1YTFD

Yeast tfiia/tbp/dna complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
100
Chain Sequence
b'GYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVESVISVDKLRIVACNSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*GP*TP*AP*TP*GP*TP*AP*TP*AP*TP*AP*AP*AP*AP*C)-3
publication title Crystal structure of a yeast TFIIA/TBP/DNA complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 25
structure length 100
sequence length 115
ec nomenclature
pdb deposition date 1996-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
D PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ytfD01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 1ytfD02
1RM1B 1NVPC 1RM1C 1NVPD 1YTFC 5IYCO 5IYBO 1YTFD 1NH2C 1NH2D 5IYDO
chains in the Genus database with same CATH superfamily
2LW1A 1NBMG 4JYCA 2DW4A 2OTJV 2A79B 3RW0A 1L1FA 3WB2A 1IX9A 5EYPA 5LGUA 2JJ2G 3CCSV 1Z5VA 4CH5A 4HZ3A 1RSOB 1KQSU 2P90A 4IYHA 1LNQA 5IYZB 1AJNA 1N8RW 5B66Z 3ZMUA 4B3RB 2FYUH 2XAHA 1QHTA 4JI5B 2F23A 3JD1A 4JI4B 4LFCB 2ZM6B 4IHJA 3GWOA 5LHGA 3FKSG 1K4CC 4K8XA 1XDCA 5H5NA 1AILA 2ZE5A 2W0XA 1I0HA 4GYCB 4JI1O 2ATKC 2P5OA 2Y0IA 1JX9A 2Q0OC 4U3FH 1US6A 2IW5A 2YC0A 4O4IB 5ITZA 2YDEA 2HLDG 3SGIA 1OJHA 5EIBC 3ZHRA 3IGAC 4UFZA 1FJGO 1N4CA 4CH3A 1XMOB 1V54C 3UT5B 1F51A 4DW1A 1VQ7V 4UCRA 4H33A 4FLUA 1XEQA 4QGPA 3ZN1A 1ROPA 1BSMA 3ZMSA 4DV4B 4DR7O 2ZR2A 4KXRA 3CHXA 3HKEB 1BS3A 3R66A 3RWRD 2WLLB 1XHZA 1N36B 1XMOO 3RBZA 4FLYA 2ZNJA 4UCVA 3U11A 5EBLC 1TUBA 2N74A 3CYOA 3ETQA 2PTMA 2ZNIA 1Q6IA 2XHBA 3H1JH 2IM9A 3CCEV 2QWNB 1AVMA 2P22C 5LMUO 1HNWB 2YEVA 1N36O 2UXXA 1V54B 4A5UB 1F7YA 3L74H 2IJIA 1O9HA 4FLTA 1NS1A 4DR3B 4J7JA 4KL1A 4LCUC 1H2LA 1LUWA 2HJDA 1JA8A 1OCCB 4FM2A 2CDYA 1FYJA 4DV2B 1YVWA 1YJNV 1KP2A 3JSLA 4O2AA 4DV1B 1GAXA 2QM4A 3OUSA 1THZA 3P32A 4K0KO 1S0VA 2R9AA 4HYOA 1XHXA 1RPOA 4R7CA 1S5JA 1K9MW 3AK2A 1Q6UA 2E5LO 3N2KA 4J80A 1YF2A 3K06A 1I94O 1R73A 2EULA 3QG5A 1EM1A 2CAZC 5HFMA 1K8AW 3FAVA 3T1CA 3C3TA 3OEHG 2ZE6A 3LDEA 3CCJV 5B1AC 3E89A 1OCZC 4LP8A 5IY5C 2B9ZA 1WJZA 4X1YA 3ABMB 1SQBH 1YIJV 4AQYO 2ZIMA 5IJ9B 2Q4PA 3PN1A 3KKYA 4NTYA 2Z0AA 4UCTA 4ZI7B 1N34B 4FZ0A 1AI4A 1L0LH 2PYLA 3ZMVA 4RUEA 3OEEG 4WFEA 4UVCA 3ZBHA 2CTRA 2OCHA 1ENVA 2YXLA 3P3PA 3M99B 3OTOB 4BWAA 3VBBA 5GONA 4JI6O 3L70H 3SPJA 1GTOA 1HNZB 3D36A 4CS2A 5B1BC 4JI8O 4W4KA 1XNQB 1Y76B 2LFRA 4WBNB 2JS5A 3EVKA 4I50B 5CA0A 1P49A 5CB4B 1I7FA 2OT5A 4I5SA 5B1AB 4G28B 1MSDA 5IY5B 3C90A 4UB6Z 2IJHA 4UV9A 4B3SO 1ZTEA 4WFFA 2NN4A 2DWDC 1YJWV 2X6BA 1SQFA 2UUBO 3VQWA 1UPGA 5KLVH 2YXHA 1MMMA 1GMGA 5B1NA 1WAZA 3JD0A 2Q6AA 3H1KH 4O4LA 4J41A 3SDLA 1VQPV 2PGGA 1E1QG 3ZS8C 1F4NA 1CPYA 2F4VB 1SQVH 3DC6A 1W0KG 5KHGA 1U97A 1VQ9V 2QTOA 3EHBB 3JALA 4LF8O 4FFKA 5DM6V 1ZL8B 4OGQB 1AR5A 2RMKB 4PDLA 1Q3EA 3JAKB 3Q4HB 1DF4A 4MW3A 1SERA 5KHJA 3FYIB 4PD4F 2QSAA 2WLNA 3OUFA 2F43G 3FB8C 2XAGA 2YXYA 3QO5A 2Q7HA 1R3KC 1HWYA 2RQ6A 1ZX3A 2VS0A 4X65B 2P4KA 5LOVB 3BFRA 4ZHQB 1M1KW 1NZ6A 2GTAA 1NH2C 4G2KA 1DTOA 5JH7B 4UCUA 1R6NA 4GKKO 1XQ8A 4X20A 3N27A 2PZSA 4LWSA 2HHHB 1MSWD 1Y74A 1VIBA 5LGTA 3JATB 4FLVA 2YS8A 3ZX6A 2LQTA 4P9OA 3CXCU 4JF3A 2HG5C 1AJQA 1DK1A 1ZSPA 1NQTA 5EZYA 5J2UA 3BABA 2A06H 3STZC 3K59A 2X0LA 5LXTA 4FLWA 4TUYA 3E83A 1WB7A 2K1EA 4DR5O 2GUZB 1BMFG 4DR2B 2E74B 2Q9LA 1N33B 1AI7A 4R8CA 3VQYA 1KKDA 3CRQA 1P4RA 1N0JA 3JD2A 1XMQO 2CH7B 1IBMO 2W0FC 4FLXA 4R6ZA 1YHQV 1NH2B 2XASA 1V55C 3P3NA 2XAJA 3NXSA 2UUCO 3UO3A 1P84F 4O4HB 4LNUB 2V7QG 3K5NA 5H6RA 4X9QA 4JYBA 4DV3O 2HKOA 3FB7C 1A32A 1TAEA 4B3TB 5LA6A 3J7AU 4LF5O 2Y4UA 2KG7B 3F5TA 1RSOA 4DV7O 1AJPA 5LGNA 2QWOB 1SS3A 5IYZA 3OAAG 4FVMA 1SQPH 2VRZA 4TOIA 2Y69C 4Z1MG 2N05A 3CE2A 1PNKA 1OZ0A 4ABMA 5KHKA 3G6EV 4NXNB 1MA1A 2DE0X 4WF9V 1GRJA 4B7KA 1NI8A 2VQEB 4PA6A 5L3DA 1DGSA 3CCUV 5IT9N 2WWWA 4DV5O 3D3QA 5LBQA 1V55B 2HR3A 5C8YB 5GTHZ 1SA0B 1RPRA 1PL4A 4PDMA 4O4IA 3THOA 2QGNA 4BR6A 2LGWA 5LHHA 3E2EA 1FPOA 5GTIZ 1IBKO 1Y4MA 4U3JB 1EZJA 4QPKA 3CWBH 4MVRA 3CRAA 4IIJB 4J9YB 5KX5B 3UT5A 1CXZB 2F66C 1LR1A 3ZMZA 4DK0A 1H2MA 1AP5A 2P4VA 4H44B 4DR4B 5FPOA 1ZLZA 3P30A 1CEZA 4X1KB 2Y69B 4DUZB 5BXZA 1HNXB 4JI3B 1KBHA 3HKEA 1R3IC 2WLLA 3UM7A 2RCVA 1WLEA 2W6IG 1VQ8V 4J9ZB 1YI2V 4LF9B 2C2AA 1Z5WA 4MTGA 2YI8A 5LYJB 4ASUG 3R65A 4LR3A 1E79G 1FXKC 2QKAA 3CX5F 3BHPA 3HKCB 4LF6B 1NR7A 4RO2A 3CC7V 4B3MB 1NKDA 2ILMA 3X2QC 3K79A 1G8MA 4I9QA 4LFAB 4DW0A 5LMNB 3CS5A 2MK3A 1Q43A 1MG1A 1UJWB 2A0LA 2Z5UA 3WFVA 5CA3A 1NU1H 1Q90D 4YJ3B 4QJFB 1GM8A 2VWKA 3AG2C 2WLIB 3O9OA 5LP6C 5LL6Y 1VMGA 1D5AA 4OX9B 4JI2B 2R9IA 3E8FA 5JWPA 1GM7A 3SYOA 5LMNO 1OCRC 1S72V 3JAWB 4Q20A 3AEIA 2OCCC 3E86A 4UCOA 1N32O 1FXKB 2O57A 2CUGA 4CC6A 5LHIA 2M7WA 1X59A 1QVFU 3X2QB 5FLXN 1SF9A 1IXMA 4GKJO 3O65A 1BCCH 1YEWA 4I55B 3RN4A 1IBLB 4LFBB 4I4TB 5JVDB 4X64O 4AI8A 3ZRWB 3OD4A 4JAVA 4ZI7A 4IYIA 5IE9A 4MVQA 4PV1B 3AG2B 3B40A 5LP6B 3L72H 2B1GA 3ZHQA 1PNMA 1OCRB 4PA3A 2P67A 3ZRVA 1GN4A 2AGAA 2OCCB 3K5OA 2ZDIC 2AHYA 5JJEB 1YDXA 3BPZA 2PY5A 1Y76A 4B3RO 4WBNA 2Z3YA 2AZ2A 1H2NA 4I50A 3K0GA 5CB4A 4JI5O 1AR1B 3BAAA 4JI4O 4JYAB 4LFCO 3HKDB 1EFRG 3M7MX 2QWQB 1VQLV 2ZM6O 1H2KA 4WCEV 4E4EA 1NR1A 4X62B 2QE7G 5CBHA 4HNAB 2UXCB 1KUQA 3A2FA 2EIJC 5IYBO 1K92A 1OCCC 4TWKA 2PI5A 1E1RG 4NR1A 2H8PC 3OM3B 4Q6GA 1Q81W 3DC5A 4MVOA 1K97A 2JGUA 1YTFD 3SPHA 1P7GA 5FL7G 3CCMV 3BA8A 1COWG 3T2MA 2EILB 5JQGB 4LF7B 3DXRB 2EBOA 3JARB 5EK0A 3JAKA 3Q4HA 1KB9F 4WFBV 1Y66A 5F2VO 4UXNA 4JAUA 1URFA 4DV4O 3FB6C 4PHZA 2ZE7A 2A9HA 4PELA 2L6LA 5CN0A 1W59A 4KHPB 3SR2C 1AI6A 1QLNA 3BY6A 5LOVA 1QCEA 3ABMC 1K34A 3SPGA 4NKGB 4ZHQA 2ZCEA 2EIJB 2WLMA 3MHSC 5JH7A 1BT8A 2MW2B 1JVMA 3VQXA 1PKXA 3FB5C 1HNWO 1SZTA 3JD3A 4PA9A 2DQ0A 3JATA 1VARA 5JCOC 4IT5A 2CTPA 3M8AA 5B5EZ 2CTWA 3CCQV 2FTKA 3CC2V 3G80A 3TK1A 1G4YB 2ITDC 4DR3O 1VQOV 3ZHUA 2WLJA 1K4DC 4X8AA 4AILC 2GV9A 4DV2O 4DV0B 2QWPB 5GW7A 1NJIW 1QNMA 4FIPC 3UQ8A 4GX5A 3CMAV 4DV1O 2AXTZ 5IYCO 2F93B 4YIPA 2BSKB 2ZQMA 4DO2A 5J2TB 4NB5A 1WA8A 4CH4A 1WP7A 1PPJH 1GKFA 3E22A 3K5MA 2CH7A 4NXMB 2BTQB 4X88A 1QU7A 3U0ZA 1IURA 3JD4A 2VQFB 2Q0AA 4KUMA 4O4HA 4X1IB 4LNUA 4EEQA 4MTFA 3G6BA 3CD6V 3SJAC 1FS0G 2M6YA 4J10A 1PD3A 3JASB 4XDLA 2IJKA 4JZGA 4LH6A 4K35A 4DRXB 3ETGA 2UXBB 4TV9B 5KMGB 2Q7GA 2KG7A 1W0JG 4QNHB 4ZKIA 1N34O 2UU9B 1UFIA 5HFLA 2L35A 4UVBA 1HDJA 1MZFA 2WLKA 4IHJB 3BRCA 1FXVA 3I55V 2Y4TA 4JTDB 1K73W 5BY1A 5IWAB 3OTOO 2A7WA 1HW7A 1XOUA 2JVDA 3TETA 3SYQA 3TJTA 3K5LA 1HNZO 1SA0A 3W7UA 1XNQO 1NT2B 1P7BA 4DUYB 1PV0A 3F7VC 2ADPA 3CPWU 1NVPD 3K9SA 1M4UA 3CCVV 1K5QA 3K9AA 4U3JA 1D2DA 1VF5B 1OHHG 4UV8A 2R9RB 1PL0A 2LJ2A 4IIJA 1XUQA 5KX5A 1FFXB 1S76D 2AZ0A 4JAAA 1JOYA 4JGSA 1B04A 1X4TA 3ZJZA 4X1KA 1YITV 5CBFA 5K1PA 4PJ0Z 4D7TA 1M56C 3E35A 3HB3B 3CJHB 4O4JB 4YY3B 1OV9A 3OTFA 3ML0A 1BE3H 3IAYA 2F4VO 2P7TC 5JJNB 2ZE8A 1XNRB 3KZIZ 5LYJA 3MDSA 4IL6Z 1AP6A 1SZXA 1F4MA 3K08A 1G6UA 2EJRA 5A9GA 3K58A 2UXDB 5EBWC 2Q73A 1JFFB 3B4SA 5DEDA 4JV5B 1ZUQA 3JYCA 3F7YC 4TV8B 1KYOF 2YEVB 3ZRSA 4B7EA 2YIBA 3BEHA 1WNSA 3S3WA 4UVAA 2OWOA 3SPCA 4X65O 3L75H 1VF7A 4TT3G 2GTSA 3RVZA 2PI4A 2JJ1G 2XAQA 1I08A 4ZOLB 1M57C 4F6RA 4YJ3A 4CH6A 3OMIB 2E75B 1M56B 4L8JA 3CRRA 1VQMV 2HHHO 2WLIA 4CZZA 1EN4A 1PNLA 1NH2D 1QQCA 1GO3F 3C3SA 3FFQA 2CK3G 2CTQA 3D36C 1FXKA 4XDKA 2HVKC 1GM9A 3T1YB 1XL4A 2BOBC 4DR2O 2F95B 2ZT9B 1I5YA 2DYRC 1EN5A 1N33O 2OYQA 5A2QN 2ZKOA 1KKCA 3QTCA 1TA8A 1BZKA 1VF6C 4I55A 4AHCA 3AG4C 3CSXA 2HEPA 4I4TA 4MSWC 1QR8A 5JVDA 1K3EA 1M57B 3ZRWA 4LF4B 4MTXA 4WFGA 2B5UA 4D6TH 4P9PA 4P2ZA 4BAYA 3RYCB 1M5IA 5KAIZ 3B77A 2DWEC 1WPBA 5LP6A 4OPAA 2WSSG 4GUNA 3KG2A 2EZOA 1WPXA 4FJCC 1H38A 2JGDB 2X6CA 4GX0A 4DR6B 3PJSK 2IU3A 4JASA 4B3TO 2IU0A 3SYAA 3RYHB 2X7RB 4CS4A 3VOUA 1BQZA 1QLEC 2BE3A 1M93A 1DF5A 1SQQH 2DYRB 5CMUA 3SJBC 4Z1VA 5KA6A 4DYLA 1BGYH 4NXNO 3HKDA 2FMLA 5IJ0B 2VQEO 2DQ3A 5H6QA 2Q7EA 3AG4B 4HNAA 4H37A 5TISZ 4I7ZB 4YHHB 4H13B 2KSDA 2Q8VA 3UO2A 5EC2C 1KMIZ 1L8DA 5KA5A 5EBMC 4GT1A 3APOA 3LUTB 2QEXV 3ABUA 2B1IA 1HR0B 4JPRA 3FX7A 2ZDIA 4LC1A 5JQGA 4QE7A 3W7XA 3AG3C 3DXRA 4CBCA 4DR4O 3CB2A 3JARA 4UCSA 1QLEB 2JEXA 1ZWIC 4DUZO 1IVSA 1ZAUA 4BIUA 1D5NA 1HNXO 4PI2A 3OGCC 3A0BZ 3ASNC 4JI3O 3TXQA 3K0DA 4X66B 1O9GA 3B8MA 2PUSA 4PDRA 4OPHA 1HP8A 4EB6B 3CRCA 2OIGA 1S77D 5KUMA 1AI5A 1KU9A 3EFFK 3T1HB 4LF9O 1FD9A 2P06A 1SESA 1K33A 1F23A 3APQA 2DOSA 4DV6B 2GSMB 4N21A 2LO1A 1BL8A 3H1IH 3LNMB 2YICA 3JCUZ 2D3OW 2QTSA 4F6EA 4LF6O 3T4ZA 2IH3C 1IDSA 4MVUA 4B3MO 3HPLC 1J5EB 2RDCA 2LGQA 3OR7C 1H2SB 2AHZA 5FNVB 4OXSA 3FD9A 1SRYA 2QWRB 4LFAO 2N04A 5E1AC 1BHAA 2EX3A 4DR1B 3AG3B 1AB3A 1PM9A 4YXWG 1XILA 1VQNV 1T5EA 4JI0B 5BR8B 4TSFG 3RYFB 3DGEA 3ASNB 1J95A 3DSQA 1IZ3A 1H8HG 2DYSC 5J2TA 4OX9O 4JI2O 3LSSA 5C93A 5L3CA 4J11A 2BTQA 1YZBA 4FLZA 4IGGA 2IJJA 3OW2U 2HJFC 5IJ9A 4RUFA 2V4DA 3G67A 2XOKG 2YIDA 5KHHA 5FPRA 2UXNA 3CMEV 4X1IA 3ASOC 2H94A 3HR0A 1KD1W 1K5SA 5JCOA 2E3CA 3N2GB 3B2EE 2Q69A 4GX2A 5LA6B 3JASA 2YSUB 1GN6A 1XL6A 2CE4A 4JI1B 4DRXA 3GVMA 1IBLO 4TV9A 4LFBO 2EILC 5KMGA 3WU2Z 1JMKC 3IC7A 2JDIG 2ADQB 3W7TA 1M90W 1AR4A 1FKAO 3ZMTA 3QO7A 1Y6XA 2DYSB 3LDCA 4J42A 1FJGB 5L3GA 2YIAA 4JYYA 3AK1A 4LH7A 2KB1A 1YTFC 4J7KA 1W2BU 4BIOA 2LW7A 1Q8IA 3ETEA 5H9CA 3I5DA 4B08A 3K04A 4DR7B 3ASOB 4YIOA 1KC8W 2K9PA 4JYAO 2ZINA 2JK5C 1R3LC 1TVKB 1XREA 4W4LA 3TXSA 3ZCCA 4H0LB 1MNGA 2HP8A 1FFXA 3AG1C 3ZIAG 5K1XA 4X62O 3E8GA 2WLHA 5KUKA 3H1LH 2RJZA 2UXCO 5H2FZ 2QM7A 2UUAB 2XUMA 1ZL8A 1V9PA 3WG7C 5EIBD 2AW9A 3ZRXA 2YI9A 3W7SA 5B3SC 2GDSA 2ZIOA 4FFBB 5LMUB 1B3QA 1SQXH 4K8ZA 1JCHA 3ICXA 3CJHA 4O4JA 2QM8A 2ZR3A 4FM0A 4RWUA 2IBZH 3RVYA 4PA4A 3CC4V 1YTFB 2ZD9A 4JTCB 1Q5OA 4LF7O 3OGIB 2UUAO 1YSCA 3I56V 4FMTA 2JEUA 5CA1B 1VQ6V 4O2BB 3ZHSA 3WB0A 1JJ2U 1JFFA 4YJ2B 4I0XB 4TV8A 3IC9A 4J7ZA 4K0KB 3OFNG 3L71H 1VQ4V 3D8CA 1PP9H 3STLC 2EZPA 4KHPO 1S5LZ 3AG1B 2E5LB 1WN7A 4CS3A 5BMVB 1BQ0A 3WG7B 1I94B 4QIWF 3E8BA 4E2LA 2Y48A 3H1HH 2ETNA 5B3SB 3ABKC 3BCCH 4ZOLA 3RYIB 2X6AA 2GUZA 4QPJA 1OCOC 4D7SA 1Q82W 2OTLV 2ZXWC 5CBGA 2WA3A 1S5HC 4F4LA 2P6JA 4AQYB 3HKBB 1VP7A 2CGOA 1SETA 2GBOA 3OE7G 5L3FA 1WB8A 4DV0O 3J81N 1R6KA 1Y67A 3TGUH 3MHHC 3RFRA 3ZEDA 3ZHTA 4WFHA 3BVOA 5EYPB 3IJ4A 4NXMO 3QO8A 3MD0A 1KP3A 4JI6B 2VWJA 2IH1C 5KAFZ 2QKSA 4JI8B 3ABKB 1VQ5V 3ZN0A 2VQFO 3RYCA 2G38A 3ETDA 1OCOB 2ZXWB 2RN9A 4ICGA 2QKCA 1NVPC 3CXHF 2LFSA 4FZ1A 2CGNA 4HAMA 1KECA 4B3SB 2JGDA 4K3AA 1MABG 5EC1C 3LNNA 4FPPA 2UUBB 1XBLA 2UXBO 3RYHA 5C8YA 3UKMA 1YJ9V 1S3JA 3BA9A 3QF7A 5ITZB 1Q86W 2UU9O 4RQFA 2WAMA 1OCZB 1JQ0A 1QR9A 2H3OA 1EBOA 4U7NA 1L0NH 5IJ0A 1XI1A 4LF8B 2R70A 5IWAO 2FB5A 1VF6A 3G4SV 3F5WC 3W7WA 1YXBA 2WPDG 1Q7YW 4DUYO 2QJ1A 3A0HZ 2V1DA 3U10A 2A3QA 1RM1C 4MS2A 1BHBA 4KP4A 1FAFA 4NTXA 3B09A 1QBZA 4JTAB 1NVPB 3GB7C 3J80N 2GHYA 2XTAA 1B06A 1JR9A 1TUBB 1RP3B 2HFEC 2KKWA 5B1BB 4P30A 4GKKB 1TGOA 3NR7A 2Q5ZA 3HKCA 2Q68A 3VQVA 1DLBA 4GLXA 4NVPA 4YY3O 4EB6A 4I9WA 4U7OA 5JJJB 1RFYA 2YUAA 1XNRO 3A8TA 1SQGA 2JS3A 5D5PA 3SPIA 2DJVA 3OMNB 3AK3A 4DR5B 2BTOA 2HVJC 4GZRB 1RM1B 4O2AB 2ITCC 2UXDO 4JV5O 4MT8A 3CCLV 1GN3A 4TQDA 3H9VA 3ABLC 4UUJC 5FNVA 1XMQB 1NTZH 1IBMB 1EZVH 4R50A 3T4DA 3JAWA 3N2KB 3K3WA 4KFMA 4BIZA 1NTMH 2LP7A 2UUCB 5DN6G 2NR5A 3FYEB 3FAVB 3EXAA 2QDOA 4RQEA 3RYFA 2F1MA 3E8HA 2PF4E 2E76B 3QNEA 1WA8B 3D3IA 4CC5A 4XDJA 3E22B 4DV3B 4MW8A 1WP8A 4X1YB 4JZ2A 4MVZA 4LF5B 1JJOA 3CRMA 1EN6A 3CEIA 5L3EA 3WB1A 4DV7B 2D2CB 2EIMC 4G27B 1JPXA 3SJCC 4BW9A 2XAFA 3KCXA 4N23A 2EINC 3T1YO 4RAIA 4FK5C 1GK9A 3ABLB 1U96A 3L9DA 2EIKC 2QA4V 3N2GA 1AROP 4ZBMA 2BOCC 4NTWA 2JIZG 4DV5B 4PI0A 5GONB 3SYPA 1K7DA 4LBEC 2WA4A 2KQXA 3MAQA 2XT9A 2R72A 4JI7B 4LF4O 1H2GA 5CA0B 4ZIBA 3SJQC 1IBKB 2JRIA 5IDJA 2ARHA 1LUVA 1R1BA 4EFBA 4GCZA 1CP9A 3RT3C 4DR6O 2QR4A 3SYCA 1TUEB 3LDDA 2EIMB 1NTKH 4JI7O 3DTUB 1FXHA 1VEWA 2EINB 4Z2WA 3A0RA 3QVNA 4O4LB 2NNUA 3B8NA 3JSNA 2EIKB 5BZBA 2OIEA 1FFTB 3LSQA 2ODMA 1TVKA 1GH6A 3K57A 3IFXA 4MVMA 2W6JG 3JALB 2Y0PA 1H8EG 3AG7A 3ABTA 1SC5B 4YHHO 1IXBA 1N0NA 4GX1A 1MZEA 4L87A 2YIBD 4MVSA 1QVGU 4FFBA 4DXWA 1Q6HA 2FL4A 4TQFA 4EKWA 3G71V 2FKXA 3RGBA 4XBFA 5J9PC 4UB8Z 2DN9A 1HR0O 3S3XA 3CP1A 1VQKV 4PA7A 3KCYA 1Z2GA 5CA1A 3JCZA 3H01A 3JAMN 4X20B 4O2BA 1R6TA 1ORQC 4X89A 3ZHVA 4LWSB 1G1XB 1Y74B 1GN2A 4YJ2A 4I0XA 3CCRV 4BW5A 3OR6C 2DMXA 4X66O 1B6QA 1M9NA 1YCIA 5IYDO 4WFAV 5EZYB 3T1HO 4PDVA 5J2UB 5BMVA 1N32B 3LSUA 5LXTB 4DV6O 4TUYB 4F6RB 3L73H 5B1OA 1I5XA 3RYIA 1SKVA 5DECA 4EFEA 4HBNA 3K03A 4FM1A 5KHIA 3UCSC 1J5EO 3OMAB 5L3BA 2BSKA 4C7UA 2XNDG 5AG2A 4GKJB 4QE9A 2NLJC 1R3JC 2EJ7A 3HKBA 4DR1O 2PYJA 2RNBA 4X64B 2Q67A 5E79Z 4MTOA 1MOFA 3GWKC 4NYKA 3TCUA 4JI0O 5BR8O 4DK1A 3OT7A 5D5QA 2BCCH
chains in the Genus database with same CATH topology
5LBQA 1V55B 1M56C 1NBMG 3E35A 2HR3A 3HB3B 4JYCA 2DW4A 2OTJV 3WG7B 2A79B 4QIWF 3E8BA 4E2LA 2Y48A 3RW0A 1L1FA 1RPRA 3ML0A 5B3SB 3ABKC 2P7TC 4PDMA 2X6AA 5LGUA 2JJ2G 5LHHA 3CCSV 3E2EA 1Y4MA 1EZJA 4QPKA 4HZ3A 4MVRA 1KQSU 4QPJA 1OCOC 2P90A 1Q82W 1LNQA 2OTLV 1AJNA 1F4MA 3K08A 2ZXWC 1N8RW 5CBGA 2EJRA 1S5HC 3ZMUA 4F4LA 4J9YB 2P6JA 5EBWC 2XAHA 3ZMZA 3JYCA 3F7YC 3JD1A 1SETA 2YEVB 3ZRSA 3OE7G 3BEHA 1CEZA 3P30A 4UVAA 5L3FA 2Y69B 3GWOA 5LHGA 3FKSG 1K4CC 1R6KA 3SPCA 3MHHC 4TT3G 2ATKC 1R3IC 4WFHA 1JX9A 3RVZA 2PI4A 2JJ1G 2XAQA 2WLLA 1M57C 3UM7A 2IW5A 1WLEA 2W6IG 1VQ8V 3OMIB 2HLDG 3QO8A 4J9ZB 1YI2V 3MD0A 2C2AA 1M56B 4MTGA 1KP3A 2IH1C 1VQMV 4ASUG 2WLIA 2QKSA 4CZZA 3IGAC 3R65A 1PNLA 1E79G 3ABKB 1NH2D 1FXKC 1VQ5V 3ZN0A 1GO3F 1V54C 1F51A 2CK3G 1NR7A 4RO2A 3CC7V 1VQ7V 1NKDA 4H33A 3ETDA 1OCOB 3X2QC 2ZXWB 1FXKA 1G8MA 3K79A 4XDKA 1NVPC 2HVKC 2LFSA 1GM9A 4HAMA 1KECA 2MK3A 1XL4A 3ZN1A 1ROPA 2BOBC 1MABG 5EC1C 3ZMSA 2ZR2A 1I5YA 1MG1A 1UJWB 2DYRC 4FPPA 2A0LA 2Z5UA 3WFVA 5CA3A 2WLLB 3UKMA 1YJ9V 3RBZA 1S3JA 4QJFB 1Q86W 4RQFA 5EBLC 2WAMA 1GM8A 3CYOA 1OCZB 3AG2C 3AG4C 2WLIB 1JQ0A 1QR9A 4MSWC 1QR8A 1K3EA 2R9IA 3E8FA 1GM7A 1EBOA 1M57B 4U7NA 3SYOA 3ZRWA 1OCRC 4MTXA 4WFGA 2B5UA 1S72V 4Q20A 3CCEV 4P9PA 4P2ZA 4BAYA 3AEIA 2OCCC 3G4SV 3F5WC 3B77A 2DWEC 3W7WA 3E86A 2WSSG 1FXKB 3KG2A 2YEVA 2WPDG 1Q7YW 2EZOA 2UXXA 1V54B 1WPXA 4FJCC 1H38A 2IJIA 2X6CA 4GX0A 2V1DA 3PJSK 5LHIA 1RM1C 2M7WA 2IU3A 4JASA 4MS2A 1BHBA 4KP4A 4LCUC 1QVFU 2IU0A 3SYAA 3X2QB 1OCCB 2X7RB 1QBZA 4JTAB 3VOUA 1NVPB 3GB7C 1YJNV 1KP2A 1IXMA 1QLEC 2GHYA 1DF5A 2DYRB 5CMUA 2HFEC 5KA6A 3OUSA 5B1BB 1THZA 4P30A 3P32A 3ZRWB 4JAVA 1S0VA 2DQ3A 4HYOA 5H6QA 4MVQA 1RPOA 4R7CA 1K9MW 3AG2B 3AG4B 4H37A 2Q68A 2B1GA 1DLBA 3K06A 1PNMA 5EC2C 1OCRB 4PA3A 2P67A 1R73A 3ZRVA 5HFMA 1K8AW 4I9WA 3T1CA 2OCCB 3OEHG 4U7OA 2ZDIC 2AHYA 3LDEA 3CCJV 5KA5A 5EBMC 4GT1A 3LUTB 5B1AC 3SPIA 3E89A 1OCZC 3OMNB 4LP8A 5IY5C 2QEXV 3ABUA 2B1IA 4JPRA 2HVJC 3ABMB 1RM1B 2Z3YA 2ITCC 2ZDIA 1YIJV 3K0GA 4LC1A 4QE7A 4MT8A 1AR1B 3W7XA 3AG3C 3CCLV 4CBCA 1EFRG 3ABLC 1VQLV 1QLEB 2JEXA 4UUJC 1ZWIC 1AI4A 4WCEV 4BIUA 1NR1A 4R50A 3T4DA 3ZMVA 4RUEA 2QE7G 5CBHA 3OEEG 4WFEA 3OGCC 3ASNC 4UVCA 3K3WA 4KFMA 2EIJC 1ENVA 4BIZA 3K0DA 5IYBO 2LP7A 1K92A 3B8MA 4PDRA 5DN6G 1OCCC 4TWKA 2PI5A 1E1RG 3FYEB 2H8PC 3OM3B 3M99B 1S77D 5KUMA 1AI5A 4RQEA 3EFFK 1Q81W 3E8HA 3VBBA 4MVOA 1K97A 1SESA 3QNEA 1K33A 1F23A 3D3IA 3SPJA 2GSMB 1GTOA 4N21A 1YTFD 1BL8A 3SPHA 3D36A 4XDJA 5B1BC 5FL7G 4MW8A 3LNMB 2LFRA 4MVZA 3CCMV 2D3OW 1COWG 3T2MA 2OT5A 2EILB 4I5SA 3T4ZA 2IH3C 5B1AB 4MVUA 3HPLC 4G28B 5L3EA 5IY5B 2EBOA 5EK0A 3OR7C 2EIMC 4G27B 1JPXA 2AHZA 2XAFA 4OXSA 4N23A 1Y66A 1SRYA 4WFBV 4UXNA 2IJHA 4JAUA 4UV9A 2EINC 5E1AC 4RAIA 1BHAA 3FB6C 4FK5C 2DWDC 4WFFA 3AG3B 2X6BA 1YJWV 1GK9A 4YXWG 2A9HA 3ABLB 1VQNV 4PELA 2EIKC 2QA4V 5CN0A 1GMGA 1AROP 5B1NA 4ZBMA 2BOCC 3JD0A 2Q6AA 1AI6A 2JIZG 4TSFG 1QLNA 3BY6A 3DGEA 3ASNB 1J95A 3SYPA 1QCEA 1K7DA 1K34A 3ABMC 3SPGA 1VQPV 4LBEC 2EIJB 2WLMA 1E1QG 3MHSC 1F4NA 1CPYA 1H8HG 2DYSC 3LSSA 5C93A 1W0KG 5L3CA 1VQ9V 1H2GA 2QTOA 3EHBB 3SJQC 1JVMA 2IJJA 3OW2U 5DM6V 1PKXA 2HJFC 3FB5C 4RUFA 4PDLA 1SZTA 3JD3A 4PA9A 5IDJA 2DQ0A 2XOKG 1DF4A 4GCZA 1CP9A 4MW3A 1SERA 2UXNA 3FYIB 3CCQV 2FTKA 3CMEV 3CC2V 2WLNA 3TK1A 1G4YB 2ITDC 3ASOC 1VQOV 2H94A 3OUFA 2F43G 3SYCA 1TUEB 3LDDA 2WLJA 1KD1W 2EIMB 1K5SA 3FB8C 1K4DC 2XAGA 4X8AA 3QO5A 3DTUB 1R3KC 1FXHA 4GX2A 2Q69A 1HWYA 5GW7A 1NJIW 2EINB 3A0RA 4FIPC 2YSUB 4GX5A 3CMAV 1XL6A 2NNUA 3B8NA 1M1KW 5IYCO 4G2KA 1NH2C 1DTOA 2EILC 2ZQMA 2EIKB 4DO2A 5BZBA 3IC7A 1FFTB 2JDIG 3LSQA 1R6NA 1GKFA 3IFXA 4MVMA 2W6JG 3W7TA 1M90W 4X88A 1H8EG 1MSWD 3ZMTA 3QO7A 3ABTA 5LGTA 2DYSB 3LDCA 4P9OA 3JD4A 5L3GA 3CXCU 4GX1A 4JF3A 4KUMA 4L87A 2HG5C 2KB1A 4MVSA 1AJQA 1QVGU 1YTFC 1NQTA 4DXWA 4MTFA 1W2BU 3CD6V 3STZC 2X0LA 4EKWA 3G71V 3ETEA 5H9CA 3E83A 1FS0G 2K1EA 4XBFA 5J9PC 1PD3A 3K04A 4XDLA 1BMFG 2IJKA 3CP1A 3ASOB 1VQKV 4PA7A 1KC8W 1AI7A 4R8CA 1KKDA 3ETGA 1P4RA 3JD2A 3JCZA 2JK5C 1W0JG 4QNHB 1R3LC 3H01A 4ZKIA 3ZCCA 1ORQC 2W0FC 4X89A 3AG1C 3ZIAG 4R6ZA 3E8GA 2WLHA 1YHQV 5HFLA 1NH2B 4UVBA 5KUKA 2XASA 1V55C 2QM7A 2WLKA 3CCRV 4BW5A 3WG7C 3OR6C 2XAJA 3NXSA 3ZRXA 1B6QA 1FXVA 3W7SA 5B3SC 1M9NA 3I55V 4JTDB 1K73W 5IYDO 4WFAV 4PDVA 2V7QG 5H6RA 1JCHA 3TETA 3SYQA 2QM8A 2ZR3A 5B1OA 3W7UA 4JYBA 1I5XA 3RVYA 2HKOA 1P7BA 3F7VC 3FB7C 4PA4A 3CC4V 1YTFB 2ZD9A 4JTCB 3CPWU 1NVPD 3K03A 3CCVV 1K5QA 3K9AA 1YSCA 3I56V 4FMTA 2JEUA 1AJPA 5LGNA 1VQ6V 3OMAB 1OHHG 5L3BA 4UV8A 3OAAG 2R9RB 2XNDG 1PL0A 2Y69C 4QE9A 4Z1MG 1JJ2U 2NLJC 1PNKA 1OZ0A 1R3JC 1S76D 3G6EV 1JOYA 3OFNG 2Q67A 4JGSA 4WF9V 1VQ4V 4MTOA 3ZJZA 3STLC 1MOFA 4PA6A 5L3DA 2EZPA 1YITV 3CCUV 3TCUA 5CBFA 3AG1B 2WWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RM1 B;  1NVP C;  1RM1 C;  1NVP D;  1YTF C;  5IYC O;  5IYB O;  1YTF D;  1NH2 C;  1NH2 D;  5IYD O; 
#chains in the Genus database with same CATH topology
 2LW1 A;  1NBM G;  4JYC A;  2DW4 A;  2OTJ V;  2A79 B;  3RW0 A;  1L1F A;  3WB2 A;  1IX9 A;  5EYP A;  5LGU A;  2JJ2 G;  3CCS V;  1Z5V A;  4CH5 A;  4HZ3 A;  1RSO B;  1KQS U;  2P90 A;  4IYH A;  1LNQ A;  5IYZ B;  1AJN A;  1N8R W;  5B66 Z;  3ZMU A;  4B3R B;  2FYU H;  2XAH A;  1QHT A;  4JI5 B;  2F23 A;  3JD1 A;  4JI4 B;  4LFC B;  2ZM6 B;  4IHJ A;  3GWO A;  5LHG A;  3FKS G;  1K4C C;  4K8X A;  1XDC A;  5H5N A;  1AIL A;  2ZE5 A;  2W0X A;  1I0H A;  4GYC B;  4JI1 O;  2ATK C;  2P5O A;  2Y0I A;  1JX9 A;  2Q0O C;  4U3F H;  1US6 A;  2IW5 A;  2YC0 A;  4O4I B;  5ITZ A;  2YDE A;  2HLD G;  3SGI A;  1OJH A;  5EIB C;  3ZHR A;  3IGA C;  4UFZ A;  1FJG O;  1N4C A;  4CH3 A;  1XMO B;  1V54 C;  3UT5 B;  1F51 A;  4DW1 A;  1VQ7 V;  4UCR A;  4H33 A;  4FLU A;  1XEQ A;  4QGP A;  3ZN1 A;  1ROP A;  1BSM A;  3ZMS A;  4DV4 B;  4DR7 O;  2ZR2 A;  4KXR A;  3CHX A;  3HKE B;  1BS3 A;  3R66 A;  3RWR D;  2WLL B;  1XHZ A;  1N36 B;  1XMO O;  3RBZ A;  4FLY A;  2ZNJ A;  4UCV A;  3U11 A;  5EBL C;  1TUB A;  2N74 A;  3CYO A;  3ETQ A;  2PTM A;  2ZNI A;  1Q6I A;  2XHB A;  3H1J H;  2IM9 A;  3CCE V;  2QWN B;  1AVM A;  2P22 C;  5LMU O;  1HNW B;  2YEV A;  1N36 O;  2UXX A;  1V54 B;  4A5U B;  1F7Y A;  3L74 H;  2IJI A;  1O9H A;  4FLT A;  1NS1 A;  4DR3 B;  4J7J A;  4KL1 A;  4LCU C;  1H2L A;  1LUW A;  2HJD A;  1JA8 A;  1OCC B;  4FM2 A;  2CDY A;  1FYJ A;  4DV2 B;  1YVW A;  1YJN V;  1KP2 A;  3JSL A;  4O2A A;  4DV1 B;  1GAX A;  2QM4 A;  3OUS A;  1THZ A;  3P32 A;  4K0K O;  1S0V A;  2R9A A;  4HYO A;  1XHX A;  1RPO A;  4R7C A;  1S5J A;  1K9M W;  3AK2 A;  1Q6U A;  2E5L O;  3N2K A;  4J80 A;  1YF2 A;  3K06 A;  1I94 O;  1R73 A;  2EUL A;  3QG5 A;  1EM1 A;  2CAZ C;  5HFM A;  1K8A W;  3FAV A;  3T1C A;  3C3T A;  3OEH G;  2ZE6 A;  3LDE A;  3CCJ V;  5B1A C;  3E89 A;  1OCZ C;  4LP8 A;  5IY5 C;  2B9Z A;  1WJZ A;  4X1Y A;  3ABM B;  1SQB H;  1YIJ V;  4AQY O;  2ZIM A;  5IJ9 B;  2Q4P A;  3PN1 A;  3KKY A;  4NTY A;  2Z0A A;  4UCT A;  4ZI7 B;  1N34 B;  4FZ0 A;  1AI4 A;  1L0L H;  2PYL A;  3ZMV A;  4RUE A;  3OEE G;  4WFE A;  4UVC A;  3ZBH A;  2CTR A;  2OCH A;  1ENV A;  2YXL A;  3P3P A;  3M99 B;  3OTO B;  4BWA A;  3VBB A;  5GON A;  4JI6 O;  3L70 H;  3SPJ A;  1GTO A;  1HNZ B;  3D36 A;  4CS2 A;  5B1B C;  4JI8 O;  4W4K A;  1XNQ B;  1Y76 B;  2LFR A;  4WBN B;  2JS5 A;  3EVK A;  4I50 B;  5CA0 A;  1P49 A;  5CB4 B;  1I7F A;  2OT5 A;  4I5S A;  5B1A B;  4G28 B;  1MSD A;  5IY5 B;  3C90 A;  4UB6 Z;  2IJH A;  4UV9 A;  4B3S O;  1ZTE A;  4WFF A;  2NN4 A;  2DWD C;  1YJW V;  2X6B A;  1SQF A;  2UUB O;  3VQW A;  1UPG A;  5KLV H;  2YXH A;  1MMM A;  1GMG A;  5B1N A;  1WAZ A;  3JD0 A;  2Q6A A;  3H1K H;  4O4L A;  4J41 A;  3SDL A;  1VQP V;  2PGG A;  1E1Q G;  3ZS8 C;  1F4N A;  1CPY A;  2F4V B;  1SQV H;  3DC6 A;  1W0K G;  5KHG A;  1U97 A;  1VQ9 V;  2QTO A;  3EHB B;  3JAL A;  4LF8 O;  4FFK A;  5DM6 V;  1ZL8 B;  4OGQ B;  1AR5 A;  2RMK B;  4PDL A;  1Q3E A;  3JAK B;  3Q4H B;  1DF4 A;  4MW3 A;  1SER A;  5KHJ A;  3FYI B;  4PD4 F;  2QSA A;  2WLN A;  3OUF A;  2F43 G;  3FB8 C;  2XAG A;  2YXY A;  3QO5 A;  2Q7H A;  1R3K C;  1HWY A;  2RQ6 A;  1ZX3 A;  2VS0 A;  4X65 B;  2P4K A;  5LOV B;  3BFR A;  4ZHQ B;  1M1K W;  1NZ6 A;  2GTA A;  1NH2 C;  4G2K A;  1DTO A;  5JH7 B;  4UCU A;  1R6N A;  4GKK O;  1XQ8 A;  4X20 A;  3N27 A;  2PZS A;  4LWS A;  2HHH B;  1MSW D;  1Y74 A;  1VIB A;  5LGT A;  3JAT B;  4FLV A;  2YS8 A;  3ZX6 A;  2LQT A;  4P9O A;  3CXC U;  4JF3 A;  2HG5 C;  1AJQ A;  1DK1 A;  1ZSP A;  1NQT A;  5EZY A;  5J2U A;  3BAB A;  2A06 H;  3STZ C;  3K59 A;  2X0L A;  5LXT A;  4FLW A;  4TUY A;  3E83 A;  1WB7 A;  2K1E A;  4DR5 O;  2GUZ B;  1BMF G;  4DR2 B;  2E74 B;  2Q9L A;  1N33 B;  1AI7 A;  4R8C A;  3VQY A;  1KKD A;  3CRQ A;  1P4R A;  1N0J A;  3JD2 A;  1XMQ O;  2CH7 B;  1IBM O;  2W0F C;  4FLX A;  4R6Z A;  1YHQ V;  1NH2 B;  2XAS A;  1V55 C;  3P3N A;  2XAJ A;  3NXS A;  2UUC O;  3UO3 A;  1P84 F;  4O4H B;  4LNU B;  2V7Q G;  3K5N A;  5H6R A;  4X9Q A;  4JYB A;  4DV3 O;  2HKO A;  3FB7 C;  1A32 A;  1TAE A;  4B3T B;  5LA6 A;  3J7A U;  4LF5 O;  2Y4U A;  2KG7 B;  3F5T A;  1RSO A;  4DV7 O;  1AJP A;  5LGN A;  2QWO B;  1SS3 A;  5IYZ A;  3OAA G;  4FVM A;  1SQP H;  2VRZ A;  4TOI A;  2Y69 C;  4Z1M G;  2N05 A;  3CE2 A;  1PNK A;  1OZ0 A;  4ABM A;  5KHK A;  3G6E V;  4NXN B;  1MA1 A;  2DE0 X;  4WF9 V;  1GRJ A;  4B7K A;  1NI8 A;  2VQE B;  4PA6 A;  5L3D A;  1DGS A;  3CCU V;  5IT9 N;  2WWW A;  4DV5 O;  3D3Q A;  5LBQ A;  1V55 B;  2HR3 A;  5C8Y B;  5GTH Z;  1SA0 B;  1RPR A;  1PL4 A;  4PDM A;  4O4I A;  3THO A;  2QGN A;  4BR6 A;  2LGW A;  5LHH A;  3E2E A;  1FPO A;  5GTI Z;  1IBK O;  1Y4M A;  4U3J B;  1EZJ A;  4QPK A;  3CWB H;  4MVR A;  3CRA A;  4IIJ B;  4J9Y B;  5KX5 B;  3UT5 A;  1CXZ B;  2F66 C;  1LR1 A;  3ZMZ A;  4DK0 A;  1H2M A;  1AP5 A;  2P4V A;  4H44 B;  4DR4 B;  5FPO A;  1ZLZ A;  3P30 A;  1CEZ A;  4X1K B;  2Y69 B;  4DUZ B;  5BXZ A;  1HNX B;  4JI3 B;  1KBH A;  3HKE A;  1R3I C;  2WLL A;  3UM7 A;  2RCV A;  1WLE A;  2W6I G;  1VQ8 V;  4J9Z B;  1YI2 V;  4LF9 B;  2C2A A;  1Z5W A;  4MTG A;  2YI8 A;  5LYJ B;  4ASU G;  3R65 A;  4LR3 A;  1E79 G;  1FXK C;  2QKA A;  3CX5 F;  3BHP A;  3HKC B;  4LF6 B;  1NR7 A;  4RO2 A;  3CC7 V;  4B3M B;  1NKD A;  2ILM A;  3X2Q C;  3K79 A;  1G8M A;  4I9Q A;  4LFA B;  4DW0 A;  5LMN B;  3CS5 A;  2MK3 A;  1Q43 A;  1MG1 A;  1UJW B;  2A0L A;  2Z5U A;  3WFV A;  5CA3 A;  1NU1 H;  1Q90 D;  4YJ3 B;  4QJF B;  1GM8 A;  2VWK A;  3AG2 C;  2WLI B;  3O9O A;  5LP6 C;  5LL6 Y;  1VMG A;  1D5A A;  4OX9 B;  4JI2 B;  2R9I A;  3E8F A;  5JWP A;  1GM7 A;  3SYO A;  5LMN O;  1OCR C;  1S72 V;  3JAW B;  4Q20 A;  3AEI A;  2OCC C;  3E86 A;  4UCO A;  1N32 O;  1FXK B;  2O57 A;  2CUG A;  4CC6 A;  5LHI A;  2M7W A;  1X59 A;  1QVF U;  3X2Q B;  5FLX N;  1SF9 A;  1IXM A;  4GKJ O;  3O65 A;  1BCC H;  1YEW A;  4I55 B;  3RN4 A;  1IBL B;  4LFB B;  4I4T B;  5JVD B;  4X64 O;  4AI8 A;  3ZRW B;  3OD4 A;  4JAV A;  4ZI7 A;  4IYI A;  5IE9 A;  4MVQ A;  4PV1 B;  3AG2 B;  3B40 A;  5LP6 B;  3L72 H;  2B1G A;  3ZHQ A;  1PNM A;  1OCR B;  4PA3 A;  2P67 A;  3ZRV A;  1GN4 A;  2AGA A;  2OCC B;  3K5O A;  2ZDI C;  2AHY A;  5JJE B;  1YDX A;  3BPZ A;  2PY5 A;  1Y76 A;  4B3R O;  4WBN A;  2Z3Y A;  2AZ2 A;  1H2N A;  4I50 A;  3K0G A;  5CB4 A;  4JI5 O;  1AR1 B;  3BAA A;  4JI4 O;  4JYA B;  4LFC O;  3HKD B;  1EFR G;  3M7M X;  2QWQ B;  1VQL V;  2ZM6 O;  1H2K A;  4WCE V;  4E4E A;  1NR1 A;  4X62 B;  2QE7 G;  5CBH A;  4HNA B;  2UXC B;  1KUQ A;  3A2F A;  2EIJ C;  5IYB O;  1K92 A;  1OCC C;  4TWK A;  2PI5 A;  1E1R G;  4NR1 A;  2H8P C;  3OM3 B;  4Q6G A;  1Q81 W;  3DC5 A;  4MVO A;  1K97 A;  2JGU A;  1YTF D;  3SPH A;  1P7G A;  5FL7 G;  3CCM V;  3BA8 A;  1COW G;  3T2M A;  2EIL B;  5JQG B;  4LF7 B;  3DXR B;  2EBO A;  3JAR B;  5EK0 A;  3JAK A;  3Q4H A;  1KB9 F;  4WFB V;  1Y66 A;  5F2V O;  4UXN A;  4JAU A;  1URF A;  4DV4 O;  3FB6 C;  4PHZ A;  2ZE7 A;  2A9H A;  4PEL A;  2L6L A;  5CN0 A;  1W59 A;  4KHP B;  3SR2 C;  1AI6 A;  1QLN A;  3BY6 A;  5LOV A;  1QCE A;  3ABM C;  1K34 A;  3SPG A;  4NKG B;  4ZHQ A;  2ZCE A;  2EIJ B;  2WLM A;  3MHS C;  5JH7 A;  1BT8 A;  2MW2 B;  1JVM A;  3VQX A;  1PKX A;  3FB5 C;  1HNW O;  1SZT A;  3JD3 A;  4PA9 A;  2DQ0 A;  3JAT A;  1VAR A;  5JCO C;  4IT5 A;  2CTP A;  3M8A A;  5B5E Z;  2CTW A;  3CCQ V;  2FTK A;  3CC2 V;  3G80 A;  3TK1 A;  1G4Y B;  2ITD C;  4DR3 O;  1VQO V;  3ZHU A;  2WLJ A;  1K4D C;  4X8A A;  4AIL C;  2GV9 A;  4DV2 O;  4DV0 B;  2QWP B;  5GW7 A;  1NJI W;  1QNM A;  4FIP C;  3UQ8 A;  4GX5 A;  3CMA V;  4DV1 O;  2AXT Z;  5IYC O;  2F93 B;  4YIP A;  2BSK B;  2ZQM A;  4DO2 A;  5J2T B;  4NB5 A;  1WA8 A;  4CH4 A;  1WP7 A;  1PPJ H;  1GKF A;  3E22 A;  3K5M A;  2CH7 A;  4NXM B;  2BTQ B;  4X88 A;  1QU7 A;  3U0Z A;  1IUR A;  3JD4 A;  2VQF B;  2Q0A A;  4KUM A;  4O4H A;  4X1I B;  4LNU A;  4EEQ A;  4MTF A;  3G6B A;  3CD6 V;  3SJA C;  1FS0 G;  2M6Y A;  4J10 A;  1PD3 A;  3JAS B;  4XDL A;  2IJK A;  4JZG A;  4LH6 A;  4K35 A;  4DRX B;  3ETG A;  2UXB B;  4TV9 B;  5KMG B;  2Q7G A;  2KG7 A;  1W0J G;  4QNH B;  4ZKI A;  1N34 O;  2UU9 B;  1UFI A;  5HFL A;  2L35 A;  4UVB A;  1HDJ A;  1MZF A;  2WLK A;  4IHJ B;  3BRC A;  1FXV A;  3I55 V;  2Y4T A;  4JTD B;  1K73 W;  5BY1 A;  5IWA B;  3OTO O;  2A7W A;  1HW7 A;  1XOU A;  2JVD A;  3TET A;  3SYQ A;  3TJT A;  3K5L A;  1HNZ O;  1SA0 A;  3W7U A;  1XNQ O;  1NT2 B;  1P7B A;  4DUY B;  1PV0 A;  3F7V C;  2ADP A;  3CPW U;  1NVP D;  3K9S A;  1M4U A;  3CCV V;  1K5Q A;  3K9A A;  4U3J A;  1D2D A;  1VF5 B;  1OHH G;  4UV8 A;  2R9R B;  1PL0 A;  2LJ2 A;  4IIJ A;  1XUQ A;  5KX5 A;  1FFX B;  1S76 D;  2AZ0 A;  4JAA A;  1JOY A;  4JGS A;  1B04 A;  1X4T A;  3ZJZ A;  4X1K A;  1YIT V;  5CBF A;  5K1P A;  4PJ0 Z;  4D7T A;  1M56 C;  3E35 A;  3HB3 B;  3CJH B;  4O4J B;  4YY3 B;  1OV9 A;  3OTF A;  3ML0 A;  1BE3 H;  3IAY A;  2F4V O;  2P7T C;  5JJN B;  2ZE8 A;  1XNR B;  3KZI Z;  5LYJ A;  3MDS A;  4IL6 Z;  1AP6 A;  1SZX A;  1F4M A;  3K08 A;  1G6U A;  2EJR A;  5A9G A;  3K58 A;  2UXD B;  5EBW C;  2Q73 A;  1JFF B;  3B4S A;  5DED A;  4JV5 B;  1ZUQ A;  3JYC A;  3F7Y C;  4TV8 B;  1KYO F;  2YEV B;  3ZRS A;  4B7E A;  2YIB A;  3BEH A;  1WNS A;  3S3W A;  4UVA A;  2OWO A;  3SPC A;  4X65 O;  3L75 H;  1VF7 A;  4TT3 G;  2GTS A;  3RVZ A;  2PI4 A;  2JJ1 G;  2XAQ A;  1I08 A;  4ZOL B;  1M57 C;  4F6R A;  4YJ3 A;  4CH6 A;  3OMI B;  2E75 B;  1M56 B;  4L8J A;  3CRR A;  1VQM V;  2HHH O;  2WLI A;  4CZZ A;  1EN4 A;  1PNL A;  1NH2 D;  1QQC A;  1GO3 F;  3C3S A;  3FFQ A;  2CK3 G;  2CTQ A;  3D36 C;  1FXK A;  4XDK A;  2HVK C;  1GM9 A;  3T1Y B;  1XL4 A;  2BOB C;  4DR2 O;  2F95 B;  2ZT9 B;  1I5Y A;  2DYR C;  1EN5 A;  1N33 O;  2OYQ A;  5A2Q N;  2ZKO A;  1KKC A;  3QTC A;  1TA8 A;  1BZK A;  1VF6 C;  4I55 A;  4AHC A;  3AG4 C;  3CSX A;  2HEP A;  4I4T A;  4MSW C;  1QR8 A;  5JVD A;  1K3E A;  1M57 B;  3ZRW A;  4LF4 B;  4MTX A;  4WFG A;  2B5U A;  4D6T H;  4P9P A;  4P2Z A;  4BAY A;  3RYC B;  1M5I A;  5KAI Z;  3B77 A;  2DWE C;  1WPB A;  5LP6 A;  4OPA A;  2WSS G;  4GUN A;  3KG2 A;  2EZO A;  1WPX A;  4FJC C;  1H38 A;  2JGD B;  2X6C A;  4GX0 A;  4DR6 B;  3PJS K;  2IU3 A;  4JAS A;  4B3T O;  2IU0 A;  3SYA A;  3RYH B;  2X7R B;  4CS4 A;  3VOU A;  1BQZ A;  1QLE C;  2BE3 A;  1M93 A;  1DF5 A;  1SQQ H;  2DYR B;  5CMU A;  3SJB C;  4Z1V A;  5KA6 A;  4DYL A;  1BGY H;  4NXN O;  3HKD A;  2FML A;  5IJ0 B;  2VQE O;  2DQ3 A;  5H6Q A;  2Q7E A;  3AG4 B;  4HNA A;  4H37 A;  5TIS Z;  4I7Z B;  4YHH B;  4H13 B;  2KSD A;  2Q8V A;  3UO2 A;  5EC2 C;  1KMI Z;  1L8D A;  5KA5 A;  5EBM C;  4GT1 A;  3APO A;  3LUT B;  2QEX V;  3ABU A;  2B1I A;  1HR0 B;  4JPR A;  3FX7 A;  2ZDI A;  4LC1 A;  5JQG A;  4QE7 A;  3W7X A;  3AG3 C;  3DXR A;  4CBC A;  4DR4 O;  3CB2 A;  3JAR A;  4UCS A;  1QLE B;  2JEX A;  1ZWI C;  4DUZ O;  1IVS A;  1ZAU A;  4BIU A;  1D5N A;  1HNX O;  4PI2 A;  3OGC C;  3A0B Z;  3ASN C;  4JI3 O;  3TXQ A;  3K0D A;  4X66 B;  1O9G A;  3B8M A;  2PUS A;  4PDR A;  4OPH A;  1HP8 A;  4EB6 B;  3CRC A;  2OIG A;  1S77 D;  5KUM A;  1AI5 A;  1KU9 A;  3EFF K;  3T1H B;  4LF9 O;  1FD9 A;  2P06 A;  1SES A;  1K33 A;  1F23 A;  3APQ A;  2DOS A;  4DV6 B;  2GSM B;  4N21 A;  2LO1 A;  1BL8 A;  3H1I H;  3LNM B;  2YIC A;  3JCU Z;  2D3O W;  2QTS A;  4F6E A;  4LF6 O;  3T4Z A;  2IH3 C;  1IDS A;  4MVU A;  4B3M O;  3HPL C;  1J5E B;  2RDC A;  2LGQ A;  3OR7 C;  1H2S B;  2AHZ A;  5FNV B;  4OXS A;  3FD9 A;  1SRY A;  2QWR B;  4LFA O;  2N04 A;  5E1A C;  1BHA A;  2EX3 A;  4DR1 B;  3AG3 B;  1AB3 A;  1PM9 A;  4YXW G;  1XIL A;  1VQN V;  1T5E A;  4JI0 B;  5BR8 B;  4TSF G;  3RYF B;  3DGE A;  3ASN B;  1J95 A;  3DSQ A;  1IZ3 A;  1H8H G;  2DYS C;  5J2T A;  4OX9 O;  4JI2 O;  3LSS A;  5C93 A;  5L3C A;  4J11 A;  2BTQ A;  1YZB A;  4FLZ A;  4IGG A;  2IJJ A;  3OW2 U;  2HJF C;  5IJ9 A;  4RUF A;  2V4D A;  3G67 A;  2XOK G;  2YID A;  5KHH A;  5FPR A;  2UXN A;  3CME V;  4X1I A;  3ASO C;  2H94 A;  3HR0 A;  1KD1 W;  1K5S A;  5JCO A;  2E3C A;  3N2G B;  3B2E E;  2Q69 A;  4GX2 A;  5LA6 B;  3JAS A;  2YSU B;  1GN6 A;  1XL6 A;  2CE4 A;  4JI1 B;  4DRX A;  3GVM A;  1IBL O;  4TV9 A;  4LFB O;  2EIL C;  5KMG A;  3WU2 Z;  1JMK C;  3IC7 A;  2JDI G;  2ADQ B;  3W7T A;  1M90 W;  1AR4 A;  1FKA O;  3ZMT A;  3QO7 A;  1Y6X A;  2DYS B;  3LDC A;  4J42 A;  1FJG B;  5L3G A;  2YIA A;  4JYY A;  3AK1 A;  4LH7 A;  2KB1 A;  1YTF C;  4J7K A;  1W2B U;  4BIO A;  2LW7 A;  1Q8I A;  3ETE A;  5H9C A;  3I5D A;  4B08 A;  3K04 A;  4DR7 B;  3ASO B;  4YIO A;  1KC8 W;  2K9P A;  4JYA O;  2ZIN A;  2JK5 C;  1R3L C;  1TVK B;  1XRE A;  4W4L A;  3TXS A;  3ZCC A;  4H0L B;  1MNG A;  2HP8 A;  1FFX A;  3AG1 C;  3ZIA G;  5K1X A;  4X62 O;  3E8G A;  2WLH A;  5KUK A;  3H1L H;  2RJZ A;  2UXC O;  5H2F Z;  2QM7 A;  2UUA B;  2XUM A;  1ZL8 A;  1V9P A;  3WG7 C;  5EIB D;  2AW9 A;  3ZRX A;  2YI9 A;  3W7S A;  5B3S C;  2GDS A;  2ZIO A;  4FFB B;  5LMU B;  1B3Q A;  1SQX H;  4K8Z A;  1JCH A;  3ICX A;  3CJH A;  4O4J A;  2QM8 A;  2ZR3 A;  4FM0 A;  4RWU A;  2IBZ H;  3RVY A;  4PA4 A;  3CC4 V;  1YTF B;  2ZD9 A;  4JTC B;  1Q5O A;  4LF7 O;  3OGI B;  2UUA O;  1YSC A;  3I56 V;  4FMT A;  2JEU A;  5CA1 B;  1VQ6 V;  4O2B B;  3ZHS A;  3WB0 A;  1JJ2 U;  1JFF A;  4YJ2 B;  4I0X B;  4TV8 A;  3IC9 A;  4J7Z A;  4K0K B;  3OFN G;  3L71 H;  1VQ4 V;  3D8C A;  1PP9 H;  3STL C;  2EZP A;  4KHP O;  1S5L Z;  3AG1 B;  2E5L B;  1WN7 A;  4CS3 A;  5BMV B;  1BQ0 A;  3WG7 B;  1I94 B;  4QIW F;  3E8B A;  4E2L A;  2Y48 A;  3H1H H;  2ETN A;  5B3S B;  3ABK C;  3BCC H;  4ZOL A;  3RYI B;  2X6A A;  2GUZ A;  4QPJ A;  1OCO C;  4D7S A;  1Q82 W;  2OTL V;  2ZXW C;  5CBG A;  2WA3 A;  1S5H C;  4F4L A;  2P6J A;  4AQY B;  3HKB B;  1VP7 A;  2CGO A;  1SET A;  2GBO A;  3OE7 G;  5L3F A;  1WB8 A;  4DV0 O;  3J81 N;  1R6K A;  1Y67 A;  3TGU H;  3MHH C;  3RFR A;  3ZED A;  3ZHT A;  4WFH A;  3BVO A;  5EYP B;  3IJ4 A;  4NXM O;  3QO8 A;  3MD0 A;  1KP3 A;  4JI6 B;  2VWJ A;  2IH1 C;  5KAF Z;  2QKS A;  4JI8 B;  3ABK B;  1VQ5 V;  3ZN0 A;  2VQF O;  3RYC A;  2G38 A;  3ETD A;  1OCO B;  2ZXW B;  2RN9 A;  4ICG A;  2QKC A;  1NVP C;  3CXH F;  2LFS A;  4FZ1 A;  2CGN A;  4HAM A;  1KEC A;  4B3S B;  2JGD A;  4K3A A;  1MAB G;  5EC1 C;  3LNN A;  4FPP A;  2UUB B;  1XBL A;  2UXB O;  3RYH A;  5C8Y A;  3UKM A;  1YJ9 V;  1S3J A;  3BA9 A;  3QF7 A;  5ITZ B;  1Q86 W;  2UU9 O;  4RQF A;  2WAM A;  1OCZ B;  1JQ0 A;  1QR9 A;  2H3O A;  1EBO A;  4U7N A;  1L0N H;  5IJ0 A;  1XI1 A;  4LF8 B;  2R70 A;  5IWA O;  2FB5 A;  1VF6 A;  3G4S V;  3F5W C;  3W7W A;  1YXB A;  2WPD G;  1Q7Y W;  4DUY O;  2QJ1 A;  3A0H Z;  2V1D A;  3U10 A;  2A3Q A;  1RM1 C;  4MS2 A;  1BHB A;  4KP4 A;  1FAF A;  4NTX A;  3B09 A;  1QBZ A;  4JTA B;  1NVP B;  3GB7 C;  3J80 N;  2GHY A;  2XTA A;  1B06 A;  1JR9 A;  1TUB B;  1RP3 B;  2HFE C;  2KKW A;  5B1B B;  4P30 A;  4GKK B;  1TGO A;  3NR7 A;  2Q5Z A;  3HKC A;  2Q68 A;  3VQV A;  1DLB A;  4GLX A;  4NVP A;  4YY3 O;  4EB6 A;  4I9W A;  4U7O A;  5JJJ B;  1RFY A;  2YUA A;  1XNR O;  3A8T A;  1SQG A;  2JS3 A;  5D5P A;  3SPI A;  2DJV A;  3OMN B;  3AK3 A;  4DR5 B;  2BTO A;  2HVJ C;  4GZR B;  1RM1 B;  4O2A B;  2ITC C;  2UXD O;  4JV5 O;  4MT8 A;  3CCL V;  1GN3 A;  4TQD A;  3H9V A;  3ABL C;  4UUJ C;  5FNV A;  1XMQ B;  1NTZ H;  1IBM B;  1EZV H;  4R50 A;  3T4D A;  3JAW A;  3N2K B;  3K3W A;  4KFM A;  4BIZ A;  1NTM H;  2LP7 A;  2UUC B;  5DN6 G;  2NR5 A;  3FYE B;  3FAV B;  3EXA A;  2QDO A;  4RQE A;  3RYF A;  2F1M A;  3E8H A;  2PF4 E;  2E76 B;  3QNE A;  1WA8 B;  3D3I A;  4CC5 A;  4XDJ A;  3E22 B;  4DV3 B;  4MW8 A;  1WP8 A;  4X1Y B;  4JZ2 A;  4MVZ A;  4LF5 B;  1JJO A;  3CRM A;  1EN6 A;  3CEI A;  5L3E A;  3WB1 A;  4DV7 B;  2D2C B;  2EIM C;  4G27 B;  1JPX A;  3SJC C;  4BW9 A;  2XAF A;  3KCX A;  4N23 A;  2EIN C;  3T1Y O;  4RAI A;  4FK5 C;  1GK9 A;  3ABL B;  1U96 A;  3L9D A;  2EIK C;  2QA4 V;  3N2G A;  1ARO P;  4ZBM A;  2BOC C;  4NTW A;  2JIZ G;  4DV5 B;  4PI0 A;  5GON B;  3SYP A;  1K7D A;  4LBE C;  2WA4 A;  2KQX A;  3MAQ A;  2XT9 A;  2R72 A;  4JI7 B;  4LF4 O;  1H2G A;  5CA0 B;  4ZIB A;  3SJQ C;  1IBK B;  2JRI A;  5IDJ A;  2ARH A;  1LUV A;  1R1B A;  4EFB A;  4GCZ A;  1CP9 A;  3RT3 C;  4DR6 O;  2QR4 A;  3SYC A;  1TUE B;  3LDD A;  2EIM B;  1NTK H;  4JI7 O;  3DTU B;  1FXH A;  1VEW A;  2EIN B;  4Z2W A;  3A0R A;  3QVN A;  4O4L B;  2NNU A;  3B8N A;  3JSN A;  2EIK B;  5BZB A;  2OIE A;  1FFT B;  3LSQ A;  2ODM A;  1TVK A;  1GH6 A;  3K57 A;  3IFX A;  4MVM A;  2W6J G;  3JAL B;  2Y0P A;  1H8E G;  3AG7 A;  3ABT A;  1SC5 B;  4YHH O;  1IXB A;  1N0N A;  4GX1 A;  1MZE A;  4L87 A;  2YIB D;  4MVS A;  1QVG U;  4FFB A;  4DXW A;  1Q6H A;  2FL4 A;  4TQF A;  4EKW A;  3G71 V;  2FKX A;  3RGB A;  4XBF A;  5J9P C;  4UB8 Z;  2DN9 A;  1HR0 O;  3S3X A;  3CP1 A;  1VQK V;  4PA7 A;  3KCY A;  1Z2G A;  5CA1 A;  3JCZ A;  3H01 A;  3JAM N;  4X20 B;  4O2B A;  1R6T A;  1ORQ C;  4X89 A;  3ZHV A;  4LWS B;  1G1X B;  1Y74 B;  1GN2 A;  4YJ2 A;  4I0X A;  3CCR V;  4BW5 A;  3OR6 C;  2DMX A;  4X66 O;  1B6Q A;  1M9N A;  1YCI A;  5IYD O;  4WFA V;  5EZY B;  3T1H O;  4PDV A;  5J2U B;  5BMV A;  1N32 B;  3LSU A;  5LXT B;  4DV6 O;  4TUY B;  4F6R B;  3L73 H;  5B1O A;  1I5X A;  3RYI A;  1SKV A;  5DEC A;  4EFE A;  4HBN A;  3K03 A;  4FM1 A;  5KHI A;  3UCS C;  1J5E O;  3OMA B;  5L3B A;  2BSK A;  4C7U A;  2XND G;  5AG2 A;  4GKJ B;  4QE9 A;  2NLJ C;  1R3J C;  2EJ7 A;  3HKB A;  4DR1 O;  2PYJ A;  2RNB A;  4X64 B;  2Q67 A;  5E79 Z;  4MTO A;  1MOF A;  3GWK C;  4NYK A;  3TCU A;  4JI0 O;  5BR8 O;  4DK1 A;  3OT7 A;  5D5Q A;  2BCC H; 
#chains in the Genus database with same CATH homology
 5LBQ A;  1V55 B;  1M56 C;  1NBM G;  3E35 A;  2HR3 A;  3HB3 B;  4JYC A;  2DW4 A;  2OTJ V;  3WG7 B;  2A79 B;  4QIW F;  3E8B A;  4E2L A;  2Y48 A;  3RW0 A;  1L1F A;  1RPR A;  3ML0 A;  5B3S B;  3ABK C;  2P7T C;  4PDM A;  2X6A A;  5LGU A;  2JJ2 G;  5LHH A;  3CCS V;  3E2E A;  1Y4M A;  1EZJ A;  4QPK A;  4HZ3 A;  4MVR A;  1KQS U;  4QPJ A;  1OCO C;  2P90 A;  1Q82 W;  1LNQ A;  2OTL V;  1AJN A;  1F4M A;  3K08 A;  2ZXW C;  1N8R W;  5CBG A;  2EJR A;  1S5H C;  3ZMU A;  4F4L A;  4J9Y B;  2P6J A;  5EBW C;  2XAH A;  3ZMZ A;  3JYC A;  3F7Y C;  3JD1 A;  1SET A;  2YEV B;  3ZRS A;  3OE7 G;  3BEH A;  1CEZ A;  3P30 A;  4UVA A;  5L3F A;  2Y69 B;  3GWO A;  5LHG A;  3FKS G;  1K4C C;  1R6K A;  3SPC A;  3MHH C;  4TT3 G;  2ATK C;  1R3I C;  4WFH A;  1JX9 A;  3RVZ A;  2PI4 A;  2JJ1 G;  2XAQ A;  2WLL A;  1M57 C;  3UM7 A;  2IW5 A;  1WLE A;  2W6I G;  1VQ8 V;  3OMI B;  2HLD G;  3QO8 A;  4J9Z B;  1YI2 V;  3MD0 A;  2C2A A;  1M56 B;  4MTG A;  1KP3 A;  2IH1 C;  1VQM V;  4ASU G;  2WLI A;  2QKS A;  4CZZ A;  3IGA C;  3R65 A;  1PNL A;  1E79 G;  3ABK B;  1NH2 D;  1FXK C;  1VQ5 V;  3ZN0 A;  1GO3 F;  1V54 C;  1F51 A;  2CK3 G;  1NR7 A;  4RO2 A;  3CC7 V;  1VQ7 V;  1NKD A;  4H33 A;  3ETD A;  1OCO B;  3X2Q C;  2ZXW B;  1FXK A;  1G8M A;  3K79 A;  4XDK A;  1NVP C;  2HVK C;  2LFS A;  1GM9 A;  4HAM A;  1KEC A;  2MK3 A;  1XL4 A;  3ZN1 A;  1ROP A;  2BOB C;  1MAB G;  5EC1 C;  3ZMS A;  2ZR2 A;  1I5Y A;  1MG1 A;  1UJW B;  2DYR C;  4FPP A;  2A0L A;  2Z5U A;  3WFV A;  5CA3 A;  2WLL B;  3UKM A;  1YJ9 V;  3RBZ A;  1S3J A;  4QJF B;  1Q86 W;  4RQF A;  5EBL C;  2WAM A;  1GM8 A;  3CYO A;  1OCZ B;  3AG2 C;  3AG4 C;  2WLI B;  1JQ0 A;  1QR9 A;  4MSW C;  1QR8 A;  1K3E A;  2R9I A;  3E8F A;  1GM7 A;  1EBO A;  1M57 B;  4U7N A;  3SYO A;  3ZRW A;  1OCR C;  4MTX A;  4WFG A;  2B5U A;  1S72 V;  4Q20 A;  3CCE V;  4P9P A;  4P2Z A;  4BAY A;  3AEI A;  2OCC C;  3G4S V;  3F5W C;  3B77 A;  2DWE C;  3W7W A;  3E86 A;  2WSS G;  1FXK B;  3KG2 A;  2YEV A;  2WPD G;  1Q7Y W;  2EZO A;  2UXX A;  1V54 B;  1WPX A;  4FJC C;  1H38 A;  2IJI A;  2X6C A;  4GX0 A;  2V1D A;  3PJS K;  5LHI A;  1RM1 C;  2M7W A;  2IU3 A;  4JAS A;  4MS2 A;  1BHB A;  4KP4 A;  4LCU C;  1QVF U;  2IU0 A;  3SYA A;  3X2Q B;  1OCC B;  2X7R B;  1QBZ A;  4JTA B;  3VOU A;  1NVP B;  3GB7 C;  1YJN V;  1KP2 A;  1IXM A;  1QLE C;  2GHY A;  1DF5 A;  2DYR B;  5CMU A;  2HFE C;  5KA6 A;  3OUS A;  5B1B B;  1THZ A;  4P30 A;  3P32 A;  3ZRW B;  4JAV A;  1S0V A;  2DQ3 A;  4HYO A;  5H6Q A;  4MVQ A;  1RPO A;  4R7C A;  1K9M W;  3AG2 B;  3AG4 B;  4H37 A;  2Q68 A;  2B1G A;  1DLB A;  3K06 A;  1PNM A;  5EC2 C;  1OCR B;  4PA3 A;  2P67 A;  1R73 A;  3ZRV A;  5HFM A;  1K8A W;  4I9W A;  3T1C A;  2OCC B;  3OEH G;  4U7O A;  2ZDI C;  2AHY A;  3LDE A;  3CCJ V;  5KA5 A;  5EBM C;  4GT1 A;  3LUT B;  5B1A C;  3SPI A;  3E89 A;  1OCZ C;  3OMN B;  4LP8 A;  5IY5 C;  2QEX V;  3ABU A;  2B1I A;  4JPR A;  2HVJ C;  3ABM B;  1RM1 B;  2Z3Y A;  2ITC C;  2ZDI A;  1YIJ V;  3K0G A;  4LC1 A;  4QE7 A;  4MT8 A;  1AR1 B;  3W7X A;  3AG3 C;  3CCL V;  4CBC A;  1EFR G;  3ABL C;  1VQL V;  1QLE B;  2JEX A;  4UUJ C;  1ZWI C;  1AI4 A;  4WCE V;  4BIU A;  1NR1 A;  4R50 A;  3T4D A;  3ZMV A;  4RUE A;  2QE7 G;  5CBH A;  3OEE G;  4WFE A;  3OGC C;  3ASN C;  4UVC A;  3K3W A;  4KFM A;  2EIJ C;  1ENV A;  4BIZ A;  3K0D A;  5IYB O;  2LP7 A;  1K92 A;  3B8M A;  4PDR A;  5DN6 G;  1OCC C;  4TWK A;  2PI5 A;  1E1R G;  3FYE B;  2H8P C;  3OM3 B;  3M99 B;  1S77 D;  5KUM A;  1AI5 A;  4RQE A;  3EFF K;  1Q81 W;  3E8H A;  3VBB A;  4MVO A;  1K97 A;  1SES A;  3QNE A;  1K33 A;  1F23 A;  3D3I A;  3SPJ A;  2GSM B;  1GTO A;  4N21 A;  1YTF D;  1BL8 A;  3SPH A;  3D36 A;  4XDJ A;  5B1B C;  5FL7 G;  4MW8 A;  3LNM B;  2LFR A;  4MVZ A;  3CCM V;  2D3O W;  1COW G;  3T2M A;  2OT5 A;  2EIL B;  4I5S A;  3T4Z A;  2IH3 C;  5B1A B;  4MVU A;  3HPL C;  4G28 B;  5L3E A;  5IY5 B;  2EBO A;  5EK0 A;  3OR7 C;  2EIM C;  4G27 B;  1JPX A;  2AHZ A;  2XAF A;  4OXS A;  4N23 A;  1Y66 A;  1SRY A;  4WFB V;  4UXN A;  2IJH A;  4JAU A;  4UV9 A;  2EIN C;  5E1A C;  4RAI A;  1BHA A;  3FB6 C;  4FK5 C;  2DWD C;  4WFF A;  3AG3 B;  2X6B A;  1YJW V;  1GK9 A;  4YXW G;  2A9H A;  3ABL B;  1VQN V;  4PEL A;  2EIK C;  2QA4 V;  5CN0 A;  1GMG A;  1ARO P;  5B1N A;  4ZBM A;  2BOC C;  3JD0 A;  2Q6A A;  1AI6 A;  2JIZ G;  4TSF G;  1QLN A;  3BY6 A;  3DGE A;  3ASN B;  1J95 A;  3SYP A;  1QCE A;  1K7D A;  1K34 A;  3ABM C;  3SPG A;  1VQP V;  4LBE C;  2EIJ B;  2WLM A;  1E1Q G;  3MHS C;  1F4N A;  1CPY A;  1H8H G;  2DYS C;  3LSS A;  5C93 A;  1W0K G;  5L3C A;  1VQ9 V;  1H2G A;  2QTO A;  3EHB B;  3SJQ C;  1JVM A;  2IJJ A;  3OW2 U;  5DM6 V;  1PKX A;  2HJF C;  3FB5 C;  4RUF A;  4PDL A;  1SZT A;  3JD3 A;  4PA9 A;  5IDJ A;  2DQ0 A;  2XOK G;  1DF4 A;  4GCZ A;  1CP9 A;  4MW3 A;  1SER A;  2UXN A;  3FYI B;  3CCQ V;  2FTK A;  3CME V;  3CC2 V;  2WLN A;  3TK1 A;  1G4Y B;  2ITD C;  3ASO C;  1VQO V;  2H94 A;  3OUF A;  2F43 G;  3SYC A;  1TUE B;  3LDD A;  2WLJ A;  1KD1 W;  2EIM B;  1K5S A;  3FB8 C;  1K4D C;  2XAG A;  4X8A A;  3QO5 A;  3DTU B;  1R3K C;  1FXH A;  4GX2 A;  2Q69 A;  1HWY A;  5GW7 A;  1NJI W;  2EIN B;  3A0R A;  4FIP C;  2YSU B;  4GX5 A;  3CMA V;  1XL6 A;  2NNU A;  3B8N A;  1M1K W;  5IYC O;  4G2K A;  1NH2 C;  1DTO A;  2EIL C;  2ZQM A;  2EIK B;  4DO2 A;  5BZB A;  3IC7 A;  1FFT B;  2JDI G;  3LSQ A;  1R6N A;  1GKF A;  3IFX A;  4MVM A;  2W6J G;  3W7T A;  1M90 W;  4X88 A;  1H8E G;  1MSW D;  3ZMT A;  3QO7 A;  3ABT A;  5LGT A;  2DYS B;  3LDC A;  4P9O A;  3JD4 A;  5L3G A;  3CXC U;  4GX1 A;  4JF3 A;  4KUM A;  4L87 A;  2HG5 C;  2KB1 A;  4MVS A;  1AJQ A;  1QVG U;  1YTF C;  1NQT A;  4DXW A;  4MTF A;  1W2B U;  3CD6 V;  3STZ C;  2X0L A;  4EKW A;  3G71 V;  3ETE A;  5H9C A;  3E83 A;  1FS0 G;  2K1E A;  4XBF A;  5J9P C;  1PD3 A;  3K04 A;  4XDL A;  1BMF G;  2IJK A;  3CP1 A;  3ASO B;  1VQK V;  4PA7 A;  1KC8 W;  1AI7 A;  4R8C A;  1KKD A;  3ETG A;  1P4R A;  3JD2 A;  3JCZ A;  2JK5 C;  1W0J G;  4QNH B;  1R3L C;  3H01 A;  4ZKI A;  3ZCC A;  1ORQ C;  2W0F C;  4X89 A;  3AG1 C;  3ZIA G;  4R6Z A;  3E8G A;  2WLH A;  1YHQ V;  5HFL A;  1NH2 B;  4UVB A;  5KUK A;  2XAS A;  1V55 C;  2QM7 A;  2WLK A;  3CCR V;  4BW5 A;  3WG7 C;  3OR6 C;  2XAJ A;  3NXS A;  3ZRX A;  1B6Q A;  1FXV A;  3W7S A;  5B3S C;  1M9N A;  3I55 V;  4JTD B;  1K73 W;  5IYD O;  4WFA V;  4PDV A;  2V7Q G;  5H6R A;  1JCH A;  3TET A;  3SYQ A;  2QM8 A;  2ZR3 A;  5B1O A;  3W7U A;  4JYB A;  1I5X A;  3RVY A;  2HKO A;  1P7B A;  3F7V C;  3FB7 C;  4PA4 A;  3CC4 V;  1YTF B;  2ZD9 A;  4JTC B;  3CPW U;  1NVP D;  3K03 A;  3CCV V;  1K5Q A;  3K9A A;  1YSC A;  3I56 V;  4FMT A;  2JEU A;  1AJP A;  5LGN A;  1VQ6 V;  3OMA B;  1OHH G;  5L3B A;  4UV8 A;  3OAA G;  2R9R B;  2XND G;  1PL0 A;  2Y69 C;  4QE9 A;  4Z1M G;  1JJ2 U;  2NLJ C;  1PNK A;  1OZ0 A;  1R3J C;  1S76 D;  3G6E V;  1JOY A;  3OFN G;  2Q67 A;  4JGS A;  4WF9 V;  1VQ4 V;  4MTO A;  3ZJZ A;  3STL C;  1MOF A;  4PA6 A;  5L3D A;  2EZP A;  1YIT V;  3CCU V;  3TCU A;  5CBF A;  3AG1 B;  2WWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...