3WB0A

Hcgb from methanocaldococcus jannaschii in complex with light-decomposed fegp cofactor of [fe]-hydrogenase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
158
structure length
158
Chain Sequence
b'VVMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0488
publication title Identification of the HcgB enzyme in [Fe]-hydrogenase-cofactor biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 59
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.-:
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3wb0A01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3wb0A02
1IWPB 2F1MA 1UC5B 5D5QA 3LNNA 1IWBB 1DIOB 3WB0A 5JJNB 4GYCB 3WB2A 3AUJB 1NBWB 1RSOA 1H2SB 4DK1A 2V4DA 5JJJB 1UC4B 1EGVB 1EGMB 1MMFB 2F93B 3BRCA 2D0OB 1T5EA 1EEXB 2F95B 1VF7A 5D5PA 4DK0A 2D0PB 5JJEB 3WB1A 4L8JA
chains in the Genus database with same CATH superfamily
3LPAA 1LH0A 5EMNA 2C4UA 3OMLA 3PTZA 4LCUC 4QWMA 3ESQA 1WCV1 3PDUA 4HAVA 2NSDA 1CZLA 5L7WA 3I5MA 3AFGA 2NUPB 1MIHA 2FZ5A 4AKIA 2J4DA 3RVDA 4RK6A 2HVJC 3M7MX 3UW1A 1MNAA 2GT1A 3NASA 4ZD6A 1NP7A 1SUBA 3LTNC 1Z6AA 4LJ9A 2AFHE 1V8OA 4FFPA 1D6SA 1WXGA 3H0EA 3LW8A 5GTIZ 5HFAA 1SZTA 4P82A 1F4LA 1ULSA 1T0UA 3W5BA 1JZQA 2PVCA 5TMPA 4HI0E 4U2BA 1R7RA 3DTNA 3VI3B 1WAMA 3ZRVA 1OXMA 2PXHA 3ZC3A 1VI6A 2H48A 2XUJA 2CZQA 2NTVA 5C4MA 2ZUDA 2VZ0A 2OL4A 4KXUA 2O2ZA 2ZREA 2Z30A 4EPTA 4X3OA 3WRYC 1GG2A 1EXWA 1VHLA 1CLEA 1KYWA 5FA8A 4JOBA 4QQFA 1FRQA 4BWYA 4QJ3A 2IE8A 1C1DA 3GMIA 4WZBA 5I7UA 5AW3A 1SXJB 3RSGA 1QOZA 3CMEV 4MR7A 3EXFA 1JIUA 2I03A 1U3TA 1NXWA 5A5VA 2BR3A 1XTZA 4XUCA 1USWA 2WSSA 1Z8HA 3RS3A 4QE3A 4K86A 1XQ6A 3VR4D 5DE3A 2FJUA 1B2RA 2I67A 2QMEA 3TOXA 3CEAA 4RD1A 4IPTA 2WJZB 4LOKA 2DKFA 3OOSA 3L9DA 1QK5A 1Z06A 1SF9A 4ZQGA 1MVLA 2WJWA 1UPBA 3C90A 1FP6A 1G63A 1FE8A 5J2UA 2KLHA 1B41A 3WGUA 2UZ1B 4I9NA 3VHXB 2GUWA 5CBFA 2FRVA 3MGCA 1BC5A 1U0EA 3U7GA 4JBYA 4M53A 3E8HA 1BKSB 3QVUA 3W5HA 1ESZA 3VSDA 4Y9DA 3S7ZA 1RQNA 3TRKA 1XAHA 1E1YA 3N8HA 1M76A 3HUUA 5KHJA 1BMTA 1WDMA 3KYJB 3IEPA 1KPIA 4MTGA 1I32A 3SXJA 3ZEIA 2XVXA 3WE7A 3FAVB 3GT3A 2VNHA 2Q46A 1I5XA 4L5IA 3CSUA 2W58A 4PDLA 4BU0A 3FRHA 1Y6GA 1NC1A 1NVUQ 2CYBA 4DLSA 3V8BA 2A86A 1ZM2A 2EOAA 2X4GA 5EERA 5BVGB 2O7NA 1UOEA 3WGJA 4W8OA 3ET5A 4CG1A 3W9SA 4QXPA 2PHZA 1VIVA 3PC8A 4X65B 5SICE 4G0NA 1VQ5V 2F62A 4NAUA 2H29A 3TXAA 4V2IA 4D3FA 3B2QA 1O4WA 3COYA 4KWIA 1DCKA 2RGGA 2WU4A 2ONJA 4NZPA 2OCHA 2GCIA 4HMQA 1FFWA 1OF1A 2WTEA 1MZEA 1OBCA 3ZDEA 3QF4B 3BMCA 3K09C 5KREA 4KFMA 1Y4MA 4QDUA 3ADPA 4ZRDA 4JUDX 3EZ9A 1H2NA 2XE7A 2Z2YA 2HLNA 1LVGA 4QYIA 4DJEC 5C5CA 3KTDA 4HMPA 4Z4IA 4JYMA 2WM3A 2Q1UA 5F51A 4L5YA 4FFBA 1TPYA 1IZ0A 1ZUD1 3LPMA 5AJTA 3AVPA 1E3IA 4OHZA 2P9BA 1Y76B 2QXYA 1EFCA 2ZBFA 4NK5A 1V3VA 2EW2A 3LBFA 5KNDH 1E5DA 2CYCA 1Q0RA 4XWGA 3SBEA 4IYIA 4DV3O 2F67A 2J30A 2ZR8A 4H7PA 4BYMA 2ATKC 2C4VA 3HVHA 4DR2B 1XTJA 2H3OA 2EW8A 4GDMA 4EPYA 3Q9SA 3STUA 3NHZA 4BE4A 4NCHA 1FFHA 3NBKA 4YAEA 1JDVA 4E32A 1LK0A 4EO7A 3VYVA 2BTOA 4V38A 3OC6A 5KNBD 1VLHA 1WKBA 2OM6A 4NDNE 1TUEA 5HDBB 1FFEA 4G8BA 5E2IA 1XU7A 2ZAOA 1NSTA 2QMHA 3U7IA 4C1BA 4WCFB 1UMDB 5LVAA 1W0KD 3K94A 4EHHA 3OX1A 3C5VA 3QMMA 2A30A 5IXSA 1MH1A 2EJUA 5JS7A 1H38A 2WVHA 1DCMA 3PHLA 3DD1A 2EIXA 2CBGA 2AOUB 5L8VA 3I52A 3PRYA 3ABKB 2FEXA 2VQ6A 2A4MA 4UUJC 2Q0OC 4JI2O 1IYZA 4NYJQ 2CLEB 1P0QA 1IVSA 5HF5A 3TVYA 1YDWA 3DE5X 4UDYX 1GMGA 5D7BA 1UBTS 4TWBA 1UBJS 1MHPA 1U8UA 1PWYE 3FYCA 3M5WA 1A5SB 5T8KA 4MV4A 1KFJB 1MP0A 1R12A 1BGYH 4PS1A 2GCGA 2R87A 3D5EA 4ISBA 4ND8A 3I8OA 4XUEA 3FIUA 3U3JA 3N8IA 1HRDA 2RN9A 1SUSA 2NLOA 4JN6B 2YV5A 2HMWA 3GUYA 1TJPB 1AXEA 1AVTA 2FG5A 5E8RA 1KQSU 5H82A 3H11A 5F21A 4R5HA 2RCNA 3CUKA 5DNCA 2HC9A 3EPLA 3ZEAA 4DCVA 3D8RA 3F6SA 2AG1A 2P2NA 3HNOA 4A6PA 1YCIA 4DG8A 3FE2A 2IHJA 1ZY2A 5KHOC 4NMXB 1SGWA 3KQWA 1MJFA 5I3ZA 2FUG1 4HQRA 4HNAB 1HA3A 2SECE 8LDHA 1VMDA 3GLIE 1VLZA 1NT2A 4QELA 1FU7A 4LJ6A 4G26A 3HCOA 3WLRA 5DTMA 3RYCA 5AVRA 2AOWA 2I8AA 2EX0A 1VFNA 4UCTA 1MGPA 2OFPA 4HH0A 4FKZA 3IESA 1ZAKA 2EKBA 4NY1A 3NWPA 4JVOA 5L4LA 3NHMA 4YCBA 2FRDC 2QBYA 2FSSA 3PU6A 1O0SA 1C9KA 2CDRA 3KUXA 1CUBA 4U0JA 2PUJA 5JRZA 4RPCA 1ZONA 3ND8A 1QHGA 3U3ZA 2EX1A 1H6AA 1WDKA 5CG1A 1CK4A 3F5TA 5ICCA 5EWJA 3C3PA 3RWRD 3WWOA 2GZ2A 3CPHA 5LP1A 1WOYA 1VXRA 5LGUA 2RD2A 5ERYA 3CN9A 2YXBA 5H9CA 2R8YA 1FNNA 3DLTA 4RSHA 1EBBA 1U2PA 3VKVA 4FE3A 2A0UA 1USGA 1C3JA 4HC4A 1NJGA 1FTWA 3F3YA 2IWRA 1FXVA 3WFVA 1GEGA 5FA6A 1TJNA 3BDIA 1GM9A 4BGEA 4U7FA 3IQGX 2QVXX 2DSNA 1OXKB 1QOQB 2FYTA 1P7GA 3CC8A 3V2UA 2XB6A 3L6EA 4Q4HB 1GKLA 3H1AA 4BL5A 3H2SA 5CNJA 4OXRA 4F7WA 4CH5A 1Z6XA 2NM0A 1XSEA 4B82A 1XZLA 1MBZA 5LB2A 1B16A 1RLIA 4EG4A 3GEIA 5B66Z 1FFSA 3V46A 4RZIA 4H7HA 2DTEA 4G25A 2ZB7A 4MK4A 3KJGA 3BT7A 5GOTA 2JIZA 1K8ZB 4M6WB 3TLEA 1GLGA 4BLUA 5EG5A 1GZ3A 3B9RA 3C7CB 3A36A 4QSHA 1WZCA 3ILHA 5A0VA 5ILQA 3IULA 3VR3A 2FCRA 4N76A 3HH8A 2YXEA 1K08A 1L4UA 5TPWB 4ENVA 3B40A 3C4JA 1YFJA 2H11A 5CTAA 1RKBA 5AYVA 4DV4B 4W82A 2ZXEA 1QNFA 2ZWPA 4INOA 1YIAA 4QLBA 3KG2A 2G9ZA 4IW3B 4YXFA 2Y1WA 4WLOA 3H9BA 4O0LA 4BOYA 4FVTA 3BJIC 2PWYA 5A5GA 2QRPA 5IANA 1RD4A 2H1HA 4B3RB 2W6QA 5CLLA 2UZAA 4AKHA 4BC0A 2D1FA 4QWWA 3VSEA 3EGIA 3COPA 1X7ZB 5SV2A 2YICA 1EMDA 3A70A 1I7NA 4A7PA 4DRXA 4V3CA 1MRZA 1YF2A 4Y2GA 1KIFA 1RWQA 2NO4A 3SEZA 3P3NA 5A05A 1N75A 4EW3A 4HJRA 4U6SA 1ZWLA 4BCCA 3SGIA 1I6KA 2GPJA 5AK3A 4I0XA 1LFDB 2QRQA 2ZWMA 3ASOC 3KELA 3OIGA 2XQJA 4E2YA 2LD4A 2IYTA 2BMVA 3I8SA 2PY5A 1Z63A 2JPDA 5L3SB 3G2OA 5EHQA 4BTLA 2EINB 2O8DB 5TS3A 5I9LA 3L7JA 3VJRA 4Z9YA 1DCFA 2X7XA 1S1MA 2W6NA 3AONB 4O2BB 4KXNA 3AC0A 1RMYA 2C7RA 2WJVA 1N2CA 3VU1A 1H22A 3GDHA 4IH4A 1DKNA 1P5FA 1VGRA 5K2OA 3R0JA 1UPFA 1M1NA 4WINA 2QIOA 5DM1A 4NYJR 1LPOA 3EZLA 3JQBC 1KI1A 5IP5A 3HDVA 1NJ1A 3USCS 1M33A 3FAKA 3KAPA 4ID9A 2WV9A 1MGOA 3K9BA 3CVOA 1XDUA 1N3LA 2Q50A 4FOPA 5K20A 1NJ2A 3R76A 5KUMA 2Q4EA 1NW6A 3RTBA 1RAAA 1E2NA 2VTKA 1PZEA 3PDWA 3SM3A 4P4NA 3EFBA 3RUIA 3IXMA 5L4SA 1N2EA 4ABYA 2ZUBA 3O2JA 3VOSA 3NTOA 2IPLA 5BR4A 4DLUA 3RT9A 2J09A 3INTA 3D3WB 4MUXA 3RHSA 1QGED 3FHCB 3OM9A 4OX9Y 2DHQA 1SS3A 2BP7A 1NW7A 2HLDG 3PYLA 1OZHA 5IWCA 3OZTA 4GGPA 4PCVA 5KVSA 2HEPA 4ZYLA 1XJCA 5ESXA 4QPKA 1C4WA 4LXQA 3VVLA 4J0QA 2JATA 3HWX1 1CHDA 4UMEA 2CNNA 5B1BC 3BL5A 3NANA 1ETHA 4KR0A 4WZBE 1D6JA 4TSKA 1G0NA 1ZD1A 2LDBA 3DLPX 4L6IA 3HCAA 4PHGA 1QRAA 2KSQA 3N8KA 3S1LA 2A9RA 1CIJA 2B4RO 5JAHA 2GAAA 3PS9A 1YMUA 3RV3A 2AE1A 3A9CA 1CT9A 5D1HA 3GWOA 2NW6A 4PQEA 3J7AU 3L1IA 4NAVA 4ARIA 4GL2A 4OFWA 5F3DA 3VPHA 3R3VA 4AG6A 3RU3A 1CV2A 4MV3A 2P4KA 1E5LA 4P9PA 5KSZA 1RHMA 3DZHA 4YP6A 2MYUA 1DRWA 4FMTA 2SCUA 4LK3A 1XB2A 3ZR4B 3R7WB 2KWIA 4RNDB 3H6HA 5H9VA 2L0XA 4JJIA 1E9RA 4Q24A 1IUKA 3R6GA 3H1LH 1DKQA 3NWJA 4F8JA 3QE2A 2RH9B 4A73A 5DGCA 4QTYA 1YH3A 4U9HS 3RT7A 2I54A 2V7TA 3SYAA 3FMGA 4X71A 1WCYA 3PUXA 1JG4A 2IS1A 3WBJA 3S8YA 2J7PD 2CXNA 3ETDA 1AR4A 2FLWA 1U2EA 1JHPA 4RXMA 3SJZA 3HB7A 4DA9A 5LIRA 3BKXA 3E27A 2XAUA 2PL1A 3LJKA 4D4JA 4ALJA 1QH9A 2A9QA 1Z35A 4ZQHA 3Q1LA 4WKCA 4MHTA 2OCDA 3QHQA 2PMBA 3QNWA 1B6QA 4YHBA 3TJTA 1RQ7A 2HDWA 5KA5A 4IY1A 1HDOA 1EVEA 4GLXA 3QSGA 1I2AA 4TLAA 3WWYA 2P4SA 2JG3A 4ARCA 5A9RA 3QWBA 1E6UA 3WO1A 4V2UA 4NZNA 3ITKA 1GSIA 4LPKA 3GJ5A 4OY3A 4R84A 4RK1A 2I55A 3B89A 4J4BA 4KPEC 2NN4A 4QUEA 2AW9A 1AN9A 1Q44A 1DO2A 2PSDA 4L9AA 2A1IA 2WUWE 1JPNA 3KVRA 4DSTA 1DMSA 4X9QA 1NBWB 4JCCA 2W48A 1CQJA 4XSVA 3V2IA 1OI4A 3U6BA 1ENPA 1PG2A 2TRSB 1XGKA 4DR3O 1A82A 1FEZA 4LBVA 4QGSA 2EFCB 2AMFA 4QOHA 2VP6A 4ALNA 1X3SA 1WB8A 4H7JA 3AEIA 1LNQA 3CNBA 3BVPA 3PITA 3OE4A 1E3SA 3QQPA 1TAHA 2P5SA 1JR3A 4EAAA 2I33A 4PEVA 1GM5A 2I80A 5EINA 2OFOA 1A7AA 1FP7A 5B6JA 3G9ZA 4NVRA 4W1SA 4HYYA 5LZ2A 3CG0A 1PBTA 4IYRA 2XDQB 5CLJA 4X5OA 2G9VA 2ZM6B 1T2NA 5B1HA 3W1EA 1XMJA 1HYQA 2P1DA 4H1VA 1JHRA 1U6JA 1V11A 1O6FA 4OB7A 1A4RA 4MVXA 1ZM3A 3HK2A 3PQ5A 5JJBA 4YAFA 1JXOA 3IAYA 3EIEA 1KU9A 1RPZA 1IWPB 4R1UA 4HJXA 2DYRC 1ODLA 2QTMA 2RGDA 3RSQA 3CKKA 3LA8A 2HSWA 2C58A 4IRMA 2H4FA 4MPPA 5G02A 2BFOA 1IEXA 3ZRWB 1GAWA 3WOHA 3K92A 3HUTA 2OCKA 2ZWOA 5ALMA 2YCBA 5EPEA 3EMBA 4Y0AA 1A5ZA 2A92A 3DUWA 4K87A 1IM2A 3V1TC 2VF8A 1PTJA 4RBNA 1PLLA 1H2XA 3JAKA 1TM5E 3DBRA 3FRJA 1E1LA 3A4VA 3ZQJA 2J7KA 3HWRA 1NXTA 3K0BA 1TNDA 1MAHA 2HQ1A 2OCIA 4LDPA 4UDNA 3CLRC 2QPLA 3TD6A 3ETLA 3ZY4A 2Y69B 2P90A 3NXSA 3TE6A 5IYZF 5C35A 3GT7A 3CPSA 2WM9B 1FFYA 2RI6A 1ZIYA 1X1AA 1I1QB 1Z68A 2OB2A 4B4DA 2QDKA 4D02A 2JHCA 1M73E 2F4VO 3CJHB 2Q4BA 3JU3A 4JI8B 4BKQA 2XXAB 2FNAA 4LOJA 3IDSA 4F6RA 1Z4PX 1YJXA 2ODWA 4FGJA 4DKJA 3GLQA 1FQKA 1JQLB 1ZPDA 3MW8A 4WNCA 3OEYA 3ED5A 5BYJA 3L8CA 5I9NA 2WA2A 4MQUA 4BMCA 2A06H 2BWJA 1B23P 3G6BA 2P69A 4DT1B 4B8YA 3TCUA 4EFNA 3U48A 4PQFA 3EF0A 1UDRA 3PL1A 3EGWA 1XWIA 2CLHB 3IMCA 3L7IA 2RHHA 4RJJA 3ZTTA 2CMFA 4YFVA 3QWIA 1W85B 3GRZA 3KD2A 2VSXA 1XTSA 4LFAO 2DWPA 2XW6A 3U80A 3MMNA 4B45A 1WB9A 1PV2A 2AEJA 1XHZA 4O8ZA 1VI2A 4ZI5A 3V4SA 1FUKA 5IEBA 1T3ZA 3NHAA 3KSUA 4F3CA 3N2YA 4A4DA 1DC8A 2IBMA 5LP6A 1VKOA 5DU2A 1J33A 5ADUS 2VTEA 4LWSA 3ZNNA 4OHCA 4PYIA 5ILOA 2Z8ZA 3WZ2A 3KWMA 3VDNB 2HQOA 2OORA 4BIMA 4QD3A 3U26A 1L4HA 2D54A 1N6LA 2CFOA 2UXCO 2OV1A 4HN4B 3GGSA 4HWRA 1T8WA 3AK4A 5TMEA 2OCGA 3PJDA 4EZIA 2PWZA 1ZAYA 3L40A 4AQYO 3BJRA 2BDEA 4O4LA 4HEA6 4BN0A 1GAEO 3P9QA 4G0PA 1KEEA 4J07A 4CETA 3HR8A 2C5AA 4XE5A 3I55V 3CMAV 1JDBC 1K5DA 3WIVA 1RMTA 2BGMA 2O54A 3C3AA 3QXCA 2BL4A 5E4TA 3G8BA 2BFEB 4EX7A 3TUJC 3R7BA 4J16C 2OC4A 1P80A 1GXSB 4DW0A 2KE5A 5CX4A 3KKEA 1MMMA 4GYWA 3ZLTA 2X1LA 2JAQA 4AUNA 2WTAA 2BZGA 3QQ5A 4MVRA 1K6EA 4H13B 2PUWA 4CG3A 3QLUC 1N2JA 2BMJA 5AW2A 3KC2A 4GKJB 4Q02A 2NT3A 5AVTA 4YONB 5F1YA 3NHSA 1KH1A 2X4IA 2C2OA 4JEUA 4OFZA 5DHRA 4FYHA 3QHAA 4CF7A 4WCEV 1NBIA 1NFFA 1T9BA 1E6KA 2ZE7A 3LK7A 3B1YA 2W2XA 2XNJA 5CEJA 4OL9A 1VI5A 2C84A 2Z0MA 1WULS 3WWCA 1JJBA 3W7SA 1IBRA 1DG1G 1FJ2A 2H3HA 1L3CA 3B3QA 3R3SA 3DJYA 3UMFA 2B0JA 1BS9A 3HXQA 2ZQYA 1B93A 1ACMA 5BN3B 1S5HC 1FXUA 4DV6O 2IELA 4MIYA 3DYBA 4BNIA 1YRWA 4DIEA 1SD2A 1SAYA 2ZJOA 4WBXC 1HV8A 2XYHA 1HE1C 5A6SB 4D9IA 4COOA 2BTEA 3KEMA 4LXXA 1DF4A 3U6KA 1SCNE 2QJOA 1EXVA 1FS0G 4X61A 1BGXT 4EFDA 5HF6A 4TSFD 3ULKA 1YVPA 3IV7A 1KZGB 5I7OA 4IF4A 2AFHA 3FNFA 1HYBA 5BVHB 4DGSA 2XCSB 5HWSA 3C4VA 4KE7A 1K7EB 4GT1A 1KSJA 1U0RA 1CX9B 4JVSB 3PHJA 3R5HA 1FZTA 1QG0A 3QVXA 1A7UA 1Y81A 1PK9A 2Z83A 2D4HA 2EIJC 3SQXA 1BMFG 4CM4A 1XQ9A 4C0QC 5JCPA 1NG1A 1TF5A 5LQMA 2X22A 1N2CE 4MJXA 3W5VA 1UT5A 3KZCA 4MWOA 1KI7A 4EYKA 2VA8A 1K6IA 1QSGA 2I91A 1YCDA 1NX6A 2O05A 3EVKA 2L18A 4P38A 3UA4A 4C0KA 2TMDA 4JBXA 5E3JA 3QKSA 2CW5A 1C9EA 4G5SA 4I1PA 2O2EA 2JLZA 3MT8A 3E1SA 2UYHA 1NI4B 1XK6A 3HRKA 4QPJC 1G5PA 2H4WA 3HC7A 4JYAB 3MTJA 2DG2A 4OH1A 2OAGA 4JLSA 2K2QB 4X7PA 4W8GA 2P22C 1IJKA 3QFHA 4Q00A 3D6JA 2QRVB 1MJ5A 2RE8A 5JWPA 4KVGA 2ZUWA 1VG8A 4LBWA 4ZEMA 2Q9UA 2GTPA 3VKWA 3WL7A 3D6MA 2DFTA 3T3EA 5A5EA 2Q07A 4MRMA 1I1HA 2CNBA 4DUGA 3H83A 1IXZA 1IJBA 1JEDA 4OQMA 3WLSA 4FSDA 4QU5A 2WOOA 3VAAA 1ISGA 1PFKA 2JRLA 2WVAA 1XAIA 5EJFA 5LYYA 3L93A 4PFKA 1OHHA 4AP9A 3ZXUB 5HIMA 3EIOA 2IF0A 1AB5A 1JSXA 3HY3A 4QDOA 2PIDA 5HZHA 3U44B 2QL6A 3PE6A 1MOSA 2ZJYA 4CH6A 2RARA 3KE8A 4QUDA 1BH2A 1EP2B 2WW8A 1ZN8A 2EWMA 3FI9A 5CXUA 1ESEA 2XUMA 3DZJA 4FN4A 3E53A 4JA2A 5A0FA 1JJVA 1UZLA 4UVHA 1ORQC 3CC7V 3ROMA 2P3QA 3LZCA 2PG3A 3AYXB 3EIHA 1WNSA 5JJCA 5K8UA 2Q1WA 4EKYA 3QLTA 4IUDS 4K9KA 1ZVMA 3S2UA 2Q3LA 2J3QA 2J1LA 2PRSA 2YS7A 3DC5A 4OUKX 4AW9A 1LZLA 4QYXA 3DEKA 2N9UA 4XGNA 1L3IA 1LRJA 1WTAA 4CQMA 2HREA 2QPAA 3HPQA 4BAYA 3T3HA 4YNBA 2ZTVA 5L3ZA 1RMQA 3FTQA 2FGKA 1V4NA 1NNSA 1Q1GA 4F2DA 3VNVA 4V0NA 4B83A 3H0CA 2BLLA 1MZVA 3LGXA 3SYTA 3L06A 2QK4A 1ONPA 4Q47A 3K6SB 3QU4A 3KRTA 1SQXH 3GFSA 3CF6R 2X5XA 4ED9A 4AECA 1CG6A 4JEHA 1FXKB 1HO3A 1R6DA 1XP8A 3FGOA 1GTRA 3E2EA 3CA8A 2WHEA 2XOKA 3T3OA 3IVRA 3S4YA 1U8TA 5DV9A 1J0DA 1WBDA 3UCXA 3GUUA 4YRDA 1ZW6A 3UT5A 1GQQA 5LWQA 4Q48A 3UAXA 1L6IA 4GPZA 1V45E 1T25A 3T12A 2PYJA 3DFKA 1JR6A 4DEXA 3G82C 1RAEA 2QAGC 5BV2P 5GJWC 1LS6A 1D9ZA 1NTOA 2YHIA 1IQRA 3ZK8A 3N2IA 5JHGB 4KQ9A 2V3VA 2FE1A 3SK0A 5BWNA 3P94A 4F56A 1JPUA 3O9MA 5J5AA 3ZIUA 3DHNA 4K3UA 4PO9A 5H81A 2BM8A 1T6BY 1NN1A 2IFTA 4YCSA 1GGKA 4ESEA 4FS8A 3K70B 1PKXA 4I55A 2EGGA 3L3BA 3BWYA 2ZJZA 2Q1XA 1DZ3A 3TEJA 4XW2A 3PEYA 4XIIA 4N6GA 2XHZA 3DXFA 1W5TA 3ZCUA 2C2MA 3BPSA 4AILC 3RRJA 1I2BA 3KCNA 4KBFA 1Z15A 4BFSA 2WY2D 1NQOA 1P3JA 1HMYA 2ABWA 5IT5A 2OO7A 4PZCA 4IJMA 5HKKA 1CQWA 3AETA 1KNXA 3EN0A 3H8JA 1X86B 3E9DA 2PYIA 1ZVQA 4QVGA 1ZIDA 4GRAA 2XVMA 3WHLA 1LRLA 4CFYA 5DM6V 3GGDA 5D2CA 2YJTD 1JPVA 1IJFA 5E1OA 3TTXA 3OPVA 1XRRA 1RJDA 1NVKA 3NIWA 4P4GA 3R7LA 3LUAA 1ZU5A 3TQRA 4EVIA 3NRJA 4B2IA 5TJHA 3CRW1 3UJCA 3ZD8A 5A3RA 3GU3A 3C0KA 1KARA 1ZCZA 3ZVRA 1RQ2A 1R37A 2WNIA 4PU0A 4ER0A 3UYKA 5G0UA 3WB0A 3VC3A 1UJBA 4BV2A 3SJCC 1YJ8A 2YJZA 1NFQA 1VDZA 3U60B 5HKBA 1H66A 2E2WA 5H3LA 1I01A 5COBA 3N87A 5AVJA 1N78A 1VE6A 1YFLA 2WINI 5FA5A 2R6JA 1INLA 2JB9A 1KP9A 1MENA 5C81A 2HV8A 1A9QA 4E1AA 1EM1A 1FBTA 1WCIB 4HBGA 3CUSA 2I9KA 5K1ZA 1L5YA 1OYYA 4KV7A 4INAA 1AKQA 1JR2A 1F48A 2RGEA 3HDJA 1XLVA 3QVSA 3BIOA 4YUVA 2EP8A 3K8YA 4DSOA 3H42B 4NF2A 4BASA 3CMCO 1KPHA 2GD2A 5KYGA 1DQZA 2F9FA 3I58A 2A33A 4LF8O 2GPWA 3FUCA 4E7PA 2JIRA 1II9A 5JXGA 3AWIA 2R6AA 3B78A 1CUDA 4G0XA 2FMUA 2XB2A 1XZMA 4QBKA 2ETVA 4FXOA 1F4VA 4EB0A 4ZICA 1TU4A 2C2KA 1S3FA 4MYSA 5H5NA 5DNEA 3PX2A 1IDOA 5LDGA 3WRXC 2J3EA 1ND5A 1PI3A 2YV2A 3SBDA 1XEFA 1F1BA 3GFTA 5GPBA 1S2IA 1QHTA 1EFPB 1QIDA 4GMDA 2XTNA 4PC1A 1L4FA 3FSGD 4OSOA 3UOGA 1UBLS 3RTAA 4X60A 4MVJD 3V6MA 1IY0A 3FPCA 3I4FA 5GWXA 3TMAA 1RACA 5IK2A 1AC5A 3CLKA 1ZTEA 4CMGA 4OXNA 2RHJA 2JS7A 3AF1A 3ELUA 5EUQB 5TARA 3K9FC 2Q7GA 2ZJ8A 3TAHA 3Q10A 2SBTA 2WK1A 2PZKA 3SHTA 3LQQA 2PMDA 2X86A 1U3WA 2PMWB 2HF2A 2IH5A 1KK2A 2HEGA 4N5IX 1NOIA 1SZJG 2WTNA 5FWXB 1L3BA 9LDTA 4F8EA 1X1SA 3DXRB 1BDHA 2P30A 1I51A 3F5WC 3CH7A 3O92A 4RY9A 3VOUA 3ERCA 5IJ9B 2C5LA 4MUMA 2WTMA 3SXUA 5JSKA 2Z6VA 4JJEA 2P3LA 2VHEA 4HDNB 3LPDA 3K59A 1SVKA 4F38A 3ILYA 4ON9A 1TAQA 3VX4A 3A14A 3MCUA 5AK5A 1Q19A 1TZBA 2UZIR 5FBWB 3AHDA 4RDIA 3UVEA 3ZV4A 4I7ZB 1J95A 4BW5A 3QSYA 1H1TA 1OE0A 1BD3A 4QTZA 4JASB 3HKDB 1JEEA 1PUIA 2LFRA 2PO5A 3LRXA 1GPMA 1KZ1A 4L85A 2X6QA 4DLTA 2P6NA 3WLNA 3IOBA 4AN0A 1ZKMA 3TRIA 1RP1A 2D5AA 3F49S 5GOZA 1KSHA 2WG0A 5LMUB 4EJSB 2QUAA 3OLVA 1O94A 3N07A 2YV1A 2W2KA 3DTYA 3JALB 5DLEA 3VR0A 1RBZA 2AFRA 4HAUA 3DV9A 1I7LA 4JLMA 4J7JA 4D97A 1A9RA 3RCBA 3WISA 5JCJD 1QPGA 4K0RA 4CDGA 2IA5A 4HMOA 3HM9A 5CT4A 4JXKA 2BC9A 3EH2A 4UBKA 3BY6A 4FU0A 4J3FA 1K0UA 1J1IA 5L7YA 1GNPA 3P97A 5HCIA 4B44A 5JS2A 3COZA 1NONA 2Z2ZA 3PYXA 3AU8A 1A9SA 4Q3DA 3KZVA 1RRFA 4BCDA 1J20A 5FFFA 2ISQA 6ADHA 2DRIA 4RD6A 3WQSB 4KQWA 3T0FA 3Q3EA 3A1VA 3G2LA 5JCOC 3VPFA 4LFBB 3COVA 4JC5A 1AY0A 2OKCA 2EZ8A 5IYZB 2RC5A 3FB6C 2GN6A 2OT3B 3MCAA 4BR6A 3WQQA 3OZRA 1GTOA 1T3HA 2LQTA 16PKA 1XQ8A 1E7QA 1AMOA 3R8CA 4OQFA 2QE7D 2PK3A 1QG6A 2ZCJA 2GTIA 1EDZA 3P96A 1VYUA 2BFPA 1WCXA 1NXQA 2IDJA 2EHJA 1A69A 1YA4A 2H51A 2Y0PA 1E6WA 3BE6A 1F8YA 2GILA 2IIQA 5L3EA 1ULAA 3JVVA 5E95A 2ZKLA 2IODA 5FTKA 4DABA 5DHPA 3RDPA 1K9SA 4NYKA 3EFFK 4KDCA 4LCJA 2WD7A 3OY7A 2GASA 3FNHA 4WDQA 5ESDA 2XZTA 3SSAA 5EEHA 2JKZA 1QIFA 2A9OA 2Q9LA 5E6UB 1LPMA 5D84A 5EJMA 3E35A 2EEZA 3DKPA 3PRKE 2FSHA 3LUKA 5KKCA 1O08A 4XDJA 1ARZA 4PLYA 1J00A 1XRMA 2DSTA 4EDHA 5IW8A 4XB6B 3H5NA 4X3PA 3FYSA 4ZVKA 4B09A 1C8KA 4CV0A 4LKOA 1CERA 4MDFA 3GJRA 1X70A 4IHJF 1XX6A 3LF1A 2PUEA 2PGOA 2EBUA 1FDVA 1WPQA 5BR7A 2CXTA 1MPTA 3UG6A 1T13A 1OLXB 2CCKA 5GJVC 4YO8A 2XWQA 3RS5A 4IIXA 4GYYA 4MMZB 1VQ1A 4LNUB 4XDLA 5JALA 5KSWB 5BYKA 3P0HA 1PEAA 1QNLA 5C31A 1ZBQA 3EIWA 2YVKA 3WL3A 1M34E 2O50A 3V7FA 1WETA 4D5GA 1TYEB 4W9MC 1GTG1 2HSDA 3NHYA 1YRYE 2V7XA 2IPMA 3BK2A 4K26A 2PZSA 1ISSA 3RFVA 1M8GA 4NU8X 3LQ2A 2FPMA 2PH1A 2O1EA 3ZWPA 4D9JA 2BMDA 4UFPA 3WS7A 2JS3A 1YBFA 2J9GA 5I7WA 4ZCSA 1RC0A 5EJ2A 3SP1A 2XMZA 3TS1A 1KDVA 2VNSA 3ZN2A 2AI3A 1GR1A 1PWHA 3I72A 1JQJC 1GZ7A 4BQEA 1Y9JA 3IS3A 2UXNA 1DTWB 4AULA 3VYTB 1V43A 4BMPB 4XGIA 2VJKA 3EVDA 1D2RA 1Y8AA 5DHTA 1VL6A 1W36D 1Y7PA 3HR7A 4X1YA 1ZUNA 1EINA 4C0JA 1M56C 2W6IG 2FPGA 5JLJA 2Q7EA 2BRUC 4KXYA 4FW9A 3OX4A 1H65A 1JEAA 4JEMA 4NEHB 3AG6A 5CYGA 1X7WA 3UMGA 3P9KA 4WKOA 1C3VA 4ZRMA 5FNVA 5ES4B 1Q2UA 3HFGA 4Y6GB 4EGCB 3ID6C 1CS0B 4FMCF 2PZJA 1FCJA 3ZVMA 4OFXA 1T6ZA 1U0TA 3GFOA 3B1KA 4C07A 3AVVA 2KG7A 1D2NA 4AL4A 1FTGA 3LBAA 1RSOB 2P91A 1R4MB 4GR4A 5DLPA 4MIOA 1QIGA 3IRVA 4XDZA 1S2DA 4TVKA 1VHJA 2PN1A 3VDMA 1WUYA 5CRIA 5LWHA 4RJTA 3HB0A 4RUKA 2YIBA 5ALGA 1Z7YA 5J40A 2ERCA 2XCLA 4YRLA 1C50A 3S1AA 1DRVA 3SE7A 5INTA 3P2MA 1RLOA 2F9LA 1KERA 2BJVA 3MT7A 3ZJ4A 3ZNQA 5EWMB 1W0JG 3JZIA 1KMIZ 4UXJA 1NY6A 5LQRA 1DIHA 3VPCA 2D3WA 4GHWA 3DC6A 3G71V 2CJXA 3SPIA 3FBWA 1ISFA 3FZNA 2UDPA 3ED1A 1JNXX 5AICA 2XR1A 2AV6A 3OO1A 3IHLA 3GPLA 1RJFA 2PH7A 1A95A 1YTUA 4LF6O 1T5OA 2OPBA 2P8SA 2C8VA 2ZKOA 3ZI0A 3X2SA 3MD0A 2X41A 1KYYA 1JTEA 1Z39A 2OAP1 2WWXA 1XZNA 2YS8A 4TXMA 3M5DA 1ECPA 3C2QA 3FLEA 1ID1A 4LRWA 1NNEA 3WR5A 3PUWA 4L8GA 3W5UA 3FF4A 5CVVA 4IGAA 2D62A 1NQ5A 3RT1A 1TO2E 3UMRA 4MUKA 1C30A 2BGIA 4KXLA 3JVDA 4Q3CA 4TMZA 5JANA 4YV2A 3WYFA 4TTSA 4HKTA 4E03A 4PBTA 1DWOA 4YRQA 4BB5A 4OIMA 4ASUG 2J6HA 1GY8A 4NPCA 1NPDA 4QVKA 3EUWA 3GNLA 5ENZA 1K89A 3F7YC 2QG6A 3SPCA 1GQRA 2XX3A 4GMKA 2WHYA 5KCZA 4AMGA 4ZVUA 3K0SA 3FYTA 3LQRA 1DKUA 7AT1A 4LYEA 3M6IA 3R3HA 4C7MA 2PMKA 5GV7A 2I9PA 3RASA 4CN9A 1N5IA 2OHFA 4JAVA 2K87A 3GNQA 3FB1A 2GJ4A 2II6A 4ODIA 1IOZA 1NF2A 4LYJA 2WM2A 1JV2B 3THXB 4PV1B 4HAXA 3MCWA 4JI7O 2YKGA 3PCXA 1SOMA 3I76A 4PAQA 3IA2A 3L6CA 3UJNA 3PQ6A 4WXEA 1JYSA 1I6MA 5C32A 5AQEA 3DAPA 4NENA 4IJ5A 4HAMA 4HN9A 1Q14A 4EUNA 4NH4A 4FN5A 2XQKA 1I36A 3F5DA 4CR7A 4FWIB 5BPHA 2X6CA 5EWLA 1LI7A 5F9MA 4EJ2A 5DNDA 1YV9A 3HV0A 4KXRA 1EVQA 4AWBA 4YREA 5E9QA 4X1KA 5JS8A 3WSWA 1ZMXA 3UMYA 2IV3A 3WGMA 4BBPA 4C3UA 1DEAA 2B4KA 3VHLB 5HMLA 5JZMA 4QFCA 4DA8A 1E6MA 1ST2A 1XZ8A 2XAQA 2C4HA 1F51E 4Q5IA 5HM6A 1TD1A 1EUCB 4J29A 1P1CA 2X2EA 1T0HB 3NTUA 2O8BB 1O95A 2I76A 2G7ZA 1XCPA 4GKAA 2GUZA 1XZDA 2VZLA 2HIMA 2IXBA 2ZEJA 1IY1A 2JNWA 2DH6A 2CUGA 5LQDA 1WLYA 4OHBA 3OCJA 3WXMA 3F7VC 1ACJA 1X0VA 4CNQA 1TTHA 3FX7A 1KY4A 3A3PA 4EHJA 4BX8A 1GQ2A 3E61A 2GOYA 3VNQA 1LSUA 4I08A 5TX7A 4TYMA 1XZCA 2ZTSA 4EW6A 4X9XA 1PD0A 1V1MB 2Q73A 3GP8A 4Q6GA 4BIIA 4G2KA 3I9V1 3G2HA 4YS6A 4E6PA 2ARKA 4ZI7A 4MW3A 2R11A 3RC3A 3CXHF 3OCUA 3A0RA 1CIVA 3VZRA 3P9NA 4L6AA 3EARA 2X58A 1NTZH 4AC9A 1AKNA 5CD1A 3L04A 2ZJFA 3HR0A 2O2GA 2OT5A 2UXDO 4M9QA 4DFDA 1UFVA 1DBSA 4OMCA 4G8JA 5I8WA 1P1FA 3I2FA 1ENZA 1IXBA 3MWFA 2Y1GA 5DH9A 4JX8A 2F1OA 4INZA 1WMFA 3FMVA 2RDCA 3GMDA 1DRUA 3WYBA 4WESB 1YZGA 1CZOA 3UJDA 3O4RA 4BO3A 2WIGA 1O5IA 2ZUEA 2OMKA 4RLHA 4WRRA 3GO4A 1O9GA 3EHDA 1T9CA 3DAHA 2DQ3A 2D00A 4YJ2F 2H6EA 1Y1RA 1II0A 3IOYA 4K46A 1CEEA 4L8YA 1Z29A 1WVGA 2C29D 4M0KA 4CG0A 1YQQA 3ZNOA 1YO6A 5D6OA 5KMGB 1BTOA 1CB0A 2VK1A 2XADA 4PA4A 1U1CA 1C8LA 5CHEA 1L0BA 2VK2A 1KI6A 3BIXA 2GYVA 2VT7A 4HN2A 3NBUA 5LR6A 4AUKA 3A0BZ 1QGOA 2W4MA 3D7SA 4QFBA 4G9GA 4RE6A 5FADA 1C1XB 4HEHA 4RLSA 5A4IS 4AF7A 1OUMA 2WA1A 3ZGZA 4FPPA 4EGFA 3U17A 3TUIC 4AZ0A 3EGXA 2AFIB 1V71A 2IHUA 1SZPA 3A6FA 1P91A 3LKDA 4G41A 2IBZH 5JTTA 3MYYA 2VYFA 3SC6A 4QEZA 4I4IA 2JCSA 4FLZA 5IUKC 1M1YB 2KM1A 1W7AA 3SR4A 3ZS8A 4JBWA 4Z0NA 1NW5A 2OTJV 1U1EA 2LKCA 1S9HA 4JWKA 1U1DA 1L5RA 2FEOA 4H35A 1QIMA 3U1TA 4OVKA 1A97A 3OJXA 1TX4B 3ZCRA 3ZDXB 1EWRA 2TSYB 3DDNA 3RJZA 2EDCA 4PTZA 4P3PA 2GK4A 4JIGA 4MGEA 4DV2B 5LL6P 4AJHA 2YJ5A 4L9RA 3G67A 3SI7A 2A9FA 1AUXA 2ID8A 4M49A 5CT5A 1PQWA 1PJ8A 4OX9B 4R7GA 4DIDA 1XRNA 1MVOA 1AB6A 2PSEA 4FUQA 4M7RA 5HTKA 4A0RA 1MC5A 4DR1B 1M2HA 3TLZA 1EK5A 3VU3A 5EJGA 4DLXA 3IKVA 3NUGA 1VJ0A 2ZJ3A 3A4TA 2B20A 4YXWA 3RTGA 2IJKA 4YV0A 2F64A 5E2BA 2H18A 3HKBA 5AI4A 2GXSA 3CEPB 4GR9A 3ZX4A 1JN0A 4Z2AA 4N3AA 3VO2A 3SVTA 3HZZA 1D4OA 2V6FA 4RHFA 1SBZA 5GINE 4KP4A 3NAZA 1VQPV 3PB3A 5AO9A 1WIWA 3ZBUA 4JS0A 1YZKA 2RHDA 3LDCA 1BDJA 3LUTB 3P5BA 2C4WA 3A6GA 1Q6YA 2OP0A 1GO3F 4IWYA 5LNK1 1C0LA 1G6Q1 4PR3A 1GYQA 3Q5EA 5ALNA 1BDIA 5A71A 5JEEA 1GPUA 4AY3A 3BPZA 2YY7A 1JLMA 4MIEA 2RI1A 2XTZA 3G2QA 4J11A 3INYA 4PM4A 1OCOB 4Q7MB 4PCAA 2YNMC 2P2SA 4HFJA 3AG2B 1XMIA 4BN4A 4JTCB 4HWKA 1VP9A 2D1QA 3QVLA 1OAOA 4MR8B 2XD9A 4LMBA 3W9BA 1U97A 2W8BA 3B6JA 2F8LA 1IAQA 3HI6A 5IPFA 2B8JA 4FYPA 1NHGA 1WY5A 3NHBA 1L7EA 4XYMA 4Q6BA 4CKXA 3EG9B 4PHCA 3WB2A 1AGRA 4I6EA 4OEHA 2DTDA 1G2OA 5FOTA 2BFMA 1XMXA 2OGUA 4DDTA 4HVAA 2IH4A 3R9KA 3QO8A 2X8JA 2B7BA 3PEWA 2RI0A 3CCEV 3FYUA 1AU9A 4EEQA 4AJJA 3DWGA 1W0JD 4TKVA 3ORFA 1KZHA 3FDXA 4AMUA 3B7GA 3QYAA 1PO7A 4RWZA 4UJ5A 3SZ3A 5DN9A 3G7NA 4BWGA 3NBXX 3JWHA 1DU4A 3DPIA 3ITEA 1FYXA 2VK4A 4R2IA 1LLUA 3VH4A 3AY3A 4LFCB 4IIDA 5DYNA 1YL7A 2WUDA 4J0EA 2OZPA 4DQ0A 4BO0A 2NUPA 3OCZA 1DE0A 2AJ8A 3EW7A 3KFXA 4KQIA 2AKYA 1IWBB 2X0RA 4LTMA 3PUYA 4BQQA 4KITB 3ZE6A 2FEAA 1DF5A 4LZZA 2NTNA 1D0SA 4RQBA 2WIFA 3VR6H 2H9IA 2HO4A 5SZHB 1RR6A 1YJNV 1Z7GA 3OQPA 3ON5A 3C3SA 2IBTA 2L2QA 3ICCA 2H5IA 5IKXA 2V7WA 1DXQA 1D4AA 1KUQA 1MFZA 2ZI4A 1U28A 1Z5PA 2AN9A 4QXAA 3Q8WA 2W0XA 4FKBA 1GKYA 1P29A 1XCJA 2GJ9A 2RJ3A 3MXOA 2P4EA 1GH6A 1C9MA 2XCUA 5SYMA 4LC9A 4WJZA 4R0NA 5AM1A 3NBYC 3K9CA 5TB5A 1T0PA 3HNRA 4JBNA 3ZBQA 1TJ4A 2IUSA 3ME5A 1YDEA 2XD4A 4ZU6X 3F47A 4QBTA 3W7WA 3DE1X 4H3VA 4AF8A 4YRRA 4U7WA 3CCUV 3FOEC 3WG7B 1ZI6A 2BM1A 4AJOA 4JLVA 2VPQA 1WABA 1ND6A 2B1GA 2B69A 1NBOA 2P2YA 2IT1A 3OPMA 5JAZA 3ZV6A 3HYTA 4IHJB 2A57A 3GBPA 5K0NA 3GB9A 1FS5A 1CJKC 3K1AA 2G88A 3CBQA 4UEWA 3C5CA 1S77D 1CY6A 3C70A 5K8VA 1COWG 4R98A 1ZDMA 4IV0A 1ZH0A 1PNMA 2PA0A 3HU3A 2UZ1A 1IXSB 2J9FB 3VHXA 3C8HA 1E96A 1SU7A 3KUDA 4J7XA 5A4FS 1DMRA 1JOYA 1UZMA 5D5QA 2BE3A 1UK9A 2ONZA 3JQ8A 3FROA 3IEMA 2RK3A 4L3OA 1I2CA 2VDNB 1W36B 4XWOA 3UMCA 4DDWA 1A7JA 5EJ4A 1FRNA 1Q11A 1BSMA 1F9EA 2WKSA 3DKIA 3LLVA 1VE1A 2G76A 1YCFA 1WY7A 3GRRA 2JEUA 4TXJA 1J09A 1N9GB 3Q7RA 4QJIA 3ZS9A 3F7MA 4J42A 2AXQA 3G0CA 1JSZA 2KSDA 3OICA 1MT0A 3AF2A 3GQBB 1EZZA 2V58A 3Q7SA 5BO5A 3ZDCA 2X8WA 3LUBA 1XJQA 1DAOA 2N05A 2Q2VA 1Y6XA 2XTJA 1GT91 1T2UA 4A8PA 1I7DA 4AX4A 5JMWA 2PUFA 4HYEA 1JT2A 2YHAA 1IH8A 3AJDA 4P36A 2Y2UA 4MDHA 3WMXA 4B9EA 1D2MA 3SS8A 2BFDA 3TOVA 3SS7X 4NLLA 4JI3O 4DLNA 1FVOA 2IY9A 3JQGA 2KHZA 4M9RA 4RCVA 5KHHA 1SOWA 1DJLA 5LQSA 2FQWA 4ARSA 4LCBA 3AR9A 2X0NA 4MAFA 1O0CA 3I61A 4XWWA 3R5XA 1ZD3A 4FMCB 4EWLA 4JGGA 4DYDA 4O0MA 1JJAA 1OX4B 1RPTA 1N33B 5CEEA 1BXZA 4UB6Z 4BBZA 1WPGA 4FCTA 3RKUA 3UWPA 4EUKA 1YC5A 3RHTA 2PWBA 3PNPA 1HTWA 1E5XA 4ALKA 3VNSA 4DLVA 3FTCA 5JJ5A 3NP9A 2M6YA 3OWOA 1P7PA 5F3RA 4HLUA 1VGVA 4M0UA 2FEMA 3TJMA 2BF4A 1I2DA 2I6QA 1ZSNA 1N34O 4GE3A 2LUOA 4V0SA 3B6IA 2Y3IA 5FHRA 4FDLA 2Y77A 3JYOA 4JR2A 3NGXA 3B1VA 5BSWA 2ZW9A 1QZTA 1KVSA 1ZM4A 2E5LB 2ZSUA 4UFNA 4HD8A 4R8LA 2XUGA 3TGLA 4RPKA 5I9MA 1CZKA 5BWOA 2QEQA 4WCFA 1VMKA 2XECA 4HWTA 3WGOA 2WIBA 4RO0A 3ZJ5A 3F1LA 3WP1B 1N8NA 4E5UA 1FFCA 4ZI3A 4DXWA 4KPGA 1NXVA 2GZHA 2NSJA 3GLFB 2QUZA 3Q0EA 4L8FA 4R83A 5ULLA 3JPWA 4G5XA 1EVZA 3TR0A 4DR5O 1J90A 4B7UA 3ZLUA 1US6A 1SIOA 3N0RA 4B71A 4MEJA 1QYDA 4J80A 3PI6A 4ZJPA 5K1PA 4KGXA 1YU6A 2QI9F 4CT5A 4K1XA 3ITDA 2XBLA 1HL7A 4KQCA 1CUIA 1QV6A 1JWAB 1Y63A 2EGHA 2O8NA 5AM0A 4D4GA 1UBMS 3IAM1 4M46A 2Z4RA 3L9WA 5LA6F 2DHCA 1F3LA 3A6JA 4F3TA 2TS1A 3A9TA 2ITDC 4MSUA 3E70C 2XVZA 4CCWA 4FQ7A 2A0XA 2WIKA 5E6SA 1KPGA 2WNHA 3LDDA 3GRCA 2CY0A 4MW8A 1MO6A 4RF2A 1KAHA 1DJQA 2BGGA 4BNNA 4GPTA 5HE9A 3BRWA 2YFHA 2YWGA 2R4TA 2DH5A 4RA6B 2REXB 1FPQA 3JQAD 1RLUA 1NYRA 4B5LA 4US0R 3LP6A 3CIOA 4J1TA 5K0ZA 2IZ5A 3L71H 1NV9A 5JFGA 2WFZA 4HNAA 5CH8A 1G1AA 4EKWA 3O7WA 2HWUA 5FWDA 2I2CA 3TINA 3T3GA 1R10A 4RFSB 4PDMA 4CT0A 1Z8DA 4H1HA 1TVMA 4TV8F 2ONKA 5JW6A 4JZKA 2XRFA 2H1CA 4ZPJA 1WVIA 2C5EA 5DPMA 4FEAA 4LX8A 3DCYA 4MWDA 5B3KA 2HLDD 1XRPA 2NXEA 3K20A 4IR7A 3FUXA 1BMQA 1CZUA 3WIEA 1ZITA 4PI2A 5AM2A 2JLWA 3NDBB 3TGUH 4DV0O 4GW3A 3H4MA 3H16A 1ZK2A 3MCVA 721PA 3REGA 2EP5A 1KYZA 2ZAMA 3STWA 9ATCA 1DUVG 4OJKA 3OD1A 2O1WA 3DT6A 4J2HA 1ZZGA 4EI2A 3IEIA 3TSWA 1WZ2A 3E7XA 1IBKO 3SE0A 4UU0A 4E5YA 3AP2A 3P2IA 1NWCA 1P7YA 4H59A 3LRPA 3K5OA 2R84A 2C9OA 2WSBA 3PT9A 3TL2A 4ZYVA 1KORA 1J9EA 5H2FZ 1GUFA 2GMWA 1VSUA 1PR3A 4I4NA 2Q0SA 1R64A 1K6JA 1CF9A 3G9TA 4GLOA 3L0ZA 4DMUB 3MERA 3DNFA 4PSAA 2H5JA 4WOJA 2VBFA 1P7CA 1SHLA 4B4WA 5AKGA 3OCVA 4MRVA 1CRWG 3K9GA 3ML1A 3I09A 4I1VA 3ELDA 1DQYA 4IEEA 4IDCA 4JFAA 2WBLC 3UJ9A 5C93A 4PWZA 2IOYA 3CCBA 3U3XA 3VQWA 3E9ZA 2GM3A 1QJ4A 1BX1A 1LVHA 1I0HA 2IY7A 1N3BA 1QF6A 2QF7A 3KZNA 2JI6A 1N9ZA 1UWCA 2QWQB 1YQTA 2VFAA 1G42A 1DX4A 1Q0ZA 4BNYA 3M7IA 3H9EO 1S3JA 1VLVA 3CCFA 2H59A 1RI1A 4KLCA 4M8NE 1M34A 3SIRA 4JKYA 4RWUA 1JQ5A 5B1YA 1PQYA 2ZIWB 3HO8A 3NNSA 1DAGA 1TT7A 2IYQA 3A0HZ 1AKRA 3Q72A 2V1XA 1OYWA 2GHRA 1R9GA 2J5XA 4UAUA 5AJVB 4JI0B 5C37A 3CNOA 3E58A 2D74A 3THOA 3CR8A 3IC9A 1ELOA 2CMKA 2AH5A 1NVPD 3IIIA 1UJ4A 1OW3B 4A9AA 1E5TA 3RAPR 1TADA 1Y8QB 3RAJA 1DEHA 4LSWA 2EP7A 2ZIUB 2OUKA 2CNKA 1G21B 1K3TA 5CVCA 4LJLA 4ZVLA 3H1EA 2GHQA 4YJ2B 3ZUGA 2FPWA 4RE5A 1HE8B 2EZTA 4R54A 4PX9A 4DDVA 2HI0A 3AIMA 3HB1A 1X8JA 5ECDA 2Z9DA 2EULA 2A9VA 1KEPA 3WKDA 4E33A 2H1LA 1PJSA 2AR0A 3BREA 5TJ9A 5SY6A 3BORA 4WFGA 1K7XB 1EVJA 2F2TA 5MHTA 1M2WA 5BMOA 5A4KA 1QYXA 2AVDA 4JD5A 1NXXA 2BD0A 1GILA 3RVOA 2O8DA 5CFLA 1L4BA 4FNGA 4XPIA 4WW0A 3A4YA 3A1DA 3LUDA 1TAUA 1EQ2A 1YQEA 2HA3A 1RZVA 4NE9A 4G4SP 3DDSA 3TRFA 3T15A 5LBQA 3FVQA 2R1TA 5M29A 1ZICA 4ZOQI 2P7IA 2NZUG 4CM9D 1NJ8A 2OVFA 2X5NA 5EP4A 1I4TD 2WA3A 1R1BA 3DUFB 1X9GA 3RYFB 1Z2CA 2FB9A 3EDCA 4MW1A 1T43A 4C21A 3Q8LA 4ESVA 2EKLA 1BN7A 5EESA 1QM5A 3GDGA 3FOZA 4GGOA 3DR5A 2OXCA 5JSUA 2ZR9A 2H9YA 4JVMA 5CFZA 3D5QA 3NH6A 1TT5B 3PQDA 2PUVA 4IUYA 4K9QA 4JH0A 3BBPA 3AUYA 3TVDA 3FZEA 5TLSA 3LNMB 1DTEA 1CJMA 2K5UA 4DY6A 4EA8A 1OCCC 4A6DA 1GL6A 2WP0A 3KHKA 3FOFC 1I0IA 1R9JA 5AUQA 1Y89A 4WXRA 3HG7A 1J23A 1TIPA 4EHKA 4FM0A 3G1WA 1Z33A 4XFKA 4RKYA 2W2LD 1T4CB 4I1UA 3EVTA 3D3WA 1O5OA 4AZVA 2X9LA 2O0KA 2CK3G 5CT8A 2X9NA 1PYOA 4HWOA 2D0IA 4R6XA 5EOVA 4A92A 1W0CA 2CH7B 4DW8A 2PLNA 4XEUA 2YDYA 3EVAA 1E1RA 1I7SB 1RKVA 2W2OA 1ZK3A 1XL1A 4YDRA 5BSTA 3FB4A 4B4KA 1A32A 3B4SA 3EY4A 1BRMA 2WE8A 3QUSA 4YRKA 4KDRA 1SXJE 3K1JA 3ZWNA 2VP5A 5DBFA 2COUA 4F2WA 2JLAA 4I5IA 1AKTA 3FVWA 2F43G 3N5CA 1YK0A 2YYSA 3N0TA 3ETJA 3DVSX 1M4UA 4RPIA 1UODA 5CHYA 4DMRA 2JA2A 5FF9A 4BLQA 1MB2A 3LT1A 3TZEA 2R00A 2WC1A 2YYAA 4B3DA 4FW8A 1IJEA 3EXHA 4ZYUA 2G0TA 2H06A 3ZIAG 4GWGA 3ZI4A 1R4NB 4YMSA 4BNLA 1KZ4A 1W47A 4B6PA 1C9JA 2I2FA 2Y1OA 3D8HA 4UCOA 2QB5A 4XTCS 4UU7A 4KFSA 3A2NA 3FCXA 4ZOAA 7ADHA 1KR5A 3H9JA 3OGCC 2YWBA 2CLDX 1RC1A 3LDAA 4RK5A 1T3LA 3NEYA 2HPHA 3I04A 1SC1A 2PBFA 1GA4A 4CUZA 2BGJA 4FYIA 2ZBVA 4K9MA 4D82A 1KA9H 4Q9KA 4Y2JA 1KI8A 2VPIA 3R24A 4K8OA 2IOQA 4ZTBA 3WLQA 4E51A 4I3HA 3NUZA 3ESCA 4B8ZA 2CNDA 2FSVC 2GN2A 1E0KA 5CGZA 3ZWCA 1IC6A 1U02A 4XX0B 2WUVA 3VV3A 1TK9A 2NP7A 1RAGA 4KWTA 3A3OA 1TW3A 2VN8A 1YAJA 3KEQA 3V8VA 4DIFA 4B08A 2Y1XA 4AQ7A 3HDQA 2XUDA 3C3MA 3OIVA 3K71B 2ZJ4A 4C0HA 1GHTA 4YP0A 1GNLA 3HKEB 4PGHA 3ZWWA 3MFQA 1FZQA 4LJ4A 2XKAA 4HRAA 4JSTA 1BA2A 4FFMA 3C8ZA 1WHTB 1K7FB 4MVJF 3G6KA 2PSFA 1F51A 3EODA 1QO7A 1MV5A 1GG8A 2BBTA 1B8OA 1BFKA 2VVTA 4A0FA 5FLKA 1TCCA 2H2GA 3HEMA 1RE0A 4H9GA 1O58A 3PXGA 5LB4A 3E89A 1ZR2A 2FFHA 4IHQA 1SEVA 3ABLB 5LU9A 4YVFA 1PL8A 1CE8A 2FWIA 1WMSA 2ZI5A 3R0VA 4BO2A 2QJFA 2YR0A 4OREX 1DIAA 4RK4A 1E0JA 1RSZA 6REQB 3I9FA 1O6CA 4Y1RA 4NBRA 2XGSA 1MB9A 1X9HA 3V8NA 3IRUA 3CPEA 2VLIA 3SOZA 3ISVA 1JU3A 4EBFA 2Q1YA 3HYLA 3I2GA 4PFJA 1H2FA 1IBMO 5BV1A 4BECA 4JJ4A 4LJ5A 1L4YA 1JFSA 4LG1A 5B6IA 5IJ0A 4GPEA 3VZBA 1GPKA 4PNZA 1SHKA 1ODJA 4XTRA 2WAMA 2VJLA 1D2AA 4UE6A 5TT1A 2WFAA 4BCBA 2CJWA 1UWVA 4CS4A 4KZPA 4QOEA 1GN6A 2HT6A 5IXJA 3PJSK 3OPXA 1WKCA 2F3RA 5CDTA 1L4EA 1WJZA 2IIVA 3I0MA 4G97A 4MO2A 2WB2A 2QLLA 5HQTA 2DPLA 4JL8A 5FOVA 1Q3HA 1C7ZA 3HYNA 5FL7A 3EGDB 3HMKA 5KJCA 1X19A 3UKOA 4OQDA 1KK1A 3T7DA 3NO4A 1PG0A 4LDNA 3RSSA 5JNWA 1KBZA 2CFIA 5JMOA 4E5PA 4RH0A 4D74A 4H1UA 3ZW9A 4D98A 3QBEA 5IM5A 1PJQA 2KI5A 2YWHA 2ZZMA 2VUIB 1QFYA 3LUPA 4DV5B 2I4MA 3UAGA 2B8TA 1W19A 3NPAA 4OPMA 5ICSA 4LF7O 1GUBA 1BA3A 1BMFD 3CZRA 4MKXA 3VR5A 2R751 2XUKA 4R1LA 5J43A 2G80A 3SM9A 3MGAA 2C59A 3ASUA 2ST1A 1E79A 1L4KA 2XUZA 4MWEA 1JJ2U 5JSYA 2B98A 2A0LA 1M6VB 1AS3A 3O73A 4DCSA 3CJHA 1JLLB 4BEVA 3NAGA 3SVZA 4Z4FA 1IQ0A 3L8YA 3D6TB 2BOCC 3PA6A 4Y18A 3ZCXA 1Z4IA 1CJCA 4TLLB 5HIJA 4IX9A 1IY8A 1ODKA 2DM6A 1J5EB 1QJCA 1HQDA 2PKCA 5GJBA 4GSKA 1E99A 2GFQA 1KVUA 3R41A 1ULHA 3LQFA 3CUTA 1GFZA 4W1QA 2PR7A 3TZKA 2AT1A 3UKDA 3V8QA 2Z2IA 2DWUA 2O0JA 3QFTA 4JJ7A 4K9NA 2NX2A 1HT2E 3JXEA 4Z3DA 2F1JA 5AIBA 5D3MB 2A7XA 4KH1A 1O9BA 3PTLA 2VJBA 2JLCA 1MH9A 2GJAA 3IURA 1JKJB 1LV7A 4F4JA 2VPTA 2YVQA 2G07A 1RM0A 2RCVA 2AL7A 3L8FA 2I7XA 4OLBA 2JBHA 1URPA 1P2BA 3BOSA 4UNSA 1D1SA 4ZOLA 3UAZA 4I9GA 5K0EA 3FOBA 4EKIA 5HM8A 1AUOA 4HZIA 2PFKA 2ZVQX 1IHUA 3F9IA 4WSOA 1CNMA 1EJ0A 4CS3A 2HPAA 1A5AB 4EKGA 1JHUA 4LHSA 4MT8A 3MJTA 4GOMD 3FKSG 1KYVA 1QIIA 1V5IA 1XHFA 3VAZA 3ZJYA 3LYHA 5CPFA 2BTQB 2B7LA 4I8XA 2XRYA 2YRFA 1HZJA 3SC2A 4L5JA 3D31A 2H0AA 4K9PA 3V1YA 1JQKA 2BFEA 3RVSA 4PIVA 2ETXA 1BWPA 2CVQA 2B6NA 3BZBA 4H3SA 1BXRB 2NXJA 4MUGA 1RXVA 2ID4A 3UJ3X 1JEYA 2HA0A 3HCPA 3RVBA 5EK0A 3W8NA 2LXNA 3TAUA 1GU0A 2P0EA 3R9WA 4KGVA 4ZVMA 4HZUB 2W0MA 1QVZA 1YE8A 1A04A 4D43A 2JGFA 4F3KA 3FOWA 4B87A 3PV0A 2VYQA 1Q81W 2IZ0A 1I94B 2EIMC 10MHA 4Z7NB 5AKXA 2IDKA 4CIYA 5KUKA 4IIUA 4A0HA 4YAIA 2ZIGA 5I7RA 1SXHA 4M1OA 4MV5A 2JKYA 2GPNA 3VZSA 6PFKA 2B4AA 2QX6A 2VPXA 1KAOA 3QITA 2PGAA 3DP7A 4PGFA 5IFKA 1Q1QA 5LA6B 1OT3A 2F3PA 3ZBTA 2PH5A 1OLUB 3K0DA 2O07A 2X8BA 4PX5A 2QN7A 2WM8A 3NB0A 4IGFA 4B2YA 3PFBA 2CXSA 1C7RA 1ODIA 2J3DA 5L95A 3F8TA 1M0EA 3EEBA 2H0RA 1FP4B 1A8SA 3WA6A 1GU1A 1FMTA 3TTSA 3H99A 1E9BA 1Z82A 1X42A 2W6MA 1F0KA 4TV8B 3LG2A 3ANLA 2WT9A 3MMPA 3B7WA 2ON6A 5LSAA 4FZ3A 4OHOA 1IZ9A 1TKRA 3YASA 4LXUA 3KSRA 3FUTA 1EUZA 4IIYA 4EG7A 3TLCA 4HQFA 4FFSA 4RQEA 2PBZA 1A8QA 3ICOA 5EE3A 3EQZA 5FBQB 5H9WA 4ZFNA 1U8AA 5JY1A 2OV3A 4NKGB 2IU3A 4I1OA 2C7PA 4E4EA 1Q6IA 4JXZA 5C3UA 3D7KA 2ZB8A 4D41A 3CX6A 3F8SA 4DY4A 1UBKS 5IAGA 3CRRA 1BGVA 1XQ1A 3GRVA 4DYHA 4BLVA 3D1LA 2I3AA 5IARA 2JBWA 1I2MA 1E7WA 2DE0X 1Y7IA 4JLNA 2AB0A 1RBYA 1EFHA 1NI4A 3SJ7A 4YJDA 2VHWA 3IDOA 4BNKA 5KVAA 1NLYA 2CC2A 1AILA 3WLHA 4FD2A 2QKSA 4FZVA 5EZ6B 1GDHA 2VYNA 2Q67A 1GUDA 2ZAIA 1X14A 4OHRA 2Q5QA 3B12A 3F3KA 1SOVA 3T99A 2FRXA 1J2UA 4KXVA 2PPLA 5JY6A 2IJHA 4DUYB 2E21A 3K2EA 4WACA 5K7SA 3OZAA 2Y8EA 2XCTB 4J0IA 4N5DA 4BNMA 3UWDA 4OIFA 3FZGA 2AGVA 4KPUB 3B36A 5BRAA 5HRUA 1RWMA 3JW8A 2E37A 2NSLA 4Z51A 3V2GA 3FHLA 1EK1A 1SA0A 4TSRA 4C08A 3E3NA 3D7MA 1AJEA 2IXEA 2QRMA 4RHXA 4D99A 4ZHQA 2PLAA 2WLSA 1QR8A 3U44A 1LLQA 1Y67A 4XAQA 2O4UX 2VUTA 3W90A 3DAOA 1RYZA 3NZEA 3UOAB 4GQBA 7REQA 1PDWA 4GE0A 2HWYA 1SKVA 5EUCA 5EZQA 4Y6PA 2QY6A 1JH9A 1O96B 2P7TC 3AEXA 3ZRSA 4RPHA 1RJEA 1U7XA 4H17A 5LBUA 3G02A 4YH1A 5EEGA 3T7JA 4WV3A 2RNBA 5DMXA 3S44A 5FNZA 1IPFA 2R7NA 3U0ZA 2HJFC 2QR5A 2UYYA 3Q5GA 4NTWA 4JYYA 4PO1A 1ZYUA 3DOFA 2JRCA 2ID7A 3ROGA 1UJ2A 4QG7A 3OUTA 4DCGA 1N2IA 1B6SA 4RVDA 1SB8A 2NOAA 2V7VA 3ABMC 4P4TA 1AHHA 1HDEA 4PAOA 1K98A 1KOFA 3AFNA 4GGMX 1DFGA 5SZKB 4IJ6A 4LQLA 1ZUIA 4M99A 4QPDA 1VLMA 1P81A 2QX7A 1RFLA 2EGUA 3U56A 4G8CA 2R6FA 1OB2A 1DELA 4PZ9A 3K6SA 1RM1B 4ZYXA 4R31A 4JI4O 1XNRO 5AKJA 2QL9A 4C01A 1DQRA 3QTLA 1ECJA 3T5MA 1WMAA 2R8ZA 1L5OA 4K9DA 3J81A 3THWB 4X66B 5JSQA 3WJ2A 4ABMA 1O6ZA 3LECA 1FXKA 1A2KC 1QQBA 4K8XA 1NF8A 4O29A 4RIHA 2AQIA 1GPWB 3TQTA 3X1KA 3EZ2A 2AZ0A 3ZD9A 3TSAA 2QA5A 5CCBA 9GPBA 1EA5A 4P4SB 3EVZA 1N2HA 4DDMA 2H3EA 4OLJA 1TLFA 1QTRA 2ZSDA 3K0FA 3WGGA 3FCEA 1EHIA 3L8GA 3CCMV 1A98A 1XCOA 1XEAA 3IVGA 2JVJA 4TKUA 3J7AC 1OV9A 1QFJA 1VSVA 4LXIA 1DLBA 4UHHA 1QU3A 4UM5A 3CF0A 1BOFA 4BB9A 1YQUA 4E3ZA 1V26A 5JEDA 2W6JA 3S29A 4TS1A 3S81A 3WNVA 2VEDA 1AUVA 1VSBA 1YQWA 4TWIA 3EQ9A 1N2GA 2B99A 2PD6A 4FLMA 3BRCA 4XDHA 4NESA 1WPRA 4G37A 1OI7A 2OCPA 2JAWA 3TLMA 3P4UA 2CLOB 1T2CA 3D54D 5TGTA 3IA7A 3JZFA 3MGBA 4CM8A 1FDUA 1RZUA 1JMVA 2D0DA 4YX9A 5HA5A 1YDGA 1I1NA 4JB0A 4EUFA 1XN4A 1O6BA 5THXA 4B7EA 3HE3A 2JFYA 4N0PA 1LFAA 1Y9EA 4I4TF 4D3XA 2V7QG 4N39A 1A9XB 2OY0A 5KOJB 3G2NA 1Z74A 3OIFA 3ECCA 4GZLA 3DKKA 5G4KB 1DINA 5D7NA 2HFJA 3LVQE 3HYRA 3LSTA 1XDWA 2QZSA 3P4YA 5U1PA 5F12A 4B6RA 2AJTA 5BQ5A 2OOKA 1KK3A 2PZMA 5IG2A 2EJVA 3EZFA 4DMFA 2AJDA 2HU2A 1IUNA 4HVTA 4PYKA 3HP4A 1SCJA 3IP9A 4LBYA 1HBJA 2Y1FA 2HMUA 1BWQA 2C07A 5JBNA 1Z2NX 4KZKA 1NSFA 5JV5A 1GAQA 3OFKA 4WY8A 4LZNA 1JIQA 3M4ZA 3D59A 5T41A 1YTLA 3S2YA 4UW9A 1M7HA 5TDHA 1T9KA 3QXGA 3DGFC 3TX2A 2LKDA 2XGJA 1KKLA 3IQFA 4JQYA 1SG6A 3TFWA 1WCIA 3W6NA 1FFBA 5GM1A 3HA2A 2ADQB 4GEKA 1M2JA 5NLLA 4EI8A 4K88A 3IVAA 4ABTA 2OXRA 3HB5X 1BNCA 3V34A 2AJCA 1ORDA 5P21A 1FP2A 2O06A 3UCSC 1B42A 5AW1A 3A37A 1UBUS 4HXYA 4XYLA 2B9ZA 3TW4A 5F23A 1AQLA 1MG5A 4UBLA 4J90A 2JIOA 4GNRA 3CW8X 1X1EA 1NH2D 4WDRA 1B6GA 3AGPA 1THTA 5H7XA 2RHLA 1COZA 1PLJA 3OD5A 3P19A 1ENVA 2M32A 5F76A 1P9RA 2H4XA 1IX9A 4DR4B 1A9ZA 4U7PB 3S5JA 1C3LA 4HGYA 1T24A 4KQMA 3UMBA 2W8ZA 1AURA 5F35A 1LJ8A 1LSJA 2QRZA 3K31A 4X97A 3WYDA 3IH5A 1ICIA 2QZ9A 1EFPA 1FUUA 3L0PA 4HDSA 4F85A 4GOOD 1C0IA 4B9AA 4BWFB 3LWBA 4DC0A 1U9IA 2AW5A 4HQ0A 5HTOA 1XTRA 1X77A 4J7CA 3KL4A 4I9QA 4FQ5A 2V9PA 4HDMB 1XTBA 3W3AA 1Z0IA 4K3VA 3OLYA 1X1BA 4PHFA 3CE6A 3AQIA 3A7EA 3R5TA 3K05A 4EUEA 3H4TA 4N6OA 2F1KA 4DNFA 2QTSA 4MEBA 1ZUHA 2QPOA 1UL1X 2DPYA 4F72A 1HF3A 2JJYA 3BQ9A 4J3JA 1E8DA 1CFJA 1G1MA 1K92A 1GZDA 3DG9A 3DOHA 5C2JB 4QRHA 4NCXA 2QXUA 5IJ9A 3U9LA 1SD5A 3Q88A 1V96A 4MB0A 2NZWA 5FI5A 4MGHA 1K3UB 4O59O 3HCBA 3IIMA 2JGNA 3IGAC 4XX1A 3SFZA 4MQBA 1Q7GA 3JQEA 3B20A 5DLDA 4X64O 2W6ID 4JASA 2Q4RA 3LP5A 3AINA 1DGQA 4RXTA 4EZBA 3NFYA 3H1KH 5EMHA 3DMTC 1SQVH 4G28B 1HETA 1EB9A 1R6KA 1RPJA 4EG6A 2G08A 3A1FA 1HSZA 2WEKA 1OIXA 4RFVA 2DQ0A 1NR1A 5TQ2B 3VPBA 1NLZA 4YY3O 6CHYA 1EDBA 2Q3FA 2YRXA 4UTZA 1J21A 1O97D 1ODSA 1OV4A 4B1FA 2CSXA 5AKIA 2VPPA 2XWSA 3BA9A 1Y1TA 3RSLA 1SC5B 1X39A 3QH4A 5C7LO 2Q49A 4LE1A 1TCUA 4FK5C 3T5BA 3U5ZB 1TA8A 3N70A 3M3DA 4LE0A 4Q1BA 1FU8A 3GUHA 2R60A 2ADOA 3MB5A 4UPDA 1X8XA 4Y8VA 1H2HA 4ITUA 1FX1A 5ELLA 1T6NA 3L70H 3A9VA 1PWEA 1QHXA 5EJEA 4AUEA 4QM6A 2B1JA 3CS3A 3B53X 2XI4A 2A5GA 1JHQA 3ZHVA 3D7LA 5HUJA 2PNJA 4A16A 1XL4A 1VQOV 3FCSB 3K1YA 1KJ9A 1USVA 2FFAA 3BB4A 1IZZA 1ZHOA 1V16B 1CRZA 3KJNA 1VPWA 4ZO9A 1QK4A 2CXRA 1OCRC 2FR8C 2HXYA 3OWXA 2XDYA 2J9XB 3KJXA 4MIKA 4RY8A 1U80A 1H85A 3STLC 1M8KA 3HCFA 3JVUA 1C9DB 3EZ7A 3V4VB 1M2EA 1A2BA 3DMGA 1GVNB 4UPVA 1OKKA 2APJA 1JMKC 1RCFA 4IXDA 4YA6A 1JAHA 2VJNA 2DR3A 2MDTA 1XLWA 1GQSA 5BWBA 2QZZA 4KR7A 2OG2A 2EZPA 2BSXA 3NHJA 2ZQZA 3GB7C 2ZRGA 5AI8A 2X5KO 3RRFA 5HK8A 1GUZA 4IBOA 3QTTA 3WX0A 4ASUD 3UJ7A 1A5BB 4P34A 1Q12A 3RI3A 1GFSA 2P67A 5CPBA 4IDDA 1M2OB 4QXOA 1JEQB 2P6UA 2BEWB 2VWHA 1SO8A 5HS4A 1MW8X 3FPJA 2FPSA 3FSEA 5TMBA 4QJFB 2AW3A 5KWJA 5IDYA 5FPKA 4I1IA 4WZ6A 1U9CA 1UJMA 4G5RA 1L8QA 1NI3A 2I34A 3KJEA 5DT2A 4B0PA 1YZHA 3A58B 1FY2A 1SXJA 2R5FA 1TXGA 1LBSA 1TQHA 3L6UA 3MTBA 2G1JA 5B37A 3ZZNA 3K4HA 1QU2A 4FT2A 4PA3A 2BGRA 1DOAA 4PRYA 4MVZA 1F7YA 4HDRB 4B40A 3O2SB 4C7JA 3HZHA 3TCKA 4KPYA 3AERB 4DHWA 2MK3A 2BY4A 1AV6A 1H8EG 4DR7O 2CLLB 1RIIA 3TPCA 3BL6A 4RSRA 4RLFA 4DSUA 1JHDA 3P0JA 1DB3A 4ZGWA 2XCQA 4G1VA 4TS3A 5E9AA 4JSRA 1AP6A 3ONFA 3G6EV 4XPZA 2IEBA 1SU6A 4KKXB 3HKCB 4P3YA 3UJHA 5L3VA 2C04A 1ZN7A 4BY9E 1A9TA 5DTRA 1SZXA 1PIWA 3DEZA 1NBMG 1QIJA 3MN1A 1DTWA 4NOJA 4O4IF 5JBIA 1FMJA 3I45A 3EPRA 2DPGA 4RX1A 1CY4A 1X7HA 4FZ1A 1YBAA 1ML3A 3OKAA 5IE9A 1UK7A 3NJ4A 1YCGA 2CHFA 5KDDA 4YDHB 1UBGA 3WNDA 3RWBA 5C34B 2X0EA 3AILA 1QHHB 1WXFA 2WMNB 1KVRA 3FAVA 4Q3OA 2FK8A 4QOSA 1WJGA 2W0SA 2ZXWB 1WHSB 4K9LA 5ERGB 4L2IB 1M7GA 1V1JA 4RH1A 2E76B 2YFYA 3M1YA 4II3A 4I9HA 1TJ5A 2ZIXB 1CS0A 1HYGA 3DONA 5BVGA 1XELA 4KR3A 4L0MA 1G291 4IWXA 4PFQA 3OG9A 1OB5A 3PGLA 3BWDD 1UBOS 1RSOA 1H6DA 1FMCA 3ZEDA 2ZXFA 4EVQA 2EJBA 3M4XA 1YDMA 3ELBA 2ZB4A 3FFWA 4XDKA 1N6RA 4FB5A 4FE4A 3SF8B 3QF4A 1SRQA 4NFHA 1UEXC 3NIBA 1EWTA 4I5SA 4DLRA 2CCGA 1E9DA 3GJSA 4DCNA 4K1LA 2IGTA 2D0PB 2GNOA 3G8AA 4P3OA 3Q7EA 1ORIA 4P7GA 1MNQA 1DLJA 4RM2A 1OFUA 5EWMA 3B1XA 2HK8A 5GMOA 4XM1A 1Z2DA 3AHFA 3K0AB 1Y76A 2FF5A 2C3OA 1CXZB 5JT1A 3OF5A 3IT2A 3U62A 2MOKA 3DW3X 1RKXA 1EP9A 3AL0C 3E9CA 2IDMA 5JFOA 5T4EA 4FS3A 1YA8A 3LHDA 3HCWA 4KYUA 1GCAA 4EW1A 3RIXA 5FI0B 2CFTA 4OLHA 4G1MB 2JEOA 2CFRA 2YEVB 4Z1MA 2VJDA 3PWZA 3QA9A 1NVGA 4AYXA 2ZAGA 1B26A 4JVNA 2O5VA 2POQX 2P9HA 3I39X 3QXXA 4EMBA 3HABA 4Q0MA 4PRKA 1K9VF 2DWCA 2CLKB 4LYFA 3SICE 1VPDA 3WK6A 1DFIA 1PNQA 3CLTD 3HSKA 3M34A 1UC9A 2CHUA 1OWOA 2E7ZA 4CDMA 3SR2C 2R9RB 1UMDA 1WXIA 3IVMA 4C7UA 5CAEB 3IAUA 2L69A 1Q82W 1E2FA 4KN5A 2J87A 3BH7A 2Q6AA 4R0VA 2EQBA 2TMYA 4FYMA 4G2TA 4CF4A 2H00A 1ZJ6A 2AOUA 4QPZA 1CNFA 4R2KA 3RO7A 1DX6A 4NBLA 5KYWB 2Z56A 1SHZA 4PCLA 2GA9A 5AJUA 1F8FA 4O2LA 4UAJA 1VB5A 1W25A 1KVTA 1GRQA 4I1RA 1WG8A 4FLTA 1JBKA 2OK7A 1TEHA 1AI6A 2IW3A 4FHEA 1QQCA 3M4YA 1XP5A 2IXGA 1Z4MA 5DN6G 3ML0A 4G65A 4PAMA 1F2DA 4DBLE 1H6BA 4P84A 1OC4A 2HL6A 4DJJA 5F7OA 3NDPA 1J1ZA 3HTXA 3R65A 2IV2X 3WGYA 5JTUA 4E22A 2QTVB 5T67A 3DF9A 3T06B 1P74A 1E3JA 2EATA 2PJUA 2W90A 2NPOA 3PQFA 3ZV7A 1TVCA 4ZODA 2QX9A 2F8MA 5BV0A 3WADA 2IEYA 4FCVA 4TMYA 2FQQA 2ACKA 3PC8C 4Z1OA 1RDFA 4EK9A 2A2ZA 4D4IA 1N4AA 4EYEA 3TBHA 4E2LA 3OZFA 3EXAA 5I7AA 2R65A 4ML3A 4QUJA 3CC4V 2VNIA 3ASVA 4X0EA 3ZTYA 3OZVA 4K6HA 3CNNA 4GO1A 3T5DA 3F6EX 2ZB2A 1I24A 1MQ9A 1PL6A 1YFZA 2OOSA 3TIIA 3PUHA 3HACA 3I5UA 2PEYA 1NA5A 4REQB 4ZT2A 1YS9A 2JZNA 2XNDG 1EZ1A 5KZMB 1SU8A 2C2GA 3G5MA 3QKRB 3GJ7A 2OYCA 2C7BA 4CUKA 4P08A 4BXOB 2FXVA 5A5FA 2C4MA 5AG2A 2IJIA 1DJOA 2C9BA 3PPIA 3WRWA 5CA0F 3TVTA 4LF9O 3ESZA 3AI1A 4HAIA 2O3RA 2H52A 4KUMA 1SRYA 1T5EA 2OWOA 4YHHO 3IUEA 4Q1AA 3DTUB 4R2WA 4TMFA 2F66C 5F5LA 4JLKA 1UIRA 4TLDA 4RTQA 1V1MA 1WLSA 4R69A 3SYNA 3IV6A 2B94A 1PGOA 5IVPA 1U94A 3CF4G 3RC8A 3JTEA 3ASZA 4IILA 3CJQA 5KTRA 4DAOA 1J7JA 2PEZA 3ZD6A 3F6BX 4Q4HA 3CLHA 3Q7PA 4F12A 4RD2A 3FUUA 4TWJA 4I1YA 3I0NA 1NVWQ 4MV1A 1V8BA 4I4TB 3PFCA 4PIMA 1LTHR 1GCIA 1E1QG 3RRXA 1HE5A 2NAFA 3IBGA 1HK7A 5AJWA 1ZHFA 1Y4SA 4JLDA 3M89A 2WSLA 1QHSA 3GCDA 4TL6A 3V8EA 2PD3A 3T3IA 4B35A 3K9WA 4M6WA 3AGQA 4L5CA 3WKEA 2AZ4A 5C7OO 3U3KA 4JI5B 1MW9X 1K5HA 3DKVA 1DC3A 2UXXA 3J7TA 4IIGA 2XNCA 3PXAA 4KC0A 3TLYA 1RYBA 1D2DA 5TPWA 4S3MA 3GP5A 5J2TB 3KE9A 1MVNA 3OUFA 2PDAA 2GKGA 3KKMA 3M4JA 2PUGA 3EDYA 3I6MA 4WZAB 1ORTA 4MW4A 4Q4LA 1X2EA 2PQ0A 1CQPA 1SURA 1GDTA 1J2EA 3F97A 3JD4A 2JIMA 4P3NA 2YZ7A 3RAFC 2GX6A 2IUTA 2JEXA 4BB6A 2H1FA 4PRLA 4JB8A 5DNUA 3ZU4A 1OT5A 1W8DA 5T8KC 3AUTA 4M87A 3JQDA 1TM7E 1C1XA 4XA8A 3OHSX 4Q3NA 1X7ZA 4H0CA 2H7VA 2ATIA 3ABQB 3V7YA 2OBMA 1Z36A 5YASA 4WXMA 3KQQA 4RZXA 4OJNA 4KJZA 1K75A 2JJ2G 3LTEA 1S8AA 1IK6A 1W48A 3U3RA 3L73H 1W59A 4EA9A 4NVPA 2GV9A 1U3VA 2WDZA 4BJ1A 4GKVA 4CHTA 4L8JA 3ASNC 1KJ8A 4YRPA 1YFKA 4BZQA 5BN1A 2EC5A 5BQXA 2QM3A 3BGVA 4CDNA 4BHTA 4MRAA 4C6SA 2VDVE 4AWXA 5L3SA 5KHKA 4G81A 3BX1A 2WJ3A 1KRHA 4F46A 3EEIA 1JHXA 3DTVD 2Q45A 4TMWA 3KOWA 1PAUA 4ZV4A 4IXMA 3WL4A 1Y42X 5C53B 4O2BA 4PZUA 2X6TA 4TL7A 1COWD 3OU2A 3QOYA 5EIOA 4Q3BA 2HRBA 3TL6A 1SU4A 4KCGA 2AOXA 3I9MA 3PGJA 4BZXA 4MITA 2UYOA 1EX9A 4JLUA 3IR5A 3RM3A 3NDIA 4MVJI 5IC4A 1H05A 3CZAA 5CM2Z 1K1EA 3BM5A 2HWWA 4N5HX 3CURA 1FW6A 2WUEA 4RIEA 4KQJA 4LCEA 1QTQA 2RG7A 4Q9HA 4F84A 3HLYA 3RVKA 2JGJA 5DBGA 2PWAA 2JCBA 1V3UA 2FUCA 4R7ZA 3VQYA 5HJ5A 1DWPA 4BFZA 4MVWA 1DTOA 1WQ1R 4DJAA 5DCUA 4UHKA 3VKHA 3TNJA 2WPDA 4DJ5X 2HJWA 1O8CA 1XXLA 1P33A 3BWMA 3T4EA 3DTTA 1VF7A 4HTAA 1LBQA 5I7EA 4JPRA 2DQ4A 3PTAA 5CGQB 1GV1A 2VQFB 4FZRA 4WUVA 4WPGA 3BE5A 1UJCA 3KL2A 5CK4A 3PFIA 3ZYCA 4BFYA 1Q6HA 1U0BB 5E1DA 3DHEA 4W9NA 3QVOA 3E84A 5IHXA 3UQZA 4PYOA 4EPWA 1KJJA 4RK0A 4OATA 2IOHA 4HZGA 4MI3A 3TI7A 3RFRA 5EQJB 2B5UA 3OFSA 2JC3A 4WADA 4FFOA 2OCCB 5BOVA 5CUQA 3ABUA 2A94A 2OCYC 2BKVA 5CXXA 3P3PA 1M75A 4QBHA 4BNTA 4RORA 4J49A 3QVWA 3BYZA 3GEPA 4LXGA 3LV8A 2WQ7A 1FRZA 3QU5A 4AKEA 2B2XA 3B5JA 3AKCA 4EATA 3A3KA 1UXOA 4ZOEA 1XMSA 1N5MA 4FYXA 4YC7A 1EFKA 3CKYA 1YKGA 1Z56C 3R7WA 3RADC 1QQTA 3QFRA 4DIOA 3EWIA 1U7ZA 2BKAA 2HFKA 4D56A 3AXSA 4J7AA 5H6RA 4X41A 4UREA 5AP9A 4G84A 3CX8A 2RGBA 3BFXA 3TIVA 4OBEA 4RANA 1MDBA 4M9SA 3A10A 3U7QB 1FYWA 1RXYA 1EFDN 2EFGA 3K5HA 1K7YA 1QZ3A 2BVNA 1C2TA 3WVNA 4AURA 5E0KB 1KE2A 3IUJA 3ABZA 5ALKA 4R81A 1KRWA 3AG3C 1PJLA 4MQ6A 4W5RA 3LA6A 4B0OA 2O9JA 4IGIA 4DM7A 2YZGA 2JGMA 2CB0A 2ZRBA 1PT6A 4U6NA 1RRCA 3AR5A 1SC4A 3KDPA 3LBYA 1JAXA 1QE5A 2ZU6A 3MAGA 3WB9A 2JS5A 2N1MA 5IWAB 5LLDA 3B9QA 3JSLA 1CRPA 1CD5A 2GHYA 2JGDB 3K32A 4I1SA 2WWYA 1WV0A 2QN2A 2YZNA 3GVXA 1E2QA 2Y1EA 3S99A 1TRKA 1LTKA 3BHPA 2BUAA 4CGZA 3T1HO 3WYEA 2EDAA 4LVNA 3ZD7A 1LBTA 4F7DA 4D3DA 4DV7O 1YB7A 1MLDA 4IAOA 4HLCA 5M34A 3VR4A 1H4SA 2FPIB 4JGBA 1UT6A 3U49A 4UNQA 3VOBA 4ITVA 1L8AA 1UMBB 3G9QA 3DDZX 2W00A 4GPAA 3FCYA 4PPYA 1GGJA 4IHJA 3L6DA 4ZEVA 3GDOA 4OYRA 1XT6A 4S2EA 1XNJA 5FFNA 5F7JA 2HG5C 2VF7A 1YI2V 4QUIA 2WTUA 1VG9B 5LJIA 4B3JA 2CF6A 2HY7A 3KXDA 3H6KA 1D5CA 4XRGA 1SBTA 5EE5B 4MPJA