3WB0A

Hcgb from methanocaldococcus jannaschii in complex with light-decomposed fegp cofactor of [fe]-hydrogenase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
158
structure length
158
Chain Sequence
VVMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the HcgB enzyme in [Fe]-hydrogenase-cofactor biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
molecule keywords Uncharacterized protein MJ0488
total genus 59
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.-:
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3wb0A01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3wb0A02
1RSOA 1H2SB 3LNNA 4DK0A 2D0OB 1T5EA 3WB0A 1EEXB 3AUJB 4DK1A 1MMFB 2D0PB 2V4DA 3WB1A 1EGVB 1UC4B 1IWBB 1UC5B 2F93B 5JJJB 5D5PA 1IWPB 2F1MA 3BRCA 5JJEB 4L8JA 1EGMB 4GYCB 1VF7A 5D5QA 2F95B 3WB2A 1NBWB 5JJNB 1DIOB
chains in the Genus database with same CATH superfamily
4A5UB 1THZA 1DTSA 2JLWA 1FMFA 4U7JA 1SBYA 3M7MX 3MSCA 3WRXA 4N4AA 2VAPA 1YDXA 2P27A 1YZTA 1M6VB 4FYJA 1T43A 1AI7A 2CMFA 4IOKA 1CZOA 1YKFA 2OESA 3Q3JB 4O0MA 3ZNPA 5A06A 5FTWA 1A96A 1IEXA 1M7BA 2CJFA 5EIBD 1TYCA 3DGEC 3DVRX 1PJQA 1QO0D 1R15A 3BHMA 2OM6A 1K63A 3GFBA 4D81A 3NCHA 1FNCA 4AMZA 4L5BA 4LZOA 2H7XA 2VP6A 1GGHA 4HY3A 1XAGA 1Y89A 4UC0A 5LLSA 3V2UA 4C78A 5JC1A 2GHIA 2P2CA 1PWYE 5IN4A 2MSWA 3T1HO 3OZXA 2YXBA 2Q0OC 3W7AA 5ALDA 2E5WA 2FDCA 1AUVA 2QRUA 2E4UA 1O4VA 3NT2A 1VMIA 2P9GA 1C3EA 4H6PA 5DDIP 5ICFA 4W5TA 5CBHA 3ENQA 4ESVA 2ERYA 4FGJA 2Q0HA 3BMOB 1NUTA 2OECA 3K8QA 3W5JA 4HFRA 3OY2A 2WYVA 1RC0A 2YL2A 2XITA 2D5IA 3E2EA 1E62A 1Q92A 3T12A 3OSUA 3TSOA 1U4NA 5IKEA 4R8LA 4JVLA 4RMHA 2IJKA 1BGVA 1OQAA 2AQ8A 2HLPA 3GROA 3K6KA 3OSZA 4JROA 3LKBA 5J2UB 3CLTD 3MVEA 2BTOA 3V3TA 2IYWA 3U19A 4TKLA 4HH3C 5HQJA 2E5LB 1DTWB 3GWKC 2XNDG 1WTAA 4FXOA 4MB0A 4QEKA 3T7RA 4ENRA 2C9YA 3HO6A 2PAAA 4YAIA 4ZJPA 2NXJA 3S8YA 1RC8A 2Z1MA 5LN1A 1G41A 1BHBA 1NVGA 1YA4A 4F84A 2H0RA 2VJDA 4K8XA 4QZVA 1RWNA 4D44A 4UTVA 1A8IA 3ET4A 5KSWB 3C3YA 2ZVJA 2GASA 2QG4A 3JQAA 4LMRA 4TZ0A 3PQ3A 3E22B 4J0HA 2A0FA 4AO6A 4D3SA 1U3UA 1H94A 4WZZA 2GCOA 3RVRA 4IJWA 4HVLA 5TSDA 2ZAMA 5C5EA 5A4IS 5GW7A 1AA9A 2B1IA 1HDYA 3GPCA 3OT4A 4PXAA 1ZK1A 2VTBA 3H1AA 1F2TB 1W49A 3HGTA 4ILKA 1OBHA 1JS1X 4EIWA 1PFUA 4PCAA 4Q20A 2JCGA 4IWNA 1SIBE 1OCCB 2F3UA 1VLZA 1ZMOA 4KRYA 4CM6A 4EG7A 4O5AA 3E0XA 3CWZA 3ZKWB 1OI2A 1VHTA 3DYIA 1DS6A 5DM0A 2YICA 3AG1B 5HA5A 4C05A 1P9NA 3WWZA 2HF8A 3PT5A 5ED0A 5AVOA 5LLDA 1TUBA 2FF5A 2R1VB 4EJ2A 3AL0C 3TRFA 4DIDA 4EMSA 2Q2OA 3ZRSA 3NZEA 2ZJ0A 3K8ZA 1QWOA 3AHEA 3KYCA 2AEJA 4YBRA 521PA 3CLVA 1ADYA 3UMFA 5FWAA 4ZEVA 5BR4A 3MOSA 5BWLA 4QBGB 2R1TA 3UEOA 4CM1A 5JY1A 3FA2A 1S4MA 3PK0A 5E38A 2JIRA 1TM2A 2ORYA 3X3HA 1TQ8A 1IBSA 2HZBA 2VL7A 1R8SA 2YZGA 1NH2D 3HN6A 4Y6GB 3ZZ1A 2QXYA 1L0LH 2X5XA 5MGNA 4RTSA 2HXYA 3RW0A 4A0RA 4MI6A 1E8DA 4M8KA 5F23A 1I0HA 5DLPA 2XB4A 4RM3A 4NONA 3TW8A 3G6EV 5IVHA 4DJDC 3HKBB 1FB5A 1Q7RA 2Q3DA 3WB9A 1YDMA 4FVTA 2GEFA 3BD8A 3EA5A 5I6DA 1H2HA 3PI6A 3EW9A 3N2GA 1RWPA 3G9ZA 4OBEA 1RPJA 2VJYA 3DW1X 1LC3A 1NLUA 1HDZA 1YQGA 1U4OA 4X20A 2ZBUA 2BBOA 4LISA 1X1RA 4U7FA 1CJVC 4P4SA 5KJ1A 2E48A 2KMLA 3KDPA 2C00A 1CUZA 1W4RA 1DBIA 1YRBA 2EBUA 4FNOA 4UKDA 5L3EA 5G3YA 2Y1WA 4W6QA 1AQJA 4CF4A 2PZBA 4DIFA 4MVCA 3O82A 5AHXA 2I9PA 3LP5A 5A04A 3UMCA 3NQ41 5KVAA 4EQ6B 1C41A 4TVKA 1FRNA 4DIUA 1E66A 3MBKA 1XQXA 2J30A 5FOXA 3QIVA 2CVFA 2ISSD 3KQYA 4N5HX 4PU0A 5ALLA 1IJBA 4TQAA 3GELA 4MS3B 5L3GA 3MWFA 2UUBO 1M2JA 1SC4A 2OCDA 1IL0A 2FG5A 4N5LA 4CDMA 2JK0A 2AYZA 2R9IA 1DG1G 3INTA 4OOEA 3JALA 4YP7A 3OCCA 5EXTA 1O95D 3CW9A 4E51A 1RBQA 3IEIA 3PTLA 2OV1A 4A27A 2O59A 3VNVA 2COEA 3R1IA 2OGZA 3WYAA 2XAJA 1JSCA 3AG3C 4JUBA 3I09A 4KMMA 3W5HA 1GUDA 1U0HC 2XASA 2QXTA 4P6VF 1DQPA 1VE9A 3EFOB 1QOZA 2X4GA 3OEHA 4WEOA 1ONOA 1P62B 3MT8A 4M1EA 5EJAA 1FXHA 3KALA 2ZE6A 5EERA 3BXOA 1ZN8A 1VQLV 4CT5A 4DVJA 1E9BA 1CUBA 1BCSB 1E5QA 4L27A 3KSMA 3OEED 3QWIA 4QECA 3WMWA 3CXRA 3JPYA 3RI3A 2HREA 4MV4A 1HT2E 2P6MA 2PRZA 3REQB 4BO1A 1M6YA 4LCJA 2EHJA 5HZMA 4Z53A 1K7DA 1GZDA 4J1TA 2J5BA 3A0UA 5FI3A 4DDKA 1V54B 1ESDA 3UM9A 2WU4A 5EP4A 1KEPA 5CDUA 4NEGA 1L5VA 2BHNA 3O3OB 3SHQA 1QGUB 1TVMA 1Y8CA 2FZ5A 3H5VA 4FZ0A 1XGKA 4LKOA 4QYTA 1N7HA 3LWBA 4NFSA 3SZMA 1U0BB 3KQHA 2J5KA 2WSMA 3S27A 1U0OC 2RGAA 4HDQB 4V1CA 2IE0A 1JV2B 3UPDA 1GQRA 4MYDA 3VU9A 4HRAA 5CCBA 1A9XA 3K0DA 1F8XA 2XTMA 3P2MA 3WO0A 3ZE8A 5EMNA 3SX4A 1JDPA 1C9JA 5KNDH 4ACAA 3QTLA 4RGVA 4BASA 5EQJB 2Q6TA 4UTPA 3QEKA 3V2GA 4E07A 4NTWA 1M6EX 3N58A 3ICVA 5FI1B 2DYRB 3TEFA 3GAFA 1RI1A 5KYUB 2PG3A 3IP6A 4GOMD 4P5PA 1SKYE 1WW2A 3I28A 4QDXA 2PRIA 3ONNA 3WXMA 2UXNA 4BJHB 3NKLA 3CX8A 2Z58A 3B77A 1I13A 3I73A 2DOSA 4HFNA 3B53X 2JJ2D 1X7GA 4C4SA 4II3A 3JRXA 3A28A 1HT1E 4X7PA 3VISA 2C5FA 3HGMA 2E6UX 4M7OA 1PD1A 2VUHB 3NBXX 3DZKA 2H94A 1C7EA 1UJNA 5EXSA 1S3JA 2V6JA 2FWBA 3GCGA 3QOXA 2ODAA 1S3SA 3C6MA 3B8NA 5L4LA 4CG2A 1E6UA 2I1QA 4C21A 1DJPA 1WXFA 3K0KA 4HX9A 4NYMQ 4XDJA 1LJLA 3D7NA 3GLTA 4F96A 4UMEA 3AK4A 5H02A 5KNDD 5DM70 1JSLA 3AGPA 1W1WA 1JBEA 3FOBA 4XPIA 1SK8A 2TMKA 3PFCA 2HU7A 2AEFA 5AJWA 2HJRA 4AILC 4RUEA 1E9DA 1QV9A 2G7MC 2X8BA 3DWIA 3MB5A 4X8MA 2F1OA 3EW7A 3SBEA 1JSRA 1USWA 1GN6A 2Q62A 3QEJA 3O26A 3H75A 4M9QA 2AJ8A 3VR3D 4POOA 1KERA 5DNCA 5EE3A 1AXRA 2HOQA 1RYMA 3VQWA 4GR5A 1XHFA 3JAWA 2QP9X 5LMCA 3PGXA 1JUDA 4GP9A 5KCZA 1ZX1A 4GLOA 1BYIA 3LVQE 2AZXA 2H57A 4JVSB 4IHQA 4CKEB 4UM5A 4J0FA 2XSZA 4UPEA 4YAKA 4KR9A 3WADA 4DEYA 2HJDA 5BT8A 4DCNA 3TTWA 4NLLA 1K98A 3CINA 3QE4A 4KDRA 3TX6A 1PPJH 5DK6A 1I6KA 1LPMA 2DJIA 2W11A 2ZETA 3QGMA 4FI3C 5F3RA 5IH7A 2D2XA 2PUVA 4F06A 3VSCA 1OCRC 2P0EA 3ITEA 1WUKS 5HCNA 4DRYA 2BRUC 1DKOA 2M1XA 2X0RA 3L6OO 1CUDA 1GGJA 1ZN7A 1CQPA 2Y1XA 4MTLA 4V0QA 5HE9A 3BWCA 4BHTA 4CLRA 3RF6A 3AGQA 3UT5B 3GUHA 5IM4A 4WFKA 5JSUA 4LZLA 2GN6A 4FPXA 1PBTA 3QBVA 2BCGY 3AR4A 1K5DA 1IC6A 2CTPA 4AHCA 5JCOA 1Z5PA 2FQ1A 3F47A 4IAOA 4NK4A 4ZDKA 3THWA 2R4TA 4F5YA 4KR7A 4NNPA 3B2EE 4FJCC 5IX8A 1NBEA 4R84A 4M0PA 4OFXA 5DNVA 4FGZA 5JUWA 1AGYA 4PI0A 5K1XA 1Q82W 1IUPA 1E77A 3FFWA 3Q7QA 4OI2A 5K3CA 1NA5A 3VU3A 1D5WA 1RPOA 3DEAA 4LF8B 1NI4B 3ABQB 4PC1A 2POQX 1XEWX 3P0FA 3W5UA 5EKUA 1SUIA 2IZ5A 5EBMC 1NVDA 2BFBB 3NAQA 1N8NA 1A8PA 3IIKA 4JT9A 3O4JA 1L7QA 4LGCA 4PRZA 4TT3D 4TSFA 4UNQA 4YALA 4LZAA 1AQIA 4HUQB 3TWOA 1P60A 4KQCA 3AOGA 4E5PA 2QDOA 3EZGA 2L0XA 2X3UA 3VOTA 3PR2B 2BEUB 2VF8A 3SPIA 4KSCA 1D4AA 4P4NA 4PDVA 2H4HA 4UV8A 3F3YA 3LO8A 4LQDA 3QFHA 4RPKA 2Y92A 3DDZX 3ETJA 4OQQA 4YRIA 3HB7A 5FQNA 1WDKA 5JAMA 5SY6A 3A9SA 3CBQA 3N59A 5DLDA 2MDTA 3MRVA 1YNSA 2RG7A 4BN5A 3UMGA 2XB2A 1DFHA 5KYWA 3O2QB 2Z6UA 1QG4A 3OR6C 3DNPA 2HMTA 2WU1A 1VCIA 2WVGA 4LVCA 5HQ3B 4FDAA 1GARA 4JV5B 2J6HA 3IB3A 4YMSA 3GP3A 4YRZA 2VP4A 3CPJB 1FFAA 4G8CA 4MK4A 2X1HA 3KL4A 2C77A 2HLNA 5L3ZA 4GLJA 4I55A 1D07A 3E9YA 3LFUA 1E0JA 1TMGE 5BN3A 8MHTA 1R37A 4G25A 3G7SA 4MYRA 3JAKA 2Z2ZA 4KR0A 1V39A 4R2MA 4TV8F 5CEJA 2F1MA 1A98A 3EUWA 1YZHA 1J2EA 3VQVA 2VQFB 4EI8A 5JYDA 4LMBA 5AW0A 1D09A 2IY8A 1E1QD 1K5PA 1T0HB 3DOCA 3VPDA 1GU0A 2F1RA 4Q3CA 1M73E 3PC8A 1NKDA 4L22A 2WD9A 4Y3UA 5CLJA 1G5QA 4P2ZA 1JTFA 2GHYA 2PR7A 3IUEA 2HUPA 4ZHQF 5HP4A 1B16A 1EFCA 1TEXA 3HUTA 2HG5C 1CY8A 3I0ZA 3L5KA 4IKOA 4XUCA 1ZC4A 1MQSA 3ZWCA 4Q02A 3X0DA 5T3UA 5J4YA 2CDCA 1A82A 4NQRA 4TKUB 2W2PA 3V42A 3VU1A 3C3WA 1G6OA 3E7FA 1A8HA 1ZQ9A 4D41A 2EBFX 2GPSA 1GGEA 1AGRA 4UULA 3V4ZA 1A2BA 1KVSA 1PFVA 5T8KA 1ETHA 4INPA 4WLVA 4DSUA 5IWAB 3NRCA 1GK9A 1H2EA 4XEHA 5D6NA 4EKEA 5L3CA 2EL7A 5GY7A 3U4HA 3AEQA 2VDOB 4OCZA 2JIZA 2EWMA 5B7PA 2YC0A 2N47A 1ECCA 2HJFC 3IPCA 4IO1A 1I2ZA 3WNVA 1IN6A 3OQPA 1Z0JA 2ZTSA 3D3QA 3KR0A 4G2TA 2ZXWC 1JYEA 1Z83A 2L17A 2FPUA 4RANA 3ZN2A 3SNKA 3K0BA 5B2FA 5A3QA 3H9VA 1VIYA 4RA6B 4ZHQB 4UZFA 5JFTA 3VZDA 4KGVA 4DG8A 4NTXA 3VZQA 1JKIA 5DT9A 4DK1A 3IHWA 3UV6A 5K20A 3H17A 2CMKA 1S9DA 3WIOA 1PVDA 2YINC 2IDMA 2JEUA 2C5HA 3LC1O 3P9XA 1M57C 3B78A 4MPRA 3TZKA 2BFCB 2I8CA 2JI9A 2A9OA 1C7QA 1W5AA 2VJBA 1X70A 2A3NA 2RGYA 1OLSA 1E7QA 2KYRA 3BCHA 3FWPA 4II2A 3ECCA 2KQUA 4BU0A 1SZTA 2JVKA 2V6MA 3LQ4A 1WVMA 2RAPA 3U0BA 4KYIB 3WP0A 4E4EA 1H2BA 3LDCA 3DV9A 4ER0A 2FKNA 5KVQA 4HNUA 3C8ZA 4I50F 4QT4A 2OC9A 1E6WA 3FB1A 3DZHA 3HBJA 1U1FA 1SY7A 3RYTC 1U2DC 1WD7A 3I6YA 2JS5A 3WLPA 4X7BA 1HFWA 1OB5A 4MI3A 1WLYA 1BWPA 1J06A 5U9CA 1UWVA 4FXPA 4X0EA 5LQKA 4C7OA 1SXPA 1NW6A 1UMDB 2Q3MA 2QLTA 4IIUA 4JQYA 2J0UA 4OK6A 1X1SA 4OXNA 1SVUA 5FFMA 5HUJA 3AR2A 3OH8A 5L7YA 2W6QA 3DNFA 2EJVA 5A2QA 2C3OA 3G9XA 1FS0G 5KAFZ 4UBKA 4XIIA 4M1YA 3G4SV 3K6SA 1U2EA 1ADGA 1T36B 3BFRA 4WF9V 4HOYA 4PELA 4QYMA 4M22A 3Q8KA 2Z3WA 3VPGA 3I6QA 1JDUA 3O94A 2QLNA 4H7IA 4BMZA 2VWHA 1ZVQA 2QUIA 4IS3A 2PIDA 3G1UA 3AUFA 1DU4A 5JLAA 4LCUC 4PSUA 2ZSKA 1W6UA 3LPNA 3OT1B 1K1EA 2QJWA 1V16A 4IIJF 5IFLA 1B2RA 1H0RA 3EC1A 4MVJF 1GQYA 2DBZA 4JY7A 2JJYA 5A03A 1BOOA 3CJHB 1N9GA 1ULUA 1QK3A 5LIRA 1QHIA 3AJEA 3IQGX 2WHRA 1DUVG 1CFZA 4GMGA 1SHLA 4LYEA 4ZAVA 1W59A 1E1CB 3GGOA 3WFJA 1D9ZA 1SU8A 3PEWA 1AUOA 4OGLA 1JHUA 1CP3A 1OKKD 3E9EA 1S5PA 4QTTB 4YRSA 3PEYA 3KSZO 3RU2A 2XPCA 5J59A 5C1BA 3ABZA 1HM5A 2O3QA 1HRKA 3O0TA 2FK8A 3Q6IA 1O87A 3V80A 3RVYA 3HCBA 3QKIA 1KGDA 2EZPA 1Y4UA 4BQNA 3IGAC 1FMTA 4OQXA 2XEXA 2G1PA 1RU3A 3KOZA 1K8ZB 1O94D 1GTRA 3L7AA 2AXQA 2IHYA 3AR8A 4BFCA 2WC1A 4D2IA 2QX4A 4B75A 2C7QA 3ONVA 1A4XA 3MGKA 5AKIA 3OUFA 2A3QA 1BHQ1 3LCMA 4RO0A 1QYRA 1F20A 4LBWA 5EJIA 5H59A 2XWPA 4Z1OA 5JZOA 1D6NA 1OWLA 2CV0A 3DLHA 4YV1A 3L7DA 1C8LA 4BO4A 2BM9A 5DLEA 2DF8A 5AO9A 5DIFA 3FBWA 3WFVA 4MX8A 1RQRA 4Y67A 1WUTA 1XWWA 1SQFA 3D64A 3V7FA 3GFOA 3FSGD 5A6VA 3PVSA 1TLLA 2XUKA 4PPYA 5LQUA 2VDPB 4MKGA 1YRHA 4XGQA 5EZSA 3U6KA 2ZI3A 3NT4A 2RG1A 3VDQA 1N6RA 1TD9A 2XECA 4HTAA 4GICA 4ER5A 3MLEA 2D6FA 3WGQA 4CEIA 2BC9A 1M57B 2PD6A 2PLAA 2R11A 4JI5B 3AL3A 3DDWA 3CMEV 3FHJA 3BVOA 1BIFA 4K3UA 3FZNA 5K45A 4Z4GA 2GZ2A 3JQEA 1YCDA 4RA9A 4EA7A 4ZN6A 3EEBA 3ME5A 4WZAA 5L3SB 3JZMA 2QMOA 2QLJA 5IMBA 2XF2A 1OZAA 1CF2O 4RGYA 2ASVA 2X5KO 1BS9A 3PHGA 4G24A 1E3TA 1L4YA 3ETLA 3T4ZA 1FSFA 1KYYA 2ZKLA 3LZCA 5CW1A 5K9ZA 2R8OA 3V7NA 4I46A 1PT7A 3R74A 4CS2A 2YVUA 1Y9ZA 3AEKB 3NXSA 4TRRA 4YJFB 1N2CA 3BFJA 1QYIA 3KV1A 3LA8A 1N33O 4FS3A 4JBWA 4GMXA 4JZYA 4E5NA 5KA6A 2UV8A 3CUTA 1G5HA 5AW3A 4ZTZB 2IYLD 4DG5A 1P9RA 1DCKA 1RI5A 2F3PA 2FN7A 2LCFA 2F3RA 1OASA 4V0MA 5AHOA 2ZBFA 2Q5ZA 3P9CA 4ZDJA 1GM7A 1G2IA 2NUAB 3TJRA 4BLQA 3FVWA 1WXDA 2C2ZA 3MCZA 2LJ2A 3SZRA 1XA4A 5BXYA 3IJRA 3OM0A 1FP6A 3FVQA 3FIUA 2C2MA 3PSAA 3OPXA 5F51A 3SLRA 3TKAA 4ZARA 3WSVA 4ENTA 1XRNA 1DX4A 5K0EA 4UFZA 4WFAV 1R0BA 2YFKA 1JXOA 1QR6A 221PA 2A33A 1K68A 2P9CA 4U9HS 5IC6A 2Y0PA 4L9SA 3TM5A 1Y80A 4NC9A 1Z37A 1J2RA 4JC0A 1JTVA 2HCTA 2IZOA 3ZIUA 1P61B 2IYFA 4IRMA 1IATA 4H0CA 2HA7A 2VN8A 4MOWA 1ZKMA 2G5GX 1T0BA 2PGOA 2ZRJA 4YR7A 3TXSA 2CXTA 2I4IA 4HQNA 4KN5A 3ASUA 4A0FA 4ERNA 3H1IH 4CBCA 1DBWA 1T5SA 4N82A 3EC2A 3U56A 4PRLA 2NO1A 4PHGA 4XYEA 4F3YA 2ZJ5A 3R5JA 5ESXA 2FKAA 2OMKA 3BWVA 3GX1A 4Q1FA 1ZGHA 3ZY4A 2CV2A 2EFEB 2BMVA 2RHJA 3KB2A 2BSKA 1A9PA 2HDNB 2QTLA 1V5FA 2QA4V 3K9NA 1WSWA 2SCUB 3M33A 2VDQB 5BSEA 1GNPA 4K2HA 2GEKA 3P3NA 1Y3BE 1JLLB 3OT5A 3ORHA 1IONA 1NZJA 1Z45A 1PS8A 3EA4A 3BIFA 3LKZA 4IV8A 5D86A 5E0OA 1XCBA 1JA1A 2PVPA 2O6HA 3B6IA 4M6WA 2NNUA 1Z25A 3EFEA 3NRJA 3PICA 2FSVC 5A71A 1C4OA 3WLAA 1YRWA 4JOBA 4ZGWA 5KX5B 1DL5A 4PD4F 1Z8DA 3B9BA 2QR4A 3I92A 2I22A 2P2ZA 4MUYA 4EZBA 4TS4A 4DDTA 3GDGA 4GYKA 2J3DA 2QE7D 2CXHA 3PUXA 3AIMA 3NM5A 2FUNB 4HVAA 4OM7A 3W9SA 2DECA 1N34O 2ZBDA 1N5DA 4JSTA 4MGZR 1OFVA 4LOLA 4MVJG 5F76A 4ZVQA 1QS0B 4LWOA 5FL7G 1VKRA 4GZ5A 3NW9A 4XIGS 1N8KA 2CDNA 6YASA 1TUIA 4YAEA 4ICIA 5B1BB 1GUYA 2FTKE 4BLPA 4DY6A 1RQ2A 3DZDA 3EQ2A 1WDWB 2AX4A 3G2QA 4TMWA 5FHQA 5FPRA 1HLDA 4GI1A 5K51A 4AFNA 4CYMA 2ZUCA 1ZD4A 4ZOQI 4DW8A 3F7YC 1ISMA 3K1ZA 3RDPA 4D9GA 1KY5A 4KH0A 3D6NB 4EBFA 4MKFA 4ESEA 3EAQA 1P2TA 2EBWA 2XDQB 4LYJA 5B7GA 2GA8A 5C7LO 3R3ZA 1P2SA 2W0XA 4H2DA 2XB6A 4OBBA 4ON9A 3OTOB 1CIVA 2B7LA 2WYUA 4FE4A 3V4VB 5BV7A 3N2KB 1J00A 3D7LA 1YZFA 3VO9A 3R7BA 3F74A 1Z36A 1X8KA 1VE1A 3QI7A 4QBIA 4YUXA 4N65A 5JJJB 1BVUA 5GIOE 1X1DA 2QHXA 4QELA 2RGXA 4D82A 5IT5A 3B9RA 4LBVA 3P94A 3CUVA 1OXSC 3FCCA 1ZI8A 2FMXA 2PRSA 4Q1EA 3UV3A 2PS1A 1Q3KA 1MABG 4DCSA 5AVXA 2ZP1A 1H8HG 2NZYA 2H1FA 4BO6A 3GEDA 4I1OA 2P6NA 5EHZA 1XF1A 1ULHA 1BHJA 2EKQA 5KTSA 3BE6A 4Y0VA 1IBLB 3TQSA 2FOXA 4LY9A 3EWIA 1K8QA 2VPXA 5JVDB 5FTJA 2QPOA 3HPQA 1FY2A 4TYQA 1RKXA 4Z54A 3BH0A 2JH9A 4KSYA 3GRAA 3WKEA 1FLVA 2RJZA 3COSA 3H3XA 2PGXA 4LPKA 4TMFA 5AJYA 1XNRB 1VHWA 3NGLA 4FFPA 3EBPA 2ZAIA 3CMCO 2C4KA 3IEKA 3P0HA 3B36A 4P31A 1FS6A 4X1YB 4ZZIA 3LJKA 1MOFA 5CJJA 4B3CA 3EXIB 2ZCEA 3UJ6A 1WPQA 3VBCA 4D0RA 1AZTA 2HTFA 2R6JA 5JJKA 3OOSA 5KJ6A 3ENVA 1Z4IA 1SNYA 3K5OA 3MAGA 1T6ZA 3L7CA 4KDFA 1NXWA 1P9LA 1PO7A 4MMXB 3HBNA 5L51A 2JL1A 4N0DA 2WM9B 3A32A 4N6GA 5BORA 4CH5A 1L4BA 2B7BA 3BN3A 4NG5A 3WMXA 2UYQA 1XL0A 2M6YA 1QFZA 4OIFA 5DP2A 3ZU5A 1KZGB 1XTPA 3EGEA 3ZBUA 1V2GA 1K66A 4I4NA 4K6FA 1V5WA 1H3FA 2BJHA 3ZUPA 4CF7A 1W0CA 3RSCA 1ULBA 1YDEA 3KB8A 2PYJA 3OO0A 5DGXA 3URKA 2OG1A 5JMPA 1U1GA 1UBHS 4DB2A 5DLQC 3MMNA 1Z0DA 1NVFA 3STXA 1PV4A 4HGQA 4F5EA 1ZWKA 5L3RA 2G1KA 3AUXA 4IXTA 5ITSA 4F56A 2CL0X 3RS4A 3UTCA 3FOFC 1QU3A 5AJTA 5TIIA 4LF6O 1PS0A 2Q4EA 1QTQA 3L82B 3C97A 1AGPA 4WXMA 3KXLA 1F3LA 2AI1A 2NYVA 4YJ3B 3PDIB 5G53C 1N3LA 4MWZA 4PLCA 1PR0A 3G88A 4IZ6A 4LGYA 4JQOA 4TZTA 1ZS9A 3I5XA 4Q3KA 4OHWA 1W8DA 4ENWA 3JZDA 4ME6A 3DXRA 5B1NA 1F1BA 1RAIA 4RKWA 4AROA 2OQIA 3R5TA 2HHCA 1SBNE 1BSMA 1UPBA 2YJTD 4IFBA 3P4UA 2COKA 3TCUA 1CVIA 1EFRA 3NTXA 1MQAA 4RCZA 5LMZA 1EZJA 2DLDA 2I71A 2ODTX 1XRQA 4CG3A 3AJDA 2ZZMA 3SYKA 3L75H 2BEVA 2I54A 1ND6A 2B2CA 3GWZA 3H3FA 3M8KA 1B0AA 2Z09A 4AJEA 4B5KA 5AUPB 2M9MA 3TF5A 3F5MA 3ORSA 1X74A 4R9UC 4YMIA 5FPSA 4XUDA 3L1IA 4F9FA 4LJ5A 4ILEA 3NHMA 1K9MW 1D2DA 2HVKC 2HRRA 4FGUA 3ZU6A 4AW9A 1L5MA 5IWAO 2BI7A 3EVDA 3QI2A 3W05A 3WFIA 4WECA 2YIBD 1LSSA 1TJNA 4WCFB 3H6HA 3A0RA 2GEUA 2OV2A 5B6PA 3ESCA 2CGNA 2FZ4A 1WZUA 2B78A 3ZC3A 4IVQA 2OK8A 1EVJA 3TXYA 4X00A 3O7WA 4KGDA 2LNDA 4N8EA 2W6CX 3JCUZ 5EP3A 9ATCA 5K4GA 1TI7A 3DNMA 3W5IA 1K4YA 1GZSA 2QW1A 3FUWA 1QHFA 3KQVA 1GO2A 4EG1A 4ESOA 2WSSA 3KHSA 2HMSA 2PK3A 3PGJA 2WJWA 1L8OA 2A5YB 5JDIC 1U8CB 1ZM2A 3LY7A 1C1XB 2ZRKA 4MRAA 1S1CA 1YF3A 4PZ0A 4R7CA 3OW2U 1EUDA 4YRGA 1PWXA 4P92A 4TM8A 2OXEA 5EWLA 3F8SA 4P81A 4R1SA 3OQIB 3GRFA 1PSWA 2QZZA 3UK2A 3NV9A 3L71H 1P31A 2NGRA 5E1OA 3FJYA 4HSGA 4B44A 2PH7A 4HAXA 5F4ZA 4BO8A 3KO8A 4LQCA 2ZIGA 4EB6B 3E53A 4OFBA 5K7SA 2XX3A 1SQ5A 1JIVA 2YDYA 1QUFA 3BORA 3F5TA 3VR4H 5J2TB 1JIUA 3ETDA 3IIMA 2P3LA 3Q4HB 3I55V 5KUMA 3EASA 3QU7A 3MCWA 2JFFA 1IOZA 4BRZA 1QBKC 1ZHOA 1H9CA 3ZCQA 4GNKA 4BBAA 3B6KA 2VO1A 2QLBA 3ILVA 1XJWA 1IOWA 5EZQA 4DCGA 3AK2A 1JE0A 1RWKA 2YWXA 2E82A 1AZLA 1C8KA 2H4ZA 2O48X 4UNPA 4AWBA 2IELA 4ZVPA 5ARCA 3IJEB 1CT9A 4FMTA 4DO2A 1B1AA 2A92A 3NJRA 4IUYA 3TQCA 3VI3B 4YQYA 2ZZNA 1G1MA 1W2WB 2POCA 4KFMA 3KBBA 1Z6XA 4TMYA 2C29D 3H0KA 3W1WA 1QP0A 4UVEA 3W7SA 1RWWA 1T2DA 1VQ6V 3FLMA 4RK5A 5F7JA 3VPAA 3BAFA 1KE2A 3EBLA 2G6TA 3PHLA 2YWJA 3FLBA 1NZ6A 4ZANA 1ZSNA 2QLMA 3Q12A 1BE8A 4YVFA 1ZVVA 2N04A 2FUCA 1RM1C 4DJAA 4QOEA 2O3UA 3R3VA 4P4GA 1PW7A 3WLQA 2GCOB 4JL5A 1V41E 2ZJFA 1L4EA 2R70A 2PWBA 4O2LA 1KZHA 4Y1EA 4BIMA 2OBLA 1TNDA 3FDFA 2XMBA 4MW4A 2FSUA 3OCXA 2XW6A 5BR8B 4XR9A 4B2LA 3F2IA 2X14A 5J47A 2A84A 4DSAA 4FX5A 3B1KA 2GDSA 1FX0A 1T4CA 2HJSA 1A9QA 4WKBA 1SVLA 3HE3A 3HXPA 2ZWIA 2BLNA 1BFUA 1ESNA 1LF5A 2D2CB 5I5EA 4OJKA 1DAHA 1CEZA 1QBGA 3QZUA 5ENVA 4BFWA 3SJBC 2EHDA 1BD4A 1XQYA 2YC2C 4KAFA 4RL6A 4UPVA 3VX3A 4BL5A 1AG9A 1UXOA 3TNYA 2O23A 3ROEA 2GVNA 5AVRA 3IVXA 2PWAA 4NESA 1XREA 2F43B 4NBSA 4INZA 4EI2A 2C7GA 2C2BA 4TLBA 5AVUA 2XE6A 5CH5A 3AETB 1U8AA 3R3UA 1VI5A 2CFSA 2R1VA 3HB0A 4XVHA 4RTOA 1LSUA 3NUZA 3K31A 1W2GA 1Y9EA 1NP6A 3B8HA 3KPWA 2G9RA 4DJEC 2UVQA 1DPGA 1NPDA 3A9UA 4BMNA 1TEHA 4UD6A 3ND7A 2VJQA 4Z0PA 1WB9A 1W5TA 1Z0ZA 5EY5B 3V9PA 1UBMS 4AYTA 1RYFA 3TLEA 3F6PA 1UJ6A 1KK2A 5DTEA 4S1PA 2GF0A 2I2DA 1XA0A 3S5JA 3AVOA 1E2FA 2V6BA 1GZUA 2DFDA 3BDIA 3H2SA 3PNMA 4YASA 1WS6A 1DEHA 2WD8A 4P0PB 3J7TA 2CBGA 2OT5A 2PX4A 3IEMA 4JI5O 3BFPA 2GF2A 4UCQA 3BXFA 4GAEA 5TVKA 1VPEA 1O54A 2BYTA 3IERA 1DF4A 1XVIA 4BEVA 2OPHA 4EI7A 4A03A 1ZM9A 3RRMA 1E7YA 4GXTA 4ND3A 4CE6A 1GN3A 4J3NA 1KBQA 3U3OA 2H2GA 5LQCA 5EKXA 1ZNQO 2R8YA 1NBOA 4MQMA 4B7ZA 5IT0A 4RV9A 4DR5B 3W3AD 2WWXA 2AFIA 3JV7A 4MARA 3B8EA 1E3DA 5JS8A 3LIPA 3LQYA 1SKQA 3U44B 3EMDA 1ORIA 3OZDA 5CB4F 2VOJA 2IDZA 4L5YA 1VP9A 5ALNA 1CUEA 3K04A 1V9SA 2FWMX 2H2DA 3ILSA 4KHPO 3OOHA 5ESWA 3RLIA 1WXXA 5L3FA 5IY5B 5TF0A 1QWSA 4QXPA 3HVRA 3ANTA 2GPNA 3ZMVA 3HFJA 1UMKA 3B4SA 4MDHA 1FJ2A 2GUGA 3WU2Z 4E30A 3O38A 1QONA 4QWWA 5DN9A 1LGYA 4HDNB 4OXIA 1Z5UA 1ZGAA 3T4UA 4M2LA 2QZPA 2IYYA 2EIHA 3G6BA 1ORWA 3TKYA 3WRWA 1NT4A 2E7ZA 2GDZA 2GCNA 3M0EA 3GLFB 4Z9FA 4RM2A 2EEZA 5EJ8A 2DX7A 4A0GA 1XZFA 3IDFA 4ZDIA 3CKYA 5HFLA 2OCCB 1LFAA 1CE8A 3AF3A 3N8NA 4X60A 3OPYI 3SS9X 1GSAA 1Q6HA 1T1GA 1PX2A 3PPIA 2CGOA 1QIJA 2Q3HA 4CTJA 2B5WA 4O3MA 3U7FB 3NTLA 1BCSA 1K8RA 5F1KA 3KDAA 2VP2A 3G85A 1XVLA 2N0SA 2R5NA 3H9UA 4RMJA 4CKBA 1QZTA 4KK4A 3UC5A 3NYIA 3Q2KA 4BMCA 3L46A 4R6WA 1ACMA 7MHTA 3HMKA 3OCYA 4I8XA 3F3MA 5BW5A 3BFVA 5DHSA 5T4EA 3F97A 3LF2A 1KECA 1SA0A 2EW2A 3QITA 2EKLA 1E2KA 4J16C 1XCJA 4JVOA 2P75A 1YZ3A 3TW4A 3SEZA 5K01A 4UCRA 4DRXB 2K7ZA 2MSDB 4PYJA 1KBOA 1NSYA 1ZL8A 4IIFA 4C4PA 4H7EA 2X0KA 3NR7A 3V4LA 4EEQA 3DF9A 1PKEA 3MFQA 2OXTA 2VNKA 3PUIA 1JI3A 1M2VA 2XCOA 1Q7GA 2PYZA 2ZIVB 3JSNA 4JS0A 5B2EA 3V32A 3KZIZ 1F4VA 3C1AA 1Z18A 2VHCA 1KJZA 2A9RA 2JLQA 3ILXA 1D5AA 2IV7A 1TM7E 5HKOA 3DC5A 1A2QA 3EYAA 4G0VA 1M1XB 3PEUA 1PJTA 5BWNA 4TV9B 3NBZC 1DRWA 2Y1OA 5DM60 1RPAA 1OZ0A 1LDEA 1CDOA 1P74A 3OPNA 1EUCB 4GE0A 4RETA 3WIBA 1YBFA 2CLOB 4L9WA 2PKXA 3DWEX 4OSEA 4DWJA 4JR2A 1P2DA 4XW2A 3WB0A 1GKFA 5E95A 1F60A 1MVNA 4RDIA 4E5VA 1P17A 2IS2A 1T2NA 2AB0A 4Z0HO 1Q84A 3KYBA 5DBGA 4U5XA 2DPXA 2HPAA 4YLYA 2F1JA 3GLHA 2ZFUA 4OP2A 5TE9A 1NBMA 4CETA 4BFXA 4UHDA 4E08A 3W79A 2IPLA 2OZLA 1BKYA 1I6WA 1OSNA 2PR2A 4PYRA 4G0WA 1BFDA 1II8B 3UYKA 1ES9A 3MB8A 3HDGA 4N7MA 3OFKA 4RY9A 2GLXA 2D3OW 4OHMA 4NV0A 4BE7B 1SC1A 5IY5C 3BMXA 1GPJA 3FHOA 1DFGA 3AEIA 1RSZA 3HYNA 3LPCA 4LRTB 3C39A 4B0OA 3T7CA 5AXCA 2WI8A 2ZEJA 4Z9AA 5K3DA 3SJBA 3USCS 3W6UA 1F8FA 2MW2B 1PRYA 3SQOA 3TQQA 3G0BA 1QF9A 1YB1A 1K08A 1R4NA 1MLDA 2Z83A 1QPBA 4PLZA 2D2VA 1MC4A 4BW5A 1SS3A 2BP7A 1TADA 3CCMV 2EJUA 3D6MA 4CTKA 2W2QA 3FYUA 4R2JA 3UAVA 2JB9A 3VV2A 4FLEA 4N3GA 4C06A 1JHYA 2HO5A 2RMKA 3D3WB 3KHTA 2BELA 3ZV3A 5AIBA 2IHKA 3FPGA 1R18A 2H65A 4GRIA 2Q7GA 4TT3G 1HTWA 3HFSA 1XLWA 2OLEA 3HV0A 3T3NA 4MW1A 1A04A 1I9GA 2QUAA 1ZIPA 3HP1A 4GPTA 3VSDA 1KO7A 5HYVA 4KNVA 5EYPB 1UP4A 2ATEA 2W2KB 1R74A 5C3MA 4QJ5A 3ZOKA 1G8AA 3VVBA 4CT4B 3ASOB 3E2PA 3VC3A 3FVTA 2QUKA 1SHKA 3IKJA 1VYVA 3UT5A 3MUEA 2Y4NA 5I9LA 2C5LA 2GN2A 1DWUA 3KXIA 2E4YA 4LE0A 4LTMA 1ZOOA 4JD5A 1M2WA 5D1HA 1OIXA 3THWB 1OD6A 3OAAG 5DBIA 3UENA 1XCPA 3K1YA 5F78A 2QJTA 2H3OA 4BNXA 2BM8A 3LBAA 2DT8A 2NU9B 2NZ8A 4QOIA 1UEIA 2XAAA 2O14A 4NFYA 3L73H 2FP4B 4YFVA 1J99A 3S4YA 2JANA 1Z75A 4DA8A 3OBIA 4MH0R 2Z4TA 3UCSC 4LW8A 4Q3DA 4TTPA 1V4VA 4JSRA 4CH3A 4JCOA 1JQ3A 2JIBA 1L7DA 2JW5A 3O4GA 4AZSA 1H0SA 2VBIA 4TL9A 1FRQA 1O03A 2D3WA 2E5LO 2X58A 3G17A 1YDFA 2BFFB 3KLBA 4KZPA 4D9MA 2QW8A 4WOCA 4E46A 2LTAA 2QRPA 5TX7A 4NABA 3UT6A 2ZGVA 3W9UA 4ZZ2A 4L2IA 2WFLA 1R16A 3ORYA 4I55F 4M8SA 4NCJA 5DGDA 2AN5A 4F4IA 2X13A 1TZJA 3IE2A 3M6XA 4IEFB 3DEIA 1W30A 4WNAA 3QKTA 4HTFA 1QOQB 5TC4A 1N0NA 4U3FH 3P9NA 1IIRA 3BRWD 3HVHA 1O95C 2E76B 1AV6A 5CHEA 4R2XA 3JWEA 3SYQA 2PN1A 4MQUA 4F7DA 5HK9A 1R6KA 3SMQA 4AZVA 1SB8A 3MJVA 1M83A 1ORHA 3JVVA 2OD7A 3D1JA 1U94A 3RVMA 5JXGA 4L3OA 3R41A 3GZ4A 4TZ6A 3DVAA 1NU8A 5FFNA 2PJRA 5EIWA 1NN0A 1NVAA 2OXFA 1Y6FA 2UKDA 2WF7A 4GWLA 2YWRA 2ICAA 2DTEA 1F0NA 1VI6A 4MI1A 5I7AA 4PNZA 2XRZA 1ODCA 4GOOD 2YV1A 4V0LA 1A9RA 3JASA 1CUSA 3R6GA 2JJ2A 3K57A 3V2IA 3HY4A 4W63A 2IOFK 3IL2A 5AW1A 4EW2A 3K0FA 5ALRA 1UMBB 4KPFC 3ZZNA 1Z2EA 3GDWA 4NVPA 1HZZA 1YCGA 3G79A 3NJ8A 2ZUTA 4B6OA 2A5FA 3UMVA 3FVRA 2W98A 2QL9A 2V0CA 1OPXA 1D2GA 2LWIA 3B09A 3LT2A 3A7EA 4KO4S 5JNVA 4MPPA 5L3BA 2EINC 1N2GA 3GFPA 3LYHA 2REXB 1BT8A 4WFBV 2RH4A 2R8EA 3N7UA 3OAAA 4PLFA 5F77A 3T4XA 4F91B 3I72A 4KZKA 5BRNA 1U0LA 5BVGB 5K3SA 5BNFA 2V03A 3HZRA 2R8ZA 1TCUA 1FDOA 1YZVA 3IAHA 4Q4LA 4R2LA 4DM7A 4CKWA 1YIJV 1OXUA 2HC9A 2XHEA 2XNDD 2A78A 2G4VA 1VJGA 3SQMA 4B82A 1ULAA 2Z95A 5DXAA 2JLYA 3UBTA 3O95A 4MUAA 3BK2A 1KPHA 3C41J 3LUBA 3KTOA 4JBIA 3I0NA 1H6DA 1P8JA 3QX9A 1OTYA 3IDZA 4OF4A 4XRRA 5IKOA 5TGTA 8ABPA 4K3VA 1R9GA 1KI9A 5CPFA 1U1CA 1APBA 4X63A 1WHSA 1YJCA 2NMVA 1AR4A 1WMDA 3KQWA 2OCCC 3AEUA 1AILA 1RM3A 1Y6QA 2GAAA 4Y98A 5FL3A 2VRWA 3RRYA 4W5NA 2JCYA 2GSDA 4WLUA 1FFWA 3CCFA 5KBYA 3ZLBA 3RUFA 5BSHA 2IHUA 2XUDA 3NWJA 5K0SA 3CP1A 1ZJ5A 2GRUA 1QVRA 2J9FB 1PFGA 1V43A 3CO5A 4FNAA 4J91A 1Z6GA 4ROTA 4BO5A 3FX7A 2XCSB 1U3WA 5FOUA 1K33A 4X1KA 4TLCA 3H9EO 2B34A 2ZRNA 4YIKA 1LWOA 2A0YA 4RYLA 2LRHA 4HX2A 5IW8A 3RKSA 4B79A 3DC6A 1IMOA 1KEVA 1GEGA 2AZ4A 2IDJA 1TXGA 2XKAA 4YCLA 1LDBA 3KAKA 5JCPA 4ALKA 1YDHA 1V1JA 1QHHA 1EK5A 3GH1A 1WXHA 3C98A 3F5FA 2OYSA 3ZG6A 1JIXA 4REMA 1OWOA 3OGCC 1TLFA 3NDPA 2PSHA 1FBTA 1AGXA 1Q44A 4FFVA 4OHRA 1I7DA 2GRAA 3INGA 3BYZA 4OU5A 1TZBA 3B3FA 1QCDA 3UAXA 3WWOA 3K6JA 2FEPA 4J1SA 3O4RA 4ARCA 4K6HA 3CGGA 4AS2A 1YR9A 1JZQA 4E11A 1DQNA 4C7OB 1GV1A 4LK3A 1WLEA 2IYOA 3ZBQA 2VIIA 1SVSA 2W8ZA 2GXQA 3HPLC 1NHWA 3GBPA 4BNYA 3I2KA 4YHHB 2Z98A 4PZAA 4NKGB 3WZMA 4B8WA 4BTVA 3Q9UA 3KQSA 4TL7A 4QPZA 3GLGE 4MZXA 4TS1A 3K0SA 1GXSA 1DKUA 1VLQA 2C8KA 2NU7B 5C93A 3SYRA 1SJ9A 1U11A 1CR0A 1TL7C 2WT4A 4YFYA 3TMKA 1CEYA 3SYLA 2CVZA 4MB6A 4RLHA 5DX1A 5AJVB 4FWIB 4IDNA 1C3OA 1AT1A 2NSHA 5C34B 1GLVA 4US0R 2OIEA 1BG6A 5G0UA 1VQ5V 3DUWA 1O9HA 3CLRD 4U2BA 4B3RO 1B3QA 4S04A 2G9VA 4IM7A 1FFXA 4BWFB 2FPIA 1OREA 3T9AA 5IMSA 2RHTA 4K35A 1PJSA 3IDQA 4DMMA 4ZQEA 3PJRA 3AJ8A 2ATIA 2NUPB 4NL4H 2W8BA 1QX3A 2N1BA 3B6MA 3S55A 2UUCO 1CRZA 1VIMA 1TMOA 1XTVA 1MB9A 2C9OA 4GOND 5L95A 3H83A 2BH2A 4LDAA 2Y77A 2HNAA 1MBZA 3I5UA 4AJHA 5HUQA 1VCNA 5CAEA 4O5OA 4U63A 3UGTA 9ABPA 1ISRA 3DV2A 3EGVA 4ECEA 5KTOA 1HPLA 3H87A 3I5YA 4TSFG 1M8JA 2R6AA 4FE3A 4NNJA 2GN0A 3SQNA 3N0RA 3DP9A 2AFIE 1AUPA 1LU9A 4I1RA 4IFIA 4KXYA 1R8JA 3CEIA 3HN2A 4RLSA 3X1JA 1DBVO 4BB6A 4Q6WA 1YGYA 1JQAA 1T25A 1DAIA 2FWRA 2RGNC 4K46A 2JFPA 1YEWA 1O96B 3EXEA 1XBTA 2WNSA 2XQIA 3LNTA 4B6JA 4KQXA 5BYAA 1AIPA 3CNHA 4CDNA 2FHPA 3WOVA 3OCJA 4JLDA 2EJ7A 3SBDA 4EO7A 1JA8A 3SQDA 1M2OB 3FPCA 1RRCA 4G4SP 3E8HA 1AJPA 3JQAD 4XCQA 3ZUGA 3IMFA 3UO8B 5BSFA 2BEKA 5EPUA 3O1LA 1EB9A 3S2IA 1E3JA 1MDFA 1NBME 3I1FA 2C95A 4BLRA 3WMRA 3RYIB 1LX7A 1US6A 1Y74B 4D7TA 2QRMA 2VXCA 2X4DA 4IZOA 1PYDA 3GG2A 2GAJA 1VMGA 5FEMA 2JAHA 4NXMB 1QQ7A 3ORQA 4AF7A 4E5KA 4DKJA 3QWBA 2QVGA 3GYGA 3Q1KA 1O5OA 1TIKA 3OEWA 1LX6A 5G1NA 4EK9A 3N8DA 2FUG6 3PC7A 1NVEA 2PFSA 2NU8B 1CLEA 4C6TB 5L3SA 4EF4A 1F7VA 3FF1A 2J33A 2O7RA 2CC2A 1UR5A 2V7UA 3DBHB 4WK0B 1UIRA 1IZ0A 1TA9A 4PA9A 1L4NA 3FZGA 3WL7A 5JIBA 5CP8A 1E9VA 3CIFA 2RB4A 3ZRXA 1T4GA 3TSWA 2NUBA 1NBHA 3SGIA 1L5GB 2Z4RA 3EGOA 3O8DA 4GIBA 3RAJA 1ZSVA 4YIHA 1HK7A 3DPSA 3LPLA 1TCCA 4YJFA 5JBQA 3ZD6A 3MMPA 3MWJA 3QVVA 2D3TA 4FYWA 4J9UE 1YRLA 1PEDA 3R9IA 4B3BA 1M1NA 5AHKA 5I9SA 3UICA 1KFKB 1CR2A 2AIRA 4Y18A 1V1RB 1W25A 1Y42X 4RK6A 1V7CA 1MA1A 4N49A 4J10A 1A95A 3DTTA 1X1CA 1CR4A 2Q9UA 3PWSA 1XNRO 4PS1A 2IC5A 3S68A 4JI1O 4JXJA 5L3VA 3E5RA 3OTFA 3GGPA 1PNRA 2PUAA 1BHAA 3ZCCA 2CFCA 5BUQA 1T3HA 1QVVA 3RLFA 4D9IA 2WJVA 1TF2A 3QU4A 3TMAA 4TQ9A 1MIOA 1NFRA 3KXKA 4YYEA 1SZJG 2JARA 1WP4A 3A6GA 3H6KA 3JWJA 4FYPA 5CD9A 2V45A 3JVDA 2O5CA 3P0RA 5KYGA 4KWEA 2W70A 3EVNA 2OBXA 1RQGA 4GHWA 2AK3A 1FXKB 4EZIA 2E5FA 4MVUA 2ZCUA 1YA8A 4LBZA 1ZNYA 4PZZA 3KQPA 3L6EA 3L79A 4UVDA 5DHPA 1H2LA 1PVVA 3ZGNA 5M29A 3OLCX 1EEXB 2ZSUA 3BSYA 3IUYA 4OXXA 4YA6A 1Z56C 5CU7A 1RRGA 3NIFB 3K0AB 2C57A 1XOUA 4JLWA 5AKLA 4EGCB 3BT7A 3UQ8A 3H04A 1ZA1A 1TAQA 2BDTA 4MWCA 5EMKA 1SQQH 3UMMA 3FRIA 1Y4ZA 3WIVA 3AHHA 3NKFA 1NY5A 3T1YO 4C88A 1HFEL 3PS9A 5JWRA 5ALUA 2VT7A 1Z2AA 2RJ3A 3EPLA 5B3JC 1D0VA 1I2MA 1YOBA 1ZNWA 3TCXB 1TA8A 2E74B 2CK3D 1PHRA 3Q3GE 4GE3A 1ZJWA 4JX9A 4S05A 2Q2WA 4M6WB 3BSSA 3VYTB 5BPHA 5F98A 3LUTB 2B4YA 3WRYA 4JPRA 4X66B 5BWMA 1Q2XA 1MO3A 1QLEB 3RAEC 8GPBA 1XSEA 5GONA 5IK2A 5I7OA 1X77A 1M0EA 5C8YB 4O4HA 1CDZA 1VFPA 4KQ6A 4HNVA 1LLUA 2RSLA 2EQAA 4CQMD 1AMNA 3MFYA 4PQEA 4JV5O 5JCZA 4D5GA 5L3DA 1UFKA 2GPAA 2J3JA 3JQ8A 2FZWA 1Z22A 1WW3A 3QVUA 4J4HA 4ZOAA 4AZ3B 3E03A 4YJHB 2Y8EA 3MWGA 2FX3A 1SBTA 2FSHA 2VDJA 2QMHA 5KVCA 1J8YF 4E2ZA 5IARA 4D0GA 3JSLA 2IEGA 2RONA 2QYOA 2AJLI 3ANLA 1G4HA 1JQEA 3L8HA 3Q2OA 1THTA 1T5BA 1HY3A 2H2AA 4NBVA 4A2CA 3ZEIA 4ALNA 4XUGB 3T54A 1L4KA 2HRBA 3L9XA 3Q2IA 3PWKA 3CIOA 3HDHA 2CNWD 1Z7YA 4DW0A 2ZR3A 3D8TA 3MSXA 4HZUA 1QG2A 3DFKA 3FKSA 4Q03A 2P9ZA 2H9YA 2XDQA 3NWPA 5E2IA 3IH5A 2W2MA 3E4DA 3EIWA 1HFKA 4LJAA 5KQGA 5DTQA 4BQQA 3U6BA 1XZGA 3PD1A 4HH1A 4Q37A 2D00A 3DAYA 3OF2A 3ZHXA 4JEIA 1ENZA 3DBLB 3KYIB 4RO2A 3VZRA 1Y8QA 4DUPA 5AFSA 1G8KA 3JYNA 5TT1A 3K72B 3A3PA 4MVJD 4DTIA 2RH5A 1GSIA 4DYLA 5AK3A 4J0DA 2GB4A 1G6Q1 2H4XA 2QMQA 1A71A 3HMQA 1P2GA 3GRPA 3MINA 1UDAA 1OE0A 1OYYA 4DOMA 5HF5A 4CIVA 4RTNA 4WA8A 1D6SA 1KK3A 1QPGA 4LRWA 4FP9A 4JB0A 4ZAXA 3R0IA 4MS1B 1UBGA 1KO8A 2H6EA 4RXTA 4S0ZA 3CEMA 4ARBA 1H9BA 4K9SA 3QVMA 1RLTA 5DYGA 3ZCTA 2QP4A 1XALA 1OLXB 1RHMA 1COWG 1SULA 2C7BA 1G98A 1RKBA 4AY3A 2Z08A 1E1RA 1ENYA 1ZIDA 2MT9A 3D4NA 3RUAA 1QGYA 4CM7A 4G0QA 3U7QA 5BRJA 4AS1A 5KHHA 5EC8A 3QHAA 3OZTA 1JFFB 4RSGA 3QWAA 4PLGA 2NACA 3T7JA 3V7WA 2QNBA 4PBRA 4E0BA 4FKZA 5EZ5A 2NU6A 3IVCA 3H1PA 4PSAA 3SR2C 1T9ZA 2ZQZA 4ZKDA 4H0LB 2VG8A 1NUAA 1VE6A 3KKKA 5AUNB 4MQ5A 1BEEA 3C5CA 2CFRA 1RP7A 2CD9A 1PZXA 2AC7A 3ELBA 3DFZA 3KB1A 4GKBA 4ID9A 4RZSA 3V4FA 4EEZA 1JSZA 1QDEA 3GB7C 2AZ2A 1YK0A 4B6RA 1JVBA 3FB6C 4MVMA 3O21A 4TWZA 4LXHA 3HFGA 1TYEB 4RPCA 3QE9Y 2PEZA 3MIIA 3R6TA 2X9LA 2OZKA 3C8HA 4K1LA 3L77A 2X6RA 3UHPA 3GRRA 4G01B 1T0IA 1ZZEA 3VPCA 5JZBA 2DN9A 1RZ3A 1U8EA 4XIYA 5K3BA 5AKGA 1OY1A 2OV8A 2GERA 2YRFA 2ZYVX 3SIXA 1NJ2A 3TRDA 4OGGA 1XDWA 2OSVA 1P9WA 3AQ4A 3O8BA 5E6RA 4UVBA 2E37A 5MFPA 1W85B 4FB4A 4PZPA 5C32A 2JFYA 2VEDA 1RWVA 3KUDA 4MPDA 1FPOA 1JG1A 2O8EA 3K5PA 5JCJA 1DDOA 2ZSEA 3LX6A 4UNNA 5AYVA 3E5NA 4D79A 3EVCA 4JB8A 4ZBMA 4E32A 1HO3A 4RH1A 4CLEA 3H5TA 2FGJA 3EY4A 3MXTA 1BVHA 4PLVA 1KFBB 1N8RW 4H1UA 4F6EA 2GNPA 1QP7A 1MTZA 3CSDA 3O75A 5C81A 4JBGA 4L57A 4KK3A 4B6FA 1GQOA 3ZNQA 4R05A 1QB8A 1XAHA 2ZDHA 1V3QE 1YKSA 1EIWA 2PKQP 1ZH0A 3C5WP 1YXBA 4CS3A 1RCUA 4ZIRA 1SXJA 2F93B 3O0DA 6GPBA 1AHPA 1D4ZA 2AN3A 4Q18A 1EFTA 2WFAA 4JELA 4AL4A 1NI8A 1ZUHA 2BBSA 4BTEA 3QXHA 3FMVA 1KEZA 3R76A 1KSHA 3LSSA 1X7DA 2VNIA 2EP7A 4RZ2A 2PUDA 5AOAA 1E5XA 3I45A 3WTCA 3PC8C 3TB6A 4L3VA 3ZHYA 5K05A 3ABKB 4BFLA 2P4SA 3QKSA 2DEUA 4ED9A 2ZCVA 4EVSA 1CJMA 1G20A 1YUNA 2G9ZA 1WIWA 3O3MB 2WJPA 1E9RA 3JQ9A 4KVAA 4XGIA 5ULLA 1W36D 3J81A 2VRNA 3AUUA 1Z33A 1NF8A 4ZU6X 2I55A 5SZJA 4U8HA 1FYWA 3PHJA 4A91A 3NB0A 2X7HA 4EPTA 4NBLA 2I80A 4ENSA 2VR1A 4ZCIA 3LSQA 5JJ5A 4XB1A 1S0UA 2QM8A 4CMIA 1Y3DE 2FZEA 3RTAA 1Q3EA 1KP3A 2HB6A 3CC4V 3ICQB 4JI0B 1HDCA 3PFFA 2XAFA 3M49A 3TBKA 5LKRA 4MA0A 5EE1A 1PL6A 3I05A 5CYPA 2DCUA 1JDTA 1QGAA 3BGVA 4ND1A 3Q3EA 1SQ0A 3RJMA 3VR4A 4DN6A 2EJTA 4AY2A 5DF1A 1I1NA 3U4AA 3C4QA 3D3KA 1DWQA 4WOJA 3MGAA 4ZK2A 4UTZA 1ZK4A 4WCDA 3SYMA 3A1UA 2FQQA 5EWLB 1K7EB 4X44A 1G3RA 2DJ5A 2C7RA 1O57A 1NJ8A 3ANYB 1NTKH 1SKYB 4DIEA 2QYSA 3KLPX 3FPJA 4TSFD 3RUIA 2XTJA 4AXXA 4UOQA 4WKPA 5LZ9A 2PUFA 3DC7A 1P45A 4DUZB 2EX0A 1P8AA 4IDQA 4KNWA 1M34E 1R0LA 5DI3B 3QMPA 3FGZA 1ROPA 5J2TA 3OM1A 3T5PA 3D6HA 4PINA 1D3AA 3KJGA 2W71A 3LKVA 4I1UA 2PFGA 3WRYC 4DYHA 1HE5A 2BM1A 2Q6LA 5J3JA 1UDBA 2I4NA 2EJWA 3QMVA 1SKUA 5PGMA 3FOWA 4L8VA 1CRWG 1BGXT 3F8WA 1XZEA 1CIPA 4ZMRA 1KORA 2F48A 2WU0A 2G5CA 4NVRA 4UU7A 3A1CA 1SXHA 3AC0A 3QF4A 3L8YA 4EDHA 3IQXA 1TAHA 3ZQUA 1GG8A 2I2CA 4CQLA 4ERXA 3ZDFA 3EX7C 4JOCA 5TT0A 1F2UB 3TOSA 3KWMA 5C80A 2B4AA 2FSSA 2O1SA 2AXEA 5AP9A 1PK7A 2C98A 1FVOA 3CH5A 3Q98A 4IMJB 3SYCA 2ZYUX 3P2IA 4TUYF 4GBED 3QNMA 2X19A 2C07A 1VBMA 4OB7A 4E2FA 4JTCB 5J23A 3NH6A 3NHKA 2FAXA 2IH3C 4FI3F 1QLWA 2CDBA 1A5ZA 1JAHA 5EHQA 3ESZA 2EYQA 1LY1A 2HJVA 2X0LA 1ZRMA 3LPMA 4TKVB 4J0JA 4EHFA 1A69A 2AEMA 2Z9CA 3EZXA 1J20A 3EEIA 4PAOA 4JH0A 3IPLA 3L0CA 4LVNA 4U7WA 3NJ4A 1WN7A 4MT8A 1SBQA 1DX9A 3N8GA 3EPKA 2WF6A 2G80A 2H85A 4TKMA 4ODIA 4QGGA 5JHHB 2C7PA 5H3LA 4I50B 1J8DA 1J9EA 1U8UA 3AHFA 3ZWOA 1N2IA 4LZNA 5IAOA 2BGGA 5E8RA 2QD4A 2VZ0A 1U65A 4JBLA 3FI9A 3FW1A 1FUUA 3B20A 1SURA 2YUTA 4RE5A 4BWGA 3ND9A 1E0AA 1TKCA 1IN7A 4IO0A 4F60A 1OLUB 2E21A 2YMMA 2QSYA 4PN7A 3WHIA 3FYDA 3J80N 3IODA 2W0MA 3EF0A 5F1PA 3QXXA 5EXXA 2IH2A 4U02A 4WZAE 1WUHS 2XD4A 4HDOB 5F73A 3S1AA 5CB0A 4EHLA 2YW9A 4KC0A 1LBEA 5JHGB 1H3NA 3W2EA 2GK4A 3DZBA 5ED4A 1K27A 4YMHA 1E92A 1VJDA 3D8RA 1WTCA 4FR5A 1J8FA 2V4DA 3H5IA 2IUUA 4BMXA 5CFRA 2R7AA 3OICA 1OA0A 4JEUA 5SYNA 3BIOA 4FOTA 2Q2NA 4FIZA 5KU7A 2NXEA 1C3VA 1PGJA 3ZE2B 2ETVA 4BVJA 4ARSA 3BJIC 4IDHA 2V0GA 3ZN1A 3L1UA 3U62A 1KFEB 5AKEA 4O2BB 4X97A 2IUFA 2YQZA 4ZI5A 1KEUA 3OMLA 1CQJA 4HB3A 4ABYA 3JS5A 4UM8B 1S5HC 2K2QB 2GZHA 3KWFA 4MUNA 1C1DA 1Z15A 4RAOA 3R7FA 1O0CA 3JYHA 2KHZA 4OX9B 3O3CA 4V3CA 1FNNA 1DKPA 1Y98A 2ILMA 2SKCA 3OPQA 1Y6XA 1HNXB 1AJNA 3VU8A 4EJ0A 1KO5A 1NR7A 1P1CA 3GFQA 3DEYX 2ZDIC 1CNEA 3LDEA 4J0QA 4AG3A 2CL6X 5AKHA 1DOAA 1GO3F 3Q7SA 2VDLB 1SOVA 2LCQA 4YB8A 3H1FA 3RTCA 3WSWA 5GIPE 3HEMA 1MIHA 3T1HB 3UJ8A 5TQ0A 2UYCA 1XL4A 3DXZA 1XRRA 1Q1GA 4CHTA 2A6PA 2EYUA 2NM0A 2X0NA 2CUGA 1HYGA 1PDVA 2H1SA 1P29A 4MWDA 3IELA 2PXCA 3W4IA 2X86A 1PP4A 1Z0KA 3DMPA 3GCZA 3ZE7A 4DLNA 4E13A 5JSQA 2ZYRA 1J1IA 1JR2A 3G8CA 5BW4A 2WA2A 2FVYA 4DV0B 1KZ7B 3K32A 1TECE 3IVGA 3KT3A 3NEAA 2H7CA 3DDNA 1E69A 2BF7A 4MCAA 1R6BX 3S28A 3BQMB 3AI3A 5AM5A 4Z8XA 5JS6A 3CZRA 4GI7A 2F3QA 4Q4HA 3ZEAA 4C4XA 1W5FA 2QLFA 1TU4A 1DRJA 2GVDC 3JQRA 1N0UA 4N0MA 4UU0A 2IH5A 1E2BA 2W4QA 1V48A 3BXPA 3DMDA 4I1VA 3NS7A 5KDLA 3ROPA 1ZH2A 4NBKA 1NVWQ 3RF7A 1NUSA 5F2EA 4UBJA 3C85A 3P8ZA 5IAJA 1D7OA 1KYWA 1O9GA 4MUKA 3RRFA 3R0ZA 1XTRA 5IHPA 2R7MA 1DCMA 3AKYA 1A7JA 4YROA 3M5CA 4RKYA 3TD9A 5FX2A 4QGPA 3AVVA 2ODBA 1E2PA 1KRXA 2QVZX 4N3AA 2WV7A 3G6WA 1OXVA 4J9YB 3WYEA 2EG5A 2HLDG 2QTSA 3HWX1 4YMVA 5KWEA 5DTIA 2ORED 3GC6A 5FBKA 3TMYA 3ETQA 4NENA 3UJCA 1I5RA 2G9QA 2WLLB 1AO3A 1Z82A 3F1KA 2YY5A 4P53A 1XLTA 3DBRA 3UQZA 1D0IA 1TTHA 3QUBA 1E3EA 3T7AA 2PGLA 3QOYA 4IHKA 5LMUO 3U1TA 1IRIA 5A3VA 1QLJA 1ZM7A 4XDHA 1JEDA 2PL1A 5KEIA 1M1YA 4C08A 1RBZA 1FRZA 3M6UA 3PXUA 1NVPB 3LGAA 4WW0A 2FI1A 3ROFA 4J3FA 4TMKA 1U2ZA 4QE7A 4I9UA 1UOOA 1SM4A 2E4VA 2C4VA 1IB0A 3A6LA 3AFOA 1X38A 4E88A 1MJFA 3DQPA 1H9AA 5IZCC 5CXSA 5KC9A 3GUCA 1CR1A 5K0JA 5M5BA 1NT2B 1L2TA 2QTFA 5AHRA 5THXA 5KNCD 2OZEA 2BFWA 4G27B 1D1SA 4K87A 2BGMA 1JQ5A 2F62A 4Z7JA 5B6JA 1PJ3A 4JI4O 3D1VA 5D7BA 4NCKA 4QYIA 3H5OA 1BC5A 5FR2A 5J63A 3O91A 1JYSA 3RARA 5GMOA 3VSBA 3V1NA 3F9CA 2JCXA 4YAWA 3SMVA 4XI9A 3ZY5A 3L4SO 3VNAA 5DISB 3ZWDA 2XI4A 4IQ8A 3CCUV 1MEEA 5AI9A 3DLAA 2WYWA 4IF6A 5EC2C 4K28A 3VBEA 5JZ9A 4FLVA 3T7EA 2F43G 2H7YA 3QUSA 1R5NA 5SY4A 3K35A 2XCLA 4AQDA 4BVBA 1CRPA 1ZUNA 3A36A 4K26A 1LSOA 4G07A 3KVVA 4RACA 4DXDA 4LV8B 3K2QA 4NCAA 1II8A 4HNAA 3DKRA 3OLZA 5E4TA 3WBFA 1PEKE 3H1HH 3GVHA 2O4UX 3MCAA 4GUDA 4HDCA 5FWNA 3AK1A 4YRBA 3M6FA 2VS1A 1Z34A 4L16A 4RHCA 4I0XA 1BWSA 4BQIA 2XIJA 4E6PA 3EGDB 3ET5A 4CT0A 3N2NA 1ECLA 1N6NA 4O4HF 3AB3A 2WK1A 2HN9A 4CFYA 2PSJA 3KQLA 2VRBA 4FBLA 4ESHA 1FFEA 3GCWA 3TNJA 4I1PA 3WC4A 4CEHA 3C3PA 2AZ0A 5BN5B 3UXHA 2P41A 2SICE 1GRQA 3NOOA 3PHBE 1KQNA 1NX6A 2FSGA 3C5EA 1YXMA 3UG6A 3UKDA 1DP4A 4WTOA 2NT3A 1Z4PX 3LY8A 4MWTA 3S8MA 4DLPA 3LD9A 2Y69B 4PPFA 3BB4A 3LXRA 3D3WA 3AKZA 2NVOA 3ENKA 1HWYA 4WASA 2DFVA 4OEHA 5K3FA 4L51A 4EO9A 5KHKA 1S01A 1VLMA 3DEKA 3OU6A 2EC5A 2YSUB 3LHDA 1KSFX 1KI6B 4DYDA 1I7PA 3MOIA 2V3WA 5EYPA 1P7YA 2ATCA 3S6JA 1W0KD 4DT1B 2FLKA 4ITVA 1N4DA 1ZAKA 2D1YA 3LO5A 4MKIA 1KEWA 5HCUA 2ZDQA 3AEXA 5KOHA 5AM4A 2I1VB 1OFIA 1XZMA 1V8BA 1A72A 3EGIA 3LHIA 3TLYA 2FL4A 5KOJB 4B2YA 1KKLA 4DBZA 1QAMA 4FLYA 2VNHA 3ZE0B 1H8HA 5CTAA 2QG9A 5H5JA 4TRJA 1N75A 2FF7A 3SPHA 1SCIA 2TMYA 3JVUA 4Y9UA 1KQOA 4E12A 4UBOA 4PN3A 1MO6A 1TCBA 4WFEA 1ISFA 1OGYA 4JUFA 4QBHA 4OHZA 5K6RA 1WNSA 3GJ6A 3BBPA 1PTJA 5J1TB 3WQQA 2DT5A 2F3TA 4MIOA 4UTOA 1I3KA 5AM0A 4AJ2A 2DKNA 4FDMA 1I5EA 3FLEA 5BP7A 4QTUB 2DHEA 1WA8A 3H9BA 1H1LB 2WM8A 3KQOA 3AFHA 3WO1A 1X1AA 3A6PC 2QTRA 1YCIA 1IXMA 1JVMA 2N74A 2BFFA 3LT5A 3NGXA 1JCHA 3OCWA 1ESMA 2FW9A 4Q05A 1USUA 5ALHA 3SOPA 4G81A 4QPNA 3EF3A 5INTA 3DZCA 4FZJA 3EG9A 3DOFA 5FRDA 4TMXA 2B3DA 4HP8A 2JBHA 5ANRB 4YCNA 3VJKA 1P3DA 2ONKA 4DCVA 3HYRA 4L3WA 5IVIA 3T34A 5CA1B 1KH3A 4ZIBA 4HPWA 1PR6A 1WP9A 4MJ7A 4AG5A 5I7UA 5EMLA 4O3FA 1YJBA 4JT4A 4OKIA 4MYHA 4C89A 4ZCTA 3IKVA 5TMPA 3U7GA 3ZMZA 1Y76B 4XD2A 2H9AA 2FDXA 1HT3A 2RKBA 1M6VA 4DR2B 2CXUA 4OYHA 1P5ZB 1P18A 1LV7A 3A37A 4QQRA 3RFFA 3HBAA 1UEJA 4B31A 1B8OA 1QH1B 2XVXA 4HAWA 3WL8A 1H2RS 3QVLA 4H31A 1XDDA 4RHTA 1AR5A 2BIFA 2WM2A 3OJ0A 3ROXA 3DZ8A 1R0SA 3R7SA 2ZSIA 5JD5A 2QKCA 3D36A 3BWEA 3E9NA 2V7BA 2DPHA 2MSLA 3LWZA 4W1RA 1WCYA 1ZGCA 3DM9B 3QEBZ 4DR2O 1W9MA 3H86A 1DRKA 1A9YA 5CH3A 4CIYA 3JQBA 1TAGA 4P83A 4BAGA 4RTJA 1G7CA 4HGNA 4XQ9A 1IEWA 1O4WA 2ZRMA 1XZLA 2X2PA 1UBUS 3KVRA 5IN5A 4HV4A 4EKGA 1KMHA 4QM7A 1JPXA 3DL7A 5H6RA 1G9SA 2XXJA 3GEMA 3MCVA 2ET6A 4O25A 1P44A 1JWAB 3BMQB 4RTMA 1SQ6A 1XDCA 2XH8A 1KJWA 2AF4C 1CTQA 4MVJA 3F67A 4NDZA 3LLVA 2FWPA 3HACA 2RC6A 4P3KA 7ADHA 3ADCA 4CLOB 3MUOA 4RIEA 2EDAA 4TGLA 1C4XA 4J4BA 5JDIA 4W99A 1MXFA 2PYLA 4YJKA 1BROA 3T4EA 4MVSA 1ESCA 4D80A 1ILEA 1LV8A 4RD3A 2O19A 4G1MB 2EGUA 4UUPA 4FPPA 1HDIA 1E3SA 2VHEA 2QN1A 3DOEA 4AP5A 2AX3A 1B8VA 3AG1C 1IY1A 4J9VA 1AUXA 4FB5A 7MDHA 1T29A 3QFTA 1BNCA 1EJ6A 1E2IA 2JFUA 2WIFA 1PGOA 2YWEA 4IIBA 3HXKA 2ECKA 4LNUB 4MROA 3WLNA 1QE5A 4BGIA 4NR1A 2LXNA 3PD0A 3FUUA 1U9ZA 1SVIA 3SSMA 5L3QA 2R00A 2Q3JA 4NAUA 4EWLA 3UGJA 4KE7A 1RPRA 4BQOA 4F9EA 4YYZA 1P80A 4L0MA 4BVHA 3HXOA 3SPCA 5JAIA 5C4MA 1I4LD 1NQWA 4G4JA 5FWDA 4F4CA 3CR8A 1XXHA 4AX4A 3NHSA 1KEKA 2P77A 2R48A 2H3EA 4JLPA 4ZQHA 5C1IA 1ORTA 3MWEA 4NOKA 1C50A 1U6JA 2HCFA 2FQYA 4L87A 4C0WA 3HZZA 5J58A 1IN1A 2P40A 4I4IA 1TDJA 3OQ1A 3EWSA 5IAKA 1EP1B 1JPVA 2MCFA 3RCBA 2GPTA 2WSYB 5SICE 3KCXA 2CUTA 2A7XA 2WJ6A 2CHUA 5IULC 3CE6A 5CFZA 2Z2XA 5HZHA 1LQTA 4Q7EA 2Q9AA 1OBVA 1W48A 4YRLA 3C14C 4EHBA 1EBUA 3M7IA 1JR9A 3IV9A 3PFWO 4I4TF 4L4ZA 3AR5A 4GBMA 4PGFA 2ODQA 3QFSA 1XP5A 3QJ5A 1N2JA 2H2HA 3LOPA 1NN3A 4FN5A 3QNEA 4LRUA 2XGJA 2Q49A 2P2NA 3Q5GA 1CX9B 4FDTA 4J9ZB 4LFAB 1ZGGA 4RVCA 1UPGA 5C5DA 2IH1C 3MHSC 1JA0A 4RXUA 2RIPA 1C1YA 3GB9A 5DT2A 3O4HA 1MEOA 5A2GA 1NBMG 3IDOA 1SWVA 1WP8A 2PD3A 5FBVB 1KPGA 1EDEA 3PLAE 1HQYE 3ED5A 3KU4A 4G56A 3B2EA 4EA6A 4KN8A 5I5GA 2ITCC 1SH7A 1NDHA 2VPQA 3L6UA 3THSA 3ASNC 1KHTA 1XZNA 1Z0IA 4X20B 1F5NA 3TIIA 1RAAA 1T9GR 4LE2A 2QUJA 4PNHA 1NLMA 5KUTA 2DFNA 5ICSA 3V8VA 3ELDA 3MJFA 1U2RA 1VHLA 3KUCA 4UXIA 3E22A 4A0SA 3FFXA 4B1FA 4UCWA 1BRMA 5HGJA 4NCNA 4P4UA 3S2YA 4WCVA 1NKSA 5LWHA 4G28B 1LDMA 4Z49A 1FSSA 5CLFA 1HEIA 3FVVA 4EQ6A 1F2TA 3TQHA 1K4KA 3THOA 4JJZA 1YHQV 1NFQA 1T2UA 2Z0AA 4JI3O 2J08A 1YJ5A 1XTIA 3G2OA 2F1IA 3CF4G 3R6WA 2R7LA 2V0NA 4K03A 3UBMA 3GLIB 1YRQA 3QUCA 2CGEA 1M2EA 3R23A 3QE2A 2NTJA 4X65O 1EAYA 2C5GA 5C0OE 5EMJA 1XHZA 3S99A 1G8PA 3CVVA 3U4QB 4CKYA 3UJNA 2NNLD 3PUVA 1B6RA 2XOKD 1NXSA 2FG6C 4R2WA 3ZKWA 4EB0A 3BMNB 4WPGA 1H4VB 1P1IA 5KKNB 2ADPA 3QPWA 5LHHA 3PQCA 3TL6A 1MHPA 2P8SA 3SLKA 4PAGA 3VHRA 4BB9A 1I4OA 4UNRA 3NFYA 3QH4A 4I6JA 4I1SA 5LMUB 1MR3F 3LRXA 4Q19A 4BUCA 3WY9A 5HUHA 1EP2B 1CJBA 3PEFA 4LHSA 2JAXA 1GHTA 2Z04A 3PCRB 2ZJYA 1MABB 3AUYA 2IEBA 1Y1PA 2PMBA 4FMPA 4LRYA 4NZ9A 2WA1A 3QHQA 3D3IA 4MVYA 4F2PA 3THXA 1BYUA 2R1TB 1OVMA 3GFRA 3DAPA 1P0PA 4GH5A 4O4JB 3QM1A 3CPSA 1U80A 2ZE7A 1SCQA 4OMCA 1UM9A 2ZSJA 3T3MB 1W1UA 5EE5B 2JGUA 2XYGA 4G8DA 4L75A 4P7JA 4QO8A 1EUZA 4B3XA 5DX0A 4EPYA 3PNQA 1J0AA 1JEQA 1LF0A 1DZIA 2FMFA 1ECGA 1OWNA 1NP7A 2XBUA 2VLIA 3DE3X 3GL9A 1H2WA 2HIAA 3QIAA 1MO5A 1NOKA 4MIYA 2A67A 4BCBA 3TEJA 4JQZA 2DUMA 2WSBA 3WYDA 4EJ6A 5FKJA 4MDYA 5KJCA 4CNQA 2I7VA 2IQ5A 1V8OA 2O57A 3A1EA 1VZ3A 4UBNA 4A16A 3VQXA 3UH1A 2J09A 3I12A 3HJUA 1U7ZA 4G3XA 1Z4KA 5H6QA 1ODJA 4MS4A 3JD4A 3L7NA 4KL8S 4C3VA 5CA3A 2NU8A 4C6TA 2PA0A 3QKWA 2D74A 4HQFA 1DBRA 3O9OA 1UC5B 2VXOA 5F1YA 2ATVA 5CB4A 3AF4A 3WIUA 4ALJA 5BMVF 2I67A 4OB6A 3RG2A 4EL0A 1JE1A 2OZPA 4ZVUA 1P4HA 3WV4A 4H1WA 1JIKA 4PR0A 5IJ9B 3OHPA 1WR8A 2GLTA 4AIIA 3GVPA 4RX1A 4Z9BA 4PLTA 2PZLA 3BE8A 3QY9A 1UK7A 3ZD8A 3BFKA 5KO2A 2PZ8A 3TM4A 1QIDA 5I48A 2ZUFA 2VJMA 1JKFA 1QUEA 3RJTA 3OJLA 3N2YA 2B1GA 4TTRA 1HQKA 2Y67A 1IHYA 3B5JA 1EGHA 1BMFG 1E32A 1IWOA 1SQSA 3KLOA 4W5HA 3DCJA 4LFCB 2Z2JA 2CNLA 5LYJF 3FMFA 3EQ6A 4XKJA 2QM7A 1F06A 5I9TA 4GPAA 4K9RA 4JB3A 1DKQA 1WQ3A 4WLFA 5IU6A 4TWAA 1GL6A 4BZXA 2OFWA 1NONA 4CR7A 4L8JA 5JZVA 1NI3A 3MHHC 4RWUA 3HU3A 4WE3A 4PCUA 3REOA 3VX4A 4ZT5A 1D2NA 2B20A 2PUWA 4QAJA 4AC9A 4QICA 3R7LA 1KBZA 4E3WA 1FXKA 3EA0A 2YJGA 1Z2DA 5E9QA 3AG5A 5DN6D 3CKMA 5FL7A 3A3KA 1UFVA 3IAEA 4M1WA 5FYQA 5KAPA 1EZ4A 1XV5A 1IFXA 3IQFA 1L4LA 1KP2A 1X9GA 2WNIA 3Q8MA 1PJ8A 2W2TA 5E7QA 4MVZA 1ZN2A 1K7SN 3T3GA 3HJBA 5K1PA 2DWCA 4X6XA 3V2HA 3DBOB 5ALGA 4C5BA 2EZ9A 1MW9X 5FBQB 3QSYA 3JAWB 4ZYVA 1GT6A 2X77A 3WGJA 2HEPA 3AVTA 3B13B 3JQ9C 4H27A 1W35A 1C9NA 4ZQIA 2QI9C 2HEIA 2HTEA 1HLPA 1XKQA 3Q6MA 4NMXB 1ZESA 4CKEA 5MDHA 3MWKA 2PUHA 1HETA 1PD0A 3C48A 3ESQA 3QQ5A 3D1LA 4JL8A 3GFFA 4ADSG 1HX7A 3OETA 2FZLA 4C22A 2O9JA 2R1ZA 1MQ8B 1Y3AA 2OGSA 3NLLA 3I52A 3B3AA 5DZSA 1WXGA 3RUEA 4F2WA 4F8EA 2JH8A 1L5HB 3L7YA 3UOWA 3ZDXB 5KPDA 8ATCA 2I6QA 4XR4A 4EY4A 2A9KA 5GONB 1A8UA 2XSZD 4K9PA 3OO1A 1AB6A 4AK9A 4QARA 4CLRB 3K08A 3L0IB 4BX9A 1JHMA 4JIGA 2H16A 4Q39A 3UN1A 4LWQA 2MU1A 2V5AA 4I3HA 4Q34A 2XOEA 2Z5VA 4KPEC 3KCYA 3PGVA 4FGSA 2CFIA 5CLQA 4OK3A 3T3OA 2AYXA 3EODA 4G2NA 3YASA 4PSCA 1KPIA 1NJSA 1AP5A 1F8GA 3DCIA 3PE4A 4G5OA 4NXNO 4ND2A 1W36B 1KJJA 5HHTA 4Q3BA 1XNHA 3AP1A 1F4MA 3MJHA 4QTZA 2Q6VA 3SCZA 1DQRA 3ZK8A 2DH5A 2FWAA 4DUGA 1CP9A 1CUUA 1U2TA 2I7TA 3BWBA 3NAGA 4CUJA 5K8VA 3B52X 3CVYA 3WWPA 4ZVNA 1L0BA 3NHAA 2P7HA 4FD2A 2OUKA 3FWYA 3WOHA 5FA8A 2ZPTX 4WRRA 3K1AB 4MR7B 1X9HA 2AGAA 3U26A 3PEVA 2LO1A 1MT3A 1SU6A 4H7HA 4CIXA 5JALA 4HL6A 3NKVA 3T5MA 1BE6A 2WAYA 1ZG3A 2BEUA 1I1QB 2PUJA 1R64A 1Y8QB 2ZYAA 4ZA2A 10MHA 3Q3IA 1H05A 3LBHA 4OG2A 1MSDA 3SBXA 5BT9A 4EHAA 3KHKA 4TX1A 4IT5A 3REGA 4QNMA 2CMDA 1GTOA 1ADBA 2Q29A 5KHOC 1KYTA 4LZZA 1XZKA 3O74A 1E59A 3A1NA 2H1OA 3C3TA 5LA6F 4D43A 5AK0A 3UH0A 1QAOA 1HXHA 5ECWA 4AQ7A 1UBLS 4NYIR 1VARA 1GAJA 3CRCA 2FRDC 1N1DA 3KOWA 2I8AA 1KETA 2PJUA 3AIOA 3RVSA 3ZDEA 3BF7A 1YS1X 1XMXA 5HTKA 3SR3A 2Y68A 2HCJB 1QGED 1N9ZA 3ST7A 1N3BA 1USKA 4ER6A 1H1DA 2P06A 1EZ1A 1L7EA 1RXUA 3FYHA 1RC1A 1NUPA 5ILQA 2XNDA 4RQEA 2YIJA 4AJPA 3H8JA 1TCAA 4H6WA 2EBHX 4LWZA 2IWHA 5EVCA 2Y9MB 1XI2A 3A1TA 1X8XA 2ZTUA 4DGQA 2G36A 3N8KA 3R20A 5DTMA 5IKXA 4YX9A 5EHGA 5KAMA 4RD0A 4UTXA 2GTAA 2HA2A 1S1MA 5ELMA 3PCTA 3IRVA 4QQNA 2I29A 3SC6A 3WL5A 1T8WA 2FSPA 1PG5A 1PFWA 4V2IA 2CHEA 4FDVA 1AM4D 4XZ3A 2OXIA 3TE7A 4AKHA 3JW8A 3HJFA 4IHJF 3P96A 2B35A 2BV3A 2IXFA 3KJZA 4HS4A 1Q21A 2IIPA 2OCAA 4XWWA 1ZKDA 4ZVMA 1YU9A 2FPMA 3D2LA 3UKOA 3D31A 3M4ZA 3MJEA 3RU9A 4FFLA 4W5OA 2CW5A 4J2OA 2IHVA 2V7QG 3OFNG 3C1UA 5DHAA 1CHDA 3EZLA 3W34A 5GADl 3WLRA 3A8TA 3WMFA 4YACA 1ZWLA 3AEQB 1U9IA 5J9PC 1FJGO 1Z4OA 1IIBA 3TTVA 2ZIOA 4KJXA 5H70A 1W36C 3UXMA 1R3KC 3IO5A 1IXSB 1S96A 1MB0A 4JA0A 4RZIA 5FPTA 5B3AA 2HSWA 3W5AA 4MQEB 1ZCZA 4JTAB 3FTCA 4O33A 1Z47A 3B3JA 3ACCA 3GAAA 3I8OA 2FK7A 4WCEV 1DOZA 1GVNB 4BMPB 1OB2A 1CY1A 4G0MA 5EUBA 1MO4A 1EXWA 1P2UA 2ZBVA 4J7ZA 3ORRA 4GW3A 4L08A 5IBQA 3UW3A 2BFCA 1SF9A 5A0VA 2V1DA 4A2QA 2A1TS 4OI0A 5F2NA 3DM5A 2OHFA 2HJHA 3C6XA 3TLMA 4WXPA 3M4YA 5F7XA 1LW7A 2PZMA 4MV1A 1CWUA 4D96A 4I55B 2ID9A 1Z2CA 2W0SA 5BN3B 5ITZB 5F3WB 1AHNA 2HBYA 3BJEA 3K7EA 1KRHA 4W82A 4BX0A 1FNDA 3RE1A 1WZNA 2Q3BA 3T3HA 1YJ9V 1YRAA 4JTDB 1T8YA 2C3UA 5CNMA 4D8YA 1NHGA 5ES4B 1YUBA 1ZO8A 1NWCA 2ODMA 1GGFA 3HVKA 5K4AA 4PX5A 1AK2A 4QXOA 1RWOA 1ZQ1A 4F7WA 5TQJA 3ZV6A 1K4CC 3Q10A 1P1RA 2QEQA 3FYTA 1PDWA 2ASEA 1FFTB 5TPWA 2WWFA 3FHLA 2AD1A 4LDQA 4Y6RA 3S1SA 2C4HA 3SEQA 3ZWKA 2AMLA 1YFJA 1EI9A 3RQIA 1R0XA 4HDRA 3I62A 3W7UA 4DUYO 1D5CA 2G9NA 4JDPA 4KUGA 2HT1A 4TKUA 3C6KA 3G1WA 3MGCA 4O08A 4YRTA 5AMXA 2C88A 3SM3A 1V5IA 3QO7A 2J5RA 3GZJA 1GPAA 3UAWA 4I3GA 1EP3B 2HV9A 2HV8A 3WRVA 5LFAA 1WA5A 1PUXA 1IY8A 3A4IA 4RHXA 1VE7A 3CVOA 3E48A 5EIOA 3T3DA 3VNQA 3OE4A 1EJBA 2C20A 1XRLA 2NYAA 3EIEA 4JZ2A 1KJ8A 4D6PA 1O6BA 1XAIA 5MF6A 1DTOA 1Z3IX 1P4GA 3D6FA 4LVOA 4DV4B 5CMUA 3TPZA 2V96A 1LA2A 1SU7A 1R0RE 1V16B 3PCXA 4RZ3A 1DWOA 2QRHA 1E7SA 2I7DA 5DEIA 3V8RA 1L7OA 2GJ4A 2VDWA 3AH8A 3B7PA 2I3AA 4RA6A 5DOVA 3T5GA 5CBKA 3E9DA 4W6ZA 4PA6A 1T24A 2WYOA 3CT4A 5DYTA 3TB4A 3ADBA 1NI5A 3G3EA