2LGQA

Human c30s/c59s-cox17 mutant
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
GSFTMPGLVDSNPAPPESQEKKPLKPCCASPETKKARDACIIEKGEEHCGHLIEAHKESMRALGFKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional role of two interhelical disulfide bonds in human cox17 protein from a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords Cytochrome c oxidase copper chaperone
total genus 11
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 2lgqA00
1U97A 2LGQA 1U96A 2LQTA 2HP8A 1HP8A 2RN9A 2RNBA 1Z2GA
chains in the Genus database with same CATH superfamily
3SPJA 3U10A 3OEEG 1VQNV 1FXVA 2XHBA 1RM1C 2N05A 3OGIB 4H44B 1B6QA 4DRXA 1N4CA 1XL6A 4K8ZA 2EINB 3M7MX 1KB9F 3WU2Z 5H5NA 3J80N 1Q5OA 4I5SA 1MZEA 3K0DA 4DR2O 1F23A 3QF7A 1V55C 1Q81W 2HLDG 4DW0A 4DV5B 3K3WA 2LFRA 4WCEV 1M90W 3M99B 3ASNC 5IYCO 2WA4A 1QCEA 2XUMA 3S3XA 4E2LA 4O4HA 2WLIA 4J80A 5IYBO 4JV5O 4UCOA 2F43G 3SPIA 4NTWA 2WLJA 1Q7YW 1TA8A 1GN4A 2ZXWB 2W6IG 3ZMUA 1JQ0A 2ODMA 1GM8A 4DUZO 4X64O 2OCCB 4GLXA 4OX9B 3JAKA 3P3NA 4I55B 3W7SA 4YJ3A 4LFBO 3UO2A 4G2KA 3CCSV 3R65A 4JI5O 1FFXA 2JGUA 5LHHA 3B8NA 4CS2A 3E35A 4X1KA 3RYIA 2W0XA 2E74B 4FFKA 3HKBB 1T5EA 1VF6C 2DJVA 4YXWG 4FM1A 2G38A 2ZE8A 3RGBA 2ZKOA 3FB5C 1THZA 2BOCC 4X20A 4TV9A 1EZVH 2WWWA 5KHGA 1M57C 1QLNA 5L3GA 5BMVB 1WNSA 4NXMO 3ABMC 3CX5F 1NVPD 4U3JA 3CCJV 4UV8A 1K4DC 2X6BA 1EFRG 1GO3F 3IGAC 1S3JA 3JATB 4PA3A 4HBNA 1YVWA 3A2FA 3S3WA 1WA8A 1OCCB 1IXBA 1PL4A 4YHHO 3CJHA 2JS5A 4UVCA 3B4SA 5B3SC 5L3CA 3X2QC 1DF5A 1R1BA 4DV0B 5C8YB 4NXMB 3B09A 4GCZA 4X1IB 4FLWA 3AK3A 4TUYB 3BAAA 2UXXA 4I9QA 2ITCC 3LDCA 2BTOA 3HKCB 1FKAO 3CRRA 1O9GA 2ZR3A 3BA8A 2CTQA 2RJZA 1ROPA 4DR5O 1YCIA 3ZCCA 3I5DA 1MSWD 2Y0IA 1LUVA 4MVUA 3AG4B 1TVKB 4MVRA 2CTRA 3L74H 3PN1A 1HR0B 4LFCO 2XT9A 4JI2O 2DQ0A 1SQVH 2AHZA 5IJ0B 4X1YB 1AR5A 2HEPA 4RQFA 1Q3EA 1BS3A 4DUYB 4TSFG 2ZE6A 1JOYA 3HKCA 1AJQA 5CBGA 2VWJA 1Z5VA 4G28B 3CC7V 4QJFB 3K5MA 5BR8B 2IH3C 4I50B 3ZRWB 1WB8A 3UQ8A 4U7NA 1W0JG 2M7WA 4O4IA 2B9ZA 4B7EA 3HPLC 1GN2A 1G4YB 5E1AC 2A06H 1BZKA 4LF6O 1F4NA 2X7RB 3EHBB 1P7GA 3G4SV 1Q6UA 2XTAA 5FNVB 1KD1W 3H1LH 2ZDIC 4X62O 2PUSA 5JWPA 3WB1A 2QM8A 4Q20A 4UCSA 1YSCA 2OTJV 1M1KW 3K5OA 4X1IA 4QE7A 2NNUA 5J2TB 2OYQA 3FB7C 5A2QN 3ASNB 1Y4MA 1W0KG 2BE3A 2RDCA 3AK2A 1R3LC 2F23A 1IBKO 2PYJA 2FYUH 2PI4A 2UXBO 4JI4O 4FZ1A 2VQEB 1OHHG 3JARB 3APQA 4F6RB 5CA0B 1XNQB 3FYIB 5IY5B 2GUZA 5K1PA 4CH3A 4JASA 3JD0A 3AEIA 3SPGA 3RWRD 5L3EA 4DRXB 4TV8A 3CHXA 3GWOA 2CTPA 4FFBB 2YEVB 3OFNG 1P49A 3E86A 5LP6A 1FXKB 1NR1A 4W4LA 2PZSA 2QDOA 1D5NA 1VQ5V 4UV9A 3ZHSA 4R7CA 1F7YA 3AG1C 4Q6GA 1OV9A 4N21A 1K5SA 1H2GA 4HZ3A 3ZS8C 2Q67A 5EZYA 4J7ZA 2EIJC 4DUZB 1WA8B 2YSUB 5JJNB 5HFLA 5KX5A 3H1IH 4JZGA 3C90A 4ASUG 3OUFA 5KHJA 4QGPA 2JS3A 4AQYB 1IBMO 5IJ0A 4MVOA 2ZT9B 1OCCC 2Y48A 2EIMB 3QG5A 4DV6O 4LF8B 3KCXA 2Z0AA 3IFXA 4I4TA 3OTOO 3RYCA 3TK1A 3OE7G 3W7UA 1ZSPA 4O2AA 3UM7A 4JI8O 1X59A 3WFVA 4LF9O 4NXNB 5KUMA 1SERA 1VARA 1XMOO 4JI1B 5L3FA 4B08A 3SJQC 2PYLA 1CP9A 5KUKA 1VQ6V 2H3OA 4DV4B 1VQ9V 1SZXA 3RYFA 1I7FA 4X20B 4KHPB 2Q8VA 1HNZB 2ZE7A 2ZNJA 1K92A 4CH6A 4NTXA 1TUEB 2WLMA 2QM4A 2EZPA 1EN4A 1Y76A 2P4KA 3GVMA 2LGQA 1Y76B 3SPHA 3W7WA 3P3PA 2Q68A 1YHQV 2JVDA 2GDSA 3LNNA 3JATA 1Y67A 4GKKB 2DYSC 4JI4B 1KP3A 1S5HC 4LWSB 2WSSG 5FPOA 5LGTA 3O65A 3D8CA 2GSMB 4JTCB 1PP9H 1AI5A 5K1XA 4G27B 1XEQA 4X65O 2ZCEA 2FB5A 2X0LA 1WPBA 4IHJB 4HNAA 4FM0A 3CCQV 1KQSU 4PDMA 3ABLB 4GYCB 1GM7A 3JASB 1WP8A 2AW9A 1PPJH 4LFAB 1QLEC 1YXBA 1BE3H 1GH6A 5IWAB 1BHBA 5BR8O 3G6BA 5LA6B 3E22A 1A32A 1XDCA 1CXZB 3AG2C 3RT3C 1PNLA 3T4DA 2DWDC 1WAZA 1K7DA 5C8YA 4O4HB 4PI0A 3E89A 1Q43A 3OAAG 1R6KA 1YZBA 3FD9A 2WLLB 3QTCA 1I94B 2JGDB 4J11A 5JH7A 1S72V 2WLLA 2OWOA 5B3SB 4I50A 1EZJA 4DV2B 4DO2A 4F6EA 1N32B 4JI8B 2XNDG 4BIUA 1FFTB 4MTGA 3IAYA 4J10A 1S0VA 4DYLA 1I5YA 4X88A 2LW1A 3F7VC 1JA8A 1K5QA 2JGDA 3EVKA 4O4LA 3LSUA 4DV7B 2P06A 1IURA 2XOKG 4FLXA 2B1IA 1H2MA 4KHPO 3OR6C 2KKWA 5KHHA 4DR4O 1PV0A 4IYHA 3CCMV 4K0KO 3B77A 3LSSA 3RYHB 4PA6A 3K57A 2AZ2A 3DGEA 4JAAA 4E4EA 3ETDA 1K33A 2HJDA 2ATKC 5LHGA 3J81N 2JDIG 1YJNV 4AI8A 2AGAA 3WG7B 2K9PA 2ZXWC 3CP1A 3SYQA 3WB2A 2AHYA 2EIMC 3ZMSA 2PGGA 1YF2A 1OCZC 4OXSA 2UUCO 1I08A 2DYSB 4LWSA 2HR3A 2DYRC 1W2BU 4OX9O 1H2KA 2QKAA 4TQDA 1EN6A 1EN5A 2PF4E 2ZIOA 4FM2A 1WP7A 1XUQA 4HNAB 3ZRSA 1M56B 4RWUA 2OCHA 1XI1A 4DW1A 5DM6V 1ZUQA 4LF8O 4EFEA 4DXWA 3A0RA 5B1OA 1NI8A 3OR7C 4Z1MG 4P9OA 2HVKC 1DTOA 3N2KB 5KMGB 2QJ1A 4MS2A 2OT5A 3AG3B 1IBLB 5EBWC 3ZRXA 3C3SA 4Z1VA 5JVDB 5B1AC 1OCOB 1M9NA 2BCCH 3K04A 3D3QA 5KLVH 4FJCC 3L72H 4JGSA 1SQXH 3OTFA 1W59A 1I94O 2Q7GA 4UCRA 3H1KH 2RNBA 3CCUV 2CH7A 4DV2O 3CE2A 4H13B 2Q7EA 1HW7A 2E76B 4JAVA 3CC2V 1M4UA 3RFRA 3CPWU 3SYOA 3CCRV 2GUZB 1XBLA 3D3IA 2KQXA 3KZIZ 2Q4PA 4LH7A 3RYHA 2QTSA 2X6CA 2Y69B 2QWNB 1QR8A 3L75H 1J5EB 2M6YA 3Q4HA 2QSAA 4QPKA 1XHZA 4CZZA 3CRMA 5KAFZ 4U3FH 4DR1O 3DC6A 4LF5B 5LYJA 1YJ9V 3ZMZA 1GN6A 5LMNO 2MW2B 4X66B 1XMQO 1KECA 1VP7A 2Q9LA 4IIJA 3BVOA 1GAXA 2V7QG 2ZM6O 3DTUB 2ZIMA 2NR5A 1IX9A 2WA3A 3E8FA 3ETGA 4PDRA 4MVQA 4WFFA 2B1GA 3KKYA 2BTQA 3ETEA 2P22C 1I0HA 1SQFA 1N0JA 5IWAO 2UU9O 4GT1A 1B04A 1BSMA 2P67A 3QO7A 4WFEA 1AP6A 2LJ2A 1R3IC 2F1MA 3B40A 2Y69C 3ZHTA 2DW4A 2UXNA 4QPJA 4U3JB 5CMUA 5B1BB 4DK1A 3FKSG 2BSKB 2QWOB 1MNGA 2HG5C 5CB4B 2XAQA 2B5UA 1Y6XA 5BY1A 4BIOA 1URFA 2GHYA 4JV5B 2BSKA 3QO8A 4YIPA 1RM1B 3JD4A 2YIBD 2CH7B 3K58A 1K97A 2UU9B 2YIAA 4LF7O 2F93B 1KC8W 4HYOA 2HVJC 2QE7G 2YC0A 4MTXA 2HFEC 3IC7A 4AQYO 3WB0A 3CCLV 1VQ8V 4GKJO 4ZBMA 5CA1A 1QVFU 3JAMN 5CB4A 1QHTA 2YDEA 2HHHO 1NTMH 4FLZA 4FLTA 5GONB 2JJ1G 3QVNA 1KYOF 4PA4A 1S76D 2UUBB 4P2ZA 1AJPA 5IE9A 4HAMA 2WLIB 4GKJB 3ABLC 2JEUA 3CRQA 2ITDC 4JYYA 3K79A 1H8HG 5H6QA 1FD9A 3LUTB 4YY3O 2CGOA 4JI7B 2GTAA 5JH7B 3ZRWA 1JMKC 4DV3B 2UUBO 1KU9A 3K9SA 3ASOB 4IIJB 1P7BA 1H2LA 3B8MA 1YJWV 3J7AU 1U97A 2FMLA 2DQ3A 2A0LA 4NR1A 5DN6G 2ADPA 5FLXN 5LXTB 1S77D 1WB7A 5EYPA 2D2CB 5LOVA 1OJHA 2W0FC 3N2GB 4H0LB 1HNWO 4X1KB 4JI3O 1AR4A 2CK3G 1VQLV 1VF5B 2QA4V 5H6RA 1ZAUA 3CWBH 3CSXA 1AB3A 1JX9A 3DSQA 4O4LB 4GX2A 4B3RB 4I55A 3ZJZA 4JI0B 3PJSK 3UT5A 3NXSA 2C2AA 1FFXB 1SZTA 4LF9B 3K03A 5BXZA 4NXNO 3SJBC 3X2QB 1YTFD 3ZHQA 4JI3B 1NTKH 3BFRA 4MSWC 3KCYA 3E8BA 1BQ0A 2NN4A 2BOBC 2R9AA 2CDYA 4N23A 4LF7B 4TT3G 1B3QA 4B3TB 1IZ3A 1HNZO 4ABMA 4UXNA 4PD4F 1GTOA 3L70H 3CD6V 1AP5A 4TV9B 3JAKB 1EBOA 4LF4B 2VRZA 3ZEDA 2XAFA 1BQZA 2Q0OC 3C3TA 4EB6A 2ZQMA 5GONA 2HHHB 4FFBA 4MTOA 5EBLC 2GBOA 1VQ7V 2ZNIA 4MW3A 4WFGA 5JJEB 4UB6Z 1N34B 4ICGA 5J9PC 1MABG 2DWEC 1AVMA 1SETA 1AJNA 3BY6A 2R9RB 1TAEA 3Q4HB 5TISZ 2YS8A 2Z3YA 3CXHF 1LUWA 2YEVA 3UO3A 1IBKB 2WPDG 1EM1A 1K4CC 1Q82W 4FVMA 1Q6HA 2EILC 4DV7O 4LFAO 4U7OA 2A79B 3K08A 1RP3B 3I55V 4D6TH 3W7TA 5HFMA 1XHXA 4BW9A 1TGOA 4X64B 3O9OA 1QVGU 4PHZA 1P4RA 3AG7A 5CA3A 5JCOA 5KX5B 1HNXB 4JZ2A 3ZN1A 1KMIZ 4JF3A 3N2GA 3VBBA 5EYPB 2P7TC 3FX7A 2JRIA 3G67A 1P84F 5L3DA 3K5NA 2ZINA 4L87A 4UCTA 3WG7C 2WLHA 2L35A 4I4TB 4PA7A 3RVYA 3D36C 3HKEB 3CC4V 3GWKC 1V54C 5EC1C 2Z5UA 3SYPA 2R72A 5FL7G 4LCUC 3THOA 4C7UA 5LOVB 3CXCU 2F66C 5LXTA 2E75B 1Q86W 3OGCC 1TUBA 1YEWA 1BMFG 3SDLA 3DC5A 3ICXA 3ZX6A 2ADQB 1O9HA 5GTIZ 1QNMA 2ETNA 4X62B 4RQEA 1FS0G 5JQGB 1XREA 1R6TA 3RBZA 4L8JA 3JCZA 3ZHRA 4DR6B 4RUFA 1UFIA 1SRYA 2R70A 2RCVA 4TV8B 4JTAB 4DK0A 4K0KB 2V1DA 1YIJV 4MT8A 1FPOA 5CA1B 4PELA 4H33A 5B1AB 4JI1O 3CCEV 5L3BA 2EBOA 4TWKA 3AK1A 3OMIB 2P90A 4IYIA 4RAIA 2UXBB 2JEXA 1NVPB 2DMXA 4PV1B 4KFMA 5LGUA 3F5WC 3F5TA 5EIBC 1NZ6A 4DV3O 1N34O 4DR6O 3T2MA 5D5PA 4NB5A 2V4DA 1PM9A 1PKXA 3OT7A 2EIKC 3CJHB 3BABA 2Y4TA 4BWAA 3P32A 1FXKC 2JJ2G 3IJ4A 1V54B 2RQ6A 1IVSA 4YJ2A 5IYZB 4MVMA 1SA0A 4D7SA 4GKKO 5H2FZ 2ZD9A 3JASA 3ML0A 5B5EZ 2EIJB 5JCOC 4UCUA 3B2EE 2CUGA 3K0GA 5LMUB 1NS1A 3MD0A 3TXQA 1E1RG 4JTDB 2N04A 4DV5O 1DK1A 1BT8A 2UXDB 1JJOA 4BW5A 1HP8A 2ZDIA 1LR1A 2IJJA 3JAWB 1FAFA 4F4LA 2QWRB 4FK5C 3ABMB 4X89A 3T1HO 1ORQC 1L0NH 3N27A 3TCUA 3CYOA 1VQOV 3SYAA 4FLVA 4DR7O 2E3CA 2O57A 4B3TO 4DV1O 2JIZG 5EZYB 4I9WA 1E1QG 3K5LA 3E2EA 1JJ2U 3LSQA 4O4IB 2UUAB 1J5EO 4B7KA 4QE9A 1QBZA 1V55B 2CAZC 2P6JA 4FLYA 1SQPH 1COWG 1TUBB 3CMAV 5DECA 1L8DA 3RN4A 2PY5A 4P30A 4DR7B 4J9YB 3A0BZ 1M56C 1GK9A 3UT5B 5LMNB 2YXYA 1XNQO 1KKCA 1D5AA 3CMEV 3EFFK 4DR3B 3K59A 4BIZA 4JYAB 1R73A 1HWYA 2IW5A 1U96A 3JD1A 1RSOA 4MW8A 4JI6O 3L71H 4FLUA 4GUNA 1YITV 4NYKA 5AG2A 1BHAA 1VIBA 4CS4A 2QGNA 3N2KA 5LGNA 5LBQA 4ZOLA 3NR7A 1MZFA 3CRAA 2P5OA 4JYAO 5CA0A 3VQYA 4B3SO 2OCCC 4FMTA 4CC5A 1KP2A 5B1BC 4H37A 4EB6B 5JJJB 2PI5A 1SA0B 1HNXO 2LFSA 3U11A 5BMVA 5E79Z 3T1CA 2IJHA 4YJ2B 3AG1B 3STZC 2CE4A 3UCSC 4PI2A 3OMNB 3F7YC 4DV6B 4R8CA 3BA9A 1WPXA 4QNHB 4JAUA 3VQXA 2IJKA 1Q8IA 2WAMA 4RO2A 1MSDA 2E5LO 1E79G 2HP8A 5C93A 3ABUA 4JI5B 1D2DA 5EK0A 3T1HB 4NKGB 1FYJA 3TJTA 1Y74B 1AILA 1HDJA 1QR9A 1OCZB 1SQQH 4O4JA 5LYJB 5ITZB 4B3MB 2VQFO 4DV1B 1K9MW 4TQFA 1VQKV 2IM9A 1OCRB 5J2TA 1N32O 1VMGA 3E8HA 2E5LB 1KUQA 3GB7C 3JD3A 2EINC 2GV9A 5IJ9A 5LP6C 3HB3B 4J9ZB 2CGNA 4UUJC 2F4VB 1OZ0A 3VOUA 3ABKB 1OCRC 1XQ8A 1N8RW 2QKCA 3A0HZ 3FYEB 3RYFB 1X4TA 1H38A 3JALB 3OTOB 3UKMA 4B3MO 2RN9A 2A3QA 2LO1A 3JALA 3H1HH 1I5XA 2UXCB 1JFFB 3BCCH 2OIEA 3VQVA 2YICA 4JPRA 1GM9A 3K9AA 5IJ9B 4D7TA 4PA9A 1HNWB 4JYBA 3P30A 3HKDA 4LF5O 5H9CA 4CH4A 1VQ4V 5LMUO 4LNUA 5LA6A 1NH2B 3CEIA 1SESA 2UUCB 3E8GA 2UXDO 5CBHA 3JSLA 3FAVA 2ZM6B 3OEHG 2MK3A 1CEZA 4CH5A 2IU0A 4UVBA 3G71V 5J2UB 1N36B 5IY5C 4JI2B 4A5UB 5IDJA 1JR9A 3OW2U 1MG1A 2KG7B 2Q5ZA 5B1NA 3ABKC 3FB8C 3STLC 4PDVA 1H8EG 4DR2B 3LNMB 3E83A 2ILMA 3BRCA 1NTZH 1NQTA 5GW7A 1VQMV 1BL8A 1QLEB 1ZWIC 3MAQA 1IBLO 3RVZA 3ZBHA 1N36O 4LF4O 4X1YA 2FKXA 2UUAO 5IYDO 2DE0X 4TUYA 4LF6B 1GKFA 3ABTA 2KB1A 2EIKB 2ARHA 2EULA 5ITZA 1ZLZA 5GTHZ 3G80A 4GX5A 1ENVA 5KAIZ 2A7WA 3FFQA 1V9PA 4X8AA 2JK5C 2Y0PA 1NJIW 1AR1B 1RFYA 1NBMG 4JI6B 5FNVA 4DV4O 2EX3A 2OIGA 4LBEC 2XAJA 4AHCA 1R3KC 2VS0A 4LNUB 1CPYA 2VQEO 1RPOA 4ZKIA 1MMMA 4W4KA 3G6EV 4MTFA 1DLBA 4X66O 1XMQB 3FAVB 3MDSA 2OTLV 1JCHA 4B3SB 1RSOB 4MVSA 4X9QA 2YIBA 2LW7A 2P4VA 1M57B 2Q0AA 1SC5B 4O2BB 1ZL8B 3QNEA 1WJZA 4YY3B 1F51A 2QWPB 1AI4A 4JI7O 1GRJA 3OD4A 3QO5A 4DR4B 4J41A 2HKOA 3W7XA 3DXRB 4X65B 2VWKA 1YI2V 3I56V 1G6UA 1VF7A 3JD2A 4UB8Z 3TGUH 3BHPA 4LFBB 2QWQB 1K3EA 1PNKA 1ZTEA 2YI8A 5LP6B 5D5QA 5EBMC 4WBNA 1PD3A 4KXRA 3RW0A 2IH1C 3BPZA 4ZHQA 1K8AW 4ZIBA 4AILC 1NKDA 1QQCA 1NU1H 4GX0A 1Q90D 3OUSA 5KMGA 1B06A 3BEHA 2EILB 3ETQA 5EIBD 5JQGA 2DOSA 4JI0O 3KG2A 2Y4UA 4EFBA 3IC9A 2IBZH 4ZOLB 1Z5WA 5IYZA 3EXAA 2YI9A 2WLNA 2ZR2A 2F4VO 1FXHA 3CB2A 5IT9N 4WBNB 2EJRA 2N74A 2QKSA 2PTMA 4LC1A 1FJGO 2DN9A 1R6NA 2IU3A 5CN0A 3HKEA 3JARA 2K1EA 4BAYA 1NH2D 2AXTZ 4WF9V 4Z2WA 2LP7A 4WFAV 2D3OW 4RUEA 4LR3A 1AI6A 5LL6Y 3D36A 4LH6A 3SJCC 3SYCA 1F4MA 1Z2GA 2YUAA 4O2BA 1XNRO 1BGYH 4J42A 3A8TA 2WLKA 4ZI7A 1SQGA 1SKVA 4DR5B 3U0ZA 4ZI7B 3DXRA 3SJAC 1PL0A 4OPHA 3L9DA 2GTSA 4O4JB 4XBFA 3ZHUA 4O2AB 4PJ0Z 4FPPA 4YJ3B 2EJ7A 3MHSC 3AG3C 3TETA 2W6JG 4LFCB 1R3JC 4OPAA 4WFHA 2XAGA 4NVPA 1DF4A 1M93A 4DUYO 3ZHVA 4K8XA 1KBHA 3RYIB 4UVAA 4GX1A 1G8MA 4IGGA 4CBCA 1VQPV 4XDKA 2RMKB 1MOFA 2AZ0A 3OMAB 3ZMVA 2F95B 2QM7A 5KA6A 2FTKA 3FB6C 1FXKA 1UPGA 1YDXA 4I0XA 1DGSA 1M5IA 2H8PC 4OGQB 1H2SB 1N33B 2LGWA 4J7JA 3OM3B 3HKDB 3E22B 1WLEA 1ZL8A 1G1XB 3ASOC 4R50A 3T1YO 5CBFA 4CC6A 2QTOA 1AI7A 5JVDA 3JSNA 2LQTA 3ZN0A 3CRCA 4J7KA 1S5LZ 4XDLA 1US6A 3JAWA 2L6LA 4BR6A 4IHJA 3L73H 2KG7A 2EZOA 1AROP 1N33O 1IXMA 2XASA 1KKDA 4EKWA 2Q69A 1NR7A 2X6AA 3R66A 2IJIA 2R9IA 2VQFB 1SQBH 4JYCA 4K35A 2FL4A 3APOA 3SGIA 4KUMA 1L0LH 1XMOB 2KSDA 1J95A 2XAHA 1WN7A 1JVMA 4DR1B 1XOUA 4KL1A 3SPCA 3RYCB 1GN3A 1Y74A 4PDLA 3AG2B 4XDJA 3JYCA 1UJWB 2UXCO 3H9VA 5FPRA 3HR0A 5BZBA 4UFZA 1JFFA 4DV0O 1XILA 3LDDA 2QEXV 5B66Z 4GZRB 1BCCH 4I7ZB 2Q6AA 2YXHA 1SF9A 3TXSA 1OCOC 1Q6IA 5KHIA 1K34A 1IBMB 3MHHC 1PNMA 4CS3A 1H2NA 2YXLA 4R6ZA 3HKBA 1Y66A 4EEQA 5EC2C 3JCUZ 4K3AA 3SR2C 1IDSA 1NT2B 2A9HA 1QU7A 2H94A 3VQWA 1VF6A 1HR0O 4TOIA 5KHKA 2QR4A 3ZIAG 4IT5A 2Q73A 1GMGA 1VEWA 5A9GA 2Q7HA 3H01A 1RPRA 1JPXA 2YIDA 4F6RA 2BTQB 1FJGB 1YTFB 4B3RO 3T1YB 4LP8A 4YIOA 1SS3A 1S5JA 2HJFC 3LDEA 1N0NA 5KA5A 4QIWF 1LNQA 3AG4C 3T4ZA 3M8AA 4MVZA 3CCVV 3H1JH 3K06A 1L1FA 2ZE5A 5J2UA 1K73W 5LHIA 5F2VO 4KP4A 2NLJC 4ZHQB 3CS5A 3ZMTA 1XNRB 1ZX3A 4I0XB 4UCVA 1XL4A 4P9PA 4FIPC 4IL6Z 4WFBV 1TVKA 4FZ0A 4YHHB 2DYRB 2CTWA 5DEDA 3ZRVA 4DR3O 1MA1A 4NTYA
chains in the Genus database with same CATH topology
1U97A 2LGQA 1U96A 2LQTA 2HP8A 1HP8A 2RN9A 2RNBA 1Z2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U97 A;  2LGQ A;  1U96 A;  2LQT A;  2HP8 A;  1HP8 A;  2RN9 A;  2RNB A;  1Z2G A; 
#chains in the Genus database with same CATH topology
 3SPJ A;  3U10 A;  3OEE G;  1VQN V;  1FXV A;  2XHB A;  1RM1 C;  2N05 A;  3OGI B;  4H44 B;  1B6Q A;  4DRX A;  1N4C A;  1XL6 A;  4K8Z A;  2EIN B;  3M7M X;  1KB9 F;  3WU2 Z;  5H5N A;  3J80 N;  1Q5O A;  4I5S A;  1MZE A;  3K0D A;  4DR2 O;  1F23 A;  3QF7 A;  1V55 C;  1Q81 W;  2HLD G;  4DW0 A;  4DV5 B;  3K3W A;  2LFR A;  4WCE V;  1M90 W;  3M99 B;  3ASN C;  5IYC O;  2WA4 A;  1QCE A;  2XUM A;  3S3X A;  4E2L A;  4O4H A;  2WLI A;  4J80 A;  5IYB O;  4JV5 O;  4UCO A;  2F43 G;  3SPI A;  4NTW A;  2WLJ A;  1Q7Y W;  1TA8 A;  1GN4 A;  2ZXW B;  2W6I G;  3ZMU A;  1JQ0 A;  2ODM A;  1GM8 A;  4DUZ O;  4X64 O;  2OCC B;  4GLX A;  4OX9 B;  3JAK A;  3P3N A;  4I55 B;  3W7S A;  4YJ3 A;  4LFB O;  3UO2 A;  4G2K A;  3CCS V;  3R65 A;  4JI5 O;  1FFX A;  2JGU A;  5LHH A;  3B8N A;  4CS2 A;  3E35 A;  4X1K A;  3RYI A;  2W0X A;  2E74 B;  4FFK A;  3HKB B;  1T5E A;  1VF6 C;  2DJV A;  4YXW G;  4FM1 A;  2G38 A;  2ZE8 A;  3RGB A;  2ZKO A;  3FB5 C;  1THZ A;  2BOC C;  4X20 A;  4TV9 A;  1EZV H;  2WWW A;  5KHG A;  1M57 C;  1QLN A;  5L3G A;  5BMV B;  1WNS A;  4NXM O;  3ABM C;  3CX5 F;  1NVP D;  4U3J A;  3CCJ V;  4UV8 A;  1K4D C;  2X6B A;  1EFR G;  1GO3 F;  3IGA C;  1S3J A;  3JAT B;  4PA3 A;  4HBN A;  1YVW A;  3A2F A;  3S3W A;  1WA8 A;  1OCC B;  1IXB A;  1PL4 A;  4YHH O;  3CJH A;  2JS5 A;  4UVC A;  3B4S A;  5B3S C;  5L3C A;  3X2Q C;  1DF5 A;  1R1B A;  4DV0 B;  5C8Y B;  4NXM B;  3B09 A;  4GCZ A;  4X1I B;  4FLW A;  3AK3 A;  4TUY B;  3BAA A;  2UXX A;  4I9Q A;  2ITC C;  3LDC A;  2BTO A;  3HKC B;  1FKA O;  3CRR A;  1O9G A;  2ZR3 A;  3BA8 A;  2CTQ A;  2RJZ A;  1ROP A;  4DR5 O;  1YCI A;  3ZCC A;  3I5D A;  1MSW D;  2Y0I A;  1LUV A;  4MVU A;  3AG4 B;  1TVK B;  4MVR A;  2CTR A;  3L74 H;  3PN1 A;  1HR0 B;  4LFC O;  2XT9 A;  4JI2 O;  2DQ0 A;  1SQV H;  2AHZ A;  5IJ0 B;  4X1Y B;  1AR5 A;  2HEP A;  4RQF A;  1Q3E A;  1BS3 A;  4DUY B;  4TSF G;  2ZE6 A;  1JOY A;  3HKC A;  1AJQ A;  5CBG A;  2VWJ A;  1Z5V A;  4G28 B;  3CC7 V;  4QJF B;  3K5M A;  5BR8 B;  2IH3 C;  4I50 B;  3ZRW B;  1WB8 A;  3UQ8 A;  4U7N A;  1W0J G;  2M7W A;  4O4I A;  2B9Z A;  4B7E A;  3HPL C;  1GN2 A;  1G4Y B;  5E1A C;  2A06 H;  1BZK A;  4LF6 O;  1F4N A;  2X7R B;  3EHB B;  1P7G A;  3G4S V;  1Q6U A;  2XTA A;  5FNV B;  1KD1 W;  3H1L H;  2ZDI C;  4X62 O;  2PUS A;  5JWP A;  3WB1 A;  2QM8 A;  4Q20 A;  4UCS A;  1YSC A;  2OTJ V;  1M1K W;  3K5O A;  4X1I A;  4QE7 A;  2NNU A;  5J2T B;  2OYQ A;  3FB7 C;  5A2Q N;  3ASN B;  1Y4M A;  1W0K G;  2BE3 A;  2RDC A;  3AK2 A;  1R3L C;  2F23 A;  1IBK O;  2PYJ A;  2FYU H;  2PI4 A;  2UXB O;  4JI4 O;  4FZ1 A;  2VQE B;  1OHH G;  3JAR B;  3APQ A;  4F6R B;  5CA0 B;  1XNQ B;  3FYI B;  5IY5 B;  2GUZ A;  5K1P A;  4CH3 A;  4JAS A;  3JD0 A;  3AEI A;  3SPG A;  3RWR D;  5L3E A;  4DRX B;  4TV8 A;  3CHX A;  3GWO A;  2CTP A;  4FFB B;  2YEV B;  3OFN G;  1P49 A;  3E86 A;  5LP6 A;  1FXK B;  1NR1 A;  4W4L A;  2PZS A;  2QDO A;  1D5N A;  1VQ5 V;  4UV9 A;  3ZHS A;  4R7C A;  1F7Y A;  3AG1 C;  4Q6G A;  1OV9 A;  4N21 A;  1K5S A;  1H2G A;  4HZ3 A;  3ZS8 C;  2Q67 A;  5EZY A;  4J7Z A;  2EIJ C;  4DUZ B;  1WA8 B;  2YSU B;  5JJN B;  5HFL A;  5KX5 A;  3H1I H;  4JZG A;  3C90 A;  4ASU G;  3OUF A;  5KHJ A;  4QGP A;  2JS3 A;  4AQY B;  1IBM O;  5IJ0 A;  4MVO A;  2ZT9 B;  1OCC C;  2Y48 A;  2EIM B;  3QG5 A;  4DV6 O;  4LF8 B;  3KCX A;  2Z0A A;  3IFX A;  4I4T A;  3OTO O;  3RYC A;  3TK1 A;  3OE7 G;  3W7U A;  1ZSP A;  4O2A A;  3UM7 A;  4JI8 O;  1X59 A;  3WFV A;  4LF9 O;  4NXN B;  5KUM A;  1SER A;  1VAR A;  1XMO O;  4JI1 B;  5L3F A;  4B08 A;  3SJQ C;  2PYL A;  1CP9 A;  5KUK A;  1VQ6 V;  2H3O A;  4DV4 B;  1VQ9 V;  1SZX A;  3RYF A;  1I7F A;  4X20 B;  4KHP B;  2Q8V A;  1HNZ B;  2ZE7 A;  2ZNJ A;  1K92 A;  4CH6 A;  4NTX A;  1TUE B;  2WLM A;  2QM4 A;  2EZP A;  1EN4 A;  1Y76 A;  2P4K A;  3GVM A;  2LGQ A;  1Y76 B;  3SPH A;  3W7W A;  3P3P A;  2Q68 A;  1YHQ V;  2JVD A;  2GDS A;  3LNN A;  3JAT A;  1Y67 A;  4GKK B;  2DYS C;  4JI4 B;  1KP3 A;  1S5H C;  4LWS B;  2WSS G;  5FPO A;  5LGT A;  3O65 A;  3D8C A;  2GSM B;  4JTC B;  1PP9 H;  1AI5 A;  5K1X A;  4G27 B;  1XEQ A;  4X65 O;  2ZCE A;  2FB5 A;  2X0L A;  1WPB A;  4IHJ B;  4HNA A;  4FM0 A;  3CCQ V;  1KQS U;  4PDM A;  3ABL B;  4GYC B;  1GM7 A;  3JAS B;  1WP8 A;  2AW9 A;  1PPJ H;  4LFA B;  1QLE C;  1YXB A;  1BE3 H;  1GH6 A;  5IWA B;  1BHB A;  5BR8 O;  3G6B A;  5LA6 B;  3E22 A;  1A32 A;  1XDC A;  1CXZ B;  3AG2 C;  3RT3 C;  1PNL A;  3T4D A;  2DWD C;  1WAZ A;  1K7D A;  5C8Y A;  4O4H B;  4PI0 A;  3E89 A;  1Q43 A;  3OAA G;  1R6K A;  1YZB A;  3FD9 A;  2WLL B;  3QTC A;  1I94 B;  2JGD B;  4J11 A;  5JH7 A;  1S72 V;  2WLL A;  2OWO A;  5B3S B;  4I50 A;  1EZJ A;  4DV2 B;  4DO2 A;  4F6E A;  1N32 B;  4JI8 B;  2XND G;  4BIU A;  1FFT B;  4MTG A;  3IAY A;  4J10 A;  1S0V A;  4DYL A;  1I5Y A;  4X88 A;  2LW1 A;  3F7V C;  1JA8 A;  1K5Q A;  2JGD A;  3EVK A;  4O4L A;  3LSU A;  4DV7 B;  2P06 A;  1IUR A;  2XOK G;  4FLX A;  2B1I A;  1H2M A;  4KHP O;  3OR6 C;  2KKW A;  5KHH A;  4DR4 O;  1PV0 A;  4IYH A;  3CCM V;  4K0K O;  3B77 A;  3LSS A;  3RYH B;  4PA6 A;  3K57 A;  2AZ2 A;  3DGE A;  4JAA A;  4E4E A;  3ETD A;  1K33 A;  2HJD A;  2ATK C;  5LHG A;  3J81 N;  2JDI G;  1YJN V;  4AI8 A;  2AGA A;  3WG7 B;  2K9P A;  2ZXW C;  3CP1 A;  3SYQ A;  3WB2 A;  2AHY A;  2EIM C;  3ZMS A;  2PGG A;  1YF2 A;  1OCZ C;  4OXS A;  2UUC O;  1I08 A;  2DYS B;  4LWS A;  2HR3 A;  2DYR C;  1W2B U;  4OX9 O;  1H2K A;  2QKA A;  4TQD A;  1EN6 A;  1EN5 A;  2PF4 E;  2ZIO A;  4FM2 A;  1WP7 A;  1XUQ A;  4HNA B;  3ZRS A;  1M56 B;  4RWU A;  2OCH A;  1XI1 A;  4DW1 A;  5DM6 V;  1ZUQ A;  4LF8 O;  4EFE A;  4DXW A;  3A0R A;  5B1O A;  1NI8 A;  3OR7 C;  4Z1M G;  4P9O A;  2HVK C;  1DTO A;  3N2K B;  5KMG B;  2QJ1 A;  4MS2 A;  2OT5 A;  3AG3 B;  1IBL B;  5EBW C;  3ZRX A;  3C3S A;  4Z1V A;  5JVD B;  5B1A C;  1OCO B;  1M9N A;  2BCC H;  3K04 A;  3D3Q A;  5KLV H;  4FJC C;  3L72 H;  4JGS A;  1SQX H;  3OTF A;  1W59 A;  1I94 O;  2Q7G A;  4UCR A;  3H1K H;  2RNB A;  3CCU V;  2CH7 A;  4DV2 O;  3CE2 A;  4H13 B;  2Q7E A;  1HW7 A;  2E76 B;  4JAV A;  3CC2 V;  1M4U A;  3RFR A;  3CPW U;  3SYO A;  3CCR V;  2GUZ B;  1XBL A;  3D3I A;  2KQX A;  3KZI Z;  2Q4P A;  4LH7 A;  3RYH A;  2QTS A;  2X6C A;  2Y69 B;  2QWN B;  1QR8 A;  3L75 H;  1J5E B;  2M6Y A;  3Q4H A;  2QSA A;  4QPK A;  1XHZ A;  4CZZ A;  3CRM A;  5KAF Z;  4U3F H;  4DR1 O;  3DC6 A;  4LF5 B;  5LYJ A;  1YJ9 V;  3ZMZ A;  1GN6 A;  5LMN O;  2MW2 B;  4X66 B;  1XMQ O;  1KEC A;  1VP7 A;  2Q9L A;  4IIJ A;  3BVO A;  1GAX A;  2V7Q G;  2ZM6 O;  3DTU B;  2ZIM A;  2NR5 A;  1IX9 A;  2WA3 A;  3E8F A;  3ETG A;  4PDR A;  4MVQ A;  4WFF A;  2B1G A;  3KKY A;  2BTQ A;  3ETE A;  2P22 C;  1I0H A;  1SQF A;  1N0J A;  5IWA O;  2UU9 O;  4GT1 A;  1B04 A;  1BSM A;  2P67 A;  3QO7 A;  4WFE A;  1AP6 A;  2LJ2 A;  1R3I C;  2F1M A;  3B40 A;  2Y69 C;  3ZHT A;  2DW4 A;  2UXN A;  4QPJ A;  4U3J B;  5CMU A;  5B1B B;  4DK1 A;  3FKS G;  2BSK B;  2QWO B;  1MNG A;  2HG5 C;  5CB4 B;  2XAQ A;  2B5U A;  1Y6X A;  5BY1 A;  4BIO A;  1URF A;  2GHY A;  4JV5 B;  2BSK A;  3QO8 A;  4YIP A;  1RM1 B;  3JD4 A;  2YIB D;  2CH7 B;  3K58 A;  1K97 A;  2UU9 B;  2YIA A;  4LF7 O;  2F93 B;  1KC8 W;  4HYO A;  2HVJ C;  2QE7 G;  2YC0 A;  4MTX A;  2HFE C;  3IC7 A;  4AQY O;  3WB0 A;  3CCL V;  1VQ8 V;  4GKJ O;  4ZBM A;  5CA1 A;  1QVF U;  3JAM N;  5CB4 A;  1QHT A;  2YDE A;  2HHH O;  1NTM H;  4FLZ A;  4FLT A;  5GON B;  2JJ1 G;  3QVN A;  1KYO F;  4PA4 A;  1S76 D;  2UUB B;  4P2Z A;  1AJP A;  5IE9 A;  4HAM A;  2WLI B;  4GKJ B;  3ABL C;  2JEU A;  3CRQ A;  2ITD C;  4JYY A;  3K79 A;  1H8H G;  5H6Q A;  1FD9 A;  3LUT B;  4YY3 O;  2CGO A;  4JI7 B;  2GTA A;  5JH7 B;  3ZRW A;  1JMK C;  4DV3 B;  2UUB O;  1KU9 A;  3K9S A;  3ASO B;  4IIJ B;  1P7B A;  1H2L A;  3B8M A;  1YJW V;  3J7A U;  1U97 A;  2FML A;  2DQ3 A;  2A0L A;  4NR1 A;  5DN6 G;  2ADP A;  5FLX N;  5LXT B;  1S77 D;  1WB7 A;  5EYP A;  2D2C B;  5LOV A;  1OJH A;  2W0F C;  3N2G B;  4H0L B;  1HNW O;  4X1K B;  4JI3 O;  1AR4 A;  2CK3 G;  1VQL V;  1VF5 B;  2QA4 V;  5H6R A;  1ZAU A;  3CWB H;  3CSX A;  1AB3 A;  1JX9 A;  3DSQ A;  4O4L B;  4GX2 A;  4B3R B;  4I55 A;  3ZJZ A;  4JI0 B;  3PJS K;  3UT5 A;  3NXS A;  2C2A A;  1FFX B;  1SZT A;  4LF9 B;  3K03 A;  5BXZ A;  4NXN O;  3SJB C;  3X2Q B;  1YTF D;  3ZHQ A;  4JI3 B;  1NTK H;  3BFR A;  4MSW C;  3KCY A;  3E8B A;  1BQ0 A;  2NN4 A;  2BOB C;  2R9A A;  2CDY A;  4N23 A;  4LF7 B;  4TT3 G;  1B3Q A;  4B3T B;  1IZ3 A;  1HNZ O;  4ABM A;  4UXN A;  4PD4 F;  1GTO A;  3L70 H;  3CD6 V;  1AP5 A;  4TV9 B;  3JAK B;  1EBO A;  4LF4 B;  2VRZ A;  3ZED A;  2XAF A;  1BQZ A;  2Q0O C;  3C3T A;  4EB6 A;  2ZQM A;  5GON A;  2HHH B;  4FFB A;  4MTO A;  5EBL C;  2GBO A;  1VQ7 V;  2ZNI A;  4MW3 A;  4WFG A;  5JJE B;  4UB6 Z;  1N34 B;  4ICG A;  5J9P C;  1MAB G;  2DWE C;  1AVM A;  1SET A;  1AJN A;  3BY6 A;  2R9R B;  1TAE A;  3Q4H B;  5TIS Z;  2YS8 A;  2Z3Y A;  3CXH F;  1LUW A;  2YEV A;  3UO3 A;  1IBK B;  2WPD G;  1EM1 A;  1K4C C;  1Q82 W;  4FVM A;  1Q6H A;  2EIL C;  4DV7 O;  4LFA O;  4U7O A;  2A79 B;  3K08 A;  1RP3 B;  3I55 V;  4D6T H;  3W7T A;  5HFM A;  1XHX A;  4BW9 A;  1TGO A;  4X64 B;  3O9O A;  1QVG U;  4PHZ A;  1P4R A;  3AG7 A;  5CA3 A;  5JCO A;  5KX5 B;  1HNX B;  4JZ2 A;  3ZN1 A;  1KMI Z;  4JF3 A;  3N2G A;  3VBB A;  5EYP B;  2P7T C;  3FX7 A;  2JRI A;  3G67 A;  1P84 F;  5L3D A;  3K5N A;  2ZIN A;  4L87 A;  4UCT A;  3WG7 C;  2WLH A;  2L35 A;  4I4T B;  4PA7 A;  3RVY A;  3D36 C;  3HKE B;  3CC4 V;  3GWK C;  1V54 C;  5EC1 C;  2Z5U A;  3SYP A;  2R72 A;  5FL7 G;  4LCU C;  3THO A;  4C7U A;  5LOV B;  3CXC U;  2F66 C;  5LXT A;  2E75 B;  1Q86 W;  3OGC C;  1TUB A;  1YEW A;  1BMF G;  3SDL A;  3DC5 A;  3ICX A;  3ZX6 A;  2ADQ B;  1O9H A;  5GTI Z;  1QNM A;  2ETN A;  4X62 B;  4RQE A;  1FS0 G;  5JQG B;  1XRE A;  1R6T A;  3RBZ A;  4L8J A;  3JCZ A;  3ZHR A;  4DR6 B;  4RUF A;  1UFI A;  1SRY A;  2R70 A;  2RCV A;  4TV8 B;  4JTA B;  4DK0 A;  4K0K B;  2V1D A;  1YIJ V;  4MT8 A;  1FPO A;  5CA1 B;  4PEL A;  4H33 A;  5B1A B;  4JI1 O;  3CCE V;  5L3B A;  2EBO A;  4TWK A;  3AK1 A;  3OMI B;  2P90 A;  4IYI A;  4RAI A;  2UXB B;  2JEX A;  1NVP B;  2DMX A;  4PV1 B;  4KFM A;  5LGU A;  3F5W C;  3F5T A;  5EIB C;  1NZ6 A;  4DV3 O;  1N34 O;  4DR6 O;  3T2M A;  5D5P A;  4NB5 A;  2V4D A;  1PM9 A;  1PKX A;  3OT7 A;  2EIK C;  3CJH B;  3BAB A;  2Y4T A;  4BWA A;  3P32 A;  1FXK C;  2JJ2 G;  3IJ4 A;  1V54 B;  2RQ6 A;  1IVS A;  4YJ2 A;  5IYZ B;  4MVM A;  1SA0 A;  4D7S A;  4GKK O;  5H2F Z;  2ZD9 A;  3JAS A;  3ML0 A;  5B5E Z;  2EIJ B;  5JCO C;  4UCU A;  3B2E E;  2CUG A;  3K0G A;  5LMU B;  1NS1 A;  3MD0 A;  3TXQ A;  1E1R G;  4JTD B;  2N04 A;  4DV5 O;  1DK1 A;  1BT8 A;  2UXD B;  1JJO A;  4BW5 A;  1HP8 A;  2ZDI A;  1LR1 A;  2IJJ A;  3JAW B;  1FAF A;  4F4L A;  2QWR B;  4FK5 C;  3ABM B;  4X89 A;  3T1H O;  1ORQ C;  1L0N H;  3N27 A;  3TCU A;  3CYO A;  1VQO V;  3SYA A;  4FLV A;  4DR7 O;  2E3C A;  2O57 A;  4B3T O;  4DV1 O;  2JIZ G;  5EZY B;  4I9W A;  1E1Q G;  3K5L A;  3E2E A;  1JJ2 U;  3LSQ A;  4O4I B;  2UUA B;  1J5E O;  4B7K A;  4QE9 A;  1QBZ A;  1V55 B;  2CAZ C;  2P6J A;  4FLY A;  1SQP H;  1COW G;  1TUB B;  3CMA V;  5DEC A;  1L8D A;  3RN4 A;  2PY5 A;  4P30 A;  4DR7 B;  4J9Y B;  3A0B Z;  1M56 C;  1GK9 A;  3UT5 B;  5LMN B;  2YXY A;  1XNQ O;  1KKC A;  1D5A A;  3CME V;  3EFF K;  4DR3 B;  3K59 A;  4BIZ A;  4JYA B;  1R73 A;  1HWY A;  2IW5 A;  1U96 A;  3JD1 A;  1RSO A;  4MW8 A;  4JI6 O;  3L71 H;  4FLU A;  4GUN A;  1YIT V;  4NYK A;  5AG2 A;  1BHA A;  1VIB A;  4CS4 A;  2QGN A;  3N2K A;  5LGN A;  5LBQ A;  4ZOL A;  3NR7 A;  1MZF A;  3CRA A;  2P5O A;  4JYA O;  5CA0 A;  3VQY A;  4B3S O;  2OCC C;  4FMT A;  4CC5 A;  1KP2 A;  5B1B C;  4H37 A;  4EB6 B;  5JJJ B;  2PI5 A;  1SA0 B;  1HNX O;  2LFS A;  3U11 A;  5BMV A;  5E79 Z;  3T1C A;  2IJH A;  4YJ2 B;  3AG1 B;  3STZ C;  2CE4 A;  3UCS C;  4PI2 A;  3OMN B;  3F7Y C;  4DV6 B;  4R8C A;  3BA9 A;  1WPX A;  4QNH B;  4JAU A;  3VQX A;  2IJK A;  1Q8I A;  2WAM A;  4RO2 A;  1MSD A;  2E5L O;  1E79 G;  2HP8 A;  5C93 A;  3ABU A;  4JI5 B;  1D2D A;  5EK0 A;  3T1H B;  4NKG B;  1FYJ A;  3TJT A;  1Y74 B;  1AIL A;  1HDJ A;  1QR9 A;  1OCZ B;  1SQQ H;  4O4J A;  5LYJ B;  5ITZ B;  4B3M B;  2VQF O;  4DV1 B;  1K9M W;  4TQF A;  1VQK V;  2IM9 A;  1OCR B;  5J2T A;  1N32 O;  1VMG A;  3E8H A;  2E5L B;  1KUQ A;  3GB7 C;  3JD3 A;  2EIN C;  2GV9 A;  5IJ9 A;  5LP6 C;  3HB3 B;  4J9Z B;  2CGN A;  4UUJ C;  2F4V B;  1OZ0 A;  3VOU A;  3ABK B;  1OCR C;  1XQ8 A;  1N8R W;  2QKC A;  3A0H Z;  3FYE B;  3RYF B;  1X4T A;  1H38 A;  3JAL B;  3OTO B;  3UKM A;  4B3M O;  2RN9 A;  2A3Q A;  2LO1 A;  3JAL A;  3H1H H;  1I5X A;  2UXC B;  1JFF B;  3BCC H;  2OIE A;  3VQV A;  2YIC A;  4JPR A;  1GM9 A;  3K9A A;  5IJ9 B;  4D7T A;  4PA9 A;  1HNW B;  4JYB A;  3P30 A;  3HKD A;  4LF5 O;  5H9C A;  4CH4 A;  1VQ4 V;  5LMU O;  4LNU A;  5LA6 A;  1NH2 B;  3CEI A;  1SES A;  2UUC B;  3E8G A;  2UXD O;  5CBH A;  3JSL A;  3FAV A;  2ZM6 B;  3OEH G;  2MK3 A;  1CEZ A;  4CH5 A;  2IU0 A;  4UVB A;  3G71 V;  5J2U B;  1N36 B;  5IY5 C;  4JI2 B;  4A5U B;  5IDJ A;  1JR9 A;  3OW2 U;  1MG1 A;  2KG7 B;  2Q5Z A;  5B1N A;  3ABK C;  3FB8 C;  3STL C;  4PDV A;  1H8E G;  4DR2 B;  3LNM B;  3E83 A;  2ILM A;  3BRC A;  1NTZ H;  1NQT A;  5GW7 A;  1VQM V;  1BL8 A;  1QLE B;  1ZWI C;  3MAQ A;  1IBL O;  3RVZ A;  3ZBH A;  1N36 O;  4LF4 O;  4X1Y A;  2FKX A;  2UUA O;  5IYD O;  2DE0 X;  4TUY A;  4LF6 B;  1GKF A;  3ABT A;  2KB1 A;  2EIK B;  2ARH A;  2EUL A;  5ITZ A;  1ZLZ A;  5GTH Z;  3G80 A;  4GX5 A;  1ENV A;  5KAI Z;  2A7W A;  3FFQ A;  1V9P A;  4X8A A;  2JK5 C;  2Y0P A;  1NJI W;  1AR1 B;  1RFY A;  1NBM G;  4JI6 B;  5FNV A;  4DV4 O;  2EX3 A;  2OIG A;  4LBE C;  2XAJ A;  4AHC A;  1R3K C;  2VS0 A;  4LNU B;  1CPY A;  2VQE O;  1RPO A;  4ZKI A;  1MMM A;  4W4K A;  3G6E V;  4MTF A;  1DLB A;  4X66 O;  1XMQ B;  3FAV B;  3MDS A;  2OTL V;  1JCH A;  4B3S B;  1RSO B;  4MVS A;  4X9Q A;  2YIB A;  2LW7 A;  2P4V A;  1M57 B;  2Q0A A;  1SC5 B;  4O2B B;  1ZL8 B;  3QNE A;  1WJZ A;  4YY3 B;  1F51 A;  2QWP B;  1AI4 A;  4JI7 O;  1GRJ A;  3OD4 A;  3QO5 A;  4DR4 B;  4J41 A;  2HKO A;  3W7X A;  3DXR B;  4X65 B;  2VWK A;  1YI2 V;  3I56 V;  1G6U A;  1VF7 A;  3JD2 A;  4UB8 Z;  3TGU H;  3BHP A;  4LFB B;  2QWQ B;  1K3E A;  1PNK A;  1ZTE A;  2YI8 A;  5LP6 B;  5D5Q A;  5EBM C;  4WBN A;  1PD3 A;  4KXR A;  3RW0 A;  2IH1 C;  3BPZ A;  4ZHQ A;  1K8A W;  4ZIB A;  4AIL C;  1NKD A;  1QQC A;  1NU1 H;  4GX0 A;  1Q90 D;  3OUS A;  5KMG A;  1B06 A;  3BEH A;  2EIL B;  3ETQ A;  5EIB D;  5JQG A;  2DOS A;  4JI0 O;  3KG2 A;  2Y4U A;  4EFB A;  3IC9 A;  2IBZ H;  4ZOL B;  1Z5W A;  5IYZ A;  3EXA A;  2YI9 A;  2WLN A;  2ZR2 A;  2F4V O;  1FXH A;  3CB2 A;  5IT9 N;  4WBN B;  2EJR A;  2N74 A;  2QKS A;  2PTM A;  4LC1 A;  1FJG O;  2DN9 A;  1R6N A;  2IU3 A;  5CN0 A;  3HKE A;  3JAR A;  2K1E A;  4BAY A;  1NH2 D;  2AXT Z;  4WF9 V;  4Z2W A;  2LP7 A;  4WFA V;  2D3O W;  4RUE A;  4LR3 A;  1AI6 A;  5LL6 Y;  3D36 A;  4LH6 A;  3SJC C;  3SYC A;  1F4M A;  1Z2G A;  2YUA A;  4O2B A;  1XNR O;  1BGY H;  4J42 A;  3A8T A;  2WLK A;  4ZI7 A;  1SQG A;  1SKV A;  4DR5 B;  3U0Z A;  4ZI7 B;  3DXR A;  3SJA C;  1PL0 A;  4OPH A;  3L9D A;  2GTS A;  4O4J B;  4XBF A;  3ZHU A;  4O2A B;  4PJ0 Z;  4FPP A;  4YJ3 B;  2EJ7 A;  3MHS C;  3AG3 C;  3TET A;  2W6J G;  4LFC B;  1R3J C;  4OPA A;  4WFH A;  2XAG A;  4NVP A;  1DF4 A;  1M93 A;  4DUY O;  3ZHV A;  4K8X A;  1KBH A;  3RYI B;  4UVA A;  4GX1 A;  1G8M A;  4IGG A;  4CBC A;  1VQP V;  4XDK A;  2RMK B;  1MOF A;  2AZ0 A;  3OMA B;  3ZMV A;  2F95 B;  2QM7 A;  5KA6 A;  2FTK A;  3FB6 C;  1FXK A;  1UPG A;  1YDX A;  4I0X A;  1DGS A;  1M5I A;  2H8P C;  4OGQ B;  1H2S B;  1N33 B;  2LGW A;  4J7J A;  3OM3 B;  3HKD B;  3E22 B;  1WLE A;  1ZL8 A;  1G1X B;  3ASO C;  4R50 A;  3T1Y O;  5CBF A;  4CC6 A;  2QTO A;  1AI7 A;  5JVD A;  3JSN A;  2LQT A;  3ZN0 A;  3CRC A;  4J7K A;  1S5L Z;  4XDL A;  1US6 A;  3JAW A;  2L6L A;  4BR6 A;  4IHJ A;  3L73 H;  2KG7 A;  2EZO A;  1ARO P;  1N33 O;  1IXM A;  2XAS A;  1KKD A;  4EKW A;  2Q69 A;  1NR7 A;  2X6A A;  3R66 A;  2IJI A;  2R9I A;  2VQF B;  1SQB H;  4JYC A;  4K35 A;  2FL4 A;  3APO A;  3SGI A;  4KUM A;  1L0L H;  1XMO B;  2KSD A;  1J95 A;  2XAH A;  1WN7 A;  1JVM A;  4DR1 B;  1XOU A;  4KL1 A;  3SPC A;  3RYC B;  1GN3 A;  1Y74 A;  4PDL A;  3AG2 B;  4XDJ A;  3JYC A;  1UJW B;  2UXC O;  3H9V A;  5FPR A;  3HR0 A;  5BZB A;  4UFZ A;  1JFF A;  4DV0 O;  1XIL A;  3LDD A;  2QEX V;  5B66 Z;  4GZR B;  1BCC H;  4I7Z B;  2Q6A A;  2YXH A;  1SF9 A;  3TXS A;  1OCO C;  1Q6I A;  5KHI A;  1K34 A;  1IBM B;  3MHH C;  1PNM A;  4CS3 A;  1H2N A;  2YXL A;  4R6Z A;  3HKB A;  1Y66 A;  4EEQ A;  5EC2 C;  3JCU Z;  4K3A A;  3SR2 C;  1IDS A;  1NT2 B;  2A9H A;  1QU7 A;  2H94 A;  3VQW A;  1VF6 A;  1HR0 O;  4TOI A;  5KHK A;  2QR4 A;  3ZIA G;  4IT5 A;  2Q73 A;  1GMG A;  1VEW A;  5A9G A;  2Q7H A;  3H01 A;  1RPR A;  1JPX A;  2YID A;  4F6R A;  2BTQ B;  1FJG B;  1YTF B;  4B3R O;  3T1Y B;  4LP8 A;  4YIO A;  1SS3 A;  1S5J A;  2HJF C;  3LDE A;  1N0N A;  5KA5 A;  4QIW F;  1LNQ A;  3AG4 C;  3T4Z A;  3M8A A;  4MVZ A;  3CCV V;  3H1J H;  3K06 A;  1L1F A;  2ZE5 A;  5J2U A;  1K73 W;  5LHI A;  5F2V O;  4KP4 A;  2NLJ C;  4ZHQ B;  3CS5 A;  3ZMT A;  1XNR B;  1ZX3 A;  4I0X B;  4UCV A;  1XL4 A;  4P9P A;  4FIP C;  4IL6 Z;  4WFB V;  1TVK A;  4FZ0 A;  4YHH B;  2DYR B;  2CTW A;  5DED A;  3ZRV A;  4DR3 O;  1MA1 A;  4NTY A; 
#chains in the Genus database with same CATH homology
 1U97 A;  2LGQ A;  1U96 A;  2LQT A;  2HP8 A;  1HP8 A;  2RN9 A;  2RNB A;  1Z2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...