3WB0A

Hcgb from methanocaldococcus jannaschii in complex with light-decomposed fegp cofactor of [fe]-hydrogenase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
158
structure length
158
Chain Sequence
VVMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized protein MJ0488
publication title Identification of the HcgB enzyme in [Fe]-hydrogenase-cofactor biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 59
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.-:
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3wb0A01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3wb0A02
5JJEB 1H2SB 1RSOA 2V4DA 3AUJB 2D0PB 2F1MA 5JJNB 4DK0A 2F93B 5D5QA 1IWPB 1DIOB 4GYCB 2D0OB 1VF7A 1EGVB 3BRCA 4DK1A 1UC4B 1NBWB 3LNNA 2F95B 3WB1A 1EEXB 1EGMB 1UC5B 1T5EA 3WB2A 3WB0A 5JJJB 4L8JA 1IWBB 5D5PA 1MMFB
chains in the Genus database with same CATH superfamily
1MUUA 1Y1LA 5EHXA 2ECKA 3EUFA 3D8TA 4DIFA 3ONWA 2IE8A 3NYWA 3K9CA 4I8XA 5M34A 2VSQA 1OW3B 4IPTA 3SX0A 2FPXA 3CIOA 4H0FA 3QW2A 2ZM6B 3WB9A 3SHTA 4JC5A 4EK9A 4DMLA 2NXWA 2C99A 1FFXA 3CVUA 4UBNA 1GUDA 3H19A 1Z5VA 5AXAA 4Q4JA 3D54D 3ZHTA 4DUGA 2CHUA 4S2UA 3V1NA 2IT1A 3CZPA 2YUAA 4DLUA 4TWKA 2XXJA 1GN4A 1QH1A 1RKUA 3KPVA 2QY6A 3SNHA 1QHXA 4LSZA 3T5MA 1XEXA 3IAS6 4IHJF 2PRKA 5C9ZA 1WF3A 3TL3A 3R9XA 5HEKA 1KKUA 4Q39A 2JHCA 1T4CB 4QUGA 5HS4A 1QCZA 2I78A 4KN5A 5IWAB 4OJKA 2GJ9A 2FCRA 2REQA 4BL5A 1I4EB 2V7WA 4EF5A 3NW9A 3DZBA 5EYPB 3L8MA 3MCZA 3U61B 2W6OA 3PNVA 1OT5A 4OQFA 3UY4A 4L73A 1KJIA 1TF5A 4N12A 4ZVMA 3K0GA 5EJAA 4ZAFA 2Q29A 4G07A 4MLDA 4GDMA 3CLSC 3T15A 2G5GX 2JH9A 2OZEA 1QQTA 4HYYA 3BULA 1QF6A 2Z98A 2KWIA 3W6PA 3F5MA 3PRJA 3LQ1A 4DEXA 1QK4A 1NT2B 1K6XA 2CVQA 5IKXA 2YWHA 4P34A 3KYDA 4PHGA 4MKGA 1NUHA 1JLRA 4I9FA 4REMA 1JLSA 4JU9A 4YDRA 5T41A 2X77A 1FDOA 5ELMA 3PGXA 1XKQA 2XUJA 4XUEA 4J0GA 3ZJVA 2AE1A 4AP9A 1MRSA 1Q6UA 5CG2A 4G0ZA 2YYSA 1QS0B 2PE5A 4CCYA 2VH2A 5BNWA 3X2QB 5ALQA 3MXOA 4MUAA 1YNOA 2P2YA 3R0JA 1JHXA 1J09A 4FQ5A 2QR2A 1TUEA 4K46A 3E8FA 1UQTA 2X5KO 4DLYA 1X7WB 1D1QA 4HWPA 5AP9A 5KB3A 1C3OB 2XMDA 3EPJA 1UJ5A 1Y1QA 5LDHA 5KX5B 5HFLA 1H42A 5LBQA 4C0SA 3P2JA 1XZCA 5LBIA 2AF4C 3IEXA 2NVWA 5G4KA 5C34B 1NT4A 4TYMA 2A5FA 4UW9A 2CW5A 4XAQA 2L82A 4KMOA 2AIRA 4RKYA 4LXGA 3SU8A 5JWOA 2D5AA 1C9EA 1VA5A 1IJFA 4TRJA 1H23A 2GN4A 3BWXA 3FKSG 5IHXA 3FOWA 5KNDD 2XRZA 1KK0A 3K9FC 3RTAA 4N8SA 1R2QA 3KQOA 3MN1A 2Q8VA 4RAQA 3I1IA 1CK4A 1CVIA 1A1VA 1ODCA 3LFTA 6ABPA 2FEWB 5CW1A 4MV5A 4NJMB 1YZ3A 1QYVA 5JECA 2E76B 1T0PA 2B1QA 4H9GA 1D4AA 2IYEA 3F3YA 1SCDA 4BLUA 3QX7A 4PE5B 3PJRA 3IIEA 3AK4A 3E5RA 1NDQA 1L4FA 4AN0A 3DLPX 1D09A 4J0EA 4E32A 1M2FA 5A6SA 3SDSA 1E94E 3TL6A 2CL0X 2WUGA 5JAPA 5EJFA 8LDHA 4JJFA 3EXFA 2O2CA 2IE0A 1Q0HA 3MOSA 2F3UA 1NWHA 2BRUA 4HNGA 4IJ5A 2Y1KA 2N05A 2R6ZA 3CJHA 3D0RA 3OF2A 4M0CA 5LQSA 4BGUA 2GA8A 5T3UA 4BNHA 3H2YA 1D2EA 3SVTA 1U4OA 4DC9A 4YGXB 2AW3A 1E2IA 2AZTA 5AMXA 5AOAA 1T36B 4X65O 2Q3FA 4RF4A 1F7UA 2VA9A 3SC4A 4GPIB 1EIWA 1SQVH 3WOHA 2XMPA 3GJ3A 4W5WA 2Q6TA 3FX2A 4X7PA 4KVGA 1FRZA 4LMPA 1NW4A 4V3CA 2VRWA 5J5VA 2VPZA 2YYZA 4LY0A 1O03A 4BLQA 3SMQA 2VHVA 5HK8A 1XMQB 4CKEB 1JG3A 3MA0A 1HT3A 2MSNA 3L79A 1KI2A 4B31A 1VP9A 3CC7V 2G1PA 4NX2A 3FYUA 4YS6A 2GUWA 4U9UA 2JBAA 1N4DA 2KB0A 3MDSA 2YWEA 3STTA 3E2MA 5JUWA 1U97A 3D3WA 3VXKA 2E82A 4WXEA 3IOYA 5AUPB 5F1KA 3R23A 4BU0A 1WZNA 4LF9B 4JQSA 1FFDA 3KELA 3ITEA 3WNQA 4CS4A 4TL6A 5CFQA 1M0TA 1OCEA 4EJSB 5CRIA 1DPFA 3AF3A 4MGKR 2M6LA 1YFLA 3DEIA 5C5DA 5CM2Z 1RFGE 4PZDA 1BU8A 4W9NC 1EQAA 4C7KA 2ZZMA 3THYB 3PGVA 2Q0AA 3BILA 2W5UA 5F12A 1NLZA 2PGNA 4N03A 3OMWA 3JAKA 4MLCA 1PL0A 1KMQA 3EVNA 3JQCA 4JXJA 4HAZA 4DR5B 4C9BA 5BVGB 2I3AA 1Q3EA 2EJWA 3PLRA 4G5HA 2FK8A 3ER6A 2IDJA 2ACEA 2R1VA 3GLTA 2XQVA 3DTVB 1E7YA 2FH5B 1OC4A 3DW1X 4ASUD 3HCCA 1WP9A 2JD1A 2GF2A 4RA6B 1QONA 2EIJC 2Y4TA 4HDRA 1D4ZA 4RWUA 4OHCA 2ZR0A 4D42A 3VKVA 2JGIA 2MOKA 4CIYA 2BFWA 1RPOA 1JQAA 4NDAA 3A0RB 1XO1A 4NENB 3NR2A 1ZFNA 2Z58A 5DLEA 1JA0A 4TQUS 5INTA 4TRRA 3LP8A 1F3LA 2GCPA 1OYOA 3H2BA 1QCDA 2XXBA 4I08A 1XR3A 1G2QA 4YRGA 2GUZB 1G21B 2ZSIA 4A5SA 2PJUA 2PA0A 3K4PA 5K0TA 1MAAA 4ER0A 3OFSA 2Q3BA 4MP6A 1CQJB 1UC4B 1M5RA 1T3HA 2G08A 1TQDA 3KQUA 5YASA 2O5EA 3ST7A 1K0UA 1RRMA 1SRYA 3E48A 1WCYA 4IDQA 1F6DA 4BJ3A 5E2AA 2A9VA 3IHLA 4PTYA 4IMRA 4YCJA 2MYPA 1NBHA 3A0UA 4ETWA 2VYCA 4NQZA 2EV9A 3GPLA 2OXIA 3I2KA 3HUDA 2GJSA 1WJZA 5JD3A 3H9GA 4LNUA 1SUSA 2HBQA 3UH1A 4DNFA 1WXQA 2EJCA 3KLMX 1RVV1 2GBPA 2FUCA 3ZI4A 5KVQA 2WSLA 1P7GA 1Z12A 2E87A 3ZIAG 5EMLA 3OEHG 3ASOC 3N3BC 3NNSA 2GX6A 3A3YA 3FPSA 4B7EA 3E7XA 1Q0ZA 5CB6A 2XLBA 1YQUA 5E6RA 1LSOA 4ZQBA 2DRIA 2I7DA 1Z6ZA 5AVUA 3K06A 1TECE 5ALPA 4WOKA 1W4RA 4XW2A 3Q12A 2AE2A 2FE4A 2ARHA 3TLGA 5CITA 2BEKA 1J56A 4H0CA 3AUJB 4PG5A 4LF8B 4OQXA 3R5JA 1L4BA 3CXRA 2P6MA 4EKWA 4C0QC 3QK7A 1WMDA 2NW6A 5CNKA 4ZVPA 1DCMA 3SYMA 3QXSA 1OFHA 1QFSA 3SD7A 3HCAA 2H4HA 1XV5A 4I3GA 3ROKA 2O50A 2V8OA 5F64A 2JI4A 4ENUA 5BV8A 3CX6A 1QZTA 5HF6A 1E8DA 1OKKA 1JKXA 5KYGA 3CWZA 2GI4A 2P9HA 3RV4A 4X89A 2J85A 3KQPA 1PSWA 2DBVO 2XQKA 1MTOA 1GG5A 4E4EA 2VXBA 1A4RA 3TI9A 3VISA 2WU1A 4R1MA 4PXAA 1TK3A 2MSEB 1ODIA 3HKBB 2BFOA 2BFBB 1OWNA 2JFOA 3OOJA 1IX9A 3MM4A 3NHRA 4GZ5A 4DPKA 3AFHA 3QO7A 3ZLBA 3Q4HB 3ABOB 2CDCA 1LLUA 1O5OA 4S35A 4UB8Z 5IXYA 2C58A 3PDHA 4V3BA 2DFTA 3ZE0B 2DUUA 2R87A 1DRWA 2W6JG 1BTOA 1HSOA 3QHAA 2RKOA 4OX9Y 1O94C 1GO2A 2FJPA 1N75A 4IILA 4NJEA 2CFCA 3PIDA 1HFKA 3D43A 1TXGA 4WUVA 2SCUA 2BEWB 3V8BA 2X0RA 1NURA 1YZUA 3ABMC 1JWBB 1JB9A 3I37X 4P35A 5MF6A 1C4KA 1XCLA 1E4VA 2P22C 4WNYA 1IB0A 1KETA 1US8A 2GZHA 1VLZA 5T64A 3N7UA 1HRKA 4IMIB 4BZXA 1GUBA 3VVLA 4Z4CA 2HLDD 4YQZA 3S2YA 3IA7A 4H27A 9LDTA 1NL3A 3IHKA 3ZCQA 3RC7A 2QVBA 3KSBC 4IG4A 3FTEA 2OYRA 3C3EA 3GGOA 4YFYA 3LPNA 4B2YA 4Z9BA 5CVJA 3O3MB 3U3KA 4BFVA 2A7XA 1GXSA 2QTAA 1H2RS 1SHKA 3K4HA 5AOVA 5CTJA 1P4JA 4IZOA 1E64A 2QSZA 2WI8A 1VIVA 1ANKA 1FQWA 1VHJA 3MTEA 1Q3TA 2XRYA 1B26A 1I94O 3ZDXB 3GLVA 2AK3A 3LXUX 1YONA 1EDDA 4E46A 1I32A 5FOTA 1K9MW 2YHUA 1P9LA 4I5GA 2Q6KA 2O8FB 4C5BA 3TTSA 3KKOA 1RXUA 4CU5A 2BH9A 3T41A 2XVMA 1SCUA 4GYKA 1UJCA 3BHJA 1P7BA 2IVFA 1L5GB 5J3JA 1ORIA 3CH6A 1Q83A 3HP4A 4OFWA 3CUUA 4WKPA 1BE8A 3VDNB 4BNDA 4Z2WA 3W5CA 3LDFA 4GPD1 3S6JA 2ZKOA 2XBMA 3MMZA 1K3TA 3KL4A 4JASB 4YBRA 4S2EA 3ZTWA 4F04A 5K0GA 1WABA 4YK7A 4DV6O 1OOEA 1JR4A 1YZHA 1U3TA 1UXKA 2PZFA 5AK3A 1SQXH 4CM8B 4ZKIA 4E3WA 2Q0OC 4D25A 3HWWA 5LM3A 1AT1A 1AU9A 2BGKA 3E1GA 3VO9A 4EM6A 1ZI6A 4XWOA 4U7DA 2ESRA 2AXQA 2E2WA 1NVMB 1USGA 1R5OA 2WSIA 5F98A 1VHDA 5IN4A 3NRBA 1PJ2A 1U3WA 3KSRA 4QVKA 4TTRA 4LF4O 2IPAB 1IM2A 5I7OA 2W4IA 3M9WA 2GF0A 5T6MA 2C2GA 4HSEA 1PNRA 1T6ZA 1M76A 1CQIB 2J0EA 1P9RA 1IXZA 4C7OB 1PR3A 3UFXB 1ZA1A 3LNTA 4MRSA 2Q27A 1N8KA 1AO3A 4MITA 1ABBA 3PJGA 4UMDA 5CDUA 2UXBO 4AQ7A 2GK6A 3MTJA 1WLYA 1JG2A 1M2NA 4O8CA 3M6LA 1ZC4A 3MINB 1T4CA 3AY0A 5B3SC 3Q4GA 4LQ4A 4WBXC 4L78A 5FX2A 2FPPA 4XX0A 4EJFA 2IXAA 3ENVA 3VNBA 2JVDA 4C7VA 1J20A 5JC8A 2GTSA 2DQKA 3ORSA 2WTNA 3Q9SA 5IARA 3OPYI 4GI2A 4QPJC 1IUPA 2CNLA 2I7TA 3U31A 5K9ZA 4KR9A 1ITZA 3EXEB 5FBQB 3G0HA 1W7AA 3CTMA 1XRQA 2HGSA 1BDJA 3GARA 1PX0A 3OTIA 1ZPDA 1B93A 1YTLA 4C0LA 4OYYA 4NY1A 1K97A 1C2YA 2V7BA 3HKCB 3WFJA 4GUAA 4Q9IA 1AN0A 2EGHA 3EXHB 5FEUA 4P86A 2OOKA 4JFAA 4ZAGA 2DBRA 2HSDA 5HZHA 1A88A 4EG7A 1WP8A 4DR1B 1JEQB 2V7EA 1U5BA 4BVBA 1JEEA 1M34E 4JUIA 2PZMA 4FMDB 2LIPA 1AHPA 5CB8A 3VBCA 4KBFA 3VJMA 2ONJA 1FLVA 2ORVA 2Q9CA 1P8JA 3RLFA 1ZVKA 1G3RA 9LDBA 4RD1A 1OTXA 1XA0A 4RE6A 2J9GA 2G4CA 4XGNA 3AWDA 3ASYA 4R9NA 2XCIA 1C3OA 3RYFB 1KC8W 3MOIA 2F17A 1R0WA 3K8YA 1IB6A 2MU1A 3CUEF 1KFBB 1QIIA 4I5IA 3UM7A 4G1UC 2H2DA 1NU8A 1ZS9A 2AI3A 1PBTA 2PR7A 4FKZA 3OY2A 3K9QO 3EUEA 3AF1A 2SICE 3IJPA 4NYIR 3MTQA 4MHSA 5KO2A 3QJYA 4AY2A 2QD1A 3MAJA 4FOPA 2RJ3A 3U19A 4ZCRA 4KQGA 2IZ1A 1S0VA 2FNAA 5AIAA 3B5JA 1EINA 3NWOA 4LV5B 7REQA 1RP7A 2BEJA 1I24A 2WU0A 1VJTA 3UAYA 1AUOA 3WWYA 3BGSA 4OGFA 3DNFA 1W0CA 1OV4A 5L4SA 2WD9A 3C70A 2ZANA 5EJ7A 3SY8A 2J6BA 1SQPH 4RTRA 3QMPA 3OJOA 3GF4A 4PA9A 1NC3A 1OLXB 5LB2A 5A2GA 2JASA 3UK1A 1GRJA 2BKVA 1Y7PA 1QKIA 1T2UA 3HR8A 2ZNIA 4ND3A 2ADQB 1MOQA 3JS5A 3SDBA 4FMBB 2I8LA 1I2ZA 4C4RA 1CZNA 4JDUA 1JHUA 5KSWB 3ZCCA 3SJCC 4BASA 3H8VA 1G59A 4EFEA 1T36A 2ZSKA 4RZHA 4WXHA 1XFAA 1VCMA 2CNBA 4DJAA 4O4IB 4KAAA 2JCSA 2C98A 1E3QA 4BO4A 3WRXA 1ISJA 1IHUA 2Q5JA 2F6RA 221PA 4LFBO 1L4KA 5BZBA 1T91A 4CKEA 1PX2A 3H6HA 2X6BA 4ZYXA 5C1OA 5F5XA 3IBFA 4DZTA 2QU7A 4F38A 4FLMA 5B7PA 2WKPA 1MQAA 4QNRA 1JQEA 2QTTA 2IJKA 1MO2A 1TTHA 5IBRA 5DYYA 1QWOA 3RJ5A 1EA7A 3FVRA 2PKYX 2DFVA 3AI3A 3P0RA 4IV8A 4D3FA 5GJCA 2OAP1 1HZZA 3FETA 3AG4B 2I2FA 5DECA 2NPOA 3KUXA 3G8BA 2JJYA 3CCQV 4CLXA 5HE8A 2R8ZA 2Y1EA 2WAYA 4B47A 3H1TA 1ZP6A 1EUDA 4ENWA 2GN1A 2OUKA 2R6DA 4RL4A 3VR0A 1KOLA 2G1KA 2O7SA 1PZEA 3PQ8A 4BP1A 3USES 1MF7A 1ZWLA 3CFYA 1YR9A 3DUWA 3HABA 1TVMA 1OB2A 5BVGA 3HGTA 4ZOQI 2WA2A 1Q84A 4PLTA 4F06A 3ASUA 2WD7B 3ZYZA 4CIDA 1TJ3A 2EL9A 3D3JA 3DHVA 1UFRA 5A4KA 3D0KA 2BW0A 1DAIA 4QYIB 4GLOA 4XSGA 1ZK3A 2EWWA 2B2CA 3LK7A 5AI0A 4ETMA 2XUGA 1OZGA 4FFDA 2I1WA 5DPMA 4JJ4A 4U6QA 3ZD9A 3O4VA 4R01A 3OUFA 3WK4A 4HP8A 5WRFA 5C3MA 1Z4JA 3BEHA 5CDHA 3RSZA 3EH1A 1PUIA 3A0RA 4DQUA 5A7HA 1DL5A 4A73A 3UEOA 4E3ZA 3VC2A 5ESXA 1VIYA 3CWCA 1SIUA 3GIWA 2PKQO 4Z3DA 2GUZA 1LI5A 4W1PA 3M34A 4FCVA 2W43A 4UAJA 4JP1A 4XRGA 3FN4A 1XPRA 3NFRA 4F2GA 4CL0A 2VO1A 3TRJA 4KJXA 3IKLA 1CQJA 5NLLA 2F66C 2WYUA 2H51A 1VIMA 4FIDA 2NO6A 4V02A 5AKLA 2XNDA 1QYDA 5CLHA 5IABA 4G4SO 1E3WA 3TAUA 3WL4A 3X2FA 4Q4HB 1X1BA 1H5NA 3WB1A 4ZEVA 1QV6A 1E9FA 5EA2A 4R98A 3V2HA 3SHQA 2Q4RA 5CDGA 2NZ8A 2Q5EA 5LJLA 1S9DA 3H2IA 4IDOA 4AN4A 3W6ZA 1ORVA 1U0GA 4R84A 3WLPA 1AI4A 2BCJQ 1K92A 2W6NA 3N8GA 1PK7A 1NP6A 3D4BA 2GM9A 3OR7C 3GOQA 1CUWA 2XYVA 3VZRA 3JX9A 2IHYA 3DMDA 2DUJA 2QRKA 4IZHA 2MT9A 1GVNB 3ONEA 1XNQO 4FP9A 1XL6A 3S3TA 2F1HA 3TR5A 2G09A 2ZSJA 2PMDA 1J9EA 3FMVA 3BRCA 2YMPA 4OI1A 3GDHA 1N1DA 2VYQA 1VF5B 2J4CA 4DIOA 4MV1A 1BVRA 5AK4A 1ULHA 1U0FA 1ZCFA 1T9KA 4D8WA 4M1ZA 2X6RA 4FYPA 4CQLA 4I1RA 2MSCB 4DCTA 2O2GA 3RUEA 5HQ3B 2V7TA 3GLGB 1K2VN 1NSYA 4B6FA 3M1AA 3CEIA 2BPOA 2YZMA 2QN9A 2LKDA 2PM8A 3JQDA 1YHNA 3KM0A 1ADJA 2JFFA 4UQPA 4AF7A 2AHRA 1M34A 3TQCA 1IQRA 2VPYA 4KX5A 2I9KA 4ZANA 2RHBA 3WMGA 3K4QA 2I80A 3KKZA 3VPAA 4NPHA 4V0KA 1K4DC 4YT4A 4KYIB 2P4SA 3ZNNA 2XCUA 2H0AA 3NTXA 3RFCA 2HO4A 3MWDB 2QBYB 2H57A 3OPYA 2GPJA 2RMKB 2V5UA 1F17A 1P60A 4KNYA 4BMZA 1P1KA 3TVYA 2R8YA 1VBKA 1P0MA 1ESMA 3VU1A 4UCSA 2CUTA 4GX5A 3L40A 4YRMA 1D8TA 1IXRC 4Z0HO 1K88A 2EL7A 3MQFA 2BGRA 2PBLA 3Q4HA 1W96A 1Y4AE 4HZIA 2IU4A 1T5BA 3KZCA 4DIBA 1U7TA 3AI2A 3RG8A 5B6JA 1M2HA 1M5TA 4AHCA 4L9WA 5F5LA 1L6RA 3HMQA 4CDNA 2WJGA 2GUGA 3QVTA 3W8FA 1R00A 3W0LB 4HB4A 3RYIA 4BB0A 4BX9A 4KIJA 2F1RA 3W5SA 2YX1A 4XUGB 4KPFC 2OHJA 3HJFA 4U02A 2P6JA 1FSSA 4PRLA 2CGOA 4D98A 4MYDA 4HHEA 2X8AA 3ACDA 4F96A 5CN0A 3QEJA 5KYWA 2I2CA 1GGKA 8OHMA 2HQRA 3F71A 4NYMQ 5KSZA 3BCSA 3MS4A 1ZSNA 1XMVA 3AXSA 1YOBA 2E5LB 3S8YA 4AUEA 5JAMA 3R44A 1X8JA 1PK9A 2D5LA 3AR2A 4DQDA 4FWBA 5FFMA 1P44A 5KEIA 3ZRXA 4LSMA 4FJCC 5L7YA 3B40A 1T9GR 2JD2A 3CUKA 3DP7A 4L3OA 1UXOA 4JHLA 2ZRMA 3EZ2A 3VFDA 4ZKDA 3K0SA 3SDLA 3DDSA 2H94A 3EJWA 4QXQA 4EF4A 2GN8A 2OCAA 1UFKA 1QHYA 2PX6A 5B55A 5FTNA 5A03A 3VC3A 1R66A 3LD9A 2Y92A 2AMYA 3OTOO 4XYMA 4BUCA 4B6OA 3PE3A 1KSGA 4RVHA 4BTEA 2FN8A 2EFJA 2Y69B 1QHTA 2H2AA 3D31A 4IOLA 1C5KA 1PSZA 2GZRA 3KRTA 1PFQA 4RQAA 3OQHA 2C9OA 3OTHA 2O8FA 4FCCA 1JBKA 2BFFB 4RMIA 4P31A 4HRXA 4PVDA 1IN7A 1UPCA 1WXGA 2K1EA 1YB4A 4O0LA 4YWHA 3RIYA 3RHSA 5GQSA 5DOVA 3K9NA 4W5QA 4OK3A 4L0DA 3UAGA 4EHIA 5IVDA 2XT0A 3GWZA 1WVIA 2EHJA 1FYFA 1T4MA 4XGIA 5AHOA 4J2HA 3ECCA 2RH9B 4RHUA 5C8YF 3TLAA 1GRNA 4FNOA 1WEKA 3NP7A 4XVQA 2JFVA 3DZFA 3TECE 4MR7B 3GFGA 2VNAA 1N8SA 2QOEA 4Y6PA 5JTTA 1W25A 3C74A 1GHTA 3M6FA 1PNOA 4DLLA 2JFQA 1R6AA 3QTLA 3DVAB 3EOZA 4X6XA 4CM8A 1NHWA 5DGTA 4PHHA 2PZGA 2Y9MB 2A0XA 1KI4A 3L93A 3VMFA 3BKWA 3U9TA 2QR4A 4ZO8A 4X93A 1H2WA 2GHRA 3THWB 1QRRA 4B3HA 4QOJA 1YR1A 5DM70 5CJJA 4RLSA 5FPPA 2R85A 5IWCA 4BWAA 4KITB 2DSTA 5EQDA 4V0NA 2OG2A 2K9PA 2YV5A 1CQIA 4HAWA 1T6YA 4HTFB 3OMIB 1SUWA 3UFXA 4EYQA 2X8WA 4GZMA 3AV0B 2EP8A 3M7MX 3OY7A 1GQRA 3FCOA 3I8XA 1FU4A 4MW2A 3RUCA 1S3GA 2QAIA 4AZVA 4BMPB 4AS2A 2RK3A 4KQEA 4EG4A 4P36A 1HE8B 1CZOA 4MIEA 4BDSA 5DGCA 3E9ZA 4O2RA 1Z68A 3JZMA 3TE7A 1RHRA 1H5QA 4C1BA 2P0AA 1THMA 1DAEA 2QX6A 1XRJA 4OUDB 3IJ4A 1CRLA 1GKKA 4LHYA 1ENYA 2QN1A 1RYYA 4PA4A 1D2NA 1V5WA 1C0KA 3BIFA 4I5EA 3REFA 5DX8A 3K70B 4YT5A 3EXEA 4WN9B 3WGHA 2PYDA 4C7JA 5MN5A 4B33A 1H6CA 1WQ4A 3N3AC 3UUWA 3U0ZA 2F9LA 3HACA 4I9QA 1AKRA 3W2TA 2PI4A 4B3TB 3AEYA 2BFEB 1RWNA 2ISCA 2DQ4A 2JLYA 3ETDA 3WHKA 4BO5A 3G5TA 1J6UA 4F72A 1L5ZA 2JDIA 1NVGA 1MNGA 4J1NA 5J59A 4EO4A 1KP3A 2RHMA 3BD6A 4G0UA 3LY7A 3UJPA 5JI3E 1XROA 3QRWA 1AK2A 3CUSA 3FYSA 1IMJA 2UUAB 2O0HA 1J5PA 3ZN0A 1XRPA 4R8MA 3AEIA 4RF2A 4ZHQB 2XB6A 1JHMA 4BLVA 3NO4A 4BBZA 3K6JA 4GQBA 2Q6AA 1HE4A 1KYYA 1ZM4A 2QG6A 5CYPA 4BVLA 4OB7A 5FOSA 4CKBA 4DMGA 2V59A 4HNRA 1IEVA 1XKXA 3AJEA 1W4BA 1X9IA 4FSDA 4GBJA 1UBCA 3EGDA 4D9CA 2Q5HA 2WVAA 5IH7A 4US2R 4PHTA 2A8YA 4NICA 1SBNE 2V45A 4XZ3A 4CI0B 3N0RA 5LFAA 4DLBA 4EDHA 4C3UA 3L75H 5EUBA 1AQJA 2VQFB 3KOUA 3WJ2A 3O4RA 4POAA 1ZLYA 3DFUA 4NOMA 4M55A 4QYMA 4LGVA 3F49S 4BUZA 3I2JA 5EKTA 2BFNA 1ZY2A 3PC3A 4MK4A 3ZKAA 1U7DA 5A5DA 5SYNA 3RANA 2BZ0A 1YDFA 2ZI7A 3J81k 1SXJD 2V6BA 1OLXA 3WHLA 1IU9A 5D8DA 5FYDA 2CV2A 1ZAYA 4RK1A 3TAXA 3C1AA 2AKYA 4RTOA 2HK8A 2R6GA 3MJTA 2XQFA 1S3FA 1YR8A 1SQSA 1GN3A 5JDIA 3MS2A 4TLBA 4IUBS 3H9UA 1JV2B 2P6PA 1JQKA 4BLSA 2R7AA 1E1KA 4ALIA 1YCGA 5KYTA 2GD0A 2OGWA 2RAVA 2Y8EA 4R2KA 3Q1KA 3KOYA 1KBQA 1IEXA 1U7ZA 1XF1A 3P27A 3C98A 2ANCA 3DV2A 3DHWC 1PKXA 4BV2A 2LV8A 1F20A 2BMJA 2XWSA 1DSSG 1A9YA 1E1CA 1AROP 4IGFA 2OCLA 2HOQA 2YYYA 1SD5A 3IS3A 4XM0A 1VBFA 3MJFA 4K6HA 3NTLA 2X1LA 5HFAA 4MS3B 1I7SB 4A2CA 1YAHA 2O5RA 4DUYB 1DARA 3AV3A 3C5CA 4RJLA 4F21A 4R9VA 5C35A 2NVUB 5JJEB 4KUGA 1TAUA 5K3CA 3LS2A 5KA5A 3B2QA 3ZGYA 4WWHA 1XK7A 3EARA 5LHHA 2JJQA 3AG3C 1XRNA 4BIMA 1GFWA 1OA1A 3WL7A 4MCHA 4BGIA 3F6BX 5HRAA 4BVJA 2EZTA 3GJ8A 1Z4QA 3QVSA 4IFIA 3GCWA 2ZYDA 4ZCSA 1FRVA 2VCEA 5KQSA 3TF5A 5EE0A 2DJIA 4BFXA 3BQ9A 2O3UA 2IEGA 5JMWA 1ZW1A 4DLAA 3H7AA 4HJXA 3SEZA 2ZAYA 1SZXA 4X1OA 4EB6B 2VBGA 5B3JA 4C7MA 4DIKA 5BYBA 1A8IA 1K2WA 4R71A 2QD5A 1XCMA 5E2BA 1Z8NA 1LLCA 1YDMA 1NW7A 2FXIA 3SIPA 3F96A 5GPBA 1PK8A 3OFNG 1S8NA 4CUZA 1N0HA 4GVPA 1GSHA 4E7PA 3I2FA 3CKKA 2GFQA 3ZGLA 1MDFA 3COSA 5ALMA 3FKSA 3EVGA 3T5PA 4JA2A 1ZOSA 3U4AA 1FP7A 5ALOA 1E4EA 1DEKA 1P3DA 5KX5F 2JJ1D 4H1TA 3F1LA 1YH3A 2PKCA 4HKTA 4GF5A 4WA7A 4QDZA 4FS8A 2F67A 4AW9A 2DP4E 2PZEA 2BRUC 2ZJ0A 1CR1A 3T7KA 1U1GA 1P61B 1GZSA 3P71T 3L73H 1JGTA 4QHTA 2OCYC 4HDMA 2XTNA 3TOZA 1BKDR 4OLAA 1QNFA 3KLOA 4KUEA 1Z5PA 3UXHA 1SA0B 3UKJA 3K8OE 4G8JA 4YCMA 1KPIA 3O47A 4GSLA 4CUJA 5FIUA 4MS1A 1GM7A 3RR2A 4KE6A 4I3HA 5B1IA 3PICA 4Q4HA 3E83A 2R9VA 2YFQA 4HGZA 1BDHA 1L5SA 4W5OA 3IHTA 4D6TH 3VI4B 2CLFB 3FYUC 3RVNA 3R7DA 3WMRA 2H3OA 1INLA 3E89A 4DBLC 1U6IA 3TQQA 3FVWA 1ZD2P 4WXPA 1H2SB 5HP4A 2G71A 1WBJB 5BVHA 3VR2A 4RO2A 3H75A 1TOAA 5EOVA 1U81A 2QLLA 4RGVA 1RC8A 2GASA 2EJBA 1XU7A 1DJPA 3PEVA 3K0FB 1E62A 1K34A 1QGUB 4ENQA 3WZLA 3NUZA 5DNUA 5G41A 3MBKA 3SLRA 4ZAVA 1CDEA 4X90A 3LCMA 2YQ4A 3N9IA 4WFFA 5F3WB 1V3QE 3G2JA 3C6QA 2G38A 3RJTA 5A9TA 3KFLA 2C78A 3KYJB 3GGDA 4U9HS 2WAXA 1O6GA 2AMVA 3N2GA 2C82A 4Y9DA 3GLGA 2E55A 3HYRA 3DVQX 3LSYA 1Y1RA 2GXUA 1ZJWA 3W04A 3V1KA 1IBSA 4GNRA 1LBIA 3EFHA 3LTEA 4CIBA 3SSAA 1C50A 4OQLA 1O96B 1L1FA 5G2OA 3SS7X 2QS9A 1DIHA 2DERA 2RC6A 4N5HX 1FSPA 1QQAA 4XYLA 3JWJA 3GA0A 5GZ1A 1I4WA 3TLEA 5IBCA 1ORWA 3JQRA 4NAUA 4F3YA 3T52A 3VSBA 3OG9A 3ZIDA 4ALKA 1PT6A 4LE2A 1VRWA 1SUAA 2O2SA 2X4DA 3H2SA 4BQSA 2WC1A 5EJIA 4P7GA 7ADHA 2RMKA 1R50A 2Z0AA 5E6UA 4U2GA 5KOYA 4HSGA 3R8XA 1YS7A 2IEDA 1CRWG 3U1VA 4C4PA 2ZSUA 2XA9A 1G8SA 3KQHA 4LWSB 4TN1A 3HJHA 4GX1A 2VWGA 5CIWA 4XQ0A 1YZQA 4CNQA 3IP8A 4WY5A 3A14A 4GSYA 4DANA 3P9IA 1X19A 3EQ2A 1YRBA 3SXUB 2ORWA 5L7TA 4XA8A 1XZKA 1YDEA 3Q7EA 4EPVA 2K4MA 3CVOA 4J9UE 4B6GA 4MVJP 2I1QA 4PU0A 4PBSA 3WGIA 1BJTA 3EEBA 2OXRA 1Z7WA 5J58A 4W5TA 4QPKA 2H16A 4JLBA 1QX3A 3BIJA 4QJIA 2HK6A 4Z4FA 3QZUA 2FWNA 3I64A 1GEEA 3WLLA 1U8EA 4GR5A 2IUTA 4QLAA 1IRIA 4LRSB 2BKEA 2C5EA 1UPAA 5C5EA 4LTDA 4MR8B 3UUFA 4Q00A 4EPRA 1CSEE 3HY6A 4Q7EA 4HB3A 3CCEV 4MTLA 3PPVA 4ACBA 2KI5A 3APOA 4IGAA 1E3EA 1S0UA 2XQGA 3BIXA 4ZQEA 2ICAA 3SYLA 4KPYA 3T34A 4L6IA 2ZYVX 3ILXA 5J5CA 3A31A 1IY2A 5H3CA 2CYAA 4HFJA 1TQ4A 4HYOA 1CG6A 4D9EA 3A28A 5HG0A 2FB5A 4HVAA 4DFDA 1GMGA 2H8PC 5EKXA 4YUVA 4FGUA 2XIQA 4PWYA 3ZIAA 1U63A 3OEHA 5I7FA 4LOKA 5D85A 5K0LA 5FL7D 2AYXA 1T8SA 1W4LA 4MMZB 5TVKA 3W3AD 2HWUA 3BWYA 3PLNA 2ZE8A 3V8VA 2YZKA 2ZIXA 1PIWA 4X65B 3DDOA 2Q0SA 9GPBA 2BFFA 1N2EA 2H1VA 1GGJA 4BQNA 4Q18A 1ZCBA 1GQFA 3EDOA 1D9XA 2FPIB 1L0NH 1AK1A 1A2OA 5JCXA 1AGNA 3ILHA 2FDCA 1W88B 1TO1E 3S2SA 4NYJR 3MZ0A 3B36A 4IJ6A 4RETA 3G2OA 2W0MA 4Q9JA 3I9FA 3VYTB 3K0BA 2ZDGA 2DYKA 1GAWA 3AIMA 1MVNA 4MR9A 2E85A 3DXZA 3HCRA 3ZTTA 2VUIB 2BHSA 1JKJB 3C7KA 2R4TA 3R0VA 1OXKB 5CBPA 3DVAA 3GU3A 2C20A 2F00A 3SE7A 1RM4A 2F3QA 1AKMA 3BFJA 2ZWVA 3OKCA 4QEZA 2V7QG 1PT8A 1OCZC 1VKHA 3GELA 1TYEB 3PDJA 4BNZA 2I3DA 4H7HA 4RJ2A 1RQXA 2P8SA 5J4LA 5GTIZ 5KOHB 2A1TR 4DPLA 4K86A 3TQSA 1OH7A 3AUAA 4ZDKA 4R8VA 2P9TA 3IERA 1I4DD 2VJKA 3ZDYB 4TS4A 2G1AA 4QXOA 4CDGA 1QF9A 1DZ3A 4LGCA 3RBAA 4Z1OA 1TZMA 2G3YA 2ZWPA 3L8HA 4G65A 3ZCTA 4U7NA 1W85A 3O9OA 1V8OA 4R1NA 1M6VB 2W6JA 3LDUA 2II6A 1C3XA 3ABRB 4MRMA 5KU1A 2WD8A 3BA1A 4EW6A 4QAJA 5AM0A 3U0VA 1U1DA 4OHVA 3WIBA 1K89A 3PLAE 2ZXUA 1MW8X 1RPRA 4ARSA 5DWVA 1NR5A 3LWBA 1POWA 4HDOB 2Z5VA 1U2QA 4WNAB 4J03A 4G0XA 5TGDA 1Z74A 1PW5A 3C5WP 5DW3A 4F46A 2JVKA 3IURA 3HDHA 2W2LA 5LUAA 4PCUA 1B06A 3N75A 2D7CA 4X00A 1EI9A 3AM1A 3E3MA 4NCAA 1T15A 1JHDA 1E1RD 3QFCA 2ATIA 4CHTA 2ZJ1A 4DJ5X 3HUEA 2MWMA 1ZNZA 3LECA 1SK8A 3T9FA 5EWLB 4RMGA 4CKWA 1TQ8A 1FP6A 4DM4A 1H2FA 5AHKA 1D6JA 4N0PA 8AT1A 1S5HC 4J0DA 3NVKI 3X1YA 1JNXX 2FEAA 5LLDA 5IC4A 3TQRA 4YRZA 4F5YA 1ARZA 1JEJA 1ONBA 3UO2A 2XVYA 1UIRA 1G0NA 3DT9A 3JV7A 3QNMA 2OFWA 4ICGA 1IVSA 3TOCA 4BOYA 2FYTA 4J7ZA 5LZ4A 1FTGA 1EPUA 1YVWA 3FLMA 3D5EA 5CVDA 4QSMA 1F7VA 2ACVA 5C8YA 3IQEA 4KHZA 3CRCA 2QUKA 3NALA 3HBNA 1FS5A 1CY4A 5GM1A 2VUSA 5BUQA 1X86B 2XQIA 5EXPA 4ENTA 5DLPA 3W9SA 1PDVA 2PX8A 1F0YA 4N8DA 4GH5A 2RK4A 2FSIA 4IM7A 4U0KA 2AWOA 1JSRA 2D06A 3EZGA 3CPSA 4GKJO 1ZUWA 3SZRA 4B3MO 1Z2NX 4TT3D 3L77A 2V7GA 3MC1A 4KG7A 1SUDA 5BMVB 1KEEB 4W1SA 2YJ5A 4R16A 3RUPA 3PZRA 2HRQA 1WRBA 1ZGCA 4ER3A 4H7DA 3AY6A 4OH7A 1TADA 3K08A 4QJFB 1EHCA 4JTAB 1KMCA 1Y7TA 3ZY5A 5JYCA 1N7HA 4JI6O 3HKEB 1GFSA 1VPEA 2FG6C 5TQVA 5ADUS 5REQB 3Q3GE 621PA 4HY3A 1EUZA 3UYKA 4M54A 4F7DA 2PXAA 3DEYX 5E1BA 4WFEA 4YACA 1KZGB 5DHAA 1UAGA 4X95A 4A82A 2JLWA 1KZ9A 3UB2A 4V1CB 1JA8A 1PP9H 2CXXA 4N5LA 4DB2A 1RZ3A 1MT0A 1SJ9A 5CXSA 2DFKB 13PKA 3WY9A 1PD1A 4OHFA 4ZCPA 5F1OA 5JSZA 5I9LA 3BAZA 4PQGA 2J6IA 4BKPA 2ZEJA 1Q1QA 1RU3A 2WKRA 4E7OA 5JJJB 1SHUX 3ZHQA 3PQFA 2Z9BA 1FFWA 3AEKA 3DC5A 4AI6A 1N0WA 4CM9A 4OHYA 3AJRA 1CFZA 1R3DA 1S8OA 2OFFA 1PFUA 2R1ZA 3FDZA 2BY4A 5HW0A 3Q6NA 1J8DA 4P4NA 2BFCB 5AVQA 3FHTA 3K94A 2G06A 1MLDA 3LCRA 3OWXA 3CY6A 2CGNA 1LQ2A 4FUQA 4UUJC 3CVWA 1SEPA 1QH0A 4MS3A 2MTBA 1CZKA 4RF5A 4ZI3A 3DBOB 3WK8A 2EZ9A 5DWDA 4PPYA 3STZC 3NHKA 3LUAA 3AYZB 4MQUA 1ZJ4A 4YJ3B 3ZZMA 1N2ZA 1DRUA 3W4JA 3IP1A 2N1BA 2NU6B 1ULBA 5HIIA 4C05A 1KMHA 4JUAA 1B3RA 4YALA 1B6TA 4HEA6 2YN0A 2QA5A 4H6XA 1N2BA 5B2EA 4BX3A 2NXEA 4H0NA 3OE7A 4PLYA 2XOKG 3I6BA 1P45A 1P19A 2VNSA 4RWZA 2VF8A 4J9YB 4FJ1A 1K68A 5DGDA 1PE0A 1UBKS 1GPDG 2C96A 1R6XA 3SS8A 2RB4A 5A4FS 1BWRA 5JADA 4EB6A 4U39A 1F51E 4ZVQA 1AV7A 1G98A 2PL9A 4PZ0A 3IR7A 4Q1VA 4R9SA 2GYWA 4YRTA 1RM1B 3E0XA 1U3CA 4KFTA 2PL3A 3KDAA 2YWRA 4MW6A 2D74A 5KMGB 3NKVA 4QXPA 1I94B 1ISFA 4FMDF 4GMDA 4O2BB 3ZCXA 2ZYTX 4RXUA 5KHOC 3RK4A 4C0AC 2WBLC 2FQQA 1DFHA 2P90A 4OYRA 2A33A 3CC2V 2QTGA 4HV4A 5H3LA 4K81B 3H97A 3BGIA 4ZOBA 3QMMA 1UMBA 2N47A 1AA9A 2GZ1A 3FAZA 2WHPB 3R5XA 1RSOB 2F59A 3T4PA 3OSUA 1TA0A 4A0HA 1CUAA 4EPYA 2EBUA 1V9PA 4MUIA 5K01A 2Q1UA 4PHZA 4NCHA 2FRDA 2R84A 2GEDA 4FLTA 5B4UA 3RUIA 3NYRA 3BX1A 1K5HA 4DV6B 1MAHA 2X0DA 1T5SA 4L8YA 1W5AA 4J16A 2YHIB 1SA0A 4GL4A 2CYCA 1KYVA 4BFSA 1E61A 3HUFA 3WRXC 3EG5A 3ISTA 3NAGA 3ZS9A 4ZMSA 1KBOA 5AI5A 1UH5A 4AMUA 1QFXA 3VR5A 4J3FA 4JT8A 5K8VA 1OZHA 5GIPE 3OEED 1RXYA 2M32A 4LF4B 3QELB 3JYPA 1UM9B 4U6SA 4JSRA 3DLAA 1BQZA 2JFBA 1MB2A 2XA1A 3RI3A 1V8FA 1FPMA 2PSFA 3ZHUA 4MQFB 2XNCA 1IOZA 1J0XO 3NIGB 2G76A 3LY9A 5I8ZA 4ECEA 2UXBB 5FPTA 3RBXA 3BHNA 1KS9A 5EYPA 2XGMA 3KQQA 5L51A 4GZRB 3RBVA 2Z3YA 1E3SA 1CDOA 3DBLB 1P2SA 1HZZC 2DPLA 4LX8A 2QIPA 1GAXA 2HADA 4JSTA 2DAPA 3UMCA 5KYNA 2W0FC 4V1CI 2PWZA 1CR2A 5ECDA 2O6HA 5DGHA 1KO1A 3LHSA 4MDYA 4M37A 1LUWA 3SG0A 3ZU5A 4RD0A 2FPGB 2VK1A 1S3JA 3NXKA 5NULA 2N46A 1NT2A 4BFZA 2YXBA 4O4IF 2LFRA 4UHDA 1SCIA 1L7MA 1RKQA 2NUAB 3EDYA 1N2CB 1EFCA 2IYOA 3B52X 1KQOA 1O97C 4KI0A 3TW6A 2ZB3A 3U13A 5FA5A 3WMXA 3MGKA 4F8EA 4RSMA 1ORRA 3TZ6A 3ZKWB 1MFPA 3OE7G 2IBZH 1Y9EA 4ZJUA 1QS0A 1Y9ZA 1J90A 3EUWA 4YRJA 2M98A 1YZFA 5FYQA 2AH5A 1X7XB 2EFEB 4KGXA 3GH3A 1Q50A 3QQ5A 1N4AA 1OIVA 1A9PA 1X7WA 1MB4A 2O1EA 4TV8B 4RHEA 2YJGA 1LF0A 4WLEA 5KX5A 1KO5A 5BXYA 1JFTA 2YV2A 1HX7A 3GEGA 5DI3B 4WSOA 5KCMA 2WUFA 4QYXA 1BHSA 2ZJ2A 2GEBA 3SKVA 4B8ZA 3FVVA 4W8HA 4CF6A 2FW7A 1O95A 4LWSA 1JQ5A 3SIWA 4L7VA 1BQEA 4PYRA 4XVHA 3ICWA 4M9UA 3H1AA 3QKIA 4HDAA 3SXUA 3KTFA 1JZQA 1UDBA 2L18A 3KWLA 1UQRA 2QTOA 3BJRA 5T8KA 2EKLA 1BGVA 2R751 1A98A 2DVMA 1CEYA 4LMAA 3BEOA 1KI1A 1B76A 1FRFS 2PNJA 3CCLV 3TTYA 3LWDA 3CP1A 4NJMA 3AG1B 3GGJA 3WGMA 2HBRA 1T8WA 4AQYO 4H59A 2RGYA 2CXTA 1WQ3A 4CFZA 3K6KA 4WNCA 2PSHA 3PQ3A 1QLWA 4JA0A 1ZJZA 1AO0A 1EN6A 1PWXA 3V4RA 2LFSA 2H4YA 4MR8A 3ROPA 3AG5A 1THTA 3ZWXA 3GP8A 1LEHA 3LH5A 2ONZA 4MUYA 3EZXA 4NNJA 3VUFA 3W5AA 1FCJA 1BMFG 2R47A 4YMWA 3DXRB 1NBEA 4QELA 3P45A 4WH0A 4MSUA 4LBEC 2Q45A 3GPBA 1K5QA 1WF6A 3QEMB 3QTCA 1DAFA 2WK1A 4WBNB 3QVVA 1DMRA 1A71A 4BQRA 3U7JA 1X9GA 3I83A 2OYSA 2YBDA 1T8RA 5DHRA 4HPWA 3A3PA 2WG1A 2HF7A 3IP7A 4UCRA 5EKSA 1GADO 3DHNA 3A3NA 4WAUA 5ICEA 1UKVY 3SQXA 1I7FA 5E3IA 3IEUA 2Q6LA 1P1BA 2OHHA 2P30A 3R77A 2QRNA 1HFEL 1USWA 4JEHA 4MJ3A 3QVUA 1UPXA 2FPIA 1CUYA 2QRVB 3UJ9A 2HJSA 3HRHA 4LFBB 3DLCA 2OZPA 1W88A 4JR0A 4C88A 1K4YA 4E70A 4Q15A 2H85A 2V96A 3RFTA 1EZVH 3VR4D 4B43A 1EE1A 2Y6UA 3GH1A 2QV0A 4IWNA 3SR4A 1JKJA 1N36O 4EJSA 1V1MB 4FIPC 5LWHA 1BW9B 2NSYA 3BZWA 4GQAA 3I1JA 1Q92A 4EY3A 4CMIB 4PCVA 1DRKA 2Y1LA 4YUWA 3THYA 3OT1B 7MHTA 3ENZA 4GRIA 5JLJA 1WQ1R 4IR7A 1F51A 5H83A 5KTKA 3D6JA 1XZEA 5KOHA 1ADFA 1KOFA 4U2EA 4DGSA 4D2IA 4Z2AA 3ZV5A 3UXYA 4HMPA 2REBA 3I72A 4L8VA 2N1MA 4I50B 3DTVA 4H2DA 4G3XA 2ZETA 1BN6A 3GO4A 2CT8A 1PR4A 1WDLA 3R4VA 5JJCA 4IJUA 2KSQA 3PV0A 3W9UA 1KK2A 1O4VA 4ENSA 4NESA 4RA6A 4DREA 3LFHA 3UWMA 3GVCA 3IQGX 3ND5A 5BQFA 3KD3A 3IO3A 3FWKA 3J7AC 6NULA 1O7JA 2B4AA 1A9SA 3V00A 4NENA 3DEJA 2HX1A 4GL2A 1DKLA 3T2MA 4R2MA 1Z26A 1Y8CA 3DBRB 4X64O 1KSJA 1MQ8B 4B40A 1RI5A 5DJ5A 4P3OA 1L0BA 2FZGA 1G21A 3QBEA 5EUQB 4GMKA 3O9VA 3A1FA 4J7KA 1I9GA 1B7GO 3W7SA 1BVUA 1KBHA 1Y4DE 2IOHA 2WM8A 5E6SB 2BFPA 4V0LA 3HLYA 5HDBB 3RUHA 2AQIA 3RPEA 3CPEA 3GGCA 2XKAA 5EWLA 4PSVA 3RRMA 3L0SA 4AKIA 1JHPA 4FQ7A 3IBGA 1JMKC 3LIIA 4EMBA 1NN3A 3BA6A 3AERB 2NNUA 3OJCA 4LI0A 5ALUA 3X44A 2MHCA 5E7MA 1QQCA 1Z4IA 3L82B 3LY8A 4LQDA 1Z4PX 3IALA 3BGWA 1PG0A 3AVPA 3B8MA 4IV0A 2A86A 2JHAA 1E1QD 5DM4A 3NTVA 4BBAA 2IPXA 2Q3HA 1RQPA 3CSDA 3LX8A 1XU4A 4LWZA 1XMJA 5F1PA 4LHVA 1NYLA 3BK1A 3ETLA 4LHSA 1WNFA 4ZT2A 1YMUA 3PDIB 3CLVA 3MHPA 2X7HA 4N6OA 4KQXA 3IC5A 2HTFA 3H83A 1SPXA 2WF6A 1XNQB 2N9UA 2GXSA 5EN4A 1KJ9A 2QJ1A 4B7XA 3JD0A 4F86A 1YKGA 4BQEA 2PBZA 4LISA 4P92A 4M83A 1TZCA 2GPSA 4GXTA 1BN7A 4MWZA 2IEZA 4JB0A 2HMTA 1ZXBA 3JVVA 1YTFB 5BMVA 4QU8A 2AX3A 1DF5A 4P22A 1C9YA 2UV8A 2DFNA 1MJNA 3UJNA 3O74A 4QL3A 3K3PA 4AZWA 3OZVA 1V26A 1WJGA 4BAZA 4IJKA 1VQ4V 3X2EA 1EK0A 4QYSA 2AGAA 4RHYA 3KAKA 2B5OA 1DRVA 2I2WA 2VK8A 4BEBA 5EEGA 2MSLA 1A8QA 2Z8YA 4JD5A 1NVVQ 1CIPA 1TM1E 5ESWA 1Z6TA 2GJ4A 4I0XB 4CEJB 3PDCA 1EBOA 1WPXA 1I7QB 5JZBA 3KR2A 1HH4A 4V1CA 4L3WA 3TK1A 4CMAA 4IIJB 4JU8A 4DCPA 4RV4A 4AXXA 3HKBA 2V9CA 2BFBA 2QZJA 4L7QA 4ARZB 5T7BA 3DQZA 3DKRA 3FE2A 3CHYA 1XZQA 1N6OA 1FP2A 4FHCA 4OTZA 5DN6D 5JSKA 3RC2A 1ZXXA 2UZ3A 1TEHA 1SCQA 2QTMA 2PV7A 3RHTA 1NVTA 3K0EA 1VMGA 1ECLA 2ZRDA 3EZ9A 3VPSA 3DKIA 2CMKA 3Q15C 1XQXA 2OXEA 2XAJA 3DJYA 1QFJA 2ID7A 3W79A 1KA9H 2Z8XA 1J97A 4HAOA 2VHXA 1XMPA 2Z4TA 3AVUA 4TXJA 2BEWA 2WOJA 1E2NA 2WUVA 1WPBA 2HLNA 2QK4A 4GPTA 2NUTB 5E8JA 2VS0A 1Q15A 2JK1A 3W7XA 4F56A 3NHSA 5DBFA 3HI4A 4ZIRB 3DMYA 4FX5A 4NCKA 4ZV7A 2GM4A 3TW0A 3HCFA 2CFIA 2IHBA 2WJJA 2YZNA 3FGNA 1FNDA 5D3ZA 4B3IA 4R5MA 4YJ3A 3Q3IA 2XUMA 2C04A 3TI7A 3X1MA 1YR3A 2BF7A 1E2BA 3DFIA 3B6JA 1M33A 2X7JA 3C3TA 2NZVG 3IJEB 1YB1A 3OLVA 1T9GS 4JI1O 1TKCA 2AFVA 3SGIA 2WV7A 5EIEA 1F1JA 4UNRA 2IYFA 4HAUA 3TNDA 2LGWA 4H35A 1QSGA 1Z0UA 4LJAA 3WZMA 3PFHA 4BLOA 5A05A 3V7NA 1VI6A 5DGIA 1G1AA 3OTOB 1ADCA 4OU5A 3X2SA 3FNQA 2GD6A 4OHWA 3AK2A 5KMGA 2FJUA 1KERA 2Z56A 2CMHA 5BWCA 3ZU6A 3HP7A 4NXNO 1S96A 2QT1A 3QXHA 2CXQA 4G97A 4FN4A 1QIGA 4WQMA 1WHSB 2APJA 3JY6A 1UK7A 3BXEA 4UOZA 4ZC1A 3A04A 3WHIA 1R4AA 2Q07A 5D5HA 3S29A 4MVUA 4X1KB 5FV4A 1MOZA 3H11B 4ZHQF 3RVSA 4JASA 3LXXA 2QJRA 1W59A 4TM7A 4TZKA 4DAEA 5JTUA 5DBOA 2WHPA 1RSOA 2JIPA 3AI7A 3VZQA 3ZWBA 3R7AA 5JDIC 1C3JA 2HJ9A 1W36B 5K3DA 4EPTA 2GZ2A 1IG0A 1K86A 3HI6A 4JP5A 3ZGZA 4P6VF 3LSUA 2YHIA 1XVLA 5AUQA 5HOQA 5AQEA 1R5BA 3IQXA 4C6HA 4OM8A 4UTNA 5DE3A 3NEJA 3ZNOA 1LI4A 4BKOA 3ZGXA 3GFFA 5EIBC 1V47A 3TFOA 5EC8A 3VZCA 4RLQA 5DRYA 4C7OA 5FOVA 3RTEA 821PA 2QP4A 2X9GA 4M9ZA 5B1YA 1ND5A 1KRWA 2NT3A 2G77B 4N3AA 3QELA 1YF2A 1UM9A 1QH8B 2VHYA 2H6EA 4QYWA 1ZRMA 2B82A 3PA6A 1WZUA 4E5KA 4C6RA 1TAGA 3U4MA 3KYIB 4YYEA 4ZI2A 3MINA 5I3ZA 1XHEA 4DG9A 3GEIA 4MQFA 3ZI0A 3I6IA 5IM4A 2JJ2G 1TJNA 5CAEB 4AKEA 5EP2A 1KO4A 4K9SA 3AL0C 4YPOA 2E4XA 2C8JA 4MYRA 4UPEA 1EJBA 2I6FA 3D36A 5B64A 1TFUA 2RBGA 1E0AA 2D4AA 1VPVA 1RZUA 3VGPA 4RBNA 2DH5A 2WLSA 1ZOPA 4FLYA 4ZT6A 3PWSA 2M2IA 4LJ4A 4A2QA 1E2KA 1WXEA 1CP9A 4ZC8A 2R65A 3HKCA 2CZGA 4RHFA 2GHTA 3TSOA 4KQ1A 5C53B 5B3JC 1ECJA 3EXHA 5B7QA 3GLGE 1R3UA 2GBLA 1N2CA 3KSUA 3RVOA 2KBFA 1X70A 1RQLA 3IA2A 1HDEA 3KUUA 3EY9A 4YAFA 1CF2O 1JEQA 3ND6A 5IKPA 3Q0EA 5ABPA 4ZZ0A 5I47A 3CRW1 2HKIA 1NV9A 2Y68A 5B5EZ 3ZKWA 1P2DA 1AI5A 1N7GA 1CY1A 5LLSA 3IPAA 1LDYA 4EI8A 3ICOA 1ZONA 3TPFA 3CZQA 4IIXA 5KVVA 2Q4OA 2I6SA 3OETA 3OZGA 1G3UA 1XLTA 1LX7A 3RFVA 5SY6A 1AMUA 1RS0A 5ERGB 1CDDA 3RYFA 3UQYS 1NFQA 2Q2VA 2C84A 3OFNA 2ODWA 4ZEOA 1ZUQA 3PEYA 3AIKA 3W8NA 4MUKA 4R2IA 3FPLA 4A91A 3GIDA 5JC1A 1IBRA 2QJOA 2P9GA 1G4UR 2GVDC 3DH0A 2H7XA 3PGA1 4NMXB 2IZ5A 1NQVA 3LUCA 5L3EA 2QLNA 3HGQA 1QGED 1YD7A 4JCCA 2AEMA 5F2KA 4DT1B 2IS6A 5KHAA 1X92A 1TJYA 3RJZA 4QU0A 4WHMA 5JRDS 3DEZA 3B1JA 1U98A 2J9ZB 3LYHA 2GN2A 5K0EA 1MU0A 4JBWA 3PUJA 3KZVA 3VHXB 4N9QA 4R50A 2C61A 4KQHA 1XZGA 1KO7A 3OUUA 3O4HA 3LDEA 4HS4A 5GGYA 4KR7A 2XADA 4G67A 4J2OA 4S1NA 3S2UA 1A7JA 4U00A 1KIMA 3FROA 2ZB8A 3NOQA 4BGVA 1ZD4A 4BMCA 1EK2A 1QH9A 3DXRA 5JFGA 4L6AA 3S5JA 3QG1A 4UVGA 1O0CA 5JJKA 4J3NA 2E6KA 4P82A 1ZGZA 4Q7JB 3GEMA 3PFWO 3D4IA 2CE2X 3WYGA 3QWIA 4P4TA 2GEFA 2GT1A 5TNXA 1SULA 4J1QA 3F67A 4DMCA 1PZMA 1JMVA 2A58A 3SSMA 4DR7O 3C3CA 4DDVA 1YR6A 2JIRA 3WRYA 1U0EA 2CHQA 2AL7A 4O4IA 2YS7A 4ZOCA 3JWPA 3C3XA 1Q17A 1A77A 4DDTA 1JHQA 5B1AB 4IIHA 4EA8A 1B8OA 3HG7A 2WM2A 3E7PA 5AH0A 3SZLA 3AG7A 2JBHA 4NZ9A 3GJTA 2SKDA 4ENPA 4NMWA 2VP2A 2PUBA 5IT0A 1KTVA 1SKAA 1W76A 1YCDA 3KR9A 4ATNA 2EYUA 2YIVX 4RFLA 4J80A 1HWYA 4QPNA 3AIIA 4O4JB 2AQKA 1RI4A 5LQDA 4O2AB 1YGYA 5JU6A 3CM0A 1J33A 1KU9A 3ET4A 4GE0A 3CWBH 1OH8A 3V48A 4XB2A 4HJRA 4FFMA 3TNJA 1DELA 4DXDA 5KAFZ 3KJNA 4UVBA 2BCCH 2ZUVA 4E1VA 1B0UA 1RE1A 2BGGA 3VR6D 5GIOE 3MMPA 3RIEA 5FPSA 2EXXA 1RWMA 2CEAA 2O1SA 3DJFA 4ETIA 2A9QA 3C41J 5A0TA 3BB4A 4GSKA 3ROXA 1BW9A 4TLAA 1E5QA 1F12A 2DY1A 3P2EA 2H1SA 1Y3BE 2AXNA 3RFFA 4CMIA 3MYRA 4H4CA 5CCDA 2CSXA 4YCBA 1KJQA 1ZN8A 3KKEA 4G6ZA 3KU1A 1S2LA 1Y66A 4IKOA 3WAGA 3BD7A 3NUQA 4BNXA 4B83A 1NVPD 3LUFA 2P0EA 3LGSA 3PUZA 1BDBA 5IHPA 1WW3A 4HATA 4Z1VA 5JNWA 4KO3S 4FONA 3IB3A 4TT8A 4I50A 2WD7A 3KKQA 3U1TA 3AVVA 2I55A 2NVBA 5LZ8A 4H18A 4QYIA 3TNYA 3PUYA 5B2ZA 1FUEA 4KHPO 1N9GB 4YTEA 1ZEJA 5CX1B 1B6SA 1VI5A 3MIIA 2F9MA 2EW8A 3KK0A 1PQYA 4WJLA 1Z6XA 1J8MF 2IHZA 2J3LA 4A8HA 3ONVA 2JBWA 2CDYA 4XCQA 1MXFA 1BH6A 3KFXA 1VLLA 2BI7A 5IS2A 2OB2A 4BMVA 3OUTA 4CLHA 4DIDA 2PUCA 4J29A 1NC1A 5BR4A 4X6LA 4FKBA 1VF6A 2P62A 1I33A 3KKKA 2WAAA 4GYJA 1OJHA 2Y1OA 1A9TA 3R3XA 4YMHA 1MN6A 5E6SA 4MGEA 4M1YA 4Y2UA 3GJSA 2CCJA 4UM7A 2RGAA 3QGMA 3WADA 2Y69C 2X3UA 4BB9A 1AZSC 3AKZA 2AG6A 2EQAA 1A7AA 4R2HA 4B34A 1GTJ1 1W5SA 4KE8A 1DOAA 2WM9B 1Y1PA 1VYHA 1KU6A 4CMHA 2X1HA 2A5JA 3SSOA 5AR1A 1WMEA 1YF3A 3E23A 2OD9A 4GOXA 1QOZA 4UD2A 2JI8A 2CUZA 5DWQA 3MELA 1CIJA 2WMOB 1DOHA 4BPRA 2CLSA 4ALJA 3B20A 4FOLA 1JJFA 3HJNA 4EF6A 4REQB 4EZIA 2WJ3A 4HEQA 5H5NA 2XCLA 3D59A 4OLJA 2HIMA 5K8LA 3F5DA 2AG8A 3G2PA 3PDIA 4AJ2A 1CC1S 1U99A 4M0LA 3OOWA 2RBKA 4XTCS 1BAPA 3I9OA 3Q11A 2WLTA 4TYYA 3ZWPA 2CNWD 2VT6A 1Q6HA 2WDZA 1BKYA 4RIIA 1N57A 3EWIA 5IEBA 2J9FB 5HQ3A 3CZCA 2EZPA 1R6DA 2M7WA 1O57A 1X2BA 4WKBA 2WWFA 3QA9A 4D0SA 5KHJA 2FSSA 4AJLA 2QQFA 4V0OA 4I7EA 5D3KA 2QWXA 3G82C 3UQ8A 4ZMBA 2V7QA 2XSZD 2CE4A 3HB9A 2QT0A 1RP1A 1ZDMA 1DVRA 1SHTX 3GRZA 3MWDA 1F48A 1ESNA 1MNAA 4I0XA 5KJ6A 1P62B 2QBYA 2ZAGA 3AUUA 4Q9DA 1MD9A 1PWZA 5BNTA 3LU1A 4P2ZA 3PQDA 3FVQA 1YEWA 4IIJA 3KZMA 5A02A 3U7IA 3RWOA 1ZYUA 3H8WA 1NLFA 1DIRA 4FINA 2E18A 3H0KA 2UUBO 4EB3A 5GZ3A 3A2KA 4H3VA 3BIWA 4K9DA 3COWA 5LD2B 3ESCA 3QSYA 4AUNA 3K70C 4BAYA 3CVVA 1Q2UA 1RQ2A 3TMYA 3K58A 3G59A 1UL1X 5I7AA 3KSZO 1LLQA 1P9NA 4PI0A 2QSJA 2C9DA 5CDSA 2P2LA 4G1FA 4PYMA 1TVKB 4Q3AA 1IHOA 1RBMA 2Z5LA 2R2AA 1ZX3A 2O2DA 3AU8A 4WUTA 5EIOA 1BDMA 2IKQA 2IHTA 2XHEA 2CD7A 1U80A 1Y4SA 2IDMA 2XCOA 4MTFA 2BR4A 2ON6A 5DHFA 4BO9A 3B3JA 3EC1A 2Q5ZA 2BKUA 2CMGA 2NUTA 2BCGY 1XMSA 1VA4A 3WWOA 5ITSA 2L6LA 2G0AA 3WLQA 4A0QA 4NFSA 1UWLA 3I23A 4HNVA 2ONKA 4ZIRA 4BO8A 1Y48E 3JQ8B 4EDFA 1MHPA 3KHKA 3IESA 3U3DA 3BQMB 2FP4B 1I3MA 3ZVNA 1SG9A 5G0VA 2XRMA 2ZW9A 4ARBA 2LNDA 1VBNA 3DF9A 5CR9A 3KJQA 3SVLA 1XRMA 2J3KA 1TL7C 5JSQA 3C6XA 3RVKA 4K2HA 5F3RA 3U4QB 5TQ0B 1EFRD 4ZEMA 3QU7A 1N6LA 2HCTA 2WE8A 2LP7A 5E3JA 3DTNA 1G8GA 1LK0A 3P9ZA 4L50A 4PW0A 5H4GA 4RHCA 2XF8A 3E27A 2VBCA 1ZMRA 4RPCA 3I9MA 2ZUWA 4E2LA 1H6AA 2WR8A 1JJ2U 2X4LA 5H0IA 4ZYZA 4D99A 4ZEWA 4RVGA 4M49A 1WNTA 1ULTA 1P9WA 1KY3A 2G83A 1AKEA 1JU3A 2Q5FA 4INAA 1UT8A 3DL4A 1Y33E 1QLHA 1QIJA 3VAZA 2XXAB 1RZVA 4YLGA 5DHTA 1TPYA 3N2LA 3QFHA 4IVQA 1Z6PA 2QE7A 1GG9A 3Q8MA 1JDZA 2PZSA 3NR7A 4C0JA 1MX5A 3KFVA 1W35A 3NS7A 3VBBA 4C43A 4Q16A 4MR7A 4YREA 3H11A 5LGTA 3UMSA 4JJIA 3P0JA 4MI3A 1VQMV 1PT5A 4DUPA 5IYDO 3R3JA 2J3IA 3AILA 4P7FA 1LWNA 4RD4A 1H4VB 1OIXA 1JMYA 1TM2A 3CLTD 3QPUA 3WYEA 1LH0A 4EYGA 4IRMA 3ASZA 4MUNA 4ER5A 1YAJA 2D2EA 3QX8A 2CZQA 2I34A 2D3WA 3FPJA 1H8HD 4MP3A 3KB2A 3L7BA 3CH7A 2ADMA 2YVLA 4J2TA 2I4IA 3THWA 5BMVF 4QBHA 3C14C 1TK9A 2I3ZA 5AKYA 4OGKA 1RKXA 2JFHA 1NATA 1AE1A 2BMEA 4N6GA 4OFXA 2A1TS 4HTFA 3CJQA 3KV3O 4CTMA 3BF8A 4AJNA 4UCTA 3RW0A 3FSEA 3WGNA 2P4EA 1M1NB 1QH8A 1YZLA 1C4WA 3TB4A 1GTSA 4JMLA 3RABA 3I0MA 3OF5A 2DOKA 2PD3A 3RC1A 2QD2A 1M1KW 4LZAA 1A2KC 1ECBA 1PJSA 4G1VA 5CAEA 4TLDA 4RMHA 3UV3A 4FK5C 2CC2A 5G0UA 1J5EO 2FZKA 4OUDA 2Q6IA 2PSSA 3TZBA 3OD4A 2FR8A 1ZWIC 1KPGA 4MTXA 4TUYB 3FPEA 2IW1A 3KT0A 4Z7NB 4EY5A 1A95A 4WN9A 4RPJA 3NLLA 4B48A 2WU4A 2FW1A 5KPJA 4YJGB 1HORA 1I3OA 2AN4A 3W2HA 4FB4A 2BAGA 4DS3A 1VE9A 3ULKA 2ZTSA 3GJYA 3FYHA 2O3RA 5H6RA 2BFEA 2W6QA 1D2RA 3S1LA 3CT6A 2ZITA 1TK2A 2DLCX 1RBZA 5JW6A 2AJTA 1QGZA 1KYTA 4IKPA 2XOKA 4Z6KA 3IEMA 2EIKB 3OZTA 1RM5A 4FE4A 2IBMA 3KUDA 3G88A 2WHXA 2Q4PA 3QKUA 2VLIA 1YCHA 1ZITA 1YZNA 1LLFA 4D8TA 2PK3A 3L0YA 2HLDG 4PLWA 2OTCA 1EFHA 2XUFA 3S68A 4YJ3F 3M6XA 1ZTEA 2BSAA 2IXEA 3S3WA 4UE6A 4ZHQA 2ZWAA 2IVZA 4JEUA 2EERA 3OJXA 4O5OA 3ZQJA 4MVJD 1P0PA 2AFHB 2ODNA 4YAKA 1KDTA 3IBCA 1HTWA 2ODQA 1WZIA 4OXIA 4MW9A 4L0QA 1J49A 2YY6A 3V2IA 2ZUEA 4QARA 5TT1A 1Z36A 2FRDC 2HZBA 3IV6A 1R6NA 2PFGA 3DW3X 2PLFA 3QUQA 2DKFA 2QE7G 4C7BA 3W5JA 4J16C 4N9WA 3LQYA 4L4ZA 4TWRA 4YCAA 5F35A 3R24A 4G0VA 1KWKA 4GKJB 1O0SA 4DT1A 5CFOA 4B3MB 4H13B 4EFDA 5AVXA 4TLEA 1CWUA 2UXXA 5AM3A 5FULA 4FNMA 4CMKA 2DMXA 5CLIA 3DAFA 4O2BF 1FQKA 1QYIA 4PYQA 4MDHA 4AUKA 5F2EA 1J2YA 1SCNE 2QYSA 3VHXA 3MHTA 2NP6A 1COZA 1K5DA 3PF9A 2ERYA 4PXYA 2C94A 4CETA 3FDJA 5D6NA 3DP9A 1V43A 2PVSA 2FN7A 4JI6B 1E5LA 2Q3DA 1O77A 4ZDIA 3V33A 4G09A 3B9BA 3L8YA 3BA8A 2VXYA 4HLUA 1XNJA 1FRNA 1RHQA 1JJBA 3Q6IA 1OZAA 4IVNA 5I9BA 2XAHA 1YDGA 4JYMA 1IBKO 3U3JA 1DBQA 2V55B 4KI7A 5KNDH 1PNVA 3NYQA 4LJ7A 4W9MC 2PT6A 5H81A 1LDMA 3B85A 2WTBA 4E6PA 1P9OA 1RC0A 2ZIZA 1AQYA 3CCUV 3KTDA 4F93B 1A2QA 4PPGA 5K3OA 4RL6A 1CUJA 3GRKA 2C8KA 2ZXWB 4BDTA 5J4KA 3QPWA 3T3IA 4R2LA 2P5OA 4GO1A 3O3NB 1RZRA 3B7GA 1ZHHA 3IX7A 5B1HA 3OU2A 2NTVA 3SPIA 4RM2A 5A04A 1TMKA 4WFBV 5FI1B 2FUG1 1US6A 1QHFA 4GX2A 2OM6A 2WWTA 1OREA 4O4JA 3GK3A 3X2QC 4B4KA 1JIIA 5T4BA 2OYCA 2PWPA 1RYMA 3V1MA 3M5PA 5IM4F 2NVUA 2R9AA 3NOXA 1JLLB 1H9BA 2EEPA 4B0PA 3WBFA 3AVQA 2PWYA 3P9XA 4ZU1X 5EK0A 5T6BA 2NN3C 3T0FA 3SBXA 5JT1A 5BR7A 4ZYWA 2ZJ4A 5G3ZA 4MEJA 1RPAA 2P91A 2VZ0A 3IQFA 5JJ5A 4RAOA 4GM1A 1O95C 4RQFA 4PLCA 1PDWA 3A7DA 5B7NA 3IBTA 2PIDA 4I9HA 3W3AH 1F2TB 3TGLA 4EG5A 3TDMA 1CXZB 2F48A 2PMKA 4AX8A 1MIOB 3T5AA 5L6MB 3U3MA 1WZEA 2A9HA 2Z4SA 3OQOA 1FVXA 3QFRA 3LZCA 1M2EA 5T8KC 3I8SA 4HH3C 3TO5A 2I6XA 1NMQA 3LSQA 4OP3A 3SR3A 3K71B 2JGEA 3IOCA 1DK1A 2GNOA 3N0TA 4BVKA 4JX8A 3L71H 2G88A 4MZDA 2FN9A 2A78A 1H22A 2IXBA 3GY0A 3EODA 2FPLA 3HRIA 4TV8F 3ZDAA 3W34A 2ZGVA 4EABA 1I0LA 4UNNA 4F12A 2IXGA 2HEPA 4C7UA 1J07A 5DTEA 4GWKA 5I7EA 4RJJA 2OBMA 3IKTA 1G8YA 1KMMA 4JB3A 1CEZA 2FF5A 1EX6A 2JKVA 2VDWB 2ZJOA 1XTUA 1O9BA 5EHGA 3ZXXA 4YUAA 1IK4A 2X5JO 3VPXA 1G21E 2RBEA 4ND6A 3S2GA 3LA8A 3ZN2A 2HBYA 4Q1EA 4M1SA 3C3MA 5L3GA 1J7JA 2NACA 1N5IA 1I6MA 3DDNA 1BMFA 1Z0SA 4PYOA 2HFEC 2C7GA 1O6CA 1M1XB 3N2KB 1DPGA 4B08A 4F45A 2O2IA 4GYCB 5C80A 3CPJB 4M0PA 4ZOAA 2A7QA 3K92A 1CD5A 2OO5A 2XDQB 4JTDB 1Q0TA 3FG9A 1RAFA 3N87A 3GFQA 1EJ2A 3MNFA 2F23A 3OE4A 2R3SA 3NC4A 2TMGA 2YC4C 3DOJA 5L3VA 4J6EA 4GPZA 1G4YB 2VCHA 4NR0A 2J45A 3NRCA 1AILA 3A6FA 3PWZA 3SSNA 5B37A 2A0WA 4NECA 1DAOA 1TM5E 4R4JA 2ZTLA 3O7MA 2C2ZA 2Q1SA 5BW4A 3K0FA 1VARA 2QMQA 4KGZA 3UV6A 4REQA 1UJ2A 1QGUA 2G9ZA 3GT0A 6Q21A 1EWYA 3NCHA 4EJSC 5L6LB 4NE2A 3DCNA 4YGYA 2J5RA 3TG2A 2HYIC 3K1ZA 4ZRNA 2DKOA 2HI0A 5TY0A 1E0DA 4YHBA 3D6MA 4WBNF 2P5UA 4NQRA 3DOOA 2WKQA 4M1EA 2J9FA 2IWHA 1P1RA 3QKWA 4GLBA 3NDJA 3GRAA 1RIFA 1A9OA 3WA7A 5LB4A 1N6PA 4F9FA 2W6CX 3GOHA 1CQXA 1GA1A 5I4CA 1CJKC 5I5GA 5ICCA 1O96A 2XT9A 1JKIA 2J3MA 3KXDA 3BKXA 2HRCA 3V1YA 1KJYA 3K0CA 2R5NA 4CRWB 2O2EA 2FYUH 2Y66A 2CDRA 1WU8A 1V54B 4L8JA 3OZAA 5JJNB 2KHZA 2GNAA 3LQRA 3K5MA 1SKUA 3P9QA 2VLBA 5IKMA 1SXIA 2WICA 2QJTA 2C5SA 4JZYA 3G7NA 4BKUA 4OJMX 3LAWA 4LYJA 3Q7SA 4XIJA 2BI4A 5F7OA 2E4AA 3R65A 3AEUB 5I9SA 1YBAA 3OZBA 2EJRA 1J39A 3DOEA 4X45A 1GCIA 1RI3A 2VDOB 4FPPA 1A0OA 4HS9A 4ONEA 3PHIA 4C6SA 3ZHBA 3OHPA 4WCFB 5BPFA 3N2NA 1FXUA 3ZE8A 5L3DA 4E2XA 5B1DA 4YV7A 2Y4NA 5K6TA 4DSZA 3PWKA 2WT4A 2PUTA 3ENWA 3GJ0A 2QN6A 3NV7A 2FQWA 2D2FA 2G67A 4C03A 5I9TA 2AV6A 1LSJA 2AOUB 4I50F 2WIJA 3VO2A 3IE0A 4FOTA 1SETA 2WNSA 1VLVA 4I1SA 2ZT5A 4JT2A 3E3OA 1IEQA 2RHJA 2IA5A 3LMKA 3NVMB 1OH6A 4X8MA 1T2CA 2W6ID 4P3PA 4AZ3B 1ZKDA 1MAVA 5EVCA 1WUJS 4HAVA 5EERA 4ZT7A 3JQ8A 2VJBA 4AQYB 1VMEA 3H6GA 1OWPA 2YFHA 2FP4A 4K6KA 5F4BA 3WYFA 5DNWA 3C3PA 1HDXA 3MHSC 3H1HH 4KSCA 2VP6A 4BRSA 3JTEA 4OHZA 5AW1A 3VVMA 3O0TA 3TZLA 4OJNA 1YZVA 1CJSA 3OCUA 2ZJ5A 3CUYA 3BDVA 1UP4A 3U4QA 3TKAA 3EDRA 1YC2A 1L5OA 3NFYA 5TQ0A 1VQPV 5KVAA 1NBMA 2AWNA 4DF3A 2GO7A 2ST1A 2G5CA 3BMNB 4W1RA 3KPWA 4L0MA 5JS2A 4FLFA 1HP8A 3LIPA 3A10A 4DL9A 2WHQA 3TLMA 1VGRA 3DZJA 3V8MA 3KP1A 4ON9A 2X0KA 2ZRGA 5KKNB 4XDHA 1KYOF 3G2MA 2I8CA 1ODFA 4XUDA 1FKAO 3OMLA 4HXYA 1BU5A 4QUKA 2GPYA 1E59A 3HQ4O 1I10A 1Z7YA 1MAUA 3T7CA 4R69A 2VJMB 5FUVA 3D2AA 4UBJA 5HUHA 1ESDA 2ID9A 3HNOA 4I5FA 1K1EA 4Q7KA 2UXCO 1Q7GA 5GTDA 3UGTA 2GRJA 5L3CA 5EXXA 1U7OA 1CB0A 3P2KA 3T3OA 2XZPA 1N34O 5IASA 5FA6A 2XCQA 4MVOA 4L85A 3IKJA 3L07A 1ESCA 2CHGA 3ER8A 1FY2A 3C15C 3GNSA 2OILA 4K9KA 3EC7A 4UCOA 3TVDA 3VQWA 3Q3HA 5ISMA 5G0WA 4EW3A 2ODMA 3D3IA 1OAOA 2XNSA 1N0JA 3RC8A 4CYMA 4UVEA 3ZPXA 2XITA 5EE5B 4MV7A 6YASA 3IGAC 4OXYA 1N36B 2ZQ5A 3OCZA 1ACJA 3UMRA 5DHUA 3AGQA 4ZCIA 4LGYA 1BO6A 4UHCA 1P0QA 5FOUA 1VB3A 3UJCA 1T3LA 4AK9A 1QLJA 3SFZA 2WF7A 4TWAA 4YV0A 1ETUA 1U28A 2P1DA 2I4MA 2VJAA 2OLEA 3INRA 5CD1A 1L8OA 3QXGA 4EHDA 4B4VA 1JTFA 4H60A 4JI2O 3O8DA 3TH5A 1M6VA 2ZDQA 3PTZA 5BW6B 3GRCA 5EMNA 4LZWA 1Y5RA 4DNQA 1VL2A 1BZKA 1JLKA 4HGQA 3IOEA 2Y4UA 3VDQA 4WFHA 3A4MA 4IIJF 4GXNA 2W22A 2NSLA 1AKQA 2HQOA 3PD7A 2V1UA 2Q0XA 4WNAA 2RI1A 3N58A 1I2CA 4CKZA 2HTEA 1MT3A 4BVFA 2WA1A 3RSOA 3WIVA 3SEFA 4GHWA 2JEZA 4ZQCB 1AGYA 1XUQA 4O4HB 4B46A 4MW0A 3F7NA 1PBNA 3ABTA 4TUYA 3T7IA 1QE0A 1DQNA 1RTTA 3ADDA 3RSSA 2D1YA 4X64B 3OA0A 4A7PA 1L5NA 3MCTA 2LO1A 1T9CA 2HDWA 1HLGA 1RRCA 3AHGA 3TLYA 4YJGA 1K6MA 2GNPA 3OFJA 3P5BA 5AXBA 4XWTA 1RQGA 1XQ8A 2FX3A 5COAA 4ZZ2A 4PA7A 1JZTA 4RKWA 1Q7BA 2RGEA 3OCWA 1LPOA 1N2CE 1MO5A 1K06A 3UT0A 3E5NA 1UKZA 1GTZA 2EINB 1HMPA 1X7HA 3FCUB 5KKAA 4P08A 3N0XA 2OFPA 3WGOA 1NBMG 3G5LA 2VZLA 5JBQA 2P3SA 1UT6A 1C9DB 1WVMA 1UOPA 1G55A 3P52A 3NHWA 3F6YA 4UULA 2R8PA 1EGAA 2PZBA 2C8LA 1TZ2A 4KBGA 4RENA 4FXPA 2QLTA 1UK6A 4I66A 3A1SA 3HZZA 2AFHA 4HYQA 3IODA 4M46A 4W5HA 1W5FA 2HJRA 3HP1A 3OWHA 1F2VA 5BR1A 3ZU2A 3D3QA 2REOA 5DTMA 2Q2QA 1JAXA 4ZCQA 4QBTA 3LPMA 4QXRA 4PFJA 1UKCA 3PPWA 4FLEA 2Q21A 5GOZA 1XGKA 2ODAA 4OGWA 1JL3A 4RYLA 4DIUA 1KEEA 2GZDA 3K30A 2WE7A 5B1SA 3AQ4A 2H18A 2E9SA 5TPZD 3EDQA 3VHLB 4E15A 3BCUA 2QRHA 4QBGB 3C3DA 5EP3A 5B6IA 4HCJA 1UBOS 1Z2DA 3M5CA 1PZFA 3RBZA 2HCFA 5A3JA 5IJ9B 2WIDA 3GFOA 3PE6A 4R31A 2AHYA 1YU6A 4FTWA 3HB5X 2A06H 3HKEA 2OG1A 5REQA 4PV7A 1VDZA 3CLRD 1WMAA 5THXA 1SELA 2POQX 4AS1A 4MW4A 5B57C 5BQXA 2NMVA 2PD6A 3HU2A 4K9RA 2X8JB 1TE2A 2VATA 3TRDA 5A5FA 1MO4A 4KWTA 4Q20A 3KD2A 2X0EA 3DDZX 3QU2A 2ZATA 4D9NA 4WVFA 4RY8A 1WDMA 3EAQA 4CG2A 3AKDA 4GCZA 1DG3A 3D7LA 4PSKA 3I42A 2AI1A 3D36C 1T2VA 4M8SA 2C0CA 1DIAA 4QPCA 2FZWA 1R0ZA 1HMYA 4II3A 4RTQA 2WY2D 3NPAA 1X39A 3H5RA 1DAHA 1GKIA 3EMBA 2EULA 4G41A 5ANRB 4E30A 2A3QA 2JJ2A 4JUFA 1FYEA 1W2GA 1SKYB 3U3OA 2ILVA 2OC4A 4AICA 1XD9A 6GPBA 5TMBA 1S5LZ 3EXHC 4D4JA 4UUNA 1BEEA 2BFCA 4AKTA 3BDIA 2CCKA 3BE4A 3K6SB 4P58A 2OMEA 1JDSA 1Y9AA 3B8NA 1I8TA 3I5AA 4R2WA 5BYJA 5IC5A 5EIAA 2POCA 4J0KA 5IUJC 4KQCA 4L15A 1TPZA 1FZQA 1U5AA 4K35A 5H3HA 4CLEA 1UJ4A 1FDIA 4C4XA 3IOMA 4QTUB 2Q1WA 5EJMA 4PHCA 5DEOA 2ZE5A 1XLTC 2WQ7A 5LJIA 5DSXA 3ESQA 4OVKA 1JLLA 2SKCA 4D8VA 2NU6A 1JBEA 1GKLA 2P7TC 1PJRA 4UHBA 3L4SO 3A1EA 2WF9A 2XB8A 3RVBA 3B6KA 4OQNA 5DEDA 3LOPA 1UPBA 1FFHA 4M7RA 4EUSA 1JYEA 1PYGA 2ZVPX 4BQPA 2PAAA 3T9AA 3RNLA 4KFSA 3V7UA 1II0A 3A6KA 2AR0A 3D8SA 1VE1A 4M9QA 2G7ZA 1UBRS 2IOYA 2R00A 1F2TA 4U9IS 2IZZA 4QYTA 4L72A 1MIOA 3GJ6A 4JI1B 4EG0A 4XXHA 1EWKA 5TEVA 4DSUA 4FYMA 1BEZA 1FOEB 4YQFA 5EZ6B 4K28A 4LRUA 1OPXA 1VMAA 4G1BA 2FMXA 5HIJA 4E2FA 3VV2A 2BBTA 1BRMA 3HB1A 4UEOA 3AG1C 1KGDA 1U65A 2XASA 3M8KA 4F3RA 5CBKA 1JHZA 4O2BA 5AKHA 4XLLA 3FNHA 3K9SA 1AZTA 1YJNV 2VRCD 1EVQA 3OJEA 1Z56C 2Z95A 2J9RA 4LSWA 4S0XA 2CLEB 4QFDA 3VR4H 5KIAA 2ZUSA 4NXNB 4PR0A 3DQPA 4WINA 1CLUA 1JI3A 2JZOA 2GTPA 3GDOA 2IBSA 2PQMA 1QDLB 2ATKC 2J0SA 3WQSB 3WB2A 4K3UA 4Z9AA 3BXFA 1EVJA 1MVOA 4J1SA 2PUGA 2C8VA 1Y98A 3ETNA 1VSQA 4QUBA 1ZD5A 4N40A 3QKRB 1JSZA 2VDWA 4PXSA 1GY8A 2NP7A 3AEQB 1WVGA 2JGLA 1KYZA 3D64A 4LHXA 1BA2A 1ND6A 2GJKA 2FWRA 1HDCA 3WRYC 3G1WA 1AF7A 3MUOA 1GM8A 3ZU3A 3KR0A 3YASA 2PRSA 3DPSA 3VR3D 4MQEB 1MC8A 4NTYA 1TW2A 1NI5A 2GLUA 4LHWA 1GN2A 1J9GA 3DWEX 1XOUA 2QM0A 2ZYUX 1N5MA 2XDQA 4GOJA 4DTCA 2XTAA 3AY7A 3IQIX 3KZIZ 2B5WA 1MX1A 1N78A 4NBNA 1M72A 5D6OA 4UARA 2F93B 5BQ3A 5D5QA 4DV4O 1RNLA 3IFXA 1ZISA 4NWIA 1FUYB 4IMPA 4BNMA 1U4NA 4H1VA 3BXGA 5BRAA 3E5MA 1P6UA 2CWWA 2DQYA 3RU2A 5KSOA 1UFQA 3LO5A 1Q6ZA 4C30A 3DBLA 3AG4C 4N3CA 4B7ZA 1U2RA 3K3WA 4P9PA 2GR9A 3ZXSA 3ISJA 5B6PA 2WM3A 4US0R 5IT5A 4PZZA 4IDGA 4Y1RB 4KRFA 1VL5A 3EZLA 3IDOA 1OXVA 2FPGA 2R7LA 3R0QA 3BSWA 3KCQA 4N54A 2P0YA 3UANA 3EUAA 1J95A 2WLJA 2B78A 3F3SA 3HVUA 5IVHA 2DG2A 3ED1A 2BL4A 3CG0A 2NUAA 4MUXA 1RCFA 2JZCA 5C8VA 4E22A 4IJQA 1YOVB 3HM9A 5BN3B 1R0RE 3L4JA 3EH2A 5C8DA 3RS7A 3E22B 5BUZA 4O4JF 2PXXA 4OXKA 4O2AF 5KNCD 2WG0A 3IDZA 2A4MA 2NZJA 2PCLA 1K3UB 5E1DA 2Q6OA 1VZ3A 2BD0A 1X7XA 3A06A 4G9BA 3V5NA 1IVYA 4GR4A 4TV8A 5KVCA 2AN9A 3DBIA 3ZQUA 3E7WA 4OLFA 1ISIA 5I9NA 1YS6A 2B4YA 3WK6A 4DEVA 3ZBUA 5DI3A 2F1JA 2XAFA 4I19A 2IUFA 1SIBE 1YR2A 4LWPA 1C3EA 2AHZA 5GWXA 1JU4A 5HYVA