2LGQA

Human c30s/c59s-cox17 mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
b'GSFTMPGLVDSNPAPPESQEKKPLKPCCASPETKKARDACIIEKGEEHCGHLIEAHKESMRALGFKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase copper chaperone
publication title Functional role of two interhelical disulfide bonds in human cox17 protein from a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 11
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 2lgqA00
1U96A 2RNBA 2RN9A 1Z2GA 1U97A 2HP8A 2LGQA 2LQTA 1HP8A
chains in the Genus database with same CATH superfamily
3QO7A 3ZN1A 2OYQA 1N33O 2JRIA 1Q6IA 4I9QA 3K03A 4PA6A 5CA0B 4I50B 1Q43A 1OCOB 1AILA 2DWEC 1OJHA 1ZLZA 4LWSB 4B3RO 5K1XA 3ABMC 2VRZA 4WFGA 5CA1A 2QSAA 4P9PA 3QO8A 1RPOA 1WLEA 1I0HA 2Q7HA 2YS8A 2P7TC 1N33B 5CB4B 2Q4PA 1XL6A 5IYZB 2X0LA 5JVDA 5KHIA 4KHPB 1YCIA 2FL4A 4LR3A 4PA4A 1DF5A 4MTOA 5BMVA 3N2GB 1JJ2U 4Q20A 4B3RB 3KKYA 2F43G 2PUSA 1K97A 5IJ0A 1AP6A 2QE7G 5KA6A 1K34A 2W6IG 4EKWA 2JS5A 3JD0A 4JPRA 4PI0A 3LDDA 3IAYA 3S3WA 1M57B 4LH7A 5GTIZ 1VIBA 3OFNG 3HPLC 1R3KC 2YEVA 3FB7C 3G80A 2ZR2A 3ASOC 2V4DA 3UO3A 1VF7A 2GDSA 4JI1O 1MOFA 1GO3F 3OD4A 1TAEA 4N23A 3SPGA 3TK1A 2IU3A 4DV5B 3MAQA 1H2SB 4LC1A 3UT5B 1XNRO 4I55A 3W7SA 1EBOA 4I4TB 1W59A 2JEUA 4QIWF 5LHHA 2JVDA 3D36A 5KUMA 2XTAA 1M90W 3A0RA 4X1IB 1S0VA 4B3SO 1SQGA 4J41A 2RMKB 4JI1B 4L87A 4FLYA 1T5EA 4YY3O 2WSSG 1YSCA 2YXLA 4DUZO 2Y0PA 1Q3EA 1AI4A 5TISZ 3SYOA 5J2UA 2UXCO 1NH2B 4FK5C 3IGAC 3MDSA 4UCRA 4ZI7A 2P6JA 5FL7G 3ZRWA 3E2EA 1N8RW 3AG3C 4B3SB 4BR6A 1FXKB 4JI5O 5KHHA 3CCEV 1VEWA 5LA6B 3BEHA 4PA7A 3W7WA 5L3FA 4FLWA 4LNUB 2GHYA 4F4LA 3W7UA 1V55C 4H33A 1L8DA 3WB0A 1HNWO 2LW7A 4MW8A 3CCUV 2OCCB 2WAMA 1NI8A 4LF5O 2HG5C 3ABTA 1NVPD 1WB8A 2D3OW 3IJ4A 4R7CA 3CPWU 3OTOO 2BSKB 2QKSA 2ZNJA 4HAMA 3STLC 1WPBA 2G38A 3AK2A 3K06A 4E2LA 3OE7G 5H9CA 1XHXA 4B7KA 1HNWB 4W4LA 4BW5A 3CXCU 4RQFA 3E35A 4O2AA 1Y4MA 1Q86W 2DJVA 5EC2C 4JYAB 4GCZA 3SJCC 4OPAA 2EILC 3G71V 2HFEC 2O57A 1HNZO 1VQOV 3IFXA 2HEPA 1S77D 3JD3A 2Y4UA 5IYBO 5CA1B 1XDCA 5FNVA 2Y4TA 5F2VO 3I5DA 3B09A 1HR0B 3LUTB 1SQXH 4CH5A 2AGAA 3X2QB 4BWAA 2ZE7A 2QM4A 4CH4A 2LGQA 4BIOA 4MVZA 4GKKB 3T4ZA 4H13B 5BMVB 1GK9A 1HNZB 1MZFA 3ICXA 2P90A 4FZ0A 3HKCA 1OCCC 2ZINA 1K92A 3L72H 2H8PC 1VQ7V 1ROPA 3JASA 3MHHC 2KG7A 1AI6A 4O4HA 1N32O 4O4IA 1P7GA 2JGDB 3RFRA 4U3JA 2P4KA 3E86A 5B3SB 2YEVB 3BFRA 3M8AA 1GN2A 3SPJA 4R6ZA 2CE4A 1Q81W 5EC1C 1YIJV 4FPPA 4IIJA 1PL0A 2F95B 3TXQA 2HHHO 1N32B 4F6RA 5GW7A 1RM1C 1R6NA 1KKDA 3JD2A 2OT5A 3T1HO 1PPJH 1P49A 1Y66A 1AR1B 4ZHQB 2GBOA 3F7VC 3ZRXA 5B66Z 2LP7A 1GAXA 5KMGA 3ASNB 2HHHB 3ZHQA 3SR2C 1AI5A 2WA3A 1N34O 2Q8VA 3CRAA 2PYLA 1SC5B 2N05A 1OCRB 4DV1B 3T1HB 4LFAB 1J5EO 5LGTA 4O4JA 2BTQA 2EX3A 2NR5A 2UXBB 1M57C 1GMGA 1K4CC 2QKAA 2AHYA 5KAIZ 1NR7A 3EXAA 1R6TA 4LFBO 1SA0A 1JX9A 5BY1A 1N34B 1K7DA 1FPOA 3FFQA 3P30A 2MK3A 3K0DA 3K79A 2ZDIA 4JF3A 1J5EB 1P7BA 2LQTA 1QBZA 4Z2WA 4JI2B 1N4CA 4MVOA 3I56V 3ZMVA 3ETQA 1YJWV 3JALA 4DRXA 3U11A 4DYLA 1AR5A 3OUSA 2XOKG 2KB1A 5B1AB 4PDMA 1GH6A 2QWNB 3DC6A 1AP5A 5BR8B 1ZWIC 4UCVA 2QWOB 4R50A 1WA8A 2QTOA 3WB1A 2ZM6B 1NH2D 1WP8A 3D8CA 3C3TA 1W2BU 5KHGA 5JJEB 3BHPA 1MA1A 2F23A 5FNVB 1VQ8V 5IJ9B 4UV9A 4DR5O 3OMAB 4DK0A 2K1EA 3MD0A 5KX5A 2QJ1A 2ZXWB 4DV6O 3LDCA 1JOYA 5DN6G 2P5OA 2EIMC 2Z3YA 1A32A 1XREA 4ABMA 2Q7GA 3SPIA 3FB6C 4X66O 4MVMA 2Y69B 2ZIMA 3RVZA 4JI6O 3SYQA 3JASB 3E89A 3DSQA 4O4HB 2GSMB 4DR5B 1AVMA 3RT3C 3CC2V 4NXMO 1XNQO 4LF6B 4X1YB 1RP3B 4Z1MG 2E5LO 1JA8A 3B77A 3BRCA 4BW9A 4DV6B 4ZIBA 2UXXA 2XAFA 3HKEA 4O2BB 4NVPA 1Y67A 5B5EZ 5ITZB 1J95A 1KC8W 1L0LH 4X66B 4DR7O 1M1KW 2A79B 3C3SA 1LUWA 2NLJC 3CEIA 1XNQB 1GTOA 3OUFA 3CHXA 1Q7YW 4TV8A 2W0XA 1P84F 4O4LA 3LNNA 2E5LB 2ITDC 4MS2A 3L71H 5D5PA 3ABUA 1CPYA 2FTKA 2V7QG 4P30A 3CCLV 3WG7C 2Q6AA 4FLUA 2X6CA 1TA8A 4UFZA 4D7TA 1S5HC 4JV5O 3H01A 4DUYO 3X2QC 3T1CA 1AI7A 1IDSA 5KMGB 3JAKB 5J2TA 3JSNA 3VQWA 2OTLV 4FVMA 1QLEC 1VQNV 4DV0O 1I5YA 1I7FA 2XUMA 1K33A 1GN6A 5H5NA 3VBBA 2CK3G 5JCOC 1YDXA 4HYOA 3KCYA 1AJQA 3ZCCA 3J7AU 4DV3O 1Y74A 2A7WA 2FB5A 3JD1A 4DUYB 1W0JG 1UPGA 5DM6V 3PJSK 4WBNB 1SA0B 1YVWA 2Q9LA 1RSOB 2QR4A 4DV0B 5IYDO 4GX1A 4J7ZA 4CH3A 2Q73A 4GX2A 4OPHA 2NN4A 3T1YO 4YJ2B 2HJFC 1MZEA 4IHJA 3AG1B 1UJWB 1TUEB 3OEEG 1GKFA 4MT8A 4C7UA 4K0KO 3ABLB 2EIKB 1HWYA 3JALB 1SF9A 4MVSA 5EBLC 3SPHA 3DXRA 2YI9A 1QNMA 4YXWG 1XHZA 4RAIA 1PL4A 4QE9A 3L74H 5EBMC 4LF7B 2QM8A 3K5NA 3FAVA 4CC5A 2VWJA 4TOIA 1WA8B 1IBKO 2XAHA 5C93A 4K0KB 2H3OA 3CD6V 1TUBB 5A2QN 5IT9N 1D2DA 1OCRC 3B8NA 2AZ2A 1R3LC 1R6KA 3ZHUA 1EZVH 5DECA 5JH7B 1VQ6V 1QHTA 5CN0A 4X1KA 5KX5B 1NKDA 4PDVA 3CCJV 1TVKB 4P2ZA 1H38A 3AK1A 3CB2A 4P9OA 2PF4E 4H37A 2Y0IA 4LFCO 5BXZA 5KUKA 3L9DA 1AR4A 3JATB 4RWUA 1R3IC 4YHHO 5B1NA 1FFXB 2UUAO 3GVMA 3A0BZ 2JJ2G 1CXZB 1UFIA 4PI2A 3N2KA 2IJJA 3UM7A 1LUVA 3ZJZA 4DR2O 1GRJA 4Z1VA 1E79G 2QWRB 5AG2A 1RFYA 3HKEB 4LFCB 2QDOA 4LF9O 1NT2B 3SGIA 2PI5A 2IH3C 3RGBA 2QTSA 4WCEV 4UB6Z 5JJJB 3RYIA 2WLNA 2JEXA 4YHHB 1VF6C 3RYHB 5EK0A 4UCOA 2QM7A 1NTMH 1IURA 1JFFA 4DR2B 4FFBB 3E22A 1HP8A 4X64O 2RCVA 3RYCA 3CCMV 1QR8A 1GN3A 3OAAG 4TV9B 2WLKA 3THOA 4EFEA 1QR9A 2JIZG 2BOBC 3FB8C 1M56B 2Z0AA 3AG2B 3HKDB 4LBEC 1XNRB 4FM1A 3RYFA 1H8HG 3OEHG 3STZC 2KKWA 1K5SA 1Q5OA 3CJHB 3CX5F 2DYRC 1VQPV 1SERA 3K5MA 3SYCA 1U97A 1RPRA 1Y74B 4YY3B 2X7RB 3QO5A 4J9YB 2N74A 2Y48A 4OX9O 4DUZB 5IYCO 1KB9F 1FS0G 1K4DC 1B06A 2UXCB 5L3DA 5CA3A 3WFVA 2LFRA 4TQDA 3HKBB 3RVYA 2ZE6A 2Q67A 4CS4A 1NS1A 1KP3A 4FM0A 1QLNA 3M99B 2QA4V 3UCSC 5IWAO 1VQ4V 1WP7A 4MTGA 3ZN0A 2C2AA 4JI5B 2IBZH 2YDEA 3K5OA 3VQXA 1R3JC 2HKOA 4U7NA 1GN4A 4JI8O 3H1KH 1K5QA 4FIPC 2GUZA 2CH7B 1EZJA 1Z2GA 3ZMUA 2RJZA 1Y76A 4ZOLB 3K04A 3ZS8C 4G28B 2LW1A 5IWAB 3ZIAG 4J7JA 1OV9A 3ETDA 3H1HH 4CS3A 4LF5B 4IGGA 4IL6Z 5BZBA 2XAQA 3AG4B 1NR1A 2EJRA 3Q4HA 2ZD9A 1BSMA 4FM2A 4N21A 4GLXA 3L70H 3QG5A 3OTOB 4MTFA 2Q5ZA 3JAWA 3SJAC 2QGNA 1AJNA 5K1PA 2N04A 4FJCC 4UCTA 1YI2V 4CC6A 3CMAV 4X1KB 1YXBA 5JVDB 2R9IA 5JJNB 1MNGA 3BPZA 5IY5B 1NJIW 1G1XB 4G27B 4JI3O 1ZSPA 2B5UA 5EIBD 2P4VA 4ICGA 5E79Z 5LMNO 1OCZB 3SJQC 5EZYA 1XQ8A 5LP6C 5IJ0B 4B3TO 5H2FZ 3FX7A 3WU2Z 2QEXV 1JJOA 2YIBD 1Q6HA 3AG1C 2EBOA 4JYCA 3G4SV 2EIKC 4JZGA 4PA3A 4MVQA 5LMNB 4JTDB 3QNEA 4J80A 4U7OA 4DK1A 3K5LA 1W0KG 1FJGO 1S76D 3P3NA 1U96A 5FPOA 1I08A 1VARA 3OW2U 2YIDA 4I55B 5GTHZ 1JFFB 1OCOC 2VS0A 3LSQA 1COWG 4FFKA 4JAAA 3SYAA 4BIZA 4WFAV 3RYCB 3E8BA 2ZR3A 3I55V 2Q0AA 2WLIA 1FJGB 4EB6A 2YUAA 4FZ1A 3H9VA 4DXWA 2UXNA 4KP4A 2IJIA 3BY6A 4K35A 1PKXA 4GUNA 1E1RG 5J2UB 4I7ZB 4DV4O 1JVMA 5CBFA 4ZI7B 5GONA 2WLLA 3ZRWB 5IE9A 3J81N 1K8AW 1DGSA 4NTWA 1S5JA 3FKSG 4NKGB 3DGEA 1KKCA 2UUCO 2P22C 1EFRG 4X65O 3VOUA 4PJ0Z 2VWKA 4QGPA 1AJPA 2BE3A 3HB3B 3CC4V 3D3IA 2JK5C 3U0ZA 4GKJO 2CTWA 4NB5A 1B04A 1IXBA 4MVRA 2HR3A 3OGIB 5LL6Y 1H2MA 5LMUO 1VQKV 1KECA 4UVCA 4G2KA 2MW2B 2A0LA 1PNLA 3B40A 2W0FC 2A9HA 2UUCB 2R72A 4X65B 2CTQA 1NTKH 3R65A 2Z5UA 3ZBHA 4QJFB 2GUZB 3GWKC 2VQEO 5HFMA 1CEZA 3C90A 4LFBB 1M4UA 4FLXA 5JQGA 4RO2A 2K9PA 5FLXN 4O2AB 2ILMA 1ORQC 1BGYH 5DEDA 3CP1A 4UCSA 5KLVH 1HW7A 1ZUQA 4PD4F 3M7MX 4TUYA 2EULA 2AXTZ 4QPKA 4LCUC 4B08A 2CAZC 2RN9A 5LXTA 3APOA 2OTJV 4WFEA 2AHZA 3O9OA 2AZ0A 4ZBMA 2LGWA 1L1FA 1FXKC 1XMOO 2E76B 2PTMA 2RNBA 1XL4A 4X62O 4UVBA 5HFLA 4DR3O 2H94A 3HKCB 5EZYB 1O9HA 3OM3B 2Q0OC 4JGSA 2OCCC 3HR0A 1ENVA 2KG7B 2IU0A 4H0LB 4BIUA 1US6A 1IVSA 1KYOF 4WFFA 1XMOB 4O4IB 4JI0O 2DW4A 4U3JB 4PHZA 2UU9O 3CYOA 4DO2A 1URFA 4KL1A 1DLBA 2DQ3A 4X89A 3N2GA 3RW0A 2D2CB 3TJTA 5A9GA 1M93A 2YC0A 3AG3B 4DR3B 1FXHA 4IIJB 3CRCA 3GB7C 5L3GA 3ZEDA 4JI6B 2YXYA 2V1DA 3FB5C 1F51A 4W4KA 1V55B 4NXMB 1XBLA 1Q82W 4JI4O 4F6RB 4ASUG 4JI0B 1YHQV 4GX0A 1FYJA 1KQSU 4DV7O 2EZPA 3JARA 2WLIB 4J7KA 1IBLO 2EIJB 2CDYA 4DR7B 3UT5A 1VQ5V 4TSFG 4CBCA 4PDLA 4A5UB 4MSWC 3ETGA 4JI4B 1M9NA 4AQYO 3BABA 4XDLA 1BL8A 4MW3A 2YI8A 4X1IA 3OMNB 3K58A 2CTRA 2E3CA 4HZ3A 1F4NA 2Q7EA 4XDJA 3EFFK 4O4JB 2HVJC 2BTQB 4JV5B 2EILB 1IBLB 4RUFA 3OR6C 1H2LA 5B3SC 4I0XA 4DR1O 5FPRA 2PGGA 3R66A 4AQYB 4J9ZB 1SS3A 2JDIG 4GT1A 2VQFO 1F23A 3ML0A 2X6AA 1FXKA 2PYJA 3J80N 3AEIA 1WB7A 4LNUA 3OGCC 4DV3B 1PP9H 2WA4A 2A3QA 3CSXA 4DW1A 5L3EA 2IJHA 1KD1W 1E1QG 1WAZA 4DR1B 2WPDG 3ZRVA 3K59A 5LXTB 1AB3A 3B2EE 4DRXB 1FKAO 4TT3G 3CCQV 1QVFU 3T1YB 2B1IA 2B1GA 2DN9A 4HNAA 1SESA 3AK3A 4WFBV 2F93B 3QVNA 2BSKA 3ZHTA 4D6TH 4JAVA 2IW5A 2XAGA 3ASNC 4KUMA 4FMTA 1YEWA 2BTOA 4KHPO 4UXNA 4LH6A 3DTUB 2UXDO 3ABKB 3E8GA 2IH1C 1MMMA 1KU9A 5KHKA 3CXHF 2E75B 5L3BA 1RM1B 3S3XA 1IBKB 2M7WA 1ZTEA 2ATKC 4X9QA 4NR1A 3CRRA 3CCSV 1L0NH 4UV8A 4JTCB 4JI7O 1K9MW 5KHJA 4YJ3A 2AW9A 4QPJA 3AG7A 3KG2A 2UXDB 2DE0X 2IM9A 2ZE5A 2FKXA 4JTAB 4B3MO 4EEQA 3JSLA 4CH6A 2DOSA 5JCOA 4JZ2A 3G6EV 3CRMA 4DV5O 1Q8IA 2A06H 4DR6O 1PNKA 4JI7B 5B1AC 1BHBA 2OIEA 3LNMB 2UUAB 2JGDA 4OXSA 2LJ2A 2ZT9B 1OHHG 4AI8A 1SQQH 4TV8B 3RWRD 4O4LB 3SDLA 4KXRA 3TGUH 2R9AA 1F7YA 1XEQA 4LP8A 4WFHA 3CC7V 2RDCA 4B3MB 2ARHA 5IDJA 2JJ1G 2F1MA 5D5QA 1HNXO 3JARB 2QWPB 3PN1A 3OR7C 4LF9B 1XI1A 1IX9A 2ZE8A 2WWWA 2M6YA 1XILA 4IYHA 2UUBO 4DR6B 3O65A 2F66C 2PI4A 4PA9A 3ZMZA 2ZXWC 4H44B 1I94O 5J2TB 2NNUA 2XNDG 3BVOA 4R8CA 1KBHA 5CBGA 1ZAUA 5EYPA 4X64B 4UCUA 1LR1A 3RBZA 1HNXB 2Y69C 4ZHQA 1DTOA 2OIGA 3N27A 2QKCA 3K9AA 1EN6A 2UUBB 3NXSA 1YZBA 4I0XB 1KUQA 1N0NA 1SQPH 1I94B 3T4DA 1IBMO 2GV9A 3SPCA 2EINB 4K3AA 2EJ7A 3ZX6A 5J9PC 1DK1A 3G6BA 1Y6XA 4KFMA 4CZZA 4IHJB 1NZ6A 1VMGA 3E8FA 2EIMB 2CGOA 3MHSC 5H6RA 4OX9B 3CS5A 3KZIZ 1IBMB 1VQMV 2R70A 2FMLA 4JYAO 3G67A 3DXRB 5LHIA 1WPXA 2EIJC 1FXVA 4J11A 4HNAB 3F5TA 3FAVB 4X20A 3FD9A 2ZIOA 1PD3A 3H1IH 2L6LA 1OZ0A 1SETA 5LGNA 1VF5B 3SJBC 4UB8Z 2HJDA 4JI8B 3UO2A 3F5WC 2IJKA 2OCHA 3P3PA 1NU1H 1ZL8A 4MVUA 3ZHVA 1HR0O 2BOCC 1B6QA 1Z5WA 3H1LH 1MABG 5KA5A 2DMXA 2YSUB 4GKKO 2LO1A 1VF6A 1H2KA 3F7YC 1EM1A 5LOVA 1ZX3A 1GM7A 3B4SA 5EIBC 3L73H 4UVAA 1WNSA 4DW0A 1NQTA 5C8YA 3WG7B 3GWOA 2ODMA 5IJ9A 5H6QA 1JPXA 1VQLV 4DV2O 1XMQO 4PV1B 2ZDIC 4YJ3B 1X59A 2ZCEA 2ZKOA 4GX5A 3N2KB 1QLEB 1N0JA 1SQFA 2WLMA 4JI3B 3ABLC 1Q90D 1D5AA 3QTCA 3NR7A 1D5NA 2GTSA 3RN4A 2P67A 2ETNA 1NTZH 3RYIB 4B3TB 4TWKA 4X1YA 4DV2B 1XMQB 2KSDA 1BE3H 5KAFZ 2B9ZA 4F6EA 2OWOA 1SRYA 3H1JH 3E22B 1LNQA 5LYJA 4QNHB 4O2BA 3SYPA 3OMIB 5B1BB 3CCRV 5ITZA 4WF9V 1O9GA 1G4YB 3EHBB 3A8TA 1YTFB 3JD4A 1MSDA 4IT5A 1BCCH 4PDRA 1S3JA 3TCUA 2R9RB 3ABKC 1BMFG 3TETA 2DYSB 4MTXA 3UKMA 4YIPA 3OT7A 3RYFB 3ZHSA 1V54B 3K57A 5EYPB 4DV1O 1BHAA 3JCUZ 4TQFA 4LFAO 3K08A 4XDKA 2UXBO 1DF4A 3BAAA 4FLTA 3VQYA 2HVKC 1YJ9V 3JAKA 4DV4B 3ABMB 3K0GA 3CE2A 4DR4O 4U3FH 3BCCH 3LDEA 1SQVH 4EFBA 2L35A 4JI2O 3ETEA 4JASA 3CCVV 4B7EA 4RUEA 3CMEV 1QCEA 1YJNV 1BQ0A 4WBNA 1BZKA 1R1BA 4Q6GA 4GKJB 1RSOA 3T2MA 1THZA 1SZTA 1R73A 5LP6A 3CWBH 1Y76B 1H8EG 1Q6UA 4JYYA 5BR8O 1TGOA 5LMUB 4YJ2A 4LF8O 4DR4B 2YIBA 1M5IA 4X20B 1G8MA 3Q4HB 2ZM6O 1JR9A 1M56C 3D3QA 1MSWD 1VQ9V 1FAFA 3AG2C 4I5SA 4K8XA 3K3WA 1FD9A 2ITCC 3ASOB 1N36O 1EN5A 3JAWB 3E8HA 2VQEB 3EVKA 1ZL8B 3BA8A 1GM8A 4GYCB 2Q69A 3FYIB 4BAYA 1X4TA 3ZMTA 5CBHA 2Q68A 5B1OA 4LF8B 5LOVB 4FLZA 2DQ0A 1XUQA 2CGNA 4J42A 5CA0A 1CP9A 4I50A 4LWSA 2DWDC 5C8YB 2E74B 1N36B 1TUBA 2EINC 4D7SA 2YIAA 4J10A 5L3CA 1G6UA 5LGUA 3L75H 2PZSA 3P32A 2XASA 2GTAA 5JH7A 4LF6O 4CS2A 3W7TA 5CB4A 3K9SA 5IYZA 2CUGA 4NTYA 3FYEB 1NBMG 1TVKA 2BCCH 2HLDG 3WB2A 1KP2A 1WN7A 1PV0A 4IYIA 4X62B 2W6JG 1QU7A 4OGQB 2DYRB 1QQCA 3E83A 4NYKA 3JAMN 1PNMA 3OTFA 1IZ3A 3JATA 3APQA 3B8MA 2PY5A 3VQVA 1FFXA 2EZOA 5JWPA 5LBQA 2WLJA 4RQEA 1XOUA 1QVGU 1BT8A 2YXHA 3AG4C 2FYUH 2JGUA 2UU9B 4UUJC 5LYJB 1PM9A 2ADQB 4JAUA 4GZRB 4PELA 1NVPB 1V9PA 1KMIZ 4LF4O 4FLVA 1HDJA 4EB6B 1FFTB 2LFSA 3RYHA 2XHBA 2XT9A 5EBWC 5IY5C 4I4TA 4FFBA 1SZXA 4X88A 1BS3A 3ZHRA 5GONB 2WLLB 4K8ZA 1Z5VA 2HP8A 3IC9A 2ADPA 1OCZC 1WJZA 5E1AC 4DV7B 4TV9A 4X8AA 3BA9A 4LF4B 4YIOA 4E4EA 1S72V 4XBFA 1P4RA 1JCHA 3A0HZ 2XAJA 3HKDA 3KCXA 4NXNO 4L8JA 4AILC 3U10A 1JMKC 1IXMA 4QE7A 3A2FA 3ZMSA 1GM9A 1S5LZ 3CRQA 3LSSA 2P06A 3JYCA 3CJHA 3ZRSA 4AHCA 1AROP 1K3EA 2ZQMA 3LSUA 3TXSA 2KQXA 1I5XA 2YICA 3UQ8A 5LA6A 4ZKIA 2F4VO 3DC5A 4JYBA 4I9WA 1EN4A 4NXNB 1F4MA 4HBNA 2WLHA 1H2GA 3HKBA 1OCCB 2QWQB 5LP6B 3QF7A 1H2NA 1BQZA 5JQGB 3D36C 4NTXA 5B1BC 1B3QA 3W7XA 2VQFB 4LF7O 3IC7A 1YTFD 1SQBH 2X6BA 2F4VB 1JQ0A 2ZNIA 5LHGA 3JCZA 1VP7A 1SKVA 5CMUA 2DYSC 1YF2A 4TUYB 1MG1A 2CTPA 2CH7A 1K73W 2RQ6A 1V54C 1YITV 2JS3A 4ZOLA
chains in the Genus database with same CATH topology
1U96A 2RNBA 2RN9A 1Z2GA 1U97A 2HP8A 2LGQA 2LQTA 1HP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U96 A;  2RNB A;  2RN9 A;  1Z2G A;  1U97 A;  2HP8 A;  2LGQ A;  2LQT A;  1HP8 A; 
#chains in the Genus database with same CATH topology
 3QO7 A;  3ZN1 A;  2OYQ A;  1N33 O;  2JRI A;  1Q6I A;  4I9Q A;  3K03 A;  4PA6 A;  5CA0 B;  4I50 B;  1Q43 A;  1OCO B;  1AIL A;  2DWE C;  1OJH A;  1ZLZ A;  4LWS B;  4B3R O;  5K1X A;  3ABM C;  2VRZ A;  4WFG A;  5CA1 A;  2QSA A;  4P9P A;  3QO8 A;  1RPO A;  1WLE A;  1I0H A;  2Q7H A;  2YS8 A;  2P7T C;  1N33 B;  5CB4 B;  2Q4P A;  1XL6 A;  5IYZ B;  2X0L A;  5JVD A;  5KHI A;  4KHP B;  1YCI A;  2FL4 A;  4LR3 A;  4PA4 A;  1DF5 A;  4MTO A;  5BMV A;  3N2G B;  1JJ2 U;  4Q20 A;  4B3R B;  3KKY A;  2F43 G;  2PUS A;  1K97 A;  5IJ0 A;  1AP6 A;  2QE7 G;  5KA6 A;  1K34 A;  2W6I G;  4EKW A;  2JS5 A;  3JD0 A;  4JPR A;  4PI0 A;  3LDD A;  3IAY A;  3S3W A;  1M57 B;  4LH7 A;  5GTI Z;  1VIB A;  3OFN G;  3HPL C;  1R3K C;  2YEV A;  3FB7 C;  3G80 A;  2ZR2 A;  3ASO C;  2V4D A;  3UO3 A;  1VF7 A;  2GDS A;  4JI1 O;  1MOF A;  1GO3 F;  3OD4 A;  1TAE A;  4N23 A;  3SPG A;  3TK1 A;  2IU3 A;  4DV5 B;  3MAQ A;  1H2S B;  4LC1 A;  3UT5 B;  1XNR O;  4I55 A;  3W7S A;  1EBO A;  4I4T B;  1W59 A;  2JEU A;  4QIW F;  5LHH A;  2JVD A;  3D36 A;  5KUM A;  2XTA A;  1M90 W;  3A0R A;  4X1I B;  1S0V A;  4B3S O;  1SQG A;  4J41 A;  2RMK B;  4JI1 B;  4L87 A;  4FLY A;  1T5E A;  4YY3 O;  2WSS G;  1YSC A;  2YXL A;  4DUZ O;  2Y0P A;  1Q3E A;  1AI4 A;  5TIS Z;  3SYO A;  5J2U A;  2UXC O;  1NH2 B;  4FK5 C;  3IGA C;  3MDS A;  4UCR A;  4ZI7 A;  2P6J A;  5FL7 G;  3ZRW A;  3E2E A;  1N8R W;  3AG3 C;  4B3S B;  4BR6 A;  1FXK B;  4JI5 O;  5KHH A;  3CCE V;  1VEW A;  5LA6 B;  3BEH A;  4PA7 A;  3W7W A;  5L3F A;  4FLW A;  4LNU B;  2GHY A;  4F4L A;  3W7U A;  1V55 C;  4H33 A;  1L8D A;  3WB0 A;  1HNW O;  2LW7 A;  4MW8 A;  3CCU V;  2OCC B;  2WAM A;  1NI8 A;  4LF5 O;  2HG5 C;  3ABT A;  1NVP D;  1WB8 A;  2D3O W;  3IJ4 A;  4R7C A;  3CPW U;  3OTO O;  2BSK B;  2QKS A;  2ZNJ A;  4HAM A;  3STL C;  1WPB A;  2G38 A;  3AK2 A;  3K06 A;  4E2L A;  3OE7 G;  5H9C A;  1XHX A;  4B7K A;  1HNW B;  4W4L A;  4BW5 A;  3CXC U;  4RQF A;  3E35 A;  4O2A A;  1Y4M A;  1Q86 W;  2DJV A;  5EC2 C;  4JYA B;  4GCZ A;  3SJC C;  4OPA A;  2EIL C;  3G71 V;  2HFE C;  2O57 A;  1HNZ O;  1VQO V;  3IFX A;  2HEP A;  1S77 D;  3JD3 A;  2Y4U A;  5IYB O;  5CA1 B;  1XDC A;  5FNV A;  2Y4T A;  5F2V O;  3I5D A;  3B09 A;  1HR0 B;  3LUT B;  1SQX H;  4CH5 A;  2AGA A;  3X2Q B;  4BWA A;  2ZE7 A;  2QM4 A;  4CH4 A;  2LGQ A;  4BIO A;  4MVZ A;  4GKK B;  3T4Z A;  4H13 B;  5BMV B;  1GK9 A;  1HNZ B;  1MZF A;  3ICX A;  2P90 A;  4FZ0 A;  3HKC A;  1OCC C;  2ZIN A;  1K92 A;  3L72 H;  2H8P C;  1VQ7 V;  1ROP A;  3JAS A;  3MHH C;  2KG7 A;  1AI6 A;  4O4H A;  1N32 O;  4O4I A;  1P7G A;  2JGD B;  3RFR A;  4U3J A;  2P4K A;  3E86 A;  5B3S B;  2YEV B;  3BFR A;  3M8A A;  1GN2 A;  3SPJ A;  4R6Z A;  2CE4 A;  1Q81 W;  5EC1 C;  1YIJ V;  4FPP A;  4IIJ A;  1PL0 A;  2F95 B;  3TXQ A;  2HHH O;  1N32 B;  4F6R A;  5GW7 A;  1RM1 C;  1R6N A;  1KKD A;  3JD2 A;  2OT5 A;  3T1H O;  1PPJ H;  1P49 A;  1Y66 A;  1AR1 B;  4ZHQ B;  2GBO A;  3F7V C;  3ZRX A;  5B66 Z;  2LP7 A;  1GAX A;  5KMG A;  3ASN B;  2HHH B;  3ZHQ A;  3SR2 C;  1AI5 A;  2WA3 A;  1N34 O;  2Q8V A;  3CRA A;  2PYL A;  1SC5 B;  2N05 A;  1OCR B;  4DV1 B;  3T1H B;  4LFA B;  1J5E O;  5LGT A;  4O4J A;  2BTQ A;  2EX3 A;  2NR5 A;  2UXB B;  1M57 C;  1GMG A;  1K4C C;  2QKA A;  2AHY A;  5KAI Z;  1NR7 A;  3EXA A;  1R6T A;  4LFB O;  1SA0 A;  1JX9 A;  5BY1 A;  1N34 B;  1K7D A;  1FPO A;  3FFQ A;  3P30 A;  2MK3 A;  3K0D A;  3K79 A;  2ZDI A;  4JF3 A;  1J5E B;  1P7B A;  2LQT A;  1QBZ A;  4Z2W A;  4JI2 B;  1N4C A;  4MVO A;  3I56 V;  3ZMV A;  3ETQ A;  1YJW V;  3JAL A;  4DRX A;  3U11 A;  4DYL A;  1AR5 A;  3OUS A;  2XOK G;  2KB1 A;  5B1A B;  4PDM A;  1GH6 A;  2QWN B;  3DC6 A;  1AP5 A;  5BR8 B;  1ZWI C;  4UCV A;  2QWO B;  4R50 A;  1WA8 A;  2QTO A;  3WB1 A;  2ZM6 B;  1NH2 D;  1WP8 A;  3D8C A;  3C3T A;  1W2B U;  5KHG A;  5JJE B;  3BHP A;  1MA1 A;  2F23 A;  5FNV B;  1VQ8 V;  5IJ9 B;  4UV9 A;  4DR5 O;  3OMA B;  4DK0 A;  2K1E A;  3MD0 A;  5KX5 A;  2QJ1 A;  2ZXW B;  4DV6 O;  3LDC A;  1JOY A;  5DN6 G;  2P5O A;  2EIM C;  2Z3Y A;  1A32 A;  1XRE A;  4ABM A;  2Q7G A;  3SPI A;  3FB6 C;  4X66 O;  4MVM A;  2Y69 B;  2ZIM A;  3RVZ A;  4JI6 O;  3SYQ A;  3JAS B;  3E89 A;  3DSQ A;  4O4H B;  2GSM B;  4DR5 B;  1AVM A;  3RT3 C;  3CC2 V;  4NXM O;  1XNQ O;  4LF6 B;  4X1Y B;  1RP3 B;  4Z1M G;  2E5L O;  1JA8 A;  3B77 A;  3BRC A;  4BW9 A;  4DV6 B;  4ZIB A;  2UXX A;  2XAF A;  3HKE A;  4O2B B;  4NVP A;  1Y67 A;  5B5E Z;  5ITZ B;  1J95 A;  1KC8 W;  1L0L H;  4X66 B;  4DR7 O;  1M1K W;  2A79 B;  3C3S A;  1LUW A;  2NLJ C;  3CEI A;  1XNQ B;  1GTO A;  3OUF A;  3CHX A;  1Q7Y W;  4TV8 A;  2W0X A;  1P84 F;  4O4L A;  3LNN A;  2E5L B;  2ITD C;  4MS2 A;  3L71 H;  5D5P A;  3ABU A;  1CPY A;  2FTK A;  2V7Q G;  4P30 A;  3CCL V;  3WG7 C;  2Q6A A;  4FLU A;  2X6C A;  1TA8 A;  4UFZ A;  4D7T A;  1S5H C;  4JV5 O;  3H01 A;  4DUY O;  3X2Q C;  3T1C A;  1AI7 A;  1IDS A;  5KMG B;  3JAK B;  5J2T A;  3JSN A;  3VQW A;  2OTL V;  4FVM A;  1QLE C;  1VQN V;  4DV0 O;  1I5Y A;  1I7F A;  2XUM A;  1K33 A;  1GN6 A;  5H5N A;  3VBB A;  2CK3 G;  5JCO C;  1YDX A;  4HYO A;  3KCY A;  1AJQ A;  3ZCC A;  3J7A U;  4DV3 O;  1Y74 A;  2A7W A;  2FB5 A;  3JD1 A;  4DUY B;  1W0J G;  1UPG A;  5DM6 V;  3PJS K;  4WBN B;  1SA0 B;  1YVW A;  2Q9L A;  1RSO B;  2QR4 A;  4DV0 B;  5IYD O;  4GX1 A;  4J7Z A;  4CH3 A;  2Q73 A;  4GX2 A;  4OPH A;  2NN4 A;  3T1Y O;  4YJ2 B;  2HJF C;  1MZE A;  4IHJ A;  3AG1 B;  1UJW B;  1TUE B;  3OEE G;  1GKF A;  4MT8 A;  4C7U A;  4K0K O;  3ABL B;  2EIK B;  1HWY A;  3JAL B;  1SF9 A;  4MVS A;  5EBL C;  3SPH A;  3DXR A;  2YI9 A;  1QNM A;  4YXW G;  1XHZ A;  4RAI A;  1PL4 A;  4QE9 A;  3L74 H;  5EBM C;  4LF7 B;  2QM8 A;  3K5N A;  3FAV A;  4CC5 A;  2VWJ A;  4TOI A;  1WA8 B;  1IBK O;  2XAH A;  5C93 A;  4K0K B;  2H3O A;  3CD6 V;  1TUB B;  5A2Q N;  5IT9 N;  1D2D A;  1OCR C;  3B8N A;  2AZ2 A;  1R3L C;  1R6K A;  3ZHU A;  1EZV H;  5DEC A;  5JH7 B;  1VQ6 V;  1QHT A;  5CN0 A;  4X1K A;  5KX5 B;  1NKD A;  4PDV A;  3CCJ V;  1TVK B;  4P2Z A;  1H38 A;  3AK1 A;  3CB2 A;  4P9O A;  2PF4 E;  4H37 A;  2Y0I A;  4LFC O;  5BXZ A;  5KUK A;  3L9D A;  1AR4 A;  3JAT B;  4RWU A;  1R3I C;  4YHH O;  5B1N A;  1FFX B;  2UUA O;  3GVM A;  3A0B Z;  2JJ2 G;  1CXZ B;  1UFI A;  4PI2 A;  3N2K A;  2IJJ A;  3UM7 A;  1LUV A;  3ZJZ A;  4DR2 O;  1GRJ A;  4Z1V A;  1E79 G;  2QWR B;  5AG2 A;  1RFY A;  3HKE B;  4LFC B;  2QDO A;  4LF9 O;  1NT2 B;  3SGI A;  2PI5 A;  2IH3 C;  3RGB A;  2QTS A;  4WCE V;  4UB6 Z;  5JJJ B;  3RYI A;  2WLN A;  2JEX A;  4YHH B;  1VF6 C;  3RYH B;  5EK0 A;  4UCO A;  2QM7 A;  1NTM H;  1IUR A;  1JFF A;  4DR2 B;  4FFB B;  3E22 A;  1HP8 A;  4X64 O;  2RCV A;  3RYC A;  3CCM V;  1QR8 A;  1GN3 A;  3OAA G;  4TV9 B;  2WLK A;  3THO A;  4EFE A;  1QR9 A;  2JIZ G;  2BOB C;  3FB8 C;  1M56 B;  2Z0A A;  3AG2 B;  3HKD B;  4LBE C;  1XNR B;  4FM1 A;  3RYF A;  1H8H G;  3OEH G;  3STZ C;  2KKW A;  1K5S A;  1Q5O A;  3CJH B;  3CX5 F;  2DYR C;  1VQP V;  1SER A;  3K5M A;  3SYC A;  1U97 A;  1RPR A;  1Y74 B;  4YY3 B;  2X7R B;  3QO5 A;  4J9Y B;  2N74 A;  2Y48 A;  4OX9 O;  4DUZ B;  5IYC O;  1KB9 F;  1FS0 G;  1K4D C;  1B06 A;  2UXC B;  5L3D A;  5CA3 A;  3WFV A;  2LFR A;  4TQD A;  3HKB B;  3RVY A;  2ZE6 A;  2Q67 A;  4CS4 A;  1NS1 A;  1KP3 A;  4FM0 A;  1QLN A;  3M99 B;  2QA4 V;  3UCS C;  5IWA O;  1VQ4 V;  1WP7 A;  4MTG A;  3ZN0 A;  2C2A A;  4JI5 B;  2IBZ H;  2YDE A;  3K5O A;  3VQX A;  1R3J C;  2HKO A;  4U7N A;  1GN4 A;  4JI8 O;  3H1K H;  1K5Q A;  4FIP C;  2GUZ A;  2CH7 B;  1EZJ A;  1Z2G A;  3ZMU A;  2RJZ A;  1Y76 A;  4ZOL B;  3K04 A;  3ZS8 C;  4G28 B;  2LW1 A;  5IWA B;  3ZIA G;  4J7J A;  1OV9 A;  3ETD A;  3H1H H;  4CS3 A;  4LF5 B;  4IGG A;  4IL6 Z;  5BZB A;  2XAQ A;  3AG4 B;  1NR1 A;  2EJR A;  3Q4H A;  2ZD9 A;  1BSM A;  4FM2 A;  4N21 A;  4GLX A;  3L70 H;  3QG5 A;  3OTO B;  4MTF A;  2Q5Z A;  3JAW A;  3SJA C;  2QGN A;  1AJN A;  5K1P A;  2N04 A;  4FJC C;  4UCT A;  1YI2 V;  4CC6 A;  3CMA V;  4X1K B;  1YXB A;  5JVD B;  2R9I A;  5JJN B;  1MNG A;  3BPZ A;  5IY5 B;  1NJI W;  1G1X B;  4G27 B;  4JI3 O;  1ZSP A;  2B5U A;  5EIB D;  2P4V A;  4ICG A;  5E79 Z;  5LMN O;  1OCZ B;  3SJQ C;  5EZY A;  1XQ8 A;  5LP6 C;  5IJ0 B;  4B3T O;  5H2F Z;  3FX7 A;  3WU2 Z;  2QEX V;  1JJO A;  2YIB D;  1Q6H A;  3AG1 C;  2EBO A;  4JYC A;  3G4S V;  2EIK C;  4JZG A;  4PA3 A;  4MVQ A;  5LMN B;  4JTD B;  3QNE A;  4J80 A;  4U7O A;  4DK1 A;  3K5L A;  1W0K G;  1FJG O;  1S76 D;  3P3N A;  1U96 A;  5FPO A;  1I08 A;  1VAR A;  3OW2 U;  2YID A;  4I55 B;  5GTH Z;  1JFF B;  1OCO C;  2VS0 A;  3LSQ A;  1COW G;  4FFK A;  4JAA A;  3SYA A;  4BIZ A;  4WFA V;  3RYC B;  3E8B A;  2ZR3 A;  3I55 V;  2Q0A A;  2WLI A;  1FJG B;  4EB6 A;  2YUA A;  4FZ1 A;  3H9V A;  4DXW A;  2UXN A;  4KP4 A;  2IJI A;  3BY6 A;  4K35 A;  1PKX A;  4GUN A;  1E1R G;  5J2U B;  4I7Z B;  4DV4 O;  1JVM A;  5CBF A;  4ZI7 B;  5GON A;  2WLL A;  3ZRW B;  5IE9 A;  3J81 N;  1K8A W;  1DGS A;  4NTW A;  1S5J A;  3FKS G;  4NKG B;  3DGE A;  1KKC A;  2UUC O;  2P22 C;  1EFR G;  4X65 O;  3VOU A;  4PJ0 Z;  2VWK A;  4QGP A;  1AJP A;  2BE3 A;  3HB3 B;  3CC4 V;  3D3I A;  2JK5 C;  3U0Z A;  4GKJ O;  2CTW A;  4NB5 A;  1B04 A;  1IXB A;  4MVR A;  2HR3 A;  3OGI B;  5LL6 Y;  1H2M A;  5LMU O;  1VQK V;  1KEC A;  4UVC A;  4G2K A;  2MW2 B;  2A0L A;  1PNL A;  3B40 A;  2W0F C;  2A9H A;  2UUC B;  2R72 A;  4X65 B;  2CTQ A;  1NTK H;  3R65 A;  2Z5U A;  3ZBH A;  4QJF B;  2GUZ B;  3GWK C;  2VQE O;  5HFM A;  1CEZ A;  3C90 A;  4LFB B;  1M4U A;  4FLX A;  5JQG A;  4RO2 A;  2K9P A;  5FLX N;  4O2A B;  2ILM A;  1ORQ C;  1BGY H;  5DED A;  3CP1 A;  4UCS A;  5KLV H;  1HW7 A;  1ZUQ A;  4PD4 F;  3M7M X;  4TUY A;  2EUL A;  2AXT Z;  4QPK A;  4LCU C;  4B08 A;  2CAZ C;  2RN9 A;  5LXT A;  3APO A;  2OTJ V;  4WFE A;  2AHZ A;  3O9O A;  2AZ0 A;  4ZBM A;  2LGW A;  1L1F A;  1FXK C;  1XMO O;  2E76 B;  2PTM A;  2RNB A;  1XL4 A;  4X62 O;  4UVB A;  5HFL A;  4DR3 O;  2H94 A;  3HKC B;  5EZY B;  1O9H A;  3OM3 B;  2Q0O C;  4JGS A;  2OCC C;  3HR0 A;  1ENV A;  2KG7 B;  2IU0 A;  4H0L B;  4BIU A;  1US6 A;  1IVS A;  1KYO F;  4WFF A;  1XMO B;  4O4I B;  4JI0 O;  2DW4 A;  4U3J B;  4PHZ A;  2UU9 O;  3CYO A;  4DO2 A;  1URF A;  4KL1 A;  1DLB A;  2DQ3 A;  4X89 A;  3N2G A;  3RW0 A;  2D2C B;  3TJT A;  5A9G A;  1M93 A;  2YC0 A;  3AG3 B;  4DR3 B;  1FXH A;  4IIJ B;  3CRC A;  3GB7 C;  5L3G A;  3ZED A;  4JI6 B;  2YXY A;  2V1D A;  3FB5 C;  1F51 A;  4W4K A;  1V55 B;  4NXM B;  1XBL A;  1Q82 W;  4JI4 O;  4F6R B;  4ASU G;  4JI0 B;  1YHQ V;  4GX0 A;  1FYJ A;  1KQS U;  4DV7 O;  2EZP A;  3JAR A;  2WLI B;  4J7K A;  1IBL O;  2EIJ B;  2CDY A;  4DR7 B;  3UT5 A;  1VQ5 V;  4TSF G;  4CBC A;  4PDL A;  4A5U B;  4MSW C;  3ETG A;  4JI4 B;  1M9N A;  4AQY O;  3BAB A;  4XDL A;  1BL8 A;  4MW3 A;  2YI8 A;  4X1I A;  3OMN B;  3K58 A;  2CTR A;  2E3C A;  4HZ3 A;  1F4N A;  2Q7E A;  4XDJ A;  3EFF K;  4O4J B;  2HVJ C;  2BTQ B;  4JV5 B;  2EIL B;  1IBL B;  4RUF A;  3OR6 C;  1H2L A;  5B3S C;  4I0X A;  4DR1 O;  5FPR A;  2PGG A;  3R66 A;  4AQY B;  4J9Z B;  1SS3 A;  2JDI G;  4GT1 A;  2VQF O;  1F23 A;  3ML0 A;  2X6A A;  1FXK A;  2PYJ A;  3J80 N;  3AEI A;  1WB7 A;  4LNU A;  3OGC C;  4DV3 B;  1PP9 H;  2WA4 A;  2A3Q A;  3CSX A;  4DW1 A;  5L3E A;  2IJH A;  1KD1 W;  1E1Q G;  1WAZ A;  4DR1 B;  2WPD G;  3ZRV A;  3K59 A;  5LXT B;  1AB3 A;  3B2E E;  4DRX B;  1FKA O;  4TT3 G;  3CCQ V;  1QVF U;  3T1Y B;  2B1I A;  2B1G A;  2DN9 A;  4HNA A;  1SES A;  3AK3 A;  4WFB V;  2F93 B;  3QVN A;  2BSK A;  3ZHT A;  4D6T H;  4JAV A;  2IW5 A;  2XAG A;  3ASN C;  4KUM A;  4FMT A;  1YEW A;  2BTO A;  4KHP O;  4UXN A;  4LH6 A;  3DTU B;  2UXD O;  3ABK B;  3E8G A;  2IH1 C;  1MMM A;  1KU9 A;  5KHK A;  3CXH F;  2E75 B;  5L3B A;  1RM1 B;  3S3X A;  1IBK B;  2M7W A;  1ZTE A;  2ATK C;  4X9Q A;  4NR1 A;  3CRR A;  3CCS V;  1L0N H;  4UV8 A;  4JTC B;  4JI7 O;  1K9M W;  5KHJ A;  4YJ3 A;  2AW9 A;  4QPJ A;  3AG7 A;  3KG2 A;  2UXD B;  2DE0 X;  2IM9 A;  2ZE5 A;  2FKX A;  4JTA B;  4B3M O;  4EEQ A;  3JSL A;  4CH6 A;  2DOS A;  5JCO A;  4JZ2 A;  3G6E V;  3CRM A;  4DV5 O;  1Q8I A;  2A06 H;  4DR6 O;  1PNK A;  4JI7 B;  5B1A C;  1BHB A;  2OIE A;  3LNM B;  2UUA B;  2JGD A;  4OXS A;  2LJ2 A;  2ZT9 B;  1OHH G;  4AI8 A;  1SQQ H;  4TV8 B;  3RWR D;  4O4L B;  3SDL A;  4KXR A;  3TGU H;  2R9A A;  1F7Y A;  1XEQ A;  4LP8 A;  4WFH A;  3CC7 V;  2RDC A;  4B3M B;  2ARH A;  5IDJ A;  2JJ1 G;  2F1M A;  5D5Q A;  1HNX O;  3JAR B;  2QWP B;  3PN1 A;  3OR7 C;  4LF9 B;  1XI1 A;  1IX9 A;  2ZE8 A;  2WWW A;  2M6Y A;  1XIL A;  4IYH A;  2UUB O;  4DR6 B;  3O65 A;  2F66 C;  2PI4 A;  4PA9 A;  3ZMZ A;  2ZXW C;  4H44 B;  1I94 O;  5J2T B;  2NNU A;  2XND G;  3BVO A;  4R8C A;  1KBH A;  5CBG A;  1ZAU A;  5EYP A;  4X64 B;  4UCU A;  1LR1 A;  3RBZ A;  1HNX B;  2Y69 C;  4ZHQ A;  1DTO A;  2OIG A;  3N27 A;  2QKC A;  3K9A A;  1EN6 A;  2UUB B;  3NXS A;  1YZB A;  4I0X B;  1KUQ A;  1N0N A;  1SQP H;  1I94 B;  3T4D A;  1IBM O;  2GV9 A;  3SPC A;  2EIN B;  4K3A A;  2EJ7 A;  3ZX6 A;  5J9P C;  1DK1 A;  3G6B A;  1Y6X A;  4KFM A;  4CZZ A;  4IHJ B;  1NZ6 A;  1VMG A;  3E8F A;  2EIM B;  2CGO A;  3MHS C;  5H6R A;  4OX9 B;  3CS5 A;  3KZI Z;  1IBM B;  1VQM V;  2R70 A;  2FML A;  4JYA O;  3G67 A;  3DXR B;  5LHI A;  1WPX A;  2EIJ C;  1FXV A;  4J11 A;  4HNA B;  3F5T A;  3FAV B;  4X20 A;  3FD9 A;  2ZIO A;  1PD3 A;  3H1I H;  2L6L A;  1OZ0 A;  1SET A;  5LGN A;  1VF5 B;  3SJB C;  4UB8 Z;  2HJD A;  4JI8 B;  3UO2 A;  3F5W C;  2IJK A;  2OCH A;  3P3P A;  1NU1 H;  1ZL8 A;  4MVU A;  3ZHV A;  1HR0 O;  2BOC C;  1B6Q A;  1Z5W A;  3H1L H;  1MAB G;  5KA5 A;  2DMX A;  2YSU B;  4GKK O;  2LO1 A;  1VF6 A;  1H2K A;  3F7Y C;  1EM1 A;  5LOV A;  1ZX3 A;  1GM7 A;  3B4S A;  5EIB C;  3L73 H;  4UVA A;  1WNS A;  4DW0 A;  1NQT A;  5C8Y A;  3WG7 B;  3GWO A;  2ODM A;  5IJ9 A;  5H6Q A;  1JPX A;  1VQL V;  4DV2 O;  1XMQ O;  4PV1 B;  2ZDI C;  4YJ3 B;  1X59 A;  2ZCE A;  2ZKO A;  4GX5 A;  3N2K B;  1QLE B;  1N0J A;  1SQF A;  2WLM A;  4JI3 B;  3ABL C;  1Q90 D;  1D5A A;  3QTC A;  3NR7 A;  1D5N A;  2GTS A;  3RN4 A;  2P67 A;  2ETN A;  1NTZ H;  3RYI B;  4B3T B;  4TWK A;  4X1Y A;  4DV2 B;  1XMQ B;  2KSD A;  1BE3 H;  5KAF Z;  2B9Z A;  4F6E A;  2OWO A;  1SRY A;  3H1J H;  3E22 B;  1LNQ A;  5LYJ A;  4QNH B;  4O2B A;  3SYP A;  3OMI B;  5B1B B;  3CCR V;  5ITZ A;  4WF9 V;  1O9G A;  1G4Y B;  3EHB B;  3A8T A;  1YTF B;  3JD4 A;  1MSD A;  4IT5 A;  1BCC H;  4PDR A;  1S3J A;  3TCU A;  2R9R B;  3ABK C;  1BMF G;  3TET A;  2DYS B;  4MTX A;  3UKM A;  4YIP A;  3OT7 A;  3RYF B;  3ZHS A;  1V54 B;  3K57 A;  5EYP B;  4DV1 O;  1BHA A;  3JCU Z;  4TQF A;  4LFA O;  3K08 A;  4XDK A;  2UXB O;  1DF4 A;  3BAA A;  4FLT A;  3VQY A;  2HVK C;  1YJ9 V;  3JAK A;  4DV4 B;  3ABM B;  3K0G A;  3CE2 A;  4DR4 O;  4U3F H;  3BCC H;  3LDE A;  1SQV H;  4EFB A;  2L35 A;  4JI2 O;  3ETE A;  4JAS A;  3CCV V;  4B7E A;  4RUE A;  3CME V;  1QCE A;  1YJN V;  1BQ0 A;  4WBN A;  1BZK A;  1R1B A;  4Q6G A;  4GKJ B;  1RSO A;  3T2M A;  1THZ A;  1SZT A;  1R73 A;  5LP6 A;  3CWB H;  1Y76 B;  1H8E G;  1Q6U A;  4JYY A;  5BR8 O;  1TGO A;  5LMU B;  4YJ2 A;  4LF8 O;  4DR4 B;  2YIB A;  1M5I A;  4X20 B;  1G8M A;  3Q4H B;  2ZM6 O;  1JR9 A;  1M56 C;  3D3Q A;  1MSW D;  1VQ9 V;  1FAF A;  3AG2 C;  4I5S A;  4K8X A;  3K3W A;  1FD9 A;  2ITC C;  3ASO B;  1N36 O;  1EN5 A;  3JAW B;  3E8H A;  2VQE B;  3EVK A;  1ZL8 B;  3BA8 A;  1GM8 A;  4GYC B;  2Q69 A;  3FYI B;  4BAY A;  1X4T A;  3ZMT A;  5CBH A;  2Q68 A;  5B1O A;  4LF8 B;  5LOV B;  4FLZ A;  2DQ0 A;  1XUQ A;  2CGN A;  4J42 A;  5CA0 A;  1CP9 A;  4I50 A;  4LWS A;  2DWD C;  5C8Y B;  2E74 B;  1N36 B;  1TUB A;  2EIN C;  4D7S A;  2YIA A;  4J10 A;  5L3C A;  1G6U A;  5LGU A;  3L75 H;  2PZS A;  3P32 A;  2XAS A;  2GTA A;  5JH7 A;  4LF6 O;  4CS2 A;  3W7T A;  5CB4 A;  3K9S A;  5IYZ A;  2CUG A;  4NTY A;  3FYE B;  1NBM G;  1TVK A;  2BCC H;  2HLD G;  3WB2 A;  1KP2 A;  1WN7 A;  1PV0 A;  4IYI A;  4X62 B;  2W6J G;  1QU7 A;  4OGQ B;  2DYR B;  1QQC A;  3E83 A;  4NYK A;  3JAM N;  1PNM A;  3OTF A;  1IZ3 A;  3JAT A;  3APQ A;  3B8M A;  2PY5 A;  3VQV A;  1FFX A;  2EZO A;  5JWP A;  5LBQ A;  2WLJ A;  4RQE A;  1XOU A;  1QVG U;  1BT8 A;  2YXH A;  3AG4 C;  2FYU H;  2JGU A;  2UU9 B;  4UUJ C;  5LYJ B;  1PM9 A;  2ADQ B;  4JAU A;  4GZR B;  4PEL A;  1NVP B;  1V9P A;  1KMI Z;  4LF4 O;  4FLV A;  1HDJ A;  4EB6 B;  1FFT B;  2LFS A;  3RYH A;  2XHB A;  2XT9 A;  5EBW C;  5IY5 C;  4I4T A;  4FFB A;  1SZX A;  4X88 A;  1BS3 A;  3ZHR A;  5GON B;  2WLL B;  4K8Z A;  1Z5V A;  2HP8 A;  3IC9 A;  2ADP A;  1OCZ C;  1WJZ A;  5E1A C;  4DV7 B;  4TV9 A;  4X8A A;  3BA9 A;  4LF4 B;  4YIO A;  4E4E A;  1S72 V;  4XBF A;  1P4R A;  1JCH A;  3A0H Z;  2XAJ A;  3HKD A;  3KCX A;  4NXN O;  4L8J A;  4AIL C;  3U10 A;  1JMK C;  1IXM A;  4QE7 A;  3A2F A;  3ZMS A;  1GM9 A;  1S5L Z;  3CRQ A;  3LSS A;  2P06 A;  3JYC A;  3CJH A;  3ZRS A;  4AHC A;  1ARO P;  1K3E A;  2ZQM A;  3LSU A;  3TXS A;  2KQX A;  1I5X A;  2YIC A;  3UQ8 A;  5LA6 A;  4ZKI A;  2F4V O;  3DC5 A;  4JYB A;  4I9W A;  1EN4 A;  4NXN B;  1F4M A;  4HBN A;  2WLH A;  1H2G A;  3HKB A;  1OCC B;  2QWQ B;  5LP6 B;  3QF7 A;  1H2N A;  1BQZ A;  5JQG B;  3D36 C;  4NTX A;  5B1B C;  1B3Q A;  3W7X A;  2VQF B;  4LF7 O;  3IC7 A;  1YTF D;  1SQB H;  2X6B A;  2F4V B;  1JQ0 A;  2ZNI A;  5LHG A;  3JCZ A;  1VP7 A;  1SKV A;  5CMU A;  2DYS C;  1YF2 A;  4TUY B;  1MG1 A;  2CTP A;  2CH7 A;  1K73 W;  2RQ6 A;  1V54 C;  1YIT V;  2JS3 A;  4ZOL A; 
#chains in the Genus database with same CATH homology
 1U96 A;  2RNB A;  2RN9 A;  1Z2G A;  1U97 A;  2HP8 A;  2LGQ A;  2LQT A;  1HP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...