3WB0A

Hcgb from methanocaldococcus jannaschii in complex with light-decomposed fegp cofactor of [fe]-hydrogenase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
158
structure length
158
Chain Sequence
VVMEEIIKKAFIESINNIRRGDKEEELKKIQEKIVNAKKIVVATNNQKKFKVIRDIMLRVCNAEIKMLDIDTRFADLTRMPALTKGLIALDIEKADLYIARGRLGAPGSGSMLVILDEKGRVLTASLSPSSVIHKEDIEERIKKELIEALSRIGISIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0488
publication title Identification of the HcgB enzyme in [Fe]-hydrogenase-cofactor biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 59
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.-:
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11576 DUF3236 Protein of unknown function (DUF3236)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.470 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3wb0A01
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3wb0A02
1DIOB 3AUJB 5JJNB 2F1MA 3BRCA 1H2SB 2F93B 5JJJB 1IWPB 1T5EA 1VF7A 3WB2A 1NBWB 2D0OB 5D5QA 1EGMB 1EEXB 4GYCB 1UC4B 4DK0A 4DK1A 1EGVB 1RSOA 4L8JA 2F95B 1IWBB 1MMFB 3LNNA 2V4DA 5JJEB 3WB0A 1UC5B 5D5PA 3WB1A 2D0PB
chains in the Genus database with same CATH superfamily
1ZN2A 3RI3A 3U5TA 3LYHA 1KO1A 3N0WA 4J80A 3TSZA 1A9XB 3ZDAA 1YA4A 4G8BA 4OBXA 2AF4C 4DA0A 1ABBA 5TEWA 1GRNA 4PDRA 3NASA 3W2TA 4WFQA 1RYNA 3K15A 4GX5A 1ZA1A 2OM2A 4D3SA 4GC5A 2EWMA 5TVKA 1N2GA 3X3HA 1S72V 3Q5GA 3RRXA 4CT5A 4XWOA 1N5LA 4GZ6A 3DDHA 1Y0BA 4EHHA 1UKEA 5A7FA 1B6GA 4NFHA 2M9MA 3D6HA 4L0MA 4NEGA 5B1AC 1QC5B 1JMVA 2VDNB 1XJ5A 2R1UA 4CKBB 3U3DA 2X4DA 4Y1RB 3AIOA 2ZT5A 4CLHA 3IE2A 3GFFA 1DAKA 2YWHA 4ESOA 1RYYA 2NTVA 1N6HA 2WT8A 3IAM1 1PZGA 3HACA 3GFOA 1WCIB 1LFAA 1E9AA 2JCGA 4BUJA 1P9NA 5LMCA 2HNBA 5BW8A 1MQ8B 5BZBA 4EX6A 1ZQ9A 5DK6A 3FB7C 1EUQA 3WV4A 1DV2A 2BEWA 4X66B 2JCBA 5IFKA 4W7SA 1P6QA 4H33A 2YVQA 3VJRA 3MQ4A 1F8XA 4RLQA 4LOKA 3FOAA 3HKCA 5FWYB 2O8BB 1V11B 3DKPA 2HLDD 3QOFA 5HKBA 4M83A 2Z1NA 2WSYB 3TR6A 1XMPA 4UNQA 2YWDA 2QA4V 1V71A 3S2IA 1AHNA 1RQLA 1YBFA 2ZSAA 1RP7A 4R83A 4KI7A 4LX8A 1TTTA 2HVJC 2FUNB 4WPGA 4JUIA 3B5EA 2OXIA 5JD5A 5TY0A 4Z86A 2ZG6A 2DT8A 3FFAA 3AJEA 2WA1A 3NHZA 3PQEA 2E85A 4HAWA 3VTFA 2HWWA 3ETHA 4EENA 3OOWA 2VG8A 2Q73A 1YZ3A 2HU5A 4NH4A 2V6JA 2WM9B 3KPYA 1XXLA 4RORA 1Z5VA 4E32A 2H16A 1E3LA 4EP1A 3GPCA 3TW8B 3QUQA 1PK7A 1M56C 4QBIA 2NO4A 1GILA 3ANLA 3RC1A 3SU8A 1ZOPA 2WV7A 1JEDA 1TT5B 2JAWA 2XQKA 4I5EA 2XBMA 2XUDA 4WFKA 3E9MA 4MVCA 3OIVA 5B4TA 4FFRA 4PFQA 5CT4A 4ETIA 1RBMA 3HL4A 4DNFA 3ZRWB 1YR8A 3DQQA 3L6DA 4TZ0A 1JB1A 1COWA 1UFOA 1BX0A 1OMOA 2GPNA 4JASB 1JTEA 3LIPA 3R3XA 4ZYWA 1D2DA 4L4RA 5CCEA 2XRMA 4BNDB 3BT7A 1KDRA 4P7KA 1GYPA 3L43A 4HVCA 1LLQA 4LJ5A 1NZ6A 4BS9A 5IXSA 2UZAA 5EJ8A 3UAYA 3V1TC 2JF0A 3K0AB 1V48A 1FJGB 5C1PA 4LA4A 3EPHA 1LTQA 2XGGA 1E1DA 3GLGA 1KSHA 4KWTA 2WKQA 4H6VA 5JALA 2YI9A 3MMXA 2IYAA 4GPAA 4BZWA 1CJMA 3RUPA 4X44A 4Z5XA 1AQJA 2P91A 1P2BA 4EFEA 4R2MA 3ZZUA 3FDIA 1RM4A 3HEAA 4WN9A 2VLBA 2I65A 4X1KB 3VMMA 5BV7A 4RULA 1KU0A 2B2XA 4MS4A 1KSFX 4J16C 2M2IA 4RVSA 1L4YA 2EVWX 3ZK9A 5GOZA 4LQCA 4ENSA 3DLAA 1KRXA 1Z7GA 3ETJA 4S1WA 1JEYA 1KMHA 2C7RA 3DBRA 3ZJYA 2QRNA 5GWXA 4B2LA 3CX5F 5F78A 2G38A 1T4DA 1P33A 3W34A 5IJ0B 2A88A 2KI5A 2FYTA 5EC8A 3UMVA 4B47A 5AVOA 1FZTA 3FHLA 2Y27A 1VJRA 1TB4A 5DP1A 3AKZA 3F90A 3NR7A 1L4GA 3I8XA 1CERA 4DV4O 1GPH1 5CB0A 4N03A 1DKNA 3X1WA 4WNAA 3CE9A 3M3DA 4E12A 4BBJA 1FS6A 3ZD6A 5FR2A 3E22A 1DRJA 5CT9A 4P6VF 4XSGA 1U0SY 4Z99A 2HK8A 2BP7A 4BMDA 2UXNA 4CLRA 4DR5B 4ZREA 3AFGA 1S8FA 5AM4A 2ZLBA 3W3AH 1F8YA 1NLFA 1T13A 1MA1A 3LY9A 3P26A 4D3YA 1NLMA 3D7SA 1N6RA 4DTIA 1R7RA 2VJOA 4RKFA 2HRBA 1M9NA 3KDSE 3HB1A 4P4UA 1EVZA 3GFGA 3QFRA 4N8SA 4NZZA 1CEZA 1E3DA 2OP1A 3L7NA 5IU6A 3PV0A 4AMVA 5AVUA 1JFLA 4CKCA 1GTZA 4AICA 1YJNV 2FRDA 1BXKA 1AZLA 1RZUA 3DD5A 3HRHA 1VF6A 1TECE 3Q3CA 2PXXA 2JIZG 3AJ9A 3E3LA 1UBOS 1FXHA 4LF8B 1H0HA 2I6QA 3LBAA 1INLA 2BGUA 2G67A 1B8OA 1U94A 4BNIA 1VQ6V 4L27A 1D2MA 1PD1A 4P7BA 2WMNB 5EE3A 2ON6A 4W4TA 2PGLA 4WEOA 1E2LA 1XT6A 3AHJA 5K45A 2V7WA 4ZQHA 1DPGA 1YB7A 3VNRA 1Q21A 4WBXC 4JXKA 1I4EB 4C0HA 1E2IA 3B52X 4PS1A 4GOND 5I3ZA 4ZCIA 3ZV6A 4EBBA 5FFNA 1GGMA 3K59A 3HB0A 1U31A 1BRTA 3EW7A 3ETEA 4K5QA 3KVRA 3VH4A 4QAJA 1T4CB 4O2AA 4PN3A 2YIBA 2W6CX 3CMEV 3JYHA 3LDUA 3N1UA 1R3DA 3BWBA 2A79B 1XVUA 1E7QA 2ZRGA 4R1TA 4LF6O 1RAGA 3A3NA 3PKZA 1QHHA 4EPXA 1XNQB 3FB4A 4D9FA 3TZKA 2QJWA 1WCWA 3PXCX 5BUZA 2VRNA 5LQCA 1NTKH 3FVTA 1FVHA 1WUIS 3O94A 3OTWA 1OX4A 3GFVA 1Y5LA 2ZUDA 2QJRA 3K3PA 2BW0A 1U2DC 2GFIA 1CW2B 5LBQA 3DVAB 4O4HF 2C2GA 4WCDA 3QU4A 3AVOA 4LOIA 2J0VA 5ICMA 1SC4A 4UCSA 4WDRA 5TNXA 3BL5A 4LF4B 2PUBA 1DOZA 1MG1A 1GPNA 1ZU4A 3L8YA 4U2GA 2GN0A 3OQIB 3W6ZA 4JOBA 4NLLA 3OOJA 4Z7OB 2YNMA 2HOQA 4CIAA 4JU8A 4H44B 1QB7A 4DR3B 3U1TA 2DBRA 4ZHSA 2OTJV 1T8PA 1RPTA 2WLIB 5A1TA 4W9MC 4BUZA 1DBPA 4YHBA 5AM3A 4WE3A 1AHPA 5JNUA 1GM5A 5KEIA 3NFYA 3JW8A 3DNPA 2P2YA 3AKEA 3FDZA 3T4EA 4MICA 4FYMA 1E2DA 1C0EA 2O7VA 4U7DA 1ZGGA 2P5SA 2C92A 4QQ8A 3ZIAD 1NOKA 1KP9A 4OF4A 5ITZA 1ML4A 1X42A 2R62A 3IODA 1IJFA 2FYUH 1NR1A 1R5NA 5FPKA 1E3EA 1OCOB 3WWCA 5ELMA 2NYUA 3TQRA 2XCSB 2R48A 3H9CA 2PTMA 2VWQA 2Y48A 1ZC4A 5I7WA 1UFQA 3NPAA 4GYCB 4BLPA 3ZXYA 1PT7A 3OHSX 1AK9A 5DXJA 3GLHB 4J3NA 4PGMA 1EFPB 4PG6A 5IJAA 4ZDJA 3BF7A 1NQWA 3NAGA 1CY6A 1MQSA 1LBHA 4NMWA 1EFLA 1NMXA 2HN9A 2AQHA 3Q7TA 3V4ZA 1WHTA 1M72A 4ZO9A 2VRCD 4JPRA 2Y93A 13PKA 3C3MA 4MUYA 3E2EA 1U3CA 4RMHA 4M8IA 1GEEA 4POAA 4MKFA 2A92A 4W4LA 2VPQA 4MWZA 3W7VA 1TUGA 1KDZA 1ZUD1 3RYCA 1IK6A 4PBTA 2J4CA 2YVAA 3FB5C 2A0YA 4NCBA 2O7SA 4A8JB 4JI5B 2BKXA 2W6MA 1S2MA 2HBRA 2C5AA 2EX4A 4LGVA 1O95C 1Y4UA 3GAAA 1MQAA 4I1OA 1R6VA 2CHUA 2BSKB 1KI2A 1N2CB 5C53B 2IOFK 2QL5A 2ETVA 5DHSA 3U7JA 1U99A 2H4WA 2XAHA 4D9CA 3V8PA 2HCRA 1XNRO 2QPTA 5T8KC 1G38A 1MO5A 2O07A 4XGKA 5JWOA 3WGYA 4KO1S 4RU1A 3GZNA 3DWFA 1IXKA 2QIOA 2Q5OA 5EERA 1JTFA 3PI7A 4LMAA 2ZI5A 3UXMA 1FP4B 1MIOA 2IYZA 4E4YA 4FOPA 3TLKA 1BXRA 2IEDA 3LL4A 2EINB 4XGNA 1VBMA 5A5VA 2QT0A 4LC0A 4PO8A 1A50B 2C1ZA 1MO3A 3HJCA 2DXIA 2FI1A 2HP8A 3V7YA 1JDJA 4MV3A 1W25A 1A8HA 2VXCA 4DE5A 5EWLB 2Q6AA 1GFWA 2VFAA 2VF4X 3REFA 4E3WA 2Q4OA 2O8VA 2ACKA 4RZ2A 1OA1A 3K0FB 1JG2A 2EIKB 1ZNYA 2Y1DA 3GLIA 5ALDA 4YMHA 1AF4A 4NU5A 4YCAA 3JSLA 1GPUA 3V55A 2OWEA 2DP4E 5CT8A 2QN8A 1I51A 3NJ4A 3RJTA 4PC2A 2WD7A 1H6CA 4D45A 2DPHA 4CF5A 2QWXA 3PCXA 3WLTA 1FRQA 4FWIB 4P3OA 1CUFA 1E4EA 4N6OA 1NU8A 1KKUA 3BXXA 4JZKA 4YV0A 3CV3A 4TRMA 5SY9A 2AWNA 2H1RA 1HFJA 3U80A 4RBNA 2YI8A 4DMGA 3WLOA 4L78A 4I46A 1WRBA 1ISMA 2ZJ0A 1RPJA 3ADOA 4M1YA 5DTIA 4ZVVA 3QBVA 5EC1C 1R6BX 5H80A 1Z4MA 1WKVA 1FTYA 4LHVA 4L7VA 3J81k 4TT3D 1T2FA 4V02A 5BSKA 1WD7A 2L0XA 3PYMA 5FJJA 4TLDA 4B3CA 4DV5B 3TX2A 4XEUA 2XAFA 1EBFA 3H8VA 3N2YA 4ND3A 6ABPA 3JD0A 3MQFA 1P9LA 4QE3A 1GITA 4EY5A 4EB0A 1EZZA 3DE4X 2NZWA 3ZS9A 1ZIPA 3I62A 3ZK8A 2XOKA 3ODGA 3FGOA 3CO5A 4P4LA 1N36O 4EK9A 2ZM5A 1FFXA 3KWLA 2ORVA 1H4VB 1P0IA 1IB0A 3M9LA 2JD2A 4LZWA 2EX0A 1XZCA 1JLRA 3L82B 1YJAA 2W2VA 2WTEA 4F4JA 4TV8B 1M34E 1VMKA 1ZJWA 2FMTA 1V41E 1Z4LA 2QUHA 1LVGA 5CVUA 5U9CA 2BL4A 2JRIA 1U0LA 1JFFA 2Q5JA 5H70A 1MB2A 4O5AA 4MO2A 4JR1A 5KTYA 2H00A 1O4WA 1P7ZA 1SQ5A 2CK3D 5JD6A 5HUHA 3IEPA 3AIIA 5DBOA 2Z2KA 4OXRA 4OYLA 3G6WA 1T29A 2I62A 5C8DA 1J09A 2H4YA 3PDHA 1PGOA 2J9XB 2G1AA 2Q1XA 1NGSA 2JFUA 4K0KB 1FYDA 3IIMA 1OVMA 4UNSA 3U0VA 3K09A 2PGJA 4MTFA 4M0FA 4LZLA 5J5AA 3NTXA 3HO8A 5H81A 2NM0A 3T9EA 4N5DA 1J6UA 3R74A 2V1XA 4NBSA 5AYVA 4PVDA 1T5EA 4HV4A 2WY2D 3DEAA 3GRFA 4RIGA 1IXSB 4G8CA 4QYWA 3TB6A 4W8HA 1QVGU 1OFIA 5T57A 4BW5A 3AG7A 1VBFA 4UUNA 2H1WA 2ZB8A 2QAGA 5CA1F 3SZUA 7REQB 3DKRA 1FDVA 3HU1A 3TD9A 4YCNA 3BMXA 3QENA 1V8PA 1C8KA 3AF1A 4UM9D 4HTFA 3K2QA 3RHZA 2HA3A 2NO9A 2Q49A 4EHLA 1BG6A 1G8YA 3O0TA 4BRZA 2X9NA 2C4HA 3SR3A 4JI8O 1Q57A 1X94A 5DB4A 4AZWA 4DRZA 3PB3A 3E1GA 2YWJA 1G8PA 1CZNA 3I9NA 3GB7C 1N2ZA 4IXWA 1NMEA 1QONA 3WFZA 2NZ2A 2AEMA 4Q47A 3ZHQA 4KQXA 2P4UA 4RTQA 5IJWA 3LNNA 2NV6A 1B0ZA 3R3SA 3QELA 3UM9A 5JSZA 4YJFA 4J0DA 2C2MA 3JASA 1OI4A 3W5HA 4KXLA 3JQAA 5AK6A 3SBDA 2RHTA 5EUCA 4L74A 5MFPA 1J1ZA 4DLWA 3VC3A 4M4SA 3F5TA 4HNUA 5TPWA 4M7WA 3N8DA 4EB8A 3MTAA 1V6CA 3TIIA 1XCJA 3C43A 1I4WA 3DEYX 1X3SA 2J3HA 4CMHA 3ZWNA 4ZCTA 5AVTA 1EFKA 4GMGA 3CJRA 5CCXA 4EGJA 4MQFA 3B6IA 4LOAA 3W6UA 2ECPA 2WJZB 3T5GA 3CC4V 3K31A 4I9NA 1N75A 4RESA 3C3SA 2WBLC 1VE9A 1WPXA 1PNLA 4MVJI 4L15A 1IUOA 3OX3A 5I7UA 4CH4A 1OBFO 1SA0A 3BHMA 3OOSA 1TU0A 5K2MA 3G82C 3DQPA 4CNQA 4NU8X 4KN8A 5THXA 2X5XA 2DY1A 1M6VB 2QUIA 3TYXA 5K6AA 3KAKA 2V7UA 4XBFA 4FQ8A 4OKSA 4FDLA 5TMDA 3WL5A 3CKLA 4ARBA 1HMPA 2RGGA 1WQ3A 2XEDA 4XE5A 1E3JA 1HBJA 5JZMA 1O77A 4KWHA 3C5EA 1KERA 2I4TA 5H4GA 4LE0A 5BOSA 3MTEA 2GJ4A 1SURA 1AG9A 1U7UA 4QPPA 3L92A 3JVIA 1L5SA 1UJCA 5A2QN 4E5YA 5I8WA 2V9PA 4QASA 1RQGA 3BHPA 3AEXA 4NTYA 5BVGA 3THXB 5KNBH 1QH8A 4DM4A 3CLUC 1RPNA 5FKJA 2NPOA 4KE7A 3COYA 4PFSA 4LNUB 4I9UA 2H1OA 2YHIA 3T3OA 5CFNA 1ZSYA 3KT3A 2RH8A 3V46A 2RBGA 3PPWA 4FMDB 5GTDA 4RV4A 4ZC8A 1M1KW 4HYQA 2CLFB 3ZQKA 4ERNA 2F1OA 1QHEA 3BK2A 1COWG 2Q8QA 3DAYA 5B3JA 4G5YA 3LHFA 4R1OA 4AWAA 1E9VA 1FU4A 4ZU1X 3PDJA 2CHFA 1E66A 1HL3A 3VYSB 4IQFA 2VDJA 2C4WA 3KHKA 1XF1A 5KMGB 1RXUA 3AQIA 2KBEA 4TWZA 5AHRA 1HLPA 2VT6A 3EJ6A 4C4TA 3LLSA 1YASA 1XZEA 2JCVA 3GP3A 4F21A 3ZIDA 1JZSA 1W85A 3QE9Y 1EIWA 3UV7A 4JR0A 3FGPA 1D0IA 1VLHA 3WNVA 1XEXB 3V1YA 2AOWA 2YXPX 1S5JA 4B3MO 2W6QA 3WL4A 1IJEA 4TUYB 3C15C 1LPSA 4KL8S 1S3FA 4RKRA 3L5KA 2AC2A 1VBNA 4GM0A 2X6CA 1W8IA 4PPGA 1X74A 4EATA 4MPJA 2QL7A 2TMKA 3OLYA 4KKVA 2PZFA 3WP0A 4I66A 3OBIA 1XK6A 4NS1A 5LR6A 1R6KA 3ZI4A 1SESA 1K5GA 4AHCA 5IC4A 2ZE6A 1KAEA 1TM1E 3L7AA 1YDGA 2DECA 2HMTA 2FWAA 3R7DA 9LDBA 5KSZA 3AG1C 2RN9A 3HHEA 1NRXA 3PEUA 4GXTA 5ALXA 3LWDA 4TKZA 2J3LA 1R4NB 1TVMA 3ZE2B 2Q5ZA 2V3WA 2VBIA 5IDYA 4DSOA 1LCIA 2BOCC 4ZEWA 5LP1A 3NI2A 4ILEA 3LLMA 1HYBA 3L40A 4Q9LA 2C8VA 5TMPA 4N5IX 2YRFA 2OLJA 3ZUPA 4JI4O 3P9PA 1K7DA 2G9NA 1BHAA 5HOEA 3U9SA 2COEA 1TRKA 2CXTA 1L5NA 1RBZA 3GEDA 3IEVA 1EK6A 3LXXA 3IYLW 3M6FA 5AFSA 2ZSEA 3IVMA 1RI1A 2XCRB 2QUAA 1NYRA 4I4CA 4AO6A 1ZLYA 5GP1A 3LWZA 1NBIA 2LDBA 4K6FA 1XRRA 3LUKA 4DMMA 3O75A 1E7SA 1V26A 1TQDA 5FBWB 4B3BA 1IQPA 3A1NA 3TD2A 4WJLA 2GEFA 4DCCA 4KRYA 4MSUA 2R4UA 4NBRA 2FR8A 4GEGA 1MO2A 3S1AB 2O0KA 2YASA 3M8AA 3EUAA 2J3KA 2OSVA 4PG7A 3H5IA 5FLKA 2G8NA 1D6MA 1ICEA 4BWGA 5CCDA 3VU3A 3KR2A 1BYIA 2I54A 3FKSA 3GLFA 4MWBA 4CF6A 2IHNA 3TG2A 2ITDC 2HIMA 2VSOA 1KEUA 1DT3A 4C3VA 4IS2A 4CW7A 2YVKA 4Z1MA 1UJ5A 2GK7A 5H7XA 1QMPA 2R97A 2DYSB 1FDIA 3P3PA 5D01A 4R1PA 1XVVA 2MJLA 5C46F 2ID8A 4BMZA 3IQWA 4DCPA 2ZUSA 3ULKA 4A6EA 3WKAA 2JBHA 1B8NA 1VIAA 2QTOA 2XIJA 1GL7A 5TT0A 3R9WA 1OFUX 3G2JA 3BEOA 3KVYA 2JIDA 3E7FA 3TLAA 3MTQA 2OCPA 2B25A 1E4YA 2LKCA 2BUBA 3F4LA 1I24A 3ENZA 2J59A 3LQ4A 3W8RA 1KZ1A 5GJWC 2AMYA 1JU4A 1YR7A 4G01B 4OQZA 2J46A 3WXBA 4UEOA 4JJZA 3JQ7B 1O0SA 4JAUA 1FFCA 3AYZB 3PR3A 3VISA 4IIYA 4LJYA 2R7KA 4LBEC 5TS3A 1R8SA 1JDBB 2ZYUX 1IG3A 1XXHE 4G8DA 4POOA 1SVKA 3W9UA 3AU9A 4XUDA 3MT7A 2XMDA 1ROPA 2ZBRA 3DC2A 2CNDA 3GUCA 4BN4A 3ZX6A 5JS1A 1M76A 1XA3A 4JENA 5MF6A 3ABOB 3MELA 5FORA 1DOAA 5KDLA 4HYEA 5IEJA 4RTRA 1IC6A 2BZ0A 2XTAA 3L8FA 2TECE 1JR3D 3BWDD 2PLRA 3K7EA 4P93A 4P3YA 5HMLA 3OAAA 2DKFA 4ZVTA 1PR1A 4QU8A 3K70D 5TX7A 2GFQA 3FNFA 4B4WA 1VPVA 4BATA 4WCFA 3Q6MA 1UINA 2WM8A 4CTJA 1NP6A 3IKMB 3C5VA 5ITVA 3AY0A 2O3RA 4XASA 3GP8A 5B64A 4ZO7A 3ETQA 3JQRA 1AK1A 4G07A 4IDQA 1USUA 4XTCS 2EILB 5JC8A 4QXAA 1LEHA 1NURA 2OT5A 2HI0A 3WIVA 1SXHA 3H2HA 2Q99A 1NJSA 4ONEA 5G3YA 2HEGA 3T5AA 4YO7A 3OMWA 5KREA 4TWKA 1ENPA 3COSA 2ZYHA 3K96A 4GE3A 1ITZA 4PYLA 4E03A 4MP6A 4WSOA 3LQ2A 2I4NA 1GKFA 4JLOA 3JD1A 3ZGLA 5DXAA 5TF0A 1G5RA 4NIMA 5CXQA 3CSDA 3I2FA 5JAHA 3AG5A 2JLXA 1ZUWA 2ABWA 5J1TB 1X7ZB 1SU4A 1XBLA 3W5VA 1VQKV 4RDIA 2F66C 1KZ7B 4M0UA 1Y4MA 1LXCA 1DEOA 3GEMA 2ZK7A 4CKEB 3ZDDA 3SFVA 4FZVA 1ZHFA 2RHMA 1RKXA 4LSZA 3QMVA 4QYIA 1IXRC 1NW6A 3APOA 3UV3A 1I9GA 3S8EA 3I3OA 3Q85A 2CC2A 3AKYA 2UU9B 1EUDA 3VPBA 5IMBA 4FIPC 1NW5A 5AHOA 3INRA 2Z9BA 3CX7A 2W00A 5CX1A 3E7WA 4Q7KA 2J9YB 5COAA 4CG3A 4C29A 1N9GA 1VGVA 2IIQA 1AUVA 1PFUA 1JAZA 1NJGA 3RAGA 4BLRA 2WUFA 1ECJA 4RK4A 4KPYA 5BYJA 2X0NA 4Z0TA 4CR7A 4IZOA 3TPCA 3FPSA 3KZMA 2HUNA 3L07A 3AI7A 4DLSA 4D99A 5JDIC 3PDWA 1PJ2A 4E70A 4NHEA 3PC7A 1PAUA 5KHHA 4I3HA 1MAHA 2VHVA 3QNWA 1MVNA 1Q0TA 3SPHA 1S3SA 3LYUA 2HYDA 1XQWA 4LJ4A 3SJCC 4HSGA 1QZTA 4RE5A 4Q24A 3QUAA 4BOYA 4L5CA 3PC4A 4COOA 4EG6A 4PELA 4I2VA 1ZX1A 1N5MA 1GKLA 4UCFA 4Y9SA 4PYKA 2FSVA 1FXWF 3TMYA 5A2QA 3ACDA 4ZD6A 5C34B 1SB9A 1NMYA 1EX6A 3OU2A 4Y2PA 1LF5A 4QJ5A 1VIVA 2XVZA 3RD5A 3DOJA 4M49A 4KR9A 4CEJA 3W3AA 5DT9A 1K5QA 3IALA 3L8ZA 5DW0A 3WDMA 2W6JA 4L72A 5C8YF 3RUFA 2AYXA 4JB0A 4X7MA 4YA6A 3QKRA 4KVFA 1YB2A 1L2TA 4BFTA 2ONYA 4MQMA 3UT0A 3R7NA 1U0FA 3AETB 2ZQYA 1UBKS 2Q3JA 1EZ4A 2QENA 3K8OE 6REQA 2F4VB 1KBQA 1K7YA 3BOSA 5EJFA 8AT1A 2P3QA 5FT9A 4JOSA 1U2GC 4WFEA 1C1XB 1CETA 4G25A 5FL3A 5FDFA 2WKRA 3DVSX 4E5PA 3L0IB 4OUDB 3AY6A 3NBMA 1OXVA 1I3KA 3K4HA 1DLBA 4LMRA 2GZDA 1WDLA 2WUEA 1FNCA 1G0OA 3SIPA 1W0JA 3PQ8A 3GYGA 1C4OA 4YRFA 5G1NA 4JQOA 3MHSC 4EHBA 4EYSA 2KYRA 4C2TA 4C3OB 2WU8A 4JYBA 1Q1NA 1T0BA 5AXAA 4HGPA 4WQMA 2GPAA 1KJYA 1CD5A 4TL7A 4F2HA 2H2GA 2OFFA 5A3RA 1SU7A 3P9XA 4QYMA 3ZMUA 2UDPA 2KSDA 2RBEA 3QU9A 2JHFA 1RYEA 1VI2A 1R6DA 1P9OA 1JBEA 2QLNA 3C3PA 2WDZA 3AYXB 2FRXA 5AJXA 3BJMA 5BSGA 3CD6V 1VE3A 3GG9A 1ST2A 2X0LA 1XNHA 3ZJ5A 2CXRA 2RJZA 2FXIA 3MWKA 2C8KA 2A0WA 4S2EA 3S4YA 1SBNE 3VBCA 3EDOA 1B73A 1JT2A 1FSPA 3RN4A 2B36A 1XN4A 1V5WA 2BFBB 2JIBA 1GWNA 2NUPB 3WGGA 3O73A 2D7DA 4ZYVA 4KH0A 2W2LA 3FJOA 2JS3A 1E1CB 4D8UA 2EJUA 4TVKA 3GLIE 2EFYA 4M37A 4DSNA 4P38A 1FX0A 3AEQB 3THSA 3VNQA 5EWMA 1OJ7A 2MSNA 3F6SA 3PDIB 2X58A 1TJ3A 2J5QA 4UKDA 2RHHA 3D5EA 3W2HA 4PSVA 2FETA 1S1MA 2GCPA 3IDOA 1MC8A 1FD9A 3JQFA 2A5GA 4OI4A 4ZAXA 1E2PA 4ZHQF 2XOKG 5BMVF 2FZGA 4S1VA 3BTUA 1T3TA 3FD8A 2JHCA 5BNZA 3OZUA 3RSOA 4KFTA 2NXCA 2AIRA 2FGJA 5L3VA 1V1MB 4AP5A 4RY8A 1D04A 3ZEAA 3G02A 3FRIA 4X20B 1FNDA 1J2EA 3ZVNA 3EXEA 1CE8B 3AG3C 1Z3CA 5BYAA 4YRLA 3I04A 1SS3A 5FOUA 6YASA 4CGZA 3AF4A 2AGVA 4EW3A 2NAFA 5L95A 2FSSA 4LSWA 4R2JA 3TZHA 2PZLA 3BRSA 3KHTA 2Q0SA 1UXIA 1CHDA 3QVGB 4RGQA 4W5OA 3GX1A 3FYDA 3EDRA 4LXQA 4NDNE 4UASA 4FMPA 3VGPA 2W6OA 2JARA 2O7QA 1O0BA 3F8TA 2X2PA 3ZWYA 4AS3A 5E1BA 1J33A 4MW7A 5EHXA 4JEUA 3B1KA 1VYHA 1RLMA 5F2OA 1XEFA 3SKXA 2BBOA 2XF2A 1UIMA 3BMQA 2JJMA 3AK4A 1PS8A 2XCQA 2IH4A 4PX2A 2NSJA 2OCGA 4U39A 1V4VA 4GOKA 3RRMA 2A9PA 1KEPA 2W58A 4DRXA 1RJEA 5ESDA 3ZDZB 3ZXXA 4CDGA 4JEHA 3AF0A 8ABPA 4M0CA 4HEJA 4DKJA 3DOOA 2RC6A 5JWRA 2H8PC 5BR8B 1N0WA 4Q3EA 3ZE8A 2G0AA 1R0RE 3KLMX 4R51A 2HJRA 5EVCA 2OY0A 4B7EA 5A71A 2GBGA 3IOCA 1Q7YW 5CBFA 5IAGA 2QVLA 4UUPA 3O26A 4JITA 2DR0A 1M66A 1ICIA 1J5XA 4L6AA 4P5PA 3B3AA 4KUEA 3Q10A 1X8JA 4OQXA 2J48A 3IMEA 4OQPA 2PZAA 3TSCA 4M3NA 3G0CA 1NMSA 4D5GA 4DG5A 5K8CA 4TYYA 2XECA 3GRYA 3WLAA 1VE1A 1X1DA 1Y8RB 2OFPA 4P3KA 4D6YA 3RYIB 2MMCA 2KKWA 5IJ9B 3G7UA 1MX3A 2DLNA 1ESCA 2XE8A 4BMOB 4KQIA 1XHLA 1HT3A 3R75A 2IJKA 1QQ5A 5IF3A 1CXZB 2OOSA 3R6WA 4PA7A 2H0QA 4EEXA 1FXWA 1Z08A 4QOIA 1QHYA 3K35A 2P2DA 2QMYA 4UBMA 3GIDA 3A6GA 4AK9A 4BX8A 3RQSA 4TT8A 1RXCA 4O2AF 3L0CA 3ILVA 3CKMA 1ZIYA 2ZVPX 2CXUA 5E7MA 5FOTA 3K4QA 3H5RA 2OCLA 1ZL2A 4HWOA 3U19A 4CQMA 3ZN0A 4KHPO 2JAHA 5C8YA 2YJ4A 4QGPA 4X0EA 2J41A 4EJSB 1L4FA 2Z43A 4EOGA 1DWQA 3ADDA 1MGOA 4B3TB 3IAYA 2D5AA 5CVJA 3SZLA 4HO1X 2B78A 2FN4A 3C8UA 4EDHA 1EZJA 3ABKB 1G5QA 2Q6OA 4J6EA 2UVQA 3BWEA 1QTQA 1ZGHA 1EEXB 3TLYA 4IIXA 3GRAA 4KAFA 2PQ6A 2B8TA 2JB9A 2NU8A 3AZPA 2FPIB 3NXSA 1VQ4V 4INPA 4XB1A 3MWDB 4CM9D 1ENYA 1VP7A 1LI5A 1GTOA 3OQHA 2BEUA 4HP8A 1EZVH 1XL6A 1U0EA 3UT5B 1UBFA 2X4IA 4G1EB 1MZVA 4D92A 2ZI4A 4IO1A 4YDQA 2HG5C 3H9GA 3O90A 4AZSA 1ACJA 3H17A 1K6JA 1IUPA 2VUHB 3K0EA 5I8ZA 1N9KA 1AVMA 4KO8A 4E6EA 5BP7A 1JXQA 2C2AA 1T5DX 1F4NA 2Y1GA 2YYAA 3WKCA 1Y82A 4PI2A 1R0CA 3OC6A 3R5FA 1QRUA 1SQ6A 3TKLA 4P83A 1ZCAA 3DZIA 4WXRA 3GF4A 2JEUA 1PI3A 4W5RA 3H8WA 4QFCA 2EFJA 1N33O 5ED0A 2C58A 3LJKA 1DAHA 3MRTA 2HBQA 4PCVA 1JHRA 4D56A 3E3OA 2QE7A 5JJBA 4EFKA 4FGWA 5IDJA 2R5WA 4CBCA 1VB3A 1MR3F 3WZLA 3PK0A 3QBEA 3MJHA 4RVCA 2QG6A 2GJ9A 4Q3DA 2WLSA 3HYRA 4U7GA 1XROA 1TL7C 3ZWMA 1CZKA 2ZPTX 1MSWD 1GTSA 3WLIA 1KK1A 4DBVO 3PSHA 2Z6UA 4NR1A 3DE1X 1NW3A 3AOEA 4ZHQA 2CTQA 5BMVA 1PWXA 2GD0A 3SLKA 4PDMA 4D42A 4BEBA 3N8IA 4DCVA 2WJ6A 3MYYA 5AW0A 4R7TA 1G18A 2XITA 2Q3LA 1S3JA 1ORRA 2R9IA 4GMKA 4DXDA 3C97A 3SDSA 4URVR 3D7LA 3M5PA 3JQBC 1WKBA 4MPTA 5FNVB 4P9PA 4E6PA 2YOFA 1NE7A 2CVOA 5DDIP 1CY1A 4UVBA 3PGJA 3CLVA 5IYDO 3VU1A 4JB3A 4EW2A 3R3UA 2JBAA 3TTSA 4MHOA 1WX1A 3N74A 1JXMA 2J7PD 5J47A 2FPWA 1Q6YA 9MHTA 5DHAA 3CH7A 1A9QA 3ZVLA 4TVSA 2V7QA 3AUUA 1X9GA 3KUCA 4D81A 3WRYC 3LE8A 4OBBA 4A0FA 3DBLA 2F62A 1GUZA 4C4YA 2EP5A 3JAWA 3NHBA 3CC2V 5BW4A 4FYIA 1GUFA 1IEVA 1VRCA 2GXSA 3GCGA 1CYEA 1V9CA 3WGKA 2UXCO 2IXAA 3P0JA 2DHEA 5TJHA 1DEAA 5EEHA 5EXDA 1KE1A 2FW8A 2QTHA 4J10A 3NXKA 3EEOA 4MLCA 5TLSA 4FI3F 4MUJA 1YA8A 4D8TA 3TQIA 3O4JA 4OPMA 1N8RW 3SX2A 2HJGA 1KZHA 1WU8A 2B1QA 4NYMR 2DRIA 3U37A 4TYQA 5I5EA 5K4AA 1M1NB 4ICGA 3QE0A 2NU7A 1FXKA 1BS9A 2CGNA 2NZUG 1UJBA 3L8EA 1FVXA 1KHHA 4EPWA 3UUEA 2OGWA 3EOBI 4UEJA 4O4LB 3ZI0A 4GKJB 2IEAA 4WA8A 3PC3A 3FKSG 5IULC 2RIRA 3CO0S 3DLTA 1UBTS 4P32A 2BPOA 4JP1A 3AG2B 1XXHB 4Q3BA 4MKHA 2P6JA 1ODTC 4PSKA 3U7EB 1GL6A 4Z1MG 2FPUA 1ZN9A 1WUJS 4OPAA 5E4YA 5CFOA 4R54A 4R31A 4N0DA 1DMRA 2PL1A 4EEZA 2VTBA 3CISA 4LJLA 1PUXA 2R751 2WHEA 1ODIA 3H1BA 2DSNA 2FVXA 2PH5A 5AKZA 3M5DA 2XW6A 2P4EA 5CLQA 4FR5A 1EM1A 3QYFA 4I1UA 4H7PA 1KI7A 4H3VA 3KQSA 3VV3A 4J0IA 3KOMA 5KNCH 2VPTA 3G9XA 1GARA 2JFXA 1OWPA 4QBKA 3N2NA 1BWRA 3UMYA 4DUYO 1ZH0A 2VJNA 5A04A 1T43A 3X1MA 4X6LA 1RE1A 3RIGA 4ACBA 1H9AA 3Q5EA 2WLMA 4PZZA 3OUUA 3U3JA 1BIFA 1Z06A 2A67A 2NP7A 5IDWA 1OAAA 2PMEA 3IXQA 1Z74A 2BHNA 4QLBA 4EKGA 1UFVA 5REQB 1UP4A 3REOA 5I45A 2UUPA 3UANA 5EUQB 4QG3A 1Z5PA 2QB5A 1GP2A 2FMUA 3WGIA 1PGQA 3U3KA 3IL2A 2WM3A 1WAZA 1ABEA 2V6IA 4V24A 4LHWA 4PANA 4ALIA 3OAAG 1W19A 1Z6YA 2I1QA 2R8OA 4Z2YA 3I28A 4IYIA 2PGIA 1SCUA 4YHHB 2B0JA 1PL0A 1EI9A 1UXHA 3PFHA 1POXA 2GCIA 3MXTA 2QTGA 2QNBA 1Z13A 1XZIA 2QZSA 4XA8A 3DL2A 1E1QA 1G5FA 3N58A 4DV3O 3WMEA 1L7RA 3FOZA 1TM7E 4PG8A 3BILA 3QVJA 2FZ4A 4G4SP 3HVUA 3NVDA 2Y9PB 2HRQA 2XVAA 2I7VA 5LA6B 5FA6A 5KNBA 3DO5A 5KHKA 4DLKA 2TMGA 4L6IA 5LD2B 1F0KA 4F7DA 2C2YA 3LXUX 2KG7B 4QNMA 1NRJB 3IBYA 5FPOA 1I4TD 2CYBA 5IF9A 3IHTA 3SDBA 3AEZA 3RC3A 5LC1A 4KE6A 4R8VA 1JPNA 2I91A 2ZI7A 4YEDA 3EB9A 3DXZA 4UM7A 2OBFA 4REQA 1IBKB 1KI4A 1XYVA 2GBOA 2C5SA 1L5GB 3UWMA 2ZWIA 1BTOA 4DLVA 2WU3A 4KQ9A 4AJEA 4DGQA 1XLWA 4PR3A 1UJ6A 1OAKA 3C39A 2HIAA 4RVHA 1ABFA 3EVGA 2XWJI 1GLNA 2C00A 2A9FA 4U8HA 3QLUA 1YQDA 1MH1A 1E5XA 4EA9A 3D2CA 1KKCA 2PBLA 3BB3A 2J0QA 2GPWA 4V0MA 3DAHA 1R4AA 1U0BB 4B74A 1DZIA 1E8DA 1BH2A 4OH1A 4JF3A 2C2BA 3CWCA 1VPWA 2XHZA 2Z5LA 3EUEA 4KFSA 2X6AA 1KDPA 1TA8A 5FOWA 5IAJA 2GZ2A 3AVYA 1WMBA 1N1MA 1QQ6A 3NHYA 1M6EX 3STZC 2PUEA 1P5RA 2ZB2A 3LRXA 1JJOA 3ABMC 1CUVA 1GXSA 3DQZA 3ZX4A 3FPGA 1YR1A 1TC2A 3MWYW 1IOWA 1DBQA 1VXRA 4FHCA 4A7PA 3OT5A 2WR8A 1O96A 2ZYVX 1U7PA 5JXGA 1N5KA 2YICA 1D2EA 5FA5A 1R5BA 3IOMA 6CHYA 2JLBA 4OHRA 2OYRA 3U61B 4FD2A 2ZBGA 2I3ZA 1RLJA 2XMCA 1OI7A 3F71A 3O2SB 5CYPA 1EA5A 2D3TA 3K0HA 3KWJA 2NXWA 2B94A 4G63A 1B8UA 4ZAVA 1TVEA 4CL0A 1DKLA 2OGTA 1OCZC 1OC4A 2V0GA 2XUGA 1R9MA 3HCPA 3FOCA 3CVVA 2XYVA 3DDOA 3PHJA 3BXHA 4JQSA 3FYIB 1BA3A 4DSZA 2R0QC 4WKPA 4I1PA 1SQGA 1K3UB 3KG2A 1Q1BA 4HVAA 4LTNA 3AI3A 3E05A 1S8NA 5CDYA 2W6JG 3OM1A 5AKHA 3ZCUA 1UBEA 2IOHA 4IIJB 1KMMA 4DQXA 1FTGA 4B48A 1VI6A 1NI5A 4ZXPA 3TX6A 3SVLA 1SXIA 2EJ7A 4QBGB 4KVGA 3PLNA 3W8FA 5P8WA 4BKUA 4ZI7B 1RI4A 1SXGA 3OQPA 4IDDA 2YWGA 4J0EA 4WZAE 5EPOA 3EXIA 4P5EA 5MHTA 2GAOA 1JJAA 4M22A 1Z0IA 4JKYA 3ZH9B 1TGVA 5CNKA 2P3LA 5EG5A 3D1VA 2E6UX 1Y89A 3WYNA 4OD0A 5L3GA 3AFNA 2YY6A 3CCUV 1I6LA 2QU8A 4CEHA 2B6HA 1W0JG 5G1PA 4M1ZA 3SHFA 1F4PA 1I1OA 1Y4ZA 1GDHA 1W49A 5CTJA 3VQTA 4QOHA 1GIAA 4HAMA 2C83A 2XUJA 2AOTA 4NL4H 2ZRBA 3NIWA 2BOBC 5HA5A 2ZT7A 3K9LA 3EH1A 3HDGA 5JNRA 1Y6FA 2XZLA 3PYXA 4R01A 2CV2A 1L7EA 1AR4A 3RG8A 2QVXX 2GJAA 2DFVA 1YS9A 2FWMX 4R50A 4EG7A 2H8KA 1YK1A 5EI5A 2IELA 1M8PA 5HF5A 3DKVA 1GUDA 5T67A 3F3SA 1ZBDA 2J3JA 1JI3A 4DMCA 1U2PA 3I5YA 1VSQA 2IPNA 4KC0A 3GJ6A 1H5UA 1W93A 3UB4A 1SETA 3MIIA 4F4UA 1TI7A 4N82A 4ZIRB 4PSCA 2QJOA 2EBOA 1GNPA 2DT5A 3KKYA 4HDRA 2PKQP 4BVJA 1TW3A 1QQCA 5BN5A 2CZQA 3ILYA 5HFAA 3UJDA 1F6WA 1N4AA 1KI1A 4NI5A 3HBAA 5F64A 4RMGA 3UGJA 5IJXA 4ZGWA 1KB9F 4EZIA 3ASOC 4O0MA 5FBLB 3O4VA 2BFOA 1CC1S 3PNKA 1WNSA 4YJ3B 3O65A 4CCAA 1E0DA 1NM5A 3C6YA 4WY8A 4WFBV 4KVZA 2JCXA 3DFZA 2C2XA 4X1OA 4HEHA 4L3OA 2H4ZA 2GEUA 5CYGA 4MJXA 1XP5A 2P22C 3CA8A 4M46A 5C2JB 4MYCA 4XWAA 4FIZA 4D9HA 1SXJA 4BFXA 3CLTC 2X5KO 2QD3A 4OK3A 1YBMA 1SRRA 3ETCA 4CIXA 3EIQA 2BDTA 4W5NA 5BRJA 5FADA 3OHMA 5EP3A 1IONA 5DLPA 2R7AA 4K26A 4R0MA 1RQ7A 3WFVA 4MCHA 4DXWA 3RYTC 4ASUD 1RCFA 3NV9A 1YI2V 2CUZA 2O7NA 4AS2A 3EFHA 5I9BA 1QGUB 2XVMA 1DX4A 3VR6H 4Q00A 4NBNA 2N3ZA 5SZKB 4UMEA 2ONCA 1HTWA 5I7OA 2PWPA 4ZT6A 4Q4AA 4HBZA 1P5HA 1XDZA 3L71H 4OX9O 2FTKA 2IUFA 1CQXA 1R8XA 4N3BA 4AMBA 1DARA 4RH3A 1P1FA 1D9XA 2DUUA 2R11A 2L2QA 4C1BA 3ZJVA 1JMYA 3T3DA 5AW9A 1R6TA 4A2PA 4QTTB 4PNHA 3CCEV 3O2NA 1UK9A 5LB4A 4COKA 4DC0A 1Z0SA 2ZWPA 2Q9LA 1XCOA 2I7CA 1J42A 5CDFE 4IKEA 4R9NA 2BWJA 2C5HA 1Q0SA 5SZHB 5TT1A 2ICAA 5LJIA 3HZZA 3VGJA 2QRUA 4UD6A 1VFNA 4K6GA 3A1UA 4GPTA 4GG1A 4OATA 4XLZA 3Q88A 3P0RA 3PHCA 1T36A 3JAKB 1NZDA 4FDMA 2P9GA 4B4KA 1JJ7A 1M2JA 1JVNA 3FA2A 3R5SA 4ZVSA 3S28A 4IMPA 1ZX3A 2NT3A 4RANA 4NXMO 1DC8A 2W93A 1J9GA 3JZDA 4FW9A 3J7AC 3RADC 4HNGA 4J6FA 3FNHA 5JT1A 3SC4A 3V42A 3GJ0A 2GZMA 2ZXWC 2QSUA 5TGDA 3OCYA 4OA8A 1TTHA 5JASA 2VPIA 4FEEA 1X87A 3UCXA 1TJNA 4KGVA 4IDCA 3E5NA 3HR4A 4KYTA 4NJEA 3EHBB 3SYLA 3Q3EA 3B7WA 4BV2A 1ZXXA 3R9XA 4I50F 1BKSB 3IVRA 3MMZA 1G4HA 2GTPA 2JATA 5DLQC 4GR9A 1PEDA 2MMGA 4MWCA 2IYWA 3I0ZA 5H5NA 2Q9CA 3EDQA 1TCBA 2FMKA 2BFEA 3VNUA 3AHEA 2OK7A 5ALJA 2W2MA 5CJJA 3C8HA 2QA5A 4YP7A 4AJLA 2TYSB 3G59A 1ZZEA 3OEHA 5ALMA 2IE8A 1U5BB 4YJHB 5AW7A 1BQ3A 3NDPA 4YAFA 2R3SA 4XGIA 5BWMA 1FTQA 5DCWA 4UCTA 2F1JA 1GQQA 1YC2A 2ZDHA 1HTBA 3ZCSA 2W6ID 3IAS1 5KYXB 2Q3EA 4HGRA 2H1IA 3JZIA 5F2KA 2DPGA 5F1PA 4M1TA 4BNHA 2PWBA 3RVLA 1LPPA 4GFDA 4OKNA 2DMXA 3JWEA 2P0YA 3ROEA 3BMOB 3SR4A 1XZ8A 2B1IA 3TVDA 4B17A 1RYFA 2ACEA 3E3MA 3QMWA 4JODA 4ZVNA 3I5UA 4CR8A 4IHJB 2Y0EA 4RM3A 2BI8A 3RRZA 1Q12A 2GMWA 1KBHA 3VSEA 3OFSA 2NLOA 1BVYF 5HTKA 4DR2O 4MKXA 1DCTA 4DCNA 4EG4A 5DN6A 2ZIXB 3T4DA 5ES4B 3AC0A 5SZJA 5P21A 1CF4A 5KVSA 4XWWA 2QWQB 2YJNA 3OP1A 2VYND 5JNLA 1KH2A 3HFSA 1Q16A 4KLAA 1GRVA 4L4ZA 3F5MA 1EVIA 2W11A 4KNYA 1UPAA 2I9KA 3R6TA 3A9TA 3OQVA 5EL0A 2YEVB 4GOMD 3ZWWA 2IGBA 4FOOA 2QE7G 3W7SA 3IV6A 4KI0A 1NVVR 1JFVA 2QLTA 1BWPA 3H19A 4D82A 4ZQBA 2ZM6B 3CRNA 3SE0A 3NVMB 2H7XA 4MKRA 1EKXA 4GMDA 5ERGB 3DMTC 4U2KA 4OGQB 4LDRA 3OZIA 4XD2A 1EVQA 4OHVA 2BLNA 3NBFA 4QNNA 4OHCA 4C3UA 1JH8A 2FG5A 1YCDA 3BL8A 3LQKA 5D3MA 2JS7A 1H1LA 1U11A 3UUGA 1AMUA 4RADA 2ETNA 5TS2A 2C4KA 1CS0A 1RPZA 4I4IA 3GFSA 1ESDA 1JG6A 3AVQA 4AVYA 5LP6F 1YJBA 4RL6A 1HO3A 1SZTA 1C9DB 2HXGA 1BCCH 3AM5A 3ND6A 1G9TA 4N5LA 5JCXA 1BQ4A 3SGIA 1TA4A 1LPBB 4KK4A 4R0VA 1TJ4A 4XB2A 4EI2A 4LQDA 1KVSA 2UUAB 1OFHA 3P0FA 4IQGA 2F90A 3NPMA 5K3FA 2ZIVB 4HX2A 1C7RA 5BSWA 4X8AA 4MAAA 6PFKA 2HX1A 1OJLA 2XTZA 2UXBB 1DAEA 4WZBA 2HLHA 4EF5A 4J9ZB 2NYAA 1JKJB 4JX8A 1AKTA 2PA3A 4LYHA 2WVHA 2O2YA 2EX1A 4GUDA 1NKVA 1AI6A 1MV5A 3KWFA 1NQVA 5GV8A 5F33A 2V7QG 1VL8A 1I0LA 5KBYA 3WJ1A 3WG7B 2QZPA 1FDTA 1NW4A 4BV9A 3RF7A 4YMWA 3GLGE 3P94A 1UH5A 2C3UA 5ALGA 3DGFC 3QXGA 1D1SA 4HUQB 1FY2A 1BE3H 3O8OB 4YPOA 3VBEA 2ATEA 2C4UA 4HX5A 2CL6X 4NYIR 2AEJA 3A32A 3G49A 2CVPA 4KLRA 4GRDA 4DABA 1WMEA 4L8WB 1UPBA 2L19A 5LMUO 1U1IA 1VJTA 3KSUA 2QWNB 2PX6A 4URXR 3EZLA 4R6WA 3NVAA 4R2XA 4K9PA 3GDFA 5SYAA 3M6MD 2DQ3A 2HFJA 3UAVA 1PJCA 1ZIXA 2I66A 3WIUA 3P30A 4AZ0B 4EH1A 3JPWA 3VNBA 1QKIA 4IJQA 1DVRA 1YNOA 3I0MA 5INTA 4G5SA 1XTUA 1O6FA 1G2QA 1KFJB 3LZDA 1NLZA 1TIPA 4CRWB 2E5LB 1RAFA 3RAPR 1UZMA 3BMNA 3OR6C 1EQUA 4WI1A 3SXPA 2IDZA 4Q9HA 4FZ0A 5IPFA 3CXHF 3OT1A 2IKQA 4D7SA 5AJWA 4ZMBA 5BVHA 4FE4A 2O9JA 1L3CA 5CBKA 5DYIA 4S12A 3BXOA 1ZWLA 3IV9A 1JHVA 4X8HA 2ODPA 4MWSA 2RKOA 2ZI3A 4C4XA 5JADA 4D46A 2G3YA 4XARA 1DTOA 2JIPA 1L9KA 4DHEA 2QY6A 2ZRMA 2X8JA 1XGKA 1OXXK 4BFCA 4HWKA 5KTMA 2FX5A 3MN1A 2OAEA 2ERXA 1G66A 2Q3CA 4I50A 4BWAA 2VF8A 3HSSA 2VJAA 1EE2A 1EXWA 4NBUA 2YJ6A 3P2JA 3ZNPA 4ZAGA 3TKYA 5JCOA 1IBLB 2L82A 5A9SA 4MMXB 1T5IA 4MQEB 3L41A 1QCZA 1CX9B 5A06A 3H3XA 5YASA 1A5SB 1LD3A 3T5CA 2OO5C 1VKHA 1GA1A 5EJ4A 3M89A 3P9RA 2IE0A 5L3QA 4Z3KA 3LRTA 2AHOA 3C16C 3AWIA 4IDFA 3SYKA 5AJZA 2OAGA 1OSNA 2IU0A 3E3AA 3LUAA 1GKUB 4BWFB 4W1QA 5EK0A 1H5NA 3A4IA 2C42A 2JD1A 1QX3A 5IVHA 2ZSFA 4LAFA 4YBRA 3B3FA 2GYYA 2FFBA 3CBQA 2YV2A 3BREA 3C3TA 3ASVA 4JLAA 4JNCA 5KAIZ 3NWEA 4C7OB 4IIGA 5AM1A 4M9SA 1S9DA 2AF3C 1OCCB 5KCZA 5AVQA 3HR0A 2WTUA 3ESXA 5FA8A 3CLHA 1E1QG 3ECSA 3Q6IA 3OETA 5AK3A 3G1UA 3BQNB 4GHWA 2EL7A 4EY4A 4GMFA 1I6MA 1HORA 3CLKA 1W7AA 1DC7A 5HR5A 4ZA2A 5FOQA 2FQXA 3H86A 4JC8A 4YJ2A 2EYQA 4WD3A 4F8JA 1BHQ1 4G4GA 1EHIA 3ZE1B 2FPXA 1VLQA 1JF8A 3E89A 4BW9A 3U10A 2ZJBA 3BHIA 1GUAA 3UJ7A 4CGYA 4U0KA 5EJ2A 1K88A 3Q3JB 4HEA1 5AKGA 3WJ7A 3CJHB 4JJKA 3BGDA 3W9SA 1OLUA 2AZTA 4JCCA 1IX9A 1ECFA 1RYBA 3ZZNA 3E3NA 4AY6A 4MWOA 3U3OA 3T1HB 2OA0A 1WVMA 5L3DA 1N34O 3HJAA 1FFGA 3WLNA 2YIDA 4LHSA 3IHLA 4OP3A 5JMWA 3GNTA 3QPVA 3KYIB 3WLPA 4X95A 2MDTA 3EIXA 4EQ6A 4NYJR 4QOEA 3AFOA 5KKNB 4DT1B 1S3GA 1DKRA 2LIVA 2B20A 3MAQA 3Q7SA 1U0GA 4RTKA 2QX9A 4Q4CA 5F12A 5LP6A 1HE4A 2OCAA 1WUKS 4EKIA 4ND6A 1YQXA 2O06A 4ER0A 4ECAA 4RJIA 4MW9A 3I9KA 2AUNA 3JD2A 3JWIA 3G2KA 4UFPA 3C3CA 3TAXA 3ESDA 4X9QA 1AI4A 2G1JA 2QVZX 2WNSA 1NHGA 1O57A 3LNCA 4TN5A 1RYDA 2OKCA 1A04A 4NU6A 1W5BA 2VH5R 3GLUA 4UFZA 1WEHA 1T8UA 2YMQA 2BKAA 1W88B 3KEFA 1W2GA 1ZUQA 5E6UB 1IDSA 2CF6A 1OA0A 1MZPA 4CV2A 2Q45A 3GRZA 3SS9X 1MA3A 3ZLTA 5IN4A 3KAJA 5EHZA 1ISRA 4YY3O 1D4ZA 2VZ8A 1F0YA 3C6MA 1OCOC 1I4DD 4NJOA 3RS8A 3L1VA 1WSDA 4U9IS 1E7YA 4DBLE 1LUWA 1Q7TA 3FUWA 3QTLA 2XDAA 2BEVB 3P97A 1JT9A 4GE0A 1AF7A 3K9WA 1NF3A 4UBOA 2Q68A 4DLXA 3RKUA 3WB1A 1AD2A 2GBLC 4RYDA 5K0LA 4JU9A 4Y2QA 5E0OA 1NKDA 5GY7A 1AP5A 1Q90D 3ELWA 4DW8A 3IE0A 1AS3A 1H2BA 1TVKA 2XXAB 3WWYA 2ONJA 1ULHA 2MHCA 3P9QA 4ZVMA 4L3WA 3VSBA 2RB4A 3FZYA 3L79A 1MEEA 4HNQA 5G4LA 2ZJ4A 4D9GA 3W4JA 1VLMA 1AGYA 3SZRA 1O95D 4B9AA 4BP3A 2QKSA 1NSFA 4A8JC 2IH2A 1CTQA 3QW2A 4FFBB 1F60A 3HR8A 3VJKA 4M1WA 4QUIA 3CB4A 4MS3B 4MARA 2Q9UA 1ZMXA 2A0UA 1AURA 3M5WA 4PO1A 3C14C 3T1NA 4FEAA 4UU7A 5DT2A 1PJTA 1HOTA 3QHQA 3GBSA 4KIWA 5KNCA 3RNOA 1C0LA 3BJRA 2OD2A 2ZXUA 3NJ8A 1X7WB 1I36A 3CZCA 3K0CC 2O8CB 1M34B 4KMOA 4R5HA 2G6TA 1O5IA 2DWOA 5LXTF 1ZJ5A 2VATA 2CFSA 2VP3A 2PX2A 3T1QA 5L53A 3F67A 1YRYE 3G9TA 2ZAMA 4FFKA 2WJVA 2EINC 4NS4A 2HNKA 1GPKA 4DLNA 3IR7A 4WWHA 1XL0A 2PLAA 3A1SA 1GSAA 3RWRD 4B83A 2EJCA 2C84A 3IQGX 1XQYA 1GM7A 2WU4A 3WZ2A 5AJYA 1QVAA 1CUYA 2IPOA 2P35A 3WHPA 2AS0A 2JBWA 2XGMA 4DY6A 2DQSA 3GJYA 3UK7A 1VQ1A 1SC9A 2EIKC 1SIUA 4RKWA 3SAJA 3DFKA 1YJXA 1O6CA 4TLCA 1E2HA 2VK1A 3R7AA 3UK6A 3A1FA 4K2AA 3ZU2A 3UTDA 3OW2U 1SVNA 2YHAA 4CM7A 2CEAA 4G5FA 3MFYA 5EKDA 1PRYA 2GLUA 3QTBA 4DM7A 5M7EA 1ZZGA 2Z2YA 1KKMA 4ZEOA 4QFDA 3OVMA 1RWPA 2FCAA 5I9TA 3X1YA 4U3FH 1TKRA 4MIOA 4J0KA 2YIAA 4GR5A 1IHPA 1Y9DA 1LI4A 3RVNA 4HADA 2MSCB 1N3YA 3CF0A 1GAXA 2UYQA 4ZVQA 5KZMB 1YFKA 3WOHA 4A8PA 4RVUA 5G3ZA 4B6OA 4NABA 2MT9A 4QT0A 1I8TA 3IT3A 4XLLA 2ZXFA 4CH6A 4ZQFA 3S68A 2PJDA 1WW8A 4L5AA 2PY6A 4AKSA 3PDUA 5EMLA 5FWAA 1RPRA 4JT9A 4Z4EA 1DZ3A 4BYMA 3U40A 1KZGB 1JHUA 3RV3A 2WTMA 4YH1A 4BJ6A 3QVSA 4JT8A 4G85A 1E2BA 3CPSA 2BE7A 4JJIA 4I55F 4OG2A 5IKPA 3D6MA 1I7PA 4K3VA 3CVXA 4PTZA 1M0EA 1HNZO 5H9CA 1ZVQA 4QNRA 4UMFA 1IXYA 4REOA 5JNTA 2ZRKA 5TVGA 4UHEA 1G3UA 5JZBA 2XNKA 4NNJA 2CHEA 4LVUA 4P84A 3Q6NA 3VRHA 4AU1A 2IYSA 4RUFA 4JYZA 1P60A 1V8OA 2E48A 4N1AA 1PR4A 4BZQA 1EFRA 3DHNA 4MRSA 1YS6A 4J2HA 4MDHA 1SXJE 5TV2A 3D4IA 4NCJA 5EGSA 2JLCA 1VQLV 1QR2A 2VP9A 1BMDA 3OIDA 1NBMD 3CRZA 1Y1TA 5AIAA 3CINA 1OOEA 5GJVC 3DHEA 3OMAB 1BOFA 1WVIA 4YTEA 1TZCA 3CLTD 5IC6A 3QKSB 2J3IA 1JAIA 4Q1BA 2BISA 1CQIA 1L4LA 2FW6A 1M90W 3OEWA 2H31A 1RQ2A 5FUBA 3KQHA 2KB0A 4LVOA 3DBVO 4YIHA 1RC8A 3STYA 4IGFA 5JVDB 4UXHA 3V5NA 2QMOA 4Q3OA 1YZYA 4HN9A 4CMEA 1ZUNA 5HGJA 4JTDB 2HV9A 2NSDA 2LCFA 4QGGA 4UBLA 4XJVA 1RBQA 4INOA 4DB4A 4ZRMA 1OXUA 2PT6A 1ZONA 4NVRA 5AI0A 3ZHBA 2AMJA 2FTKE 2RAPA 1THGA 3I58A 4LWQA 4JGBA 3RUAA 3NS7A 4TXMA 4LXIA 4KW7A 3F7NA 3K79A 4HAXA 4BNFA 3L4JA 4RS4A 3OD4A 4HLUA 2XQGA 3UAGA 4DUPA 3B8EA 4ZMSA 4Y9TA 4I4TF 4DREA 2P40A 1OH7A 1JXAA 2O2GA 3WYGA 1C1DA 4MYUA 1ZK3A 1NU1H 4Q7EA 1ZEJA 2XD4A 1EZ1A 1MEJA 3E8GA 3JS5A 5LZ8A 2JK1A 3O92A 3NHLA 2A58A 1CDDA 3MWEA 1Z6GA 2ZDIC 1FMTA 4J76A 4N7RA 3T9CA 2BEWB 3OEHG 2FUG1 3HKDA 1EMDA 1BCSB 3M1AA 2R7LA 2Q9BA 3FSGA 2H06A 3U0ZA 3HKCB 2AX4A 1J0DA 1WUTA 3ZE0B 5E6RA 5LMNO 1DG3A 1ZN7A 4UW9A 4DXHA 3D6FA 4V2IA 4JJ8A 1OY1A 1MOZA 2PJRA 3COJA 2GCOA 2HW8A 3WQBA 2LPMA 2Z8XA 1NP3A 3VOSA 1F4LA 2IYQA 4X60A 4YRKA 1EESA 3R77A 3SPJA 3DZFA 2O1EA 3QPAA 4FE7A 2ONZA 1R12A 3DE3X 1AZWA 1HM5A 5EJ6A 3IIIA 3ZWDA 5HQJA 3ZCCA 2X7XA 4LHYA 1VPEA 4ZDWA 4BMPB 4QQFA 1O87A 4KLZA 2HSJA 3S2UA 1T1EA 4MXDA 1AHIA 3HJBA 1MG0A 2DWQA 4YDSA 3GD5A 3MTGA 2X7JA 5DN6G 2HA2A 4ON9A 4PZLA 1FQJA 1VA5A 1PWYE 5LXTA 3MLEA 4EMBA 1R16A 1PL6A 4G84A 4WBNB 2XHEA 1RHMA 1WW3A 3IBSA 1DLIA 3QHAA 5C8XA 2WFLB 3GQBA 1ND6A 1FFYA 4XVQA 1AP6A 1K6EA 2F4NA 1I08A 1RFYA 2H63A 3LX4A 5EE9A 3G7NA 4GL4A 1MSDA 4E14A 3DCYA 1NQAO 3OKFA 1YXMA 3CC8A 3I5DA 4DIMA 3HJNA 2XAGA 2ACVA 1U7TA 3HXKA 3OPYI 3QM1A 1PNMA 5FBRB 3MWFA 3ND9A 1U28A 4FU0A 1PNVA 2PA0A 1PGNA 4KSYA 5FPTA 2YWCA 4YBZA 1SBCA 4NZ9A 3IKLA 2PSDA 3ESYA 2VJPA 3MGBA 1J0AA 2WG2A 1A9ZA 2W48A 3V4LA 1K0UA 1TVCA 2FZ5A 3IXLA 1NF8A 4EHKA 1LBQA 1U8FO 4DCOA 2HHHB 3EIWA 4RQBA 1UT6A 3E5HA 2H11A 3DBHA 4HDSA 5B1SA 2V6MA 3OZDA 1VPDA 1T26A 3CLUD 4HPJB 2EEZA 1N8NA 3IILA 1SEPA 3VHLB 4WN9B 4AQ7A 2FB9A 2BTEA 4UB8Z 2X3YA 1KJZA 1KI3A 5HM8A 2NOAA 4MS4B 4BHTA 1A9OA 4IKPA 4PZ9A 5FTMA 4E5VA 1MTZA 3DGEA 3FPFA 4Z3DA 2I2WA 4DV6B 1JEYB 3E8XA 2ZRHA 1QU7A 5J40A 1KMHB 2E87A 2IXTA 3QVNA 4DRYA 1RKQA 3DBRB 2X0KA 4X5OA 4BP1A 3VR6A 2WZCA 1MJ5A 2EF0A 4TMTA 2H5LA 5FUXA 5CLIA 3AR6A 1Y1KE 4J4BA 1ZR2A 3I5MA 2ZWVA 2EF1A 4C4OA 4I55A 2QD2A 1M67A 1P73A 3SNHA 3W5CA 3I01M 3TFWA 4HDMA 3ANXA 4PWZA 3LLUA 3VZRA 3KB2A 5AKXA 3CEHA 1QCYA 5C1OA 3U13A 2JLSA 4WNAB 4ND8B 5JI3E 1CUIA 4OFXA 2PBZA 2RGAA 3E22B 1GVNB 1UEJA 1GD1O 4P98A 3N87A 4H0LB 2BP7B 4UE3S 4ZQGA 1E7WA 4EI9A 1JHMA 2BMDA 4CLRB 4M9UA 2F2TA 1Z6TA 1D8TA 3H8JA 3LCCA 3HB3B 3D2AA 5CAEA 2IX9A 1XRQA 2I6TA 2G0TA 1UQTA 2YC2C 1EUCA 2QRZA 1GZDA 2HF9A 4DCUA 1ESMA 5F51A 3T12A 1WTAA 4Q03A 2QYHA 4WZBE 1U7DA 1D4AA 4YAOA 3P5BA 3TSYA 1AKMA 1S96A 1B0UA 5EINA 1NY5A 1U0RA 3RASA 2DR2A 3AT1A 2HT6A 5ICFA 4CKCB 4TWAA 3CVWA 2NWQA 3UOWA 3VDXA 2IBMA 1DQSA 2DUJA 5ECGC 3Q3IA 2PZGA 2ZR9A 3A1TA 2SBTA 5JCPA 3BCRA 4KXNA 3EZYA 2IA5A 1LDBA 3VH2A 3BH6A 2O19A 1TYBE 1R6XA 2ODAA 2QTAA 2P7IA 4P53A 4RTJA 2XDWA 1RU3A 1Y1SA 3CKYA 4IQ0A 4ZP1A 1DX6A 4TSFA 1HE8B 4WEQA 1U2QA 2YQ5A 4F1JA 1NASA 3PEWA 1EX9A 1RWOA 3BFJA 4I4TA 4X62B 3WRXA 3VR3D 2GF0A 1PTJA 1G6HA 4Q3LA 3DZGA 3GLFE 1KXZA 3KPUA 4M0EA 1YZNA 1KHTA 2VT7A 1OX6A 1KY4A 1L7QA 3WMWA 3KVVA 3EZFA 4E88A 3NMUF 4HNSA 4UXNA 3B2NA 4DMRA 1L3BA 4IXMA 3RDPA 1ZKMA 1QHHB 1EE9A 2PNJA 1JWBB 1OTYA 2Q46A 4BKPA 1BC5A 4Q1AA 1UPUA 3ZIUA 1RDFA 4KV7A 1SOAA 4HJXA 4WLEA 2B7LA 3E6AA 1S4MA 2CD9A 3ITEA 1KBZA 3K6SA 2DYSC 1OX4B 1ONPA 4OGGA 1SAYA 5FLEX 4CQNA 1R0YA 4DQVA 3RJMA 1AUQA 1Z2AA 4XYBA 2C54A 3NWOA 2F64A 4BDSA 3H5OA 5K1ZA 4LXYA 3E9EA 3V4OA 1ECLA 2YJ3A 1XKLA 3NHPA 4IDEA 1NOIA 1GQYA 1GK9A 4LZZA 4MLZA 1ZOLA 2JRCA 1BW9A 3PC6A 5EZQA 5JJIA 1TQ4A 2ZRPA 1ZA2A 3QEMA 2GN8A 4GPD1 3LOPA 3Q8WA 4F1WA 3BWVA 3FPJA 3H4VA 2W4MA 4OXNA 3GDGA 1JCHA 1F6DA 3WGMA 4GPBA 4RA6B 4JLWA 2NNWB 1MTOA 4YIKA 1UODA 1OROA 4C5CA 3ESRA 3GJRA 2CDRA 4K9QA 3VR4D 1JDBC 4YJDA 4OYRA 1TZMA 2ZRCA 2ZYGA 1AJNA 2Z57A 1GG5A 1N0IA 1TEXA 2FZEA 3FDZB 4YAEA 3AR4A 3ZE9A 4FPPA 2DY0A 1UWLA 1EFCA 1GOTA 5KOYA 1ZEMA 4KYIB 3WWEA 5ITZB 5KOIA 3KYCA 2H6EA 3COVA 5FWDA 1JEQB 5CCBA 1NUUA 5C5IA 2WSSD 3PLRA 2UAGA 4ZV4A 1Y7IA 4IV5A 1ZRSA 3SK0A 2WTBA 4CU5A 2E37A 1UK7A 3OJFA 4IZHA 2H18A 1AKYA 3P4YA 4D4LA 4I8XA 1NULA 4UDYX 2MCFA 4GW3A 1VHLA 4I3GA 2FH5B 1VHQA 3ONNA 4LVNA 2EILC 5ENDA 1DIHA 1OBOA 3QLVA 1KWKA 3LUBA 3D2BA 1R74A 3H05A 2C88A 3WI7A 2X76A 2ZDQA 1YTFB 3F3YA 3CRCA 1WM1A 3BIXA 1WHTB 4A0QA 3ZDCA 1WB6A 4M53A 1HLDA 1R5OA 3FUXA 3NETA 4LDAA 1N6OA 3QSYA 3MLAA 1S2LA 2HK7A 1H3NA 4HZGA 4IDPA 4CHTA 1SKYE 4FC6A 2IQ5A 4DFDA 3I73A 4Y2VA 3SJBA 4P4SB 4IIFA 1QMGA 1AKUA 3BKWA 4XDYA 4E7OA 3RYCB 1O08A 2VBCA 4UV8A 1ZRHA 3HU5A 3O3MB 3H7AA 4G09A 1H66A 2VR1A 2ZUFA 2I7DA 1PSDA 1MW9X 3ITNA 3VR5D 5E9JA 4CJXA 4LWOA 2ZIZA 3QO8A 2GK4A 3IMCA 1Y63A 3K9SA 2AE1A 2JAUA 4FSHA 3KKLA 3O9VA 3I9JA 3NTVA 4DQUA 5JYDA 3IBTA 2WKSA 4QO7A 2FDRA 3TJMA 3V1LA 4RAQA 3VV2A 4JJGA 1MMFB 3QLTA 4J07A 5H1YA 1F2TA 4CL3A 2BMEA 2JKVA 4NBWA 1BOOA 4HCJA 4JLSA 3SLGA 4NTWA 2R85A 3OPMA 2XI4A 3PFNA 2MINA 1O0CA 5KAFZ 4ML3A 3C70A 1MIOB 3N28A 3B2EA 1TFRA 1P5FA 3H2SA 2GPSA 1BXRB 3FUUA 3THWA 4LZAA 3JWHA 4IG9A 3QV1A 1CU1A 3RSCA 3A6PC 3PNLA 4UBJA 3PC2A 3OOHA 1Z39A 5I7EA 3KHSA 1SUAA 2V6GA 4F4FA 1BDIA 1IPHA 1Y1LA 1IH8A 4U9HS 2W98A 4OQLA 3M4NA 1YZUA 1VLJA 2HB6A 3KZKA 2B5VA 2CWDA 1KIMA 9LDTA 1J56A 3GLIB 1WR8A 2HTEA 4NMLA 2VPZA 3EZ7A 4H08A 2CFTA 3N39C 3V1NA 3LDAA 1I7NA 2CXHA 2AN5A 3ANMA 5FAXA 5E4JA 1G2IA 1QLHA 1CY7A 9GPBA 1QRTA 4G0QA 4HNAA 5D7NA 1Z34A 4HGZA 3HJHA 2GK3A 5KB3A 2CLMB 3NAQA 1UL1X 2R87A 3GVCA 3OZTA 4G81A 4GKVA 4ARZA 4LK2A 2M6KA 2Q3BA 1FJXA 3QHPA 5CFRA 1YBHA 1OFGA 4WCVA 5E9WA 1T24A 4NOMA 3V80A 3ZCPA 1Y5IA 4F86A 5AW1A 2J6BA 2JDIA 2VSFA 3G8YA 3BSWA 3LD9A 1X1BA 1KAMA 2W2NA 5T4EA 1RJGA 5TMBA 2P6UA 3ORHA 1JDUA 2KE5A 1IOVA 2R8PA 3CT6A 2GCGA 3D9QX 4YUAA 1MLDA 1XRNA 4DNPA 1IBMB 4ENPA 1HQYE 1KY5A 1K75A 1K5HA 4NEQA 1M2NA 2CH7A 1MCZA 4HDQB 3KFVA 1C30B 3BG5A 4KRFA 3E23A 4I9GA 3CPJB 1T9ZA 2BMAA 3PX2A 4O4HB 2XUIA 2WWTA 3A4MA 3OZAA 2E74B 4DR4O 2NUTA 5B58T 4FFSA 4DVGA 3JTMA 4I14A 1IOZA 4MH0R 1FFXB 1S89A 2CLKB 2IYVA 1L8XA 1Q3HA 2GD6A 2XWSA 2Q3MA 3FHJA 2HZ7A 5A6VA 3Q9UA 4IHAA 1UJ4A 4Y98A 1CUWA 3STVA 1M93A 1I7FA 1NIJA 3MUEA 1KEWA 3WS7A 2CZGA 3RRJA 1X1RA 4DYDA 4XD7D 2OLEA 3HY6A 5SY6A 2Z3ZA 3AMVA 3DULA 4KJZA 2OCXA 4CMKA 1CUAA 1JFFB 4WL0A 5L3CA 1B16A 3KUDA 5F3RA 3ZQ6A 2FR1A 4N7BA 4JEMA 2HREA 4QD3A 4K8RB 3WNZA 3W7TA 2PK3A 2DB3A 1F0NA 3H2JA 4YCDA 1GA6A 3KKQA 5AW4A 5K05A 2BHRA 5EJ9A 4QDUA 1ZXLA 3H3JA 4WA7A 3LC0A 4NY1A 2Q7XA 2QEXV 3PGMA 4HL6A 1HDCA 1HYEA 4G0ZA 2XR1A 1PV0A 1J8VA 1BHSA 4ZOCA 4QZVA 1GDTA 4UDXX 1CJUC 2A1UA 4JYCA 2WJWA 1VECA 2Y9MB 1LW6E 2AI1A 3A4NA 1PV2A 2QAGB 4ARSA 4F4LA 3TQCA 1NPYA 5IM5A 1YQGA 4N76A 2Q0OC 1GCUA 5HZGA 2HIHA 2IUUA 1WZUA 1PFWA 4JWKA 5EXXA 4PA3A 2X5JO 1EFRG 1XJCA 1QGOA 1G5TA 3AJAA 1HF3A 5CXSA 2CN1A 4R05A 2XZDA 4B35A 2Q4TA 4HTFB 1V5GA 2VHCA 3PTZA 2XMZA 4JSTA 4YR7A 4B1FA 2IW5A 4KMRA 2DWEC 2R25B 2DYRB 3WOVA 1AQLA 4J75A 5LB2A 1LPAB 4WRRA 5A4FS 2J30A 4URWR 4Y2JA 3FB8C 3STTA 1NTOA 2QF7A 4GX1A 3B3JA 3IPRA 4OHUA 2GFHA 3KD2A 4C1NA 3IESA 3PR1A 4J1TA 3OD1A 2NVUA 2PQ2A 3EZ2A 1XZQA 2DULA 1LVUA 3QU7A 5JYEA 3ABZA 3DP9A 2YY7A 1ZI6A 3TXAA 3QELB 1S77D 5JSZB 4YJFB 4XDGA 5C81A 1H4QA 1HG0A 5GZ1A 4CMIA 2ZUTA 4GR4A 3RO7A 3CRVA 3C3XA 4MVXA 1QIIA 7ADHA 5HTOA 1G5HA 1FP2A 4RQFA 1KXJA 4C0SA 3SVTA 1L4KA 5TPWB 4WT7A 3ETGA 1DKUA 4M8KA 2Q6TA 1Y9JA 4N39A 4KBYA 4RVDA 2PSFA 1PL8A 4Y2SA 4V1CA 4DMUB 3KL2A 4HDCA 1IBSA 4OUKX 3R0ZA 4D2IA 4MQFB 1LC0A 1CY4A 3ZWKA 1RQNA 5F7ZA 1G8HA 1QG4A 3C3KA 1KJWA 1THZA 1FU8A 4HH0A 4X3PA 1LZLA 3QOXA 4DJAA 4JI6O 2W2KA 2LW1A 3F73A 2BN4A 1VIMA 1F4VA 1ISPA 3CYOA 3OZGA 2YQ4A 3WQRA 1MJGM 5TDHA 3KKOA 1V0JA 4JI3B 3JQ8A 2TMDA 1SA0B 4KXUA 3AIKA 2F8TA 4IJVA 1RQXA 2LQTA 2NZYA 5FOXA 3QA9A 3ZXSA 2ZSKA 1SG0A 5E8JA 2NU6A 5F1OA 2W2PA 4LJRA 2OZLA 3T4PA 2O6HA 1I13A 4C5BA 2DCUA 5B6IA 5NULA 3EYAA 4W63A 4UEWA 2JKYA 2DVMA 1Z82A 2WZQA 3T61A 4O4IF 1Z63A 2XVYA 1KYXA 4H3HB 2CDYA 3WYBA 1SD1A 4A6XA 2HU7A 2LZ0A 4ZCLA 4DR6O 3IURA 4ZI3A 2WLTA 2MYPA 5BOSB 1CP2A 4LTMA 4PLWA 3INNA 3EIHA 3MAGA 3SC3A 3WK8A 2COUA 4YJ2F 3ZQJA 3EXHA 4DK0A 1W1IA 2CD7A 3PI6A 2VF5X 1RFLA 1GV1A 2OKGA 5CDHA 3ZU4A 2Z2ZA 3UF0A 4P7JA 1JLMA 2ZJ5A 4MQUA 4NATA 2OWDA 1CNMA 2RH5A 3N8NA 4XSVA 5BVGB 2ZRQA 1FJHA 4J0JA 4EJSC 4X93A 5KYUA 1X13A 4KNWA 3WA7A 2YHIB 2OYQA 2EBHX 4R16A 5KTNA 3R7LA 4PLCA 1B6RA 2EGGA 3EAGA 3EYWA 2F6RA 1DFGA 1UPXA 4CKYA 3TIVA 2OQ2A 1I0ZA 3U7FB 4MW6A 3M6VA 3ABKC 3K32A 1TJYA 2W2XA 3HN7A 4OHBA 4G24A 4W5TA 2A0FA 3RFUA 3OTHA 2NPIA 3G0BA 3A3KA 1K4DC 2VBGA 1Z18A 1ECCA 2VC2B 2H52A 1QFYA 1UPGA 2QL9A 2NO6A 1RHKA 1WE2A 2F59A 2DG2A 3CUVA 1V5FA 1JYFA 5EUMA 1W85B 3MUNA 1RXYA 1G6UA 1K08A 3T54A 3ZU6A 3TJTA 4JI2O 2ORWA 4JI1B 1YQ9A 1QK3A 3TXXA 2GASA 3F5SA 1A5ZA 4K2HA 1IN8A 3UM7A 1WPBA 4AFNA 3L0OA 5TISZ 3LYAA 1A8IA 3EJWA 3JU3A 5HNKA 2VNSA 4H2DA 4HRXA 2P1DA 1DC6A 4EQZA 3NW9A 2WDPA 3PJGA 3UMRA 2JD0A 4U7OA 2PKQO 1BEUB 3L4EA 4FFNA 3FWHA 1XG5A 3TQHA 4EA6A 2H48A 4MSWC 3CN7A 4YRTA 2O0MA 3QSGA 2QSAA 1P17A 1A2QA 3GT4A 3Q7PA 3CEMA 4II2A 3AF2A 1PDOA 3VQVA 3FTDA 1P75A 1HQDA 4L0QA 3CZ9A 2EJVA 3BTSA 1SK9A 4DCSA 3VJMA 3LV8A 1KJNA 3P4XA 5C7OO 1F2UA 5IH3A 2O0LA 2C5FA 2OUIA 4HHEA 5BO5A 4YUZA 1LV7A 2OLKA 5SYMA 1AR5A 4JBHA 2PGAA 4DIDA 1IEQA 1R4MA 2VDLB 4M1QA 2Q5HA 3F5WC 4WESA 1RXVA 3A28A 5JLAA 3K6RA 1K4KA 2OCBA 4OM8A 3CJTA 1PUIA 2EJRA 2GF9A 3O8NA 4CVNA 1TZ2A 4KAJA 1E6KA 2IPXA 5CA1B 1Q0UA 3MQ2A 1UFRA 2ZTHA 3DMHA 2AMFA 4MUHA 1PFGA 4QREA 3V6LA 5GTHZ 1FW6A 4WF9V 2QTFA 3WV5A 1AX9A 2XUHA 5LYJA 3UJ6A 1BHJA 5DTMA 1ODSA 5K03A 2RI0A 3BSFA 1V95A 3NBZC 1G2OA 1PNOA 5FEMA 3D7NA 4CH5A 3EZGA 2AC4A 2FN8A 3JRWA 1CUEA 1AJQA 4YXFA 3CLSC 3FYUB 4MYHA 4RIFA 5JCJD 1H4TA 4B4OA 1OI3A 3ND5A 4OGLA 3G5LA 2FFAA 5EIOA 1ZJYA 4BP8A 3VVBA 3CZ5A 3CX6A 4FFLA 4M9RA 1E7RA 4N8EA 3DAOA 4C4RA 4M89A 1BEEA 1ESEA 3DNMA 4IXNA 3OT7A 1FRVA 4FBLA 2D2XA 2BGRA 4IWYA 3HV2A 3O74A 3RGGA 2FLVA 3NHSA 3L4KA 5B36A 1DTEA 1YJ5A 4XDLA 2G5PA 3OI7A 1DUSA 1GGNA 3HG7A 4C6HA 1P7YA 4DMFA 1QF6A 3L7JA 1W5SA 4TSFG 1TUEA 2QK4A 1T5HX 3ENWA 3P96A 1GPWB 3PNMA 1GYQA 3HGTA 4XUCA 5IWCA 1W0KA 4O1HA 1K3FA 3A0RA 3HI6A 1QH1A 1C9EA 4XIJA 4H4EA 2VJMA 4XWTA 2X42A 2LGWA 4W9NA 1E1KA 2FHSA 2GXAA 2VHZA 4PZDA 5LL6P 3KTFA 4A1FA 2F23A 4NZPA 2Q6VA 2VAMA 1IRIA 4B6RA 5B3LA 2PUCA 5AKJA 4FX2A 3U7QB 1V9PA 3P3NA 4PYNA 2WFAA 3RS5A 2JI7A 2Y0DA 2R68A 3BWYA 5D84A 4DA7A 4PGGA 5A03A 1I32A 3AG2C 1OW3B 2ZSHA 3ECAA 3PL1A 2RJOA 4O4IA 1ZSPA 1JA9A 2WF8A 2WV9A 3BK1A 4N9WA 2QSYA 1OLSB 2ZR3A 3BEHA 3KSBC 4V0RA 5JDCC 5JATA 1FYXA 1LH0A 4HVLA 1T15A 3PTLA 5LPNA 1QU3A 3WICA 2FEAA 3S29A 2GKSA 4QJ4A 4RVFA 4B3JA 4B2YA 1H2SB 4JK3A 2I4MA 4JELA 1KORA 4S1PA 1AQYA 4AXXA 2ZUEA 1DADA 3WYCA 1QJCA 2K5UA 4S0ZA 1BFDA 2FG7C 1WBJB 1QF7A 1TCUA 2QQGA 3E9DA 5LQSA 3T0FA 3QMMA 4KK3A 1YRQA 5DOVA 4NK4A 1BYUA 4KIJA 1ARZA 5T4FA 3I9V1 4BUCA 4ITUA 4AZVA 4RLHA 3IQEA 1T9AA 3Q8KA 3SI7A 1G7RA 3Q2OA 2FFRA 2PBRA 2NQ8A 1Q22A 4HMOA 1V16A 1E1YA 2B82A 1VQ7V 1EUYA 3PXEA 2NTEA 3FNIA 3OLCX 3R0JA 1CZRA 2O8DA 5B1DA 3C5CA 3FDJA 4B85A 1O9BA 3ZZTA 5KSYA 1SKYB 2DPXA 3K8YA 4CMJA 4WTOA 1YDFA 1HW7A 2J7KA 4ZKIA 4QYIB 3SPGA 3HUFA 4R8LA 1DCMA 2W8BA 3ET4A 1CJVC 1JBQA 2Q0QA 3BDAA 1EUDB 4L22A 1RSOA 4RVNA 5JS2A 1K06A 3ZRXA 5E6SA 2P5OA 4AWBA 3TGWA 3CURA 2PX8A 4RK5A 3T7JA 5EE5B 1IM5A 1E1RD 1P8AA 3DKIA 1XCBA 2Q6IA 4JDUA 1L7DA 2V5AA 3VVCA 4IIVA 2YN0A 5LD2C 4N5MA 2X2OA 1TO1E 2B99A 2DCMA 2EW8A 4P0QB 3VKGA 2V58A 3KUUA 4M88A 1PGPA 4XJSA 4WXPA 1GGJA 3S2YA 2V5UA 3LCJA 2X15A 4C0WA 4G0VA 4ZZ3A 1WJZA 3WG9A 3CVUA 3WA6A 4WZAB 4L5YA 4YWJA 3ROPA 3I92A 3B38A 1QX4A 1GCAA 4BNLA 1R9NA 4V0ME 1NJ8A 2IHYA 1NVUQ 2CXXA 4Y2XA 4ZXFA 3JYQA 3RIEA 3B36A 2YV4A 1ZM3A 3LQQA 3ZS8C 3SYMA 1YB5A 1K3EA 2KMLA 4BWVA 5KTPA 1HQCA 2HKOA 4GSYA 2IDJA 2Y05A 1K6XA 1SHUX 3I9LA 4UU1A 4IMIB 4JB8A 2LP7A 3TOVA 4YP1A 2CXSA 5K0ZA 4CEJB 1W4BA 4N0EA 2IY9A 4OK5A 4O2RA 4H60A 1YAHA 1OU4A 3H1PA 1YA6A 2XUKA 3SZGA 3OZ7A 1CY2A 1CR6A 2P9FA 2IZ0A 3ZLJA 4FYYA 2KWIA 2E5FA 5BNIA 2HU2A 2ZNJA 1Z8NA 3HZOA 3JX9A 3EODA 1PNTA 6REQB 5MN6A 4PW0A 1WG8A 2BIFA 4Z7QB 2FB5A 1WU7A 4J7CA 1HRKA 1DXYA 3CGGA 2W83A 1Q8IA 1NU6A 2ZBFA 5KWIA 3BCHA 3O9MA 2Y2VA 1R0BA 4RPLA 5C7YA 2QLJA 2UXXA 2AT1A 1IMJA 4RDHA 2VNIA 1NVPB 1CJKC 3OTOO 1WY7A 1EQAA 5U4XA 4YACA 2Y1CA 4EGQA 3B6EA 4UHHA 4H27A 2VQDA 1Q7RA 1M6YA 2VOEA 3VSDA 1N32O 3KEMA 1QP7A 1CP9A 2ZS9A 4WFFA 1HPLA 2ISQA 1RBYA 4WMLA 4GNKA 1Z45A 3T38A 3CTMA 1ULTA 3AL0C 4B3XA 4NENA 3PGVA 4DDKA 2IGTA 1OB2A 4A0GA 1LX6A 2WLHA 1PYDA 1Z5GA 4N65A 4R41A 1C1HA 4K35A 3A3PA 3I12A 5A5GA 2RDCA 1YFJA 4H7EA 3QUSA 5DH9A 5FL7A 3WBKA 2SKEA 5H16A 1E3WA 4A23A 2JDIG 4D6TH 1DJOA 3SQLA 4QPKA 3CF4A 1WABA 1R1DA 4B3FX 3MF4A 2JGRA 1VMAA 2Z3YA 4H1UA 3A10A 3GEGA 4LUCA 1BGXT 4X1YA 1PK9A 4KR7A 1JH9A 3SEQA 4DVJA 2IZ6A 4ZJYA 1FX0B 3LCRA 3S5UA 4TXLA 4DAOA 4EJFA 1NONA 3AO0B 2YSUB 5BV2P 3IE1A 4ZK6A 2JEXA 2X9GA 3WGOA 7GPBA 1BJTA 4BB0A 4L08A 3K3WA 4DG8A 3ZDFA 1KPGA 3FH0A 1OXKB 3AGQA 3TZBA 2RHLA 1EX1A 1FSSA 1KK2A 2OQRA 1SVLA 4RF3A 4E5NA 1XMXA 1C50A 3X1ZA 4D25A 2BFNA 3TQQA 4ZEXA 1BMFD 2FV8A 1ZN8A 3KD3A 3MLBA 4CH3A