1F7YA

The crystal structure of two uucg loops highlights the role played by 2'-hydroxyl groups in its unusual stability
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
b'PITKEEKQKVMQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRMLIEKLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA FRAGMENT
publication title The crystal structure of UUCG tetraloop.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosome
total genus 17
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2000-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1f7yA00
1IBMO 3R66A 4B3SO 4DV2O 2FKXA 4DR2O 4K0KO 1D2DA 5H5NA 1N33O 4JYAO 1HNWO 2N74A 4JI0O 5BR8O 4JI5O 1NS1A 4DR1O 2HHHO 1XEQA 4JV5O 5LMNO 1XNQO 4X62O 3O65A 4OPAA 2UXBO 4DV7O 1R1BA 1G1XB 4NXMO 2ZKOA 1IBKO 1R6TA 3RT3C 4DUZO 1X59A 2F4VO 4X64O 4LFCO 4DUYO 1FKAO 1N36O 1AILA 1XNRO 4JI3O 1FJGO 4OPHA 5BXZA 3T1YO 3J80N 4DR5O 3J7AU 4LF6O 1KUQA 2JRIA 4DR3O 4AQYO 3OTOO 2VQFO 1IBLO 4B3TO 4LF5O 4JI1O 1XMOO 4DV3O 1XMQO 3M8AA 1A32A 4DV5O 4A5UB 2LW7A 1HNXO 2VQEO 1J5EO 4LF8O 5BY1A 4LFAO 2DOSA 3SDLA 4LF9O 5FLXN 2ZM6O 1AB3A 4JI4O 4B3RO 2DJVA 4KHPO 4X65O 1HR0O 4DV1O 5IWAO 1FYJA 5LMUO 4NXNO 2AGAA 4YHHO 2Z0AA 3JAMN 4LF4O 3F5TA 1N34O 4JI6O 4OX9O 4JI2O 3T1HO 2UUCO 4DV4O 4LFBO 3J81N 1HNZO 1N32O 4DV6O 4X66O 4YY3O 5A2QN 4B3MO 2UXCO 2UU9O 4JI8O 1DK1A 5LL6Y 5IT9N 2UXDO 4DR6O 4GKJO 4DR7O 4JI7O 2E5LO 2UUBO 4DR4O 1F7YA 4LF7O 1I94O 4GKKO 2UUAO 4DV0O 1YZBA
chains in the Genus database with same CATH superfamily
1IBMO 2LO1A 1WAZA 3TK1A 4LWSA 2EIJC 2V7QG 4OGQB 3SYQA 3CPWU 4AHCA 1EZVH 3CCLV 5J2UB 1I7FA 4UVAA 5EIBD 1XEQA 3ETQA 3ZHSA 5LBQA 2JIZG 1XNQO 4YHHB 1H8EG 4I50A 2ETNA 2YICA 2UUAB 3ZS8C 1BZKA 5KMGB 4JI2B 5L3DA 1YDXA 4MVZA 4FIPC 2CAZC 1JX9A 3VQVA 2P4KA 3IJ4A 1URFA 2B1IA 1ZTEA 4IYHA 2DE0X 4J9YB 2UXXA 5BXZA 4PJ0Z 4J7KA 3BVOA 1AI4A 1O9GA 4FLZA 5KUMA 2YIAA 1JQ0A 1NR7A 3EHBB 4MTXA 4E4EA 5KMGA 1K34A 1LUVA 2XAQA 4X64B 5GTIZ 1WPBA 2XAGA 1A32A 4MVUA 4A5UB 3BY6A 4PELA 3RYFB 1FXHA 1PNKA 1OV9A 1YCIA 2H8PC 1RPRA 2YXHA 5FLXN 1K3EA 1EFRG 3DC5A 4I55B 5FNVB 4R6ZA 2BTQB 3RFRA 2DJVA 1P84F 1XMOB 5B1AB 4J7JA 3F5TA 2X6BA 3A8TA 5IYZB 5AG2A 3JCUZ 1THZA 4LF9B 1AVMA 4UB8Z 2GV9A 3LSSA 1K7DA 1XNRB 3QVNA 1P49A 1OCOB 2QE7G 5H6QA 3RYFA 1XDCA 5LHGA 3X2QB 3UO3A 2DN9A 2L6LA 4I55A 5FNVA 3RYIB 2BTQA 2Y0IA 4CS3A 4Z1VA 2OTJV 4LCUC 4EFEA 1DLBA 1U96A 3RVZA 3O9OA 5JCOC 1GN6A 1JOYA 2YI9A 4YY3B 2Y69C 5LOVB 5IYZA 4AILC 5CMUA 4TOIA 3BEHA 5FL7G 3K04A 3LSQA 4GX1A 4GYCB 1AR5A 2PF4E 4DR6B 3W7XA 2VWJA 1I5YA 3OW2U 4EB6B 3JD3A 2P22C 2Q6AA 5IYBO 2OIEA 2WLHA 2N04A 4X62O 4EKWA 5CA3A 2R9IA 2W0XA 3RYIA 1JJOA 5EYPB 4N21A 2RJZA 3A0BZ 4DR1B 4J80A 2WLKA 2HVJC 4MTGA 1L1FA 2P90A 3FFQA 3QO8A 3FB5C 1KECA 4PA4A 4K8ZA 4HNAA 2EJRA 1WLEA 4TUYB 1S5HC 2ZR3A 2EIKB 1WJZA 1G6UA 1GM8A 2JEXA 2JGDA 2OCCB 3GVMA 4ZHQA 5EYPA 1H8HG 2CK3G 4ZIBA 1VMGA 5CN0A 4LF6B 1US6A 3CD6V 3OAAG 2LQTA 4J11A 4X88A 3K0GA 4LF5B 4JI1B 3L70H 1IXMA 2Y4UA 1TVKB 1SESA 3AG1B 4U7OA 4B08A 1NZ6A 1N34O 4X9QA 4PDMA 3N27A 1PNMA 4YIOA 3BRCA 2ADQB 4WBNB 4LFBO 4DV6O 1AJNA 2PTMA 3U10A 5JJEB 3AG7A 1KP3A 2A3QA 3FD9A 5LXTB 1OCZC 3G6BA 2WSSG 5IYDO 2E5LO 3DSQA 1WP7A 3FYEB 4DR4O 1NI8A 2W6IG 3D36C 4I0XB 3UM7A 1I94O 1TVKA 1YZBA 2GSMB 1B6QA 4DW0A 2N05A 5EK0A 4WBNA 4MW3A 4JI5O 2DWDC 1VQMV 1NVPD 1U97A 5LXTA 4DR2B 1NQTA 2XAHA 1BQ0A 4I0XA 1MNGA 1N32B 3TJTA 2ZXWC 2EZPA 4WFFA 2E74B 5CA0B 1Y74A 2DYSC 2EILC 4UCVA 3QNEA 4JI3O 3JATB 3OUFA 1B06A 3APQA 2W0FC 5KHJA 3W7WA 5B1OA 4DV0B 2DQ3A 2NR5A 3OTOO 1IURA 3ABTA 3K5OA 4U3FH 4PDVA 4UV9A 4K0KB 2GTAA 3GWOA 2LW7A 1J5EO 5L3GA 3LDDA 2DMXA 5CA0A 5CBFA 3K5LA 1J95A 4KFMA 5FPRA 2UXNA 4UCRA 1PD3A 3JATA 1YJWV 1AJQA 1K97A 1COWG 4UVBA 3A0RA 5B5EZ 1AP5A 3D3QA 3OR7C 3B8NA 2VQEB 1XL6A 4GCZA 3E89A 4J10A 1X4TA 4QIWF 4LFCB 2EX3A 4W4LA 3OE7G 1N0NA 2UUCO 2WLMA 3Q4HB 4Q20A 2Y48A 4J41A 3CHXA 4ABMA 1MZFA 2IJKA 3VOUA 1YSCA 4P30A 1SQPH 1SC5B 4AQYB 4GKJO 5GONB 3BABA 1GN2A 1Z5WA 2WPDG 3SYPA 1BGYH 4JAAA 2XTAA 4Q6GA 2EINB 3CC4V 1H2MA 5A9GA 1R6NA 3ABUA 5LGTA 2Y0PA 3ZMVA 1SQFA 2XT9A 1Q90D 2UUBB 3ZEDA 3L71H 2DWEC 5JJJB 4I4TA 4DV7O 5GONA 4B3SB 4DV2B 3HKCA 3WB1A 3ML0A 2B9ZA 1N4CA 1PL0A 3AK3A 4JYAB 1HNWB 3ABLB 3CXCU 3FYIB 3LDCA 1AR1B 1EZJA 1GMGA 4DR5O 1V54C 3K3WA 1R73A 3NR7A 3K0DA 3KCXA 1KUQA 5B3SC 4PHZA 5JQGB 4DUYB 2ZT9B 4FLVA 4PA7A 2CUGA 2EIJB 3VQWA 3IC9A 1Q82W 3K5MA 1Q43A 4JTCB 2W6JG 2PUSA 4FJCC 2CTPA 5HFLA 4RUEA 4LR3A 4DR3B 2UXBB 2HP8A 4X65O 1HR0O 1GM9A 4B3TB 2ITDC 2F1MA 2YC0A 2AGAA 4O4LB 3HKBB 2RMKB 3UKMA 1IDSA 4JI6O 2Q9LA 1N8RW 2XHBA 1RSOA 5KHGA 1S5LZ 4X66O 1EN4A 5IT9N 1YITV 3L9DA 3PN1A 3K03A 2Q7GA 4DK0A 1AI6A 3ABKC 5F2VO 4F6RA 2WWWA 2Q68A 4MTOA 2QKAA 3JD1A 1HNZB 1DF5A 4O4LA 3AK2A 3HKBA 2Q67A 3C3TA 5LP6B 4JI8B 4CS4A 4H13B 4GX5A 1L0LH 4TT3G 1H2GA 1NS1A 4U3JB 2F23A 2IM9A 2X6AA 1XQ8A 1WB7A 3OEHG 4NR1A 1BE3H 3G4SV 5CA1B 4FPPA 5IJ0B 3OUSA 1IBMB 2ZDIC 1S3JA 3JALA 3T1HB 1R3KC 4R7CA 3S3WA 3ASNC 3CSXA 4DRXB 5LP6A 4JYBA 4BIZA 3K9AA 1AROP 1XNQB 4CH4A 4O4JA 4NB5A 4UB6Z 3T1YO 3CCRV 3FB6C 4U3JA 4GKKB 3CWBH 5CA1A 1M56B 4TV8B 2R9AA 5IJ0A 3ZMUA 2AXTZ 4F4LA 1H2SB 1V55C 1HNXO 2JVDA 3RBZA 3SJQC 4GX0A 2HHHB 3EFFK 2ZQMA 1K8AW 4TSFG 2EJ7A 1KBHA 1IX9A 3ICXA 1FYJA 4NXNO 1VQNV 2Q0AA 1Z5VA 1OJHA 4BAYA 4DV4O 2IW5A 2H3OA 1Q7YW 3E2EA 2JJ2G 4B7EA 3GB7C 3EVKA 4PDLA 2EIMB 1VQ8V 5EZYB 3RYCA 1NKDA 1LR1A 4FVMA 4QE7A 1I5XA 3KZIZ 1YHQV 1DF4A 5ITZA 1VQ7V 1M4UA 5EC2C 3K57A 1ORQC 2GTSA 4TQFA 4F6EA 3WB2A 3P30A 1AJPA 5LGNA 1Q86W 1FXKC 1KU9A 1IBKO 5EZYA 4FLXA 1XILA 3W7TA 2F93B 1ZX3A 3TETA 2LFRA 1GH6A 1NU1H 4X62B 5LHIA 3ASOB 4NTXA 4OXSA 4WFAV 1OCZB 3N2KB 5KHIA 2LGWA 4CH3A 4O4IB 1BQZA 5JVDA 1KC8W 2ZIMA 2R70A 4PI0A 2OTLV 2XOKG 4LF8O 3L72H 3JASA 3JYCA 1WP8A 4UFZA 1UJWB 3JD4A 3JAKB 3AK1A 1YTFD 1DTOA 1FAFA 2YS8A 4XDKA 3OTFA 5J2UA 4ZI7B 4UXNA 2YXLA 4OX9O 5K1XA 3U11A 1G8MA 5B66Z 4RQEA 1JVMA 2DYSB 2EILB 4BW5A 3ETGA 1OHHG 2OT5A 2UU9O 3L75H 3JAKA 3OMAB 4X89A 1VQKV 1LNQA 1RM1B 1N34B 4JI7O 3CCEV 1JFFB 4DV3B 3RGBA 2XAFA 3RW0A 1ZUQA 4J42A 3I56V 1SKVA 2JS3A 1R3LC 5KA5A 4DV6B 3QO7A 3LSUA 3R66A 3WFVA 1YVWA 3W7SA 3LUTB 1V9PA 1GN4A 1VARA 1K92A 4HYOA 1YJ9V 2ARHA 4DR4B 4BIUA 2HR3A 4LF4B 3ZRWB 2ATKC 1JFFA 3ZRSA 2DW4A 2QWOB 1Q6HA 5L3FA 3AG2B 2HG5C 4JI5B 4HZ3A 4LH6A 2ZE7A 3U0ZA 4JZGA 1XOUA 2Q8VA 4G27B 1FJGO 1VF5B 4FM0A 5B1BC 3K9SA 3AG4C 2LW1A 4MVSA 5KLVH 2JRIA 3OFNG 1H38A 1TA8A 3ZRWA 4H33A 1VP7A 4FLWA 1SRYA 3SGIA 1P7GA 2Q7HA 4LH7A 4FZ1A 3M99B 1H2LA 4J7ZA 4JI3B 5BY1A 2Q0OC 4HBNA 5LOVA 3OTOB 4RAIA 4EB6A 1L8DA 4K8XA 2ZIOA 5LMUO 1QR9A 1HWYA 4YHHO 4DUZB 3UT5B 1W0KG 3ABMC 1AI7A 4JI2O 5KAFZ 4CH6A 3CC2V 1VF6A 2PY5A 1ZWIC 3CCMV 2GDSA 5A2QN 2V1DA 1PPJH 2UXDO 4QE9A 1ZSPA 5B3SB 3H9VA 5LYJB 2XNDG 2QR4A 1W2BU 1SQXH 2WA4A 4WFGA 4EFBA 2UUCB 3NXSA 4TUYA 4LFAB 3UT5A 4PI2A 1S76D 4ICGA 3ZHQA 3OEEG 4BIOA 4GKJB 1PL4A 5K1PA 1OCCB 4KHPB 3S3XA 2KKWA 3B2EE 1QU7A 5IWAB 3HKDB 4JV5O 2QTSA 3WG7C 3E35A 4R50A 1O9HA 2QKCA 5LYJA 1Q81W 1BT8A 3ZMZA 4NXMO 3CJHB 3K79A 1D5NA 1MA1A 4KL1A 4X1IB 1XHZA 3MHSC 1MSWD 4EEQA 1OZ0A 1SF9A 2L35A 1N36O 1XNRO 3ABKB 4IYIA 2PYLA 1QQCA 2FYUH 2ADPA 2EBOA 3MAQA 2VQFO 3E8BA 1FXVA 2GBOA 4FLUA 1SZXA 1VEWA 4NTWA 4JASA 3CMEV 1QLEB 3CJHA 1VQLV 4LBEC 3KKYA 2WAMA 3K06A 4X1IA 4MS2A 1ZL8B 2BSKB 2WLLB 2ZM6O 1AI5A 4DO2A 1AB3A 3WB0A 4B3RO 2CGOA 4FK5C 1JJ2U 1MZEA 2PI5A 5CBHA 3TXQA 2NN4A 2K9PA 2QM8A 3J81N 3HPLC 4X65B 1HR0B 1AR4A 1GKFA 2QSAA 3OD4A 1ZL8A 1YI2V 2BSKA 2WLLA 3K58A 4YXWG 4DR7O 1XBLA 3SJCC 1S0VA 3I5DA 1SQVH 3CCVV 2ZDIA 4J9ZB 1W59A 4X66B 3DGEA 1D5AA 1Y67A 2JJ1G 3CC7V 1N33O 2YIDA 2QGNA 5CB4B 2MW2B 2RQ6A 5LMNO 4D7TA 2YIBD 4MT8A 1JA8A 3R65A 3F5WC 3G6EV 3RVYA 2CTQA 1R1BA 3CYOA 2QTOA 1VQ9V 4DW1A 2F4VO 4FFBB 4LNUB 3T4DA 4JGSA 5CB4A 3Q4HA 3CMAV 4KP4A 4MVQA 3BA8A 5E79Z 4CBCA 3LDEA 3ZMTA 2ILMA 3C3SA 2GUZB 5EBMC 2BCCH 3UQ8A 4I9WA 3T1YB 4G28B 3GWKC 1BS3A 2A06H 1BMFG 4LNUA 4WFEA 2JDIG 3FB8C 3ZJZA 1Q3EA 3B4SA 1TUBB 4UCSA 2QJ1A 3H1IH 5IDJA 1Y76B 2PYJA 1HNXB 3F7YC 4MVRA 2EIKC 4IT5A 1FXKB 1MG1A 3KCYA 2GUZA 4JTAB 2FL4A 3LNMB 4IHJB 5LA6B 1CP9A 2LJ2A 1IVSA 4L87A 2IH1C 1N32O 5IY5C 3P32A 2UXCO 2ZE6A 1DK1A 2ZE5A 4NXNB 3BFRA 5L3BA 2QWPB 1TAEA 1BHAA 2ZD9A 1GRJA 1RPOA 1TUBA 3AG1C 4FFKA 1TUEB 3ZHTA 1Y76A 4LF7O 1BCCH 3KG2A 4DV0O 1E1QG 5JQGA 1FXKA 2NLJC 1ROPA 2FKXA 4K0KO 3SYAA 3ZHRA 1NBMG 5J2TB 1IZ3A 3B77A 5H5NA 4IHJA 5KA6A 3OMNB 4YIPA 1VQ6V 2B5UA 1S72V 1SA0B 3QO5A 3FB7C 1RFYA 4ZOLB 1FD9A 1Q6UA 4FMTA 1LUWA 1VIBA 5GW7A 2BOBC 4RWUA 4BR6A 4LFCO 1H2NA 3IAYA 4NKGB 5J2TA 2ZNJA 3BAAA 4PDRA 1EM1A 3L73H 2LFSA 5CBGA 4UUJC 4FM1A 2YSUB 1IBKB 3CCJV 1SA0A 4AQYO 1JCHA 4ZOLA 3LNNA 3CRAA 4CS2A 1IBLO 3MDSA 3M8AA 5TISZ 2MK3A 1NT2B 1NVPB 3APOA 3SJAC 5EBLC 1SQGA 1HP8A 1VQOV 4FM2A 5IE9A 4JYCA 3T2MA 5IYCO 2QDOA 1FFTB 2D2CB 4LF8B 3VQYA 3CCUV 1MABG 2Y69B 1E79G 4PD4F 2BOCC 4JF3A 1I0HA 2D3OW 4H44B 1T5EA 1NTMH 3CP1A 5B1BB 4DRXA 3EXAA 3AG4B 4OX9B 3PJSK 3G67A 4TV8A 4G2KA 2AW9A 3CS5A 2UU9B 1K73W 5JCOA 1M57C 2JGUA 1NTZH 4ZKIA 5L3EA 4PA9A 4JI0O 5BR8O 2VRZA 4JI7B 1YIJV 3G80A 2X7RB 3STZC 2DQ0A 3DC6A 3CCSV 2XAJA 5BZBA 1NH2D 2QM4A 4OPAA 2UXBO 1W0JG 2C2AA 4X8AA 2XUMA 2ZKOA 3JSNA 1X59A 2E76B 3N2GB 3SPGA 3JAWB 2X0LA 3J7AU 2HVKC 3F7VC 1NJIW 1KP2A 1OCRC 4YJ2B 3SPJA 3STLC 5KHHA 3JCZA 3CX5F 3ABLC 1QCEA 3SDLA 4KXRA 3BCCH 3JAWA 2WA3A 2CTRA 4MSWC 5DN6G 4UCOA 5IJ9B 4DV1O 2YI8A 1SERA 1SS3A 1XUQA 3K59A 2ZCEA 3T1HO 2HFEC 3VBBA 1R6KA 4B3MO 4TV9B 1QBZA 3OMIB 3L74H 5LMUB 2DYRC 3SJBC 2QWRB 5IJ9A 1PV0A 3QTCA 1PM9A 3N2KA 4TWKA 4GKKO 1H2KA 3ZRVA 4O4IA 2E75B 2QKSA 3D36A 4X1YB 3CB2A 2ZXWB 2JK5C 3JARB 2UXDB 1K5SA 4P2ZA 2F43G 3CRRA 2P4VA 3SPIA 3E83A 2N74A 2LP7A 1F51A 4JTDB 5EC1C 1K4CC 5E1AC 2HHHO 1I08A 4TV9A 1SETA 4GZRB 4NVPA 1KYOF 3O65A 4I5SA 3RWRD 4MVMA 4ZI7A 4ZBMA 4WCEV 4CC6A 1FFXB 2P67A 3ZMSA 3OGIB 3RT3C 4LFBB 3AG3C 5LP6C 1Y6XA 4X20B 4X1YA 3G71V 5KUKA 4JV5B 3JARA 2FTKA 5KAIZ 2Y4TA 1RP3B 3E8FA 2E5LB 3BPZA 3B40A 2HEPA 4IIJB 4NXMB 1VF7A 1I94B 3B8MA 2P5OA 3W7UA 1XMQO 4DV5O 3SYCA 4UCTA 1FFXA 1GN3A 4D7SA 1N36B 3QF7A 1MSDA 3MHHC 2K1EA 4X20A 1EN5A 4I7ZB 4JI4O 2HJDA 2RCVA 1XL4A 2X6CA 1KMIZ 4PA3A 4XDLA 2VQFB 2IJHA 1IXBA 3FX7A 1GM7A 2BE3A 2JS5A 1CEZA 1M56C 3JAMN 4IIJA 2Q7EA 1SZTA 5C93A 1YXBA 2ZM6B 4Z2WA 4B3RB 3BHPA 3CEIA 4HNAB 2YEVB 3SPCA 1QHTA 1F4MA 1QLNA 1GK9A 2JGDB 1DGSA 4ZHQB 1K5QA 1S5JA 1J5EB 1SQQH 2UUAO 1ZLZA 2FB5A 1D2DA 4WFHA 5D5QA 3CRQA 4UV8A 1Q8IA 1HDJA 1F4NA 2Z5UA 3DXRB 4DR7B 4MVOA 2GHYA 1V54B 2PGGA 2YEVA 2EZOA 2VS0A 2EIMC 1K4DC 1G1XB 2VWKA 4UCUA 1N33B 2CDYA 5JWPA 4WF9V 3OT7A 4X64O 1NH2B 5IY5B 1KKDA 5LMNB 5DEDA 1QR8A 3ETDA 1BSMA 1FS0G 3DXRA 1P4RA 1XREA 2KB1A 1K9MW 1PNLA 1QVFU 3IFXA 4BW9A 1XMOO 4JAVA 4DV3O 2F4VB 1B04A 1ENVA 1PP9H 4H0LB 3I55V 2P6JA 1WA8B 3OGCC 1JPXA 4LF9O 1XI1A 1SQBH 2YXYA 4TQDA 2O57A 3ASOC 4DV7B 3SR2C 4DK1A 3HKDA 4N23A 2Z0AA 4FLTA 4LF4O 3CRMA 1JR9A 2B1GA 4E2LA 1Y74B 3K5NA 1CPYA 1WA8A 3D3IA 4DR5B 3OM3B 4YY3O 2IJJA 1N0JA 2YDEA 4QPJA 2IU3A 4DR6O 4MW8A 2NNUA 1K33A 4CH5A 2WLJA 2OCHA 1YTFB 4FZ0A 4D6TH 3UO2A 1F23A 2UXCB 1M5IA 3ASNB 4MTFA 2CGNA 3CCQV 3P3PA 4AI8A 1YEWA 4DR1O 2QA4V 2YUAA 4RUFA 3P3NA 1RM1C 4LF7B 5B1AC 2ODMA 4JI6B 2AHYA 3MD0A 3M7MX 1P7BA 2Z3YA 3E22B 4K3AA 4DUZO 1V55B 2Q5ZA 3ZX6A 4RO2A 2ITCC 1FKAO 1OCOC 2QM7A 4GX2A 2R72A 1AILA 2Q69A 5H2FZ 4QJFB 4PA6A 2LGQA 4Z1MG 3CE2A 3X2QC 4LF6O 3B09A 2A7WA 3HR0A 4I9QA 3A0HZ 4P9PA 4LF5O 4JI1O 4PV1B 2JEUA 3AG2C 4C7UA 1M57B 3E22A 2KG7B 3ZRXA 4LFAO 4H37A 2OWOA 1Q5OA 1MMMA 2A9HA 5J9PC 4P9OA 3RN4A 4I4TB 4KHPO 3H1KH 1IBLB 3HKCB 1PKXA 5IWAO 2AZ2A 2IBZH 5JH7B 4JAUA 4BWAA 1VF6C 1GO3F 5DM6V 1Z2GA 4LC1A 3SPHA 2KG7A 1WN7A 5LL6Y 5JJNB 4FFBA 3ZIAG 2CTWA 2CE4A 2Q4PA 1OCRB 1TGOA 3E8GA 5KHKA 4K35A 5B1NA 4B7KA 2BTOA 1VQPV 1HW7A 3CRCA 3DTUB 1KKCA 2OCCC 5JH7A 3CXHF 2CH7B 4DR2O 1KB9F 2A0LA 2P06A 1R3JC 2ZE8A 3TGUH 5DECA 3HB3B 5GTHZ 2WLNA 2IJIA 2E3CA 1XHXA 4UVCA 2F66C 1RSOB 1B3QA 2WLIB 3JD0A 4DV4B 4R8CA 4GLXA 4O2AB 5BR8B 4JI0B 1EBOA 2CH7A 3VQXA 2AZ0A 1OCCC 5LA6A 3WU2Z 4F6RB 1M9NA 2Q73A 2DYRB 4NTYA 3TCUA 4GUNA 3H01A 3BA9A 2OIGA 2V4DA 5EBWC 5HFMA 2KSDA 2HJFC 2WLIA 2VQEO 3K08A 2A79B 3T4ZA 5C8YB 1M93A 2DOSA 1UPGA 4O2AA 1KD1W 1VQ5V 5H6RA 2ZINA 3ZHUA 4XBFA 1FPOA 3JALB 4L8JA 1JMKC 4QGPA 5EIBC 1QNMA 3AG3B 1QLEC 4O4JB 4CZZA 1M1KW 4JPRA 1GAXA 1GTOA 5FPOA 3H1JH 5C8YA 4DV1B 3IGAC 1E1RG 4U7NA 1UFIA 4IGGA 4YJ3B 5LGUA 4WFBV 4HAMA 3ETEA 2UUBO 2G38A 2OYQA 3E8HA 1BL8A 1Y4MA 3C90A 2HLDG 2IH3C 4DYLA 4B3SO 4DV2O 4B3MB 3H1LH 4JYAO 1HNWO 2F95B 3OR6C 1QVGU 1KQSU 4CC5A 1WPXA 4IL6Z 2FMLA 1ZAUA 4QPKA 4YJ3A 1Q6IA 1NTKH 3IC7A 2IU0A 1S77D 3HKEB 4JZ2A 1NR1A 4LP8A 1R6TA 5BMVB 2KQXA 2M7WA 3H1HH 3SYOA 4DUYO 4X1KB 2R9RB 4KUMA 3QG5A 4O2BB 3FKSG 5KX5B 4OPHA 5LHHA 3J80N 3ZHVA 1Y66A 3ZBHA 1CXZB 1WNSA 2AHZA 3D8CA 5L3CA 2EULA 3RYCB 4DR3O 1L0NH 4B3TO 2EINC 4O4HB 3ABMB 5ITZB 3HKEA 4JYYA 1YJNV 5BMVA 2H94A 2M6YA 3RYHB 1AP6A 1MOFA 4X1KA 3FAVB 1BHBA 4RQFA 4O2BA 5KX5A 3THOA 3T1CA 2PZSA 1XMQB 5D5PA 4DV5B 3ZCCA 1WB8A 3ZN1A 3AEIA 2HKOA 4QNHB 2P7TC 3TXSA 4NYKA 3JSLA 4LWSB 1R3IC 2RDCA 3JD2A 4DXWA 4O4HA 5H9CA 3E86A 2RNBA 3A2FA 2PI4A 1FJGB 4JI4B 4ASUG 1HNZO 4GT1A 1M90W 2QWQB 2YIBA 2ZR2A 3N2GA 1G4YB 4JI8O 3RYHA 2RN9A 4I50B 2XASA 3FAVA 2ZNIA 3WG7B 4FLYA 1YF2A 3UCSC 5JVDB 1EN6A 3ZN0A 2QEXV 1F7YA 4YJ2A 4XDJA 3JASB 2QWNB 4W4KA 1VQ4V
chains in the Genus database with same CATH topology
1IBMO 3R66A 4B3SO 4DV2O 2FKXA 4DR2O 4K0KO 1D2DA 5H5NA 1N33O 4JYAO 1HNWO 2N74A 4JI0O 5BR8O 4JI5O 1NS1A 4DR1O 2HHHO 1XEQA 4JV5O 5LMNO 1XNQO 4X62O 3O65A 4OPAA 2UXBO 4DV7O 1R1BA 1G1XB 4NXMO 2ZKOA 1IBKO 1R6TA 3RT3C 4DUZO 1X59A 2F4VO 4X64O 4LFCO 4DUYO 1FKAO 1N36O 1AILA 1XNRO 4JI3O 1FJGO 4OPHA 5BXZA 3T1YO 3J80N 4DR5O 3J7AU 4LF6O 1KUQA 2JRIA 4DR3O 4AQYO 3OTOO 2VQFO 1IBLO 4B3TO 4LF5O 4JI1O 1XMOO 4DV3O 1XMQO 3M8AA 1A32A 4DV5O 4A5UB 2LW7A 1HNXO 2VQEO 1J5EO 4LF8O 5BY1A 4LFAO 2DOSA 3SDLA 4LF9O 5FLXN 2ZM6O 1AB3A 4JI4O 4B3RO 2DJVA 4KHPO 4X65O 1HR0O 4DV1O 5IWAO 1FYJA 5LMUO 4NXNO 2AGAA 4YHHO 2Z0AA 3JAMN 4LF4O 3F5TA 1N34O 4JI6O 4OX9O 4JI2O 3T1HO 2UUCO 4DV4O 4LFBO 3J81N 1HNZO 1N32O 4DV6O 4X66O 4YY3O 5A2QN 4B3MO 2UXCO 2UU9O 4JI8O 1DK1A 5LL6Y 5IT9N 2UXDO 4DR6O 4GKJO 4DR7O 4JI7O 2E5LO 2UUBO 4DR4O 1F7YA 4LF7O 1I94O 4GKKO 2UUAO 4DV0O 1YZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM O;  3R66 A;  4B3S O;  4DV2 O;  2FKX A;  4DR2 O;  4K0K O;  1D2D A;  5H5N A;  1N33 O;  4JYA O;  1HNW O;  2N74 A;  4JI0 O;  5BR8 O;  4JI5 O;  1NS1 A;  4DR1 O;  2HHH O;  1XEQ A;  4JV5 O;  5LMN O;  1XNQ O;  4X62 O;  3O65 A;  4OPA A;  2UXB O;  4DV7 O;  1R1B A;  1G1X B;  4NXM O;  2ZKO A;  1IBK O;  1R6T A;  3RT3 C;  4DUZ O;  1X59 A;  2F4V O;  4X64 O;  4LFC O;  4DUY O;  1FKA O;  1N36 O;  1AIL A;  1XNR O;  4JI3 O;  1FJG O;  4OPH A;  5BXZ A;  3T1Y O;  3J80 N;  4DR5 O;  3J7A U;  4LF6 O;  1KUQ A;  2JRI A;  4DR3 O;  4AQY O;  3OTO O;  2VQF O;  1IBL O;  4B3T O;  4LF5 O;  4JI1 O;  1XMO O;  4DV3 O;  1XMQ O;  3M8A A;  1A32 A;  4DV5 O;  4A5U B;  2LW7 A;  1HNX O;  2VQE O;  1J5E O;  4LF8 O;  5BY1 A;  4LFA O;  2DOS A;  3SDL A;  4LF9 O;  5FLX N;  2ZM6 O;  1AB3 A;  4JI4 O;  4B3R O;  2DJV A;  4KHP O;  4X65 O;  1HR0 O;  4DV1 O;  5IWA O;  1FYJ A;  5LMU O;  4NXN O;  2AGA A;  4YHH O;  2Z0A A;  3JAM N;  4LF4 O;  3F5T A;  1N34 O;  4JI6 O;  4OX9 O;  4JI2 O;  3T1H O;  2UUC O;  4DV4 O;  4LFB O;  3J81 N;  1HNZ O;  1N32 O;  4DV6 O;  4X66 O;  4YY3 O;  5A2Q N;  4B3M O;  2UXC O;  2UU9 O;  4JI8 O;  1DK1 A;  5LL6 Y;  5IT9 N;  2UXD O;  4DR6 O;  4GKJ O;  4DR7 O;  4JI7 O;  2E5L O;  2UUB O;  4DR4 O;  1F7Y A;  4LF7 O;  1I94 O;  4GKK O;  2UUA O;  4DV0 O;  1YZB A; 
#chains in the Genus database with same CATH topology
 1IBM O;  2LO1 A;  1WAZ A;  3TK1 A;  4LWS A;  2EIJ C;  2V7Q G;  4OGQ B;  3SYQ A;  3CPW U;  4AHC A;  1EZV H;  3CCL V;  5J2U B;  1I7F A;  4UVA A;  5EIB D;  1XEQ A;  3ETQ A;  3ZHS A;  5LBQ A;  2JIZ G;  1XNQ O;  4YHH B;  1H8E G;  4I50 A;  2ETN A;  2YIC A;  2UUA B;  3ZS8 C;  1BZK A;  5KMG B;  4JI2 B;  5L3D A;  1YDX A;  4MVZ A;  4FIP C;  2CAZ C;  1JX9 A;  3VQV A;  2P4K A;  3IJ4 A;  1URF A;  2B1I A;  1ZTE A;  4IYH A;  2DE0 X;  4J9Y B;  2UXX A;  5BXZ A;  4PJ0 Z;  4J7K A;  3BVO A;  1AI4 A;  1O9G A;  4FLZ A;  5KUM A;  2YIA A;  1JQ0 A;  1NR7 A;  3EHB B;  4MTX A;  4E4E A;  5KMG A;  1K34 A;  1LUV A;  2XAQ A;  4X64 B;  5GTI Z;  1WPB A;  2XAG A;  1A32 A;  4MVU A;  4A5U B;  3BY6 A;  4PEL A;  3RYF B;  1FXH A;  1PNK A;  1OV9 A;  1YCI A;  2H8P C;  1RPR A;  2YXH A;  5FLX N;  1K3E A;  1EFR G;  3DC5 A;  4I55 B;  5FNV B;  4R6Z A;  2BTQ B;  3RFR A;  2DJV A;  1P84 F;  1XMO B;  5B1A B;  4J7J A;  3F5T A;  2X6B A;  3A8T A;  5IYZ B;  5AG2 A;  3JCU Z;  1THZ A;  4LF9 B;  1AVM A;  4UB8 Z;  2GV9 A;  3LSS A;  1K7D A;  1XNR B;  3QVN A;  1P49 A;  1OCO B;  2QE7 G;  5H6Q A;  3RYF A;  1XDC A;  5LHG A;  3X2Q B;  3UO3 A;  2DN9 A;  2L6L A;  4I55 A;  5FNV A;  3RYI B;  2BTQ A;  2Y0I A;  4CS3 A;  4Z1V A;  2OTJ V;  4LCU C;  4EFE A;  1DLB A;  1U96 A;  3RVZ A;  3O9O A;  5JCO C;  1GN6 A;  1JOY A;  2YI9 A;  4YY3 B;  2Y69 C;  5LOV B;  5IYZ A;  4AIL C;  5CMU A;  4TOI A;  3BEH A;  5FL7 G;  3K04 A;  3LSQ A;  4GX1 A;  4GYC B;  1AR5 A;  2PF4 E;  4DR6 B;  3W7X A;  2VWJ A;  1I5Y A;  3OW2 U;  4EB6 B;  3JD3 A;  2P22 C;  2Q6A A;  5IYB O;  2OIE A;  2WLH A;  2N04 A;  4X62 O;  4EKW A;  5CA3 A;  2R9I A;  2W0X A;  3RYI A;  1JJO A;  5EYP B;  4N21 A;  2RJZ A;  3A0B Z;  4DR1 B;  4J80 A;  2WLK A;  2HVJ C;  4MTG A;  1L1F A;  2P90 A;  3FFQ A;  3QO8 A;  3FB5 C;  1KEC A;  4PA4 A;  4K8Z A;  4HNA A;  2EJR A;  1WLE A;  4TUY B;  1S5H C;  2ZR3 A;  2EIK B;  1WJZ A;  1G6U A;  1GM8 A;  2JEX A;  2JGD A;  2OCC B;  3GVM A;  4ZHQ A;  5EYP A;  1H8H G;  2CK3 G;  4ZIB A;  1VMG A;  5CN0 A;  4LF6 B;  1US6 A;  3CD6 V;  3OAA G;  2LQT A;  4J11 A;  4X88 A;  3K0G A;  4LF5 B;  4JI1 B;  3L70 H;  1IXM A;  2Y4U A;  1TVK B;  1SES A;  3AG1 B;  4U7O A;  4B08 A;  1NZ6 A;  1N34 O;  4X9Q A;  4PDM A;  3N27 A;  1PNM A;  4YIO A;  3BRC A;  2ADQ B;  4WBN B;  4LFB O;  4DV6 O;  1AJN A;  2PTM A;  3U10 A;  5JJE B;  3AG7 A;  1KP3 A;  2A3Q A;  3FD9 A;  5LXT B;  1OCZ C;  3G6B A;  2WSS G;  5IYD O;  2E5L O;  3DSQ A;  1WP7 A;  3FYE B;  4DR4 O;  1NI8 A;  2W6I G;  3D36 C;  4I0X B;  3UM7 A;  1I94 O;  1TVK A;  1YZB A;  2GSM B;  1B6Q A;  4DW0 A;  2N05 A;  5EK0 A;  4WBN A;  4MW3 A;  4JI5 O;  2DWD C;  1VQM V;  1NVP D;  1U97 A;  5LXT A;  4DR2 B;  1NQT A;  2XAH A;  1BQ0 A;  4I0X A;  1MNG A;  1N32 B;  3TJT A;  2ZXW C;  2EZP A;  4WFF A;  2E74 B;  5CA0 B;  1Y74 A;  2DYS C;  2EIL C;  4UCV A;  3QNE A;  4JI3 O;  3JAT B;  3OUF A;  1B06 A;  3APQ A;  2W0F C;  5KHJ A;  3W7W A;  5B1O A;  4DV0 B;  2DQ3 A;  2NR5 A;  3OTO O;  1IUR A;  3ABT A;  3K5O A;  4U3F H;  4PDV A;  4UV9 A;  4K0K B;  2GTA A;  3GWO A;  2LW7 A;  1J5E O;  5L3G A;  3LDD A;  2DMX A;  5CA0 A;  5CBF A;  3K5L A;  1J95 A;  4KFM A;  5FPR A;  2UXN A;  4UCR A;  1PD3 A;  3JAT A;  1YJW V;  1AJQ A;  1K97 A;  1COW G;  4UVB A;  3A0R A;  5B5E Z;  1AP5 A;  3D3Q A;  3OR7 C;  3B8N A;  2VQE B;  1XL6 A;  4GCZ A;  3E89 A;  4J10 A;  1X4T A;  4QIW F;  4LFC B;  2EX3 A;  4W4L A;  3OE7 G;  1N0N A;  2UUC O;  2WLM A;  3Q4H B;  4Q20 A;  2Y48 A;  4J41 A;  3CHX A;  4ABM A;  1MZF A;  2IJK A;  3VOU A;  1YSC A;  4P30 A;  1SQP H;  1SC5 B;  4AQY B;  4GKJ O;  5GON B;  3BAB A;  1GN2 A;  1Z5W A;  2WPD G;  3SYP A;  1BGY H;  4JAA A;  2XTA A;  4Q6G A;  2EIN B;  3CC4 V;  1H2M A;  5A9G A;  1R6N A;  3ABU A;  5LGT A;  2Y0P A;  3ZMV A;  1SQF A;  2XT9 A;  1Q90 D;  2UUB B;  3ZED A;  3L71 H;  2DWE C;  5JJJ B;  4I4T A;  4DV7 O;  5GON A;  4B3S B;  4DV2 B;  3HKC A;  3WB1 A;  3ML0 A;  2B9Z A;  1N4C A;  1PL0 A;  3AK3 A;  4JYA B;  1HNW B;  3ABL B;  3CXC U;  3FYI B;  3LDC A;  1AR1 B;  1EZJ A;  1GMG A;  4DR5 O;  1V54 C;  3K3W A;  1R73 A;  3NR7 A;  3K0D A;  3KCX A;  1KUQ A;  5B3S C;  4PHZ A;  5JQG B;  4DUY B;  2ZT9 B;  4FLV A;  4PA7 A;  2CUG A;  2EIJ B;  3VQW A;  3IC9 A;  1Q82 W;  3K5M A;  1Q43 A;  4JTC B;  2W6J G;  2PUS A;  4FJC C;  2CTP A;  5HFL A;  4RUE A;  4LR3 A;  4DR3 B;  2UXB B;  2HP8 A;  4X65 O;  1HR0 O;  1GM9 A;  4B3T B;  2ITD C;  2F1M A;  2YC0 A;  2AGA A;  4O4L B;  3HKB B;  2RMK B;  3UKM A;  1IDS A;  4JI6 O;  2Q9L A;  1N8R W;  2XHB A;  1RSO A;  5KHG A;  1S5L Z;  4X66 O;  1EN4 A;  5IT9 N;  1YIT V;  3L9D A;  3PN1 A;  3K03 A;  2Q7G A;  4DK0 A;  1AI6 A;  3ABK C;  5F2V O;  4F6R A;  2WWW A;  2Q68 A;  4MTO A;  2QKA A;  3JD1 A;  1HNZ B;  1DF5 A;  4O4L A;  3AK2 A;  3HKB A;  2Q67 A;  3C3T A;  5LP6 B;  4JI8 B;  4CS4 A;  4H13 B;  4GX5 A;  1L0L H;  4TT3 G;  1H2G A;  1NS1 A;  4U3J B;  2F23 A;  2IM9 A;  2X6A A;  1XQ8 A;  1WB7 A;  3OEH G;  4NR1 A;  1BE3 H;  3G4S V;  5CA1 B;  4FPP A;  5IJ0 B;  3OUS A;  1IBM B;  2ZDI C;  1S3J A;  3JAL A;  3T1H B;  1R3K C;  4R7C A;  3S3W A;  3ASN C;  3CSX A;  4DRX B;  5LP6 A;  4JYB A;  4BIZ A;  3K9A A;  1ARO P;  1XNQ B;  4CH4 A;  4O4J A;  4NB5 A;  4UB6 Z;  3T1Y O;  3CCR V;  3FB6 C;  4U3J A;  4GKK B;  3CWB H;  5CA1 A;  1M56 B;  4TV8 B;  2R9A A;  5IJ0 A;  3ZMU A;  2AXT Z;  4F4L A;  1H2S B;  1V55 C;  1HNX O;  2JVD A;  3RBZ A;  3SJQ C;  4GX0 A;  2HHH B;  3EFF K;  2ZQM A;  1K8A W;  4TSF G;  2EJ7 A;  1KBH A;  1IX9 A;  3ICX A;  1FYJ A;  4NXN O;  1VQN V;  2Q0A A;  1Z5V A;  1OJH A;  4BAY A;  4DV4 O;  2IW5 A;  2H3O A;  1Q7Y W;  3E2E A;  2JJ2 G;  4B7E A;  3GB7 C;  3EVK A;  4PDL A;  2EIM B;  1VQ8 V;  5EZY B;  3RYC A;  1NKD A;  1LR1 A;  4FVM A;  4QE7 A;  1I5X A;  3KZI Z;  1YHQ V;  1DF4 A;  5ITZ A;  1VQ7 V;  1M4U A;  5EC2 C;  3K57 A;  1ORQ C;  2GTS A;  4TQF A;  4F6E A;  3WB2 A;  3P30 A;  1AJP A;  5LGN A;  1Q86 W;  1FXK C;  1KU9 A;  1IBK O;  5EZY A;  4FLX A;  1XIL A;  3W7T A;  2F93 B;  1ZX3 A;  3TET A;  2LFR A;  1GH6 A;  1NU1 H;  4X62 B;  5LHI A;  3ASO B;  4NTX A;  4OXS A;  4WFA V;  1OCZ B;  3N2K B;  5KHI A;  2LGW A;  4CH3 A;  4O4I B;  1BQZ A;  5JVD A;  1KC8 W;  2ZIM A;  2R70 A;  4PI0 A;  2OTL V;  2XOK G;  4LF8 O;  3L72 H;  3JAS A;  3JYC A;  1WP8 A;  4UFZ A;  1UJW B;  3JD4 A;  3JAK B;  3AK1 A;  1YTF D;  1DTO A;  1FAF A;  2YS8 A;  4XDK A;  3OTF A;  5J2U A;  4ZI7 B;  4UXN A;  2YXL A;  4OX9 O;  5K1X A;  3U11 A;  1G8M A;  5B66 Z;  4RQE A;  1JVM A;  2DYS B;  2EIL B;  4BW5 A;  3ETG A;  1OHH G;  2OT5 A;  2UU9 O;  3L75 H;  3JAK A;  3OMA B;  4X89 A;  1VQK V;  1LNQ A;  1RM1 B;  1N34 B;  4JI7 O;  3CCE V;  1JFF B;  4DV3 B;  3RGB A;  2XAF A;  3RW0 A;  1ZUQ A;  4J42 A;  3I56 V;  1SKV A;  2JS3 A;  1R3L C;  5KA5 A;  4DV6 B;  3QO7 A;  3LSU A;  3R66 A;  3WFV A;  1YVW A;  3W7S A;  3LUT B;  1V9P A;  1GN4 A;  1VAR A;  1K92 A;  4HYO A;  1YJ9 V;  2ARH A;  4DR4 B;  4BIU A;  2HR3 A;  4LF4 B;  3ZRW B;  2ATK C;  1JFF A;  3ZRS A;  2DW4 A;  2QWO B;  1Q6H A;  5L3F A;  3AG2 B;  2HG5 C;  4JI5 B;  4HZ3 A;  4LH6 A;  2ZE7 A;  3U0Z A;  4JZG A;  1XOU A;  2Q8V A;  4G27 B;  1FJG O;  1VF5 B;  4FM0 A;  5B1B C;  3K9S A;  3AG4 C;  2LW1 A;  4MVS A;  5KLV H;  2JRI A;  3OFN G;  1H38 A;  1TA8 A;  3ZRW A;  4H33 A;  1VP7 A;  4FLW A;  1SRY A;  3SGI A;  1P7G A;  2Q7H A;  4LH7 A;  4FZ1 A;  3M99 B;  1H2L A;  4J7Z A;  4JI3 B;  5BY1 A;  2Q0O C;  4HBN A;  5LOV A;  3OTO B;  4RAI A;  4EB6 A;  1L8D A;  4K8X A;  2ZIO A;  5LMU O;  1QR9 A;  1HWY A;  4YHH O;  4DUZ B;  3UT5 B;  1W0K G;  3ABM C;  1AI7 A;  4JI2 O;  5KAF Z;  4CH6 A;  3CC2 V;  1VF6 A;  2PY5 A;  1ZWI C;  3CCM V;  2GDS A;  5A2Q N;  2V1D A;  1PPJ H;  2UXD O;  4QE9 A;  1ZSP A;  5B3S B;  3H9V A;  5LYJ B;  2XND G;  2QR4 A;  1W2B U;  1SQX H;  2WA4 A;  4WFG A;  4EFB A;  2UUC B;  3NXS A;  4TUY A;  4LFA B;  3UT5 A;  4PI2 A;  1S76 D;  4ICG A;  3ZHQ A;  3OEE G;  4BIO A;  4GKJ B;  1PL4 A;  5K1P A;  1OCC B;  4KHP B;  3S3X A;  2KKW A;  3B2E E;  1QU7 A;  5IWA B;  3HKD B;  4JV5 O;  2QTS A;  3WG7 C;  3E35 A;  4R50 A;  1O9H A;  2QKC A;  5LYJ A;  1Q81 W;  1BT8 A;  3ZMZ A;  4NXM O;  3CJH B;  3K79 A;  1D5N A;  1MA1 A;  4KL1 A;  4X1I B;  1XHZ A;  3MHS C;  1MSW D;  4EEQ A;  1OZ0 A;  1SF9 A;  2L35 A;  1N36 O;  1XNR O;  3ABK B;  4IYI A;  2PYL A;  1QQC A;  2FYU H;  2ADP A;  2EBO A;  3MAQ A;  2VQF O;  3E8B A;  1FXV A;  2GBO A;  4FLU A;  1SZX A;  1VEW A;  4NTW A;  4JAS A;  3CME V;  1QLE B;  3CJH A;  1VQL V;  4LBE C;  3KKY A;  2WAM A;  3K06 A;  4X1I A;  4MS2 A;  1ZL8 B;  2BSK B;  2WLL B;  2ZM6 O;  1AI5 A;  4DO2 A;  1AB3 A;  3WB0 A;  4B3R O;  2CGO A;  4FK5 C;  1JJ2 U;  1MZE A;  2PI5 A;  5CBH A;  3TXQ A;  2NN4 A;  2K9P A;  2QM8 A;  3J81 N;  3HPL C;  4X65 B;  1HR0 B;  1AR4 A;  1GKF A;  2QSA A;  3OD4 A;  1ZL8 A;  1YI2 V;  2BSK A;  2WLL A;  3K58 A;  4YXW G;  4DR7 O;  1XBL A;  3SJC C;  1S0V A;  3I5D A;  1SQV H;  3CCV V;  2ZDI A;  4J9Z B;  1W59 A;  4X66 B;  3DGE A;  1D5A A;  1Y67 A;  2JJ1 G;  3CC7 V;  1N33 O;  2YID A;  2QGN A;  5CB4 B;  2MW2 B;  2RQ6 A;  5LMN O;  4D7T A;  2YIB D;  4MT8 A;  1JA8 A;  3R65 A;  3F5W C;  3G6E V;  3RVY A;  2CTQ A;  1R1B A;  3CYO A;  2QTO A;  1VQ9 V;  4DW1 A;  2F4V O;  4FFB B;  4LNU B;  3T4D A;  4JGS A;  5CB4 A;  3Q4H A;  3CMA V;  4KP4 A;  4MVQ A;  3BA8 A;  5E79 Z;  4CBC A;  3LDE A;  3ZMT A;  2ILM A;  3C3S A;  2GUZ B;  5EBM C;  2BCC H;  3UQ8 A;  4I9W A;  3T1Y B;  4G28 B;  3GWK C;  1BS3 A;  2A06 H;  1BMF G;  4LNU A;  4WFE A;  2JDI G;  3FB8 C;  3ZJZ A;  1Q3E A;  3B4S A;  1TUB B;  4UCS A;  2QJ1 A;  3H1I H;  5IDJ A;  1Y76 B;  2PYJ A;  1HNX B;  3F7Y C;  4MVR A;  2EIK C;  4IT5 A;  1FXK B;  1MG1 A;  3KCY A;  2GUZ A;  4JTA B;  2FL4 A;  3LNM B;  4IHJ B;  5LA6 B;  1CP9 A;  2LJ2 A;  1IVS A;  4L87 A;  2IH1 C;  1N32 O;  5IY5 C;  3P32 A;  2UXC O;  2ZE6 A;  1DK1 A;  2ZE5 A;  4NXN B;  3BFR A;  5L3B A;  2QWP B;  1TAE A;  1BHA A;  2ZD9 A;  1GRJ A;  1RPO A;  1TUB A;  3AG1 C;  4FFK A;  1TUE B;  3ZHT A;  1Y76 A;  4LF7 O;  1BCC H;  3KG2 A;  4DV0 O;  1E1Q G;  5JQG A;  1FXK A;  2NLJ C;  1ROP A;  2FKX A;  4K0K O;  3SYA A;  3ZHR A;  1NBM G;  5J2T B;  1IZ3 A;  3B77 A;  5H5N A;  4IHJ A;  5KA6 A;  3OMN B;  4YIP A;  1VQ6 V;  2B5U A;  1S72 V;  1SA0 B;  3QO5 A;  3FB7 C;  1RFY A;  4ZOL B;  1FD9 A;  1Q6U A;  4FMT A;  1LUW A;  1VIB A;  5GW7 A;  2BOB C;  4RWU A;  4BR6 A;  4LFC O;  1H2N A;  3IAY A;  4NKG B;  5J2T A;  2ZNJ A;  3BAA A;  4PDR A;  1EM1 A;  3L73 H;  2LFS A;  5CBG A;  4UUJ C;  4FM1 A;  2YSU B;  1IBK B;  3CCJ V;  1SA0 A;  4AQY O;  1JCH A;  4ZOL A;  3LNN A;  3CRA A;  4CS2 A;  1IBL O;  3MDS A;  3M8A A;  5TIS Z;  2MK3 A;  1NT2 B;  1NVP B;  3APO A;  3SJA C;  5EBL C;  1SQG A;  1HP8 A;  1VQO V;  4FM2 A;  5IE9 A;  4JYC A;  3T2M A;  5IYC O;  2QDO A;  1FFT B;  2D2C B;  4LF8 B;  3VQY A;  3CCU V;  1MAB G;  2Y69 B;  1E79 G;  4PD4 F;  2BOC C;  4JF3 A;  1I0H A;  2D3O W;  4H44 B;  1T5E A;  1NTM H;  3CP1 A;  5B1B B;  4DRX A;  3EXA A;  3AG4 B;  4OX9 B;  3PJS K;  3G67 A;  4TV8 A;  4G2K A;  2AW9 A;  3CS5 A;  2UU9 B;  1K73 W;  5JCO A;  1M57 C;  2JGU A;  1NTZ H;  4ZKI A;  5L3E A;  4PA9 A;  4JI0 O;  5BR8 O;  2VRZ A;  4JI7 B;  1YIJ V;  3G80 A;  2X7R B;  3STZ C;  2DQ0 A;  3DC6 A;  3CCS V;  2XAJ A;  5BZB A;  1NH2 D;  2QM4 A;  4OPA A;  2UXB O;  1W0J G;  2C2A A;  4X8A A;  2XUM A;  2ZKO A;  3JSN A;  1X59 A;  2E76 B;  3N2G B;  3SPG A;  3JAW B;  2X0L A;  3J7A U;  2HVK C;  3F7V C;  1NJI W;  1KP2 A;  1OCR C;  4YJ2 B;  3SPJ A;  3STL C;  5KHH A;  3JCZ A;  3CX5 F;  3ABL C;  1QCE A;  3SDL A;  4KXR A;  3BCC H;  3JAW A;  2WA3 A;  2CTR A;  4MSW C;  5DN6 G;  4UCO A;  5IJ9 B;  4DV1 O;  2YI8 A;  1SER A;  1SS3 A;  1XUQ A;  3K59 A;  2ZCE A;  3T1H O;  2HFE C;  3VBB A;  1R6K A;  4B3M O;  4TV9 B;  1QBZ A;  3OMI B;  3L74 H;  5LMU B;  2DYR C;  3SJB C;  2QWR B;  5IJ9 A;  1PV0 A;  3QTC A;  1PM9 A;  3N2K A;  4TWK A;  4GKK O;  1H2K A;  3ZRV A;  4O4I A;  2E75 B;  2QKS A;  3D36 A;  4X1Y B;  3CB2 A;  2ZXW B;  2JK5 C;  3JAR B;  2UXD B;  1K5S A;  4P2Z A;  2F43 G;  3CRR A;  2P4V A;  3SPI A;  3E83 A;  2N74 A;  2LP7 A;  1F51 A;  4JTD B;  5EC1 C;  1K4C C;  5E1A C;  2HHH O;  1I08 A;  4TV9 A;  1SET A;  4GZR B;  4NVP A;  1KYO F;  3O65 A;  4I5S A;  3RWR D;  4MVM A;  4ZI7 A;  4ZBM A;  4WCE V;  4CC6 A;  1FFX B;  2P67 A;  3ZMS A;  3OGI B;  3RT3 C;  4LFB B;  3AG3 C;  5LP6 C;  1Y6X A;  4X20 B;  4X1Y A;  3G71 V;  5KUK A;  4JV5 B;  3JAR A;  2FTK A;  5KAI Z;  2Y4T A;  1RP3 B;  3E8F A;  2E5L B;  3BPZ A;  3B40 A;  2HEP A;  4IIJ B;  4NXM B;  1VF7 A;  1I94 B;  3B8M A;  2P5O A;  3W7U A;  1XMQ O;  4DV5 O;  3SYC A;  4UCT A;  1FFX A;  1GN3 A;  4D7S A;  1N36 B;  3QF7 A;  1MSD A;  3MHH C;  2K1E A;  4X20 A;  1EN5 A;  4I7Z B;  4JI4 O;  2HJD A;  2RCV A;  1XL4 A;  2X6C A;  1KMI Z;  4PA3 A;  4XDL A;  2VQF B;  2IJH A;  1IXB A;  3FX7 A;  1GM7 A;  2BE3 A;  2JS5 A;  1CEZ A;  1M56 C;  3JAM N;  4IIJ A;  2Q7E A;  1SZT A;  5C93 A;  1YXB A;  2ZM6 B;  4Z2W A;  4B3R B;  3BHP A;  3CEI A;  4HNA B;  2YEV B;  3SPC A;  1QHT A;  1F4M A;  1QLN A;  1GK9 A;  2JGD B;  1DGS A;  4ZHQ B;  1K5Q A;  1S5J A;  1J5E B;  1SQQ H;  2UUA O;  1ZLZ A;  2FB5 A;  1D2D A;  4WFH A;  5D5Q A;  3CRQ A;  4UV8 A;  1Q8I A;  1HDJ A;  1F4N A;  2Z5U A;  3DXR B;  4DR7 B;  4MVO A;  2GHY A;  1V54 B;  2PGG A;  2YEV A;  2EZO A;  2VS0 A;  2EIM C;  1K4D C;  1G1X B;  2VWK A;  4UCU A;  1N33 B;  2CDY A;  5JWP A;  4WF9 V;  3OT7 A;  4X64 O;  1NH2 B;  5IY5 B;  1KKD A;  5LMN B;  5DED A;  1QR8 A;  3ETD A;  1BSM A;  1FS0 G;  3DXR A;  1P4R A;  1XRE A;  2KB1 A;  1K9M W;  1PNL A;  1QVF U;  3IFX A;  4BW9 A;  1XMO O;  4JAV A;  4DV3 O;  2F4V B;  1B04 A;  1ENV A;  1PP9 H;  4H0L B;  3I55 V;  2P6J A;  1WA8 B;  3OGC C;  1JPX A;  4LF9 O;  1XI1 A;  1SQB H;  2YXY A;  4TQD A;  2O57 A;  3ASO C;  4DV7 B;  3SR2 C;  4DK1 A;  3HKD A;  4N23 A;  2Z0A A;  4FLT A;  4LF4 O;  3CRM A;  1JR9 A;  2B1G A;  4E2L A;  1Y74 B;  3K5N A;  1CPY A;  1WA8 A;  3D3I A;  4DR5 B;  3OM3 B;  4YY3 O;  2IJJ A;  1N0J A;  2YDE A;  4QPJ A;  2IU3 A;  4DR6 O;  4MW8 A;  2NNU A;  1K33 A;  4CH5 A;  2WLJ A;  2OCH A;  1YTF B;  4FZ0 A;  4D6T H;  3UO2 A;  1F23 A;  2UXC B;  1M5I A;  3ASN B;  4MTF A;  2CGN A;  3CCQ V;  3P3P A;  4AI8 A;  1YEW A;  4DR1 O;  2QA4 V;  2YUA A;  4RUF A;  3P3N A;  1RM1 C;  4LF7 B;  5B1A C;  2ODM A;  4JI6 B;  2AHY A;  3MD0 A;  3M7M X;  1P7B A;  2Z3Y A;  3E22 B;  4K3A A;  4DUZ O;  1V55 B;  2Q5Z A;  3ZX6 A;  4RO2 A;  2ITC C;  1FKA O;  1OCO C;  2QM7 A;  4GX2 A;  2R72 A;  1AIL A;  2Q69 A;  5H2F Z;  4QJF B;  4PA6 A;  2LGQ A;  4Z1M G;  3CE2 A;  3X2Q C;  4LF6 O;  3B09 A;  2A7W A;  3HR0 A;  4I9Q A;  3A0H Z;  4P9P A;  4LF5 O;  4JI1 O;  4PV1 B;  2JEU A;  3AG2 C;  4C7U A;  1M57 B;  3E22 A;  2KG7 B;  3ZRX A;  4LFA O;  4H37 A;  2OWO A;  1Q5O A;  1MMM A;  2A9H A;  5J9P C;  4P9O A;  3RN4 A;  4I4T B;  4KHP O;  3H1K H;  1IBL B;  3HKC B;  1PKX A;  5IWA O;  2AZ2 A;  2IBZ H;  5JH7 B;  4JAU A;  4BWA A;  1VF6 C;  1GO3 F;  5DM6 V;  1Z2G A;  4LC1 A;  3SPH A;  2KG7 A;  1WN7 A;  5LL6 Y;  5JJN B;  4FFB A;  3ZIA G;  2CTW A;  2CE4 A;  2Q4P A;  1OCR B;  1TGO A;  3E8G A;  5KHK A;  4K35 A;  5B1N A;  4B7K A;  2BTO A;  1VQP V;  1HW7 A;  3CRC A;  3DTU B;  1KKC A;  2OCC C;  5JH7 A;  3CXH F;  2CH7 B;  4DR2 O;  1KB9 F;  2A0L A;  2P06 A;  1R3J C;  2ZE8 A;  3TGU H;  5DEC A;  3HB3 B;  5GTH Z;  2WLN A;  2IJI A;  2E3C A;  1XHX A;  4UVC A;  2F66 C;  1RSO B;  1B3Q A;  2WLI B;  3JD0 A;  4DV4 B;  4R8C A;  4GLX A;  4O2A B;  5BR8 B;  4JI0 B;  1EBO A;  2CH7 A;  3VQX A;  2AZ0 A;  1OCC C;  5LA6 A;  3WU2 Z;  4F6R B;  1M9N A;  2Q73 A;  2DYR B;  4NTY A;  3TCU A;  4GUN A;  3H01 A;  3BA9 A;  2OIG A;  2V4D A;  5EBW C;  5HFM A;  2KSD A;  2HJF C;  2WLI A;  2VQE O;  3K08 A;  2A79 B;  3T4Z A;  5C8Y B;  1M93 A;  2DOS A;  1UPG A;  4O2A A;  1KD1 W;  1VQ5 V;  5H6R A;  2ZIN A;  3ZHU A;  4XBF A;  1FPO A;  3JAL B;  4L8J A;  1JMK C;  4QGP A;  5EIB C;  1QNM A;  3AG3 B;  1QLE C;  4O4J B;  4CZZ A;  1M1K W;  4JPR A;  1GAX A;  1GTO A;  5FPO A;  3H1J H;  5C8Y A;  4DV1 B;  3IGA C;  1E1R G;  4U7N A;  1UFI A;  4IGG A;  4YJ3 B;  5LGU A;  4WFB V;  4HAM A;  3ETE A;  2UUB O;  2G38 A;  2OYQ A;  3E8H A;  1BL8 A;  1Y4M A;  3C90 A;  2HLD G;  2IH3 C;  4DYL A;  4B3S O;  4DV2 O;  4B3M B;  3H1L H;  4JYA O;  1HNW O;  2F95 B;  3OR6 C;  1QVG U;  1KQS U;  4CC5 A;  1WPX A;  4IL6 Z;  2FML A;  1ZAU A;  4QPK A;  4YJ3 A;  1Q6I A;  1NTK H;  3IC7 A;  2IU0 A;  1S77 D;  3HKE B;  4JZ2 A;  1NR1 A;  4LP8 A;  1R6T A;  5BMV B;  2KQX A;  2M7W A;  3H1H H;  3SYO A;  4DUY O;  4X1K B;  2R9R B;  4KUM A;  3QG5 A;  4O2B B;  3FKS G;  5KX5 B;  4OPH A;  5LHH A;  3J80 N;  3ZHV A;  1Y66 A;  3ZBH A;  1CXZ B;  1WNS A;  2AHZ A;  3D8C A;  5L3C A;  2EUL A;  3RYC B;  4DR3 O;  1L0N H;  4B3T O;  2EIN C;  4O4H B;  3ABM B;  5ITZ B;  3HKE A;  4JYY A;  1YJN V;  5BMV A;  2H94 A;  2M6Y A;  3RYH B;  1AP6 A;  1MOF A;  4X1K A;  3FAV B;  1BHB A;  4RQF A;  4O2B A;  5KX5 A;  3THO A;  3T1C A;  2PZS A;  1XMQ B;  5D5P A;  4DV5 B;  3ZCC A;  1WB8 A;  3ZN1 A;  3AEI A;  2HKO A;  4QNH B;  2P7T C;  3TXS A;  4NYK A;  3JSL A;  4LWS B;  1R3I C;  2RDC A;  3JD2 A;  4DXW A;  4O4H A;  5H9C A;  3E86 A;  2RNB A;  3A2F A;  2PI4 A;  1FJG B;  4JI4 B;  4ASU G;  1HNZ O;  4GT1 A;  1M90 W;  2QWQ B;  2YIB A;  2ZR2 A;  3N2G A;  1G4Y B;  4JI8 O;  3RYH A;  2RN9 A;  4I50 B;  2XAS A;  3FAV A;  2ZNI A;  3WG7 B;  4FLY A;  1YF2 A;  3UCS C;  5JVD B;  1EN6 A;  3ZN0 A;  2QEX V;  1F7Y A;  4YJ2 A;  4XDJ A;  3JAS B;  2QWN B;  4W4K A;  1VQ4 V; 
#chains in the Genus database with same CATH homology
 1IBM O;  3R66 A;  4B3S O;  4DV2 O;  2FKX A;  4DR2 O;  4K0K O;  1D2D A;  5H5N A;  1N33 O;  4JYA O;  1HNW O;  2N74 A;  4JI0 O;  5BR8 O;  4JI5 O;  1NS1 A;  4DR1 O;  2HHH O;  1XEQ A;  4JV5 O;  5LMN O;  1XNQ O;  4X62 O;  3O65 A;  4OPA A;  2UXB O;  4DV7 O;  1R1B A;  1G1X B;  4NXM O;  2ZKO A;  1IBK O;  1R6T A;  3RT3 C;  4DUZ O;  1X59 A;  2F4V O;  4X64 O;  4LFC O;  4DUY O;  1FKA O;  1N36 O;  1AIL A;  1XNR O;  4JI3 O;  1FJG O;  4OPH A;  5BXZ A;  3T1Y O;  3J80 N;  4DR5 O;  3J7A U;  4LF6 O;  1KUQ A;  2JRI A;  4DR3 O;  4AQY O;  3OTO O;  2VQF O;  1IBL O;  4B3T O;  4LF5 O;  4JI1 O;  1XMO O;  4DV3 O;  1XMQ O;  3M8A A;  1A32 A;  4DV5 O;  4A5U B;  2LW7 A;  1HNX O;  2VQE O;  1J5E O;  4LF8 O;  5BY1 A;  4LFA O;  2DOS A;  3SDL A;  4LF9 O;  5FLX N;  2ZM6 O;  1AB3 A;  4JI4 O;  4B3R O;  2DJV A;  4KHP O;  4X65 O;  1HR0 O;  4DV1 O;  5IWA O;  1FYJ A;  5LMU O;  4NXN O;  2AGA A;  4YHH O;  2Z0A A;  3JAM N;  4LF4 O;  3F5T A;  1N34 O;  4JI6 O;  4OX9 O;  4JI2 O;  3T1H O;  2UUC O;  4DV4 O;  4LFB O;  3J81 N;  1HNZ O;  1N32 O;  4DV6 O;  4X66 O;  4YY3 O;  5A2Q N;  4B3M O;  2UXC O;  2UU9 O;  4JI8 O;  1DK1 A;  5LL6 Y;  5IT9 N;  2UXD O;  4DR6 O;  4GKJ O;  4DR7 O;  4JI7 O;  2E5L O;  2UUB O;  4DR4 O;  1F7Y A;  4LF7 O;  1I94 O;  4GKK O;  2UUA O;  4DV0 O;  1YZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...