1YTFD

Yeast tfiia/tbp/dna complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
100
Chain Sequence
GYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVESVISVDKLRIVACNSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a yeast TFIIA/TBP/DNA complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*GP*TP*AP*TP*GP*TP*AP*TP*AP*TP*AP*AP*AP*AP*C)-3
total genus 25
structure length 100
sequence length 115
ec nomenclature
pdb deposition date 1996-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
D PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ytfD01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 1ytfD02
1YTFD 1YTFC 1NH2D 1NVPC 1RM1B 5IYBO 1RM1C 1NH2C 5IYDO 5IYCO 1NVPD
chains in the Genus database with same CATH superfamily
2FTKA 2E5LB 4ABMA 2A9HA 3W7WA 3OTOO 5GTIZ 1VF7A 1N36B 1D2DA 2YI8A 4DR4B 1VQKV 2ODMA 2EJ7A 4CC5A 5HFMA 2ITDC 1PKXA 4JI1B 3CMAV 3K0GA 1NTMH 3B4SA 1LNQA 3L9DA 4RUFA 4DXWA 2ILMA 2EX3A 1WAZA 5EYPB 5FNVA 1QVGU 4IL6Z 3B2EE 4NTWA 5CMUA 2EULA 3RYFA 4QJFB 2LGWA 5GONB 2UUCB 4LF8B 4LNUA 1K9MW 4R7CA 1UFIA 5LMUB 3AK2A 4Q20A 4LF8O 4CH6A 2F43G 2WA3A 1YF2A 5JQGA 4TQFA 2ZT9B 3F7VC 1U96A 2L35A 2PF4E 3MHSC 2QTSA 3RBZA 2E76B 1BS3A 3D3QA 1BZKA 5KX5B 1VQ6V 1KBHA 3QG5A 3JASA 3OFNG 1WPBA 3AG4C 1Q6HA 5GTHZ 3N2KA 5C8YB 2YS8A 1NS1A 1YI2V 4D7TA 4I9QA 3K5NA 4TWKA 1JR9A 1IVSA 4DR5B 4EB6A 5LYJB 2EIKB 2PGGA 4UB6Z 4NR1A 1LUWA 3QTCA 2DWDC 2ZIMA 2V7QG 1AB3A 4JZ2A 2JS5A 5HFLA 2V4DA 2RCVA 4X8AA 5CA1A 2WLNA 5LMNO 1M1KW 1G4YB 3OMIB 2PI5A 4RUEA 1OJHA 5K1PA 2WLLB 4MVOA 3TXQA 1OCCC 1WP8A 2GTAA 2PTMA 3X2QB 3CCVV 1TVKA 3T2MA 4BWAA 4NTYA 1K8AW 1TAEA 5L3EA 4U3JB 5IY5B 3THOA 2HHHO 2Z0AA 5EZYB 3HKCA 1NVPC 2ATKC 4P9OA 3SPHA 3ABUA 1IBMB 3ZMSA 3W7XA 3EHBB 2DQ3A 4X1YA 2Q7GA 5CA0B 1KUQA 2FL4A 4HAMA 3SYPA 2DYSB 3ZRXA 2UXDB 4G2KA 1KC8W 5LHGA 1Z5WA 5JJNB 4OX9B 2GUZA 2UXDO 1TUBA 5B3SB 2F4VB 4UCOA 3JSNA 4DR5O 3FFQA 1PPJH 5KHKA 4MW8A 1TUEB 2JJ1G 1VMGA 2CGNA 4LH7A 3CS5A 4PD4F 3CRAA 2IW5A 5B1AC 4CC6A 2GHYA 2Z3YA 4X88A 5B1OA 3O9OA 1I94O 2P4VA 1WA8B 1MSWD 1VQ4V 5KMGB 1UJWB 1DGSA 2WLIB 3U10A 1X4TA 3ZEDA 2RMKB 1R6TA 1Y4MA 5DM6V 2FB5A 2CH7A 5D5QA 2HFEC 5C8YA 1AI7A 1MA1A 1AJPA 1WJZA 4K0KB 4JV5B 2F23A 1F4NA 1IXMA 3UQ8A 4I0XA 2HEPA 1QVFU 4ZKIA 2EIJC 3CJHA 3ZRWB 2ZR3A 2YIAA 3MAQA 5LOVB 1OCCB 3X2QC 5CA0A 5B5EZ 3J81N 4MSWC 2R9IA 4JI1O 2XASA 4TUYA 4O4IA 1U97A 3FYIB 1SA0A 4H33A 1VARA 3DC5A 5E79Z 1HNZB 4LF5B 2E74B 1VQ9V 4GYCB 3ZMVA 4F6EA 1XI1A 4J11A 4JI0O 2YXHA 3CYOA 3ETQA 5D5PA 5LMUO 2DOSA 4NKGB 3HKEB 3CXHF 1S0VA 2QJ1A 3UCSC 5BMVB 3LDDA 4BIZA 3K03A 4YHHO 4X1IA 3OM3B 3TJTA 2DWEC 4RQEA 3IC7A 3G67A 4NXNO 2ADQB 1E1QG 4RAIA 2W0XA 2YC0A 4GX0A 2XAFA 1US6A 4DV5B 1Q86W 1FFXA 2VWKA 4FZ0A 1GM9A 4WF9V 2NR5A 1S72V 2R9AA 4QE9A 4BR6A 3OUFA 5C93A 1IBMO 4ZOLB 2VRZA 4NVPA 4YJ3A 4JI8B 1AR4A 4K8XA 1FPOA 3SYOA 1WN7A 2RNBA 5LGNA 3LDEA 1Q82W 4YIPA 4JI3B 3ZHSA 2EINB 2QWQB 3AG2B 1YITV 1QBZA 1SQBH 1XNQO 2Y0PA 2EIJB 4JYBA 2ZR2A 4UVCA 1Q81W 3PN1A 3CPWU 4DYLA 1I7FA 2WLIA 3ABMB 4DR3O 1YJNV 4DR1B 3ASOB 1FD9A 3H9VA 4Z1VA 2WAMA 1H38A 1JQ0A 3J80N 3K57A 1Y76A 4WFAV 1NKDA 4YY3B 3ZIAG 3PJSK 1D5NA 1DTOA 1D5AA 2E3CA 1O9GA 2Y4UA 1GKFA 4FLVA 1PL4A 2CE4A 4UUJC 2O57A 2IH1C 3T1YB 3JSLA 2XAGA 1R3KC 4BW9A 2MW2B 3L75H 3WB0A 3B40A 4XBFA 3B8NA 2CTPA 4FMTA 4LCUC 5EK0A 2ZIOA 4J9ZB 4NXMB 3OGIB 1MG1A 4GX2A 4O4IB 4BIUA 5AG2A 1Q90D 4FFBB 1URFA 2K9PA 1K97A 2Y69C 3G71V 3CX5F 4WCEV 4DK0A 3OR6C 3OEHG 2UUCO 1HNXO 1F23A 3W7UA 4ZI7B 3RYIB 4GT1A 3ASOC 1EM1A 5J2TB 4DUZB 3WB1A 2HVKC 2ZNIA 4IT5A 1MOFA 4DR7B 5IYZB 1VEWA 4EFEA 2CH7B 3ZMTA 2XAQA 1WB8A 4JZGA 3DSQA 4O4LA 3H1IH 1XREA 1YDXA 4YXWG 4K35A 3SPIA 1S3JA 4TQDA 2L6LA 3RT3C 3E83A 5KHHA 5IWAO 1GK9A 3GVMA 2JEXA 3BY6A 3DXRB 4K0KO 5B1NA 2EINC 2UXCB 3IC9A 4JI6O 3NXSA 3SJCC 1EZVH 4F6RA 1MZFA 1M5IA 1FJGO 2OWOA 4TV8A 3I55V 2JIZG 2H8PC 1XMQB 4TV9A 2CDYA 4CZZA 1TUBB 4NB5A 4FVMA 4LBEC 1M93A 3AEIA 4B7KA 4B3TO 5EC2C 1FS0G 3CRQA 3AG4B 2EIKC 2JEUA 1OCOC 3T1YO 1ZLZA 5IE9A 1OV9A 2ZE8A 4DV1O 2Q5ZA 1HNWB 1NR1A 3DGEA 2KSDA 4DO2A 3SJQC 2PUSA 1KU9A 3ZHVA 1B6QA 1XL6A 1OCZC 3K08A 5H6QA 2UXNA 4DR1O 2PYLA 5EBWC 1I5YA 5DEDA 4DW1A 2RDCA 3A0BZ 3TCUA 3JALA 1RFYA 5EIBD 1PV0A 4GKJB 4DV1B 1XILA 1SESA 1NU1H 2R72A 4K3AA 5L3FA 3I5DA 3OR7C 5DN6G 1F4MA 1IZ3A 3RYCA 4MTGA 3HKEA 4UCSA 3MDSA 4Z1MG 3E8FA 3ABMC 1IBLB 3O65A 3CHXA 3K58A 4DV3B 4GUNA 5JCOA 2WLMA 2BOCC 3WU2Z 1AP5A 2PZSA 1IURA 4JI6B 4I9WA 3FAVB 4MVMA 4N23A 1VQOV 5IWAB 2Y48A 5CB4B 5KHIA 2Y4TA 2DW4A 4O4HB 2BTQB 3FB7C 2C2AA 1SC5B 1VQ7V 1EN4A 1B04A 3WG7C 4ZOLA 4MW3A 4UB8Z 4QPKA 4GX1A 2QM8A 1CP9A 3P3PA 3G6EV 2CTRA 3JAWA 3I56V 4FIPC 1QU7A 3B77A 3QO7A 4HBNA 5L3BA 2P67A 3ZBHA 5EIBC 3IGAC 2Q0AA 4LF9O 4DV3O 5A9GA 1SQVH 3JARB 4KXRA 4MS2A 1WA8A 4O4HA 3E89A 1N32B 2P4KA 2Q68A 1AJQA 4E2LA 2N04A 5LP6A 4YJ3B 3UT5B 1NI8A 2IU3A 1WPXA 5J2UA 3OEEG 3DXRA 1RM1B 3G4SV 3JD0A 3K04A 1W0JG 1EBOA 4J41A 1GRJA 2X7RB 1SF9A 3BFRA 4UVBA 2VS0A 1OHHG 3SGIA 4CS4A 2YEVB 1XUQA 2HJFC 2B1IA 4X65B 3RGBA 4XDJA 1NH2D 5GW7A 2WLJA 1MZEA 1K4DC 5FL7G 2H94A 4AI8A 1VQPV 3QO5A 2ZM6O 3AG3C 4LFAO 5CBHA 1BE3H 2F95B 3KCYA 1G8MA 3IFXA 3BA8A 5KLVH 2Q73A 2VQEB 4KHPO 2ZE7A 1VQLV 5E1AC 2Q67A 5LHIA 2P5OA 3JALB 1DLBA 4H0LB 3CRMA 4U3FH 3KKYA 2ZNJA 4LF4O 3ZS8C 2GV9A 4J7JA 3U0ZA 1N34O 3LNMB 2VQEO 2XHBA 1FKAO 2WLHA 3CRCA 1Y74B 1V54C 3AK1A 4LP8A 1CEZA 2ZXWC 3HKDB 2QM7A 3E8GA 3C3TA 1Q6UA 2V1DA 4DV5O 1GN2A 1XMOO 2ZE5A 4I7ZB 5FLXN 3BHPA 1GN6A 3OMAB 5IJ0A 4I4TA 1V9PA 1XQ8A 1AI5A 1ENVA 3E22A 2LW7A 2EIMB 1ZWIC 4DR7O 5LGTA 3UT5A 2A79B 4QIWF 1NZ6A 1VF6A 2XAHA 4ZBMA 4FPPA 1SS3A 4OPAA 1YEWA 1ZAUA 4FLUA 1EZJA 3ZCCA 1K34A 3C3SA 5LOVA 4B3TB 1KP3A 5JH7A 5JVDA 4KP4A 4UVAA 1YIJV 3ASNB 4LFCO 2JK5C 4O2AB 5IT9N 1L0LH 1AROP 4LFCB 3WB2A 1OCRC 4LF5O 2AXTZ 2YI9A 1H2NA 1OCOB 3E8BA 4B3MO 5J2UB 3TETA 3TK1A 2W6JG 3QO8A 3D36A 4F4LA 2X6AA 3P30A 2CK3G 4DV4O 1OCRB 1H2SB 2XOKG 1AILA 4C7UA 4TV9B 4TOIA 3FYEB 3L72H 5IDJA 1LR1A 4MVZA 3H1HH 4IIJB 4L87A 4DR4O 3CSXA 1QLEB 3LSSA 1HNXB 2R9RB 3EVKA 2VQFB 3QVNA 1N4CA 3CC2V 1XHZA 1N34B 1IX9A 1XNQB 4H37A 4FLTA 3N2GA 1E1RG 4E4EA 4ICGA 1FAFA 1AJNA 4FM2A 4ASUG 5JVDB 4JI7B 4BAYA 1XL4A 3JATB 4DV2O 2JJ2G 4MVRA 1S5HC 4H44B 3GWKC 2QM4A 3SPGA 4ZI7A 1XNRO 1JOYA 4HZ3A 3BRCA 4W4KA 4YY3O 1THZA 4LFAB 4B7EA 2IJJA 5CA3A 3EFFK 4YJ2B 1SQGA 3AG7A 1P7BA 2DYRC 2YIBD 1BHBA 4MVQA 2YXLA 2DE0X 2FMLA 5BR8B 2F66C 4PA4A 4NXNB 3D8CA 4WFHA 2M6YA 4PV1B 4I50B 4K8ZA 3AG1B 1EFRG 2OCCC 1B06A 1YTFB 2OYQA 2FKXA 1OZ0A 1H8EG 2HHHB 3EXAA 3ZN1A 3OGCC 1MABG 1Q43A 3CD6V 2ZINA 5IYCO 2LJ2A 3U11A 1ZTEA 3ABTA 4D6TH 2X6BA 1SQPH 1W2BU 1SQQH 4J80A 1I08A 4JI8O 4JF3A 5CB4A 2YIDA 3B8MA 2D2CB 5LGUA 2Q7EA 1VF6C 5KX5A 4TV8B 1Q5OA 2KB1A 5LL6Y 3SPCA 1PP9H 4J7ZA 3S3WA 4JI5B 1ORQC 5LA6B 2DQ0A 2QKSA 2LW1A 1R73A 3APQA 1EN6A 1QQCA 3LSUA 1FXKB 1GMGA 2A7WA 3E2EA 1FFTB 1KKDA 3ZN0A 2XAJA 2G38A 4N21A 1QLNA 5CBGA 4LR3A 1IXBA 1XHXA 3AG3B 3CWBH 2EJRA 3VBBA 4JAVA 4DK1A 4WFFA 1QHTA 3J7AU 3WFVA 5FPOA 2EIMC 3GWOA 1TVKB 2X6CA 4MVUA 2HG5C 5JQGB 3ZMZA 3OW2U 2HJDA 4L8JA 4PA7A 1S5LZ 4PDMA 3RYFB 4NXMO 2DYRB 4X64B 4X1IB 4FZ1A 1K3EA 3B09A 3FKSG 2D3OW 1WLEA 3H1LH 2F1MA 1Z2GA 5L3DA 2ZKOA 3E22B 1YJWV 4GCZA 4OXSA 2KG7A 4DR6O 3KG2A 4GKJO 4JI4B 2ZCEA 4GLXA 1GH6A 2QWRB 1XBLA 2ZDIC 5H2FZ 2XUMA 4LC1A 5LYJA 4DV4B 1VQ8V 1ZX3A 4MTXA 1S5JA 2QE7G 4PJ0Z 1IDSA 1BQZA 3JYCA 2PY5A 2QTOA 3R65A 4IIJA 2HKOA 4I50A 1GTOA 4FFKA 4YIOA 5CN0A 4H13B 3K06A 3LNNA 3JATA 4JYCA 1A32A 3Q4HA 4IYIA 4FM0A 1YVWA 3OMNB 5KHJA 1N8RW 5JWPA 2CTQA 3C90A 2R70A 4X66B 1F7YA 5H9CA 4I4TB 2UUBO 2YDEA 2OIEA 1N33O 4CBCA 5H6RA 3MHHC 2DJVA 3ZHUA 1J5EO 5K1XA 4DV0B 4X1YB 4NTXA 3E35A 5KAIZ 4JI2O 4DV6B 1SA0B 5EZYA 1XMQO 3BABA 4GKKB 3CCSV 2ETNA 4X9QA 1FJGB 4CH4A 1TGOA 1NT2B 3ZHRA 3HKBA 3JD3A 3M99B 5JJJB 4KFMA 1IBKO 4X1KB 3BA9A 1JX9A 1ZUQA 1SRYA 3VOUA 1M57C 5B1BB 1Q7YW 2NNUA 1SZXA 4TSFG 5JH7B 4FLWA 5LBQA 3ZHQA 1XEQA 4DR6B 4O2BA 2VWJA 1R3JC 4FLZA 4HNAA 4DV6O 1M57B 4LF4B 3S3XA 1GM8A 3H01A 4DV0O 2BSKB 3OE7G 3LSQA 2AGAA 1Y6XA 4O4LB 3FX7A 4WFEA 2LFRA 2UU9B 4PI0A 1HW7A 3RN4A 4KHPB 1JVMA 4JAUA 4PA9A 3JD1A 1L8DA 1K4CC 4X62O 4QNHB 4MTOA 3M7MX 2IJIA 1Q3EA 4A5UB 2Q69A 4J10A 3CMEV 3OUSA 3H1KH 3G80A 4O2AA 3SYQA 1VIBA 4RWUA 3JAMN 3ZRWA 3CEIA 1NTZH 5H5NA 4JI4O 4O4JA 3HKBB 1K92A 1W0KG 3SPJA 1AR5A 3AG2C 2Q9LA 4WFGA 4X1KA 3ETEA 1BHAA 4XDLA 4B08A 4G28B 4GX5A 2W0FC 1KD1W 1CPYA 3CCRV 2X0LA 2OCCB 2KQXA 1N0JA 4MVSA 1N32O 3AK3A 2WLKA 2P90A 2Q8VA 3F7YC 1T5EA 2FYUH 2UU9O 4ZHQA 4I5SA 1BGYH 1M90W 3IAYA 1Y76B 2EILC 4UCVA 2BSKA 1ROPA 2BTOA 4TT3G 2IH3C 2ITCC 2E75B 4O2BB 3K5LA 1SZTA 3VQWA 1HR0B 1DK1A 1HDJA 4TUYB 1ZSPA 1S77D 1G1XB 2AHZA 2UUAO 1H8HG 2QSAA 3L73H 2F4VO 5IY5C 2HP8A 3HPLC 1WNSA 3OT7A 3FB5C 4EB6B 2F93B 4AHCA 2IBZH 3CP1A 3OTOB 2OT5A 1KECA 3HKDA 4GKKO 3N2KB 4JAAA 4DV7B 4YHHB 4B3SO 1YTFD 4DV2B 2RQ6A 1YXBA 2LGQA 2QDOA 3CXCU 3CJHB 1V55C 3KCXA 1OCZB 2WPDG 4LFBO 4NYKA 2YXYA 3GB7C 2BTQA 3K3WA 1RSOB 2GDSA 3KZIZ 2N74A 4BW5A 3CC4V 4EKWA 3SJAC 1YSCA 3K5OA 4G27B 5ITZB 3JAWB 2AW9A 1RM1C 1JJOA 5B66Z 3RFRA 1K5SA 3DTUB 3MD0A 1HNZO 2ADPA 4AQYO 3ZRVA 4JTCB 1G6UA 2CTWA 3ABLC 1F51A 2QWOB 2JVDA 3E86A 1P4RA 1WP7A 1BSMA 3K9AA 4KUMA 4JPRA 4JTDB 4W4LA 2EBOA 3JASB 4FK5C 3K79A 3NR7A 2GSMB 3OD4A 4HNAB 1R3LC 4LF6B 1Y66A 4DUZO 1EN5A 4B3MB 3BCCH 5B3SC 3SDLA 1H2LA 4HYOA 4PA6A 3P3NA 4X64O 1KQSU 1Y67A 2LO1A 3UKMA 2KKWA 3ML0A 2IJKA 5EC1C 1K7DA 1NJIW 1LUVA 2EZOA 1FXKC 1AR1B 4UV8A 2UXBO 2LFSA 3L74H 1NVPB 3ABLB 2DN9A 2LP7A 2CUGA 3ETDA 2DYSC 5J2TA 1K5QA 3K9SA 1JMKC 4J42A 1HWYA 3ZRSA 4LF6O 3ICXA 1VP7A 4DR2B 2M7WA 1RPRA 3OAAG 1GAXA 3FB6C 2OIGA 1PD3A 4O4JB 5LA6A 2QA4V 4RQFA 5IJ9B 2WSSG 4CH5A 4OX9O 3BAAA 4JYYA 4IHJA 4JI5O 4DR3B 1N0NA 2LQTA 1H2MA 4FLYA 4B3RO 2P22C 4GZRB 3T4DA 4PELA 3CCJV 1JFFB 4R8CA 2HR3A 5CA1B 1L1FA 2ZDIA 2JRIA 4MT8A 4U7OA 1BQ0A 1K33A 5EBMC 2Q4PA 2PI4A 1E79G 3T1CA 4FLXA 1J5EB 2HLDG 4CS3A 5IYZA 4X20B 4PDRA 2JDIG 4DUYO 1FXVA 4X66O 2XTAA 2A3QA 1COWG 3UO3A 3A8TA 2YICA 2RJZA 4AILC 3W7TA 4U3JA 5F2VO 1NTKH 1M56B 2Y69B 1SETA 4UCUA 5LP6B 1KB9F 2ZM6B 4JASA 2IM9A 3JD4A 3ETGA 3Q4HB 1NQTA 3JARA 3T1HO 4X65O 5B1AB 3FAVA 1GO3F 3ZHTA 2K1EA 2DMXA 1BCCH 1JA8A 3HKCB 4PA3A 4JI2B 4JYAB 5IJ0B 3W7SA 4LFBB 4WBNA 1N33B 3A2FA 4UCTA 3QNEA 5FPRA 3HR0A 3RYHA 1FYJA 3JAKA 4QPJA 1RP3B 4LF7O 1W59A 2ZXWB 4J7KA 3VQYA 5L3GA 1NR7A 1QNMA 4DV7O 2VQFO 3RYCB 3VQXA 3T4ZA 5IYBO 2NLJC 3G6BA 2QKAA 3BEHA 1MSDA 3SYCA 1Q6IA 5KA6A 2EILB 3UM7A 4X89A 2MK3A 3APOA 4FM1A 1FXHA 4J9YB 1Z5VA 1DF4A 2P06A 3E8HA 3JCUZ 1R1BA 3K5MA 3CB2A 1XDCA 2A0LA 2AZ2A 3RVYA 1HP8A 1R6NA 1YZBA 4XDKA 2GTSA 3ABKB 3M8AA 1VQ5V 2XNDG 3ASNC 2UXXA 4PDLA 3CRRA 2KG7B 1VQNV 3RWRD 2B5UA 1Y74A 3RYIA 4X62B 2UXBB 5KMGA 2EZPA 1Q8IA 2N05A 2YSUB 5KUMA 4OPHA 5IYDO 2PYJA 2YUAA 4LF7B 4X20A 2BOBC 3A0RA 5B1BC 5BZBA 2Y0IA 1BL8A 2OCHA 1UPGA 4F6RB 5ITZA 2B9ZA 4UCRA 4JYAO 3FB8C 1H2KA 4FJCC 3SYAA 3D3IA 2Q0OC 1AI6A 3K0DA 4RO2A 3P32A 1KKCA 3CCLV 1ZL8B 5BY1A 2IU0A 1P7GA 1JJ2U 1XMOB 4JV5O 5J9PC 1O9HA 4IGGA 1YHQV 1H2GA 2JS3A 1N36O 5EBLC 2RN9A 1BMFG 2JGDA 3FD9A 3STZC 2CAZC 1XNRB 4Z2WA 1MNGA 2Q6AA 2E5LO 5BMVA 1FFXB 1X59A 3CC7V 4R50A 2QWNB 3L71H 5KUKA 1IBLO 4P30A 3VQVA 1R6KA 4DUYB 5LXTB 3ZMUA 1PL0A 1B3QA 4I0XB 1NBMG 3RW0A 3DC6A 5KAFZ 3HB3B 2IJHA 1GN3A 4R6ZA 1VF5B 5EYPA 5FNVB 2YIBA 4IYHA 1WB7A 2QGNA 2ZQMA 4QGPA 2JGDB 5KHGA 1XOUA 5A2QN 1L0NH 5BR8O 3T1HB 4PI2A 2UXCO 2ZE6A 1I0HA 1YJ9V 4ZHQB 3LUTB 4CS2A 1JPXA 4I55A 2JGUA 4MTFA 4CH3A 4QE7A 1AP6A 4UV9A 2UUAB 1HNWO 3CE2A 4PHZA 5BXZA 1J95A 5JCOC 4JI7O 4Q6GA 2AZ0A 1P49A 1M9NA 4ZIBA 1SQXH 5IJ9A 1MMMA 4LNUB 5LHHA 2W6IG 4I55B 4LF9B 1TA8A 3CCUV 4LWSA 3L70H 4JI0B 1NVPD 2BCCH 4WBNB 4LH6A 4B3RB 3TXSA 1VQMV 5LMNB 3F5TA 4DRXB 3CCEV 4D7SA 3CCMV 4U7NA 1SKVA 2Z5UA 1NH2B 1V54B 4LWSB 2CGOA 3STLC 3OTFA 3JD2A 3QF7A 1KYOF 2BE3A 1M4UA 1ZL8A 4WFBV 4YJ2A 1GN4A 3K59A 1KP2A 2GUZB 1JFFA 4JGSA 2AHYA 4FFBA 1BT8A 4DR2O 2WLLA 2ZD9A 1V55B 2QR4A 5GONA 1PNKA 2B1GA 1YCIA 3F5WC 3SR2C 1K73W 1YTFC 4BIOA 5KA5A 1SERA 3ABKC 3ZX6A 1DF5A 2OTJV 3D36C 4PDVA 4UXNA 5CBFA 1AI4A 3AG1C 3CCQV 3RYHB 3JAKB 4P2ZA 4UFZA 3JCZA 2WA4A 2NN4A 3H1JH 1QR8A 3N27A 1NH2C 4JI3O 2QKCA 5DECA 1I94B 2OTLV 1RPOA 4DW0A 2HVJC 4KL1A 1S76D 3LDCA 4JTAB 5LP6C 5TISZ 4B3SB 1GM7A 3TGUH 4IHJB 1CXZB 2P6JA 1QCEA 1I5XA 2A06H 5L3CA 1PNLA 1KMIZ 3BPZA 1PM9A 1AVMA 2GBOA 3BVOA 4P9PA 1PNMA 1SQFA 1RSOA 2WWWA 4OGQB 2P7TC 2H3OA 1IBKB 4AQYB 3R66A 3SJBC 5LXTA 5JJEB 1P84F 3WG7B 3A0HZ 2ARHA 2QWPB 4DRXA 3IJ4A 1QLEC 1R3IC 1HR0O 4EFBA 1JCHA 1FXKA 1QR9A 4EEQA 2YEVA 3N2GB 3UO2A 2XT9A 2UUBB 2QEXV 3RVZA 2Q7HA 1M56C 3ZJZA
chains in the Genus database with same CATH topology
2FTKA 3E83A 2WSSG 1GK9A 4JF3A 2JEXA 3BY6A 3B8MA 5B1NA 2A9HA 2EINC 3W7WA 5LGUA 3NXSA 2KB1A 3I55V 3SPCA 3T4DA 2JIZG 4PELA 2H8PC 3CCJV 1VQKV 4CZZA 4R8CA 1ORQC 2HR3A 1L1FA 2ZDIA 2DQ0A 2QKSA 5HFMA 4MT8A 4LBEC 1R73A 2ITDC 1PKXA 4U7OA 3CMAV 1K33A 3AEIA 5EBMC 2PI4A 1E79G 5EC2C 3K0GA 3T1CA 2HLDG 1FXKB 1GMGA 1FS0G 1LNQA 4PDRA 3E2EA 3AG4B 2JDIG 1FFTB 1KKDA 3ZN0A 2XAJA 2EIKC 4RUFA 2JEUA 1FXVA 4N21A 1QLNA 1OCOC 5CBGA 1COWG 4DXWA 3AG3B 2EJRA 3VBBA 1QVGU 5CMUA 1NR1A 3W7TA 4JAVA 3DGEA 4DO2A 4QJFB 3SJQC 4WFFA 1M56B 2Y69B 1SETA 1B6QA 1XL6A 1OCZC 3WFVA 4JASA 1K9MW 2EIMC 3GWOA 4R7CA 2X6CA 4MVUA 3K08A 3JD4A 3ETGA 2HG5C 2UXNA 5H6QA 4Q20A 3ZMZA 2F43G 3OW2U 1NQTA 5EBWC 1I5YA 4PA7A 5B1AB 4PDMA 2DYRB 3TCUA 1GO3F 3F7VC 3MHSC 1K3EA 3FKSG 3RBZA 2D3OW 2K1EA 1VQ6V 1WLEA 1SESA 3OFNG 3AG4C 5L3DA 5L3FA 1YJWV 3OR7C 4GCZA 4OXSA 4PA3A 1YI2V 5DN6G 1F4MA 3KG2A 3W7SA 4MTGA 4TWKA 2ZDIC 3QNEA 2EIKB 4LC1A 4Z1MG 3E8FA 1VQ8V 3ABMC 4MTXA 4QPJA 2DWDC 2QE7G 2ZXWB 2V7QG 5L3GA 1NR7A 3JYCA 5HFLA 2QTOA 3R65A 2WLMA 2BOCC 4X8AA 3T4ZA 2HKOA 2WLNA 1M1KW 2PI5A 1G4YB 1GTOA 3OMIB 4RUEA 5IYBO 2NLJC 4I9WA 5CN0A 3K06A 2WLLB 3BEHA 4MVMA 4N23A 4MVOA 3SYCA 5KA6A 2EILB 3UM7A 1OCCC 4X89A 2MK3A 3X2QB 4JYCA 1VQOV 2Y48A 1N8RW 3OMNB 1FXHA 4J9YB 1DF4A 3E8HA 3CCVV 3T2MA 2A0LA 5H9CA 2DW4A 1K8AW 3RVYA 4CBCA 5H6RA 3FB7C 3MHHC 1R6NA 2C2AA 5L3EA 1VQ7V 4XDKA 3ABKB 3E35A 5IY5B 1VQ5V 2XNDG 3WG7C 3ASNC 2UXXA 4PDLA 4MW3A 1NVPC 2ATKC 4P9OA 3SPHA 3ABUA 4QPKA 4GX1A 2QM8A 1CP9A 3G6EV 3CCSV 1VQNV 3I56V 4FIPC 3ZMSA 2B5UA 3W7XA 3B77A 2DQ3A 3EHBB 3QO7A 5L3BA 3JD3A 4HAMA 3SYPA 2DYSB 3M99B 2P67A 3ZRXA 4KFMA 3IGAC 2EZPA 4G2KA 1KC8W 5LHGA 2YSUB 5KUMA 5IYDO 4MS2A 5B3SB 2BOBC 3A0RA 1JX9A 3E89A 5B1BC 1SRYA 3VOUA 1M57C 5B1BB 2Q68A 1Q7YW 2NNUA 5BZBA 4TSFG 1AJQA 1BL8A 4E2LA 4MW8A 1TUEB 2JJ1G 5LBQA 2IW5A 3FB8C 5B1AC 1R3JC 2IU3A 1WPXA 2GHYA 3OEEG 2Z3YA 4FJCC 1RM1B 4X88A 1M57B 5B1OA 3SYAA 3D3IA 3G4SV 3JD0A 1AI6A 1GM8A 3H01A 3K0DA 3K04A 1W0JG 1EBOA 4RO2A 3OE7G 3LSQA 2X7RB 1MSWD 3P32A 4UVBA 1OHHG 1VQ4V 2YEVB 3CCLV 2HJFC 4WFEA 2B1IA 2LFRA 4XDJA 2IU0A 1NH2D 1JJ2U 5GW7A 1UJWB 5J9PC 2WLJA 1K4DC 2WLIB 5FL7G 1JVMA 1YHQV 2H94A 4JAUA 1VQPV 4PA9A 1H2GA 3QO5A 3JD1A 1K4CC 1Y4MA 4QNHB 3AG3C 5EBLC 5DM6V 5CBHA 4MTOA 1BMFG 2HFEC 2IJIA 1AI7A 1G8MA 3IFXA 3STZC 2Q69A 1AJPA 2Q6AA 3CMEV 3OUSA 3CC7V 4R50A 1VQLV 5E1AC 2Q67A 5LHIA 5KUKA 1F4NA 1IXMA 1DLBA 4P30A 3SYQA 1R6KA 3ZRWA 1QVFU 4ZKIA 2EIJC 3ZMUA 1PL0A 3ZRWB 2ZR3A 1NBMG 3RW0A 1OCCB 3HB3B 3X2QC 2IJHA 1K92A 2R9IA 4MSWC 1W0KG 4R6ZA 3SPJA 2XASA 4WFGA 3AG2C 3ETEA 1BHAA 4XDLA 3FYIB 4H33A 3LNMB 4G28B 4GX5A 2W0FC 1KD1W 2ZQMA 1CPYA 2WLHA 3CCRV 1V54C 2X0LA 4LP8A 1CEZA 1VQ9V 2OCCB 3ZMVA 4MVSA 2ZXWC 2QM7A 3E8GA 2WLKA 2P90A 2V1DA 3CYOA 1YJ9V 3F7YC 3LUTB 1JPXA 4MTFA 4I5SA 1M90W 4QE7A 2EILC 3OMAB 1ROPA 4UV9A 1AI5A 1ENVA 4TT3G 2IH3C 1S0VA 2EIMB 2ITCC 1ZWIC 5LGTA 2A79B 1J95A 4QIWF 1SZTA 3LDDA 4BIZA 3K03A 2XAHA 3OM3B 1S77D 4ZBMA 4FPPA 2DWEC 2AHZA 4RQEA 3IC7A 1H8HG 1EZJA 3ZCCA 1K34A 1KP3A 4KP4A 4UVAA 1YIJV 1E1QG 1M9NA 3ASNB 4RAIA 5LHHA 2JK5C 5IY5C 2W6IG 4GX0A 2XAFA 1AROP 3CCUV 1Q86W 3HPLC 3FB5C 1NVPD 1GM9A 1OCRC 4WF9V 3CP1A 1VQMV 1S72V 2OT5A 4QE9A 1KECA 1OCOB 3CCEV 3E8BA 3OUFA 5C93A 3TETA 3CCMV 4U7NA 2W6JG 3TK1A 3QO8A 2Z5UA 3D36A 1NH2B 1V54B 4F4LA 3STLC 2X6AA 1YTFD 3P30A 2CK3G 3JD2A 3SYOA 1OCRB 5LGNA 3CXCU 3LDEA 1Q82W 2XOKG 4WFBV 1V55C 1OCZB 2WPDG 2EINB 3AG2B 3GB7C 1YITV 3K3WA 1KP2A 1QBZA 4JGSA 2AHYA 3FYEB 2WLLA 2ZD9A 1V55B 4BW5A 2EIJB 5IDJA 4JYBA 3CC4V 2ZR2A 4UVCA 4MVZA 1Q81W 1PNKA 4EKWA 2B1GA 4L87A 3F5WC 1YSCA 1K73W 4G27B 1YTFC 5KA5A 3CPWU 1SERA 1RM1C 1QLEB 3ABKC 3LSSA 1DF5A 1K5SA 3DTUB 2OTJV 3MD0A 2WLIA 2R9RB 3ABMB 4PDVA 4UXNA 5CBFA 1YJNV 3ASOB 1AI4A 3AG1C 3CCQV 3CC2V 3ZRVA 4JTCB 4P2ZA 2WAMA 4H37A 1H38A 1JQ0A 3JCZA 1E1RG 3ABLC 1F51A 3E86A 4WFAV 1NKDA 1AJNA 3ZIAG 3PJSK 1P4RA 1QR8A 1DTOA 3K9AA 4KUMA 4ASUG 1NH2C 4BAYA 4JPRA 4JTDB 2OTLV 1RPOA 2EBOA 1GKFA 1XL4A 2HVJC 1S76D 4FK5C 3K79A 4UUJC 2IH1C 3LDCA 4JTAB 2XAGA 2JJ2G 1R3KC 4MVRA 2GSMB 1S5HC 1GM7A 1R3LC 3SPGA 1Y66A 1JOYA 4LCUC 3B8NA 2P6JA 4FMTA 1QCEA 4HZ3A 5EK0A 4XBFA 5B3SC 4HYOA 1I5XA 4PA6A 5L3CA 1PNLA 1THZA 4J9ZB 1KQSU 1MG1A 4GX2A 4P9PA 1PNMA 2IJJA 5CA3A 3EFFK 4BIUA 2WWWA 3UKMA 3ML0A 2IJKA 2Y69C 1K97A 5EC1C 1K7DA 1NJIW 1P7BA 2DYRC 4WCEV 3G71V 1BHBA 2P7TC 4MVQA 2EZOA 3OR6C 3OEHG 1FXKC 1AR1B 4UV8A 2LFSA 1F23A 1W2BU 1NVPB 3W7UA 3ABLB 4PA4A 2LP7A 4GT1A 3ASOC 3WG7B 3ETDA 4WFHA 2DYSC 1K5QA 3AG1B 1HWYA 2HVKC 1EFRG 1QLEC 1R3IC 3ZRSA 2OCCC 1YTFB 1MOFA 1JCHA 1OZ0A 1H8EG 1FXKA 3ZN1A 2M7WA 3OGCC 1RPRA 1MABG 1QR9A 3OAAG 3ZMTA 2XAQA 3FB6C 3CD6V 2YEVA 5IYCO 4YXWG 1PD3A 2QEXV 3RVZA 3SPIA 1M56C 1S3JA 3ABTA 3ZJZA 2QA4V 4RQFA 2X6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTF D;  1YTF C;  1NH2 D;  1NVP C;  1RM1 B;  5IYB O;  1RM1 C;  1NH2 C;  5IYD O;  5IYC O;  1NVP D; 
#chains in the Genus database with same CATH topology
 2FTK A;  2E5L B;  4ABM A;  2A9H A;  3W7W A;  3OTO O;  5GTI Z;  1VF7 A;  1N36 B;  1D2D A;  2YI8 A;  4DR4 B;  1VQK V;  2ODM A;  2EJ7 A;  4CC5 A;  5HFM A;  2ITD C;  1PKX A;  4JI1 B;  3CMA V;  3K0G A;  1NTM H;  3B4S A;  1LNQ A;  3L9D A;  4RUF A;  4DXW A;  2ILM A;  2EX3 A;  1WAZ A;  5EYP B;  5FNV A;  1QVG U;  4IL6 Z;  3B2E E;  4NTW A;  5CMU A;  2EUL A;  3RYF A;  4QJF B;  2LGW A;  5GON B;  2UUC B;  4LF8 B;  4LNU A;  1K9M W;  4R7C A;  1UFI A;  5LMU B;  3AK2 A;  4Q20 A;  4LF8 O;  4CH6 A;  2F43 G;  2WA3 A;  1YF2 A;  5JQG A;  4TQF A;  2ZT9 B;  3F7V C;  1U96 A;  2L35 A;  2PF4 E;  3MHS C;  2QTS A;  3RBZ A;  2E76 B;  1BS3 A;  3D3Q A;  1BZK A;  5KX5 B;  1VQ6 V;  1KBH A;  3QG5 A;  3JAS A;  3OFN G;  1WPB A;  3AG4 C;  1Q6H A;  5GTH Z;  3N2K A;  5C8Y B;  2YS8 A;  1NS1 A;  1YI2 V;  4D7T A;  4I9Q A;  3K5N A;  4TWK A;  1JR9 A;  1IVS A;  4DR5 B;  4EB6 A;  5LYJ B;  2EIK B;  2PGG A;  4UB6 Z;  4NR1 A;  1LUW A;  3QTC A;  2DWD C;  2ZIM A;  2V7Q G;  1AB3 A;  4JZ2 A;  2JS5 A;  5HFL A;  2V4D A;  2RCV A;  4X8A A;  5CA1 A;  2WLN A;  5LMN O;  1M1K W;  1G4Y B;  3OMI B;  2PI5 A;  4RUE A;  1OJH A;  5K1P A;  2WLL B;  4MVO A;  3TXQ A;  1OCC C;  1WP8 A;  2GTA A;  2PTM A;  3X2Q B;  3CCV V;  1TVK A;  3T2M A;  4BWA A;  4NTY A;  1K8A W;  1TAE A;  5L3E A;  4U3J B;  5IY5 B;  3THO A;  2HHH O;  2Z0A A;  5EZY B;  3HKC A;  1NVP C;  2ATK C;  4P9O A;  3SPH A;  3ABU A;  1IBM B;  3ZMS A;  3W7X A;  3EHB B;  2DQ3 A;  4X1Y A;  2Q7G A;  5CA0 B;  1KUQ A;  2FL4 A;  4HAM A;  3SYP A;  2DYS B;  3ZRX A;  2UXD B;  4G2K A;  1KC8 W;  5LHG A;  1Z5W A;  5JJN B;  4OX9 B;  2GUZ A;  2UXD O;  1TUB A;  5B3S B;  2F4V B;  4UCO A;  3JSN A;  4DR5 O;  3FFQ A;  1PPJ H;  5KHK A;  4MW8 A;  1TUE B;  2JJ1 G;  1VMG A;  2CGN A;  4LH7 A;  3CS5 A;  4PD4 F;  3CRA A;  2IW5 A;  5B1A C;  4CC6 A;  2GHY A;  2Z3Y A;  4X88 A;  5B1O A;  3O9O A;  1I94 O;  2P4V A;  1WA8 B;  1MSW D;  1VQ4 V;  5KMG B;  1UJW B;  1DGS A;  2WLI B;  3U10 A;  1X4T A;  3ZED A;  2RMK B;  1R6T A;  1Y4M A;  5DM6 V;  2FB5 A;  2CH7 A;  5D5Q A;  2HFE C;  5C8Y A;  1AI7 A;  1MA1 A;  1AJP A;  1WJZ A;  4K0K B;  4JV5 B;  2F23 A;  1F4N A;  1IXM A;  3UQ8 A;  4I0X A;  2HEP A;  1QVF U;  4ZKI A;  2EIJ C;  3CJH A;  3ZRW B;  2ZR3 A;  2YIA A;  3MAQ A;  5LOV B;  1OCC B;  3X2Q C;  5CA0 A;  5B5E Z;  3J81 N;  4MSW C;  2R9I A;  4JI1 O;  2XAS A;  4TUY A;  4O4I A;  1U97 A;  3FYI B;  1SA0 A;  4H33 A;  1VAR A;  3DC5 A;  5E79 Z;  1HNZ B;  4LF5 B;  2E74 B;  1VQ9 V;  4GYC B;  3ZMV A;  4F6E A;  1XI1 A;  4J11 A;  4JI0 O;  2YXH A;  3CYO A;  3ETQ A;  5D5P A;  5LMU O;  2DOS A;  4NKG B;  3HKE B;  3CXH F;  1S0V A;  2QJ1 A;  3UCS C;  5BMV B;  3LDD A;  4BIZ A;  3K03 A;  4YHH O;  4X1I A;  3OM3 B;  3TJT A;  2DWE C;  4RQE A;  3IC7 A;  3G67 A;  4NXN O;  2ADQ B;  1E1Q G;  4RAI A;  2W0X A;  2YC0 A;  4GX0 A;  2XAF A;  1US6 A;  4DV5 B;  1Q86 W;  1FFX A;  2VWK A;  4FZ0 A;  1GM9 A;  4WF9 V;  2NR5 A;  1S72 V;  2R9A A;  4QE9 A;  4BR6 A;  3OUF A;  5C93 A;  1IBM O;  4ZOL B;  2VRZ A;  4NVP A;  4YJ3 A;  4JI8 B;  1AR4 A;  4K8X A;  1FPO A;  3SYO A;  1WN7 A;  2RNB A;  5LGN A;  3LDE A;  1Q82 W;  4YIP A;  4JI3 B;  3ZHS A;  2EIN B;  2QWQ B;  3AG2 B;  1YIT V;  1QBZ A;  1SQB H;  1XNQ O;  2Y0P A;  2EIJ B;  4JYB A;  2ZR2 A;  4UVC A;  1Q81 W;  3PN1 A;  3CPW U;  4DYL A;  1I7F A;  2WLI A;  3ABM B;  4DR3 O;  1YJN V;  4DR1 B;  3ASO B;  1FD9 A;  3H9V A;  4Z1V A;  2WAM A;  1H38 A;  1JQ0 A;  3J80 N;  3K57 A;  1Y76 A;  4WFA V;  1NKD A;  4YY3 B;  3ZIA G;  3PJS K;  1D5N A;  1DTO A;  1D5A A;  2E3C A;  1O9G A;  2Y4U A;  1GKF A;  4FLV A;  1PL4 A;  2CE4 A;  4UUJ C;  2O57 A;  2IH1 C;  3T1Y B;  3JSL A;  2XAG A;  1R3K C;  4BW9 A;  2MW2 B;  3L75 H;  3WB0 A;  3B40 A;  4XBF A;  3B8N A;  2CTP A;  4FMT A;  4LCU C;  5EK0 A;  2ZIO A;  4J9Z B;  4NXM B;  3OGI B;  1MG1 A;  4GX2 A;  4O4I B;  4BIU A;  5AG2 A;  1Q90 D;  4FFB B;  1URF A;  2K9P A;  1K97 A;  2Y69 C;  3G71 V;  3CX5 F;  4WCE V;  4DK0 A;  3OR6 C;  3OEH G;  2UUC O;  1HNX O;  1F23 A;  3W7U A;  4ZI7 B;  3RYI B;  4GT1 A;  3ASO C;  1EM1 A;  5J2T B;  4DUZ B;  3WB1 A;  2HVK C;  2ZNI A;  4IT5 A;  1MOF A;  4DR7 B;  5IYZ B;  1VEW A;  4EFE A;  2CH7 B;  3ZMT A;  2XAQ A;  1WB8 A;  4JZG A;  3DSQ A;  4O4L A;  3H1I H;  1XRE A;  1YDX A;  4YXW G;  4K35 A;  3SPI A;  1S3J A;  4TQD A;  2L6L A;  3RT3 C;  3E83 A;  5KHH A;  5IWA O;  1GK9 A;  3GVM A;  2JEX A;  3BY6 A;  3DXR B;  4K0K O;  5B1N A;  2EIN C;  2UXC B;  3IC9 A;  4JI6 O;  3NXS A;  3SJC C;  1EZV H;  4F6R A;  1MZF A;  1M5I A;  1FJG O;  2OWO A;  4TV8 A;  3I55 V;  2JIZ G;  2H8P C;  1XMQ B;  4TV9 A;  2CDY A;  4CZZ A;  1TUB B;  4NB5 A;  4FVM A;  4LBE C;  1M93 A;  3AEI A;  4B7K A;  4B3T O;  5EC2 C;  1FS0 G;  3CRQ A;  3AG4 B;  2EIK C;  2JEU A;  1OCO C;  3T1Y O;  1ZLZ A;  5IE9 A;  1OV9 A;  2ZE8 A;  4DV1 O;  2Q5Z A;  1HNW B;  1NR1 A;  3DGE A;  2KSD A;  4DO2 A;  3SJQ C;  2PUS A;  1KU9 A;  3ZHV A;  1B6Q A;  1XL6 A;  1OCZ C;  3K08 A;  5H6Q A;  2UXN A;  4DR1 O;  2PYL A;  5EBW C;  1I5Y A;  5DED A;  4DW1 A;  2RDC A;  3A0B Z;  3TCU A;  3JAL A;  1RFY A;  5EIB D;  1PV0 A;  4GKJ B;  4DV1 B;  1XIL A;  1SES A;  1NU1 H;  2R72 A;  4K3A A;  5L3F A;  3I5D A;  3OR7 C;  5DN6 G;  1F4M A;  1IZ3 A;  3RYC A;  4MTG A;  3HKE A;  4UCS A;  3MDS A;  4Z1M G;  3E8F A;  3ABM C;  1IBL B;  3O65 A;  3CHX A;  3K58 A;  4DV3 B;  4GUN A;  5JCO A;  2WLM A;  2BOC C;  3WU2 Z;  1AP5 A;  2PZS A;  1IUR A;  4JI6 B;  4I9W A;  3FAV B;  4MVM A;  4N23 A;  1VQO V;  5IWA B;  2Y48 A;  5CB4 B;  5KHI A;  2Y4T A;  2DW4 A;  4O4H B;  2BTQ B;  3FB7 C;  2C2A A;  1SC5 B;  1VQ7 V;  1EN4 A;  1B04 A;  3WG7 C;  4ZOL A;  4MW3 A;  4UB8 Z;  4QPK A;  4GX1 A;  2QM8 A;  1CP9 A;  3P3P A;  3G6E V;  2CTR A;  3JAW A;  3I56 V;  4FIP C;  1QU7 A;  3B77 A;  3QO7 A;  4HBN A;  5L3B A;  2P67 A;  3ZBH A;  5EIB C;  3IGA C;  2Q0A A;  4LF9 O;  4DV3 O;  5A9G A;  1SQV H;  3JAR B;  4KXR A;  4MS2 A;  1WA8 A;  4O4H A;  3E89 A;  1N32 B;  2P4K A;  2Q68 A;  1AJQ A;  4E2L A;  2N04 A;  5LP6 A;  4YJ3 B;  3UT5 B;  1NI8 A;  2IU3 A;  1WPX A;  5J2U A;  3OEE G;  3DXR A;  1RM1 B;  3G4S V;  3JD0 A;  3K04 A;  1W0J G;  1EBO A;  4J41 A;  1GRJ A;  2X7R B;  1SF9 A;  3BFR A;  4UVB A;  2VS0 A;  1OHH G;  3SGI A;  4CS4 A;  2YEV B;  1XUQ A;  2HJF C;  2B1I A;  4X65 B;  3RGB A;  4XDJ A;  1NH2 D;  5GW7 A;  2WLJ A;  1MZE A;  1K4D C;  5FL7 G;  2H94 A;  4AI8 A;  1VQP V;  3QO5 A;  2ZM6 O;  3AG3 C;  4LFA O;  5CBH A;  1BE3 H;  2F95 B;  3KCY A;  1G8M A;  3IFX A;  3BA8 A;  5KLV H;  2Q73 A;  2VQE B;  4KHP O;  2ZE7 A;  1VQL V;  5E1A C;  2Q67 A;  5LHI A;  2P5O A;  3JAL B;  1DLB A;  4H0L B;  3CRM A;  4U3F H;  3KKY A;  2ZNJ A;  4LF4 O;  3ZS8 C;  2GV9 A;  4J7J A;  3U0Z A;  1N34 O;  3LNM B;  2VQE O;  2XHB A;  1FKA O;  2WLH A;  3CRC A;  1Y74 B;  1V54 C;  3AK1 A;  4LP8 A;  1CEZ A;  2ZXW C;  3HKD B;  2QM7 A;  3E8G A;  3C3T A;  1Q6U A;  2V1D A;  4DV5 O;  1GN2 A;  1XMO O;  2ZE5 A;  4I7Z B;  5FLX N;  3BHP A;  1GN6 A;  3OMA B;  5IJ0 A;  4I4T A;  1V9P A;  1XQ8 A;  1AI5 A;  1ENV A;  3E22 A;  2LW7 A;  2EIM B;  1ZWI C;  4DR7 O;  5LGT A;  3UT5 A;  2A79 B;  4QIW F;  1NZ6 A;  1VF6 A;  2XAH A;  4ZBM A;  4FPP A;  1SS3 A;  4OPA A;  1YEW A;  1ZAU A;  4FLU A;  1EZJ A;  3ZCC A;  1K34 A;  3C3S A;  5LOV A;  4B3T B;  1KP3 A;  5JH7 A;  5JVD A;  4KP4 A;  4UVA A;  1YIJ V;  3ASN B;  4LFC O;  2JK5 C;  4O2A B;  5IT9 N;  1L0L H;  1ARO P;  4LFC B;  3WB2 A;  1OCR C;  4LF5 O;  2AXT Z;  2YI9 A;  1H2N A;  1OCO B;  3E8B A;  4B3M O;  5J2U B;  3TET A;  3TK1 A;  2W6J G;  3QO8 A;  3D36 A;  4F4L A;  2X6A A;  3P30 A;  2CK3 G;  4DV4 O;  1OCR B;  1H2S B;  2XOK G;  1AIL A;  4C7U A;  4TV9 B;  4TOI A;  3FYE B;  3L72 H;  5IDJ A;  1LR1 A;  4MVZ A;  3H1H H;  4IIJ B;  4L87 A;  4DR4 O;  3CSX A;  1QLE B;  3LSS A;  1HNX B;  2R9R B;  3EVK A;  2VQF B;  3QVN A;  1N4C A;  3CC2 V;  1XHZ A;  1N34 B;  1IX9 A;  1XNQ B;  4H37 A;  4FLT A;  3N2G A;  1E1R G;  4E4E A;  4ICG A;  1FAF A;  1AJN A;  4FM2 A;  4ASU G;  5JVD B;  4JI7 B;  4BAY A;  1XL4 A;  3JAT B;  4DV2 O;  2JJ2 G;  4MVR A;  1S5H C;  4H44 B;  3GWK C;  2QM4 A;  3SPG A;  4ZI7 A;  1XNR O;  1JOY A;  4HZ3 A;  3BRC A;  4W4K A;  4YY3 O;  1THZ A;  4LFA B;  4B7E A;  2IJJ A;  5CA3 A;  3EFF K;  4YJ2 B;  1SQG A;  3AG7 A;  1P7B A;  2DYR C;  2YIB D;  1BHB A;  4MVQ A;  2YXL A;  2DE0 X;  2FML A;  5BR8 B;  2F66 C;  4PA4 A;  4NXN B;  3D8C A;  4WFH A;  2M6Y A;  4PV1 B;  4I50 B;  4K8Z A;  3AG1 B;  1EFR G;  2OCC C;  1B06 A;  1YTF B;  2OYQ A;  2FKX A;  1OZ0 A;  1H8E G;  2HHH B;  3EXA A;  3ZN1 A;  3OGC C;  1MAB G;  1Q43 A;  3CD6 V;  2ZIN A;  5IYC O;  2LJ2 A;  3U11 A;  1ZTE A;  3ABT A;  4D6T H;  2X6B A;  1SQP H;  1W2B U;  1SQQ H;  4J80 A;  1I08 A;  4JI8 O;  4JF3 A;  5CB4 A;  2YID A;  3B8M A;  2D2C B;  5LGU A;  2Q7E A;  1VF6 C;  5KX5 A;  4TV8 B;  1Q5O A;  2KB1 A;  5LL6 Y;  3SPC A;  1PP9 H;  4J7Z A;  3S3W A;  4JI5 B;  1ORQ C;  5LA6 B;  2DQ0 A;  2QKS A;  2LW1 A;  1R73 A;  3APQ A;  1EN6 A;  1QQC A;  3LSU A;  1FXK B;  1GMG A;  2A7W A;  3E2E A;  1FFT B;  1KKD A;  3ZN0 A;  2XAJ A;  2G38 A;  4N21 A;  1QLN A;  5CBG A;  4LR3 A;  1IXB A;  1XHX A;  3AG3 B;  3CWB H;  2EJR A;  3VBB A;  4JAV A;  4DK1 A;  4WFF A;  1QHT A;  3J7A U;  3WFV A;  5FPO A;  2EIM C;  3GWO A;  1TVK B;  2X6C A;  4MVU A;  2HG5 C;  5JQG B;  3ZMZ A;  3OW2 U;  2HJD A;  4L8J A;  4PA7 A;  1S5L Z;  4PDM A;  3RYF B;  4NXM O;  2DYR B;  4X64 B;  4X1I B;  4FZ1 A;  1K3E A;  3B09 A;  3FKS G;  2D3O W;  1WLE A;  3H1L H;  2F1M A;  1Z2G A;  5L3D A;  2ZKO A;  3E22 B;  1YJW V;  4GCZ A;  4OXS A;  2KG7 A;  4DR6 O;  3KG2 A;  4GKJ O;  4JI4 B;  2ZCE A;  4GLX A;  1GH6 A;  2QWR B;  1XBL A;  2ZDI C;  5H2F Z;  2XUM A;  4LC1 A;  5LYJ A;  4DV4 B;  1VQ8 V;  1ZX3 A;  4MTX A;  1S5J A;  2QE7 G;  4PJ0 Z;  1IDS A;  1BQZ A;  3JYC A;  2PY5 A;  2QTO A;  3R65 A;  4IIJ A;  2HKO A;  4I50 A;  1GTO A;  4FFK A;  4YIO A;  5CN0 A;  4H13 B;  3K06 A;  3LNN A;  3JAT A;  4JYC A;  1A32 A;  3Q4H A;  4IYI A;  4FM0 A;  1YVW A;  3OMN B;  5KHJ A;  1N8R W;  5JWP A;  2CTQ A;  3C90 A;  2R70 A;  4X66 B;  1F7Y A;  5H9C A;  4I4T B;  2UUB O;  2YDE A;  2OIE A;  1N33 O;  4CBC A;  5H6R A;  3MHH C;  2DJV A;  3ZHU A;  1J5E O;  5K1X A;  4DV0 B;  4X1Y B;  4NTX A;  3E35 A;  5KAI Z;  4JI2 O;  4DV6 B;  1SA0 B;  5EZY A;  1XMQ O;  3BAB A;  4GKK B;  3CCS V;  2ETN A;  4X9Q A;  1FJG B;  4CH4 A;  1TGO A;  1NT2 B;  3ZHR A;  3HKB A;  3JD3 A;  3M99 B;  5JJJ B;  4KFM A;  1IBK O;  4X1K B;  3BA9 A;  1JX9 A;  1ZUQ A;  1SRY A;  3VOU A;  1M57 C;  5B1B B;  1Q7Y W;  2NNU A;  1SZX A;  4TSF G;  5JH7 B;  4FLW A;  5LBQ A;  3ZHQ A;  1XEQ A;  4DR6 B;  4O2B A;  2VWJ A;  1R3J C;  4FLZ A;  4HNA A;  4DV6 O;  1M57 B;  4LF4 B;  3S3X A;  1GM8 A;  3H01 A;  4DV0 O;  2BSK B;  3OE7 G;  3LSQ A;  2AGA A;  1Y6X A;  4O4L B;  3FX7 A;  4WFE A;  2LFR A;  2UU9 B;  4PI0 A;  1HW7 A;  3RN4 A;  4KHP B;  1JVM A;  4JAU A;  4PA9 A;  3JD1 A;  1L8D A;  1K4C C;  4X62 O;  4QNH B;  4MTO A;  3M7M X;  2IJI A;  1Q3E A;  4A5U B;  2Q69 A;  4J10 A;  3CME V;  3OUS A;  3H1K H;  3G80 A;  4O2A A;  3SYQ A;  1VIB A;  4RWU A;  3JAM N;  3ZRW A;  3CEI A;  1NTZ H;  5H5N A;  4JI4 O;  4O4J A;  3HKB B;  1K92 A;  1W0K G;  3SPJ A;  1AR5 A;  3AG2 C;  2Q9L A;  4WFG A;  4X1K A;  3ETE A;  1BHA A;  4XDL A;  4B08 A;  4G28 B;  4GX5 A;  2W0F C;  1KD1 W;  1CPY A;  3CCR V;  2X0L A;  2OCC B;  2KQX A;  1N0J A;  4MVS A;  1N32 O;  3AK3 A;  2WLK A;  2P90 A;  2Q8V A;  3F7Y C;  1T5E A;  2FYU H;  2UU9 O;  4ZHQ A;  4I5S A;  1BGY H;  1M90 W;  3IAY A;  1Y76 B;  2EIL C;  4UCV A;  2BSK A;  1ROP A;  2BTO A;  4TT3 G;  2IH3 C;  2ITC C;  2E75 B;  4O2B B;  3K5L A;  1SZT A;  3VQW A;  1HR0 B;  1DK1 A;  1HDJ A;  4TUY B;  1ZSP A;  1S77 D;  1G1X B;  2AHZ A;  2UUA O;  1H8H G;  2QSA A;  3L73 H;  2F4V O;  5IY5 C;  2HP8 A;  3HPL C;  1WNS A;  3OT7 A;  3FB5 C;  4EB6 B;  2F93 B;  4AHC A;  2IBZ H;  3CP1 A;  3OTO B;  2OT5 A;  1KEC A;  3HKD A;  4GKK O;  3N2K B;  4JAA A;  4DV7 B;  4YHH B;  4B3S O;  1YTF D;  4DV2 B;  2RQ6 A;  1YXB A;  2LGQ A;  2QDO A;  3CXC U;  3CJH B;  1V55 C;  3KCX A;  1OCZ B;  2WPD G;  4LFB O;  4NYK A;  2YXY A;  3GB7 C;  2BTQ A;  3K3W A;  1RSO B;  2GDS A;  3KZI Z;  2N74 A;  4BW5 A;  3CC4 V;  4EKW A;  3SJA C;  1YSC A;  3K5O A;  4G27 B;  5ITZ B;  3JAW B;  2AW9 A;  1RM1 C;  1JJO A;  5B66 Z;  3RFR A;  1K5S A;  3DTU B;  3MD0 A;  1HNZ O;  2ADP A;  4AQY O;  3ZRV A;  4JTC B;  1G6U A;  2CTW A;  3ABL C;  1F51 A;  2QWO B;  2JVD A;  3E86 A;  1P4R A;  1WP7 A;  1BSM A;  3K9A A;  4KUM A;  4JPR A;  4JTD B;  4W4L A;  2EBO A;  3JAS B;  4FK5 C;  3K79 A;  3NR7 A;  2GSM B;  3OD4 A;  4HNA B;  1R3L C;  4LF6 B;  1Y66 A;  4DUZ O;  1EN5 A;  4B3M B;  3BCC H;  5B3S C;  3SDL A;  1H2L A;  4HYO A;  4PA6 A;  3P3N A;  4X64 O;  1KQS U;  1Y67 A;  2LO1 A;  3UKM A;  2KKW A;  3ML0 A;  2IJK A;  5EC1 C;  1K7D A;  1NJI W;  1LUV A;  2EZO A;  1FXK C;  1AR1 B;  4UV8 A;  2UXB O;  2LFS A;  3L74 H;  1NVP B;  3ABL B;  2DN9 A;  2LP7 A;  2CUG A;  3ETD A;  2DYS C;  5J2T A;  1K5Q A;  3K9S A;  1JMK C;  4J42 A;  1HWY A;  3ZRS A;  4LF6 O;  3ICX A;  1VP7 A;  4DR2 B;  2M7W A;  1RPR A;  3OAA G;  1GAX A;  3FB6 C;  2OIG A;  1PD3 A;  4O4J B;  5LA6 A;  2QA4 V;  4RQF A;  5IJ9 B;  2WSS G;  4CH5 A;  4OX9 O;  3BAA A;  4JYY A;  4IHJ A;  4JI5 O;  4DR3 B;  1N0N A;  2LQT A;  1H2M A;  4FLY A;  4B3R O;  2P22 C;  4GZR B;  3T4D A;  4PEL A;  3CCJ V;  1JFF B;  4R8C A;  2HR3 A;  5CA1 B;  1L1F A;  2ZDI A;  2JRI A;  4MT8 A;  4U7O A;  1BQ0 A;  1K33 A;  5EBM C;  2Q4P A;  2PI4 A;  1E79 G;  3T1C A;  4FLX A;  1J5E B;  2HLD G;  4CS3 A;  5IYZ A;  4X20 B;  4PDR A;  2JDI G;  4DUY O;  1FXV A;  4X66 O;  2XTA A;  2A3Q A;  1COW G;  3UO3 A;  3A8T A;  2YIC A;  2RJZ A;  4AIL C;  3W7T A;  4U3J A;  5F2V O;  1NTK H;  1M56 B;  2Y69 B;  1SET A;  4UCU A;  5LP6 B;  1KB9 F;  2ZM6 B;  4JAS A;  2IM9 A;  3JD4 A;  3ETG A;  3Q4H B;  1NQT A;  3JAR A;  3T1H O;  4X65 O;  5B1A B;  3FAV A;  1GO3 F;  3ZHT A;  2K1E A;  2DMX A;  1BCC H;  1JA8 A;  3HKC B;  4PA3 A;  4JI2 B;  4JYA B;  5IJ0 B;  3W7S A;  4LFB B;  4WBN A;  1N33 B;  3A2F A;  4UCT A;  3QNE A;  5FPR A;  3HR0 A;  3RYH A;  1FYJ A;  3JAK A;  4QPJ A;  1RP3 B;  4LF7 O;  1W59 A;  2ZXW B;  4J7K A;  3VQY A;  5L3G A;  1NR7 A;  1QNM A;  4DV7 O;  2VQF O;  3RYC B;  3VQX A;  3T4Z A;  5IYB O;  2NLJ C;  3G6B A;  2QKA A;  3BEH A;  1MSD A;  3SYC A;  1Q6I A;  5KA6 A;  2EIL B;  3UM7 A;  4X89 A;  2MK3 A;  3APO A;  4FM1 A;  1FXH A;  4J9Y B;  1Z5V A;  1DF4 A;  2P06 A;  3E8H A;  3JCU Z;  1R1B A;  3K5M A;  3CB2 A;  1XDC A;  2A0L A;  2AZ2 A;  3RVY A;  1HP8 A;  1R6N A;  1YZB A;  4XDK A;  2GTS A;  3ABK B;  3M8A A;  1VQ5 V;  2XND G;  3ASN C;  2UXX A;  4PDL A;  3CRR A;  2KG7 B;  1VQN V;  3RWR D;  2B5U A;  1Y74 A;  3RYI A;  4X62 B;  2UXB B;  5KMG A;  2EZP A;  1Q8I A;  2N05 A;  2YSU B;  5KUM A;  4OPH A;  5IYD O;  2PYJ A;  2YUA A;  4LF7 B;  4X20 A;  2BOB C;  3A0R A;  5B1B C;  5BZB A;  2Y0I A;  1BL8 A;  2OCH A;  1UPG A;  4F6R B;  5ITZ A;  2B9Z A;  4UCR A;  4JYA O;  3FB8 C;  1H2K A;  4FJC C;  3SYA A;  3D3I A;  2Q0O C;  1AI6 A;  3K0D A;  4RO2 A;  3P32 A;  1KKC A;  3CCL V;  1ZL8 B;  5BY1 A;  2IU0 A;  1P7G A;  1JJ2 U;  1XMO B;  4JV5 O;  5J9P C;  1O9H A;  4IGG A;  1YHQ V;  1H2G A;  2JS3 A;  1N36 O;  5EBL C;  2RN9 A;  1BMF G;  2JGD A;  3FD9 A;  3STZ C;  2CAZ C;  1XNR B;  4Z2W A;  1MNG A;  2Q6A A;  2E5L O;  5BMV A;  1FFX B;  1X59 A;  3CC7 V;  4R50 A;  2QWN B;  3L71 H;  5KUK A;  1IBL O;  4P30 A;  3VQV A;  1R6K A;  4DUY B;  5LXT B;  3ZMU A;  1PL0 A;  1B3Q A;  4I0X B;  1NBM G;  3RW0 A;  3DC6 A;  5KAF Z;  3HB3 B;  2IJH A;  1GN3 A;  4R6Z A;  1VF5 B;  5EYP A;  5FNV B;  2YIB A;  4IYH A;  1WB7 A;  2QGN A;  2ZQM A;  4QGP A;  2JGD B;  5KHG A;  1XOU A;  5A2Q N;  1L0N H;  5BR8 O;  3T1H B;  4PI2 A;  2UXC O;  2ZE6 A;  1I0H A;  1YJ9 V;  4ZHQ B;  3LUT B;  4CS2 A;  1JPX A;  4I55 A;  2JGU A;  4MTF A;  4CH3 A;  4QE7 A;  1AP6 A;  4UV9 A;  2UUA B;  1HNW O;  3CE2 A;  4PHZ A;  5BXZ A;  1J95 A;  5JCO C;  4JI7 O;  4Q6G A;  2AZ0 A;  1P49 A;  1M9N A;  4ZIB A;  1SQX H;  5IJ9 A;  1MMM A;  4LNU B;  5LHH A;  2W6I G;  4I55 B;  4LF9 B;  1TA8 A;  3CCU V;  4LWS A;  3L70 H;  4JI0 B;  1NVP D;  2BCC H;  4WBN B;  4LH6 A;  4B3R B;  3TXS A;  1VQM V;  5LMN B;  3F5T A;  4DRX B;  3CCE V;  4D7S A;  3CCM V;  4U7N A;  1SKV A;  2Z5U A;  1NH2 B;  1V54 B;  4LWS B;  2CGO A;  3STL C;  3OTF A;  3JD2 A;  3QF7 A;  1KYO F;  2BE3 A;  1M4U A;  1ZL8 A;  4WFB V;  4YJ2 A;  1GN4 A;  3K59 A;  1KP2 A;  2GUZ B;  1JFF A;  4JGS A;  2AHY A;  4FFB A;  1BT8 A;  4DR2 O;  2WLL A;  2ZD9 A;  1V55 B;  2QR4 A;  5GON A;  1PNK A;  2B1G A;  1YCI A;  3F5W C;  3SR2 C;  1K73 W;  1YTF C;  4BIO A;  5KA5 A;  1SER A;  3ABK C;  3ZX6 A;  1DF5 A;  2OTJ V;  3D36 C;  4PDV A;  4UXN A;  5CBF A;  1AI4 A;  3AG1 C;  3CCQ V;  3RYH B;  3JAK B;  4P2Z A;  4UFZ A;  3JCZ A;  2WA4 A;  2NN4 A;  3H1J H;  1QR8 A;  3N27 A;  1NH2 C;  4JI3 O;  2QKC A;  5DEC A;  1I94 B;  2OTL V;  1RPO A;  4DW0 A;  2HVJ C;  4KL1 A;  1S76 D;  3LDC A;  4JTA B;  5LP6 C;  5TIS Z;  4B3S B;  1GM7 A;  3TGU H;  4IHJ B;  1CXZ B;  2P6J A;  1QCE A;  1I5X A;  2A06 H;  5L3C A;  1PNL A;  1KMI Z;  3BPZ A;  1PM9 A;  1AVM A;  2GBO A;  3BVO A;  4P9P A;  1PNM A;  1SQF A;  1RSO A;  2WWW A;  4OGQ B;  2P7T C;  2H3O A;  1IBK B;  4AQY B;  3R66 A;  3SJB C;  5LXT A;  5JJE B;  1P84 F;  3WG7 B;  3A0H Z;  2ARH A;  2QWP B;  4DRX A;  3IJ4 A;  1QLE C;  1R3I C;  1HR0 O;  4EFB A;  1JCH A;  1FXK A;  1QR9 A;  4EEQ A;  2YEV A;  3N2G B;  3UO2 A;  2XT9 A;  2UUB B;  2QEX V;  3RVZ A;  2Q7H A;  1M56 C;  3ZJZ A; 
#chains in the Genus database with same CATH homology
 2FTK A;  3E83 A;  2WSS G;  1GK9 A;  4JF3 A;  2JEX A;  3BY6 A;  3B8M A;  5B1N A;  2A9H A;  2EIN C;  3W7W A;  5LGU A;  3NXS A;  2KB1 A;  3I55 V;  3SPC A;  3T4D A;  2JIZ G;  4PEL A;  2H8P C;  3CCJ V;  1VQK V;  4CZZ A;  4R8C A;  1ORQ C;  2HR3 A;  1L1F A;  2ZDI A;  2DQ0 A;  2QKS A;  5HFM A;  4MT8 A;  4LBE C;  1R73 A;  2ITD C;  1PKX A;  4U7O A;  3CMA V;  1K33 A;  3AEI A;  5EBM C;  2PI4 A;  1E79 G;  5EC2 C;  3K0G A;  3T1C A;  2HLD G;  1FXK B;  1GMG A;  1FS0 G;  1LNQ A;  4PDR A;  3E2E A;  3AG4 B;  2JDI G;  1FFT B;  1KKD A;  3ZN0 A;  2XAJ A;  2EIK C;  4RUF A;  2JEU A;  1FXV A;  4N21 A;  1QLN A;  1OCO C;  5CBG A;  1COW G;  4DXW A;  3AG3 B;  2EJR A;  3VBB A;  1QVG U;  5CMU A;  1NR1 A;  3W7T A;  4JAV A;  3DGE A;  4DO2 A;  4QJF B;  3SJQ C;  4WFF A;  1M56 B;  2Y69 B;  1SET A;  1B6Q A;  1XL6 A;  1OCZ C;  3WFV A;  4JAS A;  1K9M W;  2EIM C;  3GWO A;  4R7C A;  2X6C A;  4MVU A;  3K08 A;  3JD4 A;  3ETG A;  2HG5 C;  2UXN A;  5H6Q A;  4Q20 A;  3ZMZ A;  2F43 G;  3OW2 U;  1NQT A;  5EBW C;  1I5Y A;  4PA7 A;  5B1A B;  4PDM A;  2DYR B;  3TCU A;  1GO3 F;  3F7V C;  3MHS C;  1K3E A;  3FKS G;  3RBZ A;  2D3O W;  2K1E A;  1VQ6 V;  1WLE A;  1SES A;  3OFN G;  3AG4 C;  5L3D A;  5L3F A;  1YJW V;  3OR7 C;  4GCZ A;  4OXS A;  4PA3 A;  1YI2 V;  5DN6 G;  1F4M A;  3KG2 A;  3W7S A;  4MTG A;  4TWK A;  2ZDI C;  3QNE A;  2EIK B;  4LC1 A;  4Z1M G;  3E8F A;  1VQ8 V;  3ABM C;  4MTX A;  4QPJ A;  2DWD C;  2QE7 G;  2ZXW B;  2V7Q G;  5L3G A;  1NR7 A;  3JYC A;  5HFL A;  2QTO A;  3R65 A;  2WLM A;  2BOC C;  4X8A A;  3T4Z A;  2HKO A;  2WLN A;  1M1K W;  2PI5 A;  1G4Y B;  1GTO A;  3OMI B;  4RUE A;  5IYB O;  2NLJ C;  4I9W A;  5CN0 A;  3K06 A;  2WLL B;  3BEH A;  4MVM A;  4N23 A;  4MVO A;  3SYC A;  5KA6 A;  2EIL B;  3UM7 A;  1OCC C;  4X89 A;  2MK3 A;  3X2Q B;  4JYC A;  1VQO V;  2Y48 A;  1N8R W;  3OMN B;  1FXH A;  4J9Y B;  1DF4 A;  3E8H A;  3CCV V;  3T2M A;  2A0L A;  5H9C A;  2DW4 A;  1K8A W;  3RVY A;  4CBC A;  5H6R A;  3FB7 C;  3MHH C;  1R6N A;  2C2A A;  5L3E A;  1VQ7 V;  4XDK A;  3ABK B;  3E35 A;  5IY5 B;  1VQ5 V;  2XND G;  3WG7 C;  3ASN C;  2UXX A;  4PDL A;  4MW3 A;  1NVP C;  2ATK C;  4P9O A;  3SPH A;  3ABU A;  4QPK A;  4GX1 A;  2QM8 A;  1CP9 A;  3G6E V;  3CCS V;  1VQN V;  3I56 V;  4FIP C;  3ZMS A;  2B5U A;  3W7X A;  3B77 A;  2DQ3 A;  3EHB B;  3QO7 A;  5L3B A;  3JD3 A;  4HAM A;  3SYP A;  2DYS B;  3M99 B;  2P67 A;  3ZRX A;  4KFM A;  3IGA C;  2EZP A;  4G2K A;  1KC8 W;  5LHG A;  2YSU B;  5KUM A;  5IYD O;  4MS2 A;  5B3S B;  2BOB C;  3A0R A;  1JX9 A;  3E89 A;  5B1B C;  1SRY A;  3VOU A;  1M57 C;  5B1B B;  2Q68 A;  1Q7Y W;  2NNU A;  5BZB A;  4TSF G;  1AJQ A;  1BL8 A;  4E2L A;  4MW8 A;  1TUE B;  2JJ1 G;  5LBQ A;  2IW5 A;  3FB8 C;  5B1A C;  1R3J C;  2IU3 A;  1WPX A;  2GHY A;  3OEE G;  2Z3Y A;  4FJC C;  1RM1 B;  4X88 A;  1M57 B;  5B1O A;  3SYA A;  3D3I A;  3G4S V;  3JD0 A;  1AI6 A;  1GM8 A;  3H01 A;  3K0D A;  3K04 A;  1W0J G;  1EBO A;  4RO2 A;  3OE7 G;  3LSQ A;  2X7R B;  1MSW D;  3P32 A;  4UVB A;  1OHH G;  1VQ4 V;  2YEV B;  3CCL V;  2HJF C;  4WFE A;  2B1I A;  2LFR A;  4XDJ A;  2IU0 A;  1NH2 D;  1JJ2 U;  5GW7 A;  1UJW B;  5J9P C;  2WLJ A;  1K4D C;  2WLI B;  5FL7 G;  1JVM A;  1YHQ V;  2H94 A;  4JAU A;  1VQP V;  4PA9 A;  1H2G A;  3QO5 A;  3JD1 A;  1K4C C;  1Y4M A;  4QNH B;  3AG3 C;  5EBL C;  5DM6 V;  5CBH A;  4MTO A;  1BMF G;  2HFE C;  2IJI A;  1AI7 A;  1G8M A;  3IFX A;  3STZ C;  2Q69 A;  1AJP A;  2Q6A A;  3CME V;  3OUS A;  3CC7 V;  4R50 A;  1VQL V;  5E1A C;  2Q67 A;  5LHI A;  5KUK A;  1F4N A;  1IXM A;  1DLB A;  4P30 A;  3SYQ A;  1R6K A;  3ZRW A;  1QVF U;  4ZKI A;  2EIJ C;  3ZMU A;  1PL0 A;  3ZRW B;  2ZR3 A;  1NBM G;  3RW0 A;  1OCC B;  3HB3 B;  3X2Q C;  2IJH A;  1K92 A;  2R9I A;  4MSW C;  1W0K G;  4R6Z A;  3SPJ A;  2XAS A;  4WFG A;  3AG2 C;  3ETE A;  1BHA A;  4XDL A;  3FYI B;  4H33 A;  3LNM B;  4G28 B;  4GX5 A;  2W0F C;  1KD1 W;  2ZQM A;  1CPY A;  2WLH A;  3CCR V;  1V54 C;  2X0L A;  4LP8 A;  1CEZ A;  1VQ9 V;  2OCC B;  3ZMV A;  4MVS A;  2ZXW C;  2QM7 A;  3E8G A;  2WLK A;  2P90 A;  2V1D A;  3CYO A;  1YJ9 V;  3F7Y C;  3LUT B;  1JPX A;  4MTF A;  4I5S A;  1M90 W;  4QE7 A;  2EIL C;  3OMA B;  1ROP A;  4UV9 A;  1AI5 A;  1ENV A;  4TT3 G;  2IH3 C;  1S0V A;  2EIM B;  2ITC C;  1ZWI C;  5LGT A;  2A79 B;  1J95 A;  4QIW F;  1SZT A;  3LDD A;  4BIZ A;  3K03 A;  2XAH A;  3OM3 B;  1S77 D;  4ZBM A;  4FPP A;  2DWE C;  2AHZ A;  4RQE A;  3IC7 A;  1H8H G;  1EZJ A;  3ZCC A;  1K34 A;  1KP3 A;  4KP4 A;  4UVA A;  1YIJ V;  1E1Q G;  1M9N A;  3ASN B;  4RAI A;  5LHH A;  2JK5 C;  5IY5 C;  2W6I G;  4GX0 A;  2XAF A;  1ARO P;  3CCU V;  1Q86 W;  3HPL C;  3FB5 C;  1NVP D;  1GM9 A;  1OCR C;  4WF9 V;  3CP1 A;  1VQM V;  1S72 V;  2OT5 A;  4QE9 A;  1KEC A;  1OCO B;  3CCE V;  3E8B A;  3OUF A;  5C93 A;  3TET A;  3CCM V;  4U7N A;  2W6J G;  3TK1 A;  3QO8 A;  2Z5U A;  3D36 A;  1NH2 B;  1V54 B;  4F4L A;  3STL C;  2X6A A;  1YTF D;  3P30 A;  2CK3 G;  3JD2 A;  3SYO A;  1OCR B;  5LGN A;  3CXC U;  3LDE A;  1Q82 W;  2XOK G;  4WFB V;  1V55 C;  1OCZ B;  2WPD G;  2EIN B;  3AG2 B;  3GB7 C;  1YIT V;  3K3W A;  1KP2 A;  1QBZ A;  4JGS A;  2AHY A;  3FYE B;  2WLL A;  2ZD9 A;  1V55 B;  4BW5 A;  2EIJ B;  5IDJ A;  4JYB A;  3CC4 V;  2ZR2 A;  4UVC A;  4MVZ A;  1Q81 W;  1PNK A;  4EKW A;  2B1G A;  4L87 A;  3F5W C;  1YSC A;  1K73 W;  4G27 B;  1YTF C;  5KA5 A;  3CPW U;  1SER A;  1RM1 C;  1QLE B;  3ABK C;  3LSS A;  1DF5 A;  1K5S A;  3DTU B;  2OTJ V;  3MD0 A;  2WLI A;  2R9R B;  3ABM B;  4PDV A;  4UXN A;  5CBF A;  1YJN V;  3ASO B;  1AI4 A;  3AG1 C;  3CCQ V;  3CC2 V;  3ZRV A;  4JTC B;  4P2Z A;  2WAM A;  4H37 A;  1H38 A;  1JQ0 A;  3JCZ A;  1E1R G;  3ABL C;  1F51 A;  3E86 A;  4WFA V;  1NKD A;  1AJN A;  3ZIA G;  3PJS K;  1P4R A;  1QR8 A;  1DTO A;  3K9A A;  4KUM A;  4ASU G;  1NH2 C;  4BAY A;  4JPR A;  4JTD B;  2OTL V;  1RPO A;  2EBO A;  1GKF A;  1XL4 A;  2HVJ C;  1S76 D;  4FK5 C;  3K79 A;  4UUJ C;  2IH1 C;  3LDC A;  4JTA B;  2XAG A;  2JJ2 G;  1R3K C;  4MVR A;  2GSM B;  1S5H C;  1GM7 A;  1R3L C;  3SPG A;  1Y66 A;  1JOY A;  4LCU C;  3B8N A;  2P6J A;  4FMT A;  1QCE A;  4HZ3 A;  5EK0 A;  4XBF A;  5B3S C;  4HYO A;  1I5X A;  4PA6 A;  5L3C A;  1PNL A;  1THZ A;  4J9Z B;  1KQS U;  1MG1 A;  4GX2 A;  4P9P A;  1PNM A;  2IJJ A;  5CA3 A;  3EFF K;  4BIU A;  2WWW A;  3UKM A;  3ML0 A;  2IJK A;  2Y69 C;  1K97 A;  5EC1 C;  1K7D A;  1NJI W;  1P7B A;  2DYR C;  4WCE V;  3G71 V;  1BHB A;  2P7T C;  4MVQ A;  2EZO A;  3OR6 C;  3OEH G;  1FXK C;  1AR1 B;  4UV8 A;  2LFS A;  1F23 A;  1W2B U;  1NVP B;  3W7U A;  3ABL B;  4PA4 A;  2LP7 A;  4GT1 A;  3ASO C;  3WG7 B;  3ETD A;  4WFH A;  2DYS C;  1K5Q A;  3AG1 B;  1HWY A;  2HVK C;  1EFR G;  1QLE C;  1R3I C;  3ZRS A;  2OCC C;  1YTF B;  1MOF A;  1JCH A;  1OZ0 A;  1H8E G;  1FXK A;  3ZN1 A;  2M7W A;  3OGC C;  1RPR A;  1MAB G;  1QR9 A;  3OAA G;  3ZMT A;  2XAQ A;  3FB6 C;  3CD6 V;  2YEV A;  5IYC O;  4YXW G;  1PD3 A;  2QEX V;  3RVZ A;  3SPI A;  1M56 C;  1S3J A;  3ABT A;  3ZJZ A;  2QA4 V;  4RQF A;  2X6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...