2LGQA

Human c30s/c59s-cox17 mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
GSFTMPGLVDSNPAPPESQEKKPLKPCCASPETKKARDACIIEKGEEHCGHLIEAHKESMRALGFKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Cytochrome c oxidase copper chaperone
publication title Functional role of two interhelical disulfide bonds in human cox17 protein from a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 2lgqA00
1HP8A 2HP8A 2RNBA 2LQTA 1Z2GA 1U96A 2LGQA 1U97A 2RN9A
chains in the Genus database with same CATH superfamily
2A3QA 3F5TA 1V54B 3CE2A 5EBMC 2BOCC 1WJZA 5EIBC 3HKCB 1H2LA 2HR3A 2WLJA 3MHSC 4Z1VA 1FS0G 3JD0A 5DM6V 3JAKA 4PHZA 2M6YA 3SDLA 1YF2A 3JALB 2RQ6A 1AI4A 5B1OA 1OCRC 2QKCA 1IBKO 1IBMO 4WFFA 3H1HH 4GX2A 1K34A 4JZ2A 3GWOA 4MVRA 1QU7A 3K57A 4JYYA 1WA8B 4FM2A 4PDRA 2QWPB 1ZL8A 2QKAA 1OCZC 3WB0A 1M57B 3AG1B 1FXKB 4BIUA 2FKXA 2W0XA 2Y0PA 2P7TC 2YICA 1AI7A 5L3CA 1SQGA 5J2TB 3DXRB 3BPZA 5LA6B 5E79Z 2ZM6O 2QEXV 4TUYB 3H1JH 2WWWA 4NB5A 5CA0B 4KP4A 1V54C 3J80N 1H38A 4I9WA 1IXBA 2ZQMA 4O4LB 1Q6IA 5CB4B 2F4VO 4O4JB 3ABLB 1PL0A 4PDLA 3BCCH 3BFRA 3CD6V 1Q90D 1IBLB 3CRRA 4U3JB 1XQ8A 4LF4B 4J11A 4IYIA 5GTHZ 1BZKA 4I0XB 2OYQA 5A2QN 4JV5B 2ZXWB 1XNRB 4BW5A 3N2KA 3RVZA 2DJVA 4NXMO 4UCRA 1Z2GA 4X66B 4FFBB 3N2GA 1XL4A 4HAMA 5IYCO 2YIBA 3ABMC 1QBZA 3ETQA 1FKAO 2E5LB 2Q8VA 4MT8A 3CRMA 5H6QA 4FLYA 2Y0IA 3X2QB 3AG1C 1FXKC 1K97A 2JEXA 1IBKB 2IW5A 1IBMB 2Q9LA 2W6JG 2HJFC 5H5NA 3VBBA 1J5EO 3OMIB 4XBFA 5KAIZ 4CZZA 3CC7V 1I0HA 3ZHUA 5DN6G 3CJHA 4TT3G 2P22C 4UCSA 4FM1A 2HG5C 4I50A 3CCEV 4MS2A 1PL4A 3A8TA 1FAFA 3FFQA 2VQEO 4ASUG 2R9IA 2ZXWC 1K73W 2P4KA 3STLC 2YEVA 5A9GA 5DECA 5LHGA 2ZIMA 2ZM6B 3OMNB 1JFFA 1NBMG 3CC2V 4DR1O 3SPCA 4MVSA 1VEWA 4U7NA 5KMGA 4J42A 2F4VB 4B3MO 3ZMSA 4CH3A 2C2AA 1RSOA 3X2QC 1AJQA 1EZVH 4O4IB 4WFBV 3FB8C 1R6TA 4NXMB 2OT5A 2IU0A 4YY3B 2AW9A 5JH7B 1I94O 2UU9B 2HVJC 5EYPA 5LP6B 2OCHA 2ZR3A 1H2SB 4UB6Z 2Y48A 2B1GA 2GDSA 3D36A 1JX9A 3I56V 4X1KB 3M8AA 3SJQC 1F51A 1X4TA 1YVWA 4CH6A 1P7GA 1OCOB 2EIMB 3E35A 3W7WA 3TXQA 2PTMA 2OCCC 4UVBA 3CMEV 5KHKA 1QVGU 1J5EB 1PD3A 5JQGA 1BSMA 2AHZA 5IWAO 2E74B 3RBZA 2DMXA 2ZT9B 5KA5A 4QPJA 4RUFA 5IYZB 2GBOA 2XAGA 2YSUB 2R9AA 2ZINA 3E8HA 3ZRWB 2JS3A 3THOA 1QR8A 3T1CA 4HZ3A 3H1IH 3LNMB 4F6RA 3W7TA 1DF5A 1LUVA 2VQEB 5IY5C 3O65A 3RYIA 3JSNA 2P67A 3SJCC 4W4LA 4CS2A 4DV2O 1PM9A 1PNKA 2WLIB 1VIBA 3FD9A 4DR1B 5J2UA 1Y66A 5KUKA 2Y4UA 2JEUA 2PI4A 4GUNA 4B3MB 2ZR2A 1G1XB 4DV6O 4WBNB 1K5QA 4GKKO 4LR3A 1HNXO 3OUSA 4AHCA 4X8AA 2UXXA 3JARA 4JI3O 4L8JA 2V7QG 3K0GA 4QJFB 1I94B 4UXNA 1MZFA 3TJTA 4K8XA 1VQNV 3OE7G 3ZMVA 1WB8A 2ZD9A 3KZIZ 4DR4O 2PF4E 4NTXA 3O9OA 1XMQO 1Y6XA 2RN9A 3B2EE 2IJIA 2ZKOA 4MVQA 3ZIAG 1NVPB 5KHGA 1D5NA 3RT3C 1N0JA 1JA8A 1H2KA 3FKSG 5K1XA 1R73A 3E22B 1N4CA 2DWEC 2X7RB 4YJ3B 1IURA 5IWAB 2ARHA 4C7UA 2VRZA 1P49A 4TOIA 3G6BA 3CEIA 1IDSA 3BAAA 1M4UA 4NTYA 1K5SA 2BSKA 2RNBA 3JATB 1N8RW 4G28B 4CC6A 3LNNA 1ZWIC 2DYSC 4DV2B 2IH1C 3JSLA 4UCVA 3I55V 3ZRXA 3FB7C 4YIPA 3QNEA 3AG4B 3T2MA 4J7KA 3P3PA 3T4ZA 1ROPA 1KECA 1L1FA 1KC8W 1HNXB 5LGUA 5BXZA 2DE0X 5IJ9B 3JAWA 1SZXA 4IIJA 2Q7EA 1SC5B 2WLKA 4N23A 1VF7A 3SPGA 4J41A 5KAFZ 3LSUA 4X65O 1DTOA 4IT5A 3R66A 1S5JA 4NYKA 4DR4B 2YS8A 3RYFB 1XMQB 2HLDG 1XHZA 3L9DA 4DV1O 3LDDA 4K3AA 3L74H 1GO3F 3DSQA 2ZE5A 4NTWA 1NR1A 3K9AA 4O2BB 3OTOO 4GCZA 3ABTA 1KP3A 4R7CA 2AXTZ 2WLHA 3RYCB 3APOA 1NVPD 3UM7A 5F2VO 4LFAO 1GN2A 1WP8A 3AG4C 1N0NA 3ZS8C 2Z3YA 4LFBO 2P06A 3HKEB 1JVMA 3A0BZ 1AP5A 3SJAC 1W2BU 4RQFA 2F23A 2BTQB 1NT2B 3C3TA 1Y76A 3HKDB 4QNHB 4D7SA 2ODMA 4CH5A 1R6NA 1FXVA 5IJ0B 2XT9A 5LOVA 4DR2B 1K33A 5CA1B 2PYJA 2LW7A 3BA9A 1I5XA 2PY5A 2UUAO 4CH4A 1I08A 4G27B 2AZ0A 5BMVA 3UQ8A 1UFIA 4YJ2A 1HDJA 3IFXA 4MW8A 2EJ7A 3C90A 5AG2A 2QDOA 2QTOA 3IC7A 5D5PA 4X1IA 5KHHA 3CRCA 4O2AB 2G38A 1AR4A 3ZHVA 1FD9A 1OCCC 4ZBMA 1GKFA 2UUCO 3CCRV 3RYHB 4ZOLB 5GTIZ 4JAAA 1N33O 1P7BA 5FLXN 2VWJA 3QO7A 5FPOA 1D2DA 4U7OA 3B09A 1TGOA 3JD4A 5LMNO 2Q73A 1NTZH 4HNAA 3GWKC 4LNUB 3DGEA 1VQ6V 3HKBA 1T5EA 2A79B 2GV9A 4LFAB 2QTSA 1MNGA 4R6ZA 2P90A 2MW2B 2JS5A 4GZRB 4LFBB 4NR1A 3TGUH 2LQTA 1VQ8V 3HR0A 2V1DA 1ZAUA 4LF6B 4X1YB 4J9ZB 1VQ7V 1S5LZ 4I9QA 2V4DA 1W59A 4Z1MG 2Q0OC 2QJ1A 4JI2B 1G6UA 1OCRB 2VWKA 3ASNB 1FFXA 3JASB 4ZI7B 1Q5OA 4GX5A 1DGSA 1HP8A 1S76D 2H3OA 4PA9A 2RCVA 2UUAB 3NR7A 2EZOA 4K0KB 4UV9A 1OCZB 4DR5O 3CCVV 3CXHF 5EBWC 4IHJB 2VQFO 3SYPA 2R70A 4O4LA 1KU9A 2JGDB 1SETA 4E2LA 1ZSPA 2GUZB 5C8YA 2XASA 1KKDA 1AROP 3P30A 3K03A 4ABMA 3CXCU 2XTAA 4UFZA 1Z5WA 1N33B 2QM7A 1MSWD 1AJPA 1SESA 3LDEA 5LMNB 1YCIA 1OJHA 1ORQC 1WB7A 2CTPA 1YITV 4DUYO 4XDKA 3U10A 2ADQB 2ZE6A 1FYJA 5JJJB 3ASNC 4ZKIA 4B7EA 3CCSV 1BHAA 2F66C 3NXSA 1DK1A 1ZUQA 2F93B 4FFKA 5LMUO 1PPJH 1MOFA 1S5HC 1BGYH 3ABMB 4I4TB 3KCXA 3APQA 2Y69B 1YJNV 4AQYO 1K9MW 3W7UA 1OZ0A 3UO3A 5EIBD 4LH7A 4QIWF 3HB3B 3CPWU 2GTSA 4I55A 2DOSA 1KUQA 1SRYA 3JCUZ 3W7SA 4N21A 2ITCC 1VQPV 1HNZB 2JRIA 3CCUV 1MSDA 3OGCC 1L0LH 4TWKA 5KHJA 4TV9B 4DUZO 4QE9A 4MVOA 1LUWA 4PI0A 3ZCCA 4EB6B 1AP6A 4WFAV 2LGQA 2EZPA 4LCUC 4DR5B 2Q7GA 4R50A 4DRXA 3ZBHA 1PP9H 1M9NA 3A2FA 4MVUA 1OV9A 3STZC 2VQFB 4X89A 2XOKG 2NNUA 3H1KH 1TVKB 1P4RA 1SQVH 4WFHA 4JI0O 5FL7G 3OR6C 4DO2A 4JI8O 4EEQA 3EHBB 2N05A 2QE7G 1HW7A 4PA6A 5EC1C 2Y69C 2JJ1G 2D3OW 1GTOA 1MG1A 4LWSA 4R8CA 2HHHO 3RN4A 4YHHO 3K5NA 4GX1A 4FLZA 2ILMA 4DUYB 2UXNA 3I5DA 1AI6A 1SS3A 2GSMB 2P6JA 2IM9A 4LF7O 3IAYA 5GW7A 2N04A 5LMUB 4L87A 1Q43A 1Z5VA 1EZJA 4G2KA 1I7FA 1EM1A 4WCEV 2W6IG 1AJNA 4LF5O 4OPAA 3K59A 3SR2C 2WAMA 3WFVA 2KG7A 1YJ9V 1ZL8B 2GTAA 1SQBH 1KB9F 1XUQA 3H9VA 1Q81W 5CN0A 3IGAC 4E4EA 2OCCB 3LDCA 3OAAG 4YIOA 5KLVH 3CCMV 2CGOA 1JR9A 5LXTA 2Q4PA 1R6KA 2WSSG 3QO5A 1K7DA 3TK1A 3ZEDA 4DUZB 1XILA 1GM8A 3ETGA 5JJEB 1MMMA 4PA4A 2UUBO 3Q4HB 3W7XA 4A5UB 5IY5B 3L73H 4PI2A 1NR7A 5JJNB 4JI0B 5CBFA 4UVAA 2B5UA 2K1EA 4JI8B 3SYCA 3N2KB 4TV8A 3EFFK 2KKWA 2IH3C 2HP8A 4PA3A 3N2GB 1GM7A 2PYLA 2JDIG 4YHHB 1YZBA 2XNDG 1M93A 3QVNA 3CYOA 3S3WA 1QVFU 4XDJA 4LF7B 1Q86W 5KX5A 1G4YB 4Q6GA 1U97A 4H37A 1XNQO 3AG7A 1US6A 4LF5B 2LGWA 3CC4V 2QR4A 2QKSA 1K3EA 3U11A 1NTKH 1EN5A 3CJHB 4JYBA 3ICXA 4F4LA 4I50B 3ZMZA 5B66Z 2Z5UA 1OHHG 2X6CA 3TXSA 3OUFA 1VF6A 3AK2A 1X59A 2Q68A 2YEVB 1NZ6A 3SGIA 1JFFB 4JTCB 5ITZB 5JVDA 2JIZG 2HVKC 1MABG 2FTKA 5KMGB 1FPOA 2YC0A 2AZ2A 4NKGB 1VARA 1XMOO 2UUBB 4JYAO 4I7ZB 1RSOB 4RQEA 3OW2U 2CH7A 4X64O 3VQXA 1PKXA 5KA6A 2DYSB 1DLBA 5BR8O 5LGNA 2H8PC 2QM8A 1H8HG 1TAEA 4JI6O 3UT5A 4GT1A 5HFMA 1Q6UA 3K9SA 2OTLV 3D3IA 2ZDIA 5LYJA 5EYPB 1K4CC 3CCJV 3E83A 2YIBD 2XAQA 1V55B 2YXYA 5IJ9A 1BL8A 3B77A 4UUJC 2EILB 1Y74B 2XHBA 2LW1A 1YEWA 1XNQB 4O4HA 3SYOA 4DW0A 2HEPA 4LBEC 5JQGB 3RW0A 4I5SA 3AG2C 1RM1C 3U0ZA 5EK0A 1NS1A 4WFEA 2CAZC 2Q7HA 1D5AA 4JTAB 3CRQA 2IJJA 3IJ4A 4DV3O 2B9ZA 4F6RB 3G6EV 1THZA 2LP7A 3AK3A 4JASA 1WPXA 2DYRC 4DR3O 1SQPH 5IT9N 2BOBC 3K5OA 4LC1A 3UCSC 2BE3A 5J2UB 3QG5A 4OGQB 5B1NA 4JZGA 4DV6B 3HKDA 1V55C 2OWOA 3D36C 4B3TO 4JYAB 1B3QA 1W0JG 5IYDO 2HJDA 4GKKB 3MAQA 4X64B 2EILC 3ASOC 2EBOA 1R3IC 3E86A 1BCCH 4JI3B 1BQ0A 5BR8B 2QM4A 4UCUA 3OD4A 3JARB 3WG7C 1SQQH 4JI6B 4TQFA 3FX7A 2YI9A 4JAVA 1R3LC 1JQ0A 3K5MA 3FAVA 4LF8O 3G71V 1L0NH 1VP7A 2EIKC 5CA3A 1VQ5V 2DQ3A 2EX3A 4KHPO 1JJ2U 3M99B 3JD2A 4GYCB 3RYHA 2GHYA 3ETEA 3OFNG 4NVPA 1AB3A 1OCCB 3GVMA 1NH2B 1B04A 3MDSA 1WAZA 1MA1A 3CS5A 2YUAA 1CXZB 3KKYA 2EULA 1PNLA 3VQVA 2BSKB 2OIEA 3K58A 1K8AW 2WPDG 3ZMUA 4DR3B 1E1RG 5J9PC 4JI1O 5EZYA 4KUMA 2L6LA 3E8GA 5TISZ 4B3SO 2FB5A 4MVZA 3T1YO 4B3TB 4ZI7A 5L3DA 1RFYA 4ZHQA 2QWQB 2YIAA 3LSSA 4PDMA 3CMAV 2WLLB 4F6EA 1TUBB 4JPRA 4UCOA 1WN7A 5FNVA 4MVMA 1BE3H 2ZNJA 3CCLV 3AG3C 4P9OA 3JAWB 4X65B 4PD4F 2JK5C 1BMFG 4MTOA 3MD0A 4DV1B 3ZN1A 1I5YA 1KD1W 3H01A 4KHPB 3OTOB 1O9HA 3VQWA 3J81N 2JVDA 1F7YA 4JI7O 5CBGA 1NQTA 2Q69A 3HKCA 2MK3A 1LNQA 3DC5A 5CMUA 5B5EZ 3JALA 4YXWG 2AHYA 4PA7A 2KSDA 1NH2D 1S77D 4H33A 4PJ0Z 1WA8A 1Y76B 2CGNA 2BTOA 4JTDB 1RP3B 1GM9A 2P5OA 5LOVB 4JI1B 4FMTA 1FXKA 4J7JA 2ADPA 4B3SB 5B1BC 5H6RA 1LR1A 1R3JC 3FYEB 5DEDA 3ZN0A 3OGIB 3K79A 5BMVB 2IU3A 5J2TA 3DXRA 5LA6A 4TUYA 1S3JA 3ZRVA 5CA0A 1DF4A 4UV8A 2E3CA 1L8DA 5CB4A 4O4JA 1KKCA 1RPOA 1VQOV 4PV1B 4QE7A 4X1IB 4X62O 2UUCB 4FM0A 4U3JA 1ZTEA 5GONB 3OM3B 1H2NA 4I0XA 1QLNA 1TVKA 5L3FA 3VQYA 4JV5O 1WP7A 1F23A 1YHQV 4FFBA 4HNAB 3ZHTA 3HKBB 1YTFB 4D7TA 4DK0A 5B3SB 2E5LO 1JCHA 4PDVA 4X9QA 2IBZH 3BY6A 1KMIZ 2W0FC 2YI8A 2X0LA 1GN4A 3T4DA 2AGAA 1M56C 1KYOF 3K08A 4X20B 5BY1A 4H13B 3SJBC 4FLWA 1QR9A 1FFXB 5LHHA 3KG2A 4RWUA 2K9PA 4DV5O 3D8CA 3F7YC 1WPBA 2A06H 5LBQA 1SF9A 4DV4O 1A32A 4GKJO 3ABUA 4MW3A 1SA0B 3CX5F 4WF9V 1V9PA 3G67A 2ETNA 3D3QA 3BEHA 5FPRA 2KB1A 2JGUA 2BCCH 1Q7YW 1Q6HA 5B3SC 3JCZA 4X62B 1S72V 3Q4HA 3WB1A 3QTCA 4O4IA 5C8YB 2ZCEA 2KQXA 2PGGA 4QGPA 3JAKB 1F4NA 1TUEB 3ZHSA 3B8NA 4UB8Z 3BHPA 4FIPC 4CC5A 3K04A 3VOUA 5JH7A 4CS4A 5LP6A 2O57A 4YY3O 3K3WA 1KP2A 3ML0A 2UU9O 1XI1A 1FFTB 4JI4O 2XAFA 4RAIA 1YTFD 1WLEA 4X1KA 1AR1B 4OX9O 1M57C 1EBOA 2DWDC 4AQYB 3G4SV 3OT7A 4PELA 4FLUA 1XOUA 2LO1A 2R9RB 4ICGA 1XHXA 2E76B 2NLJC 2QWNB 4KL1A 3AK1A 4I55B 3WU2Z 4EFEA 3B8MA 1YI2V 1YIJV 5IYZA 4J7ZA 4OXSA 3ZRWA 3ABLC 3OEEG 2HKOA 1J95A 4DV5B 4H0LB 4MTFA 2OIGA 2PUSA 3JD1A 5HFLA 1M90W 5EC2C 1PNMA 4CBCA 4K8ZA 4DV4B 1JOYA 3K0DA 4GKJB 1JJOA 2OTJV 2L35A 2P4VA 2WLIA 3L72H 4DRXB 4MTGA 4DXWA 4H44B 5ITZA 2XAJA 1XEQA 3RWRD 2ZNIA 1TA8A 2WLNA 5K1PA 1ZX3A 3JAMN 1SZTA 5C93A 4WBNA 2A9HA 3F5WC 4UVCA 4W4KA 5JWPA 4LFCO 2HHHB 4LWSB 4DK1A 1AR5A 1MZEA 4DR6O 1H8EG 2EINB 5CBHA 4DR7O 2WA3A 5H2FZ 1GK9A 2JJ2G 4CS3A 3B4SA 4GX0A 2DQ0A 5L3GA 4JI4B 2DN9A 2XUMA 4OX9B 4MSWC 2EIJB 1JPXA 2YXLA 1ZLZA 3SPJA 4GLXA 4J9YB 2NN4A 1E79G 1B6QA 1Y74A 4Z2WA 2KG7B 3E22A 4YJ3A 4KFMA 2Q67A 3WB2A 1BS3A 2RMKB 1BT8A 4FPPA 3SYQA 4EKWA 3G80A 3EXAA 5LGTA 2IJHA 4FZ1A 2Q5ZA 1PV0A 5LXTB 2E75B 2ZIOA 3SPHA 1YJWV 4JF3A 3ETDA 4B7KA 5B1AB 1R1BA 3JATA 1SQXH 3AG2B 1RM1B 4P9PA 1NTMH 3TETA 2A0LA 1B06A 1XREA 1GMGA 5L3BA 4J10A 2EINC 3BABA 3LSQA 4J80A 4LP8A 4HBNA 4P2ZA 1UPGA 2CUGA 5LP6C 1HNWO 4FVMA 2DYRB 2F95B 1Q82W 4TV8B 1Q3EA 2EIJC 3UO2A 1YSCA 3JD3A 4BIOA 5EBLC 4JGSA 5KUMA 1OCOC 2EIMC 4LFCB 2EJRA 3T1HO 3K06A 1AI5A 2DW4A 5L3EA 1W0KG 3BA8A 4DR6B 3CWBH 4DR7B 1QNMA 3PJSK 1VF5B 4BIZA 2IJKA 3ASOB 3K5LA 2RDCA 5LL6Y 1VQKV 5KX5B 3DC6A 3RYFA 3WG7B 1GN3A 1Q8IA 5B1AC 3OR7C 1YDXA 3B40A 2D2CB 4D6TH 4O2BA 1SERA 1BHBA 1WNSA 4JAUA 3L75H 3RYCA 3J7AU 4DV0O 2EIKB 1XBLA 2R72A 3CB2A 2CTWA 3C3SA 3RYIB 4P30A 3HKEA 3RGBA 3ZJZA 2HFEC 3TCUA 1N32O 1QLEB 2RJZA 1GRJA 2A7WA 4ZIBA 3E2EA 5JVDB 3A0RA 2UXDO 2BTQA 3OEHG 1GAXA 5JCOA 1XMOB 1HWYA 2M7WA 2FMLA 2FL4A 5IJ0A 4IL6Z 2YIDA 1FXHA 2UXCO 5CA1A 1IZ3A 2CH7B 1K92A 1VQLV 3MHHC 4DR2O 4OPHA 1HNWB 3FB6C 2YXHA 2LFSA 1Y67A 4LF9O 4JI5O 3UT5B 2WLLA 1TUBA 1IX9A 1XDCA 4IGGA 3T1HB 2CE4A 5E1AC 1AVMA 1Y4MA 2Q0AA 4K35A 4RO2A 5LYJB 4BW9A 3PN1A 3HPLC 3EVKA 1GH6A 3P32A 2CTQA 1YXBA 2NR5A 4O2AA 2ATKC 1EN4A 1VMGA 3ABKB 1VF6C 4HYOA 4ZOLA 1EFRG 1QLEC 3AG3B 3BRCA 4DV7O 2X6AA 4O4HB 2CK3G 3ZMTA 2F1MA 1H2MA 4LNUA 4BWAA 3QF7A 1QQCA 3L70H 2Y4TA 1VQ9V 2F43G 4DV0B 4JYCA 1CEZA 1KQSU 4XDLA 2QWRB 4DV3B 2H94A 4Q20A 3SYAA 3UKMA 3RFRA 1G8MA 2LFRA 1N32B 1NKDA 1P84F 3F7VC 4B3RO 3FYIB 5BZBA 2CTRA 3SPIA 4X1YA 2WA4A 3LUTB 4LF6O 4DW1A 2UXDB 4FLTA 1BQZA 4AILC 3DTUB 2ZDIC 3JASA 3IC9A 4JI2O 4LH6A 1CPYA 3AEIA 3N27A 2PZSA 2UXCB 1N36O 1NI8A 3RVYA 1N34O 1FJGO 4TQDA 3CSXA 3P3NA 4FLVA 1ENVA 3ABKC 4QPKA 1RPRA 2QA4V 1IVSA 4LF9B 5H9CA 3JYCA 3CCQV 2X6BA 4K0KO 4IIJB 1AILA 3E8FA 4JI5B 2PI5A 4IHJA 4EFBA 4TSFG 4KXRA 1NU1H 4U3FH 3M7MX 5IDJA 5B1BB 3E8BA 2Q6AA 2ZE8A 4LF8B 1HR0O 2UXBO 3FAVB 2JGDA 5IE9A 2QWOB 1M1KW 2GUZA 1XL6A 3S3XA 2YDEA 4NXNO 4RUEA 3OTFA 1COWG 5GONA 1H2GA 4DV7B 2WLMA 2VS0A 2CDYA 1E1QG 1GN6A 2FYUH 1NJIW 1EN6A 2ITDC 2QSAA 3CHXA 4AI8A 5JCOC 4BAYA 4BR6A 4FK5C 1UJWB 4WFGA 1K4DC 5IYBO 1QHTA 1JMKC 2LJ2A 1SKVA 3A0HZ 1VQ4V 4I4TA 5KHIA 3CP1A 5D5QA 4B3RB 1VQMV 3OMAB 4FLXA 3E89A 3GB7C 4B08A 3BVOA 4MTXA 5EZYB 2XAHA 4X20A 3T1YB 1M5IA 1F4MA 3ZX6A 4IYHA 2ZE7A 1M56B 1N36B 1N34B 1FJGB 3ZRSA 4ZHQB 1HNZO 4YJ2B 4TV9A 3R65A 4X88A 3ZHRA 3H1LH 1QCEA 1SQFA 1URFA 5LHIA 5FNVB 4EB6A 1KBHA 1S0VA 1R3KC 4FZ0A 3L71H 1SA0A 1IXMA 4FJCC 3CRAA 1IBLO 1HR0B 3QO8A 4LF4O 2UXBB 2QGNA 1U96A 1O9GA 3FB5C 1XNRO 3ZHQA 4DYLA 3KCYA 2Z0AA 1CP9A 2N74A 4JI7B 4NXNB 4UCTA 4X66O 2B1IA
chains in the Genus database with same CATH topology
1HP8A 2HP8A 2RNBA 2LQTA 1Z2GA 1U96A 2LGQA 1U97A 2RN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HP8 A;  2HP8 A;  2RNB A;  2LQT A;  1Z2G A;  1U96 A;  2LGQ A;  1U97 A;  2RN9 A; 
#chains in the Genus database with same CATH topology
 2A3Q A;  3F5T A;  1V54 B;  3CE2 A;  5EBM C;  2BOC C;  1WJZ A;  5EIB C;  3HKC B;  1H2L A;  2HR3 A;  2WLJ A;  3MHS C;  4Z1V A;  1FS0 G;  3JD0 A;  5DM6 V;  3JAK A;  4PHZ A;  2M6Y A;  3SDL A;  1YF2 A;  3JAL B;  2RQ6 A;  1AI4 A;  5B1O A;  1OCR C;  2QKC A;  1IBK O;  1IBM O;  4WFF A;  3H1H H;  4GX2 A;  1K34 A;  4JZ2 A;  3GWO A;  4MVR A;  1QU7 A;  3K57 A;  4JYY A;  1WA8 B;  4FM2 A;  4PDR A;  2QWP B;  1ZL8 A;  2QKA A;  1OCZ C;  3WB0 A;  1M57 B;  3AG1 B;  1FXK B;  4BIU A;  2FKX A;  2W0X A;  2Y0P A;  2P7T C;  2YIC A;  1AI7 A;  5L3C A;  1SQG A;  5J2T B;  3DXR B;  3BPZ A;  5LA6 B;  5E79 Z;  2ZM6 O;  2QEX V;  4TUY B;  3H1J H;  2WWW A;  4NB5 A;  5CA0 B;  4KP4 A;  1V54 C;  3J80 N;  1H38 A;  4I9W A;  1IXB A;  2ZQM A;  4O4L B;  1Q6I A;  5CB4 B;  2F4V O;  4O4J B;  3ABL B;  1PL0 A;  4PDL A;  3BCC H;  3BFR A;  3CD6 V;  1Q90 D;  1IBL B;  3CRR A;  4U3J B;  1XQ8 A;  4LF4 B;  4J11 A;  4IYI A;  5GTH Z;  1BZK A;  4I0X B;  2OYQ A;  5A2Q N;  4JV5 B;  2ZXW B;  1XNR B;  4BW5 A;  3N2K A;  3RVZ A;  2DJV A;  4NXM O;  4UCR A;  1Z2G A;  4X66 B;  4FFB B;  3N2G A;  1XL4 A;  4HAM A;  5IYC O;  2YIB A;  3ABM C;  1QBZ A;  3ETQ A;  1FKA O;  2E5L B;  2Q8V A;  4MT8 A;  3CRM A;  5H6Q A;  4FLY A;  2Y0I A;  3X2Q B;  3AG1 C;  1FXK C;  1K97 A;  2JEX A;  1IBK B;  2IW5 A;  1IBM B;  2Q9L A;  2W6J G;  2HJF C;  5H5N A;  3VBB A;  1J5E O;  3OMI B;  4XBF A;  5KAI Z;  4CZZ A;  3CC7 V;  1I0H A;  3ZHU A;  5DN6 G;  3CJH A;  4TT3 G;  2P22 C;  4UCS A;  4FM1 A;  2HG5 C;  4I50 A;  3CCE V;  4MS2 A;  1PL4 A;  3A8T A;  1FAF A;  3FFQ A;  2VQE O;  4ASU G;  2R9I A;  2ZXW C;  1K73 W;  2P4K A;  3STL C;  2YEV A;  5A9G A;  5DEC A;  5LHG A;  2ZIM A;  2ZM6 B;  3OMN B;  1JFF A;  1NBM G;  3CC2 V;  4DR1 O;  3SPC A;  4MVS A;  1VEW A;  4U7N A;  5KMG A;  4J42 A;  2F4V B;  4B3M O;  3ZMS A;  4CH3 A;  2C2A A;  1RSO A;  3X2Q C;  1AJQ A;  1EZV H;  4O4I B;  4WFB V;  3FB8 C;  1R6T A;  4NXM B;  2OT5 A;  2IU0 A;  4YY3 B;  2AW9 A;  5JH7 B;  1I94 O;  2UU9 B;  2HVJ C;  5EYP A;  5LP6 B;  2OCH A;  2ZR3 A;  1H2S B;  4UB6 Z;  2Y48 A;  2B1G A;  2GDS A;  3D36 A;  1JX9 A;  3I56 V;  4X1K B;  3M8A A;  3SJQ C;  1F51 A;  1X4T A;  1YVW A;  4CH6 A;  1P7G A;  1OCO B;  2EIM B;  3E35 A;  3W7W A;  3TXQ A;  2PTM A;  2OCC C;  4UVB A;  3CME V;  5KHK A;  1QVG U;  1J5E B;  1PD3 A;  5JQG A;  1BSM A;  2AHZ A;  5IWA O;  2E74 B;  3RBZ A;  2DMX A;  2ZT9 B;  5KA5 A;  4QPJ A;  4RUF A;  5IYZ B;  2GBO A;  2XAG A;  2YSU B;  2R9A A;  2ZIN A;  3E8H A;  3ZRW B;  2JS3 A;  3THO A;  1QR8 A;  3T1C A;  4HZ3 A;  3H1I H;  3LNM B;  4F6R A;  3W7T A;  1DF5 A;  1LUV A;  2VQE B;  5IY5 C;  3O65 A;  3RYI A;  3JSN A;  2P67 A;  3SJC C;  4W4L A;  4CS2 A;  4DV2 O;  1PM9 A;  1PNK A;  2WLI B;  1VIB A;  3FD9 A;  4DR1 B;  5J2U A;  1Y66 A;  5KUK A;  2Y4U A;  2JEU A;  2PI4 A;  4GUN A;  4B3M B;  2ZR2 A;  1G1X B;  4DV6 O;  4WBN B;  1K5Q A;  4GKK O;  4LR3 A;  1HNX O;  3OUS A;  4AHC A;  4X8A A;  2UXX A;  3JAR A;  4JI3 O;  4L8J A;  2V7Q G;  3K0G A;  4QJF B;  1I94 B;  4UXN A;  1MZF A;  3TJT A;  4K8X A;  1VQN V;  3OE7 G;  3ZMV A;  1WB8 A;  2ZD9 A;  3KZI Z;  4DR4 O;  2PF4 E;  4NTX A;  3O9O A;  1XMQ O;  1Y6X A;  2RN9 A;  3B2E E;  2IJI A;  2ZKO A;  4MVQ A;  3ZIA G;  1NVP B;  5KHG A;  1D5N A;  3RT3 C;  1N0J A;  1JA8 A;  1H2K A;  3FKS G;  5K1X A;  1R73 A;  3E22 B;  1N4C A;  2DWE C;  2X7R B;  4YJ3 B;  1IUR A;  5IWA B;  2ARH A;  4C7U A;  2VRZ A;  1P49 A;  4TOI A;  3G6B A;  3CEI A;  1IDS A;  3BAA A;  1M4U A;  4NTY A;  1K5S A;  2BSK A;  2RNB A;  3JAT B;  1N8R W;  4G28 B;  4CC6 A;  3LNN A;  1ZWI C;  2DYS C;  4DV2 B;  2IH1 C;  3JSL A;  4UCV A;  3I55 V;  3ZRX A;  3FB7 C;  4YIP A;  3QNE A;  3AG4 B;  3T2M A;  4J7K A;  3P3P A;  3T4Z A;  1ROP A;  1KEC A;  1L1F A;  1KC8 W;  1HNX B;  5LGU A;  5BXZ A;  2DE0 X;  5IJ9 B;  3JAW A;  1SZX A;  4IIJ A;  2Q7E A;  1SC5 B;  2WLK A;  4N23 A;  1VF7 A;  3SPG A;  4J41 A;  5KAF Z;  3LSU A;  4X65 O;  1DTO A;  4IT5 A;  3R66 A;  1S5J A;  4NYK A;  4DR4 B;  2YS8 A;  3RYF B;  1XMQ B;  2HLD G;  1XHZ A;  3L9D A;  4DV1 O;  3LDD A;  4K3A A;  3L74 H;  1GO3 F;  3DSQ A;  2ZE5 A;  4NTW A;  1NR1 A;  3K9A A;  4O2B B;  3OTO O;  4GCZ A;  3ABT A;  1KP3 A;  4R7C A;  2AXT Z;  2WLH A;  3RYC B;  3APO A;  1NVP D;  3UM7 A;  5F2V O;  4LFA O;  1GN2 A;  1WP8 A;  3AG4 C;  1N0N A;  3ZS8 C;  2Z3Y A;  4LFB O;  2P06 A;  3HKE B;  1JVM A;  3A0B Z;  1AP5 A;  3SJA C;  1W2B U;  4RQF A;  2F23 A;  2BTQ B;  1NT2 B;  3C3T A;  1Y76 A;  3HKD B;  4QNH B;  4D7S A;  2ODM A;  4CH5 A;  1R6N A;  1FXV A;  5IJ0 B;  2XT9 A;  5LOV A;  4DR2 B;  1K33 A;  5CA1 B;  2PYJ A;  2LW7 A;  3BA9 A;  1I5X A;  2PY5 A;  2UUA O;  4CH4 A;  1I08 A;  4G27 B;  2AZ0 A;  5BMV A;  3UQ8 A;  1UFI A;  4YJ2 A;  1HDJ A;  3IFX A;  4MW8 A;  2EJ7 A;  3C90 A;  5AG2 A;  2QDO A;  2QTO A;  3IC7 A;  5D5P A;  4X1I A;  5KHH A;  3CRC A;  4O2A B;  2G38 A;  1AR4 A;  3ZHV A;  1FD9 A;  1OCC C;  4ZBM A;  1GKF A;  2UUC O;  3CCR V;  3RYH B;  4ZOL B;  5GTI Z;  4JAA A;  1N33 O;  1P7B A;  5FLX N;  2VWJ A;  3QO7 A;  5FPO A;  1D2D A;  4U7O A;  3B09 A;  1TGO A;  3JD4 A;  5LMN O;  2Q73 A;  1NTZ H;  4HNA A;  3GWK C;  4LNU B;  3DGE A;  1VQ6 V;  3HKB A;  1T5E A;  2A79 B;  2GV9 A;  4LFA B;  2QTS A;  1MNG A;  4R6Z A;  2P90 A;  2MW2 B;  2JS5 A;  4GZR B;  4LFB B;  4NR1 A;  3TGU H;  2LQT A;  1VQ8 V;  3HR0 A;  2V1D A;  1ZAU A;  4LF6 B;  4X1Y B;  4J9Z B;  1VQ7 V;  1S5L Z;  4I9Q A;  2V4D A;  1W59 A;  4Z1M G;  2Q0O C;  2QJ1 A;  4JI2 B;  1G6U A;  1OCR B;  2VWK A;  3ASN B;  1FFX A;  3JAS B;  4ZI7 B;  1Q5O A;  4GX5 A;  1DGS A;  1HP8 A;  1S76 D;  2H3O A;  4PA9 A;  2RCV A;  2UUA B;  3NR7 A;  2EZO A;  4K0K B;  4UV9 A;  1OCZ B;  4DR5 O;  3CCV V;  3CXH F;  5EBW C;  4IHJ B;  2VQF O;  3SYP A;  2R70 A;  4O4L A;  1KU9 A;  2JGD B;  1SET A;  4E2L A;  1ZSP A;  2GUZ B;  5C8Y A;  2XAS A;  1KKD A;  1ARO P;  3P30 A;  3K03 A;  4ABM A;  3CXC U;  2XTA A;  4UFZ A;  1Z5W A;  1N33 B;  2QM7 A;  1MSW D;  1AJP A;  1SES A;  3LDE A;  5LMN B;  1YCI A;  1OJH A;  1ORQ C;  1WB7 A;  2CTP A;  1YIT V;  4DUY O;  4XDK A;  3U10 A;  2ADQ B;  2ZE6 A;  1FYJ A;  5JJJ B;  3ASN C;  4ZKI A;  4B7E A;  3CCS V;  1BHA A;  2F66 C;  3NXS A;  1DK1 A;  1ZUQ A;  2F93 B;  4FFK A;  5LMU O;  1PPJ H;  1MOF A;  1S5H C;  1BGY H;  3ABM B;  4I4T B;  3KCX A;  3APQ A;  2Y69 B;  1YJN V;  4AQY O;  1K9M W;  3W7U A;  1OZ0 A;  3UO3 A;  5EIB D;  4LH7 A;  4QIW F;  3HB3 B;  3CPW U;  2GTS A;  4I55 A;  2DOS A;  1KUQ A;  1SRY A;  3JCU Z;  3W7S A;  4N21 A;  2ITC C;  1VQP V;  1HNZ B;  2JRI A;  3CCU V;  1MSD A;  3OGC C;  1L0L H;  4TWK A;  5KHJ A;  4TV9 B;  4DUZ O;  4QE9 A;  4MVO A;  1LUW A;  4PI0 A;  3ZCC A;  4EB6 B;  1AP6 A;  4WFA V;  2LGQ A;  2EZP A;  4LCU C;  4DR5 B;  2Q7G A;  4R50 A;  4DRX A;  3ZBH A;  1PP9 H;  1M9N A;  3A2F A;  4MVU A;  1OV9 A;  3STZ C;  2VQF B;  4X89 A;  2XOK G;  2NNU A;  3H1K H;  1TVK B;  1P4R A;  1SQV H;  4WFH A;  4JI0 O;  5FL7 G;  3OR6 C;  4DO2 A;  4JI8 O;  4EEQ A;  3EHB B;  2N05 A;  2QE7 G;  1HW7 A;  4PA6 A;  5EC1 C;  2Y69 C;  2JJ1 G;  2D3O W;  1GTO A;  1MG1 A;  4LWS A;  4R8C A;  2HHH O;  3RN4 A;  4YHH O;  3K5N A;  4GX1 A;  4FLZ A;  2ILM A;  4DUY B;  2UXN A;  3I5D A;  1AI6 A;  1SS3 A;  2GSM B;  2P6J A;  2IM9 A;  4LF7 O;  3IAY A;  5GW7 A;  2N04 A;  5LMU B;  4L87 A;  1Q43 A;  1Z5V A;  1EZJ A;  4G2K A;  1I7F A;  1EM1 A;  4WCE V;  2W6I G;  1AJN A;  4LF5 O;  4OPA A;  3K59 A;  3SR2 C;  2WAM A;  3WFV A;  2KG7 A;  1YJ9 V;  1ZL8 B;  2GTA A;  1SQB H;  1KB9 F;  1XUQ A;  3H9V A;  1Q81 W;  5CN0 A;  3IGA C;  4E4E A;  2OCC B;  3LDC A;  3OAA G;  4YIO A;  5KLV H;  3CCM V;  2CGO A;  1JR9 A;  5LXT A;  2Q4P A;  1R6K A;  2WSS G;  3QO5 A;  1K7D A;  3TK1 A;  3ZED A;  4DUZ B;  1XIL A;  1GM8 A;  3ETG A;  5JJE B;  1MMM A;  4PA4 A;  2UUB O;  3Q4H B;  3W7X A;  4A5U B;  5IY5 B;  3L73 H;  4PI2 A;  1NR7 A;  5JJN B;  4JI0 B;  5CBF A;  4UVA A;  2B5U A;  2K1E A;  4JI8 B;  3SYC A;  3N2K B;  4TV8 A;  3EFF K;  2KKW A;  2IH3 C;  2HP8 A;  4PA3 A;  3N2G B;  1GM7 A;  2PYL A;  2JDI G;  4YHH B;  1YZB A;  2XND G;  1M93 A;  3QVN A;  3CYO A;  3S3W A;  1QVF U;  4XDJ A;  4LF7 B;  1Q86 W;  5KX5 A;  1G4Y B;  4Q6G A;  1U97 A;  4H37 A;  1XNQ O;  3AG7 A;  1US6 A;  4LF5 B;  2LGW A;  3CC4 V;  2QR4 A;  2QKS A;  1K3E A;  3U11 A;  1NTK H;  1EN5 A;  3CJH B;  4JYB A;  3ICX A;  4F4L A;  4I50 B;  3ZMZ A;  5B66 Z;  2Z5U A;  1OHH G;  2X6C A;  3TXS A;  3OUF A;  1VF6 A;  3AK2 A;  1X59 A;  2Q68 A;  2YEV B;  1NZ6 A;  3SGI A;  1JFF B;  4JTC B;  5ITZ B;  5JVD A;  2JIZ G;  2HVK C;  1MAB G;  2FTK A;  5KMG B;  1FPO A;  2YC0 A;  2AZ2 A;  4NKG B;  1VAR A;  1XMO O;  2UUB B;  4JYA O;  4I7Z B;  1RSO B;  4RQE A;  3OW2 U;  2CH7 A;  4X64 O;  3VQX A;  1PKX A;  5KA6 A;  2DYS B;  1DLB A;  5BR8 O;  5LGN A;  2H8P C;  2QM8 A;  1H8H G;  1TAE A;  4JI6 O;  3UT5 A;  4GT1 A;  5HFM A;  1Q6U A;  3K9S A;  2OTL V;  3D3I A;  2ZDI A;  5LYJ A;  5EYP B;  1K4C C;  3CCJ V;  3E83 A;  2YIB D;  2XAQ A;  1V55 B;  2YXY A;  5IJ9 A;  1BL8 A;  3B77 A;  4UUJ C;  2EIL B;  1Y74 B;  2XHB A;  2LW1 A;  1YEW A;  1XNQ B;  4O4H A;  3SYO A;  4DW0 A;  2HEP A;  4LBE C;  5JQG B;  3RW0 A;  4I5S A;  3AG2 C;  1RM1 C;  3U0Z A;  5EK0 A;  1NS1 A;  4WFE A;  2CAZ C;  2Q7H A;  1D5A A;  4JTA B;  3CRQ A;  2IJJ A;  3IJ4 A;  4DV3 O;  2B9Z A;  4F6R B;  3G6E V;  1THZ A;  2LP7 A;  3AK3 A;  4JAS A;  1WPX A;  2DYR C;  4DR3 O;  1SQP H;  5IT9 N;  2BOB C;  3K5O A;  4LC1 A;  3UCS C;  2BE3 A;  5J2U B;  3QG5 A;  4OGQ B;  5B1N A;  4JZG A;  4DV6 B;  3HKD A;  1V55 C;  2OWO A;  3D36 C;  4B3T O;  4JYA B;  1B3Q A;  1W0J G;  5IYD O;  2HJD A;  4GKK B;  3MAQ A;  4X64 B;  2EIL C;  3ASO C;  2EBO A;  1R3I C;  3E86 A;  1BCC H;  4JI3 B;  1BQ0 A;  5BR8 B;  2QM4 A;  4UCU A;  3OD4 A;  3JAR B;  3WG7 C;  1SQQ H;  4JI6 B;  4TQF A;  3FX7 A;  2YI9 A;  4JAV A;  1R3L C;  1JQ0 A;  3K5M A;  3FAV A;  4LF8 O;  3G71 V;  1L0N H;  1VP7 A;  2EIK C;  5CA3 A;  1VQ5 V;  2DQ3 A;  2EX3 A;  4KHP O;  1JJ2 U;  3M99 B;  3JD2 A;  4GYC B;  3RYH A;  2GHY A;  3ETE A;  3OFN G;  4NVP A;  1AB3 A;  1OCC B;  3GVM A;  1NH2 B;  1B04 A;  3MDS A;  1WAZ A;  1MA1 A;  3CS5 A;  2YUA A;  1CXZ B;  3KKY A;  2EUL A;  1PNL A;  3VQV A;  2BSK B;  2OIE A;  3K58 A;  1K8A W;  2WPD G;  3ZMU A;  4DR3 B;  1E1R G;  5J9P C;  4JI1 O;  5EZY A;  4KUM A;  2L6L A;  3E8G A;  5TIS Z;  4B3S O;  2FB5 A;  4MVZ A;  3T1Y O;  4B3T B;  4ZI7 A;  5L3D A;  1RFY A;  4ZHQ A;  2QWQ B;  2YIA A;  3LSS A;  4PDM A;  3CMA V;  2WLL B;  4F6E A;  1TUB B;  4JPR A;  4UCO A;  1WN7 A;  5FNV A;  4MVM A;  1BE3 H;  2ZNJ A;  3CCL V;  3AG3 C;  4P9O A;  3JAW B;  4X65 B;  4PD4 F;  2JK5 C;  1BMF G;  4MTO A;  3MD0 A;  4DV1 B;  3ZN1 A;  1I5Y A;  1KD1 W;  3H01 A;  4KHP B;  3OTO B;  1O9H A;  3VQW A;  3J81 N;  2JVD A;  1F7Y A;  4JI7 O;  5CBG A;  1NQT A;  2Q69 A;  3HKC A;  2MK3 A;  1LNQ A;  3DC5 A;  5CMU A;  5B5E Z;  3JAL A;  4YXW G;  2AHY A;  4PA7 A;  2KSD A;  1NH2 D;  1S77 D;  4H33 A;  4PJ0 Z;  1WA8 A;  1Y76 B;  2CGN A;  2BTO A;  4JTD B;  1RP3 B;  1GM9 A;  2P5O A;  5LOV B;  4JI1 B;  4FMT A;  1FXK A;  4J7J A;  2ADP A;  4B3S B;  5B1B C;  5H6R A;  1LR1 A;  1R3J C;  3FYE B;  5DED A;  3ZN0 A;  3OGI B;  3K79 A;  5BMV B;  2IU3 A;  5J2T A;  3DXR A;  5LA6 A;  4TUY A;  1S3J A;  3ZRV A;  5CA0 A;  1DF4 A;  4UV8 A;  2E3C A;  1L8D A;  5CB4 A;  4O4J A;  1KKC A;  1RPO A;  1VQO V;  4PV1 B;  4QE7 A;  4X1I B;  4X62 O;  2UUC B;  4FM0 A;  4U3J A;  1ZTE A;  5GON B;  3OM3 B;  1H2N A;  4I0X A;  1QLN A;  1TVK A;  5L3F A;  3VQY A;  4JV5 O;  1WP7 A;  1F23 A;  1YHQ V;  4FFB A;  4HNA B;  3ZHT A;  3HKB B;  1YTF B;  4D7T A;  4DK0 A;  5B3S B;  2E5L O;  1JCH A;  4PDV A;  4X9Q A;  2IBZ H;  3BY6 A;  1KMI Z;  2W0F C;  2YI8 A;  2X0L A;  1GN4 A;  3T4D A;  2AGA A;  1M56 C;  1KYO F;  3K08 A;  4X20 B;  5BY1 A;  4H13 B;  3SJB C;  4FLW A;  1QR9 A;  1FFX B;  5LHH A;  3KG2 A;  4RWU A;  2K9P A;  4DV5 O;  3D8C A;  3F7Y C;  1WPB A;  2A06 H;  5LBQ A;  1SF9 A;  4DV4 O;  1A32 A;  4GKJ O;  3ABU A;  4MW3 A;  1SA0 B;  3CX5 F;  4WF9 V;  1V9P A;  3G67 A;  2ETN A;  3D3Q A;  3BEH A;  5FPR A;  2KB1 A;  2JGU A;  2BCC H;  1Q7Y W;  1Q6H A;  5B3S C;  3JCZ A;  4X62 B;  1S72 V;  3Q4H A;  3WB1 A;  3QTC A;  4O4I A;  5C8Y B;  2ZCE A;  2KQX A;  2PGG A;  4QGP A;  3JAK B;  1F4N A;  1TUE B;  3ZHS A;  3B8N A;  4UB8 Z;  3BHP A;  4FIP C;  4CC5 A;  3K04 A;  3VOU A;  5JH7 A;  4CS4 A;  5LP6 A;  2O57 A;  4YY3 O;  3K3W A;  1KP2 A;  3ML0 A;  2UU9 O;  1XI1 A;  1FFT B;  4JI4 O;  2XAF A;  4RAI A;  1YTF D;  1WLE A;  4X1K A;  1AR1 B;  4OX9 O;  1M57 C;  1EBO A;  2DWD C;  4AQY B;  3G4S V;  3OT7 A;  4PEL A;  4FLU A;  1XOU A;  2LO1 A;  2R9R B;  4ICG A;  1XHX A;  2E76 B;  2NLJ C;  2QWN B;  4KL1 A;  3AK1 A;  4I55 B;  3WU2 Z;  4EFE A;  3B8M A;  1YI2 V;  1YIJ V;  5IYZ A;  4J7Z A;  4OXS A;  3ZRW A;  3ABL C;  3OEE G;  2HKO A;  1J95 A;  4DV5 B;  4H0L B;  4MTF A;  2OIG A;  2PUS A;  3JD1 A;  5HFL A;  1M90 W;  5EC2 C;  1PNM A;  4CBC A;  4K8Z A;  4DV4 B;  1JOY A;  3K0D A;  4GKJ B;  1JJO A;  2OTJ V;  2L35 A;  2P4V A;  2WLI A;  3L72 H;  4DRX B;  4MTG A;  4DXW A;  4H44 B;  5ITZ A;  2XAJ A;  1XEQ A;  3RWR D;  2ZNI A;  1TA8 A;  2WLN A;  5K1P A;  1ZX3 A;  3JAM N;  1SZT A;  5C93 A;  4WBN A;  2A9H A;  3F5W C;  4UVC A;  4W4K A;  5JWP A;  4LFC O;  2HHH B;  4LWS B;  4DK1 A;  1AR5 A;  1MZE A;  4DR6 O;  1H8E G;  2EIN B;  5CBH A;  4DR7 O;  2WA3 A;  5H2F Z;  1GK9 A;  2JJ2 G;  4CS3 A;  3B4S A;  4GX0 A;  2DQ0 A;  5L3G A;  4JI4 B;  2DN9 A;  2XUM A;  4OX9 B;  4MSW C;  2EIJ B;  1JPX A;  2YXL A;  1ZLZ A;  3SPJ A;  4GLX A;  4J9Y B;  2NN4 A;  1E79 G;  1B6Q A;  1Y74 A;  4Z2W A;  2KG7 B;  3E22 A;  4YJ3 A;  4KFM A;  2Q67 A;  3WB2 A;  1BS3 A;  2RMK B;  1BT8 A;  4FPP A;  3SYQ A;  4EKW A;  3G80 A;  3EXA A;  5LGT A;  2IJH A;  4FZ1 A;  2Q5Z A;  1PV0 A;  5LXT B;  2E75 B;  2ZIO A;  3SPH A;  1YJW V;  4JF3 A;  3ETD A;  4B7K A;  5B1A B;  1R1B A;  3JAT A;  1SQX H;  3AG2 B;  1RM1 B;  4P9P A;  1NTM H;  3TET A;  2A0L A;  1B06 A;  1XRE A;  1GMG A;  5L3B A;  4J10 A;  2EIN C;  3BAB A;  3LSQ A;  4J80 A;  4LP8 A;  4HBN A;  4P2Z A;  1UPG A;  2CUG A;  5LP6 C;  1HNW O;  4FVM A;  2DYR B;  2F95 B;  1Q82 W;  4TV8 B;  1Q3E A;  2EIJ C;  3UO2 A;  1YSC A;  3JD3 A;  4BIO A;  5EBL C;  4JGS A;  5KUM A;  1OCO C;  2EIM C;  4LFC B;  2EJR A;  3T1H O;  3K06 A;  1AI5 A;  2DW4 A;  5L3E A;  1W0K G;  3BA8 A;  4DR6 B;  3CWB H;  4DR7 B;  1QNM A;  3PJS K;  1VF5 B;  4BIZ A;  2IJK A;  3ASO B;  3K5L A;  2RDC A;  5LL6 Y;  1VQK V;  5KX5 B;  3DC6 A;  3RYF A;  3WG7 B;  1GN3 A;  1Q8I A;  5B1A C;  3OR7 C;  1YDX A;  3B40 A;  2D2C B;  4D6T H;  4O2B A;  1SER A;  1BHB A;  1WNS A;  4JAU A;  3L75 H;  3RYC A;  3J7A U;  4DV0 O;  2EIK B;  1XBL A;  2R72 A;  3CB2 A;  2CTW A;  3C3S A;  3RYI B;  4P30 A;  3HKE A;  3RGB A;  3ZJZ A;  2HFE C;  3TCU A;  1N32 O;  1QLE B;  2RJZ A;  1GRJ A;  2A7W A;  4ZIB A;  3E2E A;  5JVD B;  3A0R A;  2UXD O;  2BTQ A;  3OEH G;  1GAX A;  5JCO A;  1XMO B;  1HWY A;  2M7W A;  2FML A;  2FL4 A;  5IJ0 A;  4IL6 Z;  2YID A;  1FXH A;  2UXC O;  5CA1 A;  1IZ3 A;  2CH7 B;  1K92 A;  1VQL V;  3MHH C;  4DR2 O;  4OPH A;  1HNW B;  3FB6 C;  2YXH A;  2LFS A;  1Y67 A;  4LF9 O;  4JI5 O;  3UT5 B;  2WLL A;  1TUB A;  1IX9 A;  1XDC A;  4IGG A;  3T1H B;  2CE4 A;  5E1A C;  1AVM A;  1Y4M A;  2Q0A A;  4K35 A;  4RO2 A;  5LYJ B;  4BW9 A;  3PN1 A;  3HPL C;  3EVK A;  1GH6 A;  3P32 A;  2CTQ A;  1YXB A;  2NR5 A;  4O2A A;  2ATK C;  1EN4 A;  1VMG A;  3ABK B;  1VF6 C;  4HYO A;  4ZOL A;  1EFR G;  1QLE C;  3AG3 B;  3BRC A;  4DV7 O;  2X6A A;  4O4H B;  2CK3 G;  3ZMT A;  2F1M A;  1H2M A;  4LNU A;  4BWA A;  3QF7 A;  1QQC A;  3L70 H;  2Y4T A;  1VQ9 V;  2F43 G;  4DV0 B;  4JYC A;  1CEZ A;  1KQS U;  4XDL A;  2QWR B;  4DV3 B;  2H94 A;  4Q20 A;  3SYA A;  3UKM A;  3RFR A;  1G8M A;  2LFR A;  1N32 B;  1NKD A;  1P84 F;  3F7V C;  4B3R O;  3FYI B;  5BZB A;  2CTR A;  3SPI A;  4X1Y A;  2WA4 A;  3LUT B;  4LF6 O;  4DW1 A;  2UXD B;  4FLT A;  1BQZ A;  4AIL C;  3DTU B;  2ZDI C;  3JAS A;  3IC9 A;  4JI2 O;  4LH6 A;  1CPY A;  3AEI A;  3N27 A;  2PZS A;  2UXC B;  1N36 O;  1NI8 A;  3RVY A;  1N34 O;  1FJG O;  4TQD A;  3CSX A;  3P3N A;  4FLV A;  1ENV A;  3ABK C;  4QPK A;  1RPR A;  2QA4 V;  1IVS A;  4LF9 B;  5H9C A;  3JYC A;  3CCQ V;  2X6B A;  4K0K O;  4IIJ B;  1AIL A;  3E8F A;  4JI5 B;  2PI5 A;  4IHJ A;  4EFB A;  4TSF G;  4KXR A;  1NU1 H;  4U3F H;  3M7M X;  5IDJ A;  5B1B B;  3E8B A;  2Q6A A;  2ZE8 A;  4LF8 B;  1HR0 O;  2UXB O;  3FAV B;  2JGD A;  5IE9 A;  2QWO B;  1M1K W;  2GUZ A;  1XL6 A;  3S3X A;  2YDE A;  4NXN O;  4RUE A;  3OTF A;  1COW G;  5GON A;  1H2G A;  4DV7 B;  2WLM A;  2VS0 A;  2CDY A;  1E1Q G;  1GN6 A;  2FYU H;  1NJI W;  1EN6 A;  2ITD C;  2QSA A;  3CHX A;  4AI8 A;  5JCO C;  4BAY A;  4BR6 A;  4FK5 C;  1UJW B;  4WFG A;  1K4D C;  5IYB O;  1QHT A;  1JMK C;  2LJ2 A;  1SKV A;  3A0H Z;  1VQ4 V;  4I4T A;  5KHI A;  3CP1 A;  5D5Q A;  4B3R B;  1VQM V;  3OMA B;  4FLX A;  3E89 A;  3GB7 C;  4B08 A;  3BVO A;  4MTX A;  5EZY B;  2XAH A;  4X20 A;  3T1Y B;  1M5I A;  1F4M A;  3ZX6 A;  4IYH A;  2ZE7 A;  1M56 B;  1N36 B;  1N34 B;  1FJG B;  3ZRS A;  4ZHQ B;  1HNZ O;  4YJ2 B;  4TV9 A;  3R65 A;  4X88 A;  3ZHR A;  3H1L H;  1QCE A;  1SQF A;  1URF A;  5LHI A;  5FNV B;  4EB6 A;  1KBH A;  1S0V A;  1R3K C;  4FZ0 A;  3L71 H;  1SA0 A;  1IXM A;  4FJC C;  3CRA A;  1IBL O;  1HR0 B;  3QO8 A;  4LF4 O;  2UXB B;  2QGN A;  1U96 A;  1O9G A;  3FB5 C;  1XNR O;  3ZHQ A;  4DYL A;  3KCY A;  2Z0A A;  1CP9 A;  2N74 A;  4JI7 B;  4NXN B;  4UCT A;  4X66 O;  2B1I A; 
#chains in the Genus database with same CATH homology
 1HP8 A;  2HP8 A;  2RNB A;  2LQT A;  1Z2G A;  1U96 A;  2LGQ A;  1U97 A;  2RN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...