1YTFD

Yeast tfiia/tbp/dna complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
100
Chain Sequence
GYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVESVISVDKLRIVACNSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*GP*TP*AP*TP*GP*TP*AP*TP*AP*TP*AP*AP*AP*AP*C)-3
publication title Crystal structure of a yeast TFIIA/TBP/DNA complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 25
structure length 100
sequence length 115
ec nomenclature
pdb deposition date 1996-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
D PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ytfD01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 1ytfD02
1NH2D 1YTFD 5IYDO 1RM1C 1NVPC 1RM1B 1YTFC 1NH2C 5IYBO 1NVPD 5IYCO
chains in the Genus database with same CATH superfamily
3D3IA 1ZX3A 1WAZA 1VQPV 3CCSV 1MG1A 1FD9A 3ZHQA 4QGPA 4B3MB 3L74H 1VQNV 3BFRA 3SPCA 1YF2A 4JI0O 4PA6A 1OCOC 2B9ZA 1FXVA 3CPWU 3PN1A 3ETDA 3T1YO 1AI6A 2QKAA 2DQ0A 1R73A 4D6TH 2P06A 4FK5C 2UUBO 2IJJA 1KC8W 1Y76A 3G71V 5LMNO 3JASA 1XHXA 5LHHA 3AG1B 4BR6A 1YI2V 4DV5B 4UUJC 3CSXA 3GWKC 1NR7A 1PNMA 5EC1C 1OCCB 4GYCB 3K0GA 4QIWF 1TVKB 3M8AA 1QLEB 4CC5A 2EINC 5E1AC 3VBBA 1S5HC 3CHXA 3JALA 4FLXA 4PA3A 2EJRA 3WU2Z 5IYCO 1VF6C 1QVGU 4UB8Z 4CC6A 4NTXA 4LF5B 1S0VA 4ZOLB 3LDEA 4YIOA 2QSAA 4YY3O 1TUEB 1W0JG 1M1KW 2LJ2A 3ABKC 2DWDC 1XOUA 3T4DA 3CJHB 5LA6A 1OCRC 1M56B 3APQA 2PI5A 3RYIA 4O4LB 1VQ6V 2E5LO 4I4TB 2N74A 4ZIBA 1GO3F 1OCZB 3JCZA 2Q4PA 3HKEB 2R72A 3RVYA 5E79Z 1Q90D 2Z3YA 4DR6B 1XMQB 1IBLO 1H8HG 1YEWA 4DYLA 4JI6O 3N2KA 4QE9A 4CH4A 3FAVA 5L3BA 2NN4A 5BY1A 4PA4A 5JJJB 1BQZA 5FPOA 1Y74B 1Z5VA 3CYOA 4JTDB 3K58A 4LP8A 1E79G 1LUVA 3RW0A 3DSQA 5B1AC 5GONB 3CRMA 1Q5OA 1MSDA 2Q6AA 3SYCA 1P84F 2EJ7A 5BR8O 1F51A 1FFTB 3UCSC 5LHGA 4ZKIA 3OT7A 4DRXA 4OXSA 2ZD9A 4WFHA 1J5EB 2JJ2G 2EIKB 2UXCO 1QNMA 5CBFA 2PF4E 3DC6A 3C3SA 1Q7YW 4U3JB 4R7CA 1PV0A 3T1HB 2DYSB 3F5TA 2FYUH 1BE3H 1M57C 3U10A 4UXNA 2XASA 4PDRA 4LFCO 1JOYA 4UFZA 3K08A 4GLXA 2OWOA 1XL6A 2GDSA 4TV9A 2KKWA 1VP7A 1N33O 2JEXA 4DV4B 2OIEA 3E8BA 3RBZA 1GN4A 5KLVH 2ITDC 2ZQMA 2R9IA 4JI2B 3H9VA 1H2LA 3F5WC 3E2EA 2VRZA 3DXRA 3I55V 3RVZA 4X89A 3FB8C 3Q4HA 4JI3O 2X7RB 3A0RA 5GTHZ 2QKCA 4I50B 1BHAA 4O2BA 2X6CA 3B4SA 4EFEA 1NH2D 5AG2A 1ZL8A 2GSMB 1ZLZA 4DV7B 4UCVA 1K5SA 2DYRB 4WFGA 2CTRA 2UXDO 2GUZB 3ZS8C 4LF7O 2ETNA 1VQ5V 4LF6O 1S3JA 4LF9B 2UXNA 4WFFA 3F7YC 2Q0AA 3CCMV 3FYEB 4CS2A 4LF8O 3SJAC 1YTFD 1X4TA 1SQPH 2FKXA 2AHZA 3K59A 4MVOA 1G1XB 1R3LC 4TQFA 3WG7B 4O4JA 4Q6GA 1FFXB 1BQ0A 1WPBA 1CPYA 3I5DA 2P4KA 1WPXA 5L3DA 3CCJV 3SJBC 1FXKA 1Y4MA 3J7AU 1PL0A 3CMAV 4OPHA 2AHYA 1SA0B 1Q6HA 4UCSA 4XBFA 4DV0B 4DR5O 1W2BU 3E8FA 5C93A 5LHIA 1W59A 2UXXA 4XDJA 3HKCB 4FFBB 2CTQA 2WA3A 1JR9A 1V9PA 1R3KC 5EIBC 3RWRD 4DR7O 2YI9A 3ML0A 4YXWG 1ZWIC 4I55B 4NXNO 3H1JH 1GN6A 1COWG 3OW2U 2W0FC 2CK3G 4DK1A 2RQ6A 1UPGA 5IYDO 1PL4A 1GAXA 1P7GA 5IY5C 5IJ9B 1NBMG 5LMUO 3FB5C 4MVUA 4CZZA 2Q7GA 4TUYB 3E86A 3CCLV 4K0KO 3ABTA 5CBHA 2WLMA 2ITCC 2QTOA 3RT3C 2H8PC 5HFMA 4JZ2A 1B3QA 4ZI7B 1OV9A 4YJ3A 1SC5B 3FB6C 4D7SA 3AK1A 3AG2C 2JDIG 4FLZA 3IFXA 1Q43A 3OUSA 4IHJB 2A79B 4LF8B 1MSWD 3ZJZA 4CH6A 3VQYA 1OCOB 2Q67A 3ZRWB 5CA0B 3BHPA 2LW7A 3JD0A 3RYHB 1I5YA 3UO3A 2QEXV 1H8EG 1AR4A 3MD0A 3P3NA 3O9OA 2YEVB 1BZKA 1GRJA 1CP9A 4CH5A 3OMNB 3JARA 1FXKC 1DGSA 1GKFA 5BMVB 1R6NA 1L8DA 4GX5A 4N21A 3CXHF 5KHIA 3OGIB 3TK1A 3H1HH 2QWOB 2OTLV 4X20A 5H6RA 2PY5A 4B08A 1SZXA 1IXBA 1F23A 5EBLC 4ZHQA 2YSUB 3ETGA 1FS0G 4NXNB 3KZIZ 2F4VO 1VF5B 2ODMA 2IM9A 3HKDB 4FLTA 4GKJB 5DN6G 1PNLA 4CS3A 3TXSA 1EN6A 1AJNA 2H94A 5LYJB 1GM8A 2HP8A 1FYJA 2GV9A 2PI4A 4J9ZB 3G80A 4QJFB 2A0LA 3ABLC 5K1PA 3ZHRA 4R50A 3ABKB 4UCTA 4K0KB 4O2AA 4B7KA 3KG2A 2ZDIA 4MVMA 1NQTA 1OCRB 3B8MA 3CS5A 4JYCA 4MTOA 2WWWA 1QU7A 3AG7A 4X64B 3EVKA 2IU3A 1GN3A 4ASUG 5A9GA 5LP6A 5EBMC 3JYCA 1HNZO 3DTUB 5L3GA 1ZUQA 1SS3A 1YXBA 1YSCA 2ATKC 4MVZA 4X62O 2JJ1G 4B3MO 3SPIA 2R9RB 1T5EA 4FZ1A 3LSSA 4J7KA 5TISZ 2EULA 1DF4A 1XUQA 4FMTA 3D3QA 3W7WA 4LF4B 2WLLA 5B1AB 5LGUA 3ASNC 1NI8A 3OM3B 2AZ2A 2YUAA 3FKSG 3L9DA 4GX0A 4YJ2B 2P67A 5KUMA 4NXMO 1WA8A 4AHCA 4FVMA 4LR3A 3BRCA 4GX1A 4BWAA 1MNGA 2RN9A 2D2CB 3APOA 3G6BA 5J2TA 4LWSA 3NR7A 3TETA 1M57B 3CEIA 4J41A 1Q3EA 1MOFA 2KQXA 1DK1A 2HJFC 3CCUV 3LUTB 3BABA 2QJ1A 3LDDA 2QA4V 3DGEA 4UV8A 5KX5A 4LF5O 5CBGA 2AGAA 4X8AA 4K8ZA 1JJOA 1XNRB 1D2DA 1HWYA 1V55C 4KP4A 2ZT9B 3CB2A 4K8XA 2ZDIC 4KXRA 1K4DC 5LA6B 4J10A 1B6QA 2G38A 1I5XA 4TV8A 2KSDA 2W0XA 3CC4V 3RYIB 2KB1A 2UU9B 1JFFA 2QE7G 4RUEA 2X6BA 4RWUA 1HNZB 5LP6C 2BSKA 4W4KA 1L1FA 4JAAA 4X62B 4DXWA 2BOCC 3CC7V 4NKGB 2WLIA 4DR6O 1XMQO 2F43G 1QVFU 3CRRA 2QM4A 2XTAA 4AI8A 1Y66A 1L0LH 4IT5A 4QPKA 4IGGA 4DO2A 1WLEA 1Y67A 2QM7A 1NTZH 4EB6A 2ADQB 3K3WA 4J42A 2LQTA 5LOVA 4DUYB 1WJZA 4B7EA 4IIJA 4NXMB 4J80A 1SESA 1I08A 1NTMH 4DW0A 5BZBA 3JATA 5EYPB 1J5EO 1ORQC 3GB7C 5ITZA 1FAFA 3CCVV 1O9HA 4L87A 2F66C 4J9YB 1K34A 5CB4B 3T1HO 3B09A 1H2MA 2Y4UA 4G28B 3G67A 1I7FA 4DR1B 4DV3B 3FYIB 4I0XA 1W0KG 1Z2GA 5FL7G 1WP8A 4WF9V 2WSSG 4OGQB 4BIZA 4DV4O 2YIDA 1RSOA 1OHHG 1MZEA 5LL6Y 1NKDA 2PGGA 2ZE6A 5FNVB 2XOKG 3LSUA 4HNAB 1NVPD 4JI7B 4JI2O 1RM1C 3QTCA 3A0BZ 1HNWB 3Q4HB 4X9QA 1VQ8V 5IY5B 5EC2C 4BAYA 5JCOA 4B3SB 4O4IA 1AROP 2GTAA 3R65A 1ZL8B 4RQEA 1M5IA 2QGNA 3OFNG 1M90W 2CH7B 2WLKA 3K79A 1NZ6A 2Q7EA 1WNSA 4DV7O 4JAVA 4TSFG 3SJQC 3AG2B 1QR9A 4WBNB 2QKSA 4G2KA 4I9QA 5CN0A 5IYZB 4LF9O 1BGYH 1KP2A 3T1CA 1EN5A 3L75H 5KHKA 2A9HA 1Q6IA 4JI4B 1SRYA 2ZXWB 4C7UA 3OTOB 3L71H 3OR6C 1NU1H 4O4JB 1XBLA 3QVNA 3P30A 4AQYO 1VEWA 4H0LB 2HR3A 3OEEG 1P4RA 2AXTZ 3E35A 3F7VC 5CMUA 1FXKB 4JYAB 5B3SC 2ZKOA 2CDYA 3ZN1A 2BTQA 2M6YA 2PYLA 2IU0A 2DE0X 3BEHA 4H37A 5KHGA 5JH7B 3RYCB 4BW5A 4MW8A 4UV9A 5IJ0A 4LBEC 2QWRB 1I94B 4GCZA 5EBWC 4DV0O 4FLUA 1F4NA 5LGTA 1K92A 3CCRV 4FJCC 4GX2A 1K8AW 3LSQA 4X88A 1TVKA 1FXHA 1Z5WA 3L72H 1NTKH 2Z5UA 1IBKO 1D5NA 3ABMB 2CTWA 2FTKA 3AG4B 2EIJC 3JAKA 5LXTB 3S3XA 5KMGA 2JGDA 3GWOA 4KFMA 3NXSA 4O4HB 3OUFA 2PYJA 3ABLB 1XL4A 2RJZA 4EFBA 1YTFC 5A2QN 4UB6Z 4MW3A 2R70A 5JCOC 1N34B 3HKBB 5JVDA 1N36B 1IZ3A 2DMXA 2ZE5A 2HG5C 2IJHA 1VQOV 1OJHA 2ZIOA 2HLDG 4WFBV 4YJ3B 4JGSA 3CJHA 5B1NA 2BTOA 3A2FA 4X1KA 2XNDG 2YC0A 1EM1A 3ZHVA 4LH7A 4EEQA 1PPJH 4DV2O 1ROPA 2KG7B 3STZC 3ZN0A 3T4ZA 4I4TA 2WLJA 2HJDA 4LNUB 2VS0A 1KKDA 2X0LA 4Z2WA 1AJPA 1ENVA 2WPDG 2DJVA 1H2KA 1P7BA 2ZNIA 1GH6A 4AQYB 3H1KH 4X1YA 2YDEA 3QO7A 4OPAA 3G4SV 5KHJA 4A5UB 2ZM6B 2B5UA 3JARB 4TWKA 3W7UA 1Y74A 2CE4A 2A3QA 1JPXA 4F6EA 5H6QA 1HR0B 4UCRA 1XMOB 3WB0A 4JV5O 5J2UA 4DR3O 1F4MA 3WB1A 3K5MA 4HZ3A 4JI1B 4GKKB 3AK3A 2UXBB 1SQVH 4IL6Z 3JD3A 5CA3A 4ZHQB 2YXYA 3IJ4A 1OCCC 4GUNA 1BS3A 3UKMA 1IBKB 4FPPA 1MZFA 3ZMVA 4U3JA 4HAMA 2GHYA 1WN7A 1Q6UA 2XAGA 1U96A 3SDLA 2XAFA 4GKJO 4BIUA 4CS4A 3E8GA 1Q8IA 2CTPA 3BA9A 2LFRA 1R3IC 1BL8A 2A06H 3GVMA 4PA7A 4LFAB 1VQ7V 1V55B 3T2MA 3LDCA 4O2AB 4P30A 2ZCEA 3SYQA 4JZGA 1EZVH 2YIBD 3HPLC 1M4UA 3CCQV 4LH6A 4X64O 4J11A 5LP6B 4DV2B 3JAWB 2HVJC 4JTAB 1S72V 3W7TA 2B1IA 1EBOA 3X2QC 4I50A 1E1QG 1K7DA 3K5NA 1LUWA 4NYKA 1GK9A 1BT8A 4JF3A 1N8RW 4JYBA 3E22B 3HR0A 3M99B 2DN9A 2JIZG 1XNQO 2EILC 4KL1A 1BCCH 3EFFK 1HDJA 3UT5A 4MVQA 2Q8VA 3D8CA 4NVPA 2D3OW 3BA8A 4XDLA 1BHBA 4LF4O 4E4EA 3ZX6A 4JV5B 3QNEA 1KQSU 4DR3B 4R6ZA 5JWPA 3P32A 3C90A 3OMIB 3RYFA 2UUAB 4I7ZB 4PHZA 1QBZA 3N2GB 5J2TB 2QM8A 1AR1B 3EHBB 4H44B 2Y69C 2EIKC 4F6RB 3E8HA 2EINB 2H3OA 2Y48A 3SPGA 2Q73A 2ZINA 1JQ0A 2XHBA 3BVOA 2P90A 1SQGA 3HKCA 4FFBA 3VQVA 5L3CA 3J80N 2F95B 2Q69A 2EBOA 2XAQA 2K1EA 1KECA 1Q86W 4JI8O 1MMMA 2CGOA 2OYQA 1XNRO 2WAMA 3ASOC 1RM1B 3FX7A 1PNKA 4LCUC 1LR1A 1LNQA 4FM2A 3TXQA 4DV1B 1YVWA 1HW7A 2ZR2A 5H9CA 1TA8A 1JFFB 1US6A 1VARA 3TCUA 3ZRVA 2UU9O 2BSKB 1K5QA 3S3WA 2UUCO 2JVDA 5CA1A 1G8MA 2EX3A 4PELA 1KKCA 1KU9A 1E1RG 2QR4A 3THOA 3JCUZ 4DR4B 1XNQB 5KAIZ 1Q82W 2NLJC 2OIGA 5H5NA 3FFQA 1R6KA 3DC5A 3CE2A 4ZI7A 2RDCA 3B8NA 4MSWC 4MTXA 3K5LA 1AP6A 1GN2A 4Q20A 3UO2A 2IJIA 1KUQA 4IHJA 4Z1MG 1FKAO 4XDKA 4H33A 1K9MW 1Y76B 2LGQA 3CP1A 5CA0A 4IIJB 4PA9A 3K03A 3JASB 4DUYO 3KCYA 3AG3C 4UCUA 5EZYA 1UFIA 2VQEO 2QTSA 4N23A 3OE7G 5C8YA 1PP9H 3MDSA 2YEVA 1V54C 2YIAA 3VOUA 4J7JA 1S77D 1THZA 4H13B 5BMVA 3BPZA 2Z0AA 1GTOA 1TUBA 3JALB 1JJ2U 2E76B 4I0XB 3JAMN 4KHPO 4DR1O 4DV3O 4WFAV 2Q7HA 2FL4A 5IWAB 1VQ4V 3OD4A 4JI8B 2AZ0A 2EIJB 2JS3A 5JQGA 1JX9A 1MABG 1GM7A 2W6IG 4FLVA 2RNBA 3CC2V 1PM9A 2Q9LA 4BIOA 1KP3A 4JI5B 4JI7O 1N32B 3SPHA 3K04A 4LFBB 3SYPA 1HNWO 2QWQB 2JK5C 1K73W 2YI8A 2UUCB 3K0DA 4B3SO 2DOSA 2YXLA 1YCIA 4B3TB 2DQ3A 2VQFO 1TAEA 5IT9N 2ADPA 3N2KB 5HFLA 3SPJA 2P5OA 3E83A 2CUGA 3FAVB 4U3FH 4QNHB 1HNXB 2Y4TA 1EZJA 4X1IA 3W7SA 4KUMA 2K9PA 1S76D 2X6AA 1WB8A 4GZRB 2XT9A 2VWJA 3ZHUA 4MTFA 4JI4O 2BOBC 2Y0IA 3OTOO 4JAUA 3OMAB 2VQEB 4DRXB 2PZSA 1K97A 5FLXN 2BTQB 4JYAO 1B06A 1XQ8A 1NVPC 5IDJA 4TT3G 3LNMB 4PV1B 1S5JA 2P22C 5IJ0B 1XI1A 5D5QA 4YJ2A 4DR2B 4D7TA 1Y6XA 2ZE8A 5BXZA 4KHPB 4TV9B 1I94O 5L3EA 4IYIA 4DV6B 1YIJV 3KCXA 3U0ZA 1RP3B 5B1BC 4X66B 4P9PA 3CX5F 3QO5A 3JAKB 3CCEV 1YJWV 2JEUA 5EK0A 5KMGB 4MVRA 3DXRB 2JGDB 2EZPA 1EFRG 3ZRXA 1R3JC 1UJWB 1G6UA 3PJSK 2QWPB 4O2BB 4E2LA 3QF7A 1M9NA 2LFSA 5J9PC 1N0NA 1VMGA 3MAQA 2CGNA 1H2NA 1BSMA 5JVDB 4JYYA 3ZHTA 1N34O 1KB9F 2WLHA 1N36O 2AW9A 1H2GA 4W4LA 2VQFB 2HHHB 2IBZH 3H1IH 4X1KB 2YS8A 3L70H 3X2QB 1L0NH 1XDCA 2OCCC 2RCVA 5GTIZ 1FJGO 1ZSPA 2V4DA 1NJIW 3P3PA 3RGBA 3ABUA 2OT5A 2EILB 5L3FA 4NB5A 4JI0B 3OR7C 3MHSC 2A7WA 3CRAA 4MTGA 3T1YB 4X1YB 4OX9O 5B66Z 4PDVA 1F7YA 1XEQA 3LNNA 4LC1A 1DLBA 1XREA 1IX9A 4PI0A 4UVBA 4FIPC 1I0HA 4NR1A 1O9GA 2ZM6O 3H1LH 2HVKC 2UUBB 1QHTA 2VWKA 5J2UB 2ILMA 1HR0O 1XMOO 2MW2B 4RO2A 2M7WA 5LMNB 5GW7A 1SETA 4FLYA 4JTCB 2Q68A 2N04A 1H38A 1NH2C 2R9AA 4JI1O 4GKKO 2YIBA 1SQQH 2GBOA 2UXBO 2Y69B 1SQBH 2BCCH 5EYPA 3H01A 2QDOA 4PDMA 3W7XA 3B40A 3K06A 2PUSA 2IJKA 5CB4A 1IURA 5F2VO 3STLC 2EZOA 3CRCA 2EIMC 1DF5A 1ZAUA 5KAFZ 1X59A 1IBMO 1K3EA 1MA1A 1R6TA 2HFEC 2L35A 3HB3B 4F4LA 4ZOLA 4HBNA 4YY3B 3ASOB 4LFAO 5B5EZ 3ETEA 4EKWA 1HP8A 2HEPA 5D5PA 1JVMA 2JS5A 2LGWA 1XHZA 1VQ9V 5FNVA 5B1OA 2N05A 4HNAA 2FB5A 1QLNA 4TOIA 2E74B 1RPOA 1FJGB 2E5LB 4O4LA 1OZ0A 3O65A 3CWBH 4FLWA 1G4YB 2GTSA 1P49A 3SYAA 1IBLB 1K33A 3VQWA 3HKEA 2CH7A 1AI4A 3UT5B 4JI6B 4OX9B 1SKVA 1KBHA 5IE9A 2YXHA 1D5AA 4WBNA 2MK3A 3CXCU 1URFA 5IYZA 2B1GA 3ASNB 3SR2C 1CEZA 1YJNV 5JJNB 4JPRA 3AG3B 3U11A 4NTYA 1YDXA 2ZIMA 1NS1A 1ZTEA 1AJQA 5GONA 2L6LA 3RYFB 3ETQA 3ZMZA 1QCEA 5BR8B 1A32A 1V54B 4X20B 2UUAO 2Q0OC 3JSLA 3AG1C 1BMFG 1NR1A 4PDLA 2UXCB 4I5SA 3SGIA 3B2EE 3SYOA 2Y0PA 1QQCA 4LFCB 1QLEC 1YHQV 5JH7A 3RYCA 1YZBA 1VQMV 1S5LZ 2ARHA 2C2AA 2JRIA 1YITV 1N33B 4BW9A 1IBMB 2CAZC 4TQDA 3CRQA 3ZMSA 2E3CA 4I9WA 1K4CC 4HYOA 2JGUA 2QWNB 4DUZO 3MHHC 1JMKC 5LXTA 4DV1O 4WFEA 4RAIA 4JI3B 3FD9A 1AB3A 3BY6A 5FPRA 1AP5A 4K3AA 4O4HA 5CA1B 2F93B 1M56C 2OCHA 1AVMA 4L8JA 3OTFA 1AI5A 2ZNJA 4MT8A 3HKBA 3J81N 4DR4O 2BE3A 1OCZC 1SF9A 3UQ8A 2UXDB 4DW1A 5EIBD 1PKXA 3C3TA 3E89A 4LF7B 3ZIAG 3K9SA 3QO8A 1KD1W 3R66A 4LF6B 2F1MA 2GUZA 2NNUA 3IC9A 4GT1A 3A0HZ 2KG7A 2WLLB 3K9AA 4G27B 2P7TC 2LP7A 4LNUA 1CXZB 1RPRA 3AEIA 2DWEC 1GM9A 2ZXWC 4IYHA 5EZYB 3SJCC 1WP7A 1DTOA 4AILC 1WA8B 4X65O 5C8YB 1FFXA 1NVPB 1GMGA 1VQKV 1Q81W 1IVSA 1R1BA 4LWSB 1RFYA 1YJ9V 4CH3A 1XILA 3QG5A 5DECA 3BAAA 4JASA 5H2FZ 3BCCH 3ZRSA 1TUBB 3JD1A 1SQFA 2IH1C 4DR5B 5K1XA 1VIBA 1SA0A 4FZ0A 3WB2A 2DYSC 3G6EV 4P9OA 5B1BB 4RQFA 3K57A 2OTJV 5KX5B 4ICGA 2HKOA 4FM0A 4NTWA 1FPOA 3FB7C 4DR7B 5IWAO 1AI7A 3IC7A 5JQGB 2E75B 4U7OA 4YHHO 5KA5A 4I55A 4DUZB 3ABMC 3AG4C 4TV8B 1PD3A 4JI5O 1N32O 1WB7A 4LFBO 2IH3C 2FMLA 3ZEDA 5LMUB 1KYOF 2LW1A 4PD4F 1N0JA 3A8TA 3B77A 5IJ9A 4ZBMA 4B3RO 4TUYA 3ZBHA 1IDSA 1VF7A 3KKYA 5JJEB 2WLIB 4B3TO 4K35A 2V7QG 3D36A 3EXAA 3ZCCA 2OCCB 4YIPA 3RFRA 3ICXA 2NR5A 2DYRC 4DK0A 3OAAG 1EN4A 1JCHA 1HNXO 3JD2A 3JAWA 4X1IB 2WA4A 3WFVA 5IYBO 4ABMA 3I56V 3IGAC 4RUFA 4EB6B 5DEDA 3L73H 4PI2A 4CBCA 4FFKA 5LOVB 3E22A 2YICA 3ZRWA 4U7NA 3CD6V 1VQLV 3JD4A 3RN4A 3RYHA 4X65B 1SQXH 1U97A 2O57A 2V1DA 2PTMA 5B3SB 3WG7C 2LO1A 3JATB 4UCOA 2P4VA 3IAYA 5ITZB 3OEHG 4QE7A 4UVCA 3ZMTA 1J95A 4FM1A 3AK2A 2IW5A 2WLNA 1NH2B 1JA8A 1AILA 2ZE7A 4PJ0Z 2RMKB 4J7ZA 2XAHA 3JSNA 4DR2O 3N27A 3TGUH 4DV5O 2XAJA 1KMIZ 4DV6O 3N2GA 3VQXA 3ZMUA 3CMEV 4X66O 1RSOB 2DW4A 4YHHB 2F4VB 1SERA 4F6RA 2ZR3A 5KA6A 3M7MX 2EIMB 3K5OA 5KHHA 4QPJA 5LGNA 4UVAA 1SZTA 3HKDA 1VF6A 1YTFB 1M93A 2W6JG 3TJTA 5LYJA 2F23A 1TGOA 3UM7A 4Z1VA 1QR8A 5KUKA 4O4IB 2Q5ZA 5LBQA 4B3RB 2P6JA 1AR5A 3OGCC 3ZHSA 5DM6V 1NT2B 2XUMA 4R8CA 1B04A 4WCEV 4MVSA 1IXMA 4P2ZA 4MS2A 2HHHO 1H2SB 3D36C 1N4CA
chains in the Genus database with same CATH topology
4LC1A 1DLBA 3D3IA 2PI4A 4J9ZB 3JD3A 1VQPV 5CA3A 3CCSV 4UVBA 4QJFB 2A0LA 4FIPC 3ABLC 1MG1A 1OCCC 2HVKC 4R50A 3UKMA 3ABKB 4FPPA 3KG2A 3ZMVA 2ZDIA 4MVMA 1NQTA 1VQNV 1OCRB 3B8MA 4RO2A 2M7WA 4HAMA 2GHYA 4JYCA 5GW7A 1SETA 3SPCA 2XAGA 2WWWA 4MTOA 2XAFA 1OCOC 4JTCB 4PA6A 2Q68A 1FXVA 3CPWU 4BIUA 3ETDA 1H38A 3E8GA 1NH2C 2IU3A 4ASUG 1AI6A 2LFRA 2Y69B 1R3IC 1BL8A 5EBMC 2DQ0A 3JYCA 4PA7A 1R73A 3DTUB 5L3GA 3H01A 1VQ7V 1V55B 3T2MA 3LDCA 4PDMA 3W7XA 1YSCA 2ATKC 4P30A 3SYQA 3K06A 4FK5C 2IJKA 4MVZA 2JJ1G 3HPLC 2IJJA 1KC8W 3SPIA 2R9RB 3G71V 3LSSA 3STLC 2EZOA 5LHHA 3CCQV 3AG1B 2EIMC 1YI2V 1DF5A 4UUJC 1DF4A 1NR7A 1PNMA 4FMTA 2HVJC 4JTAB 5EC1C 1S72V 3W7TA 1K3EA 3W7WA 1OCCB 2B1IA 1EBOA 2HFEC 3K0GA 3X2QC 1E1QG 3HB3B 1K7DA 2WLLA 4QIWF 4F4LA 1GK9A 5B1AB 3ASOB 4JF3A 5LGUA 3ASNC 1QLEB 3ETEA 3OM3B 1N8RW 4JYBA 4EKWA 3FKSG 3M99B 1JVMA 2JIZG 2EILC 4GX0A 1VQ9V 2EINC 3EFFK 5B1OA 5E1AC 3VBBA 4MVQA 2P67A 5KUMA 1S5HC 1QLNA 4PA3A 2EJRA 5IYCO 2D3OW 4GX1A 1RPOA 1QVGU 1S0VA 3LDEA 4XDLA 1OZ0A 1G4YB 1BHBA 3TETA 1M57B 3SYAA 1TUEB 1K33A 1MOFA 1W0JG 3QNEA 1M1KW 1KQSU 1AI4A 3ABKC 4R6ZA 2DWDC 2HJFC 3P32A 3T4DA 3OMIB 1OCRC 3CCUV 1M56B 3LUTB 2PI5A 3LDDA 2QA4V 1QBZA 2MK3A 3DGEA 4UV8A 3CXCU 1VQ6V 2QM8A 1AR1B 5CBGA 2B1GA 3ASNB 3EHBB 4X8AA 1CEZA 1YJNV 2Y69C 1HWYA 1GO3F 2EIKC 1OCZB 3JCZA 3RVYA 3E8HA 2EINB 4JPRA 1V55C 2Z3YA 3AG3B 4KP4A 2Y48A 2ZDIC 3SPGA 1AJQA 1H8HG 1K4DC 1JQ0A 1B6QA 3ZMZA 1I5XA 1QCEA 4QE9A 2P90A 1V54B 5L3BA 3CC4V 2KB1A 2QE7G 4PA4A 3AG1C 4RUEA 5L3CA 1BMFG 2X6BA 1NR1A 4PDLA 2Q69A 4I5SA 2EBOA 2XAQA 2K1EA 3CYOA 1KECA 4JTDB 4LP8A 1L1FA 1Q86W 1E79G 3RW0A 3SYOA 4DXWA 2BOCC 2WAMA 5B1AC 3ASOC 1RM1B 3CC7V 1PNKA 4LCUC 2WLIA 2Q6AA 1LNQA 1QLEC 1YHQV 2F43G 1QVFU 1VQMV 2ZR2A 3SYCA 1Y66A 5H9CA 2C2AA 1YITV 1F51A 1FFTB 5LHGA 3TCUA 4ZKIA 4QPKA 4OXSA 3ZRVA 2ZD9A 4WFHA 1K5QA 2JJ2G 2EIKB 4DO2A 1WLEA 3ZMSA 1G8MA 5CBFA 2QM7A 4PELA 1E1RG 1Q7YW 3K3WA 4I9WA 4R7CA 1K4CC 1Q82W 2NLJC 2DYSB 1M57C 4HYOA 4UXNA 2XASA 4PDRA 3MHHC 1JOYA 1R6KA 4WFEA 4RAIA 3K08A 1XL6A 1SESA 3BY6A 3B8NA 4MSWC 4MTXA 5BZBA 1M56C 1ORQC 2JEXA 3GB7C 4Q20A 2IJIA 3E8BA 3CCVV 1AI5A 4Z1MG 4L87A 4MT8A 3RBZA 4J9YB 1K34A 2ITDC 4XDKA 4H33A 1K9MW 2ZQMA 1OCZC 2R9IA 3CP1A 4PA9A 3K03A 3F5WC 3E2EA 4G28B 1PKXA 3AG3C 3I55V 3E89A 3FYIB 3RVZA 3ZIAG 4X89A 3QO8A 1KD1W 3FB8C 4N23A 2X7RB 3OE7G 3A0RA 1W0KG 2NNUA 1BHAA 2X6CA 4GT1A 2YEVA 1V54C 2WLLB 5FL7G 3K9AA 1NH2D 4G27B 4WF9V 3VOUA 2WSSG 4BIZA 2P7TC 2LP7A 1OHHG 1S77D 1THZA 1NKDA 2GSMB 1RPRA 3AEIA 2DWEC 1K5SA 2XOKG 1NVPD 1GM9A 1GTOA 2DYRB 2ZXWC 4WFGA 1RM1C 1JJ2U 1DTOA 1VQ8V 5IY5B 4WFAV 1VQ5V 1NVPB 1GMGA 5EC2C 1VQKV 1S3JA 4BAYA 2UXNA 4WFFA 1Q81W 1AROP 1YJ9V 1VQ4V 3F7YC 3R65A 3CCMV 3FYEB 4RQEA 2EIJB 1JX9A 4JASA 3OFNG 1M90W 1YTFD 2WLKA 3K79A 3ZRSA 1MABG 1GM7A 2AHZA 2W6IG 4MVOA 3CC2V 3JD1A 1R3LC 2IH1C 4JAVA 1KP3A 3WG7B 4TSFG 3SPHA 2DYSC 3K04A 3G6EV 3SJQC 3SYPA 3AG2B 1QR9A 4P9OA 2JK5C 1CPYA 2QKSA 4G2KA 5B1BB 5CN0A 4RQFA 1WPXA 2OTJV 1K73W 2HKOA 5L3DA 3CCJV 3FB7C 3K0DA 1AI7A 1FXKA 1KP2A 3IC7A 1Y4MA 3T1CA 1PL0A 3CMAV 2A9HA 4U7OA 5KA5A 1SRYA 2ZXWB 2DQ3A 2AHYA 3ABMC 3OR6C 3AG4C 5HFLA 3SPJA 4XBFA 1W2BU 3E8FA 5C93A 3P30A 1PD3A 3E83A 5LHIA 2UXXA 4XDJA 2IH3C 4QNHB 2HR3A 3OEEG 1P4RA 1EZJA 3E35A 3F7VC 5CMUA 1FXKB 5B3SC 3W7SA 4KUMA 3B77A 1S76D 3ZN1A 1R3KC 2X6AA 3ML0A 4YXWG 4ZBMA 2IU0A 1ZWIC 2WLIB 3BEHA 4H37A 4MTFA 2BOBC 4BW5A 4MW8A 2V7QG 4UV9A 1COWG 3OW2U 3D36A 4JAUA 2W0FC 2CK3G 3OMAB 4LBEC 3ZCCA 2OCCB 4GCZA 5EBWC 1F4NA 2DYRC 5LGTA 3OAAG 1K92A 5IYDO 3CCRV 4FJCC 1JCHA 3JD2A 4GX2A 3WFVA 1K8AW 5IY5C 5IYBO 1NBMG 3LSQA 3FB5C 1K97A 4MVUA 4X88A 4CZZA 1NVPC 5IDJA 1FXHA 3I56V 3IGAC 4RUFA 3E86A 4TT3G 3LNMB 2Z5UA 4CBCA 3CCLV 3ABMB 2FTKA 3ABTA 3AG4B 5CBHA 2WLMA 2EIJC 2ITCC 3ZRWA 4U7NA 2QTOA 3CD6V 2H8PC 5HFMA 1VQLV 3JD4A 3GWOA 4KFMA 2V1DA 3FB6C 3NXSA 5B3SB 3OUFA 5L3EA 3ABLB 3WG7C 1XL4A 1YIJV 1YTFC 3AG2C 2JDIG 3IFXA 4MW3A 5B1BC 3OUSA 3OEHG 4QE7A 2A79B 4UVCA 1MSWD 3ZMTA 1J95A 3ZJZA 4P9PA 1OCOB 2HG5C 2IJHA 2Q67A 3QO5A 3ZRWB 2IW5A 3CCEV 1VQOV 2WLNA 1YJWV 1NH2B 2JEUA 5EK0A 3JD0A 2HLDG 4WFBV 1I5YA 4MVRA 2QEXV 2EZPA 1EFRG 2XAHA 4JGSA 3ZRXA 5B1NA 1H8EG 2XNDG 1R3JC 3MD0A 1UJWB 3PJSK 2XAJA 4E2LA 1M9NA 1ROPA 2YEVB 2LFSA 3STZC 1CP9A 3ZN0A 3T4ZA 3ZMUA 5J9PC 3CMEV 3OMNB 2WLJA 2DW4A 1FXKC 1GKFA 1SERA 1KKDA 2WLHA 1R6NA 2X0LA 1AJPA 2ZR3A 4GX5A 1H2GA 1ENVA 4N21A 5KA6A 2EIMB 2WPDG 4QPJA 5LGNA 1P7BA 4UVAA 1SZTA 3TK1A 1YTFB 3X2QB 2OTLV 2W6JG 3QO7A 3G4SV 5H6RA 2OCCC 3UM7A 1QR8A 1NJIW 5KUKA 1F23A 5EBLC 2B5UA 4TWKA 3W7UA 2YSUB 3ETGA 5LBQA 3ABUA 2OT5A 1FS0G 1JPXA 2EILB 2P6JA 5H6QA 3OGCC 5L3FA 5DM6V 4R8CA 4WCEV 4MVSA 1IXMA 4P2ZA 3OR7C 3MHSC 4MS2A 4MTGA 5DN6G 1PNLA 1F4MA 4PDVA 4HZ3A 1AJNA 2H94A 1GM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NH2 D;  1YTF D;  5IYD O;  1RM1 C;  1NVP C;  1RM1 B;  1YTF C;  1NH2 C;  5IYB O;  1NVP D;  5IYC O; 
#chains in the Genus database with same CATH topology
 3D3I A;  1ZX3 A;  1WAZ A;  1VQP V;  3CCS V;  1MG1 A;  1FD9 A;  3ZHQ A;  4QGP A;  4B3M B;  3L74 H;  1VQN V;  3BFR A;  3SPC A;  1YF2 A;  4JI0 O;  4PA6 A;  1OCO C;  2B9Z A;  1FXV A;  3CPW U;  3PN1 A;  3ETD A;  3T1Y O;  1AI6 A;  2QKA A;  2DQ0 A;  1R73 A;  4D6T H;  2P06 A;  4FK5 C;  2UUB O;  2IJJ A;  1KC8 W;  1Y76 A;  3G71 V;  5LMN O;  3JAS A;  1XHX A;  5LHH A;  3AG1 B;  4BR6 A;  1YI2 V;  4DV5 B;  4UUJ C;  3CSX A;  3GWK C;  1NR7 A;  1PNM A;  5EC1 C;  1OCC B;  4GYC B;  3K0G A;  4QIW F;  1TVK B;  3M8A A;  1QLE B;  4CC5 A;  2EIN C;  5E1A C;  3VBB A;  1S5H C;  3CHX A;  3JAL A;  4FLX A;  4PA3 A;  2EJR A;  3WU2 Z;  5IYC O;  1VF6 C;  1QVG U;  4UB8 Z;  4CC6 A;  4NTX A;  4LF5 B;  1S0V A;  4ZOL B;  3LDE A;  4YIO A;  2QSA A;  4YY3 O;  1TUE B;  1W0J G;  1M1K W;  2LJ2 A;  3ABK C;  2DWD C;  1XOU A;  3T4D A;  3CJH B;  5LA6 A;  1OCR C;  1M56 B;  3APQ A;  2PI5 A;  3RYI A;  4O4L B;  1VQ6 V;  2E5L O;  4I4T B;  2N74 A;  4ZIB A;  1GO3 F;  1OCZ B;  3JCZ A;  2Q4P A;  3HKE B;  2R72 A;  3RVY A;  5E79 Z;  1Q90 D;  2Z3Y A;  4DR6 B;  1XMQ B;  1IBL O;  1H8H G;  1YEW A;  4DYL A;  4JI6 O;  3N2K A;  4QE9 A;  4CH4 A;  3FAV A;  5L3B A;  2NN4 A;  5BY1 A;  4PA4 A;  5JJJ B;  1BQZ A;  5FPO A;  1Y74 B;  1Z5V A;  3CYO A;  4JTD B;  3K58 A;  4LP8 A;  1E79 G;  1LUV A;  3RW0 A;  3DSQ A;  5B1A C;  5GON B;  3CRM A;  1Q5O A;  1MSD A;  2Q6A A;  3SYC A;  1P84 F;  2EJ7 A;  5BR8 O;  1F51 A;  1FFT B;  3UCS C;  5LHG A;  4ZKI A;  3OT7 A;  4DRX A;  4OXS A;  2ZD9 A;  4WFH A;  1J5E B;  2JJ2 G;  2EIK B;  2UXC O;  1QNM A;  5CBF A;  2PF4 E;  3DC6 A;  3C3S A;  1Q7Y W;  4U3J B;  4R7C A;  1PV0 A;  3T1H B;  2DYS B;  3F5T A;  2FYU H;  1BE3 H;  1M57 C;  3U10 A;  4UXN A;  2XAS A;  4PDR A;  4LFC O;  1JOY A;  4UFZ A;  3K08 A;  4GLX A;  2OWO A;  1XL6 A;  2GDS A;  4TV9 A;  2KKW A;  1VP7 A;  1N33 O;  2JEX A;  4DV4 B;  2OIE A;  3E8B A;  3RBZ A;  1GN4 A;  5KLV H;  2ITD C;  2ZQM A;  2R9I A;  4JI2 B;  3H9V A;  1H2L A;  3F5W C;  3E2E A;  2VRZ A;  3DXR A;  3I55 V;  3RVZ A;  4X89 A;  3FB8 C;  3Q4H A;  4JI3 O;  2X7R B;  3A0R A;  5GTH Z;  2QKC A;  4I50 B;  1BHA A;  4O2B A;  2X6C A;  3B4S A;  4EFE A;  1NH2 D;  5AG2 A;  1ZL8 A;  2GSM B;  1ZLZ A;  4DV7 B;  4UCV A;  1K5S A;  2DYR B;  4WFG A;  2CTR A;  2UXD O;  2GUZ B;  3ZS8 C;  4LF7 O;  2ETN A;  1VQ5 V;  4LF6 O;  1S3J A;  4LF9 B;  2UXN A;  4WFF A;  3F7Y C;  2Q0A A;  3CCM V;  3FYE B;  4CS2 A;  4LF8 O;  3SJA C;  1YTF D;  1X4T A;  1SQP H;  2FKX A;  2AHZ A;  3K59 A;  4MVO A;  1G1X B;  1R3L C;  4TQF A;  3WG7 B;  4O4J A;  4Q6G A;  1FFX B;  1BQ0 A;  1WPB A;  1CPY A;  3I5D A;  2P4K A;  1WPX A;  5L3D A;  3CCJ V;  3SJB C;  1FXK A;  1Y4M A;  3J7A U;  1PL0 A;  3CMA V;  4OPH A;  2AHY A;  1SA0 B;  1Q6H A;  4UCS A;  4XBF A;  4DV0 B;  4DR5 O;  1W2B U;  3E8F A;  5C93 A;  5LHI A;  1W59 A;  2UXX A;  4XDJ A;  3HKC B;  4FFB B;  2CTQ A;  2WA3 A;  1JR9 A;  1V9P A;  1R3K C;  5EIB C;  3RWR D;  4DR7 O;  2YI9 A;  3ML0 A;  4YXW G;  1ZWI C;  4I55 B;  4NXN O;  3H1J H;  1GN6 A;  1COW G;  3OW2 U;  2W0F C;  2CK3 G;  4DK1 A;  2RQ6 A;  1UPG A;  5IYD O;  1PL4 A;  1GAX A;  1P7G A;  5IY5 C;  5IJ9 B;  1NBM G;  5LMU O;  3FB5 C;  4MVU A;  4CZZ A;  2Q7G A;  4TUY B;  3E86 A;  3CCL V;  4K0K O;  3ABT A;  5CBH A;  2WLM A;  2ITC C;  2QTO A;  3RT3 C;  2H8P C;  5HFM A;  4JZ2 A;  1B3Q A;  4ZI7 B;  1OV9 A;  4YJ3 A;  1SC5 B;  3FB6 C;  4D7S A;  3AK1 A;  3AG2 C;  2JDI G;  4FLZ A;  3IFX A;  1Q43 A;  3OUS A;  4IHJ B;  2A79 B;  4LF8 B;  1MSW D;  3ZJZ A;  4CH6 A;  3VQY A;  1OCO B;  2Q67 A;  3ZRW B;  5CA0 B;  3BHP A;  2LW7 A;  3JD0 A;  3RYH B;  1I5Y A;  3UO3 A;  2QEX V;  1H8E G;  1AR4 A;  3MD0 A;  3P3N A;  3O9O A;  2YEV B;  1BZK A;  1GRJ A;  1CP9 A;  4CH5 A;  3OMN B;  3JAR A;  1FXK C;  1DGS A;  1GKF A;  5BMV B;  1R6N A;  1L8D A;  4GX5 A;  4N21 A;  3CXH F;  5KHI A;  3OGI B;  3TK1 A;  3H1H H;  2QWO B;  2OTL V;  4X20 A;  5H6R A;  2PY5 A;  4B08 A;  1SZX A;  1IXB A;  1F23 A;  5EBL C;  4ZHQ A;  2YSU B;  3ETG A;  1FS0 G;  4NXN B;  3KZI Z;  2F4V O;  1VF5 B;  2ODM A;  2IM9 A;  3HKD B;  4FLT A;  4GKJ B;  5DN6 G;  1PNL A;  4CS3 A;  3TXS A;  1EN6 A;  1AJN A;  2H94 A;  5LYJ B;  1GM8 A;  2HP8 A;  1FYJ A;  2GV9 A;  2PI4 A;  4J9Z B;  3G80 A;  4QJF B;  2A0L A;  3ABL C;  5K1P A;  3ZHR A;  4R50 A;  3ABK B;  4UCT A;  4K0K B;  4O2A A;  4B7K A;  3KG2 A;  2ZDI A;  4MVM A;  1NQT A;  1OCR B;  3B8M A;  3CS5 A;  4JYC A;  4MTO A;  2WWW A;  1QU7 A;  3AG7 A;  4X64 B;  3EVK A;  2IU3 A;  1GN3 A;  4ASU G;  5A9G A;  5LP6 A;  5EBM C;  3JYC A;  1HNZ O;  3DTU B;  5L3G A;  1ZUQ A;  1SS3 A;  1YXB A;  1YSC A;  2ATK C;  4MVZ A;  4X62 O;  2JJ1 G;  4B3M O;  3SPI A;  2R9R B;  1T5E A;  4FZ1 A;  3LSS A;  4J7K A;  5TIS Z;  2EUL A;  1DF4 A;  1XUQ A;  4FMT A;  3D3Q A;  3W7W A;  4LF4 B;  2WLL A;  5B1A B;  5LGU A;  3ASN C;  1NI8 A;  3OM3 B;  2AZ2 A;  2YUA A;  3FKS G;  3L9D A;  4GX0 A;  4YJ2 B;  2P67 A;  5KUM A;  4NXM O;  1WA8 A;  4AHC A;  4FVM A;  4LR3 A;  3BRC A;  4GX1 A;  4BWA A;  1MNG A;  2RN9 A;  2D2C B;  3APO A;  3G6B A;  5J2T A;  4LWS A;  3NR7 A;  3TET A;  1M57 B;  3CEI A;  4J41 A;  1Q3E A;  1MOF A;  2KQX A;  1DK1 A;  2HJF C;  3CCU V;  3LUT B;  3BAB A;  2QJ1 A;  3LDD A;  2QA4 V;  3DGE A;  4UV8 A;  5KX5 A;  4LF5 O;  5CBG A;  2AGA A;  4X8A A;  4K8Z A;  1JJO A;  1XNR B;  1D2D A;  1HWY A;  1V55 C;  4KP4 A;  2ZT9 B;  3CB2 A;  4K8X A;  2ZDI C;  4KXR A;  1K4D C;  5LA6 B;  4J10 A;  1B6Q A;  2G38 A;  1I5X A;  4TV8 A;  2KSD A;  2W0X A;  3CC4 V;  3RYI B;  2KB1 A;  2UU9 B;  1JFF A;  2QE7 G;  4RUE A;  2X6B A;  4RWU A;  1HNZ B;  5LP6 C;  2BSK A;  4W4K A;  1L1F A;  4JAA A;  4X62 B;  4DXW A;  2BOC C;  3CC7 V;  4NKG B;  2WLI A;  4DR6 O;  1XMQ O;  2F43 G;  1QVF U;  3CRR A;  2QM4 A;  2XTA A;  4AI8 A;  1Y66 A;  1L0L H;  4IT5 A;  4QPK A;  4IGG A;  4DO2 A;  1WLE A;  1Y67 A;  2QM7 A;  1NTZ H;  4EB6 A;  2ADQ B;  3K3W A;  4J42 A;  2LQT A;  5LOV A;  4DUY B;  1WJZ A;  4B7E A;  4IIJ A;  4NXM B;  4J80 A;  1SES A;  1I08 A;  1NTM H;  4DW0 A;  5BZB A;  3JAT A;  5EYP B;  1J5E O;  1ORQ C;  3GB7 C;  5ITZ A;  1FAF A;  3CCV V;  1O9H A;  4L87 A;  2F66 C;  4J9Y B;  1K34 A;  5CB4 B;  3T1H O;  3B09 A;  1H2M A;  2Y4U A;  4G28 B;  3G67 A;  1I7F A;  4DR1 B;  4DV3 B;  3FYI B;  4I0X A;  1W0K G;  1Z2G A;  5FL7 G;  1WP8 A;  4WF9 V;  2WSS G;  4OGQ B;  4BIZ A;  4DV4 O;  2YID A;  1RSO A;  1OHH G;  1MZE A;  5LL6 Y;  1NKD A;  2PGG A;  2ZE6 A;  5FNV B;  2XOK G;  3LSU A;  4HNA B;  1NVP D;  4JI7 B;  4JI2 O;  1RM1 C;  3QTC A;  3A0B Z;  1HNW B;  3Q4H B;  4X9Q A;  1VQ8 V;  5IY5 B;  5EC2 C;  4BAY A;  5JCO A;  4B3S B;  4O4I A;  1ARO P;  2GTA A;  3R65 A;  1ZL8 B;  4RQE A;  1M5I A;  2QGN A;  3OFN G;  1M90 W;  2CH7 B;  2WLK A;  3K79 A;  1NZ6 A;  2Q7E A;  1WNS A;  4DV7 O;  4JAV A;  4TSF G;  3SJQ C;  3AG2 B;  1QR9 A;  4WBN B;  2QKS A;  4G2K A;  4I9Q A;  5CN0 A;  5IYZ B;  4LF9 O;  1BGY H;  1KP2 A;  3T1C A;  1EN5 A;  3L75 H;  5KHK A;  2A9H A;  1Q6I A;  4JI4 B;  1SRY A;  2ZXW B;  4C7U A;  3OTO B;  3L71 H;  3OR6 C;  1NU1 H;  4O4J B;  1XBL A;  3QVN A;  3P30 A;  4AQY O;  1VEW A;  4H0L B;  2HR3 A;  3OEE G;  1P4R A;  2AXT Z;  3E35 A;  3F7V C;  5CMU A;  1FXK B;  4JYA B;  5B3S C;  2ZKO A;  2CDY A;  3ZN1 A;  2BTQ A;  2M6Y A;  2PYL A;  2IU0 A;  2DE0 X;  3BEH A;  4H37 A;  5KHG A;  5JH7 B;  3RYC B;  4BW5 A;  4MW8 A;  4UV9 A;  5IJ0 A;  4LBE C;  2QWR B;  1I94 B;  4GCZ A;  5EBW C;  4DV0 O;  4FLU A;  1F4N A;  5LGT A;  1K92 A;  3CCR V;  4FJC C;  4GX2 A;  1K8A W;  3LSQ A;  4X88 A;  1TVK A;  1FXH A;  1Z5W A;  3L72 H;  1NTK H;  2Z5U A;  1IBK O;  1D5N A;  3ABM B;  2CTW A;  2FTK A;  3AG4 B;  2EIJ C;  3JAK A;  5LXT B;  3S3X A;  5KMG A;  2JGD A;  3GWO A;  4KFM A;  3NXS A;  4O4H B;  3OUF A;  2PYJ A;  3ABL B;  1XL4 A;  2RJZ A;  4EFB A;  1YTF C;  5A2Q N;  4UB6 Z;  4MW3 A;  2R70 A;  5JCO C;  1N34 B;  3HKB B;  5JVD A;  1N36 B;  1IZ3 A;  2DMX A;  2ZE5 A;  2HG5 C;  2IJH A;  1VQO V;  1OJH A;  2ZIO A;  2HLD G;  4WFB V;  4YJ3 B;  4JGS A;  3CJH A;  5B1N A;  2BTO A;  3A2F A;  4X1K A;  2XND G;  2YC0 A;  1EM1 A;  3ZHV A;  4LH7 A;  4EEQ A;  1PPJ H;  4DV2 O;  1ROP A;  2KG7 B;  3STZ C;  3ZN0 A;  3T4Z A;  4I4T A;  2WLJ A;  2HJD A;  4LNU B;  2VS0 A;  1KKD A;  2X0L A;  4Z2W A;  1AJP A;  1ENV A;  2WPD G;  2DJV A;  1H2K A;  1P7B A;  2ZNI A;  1GH6 A;  4AQY B;  3H1K H;  4X1Y A;  2YDE A;  3QO7 A;  4OPA A;  3G4S V;  5KHJ A;  4A5U B;  2ZM6 B;  2B5U A;  3JAR B;  4TWK A;  3W7U A;  1Y74 A;  2CE4 A;  2A3Q A;  1JPX A;  4F6E A;  5H6Q A;  1HR0 B;  4UCR A;  1XMO B;  3WB0 A;  4JV5 O;  5J2U A;  4DR3 O;  1F4M A;  3WB1 A;  3K5M A;  4HZ3 A;  4JI1 B;  4GKK B;  3AK3 A;  2UXB B;  1SQV H;  4IL6 Z;  3JD3 A;  5CA3 A;  4ZHQ B;  2YXY A;  3IJ4 A;  1OCC C;  4GUN A;  1BS3 A;  3UKM A;  1IBK B;  4FPP A;  1MZF A;  3ZMV A;  4U3J A;  4HAM A;  2GHY A;  1WN7 A;  1Q6U A;  2XAG A;  1U96 A;  3SDL A;  2XAF A;  4GKJ O;  4BIU A;  4CS4 A;  3E8G A;  1Q8I A;  2CTP A;  3BA9 A;  2LFR A;  1R3I C;  1BL8 A;  2A06 H;  3GVM A;  4PA7 A;  4LFA B;  1VQ7 V;  1V55 B;  3T2M A;  3LDC A;  4O2A B;  4P30 A;  2ZCE A;  3SYQ A;  4JZG A;  1EZV H;  2YIB D;  3HPL C;  1M4U A;  3CCQ V;  4LH6 A;  4X64 O;  4J11 A;  5LP6 B;  4DV2 B;  3JAW B;  2HVJ C;  4JTA B;  1S72 V;  3W7T A;  2B1I A;  1EBO A;  3X2Q C;  4I50 A;  1E1Q G;  1K7D A;  3K5N A;  1LUW A;  4NYK A;  1GK9 A;  1BT8 A;  4JF3 A;  1N8R W;  4JYB A;  3E22 B;  3HR0 A;  3M99 B;  2DN9 A;  2JIZ G;  1XNQ O;  2EIL C;  4KL1 A;  1BCC H;  3EFF K;  1HDJ A;  3UT5 A;  4MVQ A;  2Q8V A;  3D8C A;  4NVP A;  2D3O W;  3BA8 A;  4XDL A;  1BHB A;  4LF4 O;  4E4E A;  3ZX6 A;  4JV5 B;  3QNE A;  1KQS U;  4DR3 B;  4R6Z A;  5JWP A;  3P32 A;  3C90 A;  3OMI B;  3RYF A;  2UUA B;  4I7Z B;  4PHZ A;  1QBZ A;  3N2G B;  5J2T B;  2QM8 A;  1AR1 B;  3EHB B;  4H44 B;  2Y69 C;  2EIK C;  4F6R B;  3E8H A;  2EIN B;  2H3O A;  2Y48 A;  3SPG A;  2Q73 A;  2ZIN A;  1JQ0 A;  2XHB A;  3BVO A;  2P90 A;  1SQG A;  3HKC A;  4FFB A;  3VQV A;  5L3C A;  3J80 N;  2F95 B;  2Q69 A;  2EBO A;  2XAQ A;  2K1E A;  1KEC A;  1Q86 W;  4JI8 O;  1MMM A;  2CGO A;  2OYQ A;  1XNR O;  2WAM A;  3ASO C;  1RM1 B;  3FX7 A;  1PNK A;  4LCU C;  1LR1 A;  1LNQ A;  4FM2 A;  3TXQ A;  4DV1 B;  1YVW A;  1HW7 A;  2ZR2 A;  5H9C A;  1TA8 A;  1JFF B;  1US6 A;  1VAR A;  3TCU A;  3ZRV A;  2UU9 O;  2BSK B;  1K5Q A;  3S3W A;  2UUC O;  2JVD A;  5CA1 A;  1G8M A;  2EX3 A;  4PEL A;  1KKC A;  1KU9 A;  1E1R G;  2QR4 A;  3THO A;  3JCU Z;  4DR4 B;  1XNQ B;  5KAI Z;  1Q82 W;  2NLJ C;  2OIG A;  5H5N A;  3FFQ A;  1R6K A;  3DC5 A;  3CE2 A;  4ZI7 A;  2RDC A;  3B8N A;  4MSW C;  4MTX A;  3K5L A;  1AP6 A;  1GN2 A;  4Q20 A;  3UO2 A;  2IJI A;  1KUQ A;  4IHJ A;  4Z1M G;  1FKA O;  4XDK A;  4H33 A;  1K9M W;  1Y76 B;  2LGQ A;  3CP1 A;  5CA0 A;  4IIJ B;  4PA9 A;  3K03 A;  3JAS B;  4DUY O;  3KCY A;  3AG3 C;  4UCU A;  5EZY A;  1UFI A;  2VQE O;  2QTS A;  4N23 A;  3OE7 G;  5C8Y A;  1PP9 H;  3MDS A;  2YEV A;  1V54 C;  2YIA A;  3VOU A;  4J7J A;  1S77 D;  1THZ A;  4H13 B;  5BMV A;  3BPZ A;  2Z0A A;  1GTO A;  1TUB A;  3JAL B;  1JJ2 U;  2E76 B;  4I0X B;  3JAM N;  4KHP O;  4DR1 O;  4DV3 O;  4WFA V;  2Q7H A;  2FL4 A;  5IWA B;  1VQ4 V;  3OD4 A;  4JI8 B;  2AZ0 A;  2EIJ B;  2JS3 A;  5JQG A;  1JX9 A;  1MAB G;  1GM7 A;  2W6I G;  4FLV A;  2RNB A;  3CC2 V;  1PM9 A;  2Q9L A;  4BIO A;  1KP3 A;  4JI5 B;  4JI7 O;  1N32 B;  3SPH A;  3K04 A;  4LFB B;  3SYP A;  1HNW O;  2QWQ B;  2JK5 C;  1K73 W;  2YI8 A;  2UUC B;  3K0D A;  4B3S O;  2DOS A;  2YXL A;  1YCI A;  4B3T B;  2DQ3 A;  2VQF O;  1TAE A;  5IT9 N;  2ADP A;  3N2K B;  5HFL A;  3SPJ A;  2P5O A;  3E83 A;  2CUG A;  3FAV B;  4U3F H;  4QNH B;  1HNX B;  2Y4T A;  1EZJ A;  4X1I A;  3W7S A;  4KUM A;  2K9P A;  1S76 D;  2X6A A;  1WB8 A;  4GZR B;  2XT9 A;  2VWJ A;  3ZHU A;  4MTF A;  4JI4 O;  2BOB C;  2Y0I A;  3OTO O;  4JAU A;  3OMA B;  2VQE B;  4DRX B;  2PZS A;  1K97 A;  5FLX N;  2BTQ B;  4JYA O;  1B06 A;  1XQ8 A;  1NVP C;  5IDJ A;  4TT3 G;  3LNM B;  4PV1 B;  1S5J A;  2P22 C;  5IJ0 B;  1XI1 A;  5D5Q A;  4YJ2 A;  4DR2 B;  4D7T A;  1Y6X A;  2ZE8 A;  5BXZ A;  4KHP B;  4TV9 B;  1I94 O;  5L3E A;  4IYI A;  4DV6 B;  1YIJ V;  3KCX A;  3U0Z A;  1RP3 B;  5B1B C;  4X66 B;  4P9P A;  3CX5 F;  3QO5 A;  3JAK B;  3CCE V;  1YJW V;  2JEU A;  5EK0 A;  5KMG B;  4MVR A;  3DXR B;  2JGD B;  2EZP A;  1EFR G;  3ZRX A;  1R3J C;  1UJW B;  1G6U A;  3PJS K;  2QWP B;  4O2B B;  4E2L A;  3QF7 A;  1M9N A;  2LFS A;  5J9P C;  1N0N A;  1VMG A;  3MAQ A;  2CGN A;  1H2N A;  1BSM A;  5JVD B;  4JYY A;  3ZHT A;  1N34 O;  1KB9 F;  2WLH A;  1N36 O;  2AW9 A;  1H2G A;  4W4L A;  2VQF B;  2HHH B;  2IBZ H;  3H1I H;  4X1K B;  2YS8 A;  3L70 H;  3X2Q B;  1L0N H;  1XDC A;  2OCC C;  2RCV A;  5GTI Z;  1FJG O;  1ZSP A;  2V4D A;  1NJI W;  3P3P A;  3RGB A;  3ABU A;  2OT5 A;  2EIL B;  5L3F A;  4NB5 A;  4JI0 B;  3OR7 C;  3MHS C;  2A7W A;  3CRA A;  4MTG A;  3T1Y B;  4X1Y B;  4OX9 O;  5B66 Z;  4PDV A;  1F7Y A;  1XEQ A;  3LNN A;  4LC1 A;  1DLB A;  1XRE A;  1IX9 A;  4PI0 A;  4UVB A;  4FIP C;  1I0H A;  4NR1 A;  1O9G A;  2ZM6 O;  3H1L H;  2HVK C;  2UUB B;  1QHT A;  2VWK A;  5J2U B;  2ILM A;  1HR0 O;  1XMO O;  2MW2 B;  4RO2 A;  2M7W A;  5LMN B;  5GW7 A;  1SET A;  4FLY A;  4JTC B;  2Q68 A;  2N04 A;  1H38 A;  1NH2 C;  2R9A A;  4JI1 O;  4GKK O;  2YIB A;  1SQQ H;  2GBO A;  2UXB O;  2Y69 B;  1SQB H;  2BCC H;  5EYP A;  3H01 A;  2QDO A;  4PDM A;  3W7X A;  3B40 A;  3K06 A;  2PUS A;  2IJK A;  5CB4 A;  1IUR A;  5F2V O;  3STL C;  2EZO A;  3CRC A;  2EIM C;  1DF5 A;  1ZAU A;  5KAF Z;  1X59 A;  1IBM O;  1K3E A;  1MA1 A;  1R6T A;  2HFE C;  2L35 A;  3HB3 B;  4F4L A;  4ZOL A;  4HBN A;  4YY3 B;  3ASO B;  4LFA O;  5B5E Z;  3ETE A;  4EKW A;  1HP8 A;  2HEP A;  5D5P A;  1JVM A;  2JS5 A;  2LGW A;  1XHZ A;  1VQ9 V;  5FNV A;  5B1O A;  2N05 A;  4HNA A;  2FB5 A;  1QLN A;  4TOI A;  2E74 B;  1RPO A;  1FJG B;  2E5L B;  4O4L A;  1OZ0 A;  3O65 A;  3CWB H;  4FLW A;  1G4Y B;  2GTS A;  1P49 A;  3SYA A;  1IBL B;  1K33 A;  3VQW A;  3HKE A;  2CH7 A;  1AI4 A;  3UT5 B;  4JI6 B;  4OX9 B;  1SKV A;  1KBH A;  5IE9 A;  2YXH A;  1D5A A;  4WBN A;  2MK3 A;  3CXC U;  1URF A;  5IYZ A;  2B1G A;  3ASN B;  3SR2 C;  1CEZ A;  1YJN V;  5JJN B;  4JPR A;  3AG3 B;  3U11 A;  4NTY A;  1YDX A;  2ZIM A;  1NS1 A;  1ZTE A;  1AJQ A;  5GON A;  2L6L A;  3RYF B;  3ETQ A;  3ZMZ A;  1QCE A;  5BR8 B;  1A32 A;  1V54 B;  4X20 B;  2UUA O;  2Q0O C;  3JSL A;  3AG1 C;  1BMF G;  1NR1 A;  4PDL A;  2UXC B;  4I5S A;  3SGI A;  3B2E E;  3SYO A;  2Y0P A;  1QQC A;  4LFC B;  1QLE C;  1YHQ V;  5JH7 A;  3RYC A;  1YZB A;  1VQM V;  1S5L Z;  2ARH A;  2C2A A;  2JRI A;  1YIT V;  1N33 B;  4BW9 A;  1IBM B;  2CAZ C;  4TQD A;  3CRQ A;  3ZMS A;  2E3C A;  4I9W A;  1K4C C;  4HYO A;  2JGU A;  2QWN B;  4DUZ O;  3MHH C;  1JMK C;  5LXT A;  4DV1 O;  4WFE A;  4RAI A;  4JI3 B;  3FD9 A;  1AB3 A;  3BY6 A;  5FPR A;  1AP5 A;  4K3A A;  4O4H A;  5CA1 B;  2F93 B;  1M56 C;  2OCH A;  1AVM A;  4L8J A;  3OTF A;  1AI5 A;  2ZNJ A;  4MT8 A;  3HKB A;  3J81 N;  4DR4 O;  2BE3 A;  1OCZ C;  1SF9 A;  3UQ8 A;  2UXD B;  4DW1 A;  5EIB D;  1PKX A;  3C3T A;  3E89 A;  4LF7 B;  3ZIA G;  3K9S A;  3QO8 A;  1KD1 W;  3R66 A;  4LF6 B;  2F1M A;  2GUZ A;  2NNU A;  3IC9 A;  4GT1 A;  3A0H Z;  2KG7 A;  2WLL B;  3K9A A;  4G27 B;  2P7T C;  2LP7 A;  4LNU A;  1CXZ B;  1RPR A;  3AEI A;  2DWE C;  1GM9 A;  2ZXW C;  4IYH A;  5EZY B;  3SJC C;  1WP7 A;  1DTO A;  4AIL C;  1WA8 B;  4X65 O;  5C8Y B;  1FFX A;  1NVP B;  1GMG A;  1VQK V;  1Q81 W;  1IVS A;  1R1B A;  4LWS B;  1RFY A;  1YJ9 V;  4CH3 A;  1XIL A;  3QG5 A;  5DEC A;  3BAA A;  4JAS A;  5H2F Z;  3BCC H;  3ZRS A;  1TUB B;  3JD1 A;  1SQF A;  2IH1 C;  4DR5 B;  5K1X A;  1VIB A;  1SA0 A;  4FZ0 A;  3WB2 A;  2DYS C;  3G6E V;  4P9O A;  5B1B B;  4RQF A;  3K57 A;  2OTJ V;  5KX5 B;  4ICG A;  2HKO A;  4FM0 A;  4NTW A;  1FPO A;  3FB7 C;  4DR7 B;  5IWA O;  1AI7 A;  3IC7 A;  5JQG B;  2E75 B;  4U7O A;  4YHH O;  5KA5 A;  4I55 A;  4DUZ B;  3ABM C;  3AG4 C;  4TV8 B;  1PD3 A;  4JI5 O;  1N32 O;  1WB7 A;  4LFB O;  2IH3 C;  2FML A;  3ZED A;  5LMU B;  1KYO F;  2LW1 A;  4PD4 F;  1N0J A;  3A8T A;  3B77 A;  5IJ9 A;  4ZBM A;  4B3R O;  4TUY A;  3ZBH A;  1IDS A;  1VF7 A;  3KKY A;  5JJE B;  2WLI B;  4B3T O;  4K35 A;  2V7Q G;  3D36 A;  3EXA A;  3ZCC A;  2OCC B;  4YIP A;  3RFR A;  3ICX A;  2NR5 A;  2DYR C;  4DK0 A;  3OAA G;  1EN4 A;  1JCH A;  1HNX O;  3JD2 A;  3JAW A;  4X1I B;  2WA4 A;  3WFV A;  5IYB O;  4ABM A;  3I56 V;  3IGA C;  4RUF A;  4EB6 B;  5DED A;  3L73 H;  4PI2 A;  4CBC A;  4FFK A;  5LOV B;  3E22 A;  2YIC A;  3ZRW A;  4U7N A;  3CD6 V;  1VQL V;  3JD4 A;  3RN4 A;  3RYH A;  4X65 B;  1SQX H;  1U97 A;  2O57 A;  2V1D A;  2PTM A;  5B3S B;  3WG7 C;  2LO1 A;  3JAT B;  4UCO A;  2P4V A;  3IAY A;  5ITZ B;  3OEH G;  4QE7 A;  4UVC A;  3ZMT A;  1J95 A;  4FM1 A;  3AK2 A;  2IW5 A;  2WLN A;  1NH2 B;  1JA8 A;  1AIL A;  2ZE7 A;  4PJ0 Z;  2RMK B;  4J7Z A;  2XAH A;  3JSN A;  4DR2 O;  3N27 A;  3TGU H;  4DV5 O;  2XAJ A;  1KMI Z;  4DV6 O;  3N2G A;  3VQX A;  3ZMU A;  3CME V;  4X66 O;  1RSO B;  2DW4 A;  4YHH B;  2F4V B;  1SER A;  4F6R A;  2ZR3 A;  5KA6 A;  3M7M X;  2EIM B;  3K5O A;  5KHH A;  4QPJ A;  5LGN A;  4UVA A;  1SZT A;  3HKD A;  1VF6 A;  1YTF B;  1M93 A;  2W6J G;  3TJT A;  5LYJ A;  2F23 A;  1TGO A;  3UM7 A;  4Z1V A;  1QR8 A;  5KUK A;  4O4I B;  2Q5Z A;  5LBQ A;  4B3R B;  2P6J A;  1AR5 A;  3OGC C;  3ZHS A;  5DM6 V;  1NT2 B;  2XUM A;  4R8C A;  1B04 A;  4WCE V;  4MVS A;  1IXM A;  4P2Z A;  4MS2 A;  2HHH O;  1H2S B;  3D36 C;  1N4C A; 
#chains in the Genus database with same CATH homology
 4LC1 A;  1DLB A;  3D3I A;  2PI4 A;  4J9Z B;  3JD3 A;  1VQP V;  5CA3 A;  3CCS V;  4UVB A;  4QJF B;  2A0L A;  4FIP C;  3ABL C;  1MG1 A;  1OCC C;  2HVK C;  4R50 A;  3UKM A;  3ABK B;  4FPP A;  3KG2 A;  3ZMV A;  2ZDI A;  4MVM A;  1NQT A;  1VQN V;  1OCR B;  3B8M A;  4RO2 A;  2M7W A;  4HAM A;  2GHY A;  4JYC A;  5GW7 A;  1SET A;  3SPC A;  2XAG A;  2WWW A;  4MTO A;  2XAF A;  1OCO C;  4JTC B;  4PA6 A;  2Q68 A;  1FXV A;  3CPW U;  4BIU A;  3ETD A;  1H38 A;  3E8G A;  1NH2 C;  2IU3 A;  4ASU G;  1AI6 A;  2LFR A;  2Y69 B;  1R3I C;  1BL8 A;  5EBM C;  2DQ0 A;  3JYC A;  4PA7 A;  1R73 A;  3DTU B;  5L3G A;  3H01 A;  1VQ7 V;  1V55 B;  3T2M A;  3LDC A;  4PDM A;  3W7X A;  1YSC A;  2ATK C;  4P30 A;  3SYQ A;  3K06 A;  4FK5 C;  2IJK A;  4MVZ A;  2JJ1 G;  3HPL C;  2IJJ A;  1KC8 W;  3SPI A;  2R9R B;  3G71 V;  3LSS A;  3STL C;  2EZO A;  5LHH A;  3CCQ V;  3AG1 B;  2EIM C;  1YI2 V;  1DF5 A;  4UUJ C;  1DF4 A;  1NR7 A;  1PNM A;  4FMT A;  2HVJ C;  4JTA B;  5EC1 C;  1S72 V;  3W7T A;  1K3E A;  3W7W A;  1OCC B;  2B1I A;  1EBO A;  2HFE C;  3K0G A;  3X2Q C;  1E1Q G;  3HB3 B;  1K7D A;  2WLL A;  4QIW F;  4F4L A;  1GK9 A;  5B1A B;  3ASO B;  4JF3 A;  5LGU A;  3ASN C;  1QLE B;  3ETE A;  3OM3 B;  1N8R W;  4JYB A;  4EKW A;  3FKS G;  3M99 B;  1JVM A;  2JIZ G;  2EIL C;  4GX0 A;  1VQ9 V;  2EIN C;  3EFF K;  5B1O A;  5E1A C;  3VBB A;  4MVQ A;  2P67 A;  5KUM A;  1S5H C;  1QLN A;  4PA3 A;  2EJR A;  5IYC O;  2D3O W;  4GX1 A;  1RPO A;  1QVG U;  1S0V A;  3LDE A;  4XDL A;  1OZ0 A;  1G4Y B;  1BHB A;  3TET A;  1M57 B;  3SYA A;  1TUE B;  1K33 A;  1MOF A;  1W0J G;  3QNE A;  1M1K W;  1KQS U;  1AI4 A;  3ABK C;  4R6Z A;  2DWD C;  2HJF C;  3P32 A;  3T4D A;  3OMI B;  1OCR C;  3CCU V;  1M56 B;  3LUT B;  2PI5 A;  3LDD A;  2QA4 V;  1QBZ A;  2MK3 A;  3DGE A;  4UV8 A;  3CXC U;  1VQ6 V;  2QM8 A;  1AR1 B;  5CBG A;  2B1G A;  3ASN B;  3EHB B;  4X8A A;  1CEZ A;  1YJN V;  2Y69 C;  1HWY A;  1GO3 F;  2EIK C;  1OCZ B;  3JCZ A;  3RVY A;  3E8H A;  2EIN B;  4JPR A;  1V55 C;  2Z3Y A;  3AG3 B;  4KP4 A;  2Y48 A;  2ZDI C;  3SPG A;  1AJQ A;  1H8H G;  1K4D C;  1JQ0 A;  1B6Q A;  3ZMZ A;  1I5X A;  1QCE A;  4QE9 A;  2P90 A;  1V54 B;  5L3B A;  3CC4 V;  2KB1 A;  2QE7 G;  4PA4 A;  3AG1 C;  4RUE A;  5L3C A;  1BMF G;  2X6B A;  1NR1 A;  4PDL A;  2Q69 A;  4I5S A;  2EBO A;  2XAQ A;  2K1E A;  3CYO A;  1KEC A;  4JTD B;  4LP8 A;  1L1F A;  1Q86 W;  1E79 G;  3RW0 A;  3SYO A;  4DXW A;  2BOC C;  2WAM A;  5B1A C;  3ASO C;  1RM1 B;  3CC7 V;  1PNK A;  4LCU C;  2WLI A;  2Q6A A;  1LNQ A;  1QLE C;  1YHQ V;  2F43 G;  1QVF U;  1VQM V;  2ZR2 A;  3SYC A;  1Y66 A;  5H9C A;  2C2A A;  1YIT V;  1F51 A;  1FFT B;  5LHG A;  3TCU A;  4ZKI A;  4QPK A;  4OXS A;  3ZRV A;  2ZD9 A;  4WFH A;  1K5Q A;  2JJ2 G;  2EIK B;  4DO2 A;  1WLE A;  3ZMS A;  1G8M A;  5CBF A;  2QM7 A;  4PEL A;  1E1R G;  1Q7Y W;  3K3W A;  4I9W A;  4R7C A;  1K4C C;  1Q82 W;  2NLJ C;  2DYS B;  1M57 C;  4HYO A;  4UXN A;  2XAS A;  4PDR A;  3MHH C;  1JOY A;  1R6K A;  4WFE A;  4RAI A;  3K08 A;  1XL6 A;  1SES A;  3BY6 A;  3B8N A;  4MSW C;  4MTX A;  5BZB A;  1M56 C;  1ORQ C;  2JEX A;  3GB7 C;  4Q20 A;  2IJI A;  3E8B A;  3CCV V;  1AI5 A;  4Z1M G;  4L87 A;  4MT8 A;  3RBZ A;  4J9Y B;  1K34 A;  2ITD C;  4XDK A;  4H33 A;  1K9M W;  2ZQM A;  1OCZ C;  2R9I A;  3CP1 A;  4PA9 A;  3K03 A;  3F5W C;  3E2E A;  4G28 B;  1PKX A;  3AG3 C;  3I55 V;  3E89 A;  3FYI B;  3RVZ A;  3ZIA G;  4X89 A;  3QO8 A;  1KD1 W;  3FB8 C;  4N23 A;  2X7R B;  3OE7 G;  3A0R A;  1W0K G;  2NNU A;  1BHA A;  2X6C A;  4GT1 A;  2YEV A;  1V54 C;  2WLL B;  5FL7 G;  3K9A A;  1NH2 D;  4G27 B;  4WF9 V;  3VOU A;  2WSS G;  4BIZ A;  2P7T C;  2LP7 A;  1OHH G;  1S77 D;  1THZ A;  1NKD A;  2GSM B;  1RPR A;  3AEI A;  2DWE C;  1K5S A;  2XOK G;  1NVP D;  1GM9 A;  1GTO A;  2DYR B;  2ZXW C;  4WFG A;  1RM1 C;  1JJ2 U;  1DTO A;  1VQ8 V;  5IY5 B;  4WFA V;  1VQ5 V;  1NVP B;  1GMG A;  5EC2 C;  1VQK V;  1S3J A;  4BAY A;  2UXN A;  4WFF A;  1Q81 W;  1ARO P;  1YJ9 V;  1VQ4 V;  3F7Y C;  3R65 A;  3CCM V;  3FYE B;  4RQE A;  2EIJ B;  1JX9 A;  4JAS A;  3OFN G;  1M90 W;  1YTF D;  2WLK A;  3K79 A;  3ZRS A;  1MAB G;  1GM7 A;  2AHZ A;  2W6I G;  4MVO A;  3CC2 V;  3JD1 A;  1R3L C;  2IH1 C;  4JAV A;  1KP3 A;  3WG7 B;  4TSF G;  3SPH A;  2DYS C;  3K04 A;  3G6E V;  3SJQ C;  3SYP A;  3AG2 B;  1QR9 A;  4P9O A;  2JK5 C;  1CPY A;  2QKS A;  4G2K A;  5B1B B;  5CN0 A;  4RQF A;  1WPX A;  2OTJ V;  1K73 W;  2HKO A;  5L3D A;  3CCJ V;  3FB7 C;  3K0D A;  1AI7 A;  1FXK A;  1KP2 A;  3IC7 A;  1Y4M A;  3T1C A;  1PL0 A;  3CMA V;  2A9H A;  4U7O A;  5KA5 A;  1SRY A;  2ZXW B;  2DQ3 A;  2AHY A;  3ABM C;  3OR6 C;  3AG4 C;  5HFL A;  3SPJ A;  4XBF A;  1W2B U;  3E8F A;  5C93 A;  3P30 A;  1PD3 A;  3E83 A;  5LHI A;  2UXX A;  4XDJ A;  2IH3 C;  4QNH B;  2HR3 A;  3OEE G;  1P4R A;  1EZJ A;  3E35 A;  3F7V C;  5CMU A;  1FXK B;  5B3S C;  3W7S A;  4KUM A;  3B77 A;  1S76 D;  3ZN1 A;  1R3K C;  2X6A A;  3ML0 A;  4YXW G;  4ZBM A;  2IU0 A;  1ZWI C;  2WLI B;  3BEH A;  4H37 A;  4MTF A;  2BOB C;  4BW5 A;  4MW8 A;  2V7Q G;  4UV9 A;  1COW G;  3OW2 U;  3D36 A;  4JAU A;  2W0F C;  2CK3 G;  3OMA B;  4LBE C;  3ZCC A;  2OCC B;  4GCZ A;  5EBW C;  1F4N A;  2DYR C;  5LGT A;  3OAA G;  1K92 A;  5IYD O;  3CCR V;  4FJC C;  1JCH A;  3JD2 A;  4GX2 A;  3WFV A;  1K8A W;  5IY5 C;  5IYB O;  1NBM G;  3LSQ A;  3FB5 C;  1K97 A;  4MVU A;  4X88 A;  4CZZ A;  1NVP C;  5IDJ A;  1FXH A;  3I56 V;  3IGA C;  4RUF A;  3E86 A;  4TT3 G;  3LNM B;  2Z5U A;  4CBC A;  3CCL V;  3ABM B;  2FTK A;  3ABT A;  3AG4 B;  5CBH A;  2WLM A;  2EIJ C;  2ITC C;  3ZRW A;  4U7N A;  2QTO A;  3CD6 V;  2H8P C;  5HFM A;  1VQL V;  3JD4 A;  3GWO A;  4KFM A;  2V1D A;  3FB6 C;  3NXS A;  5B3S B;  3OUF A;  5L3E A;  3ABL B;  3WG7 C;  1XL4 A;  1YIJ V;  1YTF C;  3AG2 C;  2JDI G;  3IFX A;  4MW3 A;  5B1B C;  3OUS A;  3OEH G;  4QE7 A;  2A79 B;  4UVC A;  1MSW D;  3ZMT A;  1J95 A;  3ZJZ A;  4P9P A;  1OCO B;  2HG5 C;  2IJH A;  2Q67 A;  3QO5 A;  3ZRW B;  2IW5 A;  3CCE V;  1VQO V;  2WLN A;  1YJW V;  1NH2 B;  2JEU A;  5EK0 A;  3JD0 A;  2HLD G;  4WFB V;  1I5Y A;  4MVR A;  2QEX V;  2EZP A;  1EFR G;  2XAH A;  4JGS A;  3ZRX A;  5B1N A;  1H8E G;  2XND G;  1R3J C;  3MD0 A;  1UJW B;  3PJS K;  2XAJ A;  4E2L A;  1M9N A;  1ROP A;  2YEV B;  2LFS A;  3STZ C;  1CP9 A;  3ZN0 A;  3T4Z A;  3ZMU A;  5J9P C;  3CME V;  3OMN B;  2WLJ A;  2DW4 A;  1FXK C;  1GKF A;  1SER A;  1KKD A;  2WLH A;  1R6N A;  2X0L A;  1AJP A;  2ZR3 A;  4GX5 A;  1H2G A;  1ENV A;  4N21 A;  5KA6 A;  2EIM B;  2WPD G;  4QPJ A;  5LGN A;  1P7B A;  4UVA A;  1SZT A;  3TK1 A;  1YTF B;  3X2Q B;  2OTL V;  2W6J G;  3QO7 A;  3G4S V;  5H6R A;  2OCC C;  3UM7 A;  1QR8 A;  1NJI W;  5KUK A;  1F23 A;  5EBL C;  2B5U A;  4TWK A;  3W7U A;  2YSU B;  3ETG A;  5LBQ A;  3ABU A;  2OT5 A;  1FS0 G;  1JPX A;  2EIL B;  2P6J A;  5H6Q A;  3OGC C;  5L3F A;  5DM6 V;  4R8C A;  4WCE V;  4MVS A;  1IXM A;  4P2Z A;  3OR7 C;  3MHS C;  4MS2 A;  4MTG A;  5DN6 G;  1PNL A;  1F4M A;  4PDV A;  4HZ3 A;  1AJN A;  2H94 A;  1GM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...