTOA 2A73A 3F85A 4BK5C 2VM4A 4L0YA 1O6SA 4OVVA 5E70A 5GS1C 1I1AA 3F5WC 4PMFA 3RVXC 3QUYB 3DXAA 2AK4A 2CIIB 5E1AA 3CMAV 2ENJA 3RU8H 3IRZA 4GXVL 1BXAA 2XKNA 2CRYA 1K73W 4XI5C 5DEFA 2VR8A 3BQUD 2P5ED 3TXSA 4QTHB 5GTHZ 3KYOB 2HLDG 2E76C 3TL5A 1IAKB 3KPTA 4MRCA 5DJDA 3MZTA 3OAUL 4MMYB 1FH2A 2EICA 2B2XH 4XVUC 3WY3A 1BAWA 3NAAH 1T3FB 1JGEA 3FO2B 4P4RA 4LCWB 4MHHG 5GSVB 2VLKB 5AALA 1U3HC 4JAVA 2MCAA 2M8XA 5MENA 4OW6A 3IMWA 5F3HA 1J7VR 4Z0XB 1F02I 2QLYA 2VQFO 3LKQA 4K3EL 4NT6A 2YAPA 5L8KB 1CE6A 4TUOB 4U3JA 1TTCA 3X17A 3QUMH 2APWA 2QJ1A 1EFXD 2WN2A 3HAEG 1XR8A 2W94A 3B6SA 4ISVA 4N2HA 4BSVB 5CB4A 1M1XB 1GJUA 1GC1L 3L13A 1U8HA 2CHDA 4HZ1A 4X7TB 3MNWA 3O8XD 2ZONA 5AG8A 5A2KH 3SGIA 4IK6A 1E3ZA 2P8PA 4QHNA 5J57B 3GLZA 3DI3B 1JZDC 3S96B 1XCTA 2A2QT 2BP8A 3DDFA 3IJHB 2VTFA 2AQTA 3DWTA 4NP4H 2A6KA 1XMQB 1ML0A 1OPGH 1W72L 3H6JA 4QHLB 5IHZA 3FSWA 3CFBA 3W7UA 1K6QH 3GSQB 3RURA 1INEL 1ESOA 2NXZC 1FZOA 3LNHA 5DHXB 2R51A 5E9DA 3T8XB 4AQ1B 3HE7A 3HS0B 3FYIB 4WBNA 1N70A 4GOSA 4O02L 3BZ5A 3LZFH 1JZGA 1NGWA 1R5VB 2X53A 3L3OA 3S3BB 1RUML 3L4UA 4PPTA 5DUBA 4F58H 2DLFH 2QKAA 2BZ7A 4OCRL 4WWKC 1EAOA 4NM8L 4GW5A 3OG6B 1RURL 3DOHA 3EYOA 2UXCB 1BX2B 3EJPA 4JRYA 2RDCA 4MJHA 4WAFA 3N41B 3RWFA 2YRBA 2O5XL 2VLRB 1CFVH 3QG6A 4LLDA 4I0PC 3ABMB 3M8AA 2DM7A 4JLRA 1T1WA 3ZIMA 4F2EA 3O45B 5T1JA 3CPUA 4GRLD 4U49A 1IGJA 1K4CA 1F58H 1H6UA 2HVKA 4NC0B 4XC1H 3EFFK 2CBQA 4GBXA 4YUEH 3NJLA 2BSKA 1R5IA 3LKOB 2Z93B 5D7SL 2XICA 3GUTA 1P5UC 1BG9A 1JK9B 3QS3A 3W11C 2R39A 2X0UA 1DQKA 1U58A 3QVNA 3HMXL 1OP4A 2F0CA 2ILLA 4HW6A 3UPRA 4U7SA 1A3RL 1OGSA 3PWPA 1NS1A 3TWCH 4ZNCD 1UA6H 5C0CA 1DQJA 4RVBA 4HBCL 2OSYA 3OTOO 1Q5OA 4D9RE 1ADQA 1QVOB 3LKPA 4JZOA 1RH8A 4F33B 3MXVL 2BIMA 4GKZB 3SKMB 1DO5A 5HGHA 5LMUO 2OMWA 3S3SA 2FB5A 4N0YL 3IB4A 2A79B 1C16A 1IAIL 2IPKA 2B59A 2LGWA 4UVBA 1NWPA 3QUZB 1Q9LA 3CVHL 3KE0A 1RP3B 1CGVA 1A6AB 3FU7A 4WTXA 4KMTL 4ZPTA 4FL4C 4PG2A 2J5WA 1RZ8B 4HEPA 3WIFA 1VQ9V 3KBEA 1RPKA 5TE6L 4ELKB 4PS8A 1GYVA 3HN3A 3I9IA 2JK5B 3NRPA 1ODUA 1ZS8A 5DMIH 1MJUH 1F23A 5FUZH 1G7IA 3IDGA 2KKQA 1KB5B 4RWYL 5LXTB 2ZSWB 4MX7B 5EIBC 4I8DA 4NO2A 4QJ4B 3LJ3A 4Z7QE 1GW6A 4KV5E 1M4KA 1FFOB 4IRZL 1HSAA 4JHAL 2F54B 1ADQL 1U2HA 2ZUTA 1ANUA 1FNEB 4KUZL 3D39D 3GZQA 5AAPA 2MNWA 2B77A 2JS5A 5D5PA 2PPDA 1L6XA 1P49A 2C4FT 3BW9A 5JIIA 2LFRA 4O4HA 5GIRA 3HI6L 1OE1A 3PNRB 2G5RA 5LHIA 1XGRB 4P2RE 4LCCA 3MC0A 4HAFA 3KPLB 2ILMA 3MRCB 3GSVB 1U30A 3ZT7A 2IJJA 1AFVL 5KSBA 4A38A 1JN6A 4M7JH 5LWYL 3L71H 3MGOB 4M8UA 4NNYA 2PTTB 4JJOA 2Y23A 3O9WD 2MCPL 4P3CL 3FFOA 5CA3A 3JASA 2CUGA 4HS6A 3BGFB 2X89A 1CG9B 3N50A 4JMXA 1OWRM 5I17B 1O9WA 5PAZA 1AP2B 5DZOA 1QASA 4P9PA 1KECA 1SMAA 1TYEB 4JQVC 2YC1B 1K5SA 2AKRA 1J5IA 2HG5B 1X9LA 3B7UX 1K5NA 5H4ZA 2NY0D 4X6DA 3VD2A 4Z3IA 4Z77B 1H2LA 4YXWG 2VCOA 3MCG1 3D33A 3RAJL 5C6PB 2PCYA 1ECYA 1Q7YW 1URLA 1MEXH 2Y7LA 1TQCC 5CN0A 4J3OH 2BVOB 4KKLC 1EDYA 2X3CA 3UBXB 4JY6B 2JEUA 3OKKA 4KJQC 4U1SB 3PXJA 3VXSA 4F7CB 1JF5A 3JD0A 1MLBB 1YTFD 2W0LA 3KPNA 5F7NC 2GI7A 1YNTF 4H1LG 4KK6C 1SUHA 3ZDWA 3OPZH 1HHKA 4LKXB 4OLVH 3P3NA 3HCVB 5CHNB 5HYJE 1FAIH 2DV6A 3QB7C 4D3CL 3QZOA 2X40A 3K6NA 1YEEL 2RIKA 2HT4C 4KOCA 4C4KO 4C83A 1EEQA 4FLXA 1COWG 1B4LA 4P2YA 4PRIE 1KXTB 3L3DA 2EJ7A 3BZEA 5IV2A 5D1QA 1F3RB 5JPNA 4R7NB 1TJIL 3T6WA 1KCBA 4TV9A 4Y2DB 1W0VB 3L9YA 3PIQA 3ZKQD 4H8WC 5CD5D 1KULA 2IWGA 2K9FB 5TDOB 3QUHA 4P04A 2WHVA 5EU6E 4ONHA 3HNTH 2EXWC 1OM3H 2ICWJ 5LCVL 4PBVC 1BMFG 5CA0B 2L8AA 4XN2A 1X9UA 4IOSD 3PHAA 3UG3A 2WLMA 1CT8B 3B1UA 5C0FA 2Z1PA 2Q8VA 2PYFA 5INCA 4BJLA 3RUGA 4JV5O 3ESNA 4FQXC 3D3VE 4L2YA 1Z9OA 3OLEA 4HWNA 4U7MA 2LLNA 2EACA 5JH7B 1KCVL 3IGLA 4PV1B 3NJXA 2PY5A 3QUXD 5LGUA 4XVJH 3RFZC 5CA1A 1NCOA 1WC7B 1ZTXH 2YGNA 3QNXA 2YD3A 4I18C 4JGSA 4F2MA 3QRBA 4UCOA 4EI6B 4FG4A 3G6BA 2D31B 3OC8A 5DK0B 4BWTA 3UGEA 1EEUA 2DI7A 4BDVB 5K9QG 3H9HB 1AS8A 3MBXL 1JOIA 2JGUA 1GJIA 3I56V 3WFHA 4QJ3B 3IBOA 3MA9L 4I48A 3D08A 1B2WL 4X1IA 1LK3H 3QRFM 5C8JB 1VZGA 4B9IA 5D1ZA 1W72B 3FTXA 4DO6A 5JXEC 2ZSVA 4ZOLB 3CXHK 5CCJA 4IRJC 5T33H 5T1KB 4JFYB 3IMTA 2Q8AH 5FK9B 5ID1A 4CC1A 3IGAA 2A9ML 4JRXB 4GG6E 1SXZA 1ZLVH 3FJTA 5MEOA 4O02B 2CTRA 1G7PA 3AK1A 2RALA 3MRPB 4NQEB 1SVCP 5IEHB 2R0LH 1GGCL 4LFCO 3QIWA 2YK1H 1T0PB 4HKBB 4OTXH 4POUB 4R26H 5JR1H 3AQDA 4FMKA 4MSWC 5E1QA 3CJHB 2BP0A 5C08B 5DUPL 5C0ND 1AB3A 4JI6B 3MGTA 4B60A 1C5CH 1KPUA 1MJ8H 2IH3B 3L48A 2ITCC 2RN9A 5I74B 1X5LA 5I8EB 3DIFB 4L3CB 1FL5B 3WO4B 4KHXL 3VDBA 4Y16B 1AGEA 3MUZ1 2DQFA 4LSPH 4QPKA 4PJIE 3RGVA 3B2DC 1R6KA 3C5XA 1MF2H 2OK0H 3MAWA 5DD5H 1V05A 4DR5O 4ORGB 3ZMRA 2V2WB 3TBVB 3TVMD 4JREB 2WO3B 4PY7B 3BKJL 3S36H 3BLKA 2F5AL 1GY2A 3WLBB 1ILSA 1PLGH 3MV9B 2CO4A 4CA4A 1C5BH 4B7IA 3O6LL 4OH2A 4UOW0 3WNNA 2H2SC 4M8RA 2XTJB 4MAYA 1RZQA 4E0RA 2NY3B 1WT5A 1KG0A 3GSRB 4UQIM 1BFSA 5KHKA 2J88L 3ZGHA 3C9NA 1OCRB 3CVHB 3U4AA 2GW5A 4GXVH 4S1DC 3T0BA 5J3HC 3RNKB 4E41A 3EGDA 3QH3B 1R3LA 3SGKA 3HNSL 2PI4A 3QSKB 4UQ9A 1GS7A 1IC1A 1UD6A 4ZFOB 3EGSA 2J7LA 3QJHA 1S7RB 1A4JA 2MEJB 1LO3L 3OAUH 4WTQA 1YNTB 3CFKA 5DSCA 4AJYV 5HY9B 4K3DH 3ZYJA 3D36C 5EBWB 1UUSA 1I8MB 2AZ2A 4UT9A 2YXWA 3II2A 3WELA 2XAGA 4DIXA 4I87A 5PCYA 1ULVA 4GINA 5LQBL 4KHTH 1EFRG 3DROB 4MB1A 2PUQT 3VRLE 1GOFA 4I7ZB 4K3EH 4AEHL 3B4NA 1GTFA 3B2UD 4Y5YB 1ITCA 4NQXA 2WWNA 3NUKA 3NABL 4HIIB 3MRMA 4YSOA 3UG5A 1K4DB 4D7TA 1ZSDA 1E7UA 2VMCA 4FLHA 3WG7B 4LDCA 1URFA 5DRWB 4OFPA 1EFQA 2BNQB 3CHRA 4LLMB 1FXVA 3MV8E 3O3DB 1GC1H 3JD4A 4BZ1L 2JI2A 3LDBB 5D1XD 4K5LA 4PGBB 3BGAA 3TBYB 2A99A 3CCSV 4E4EA 3MRHA 4JI8B 2WKLA 3VAEA 1J8HD 4KK5C 1IKNA 1AKJA 1A02N 3T2MA 1P1VA 2PYED 5BXFA 3N43F 1W72H 2LHAA 4Z7QF 4KV5F 4ZOEA 4F7PA 2XXMB 3VI4E 3BCDA 4GKNA 2B4CL 1FFXB 1NFDA 4XNYH 4D8PB 1INEH 1HXKA 3L3IA 3S3WA 3WFZA 4C83B 1RZGB 3I02B 1JJUA 3PPEA 2OMNA 2YXMA 1OSEA 4O02H 4KKAC 2BWQA 2HUHA 2WNKA 3AM8C 4W4OA 1T1ZA 3CUPA 1RUMH 5CD3B 4J1UA 3IN0A 3N91A 4OCRH 1A6WL 2QJDA 4NM8H 1PD0A 1JNHB 1RURH 3GJFB 4Z0BL 1AOZA 5KYWA 4WI8A 3TA3C 2D9QB 2O5XH 3MO1A 1O75A 3GHEL 2WVVB 2X4TB 1BFTA 4HIXH 1O7SA 2AI0L 1QW9A 5BO1L 1FLRL 4MTFA 4R3SB 5AOIA 3IKCB 3O2DL 3OSKA 5I66A 3N06B 3UC0L 4B3RO 5BQ7A 5D7SH 2NT0A 4LF6O 2RNBA 4R4ND 4IIJA 3P3PA 2YSUB 2GJ6D 3L08A 1FZKB 3HKDA 4A7GA 3HMXH 1UWXK 4QXTB 4WFED 2LW7A 1DLHA 3FF8A 1RUKL 3DVGA 4XMPL 4GFTB 5LOVB 3GMQB 5KANI 5C2BH 1ODAA 1XCWA 2X4SA 4HPYL 4N2LA 5LUMA 1ZDSA 5JJEB 3QW9A 2DWDA 1EAQA 1W0WA 3ZSTA 1WAZA 4B9ZA 2GI0A 5IMMA 2H1PL 1S5JA 1S7QB 3MXVH 1U8IA 3BZFB 3V6OE 2H8PB 4OLZL 4N0YH 2G75A 3SYAA 3H9SD 5I0DA 3JAKB 4KL1A 2Z31B 3B2VL 2VQFB 1K9TA 3DRTA 5IFAL 3OB0K 3IDXL 3FB7A 4ANKA 3CVHH 2VLLB 5DYOA 2OW7A 4B7KA 5GZNC 4KMTH 2C9SA 2ZOKB 4BK4A 5L9DL 1P6WA 2WLLA 4OCYL 5AKSA 4HDIB 4DUZO 1UXLA 2W0FA 3DO7B 1H2MA 3L4VA 1TJMA 1UOKA 3MRKA 4K8RL 4KK8C 5FO7A 2HKHL 1OWWA 2QLVB 5TE6H 4L9LA 3QR2A 4GNKB 4G8IB 3BOVA 3BSZL 1G9ML 2V4DA 1YAZA 3NJKA 5BO0D 5I2IB 2OR9H 4A67A 2E4FA 2LAGB 1AS7A 3APQA 1GAXA 1NSNL 1PZ3A 4BH7A 2GEQA 3CSXA 3ETTA 4HH9A 4RWYH 5JMOC 1ONQB 1CR9L 1ZTEA 4IRZH 1RU9L 2HJKB 4JHAH 2XXFA 2CIKA 4RH4A 1ADQH 5B1OA 1IQWL 5TK2A 3PL6C 1A7OL 4KUZH 4IKKA 4QAWA 3QZBA 2AV1A 5ECJE 4PGEB 2PPEA 1E27B 1U3ZA 3FQTA 4ZI7A 3ARDC 4XZUA 3UDWC 3HI6H 3QWQB 5HDQL 4F6RB 2QEJA 1YNLL 2NQCA 3WHE0 5L88L 2CTWA 2CDYA 2VN5A 3H85A 4H0GA 4TNWF 1EXUB 1PNMA 1AFVH 2G4EA 2WYZA 4EI0A 3U25A 5LWYH 3S5LG 5DA0B 3FCSA 1RSYA 3BEHA 3BVVA 4EEEA 2BNRD 2MCPH 4P3CH 5I6XC 3TT3L 1VESA 3IDYB 3DXRB 2ZD0A 3V5HB 2KQMA 2AZ0A 3MJ8B 1SYSA 1IM9A 1X5HA 2IJKA 1KCSL 2HP4A 4UM8B 4WK2B 1R24A 1I8UA 3R06A 3EJRA 2ORBL 5BRPA 3VU1A 1M2VA 2B9ZA 1D7CA 1B90A 3RTQC 1OGPA 4X8AA 1DVFD 1FSKB 1FVDA 2KDYA 3G6AA 3EGXA 5IP4A 1RJZA 3OTOB 2W0PA 4AIOA 5EU5B 1CBVL 4XN1A 1XGYL 2QPFA 5LMUB 3GJFH 4MXQC 3S4SG 3VFSA 4A37A 3HRPA 1YC7A 2P5EE 1RLBA 5H37G 4DHLA 3QA3A 3NK4A 1FJ1B 4ZMVA 3KBPA 4X7DC 2K6ZA 2ZCLL 1CP9A 3T6XA 4L9DA 2ODMA 3N43B 4Z7QB 4JFXB 3NCJL 3VSQA 4DH2A 4GG6F 4H20L 1S7UA 4GP8B 1H3UA 3CD4A 3WU1A 3DGDA 5EC1A 1TUPA 1MHEB 1LILA 3BUPA 2QM8A 4Z7WA 4D7SA 1NCBL 1YVLA 5TFSL 5AOMA 1NUDA 4E5XB 1HSBB 3K71B 4D3CH 1QEXA 2BY3A 2Q4PA 2I85A 3HZYB 5AYUL 1YEEH 4P2RB 5BRQA 1MZYA 5CJOL 1CDGA 3AAZA 4QF1B 4AQ8C 2WXIA 3QQNA 4QRUB 4EZMA 1HNFA 3CX5K 3KH4A 5CCHE 2A7BA 5CEZL 5DURD 1NR1A 4PJIF 3FT2A 3S8WA 1ZGLP 4OIBA 2E7CA 1E6OL 4U6YB 1TJIH 4A7UA 2WUCL 2FEDC 3C2SA 4MVZA 1IM3B 3ARFD 1TQWA 2A9HA 1EHXA 2IJ0C 4I9XA 4HJUA 4ODVL 5DJ8A 5T1LD 3WJMB 5IF0A 5LCVH 1AYOA 1KOAA 1SLWA 2AC0A 2Y5QA 4G82A 4MD0A 1KCKA 2IH8A 2P8LA 3EFOB 5TDNB 4NPYA 4HYTB 2E6QA 3C87A 1HYSC 4KXZH 3MACL 4AX3A 2XIDA 1F4YL 2PXYA 4DP2X 1KLGA 2N74A 1KCVH 5DRXA 4ZXBD 3DOSA 1J87A 3GLDA 3ET9F 5B5EZ 1I8KA 4JO5A 1NBVL 4KKZA 1IIIA 1TDQA 2BRRL 1BL8A 2DM3A 1TUEB 4QRSB 1AVMA 4J7ZA 1LWHA 3PGDA 3BFWA 1AY1L 4G59C 5F6IC 2C2AA 3BAWA 4TKWA 3VFGL 5KSAA 1HHIB 3MBXH 4YDMA 4O4JB 1DBAH 3F05A 5SWQA 3ZDXE 2Y7MA 3DX4A 2JGDA 2VITB 3IJ4A 4FFBA 1ZRUA 5GJTL 5HYJB 4JYAO 4F5CE 3LZQA 3P4LA 1QVFU 2Z8RA 3L7FA 2YKLL 1I1AC 3X1BA 3VRLF 1EH9A 5E1AC 5T1MB 1ID5I 3S6CA 4EZKA 3SQBB 3RZCD 2A9MH 3DTXB 3GK8L 4P23D 4PRIB 1P4IL 5ICYA 5EC2A 1AS6A 2ATPB 3RVWC 1SHWA 1NCGA 2R9HD 2X0LA 3GIVB 2E59A 1GGCH 4RQFA 3C5JA 2PCPB 4WHDA 2R23B 1PBYA 4GUPB 4HOMA 2J6EA 3TV8A 4AE1A 3F6JA 4XAWL 1BSMA 4KJYA 4MW3A 5EU6B 1Z5LA 3SGEI 1EHNA 2A83B 4G43B 4E2OA 3POHA 3LHAA 2WNWA 2UV3A 4KHXH 1Q38A 5KX5A 4IJ3B 1E2ZA 2CUAA 2DKUA 2F53A 3ARGB 2ZP9A 3KPQA 1DCEA 4ZUTB 3U2IA 3WIHA 4RQEA 3GKWL 3QIBA 3VI4F 3D3VB 2C3WA 4L8BA 2WBJA 4NN5B 4UINL 4X4ZA 3DK0A 4YEEA 2R4SL 4CMHB 4IYHA 3V0DA 3WEXA 1CXHA 4ANUA 3BKJH 1OCOB 1D7DA 2IU3A 2F5AH 2XWCA 5HHQA 4FS0A 1J9RA 2BP5M 4IGBD 1AQHA 3RBZA 2WXKA 3C60D 2RA1A 3VXRA 2EIZB 4FFWD 5G4MA 1VFOA 2DYSB 3O6LH 1E6JL 3AG1C 1IIKA 1FNGB 3GTTA 4MJIA 5F0MB 4HAMA 3D39E 3NFNB 1AI6A 1AR4A 4UQCA 1IGTB 2UUBB 5F70A 1M71A 2EE3A 3MXWL 4QRQB 4POYA 2J88H 2VOTA 4A66A 1CD1A 2ZYIA 2P06A 4MVBD 1AO7A 5L7XL 3H6AA 2M2DA 4X5XA 5E03A 4O2BB 4K5MA 5LMNO 3WTXA 5ITZA 4X5QA 5B1AB 5B38A 3HNSH 1U2YA 3ZLQC 1TA8A 3B8YA 2H3OA 1H8OA 3HFML 2FIRT 1XNQO 4GKOA 3RWEA 3WS6A 4GG6B 2CRZA 1TTBA 3FU8A 3L3OC 6FABH 3VQMA 4JZGA 1NIDA 4GEJA 3DHUA 4P2OB 3FU9A 2Y5TA 3L5IA 4OF3A 5IBLD 3WFDL 2A9DA 2QQNL 4OFYD 2IXQA 3QAZC 1WN7A 1UB5A 4WNQA 5I73C 3J80N 4MJJA 1CWVA 1P2CB 3QFGA 5LQBH 3CZUB 2ZJSH 4XXDB 2P49B 3BKML 1UH4A 3ES6B 3MRIA 5CSZB 3VFMA 4DAGL 4AEHH 5A2JH 3CQPA 1K4CC 4G5AA 3HB3B 3ZYOA 4WI0A 5EN2B 4GBXC 3NABH 2QTVA 2MNUA 2XHNA 2X2JA 4PJIB 3BZ4A 3CSYB 1VQ5V 4B9JA 2QQKL 2JXMA 1SDDB 3RWRD 1QOKA 4N5ED 4LFCB 5E0QA 3ZHUA 1AGFB 4L8CA 5JIKA 2MCG1 5I1HH 4UZSA 3K06A 2FZ3B 4JO3L 4WJ5A 3VFNA 1X4ZA 1F11A 2AEOA 4G6AD 3VA6A 2QQLL 3D51A 1A3ZA 3EYUL 4N4YB 4CVXB 4LESA 2V37A 3C5ZD 4GQRA 4YZWA 3BXNB 3OXRA 2OJEB 4NO3A 1SMOA 3CZEA 3U11A 4AILC 4DR5B 2B4CH 1HOCA 4U1MB 4QRTB 3BD3A 1CCZA 4YPGA 3TBWA 4WV1A 4TQEL 4PG2C 3QWRD 4NQCA 2LTQB 3FNKA 1H6TA 4L3EA 1W9XA 4I9WD 4RO2A 3ZK0A 4UNVA 3MTXA 3LN5A 1KGYE 5GS0D 2CLZA 2A77H 1JRHH 2IAMB 4OZ4A 1A6WH 5IFJB 1QPXA 3QP3A 1S7WB 4Z0BH 3C09C 2YXYA 5E1IA 2GK0B 3U30B 4ETQA 1X9QA 3WTUA 3GHEH 5DMGD 3K74B 3V0FA 4X9HA 2AI0H 3S37X 3ATEA 1FLRH 2EIMB 2YIAA 4OSUL 3O2DH 3KCYA 2A4EA 1ORQB 4E42B 1MFBH 1SXSA 2BOLA 4CC6A 3FF7A 5C0EA 3GXMA 3LS4L 3SGDH 2XJLA 3KYNB 3Q48A 3OKLA 4GAYA 1C5DB 3BJLA 3L45A 5ITBL 4OXSA 4UT6A 4O2FB 3TNMA 3QFJD 6TAAA 4QCIB 1E5ZA 3SDDA 4F2FA 1NTDA 3MMEB 2WXJA 4OF7A 1JAEA 1ETJA 1RUKH 4LCYB 4XMPH 1E79G 1YY9D 5I6KA 3TPUB 4DW1A 2HLFC 4NQDA 4J7RA 1GHFL 4ZNEA 1OHQA 3MV8B 5C0BD 1HHGA 2V9RA 3EO9L 2P24A 4H8VA 3BRFA 5J89A 4AHCA 1CDIA 3IPFA 4OLZH 4ZO8A 4XOCA 3LVEA 2DJUA 4NIKB 2HVJA 3B2VH 3TS8A 5C0IA 1KWGA 1UURA 3HC2A 1SF9A 3L7EB 5IFAH 3QXDA 3ILQD 1QRNA 4A7VA 5L9DH 1B0GB 1JYVA 4OCYH 1GO3F 2V2XA 5CJ8A 3VI4B 1K85A 3Q8FA 2HKHH 4ZMAT 2OCCB 3B09A 1VF5B 4JDZA 4WY7H 2LJ2A 3BSZH 1G9MH 4LP8A 3MNDA 5JQGA 3MROB 3VFWA 3WL9B 2Z65C 3E8UL 3G71V 1GN4A 1LD9A 3QORA 4AMWA 3D2UB 5KA5A 3HA0A 3NCEB 2YJQA 5CEYB 4GW4A 3BPOB 3N0AA 4NO0D 2VXVL 2JVDA 4BXSV 3TX4A 5FECB 4ZAKA 1NU1H 1T7VA 4FK5C 4YJ3B 1CR9H 4JAUA 3MUJA 5CR1A 1XF2B 3KKYA 4X88A 1RU9H 1N5AB 1WQVT 3DUHA 5GJSL 2DKSA 4PRBB 3ZYIA 4XODA 1A7OH 2FO8A 4QO1B 2EDFA 3W7TA 2WXLA 4G8GD 4PN6A 1JNJA 1MWAA 5T5NF 2K9PA 4R7LA 3ROOB 1JXJA 3N1PC 5LNEA 2V6HA 3K08A 5HDQH 3PCYA 4ODUA 1YNLH 1OV8A 1N59B 5L88H 4W93A 3FHQA 1L4IA 3ULUD 3TF7C 3L3JA 5IM7A 1P4RA 5LA6B 4URTB 3ISYA 2GV9A 4XO9A 4PRPD 2HYMA 3ABUA 5C0AD 4Y9EA 1FNAA 3M7FB 5EBMA 5I16A 3PYCA 2GSIA 4JN1L 3TT3H 3MRFB 1NEUA 4LH6A 2EEDA 4D0DB 4B3RB 4YHHO 2Z7ZA 4LF6B 1P7GA 5D1QC 2YD7A 5CMAA 4XE5B 3QUYA 4J10A 5TE7L 1NDTA 2OJZL 5JPNC 3QIUB 4NYLB 4JUTA 1KCSH 3BWUF 4NOBA 5GRUL 5EEXA 1AOHA 1NJ9B 2B5IB 5KG9A 3MV7A 2ORBH 1N7ML 3VXMD 3HJEA 3WE6A 2Z35B 5IMOA 2B9BA 1HILB 4LDLB 4JG0H 4RIRA 3ZDXF 4N9OB 1SXCA 1CBVH 3AROA 2YUZA 1K5QA 1ZA6B 1XGYH 4P4KB 5BZDB 1PEWA 3RDTD 3R4DA 3DO3A 2YPLA 4PRNA 4XO8A 4AG4L 4AIXA 5D7JB 5IB2A 2LU4A 2VDOL 2ZCLH 2DQEL 2WSSG 3EOBB 4MCYA 4P9ML 2EDOA 5FDWB 3NCJH 4F1SA 5ACZB 2VUYA 2X9ZA 3O11B 3IDIB 3OEEG 1NOFA 4V1DD 3O6KH 4DUZB 1VJSA 3SE6A 2AJVH 2AJXL 2V0AA 2HTLC