1YTFD

Yeast tfiia/tbp/dna complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
100
Chain Sequence
GYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVESVISVDKLRIVACNSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*GP*TP*AP*TP*GP*TP*AP*TP*AP*TP*AP*AP*AP*AP*C)-3
publication title Crystal structure of a yeast TFIIA/TBP/DNA complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 25
structure length 100
sequence length 115
ec nomenclature
pdb deposition date 1996-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
D PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ytfD01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 1ytfD02
1NH2C 1NVPD 1RM1B 1NH2D 1YTFC 1NVPC 5IYBO 1YTFD 5IYDO 1RM1C 5IYCO
chains in the Genus database with same CATH superfamily
1YXBA 1LNQA 4QNHB 5L3EA 5KUMA 3DSQA 4J7KA 4PA4A 5LMUB 1HNXB 2UXDO 1M93A 1Q5OA 4U7OA 3IJ4A 1MZFA 3EFFK 1W0KG 1RM1B 1WPXA 3OR6C 5FPOA 5KLVH 4J10A 4GKJB 1LUWA 2Y69B 1D2DA 3GB7C 4TV8B 1SQPH 4EFEA 4UUJC 2K9PA 2P7TC 4JI5B 5IY5B 1VARA 5EBLC 1BT8A 3OW2U 1RPRA 2UUBO 4ZHQA 1IBKB 4QE9A 2CTQA 4DR5O 2YICA 2BSKB 3OMAB 1OCCC 1BSMA 4QE7A 4DRXB 2HEPA 1QLNA 3DXRA 3SR2C 4LF9B 4O4IB 4JTDB 4OXSA 5BZBA 3TXSA 4YJ2B 2V1DA 5H2FZ 3ABUA 3H1LH 1YITV 4G2KA 2WLHA 4MVZA 1FS0G 2G38A 3ABKC 1RSOA 2UXDB 1OCCB 3OUFA 4I55B 4OPHA 5B1BB 1XL4A 2HHHB 1W59A 3RYCA 2QTOA 1QNMA 3SYQA 4KXRA 1MOFA 5A2QN 2LQTA 4WFEA 1GN4A 2EINC 4BW5A 4WFHA 4X1YA 2LFRA 2FYUH 2AHZA 4DR5B 2OT5A 1Q90D 2AW9A 5CBGA 2QEXV 4I50B 1QHTA 2IH3C 2QSAA 2CH7A 3CX5F 4J7ZA 1AB3A 3A0BZ 3AG3B 1PPJH 3E8BA 3RVYA 2QE7G 2Y4TA 4X66O 5HFLA 4I9WA 3CP1A 4DR7B 3OMIB 3ETQA 3Q4HA 4X1KB 5LHGA 1PNKA 4MW3A 2F43G 2EINB 1PV0A 1JCHA 1DF5A 1VQ8V 2F23A 5KAFZ 5KHGA 4HNAB 4LFAO 3JAWB 3N2KA 1Q82W 4GX5A 3CCLV 4B3TO 3CXCU 5IYZA 4J11A 2RMKB 4EB6A 5ITZB 4Z2WA 1SETA 4F4LA 1YF2A 2H3OA 4DR6O 3KZIZ 5LYJA 5H9CA 3K5NA 4B3RO 5LHIA 1SQBH 3JARB 2RCVA 2LO1A 2O57A 4B7EA 2VS0A 3RYHA 1QQCA 2E3CA 2ADQB 2IJJA 3D36C 2E76B 4Z1VA 1OCOC 1VP7A 4R50A 4X66B 4RQEA 2XOKG 2DOSA 3HKBB 1M56C 4DR1O 4FFBA 3IC9A 1Q43A 3SPGA 3HKEA 4PA7A 3CJHB 2JGDB 4TQDA 3OMNB 3HKDA 4JYCA 2W6JG 5IYDO 4O4HB 3H1KH 2Y0PA 2XHBA 1B04A 3RT3C 3B8NA 1FPOA 2C2AA 1K8AW 5KHHA 1N32O 3JALB 4LFAB 3CCVV 4B3TB 3QO5A 1NH2B 1OCOB 3OEEG 1WLEA 3CCJV 2YEVA 4N21A 4DV5O 4DR6B 1XMOO 4B3RB 3ABLC 1OCRB 3FYEB 5B3SB 3C90A 3FAVB 1K97A 2OWOA 3I55V 5H6RA 1YIJV 2JS5A 4JI0O 1R6TA 1VQ9V 4MTFA 4MVSA 5JVDB 5H6QA 2Z3YA 4LWSA 3LNMB 4DR1B 4X89A 2E5LO 1P84F 1YCIA 4B08A 3K04A 5GW7A 2WLNA 3LDCA 4DV2O 3M8AA 2KQXA 4ZI7B 4U3JB 3FB6C 2UXBO 3MHSC 1NVPD 1N32B 5L3BA 4LF7O 1Y76A 4P9PA 5JQGB 5KMGA 4CH3A 3P30A 1HR0O 4MTGA 2WLLA 1NTMH 1YHQV 3X2QB 3JD3A 4JI8B 2JS3A 1WB8A 3K5LA 3JD4A 2ZM6O 1K3EA 2D3OW 4DXWA 1PL0A 1AR4A 4WFAV 2LW1A 2ZXWC 5DEDA 1R6KA 4LNUA 1ZUQA 1JFFB 4JI0B 1NZ6A 1AVMA 3RYFB 4RWUA 5EBWC 1FAFA 3G71V 4NYKA 5IJ0B 3OTFA 2E5LB 3F7YC 4AQYO 4I9QA 1XDCA 2VQFB 4DV2B 2CDYA 1TVKA 3AG4C 3CMEV 4IT5A 1Y67A 3FKSG 3UCSC 3ZHSA 4GUNA 5IDJA 4LF7B 4LF8O 4UVBA 2WPDG 1HR0B 3ZRXA 1SA0B 2YIBD 1FXKA 1VF5B 4UCSA 3B40A 5CB4B 2AZ2A 3OM3B 1VQ7V 2FB5A 4JV5O 4YJ3A 3CRQA 3APQA 3BAAA 1I5YA 4DV0O 1F7YA 2WLIB 4UCOA 1VIBA 2JEXA 1OV9A 3B09A 5L3FA 1NTZH 1JJOA 1WP7A 1J95A 3C3TA 4IHJA 4JI1O 1N0JA 4TOIA 3TXQA 1FFTB 1V55C 2Q7HA 1ZL8B 4WF9V 1XMQB 1H38A 2OIEA 3G6BA 4AQYB 3UT5A 3ZN0A 3RN4A 3RVZA 4OX9O 2DYRC 2EJRA 3CC7V 4X8AA 3DC5A 3J81N 2IH1C 4I7ZB 2DWDC 2ETNA 3CRMA 3CWBH 3H1IH 4CBCA 4I0XB 3E22A 4QIWF 3I56V 3E89A 3ASOC 2H94A 4LF8B 3CS5A 1KQSU 4UV8A 1BCCH 4XDKA 5DM6V 2VRZA 2Q6AA 2JJ1G 2B5UA 5C93A 2PYLA 1AP6A 4NTWA 1LUVA 1HWYA 3STZC 4JV5B 1V55B 4ZIBA 1V9PA 4HZ3A 2DYRB 4DV0B 2ZDIA 5CA0B 1IBMO 1Q86W 4WFGA 2GUZB 1TUEB 2E75B 3ASOB 2NR5A 1W0JG 1N8RW 4L8JA 3KKYA 1MA1A 5J2UB 2JJ2G 1M9NA 3JAKA 5C8YB 4GCZA 4OX9B 3BVOA 2BE3A 4GX2A 4PDRA 3JSLA 4CS4A 3IC7A 4NXNO 1Q6HA 2HKOA 3ML0A 3SPIA 1HNWB 2BTQA 3SGIA 5L3DA 3NR7A 5KHJA 3QF7A 4DRXA 5EZYB 3LSQA 1MZEA 3BPZA 4FK5C 3A8TA 3CB2A 3RGBA 2XNDG 1IDSA 4LFBB 5LOVA 4J9ZB 4YJ2A 3ICXA 1NTKH 3BCCH 4JYAO 5EK0A 4DV4B 2PZSA 2N04A 4K0KB 4LR3A 1DLBA 1QR8A 3CRRA 4G27B 4DK1A 4CH6A 5E1AC 1L0NH 1ORQC 1Y66A 3ZMTA 4FLYA 1FXVA 1JOYA 2FTKA 3FB5C 1M57C 4K8XA 1KMIZ 4QGPA 2IU3A 2R70A 3DTUB 1XREA 2Q67A 3QNEA 3JATA 4I50A 1KB9F 3P32A 4O4LA 3K57A 2Q0OC 2QWRB 3GWKC 1GRJA 5B1OA 1TAEA 4X9QA 1B6QA 1QVGU 4JYAB 3L72H 4PA3A 4PDMA 1BHBA 1ZWIC 1COWG 2IM9A 1R3IC 4JI7O 1NR7A 2R9RB 2NN4A 3JAWA 3U10A 4GKJO 3K58A 4FFKA 3CC4V 5JWPA 1VQNV 4JI5O 2Z0AA 3VOUA 4GKKB 2RNBA 3RYIA 1K4DC 3D3IA 3CSXA 2DQ0A 2VQEO 1XHXA 3SYOA 1QU7A 1H2LA 4BR6A 4WBNA 1NVPB 1SQXH 2HG5C 4NXMO 4D7TA 4FM1A 3TCUA 4LF9O 2EZPA 4P9OA 2UXCO 3CYOA 3E83A 2HLDG 3EXAA 2XASA 4FMTA 2XUMA 4GLXA 2Q68A 4N23A 1QR9A 2EIKC 1N0NA 1VF6A 1VQ4V 4JI7B 4O2AB 3B77A 3ZMZA 3JALA 4IIJB 2YC0A 4UB6Z 4U7NA 4FLVA 2WA3A 4IYIA 2N05A 2HHHO 2P22C 2ZD9A 1R3JC 3WB2A 4Q6GA 2ITCC 1N4CA 3SJCC 3MDSA 4KL1A 2QM4A 4X1IB 2DWEC 3T4DA 3FAVA 2EIKB 1VMGA 3L75H 3LDDA 2VQEB 2AHYA 4ABMA 4P30A 3T2MA 2ODMA 1VQMV 4NXMB 1GMGA 2WWWA 3KCYA 3ZIAG 3ABMC 5JVDA 4HYOA 1U96A 4U3FH 1ENVA 2UXCB 1R73A 3CPWU 1XL6A 4DR7O 3MHHC 1K33A 3UKMA 1SQQH 2V7QG 2HJFC 3W7WA 2ZNJA 3FFQA 3TK1A 2UXNA 1H2GA 3AEIA 1FJGB 4FM0A 1W2BU 5JQGA 5DECA 1K5QA 3F7VC 5GONB 1XHZA 2F4VB 1U97A 3VQXA 3J80N 5IE9A 5IWAB 3N2GA 2OCHA 3L70H 5CA1B 2QWNB 1IZ3A 4XDJA 3ZRVA 4TV9B 5KHKA 3K0DA 3ABKB 1PP9H 2YSUB 4KHPO 4JYYA 5JH7B 3E86A 4QJFB 4X64O 5IJ0A 4MT8A 4DUYB 4O2BA 4JZ2A 4GX1A 5IJ9A 3ZHUA 1XNQO 4JZGA 3U11A 2PGGA 2QKAA 2P67A 3APOA 1RFYA 2YIAA 1SESA 1AJNA 2FL4A 3LSUA 1CXZB 1NS1A 1WA8B 3CE2A 1NKDA 2YI8A 2AGAA 4ZBMA 3W7SA 1BZKA 1M90W 1L8DA 1SA0A 1F51A 4LFCB 1H8EG 4JAAA 1HW7A 3W7TA 4CH4A 5LA6B 3W7UA 2WLIA 4H33A 1WP8A 1H8HG 2QDOA 3ZEDA 1SQVH 3R66A 2YIDA 5LP6C 1Z5VA 4ZOLB 4KHPB 2DW4A 2ZE5A 2ITDC 4X64B 4LC1A 2GTAA 1FXHA 3PN1A 1XNQB 1Y6XA 4TWKA 5FPRA 4I4TB 4UCRA 2V4DA 4I0XA 2GHYA 2CTWA 4MVRA 1AILA 3N27A 1QBZA 3ASNC 4MVMA 2NLJC 3H1JH 3CEIA 3K59A 2B1IA 2EIJC 4KP4A 2ZR2A 4QPJA 4NVPA 3ETGA 4TUYB 2KB1A 3K5OA 1VQKV 1KBHA 1JMKC 4YHHO 1EZVH 1GN6A 3BY6A 4JI8O 1M56B 2RQ6A 3ZMUA 4KUMA 1A32A 5CA0A 5LGNA 1O9GA 1EN4A 2LW7A 4J80A 3CCQV 1GKFA 2WAMA 3HKCA 1KECA 4MW8A 2Y4UA 3ASNB 2ZR3A 1E1RG 5C8YA 2EIJB 3L9DA 1WNSA 4YIOA 1K9MW 4FPPA 3OGIB 2VQFO 1GM8A 3ABLB 4NB5A 3RW0A 3H1HH 2EIMC 4PHZA 5J2TA 5HFMA 1AI6A 2XAHA 4JTAB 5IT9N 3S3WA 3IGAC 3OT7A 1XI1A 2ARHA 1D5AA 1WJZA 4R6ZA 4YHHB 1M5IA 3SJBC 2KG7B 2DYSC 3K03A 3UM7A 1RSOB 2ATKC 1I7FA 1FFXA 4X65O 5KHIA 5LXTB 5B5EZ 1B06A 4GYCB 4JYBA 1Q8IA 1SERA 1IXMA 3RYCB 3JCUZ 3AG7A 2QKSA 3L73H 4FZ0A 2ZKOA 4J41A 4JI6O 1I08A 4MTOA 5KA6A 1XMQO 3SYAA 2CTRA 1PD3A 2X6BA 5B1AC 4D6TH 1H2MA 4B3SO 3NXSA 3G6EV 3AK3A 2DYSB 2BTOA 2WLJA 2MK3A 2PY5A 1YTFC 3WG7C 3OFNG 2CK3G 3JSNA 3W7XA 5JCOA 2ZXWB 5LL6Y 3K08A 1HNZB 1E1QG 3Q4HB 1XILA 3IAYA 3UO2A 3SPJA 4YY3O 1JVMA 1HDJA 2JGUA 5B1AB 5JJJB 3J7AU 1K34A 2QWPB 3RWRD 1EZJA 2QJ1A 2Q9LA 4X65B 3AG4B 4LBEC 3N2KB 3T1CA 1VQ6V 4WCEV 4RUFA 4HAMA 5IYZB 1YTFB 5FNVA 1IBLO 3WG7B 3T4ZA 2LGWA 4EB6B 1NJIW 4JI6B 1M4UA 3IFXA 1AR1B 1K73W 2ZT9B 4B3SB 2DQ3A 1BE3H 2FKXA 2ZINA 2XAGA 2A0LA 2Q0AA 2F66C 1HNWO 2BOCC 1PL4A 3VBBA 3M7MX 1NT2B 4E4EA 5FL7G 1TUBA 2L6LA 4FFBB 5IYCO 4FLXA 4BIZA 4YY3B 2A9HA 3CD6V 3HKDB 1XQ8A 4LFBO 1MMMA 3UQ8A 5A9GA 1JR9A 4AILC 1P4RA 2ZIOA 3WU2Z 2QWOB 3SJQC 4PJ0Z 3CMAV 4DV4O 4JI2O 4B3MO 3GWOA 4K0KO 1YSCA 4IL6Z 4X62O 1YVWA 5L3CA 1IBLB 4PV1B 2P4KA 1OCZC 4MVOA 1QLEC 4CC5A 3H01A 3TETA 3OUSA 4TV8A 3ZN1A 1R3LC 2PF4E 2RJZA 1JJ2U 2BSKA 2IJHA 5KA5A 3AK2A 3L71H 3LSSA 4IGGA 1VQOV 3CCSV 2VWKA 2FMLA 5GTIZ 1SZTA 5KAIZ 3FB8C 2HFEC 2DN9A 2HP8A 4J42A 4PDLA 2YUAA 1OCZB 2DE0X 1QLEB 4O4IA 2YIBA 2HVJC 1URFA 3K3WA 1Y4MA 4UVCA 2CAZC 3DGEA 1FD9A 1MABG 2Q7GA 1NQTA 2P6JA 4CZZA 2QR4A 1Y76B 4JI2B 4B3MB 4X62B 1K4CC 4BW9A 2DJVA 3ETDA 1SQGA 4J7JA 2Y0IA 1I0HA 2YXYA 3THOA 4I55A 4MSWC 1KP2A 4DYLA 3CHXA 4UCTA 2P5OA 1M1KW 2EILC 5BXZA 1G6UA 3LDEA 2AZ0A 4DV6O 1N36O 1R6NA 1R3KC 1YEWA 3PJSK 4GKKO 4YIPA 4LNUB 5JJNB 1DTOA 5BMVB 2HVKC 1FXKC 4JAUA 3O65A 3OD4A 2E74B 4MTXA 3H9VA 1TGOA 3JD0A 5KUKA 5B1NA 3AG1C 4JI3B 4EKWA 1VF7A 3A0RA 2ZCEA 2D2CB 4UB8Z 4X1KA 2EILB 3B8MA 1GK9A 4CS3A 2IW5A 3QO8A 4X88A 2F1MA 3DC6A 4BIUA 4DK0A 1JX9A 1M57B 4GX0A 3HPLC 1WA8A 2CTPA 4NTYA 1FXKB 3CCUV 4HNAA 2JDIG 4TQFA 1KU9A 3UO3A 2PI5A 3CCEV 4FM2A 4FJCC 1S72V 4MS2A 5ITZA 1BMFG 3AG1B 3GVMA 4DV6B 1N36B 3CRCA 5LGUA 3JARA 4FZ1A 3OEHG 4ZOLA 1CEZA 4J9YB 1PNLA 3UT5B 5J9PC 4DR3O 2ZDIC 2P06A 4PA9A 2XAFA 4LCUC 1XEQA 3RFRA 1N33O 5CA3A 3B4SA 3HKBA 2UU9B 3E22B 2W0FC 4NTXA 3CJHA 3ZHVA 2JGDA 3QTCA 1EBOA 4JAVA 4LF5B 2IJKA 1SQFA 1L1FA 4O4HA 1RM1C 3SYPA 3BABA 3ABTA 3CCRV 4DUZO 2QM7A 1FJGO 4FLTA 1MNGA 3ZRSA 5IY5C 3B2EE 4BIOA 1UFIA 1V54C 2F4VO 1F23A 3D36A 1H2NA 3RBZA 4OGQB 2UUCB 3KCXA 2IU0A 4FLUA 2N74A 1JPXA 3SJAC 5IWAO 4DV3B 3E35A 3MD0A 4X20B 3WB1A 1YTFD 3D8CA 3JAKB 1XUQA 1O9HA 5LMNO 1S3JA 3D3QA 2CE4A 4DW1A 4DR3B 1N33B 1NBMG 1IVSA 1V54B 1B3QA 2BTQB 4JF3A 5GTHZ 1US6A 4WFBV 1D5NA 4EEQA 2WA4A 4DUYO 1EFRG 3S3XA 2XT9A 1BL8A 3BHPA 1AR5A 4ZI7A 1HP8A 4U3JA 2HJDA 3G4SV 2GBOA 5B1BC 4Q20A 3ZS8C 2WSSG 3T1HO 4DUZB 1YJ9V 5EBMC 3JASB 2XAQA 3ZHRA 2A79B 3A2FA 2JRIA 3ZMSA 2EBOA 2A7WA 2ILMA 5LOVB 1WB7A 3ZX6A 1S0VA 4YXWG 1S77D 4Z1MG 3ABMB 4LFCO 2KG7A 2P4VA 2GSMB 4FIPC 1EN6A 4K35A 1SS3A 1SKVA 3AG3C 5LXTA 1YJNV 5LMNB 1JFFA 2PUSA 1F4MA 5EC2C 3RYFA 1AI5A 3TJTA 2EULA 2JK5C 3ZCCA 4ICGA 5K1PA 3E8FA 2UUBB 2F95B 1K7DA 4HBNA 1OZ0A 4AI8A 2ZQMA 4TT3G 1Y74B 2W0XA 4FLWA 1ZX3A 3JATB 1RP3B 4P2ZA 1JQ0A 4CC6A 1I94O 3T1HB 2OCCC 4O4LB 4A5UB 4LF6O 3F5TA 3EVKA 4TSFG 1YJWV 1MG1A 4XDLA 2BOBC 3FYIB 1GN2A 5CB4A 1JA8A 5B66Z 4R8CA 2WLKA 4PDVA 4XBFA 3ZRWB 4JASA 5EIBD 2AXTZ 3K9AA 1GTOA 3TGUH 4GT1A 2L35A 2RN9A 4F6RB 1AJPA 4IYHA 5LHHA 3F5WC 2OCCB 3FB7C 5BR8O 4O4JB 4UFZA 2IJIA 1WN7A 1ZL8A 3BA9A 4OPAA 1VF6C 4R7CA 4L87A 3BEHA 3CRAA 3RYIB 3VQYA 4LP8A 5BY1A 4K3AA 5EYPB 3K0GA 4WBNB 2K1EA 1I94B 2A3QA 4LF6B 2YI9A 4QPKA 1NH2C 2B1GA 3E8HA 5KX5B 5LP6B 2GV9A 2CUGA 2CGNA 3QO7A 3T1YO 4B7KA 2QWQB 4PELA 4WFFA 1OCRC 5B3SC 2WLMA 1UJWB 1Q6UA 3ETEA 2GDSA 3C3SA 5AG2A 1OHHG 1XOUA 1GH6A 2BCCH 2EJ7A 2GUZA 1F4NA 3JYCA 5BR8B 2HR3A 1H2KA 5J2UA 4UCVA 1LR1A 3EHBB 2OTLV 3OTOO 4ZHQB 2ZIMA 1S76D 2KKWA 4NKGB 2H8PC 4MVQA 1IXBA 2B9ZA 2PI4A 3VQWA 1KD1W 2LJ2A 4ASUG 1VQPV 3DXRB 2PYJA 5EZYA 1AI7A 4PI2A 3X2QC 3T1YB 5CN0A 4C7UA 2YDEA 4JI4O 3BA8A 1AI4A 1HNZO 2ADPA 1MSDA 3K9SA 3P3PA 2JEUA 1S5HC 4AHCA 2ZNIA 1ZAUA 4H44B 3E8GA 1NR1A 1Q7YW 1X59A 2EIMB 2X0LA 3E2EA 3ZHTA 1KC8W 4DV5B 3OE7G 1XMOB 3N2GB 3OTOB 4ZKIA 3VQVA 4X1YB 1RPOA 1AP5A 1WPBA 4F6EA 1EM1A 3ZHQA 4NR1A 4CS2A 1QVFU 1DF4A 1CP9A 1P7BA 5D5QA 2CH7B 1WAZA 4KFMA 2Z5UA 5BMVA 1GN3A 1N34O 4H13B 3AG2C 3JD2A 3JAMN 4JI4B 5CMUA 4CH5A 3OGCC 4O2BB 5IJ9B 4BAYA 3OAAG 1FYJA 5K1XA 3BFRA 2UXBB 3G80A 4UXNA 1L0LH 4RUEA 1AJQA 1KP3A 1KKDA 4JGSA 5LBQA 1OJHA 1XNRO 2EX3A 3AG2B 1KUQA 2LFSA 3I5DA 3WFVA 3HB3B 2ZM6B 5LYJB 3SDLA 3STLC 1VQ5V 1BQZA 1YZBA 5D5PA 3SYCA 5IYBO 1TA8A 5CBFA 4LH7A 4PA6A 3JCZA 2IBZH 5FLXN 3FD9A 4G28B 3G67A 1Z2GA 3RYHB 1IURA 1K92A 2QTSA 1N34B 2YXLA 3CCMV 2QA4V 2OIGA 4DV1O 1E79G 3HKEB 1IX9A 3KG2A 4UCUA 2R9AA 2F93B 1KYOF 1UPGA 3LNNA 1GM9A 3QG5A 3LUTB 4JTCB 4DO2A 1VEWA 2YXHA 4O2AA 2OYQA 1XNRB 4IIJA 1GAXA 1PNMA 5EC1C 2M6YA 4RQFA 2YEVB 4EFBA 1DK1A 5LGTA 2A06H 1DGSA 1NU1H 1ZLZA 2R9IA 1G8MA 2Q4PA 1BS3A 3P3NA 5EIBC 4X1IA 1GO3F 1KKCA 3HKCB 4X20A 5TISZ 4JI1B 3CXHF 2NNUA 4H37A 4DV7O 3SPHA 4LWSB 5JJEB 4DV1B 1FKAO 4W4LA 3MAQA 4JI3O 1ZTEA 2Y48A 3JD1A 4I5SA 5J2TB 1Z5WA 3L74H 3SPCA 4DW0A 2EZOA 2X6CA 3K79A 1SZXA 2QM8A 2ZE8A 5KMGB 4LH6A 4H0LB 1AROP 2WLLB 2ZE6A 3JASA 1BGYH 5GONA 1CPYA 2Q8VA 1ROPA 1YDXA 1IBMB 2ZE7A 4GZRB 4DR4O 1S5LZ 1SC5B 1FFXB 1SRYA 4RAIA 5CA1A 4PD4F 5JCOC 1BHAA 3WB0A 4LF4O 1PM9A 1Q81W 1R1BA 3HR0A 4FVMA 4TV9A 1SF9A 1NH2D 3CC2V 4DV7B 3K5MA 3O9OA 1Q6IA 4DR2O 3ZJZA 3BRCA 3M99B 1GM7A 5JH7A 4NXNB 1X4TA 1ZSPA 1J5EO 2QKCA 1TVKB 5H5NA 5L3GA 2UU9O 4UVAA 1Y74A 4LF5O 1NI8A 1PKXA 1XBLA 2UUAO 2QGNA 3U0ZA 1EN5A 2W6IG 1K5SA 2JIZG 1YI2V 2LGQA 4RO2A 4D7SA 1VQLV 4YJ3B 1H2SB 2PTMA 2KSDA 1G1XB 4DR4B 1QCEA 2Q69A 2UUCO 2XAJA 1I5XA 1T5EA 3R65A 2RDCA 3ZRWA 2MW2B 1NVPC 5LA6A 3QVNA 4LF4B 1G4YB 5LMUO 1HNXO 4DV3O 5DN6G 5F2VO 4F6RA 2YS8A 1P7GA 3FX7A 5FNVB 4IHJB 3OR7C 2GTSA 3ZMVA 4E2LA 2UXXA 4DR2B 4PI0A 2OTJV 4UV9A 4O4JA 1Q3EA 3K06A 2X6AA 4K8ZA 5CBHA 2Q73A 1J5EB 2CGOA 2Q7EA 1P49A 2DMXA 3AK1A 1IBKO 2JVDA 2R72A 1MSWD 2XTAA 4MVUA 3A0HZ 4I4TA 5EYPA 2P90A 2UUAB 1THZA 4BWAA 2VWJA 4FLZA 5E79Z 1TUBB 3ZBHA 2Y69C 5KX5A 5LP6A 4W4KA 2LP7A 2X7RB 2M7WA 4TUYA 2Q5ZA 1BQ0A 1S5JA 4JPRA
chains in the Genus database with same CATH topology
2OCCB 3FB7C 3G6EV 5L3EA 1LNQA 2DYSB 4QNHB 2IJIA 4FK5C 5KUMA 2XNDG 4PA4A 2WLJA 2MK3A 1YTFC 4J9ZB 4U7OA 3WG7C 4R7CA 4L87A 3OFNG 2CK3G 3EFFK 3W7XA 1W0KG 2ZXWB 1WPXA 3BEHA 3OR6C 1RM1B 4LP8A 3K08A 5EK0A 1E1QG 2Y69B 3GB7C 3K0GA 2K1EA 1DLBA 1QR8A 4UUJC 2P7TC 5IY5B 3SPJA 4G27B 5EBLC 3OW2U 1RPRA 4QPKA 1JVMA 1NH2C 2B1GA 3E8HA 5E1AC 5B1AB 1K34A 3QO7A 4QE9A 1EZJA 4PELA 1ORQC 3OMAB 1OCCC 3AG4B 4WFFA 1OCRC 4QE7A 4LBEC 1QLNA 5B3SC 3T1CA 2WLMA 1VQ6V 1Y66A 3ZMTA 1UJWB 4WCEV 4RUFA 1FXVA 3ETEA 4HAMA 1YTFB 2FTKA 1JOYA 3WG7B 3T4ZA 1NJIW 3FB5C 1M57C 1OHHG 4JPRA 2IU3A 4JTDB 3DTUB 3IFXA 4OXSA 2Q67A 5BZBA 1AR1B 1K73W 3QNEA 1F4NA 3JYCA 2V1DA 2DQ3A 3P32A 3ABUA 2XAGA 2A0LA 2HR3A 4G2KA 1YITV 2WLHA 4MVZA 1FS0G 2BOCC 3ABKC 5B1OA 3VBBA 3EHBB 2OTLV 1OCCB 3OUFA 1B6QA 1S76D 5FL7G 1QVGU 5B1BB 2H8PC 4MVQA 1XL4A 4PA3A 4PDMA 1BHBA 1ZWIC 2QTOA 3SYQA 1COWG 2PI4A 1MOFA 5IYCO 1R3IC 1KD1W 4ASUG 4BIZA 1VQPV 4WFEA 2EINC 2A9HA 4BW5A 1NR7A 2R9RB 3CD6V 4WFHA 1AI7A 3X2QC 2LFRA 5CN0A 1P4RA 2AHZA 3SJQC 2OT5A 1AI4A 5CBGA 3CMAV 2QEXV 2IH3C 3GWOA 3CC4V 1YSCA 2JEUA 1VQNV 1S5HC 5L3CA 3VOUA 3AG3B 3E8BA 3RVYA 2QE7G 1OCZC 4MVOA 1K4DC 1QLEC 3D3IA 3H01A 5HFLA 4I9WA 3TETA 3CP1A 1NR1A 2DQ0A 3E8GA 3OMIB 3OUSA 3SYOA 1Q7YW 1NVPB 5LHGA 1PNKA 2HG5C 4MW3A 3ZN1A 2F43G 2EIMB 2EINB 2X0LA 1R3LC 1JCHA 3E2EA 1DF5A 3TCUA 1KC8W 1JJ2U 2EZPA 1VQ8V 3OE7G 4P9OA 2IJHA 3CYOA 4ZKIA 3E83A 5KA5A 2HLDG 1RPOA 2XASA 4FMTA 1Q82W 3LSSA 4GX5A 1VQOV 3CCSV 2Q68A 4N23A 1QR9A 1SZTA 2EIKC 3FB8C 3CXCU 2HFEC 3CCLV 1QVFU 1DF4A 1VQ4V 1CP9A 4PDLA 1P7BA 1OCZB 1SETA 3B77A 1QLEB 4F4LA 2HVJC 4KFMA 3ZMZA 2Z5UA 3K3WA 5H9CA 5LHIA 1Y4MA 3AG2C 4UVCA 3DGEA 1MABG 3JD2A 1NQTA 4U7NA 2P6JA 5CMUA 4CZZA 3OGCC 2ZD9A 1R3JC 4BAYA 3OAAG 1K4CC 2ITCC 3ETDA 2IJJA 1OCOC 4R50A 2DWEC 4MSWC 1KP2A 4UXNA 4RQEA 4RUEA 2XOKG 3T4DA 1AJQA 1KP3A 1M56C 2EIKB 1KKDA 3LDDA 2AHYA 4JGSA 4P30A 3SPGA 4PA7A 3T2MA 5LBQA 1M1KW 2EILC 1VQMV 3LDEA 1GMGA 2WWWA 3OMNB 4JYCA 2W6JG 1R6NA 3ZIAG 5IYDO 1R3KC 3ABMC 3AG2B 4HYOA 3PJSK 1ENVA 2LFSA 3WFVA 3B8NA 3HB3B 1K8AW 1R73A 2C2AA 1DTOA 3CPWU 2HVKC 1FXKC 4JAUA 1XL6A 4MTXA 3MHHC 3STLC 1VQ5V 1K33A 3SYCA 3UKMA 5IYBO 5CBFA 3CCVV 3QO5A 3JD0A 4PA6A 5KUKA 3JCZA 2V7QG 5B1NA 2HJFC 3W7WA 4G28B 1NH2B 1OCOB 3OEEG 1WLEA 3AG1C 3TK1A 3CCJV 2UXNA 4EKWA 1H2GA 3A0RA 2YEVA 4N21A 1K92A 3AEIA 3ABLC 1W2BU 1OCRB 3CCMV 2QA4V 1K5QA 3F7VC 2EILB 3B8MA 3FYEB 5B3SB 1GK9A 2IW5A 3QO8A 1K97A 4X88A 1E79G 3I55V 5H6RA 1YIJV 4BIUA 1JX9A 1M57B 4GX0A 3HPLC 3KG2A 1FXKB 3CCUV 1VQ9V 4MTFA 4MVSA 2JDIG 5H6QA 2Z3YA 3LNMB 2PI5A 1GM9A 4XDJA 3CCEV 4X89A 3LUTB 4JTCB 4DO2A 3ZRVA 4FJCC 1S72V 3K0DA 4MS2A 1BMFG 3ABKB 3AG1B 3K04A 5GW7A 2WLNA 3LDCA 2YSUB 5LGUA 1PNMA 3E86A 3FB6C 4QJFB 5EC1C 3MHSC 1NVPD 4MT8A 4RQFA 5L3BA 2YEVB 3OEHG 5LGTA 4GX1A 4P9PA 1CEZA 4J9YB 1PNLA 2R9IA 3P30A 2P67A 1G8MA 4MTGA 2WLLA 5J9PC 2ZDIC 1YHQV 1SESA 2XAFA 1AJNA 4LCUC 4PA9A 3X2QB 1GO3F 3JD3A 5CA3A 1NKDA 3JD4A 2W0FC 2NNUA 4ZBMA 1K3EA 4H37A 3W7SA 3SPHA 1EBOA 4JAVA 2D3OW 4DXWA 1PL0A 2IJKA 1M90W 1F51A 1L1FA 4WFAV 2ZXWC 1RM1C 3SYPA 1H8EG 1R6KA 3ABTA 3W7TA 3CCRV 2QM7A 2Y48A 3JD1A 3W7UA 5EBWC 2WLIA 3ZRSA 5IY5C 4H33A 3G71V 4I5SA 1H8HG 1V54C 1F23A 3F7YC 3SPCA 3D36A 2EZOA 2X6CA 3K79A 3RBZA 2QM8A 2IU0A 1JPXA 3AG4C 1AROP 2WLLB 2DW4A 3CMEV 2ITDC 4LC1A 3FKSG 1CPYA 3E35A 3MD0A 1FXHA 5IDJA 1ROPA 1YTFD 4UVBA 2WPDG 4TWKA 3ZRXA 1S3JA 1SRYA 1FXKA 2GHYA 4RAIA 4MVRA 3OM3B 1VQ7V 1BHAA 1NBMG 1V54B 1Q81W 1QBZA 4JF3A 4WFBV 3ASNC 4MVMA 1I5YA 2NLJC 1NH2D 1EFRG 3CC2V 2B1IA 2WLIB 2EIJC 1BL8A 4KP4A 2JEXA 2ZR2A 4QPJA 3ETGA 5L3FA 3ZJZA 2KB1A 1VQKV 3M99B 1GM7A 3G4SV 5B1BC 4Q20A 2WSSG 3BY6A 1J95A 1M56B 1YJ9V 5L3GA 5EBMC 3ZMUA 2XAQA 4UVAA 4KUMA 2A79B 1FFTB 1V55C 5LGNA 1H38A 4WF9V 3ZMSA 2EBOA 3ZN0A 3CCQV 1PKXA 3RVZA 2DYRC 2EJRA 1GKFA 4YXWG 1S0VA 4Z1MG 1S77D 3ABMB 3CC7V 2WAMA 4X8AA 2IH1C 2W6IG 2DWDC 2GSMB 1KECA 4MW8A 1K5SA 4FIPC 4CBCA 2JIZG 3ASNB 2ZR3A 4QIWF 1E1RG 3I56V 3E89A 1YI2V 3ASOC 4RO2A 2H94A 2EIJB 1VQLV 3AG3C 1KQSU 4UV8A 1YJNV 4XDKA 5DM6V 1QCEA 2Q6AA 1K9MW 2JJ1G 2Q69A 2B5UA 2XAJA 4FPPA 5C93A 1I5XA 1F4MA 1GM8A 3R65A 5EC2C 3ZRWA 3ABLB 1NVPC 1AI5A 1HWYA 2JK5C 3STZC 3RW0A 3ZCCA 1V55B 1G4YB 2EIMC 3E8FA 5DN6G 5HFMA 1K7DA 1AI6A 1OZ0A 4HZ3A 2DYRB 3OR7C 2XAHA 2ZDIA 4JTAB 3ZMVA 4E2LA 2ZQMA 2UXXA 4TT3G 1Q86W 3IGAC 2OTJV 4UV9A 4WFGA 3K06A 1TUEB 2X6AA 4P2ZA 3ASOB 1JQ0A 5CBHA 4R6ZA 1W0JG 1N8RW 2OCCC 2DYSC 3K03A 3UM7A 2JJ2G 1M9NA 4TSFG 1YJWV 1MSWD 4GCZA 2ATKC 1MG1A 4MVUA 2P90A 4XDLA 1THZA 2BOBC 3FYIB 4GX2A 4PDRA 4JYBA 3IC7A 4R8CA 1SERA 1IXMA 2HKOA 3ML0A 3SPIA 2WLKA 2Y69C 4PDVA 4XBFA 2QKSA 3ZRWB 4JASA 5L3DA 3K9AA 1GTOA 4MTOA 2LP7A 4GT1A 5KA6A 2X7RB 3SYAA 2M7WA 1PD3A 2X6BA 3LSQA 5B1AC 1AJPA 5LHHA 3F5WC 3NXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NH2 C;  1NVP D;  1RM1 B;  1NH2 D;  1YTF C;  1NVP C;  5IYB O;  1YTF D;  5IYD O;  1RM1 C;  5IYC O; 
#chains in the Genus database with same CATH topology
 1YXB A;  1LNQ A;  4QNH B;  5L3E A;  5KUM A;  3DSQ A;  4J7K A;  4PA4 A;  5LMU B;  1HNX B;  2UXD O;  1M93 A;  1Q5O A;  4U7O A;  3IJ4 A;  1MZF A;  3EFF K;  1W0K G;  1RM1 B;  1WPX A;  3OR6 C;  5FPO A;  5KLV H;  4J10 A;  4GKJ B;  1LUW A;  2Y69 B;  1D2D A;  3GB7 C;  4TV8 B;  1SQP H;  4EFE A;  4UUJ C;  2K9P A;  2P7T C;  4JI5 B;  5IY5 B;  1VAR A;  5EBL C;  1BT8 A;  3OW2 U;  1RPR A;  2UUB O;  4ZHQ A;  1IBK B;  4QE9 A;  2CTQ A;  4DR5 O;  2YIC A;  2BSK B;  3OMA B;  1OCC C;  1BSM A;  4QE7 A;  4DRX B;  2HEP A;  1QLN A;  3DXR A;  3SR2 C;  4LF9 B;  4O4I B;  4JTD B;  4OXS A;  5BZB A;  3TXS A;  4YJ2 B;  2V1D A;  5H2F Z;  3ABU A;  3H1L H;  1YIT V;  4G2K A;  2WLH A;  4MVZ A;  1FS0 G;  2G38 A;  3ABK C;  1RSO A;  2UXD B;  1OCC B;  3OUF A;  4I55 B;  4OPH A;  5B1B B;  1XL4 A;  2HHH B;  1W59 A;  3RYC A;  2QTO A;  1QNM A;  3SYQ A;  4KXR A;  1MOF A;  5A2Q N;  2LQT A;  4WFE A;  1GN4 A;  2EIN C;  4BW5 A;  4WFH A;  4X1Y A;  2LFR A;  2FYU H;  2AHZ A;  4DR5 B;  2OT5 A;  1Q90 D;  2AW9 A;  5CBG A;  2QEX V;  4I50 B;  1QHT A;  2IH3 C;  2QSA A;  2CH7 A;  3CX5 F;  4J7Z A;  1AB3 A;  3A0B Z;  3AG3 B;  1PPJ H;  3E8B A;  3RVY A;  2QE7 G;  2Y4T A;  4X66 O;  5HFL A;  4I9W A;  3CP1 A;  4DR7 B;  3OMI B;  3ETQ A;  3Q4H A;  4X1K B;  5LHG A;  1PNK A;  4MW3 A;  2F43 G;  2EIN B;  1PV0 A;  1JCH A;  1DF5 A;  1VQ8 V;  2F23 A;  5KAF Z;  5KHG A;  4HNA B;  4LFA O;  3JAW B;  3N2K A;  1Q82 W;  4GX5 A;  3CCL V;  4B3T O;  3CXC U;  5IYZ A;  4J11 A;  2RMK B;  4EB6 A;  5ITZ B;  4Z2W A;  1SET A;  4F4L A;  1YF2 A;  2H3O A;  4DR6 O;  3KZI Z;  5LYJ A;  5H9C A;  3K5N A;  4B3R O;  5LHI A;  1SQB H;  3JAR B;  2RCV A;  2LO1 A;  2O57 A;  4B7E A;  2VS0 A;  3RYH A;  1QQC A;  2E3C A;  2ADQ B;  2IJJ A;  3D36 C;  2E76 B;  4Z1V A;  1OCO C;  1VP7 A;  4R50 A;  4X66 B;  4RQE A;  2XOK G;  2DOS A;  3HKB B;  1M56 C;  4DR1 O;  4FFB A;  3IC9 A;  1Q43 A;  3SPG A;  3HKE A;  4PA7 A;  3CJH B;  2JGD B;  4TQD A;  3OMN B;  3HKD A;  4JYC A;  2W6J G;  5IYD O;  4O4H B;  3H1K H;  2Y0P A;  2XHB A;  1B04 A;  3RT3 C;  3B8N A;  1FPO A;  2C2A A;  1K8A W;  5KHH A;  1N32 O;  3JAL B;  4LFA B;  3CCV V;  4B3T B;  3QO5 A;  1NH2 B;  1OCO B;  3OEE G;  1WLE A;  3CCJ V;  2YEV A;  4N21 A;  4DV5 O;  4DR6 B;  1XMO O;  4B3R B;  3ABL C;  1OCR B;  3FYE B;  5B3S B;  3C90 A;  3FAV B;  1K97 A;  2OWO A;  3I55 V;  5H6R A;  1YIJ V;  2JS5 A;  4JI0 O;  1R6T A;  1VQ9 V;  4MTF A;  4MVS A;  5JVD B;  5H6Q A;  2Z3Y A;  4LWS A;  3LNM B;  4DR1 B;  4X89 A;  2E5L O;  1P84 F;  1YCI A;  4B08 A;  3K04 A;  5GW7 A;  2WLN A;  3LDC A;  4DV2 O;  3M8A A;  2KQX A;  4ZI7 B;  4U3J B;  3FB6 C;  2UXB O;  3MHS C;  1NVP D;  1N32 B;  5L3B A;  4LF7 O;  1Y76 A;  4P9P A;  5JQG B;  5KMG A;  4CH3 A;  3P30 A;  1HR0 O;  4MTG A;  2WLL A;  1NTM H;  1YHQ V;  3X2Q B;  3JD3 A;  4JI8 B;  2JS3 A;  1WB8 A;  3K5L A;  3JD4 A;  2ZM6 O;  1K3E A;  2D3O W;  4DXW A;  1PL0 A;  1AR4 A;  4WFA V;  2LW1 A;  2ZXW C;  5DED A;  1R6K A;  4LNU A;  1ZUQ A;  1JFF B;  4JI0 B;  1NZ6 A;  1AVM A;  3RYF B;  4RWU A;  5EBW C;  1FAF A;  3G71 V;  4NYK A;  5IJ0 B;  3OTF A;  2E5L B;  3F7Y C;  4AQY O;  4I9Q A;  1XDC A;  2VQF B;  4DV2 B;  2CDY A;  1TVK A;  3AG4 C;  3CME V;  4IT5 A;  1Y67 A;  3FKS G;  3UCS C;  3ZHS A;  4GUN A;  5IDJ A;  4LF7 B;  4LF8 O;  4UVB A;  2WPD G;  1HR0 B;  3ZRX A;  1SA0 B;  2YIB D;  1FXK A;  1VF5 B;  4UCS A;  3B40 A;  5CB4 B;  2AZ2 A;  3OM3 B;  1VQ7 V;  2FB5 A;  4JV5 O;  4YJ3 A;  3CRQ A;  3APQ A;  3BAA A;  1I5Y A;  4DV0 O;  1F7Y A;  2WLI B;  4UCO A;  1VIB A;  2JEX A;  1OV9 A;  3B09 A;  5L3F A;  1NTZ H;  1JJO A;  1WP7 A;  1J95 A;  3C3T A;  4IHJ A;  4JI1 O;  1N0J A;  4TOI A;  3TXQ A;  1FFT B;  1V55 C;  2Q7H A;  1ZL8 B;  4WF9 V;  1XMQ B;  1H38 A;  2OIE A;  3G6B A;  4AQY B;  3UT5 A;  3ZN0 A;  3RN4 A;  3RVZ A;  4OX9 O;  2DYR C;  2EJR A;  3CC7 V;  4X8A A;  3DC5 A;  3J81 N;  2IH1 C;  4I7Z B;  2DWD C;  2ETN A;  3CRM A;  3CWB H;  3H1I H;  4CBC A;  4I0X B;  3E22 A;  4QIW F;  3I56 V;  3E89 A;  3ASO C;  2H94 A;  4LF8 B;  3CS5 A;  1KQS U;  4UV8 A;  1BCC H;  4XDK A;  5DM6 V;  2VRZ A;  2Q6A A;  2JJ1 G;  2B5U A;  5C93 A;  2PYL A;  1AP6 A;  4NTW A;  1LUV A;  1HWY A;  3STZ C;  4JV5 B;  1V55 B;  4ZIB A;  1V9P A;  4HZ3 A;  2DYR B;  4DV0 B;  2ZDI A;  5CA0 B;  1IBM O;  1Q86 W;  4WFG A;  2GUZ B;  1TUE B;  2E75 B;  3ASO B;  2NR5 A;  1W0J G;  1N8R W;  4L8J A;  3KKY A;  1MA1 A;  5J2U B;  2JJ2 G;  1M9N A;  3JAK A;  5C8Y B;  4GCZ A;  4OX9 B;  3BVO A;  2BE3 A;  4GX2 A;  4PDR A;  3JSL A;  4CS4 A;  3IC7 A;  4NXN O;  1Q6H A;  2HKO A;  3ML0 A;  3SPI A;  1HNW B;  2BTQ A;  3SGI A;  5L3D A;  3NR7 A;  5KHJ A;  3QF7 A;  4DRX A;  5EZY B;  3LSQ A;  1MZE A;  3BPZ A;  4FK5 C;  3A8T A;  3CB2 A;  3RGB A;  2XND G;  1IDS A;  4LFB B;  5LOV A;  4J9Z B;  4YJ2 A;  3ICX A;  1NTK H;  3BCC H;  4JYA O;  5EK0 A;  4DV4 B;  2PZS A;  2N04 A;  4K0K B;  4LR3 A;  1DLB A;  1QR8 A;  3CRR A;  4G27 B;  4DK1 A;  4CH6 A;  5E1A C;  1L0N H;  1ORQ C;  1Y66 A;  3ZMT A;  4FLY A;  1FXV A;  1JOY A;  2FTK A;  3FB5 C;  1M57 C;  4K8X A;  1KMI Z;  4QGP A;  2IU3 A;  2R70 A;  3DTU B;  1XRE A;  2Q67 A;  3QNE A;  3JAT A;  4I50 A;  1KB9 F;  3P32 A;  4O4L A;  3K57 A;  2Q0O C;  2QWR B;  3GWK C;  1GRJ A;  5B1O A;  1TAE A;  4X9Q A;  1B6Q A;  1QVG U;  4JYA B;  3L72 H;  4PA3 A;  4PDM A;  1BHB A;  1ZWI C;  1COW G;  2IM9 A;  1R3I C;  4JI7 O;  1NR7 A;  2R9R B;  2NN4 A;  3JAW A;  3U10 A;  4GKJ O;  3K58 A;  4FFK A;  3CC4 V;  5JWP A;  1VQN V;  4JI5 O;  2Z0A A;  3VOU A;  4GKK B;  2RNB A;  3RYI A;  1K4D C;  3D3I A;  3CSX A;  2DQ0 A;  2VQE O;  1XHX A;  3SYO A;  1QU7 A;  1H2L A;  4BR6 A;  4WBN A;  1NVP B;  1SQX H;  2HG5 C;  4NXM O;  4D7T A;  4FM1 A;  3TCU A;  4LF9 O;  2EZP A;  4P9O A;  2UXC O;  3CYO A;  3E83 A;  2HLD G;  3EXA A;  2XAS A;  4FMT A;  2XUM A;  4GLX A;  2Q68 A;  4N23 A;  1QR9 A;  2EIK C;  1N0N A;  1VF6 A;  1VQ4 V;  4JI7 B;  4O2A B;  3B77 A;  3ZMZ A;  3JAL A;  4IIJ B;  2YC0 A;  4UB6 Z;  4U7N A;  4FLV A;  2WA3 A;  4IYI A;  2N05 A;  2HHH O;  2P22 C;  2ZD9 A;  1R3J C;  3WB2 A;  4Q6G A;  2ITC C;  1N4C A;  3SJC C;  3MDS A;  4KL1 A;  2QM4 A;  4X1I B;  2DWE C;  3T4D A;  3FAV A;  2EIK B;  1VMG A;  3L75 H;  3LDD A;  2VQE B;  2AHY A;  4ABM A;  4P30 A;  3T2M A;  2ODM A;  1VQM V;  4NXM B;  1GMG A;  2WWW A;  3KCY A;  3ZIA G;  3ABM C;  5JVD A;  4HYO A;  1U96 A;  4U3F H;  1ENV A;  2UXC B;  1R73 A;  3CPW U;  1XL6 A;  4DR7 O;  3MHH C;  1K33 A;  3UKM A;  1SQQ H;  2V7Q G;  2HJF C;  3W7W A;  2ZNJ A;  3FFQ A;  3TK1 A;  2UXN A;  1H2G A;  3AEI A;  1FJG B;  4FM0 A;  1W2B U;  5JQG A;  5DEC A;  1K5Q A;  3F7V C;  5GON B;  1XHZ A;  2F4V B;  1U97 A;  3VQX A;  3J80 N;  5IE9 A;  5IWA B;  3N2G A;  2OCH A;  3L70 H;  5CA1 B;  2QWN B;  1IZ3 A;  4XDJ A;  3ZRV A;  4TV9 B;  5KHK A;  3K0D A;  3ABK B;  1PP9 H;  2YSU B;  4KHP O;  4JYY A;  5JH7 B;  3E86 A;  4QJF B;  4X64 O;  5IJ0 A;  4MT8 A;  4DUY B;  4O2B A;  4JZ2 A;  4GX1 A;  5IJ9 A;  3ZHU A;  1XNQ O;  4JZG A;  3U11 A;  2PGG A;  2QKA A;  2P67 A;  3APO A;  1RFY A;  2YIA A;  1SES A;  1AJN A;  2FL4 A;  3LSU A;  1CXZ B;  1NS1 A;  1WA8 B;  3CE2 A;  1NKD A;  2YI8 A;  2AGA A;  4ZBM A;  3W7S A;  1BZK A;  1M90 W;  1L8D A;  1SA0 A;  1F51 A;  4LFC B;  1H8E G;  4JAA A;  1HW7 A;  3W7T A;  4CH4 A;  5LA6 B;  3W7U A;  2WLI A;  4H33 A;  1WP8 A;  1H8H G;  2QDO A;  3ZED A;  1SQV H;  3R66 A;  2YID A;  5LP6 C;  1Z5V A;  4ZOL B;  4KHP B;  2DW4 A;  2ZE5 A;  2ITD C;  4X64 B;  4LC1 A;  2GTA A;  1FXH A;  3PN1 A;  1XNQ B;  1Y6X A;  4TWK A;  5FPR A;  4I4T B;  4UCR A;  2V4D A;  4I0X A;  2GHY A;  2CTW A;  4MVR A;  1AIL A;  3N27 A;  1QBZ A;  3ASN C;  4MVM A;  2NLJ C;  3H1J H;  3CEI A;  3K59 A;  2B1I A;  2EIJ C;  4KP4 A;  2ZR2 A;  4QPJ A;  4NVP A;  3ETG A;  4TUY B;  2KB1 A;  3K5O A;  1VQK V;  1KBH A;  1JMK C;  4YHH O;  1EZV H;  1GN6 A;  3BY6 A;  4JI8 O;  1M56 B;  2RQ6 A;  3ZMU A;  4KUM A;  1A32 A;  5CA0 A;  5LGN A;  1O9G A;  1EN4 A;  2LW7 A;  4J80 A;  3CCQ V;  1GKF A;  2WAM A;  3HKC A;  1KEC A;  4MW8 A;  2Y4U A;  3ASN B;  2ZR3 A;  1E1R G;  5C8Y A;  2EIJ B;  3L9D A;  1WNS A;  4YIO A;  1K9M W;  4FPP A;  3OGI B;  2VQF O;  1GM8 A;  3ABL B;  4NB5 A;  3RW0 A;  3H1H H;  2EIM C;  4PHZ A;  5J2T A;  5HFM A;  1AI6 A;  2XAH A;  4JTA B;  5IT9 N;  3S3W A;  3IGA C;  3OT7 A;  1XI1 A;  2ARH A;  1D5A A;  1WJZ A;  4R6Z A;  4YHH B;  1M5I A;  3SJB C;  2KG7 B;  2DYS C;  3K03 A;  3UM7 A;  1RSO B;  2ATK C;  1I7F A;  1FFX A;  4X65 O;  5KHI A;  5LXT B;  5B5E Z;  1B06 A;  4GYC B;  4JYB A;  1Q8I A;  1SER A;  1IXM A;  3RYC B;  3JCU Z;  3AG7 A;  2QKS A;  3L73 H;  4FZ0 A;  2ZKO A;  4J41 A;  4JI6 O;  1I08 A;  4MTO A;  5KA6 A;  1XMQ O;  3SYA A;  2CTR A;  1PD3 A;  2X6B A;  5B1A C;  4D6T H;  1H2M A;  4B3S O;  3NXS A;  3G6E V;  3AK3 A;  2DYS B;  2BTO A;  2WLJ A;  2MK3 A;  2PY5 A;  1YTF C;  3WG7 C;  3OFN G;  2CK3 G;  3JSN A;  3W7X A;  5JCO A;  2ZXW B;  5LL6 Y;  3K08 A;  1HNZ B;  1E1Q G;  3Q4H B;  1XIL A;  3IAY A;  3UO2 A;  3SPJ A;  4YY3 O;  1JVM A;  1HDJ A;  2JGU A;  5B1A B;  5JJJ B;  3J7A U;  1K34 A;  2QWP B;  3RWR D;  1EZJ A;  2QJ1 A;  2Q9L A;  4X65 B;  3AG4 B;  4LBE C;  3N2K B;  3T1C A;  1VQ6 V;  4WCE V;  4RUF A;  4HAM A;  5IYZ B;  1YTF B;  5FNV A;  1IBL O;  3WG7 B;  3T4Z A;  2LGW A;  4EB6 B;  1NJI W;  4JI6 B;  1M4U A;  3IFX A;  1AR1 B;  1K73 W;  2ZT9 B;  4B3S B;  2DQ3 A;  1BE3 H;  2FKX A;  2ZIN A;  2XAG A;  2A0L A;  2Q0A A;  2F66 C;  1HNW O;  2BOC C;  1PL4 A;  3VBB A;  3M7M X;  1NT2 B;  4E4E A;  5FL7 G;  1TUB A;  2L6L A;  4FFB B;  5IYC O;  4FLX A;  4BIZ A;  4YY3 B;  2A9H A;  3CD6 V;  3HKD B;  1XQ8 A;  4LFB O;  1MMM A;  3UQ8 A;  5A9G A;  1JR9 A;  4AIL C;  1P4R A;  2ZIO A;  3WU2 Z;  2QWO B;  3SJQ C;  4PJ0 Z;  3CMA V;  4DV4 O;  4JI2 O;  4B3M O;  3GWO A;  4K0K O;  1YSC A;  4IL6 Z;  4X62 O;  1YVW A;  5L3C A;  1IBL B;  4PV1 B;  2P4K A;  1OCZ C;  4MVO A;  1QLE C;  4CC5 A;  3H01 A;  3TET A;  3OUS A;  4TV8 A;  3ZN1 A;  1R3L C;  2PF4 E;  2RJZ A;  1JJ2 U;  2BSK A;  2IJH A;  5KA5 A;  3AK2 A;  3L71 H;  3LSS A;  4IGG A;  1VQO V;  3CCS V;  2VWK A;  2FML A;  5GTI Z;  1SZT A;  5KAI Z;  3FB8 C;  2HFE C;  2DN9 A;  2HP8 A;  4J42 A;  4PDL A;  2YUA A;  1OCZ B;  2DE0 X;  1QLE B;  4O4I A;  2YIB A;  2HVJ C;  1URF A;  3K3W A;  1Y4M A;  4UVC A;  2CAZ C;  3DGE A;  1FD9 A;  1MAB G;  2Q7G A;  1NQT A;  2P6J A;  4CZZ A;  2QR4 A;  1Y76 B;  4JI2 B;  4B3M B;  4X62 B;  1K4C C;  4BW9 A;  2DJV A;  3ETD A;  1SQG A;  4J7J A;  2Y0I A;  1I0H A;  2YXY A;  3THO A;  4I55 A;  4MSW C;  1KP2 A;  4DYL A;  3CHX A;  4UCT A;  2P5O A;  1M1K W;  2EIL C;  5BXZ A;  1G6U A;  3LDE A;  2AZ0 A;  4DV6 O;  1N36 O;  1R6N A;  1R3K C;  1YEW A;  3PJS K;  4GKK O;  4YIP A;  4LNU B;  5JJN B;  1DTO A;  5BMV B;  2HVK C;  1FXK C;  4JAU A;  3O65 A;  3OD4 A;  2E74 B;  4MTX A;  3H9V A;  1TGO A;  3JD0 A;  5KUK A;  5B1N A;  3AG1 C;  4JI3 B;  4EKW A;  1VF7 A;  3A0R A;  2ZCE A;  2D2C B;  4UB8 Z;  4X1K A;  2EIL B;  3B8M A;  1GK9 A;  4CS3 A;  2IW5 A;  3QO8 A;  4X88 A;  2F1M A;  3DC6 A;  4BIU A;  4DK0 A;  1JX9 A;  1M57 B;  4GX0 A;  3HPL C;  1WA8 A;  2CTP A;  4NTY A;  1FXK B;  3CCU V;  4HNA A;  2JDI G;  4TQF A;  1KU9 A;  3UO3 A;  2PI5 A;  3CCE V;  4FM2 A;  4FJC C;  1S72 V;  4MS2 A;  5ITZ A;  1BMF G;  3AG1 B;  3GVM A;  4DV6 B;  1N36 B;  3CRC A;  5LGU A;  3JAR A;  4FZ1 A;  3OEH G;  4ZOL A;  1CEZ A;  4J9Y B;  1PNL A;  3UT5 B;  5J9P C;  4DR3 O;  2ZDI C;  2P06 A;  4PA9 A;  2XAF A;  4LCU C;  1XEQ A;  3RFR A;  1N33 O;  5CA3 A;  3B4S A;  3HKB A;  2UU9 B;  3E22 B;  2W0F C;  4NTX A;  3CJH A;  3ZHV A;  2JGD A;  3QTC A;  1EBO A;  4JAV A;  4LF5 B;  2IJK A;  1SQF A;  1L1F A;  4O4H A;  1RM1 C;  3SYP A;  3BAB A;  3ABT A;  3CCR V;  4DUZ O;  2QM7 A;  1FJG O;  4FLT A;  1MNG A;  3ZRS A;  5IY5 C;  3B2E E;  4BIO A;  1UFI A;  1V54 C;  2F4V O;  1F23 A;  3D36 A;  1H2N A;  3RBZ A;  4OGQ B;  2UUC B;  3KCX A;  2IU0 A;  4FLU A;  2N74 A;  1JPX A;  3SJA C;  5IWA O;  4DV3 B;  3E35 A;  3MD0 A;  4X20 B;  3WB1 A;  1YTF D;  3D8C A;  3JAK B;  1XUQ A;  1O9H A;  5LMN O;  1S3J A;  3D3Q A;  2CE4 A;  4DW1 A;  4DR3 B;  1N33 B;  1NBM G;  1IVS A;  1V54 B;  1B3Q A;  2BTQ B;  4JF3 A;  5GTH Z;  1US6 A;  4WFB V;  1D5N A;  4EEQ A;  2WA4 A;  4DUY O;  1EFR G;  3S3X A;  2XT9 A;  1BL8 A;  3BHP A;  1AR5 A;  4ZI7 A;  1HP8 A;  4U3J A;  2HJD A;  3G4S V;  2GBO A;  5B1B C;  4Q20 A;  3ZS8 C;  2WSS G;  3T1H O;  4DUZ B;  1YJ9 V;  5EBM C;  3JAS B;  2XAQ A;  3ZHR A;  2A79 B;  3A2F A;  2JRI A;  3ZMS A;  2EBO A;  2A7W A;  2ILM A;  5LOV B;  1WB7 A;  3ZX6 A;  1S0V A;  4YXW G;  1S77 D;  4Z1M G;  3ABM B;  4LFC O;  2KG7 A;  2P4V A;  2GSM B;  4FIP C;  1EN6 A;  4K35 A;  1SS3 A;  1SKV A;  3AG3 C;  5LXT A;  1YJN V;  5LMN B;  1JFF A;  2PUS A;  1F4M A;  5EC2 C;  3RYF A;  1AI5 A;  3TJT A;  2EUL A;  2JK5 C;  3ZCC A;  4ICG A;  5K1P A;  3E8F A;  2UUB B;  2F95 B;  1K7D A;  4HBN A;  1OZ0 A;  4AI8 A;  2ZQM A;  4TT3 G;  1Y74 B;  2W0X A;  4FLW A;  1ZX3 A;  3JAT B;  1RP3 B;  4P2Z A;  1JQ0 A;  4CC6 A;  1I94 O;  3T1H B;  2OCC C;  4O4L B;  4A5U B;  4LF6 O;  3F5T A;  3EVK A;  4TSF G;  1YJW V;  1MG1 A;  4XDL A;  2BOB C;  3FYI B;  1GN2 A;  5CB4 A;  1JA8 A;  5B66 Z;  4R8C A;  2WLK A;  4PDV A;  4XBF A;  3ZRW B;  4JAS A;  5EIB D;  2AXT Z;  3K9A A;  1GTO A;  3TGU H;  4GT1 A;  2L35 A;  2RN9 A;  4F6R B;  1AJP A;  4IYH A;  5LHH A;  3F5W C;  2OCC B;  3FB7 C;  5BR8 O;  4O4J B;  4UFZ A;  2IJI A;  1WN7 A;  1ZL8 A;  3BA9 A;  4OPA A;  1VF6 C;  4R7C A;  4L87 A;  3BEH A;  3CRA A;  3RYI B;  3VQY A;  4LP8 A;  5BY1 A;  4K3A A;  5EYP B;  3K0G A;  4WBN B;  2K1E A;  1I94 B;  2A3Q A;  4LF6 B;  2YI9 A;  4QPK A;  1NH2 C;  2B1G A;  3E8H A;  5KX5 B;  5LP6 B;  2GV9 A;  2CUG A;  2CGN A;  3QO7 A;  3T1Y O;  4B7K A;  2QWQ B;  4PEL A;  4WFF A;  1OCR C;  5B3S C;  2WLM A;  1UJW B;  1Q6U A;  3ETE A;  2GDS A;  3C3S A;  5AG2 A;  1OHH G;  1XOU A;  1GH6 A;  2BCC H;  2EJ7 A;  2GUZ A;  1F4N A;  3JYC A;  5BR8 B;  2HR3 A;  1H2K A;  5J2U A;  4UCV A;  1LR1 A;  3EHB B;  2OTL V;  3OTO O;  4ZHQ B;  2ZIM A;  1S76 D;  2KKW A;  4NKG B;  2H8P C;  4MVQ A;  1IXB A;  2B9Z A;  2PI4 A;  3VQW A;  1KD1 W;  2LJ2 A;  4ASU G;  1VQP V;  3DXR B;  2PYJ A;  5EZY A;  1AI7 A;  4PI2 A;  3X2Q C;  3T1Y B;  5CN0 A;  4C7U A;  2YDE A;  4JI4 O;  3BA8 A;  1AI4 A;  1HNZ O;  2ADP A;  1MSD A;  3K9S A;  3P3P A;  2JEU A;  1S5H C;  4AHC A;  2ZNI A;  1ZAU A;  4H44 B;  3E8G A;  1NR1 A;  1Q7Y W;  1X59 A;  2EIM B;  2X0L A;  3E2E A;  3ZHT A;  1KC8 W;  4DV5 B;  3OE7 G;  1XMO B;  3N2G B;  3OTO B;  4ZKI A;  3VQV A;  4X1Y B;  1RPO A;  1AP5 A;  1WPB A;  4F6E A;  1EM1 A;  3ZHQ A;  4NR1 A;  4CS2 A;  1QVF U;  1DF4 A;  1CP9 A;  1P7B A;  5D5Q A;  2CH7 B;  1WAZ A;  4KFM A;  2Z5U A;  5BMV A;  1GN3 A;  1N34 O;  4H13 B;  3AG2 C;  3JD2 A;  3JAM N;  4JI4 B;  5CMU A;  4CH5 A;  3OGC C;  4O2B B;  5IJ9 B;  4BAY A;  3OAA G;  1FYJ A;  5K1X A;  3BFR A;  2UXB B;  3G80 A;  4UXN A;  1L0L H;  4RUE A;  1AJQ A;  1KP3 A;  1KKD A;  4JGS A;  5LBQ A;  1OJH A;  1XNR O;  2EX3 A;  3AG2 B;  1KUQ A;  2LFS A;  3I5D A;  3WFV A;  3HB3 B;  2ZM6 B;  5LYJ B;  3SDL A;  3STL C;  1VQ5 V;  1BQZ A;  1YZB A;  5D5P A;  3SYC A;  5IYB O;  1TA8 A;  5CBF A;  4LH7 A;  4PA6 A;  3JCZ A;  2IBZ H;  5FLX N;  3FD9 A;  4G28 B;  3G67 A;  1Z2G A;  3RYH B;  1IUR A;  1K92 A;  2QTS A;  1N34 B;  2YXL A;  3CCM V;  2QA4 V;  2OIG A;  4DV1 O;  1E79 G;  3HKE B;  1IX9 A;  3KG2 A;  4UCU A;  2R9A A;  2F93 B;  1KYO F;  1UPG A;  3LNN A;  1GM9 A;  3QG5 A;  3LUT B;  4JTC B;  4DO2 A;  1VEW A;  2YXH A;  4O2A A;  2OYQ A;  1XNR B;  4IIJ A;  1GAX A;  1PNM A;  5EC1 C;  2M6Y A;  4RQF A;  2YEV B;  4EFB A;  1DK1 A;  5LGT A;  2A06 H;  1DGS A;  1NU1 H;  1ZLZ A;  2R9I A;  1G8M A;  2Q4P A;  1BS3 A;  3P3N A;  5EIB C;  4X1I A;  1GO3 F;  1KKC A;  3HKC B;  4X20 A;  5TIS Z;  4JI1 B;  3CXH F;  2NNU A;  4H37 A;  4DV7 O;  3SPH A;  4LWS B;  5JJE B;  4DV1 B;  1FKA O;  4W4L A;  3MAQ A;  4JI3 O;  1ZTE A;  2Y48 A;  3JD1 A;  4I5S A;  5J2T B;  1Z5W A;  3L74 H;  3SPC A;  4DW0 A;  2EZO A;  2X6C A;  3K79 A;  1SZX A;  2QM8 A;  2ZE8 A;  5KMG B;  4LH6 A;  4H0L B;  1ARO P;  2WLL B;  2ZE6 A;  3JAS A;  1BGY H;  5GON A;  1CPY A;  2Q8V A;  1ROP A;  1YDX A;  1IBM B;  2ZE7 A;  4GZR B;  4DR4 O;  1S5L Z;  1SC5 B;  1FFX B;  1SRY A;  4RAI A;  5CA1 A;  4PD4 F;  5JCO C;  1BHA A;  3WB0 A;  4LF4 O;  1PM9 A;  1Q81 W;  1R1B A;  3HR0 A;  4FVM A;  4TV9 A;  1SF9 A;  1NH2 D;  3CC2 V;  4DV7 B;  3K5M A;  3O9O A;  1Q6I A;  4DR2 O;  3ZJZ A;  3BRC A;  3M99 B;  1GM7 A;  5JH7 A;  4NXN B;  1X4T A;  1ZSP A;  1J5E O;  2QKC A;  1TVK B;  5H5N A;  5L3G A;  2UU9 O;  4UVA A;  1Y74 A;  4LF5 O;  1NI8 A;  1PKX A;  1XBL A;  2UUA O;  2QGN A;  3U0Z A;  1EN5 A;  2W6I G;  1K5S A;  2JIZ G;  1YI2 V;  2LGQ A;  4RO2 A;  4D7S A;  1VQL V;  4YJ3 B;  1H2S B;  2PTM A;  2KSD A;  1G1X B;  4DR4 B;  1QCE A;  2Q69 A;  2UUC O;  2XAJ A;  1I5X A;  1T5E A;  3R65 A;  2RDC A;  3ZRW A;  2MW2 B;  1NVP C;  5LA6 A;  3QVN A;  4LF4 B;  1G4Y B;  5LMU O;  1HNX O;  4DV3 O;  5DN6 G;  5F2V O;  4F6R A;  2YS8 A;  1P7G A;  3FX7 A;  5FNV B;  4IHJ B;  3OR7 C;  2GTS A;  3ZMV A;  4E2L A;  2UXX A;  4DR2 B;  4PI0 A;  2OTJ V;  4UV9 A;  4O4J A;  1Q3E A;  3K06 A;  2X6A A;  4K8Z A;  5CBH A;  2Q73 A;  1J5E B;  2CGO A;  2Q7E A;  1P49 A;  2DMX A;  3AK1 A;  1IBK O;  2JVD A;  2R72 A;  1MSW D;  2XTA A;  4MVU A;  3A0H Z;  4I4T A;  5EYP A;  2P90 A;  2UUA B;  1THZ A;  4BWA A;  2VWJ A;  4FLZ A;  5E79 Z;  1TUB B;  3ZBH A;  2Y69 C;  5KX5 A;  5LP6 A;  4W4K A;  2LP7 A;  2X7R B;  2M7W A;  4TUY A;  2Q5Z A;  1BQ0 A;  1S5J A;  4JPR A; 
#chains in the Genus database with same CATH homology
 2OCC B;  3FB7 C;  3G6E V;  5L3E A;  1LNQ A;  2DYS B;  4QNH B;  2IJI A;  4FK5 C;  5KUM A;  2XND G;  4PA4 A;  2WLJ A;  2MK3 A;  1YTF C;  4J9Z B;  4U7O A;  3WG7 C;  4R7C A;  4L87 A;  3OFN G;  2CK3 G;  3EFF K;  3W7X A;  1W0K G;  2ZXW B;  1WPX A;  3BEH A;  3OR6 C;  1RM1 B;  4LP8 A;  3K08 A;  5EK0 A;  1E1Q G;  2Y69 B;  3GB7 C;  3K0G A;  2K1E A;  1DLB A;  1QR8 A;  4UUJ C;  2P7T C;  5IY5 B;  3SPJ A;  4G27 B;  5EBL C;  3OW2 U;  1RPR A;  4QPK A;  1JVM A;  1NH2 C;  2B1G A;  3E8H A;  5E1A C;  5B1A B;  1K34 A;  3QO7 A;  4QE9 A;  1EZJ A;  4PEL A;  1ORQ C;  3OMA B;  1OCC C;  3AG4 B;  4WFF A;  1OCR C;  4QE7 A;  4LBE C;  1QLN A;  5B3S C;  3T1C A;  2WLM A;  1VQ6 V;  1Y66 A;  3ZMT A;  1UJW B;  4WCE V;  4RUF A;  1FXV A;  3ETE A;  4HAM A;  1YTF B;  2FTK A;  1JOY A;  3WG7 B;  3T4Z A;  1NJI W;  3FB5 C;  1M57 C;  1OHH G;  4JPR A;  2IU3 A;  4JTD B;  3DTU B;  3IFX A;  4OXS A;  2Q67 A;  5BZB A;  1AR1 B;  1K73 W;  3QNE A;  1F4N A;  3JYC A;  2V1D A;  2DQ3 A;  3P32 A;  3ABU A;  2XAG A;  2A0L A;  2HR3 A;  4G2K A;  1YIT V;  2WLH A;  4MVZ A;  1FS0 G;  2BOC C;  3ABK C;  5B1O A;  3VBB A;  3EHB B;  2OTL V;  1OCC B;  3OUF A;  1B6Q A;  1S76 D;  5FL7 G;  1QVG U;  5B1B B;  2H8P C;  4MVQ A;  1XL4 A;  4PA3 A;  4PDM A;  1BHB A;  1ZWI C;  2QTO A;  3SYQ A;  1COW G;  2PI4 A;  1MOF A;  5IYC O;  1R3I C;  1KD1 W;  4ASU G;  4BIZ A;  1VQP V;  4WFE A;  2EIN C;  2A9H A;  4BW5 A;  1NR7 A;  2R9R B;  3CD6 V;  4WFH A;  1AI7 A;  3X2Q C;  2LFR A;  5CN0 A;  1P4R A;  2AHZ A;  3SJQ C;  2OT5 A;  1AI4 A;  5CBG A;  3CMA V;  2QEX V;  2IH3 C;  3GWO A;  3CC4 V;  1YSC A;  2JEU A;  1VQN V;  1S5H C;  5L3C A;  3VOU A;  3AG3 B;  3E8B A;  3RVY A;  2QE7 G;  1OCZ C;  4MVO A;  1K4D C;  1QLE C;  3D3I A;  3H01 A;  5HFL A;  4I9W A;  3TET A;  3CP1 A;  1NR1 A;  2DQ0 A;  3E8G A;  3OMI B;  3OUS A;  3SYO A;  1Q7Y W;  1NVP B;  5LHG A;  1PNK A;  2HG5 C;  4MW3 A;  3ZN1 A;  2F43 G;  2EIM B;  2EIN B;  2X0L A;  1R3L C;  1JCH A;  3E2E A;  1DF5 A;  3TCU A;  1KC8 W;  1JJ2 U;  2EZP A;  1VQ8 V;  3OE7 G;  4P9O A;  2IJH A;  3CYO A;  4ZKI A;  3E83 A;  5KA5 A;  2HLD G;  1RPO A;  2XAS A;  4FMT A;  1Q82 W;  3LSS A;  4GX5 A;  1VQO V;  3CCS V;  2Q68 A;  4N23 A;  1QR9 A;  1SZT A;  2EIK C;  3FB8 C;  3CXC U;  2HFE C;  3CCL V;  1QVF U;  1DF4 A;  1VQ4 V;  1CP9 A;  4PDL A;  1P7B A;  1OCZ B;  1SET A;  3B77 A;  1QLE B;  4F4L A;  2HVJ C;  4KFM A;  3ZMZ A;  2Z5U A;  3K3W A;  5H9C A;  5LHI A;  1Y4M A;  3AG2 C;  4UVC A;  3DGE A;  1MAB G;  3JD2 A;  1NQT A;  4U7N A;  2P6J A;  5CMU A;  4CZZ A;  3OGC C;  2ZD9 A;  1R3J C;  4BAY A;  3OAA G;  1K4C C;  2ITC C;  3ETD A;  2IJJ A;  1OCO C;  4R50 A;  2DWE C;  4MSW C;  1KP2 A;  4UXN A;  4RQE A;  4RUE A;  2XOK G;  3T4D A;  1AJQ A;  1KP3 A;  1M56 C;  2EIK B;  1KKD A;  3LDD A;  2AHY A;  4JGS A;  4P30 A;  3SPG A;  4PA7 A;  3T2M A;  5LBQ A;  1M1K W;  2EIL C;  1VQM V;  3LDE A;  1GMG A;  2WWW A;  3OMN B;  4JYC A;  2W6J G;  1R6N A;  3ZIA G;  5IYD O;  1R3K C;  3ABM C;  3AG2 B;  4HYO A;  3PJS K;  1ENV A;  2LFS A;  3WFV A;  3B8N A;  3HB3 B;  1K8A W;  1R73 A;  2C2A A;  1DTO A;  3CPW U;  2HVK C;  1FXK C;  4JAU A;  1XL6 A;  4MTX A;  3MHH C;  3STL C;  1VQ5 V;  1K33 A;  3SYC A;  3UKM A;  5IYB O;  5CBF A;  3CCV V;  3QO5 A;  3JD0 A;  4PA6 A;  5KUK A;  3JCZ A;  2V7Q G;  5B1N A;  2HJF C;  3W7W A;  4G28 B;  1NH2 B;  1OCO B;  3OEE G;  1WLE A;  3AG1 C;  3TK1 A;  3CCJ V;  2UXN A;  4EKW A;  1H2G A;  3A0R A;  2YEV A;  4N21 A;  1K92 A;  3AEI A;  3ABL C;  1W2B U;  1OCR B;  3CCM V;  2QA4 V;  1K5Q A;  3F7V C;  2EIL B;  3B8M A;  3FYE B;  5B3S B;  1GK9 A;  2IW5 A;  3QO8 A;  1K97 A;  4X88 A;  1E79 G;  3I55 V;  5H6R A;  1YIJ V;  4BIU A;  1JX9 A;  1M57 B;  4GX0 A;  3HPL C;  3KG2 A;  1FXK B;  3CCU V;  1VQ9 V;  4MTF A;  4MVS A;  2JDI G;  5H6Q A;  2Z3Y A;  3LNM B;  2PI5 A;  1GM9 A;  4XDJ A;  3CCE V;  4X89 A;  3LUT B;  4JTC B;  4DO2 A;  3ZRV A;  4FJC C;  1S72 V;  3K0D A;  4MS2 A;  1BMF G;  3ABK B;  3AG1 B;  3K04 A;  5GW7 A;  2WLN A;  3LDC A;  2YSU B;  5LGU A;  1PNM A;  3E86 A;  3FB6 C;  4QJF B;  5EC1 C;  3MHS C;  1NVP D;  4MT8 A;  4RQF A;  5L3B A;  2YEV B;  3OEH G;  5LGT A;  4GX1 A;  4P9P A;  1CEZ A;  4J9Y B;  1PNL A;  2R9I A;  3P30 A;  2P67 A;  1G8M A;  4MTG A;  2WLL A;  5J9P C;  2ZDI C;  1YHQ V;  1SES A;  2XAF A;  1AJN A;  4LCU C;  4PA9 A;  3X2Q B;  1GO3 F;  3JD3 A;  5CA3 A;  1NKD A;  3JD4 A;  2W0F C;  2NNU A;  4ZBM A;  1K3E A;  4H37 A;  3W7S A;  3SPH A;  1EBO A;  4JAV A;  2D3O W;  4DXW A;  1PL0 A;  2IJK A;  1M90 W;  1F51 A;  1L1F A;  4WFA V;  2ZXW C;  1RM1 C;  3SYP A;  1H8E G;  1R6K A;  3ABT A;  3W7T A;  3CCR V;  2QM7 A;  2Y48 A;  3JD1 A;  3W7U A;  5EBW C;  2WLI A;  3ZRS A;  5IY5 C;  4H33 A;  3G71 V;  4I5S A;  1H8H G;  1V54 C;  1F23 A;  3F7Y C;  3SPC A;  3D36 A;  2EZO A;  2X6C A;  3K79 A;  3RBZ A;  2QM8 A;  2IU0 A;  1JPX A;  3AG4 C;  1ARO P;  2WLL B;  2DW4 A;  3CME V;  2ITD C;  4LC1 A;  3FKS G;  1CPY A;  3E35 A;  3MD0 A;  1FXH A;  5IDJ A;  1ROP A;  1YTF D;  4UVB A;  2WPD G;  4TWK A;  3ZRX A;  1S3J A;  1SRY A;  1FXK A;  2GHY A;  4RAI A;  4MVR A;  3OM3 B;  1VQ7 V;  1BHA A;  1NBM G;  1V54 B;  1Q81 W;  1QBZ A;  4JF3 A;  4WFB V;  3ASN C;  4MVM A;  1I5Y A;  2NLJ C;  1NH2 D;  1EFR G;  3CC2 V;  2B1I A;  2WLI B;  2EIJ C;  1BL8 A;  4KP4 A;  2JEX A;  2ZR2 A;  4QPJ A;  3ETG A;  5L3F A;  3ZJZ A;  2KB1 A;  1VQK V;  3M99 B;  1GM7 A;  3G4S V;  5B1B C;  4Q20 A;  2WSS G;  3BY6 A;  1J95 A;  1M56 B;  1YJ9 V;  5L3G A;  5EBM C;  3ZMU A;  2XAQ A;  4UVA A;  4KUM A;  2A79 B;  1FFT B;  1V55 C;  5LGN A;  1H38 A;  4WF9 V;  3ZMS A;  2EBO A;  3ZN0 A;  3CCQ V;  1PKX A;  3RVZ A;  2DYR C;  2EJR A;  1GKF A;  4YXW G;  1S0V A;  4Z1M G;  1S77 D;  3ABM B;  3CC7 V;  2WAM A;  4X8A A;  2IH1 C;  2W6I G;  2DWD C;  2GSM B;  1KEC A;  4MW8 A;  1K5S A;  4FIP C;  4CBC A;  2JIZ G;  3ASN B;  2ZR3 A;  4QIW F;  1E1R G;  3I56 V;  3E89 A;  1YI2 V;  3ASO C;  4RO2 A;  2H94 A;  2EIJ B;  1VQL V;  3AG3 C;  1KQS U;  4UV8 A;  1YJN V;  4XDK A;  5DM6 V;  1QCE A;  2Q6A A;  1K9M W;  2JJ1 G;  2Q69 A;  2B5U A;  2XAJ A;  4FPP A;  5C93 A;  1I5X A;  1F4M A;  1GM8 A;  3R65 A;  5EC2 C;  3ZRW A;  3ABL B;  1NVP C;  1AI5 A;  1HWY A;  2JK5 C;  3STZ C;  3RW0 A;  3ZCC A;  1V55 B;  1G4Y B;  2EIM C;  3E8F A;  5DN6 G;  5HFM A;  1K7D A;  1AI6 A;  1OZ0 A;  4HZ3 A;  2DYR B;  3OR7 C;  2XAH A;  2ZDI A;  4JTA B;  3ZMV A;  4E2L A;  2ZQM A;  2UXX A;  4TT3 G;  1Q86 W;  3IGA C;  2OTJ V;  4UV9 A;  4WFG A;  3K06 A;  1TUE B;  2X6A A;  4P2Z A;  3ASO B;  1JQ0 A;  5CBH A;  4R6Z A;  1W0J G;  1N8R W;  2OCC C;  2DYS C;  3K03 A;  3UM7 A;  2JJ2 G;  1M9N A;  4TSF G;  1YJW V;  1MSW D;  4GCZ A;  2ATK C;  1MG1 A;  4MVU A;  2P90 A;  4XDL A;  1THZ A;  2BOB C;  3FYI B;  4GX2 A;  4PDR A;  4JYB A;  3IC7 A;  4R8C A;  1SER A;  1IXM A;  2HKO A;  3ML0 A;  3SPI A;  2WLK A;  2Y69 C;  4PDV A;  4XBF A;  2QKS A;  3ZRW B;  4JAS A;  5L3D A;  3K9A A;  1GTO A;  4MTO A;  2LP7 A;  4GT1 A;  5KA6 A;  2X7R B;  3SYA A;  2M7W A;  1PD3 A;  2X6B A;  3LSQ A;  5B1A C;  1AJP A;  5LHH A;  3F5W C;  3NXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...