3WB0A

Hcgb from methanocaldococcus jannaschii in complex with light-decomposed fegp cofactor of [fe]-hydrogenase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
158
structure length
158
Chain Sequence
VVMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0488
publication title Identification of the HcgB enzyme in [Fe]-hydrogenase-cofactor biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 59
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.-:
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3wb0A01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3wb0A02
1IWPB 1EGVB 1IWBB 1UC5B 2F93B 4DK1A 1RSOA 3WB2A 3AUJB 4L8JA 1EEXB 2D0OB 3WB0A 2F95B 3LNNA 5JJJB 2D0PB 4GYCB 3WB1A 1DIOB 5JJEB 5JJNB 1UC4B 2F1MA 3BRCA 5D5QA 1VF7A 5D5PA 4DK0A 1T5EA 1NBWB 1H2SB 2V4DA 1MMFB 1EGMB
chains in the Genus database with same CATH superfamily
2C84A 2QGZA 1MF7A 5AM1A 4FB4A 5HA5A 4J76A 4LVNA 5T41A 3M4JA 3ICXA 3MPUA 1JEAA 5JSZA 4YVFA 5FAKA 3ZE9A 1TQHA 4CIAA 1E9AA 1ZIXA 3WS7A 1FX1A 3LCUA 2PEZA 1RW4A 4Z2YA 1K5SA 1B00A 3AESA 3CRZA 3UKMA 4B3TO 4AKEA 3N2KA 3L8GA 3DPUA 3IAM1 2H0QA 3ZKAA 3CW2A 3SX2A 1AJNA 4DNOA 2WBLC 5ILQA 2O20A 2H51A 3H1AA 4DXWA 4YPOA 1E2DA 1JZTA 1MX5A 4NAVA 4MV9A 4GI3A 3V8NA 5K6AA 2E82A 3T06B 3SQOA 3RH0A 4EABA 5HFLA 5EQFA 1E58A 4M54A 2AFIA 3NUQA 2A5JA 5E4JA 3F7OA 3RUHA 3U10A 1GTL1 4HP8A 4E94A 1H2HA 3QFFA 3ZCQA 2PHZA 1SVUA 1NBME 4UMEA 3I28A 3T1YB 3KOYA 4P22A 2JDIA 1RAEA 3Q7IA 2WM9B 4IHJA 2RGEA 2GTSA 1UEIA 4XWTA 1CDOA 5IK2D 3PQCA 3COWA 1MHTA 4CF6A 3RREA 1LBHA 1EA7A 2VJYA 1KJWA 4MW9A 4RPGA 2QTFA 3LVQE 3N2ZB 1ZGAA 3T5BA 3A11A 1A5TA 2V9PA 5KKCA 3CWQA 3WIVA 1B06A 4EB3A 4KIUA 4LF5B 1U8TA 2Z8XA 1PKEA 5KA6A 1UT6A 2QTBA 3EAGA 4NONA 2R1VB 4KBFA 5BVHB 5BSKA 3D8SA 3Q4HA 1PX2A 1LPMA 2H00A 4M87A 2Q4RA 1ZX3A 3SYQA 4C4RA 3L07A 1TMKA 5K6TA 3Q88A 3SFVA 1GPNA 3MMPA 4MS3A 5DVZA 5IVDA 2Y99A 5K8IA 3AO0B 3P0IA 2NNLD 4UVAA 2L0XA 2VDUE 4FDLA 1JDUA 3VR5A 4DC1A 1RWWA 2HMSA 2IYQA 4EPYA 2FEKA 4M0EA 1P4GA 1TIKA 1ZCZA 1FNSA 2J0VA 5G02A 4O4HA 2XQVA 4ZO9A 1QOQB 1ZLZA 1JHZA 2Y0CA 2F8SA 4AUNA 1NU1H 1NNSA 3CN7A 1JHAA 3G8CA 1V16B 2X77A 5EP3A 3EWIA 2CYCA 3IXQA 4ISCA 5CVUA 5IJ9A 2HQBA 1GUAA 1WBJB 5I51A 3ZRSA 1HI9A 4WADA 4EO7A 1E2QA 2YWEA 2R8RA 3W7UA 3KDAA 4P4NA 2OHGA 3IUBA 1V1MA 3WGLA 4M1QA 5L51A 4HQRA 1XKXA 3P4YA 4Z99A 1J22A 3FOCA 3K0SA 1GZ4A 1P1CA 3KPJA 2ZJAA 3OIWA 1TZMA 5B12A 1XNRB 3FOEC 4RYLA 2DG2A 2FZWA 1CJCA 1NKVA 3K06A 2BTOA 5HZMA 2EJVA 4EB6A 3L0IB 1HEIA 2W37A 1GM5A 2IZ1A 2PTGA 5DNDA 3JQCA 5ES4B 5KLVH 1D2HA 1YJWV 3Q8XB 3OCYA 5KKAA 2O8BB 1XILA 1JG7A 1XGKA 1IHOA 3K2EA 5GWXA 1PJAA 1UXIA 4ZI2A 4Z53A 5JS7A 4YUYA 1DAFA 5L3BA 3TBHA 1R0YA 3EVKA 5KAIZ 1ID8A 3M8AA 1CVLA 3ISTA 4WBNF 3MIIA 3RABA 5D1HA 3TXAA 3HDTA 3ESDA 4ZU6X 2O7VA 4I9QA 4MHSA 4Z0NA 3E8MA 2XITA 4NIMA 1JT9A 5BMVF 4DYHA 2I6UA 4RFLA 3UV7A 3MINA 3APQA 4F92B 1T9KA 4U63A 2FU5C 4DJAA 4PBTA 2O7NA 2WYVA 1JEDA 4P3PA 3OIUA 4EKNB 3GLFE 3P0EA 1PK9A 3DOOA 1NC1A 4CMJA 3Q7TA 5A62A 3NXSA 3OA2A 3FH0A 3KE9A 5IASA 1PX0A 1KYWA 4ARBA 4U00A 1SXJD 1VBFA 3DDWA 5GVSA 2G25A 1SXJB 4P58A 2CUNA 3K1TA 2C9ZA 4TV9A 1BA2A 5G41A 2V0CA 4XPZA 4WZZA 1KEPA 3CKMA 3QKIA 2O0MA 1TVEA 3HJUA 3B8EA 5EJ9A 5BRAA 3O4JA 4K81B 2Q4TA 1R74A 4NCNA 2VTDA 4OHXA 3GPLA 4WUTA 3UV6A 1WDWB 3DWFA 4Q4AA 1LPSA 3T2MA 3KQQA 4XUGB 2Z6AA 1PHRA 1Z2PX 3ZGVA 4O0MA 3T38A 3RHZA 1K6EA 2HN9A 3GVMA 3MS7A 4JLPA 1XU4A 3KHKA 2GLTA 2JJ8A 5E2IA 1DF5A 2XNDD 2W48A 3C1OA 1UBUS 4G65A 3PFKA 4CT0A 3B6MA 2PPLA 2E3CA 3ZDQA 4P4GA 3A36A 1ZIPA 4HDSB 2ZUUA 1JDBC 1SC4A 1K6MA 1UBTS 1S5HC 5K3CA 3ZTWA 2E75B 4RORA 1H2NA 3HB7A 5CLHA 1EUYA 4L85A 1SUEA 2OMEA 4PX2A 2RGDA 2FLKA 4CFSA 2C0CA 1EFPA 1YOVB 4AG6A 1IEVA 3V6MA 5HFNA 3DQZA 1BFKA 3DEZA 1TF2A 1S2DA 4MWTA 3K05A 2EP8A 3RAGA 4CKEB 3K1YA 1BDMA 4GOKA 5L4LA 4OBBA 4NENA 5JE8A 4EFEA 1C8LA 2P6JA 1ZJ4A 4FI3F 6GPBA 1VFNA 1EBFA 4ZCQA 3ZLTA 2ASVA 1EK2A 3RHTA 2WU8A 3NGXA 1ODFA 3FNIA 4FE4A 2B9EA 2WG2A 3IGFA 2VDNB 3OCJA 1QF7A 4A3SA 3NWOA 1ZGCA 2NZWA 4PWYA 5D85A 3GDWA 4CDGA 1EG7A 3TJMA 1WULS 4Q6GA 3PN1A 2YVUA 1KDZA 1WNSA 4UHHA 3NHYA 4QBTA 3SNHA 3ZX6A 1QO0A 1TF5A 1DKUA 4LDQA 4XB1A 1Z28A 3OM9A 2DBVO 2VHXA 2E89A 3GJSA 5FUVA 4WINA 1GQOA 3V2GA 3ITEA 4K46A 5E1AC 4YP9A 1WV1A 1H8HG 4JIGA 5A6VA 2BBOA 3JQ6A 2QPOA 3MCZA 4R2HA 3WSTA 2IU4A 3RSFA 5KWEA 1DAKA 3IH5A 2Q3LA 1RBYA 4F56A 5B1AC 1XMXA 2HSDA 1MX1A 1EE9A 4YIHA 10MHA 4H7FA 3D3WA 2ZGVA 1JTVA 1XJCA 3O5AA 3EZGA 1FQOA 1VKZA 1G8PA 3S1AB 3PHIA 2ZE7A 2FSIA 1R3UA 1YDWA 421PA 1HBJA 4GLXA 4JWKA 2RGWA 3HO8A 2YJGA 1A98A 5A4DA 3AG7A 2PNJA 3FR7A 3DO6A 2HL6A 4KLCA 1N5DA 1U5BB 3C5HA 1E79G 1YJNV 2PA3A 2PGXA 2I8LA 3DC2A 4YJ2F 2I99A 2R96A 3M3PA 2AJLI 4NXNB 4GKKB 3UJDA 5B37A 2H29A 4ZTZB 3RTDA 4A03A 3LXUX 3WYBA 5AW9A 3EQ7A 2V7GA 5HTOA 4MTGA 2I4RA 3ER6A 1CDDA 3ORHA 2BMWA 2DOSA 1L7PA 4LYAA 5FEUA 3K94A 4K8XA 3UKJA 2V7PA 2BHTA 4ENQA 5KNBA 5AOAA 3IEVA 4YWHA 2HCRA 5C1PA 3I9KA 1NYTA 1D9XA 1NP6A 2HF8A 1SRYA 2UYQA 4IDPA 1LK7A 3FVRA 4ALJA 5THQA 4A0RA 4ZI7F 4I0XA 1JQKA 3KD3A 4TOIA 4GSYA 3TQHA 1EM1A 4NHOA 2BV3A 2O3RA 2COUA 2VQ6A 3NC0C 3SC4A 2VAMA 2V9CA 3NNNA 5ALOA 3OZBA 4GX1A 4QDJA 1AS0A 1YO6A 4RA6A 1YOBA 4RDCA 5JATA 4FKZA 4FNGA 5LQRA 3K35A 3OE7A 1JRLA 4GE0A 3OTFA 4S0ZA 1UT5A 2F1HA 3VHRA 1WHSA 3ZHXA 3S2SA 5EXXA 4P6VF 3GU3A 1JQJC 1A9ZA 3RIYA 2WKRA 3A2NA 1I9CA 2BN4A 3E3OA 5DYGA 1WG8A 3KRTA 3SPCA 1FYEA 4JA2A 2X6BA 4I08A 2JVDA 2DLDA 2O5EA 1Z8DA 4DC9A 3VO9A 3ASZA 4OF4A 1H0KA 2DY1A 1AKVA 5H2FZ 3DMTC 1PYGA 2YVQA 2FFHA 1UZAA 3RRYA 1DDOA 2HHJA 4G8JA 2AIRA 1TXGA 5M7EA 2BFMA 4GW3A 1YB4A 5FI5A 2MMGA 3DTTA 3ZV6A 1AJEA 2I4OA 1UPUA 2C4NA 4HAXA 1IQRA 1LD3A 1K4YA 3CXCU 1VHTA 5AMXA 4NAUA 1RYBA 4DA9A 3DXFA 5NLLA 2ARKA 2AMFA 3PVZA 4WASA 3AG5A 3COVA 1DE0A 5L4NA 3WMXA 3EF1A 1QQBA 1QGYA 3RBAA 3OQNA 1EBBA 1LK0A 3KQSA 1LV8A 3UF0A 5HK9A 3AIOA 2B8TA 1RE1A 2XWSA 1RC8A 3QWIA 4S1WA 1V5GA 2QSAA 4C01A 1P45A 3PL1A 4OLJA 3SQDA 4IIJB 3P2YA 5HM8A 2ST1A 3KZ1E 4TT8A 1K3FA 4FFBA 2GAIA 3HXPA 4EYSA 3NAZA 4XFJA 4MW7A 2WINI 4U7GA 5FI0B 1T3GA 1O94D 4BN4A 1L4GA 1C3EA 1SCUA 4PI0A 4D4GA 3JZIA 1W1UA 3FSEA 4BVKA 4RHUA 3L7OA 1IDN1 1JHYA 4YT4A 3NYWA 1NE2A 4EG5A 1EVIA 4DR6O 4KWEA 3LDHA 1NW7A 3CUYA 3QVNA 3THSA 4W5JA 1JXAA 1QMPA 2CUGA 4CF5A 3GW8A 3ZJVA 5BT8A 4LJ8A 3M5DA 2ZUCA 3RYIA 2DPLA 4LPSA 5K1PA 1ZUHA 5J9PC 4UTRA 1W47A 1ST3A 1CERA 2ZR7A 4A27A 1JE0A 5FPHA 5ES3A 5EIXA 1Y66A 3Q6IA 3E86A 3CONA 1YNSA 1FVHA 1GRJA 1L5MA 3BK1A 4Y6LA 1NVDA 4MZXA 3VNRA 4UBJA 4HUJA 2GX6A 2BOVA 1Z08A 2UYGA 2VHZA 4EF5A 4G9EA 4IWYA 3DCYA 3PLNA 1OSNA 4Q9KA 3VZBA 1SWVA 3DGEC 3SP1A 2WVGA 5C1IA 1N3LA 5HQJA 4DIDA 2RG1A 4PYIA 1U0JA 4M9ZA 3QXJA 1FQJA 2H17A 2JS7A 2G38A 1Q95A 2EKLA 3PCTA 4RD2A 4G36A 3RSQA 5I9IA 1RJ9B 5HHTA 1VPWA 4GG1A 2XB6A 1O58A 2P06A 3MCVA 4FM0A 1GADO 2DQ4A 2WF6A 5L3VA 3WLRA 2QI9C 1R0XA 1OV4A 1V6CA 4DV7O 3UC5A 4YJFA 4PNEA 1FXUA 2A9JA 1WB8A 3CVVA 3V33A 5AFSA 1XTQA 2R79A 4E4RA 2QPLA 2GAAA 2OQ2A 3I30X 3ZDAA 3DBIA 2PX2A 4HFMA 2F1MA 1TM5E 1ZM9A 2QVGA 1OYVA 3BA9A 1SCJA 1ECBA 2M6SA 3HBFA 3U39A 2P9BA 4W8HA 2D7CA 1GLVA 4TTJA 1H8HD 1A50B 2CVZA 2JEOA 3IMGA 5E1BA 4W1SA 1N1DA 1N8TA 2E1PA 1GEGA 5BNZA 4JL5A 2AZTA 4RHEA 3MB8A 1V7ZA 3IJRA 1KAGA 3PYLA 3K04A 3KYDB 3B3JA 4PTYA 1HLGA 1CZNA 1X94A 4LJLA 5AJZA 3BKXA 3ZCRA 4I46A 4MS1B 3ZGYA 5AM0A 4HKTA 3WLIA 1UC4B 5H68A 3BXPA 2CFOA 3VKHA 1E79D 3C3AA 4L22A 4E15A 4NP6A 3F4KA 1Y33E 5IDQA 4N0QA 1AMNA 4MUEA 4DG9A 2BFDB 3N2GB 1VL2A 4DRXA 4BAUA 3MERA 5B6PA 2Z98A 3W7AA 1X59A 1E66A 2PKEA 4RK6A 2JDIG 4FJ1A 3JVDA 4EQZA 3N6RA 1XBTA 1X7WA 2BJVA 3R41A 1GRNA 2W58A 3EY4A 4DIEA 1P4HA 3WLJA 4RFSB 2HSZA 2R70A 5L40A 1QLEB 1UFRA 1KOJA 4MKXA 3NTRA 2FWPA 5J5VA 3B9PA 3SBXA 4FCVA 1ONBA 3I9OA 1JFLA 4FYKA 3RG8A 3M6XA 3O9VA 5BT9A 5JLJA 2HU5A 1M72A 5J43A 5CG2A 1U7DA 2VIIA 1VGVA 2RB4A 2GYYA 1QFMA 1Z88A 3WWCA 1PNVA 5KTRA 4NEQA 4JAAA 3E89A 3F90A 3T7JA 1TYAE 1Z17A 4OB8A 1K3UB 1IAVA 2QY6A 1IM8A 1ZYUA 4QX6A 2VDQB 5EN4A 4PE5B 3T9FA 4Z3DA 1YD7A 3CIFA 3GCGA 5C5IA 1BFUA 4UNNA 4LHYA 3DLIA 4DJDC 4LJ9A 3V8PA 4R9SA 4AI8A 1O96B 5IM4F 4B3MB 4B44A 2LGJA 3UUWA 4OXXA 1UDBA 2H85A 4X00A 4YTEA 4BP8A 1ZOSA 1U8EA 4GKAA 1FUKA 1EM8A 1VMGA 2XWQA 4J9YB 3W6OA 1D6NA 4QHSA 5JWHA 2EW1A 4FYPA 1H4SA 4OPMA 2PKQP 5HJ5A 4MVCA 1EAYA 2YS8A 3LZ6A 3E82A 2HKOA 4ZHQA 5FTWA 2VYCA 2WUDA 3FUUA 1T8SA 3L06A 3QLUC 2Q21A 2BISA 3WKEA 1HMYA 2IS2A 4KO3S 4ZRNA 3LRTA 1RC1A 2VRWA 5IKPA 3SZOA 1I2BA 5SZKB 3VMFA 2VWGA 1J0CA 1DQYA 1M7GA 2GN2A 3BXXA 3DVAA 3K1AA 4HX2A 1RRCA 3HJNA 4D4LA 1S72V 5FHRA 3ABSB 3ZI7A 1UXKA 4OKIA 4BUZA 3EZ7A 1N34O 3EW7A 1CUWA 2B8JA 2I7CA 2X9GA 3H1JH 3QEMA 4BNLA 1NC3A 3WLMA 5REQA 4BLOA 4S1OA 4L28A 4L0DA 2TMYA 3L7NA 2WLIB 4ALNA 3VH3A 3EFFK 3BGDA 1NNEA 4BGUA 2VHTA 4XE5A 2OCAA 1U2DA 4IX9A 5K0SA 3KUXA 1Q22A 5F7XA 1INLA 2I8AA 2AOXA 3D8NA 3ZMVA 3GMDA 1ZOPA 1OGYA 2AFHE 1MW8X 2UVDA 5MF6A 3AV3A 3RVSA 1Y6QA 2DKOA 2ZRPA 1G8YA 1L3CA 1V35A 3KYCA 5A05A 4DEXA 3W8FA 3UGTA 3ZCSA 2CCJA 1JKJB 3WY9A 1AK2A 3BXFA 1ZEJA 4QHYA 1U7PA 2FQXA 2GEUA 2HO5A 5TMPA 4Z4FA 1W4RA 1A32A 2DP4E 2HSGA 2ZJ1A 1T13A 2LKCA 2R8ZA 5EPEA 5BR1A 4MWOA 2FKAA 2YY5A 1TD9A 3D3JA 3H11A 1J0XO 1CY4A 3TOSA 3GWKC 1S1CA 1HYHA 4HPJB 4A8JB 1I30A 4JTDB 2GPBA 2QRJA 3QKRA 4G2NA 4EO4A 5KDOA 3WYNA 1H2YA 4IT5A 4ZVMA 2QLJA 2YIDA 4NKGB 1V0JA 3TGWA 2ZDIC 1QYDA 2W2KB 4HXFB 7GPBA 5JSQA 1Y76A 1FW8A 1MU0A 3OUUA 1CXZA 3DE1X 3MSXA 3V34A 2OGUA 3FX7A 1FNMA 5M29A 1Q57A 4JP3A 1G21E 2HUPA 3D64A 1KMMA 2YHAA 5E1DA 2GHTA 3VGPA 4EKIA 3QV1A 3CF2A 5IYDO 3DFUA 1VYTA 2A94A 4MP8A 1R0ZA 5ABPA 5KINB 2VJQA 1I0ZA 2Q68A 1ZNQO 1ZKDA 3H8SA 3NG1A 5LR6A 3T3OA 3OKFA 2VF7A 3FF4A 1B4DA 4PGGA 3CX4A 1VE3A 1Y6FA 4QTZA 4AC9A 4BP3A 1FPOA 1CF9A 5DNWA 2OORC 4BNYA 1CIVA 3CWZA 2WA3A 5CAEA 4ZCIA 2WJ4A 3N9IA 1IUOA 4E2ZA 2UXBB 3QQPA 1MO4A 2WJVA 2I03A 4OLAA 1Z5GA 1B2LA 3UH1A 4YDSA 4UAJA 3T1HO 3ILXA 4Z9YA 3H5NA 4NG4A 4YK7A 4H35A 4QGFA 1I4TD 3O4RA 5D6NA 4QPJC 2HHHB 1I3MA 1P9LA 3WLAA 1K97A 4XIGS 2UXXA 3GLQA 3S2EA 5KVSA 1T3ZA 3WK6A 4WZAE 4CKYA 5JJNB 1OLUA 1L8LA 2JJ2G 3Q8MA 2NN4A 3AESB 3N2KB 1SBTA 3DAHA 3ZE8A 3ZHBA 2PSFA 5JMTA 4F2GA 1ATZA 2I29A 1WBDA 1TEHA 1DV2A 3V8VA 2PQ0A 1O8CA 2IPOA 5F76A 2ODEA 3FNEA 2ZYUX 2GHQA 2OCHA 2AFIB 5IVPA 2Q3EA 2UU9O 4PHHA 1DCTA 2C96A 3SXPA 3LDDA 1P1IA 1PK7A 2JDID 3ZZ0A 7MDHA 3ZMZA 3Q12A 3GUUA 4IHJB 4DNPA 3AM5A 2PVSA 5TB5A 4MIOA 1DT5A 4RWEA 2FKXA 2G70A 1KE1A 3W6NA 3UBMA 1RXWA 3QBDA 4ZREA 2PH1A 2GMWA 4M9UA 3TDMA 1SJ9A 1VMDA 1EVJA 3DD5A 4UPVA 3TSOA 1E6EA 2Q5CA 1T9ZA 2K5UA 1AUOA 1N2CA 3UMCA 4H0CA 1AA6A 3PGA1 1X7GA 1XD9A 1ZVQA 3RANA 5K05A 4ZVUA 4HDOB 1S8AA 1TFUA 3IVXA 1PQWA 1ID1A 2JLZA 1HDZA 1GQRA 3M0EA 4C7XA 1KB9F 4OX9Y 2FMKA 4FFSA 3Q4HB 4QKQA 1ISFA 3AEIA 2DC1A 1HZZC 1Z0UA 3PNKA 3PNLA 3HCWA 3A1EA 2YN4A 4MS3B 1BW9A 4CL8A 4LXIA 2O1SA 2NAPA 3ZW7A 2WJYA 3NJ4A 5HFMA 4DR5O 1PJSA 3VR5D 1NVPD 3UJHA 1PLJA 4KIJA 4JY7A 2PKXA 1NVPB 5JAUA 3I5YA 5I4KA 5JO9A 1IE3A 3CJQA 4PC2A 1X39A 2OPBA 4O4HB 2PU7A 1BQ3A 5AICA 3RPEA 1QANA 5IT4A 2K7FA 4WFKA 5AW2A 4AJ2A 2Q4EA 3U4HA 3C3DA 1TVKA 3EZXA 1H6BA 3R5SA 4HTAA 4BZXA 5IJ9B 4KV9A 1CNEA 3ST7A 3QENA 3O8LA 2MOKA 5GZ1A 4RZHA 1I2ZA 2O3TA 1RSOA 1ZCJA 5AM2A 2GK6A 4YRZA 4I5GA 1V1MB 3NWEA 4QJ3A 1IXZA 3G0DA 2XQGA 2O57A 1FC0A 1KA9H 4NCXA 1H1DA 3DTUB 3EXAA 2CVFA 2FN9A 5EBLC 5KYNA 4KWIA 3B1YA 3QUAA 3LY8A 2GZ2A 5FNVF 3O8QA 4B43A 4HOYA 4U3FH 1VCHA 2P5OA 1WR8A 3PA8A 3K09C 3FAZA 4L8WB 4LCEA 2DQ3A 4OXIA 2P4VA 2R62A 2PRYA 3KU1A 4RBNA 3CZMA 1K34A 2YFHA 3ZY6A 4L2IA 5HRUA 1LA2A 1B04A 4F4UA 3NIBA 3SZGA 2I62A 5EIEA 1NYQA 3VI4B 2GYVA 5EIOA 5KYKA 2QBYA 3HVKA 4JI0O 4XSGA 2OM6A 3W2TA 2HTEA 4L08A 3TFOA 4FD3A 2PYIA 1S7CA 2Q5HA 2VH1A 1SGWA 3M9WA 1NVUQ 4NARA 2GO1A 2ZM6O 3FR8A 3K5MA 3KYIB 2GCNA 4I55F 1WO8A 3QXGA 2QSUA 2QI9F 4W5WA 2FKNA 2OAEA 3HBJA 3V4PB 2VNJA 5K3OA 5K6RA 5CX4A 3DCIA 3CW9A 3OEYA 1XMIA 2GK7A 3MINB 3OSUA 3WL8A 2JGDA 5L6MB 1TX4B 5LL6Y 5HMMA 3VQVA 1G8FA 1U8AA 2CD9A 3SQWA 4IG4A 5MN4A 2QWOB 4H0FA 3F3KA 4XIFA 1XA3A 3QPDA 4KNVA 2OBBA 2NN3C 2ZS7A 3CO0S 4PQYA 2ILTA 4OGQB 3MWKA 5KDLA 1R9NA 3I0ZA 4M4SA 4D3FA 4UV8A 4TV9B 5KOJA 2EC5A 3SIXA 4QOFA 1GL7A 4W7HA 2RHDA 4BFLA 2I5PO 4RU1A 3RI3A 3S0JA 3QYPA 1J0EA 2YW9A 4J6EA 5IC6A 2VPPA 3DXXA 1X1AA 3OHMA 3AL3A 3MAGA 4GPD1 4N41A 4Q4AB 2H07A 2P7IA 3QVJA 3G2LA 2C5SA 3WL4A 5D51S 1IU9A 2IIBA 2V7TA 4DQKA 2WLKA 2DFKB 4MMZB 5DWQA 4OPAA 4J0FA 3QJ5A 3QSYA 2LP7A 5AJHA 3KSMA 3E9NA 3LUFA 1WSWA 3VDRA 1NPYA 1UBHS 5AW5A 4L74A 4IJMA 4OH7A 4W7IA 4P0QB 3AWIA 4FSXA 2QM8A 5JQWA 3QX8A 4P0PB 4RO0A 1QMGA 1Q81W 1N2GA 4D9CA 4LW8A 4ZV7A 2JLCA 3M70A 1G5FA 3ONFA 3U16A 3PA6A 1J00A 2OV8A 2RG7A 3IUJA 1IVNA 1X38A 2WF7A 4UMVA 2BTQA 1EG2A 3DE3X 2G07A 1EFPB 2Q2NA 1SOUA 3NP7A 3CTPA 2GQ0A 1KECA 2PBLA 4R98A 1QE0A 1K6XA 3UMGA 5K7SA 4M55A 4Q3OA 4GE3A 5AYVA 4AIIA 1NJ6A 4JJFA 2E5LO 4AS1A 4NENB 2BE9A 3GLSA 5TPWA 4NVPA 4ENWA 4MROA 3CUEF 3KCXA 2C5EA 4R1OA 5KC8A 2WNHA 4YIOA 2QN2A 3EXFA 5ALLA 2D13A 2VL7A 1FRQA 3KT3A 4IIFA 2REXB 4M1ZA 1YIOA 2YNMD 1UKYA 5LVAA 1AH2A 1T0JB 2I6SA 4X66B 2VK8A 1EUDA 3PEFA 1X7XA 4V39A 4G41A 2QX7A 1C4WA 2ON6A 3AW9A 3UKDA 1GVNB 2Z6VA 1RWNA 2D8MA 1JB9A 4NBWA 2PSEA 3U3XA 2O3SA 4W5TA 2AA3A 4Z3KA 1PV2A 3WIBA 4KEAA 1QGAA 3IQZA 1JLMA 4J0QA 2ORVA 4F4FA 4FI3C 1GPYA 1SAYA 1T2NA 2R751 1AN0A 4FEYA 4D9FA 3B09A 1T2EA 3G6KA 4LMPA 3EISA 1NZ6A 4HAUA 4GECA 4XA8A 4DYLA 4MR8A 4C87A 1RJFA 3OU6A 2FWBA 5BSEA 1YZVA 3QLEA 4MPDA 2H4HA 2CTQA 3W7SA 3IRVA 1L4HA 1EN6A 1AF4A 4PDLA 1QS0A 4LXQA 3WBJA 4BNMA 3EFOA 1SPXA 4LA4A 4G0QA 5FL7A 4KR0A 4IYJA 1QWOA 5JQGA 3IAS6 5ICMA 1FUIA 1H2LA 4X3PA 5CDFA 3SKVA 4ER5A 1VDMA 1HNXB 1K73W 3ZHSA 3UJCA 1FMFA 4AF7A 5JISA 1IN6A 3SEQA 2YC2C 4A1FA 1FIUA 3ORYA 4B0PA 4ER0A 1HV8A 5CU7A 1I1OA 5AI6A 3E48A 1KMHA 2WLTA 1S2GA 1K2VN 2OYSA 1S2OA 3OLZA 3HL0A 2AE1A 4CLXA 1M1YA 1DAOA 4G3XA 3WQBA 4Q4CA 3OPMA 2AHYA 2YINC 1RYNA 3LDAA 2PX6A 2GJSA 3ILSA 3N8GA 4JVLA 3B9BA 2H1SA 4R84A 4OHKA 2PUTA 1HT1E 2BGKA 3D59A 2BONA 1BVUA 1K89A 4CIBA 5EUBA 5KNBD 1OXXK 3OEHG 2OXCA 1EXVA 3OT1A 5JDIC 1NA5A 5BXYA 3GOHA 1T2CA 4I0XB 2HNBA 2HCBA 2HQOA 1H38A 5LOVA 2IP1A 5LA6F 5A3VA 4CR6A 1NZJA 2CYBA 1W36C 1I6WA 2XODA 3ZW8A 2IHYA 4PC3A 2CGNA 4RA6B 4H15A 1R2QA 2QRLA 1VJTA 3LWDA 1BQ0A 1XRJA 3B3QA 5DSZA 3AHDA 4BNHA 3Q1KA 1V3UA 3RFTA 2F9FA 1WHSB 5EWLA 2YKGA 1S76D 3D6HA 3IJ5A 4NPHA 2R6R1 4PQFA 1FU8A 3L7JA 3D1VA 1EDDA 4IJKA 1E96A 2OG2A 1JHMA 1R5NA 1O0BA 1CQJA 2JRCA 4PR0A 2Q8PA 5JY1A 4M0KA 4ZDWA 2JIZA 4X63A 3D0QA 1O6FA 3LSUA 3LQRA 3D6NB 2FUCA 2QM3A 4AUMA 1ZJ6A 3TLJA 2D1SA 4QGPA 3T9AA 3NFYA 3OWXA 4GMKA 4UFPA 3Q4GA 1CEEA 1NQTA 1E0KA 4PLPA 1X3SA 5TPZA 4TMFA 1XQVA 4DLYA 3I05A 5A5GA 1CZOA 1E9CA 5DB4A 2NV2B 1OWOA 2ZOSA 2VZLA 2IXBA 2E6KA 4Q4HA 2YUIA 1SUPA 3O0TA 4UUJC 4IIVA 2QIOA 2VCEA 2Y69C 3FKQA 1B3BA 4C4PA 5BQXA 1D6JA 5C5EA 2A86A 4QGGA 3C45A 4RGYA 4KZPA 5JPDA 1CUDA 2OXIA 2BMVA 5JCJA 4E08A 4MB2A 1Q83A 2R84A 5DBEX 5A3RA 4CMHA 4Z0HO 5DLYA 4G81A 4PX5A 2DFLA 1TJ5A 1MZFA 2Q8NA 1SCUB 2GZSA 4KPFC 1K75A 2UZ4A 1GGFA 4ZTUB 3HSKA 4RD1A 2L82A 3EG5A 3VXKA 3EMVA 2PAAA 4Q7LA 2F48A 4I5EA 4Q3LA 2EJ7A 4BHTA 4YCAA 3DA8A 2FWIA 2DMRA 3K72B 3MCAA 2HADA 5FRDA 3KPVA 3E9CA 2VI5A 4QTXA 4DZRA 1Q20A 4XW2A 1OF1A 3EX7C 5A1TA 4IXWA 2XUHA 5ED4A 4JROA 3IUMA 4JVSB 4OU4A 5A4MS 4C21A 5CNKA 4Z4CA 2KW5A 4YECA 4LOIA 1UBLS 4F91B 2BEVA 5BP7A 4MVRA 4DQXA 1DFGA 2ZYVX 3WKDA 4J7XA 2Q5FA 3IUSA 1YMQA 2PT7A 4V24A 4NK5A 3QFCA 2AZDA 1OH7A 1KI9A 2D06A 5IKOA 1NVMB 1GNQA 1DB3A 2WLLA 4AP5A 3EDRA 1N4AA 5I9NA 4V0LA 1RBZA 2H2DA 1MIOB 4ZYXA 2P0YA 2HOQA 4ND3A 4B7KA 2J32A 4NESA 3DLAA 4UBLA 4YP5A 1XA4A 1QHIA 3JQDA 1MOQA 5CJJA 2CLHB 4LY0A 3G8DA 1U9IA 2HLPA 4NTZA 3H9JA 4G1MB 3MC1A 3FYHA 1V9SA 4B8ZA 2PKCA 2MK3A 3RKSA 3U09A 2B69A 2WNIA 4AL4A 2GRAA 3I01M 3TRJA 5KVAA 4YJFB 5DRTA 2FCAA 3HBAA 4O0LA 3R6TA 4YNBA 3JQAA 1QH0A 2NO6A 1ILEA 4D4MA 1QRUA 3E83A 3L7DA 4W4TA 5GZ3A 2XCTB 3FB6C 2FRVA 4ZVPA 3I42A 2XQFA 1OBCA 1Q7RA 1M93A 1F0YA 4JI5O 3SC3A 3Q8KA 3RF6A 4EG8A 2Y6VA 4H7EA 1TAGA 1CLUA 2KKWA 3T1OA 4NEHB 2X1VA 3ZXXA 1U04A 4OQLA 5JI3E 4PLGA 3E22A 3LLMA 1GNRA 5IBQA 3VZDA 3H9BA 3BJRA 3H65A 3MWGA 1JMYA 4JT2A 4WL0A 2JAOA 2MCFA 3UXEA 1GIAA 1S4QA 3D1JA 1Z8HA 2C00A 3QPVA 1JXMA 3GD7A 4QL3A 1ZUWA 2XZPA 1H6AA 2DQ0A 3UWDA 2WDPA 4PM4A 2LUOA 3ID6C 2Q99A 2WTUA 1ZKMA 4EF6A 1P7GA 2QVBA 4X71A 5HZKA 4M1KA 4F3KA 3IVAA 3GDOA 3EMKA 5K8VA 4FLWA 1ORIA 5BUSA 1SXPA 2EKQA 3RE1A 1BKYA 3GGJA 2BM1A 3R40A 2UUCB 1RQ2A 4K9LA 3T3HA 3QLVA 1G41A 3U3KA 4TQGA 1YRQA 2QJOA 2QOEA 3HP1A 2Q7GA 1Z5ZA 4DRXB 4EI9A 4F5ZA 3K4HA 3SVLA 1QP4A 3RRZA 3PQ4A 1UBRS 3Q3HA 1QQ5A 1U0LA 3L8EA 2WQ6A 1DRVA 1X7WB 4KYTA 4M1YA 3A6HA 3FLAA 1GCUA 3VH4A 2UV8A 2XMQA 3PDWA 5CYGA 3W78A 5DHUA 3OEHD 4YAUA 4P54A 4ARCA 2H54A 1Q74A 4I5IA 1Y7HA 1EFAA 5KOYA 3IAS1 4UVCA 2DBQA 2WHRA 2G63A 2HIAA 7REQB 2A0UA 2CFTA 5DNAA 3BXZA 1P8JA 1L1RA 4G4SO 1YJBA 3DAFA 3IPLA 5BV8A 4GNRA 1FDVA 1ZA1A 4JR1A 4IZOA 4W5OA 2GDJA 4IDAA 2F9LA 4HAZA 2P8JA 1SR8A 2CV2A 1QCDA 2CBGA 3DTNA 4B5KA 4WLNA 2ZTSA 1UMCA 4E2WA 1HM5A 1AV7A 2ILVA 3GJ5A 3QA9A 2ZIWB 4CTOA 1DLBA 4M60A 1CUBA 4CLHA 3IEKA 4G86A 3AILA 1CK4A 2ENUA 4Q6WA 2YZ2A 3FDJA 3FFWA 3SJAC 1GZVA 4KSYA 2WA1A 1R0LA 3QVGA 5AT1A 4CDRA 5KCZA 4X9QA 1EM8B 5AIAA 4UE6A 1HO3A 3G9XA 5DYWA 4K3VA 2ZXUA 5CNMA 4URWR 3ZS9A 1E2EA 5EKUA 1WTCA 3DE0X 4ZHQB 1V1RA 2A9KA 5KS2A 3FNQA 4DMMA 2FH5B 3T1VA 4XDKA 4EG1A 3KLBA 4KAAA 5GJBA 4R71A 4IGEA 3FTCA 4NBVA 5IAOA 5EUMA 4RY2A 2LFRA 2Z0AA 2ZQ5A 2IQIA 4D9NA 3UM7A 2I22A 4HD8A 4NBNA 4WVFA 2OTJV 3LL7A 5CK5A 4XVHA 2QS9A 1N2XA 4M9SA 2JH9A 1YZKA 4WFBV 2R4TA 3MBOA 2FOLA 3DVAB 4C76A 5B7QA 3LDCA 3IHLA 4E0BA 5G0VA 4XJXA 4O08A 3QTCA 3L0ZA 2AGAA 3HJBA 2RJOA 5ENDA 4LY9A 1MB9A 3QEMB 2WWVD 3L0SA 5REQB 3WRVA 3ZWPA 4GT1A 1YZTA 3QNEA 1MJGM 2OOKA 2Q9UA 5HFAA 3IR5A 4UPDA 3HC7A 2M1XA 5IANA 3USES 1W0JA 4ROTA 4HDCA 1MV8A 1ZD3A 3QU5A 3B7GA 2WIFA 1DRWA 1G1AA 3RS7A 1ADFA 2ZRQA 5AW4A 5A5DA 3E7FA 1M0WA 2GVNA 1KVRA 4KXUA 3DPIA 4MV4A 3VDQA 3FCYA 4CM6A 3HWWA 5K0BA 5KPJA 3FFAA 4S04A 3RS2A 2CFCA 5B2EA 1TA4A 4C6TA 5JD5A 5EMNA 4GYYA 4UU8A 5KWIA 3EXIA 5KTKA 1H65A 3KUCA 2OILA 2F4VO 4Y2VA 1O95A 1J24A 1KJZA 1Z13A 2ZWIA 3H11B 4DB4A 2FYUH 1W2WB 4FR0A 1PNRA 1ZIOA 3N70A 2L42A 1NN5A 3DONA 3DMGA 1I7PA 3QKRB 1UC8A 1OTHA 4EKDA 1MC5A 3ILVA 3L05A 1GQFA 2Q4DA 2Y92A 3TTWA 2HG5C 1DBVO 4OU5A 4M0MA 1LSJA 2AJDA 4WNIA 2YMLA 1R66A 4UZSA 5KHJA 2E5FA 4JA0A 4R51A 5F73A 3R7DA 2W93A 3DH0A 1ZD4A 1K8XB 1CUCA 1EJBA 3EZYA 4UUQA 4F96A 4ENPA 5A02A 3KD2A 1H2ZA 4LFAB 2JI6A 5AJYA 4BO5A 2FPPA 2YXPX 2POCA 3P2IA 3LCMA 1WJGA 2ZBFA 1ACJA 3Q9NA 3PNPA 4DA4A 3C7AA 4QLBA 2RHJA 5G3YA 1THTA 3LECA 3ELDA 3T4UA 2ZDHA 3B5EA 3AR2A 4FDAA 1RVDA 5CVEA 1XO1A 1GTG1 4FZJA 1F2TA 4MV3A 3LKZA 4OIMA 1Q50A 4RM3A 2ICAA 2O5VA 2GHIA 3OM8A 2ZSJA 3ZEDA 1KI4A 5CAEB 4RXTA 3MTQA 4DLBA 4HTFA 5B2ZA 5TSDA 5AVRA 2BFCA 1OJ7A 3FUVA 3V8RA 1JLHA 1G6HA 5BSFA 3N5CA 4HAYA 5I01A 1TIBA 2TECE 1COWA 5ADUS 3VKUA 4MIEA 4REQB 4JI3O 3PT5A 3U7RA 3AUFA 1X1SA 5LMNO 3Q40A 2RONA 4RPCA 2GAOA 4ENSA 2YCLA 4J80A 2X5JO 3UCFA 3MLBA 4JU8A 2ZKOA 1OLUB 3QYAA 1E20A 5C3UA 4CODB 1Z7EA 3EVZA 3U62A 1Z16A 2PT6A 2QU7A 2P2GA 1SM4A 1F6BA 5L7YA 5C3MA 4D79A 4J8PA 4FMBB 5BR7A 1Y80A 2DFTA 4X97A 1JZSA 3RSOA 2C2OA 4V0NA 1LB1B 4CCYA 1Q3HA 2HEGA 3D4OA 4IMJB 1IH8A 3C6XA 4LDPA 4DV5B 1YB7A 5BWMA 3ISVA 2FNAA 5ENVA 3ETEA 4RVUA 4AWAA 2ZBRA 2Q0SA 1JILA 4WDRA 3K2QA 3OCWA 5EKTA 2WD8A 1AQUA 3DDHA 4FPXA 4NFLA 1Z8FA 4A82A 1G20A 3RVKA 1RNLA 2AKAB 1G98A 1N2EA 1PBNA 2AVDA 4KI0A 1DSSG 3A0RB 4CZZA 4U6SA 3G2HA 4LBZA 3O83A 4DPKA 1LXCA 2GVDC 3FYUA 1E3WA 4P4TA 4E51A 3VDXA 1DK1A 1N2CB 5IY5C 1KYQA 5EAIA 3BFRA 1G16A 3GJ4A 3RUIA 1DX6A 1WSBA 2J09A 1H5UA 1FJ2A 3BIOA 2YOHA 4YWJA 3OM3B 3M1LA 1NUHA 4C07A 1BW9B 4U0KA 1KXZA 4ZN6A 3LNMB 1A9YA 2OO7A 2QQ5A 1L5WA 4JFRA 1QBZA 2ZSHA 1Y5MA 4KSBA 4P92A 4RO2A 4KFTA 3WWEA 3X43A 2AOVA 4RF4A 3KUUA 4AQDA 3MZ0A 1VPEA 5JR3A 2QX9A 2Q6OA 3EVEA 1G3UA 2OGTA 2MT9A 1E3JA 1FXWA 3KS9A 4OY3A 3SSNA 4IFBA 4Q3BA 4R6ZA 3STHA 3WTCA 1SIOA 1VGQA 2ZBEA 1PTJC 1VJRA 2FZVA 1RSOB 4G1VA 4TV8A 1N33B 4PG5A 3R23A 4BO7A 2X6CA 4NR1A 1MJFA 3AG6A 1EK1A 3PJEA 3IPCA 4P4UA 4KO8A 8LDHA 4BC0A 5ALVA 1OGJA 4V1CA 1N5RA 3PFCA 2GM3A 1NTKH 5K9ZA 4GRIA 3O8QB 3I04A 4Y0NA 2Q62A 3H18A 5C0OE 2VAWA 2KHZA 2YQ4A 4S1NA 4FHEA 3DE7X 4EF4A 2N04A 3ABTA 1G2PA 1USUA 3F6CA 1PWYE 4IQGA 1TRKA 4LGMA 4L2IB 1T4DA 3PHJA 2YHSA 4DNQA 4XVUA 2YMPA 1SC9A 4JB3A 5CDGA 5LMUB 2F3TA 1QRTA 3TR5A 4QYWA 1K0FA 3NHJA 2QBYB 1DEKA 2JIZG 3IIMA 4RWUA 1XSEA 3SGIA 2FR8C 2R1TA 2ZRFA 4FBGA 2Q6LA 1PAUA 2NX2A 3DBHA 4V38A 2OYCA 4HYOA 4RQAA 4K6GA 4EFMA 3L0OA 2W71A 4B87A 3OC0A 4QECA 1ZMTA 4JT9A 4HLCA 1DXOA 2W6NA 4IFEA 4LQLA 3R09A 1S5LZ 1RKXA 3IAHA 3AZQA 2A06H 2JGDB 3LLSA 4INZA 4AYXA 3VVLA 2GNOA 4KLRA 5K4AA 2IEAA 4EBFA 3DV2A 1IN4A 1P44A 4BDSA 2EIKC 4PCVA 5ESDA 1PR4A 2G82A 4X64O 5KOJB 3JQEA 4LRXA 4YYEA 2B92A 3WYEA 2X22A 1AD2A 4FNOA 3QFHA 1Z07A 5CFQA 1PFQA 3O1JC 4MB6A 3U9LA 4ZU3A 1OYWA 1X1QA 3I23A 1P0FA 2IYVA 2B6HA 2DWEC 4GF5A 1FYDA 4BGEA 2ZYTX 5EZYA 1U9YA 2R47A 2AQHA 1U98A 4A0QA 2RHTA 4EVSA 4EG6A 4IGGA 4IVRA 4B4DA 1IBMO 4IGIA 3RAPR 4TTQA 2WUWE 5DYYA 2YTZA 4D3YA 2FPSA 1B6RA 4JP2A 3DKVA 2XZOA 3T9BA 3NHUA 2AOTB 1SELA 3MJCA 1VL0A 1AO0A 1U2QA 2WV9A 3FMOB 4MA0A 3R44A 2FDCA 2HIGA 4Q1FA 1YBFA 5DK4A 3TG2A 3W6ZA 1EFHA 2X7JA 2GSMB 1YQQA 2F7SA 4AICA 5DJ5A 4RPIA 3JQRA 1SESA 4W1QA 4D02A 4M7WA 2I7DA 4PRZA 2VZEA 2BTQB 3SD7A 5JOQA 3VTAA 3WBFA 5CA1F 2PX8A 2ZI3A 4D4JA 1R8XA 3U7FB 1D1SA 4UU1A 5TPWB 1VSQA 2IYAA 4UB8Z 4QTTB 2FRDC 4JUDX 4QULA 2CZQA 3SS8A 4DQVA 1V96A 4CF3A 3EXFB 2XKBA 3OFVA 4BIIA 1QDEA 1MMFB 2VDOB 4PSVA 3WNCA 2CXHA 1SHZA 1GPBA 1O97D 4JLUA 5KJCA 4EPXA 3CFYA 1ZNWA 3P2KA 1EUDB 4KCGA 5FPSA 4LTMA 1X7XB 3V4RA 2NZVG 3PGKA 5AK0A 1AURA 4KQWA 2VJCA 2IF2A 5T3UA 1Z29A 5ERGB 4F8EA 4YBRA 4AMUA 1D2MA 2RN9A 4MVOA 5ICGA 1BE3H 3OU7A 3CX5F 4PFQA 1SUCA 1WB9A 1A95A 3GNSA 4WKGA 4MR8B 3OPXA 4KXRA 1Q3EA 1BCRA 3D6AA 2ZB2A 3FYCA 3R77A 4NYMQ 4XB2A 3S44A 5TEWA 1Q1AA 1NUQA 2WIAA 3GGSA 4RD0A 3JQFC 1QS0B 1Z0FA 3GR6A 3EFOB 3V2IA 3DVRX 1P2DA 1IOVA 3M5CA 3ASVA 4X93A 5F3RA 2ATEA 4MVWA 2VSQA 1XDWA 5G40A 1YUNA 1QCCA 5LBQA 3QEBZ 2CZCA 1OCCC 1QIEA 1Z47A 1TAUA 5EQJB 3NWJA 1T4BA 1NU6A 4KMOA 2C4TA 2OCYC 3L7YA 4B2IA 3CX6A 3TL6A 5TGZA 3T5AA 4F8JA 5MN6A 4UTOA 4LFBO 1KZ4A 3UMJA 2CW5A 1YFJA 1OXBB 1KE2A 2OCLA 2EV9A 4R1SA 2V4UA 1KMHB 3HCDA 2QUKA 3T1NA 1EFDN 2IYOA 4F11A 1U8YA 4KREA 2IDMA 1M1YB 2R9IA 2WSSA 1CUGA 2FPLA 3CLKA 1IZ9A 1UEXC 4CIWA 2VYNA 1UBSB 1HX7A 4ZVNA 3OO1A 5C8VA 2WJ6A 3P0HA 2GH1A 1KSHA 1OWNA 1USKA 2C9BA 3UEOA 4PN7A 2PXAA 5FD8A 5H83A 5BY1A 3WL6A 2G04A 3K8YA 3LIIA 3OT1B 1GPJA 4JI4O 2HF7A 2W5UA 4KYVA 1W5TA 5AP9A 2BH9A 2VN8A 2Z4SA 2OENG 3DVSX 3Q3IA 5LOVB 3JTMA 2B37A 4K88A 1MKYA 3NBZC 1VI6A 3AB7A 4BLVA 2QTOA 3R9KA 4QOIA 1JJFA 3B8HA 1XXHE 3NTVA 1TC1A 4V2IA 2FFJA 1JPUA 4KMRA 1F2UA 2ZRGA 4MCHA 2D8AA 5ECGC 4OHRA 4LSMA 5LXTF 5EWLB 3UAVA 4ZARA 4U2GA 4P80A 4YPFA 1KNXA 4GWGA 5DFAA 1U2RA 1YA8A 4Q7QA 4EIWA 3RTEA 4Y1FA 3GH3A 5AKKA 3KOZA 4Y6SA 2EL9A 2JIZD 4DUGD 1RJGA 4AJHA 3UZUA 3F2VA 4LSGA 3A4MA 3DYIA 1F7VA 3OP1A 3WOHA 1IZ0A 5DKFA 1U96A 1GAQA 1UFIA 4D97A 3DFIA 5IAEA 3SYCA 4JQZA 1I1HA 4TMZA 1SERA 1XEAA 3TETA 4X62O 1PCXA 4M98A 2IELA 1KDPA 3WC4A 1EE1A 4Q4HB 5JMOA 3M34A 2HZ7A 2Y0BA 4TS3A 4MW1A 4F9FA 1BG6A 3T7KA 1BEZA 4RY9A 3FMPB 4NULA 1A4IA 3S6JA 3HWSA 4Q47A 2ZIMA 4KODA 2FWJA 4JN6B 1U2ZA 4XDYA 2F8MA 3CNEA 3DHEA 4P9NA 4FDUA 1RM1C 2ADQB 1GTVA 3ZJ5A 1MPTA 2PPVA 5M5BA 4ND2A 2W7TA 4IZIA 5AJVB 3EIFA 5E2AA 1YAJA 3EOZA 1U02A 3BCCH 1W0JG 5DULA 4KRYA 4CKWA 5K8LA 5H80A 1A4UA 1W8IA 3LY5A 4OXRA 1M56B 3G6WA 1WXEA 2QT9A 1Y3HA 1VARA 3MGKA 1YDEA 4ZO8A 3LIPA 1GWNA 4XKJA 1GTSA 3A14A 1JHXA 1Q0UA 4G1CA 3LQ2A 4F5YA 1YCDA 4JHLA 3G4SV 2HMVA 4ZEVA 1YJXA 1HNZB 4GFDA 1THGA 2X76A 5DIZA 2FMTA 1WB4A 1KDTA 2QNRA 2F17A 3TKAA 4AD8A 4AI6A 1RZRA 2AN1A 3B1VA 4CT5A 4ICGA 5L3SA 4DV1B 2CLFB 4NY1A 2XNCA 1AT1A 5J4LA 2P30A 5JSZB 4UBNA 4EWLA 4BEJA 2CNNA 1FTYA 5TF4A 2BEVB 4TYWA 2J7PA 1Q15A 1XTJA 1R6XA 3CUVA 1V7CA 4IHQA 5DTQA 1RRVA 1FMLA 2PUJA 2XB4A 2G7ZA 2WLLB 1XRNA 3PUKA 3V00A 4LUCA 3EDOA 2Q1UA 5KTTA 2VHJA 4U5QA 4ZGWA 3OZRA 5IJZA 1VIYA 3NR7A 4LFCB 2ZAOA 1YVEI 4WXYB 2UZ0A 3NONA 4YP1A 3CO5A 3QO7A 4MVJH 4IOMA 1TA0A 5CCEA 2I6QA 4QEZA 1F0KA 3BREA 4H3HB 4EVIA 4ONEA 3QGMA 1A7AA 3D6FA 1SCNE 3MTDA 4B35A 1BT8A 3JQAD 4WN3A 4L50A 3JQAB 3AMVA 3MLEA 3H2SA 4M9XA 2GLXA 3K8ZA 1Z5VA 1E4YA 2J3KA 4QLAA 1EP9A 3RHSA 5LHGA 4UVEA 2RBKA 3Q6NA 4KFSA 1T3TA 4L5AA 2GHRA 3A6JA 4NMXB 4DIMA 1COWG 3E22B 4MRVA 1I9GA 1WV0A 1MR3F 1U2PA 2ODTX 5DGXA 1HR0O 1A4XA 3BVPA 3HJAA 5JAZA 4ADSG 1DKMA 5JSUA 1ZI9A 1F8UA 2VT2A 1EVKA 3TOVA 3PUWA 2YV5A 3ZD9A 4UVGA 1XCLA 4DDTA 2BR4A 4QXAA 1GUBA 4UBKA 4LXXA 1EGVB 4KHZA 3M9LA 4KFUA 4MK4A 1PFKA 5LLTA 1JA8A 2VHWA 2YIBA 1PG2A 3ND6A 3SDBA 3VBEA 1RCTE 4BC1A 4QLOA 1E5VA 1XTIA 2EZOA 4LDJA 1HFJA 4DR1O 3FNBA 4AN4A 2B4AA 1GLNA 2WHYA 4S0XA 5E7QA 3C5EA 4MYCA 5A7FA 3R20A 4ZJYA 4F1KA 4AXXA 3MTGA 2HI0A 3W7WA 4K8RB 5BSUA 3MLAA 5JXWA 4G5RA 1R3IC 2NT4A 1KEUA 4AY3A 2ACWA 3MGBA 1CRLA 2Q45A 3SMQA 4FM9A 1VRCA 3BRSA 1NFQA 1SURA 5AQEA 3TB4A 3TLXA 5JYCA 3OE7G 5ALHA 1PJBA 2FEAA 3SJQC 2GB4A 4EB6B 3DMYA 5AKHA 3OM1A 3LUBA 2DAPA 4C4OA 2VVTA 1N3IA 2H2WA 3RK4A 2VP9A 2HB6A 1E18A 3AWDA 3RT9A 4KPYA 1HFWA 2ZQYA 2IL1A 4WK2B 3DAYA 1TADA 1ESDA 4YMLA 3BPSA 3I2GA 4GGPA 2H9YA 3CCLV 5CA0A 5EGSA 5EMHA 3OLCX 1D2NA 4F2DA 1QU7A 1LF5A 1UMCB 1WD7A 3UN1A 3DL0A 2QP9X 4RQBA 2JRLA 2IYNA 4EPRA 4GX0A 3ENWA 3LCVB 1JEQA 3TPFA 4IINA 3O1HB 1Z83A 1YU9A 4XLZA 3L6BA 3LUDA 1C7IA 1EZZA 2E87A 5KHKA 4OI1A 3QVGB 4ZO4A 3K70D 1K5PA 4NMWA 1P7VA 3WL7A 2JAHA 2OBMA 3OJLA 1DADA 4RAIA 3K70B 3DMNA 3IUQA 5JUWA 3ZDEA 5HCIA 4DBLE 4IHKA 4KR6A 5IMSA 4EH1A 1V1RB 1W25A 1VQ5V 3C43A 2FFBA 2H2FA 4IHAA 4IYHA 2NXWA 1KOLA 1S5JA 2JFUA 3SYPA 2VDVE 3WMFA 1P2BA 3T5TA 3T9CA 5CFRA 4DABA 3K5NA 1PL6A 5KUKA 3OFKA 2Q5EA 4JZ2A 4E7OA 2XQKA 5TT0A 4BS9A 4V1CI 1T2VA 1S0UA 2YV3A 3WJAA 4QFMA 2C0PA 2XASA 2PXXA 4BNUA 3JCUZ 2Y66A 3A6DA 5FFNA 3OOSA 4AMGA 3JY6A 3L6RA 3LHKA 4P0TA 3EXHA 2ZT9B 4L5BA 1LBIA 1YJCA 1U1GA 2CLLB 4ENRA 2R48A 1HDYA 2VDRB 2Q5JA 5ALEA 3WI7A 1DWQA 1XNGA 2DPGA 3KUKA 4HEA6 2A84A 4YCSA 2RAVA 3T3PB 1W0JD 2MIIA 3DLTA 3PHCA 5A4IS 2VTVA 4ZOCA 5A9RA 2PMEA 2BMDA 4P32A 1T25A 3G2JA 3EPLA 1SHUX 1SXJE 3SJ7A 1TZBA 3JQBC 1KY5A 2P9TA 5AJWA 2FWNA 2QYTA 4WESA 1LI4A 4QOGA 2EARA 5EHGA 1S8FA 2O2XA 4LQDA 4XGRA 1ABBA 2ZRIA 1NY6A 2O54A 1VLZA 4CNBA 3QVLA 3CEMA 3L7BA 4C6TB 1DRJA 1UWKA 4GYJA 1M90W 4JGSA 1VQ8V 2PFGA 4O4LF 1KO5A 4YCLA 3EXIB 1VB5A 1O95D 3TD9A 2I4MA 5GONF 2PTMA 2WLJA 4WXEA 3UK2A 2KYRA 1BX1A 1HSZA 4Q1CA 3H2BA 3H2HA 1BOOA 1XRRA 4CM4A 4U4AA 4U7PB 1U3UA 2AK2A 1P2TA 2AL7A 4I81A 4UHFA 4Y98A 3H97A 4AN0A 3KR0A 4RYDA 2FPKA 1J70A 4XDLA 2SKDA 1HDGO 2ZRJA 3U0ZA 1QO0D 3THXA 2VDMB 4LCBA 3AY0A 1H3EA 3CEHA 1H85A 3NT5A 1ACLA 3GFBA 2VF4X 3PWSA 2FPPB 4AJEA 1PWEA 1YRLA 3M5WA 4MI9A 3D3NA 2OLJA 3TW4A 1J8YF 3SWWA 4F3CA 5A5FA 1SBQA 2E0IA 4N54A 1JKIA 1TU0A 3IX7A 2PF4E 4OTZA 4YAOA 2HM7A 4XDZA 1VQLV 3QY9A 3ZU6A 1F2TB 4H17A 5KSWB 5KVVA 4ZIBA 5CR9A 5JRDS 3AZOA 1RD4A 4H1WA 3GFVA 5CFZA 3D3WB 1GA4A 3RT3C 2NR5A 3U56A 2RHRA 4HTFB 2BFCB 2ZBPA 2F8TA 2GA9A 3IPRA 5AXCA 1T29A 1COWD 3FUTA 1HW7A 2H0RA 1PVDA 3EOBI 1WDLA 2IU0A 5HM6A 5L9AA 2PH5A 4RDHA 3LUAA 3DC6A 4W7SA 2VP4A 3NAGA 4L4SA 3L8FA 1E9EA 5JH7F 3HXLA 5FI3A 2NO1A 4WOCA 3WL5A 1GZHB 3O4VA 4QUBA 1EGQA 4BZWA 1PYDA 1BWRA 2G09A 1KH1A 4J7ZA 4YRRA 1L5SA 1Y5IA 3A7EA 5DHQA 4K5QA 3I1IA 3RIMA 3UOWA 3E2EA 2C9OA 3MUEA 3AF5A 3BF8A 3W3ZB 5EIFA 3A2MA 3MMSA 5K0CA 4H7DA 3WQSB 2EKZA 1XG5A 3ZLVA 2UZAA 1AKWA 1ODSA 2XYQA 4CCYB 4E14A 5MDHA 4HFNA 3TJZA 4JASA 3LV8A 2WD9A 4MGYR 3OWHA 4JR2A 1SF9A 4I19A 3TUZC 1TVMA 4ZC8A 3C7TA 1TLFA 1STOA 4OA5A 4LYGA 4N0PA 2AR9A 3QH4A 5GJVC 1CDZA 3W5BA 5LQNA 2HC9A 4UC0A 4M83A 1COZA 1G20B 4ARVA 1U3VA 1DAPA 1W29A 1UBCA 4H6WA 1VIMA 3OE7D 4UTVA 5P8WA 4UEOA 3FYUB 1DKOA 1E3WB 2IPLA 3AOEA 4IZHA 3QE2A 1F1JA 2SECE 4WNCA 1TYCA 4IW3B 4F9EA 2P0AA 4NS4A 1NQ5A 1NUUA 1JH9A 1YJ5A 4RUEA 1QAMA 5CB0A 4N12A 2DERA 3ULKA 2N74A 1DKRA 3FMFA 2Q7OE 5CCBA 3C1AA 3N8IA 5LYYA 1P1HA 1RR6A 3ZX5A 5A03A 2XKKA 5UKDA 5D7BA 3K73O 1EFRA 4B83A 1US8A 1V8PA 5MHTA 3D8RA 2WSSG 3LOUA 4OLBA 4B45A 4WCVA 1T0IA 2VRNA 1CKEA 3AKDA 4M46A 4MVJA 3TGLA 4D5GA 1AILA 3WGZA 4P33A 2E4XA 4OK3A 1E6CA 4EYGA 2VAXA 1QCEA 4RZSA 1RKQA 2O8DA 2X8BA 3ZQUA 5P21A 1B14A 3K5PA 4MO9A 3BMXA 2F59A 2ZAMA 3N2LA 2JGMA 1RI5A 3EVBA 3KLMX 1CVRA 1D3AA 3PD1A 1JIXA 1T6YA 5THXA 3B1XA 4OJQA 3ZS8C 3IUYA 4TV8B 1U7UA 2VXCA 3KSRA 1GRVA 1KMIY 3PTAA 1PJLA 2O0JA 3HY6A 4PXAA 3NGMA 4JJ7A 3R2JA 4QG3A 4YRGA 4FFBB 5EHZA 3VOTA 3N0XA 4FGJA 1U63A 4IV0A 1SHTX 4G27B 4L95C 4RV4A 4V1CB 1EGAA 1XRQA 3BJIC 1V39A 3MWDA 3R75A 4C0JA 3BB3A 3G0IA 2FZLA 1V55C 4O2AF 3G82C 3CXUA 3DCNA 4ZO7A 5LQAA 4REMA 3RYIB 1QIKA 1FNNA 1M5TA 2WUEA 3FLMA 1U1FA 1Z7YA 3CRRA 4RK7A 4PYOA 3GXOA 2R1TB 1JNYA 3DBHB 1ZOIA 2O4UX 4YASA 1KQGA 1QPBA 1M2HA 3QVMA 3ASYA 4MS2A 3C90A 4KQ9A 1EVZA 1FP4A 1MTOA 3CB2A 3IPXA 5KU1A 3K59A 1M57C 1MXFA 1CX9B 4C7JA 3CLVA 3TLKA 3LC0A 1QF9A 3A6EA 4OXNA 3SKXA 3CM0A 1BVHA 4IIXA 3N0TA 2R8YA 2XGMA 2DSTA 2DWUA 4WMLA 1AK9A 3LOPA 3HZOA 1WF3A 4KQCA 1IM5A 3K3PA 4K35A 2WUVA 5ITSA 5TRTA 2GPWA 2I2WA 4TZKA 4KR7A 3PGJA 1TJNA 4HEA1 1ABFA 4FJ0A 3R1IA 1KO7A 4MT8A 4F3YA 2GJAA 1DBIA 2ZRDA 1RPTA 5LQDA 3ZWDA 4LF8O 1VJ0A 5EZYB 1LDGA 1PQYA 1SKYB 4R1NA 2AHZA 3BC1A 4MRMA 2Z2ZA 4YALA 5CDYA 4TZ6A 2QTVA 3VAAA 4HHEA 4IOJA 1NP3A 3UNXA 3O8RA 1U1IA 2K7ZA 1JJIA 5HQ3A 4QE7A 4BCBA 3OE1A 1NU8A 2NVWA 5HX7A 3KG2A 4WH0A 3IMKA 3S7TA 4NMHA 2HMTA 3QEJA 5F23A 2EIJB 3QHQA 3VU3A 1WSAA 2FGJA 2JFZA 3UPTA 4KRFA 3NHSA 4ZTBA 4ZAGA 1C3LA 3NEPX 2C4MA 2HU7A 4NYIR 1AGPA 2CZGA 3NH6A 1U80A 5HCNA 5KYTA 5FLEX 3TXSA 4KDCA 3D4PA 4KB5A 1BHAA 5CCXA 2FCRA 3OLQA 5JD4A 5KSOA 2X14A 3DXZA 1JAHA 2GPYA 3ZRVA 2LWIA 3UB3A 2HY7A 2GBGA 4B46A 3CR3C 3WNDA 3G0BA 3CSUA 4NBRA 1WUKS 4FB5A 4B09A 1DC6A 3FCSB 4WKPA 5F7JA 2WLMA 4WLVA 4TKZA 5GMOA 3EPPA 1JU3A 2Z4TA 2WU1A 4F71A 2JHPA 1Y5NA 4HZGA 2CHVA 2GNPA 4EVRA 2HJRA 5C8YF 4X44A 2DUWA 5CHEA 3ZGNA 1HG0A 3MUNA 3DCJA 3EXG2 2QMUA 2C2KA 1EK0A 4GR4A 3ZGLA 4BEBA 1IEXA 2OD2A 1V25A 3D4IA 4TWJA 4F4IA 2QM0A 5KWVA 1VKRA 3R3ZA 3NOVA 3GDGA 2EILB 3MJFA 3QVWA 4INPA 3ECCA 3SN6A 2ZYSA 3TFWA 4OQZA 3VNSA 3FPLA 3EBLA 2Z3YA 1BCRB 2CNWA 2EIMB 2B5WA 4Z1MA 2F2TA 3ASNB 1SQPH 2F55A 5JSKA 2VXOA 4EUKA 4L3VA 4ETNA 1H23A 3EFEA 4CTJA 3ZHZA 1PNQA 4UDXX 2JHCA 4YUZA 3CJHA 1BE8A 3H2JA 1YR7A 3R7LA 4WUVA 5I7EA 3K9GA 4J6FA 4P30A 3G2NA 4CM5A 5B66Z 1HNWO 1CY8A 1SCAA 3WGUA 4HWGA 5D6OA 2E5WA 3HPLC 4WDQA 5AOBA 4UASA 3FPBA 2BKAA 3FCXA 1JQBA 3FNHA 5A6SA 4LIPD 2JKZA 4YV1A 2LJ2A 5FBQB 3DPSA 1RWXA 1SCQA 3IBCA 1T8PA 2PK3A 3R3YA 3MJVA 1X7YA 2GO7A 2WSSD 3VO8A 4HCJA 3U48A 1YR6A 2OO5A 2CJYA 3F0TA 3H1LH 2WF8A 3JWEA 2VYND 5CLLA 2WJPA 4RK5A 3A4NA 2V5AA 1GU0A 3FW1A 2WWFA 4B84A 2Z8YM 2H1HA 4OM7A 4F12A 5CJPA 1TKBA 3FZGA 2XUAA 2EGHA 4I9GA 4CMCA 3I45A 3CH6A 3AVQA 3GAAA 4JJEA 2W0SA 4AT1A 3PNSA 3A3KA 3NVMB 3K1AB 3S28A 1E9RA 2G5TA 4K1XA 1OU0A 2B94A 1QH8A 3MRSA 4NEGA 2P5SA 4Y6PA 2JGNA 2C5AA 5SYAA 5KB3A 3CLSD 3MELA 3FMVA 3P9YA 5KREA 1XPJA 4DFDA 5AI9A 5JFOA 3L0CA 4TM8A 1FMTA 1ZFNA 3GHHA 2FHSA 2I3DA 4QDTA 4KQKA 5E4TA 2IHUA 2ZYDA 1F2UB 1S2NA 1JGTA 1U3WA 4IQ8A 1MQ9A 1W4LA 1ORQC 4KN8A 3E5RA 1KJ9A 5KYYA 4I9WA 4H1HA 2AYYA 4GGOA 3L41A 4FLYA 4I14A 3JSNA 2A57A 3BB1A 3KYCB 3C6QA 1T1SA 2GA8A 2NPFA 2IJJA 3RJ9A 4UHDA 3ONEA 3FUWA 4X7RA 2WLNA 2ZVPX 5HF6A 4FMCB 2N46A 1OAAA 1ANKA 4C7OA 2CEKA 3GCZA 5IDJA 4DLAA 4LISA 4ZMBA 1MG5A 1L8OA 1FLAA 3PTLA 1WEKA 4MICA 2O1XA 1ODCA 4JEMA 4RPJA 3ZX4A 3D3IA 3EJ6A 2J0EA 5K8CA 1XQ1A 5DN9A 1TFRA 4RVNA 2PY5A 1P9RA 2GOYA 3K0AA 4Z9AA 5JXGA 3WLHA 5TJ9A 4IL5A 2ZBQA 4F45A 3H6HA 1E5DA 2B1JA 2JEUA 4KAXA 4CMBA 3LTNC 1Y76B 4L0CA 5MGBA 1RJEA 5HPYB 1CXZB 5EKSA 1Y8QA 5BW5A 5J4HA 3AU8A 2F90A 1N9KA 1ZN9A 4QOHA 1ZP6A 4LXTA 3WAJA 1RCFA 3BWYA 2XEXA 3VNAA 2WWTA 4L07A 3IE0A 2F1RA 1K06A 1VLLA 4BLQA 2VATA 1TEVA 4MP3A 1I32A 4TVSA 5EP1A 2BGTA 2DZDA 3COSA 1XDCA 3KL2A 1Z2DA 5HCUA 4KHPB 4DV6B 4QT0A 2J85A 5TX7A 2HU2A 3MHSC 1E1KA 1EVQA 2F3SA 4CKWB 2M9MA 5ILOA 5B4UA 1NY5A 4YMTA 3MS4A 5FOSA 2PMBA 1Q16A 1V2GA 4JDUA 4KNYA 2IE8A 4WCEV 4DREA 1GZUA 2O2DA 2EKBA 1XU9A 3AXSA 4DWWA 2CE4A 4EUFA 1T0BA 4FGSA 1SA0A 5FYQA 2XIJA 4GKVA 1BC5A 3VU0A 3MN1A 1V8ZA 3IQWA 3CCUV 2DH6A 1RZRD 4WPGA 5C5CA 5L3SB 1U8FO 3ZV7A 4WBXC 1VDZA 2A0WA 2CKMA 3TQQA 3OPNA 5AO9A 1ABEA 2EULA 2J7PD 4A73A 1RACA 2ZRLA 4B6QA 3LX6A 3AHIA 3H8VA 3ABLB 1OR8A 2GSWA 3IV7A 2BY4A 5HMLA 1FYFA 3WNBA 1ZK1A 2JHFA 2P90A 3UHJA 3G59A 4QU5A 5IUNC 2C2AA 1YKGA 5BNIA 1R3KC 3QW4B 3LCRA 4MDFA 2HLDA 2QLBA 4KSCA 2VS0A 4BKQA 3GRZA 4OP2A 3PKJA 2AFVA 4ZAYA 3K6KA 3CJTA 5TGDA 3M4XA 2IT1A 4DQDA 3OX1A 4UCWA 4MV6A 8ADHA 4YHBA 3HJHA 3X1JA 4JEIA 2WYUA 2HAEA 1FJGB 2Z58A 4RPLA 4CV3A 1OZGA 3C16C 1NVAA 3HPQA 4XFDA 4X1YA 3KOMA 4FYJA 2V6JA 3KOOA 1C1XA 4YAEA 1C0KA 1RRMA 4KFRA 2C9MA 2X40A 4X94A 1TF7A 4JDPA 5T6BA 3S2IA 4TZ0A 2J67A 2X8LA 1Y0BA 1T5SA 1VHWA 3BIWA 5IC5A 1BU8A 3KL4A 3HXOA 5JASA 5FL7G 1K68A 4N01A 3L8CA 4D9EA 2BKXA 4HBNA 4L1KA 2XTJA 3M6MD 3BCSA 4DNFA 4JJZA 1RXSA 4A6XA 3AR4A 4DCNA 2WTEA 3CVXA 4CC6A 1IFXA 2Q2VA 1YK1A 4JH0A 1D4AA 3ORQA 2WTAA 4TTVA 1ZMBA 4HDNA 4NOLA 1LQTA 2PL3A 2IHBA 2XMSA 4AKTA 3BXEA 1C9EA 3C7KA 2R5FA 4R8VA 2B5UA 4B1FA 4I50A 2B7BA 1UAAA 4FU0A 4HV4A 3TNYA 5TV2A 5IH3A 1SUWA 2RKBA 1N77A 5AXBA 2JC3A 1M3SA 4QTYA 3CMAV 1XZGA 3K1JA 3JQ7A 2YIBD 3LVFO 4UDOA 4L51A 3SIRA 2AZMA 1MVLA 2DQKA 1C9KA 1TVKB 3JRNA 2BP7A 4XX0A 4Q21A 5CVCA 4F85A 2PMFA 5FR2A 4OMFG 1AROP 1WMFA 3EEIA 3K2IA 3B1FA 4G5FA 2LNDA 1MB0A 3GD5A 3MQFA 3UAXA 1ZH6A 3Q7RA 4IWXA 5FORA 4J0IA 2XNJA 2ZI7A 3MFYA 2VKQA 1SQSA 1G3MA 3TGPA 4V03A 4US0R 4OJKA 3ML1A 3I2KA 2HA5A 4QHTA 1JR6A 4AZTA 4B31A 2B25A 5T5QA 4UULA 3JQ9A 5JC8A 4L02A 5BQOA 1E9FA 5CITA 1M33A 2IEDA 4L4YA 1SB8A 3UAYA 3ZKWA 4ED9A 2GCEA 1GN3A 3L8MA 4PCAA 3GZTB 1I7FA 1O6ZA 2OC9A 4J03A 5CA0B 1GKKA 1EFRG 2I65A 4EEKA 4EYOA 1XVVA 1C7RA 2X3YA 4YREA 4KUHA 3GAFA 2YYSA 4AKIA 3OIVA 3RF7A 1EWYA 1C14A 1IBRA 4FGKA 4MVJG 3F71A 4PBSA 2CMGA 4A8HA 4MVJI 1OHHA 1KKMA 2IJKA 1R5JA 1VPDA 1JEQB 4M36A 4ERNA 3QJGA 1XTSA 2ZP1A 2WVJA 2RJZA 3GUCA 5K8JB 4ARAA 2H5JA 2GJ9A 5FPOA 3I3SR 5JNLA 4DCPA 1ZQ9A 3FRJA 2QTTA 3GJTA 1H2RS 1PGQA 3B60A 3Q10A 5E9AA 2V5UA 3AM1A 3K53A 5JW6A 3P5SA 4PZCA 1UAYA 1WOYA 4TSKA 1PEYA 3WLKX 1H2XA 4V3BA 4IILA 4C3VA 4NMMA 4MKZA 1CEQA 1ODIA 1V71A 4LWQA 2V1UA 2V58A 4KN5A 2J08A 3MJTA 3QSGA 4L4XA 1M0SA 3QIVA 3D7SA 4N7MA 5TQJA 5JTUA 3EXHB 5AVZA 1XEFA 3R7NA 1YZGA 5FAXA 3DV9A 4XR9A 4KZKA 2GN1A 3AERA 1EDBA 3G68A 3S99A 1Y37A 2RGBA 1AQIA 3NCTA 4JQSA 3KVYA 5B3JC 2ZIZA 2QTNA 4BY9E 4J0DA 4BFXA 2VJKA 5FBWB 1JU9A 2CFIA 2YC0A 4EYEA 1LDNA 1OUMA 1WW8A 3D3EA 5IUJC 1Z5OA 5JDCA 4WESB 3LRXA 2YJZA 2O6HA 3IILA 1L7NA 3GT4A 3JASA 5HF5A 2VEOA 3OI7A 3FFQA 2ZVDA 3X2SA 3DBRA 3L7MA 1U0BB 2C4VA 2AEFA 3N86A 4BWGA 1L8AA 5E7JA 1AQLA 3PQFA 3ESYA 2I8CA 4DJEC 1QR9A 2Q07A 4PZLA 1ZVMA 1JA0A 2QM7A 2QMZA 4XRRA 4DWJA 1P2GA 2XWPA 2WAXA 4XGNA 4Q3KA 4ZK2A 1L7XA 3UAGA 2Q49A 4CM4B 3WQRA 3WMEA 2P3OA 1RYEA 3A6PC 2IKQA 4UCSA 1UH5A 3DOUA 2YZGA 1RLJA 1HY3A 4WFAV 4DUYB 3HYNA 4ZVRA 3THXB 4LV6A 1DO8A 3F7TA 5D3ZA 5DN6A 4EW6A 3HVRA 1MX3A 4KH1A 3THYA 4RLHA 2INGX 1RRKA 4FYMA 2A0LA 3OTOB 4JSTA 4GHWA 3WGYA 3V3TA 4ZOLF 1GNSA 2I54A 3K8OE 5C34B 1C9MA 2CHUA 1W7AA 2FZCA 4TMYA 4GYCB 1UBGA 1XDBA 3D2AA 3UG7A 2E21A 2V96A 1FFXA 3NM6B 3ZWXA 4RKQA 2VK4A 2JD2A 4CZ2A 2QLNA 3BA8A 3X2QB 1F9EA 1YQTA 2LQTA 5J2TF 1AHHA 1DRKA 5A3QA 2P2CA 3TS1A 3BE8A 1DJNA 3CLTD 4URZR 4E2YA 5FL7D 1RQGA 1P2UA 3FWKA 3LVBA 3LPLA 4UUAA 2LP4Y 3W5VA 5JQGB 1JAIA 1Q84A 3SJCA 4RLQA 2X0LA 4N4AA 3E35A 2GWRA 2RH4A 4I6GA 3EVDA 4CLOA 1VBKA 1VG0B 3EW9A 4M7OA 5LD2B 4N3CA 4HMPA 2RGNA 4X24A 1MEOA 2WFAA 1XP5A 5JNVA 3VKWA 4YPVA 1RYHA 5LZ7A 3O9MA 3TR6A 1G7TA 4XGQA 4P5PA 4TXNA 4YLEA 3C87A 1BGYH 1E6WA 3SQNA 2ZRHA 2OG1A 2FSVA 3WFJA 2QE6A 2C54A 3EH2A 4PNPA 2BMEA 4FFWA 5JS1A 1LZKA 1GRCA 4RK0A 4J1TA 1NONA 3V32A 1NBIA 4GYWA 2P2ZA 1US6A 1QRDA 3X1XA 3ICOA 3I2IA 3ANMA 2NSYA 1YVDA 5JVDA 4JASB 3AG4C 1E94E 2WT8A 4MGKR 1DEOA 1AZSC 2WNSA 1EEXB 3ND5A 2C5LA 4TGLA 3ELYA 1XN4A 2XUDA 1QO9A 1MB3A 3CF0A 2B20A 2JEZA 5HS6A 3UWPA 1XFAA 2J3EA 3HKBA 5KU7A 2CLCX 3CH5A 1TQDA 2JIOA 3AFMA 1OFGA 4POOA 3RSZA 2OXRA 3EYWA 3T4PA 3M1IA 3E3MA 1I7LA 6REQA 1T3LA 2YJ4A 3C8HA 4LMRA 3ZCXA 3AYXB 4RX1A 2PZBA 4WJKB 1TJ3A 1TYZA 1TCUA 5BW4A 1Y7IA 2JI8A 3DFMA 3UQYS 3K3WA 3GEGA 4PZAA 1JUDA 1CQJB 1G6UA 2IY7A 3INRA 2FRXA 4HDQB 2DU8A 5JMPA 3GARA 1EFRD 2H7XA 3D8BA 3ED1A 1QZUA 1XXLA 2ZANA 4MVJD 1SUBA 3AG3C 4MVZA 3OJCA 3HA3A 1WQ1R 3EDYA 3IB6A 4YRPA 1J2TA 1OZHA 5TPZD 2C9YA 2ZSBA 2O8DB 3IYLW 3HYLA 1M0EA 1XMOO 2FVXA 4A36A 1H2EA 3TKLA 4CETA 4UZEA 3CIOA 3OZFA 4O1IA 3A1SA 2EX1A 4N47A 3DO5A 2PUEA 2EXXA 4KACA 3ESCA 3RWMB 1OCOC 1PWZA 3OZIA 3PFNA 5DM2A 1E92A 3K32A 1IATA 1YRYE 1CEZA 1DJLA 2LV8A 3DBLA 1ZD8A 4B75A 4O4IF 4MCAA 4FUQA 3PXXA 2P4EA 1WMSA 5JCJD 3TEJA 3VAZA 3PC3A 3C48A 4B7CA 3SR4A 1E2PA 3GPBA 4HXYA 3THOA 3GBVA 1RXCA 2AG6A 5KNDH 7YASA 3MBIA 3MWDB 4DR3B 3A3YA 2R4UA 1JKFA 2NW6A 1UBMS 4M38A 1BDBA 4KC0A 3BOSA 4J0KA 4O25A 1YKSA 3N8HA 5F7OA 2J48A 3HR8A 2Q3BA 2XAQA 1QAOA 1TZ2A 5I4BA 4UXNA 1JFTA 4QT4A 5PGMA 1N6LA 1EWRA 3N3BC 1AUQA 4AJPA 3AB3A 4ACAA 2GBOA 3U4MA 2Z30A 4FCCA 4FUTA 2XMGA 4Z7JA 2R68A 4AU1A 1PR0A 2DX7A 4JQCA 1WBBA 4WTOA 4PXYA 1YDMA 2LCQA 3TZHA 4N5DA 4V02A 5H7XA 1FP4B 2JANA 4LRWA 1NNUA 4ZOQI 1I6KA 5BUQA 3WLFA 2CTPA 1BHBA 4UXJA 4HSGA 3BN3A 2R1UA 2GVZC 2JKVA 1UPAA 2A1UA 1OGIA 1NNI1 4DT1A 4PG7A 5D5PA 3A6ZA 3RIXA 4FE3A 2XGGA 3SS9X 1XZDA 2OWDA 2YS7A 4G1EB 4L8VA 3EMBA 4JI2B 3HACA 5TQVA 3HXQA 2DUUA 3W6UA 1PU2A 3OVMA 4X60A 4CUZA 1ENVA 1AGXA 2F66C 2WTMA 1XUOA 3AUTA 5CH5A 4NG5A 3O91A 1RHKA 2VHQA 3A1CA 2OZKA 2A59A 1QGED 3WL3A 4FFMA 1OC2A 2VSYA 5B58C 5KVCA 2UYHA 3AR6A 2CL6X 4MRMB 1HKUA 2Z08A 4G25A 3JWIA 2QTVB 3QVOA 1U28C 1USIA 2IGBA 3Q5EA 4EUHA 2XWBF 1SC6A 3MF4A 5CMLA 5HQ3B 4QE9A 1CW2B 3AIMA 4MYTA 4WN9A 2AQIA 3P9PA 4QDXA 4QRHA 2NSHA 4C7MA 1OFTA 3JYOA 5IABA 1WCWA 3B13B 2KI5A 2C58A 1YNOA 2BL4A 2BTEA 4KK4A 2QL7A 3MT8A 1KY3A 3RAFC 4GBED 3WYDA 1YB6A 1N7IA 2C77A 1A77A 5HW0A 5JMWA 2J45A 3TTSA 2QGFA 3JYQA 3GJRA 1H6CA 5IYZA 4HWTA 4IOKA 3IO3A 5CLFA 3HM9A 4ZO6A 2DLNA 4EX6A 1P0CA 4RIEA 2HLDG 3N0VA 3NWBA 4JNCA 5J40A 2C2GA 1VMKA 2Q1YA 2W2QA 2Y0DA 1X7DA 2QSYA 3GAMA 1Y4MA 4RQTA 2WSLA 2JH3A 3F7NA 1F20A 4B5LA 5H16A 1RPOA 4DGSA 2DE0X 2JEXA 4LAFA 1WXIA 2VPQA 3U1TA 3E3AA 3NTLA 2JI9A 4MA5A 5KX5A 3E6AA 4LYHA 1PSDA 2OGSA 2X7HA 3WU2Z 4Q01A 1JLKA 3UJ6A 2O7QA 1PDVA 2FPOA 1S3IA 2A5FA 4YJGA 4YRCA 2QZSA 3AEUA 1XI1A 3H0KA 3W5DA 4I7EA 4CFZA 3IHKA 5BV0A 1AI5A 2J3LA 1ZVJA 3EHEA 1QNMA 2I1VB 2Y0IA 4HGZA 1SBYA 3COZA 1KPIA 5LPNA 3CH7A 2OLEA 5F2VO 5B3LA 1CR4A 3RGWS 1YAHA 3AYZB 3CKLA 3FDIA 3CZ4A 2GD1O 3E2IA 2ECQA 4Z1MD 4ZIRA 3LK6A 4X65B 1M9NA 4LZPA 1ECGA 4JSRA 2BDEA 2JZOA 3IQXA 3L4BA 2Y48A 2JATA 2ZPUA 2O2JA 4N0EA 1MHPA 3CJHB 2IPAB 4XH9B 4EB8A 2G9UA 1HYQA 3N74A 5ISMA 3ORFA 2CLKB 4F3TA 2EINB 1TRHA 3JU3A 1GG8A 2G7MC 4RACA 1KOFA 1I01A 3WX0A 2WPDA 5FH9A 1UK7A 2WK1A 1I8TA 4GYKA 1TQ2A 3WR5A 3O90A 1ZRNA 1U4SA 2IX9A 2DCMA 1XZHA 4OLFA 5I9BA 5A6SB 4YP0A 2HJ9A 2PZAA 5DTRA 3NALA 2KS6A 4JI1B 2Y2UA 2ESRA 3TIVA 1L1QA 4A10A 1C1DA 4YJ3F 3U7HB 1POWA 1P5JA 5ALZA 1C2YA 4AKSA 1EH5A 4QOSA 1Z75A 1T26A 3HNOA 3P30A 3TSZA 3IAYA 2H2AA 1OTYA 4FEAA 3UUGA 2Y1FA 2WOJA 1IONA 3NVDA 4UOZA 4C2AA 1XZBA 1BQZA 1F8XA 4W82A 1R64A 1IBSA 2BCGY 1MP0A 5JS8A 4C4AA 2P68A 5CM8B 1D1PA 3HYRA 2IIPA 1QH8B 2G76A 3DZJA 1YXMA 3CU5A 6ABPA 3WO0A 3JAWA 4NFSA 1SULA 2ZRMA 2XAAA 4KLZA 3GGCA 3CRQA 4FBLA 2X1HA 4DG5A 1SN7A 3BY6A 1ISIA 4RMIA 1NF9A 4ZDJA 2XBUA 5FL3A 2IYFA 3GJ0A 4PX9A 4P98A 3ET4A 4BE9A 4ZALA 3BCHA 4XEHA 3W7TA 3H13A 4RAQA 3VAYA 3ADKA 1QVRA 4O29A 1VQMV 1XL4A 4YJKA 1WB5A 4N40A 5KYYB 4AQYO 1DAIA 3CLHA 5E7IA 1OHHG 4BU0A 5C46F 5GTIZ 1AKNA 4GX5A 4TKVA 2BFWA 1JVNA 2V1DA 2DTEA 2IYTA 4LK3A 3IMEA 5D8DA 2DSNA 3JVIA 4KXYA 4MW0A 1N2SA 3D1LA 5KEIA 2GETA 3FBTA 1YMVA 2GM9A 2ODQA 1ZOLA 4WIAA 3EIOA 2IH1C 2UUBB 1TKAA 1LLDA 1P6UA 2XF8A 3DNFA 2OBYA 4EARA 4RGVA 3T94A 2Q7HA 3U11A 4BRSA 3VX3A 3KKLA 2ZRNA 3BE5A 2XE4A 4YMIA 3QTLA 3K0AB 2O59A 2Q73A 4YRQA 1QPGA 2YH2A 1RTKA 3AR5A 3QU4A 1NTZH 3G71V 2H65A 4U7TB 5T4BA 4U7WA 1SVKA 3K0GA 1T8YA 4RNCA 4RKFA 1VQPV 1Y8QB 2BLLA 1SO8A 3FPEA 1FP7A 4OHPA 1WPGA 2VC2B 3AF4A 3AI1A 3WWDA 5HBRA 3AG2B 1A9OA 3KEGA 1ZM3A 4Q18A 4ENTA 4MW3A 4UV9A 5TMEA 3W8DA 1VQKV 4XLTA 5CMUA 3TZ6A 1W5EA 4PS1A 4HAOA 3WK9A 2TRSB 3DKPA 3OD1A 3RRMA 2Q9LA 3RLFA 1WUTA 2BDUA 2I9PA 4LNHA 2YRWA 3PE6A 1WDMA 3IEXA 4TUYA 2BEWA 4NCBA 3IKMB 4ID9A 1WKCA 4BBJA 5BR8B 4MA4A 1YB5A 4TMWA 2D54A 4CH3A 1EX6A 1R8YA 4BFVA 2I80A 4CQMA 1SA0B 5IUKC 2VPZA 1JI0A 2AG8A 4A1OA 2P1RA 3S2GA 3KTAA 3BA6A 1G5RA 1L2TA 3HHEA 5IXJA 1PL8A 4Q3CA 4HWSA 2YWCA 3P9NA 4N18A 1IHXA 5CJ2A 4UUOA 3STUA 2VJLA 1IZYA 4DZZA 3U0VA 5JHHB 4KQ6A 1RPZA 1IVSA 2ZATA 3EB9A 3AI7A 2IX3A 1G7RA 1AQJA 4ALIA 3QG5A 5IW8A 2RSLA 1DUSA 1M34A 1UIRA 2FN3A 3QQ5A 2CFRA 2DQSA 3DWIA 2CLOB 1Q0ZA 3P2MA 1NI3A 2HLDD 5FT9A 2LW7A 1MO6A 4PO1A 5B7PA 3IBGA 3EH1A 1UJBA 3SK0A 5K3BA 4XUDA 4YT8A 4NU8X 2G72A 2O50A 5DN6G 2DMXA 5KNDA 2KQUA 3OJWA 2GFIA 4I9FA 2IZZA 3D5TA 1RDFA 4NJEA 1J8FA 2OWOA 1YMUA 4M8SA