1YTFD

Yeast tfiia/tbp/dna complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
115
structure length
100
Chain Sequence
GYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVESVISVDKLRIVACNSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a yeast TFIIA/TBP/DNA complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*GP*TP*AP*TP*GP*TP*AP*TP*AP*TP*AP*AP*AP*AP*C)-3
total genus 25
structure length 100
sequence length 115
ec nomenclature
pdb deposition date 1996-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
D PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1ytfD01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 1ytfD02
1NH2D 1RM1B 1YTFC 1NH2C 5IYCO 5IYDO 1YTFD 1RM1C 1NVPC 5IYBO 1NVPD
chains in the Genus database with same CATH superfamily
1N4CA 1FJGB 1XREA 2ILMA 1PNMA 1QQCA 3I5DA 5IY5B 5KAIZ 1HNXO 4JI1B 4JI8O 3BRCA 3O65A 2GUZB 3EHBB 2R9AA 1CP9A 1IXMA 5DECA 3TCUA 1BHAA 1S76D 1G1XB 3AK1A 2OCCC 4OXSA 4YJ3B 2FTKA 3HPLC 4JYBA 1XOUA 1VARA 4Z1VA 2L6LA 1SA0B 1Q6UA 1Y74B 2E5LO 1XNQB 2EIJC 3B77A 4IGGA 4I9QA 4QIWF 1RP3B 2P4VA 2Q7EA 4UB8Z 4JPRA 1JCHA 4GX0A 4CH4A 4RUEA 4MVQA 4DO2A 4J9ZB 4WBNB 4I0XB 3DGEA 2CGOA 2H3OA 2Q73A 4FM2A 3OTFA 2Y4TA 1YJNV 2G38A 2IU3A 3T4DA 5CA3A 1MZEA 1L1FA 1G4YB 3IC7A 3SPGA 2UU9O 1KD1W 4TSFG 4UCSA 4E2LA 3IAYA 3OTOB 1VEWA 1N34O 4D7SA 1MG1A 1MMMA 4DW0A 1YTFB 1X59A 3T1CA 3UCSC 3DSQA 1M90W 4LF9O 2Y48A 4NXNO 2CTWA 1KQSU 2LP7A 5FNVB 3B8NA 4J7ZA 2DQ3A 1AJPA 4DV5O 4JI2O 5H6RA 1IXBA 1GM9A 2GTSA 2YEVA 1N0NA 1JJ2U 3LDCA 1K5SA 1DLBA 3SYPA 2AXTZ 3LSUA 1S72V 4RQFA 3M99B 5H5NA 2EX3A 3MHHC 1XEQA 4DR2B 4FLXA 2YICA 2RMKB 3ZHQA 1NJIW 4CH6A 2UXBB 3OT7A 3AG2B 1YVWA 3P3PA 5A9GA 3JAMN 3T1HO 5J2TB 4PELA 1NR7A 2JDIG 3SPCA 2YXYA 2QWOB 4DK0A 2JIZG 3CC2V 4DR4O 4MTFA 1OV9A 1R1BA 1SQBH 3AK2A 5IJ0A 5FNVA 5KUMA 1JQ0A 1JMKC 5CN0A 4AI8A 4X88A 4UB6Z 1GMGA 2DYSC 1VIBA 1HP8A 4TUYB 3AK3A 3BAAA 3F7VC 4MS2A 1B04A 1XNRO 5C8YB 2LGWA 3K58A 1VQOV 1FXKB 1JFFA 1AP5A 2A79B 5BMVA 4MVOA 4R8CA 1JPXA 1EN6A 1NU1H 2XAHA 3JASB 3ABUA 3CCRV 1FPOA 2VQEO 3CE2A 2KB1A 1K4DC 3JD4A 1CEZA 2X6CA 1VQMV 2UXCO 1THZA 4KFMA 4X1IB 4FLUA 3BHPA 3ZEDA 4WF9V 4TWKA 2P7TC 4GX2A 2QTSA 2V4DA 1COWG 2QTOA 3OEEG 4CBCA 2WA3A 2R9RB 1V55C 3K79A 5KHKA 2WLJA 2ZNJA 4CS4A 3CCMV 3ABKC 3X2QC 3JSNA 4TUYA 4HNAA 3LNMB 4TV9A 1PL0A 1JFFB 4DV1B 1B06A 1RM1C 1R3JC 1WP8A 4NB5A 1IBLO 5H2FZ 3ZHTA 2XTAA 3WU2Z 4CZZA 3RBZA 1QLEC 5JJJB 3MAQA 3K03A 2EZOA 4DR6O 1HR0B 2W6IG 3H1JH 5KX5A 1YCIA 2HHHB 5HFLA 2EIKC 2Z3YA 1FXVA 4FVMA 3RW0A 1B3QA 1MA1A 2BOCC 3LSQA 4BIUA 3TXQA 3SPIA 4IIJB 1Q90D 2QE7G 3L9DA 3QO5A 1XI1A 1AI6A 3FYEB 3K9AA 3QTCA 4PDVA 4LF8B 2JS3A 3UKMA 3CXCU 1XBLA 4JI6O 3OE7G 4O2AA 4WFAV 4E4EA 3E83A 3LUTB 3AG3C 4MVMA 3ZX6A 1Q7YW 4RWUA 5B1OA 4HNAB 2YIBA 5H6QA 4B3SO 1M1KW 2EJ7A 3NR7A 4LP8A 2CTRA 2RDCA 4LF5B 1HNWB 2XOKG 1J95A 5LP6C 1VQ4V 5GONA 4LNUB 1CXZB 2E76B 4YJ2A 1ENVA 4KL1A 3B8MA 1YJ9V 1SZXA 1S3JA 3DC6A 5KX5B 4PA4A 3ZHSA 5A2QN 3APOA 3CEIA 4NXMB 4CH3A 3E22B 3FX7A 3ZRWB 5ITZB 4X62O 1ZLZA 5LMNB 4B3TB 1S77D 2DE0X 1GAXA 2HJFC 3PJSK 3IC9A 3U11A 2FKXA 1VF6C 4OX9B 5GW7A 4DV7O 1TGOA 3RYFA 5LXTB 2PYJA 1AR5A 1SS3A 1XMOO 2UXCB 3DXRB 4F6RA 2Q68A 1QNMA 5BY1A 1U96A 3WFVA 5JQGB 4DV6B 1Z5VA 2BOBC 4X66O 1BGYH 4C7UA 2OWOA 5GONB 4LNUA 1EM1A 3SJAC 3IGAC 4JYYA 2FL4A 5IJ9B 4DUZO 3CYOA 4YJ2B 3K5MA 4Q6GA 3JD2A 3RYHB 1K8AW 4LFAB 2DQ0A 3FFQA 1H2MA 2N05A 5BR8O 3AG1C 4CH5A 1JX9A 1OCRC 1KB9F 3E22A 4EKWA 5ITZA 3DC5A 2R9IA 4DV0B 1EFRG 1GN6A 3BPZA 3HKDA 2Y69B 3S3XA 5IYBO 3RYFB 3OAAG 1VQ7V 4EB6A 5BZBA 5LXTA 2UXBO 1RFYA 2LO1A 3RVZA 3K04A 1NT2B 4U7NA 4F6RB 4JI4B 1R3LC 1QCEA 2Y4UA 4DR2O 2UXXA 5DM6V 4DR5B 3G80A 3MDSA 4QPJA 1W0KG 2RQ6A 2F23A 5D5QA 1YJWV 1XHZA 3F5WC 1SQVH 1H2KA 2EBOA 3HKBB 3K59A 1VF7A 4X1YA 1R6NA 4FMTA 3OMIB 1N33B 1WB7A 3CMAV 2BSKB 2Q67A 4ZOLB 2ZIOA 5KMGB 3ABKB 4QNHB 3J80N 1LUWA 5B5EZ 4X8AA 5IYCO 2E74B 3BEHA 3CC7V 1P4RA 4D6TH 4LF4O 4MW8A 3QO8A 2D3OW 1N36B 2RCVA 2V7QG 2KG7A 3ABTA 3ETDA 4I55A 4U3JA 5F2VO 1PPJH 2HP8A 4DR5O 5EC2C 1VP7A 4JYCA 3T1YO 1XUQA 4JI4O 2WLKA 4I9WA 1AJQA 3AG2C 1GM8A 4P2ZA 1GH6A 4MVRA 2KSDA 4O2BB 3OR6C 1SRYA 3ETQA 3G6BA 2Z0AA 4YHHO 3CPWU 4NKGB 1K97A 3HKBA 1K92A 1TUBB 4H13B 1BCCH 4ZIBA 1F4MA 1M4UA 3CS5A 2BSKA 1WN7A 2JJ2G 3E89A 2JJ1G 5BR8B 3OR7C 1VQ6V 3WB0A 3G4SV 4PHZA 2P67A 2E5LB 1GKFA 2Q7HA 4B3RB 1AP6A 1V55B 2KG7B 3OD4A 2DYRB 4X66B 4PA6A 1JVMA 1M56C 1H2NA 3JSLA 3UT5B 1VMGA 3E2EA 3SYQA 3HR0A 1O9GA 3OUFA 4BIZA 4J41A 3QF7A 4JTCB 1GO3F 4DV2B 5KHHA 4B7EA 4JF3A 1VF5B 2AHZA 3KZIZ 4I4TA 2IW5A 2YUAA 4DV7B 3ZHVA 3ETEA 5LOVB 5LMNO 2LW7A 5B1AC 1I94B 4JI1O 4X62B 1HNXB 2ZE5A 5CA1B 2A7WA 4FLVA 2F95B 3F7YC 1T5EA 4MSWC 2CTPA 2ZNIA 2ZM6O 2P06A 4UV8A 4JI0O 4CC6A 1WA8B 2X7RB 1R3KC 5GTHZ 3WG7C 1RSOA 2OTJV 4B3SB 2EJRA 1GTOA 2HFEC 4P9PA 5LHGA 1IURA 4R50A 3CCLV 4FPPA 5EIBC 2UUBO 4JASA 2X0LA 3Q4HA 4K35A 1NKDA 3ASNB 1WP7A 2QKAA 4EEQA 3CRQA 4JI5O 4GYCB 4JYAO 3H1IH 5LL6Y 4IYHA 4YY3O 1K9MW 3RWRD 4ZHQA 1PV0A 3HKEA 4JV5B 1HR0O 2EINB 5IYDO 3THOA 1O9HA 1U97A 3E8GA 1AR1B 3I56V 3U0ZA 4NTWA 4J80A 2D2CB 4H0LB 1HWYA 1RSOB 2IBZH 4ABMA 1ZL8B 3SYAA 5EYPB 4NYKA 1OCZB 1V54C 5LMUO 3VBBA 3CRMA 5CB4B 3KCYA 4WFEA 4HZ3A 4PA9A 1AJNA 4U3FH 1MSWD 3Q4HB 3ZMTA 2YI8A 3TJTA 4KHPO 3ABLB 2CH7A 3JD3A 3TXSA 1KKDA 1VQ5V 5JH7A 4LC1A 5B1BB 2JEXA 3GB7C 4YIPA 1KYOF 4FZ0A 3N2KB 1UPGA 1YDXA 3HKEB 2QA4V 4IYIA 1S5JA 3J81N 4FLYA 1EN4A 3ZMSA 4FM1A 2JGDB 5LA6B 1EZJA 4X9QA 2VQEB 1JR9A 5E1AC 3ZBHA 1YTFD 2HLDG 2W0FC 1HNZB 2PUSA 3WB1A 4X1KA 1AROP 1QLEB 1QBZA 2ZKOA 4W4KA 3K3WA 4QE7A 3K0GA 1XNRB 5CB4A 2ZQMA 2YXLA 3CRCA 3RT3C 3B09A 2ARHA 4DRXA 1R73A 1GM7A 1W0JG 3GWKC 1Q8IA 4J42A 1K5QA 1GK9A 1LR1A 1AI5A 1WJZA 4K3AA 5B1NA 2AZ0A 3FB7C 1GN4A 4RAIA 2Y0IA 4HBNA 1IVSA 2PYLA 2UXDB 4PA7A 5JCOA 5LHHA 4DW1A 2M6YA 1WNSA 2JGDA 2QWPB 1H2GA 2B5UA 4B3MB 3K08A 2WLIA 2GUZA 4MVZA 3JYCA 3LDEA 3K5NA 1NVPD 3FKSG 2Q69A 4OPHA 4YXWG 4PI0A 4X20A 2FYUH 4YJ3A 3CHXA 3SJCC 2KKWA 2ADPA 4JI2B 4KXRA 2XAFA 4UCOA 1VF6A 3DTUB 1L0NH 4IT5A 1SA0A 4NTXA 3B4SA 2WLLB 5LMUB 4F4LA 3L71H 3HKCA 5K1XA 2WA4A 2CUGA 4JAAA 3OTOO 1H2SB 3K06A 1G6UA 2ZR3A 4WFHA 3P32A 4F6EA 3CCEV 2UU9B 2H94A 4I0XA 4BR6A 4B08A 3JALB 2WLIB 3R65A 2CK3G 5EZYB 5KUKA 3OM3B 1PKXA 4FFBB 4FZ1A 2UXNA 2DWDC 3IFXA 1YITV 4QE9A 4DV4B 4X20B 2P22C 4DUYO 3ZJZA 1V9PA 5CBGA 2JEUA 4BW9A 5J2UA 4O4IB 3TK1A 2VWKA 1YI2V 3SYCA 1M56B 1JJOA 2WLLA 1K34A 2UUAO 2PI4A 1KP3A 4NTYA 3SR2C 2QWNB 4UFZA 2BE3A 1MZFA 4B7KA 4GKKO 2ZINA 4UCRA 2YEVB 3CCVV 1KBHA 3T2MA 2PF4E 5EZYA 1YTFC 4JI0B 2LQTA 1SQGA 4AQYO 4MVSA 2GHYA 4DR3B 1LUVA 2HR3A 2Q7GA 4P30A 4K0KB 1ZSPA 4DR1O 4CS3A 3L70H 2ZCEA 4FJCC 2LJ2A 1SZTA 3LDDA 2HKOA 4DR3O 5J2TA 4O4IA 1I7FA 3M7MX 1NH2B 4JI3O 1CPYA 5LP6B 2HJDA 2WLMA 3JAKB 5IJ0B 1DF4A 3JD1A 2QM7A 1M93A 4X65O 4TOIA 3OEHG 4K8XA 3O9OA 2UUAB 4A5UB 2QM8A 5CMUA 2PGGA 5C8YA 3ZMVA 5EBLC 1XL4A 4O4LA 3FAVB 4FLWA 5JWPA 2QSAA 1OCCC 3E8HA 2VQFO 1QR9A 3OMNB 2CDYA 1ZUQA 3JASA 1Q81W 1FD9A 2ZXWC 1H8HG 4X89A 4CS2A 1V54B 2ITDC 2B1IA 3OGIB 3VOUA 4DV4O 3JARB 3VQXA 2MK3A 1F4NA 5LHIA 2F1MA 2HVJC 3P3NA 3K5OA 1FFXA 1VQ8V 3RYIB 4L8JA 5K1PA 4TV8A 1NI8A 4YHHB 1QVFU 3ZHUA 4LFCB 4XDJA 5IY5C 1F7YA 1Z2GA 2YIAA 4O4HB 4I50A 4KP4A 5DEDA 1KMIZ 3SDLA 2OIGA 1TVKB 2QKSA 3T1YB 1NBMG 3E8FA 4OPAA 4PDMA 3ZRVA 1UJWB 1OCRB 2DN9A 4TV9B 3UM7A 1WLEA 1NTMH 2ZXWB 4MTGA 4LF4B 2AGAA 3FAVA 4G2KA 3ABLC 1FAFA 3M8AA 2MW2B 1NTZH 2WLHA 4PV1B 1IX9A 3ZIAG 1AI7A 5CA0B 2CE4A 3BFRA 1FFXB 3RYIA 1I0HA 4PJ0Z 2H8PC 4MTXA 3RGBA 3W7SA 2EULA 2X6AA 4WFBV 2W6JG 3W7UA 3QVNA 4UCUA 1R3IC 4IIJA 5FL7G 2PI5A 2EILB 2QWRB 3WG7B 4I50B 1BZKA 3C3TA 4WFFA 5EK0A 3TETA 3LNNA 4LH6A 4GKJB 4Z2WA 3H1LH 1PNLA 2DWEC 4FLTA 3EXAA 4PDRA 3RYCB 1FXHA 1Q82W 1FYJA 1SQXH 1Y6XA 2NLJC 3OGCC 3L73H 2F43G 4DV3B 4PI2A 4N23A 4CC5A 4LFAO 2BTOA 5CA0A 4DYLA 3K5LA 1QVGU 5KHJA 5L3EA 2IJKA 5J9PC 3K9SA 2Q0OC 3K0DA 4H44B 4YIOA 3AG3B 3BVOA 4UCVA 1HNZO 2EIMB 2Q5ZA 5JVDB 3A0HZ 2CTQA 1WPXA 2LW1A 4WBNA 2GSMB 1PNKA 1SESA 1M57C 3N27A 1NR1A 1QR8A 1KP2A 1UFIA 3RYCA 3JATB 4Z1MG 2OCHA 2OIEA 5C93A 4ZI7A 1ROPA 4KHPB 4NXMO 1AILA 3BY6A 3CWBH 1NH2C 3P30A 4BWAA 4WCEV 2YS8A 1YF2A 5CBHA 3CMEV 3SPHA 2WLNA 3RYHA 1DTOA 3L75H 4J9YB 1TAEA 3L74H 4GCZA 3D3QA 4LF5O 1Q3EA 4UV9A 1XMQB 2P6JA 4JZGA 2P90A 3VQWA 5JVDA 2Q6AA 1N0JA 5FPOA 4FM0A 1GN2A 1MOFA 4LFBB 1IBMB 2XT9A 2F66C 4LCUC 3ZN1A 2QKCA 4HYOA 4XBFA 4EB6B 1HW7A 4MT8A 2E75B 5KHGA 2Z5UA 3FD9A 3JATA 2DW4A 2NR5A 3CXHF 4YY3B 5L3BA 1URFA 2N74A 1YSCA 2XAQA 4J7JA 4H33A 4FIPC 4ZI7B 4JI5B 2HHHO 2QGNA 3PN1A 4BIOA 3AG4B 2YI9A 3U10A 1IZ3A 4TQFA 5B3SB 2WWWA 1IBMO 4LFBO 1SKVA 1IBKO 2EINC 3ZN0A 1R6TA 4ZOLA 5AG2A 3ZMZA 1W59A 4N21A 3RFRA 1AR4A 1XMQO 4J7KA 4O4JB 2XUMA 2OTLV 5KHIA 1YEWA 4DV1O 1FKAO 3UO3A 4JI7O 1Q43A 1ZTEA 1BHBA 3A0RA 1FFTB 1G8MA 2ZM6B 4NVPA 1TA8A 3CC4V 3W7WA 2IJHA 2JK5C 1FXKA 2LFSA 5BMVB 3FB8C 1EZVH 4IHJA 1I5XA 1LNQA 1Y67A 1I94O 2NN4A 2VS0A 4O2BA 5JJNB 1F23A 2E3CA 1BMFG 2VRZA 4X1IA 2DJVA 2ADQB 2K1EA 2DMXA 4W4LA 2GDSA 3B2EE 5JCOC 4DV2O 3SJQC 1ORQC 3BCCH 5TISZ 4PA3A 5L3GA 4UVBA 3BABA 2QM4A 1VQPV 4O4JA 5KLVH 4H37A 1D5NA 2ZE8A 1BL8A 4B3RO 1SERA 5EC1C 3KCXA 1Q6HA 5BXZA 1J5EB 1Q6IA 5IYZA 4R7CA 1YXBA 2IM9A 3CX5F 1AB3A 2ATKC 4JTAB 1K3EA 2JVDA 4IHJB 4DV3O 3QNEA 1QLNA 3VQYA 1I08A 1PM9A 4MVUA 5IT9N 4DR4B 1Q86W 4I4TB 2IH3C 3KKYA 1KC8W 2JS5A 1QHTA 1Y4MA 5B1BC 3WB2A 4X64B 1ZX3A 3JCUZ 2YIDA 5CA1A 2YIBD 1Q5OA 2O57A 2F4VB 4LBEC 4KUMA 1WPBA 5KA5A 2RN9A 1L0LH 3OFNG 2A06H 2HVKC 1N36O 2LGQA 4HAMA 2DOSA 4O2AB 5IYZB 1BQ0A 1PL4A 1VQ9V 2AZ2A 4RQEA 1QU7A 5HFMA 3A0BZ 3CP1A 1KKCA 1N33O 3N2GB 3CCQV 3AEIA 1EN5A 4LH7A 1SQPH 3SPJA 4GLXA 4NXNB 4QGPA 2X6BA 4DXWA 1PP9H 2OCCB 1NZ6A 4I5SA 3E8BA 4G27B 4GT1A 3ZMUA 2F4VO 2FMLA 3GVMA 5B66Z 3ETGA 3ZHRA 4BAYA 3ZRWA 2Y69C 4OGQB 1OZ0A 4X64O 4LFCO 3CJHB 1DK1A 2Q8VA 1AI4A 2PTMA 2EIMC 4XDKA 4DV0O 1X4TA 2WAMA 1D2DA 3AG1B 2GBOA 2R72A 2EIJB 5LYJB 3DXRA 1ZL8A 3JD0A 4EFBA 1P84F 3G67A 5CBFA 1K33A 1R6KA 1VQLV 3SJBC 5JQGA 2VQFB 2F93B 3D8CA 3CSXA 3S3WA 2ZDIA 1HDJA 5EIBD 5GTIZ 3N2GA 2Q0AA 1NVPB 1J5EO 4DUZB 2QDOA 2QEXV 5IJ9A 1KUQA 4AHCA 1WAZA 1L8DA 3D36A 3K57A 1K7DA 1GN3A 1XDCA 3NXSA 4DV6O 4TT3G 5LGUA 3ASNC 2ITCC 2ZE6A 5JH7B 4PD4F 2LFRA 1M57B 2A0LA 1XMOB 2ZT9B 5EBMC 3ABMC 2FB5A 2ZIMA 4UXNA 1E1RG 2IJJA 4JI3B 1K73W 1M5IA 2EIKB 3CJHA 5DN6G 4OX9O 3HKDB 5LA6A 4B3TO 2CGNA 2A9HA 4JI8B 1BQZA 1MNGA 3B40A 5LYJA 4DR1B 3JAWA 3AG4C 3AG7A 4X1KB 4J10A 3H01A 1OJHA 3X2QB 4K0KO 3ZS8C 1FJGO 1DGSA 3FB5C 4AQYB 2W0XA 4BW5A 1BS3A 3CCJV 1P7BA 1SETA 2P4KA 3MD0A 4EFEA 3LSSA 3OUSA 3TGUH 4JI7B 4LWSA 1ZAUA 1PD3A 4DRXB 4X1YB 1NQTA 2V1DA 4XDLA 3SGIA 1HNWO 1H2LA 4GKKB 3GWOA 2YDEA 2AHYA 3A8TA 2VWJA 4AILC 5KMGA 4J11A 3FYIB 1S5HC 3H1KH 5L3DA 4LF7O 1IBKB 2P5OA 1YIJV 3FB6C 1RPRA 4JGSA 4JZ2A 1VQNV 4JI6B 3EVKA 1JOYA 5IWAB 4LF8O 1E79G 1EBOA 4I55B 4U3JB 3SYOA 3W7XA 1S5LZ 1BT8A 3L72H 2IU0A 4DUYB 3ABMB 2BCCH 4FK5C 2XASA 1S0VA 3JAWB 1H8EG 2UUCB 1NVPC 3KG2A 2IJIA 2DYSB 3T4ZA 5D5PA 2XHBA 2Y0PA 1XQ8A 1ZWIC 2QR4A 4DR6B 1KU9A 1B6QA 2R70A 3C90A 4ZBMA 1W2BU 2ZR2A 3CB2A 4LWSB 3G71V 2YC0A 4ICGA 3JCZA 3H1HH 1TUBA 1OCCB 4LR3A 1NS1A 4MW3A 1IBLB 1MSDA 1BSMA 4JAUA 1N8RW 1N32O 5H9CA 4QPKA 4UCTA 2ZE7A 2XNDG 2ODMA 5FPRA 3RVYA 2XAJA 3HKCB 3R66A 3UQ8A 1SQQH 3CCSV 5L3CA 1OCOC 2N04A 4QJFB 1YHQV 3UT5A 3JALA 2NNUA 4FLZA 1A32A 4L87A 5IDJA 4ZKIA 1YZBA 4FFBA 4IL6Z 3CD6V 1Z5WA 4NR1A 3ICXA 2OYQA 4R6ZA 2IH1C 4LF6O 1SF9A 3J7AU 5LOVA 4UUJC 5EBWC 2ZD9A 4GUNA 4B3MO 4P9OA 4FFKA 5J2UB 2OT5A 2ETNA 5KA6A 1P7GA 2UXDO 2JGUA 3H9VA 4DR7B 1K4CC 1RPOA 3CCUV 1F51A 2HEPA 2Q4PA 2Q9LA 1WA8A 2YXHA 4DK1A 5LBQA 1D5AA 1XL6A 2B9ZA 3APQA 3ASOC 2PY5A 4UVAA 2GTAA 1XILA 1BE3H 3HB3B 1NTKH 2M7WA 2WSSG 4U7OA 1E1QG 3ML0A 3T1HB 2DYRC 2HG5C 4DR7O 1OHHG 1JA8A 4GKJO 4GX5A 1IDSA 2BTQB 2B1GA 2RJZA 1Y66A 3EFFK 1OCZC 4LF6B 2EILC 5LGNA 1SC5B 3QG5A 1AVMA 5E79Z 3ZRSA 2CAZC 5LP6A 4ZHQB 2PZSA 3JAKA 3STLC 4G28B 3OW2U 1Y76A 1OCOB 3QO7A 3C3SA 4TQDA 4RUFA 3E35A 1NH2D 3E86A 3BA8A 1US6A 4DV5B 2A3QA 1DF5A 1FS0G 5LGTA 3CRRA 2EZPA 4O4LB 5KAFZ 5EYPA 2KQXA 4LF9B 4D7TA 3UO2A 5FLXN 4WFGA 3VQVA 1N32B 2JRIA 4PDLA 3G6EV 1N34B 1FXKC 4JTDB 1SQFA 4GZRB 4I7ZB 1VQKV 1RM1B 2BTQA 3JARA 1M9NA 2YSUB 4Q20A 2CH7B 4MTOA 3I55V 4JAVA 4TV8B 4UVCA 3STZC 1MABG 1I5YA 1GRJA 2AW9A 4JV5O 4K8ZA 3N2KA 3ZCCA 4O4HA 3F5TA 3BA9A 1Y76B 2UUCO 3ASOB 3OMAB 3W7TA 1TVKA 1H38A 5JJEB 2QJ1A 1XHXA 4JYAB 3ZRXA 1P49A 3D3IA 5IE9A 2K9PA 5IWAO 3CRAA 1XNQO 2UUBB 1TUEB 5B1AB 4LF7B 4GX1A 5B3SC 3MHSC 2WPDG 2XAGA 4RO2A 2GV9A 3A2FA 4X65B 2ZDIC 1KECA 3IJ4A 2C2AA 3RN4A 1WB8A 4ASUG 2L35A 1Y74A 2QWQB 2RNBA 5L3FA 3D36C
chains in the Genus database with same CATH topology
4FMTA 3OMIB 2HR3A 4P30A 3CMAV 1PNMA 2Q67A 5IY5B 1VQ9V 4RQEA 3ABKB 4QNHB 5HFMA 3CP1A 4FJCC 4X8AA 3EHBB 5IYCO 3BEHA 1SZTA 1P4RA 3LDDA 3CCQV 3CC7V 1CP9A 2HKOA 3AEIA 1IXMA 4MW8A 3SPJA 1NH2B 3QO8A 3TCUA 2D3OW 4MVSA 1CPYA 2V7QG 2X6BA 4DXWA 2WLMA 3ABTA 3ETDA 1BHAA 1S76D 2OCCB 1DF4A 4I5SA 3E8BA 3JD1A 2QM7A 5EC2C 4G27B 2OCCC 4GT1A 4OXSA 4JYCA 3ZMUA 3OEHG 2FTKA 2WLKA 4I9WA 1AJQA 3ETGA 3HPLC 3AG2C 4BAYA 1GM8A 4JYBA 2QM8A 2Y69C 3ZRWA 1OZ0A 4P2ZA 5CMUA 4MVRA 3OR6C 1SRYA 3ZMVA 5EBLC 1XL4A 1AI4A 2EIMC 4XDKA 1OCCC 3CPWU 2EIJC 3B77A 1K97A 3E8HA 2WAMA 3AG1B 4QIWF 1QR9A 1K92A 3OMNB 2EIJB 1Q81W 2ZXWC 1H8HG 4X89A 4JPRA 1JCHA 4GX0A 1F4MA 3JD0A 1V54B 2ITDC 2B1IA 2JJ2G 4RUEA 5CBFA 3E89A 4MVQA 4DO2A 1K33A 3VOUA 4J9ZB 2MK3A 1F4NA 1R6KA 2JJ1G 5LHIA 1VQLV 3OR7C 1VQ6V 2HVJC 3DGEA 1VQ8V 2ZDIA 3G4SV 2P67A 1QVFU 1NVPB 1GKFA 1YJNV 2QEXV 4XDJA 5IY5C 1V55B 2IU3A 3T4DA 2DYRB 5CA3A 4PA6A 1JVMA 1M56C 3D36A 1K7DA 3NXSA 1L1FA 1G4YB 3IC7A 3SPGA 4KP4A 1KD1W 4TT3G 5LGUA 4TSFG 4E2LA 3E2EA 3ASNC 2ITCC 3SYQA 2QKSA 3OUFA 1NBMG 4BIZA 3E8FA 2LFRA 1MG1A 1M57B 2A0LA 4JTCB 1YTFB 1GO3F 5EBMC 3ABMC 4PDMA 4JF3A 4UXNA 3T1CA 3ZRVA 1UJWB 1OCRB 2AHZA 1E1RG 2IJJA 1M90W 2IW5A 1K73W 2Y48A 3UM7A 1WLEA 2EIKB 1KQSU 2ZXWB 2LP7A 4MTGA 5DN6G 3ETEA 4G2KA 3ABLC 3B8NA 2A9HA 5B1AC 2DQ3A 1AJPA 5H6RA 2WLHA 1GM9A 3AG4C 2YEVA 3H01A 3X2QB 3ZIAG 3F7YC 1AI7A 1JJ2U 4MSWC 3LDCA 1K5SA 3FB5C 4BW5A 3CCJV 1DLBA 1P7BA 1SETA 4UV8A 3SYPA 3MD0A 2H8PC 3LSSA 1S72V 3OUSA 4MTXA 2X7RB 3W7SA 4WFBV 1R3KC 1PD3A 2X6AA 4RQFA 2W6JG 3W7UA 3M99B 3WG7C 1NQTA 2V1DA 3MHHC 4XDLA 1R3IC 5FL7G 2PI5A 2EILB 3WG7B 2OTJV 3GWOA 4WFFA 2AHYA 2EJRA 1NJIW 1GTOA 5EK0A 2HFEC 3TETA 3FYIB 1S5HC 3AG2B 5L3DA 4P9PA 5LHGA 1PNLA 2DWEC 3FB6C 4R50A 1YIJV 1RPRA 4JGSA 3CCLV 4PDRA 4FPPA 1VQNV 4PELA 1FXHA 4JASA 2X0LA 1Q82W 1NR7A 1JOYA 2JDIG 3SPCA 1NKDA 3ASNB 1E79G 1EBOA 2JIZG 3CC2V 3SYOA 4MTFA 3W7XA 2NLJC 3OGCC 2IU0A 5KUMA 2F43G 1JQ0A 3ABMB 4FK5C 2XASA 5CN0A 4X88A 4N23A 1S0VA 1GMGA 2DYSC 1K9MW 1H8EG 1NVPC 3KG2A 2IJIA 2DYSB 3F7VC 4MS2A 3T4ZA 1VQOV 1ZWIC 2EINB 5IYDO 1QVGU 1B6QA 1FXKB 5L3EA 2A79B 2IJKA 4MVOA 4ZBMA 2ZR2A 5J9PC 1W2BU 3E8GA 3K0DA 3G71V 4R8CA 1JPXA 3AG3B 1AR1B 3I56V 3JCZA 1HWYA 2EIMB 2XAHA 1OCCB 4MW3A 3ABUA 3CCRV 2KB1A 1K4DC 3JD4A 4JAUA 1CEZA 1WPXA 2X6CA 3SYAA 1VQMV 1N8RW 1THZA 4KFMA 1OCZB 1V54C 4QPKA 5H9CA 2GSMB 1PNKA 2XNDG 1SESA 3RVYA 1M57C 3VBBA 4WF9V 4TWKA 2P7TC 4WFEA 2XAJA 1NR1A 1QR8A 4GX2A 4HZ3A 1KP2A 4PA9A 1AJNA 1MSWD 3CCSV 3ZMTA 5L3CA 1OCOC 1COWG 2QTOA 3OEEG 4QJFB 4CBCA 4Z1MG 3ABLB 2R9RB 5C93A 3JD3A 1V55C 3K79A 1ROPA 1YHQV 2WLJA 1KKDA 2NNUA 1VQ5V 3BY6A 4LC1A 5B1BB 3CCMV 1NH2C 3ABKC 4L87A 2JEXA 3P30A 4ZKIA 5IDJA 3GB7C 3X2QC 4WCEV 5CBHA 3CMEV 3SPHA 2WLNA 1DTOA 3CD6V 2QA4V 3LNMB 4J9YB 1PL0A 4R6ZA 3ZMSA 2IH1C 4GCZA 1RM1C 1R3JC 1EZJA 4UUJC 5E1AC 4UV9A 2ZD9A 5EBWC 2P6JA 2P90A 1YTFD 2HLDG 4P9OA 2W0FC 2OT5A 5KA6A 4CZZA 3RBZA 1QLEC 2Q6AA 1AROP 1MOFA 3K03A 1QLEB 1QBZA 2EZOA 1K4CC 4LCUC 1RPOA 3ZN1A 3K3WA 3CCUV 1F51A 2W6IG 4HYOA 4XBFA 4QE7A 3K0GA 2ZQMA 4MT8A 5LBQA 2Z5UA 5HFLA 1XL6A 1R73A 1GM7A 1W0JG 2DW4A 2EIKC 2Z3YA 1FXVA 3RW0A 3ASOC 2BOCC 3LSQA 4UVAA 5L3BA 4BIUA 1YSCA 3SPIA 2XAQA 2QE7G 1K5QA 4H33A 3QO5A 4FIPC 1GK9A 3HB3B 1AI6A 3FYEB 3K9AA 1AI5A 4PDVA 2M7WA 2WSSG 4U7OA 3AG4B 5B1NA 3UKMA 3CXCU 1E1QG 3ML0A 3OE7G 4WFAV 2DYRC 2HG5C 3FB7C 5B3SB 1OHHG 3E83A 3LUTB 2WWWA 3AG3C 4RAIA 4MVMA 1Q7YW 5B1OA 4GX5A 2EINC 4PA7A 3ZN0A 5LHHA 3ZMZA 4N21A 5H6QA 2B1GA 1M1KW 1H2GA 1Y66A 2B5UA 4LP8A 3K08A 2OTLV 2WLIA 2XOKG 3EFFK 1OCZC 1J95A 1VQ4V 4MVZA 3JYCA 3LDEA 2EILC 5LGNA 3ZRSA 1NVPD 3FKSG 2Q69A 1ENVA 1BHBA 3B8MA 3STLC 4YXWG 4G28B 3A0RA 1FFTB 1YJ9V 1G8MA 3OW2U 1S3JA 1OCOB 3CC4V 3W7WA 2IJHA 2JK5C 1FXKA 2LFSA 3QO7A 3FB8C 4PA4A 4RUFA 1I5XA 3E35A 1NH2D 1LNQA 3E86A 1DF5A 3ZRWB 1FS0G 2XAFA 3DTUB 1S77D 5LGTA 1F23A 2EZPA 2HJFC 3PJSK 1BMFG 5GW7A 2K1EA 2WLLB 4F4LA 4WFGA 3SJQC 1ORQC 4PDLA 4PA3A 5L3GA 3G6EV 1FXKC 4JTDB 4UVBA 2Q68A 1VQKV 1RM1B 3K06A 2ZR3A 4WFHA 4Q20A 1M9NA 2YSUB 3P32A 4MTOA 3I55V 3CCEV 4JAVA 1VQPV 3WFVA 2H94A 2WLIB 2BOBC 2CK3G 3R65A 4H37A 4UVCA 5KUKA 3STZC 1BL8A 1MABG 1SERA 5EC1C 1I5YA 3IGAC 3OM3B 1PKXA 3CYOA 4R7CA 3ZCCA 3JD2A 1K8AW 2UXNA 2DQ0A 3ASOB 3OMAB 2DWDC 3W7TA 2ATKC 3IFXA 4JTAB 4QE9A 1K3EA 3AG1C 1YITV 1H38A 1JX9A 3QNEA 3ZJZA 3ZRXA 1QLNA 1OCRC 5CBGA 2JEUA 4EKWA 4MVUA 3D3IA 1Q86W 2R9IA 2IH3C 1EFRG 1KC8W 3TK1A 1Y4MA 1TUEB 1YI2V 5B1AB 5B1BC 3SYCA 2Y69B 5IYBO 1M56B 2WLLA 1K34A 3OAAG 1VQ7V 5BZBA 4GX1A 5B3SC 3MHSC 3K04A 3RVZA 2WPDG 1KP3A 2PI4A 2XAGA 4RO2A 4U7NA 2YEVB 1R3LC 2ZDIC 3CCVV 1QCEA 1KECA 2UXXA 4KUMA 4LBEC 5DM6V 3T2MA 5KA5A 2C2AA 1W0KG 4QPJA 4ASUG 1YJWV 3OFNG 3F5WC 2HVKC 1YTFC 5L3FA 2EBOA 4HAMA 2GHYA 1R6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NH2 D;  1RM1 B;  1YTF C;  1NH2 C;  5IYC O;  5IYD O;  1YTF D;  1RM1 C;  1NVP C;  5IYB O;  1NVP D; 
#chains in the Genus database with same CATH topology
 1N4C A;  1FJG B;  1XRE A;  2ILM A;  1PNM A;  1QQC A;  3I5D A;  5IY5 B;  5KAI Z;  1HNX O;  4JI1 B;  4JI8 O;  3BRC A;  3O65 A;  2GUZ B;  3EHB B;  2R9A A;  1CP9 A;  1IXM A;  5DEC A;  3TCU A;  1BHA A;  1S76 D;  1G1X B;  3AK1 A;  2OCC C;  4OXS A;  4YJ3 B;  2FTK A;  3HPL C;  4JYB A;  1XOU A;  1VAR A;  4Z1V A;  2L6L A;  1SA0 B;  1Q6U A;  1Y74 B;  2E5L O;  1XNQ B;  2EIJ C;  3B77 A;  4IGG A;  4I9Q A;  4QIW F;  1RP3 B;  2P4V A;  2Q7E A;  4UB8 Z;  4JPR A;  1JCH A;  4GX0 A;  4CH4 A;  4RUE A;  4MVQ A;  4DO2 A;  4J9Z B;  4WBN B;  4I0X B;  3DGE A;  2CGO A;  2H3O A;  2Q73 A;  4FM2 A;  3OTF A;  2Y4T A;  1YJN V;  2G38 A;  2IU3 A;  3T4D A;  5CA3 A;  1MZE A;  1L1F A;  1G4Y B;  3IC7 A;  3SPG A;  2UU9 O;  1KD1 W;  4TSF G;  4UCS A;  4E2L A;  3IAY A;  3OTO B;  1VEW A;  1N34 O;  4D7S A;  1MG1 A;  1MMM A;  4DW0 A;  1YTF B;  1X59 A;  3T1C A;  3UCS C;  3DSQ A;  1M90 W;  4LF9 O;  2Y48 A;  4NXN O;  2CTW A;  1KQS U;  2LP7 A;  5FNV B;  3B8N A;  4J7Z A;  2DQ3 A;  1AJP A;  4DV5 O;  4JI2 O;  5H6R A;  1IXB A;  1GM9 A;  2GTS A;  2YEV A;  1N0N A;  1JJ2 U;  3LDC A;  1K5S A;  1DLB A;  3SYP A;  2AXT Z;  3LSU A;  1S72 V;  4RQF A;  3M99 B;  5H5N A;  2EX3 A;  3MHH C;  1XEQ A;  4DR2 B;  4FLX A;  2YIC A;  2RMK B;  3ZHQ A;  1NJI W;  4CH6 A;  2UXB B;  3OT7 A;  3AG2 B;  1YVW A;  3P3P A;  5A9G A;  3JAM N;  3T1H O;  5J2T B;  4PEL A;  1NR7 A;  2JDI G;  3SPC A;  2YXY A;  2QWO B;  4DK0 A;  2JIZ G;  3CC2 V;  4DR4 O;  4MTF A;  1OV9 A;  1R1B A;  1SQB H;  3AK2 A;  5IJ0 A;  5FNV A;  5KUM A;  1JQ0 A;  1JMK C;  5CN0 A;  4AI8 A;  4X88 A;  4UB6 Z;  1GMG A;  2DYS C;  1VIB A;  1HP8 A;  4TUY B;  3AK3 A;  3BAA A;  3F7V C;  4MS2 A;  1B04 A;  1XNR O;  5C8Y B;  2LGW A;  3K58 A;  1VQO V;  1FXK B;  1JFF A;  1AP5 A;  2A79 B;  5BMV A;  4MVO A;  4R8C A;  1JPX A;  1EN6 A;  1NU1 H;  2XAH A;  3JAS B;  3ABU A;  3CCR V;  1FPO A;  2VQE O;  3CE2 A;  2KB1 A;  1K4D C;  3JD4 A;  1CEZ A;  2X6C A;  1VQM V;  2UXC O;  1THZ A;  4KFM A;  4X1I B;  4FLU A;  3BHP A;  3ZED A;  4WF9 V;  4TWK A;  2P7T C;  4GX2 A;  2QTS A;  2V4D A;  1COW G;  2QTO A;  3OEE G;  4CBC A;  2WA3 A;  2R9R B;  1V55 C;  3K79 A;  5KHK A;  2WLJ A;  2ZNJ A;  4CS4 A;  3CCM V;  3ABK C;  3X2Q C;  3JSN A;  4TUY A;  4HNA A;  3LNM B;  4TV9 A;  1PL0 A;  1JFF B;  4DV1 B;  1B06 A;  1RM1 C;  1R3J C;  1WP8 A;  4NB5 A;  1IBL O;  5H2F Z;  3ZHT A;  2XTA A;  3WU2 Z;  4CZZ A;  3RBZ A;  1QLE C;  5JJJ B;  3MAQ A;  3K03 A;  2EZO A;  4DR6 O;  1HR0 B;  2W6I G;  3H1J H;  5KX5 A;  1YCI A;  2HHH B;  5HFL A;  2EIK C;  2Z3Y A;  1FXV A;  4FVM A;  3RW0 A;  1B3Q A;  1MA1 A;  2BOC C;  3LSQ A;  4BIU A;  3TXQ A;  3SPI A;  4IIJ B;  1Q90 D;  2QE7 G;  3L9D A;  3QO5 A;  1XI1 A;  1AI6 A;  3FYE B;  3K9A A;  3QTC A;  4PDV A;  4LF8 B;  2JS3 A;  3UKM A;  3CXC U;  1XBL A;  4JI6 O;  3OE7 G;  4O2A A;  4WFA V;  4E4E A;  3E83 A;  3LUT B;  3AG3 C;  4MVM A;  3ZX6 A;  1Q7Y W;  4RWU A;  5B1O A;  4HNA B;  2YIB A;  5H6Q A;  4B3S O;  1M1K W;  2EJ7 A;  3NR7 A;  4LP8 A;  2CTR A;  2RDC A;  4LF5 B;  1HNW B;  2XOK G;  1J95 A;  5LP6 C;  1VQ4 V;  5GON A;  4LNU B;  1CXZ B;  2E76 B;  4YJ2 A;  1ENV A;  4KL1 A;  3B8M A;  1YJ9 V;  1SZX A;  1S3J A;  3DC6 A;  5KX5 B;  4PA4 A;  3ZHS A;  5A2Q N;  3APO A;  3CEI A;  4NXM B;  4CH3 A;  3E22 B;  3FX7 A;  3ZRW B;  5ITZ B;  4X62 O;  1ZLZ A;  5LMN B;  4B3T B;  1S77 D;  2DE0 X;  1GAX A;  2HJF C;  3PJS K;  3IC9 A;  3U11 A;  2FKX A;  1VF6 C;  4OX9 B;  5GW7 A;  4DV7 O;  1TGO A;  3RYF A;  5LXT B;  2PYJ A;  1AR5 A;  1SS3 A;  1XMO O;  2UXC B;  3DXR B;  4F6R A;  2Q68 A;  1QNM A;  5BY1 A;  1U96 A;  3WFV A;  5JQG B;  4DV6 B;  1Z5V A;  2BOB C;  4X66 O;  1BGY H;  4C7U A;  2OWO A;  5GON B;  4LNU A;  1EM1 A;  3SJA C;  3IGA C;  4JYY A;  2FL4 A;  5IJ9 B;  4DUZ O;  3CYO A;  4YJ2 B;  3K5M A;  4Q6G A;  3JD2 A;  3RYH B;  1K8A W;  4LFA B;  2DQ0 A;  3FFQ A;  1H2M A;  2N05 A;  5BR8 O;  3AG1 C;  4CH5 A;  1JX9 A;  1OCR C;  1KB9 F;  3E22 A;  4EKW A;  5ITZ A;  3DC5 A;  2R9I A;  4DV0 B;  1EFR G;  1GN6 A;  3BPZ A;  3HKD A;  2Y69 B;  3S3X A;  5IYB O;  3RYF B;  3OAA G;  1VQ7 V;  4EB6 A;  5BZB A;  5LXT A;  2UXB O;  1RFY A;  2LO1 A;  3RVZ A;  3K04 A;  1NT2 B;  4U7N A;  4F6R B;  4JI4 B;  1R3L C;  1QCE A;  2Y4U A;  4DR2 O;  2UXX A;  5DM6 V;  4DR5 B;  3G80 A;  3MDS A;  4QPJ A;  1W0K G;  2RQ6 A;  2F23 A;  5D5Q A;  1YJW V;  1XHZ A;  3F5W C;  1SQV H;  1H2K A;  2EBO A;  3HKB B;  3K59 A;  1VF7 A;  4X1Y A;  1R6N A;  4FMT A;  3OMI B;  1N33 B;  1WB7 A;  3CMA V;  2BSK B;  2Q67 A;  4ZOL B;  2ZIO A;  5KMG B;  3ABK B;  4QNH B;  3J80 N;  1LUW A;  5B5E Z;  4X8A A;  5IYC O;  2E74 B;  3BEH A;  3CC7 V;  1P4R A;  4D6T H;  4LF4 O;  4MW8 A;  3QO8 A;  2D3O W;  1N36 B;  2RCV A;  2V7Q G;  2KG7 A;  3ABT A;  3ETD A;  4I55 A;  4U3J A;  5F2V O;  1PPJ H;  2HP8 A;  4DR5 O;  5EC2 C;  1VP7 A;  4JYC A;  3T1Y O;  1XUQ A;  4JI4 O;  2WLK A;  4I9W A;  1AJQ A;  3AG2 C;  1GM8 A;  4P2Z A;  1GH6 A;  4MVR A;  2KSD A;  4O2B B;  3OR6 C;  1SRY A;  3ETQ A;  3G6B A;  2Z0A A;  4YHH O;  3CPW U;  4NKG B;  1K97 A;  3HKB A;  1K92 A;  1TUB B;  4H13 B;  1BCC H;  4ZIB A;  1F4M A;  1M4U A;  3CS5 A;  2BSK A;  1WN7 A;  2JJ2 G;  3E89 A;  2JJ1 G;  5BR8 B;  3OR7 C;  1VQ6 V;  3WB0 A;  3G4S V;  4PHZ A;  2P67 A;  2E5L B;  1GKF A;  2Q7H A;  4B3R B;  1AP6 A;  1V55 B;  2KG7 B;  3OD4 A;  2DYR B;  4X66 B;  4PA6 A;  1JVM A;  1M56 C;  1H2N A;  3JSL A;  3UT5 B;  1VMG A;  3E2E A;  3SYQ A;  3HR0 A;  1O9G A;  3OUF A;  4BIZ A;  4J41 A;  3QF7 A;  4JTC B;  1GO3 F;  4DV2 B;  5KHH A;  4B7E A;  4JF3 A;  1VF5 B;  2AHZ A;  3KZI Z;  4I4T A;  2IW5 A;  2YUA A;  4DV7 B;  3ZHV A;  3ETE A;  5LOV B;  5LMN O;  2LW7 A;  5B1A C;  1I94 B;  4JI1 O;  4X62 B;  1HNX B;  2ZE5 A;  5CA1 B;  2A7W A;  4FLV A;  2F95 B;  3F7Y C;  1T5E A;  4MSW C;  2CTP A;  2ZNI A;  2ZM6 O;  2P06 A;  4UV8 A;  4JI0 O;  4CC6 A;  1WA8 B;  2X7R B;  1R3K C;  5GTH Z;  3WG7 C;  1RSO A;  2OTJ V;  4B3S B;  2EJR A;  1GTO A;  2HFE C;  4P9P A;  5LHG A;  1IUR A;  4R50 A;  3CCL V;  4FPP A;  5EIB C;  2UUB O;  4JAS A;  2X0L A;  3Q4H A;  4K35 A;  1NKD A;  3ASN B;  1WP7 A;  2QKA A;  4EEQ A;  3CRQ A;  4JI5 O;  4GYC B;  4JYA O;  3H1I H;  5LL6 Y;  4IYH A;  4YY3 O;  1K9M W;  3RWR D;  4ZHQ A;  1PV0 A;  3HKE A;  4JV5 B;  1HR0 O;  2EIN B;  5IYD O;  3THO A;  1O9H A;  1U97 A;  3E8G A;  1AR1 B;  3I56 V;  3U0Z A;  4NTW A;  4J80 A;  2D2C B;  4H0L B;  1HWY A;  1RSO B;  2IBZ H;  4ABM A;  1ZL8 B;  3SYA A;  5EYP B;  4NYK A;  1OCZ B;  1V54 C;  5LMU O;  3VBB A;  3CRM A;  5CB4 B;  3KCY A;  4WFE A;  4HZ3 A;  4PA9 A;  1AJN A;  4U3F H;  1MSW D;  3Q4H B;  3ZMT A;  2YI8 A;  3TJT A;  4KHP O;  3ABL B;  2CH7 A;  3JD3 A;  3TXS A;  1KKD A;  1VQ5 V;  5JH7 A;  4LC1 A;  5B1B B;  2JEX A;  3GB7 C;  4YIP A;  1KYO F;  4FZ0 A;  3N2K B;  1UPG A;  1YDX A;  3HKE B;  2QA4 V;  4IYI A;  1S5J A;  3J81 N;  4FLY A;  1EN4 A;  3ZMS A;  4FM1 A;  2JGD B;  5LA6 B;  1EZJ A;  4X9Q A;  2VQE B;  1JR9 A;  5E1A C;  3ZBH A;  1YTF D;  2HLD G;  2W0F C;  1HNZ B;  2PUS A;  3WB1 A;  4X1K A;  1ARO P;  1QLE B;  1QBZ A;  2ZKO A;  4W4K A;  3K3W A;  4QE7 A;  3K0G A;  1XNR B;  5CB4 A;  2ZQM A;  2YXL A;  3CRC A;  3RT3 C;  3B09 A;  2ARH A;  4DRX A;  1R73 A;  1GM7 A;  1W0J G;  3GWK C;  1Q8I A;  4J42 A;  1K5Q A;  1GK9 A;  1LR1 A;  1AI5 A;  1WJZ A;  4K3A A;  5B1N A;  2AZ0 A;  3FB7 C;  1GN4 A;  4RAI A;  2Y0I A;  4HBN A;  1IVS A;  2PYL A;  2UXD B;  4PA7 A;  5JCO A;  5LHH A;  4DW1 A;  2M6Y A;  1WNS A;  2JGD A;  2QWP B;  1H2G A;  2B5U A;  4B3M B;  3K08 A;  2WLI A;  2GUZ A;  4MVZ A;  3JYC A;  3LDE A;  3K5N A;  1NVP D;  3FKS G;  2Q69 A;  4OPH A;  4YXW G;  4PI0 A;  4X20 A;  2FYU H;  4YJ3 A;  3CHX A;  3SJC C;  2KKW A;  2ADP A;  4JI2 B;  4KXR A;  2XAF A;  4UCO A;  1VF6 A;  3DTU B;  1L0N H;  4IT5 A;  1SA0 A;  4NTX A;  3B4S A;  2WLL B;  5LMU B;  4F4L A;  3L71 H;  3HKC A;  5K1X A;  2WA4 A;  2CUG A;  4JAA A;  3OTO O;  1H2S B;  3K06 A;  1G6U A;  2ZR3 A;  4WFH A;  3P32 A;  4F6E A;  3CCE V;  2UU9 B;  2H94 A;  4I0X A;  4BR6 A;  4B08 A;  3JAL B;  2WLI B;  3R65 A;  2CK3 G;  5EZY B;  5KUK A;  3OM3 B;  1PKX A;  4FFB B;  4FZ1 A;  2UXN A;  2DWD C;  3IFX A;  1YIT V;  4QE9 A;  4DV4 B;  4X20 B;  2P22 C;  4DUY O;  3ZJZ A;  1V9P A;  5CBG A;  2JEU A;  4BW9 A;  5J2U A;  4O4I B;  3TK1 A;  2VWK A;  1YI2 V;  3SYC A;  1M56 B;  1JJO A;  2WLL A;  1K34 A;  2UUA O;  2PI4 A;  1KP3 A;  4NTY A;  3SR2 C;  2QWN B;  4UFZ A;  2BE3 A;  1MZF A;  4B7K A;  4GKK O;  2ZIN A;  4UCR A;  2YEV B;  3CCV V;  1KBH A;  3T2M A;  2PF4 E;  5EZY A;  1YTF C;  4JI0 B;  2LQT A;  1SQG A;  4AQY O;  4MVS A;  2GHY A;  4DR3 B;  1LUV A;  2HR3 A;  2Q7G A;  4P30 A;  4K0K B;  1ZSP A;  4DR1 O;  4CS3 A;  3L70 H;  2ZCE A;  4FJC C;  2LJ2 A;  1SZT A;  3LDD A;  2HKO A;  4DR3 O;  5J2T A;  4O4I A;  1I7F A;  3M7M X;  1NH2 B;  4JI3 O;  1CPY A;  5LP6 B;  2HJD A;  2WLM A;  3JAK B;  5IJ0 B;  1DF4 A;  3JD1 A;  2QM7 A;  1M93 A;  4X65 O;  4TOI A;  3OEH G;  4K8X A;  3O9O A;  2UUA B;  4A5U B;  2QM8 A;  5CMU A;  2PGG A;  5C8Y A;  3ZMV A;  5EBL C;  1XL4 A;  4O4L A;  3FAV B;  4FLW A;  5JWP A;  2QSA A;  1OCC C;  3E8H A;  2VQF O;  1QR9 A;  3OMN B;  2CDY A;  1ZUQ A;  3JAS A;  1Q81 W;  1FD9 A;  2ZXW C;  1H8H G;  4X89 A;  4CS2 A;  1V54 B;  2ITD C;  2B1I A;  3OGI B;  3VOU A;  4DV4 O;  3JAR B;  3VQX A;  2MK3 A;  1F4N A;  5LHI A;  2F1M A;  2HVJ C;  3P3N A;  3K5O A;  1FFX A;  1VQ8 V;  3RYI B;  4L8J A;  5K1P A;  4TV8 A;  1NI8 A;  4YHH B;  1QVF U;  3ZHU A;  4LFC B;  4XDJ A;  5IY5 C;  1F7Y A;  1Z2G A;  2YIA A;  4O4H B;  4I50 A;  4KP4 A;  5DED A;  1KMI Z;  3SDL A;  2OIG A;  1TVK B;  2QKS A;  3T1Y B;  1NBM G;  3E8F A;  4OPA A;  4PDM A;  3ZRV A;  1UJW B;  1OCR B;  2DN9 A;  4TV9 B;  3UM7 A;  1WLE A;  1NTM H;  2ZXW B;  4MTG A;  4LF4 B;  2AGA A;  3FAV A;  4G2K A;  3ABL C;  1FAF A;  3M8A A;  2MW2 B;  1NTZ H;  2WLH A;  4PV1 B;  1IX9 A;  3ZIA G;  1AI7 A;  5CA0 B;  2CE4 A;  3BFR A;  1FFX B;  3RYI A;  1I0H A;  4PJ0 Z;  2H8P C;  4MTX A;  3RGB A;  3W7S A;  2EUL A;  2X6A A;  4WFB V;  2W6J G;  3W7U A;  3QVN A;  4UCU A;  1R3I C;  4IIJ A;  5FL7 G;  2PI5 A;  2EIL B;  2QWR B;  3WG7 B;  4I50 B;  1BZK A;  3C3T A;  4WFF A;  5EK0 A;  3TET A;  3LNN A;  4LH6 A;  4GKJ B;  4Z2W A;  3H1L H;  1PNL A;  2DWE C;  4FLT A;  3EXA A;  4PDR A;  3RYC B;  1FXH A;  1Q82 W;  1FYJ A;  1SQX H;  1Y6X A;  2NLJ C;  3OGC C;  3L73 H;  2F43 G;  4DV3 B;  4PI2 A;  4N23 A;  4CC5 A;  4LFA O;  2BTO A;  5CA0 A;  4DYL A;  3K5L A;  1QVG U;  5KHJ A;  5L3E A;  2IJK A;  5J9P C;  3K9S A;  2Q0O C;  3K0D A;  4H44 B;  4YIO A;  3AG3 B;  3BVO A;  4UCV A;  1HNZ O;  2EIM B;  2Q5Z A;  5JVD B;  3A0H Z;  2CTQ A;  1WPX A;  2LW1 A;  4WBN A;  2GSM B;  1PNK A;  1SES A;  1M57 C;  3N27 A;  1NR1 A;  1QR8 A;  1KP2 A;  1UFI A;  3RYC A;  3JAT B;  4Z1M G;  2OCH A;  2OIE A;  5C93 A;  4ZI7 A;  1ROP A;  4KHP B;  4NXM O;  1AIL A;  3BY6 A;  3CWB H;  1NH2 C;  3P30 A;  4BWA A;  4WCE V;  2YS8 A;  1YF2 A;  5CBH A;  3CME V;  3SPH A;  2WLN A;  3RYH A;  1DTO A;  3L75 H;  4J9Y B;  1TAE A;  3L74 H;  4GCZ A;  3D3Q A;  4LF5 O;  1Q3E A;  4UV9 A;  1XMQ B;  2P6J A;  4JZG A;  2P90 A;  3VQW A;  5JVD A;  2Q6A A;  1N0J A;  5FPO A;  4FM0 A;  1GN2 A;  1MOF A;  4LFB B;  1IBM B;  2XT9 A;  2F66 C;  4LCU C;  3ZN1 A;  2QKC A;  4HYO A;  4XBF A;  4EB6 B;  1HW7 A;  4MT8 A;  2E75 B;  5KHG A;  2Z5U A;  3FD9 A;  3JAT A;  2DW4 A;  2NR5 A;  3CXH F;  4YY3 B;  5L3B A;  1URF A;  2N74 A;  1YSC A;  2XAQ A;  4J7J A;  4H33 A;  4FIP C;  4ZI7 B;  4JI5 B;  2HHH O;  2QGN A;  3PN1 A;  4BIO A;  3AG4 B;  2YI9 A;  3U10 A;  1IZ3 A;  4TQF A;  5B3S B;  2WWW A;  1IBM O;  4LFB O;  1SKV A;  1IBK O;  2EIN C;  3ZN0 A;  1R6T A;  4ZOL A;  5AG2 A;  3ZMZ A;  1W59 A;  4N21 A;  3RFR A;  1AR4 A;  1XMQ O;  4J7K A;  4O4J B;  2XUM A;  2OTL V;  5KHI A;  1YEW A;  4DV1 O;  1FKA O;  3UO3 A;  4JI7 O;  1Q43 A;  1ZTE A;  1BHB A;  3A0R A;  1FFT B;  1G8M A;  2ZM6 B;  4NVP A;  1TA8 A;  3CC4 V;  3W7W A;  2IJH A;  2JK5 C;  1FXK A;  2LFS A;  5BMV B;  3FB8 C;  1EZV H;  4IHJ A;  1I5X A;  1LNQ A;  1Y67 A;  1I94 O;  2NN4 A;  2VS0 A;  4O2B A;  5JJN B;  1F23 A;  2E3C A;  1BMF G;  2VRZ A;  4X1I A;  2DJV A;  2ADQ B;  2K1E A;  2DMX A;  4W4L A;  2GDS A;  3B2E E;  5JCO C;  4DV2 O;  3SJQ C;  1ORQ C;  3BCC H;  5TIS Z;  4PA3 A;  5L3G A;  4UVB A;  3BAB A;  2QM4 A;  1VQP V;  4O4J A;  5KLV H;  4H37 A;  1D5N A;  2ZE8 A;  1BL8 A;  4B3R O;  1SER A;  5EC1 C;  3KCX A;  1Q6H A;  5BXZ A;  1J5E B;  1Q6I A;  5IYZ A;  4R7C A;  1YXB A;  2IM9 A;  3CX5 F;  1AB3 A;  2ATK C;  4JTA B;  1K3E A;  2JVD A;  4IHJ B;  4DV3 O;  3QNE A;  1QLN A;  3VQY A;  1I08 A;  1PM9 A;  4MVU A;  5IT9 N;  4DR4 B;  1Q86 W;  4I4T B;  2IH3 C;  3KKY A;  1KC8 W;  2JS5 A;  1QHT A;  1Y4M A;  5B1B C;  3WB2 A;  4X64 B;  1ZX3 A;  3JCU Z;  2YID A;  5CA1 A;  2YIB D;  1Q5O A;  2O57 A;  2F4V B;  4LBE C;  4KUM A;  1WPB A;  5KA5 A;  2RN9 A;  1L0L H;  3OFN G;  2A06 H;  2HVK C;  1N36 O;  2LGQ A;  4HAM A;  2DOS A;  4O2A B;  5IYZ B;  1BQ0 A;  1PL4 A;  1VQ9 V;  2AZ2 A;  4RQE A;  1QU7 A;  5HFM A;  3A0B Z;  3CP1 A;  1KKC A;  1N33 O;  3N2G B;  3CCQ V;  3AEI A;  1EN5 A;  4LH7 A;  1SQP H;  3SPJ A;  4GLX A;  4NXN B;  4QGP A;  2X6B A;  4DXW A;  1PP9 H;  2OCC B;  1NZ6 A;  4I5S A;  3E8B A;  4G27 B;  4GT1 A;  3ZMU A;  2F4V O;  2FML A;  3GVM A;  5B66 Z;  3ETG A;  3ZHR A;  4BAY A;  3ZRW A;  2Y69 C;  4OGQ B;  1OZ0 A;  4X64 O;  4LFC O;  3CJH B;  1DK1 A;  2Q8V A;  1AI4 A;  2PTM A;  2EIM C;  4XDK A;  4DV0 O;  1X4T A;  2WAM A;  1D2D A;  3AG1 B;  2GBO A;  2R72 A;  2EIJ B;  5LYJ B;  3DXR A;  1ZL8 A;  3JD0 A;  4EFB A;  1P84 F;  3G67 A;  5CBF A;  1K33 A;  1R6K A;  1VQL V;  3SJB C;  5JQG A;  2VQF B;  2F93 B;  3D8C A;  3CSX A;  3S3W A;  2ZDI A;  1HDJ A;  5EIB D;  5GTI Z;  3N2G A;  2Q0A A;  1NVP B;  1J5E O;  4DUZ B;  2QDO A;  2QEX V;  5IJ9 A;  1KUQ A;  4AHC A;  1WAZ A;  1L8D A;  3D36 A;  3K57 A;  1K7D A;  1GN3 A;  1XDC A;  3NXS A;  4DV6 O;  4TT3 G;  5LGU A;  3ASN C;  2ITC C;  2ZE6 A;  5JH7 B;  4PD4 F;  2LFR A;  1M57 B;  2A0L A;  1XMO B;  2ZT9 B;  5EBM C;  3ABM C;  2FB5 A;  2ZIM A;  4UXN A;  1E1R G;  2IJJ A;  4JI3 B;  1K73 W;  1M5I A;  2EIK B;  3CJH A;  5DN6 G;  4OX9 O;  3HKD B;  5LA6 A;  4B3T O;  2CGN A;  2A9H A;  4JI8 B;  1BQZ A;  1MNG A;  3B40 A;  5LYJ A;  4DR1 B;  3JAW A;  3AG4 C;  3AG7 A;  4X1K B;  4J10 A;  3H01 A;  1OJH A;  3X2Q B;  4K0K O;  3ZS8 C;  1FJG O;  1DGS A;  3FB5 C;  4AQY B;  2W0X A;  4BW5 A;  1BS3 A;  3CCJ V;  1P7B A;  1SET A;  2P4K A;  3MD0 A;  4EFE A;  3LSS A;  3OUS A;  3TGU H;  4JI7 B;  4LWS A;  1ZAU A;  1PD3 A;  4DRX B;  4X1Y B;  1NQT A;  2V1D A;  4XDL A;  3SGI A;  1HNW O;  1H2L A;  4GKK B;  3GWO A;  2YDE A;  2AHY A;  3A8T A;  2VWJ A;  4AIL C;  5KMG A;  4J11 A;  3FYI B;  1S5H C;  3H1K H;  5L3D A;  4LF7 O;  1IBK B;  2P5O A;  1YIJ V;  3FB6 C;  1RPR A;  4JGS A;  4JZ2 A;  1VQN V;  4JI6 B;  3EVK A;  1JOY A;  5IWA B;  4LF8 O;  1E79 G;  1EBO A;  4I55 B;  4U3J B;  3SYO A;  3W7X A;  1S5L Z;  1BT8 A;  3L72 H;  2IU0 A;  4DUY B;  3ABM B;  2BCC H;  4FK5 C;  2XAS A;  1S0V A;  3JAW B;  1H8E G;  2UUC B;  1NVP C;  3KG2 A;  2IJI A;  2DYS B;  3T4Z A;  5D5P A;  2XHB A;  2Y0P A;  1XQ8 A;  1ZWI C;  2QR4 A;  4DR6 B;  1KU9 A;  1B6Q A;  2R70 A;  3C90 A;  4ZBM A;  1W2B U;  2ZR2 A;  3CB2 A;  4LWS B;  3G71 V;  2YC0 A;  4ICG A;  3JCZ A;  3H1H H;  1TUB A;  1OCC B;  4LR3 A;  1NS1 A;  4MW3 A;  1IBL B;  1MSD A;  1BSM A;  4JAU A;  1N8R W;  1N32 O;  5H9C A;  4QPK A;  4UCT A;  2ZE7 A;  2XND G;  2ODM A;  5FPR A;  3RVY A;  2XAJ A;  3HKC B;  3R66 A;  3UQ8 A;  1SQQ H;  3CCS V;  5L3C A;  1OCO C;  2N04 A;  4QJF B;  1YHQ V;  3UT5 A;  3JAL A;  2NNU A;  4FLZ A;  1A32 A;  4L87 A;  5IDJ A;  4ZKI A;  1YZB A;  4FFB A;  4IL6 Z;  3CD6 V;  1Z5W A;  4NR1 A;  3ICX A;  2OYQ A;  4R6Z A;  2IH1 C;  4LF6 O;  1SF9 A;  3J7A U;  5LOV A;  4UUJ C;  5EBW C;  2ZD9 A;  4GUN A;  4B3M O;  4P9O A;  4FFK A;  5J2U B;  2OT5 A;  2ETN A;  5KA6 A;  1P7G A;  2UXD O;  2JGU A;  3H9V A;  4DR7 B;  1K4C C;  1RPO A;  3CCU V;  1F51 A;  2HEP A;  2Q4P A;  2Q9L A;  1WA8 A;  2YXH A;  4DK1 A;  5LBQ A;  1D5A A;  1XL6 A;  2B9Z A;  3APQ A;  3ASO C;  2PY5 A;  4UVA A;  2GTA A;  1XIL A;  1BE3 H;  3HB3 B;  1NTK H;  2M7W A;  2WSS G;  4U7O A;  1E1Q G;  3ML0 A;  3T1H B;  2DYR C;  2HG5 C;  4DR7 O;  1OHH G;  1JA8 A;  4GKJ O;  4GX5 A;  1IDS A;  2BTQ B;  2B1G A;  2RJZ A;  1Y66 A;  3EFF K;  1OCZ C;  4LF6 B;  2EIL C;  5LGN A;  1SC5 B;  3QG5 A;  1AVM A;  5E79 Z;  3ZRS A;  2CAZ C;  5LP6 A;  4ZHQ B;  2PZS A;  3JAK A;  3STL C;  4G28 B;  3OW2 U;  1Y76 A;  1OCO B;  3QO7 A;  3C3S A;  4TQD A;  4RUF A;  3E35 A;  1NH2 D;  3E86 A;  3BA8 A;  1US6 A;  4DV5 B;  2A3Q A;  1DF5 A;  1FS0 G;  5LGT A;  3CRR A;  2EZP A;  4O4L B;  5KAF Z;  5EYP A;  2KQX A;  4LF9 B;  4D7T A;  3UO2 A;  5FLX N;  4WFG A;  3VQV A;  1N32 B;  2JRI A;  4PDL A;  3G6E V;  1N34 B;  1FXK C;  4JTD B;  1SQF A;  4GZR B;  4I7Z B;  1VQK V;  1RM1 B;  2BTQ A;  3JAR A;  1M9N A;  2YSU B;  4Q20 A;  2CH7 B;  4MTO A;  3I55 V;  4JAV A;  4TV8 B;  4UVC A;  3STZ C;  1MAB G;  1I5Y A;  1GRJ A;  2AW9 A;  4JV5 O;  4K8Z A;  3N2K A;  3ZCC A;  4O4H A;  3F5T A;  3BA9 A;  1Y76 B;  2UUC O;  3ASO B;  3OMA B;  3W7T A;  1TVK A;  1H38 A;  5JJE B;  2QJ1 A;  1XHX A;  4JYA B;  3ZRX A;  1P49 A;  3D3I A;  5IE9 A;  2K9P A;  5IWA O;  3CRA A;  1XNQ O;  2UUB B;  1TUE B;  5B1A B;  4LF7 B;  4GX1 A;  5B3S C;  3MHS C;  2WPD G;  2XAG A;  4RO2 A;  2GV9 A;  3A2F A;  4X65 B;  2ZDI C;  1KEC A;  3IJ4 A;  2C2A A;  3RN4 A;  1WB8 A;  4ASU G;  2L35 A;  1Y74 A;  2QWQ B;  2RNB A;  5L3F A;  3D36 C; 
#chains in the Genus database with same CATH homology
 4FMT A;  3OMI B;  2HR3 A;  4P30 A;  3CMA V;  1PNM A;  2Q67 A;  5IY5 B;  1VQ9 V;  4RQE A;  3ABK B;  4QNH B;  5HFM A;  3CP1 A;  4FJC C;  4X8A A;  3EHB B;  5IYC O;  3BEH A;  1SZT A;  1P4R A;  3LDD A;  3CCQ V;  3CC7 V;  1CP9 A;  2HKO A;  3AEI A;  1IXM A;  4MW8 A;  3SPJ A;  1NH2 B;  3QO8 A;  3TCU A;  2D3O W;  4MVS A;  1CPY A;  2V7Q G;  2X6B A;  4DXW A;  2WLM A;  3ABT A;  3ETD A;  1BHA A;  1S76 D;  2OCC B;  1DF4 A;  4I5S A;  3E8B A;  3JD1 A;  2QM7 A;  5EC2 C;  4G27 B;  2OCC C;  4GT1 A;  4OXS A;  4JYC A;  3ZMU A;  3OEH G;  2FTK A;  2WLK A;  4I9W A;  1AJQ A;  3ETG A;  3HPL C;  3AG2 C;  4BAY A;  1GM8 A;  4JYB A;  2QM8 A;  2Y69 C;  3ZRW A;  1OZ0 A;  4P2Z A;  5CMU A;  4MVR A;  3OR6 C;  1SRY A;  3ZMV A;  5EBL C;  1XL4 A;  1AI4 A;  2EIM C;  4XDK A;  1OCC C;  3CPW U;  2EIJ C;  3B77 A;  1K97 A;  3E8H A;  2WAM A;  3AG1 B;  4QIW F;  1QR9 A;  1K92 A;  3OMN B;  2EIJ B;  1Q81 W;  2ZXW C;  1H8H G;  4X89 A;  4JPR A;  1JCH A;  4GX0 A;  1F4M A;  3JD0 A;  1V54 B;  2ITD C;  2B1I A;  2JJ2 G;  4RUE A;  5CBF A;  3E89 A;  4MVQ A;  4DO2 A;  1K33 A;  3VOU A;  4J9Z B;  2MK3 A;  1F4N A;  1R6K A;  2JJ1 G;  5LHI A;  1VQL V;  3OR7 C;  1VQ6 V;  2HVJ C;  3DGE A;  1VQ8 V;  2ZDI A;  3G4S V;  2P67 A;  1QVF U;  1NVP B;  1GKF A;  1YJN V;  2QEX V;  4XDJ A;  5IY5 C;  1V55 B;  2IU3 A;  3T4D A;  2DYR B;  5CA3 A;  4PA6 A;  1JVM A;  1M56 C;  3D36 A;  1K7D A;  3NXS A;  1L1F A;  1G4Y B;  3IC7 A;  3SPG A;  4KP4 A;  1KD1 W;  4TT3 G;  5LGU A;  4TSF G;  4E2L A;  3E2E A;  3ASN C;  2ITC C;  3SYQ A;  2QKS A;  3OUF A;  1NBM G;  4BIZ A;  3E8F A;  2LFR A;  1MG1 A;  1M57 B;  2A0L A;  4JTC B;  1YTF B;  1GO3 F;  5EBM C;  3ABM C;  4PDM A;  4JF3 A;  4UXN A;  3T1C A;  3ZRV A;  1UJW B;  1OCR B;  2AHZ A;  1E1R G;  2IJJ A;  1M90 W;  2IW5 A;  1K73 W;  2Y48 A;  3UM7 A;  1WLE A;  2EIK B;  1KQS U;  2ZXW B;  2LP7 A;  4MTG A;  5DN6 G;  3ETE A;  4G2K A;  3ABL C;  3B8N A;  2A9H A;  5B1A C;  2DQ3 A;  1AJP A;  5H6R A;  2WLH A;  1GM9 A;  3AG4 C;  2YEV A;  3H01 A;  3X2Q B;  3ZIA G;  3F7Y C;  1AI7 A;  1JJ2 U;  4MSW C;  3LDC A;  1K5S A;  3FB5 C;  4BW5 A;  3CCJ V;  1DLB A;  1P7B A;  1SET A;  4UV8 A;  3SYP A;  3MD0 A;  2H8P C;  3LSS A;  1S72 V;  3OUS A;  4MTX A;  2X7R B;  3W7S A;  4WFB V;  1R3K C;  1PD3 A;  2X6A A;  4RQF A;  2W6J G;  3W7U A;  3M99 B;  3WG7 C;  1NQT A;  2V1D A;  3MHH C;  4XDL A;  1R3I C;  5FL7 G;  2PI5 A;  2EIL B;  3WG7 B;  2OTJ V;  3GWO A;  4WFF A;  2AHY A;  2EJR A;  1NJI W;  1GTO A;  5EK0 A;  2HFE C;  3TET A;  3FYI B;  1S5H C;  3AG2 B;  5L3D A;  4P9P A;  5LHG A;  1PNL A;  2DWE C;  3FB6 C;  4R50 A;  1YIJ V;  1RPR A;  4JGS A;  3CCL V;  4PDR A;  4FPP A;  1VQN V;  4PEL A;  1FXH A;  4JAS A;  2X0L A;  1Q82 W;  1NR7 A;  1JOY A;  2JDI G;  3SPC A;  1NKD A;  3ASN B;  1E79 G;  1EBO A;  2JIZ G;  3CC2 V;  3SYO A;  4MTF A;  3W7X A;  2NLJ C;  3OGC C;  2IU0 A;  5KUM A;  2F43 G;  1JQ0 A;  3ABM B;  4FK5 C;  2XAS A;  5CN0 A;  4X88 A;  4N23 A;  1S0V A;  1GMG A;  2DYS C;  1K9M W;  1H8E G;  1NVP C;  3KG2 A;  2IJI A;  2DYS B;  3F7V C;  4MS2 A;  3T4Z A;  1VQO V;  1ZWI C;  2EIN B;  5IYD O;  1QVG U;  1B6Q A;  1FXK B;  5L3E A;  2A79 B;  2IJK A;  4MVO A;  4ZBM A;  2ZR2 A;  5J9P C;  1W2B U;  3E8G A;  3K0D A;  3G71 V;  4R8C A;  1JPX A;  3AG3 B;  1AR1 B;  3I56 V;  3JCZ A;  1HWY A;  2EIM B;  2XAH A;  1OCC B;  4MW3 A;  3ABU A;  3CCR V;  2KB1 A;  1K4D C;  3JD4 A;  4JAU A;  1CEZ A;  1WPX A;  2X6C A;  3SYA A;  1VQM V;  1N8R W;  1THZ A;  4KFM A;  1OCZ B;  1V54 C;  4QPK A;  5H9C A;  2GSM B;  1PNK A;  2XND G;  1SES A;  3RVY A;  1M57 C;  3VBB A;  4WF9 V;  4TWK A;  2P7T C;  4WFE A;  2XAJ A;  1NR1 A;  1QR8 A;  4GX2 A;  4HZ3 A;  1KP2 A;  4PA9 A;  1AJN A;  1MSW D;  3CCS V;  3ZMT A;  5L3C A;  1OCO C;  1COW G;  2QTO A;  3OEE G;  4QJF B;  4CBC A;  4Z1M G;  3ABL B;  2R9R B;  5C93 A;  3JD3 A;  1V55 C;  3K79 A;  1ROP A;  1YHQ V;  2WLJ A;  1KKD A;  2NNU A;  1VQ5 V;  3BY6 A;  4LC1 A;  5B1B B;  3CCM V;  1NH2 C;  3ABK C;  4L87 A;  2JEX A;  3P30 A;  4ZKI A;  5IDJ A;  3GB7 C;  3X2Q C;  4WCE V;  5CBH A;  3CME V;  3SPH A;  2WLN A;  1DTO A;  3CD6 V;  2QA4 V;  3LNM B;  4J9Y B;  1PL0 A;  4R6Z A;  3ZMS A;  2IH1 C;  4GCZ A;  1RM1 C;  1R3J C;  1EZJ A;  4UUJ C;  5E1A C;  4UV9 A;  2ZD9 A;  5EBW C;  2P6J A;  2P90 A;  1YTF D;  2HLD G;  4P9O A;  2W0F C;  2OT5 A;  5KA6 A;  4CZZ A;  3RBZ A;  1QLE C;  2Q6A A;  1ARO P;  1MOF A;  3K03 A;  1QLE B;  1QBZ A;  2EZO A;  1K4C C;  4LCU C;  1RPO A;  3ZN1 A;  3K3W A;  3CCU V;  1F51 A;  2W6I G;  4HYO A;  4XBF A;  4QE7 A;  3K0G A;  2ZQM A;  4MT8 A;  5LBQ A;  2Z5U A;  5HFL A;  1XL6 A;  1R73 A;  1GM7 A;  1W0J G;  2DW4 A;  2EIK C;  2Z3Y A;  1FXV A;  3RW0 A;  3ASO C;  2BOC C;  3LSQ A;  4UVA A;  5L3B A;  4BIU A;  1YSC A;  3SPI A;  2XAQ A;  2QE7 G;  1K5Q A;  4H33 A;  3QO5 A;  4FIP C;  1GK9 A;  3HB3 B;  1AI6 A;  3FYE B;  3K9A A;  1AI5 A;  4PDV A;  2M7W A;  2WSS G;  4U7O A;  3AG4 B;  5B1N A;  3UKM A;  3CXC U;  1E1Q G;  3ML0 A;  3OE7 G;  4WFA V;  2DYR C;  2HG5 C;  3FB7 C;  5B3S B;  1OHH G;  3E83 A;  3LUT B;  2WWW A;  3AG3 C;  4RAI A;  4MVM A;  1Q7Y W;  5B1O A;  4GX5 A;  2EIN C;  4PA7 A;  3ZN0 A;  5LHH A;  3ZMZ A;  4N21 A;  5H6Q A;  2B1G A;  1M1K W;  1H2G A;  1Y66 A;  2B5U A;  4LP8 A;  3K08 A;  2OTL V;  2WLI A;  2XOK G;  3EFF K;  1OCZ C;  1J95 A;  1VQ4 V;  4MVZ A;  3JYC A;  3LDE A;  2EIL C;  5LGN A;  3ZRS A;  1NVP D;  3FKS G;  2Q69 A;  1ENV A;  1BHB A;  3B8M A;  3STL C;  4YXW G;  4G28 B;  3A0R A;  1FFT B;  1YJ9 V;  1G8M A;  3OW2 U;  1S3J A;  1OCO B;  3CC4 V;  3W7W A;  2IJH A;  2JK5 C;  1FXK A;  2LFS A;  3QO7 A;  3FB8 C;  4PA4 A;  4RUF A;  1I5X A;  3E35 A;  1NH2 D;  1LNQ A;  3E86 A;  1DF5 A;  3ZRW B;  1FS0 G;  2XAF A;  3DTU B;  1S77 D;  5LGT A;  1F23 A;  2EZP A;  2HJF C;  3PJS K;  1BMF G;  5GW7 A;  2K1E A;  2WLL B;  4F4L A;  4WFG A;  3SJQ C;  1ORQ C;  4PDL A;  4PA3 A;  5L3G A;  3G6E V;  1FXK C;  4JTD B;  4UVB A;  2Q68 A;  1VQK V;  1RM1 B;  3K06 A;  2ZR3 A;  4WFH A;  4Q20 A;  1M9N A;  2YSU B;  3P32 A;  4MTO A;  3I55 V;  3CCE V;  4JAV A;  1VQP V;  3WFV A;  2H94 A;  2WLI B;  2BOB C;  2CK3 G;  3R65 A;  4H37 A;  4UVC A;  5KUK A;  3STZ C;  1BL8 A;  1MAB G;  1SER A;  5EC1 C;  1I5Y A;  3IGA C;  3OM3 B;  1PKX A;  3CYO A;  4R7C A;  3ZCC A;  3JD2 A;  1K8A W;  2UXN A;  2DQ0 A;  3ASO B;  3OMA B;  2DWD C;  3W7T A;  2ATK C;  3IFX A;  4JTA B;  4QE9 A;  1K3E A;  3AG1 C;  1YIT V;  1H38 A;  1JX9 A;  3QNE A;  3ZJZ A;  3ZRX A;  1QLN A;  1OCR C;  5CBG A;  2JEU A;  4EKW A;  4MVU A;  3D3I A;  1Q86 W;  2R9I A;  2IH3 C;  1EFR G;  1KC8 W;  3TK1 A;  1Y4M A;  1TUE B;  1YI2 V;  5B1A B;  5B1B C;  3SYC A;  2Y69 B;  5IYB O;  1M56 B;  2WLL A;  1K34 A;  3OAA G;  1VQ7 V;  5BZB A;  4GX1 A;  5B3S C;  3MHS C;  3K04 A;  3RVZ A;  2WPD G;  1KP3 A;  2PI4 A;  2XAG A;  4RO2 A;  4U7N A;  2YEV B;  1R3L C;  2ZDI C;  3CCV V;  1QCE A;  1KEC A;  2UXX A;  4KUM A;  4LBE C;  5DM6 V;  3T2M A;  5KA5 A;  2C2A A;  1W0K G;  4QPJ A;  4ASU G;  1YJW V;  3OFN G;  3F5W C;  2HVK C;  1YTF C;  5L3F A;  2EBO A;  4HAM A;  2GHY A;  1R6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...