1F7YA

The crystal structure of two uucg loops highlights the role played by 2'-hydroxyl groups in its unusual stability
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
PITKEEKQKVMQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRMLIEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of UUCG tetraloop.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA FRAGMENT
total genus 17
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2000-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1f7yA00
1AB3A 4DV4O 1D2DA 3SDLA 4B3RO 4LFAO 4NXNO 4YY3O 3J7AU 5LL6Y 5BR8O 4KHPO 4YHHO 5BXZA 4GKJO 4DUYO 4LFBO 2UUCO 2VQEO 4DV7O 1YZBA 2HHHO 2ZKOA 3O65A 1R1BA 4JI3O 3F5TA 2VQFO 5IT9N 3J81N 1AILA 4X64O 1J5EO 1DK1A 4DR7O 1NS1A 1FYJA 2UUBO 4GKKO 1HNXO 4DV0O 4AQYO 1I94O 2F4VO 2E5LO 4DR6O 4B3SO 4LF4O 5IWAO 4B3MO 1HR0O 1N32O 4DR1O 1A32A 3J80N 2LW7A 1XNQO 1N33O 4X66O 1HNWO 1HNZO 3T1YO 3R66A 5FLXN 1N36O 4B3TO 1XNRO 4DR2O 4JI8O 4DV1O 2JRIA 4JYAO 5LMUO 1IBLO 4JI7O 1FJGO 2AGAA 2Z0AA 1G1XB 4JV5O 3JAMN 4DV2O 4LF8O 1XEQA 4X62O 4DV6O 3OTOO 1R6TA 2ZM6O 4DR3O 4OPAA 5LMNO 4JI5O 1KUQA 1IBKO 1IBMO 4LF5O 4JI1O 4NXMO 3M8AA 4DV5O 4DR5O 2FKXA 2UXCO 4K0KO 1XMOO 1F7YA 5BY1A 3RT3C 3T1HO 4JI6O 4DV3O 4LF6O 4LFCO 4X65O 1N34O 2DOSA 1X59A 4OX9O 4LF9O 4LF7O 2UXDO 4DUZO 1FKAO 4JI4O 4OPHA 5A2QN 2N74A 4JI0O 4JI2O 1XMQO 2UUAO 2DJVA 2UU9O 2UXBO 4DR4O 4A5UB 5H5NA
chains in the Genus database with same CATH superfamily
5LOVB 2DQ3A 2FL4A 4EKWA 2K9PA 3ZEDA 1S5LZ 1OCOC 4DV3B 2QTSA 1P49A 1DF4A 1P4RA 2V1DA 1SQQH 3ABUA 4O4HB 4QIWF 3SJQC 2PI4A 3CXCU 3HKDA 4TV9B 4LFBO 3CCRV 3GVMA 4MTXA 1R1BA 2OIEA 1GK9A 1VQ5V 5LYJA 1W2BU 1EZJA 3RVZA 1U97A 4CC5A 4U3JB 1Y76A 4BIUA 1NS1A 4UCVA 1DLBA 3W7SA 4LC1A 3QVNA 3JAWB 3K9SA 3CCUV 1GKFA 1Q6HA 5IWAO 2ARHA 2WLLB 1PD3A 1JR9A 3X2QC 5KA6A 5CBFA 1K34A 4QNHB 3P30A 3RYIB 1IXBA 2HG5C 2Q7EA 4H0LB 4FLWA 1PNKA 4DV6O 3JAKA 3B8MA 1H8HG 3BCCH 4NXMO 1YIJV 1YCIA 3LSUA 2UXCO 4FM2A 4GKKB 2ZT9B 4FFBB 1XMOO 1I94B 1K5QA 1GO3F 4B3MB 1O9GA 4PJ0Z 3OMIB 3N27A 1LR1A 1SQVH 3L71H 1VF6A 2Q69A 4MW8A 2IJKA 2GV9A 1PKXA 1V55C 1H2GA 2QWRB 2LGWA 1B04A 3FFQA 5LGUA 3IAYA 1X4TA 3TGUH 2Z3YA 4O4IB 4XDKA 1VQ8V 4BIOA 4LWSB 4KP4A 4R50A 5IYZA 2WSSG 1M57B 3U11A 1KB9F 3ZHVA 1LUWA 3AG1B 4N21A 4R8CA 3G4SV 3RFRA 5KMGA 4DV7O 1EN6A 4CH4A 2RN9A 3O65A 1SQBH 4ZI7A 3WU2Z 2OCHA 1BMFG 4FZ0A 4I9WA 2ZNJA 4J11A 4H44B 2WPDG 2JS5A 1RPOA 4DV0O 1XMOB 4Z1VA 4Z1MG 2XOKG 3EHBB 3ZX6A 4LF6B 2YI9A 4IYHA 1MMMA 1N33O 1HNWO 1GN2A 1SKVA 3ZMUA 3OGIB 3VQXA 5TISZ 3W7XA 4JPRA 3VQYA 1Q3EA 4BW9A 2IJHA 5JQGA 1XEQA 2MW2B 3TCUA 2GTAA 4QPJA 1AR1B 1KUQA 4D7SA 2Y69B 5J9PC 2UUBB 1K4DC 5CMUA 4K0KO 4EB6B 3JALA 1WPXA 2QDOA 3I55V 1JX9A 4D7TA 3N2GA 1FD9A 1BHAA 4GX5A 2IH1C 2P90A 5H6RA 4I4TB 1VQPV 4HBNA 1PPJH 1OCZC 2QWOB 3ETQA 1R6KA 4DV2B 2W0FC 1H8EG 4DR3B 1XDCA 4NXMB 2B1GA 2JDIG 1CP9A 3EVKA 1NJIW 4PD4F 3MD0A 4X65B 3JASB 2YC0A 1RSOB 3QTCA 3RYFA 2UXDB 1G6UA 2ETNA 2UUCO 1HW7A 2F43G 1YZBA 1FXVA 2V7QG 3L9DA 2WLIB 5LMUB 3KCYA 4J9YB 2UU9B 2EIJB 1R73A 2RDCA 1QCEA 4EFEA 2LQTA 1NTZH 2BOBC 3UCSC 1E79G 4PHZA 4FPPA 4NYKA 1HNXO 1K73W 1S0VA 2OYQA 3OEEG 3T1HB 2JS3A 4OGQB 1MG1A 3AG4C 1TVKA 2V4DA 4X66O 2VQEB 2AW9A 2D2CB 4YIPA 3H1IH 2ODMA 4EEQA 3ZHTA 3APQA 2O57A 1KC8W 4JI4B 4BIZA 3OUFA 3OTOO 1W59A 3ZMSA 5IJ0A 4LF5O 1WA8A 4L87A 1U96A 3QO5A 4B3RB 5IWAB 1SS3A 1Y74A 3CCEV 5L3BA 2XAGA 4KFMA 3CCJV 3CC7V 4AILC 3STZC 3P3NA 1X59A 3QF7A 4UFZA 5EZYB 2VRZA 4MVMA 2NR5A 2Q4PA 1H2KA 3ASNC 3ZRWB 4JTCB 4X62B 4KUMA 2KKWA 2LP7A 2PYJA 1GTOA 2WLMA 1R3IC 1ZTEA 2UUAO 2UU9O 2JEXA 5B1AB 1I7FA 5B1NA 5IJ9B 1Q8IA 1Z2GA 5B1OA 1VQ9V 4R6ZA 5JVDA 5LL6Y 3VBBA 1IDSA 2F93B 1AJNA 2QM4A 4PDVA 2VQEO 1EN5A 3TXSA 3DTUB 2XT9A 1L1FA 1WB8A 3OTFA 4JI8B 3D36C 3ZHUA 5JH7B 2LJ2A 1BE3H 3DXRB 3H1LH 1FFTB 2A7WA 2EIMB 1NT2B 2BTOA 4YJ2A 3FB5C 2BTQA 1IBKB 2EILB 1IBMB 3K08A 2IJIA 1AVMA 4JYCA 1N4CA 1M93A 5H9CA 4AQYO 5IJ0B 1XOUA 1WA8B 3AG7A 4JZGA 3T4DA 4TV9A 2CH7B 3WB2A 1N32O 3E8FA 2CTPA 3Q4HB 1TUEB 4RO2A 1XNQO 1WAZA 2EBOA 1ROPA 1M4UA 3T1YO 2PI5A 5H6QA 2M6YA 2DW4A 4XDJA 1YSCA 3SJBC 4K8XA 3IFXA 4DRXA 2CTRA 2CTWA 4IIJB 1R6TA 3HKBA 1SETA 1QQCA 4DK1A 2FKXA 2A79B 1MZFA 1MOFA 3WG7C 5J2TA 4B3SB 4LFAB 1AI7A 3E8HA 1FS0G 4O4LB 4WF9V 4DUZO 3BEHA 4O4JB 5FPRA 1RSOA 2EIKC 2LGQA 4JV5B 4DYLA 4PA7A 3OTOB 3SYOA 1XILA 1AJPA 4FFBA 5K1PA 3SJAC 2OT5A 4X64B 3S3XA 2QE7G 3UKMA 4ASUG 3CS5A 3DC5A 4JI6B 2EJRA 4IYIA 1VQNV 3SYCA 1H2SB 1SERA 1JJOA 2M7WA 4KHPO 2GTSA 3CRMA 2ADQB 1VP7A 3KKYA 3CB2A 1ENVA 1RM1C 4DR2B 2HHHO 2WLLA 1O9HA 2QTOA 4HNAA 1M56C 3K5LA 3APOA 4LWSA 2W0XA 1NI8A 3CD6V 4CS2A 2OIGA 5KHIA 3LNNA 3G71V 5DN6G 3HKEA 1ZLZA 2R9RB 3BHPA 2OCCC 3UO2A 5JJJB 3SYAA 2E74B 3HKBB 4KXRA 3HKCB 4MVSA 1R3KC 4B3MO 4WFFA 3CRRA 3D8CA 4GKJB 1WJZA 2Y0IA 4LFBB 2Y0PA 3M7MX 2Q73A 4PI2A 1VQOV 1KKCA 4CH6A 4LNUB 1AI4A 5EZYA 1G1XB 4KL1A 1Q5OA 4O4JA 4X89A 3AK2A 1IBKO 4JI1O 4CBCA 3IGAC 4JAVA 3FAVB 3RT3C 4IL6Z 4FM0A 2N05A 3PN1A 1YJ9V 5GW7A 1FFXB 2X6AA 2EULA 4OX9O 3ABKB 1D5AA 3NR7A 2P4VA 3ICXA 4RAIA 5F2VO 5FPOA 1HP8A 2N74A 4WBNA 5EBMC 1S5JA 1SF9A 2BSKB 1F4MA 4EB6A 2DJVA 4A5UB 4WCEV 4ZBMA 2PZSA 1PNLA 3X2QB 4B3RO 5EBLC 1PL4A 4GLXA 1R6NA 4MVRA 1KQSU 4GCZA 5BXZA 3P3PA 1M56B 4WFAV 3JCUZ 1SA0A 1N8RW 1SZXA 1H38A 1US6A 5BZBA 5LHGA 1ORQC 1BT8A 1VARA 1KBHA 2JK5C 4PA4A 4PELA 1F51A 4JI2B 1GM8A 1XI1A 5KHGA 4DR4B 3CP1A 3ZS8C 4GX1A 4F6RB 3DC6A 4DR7O 3FYIB 1WB7A 4JAAA 2QWPB 3AEIA 4TWKA 3BRCA 4ABMA 2HP8A 2UUBO 2VS0A 1Q82W 1GN3A 2QJ1A 4X20A 1KP2A 1M1KW 1VQ4V 1VQLV 4PV1B 3OW2U 2ZXWC 1A32A 2AHZA 3OFNG 4IGGA 1K5SA 4X1IA 1NBMG 1JFFA 4LF7B 3R65A 5KAIZ 5L3CA 1FFXA 3CXHF 2WA3A 1IBLO 2AZ2A 3F7YC 4LF8O 1JQ0A 5GTIZ 3UQ8A 3N2GB 2A3QA 1KECA 4J7ZA 1K9MW 3OEHG 4HAMA 3RYHB 2P6JA 3AG3B 4WFGA 2YXHA 1F7YA 1BQ0A 5L3DA 4UCUA 5CBGA 1DF5A 1P7GA 3L72H 3CC4V 2ZE5A 1B6QA 4H37A 4LF6O 3JASA 1G4YB 2UXNA 2QKSA 5CN0A 2HR3A 3F7VC 1IURA 1BSMA 3CJHA 2GSMB 4JYAB 2R9AA 1S76D 1MABG 3IJ4A 3K06A 3ABLC 2JGDB 1E1RG 4JI2O 4WFBV 3B2EE 5KHKA 2ZE6A 4K0KB 3H1JH 4TQFA 1D2DA 5LP6A 2JJ1G 3HKEB 4LFAO 4CH5A 4I4TA 1NVPD 4X1KA 1HR0B 3BA8A 3ETGA 3E35A 3ABMB 5IYZB 4P9OA 4JTAB 3W7UA 3AG1C 2ZKOA 1N0JA 3G80A 4FMTA 1D5NA 1V54B 2YSUB 2P4KA 5LP6B 2QM7A 3U0ZA 2IJJA 2IM9A 5JJEB 2EX3A 2GBOA 5LXTB 2UXCB 2JEUA 2KG7A 2ZD9A 3LSSA 1M9NA 3K9AA 2DQ0A 2F4VO 1DTOA 5KAFZ 3WG7B 2PF4E 3NXSA 5CA0A 4KHPB 3CRCA 3OE7G 3T4ZA 5H2FZ 2XHBA 5LXTA 4FM1A 3DSQA 3KZIZ 4B3TO 4FJCC 4UVBA 4LF9B 4DV1O 2BTQB 2HJFC 1AI5A 4YJ2B 1V9PA 3TJTA 5KUKA 1IZ3A 1SQGA 2Q8VA 5B5EZ 2ITDC 1L0LH 4ZI7B 3EXAA 3JD0A 3W7WA 2WLJA 4WBNB 3HR0A 1WPBA 2IU0A 3K58A 4K8ZA 1HNXB 4ZHQA 5LHHA 2H3OA 4O4HA 1NVPB 4PA6A 2ZIMA 4Q20A 4O2AA 3AG3C 3K79A 3RYIA 2DOSA 1NTMH 4NTXA 4FZ1A 2EZOA 3ZHQA 2H8PC 3B8NA 4TUYB 4JI4O 1Y66A 1KD1W 4TV8A 4PI0A 1H2LA 4GUNA 1GAXA 3CJHB 1Y74B 4TUYA 3CCQV 1PL0A 3SDLA 1RPRA 2R9IA 1AP6A 2ATKC 2F4VB 1J95A 4DO2A 5JH7A 3BAAA 3ASOB 4FIPC 1N32B 3P32A 3IC9A 5KX5B 5FNVB 5CB4B 3RYCB 1K97A 3ZBHA 5LOVA 4ZIBA 4UV9A 1JCHA 4D6TH 4TV8B 3N2KB 5IJ9A 5KX5A 4JF3A 4P30A 5DM6V 1YJWV 1YTFB 1OCCB 5IDJA 2P5OA 1VF7A 3JYCA 3SR2C 1I94O 3SPIA 4B3SO 4CC6A 4P9PA 4YJ3A 2L35A 1JJ2U 3M99B 4LNUA 2HEPA 5DEDA 2PUSA 4E2LA 1YTFD 2P7TC 2UXXA 1XNRO 1QBZA 2BOCC 1TGOA 4JI8O 2YXYA 3UT5B 2CDYA 1K3EA 2W6JG 4MW3A 5GTHZ 4B7KA 1G8MA 2BCCH 4JV5O 4DV2O 3JD1A 1Y4MA 4JI0B 3CE2A 5E79Z 5FL7G 1XMQB 3D3QA 5D5PA 3SPCA 4X1YB 2W6IG 4NTWA 4JI6O 4NXNB 4MTOA 1SC5B 5KUMA 2RJZA 2AHYA 2BE3A 1MSDA 1N36B 5ITZA 3LDCA 3RN4A 1XL4A 3S3WA 3CHXA 3SYPA 3JAKB 2WLNA 3E22B 3CPWU 2HHHB 4O2BA 4L8JA 3LSQA 2RMKB 3E8GA 2XAQA 4NKGB 2IBZH 1F4NA 3L74H 4R7CA 3OMNB 2OWOA 2EIKB 3ZRWA 1CEZA 4RQEA 1IXMA 3D3IA 2DE0X 4GKJO 1I5XA 1MZEA 4O2BB 2YIBD 5B3SB 1IVSA 4IHJA 4FLTA 3GB7C 1AROP 2WLKA 1QVFU 1Y6XA 3HPLC 2XAJA 3RYHA 1VIBA 1J5EO 1DK1A 1SRYA 1QLEB 3CCMV 1FYJA 3ABLB 2RCVA 3JARA 1Q90D 1NH2B 3A8TA 1HR0O 4DUYB 2LW7A 2AXTZ 2OCCB 2QSAA 5JJNB 2KB1A 1KU9A 2X7RB 1HNZO 1BZKA 1RM1B 1Q6UA 4O2AB 2CE4A 2Y48A 5B1BB 3B40A 2ZR2A 3RYCA 4F6RA 1BL8A 3K59A 2P06A 4O4IA 4X62O 3FB7C 4DR3O 3UO3A 2DMXA 4DV5O 3BA9A 1OJHA 5DECA 5EBWC 1GMGA 3WFVA 3I5DA 4K3AA 3ZJZA 2JVDA 4WFEA 4QGPA 5BY1A 1BGYH 5LP6C 4YY3B 3L75H 3AK1A 4LFCO 4X65O 2YEVA 4BR6A 5BR8B 1AP5A 4LF9O 1W0KG 5KHJA 3ABMC 1SQXH 3OAAG 4OPHA 3QNEA 1N0NA 2JIZG 4JI0O 4JI5B 1XMQO 4MS2A 3SPGA 5C8YB 4DR4O 2EINC 4K35A 4IT5A 4GZRB 2QA4V 1ZL8A 3ZRSA 1NH2D 1T5EA 4NTYA 1WN7A 2GHYA 5J2TB 3J7AU 1SQFA 1QU7A 3STLC 1OCRB 2XNDG 1XNQB 2ZNIA 3CYOA 1GM7A 4I5SA 4TOIA 1S72V 4TT3G 2KQXA 1Q81W 1ZUQA 4LF8B 3PJSK 2ADPA 4NR1A 3E8BA 1NR7A 3CCSV 5C8YA 4DV5B 1Q86W 5J2UA 5LA6A 1RFYA 4I0XB 1FXKC 3CRAA 4X88A 3OR7C 2E5LO 4UCSA 2ZE7A 2Q7HA 1MA1A 2IW5A 2YS8A 4JTDB 3RW0A 2VWJA 1N34B 2JJ2G 3MHSC 4TSFG 4W4LA 2HFEC 2YEVB 3ABTA 5LGNA 2ZINA 1XL6A 4DXWA 1GM9A 3JAMN 2ZXWB 5EIBC 1RP3B 4I0XA 4BW5A 4OPAA 3JD2A 1J5EB 4JI5O 2Y4UA 5IYBO 2ZR3A 4ZOLB 4MVQA 1VF6C 1NR1A 4HYOA 4MSWC 1I0HA 1VEWA 5J2UB 1BHBA 4FLYA 1HWYA 2OTLV 1R3JC 3OT7A 2OTJV 1L8DA 1XNRB 1OHHG 4HZ3A 1WP8A 4JASA 3K3WA 1FKAO 1AR5A 4JYYA 1L0NH 3D36A 4ZOLA 3KG2A 2ILMA 2WWWA 3BABA 1HDJA 1FXKA 2FTKA 2HVKC 1Y67A 3ZMTA 4LF5B 4XBFA 4FFKA 5H5NA 4GYCB 4U3FH 4U7NA 5A9GA 1VQMV 3VOUA 1OCRC 4NB5A 3A0RA 2E5LB 2WLIA 4LFCB 4DR6B 5BR8O 2KG7B 4J10A 3RBZA 1N33B 2HVJC 4YIOA 1VMGA 2YIDA 3ZRXA 4CZZA 3CRQA 1JFFB 5BMVB 4DW1A 4JAUA 1OZ0A 4MVZA 3CEIA 2BSKA 3MAQA 5LMNB 2YDEA 3BFRA 5JVDB 1P84F 2QKCA 3FD9A 3HB3B 1OCOB 1TAEA 5L3FA 3C3TA 1IX9A 2X0LA 4RWUA 3J80N 2PY5A 3W7TA 2E3CA 2XUMA 3QO7A 2ZCEA 4DV7B 3JSNA 1YEWA 3MHHC 1XBLA 4PDMA 3FB6C 2E75B 2Q6AA 1KKDA 1V54C 1FJGO 2CAZC 1NU1H 4JI3B 5B66Z 2Z5UA 2YI8A 3CMAV 4I50B 3LDDA 2YIAA 2N04A 1K33A 1SZTA 5KLVH 3E86A 1IBMO 3WB1A 2WA4A 4JGSA 4O4LA 1Q43A 2B9ZA 2QR4A 3I56V 3ZRVA 4UB6Z 5JQGB 3TXQA 1F23A 1GN6A 1FXHA 5K1XA 3BVOA 4J80A 3UT5A 1N34O 4ZKIA 3T1YB 3B77A 4B3TB 1TVKB 1GRJA 3G6BA 2CK3G 2UUCB 3ZHSA 4IIJA 4B08A 2DWEC 2PTMA 1TUBB 3K0DA 1S3JA 2ZM6B 2XAHA 5B1AC 1YVWA 2CGOA 1QHTA 2QM8A 1EZVH 5BMVA 5EYPB 4E4EA 4UXNA 4MTGA 4BAYA 4UCRA 2EZPA 2YXLA 2ZDIA 3EFFK 4X20B 5LGTA 2KSDA 4G2KA 1PV0A 1GN4A 1PNMA 2A06H 4JI3O 2DWDC 3F5TA 4H13B 2X6CA 3J81N 1AILA 1EFRG 1FXKB 5GONA 5CB4A 1BS3A 4P2ZA 3OMAB 2QWQB 3HKDB 4LH6A 4DR6O 2F66C 2Q7GA 3FKSG 1TA8A 4EFBA 1UFIA 4MVUA 2RQ6A 3MDSA 2A0LA 4I55B 1K8AW 4X8AA 1JMKC 3RWRD 1VQKV 4QE7A 5LMUO 2VQFB 2AZ0A 3WB0A 4FLXA 1AI6A 3A2FA 2NNUA 5LMNO 1TUBA 5EC1C 2CTQA 5IY5B 4DV4B 1AR4A 3K57A 4U7OA 4B7EA 2QEXV 4UB8Z 2ZDIC 5CA0B 3OR6C 3Q4HA 4YHHB 3FB8C 1CPYA 2RNBA 4I7ZB 5FNVA 4RQFA 3CX5F 3K03A 2UXBO 1Y76B 4DR5B 2Q9LA 4UCOA 3K04A 1I5YA 4FLVA 3SPJA 3DXRA 2DYSC 1LUVA 1THZA 2Q5ZA 3JCZA 5C93A 5LHIA 2MK3A 4UV8A 4LF4B 4DR1B 4DUYO 2R72A 1M57C 2JGUA 5CA3A 4ICGA 4AI8A 1FPOA 4J9ZB 1YDXA 1YF2A 4GX0A 2FYUH 5CBHA 1IBLB 3OGCC 3JARB 4C7UA 3U10A 1QR9A 3H01A 2Y4TA 5CA1B 1B3QA 3UM7A 2EJ7A 1YI2V 4CS4A 5EYPA 1KYOF 2NLJC 1QLEC 2ZQMA 1EM1A 3CCVV 1BQZA 3OUSA 4U3JA 3OD4A 5LYJB 3JSLA 1URFA 4DUZB 3TK1A 1OCCC 3ZCCA 2G38A 2AGAA 2HJDA 1WLEA 1JOYA 3A0HZ 4F4LA 3QG5A 1Q6IA 4UVAA 3LUTB 3M8AA 3C90A 5HFMA 3SYQA 5CA1A 5EC2C 3K5OA 1OCZB 3E83A 1MNGA 3T1HO 3IC7A 4GX2A 2YUAA 1HNZB 3ASOC 5HFLA 5AG2A 1PP9H 2P22C 3CWBH 1FJGB 2A9HA 5A2QN 3O9OA 5KMGB 4DV6B 3ETDA 5IE9A 1AJQA 3JALB 4W4KA 4X1KB 3JATA 1LNQA 4N23A 4DV4O 3L70H 4MTFA 5JWPA 3K5MA 4CH3A 2PYLA 1K7DA 4RUEA 1SESA 4DW0A 4YY3O 4JZ2A 3E89A 1M90W 4BWAA 4J41A 2JGDA 5JCOA 2B5UA 2GDSA 2Q68A 3ASNB 2CUGA 4F6EA 1MSWD 1H2NA 1ZSPA 3OM3B 5B3SC 1I08A 1JA8A 2DYSB 1NQTA 4H33A 3JATB 1FAFA 3THOA 2GUZA 4LF4O 2F23A 5B1BC 2QGNA 2LW1A 2VWKA 3GWOA 3R66A 5FLXN 1N36O 4PDRA 1VQ6V 4QPKA 1R3LC 1PM9A 4Q6GA 1P7BA 2FB5A 3VQVA 4JI7O 3G6EV 2Z0AA 4X1IB 3SJCC 2F1MA 1XHXA 3F5WC 2Q0AA 1JVMA 3LNMB 1S77D 5E1AC 3ZN0A 1XQ8A 1YHQV 3JD4A 2P67A 4DV3O 3K5NA 2F95B 4MT8A 1ZL8B 3AK3A 1W0JG 3L73H 4RUFA 4DV1B 4WFHA 4FLUA 3ZHRA 3T1CA 1M5IA 3RYFB 1SA0B 3CSXA 1B06A 4ZHQB 4JI1B 2E76B 4LBEC 2DN9A 5JCOC 2QWNB 1AB3A 3CCLV 4GT1A 3AG2C 2EINB 3E2EA 3FAVA 5L3EA 4I55A 4JYBA 1Q7YW 3HKCA 4YHHO 3CC2V 4X66B 5L3GA 1ZX3A 3GWKC 1DGSA 2H94A 2HKOA 4JI7B 3SGIA 1KMIZ 5IT9N 1VQ7V 1ZWIC 5EK0A 1EBOA 4FK5C 4X64O 3BY6A 2LFRA 1XHZA 2WLHA 2L6LA 4X1YA 3ZMVA 3FX7A 1Z5WA 2EIMC 3CMEV 2WAMA 1Z5VA 3T2MA 5D5QA 5IY5C 1WNSA 4DR1O 4IHJB 3QO8A 2YICA 4FVMA 2PGGA 4XDLA 2DYRC 4DR2O 2QKAA 4QE9A 4JYAO 5GONB 1YJNV 2Q67A 5LBQA 4FLZA 4LP8A 1K4CC 2ZM6O 2ITCC 3ML0A 1QVGU 2K1EA 4DR7B 1QR8A 1WP7A 4J42A 1NKDA 4PDLA 3H9VA 4AHCA 3E22A 4J7KA 3KCXA 4LCUC 2GUZB 2EILC 3K0GA 3VQWA 2FMLA 1UPGA 4X9QA 4YXWG 4I9QA 1XREA 2NN4A 3B4SA 1SQPH 3BPZA 3ZMZA 3AG4B 1K92A 3H1HH 4CS3A 4UCTA 4G27B 1JPXA 1NZ6A 5IYDO 4DV0B 3DGEA 4NXNO 1CXZB 1YXBA 4DK0A 5LA6B 3LDEA 2YIBA 4OX9B 1HNWB 4OXSA 2Y69C 4UUJC 1V55B 1BCCH 2Q0OC 2LO1A 1EN4A 3SPHA 2VQFO 2R70A 2UUAB 2B1IA 3RGBA 2XAFA 1KP3A 4PA9A 4GKKO 2ZIOA 2IH3C 3ZN1A 2IU3A 4TQDA 3TETA 4DRXB 1VF5B 2XASA 5KHHA 1H2MA 1E1QG 4UVCA 4LH7A 5KA5A 4QJFB 2C2AA 4G28B 3ETEA 3N2KA 2JRIA 1GH6A 4PA3A 5ITZB 2ZE8A 4NVPA 3C3SA 3H1KH 1OV9A 2D3OW 3JAWA 2UXBB 4LR3A 2CH7A 4DR5O 4J7JA 3RVYA 4Z2WA 3ZIAG 4AQYB 1ZAUA 4I50A 1NTKH 1UJWB 2CGNA 5IYCO 2XTAA 3FYEB 2DYRB 5EIBD 4YJ3B 2EIJC 2X6BA 1COWG 4LF7O 2UXDO 1S5HC 4HNAB 1YITV 3JD3A 2LFSA 4MVOA 3G67A 1XUQA 1QNMA 3ABKC 3A0BZ 3AG2B 2HLDG 1QLNA 3B09A
chains in the Genus database with same CATH topology
1AB3A 4DV4O 1D2DA 3SDLA 4B3RO 4LFAO 4NXNO 4YY3O 3J7AU 5LL6Y 5BR8O 4KHPO 4YHHO 5BXZA 4GKJO 4DUYO 4LFBO 2UUCO 2VQEO 4DV7O 1YZBA 2HHHO 2ZKOA 3O65A 1R1BA 4JI3O 3F5TA 2VQFO 5IT9N 3J81N 1AILA 4X64O 1J5EO 1DK1A 4DR7O 1NS1A 1FYJA 2UUBO 4GKKO 1HNXO 4DV0O 4AQYO 1I94O 2F4VO 2E5LO 4DR6O 4B3SO 4LF4O 5IWAO 4B3MO 1HR0O 1N32O 4DR1O 1A32A 3J80N 2LW7A 1XNQO 1N33O 4X66O 1HNWO 1HNZO 3T1YO 3R66A 5FLXN 1N36O 4B3TO 1XNRO 4DR2O 4JI8O 4DV1O 2JRIA 4JYAO 5LMUO 1IBLO 4JI7O 1FJGO 2AGAA 2Z0AA 1G1XB 4JV5O 3JAMN 4DV2O 4LF8O 1XEQA 4X62O 4DV6O 3OTOO 1R6TA 2ZM6O 4DR3O 4OPAA 5LMNO 4JI5O 1KUQA 1IBKO 1IBMO 4LF5O 4JI1O 4NXMO 3M8AA 4DV5O 4DR5O 2FKXA 2UXCO 4K0KO 1XMOO 1F7YA 5BY1A 3RT3C 3T1HO 4JI6O 4DV3O 4LF6O 4LFCO 4X65O 1N34O 2DOSA 1X59A 4OX9O 4LF9O 4LF7O 2UXDO 4DUZO 1FKAO 4JI4O 4OPHA 5A2QN 2N74A 4JI0O 4JI2O 1XMQO 2UUAO 2DJVA 2UU9O 2UXBO 4DR4O 4A5UB 5H5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AB3 A;  4DV4 O;  1D2D A;  3SDL A;  4B3R O;  4LFA O;  4NXN O;  4YY3 O;  3J7A U;  5LL6 Y;  5BR8 O;  4KHP O;  4YHH O;  5BXZ A;  4GKJ O;  4DUY O;  4LFB O;  2UUC O;  2VQE O;  4DV7 O;  1YZB A;  2HHH O;  2ZKO A;  3O65 A;  1R1B A;  4JI3 O;  3F5T A;  2VQF O;  5IT9 N;  3J81 N;  1AIL A;  4X64 O;  1J5E O;  1DK1 A;  4DR7 O;  1NS1 A;  1FYJ A;  2UUB O;  4GKK O;  1HNX O;  4DV0 O;  4AQY O;  1I94 O;  2F4V O;  2E5L O;  4DR6 O;  4B3S O;  4LF4 O;  5IWA O;  4B3M O;  1HR0 O;  1N32 O;  4DR1 O;  1A32 A;  3J80 N;  2LW7 A;  1XNQ O;  1N33 O;  4X66 O;  1HNW O;  1HNZ O;  3T1Y O;  3R66 A;  5FLX N;  1N36 O;  4B3T O;  1XNR O;  4DR2 O;  4JI8 O;  4DV1 O;  2JRI A;  4JYA O;  5LMU O;  1IBL O;  4JI7 O;  1FJG O;  2AGA A;  2Z0A A;  1G1X B;  4JV5 O;  3JAM N;  4DV2 O;  4LF8 O;  1XEQ A;  4X62 O;  4DV6 O;  3OTO O;  1R6T A;  2ZM6 O;  4DR3 O;  4OPA A;  5LMN O;  4JI5 O;  1KUQ A;  1IBK O;  1IBM O;  4LF5 O;  4JI1 O;  4NXM O;  3M8A A;  4DV5 O;  4DR5 O;  2FKX A;  2UXC O;  4K0K O;  1XMO O;  1F7Y A;  5BY1 A;  3RT3 C;  3T1H O;  4JI6 O;  4DV3 O;  4LF6 O;  4LFC O;  4X65 O;  1N34 O;  2DOS A;  1X59 A;  4OX9 O;  4LF9 O;  4LF7 O;  2UXD O;  4DUZ O;  1FKA O;  4JI4 O;  4OPH A;  5A2Q N;  2N74 A;  4JI0 O;  4JI2 O;  1XMQ O;  2UUA O;  2DJV A;  2UU9 O;  2UXB O;  4DR4 O;  4A5U B;  5H5N A; 
#chains in the Genus database with same CATH topology
 5LOV B;  2DQ3 A;  2FL4 A;  4EKW A;  2K9P A;  3ZED A;  1S5L Z;  1OCO C;  4DV3 B;  2QTS A;  1P49 A;  1DF4 A;  1P4R A;  2V1D A;  1SQQ H;  3ABU A;  4O4H B;  4QIW F;  3SJQ C;  2PI4 A;  3CXC U;  3HKD A;  4TV9 B;  4LFB O;  3CCR V;  3GVM A;  4MTX A;  1R1B A;  2OIE A;  1GK9 A;  1VQ5 V;  5LYJ A;  1W2B U;  1EZJ A;  3RVZ A;  1U97 A;  4CC5 A;  4U3J B;  1Y76 A;  4BIU A;  1NS1 A;  4UCV A;  1DLB A;  3W7S A;  4LC1 A;  3QVN A;  3JAW B;  3K9S A;  3CCU V;  1GKF A;  1Q6H A;  5IWA O;  2ARH A;  2WLL B;  1PD3 A;  1JR9 A;  3X2Q C;  5KA6 A;  5CBF A;  1K34 A;  4QNH B;  3P30 A;  3RYI B;  1IXB A;  2HG5 C;  2Q7E A;  4H0L B;  4FLW A;  1PNK A;  4DV6 O;  3JAK A;  3B8M A;  1H8H G;  3BCC H;  4NXM O;  1YIJ V;  1YCI A;  3LSU A;  2UXC O;  4FM2 A;  4GKK B;  2ZT9 B;  4FFB B;  1XMO O;  1I94 B;  1K5Q A;  1GO3 F;  4B3M B;  1O9G A;  4PJ0 Z;  3OMI B;  3N27 A;  1LR1 A;  1SQV H;  3L71 H;  1VF6 A;  2Q69 A;  4MW8 A;  2IJK A;  2GV9 A;  1PKX A;  1V55 C;  1H2G A;  2QWR B;  2LGW A;  1B04 A;  3FFQ A;  5LGU A;  3IAY A;  1X4T A;  3TGU H;  2Z3Y A;  4O4I B;  4XDK A;  1VQ8 V;  4BIO A;  4LWS B;  4KP4 A;  4R50 A;  5IYZ A;  2WSS G;  1M57 B;  3U11 A;  1KB9 F;  3ZHV A;  1LUW A;  3AG1 B;  4N21 A;  4R8C A;  3G4S V;  3RFR A;  5KMG A;  4DV7 O;  1EN6 A;  4CH4 A;  2RN9 A;  3O65 A;  1SQB H;  4ZI7 A;  3WU2 Z;  2OCH A;  1BMF G;  4FZ0 A;  4I9W A;  2ZNJ A;  4J11 A;  4H44 B;  2WPD G;  2JS5 A;  1RPO A;  4DV0 O;  1XMO B;  4Z1V A;  4Z1M G;  2XOK G;  3EHB B;  3ZX6 A;  4LF6 B;  2YI9 A;  4IYH A;  1MMM A;  1N33 O;  1HNW O;  1GN2 A;  1SKV A;  3ZMU A;  3OGI B;  3VQX A;  5TIS Z;  3W7X A;  4JPR A;  3VQY A;  1Q3E A;  4BW9 A;  2IJH A;  5JQG A;  1XEQ A;  2MW2 B;  3TCU A;  2GTA A;  4QPJ A;  1AR1 B;  1KUQ A;  4D7S A;  2Y69 B;  5J9P C;  2UUB B;  1K4D C;  5CMU A;  4K0K O;  4EB6 B;  3JAL A;  1WPX A;  2QDO A;  3I55 V;  1JX9 A;  4D7T A;  3N2G A;  1FD9 A;  1BHA A;  4GX5 A;  2IH1 C;  2P90 A;  5H6R A;  4I4T B;  1VQP V;  4HBN A;  1PPJ H;  1OCZ C;  2QWO B;  3ETQ A;  1R6K A;  4DV2 B;  2W0F C;  1H8E G;  4DR3 B;  1XDC A;  4NXM B;  2B1G A;  2JDI G;  1CP9 A;  3EVK A;  1NJI W;  4PD4 F;  3MD0 A;  4X65 B;  3JAS B;  2YC0 A;  1RSO B;  3QTC A;  3RYF A;  2UXD B;  1G6U A;  2ETN A;  2UUC O;  1HW7 A;  2F43 G;  1YZB A;  1FXV A;  2V7Q G;  3L9D A;  2WLI B;  5LMU B;  3KCY A;  4J9Y B;  2UU9 B;  2EIJ B;  1R73 A;  2RDC A;  1QCE A;  4EFE A;  2LQT A;  1NTZ H;  2BOB C;  3UCS C;  1E79 G;  4PHZ A;  4FPP A;  4NYK A;  1HNX O;  1K73 W;  1S0V A;  2OYQ A;  3OEE G;  3T1H B;  2JS3 A;  4OGQ B;  1MG1 A;  3AG4 C;  1TVK A;  2V4D A;  4X66 O;  2VQE B;  2AW9 A;  2D2C B;  4YIP A;  3H1I H;  2ODM A;  4EEQ A;  3ZHT A;  3APQ A;  2O57 A;  1KC8 W;  4JI4 B;  4BIZ A;  3OUF A;  3OTO O;  1W59 A;  3ZMS A;  5IJ0 A;  4LF5 O;  1WA8 A;  4L87 A;  1U96 A;  3QO5 A;  4B3R B;  5IWA B;  1SS3 A;  1Y74 A;  3CCE V;  5L3B A;  2XAG A;  4KFM A;  3CCJ V;  3CC7 V;  4AIL C;  3STZ C;  3P3N A;  1X59 A;  3QF7 A;  4UFZ A;  5EZY B;  2VRZ A;  4MVM A;  2NR5 A;  2Q4P A;  1H2K A;  3ASN C;  3ZRW B;  4JTC B;  4X62 B;  4KUM A;  2KKW A;  2LP7 A;  2PYJ A;  1GTO A;  2WLM A;  1R3I C;  1ZTE A;  2UUA O;  2UU9 O;  2JEX A;  5B1A B;  1I7F A;  5B1N A;  5IJ9 B;  1Q8I A;  1Z2G A;  5B1O A;  1VQ9 V;  4R6Z A;  5JVD A;  5LL6 Y;  3VBB A;  1IDS A;  2F93 B;  1AJN A;  2QM4 A;  4PDV A;  2VQE O;  1EN5 A;  3TXS A;  3DTU B;  2XT9 A;  1L1F A;  1WB8 A;  3OTF A;  4JI8 B;  3D36 C;  3ZHU A;  5JH7 B;  2LJ2 A;  1BE3 H;  3DXR B;  3H1L H;  1FFT B;  2A7W A;  2EIM B;  1NT2 B;  2BTO A;  4YJ2 A;  3FB5 C;  2BTQ A;  1IBK B;  2EIL B;  1IBM B;  3K08 A;  2IJI A;  1AVM A;  4JYC A;  1N4C A;  1M93 A;  5H9C A;  4AQY O;  5IJ0 B;  1XOU A;  1WA8 B;  3AG7 A;  4JZG A;  3T4D A;  4TV9 A;  2CH7 B;  3WB2 A;  1N32 O;  3E8F A;  2CTP A;  3Q4H B;  1TUE B;  4RO2 A;  1XNQ O;  1WAZ A;  2EBO A;  1ROP A;  1M4U A;  3T1Y O;  2PI5 A;  5H6Q A;  2M6Y A;  2DW4 A;  4XDJ A;  1YSC A;  3SJB C;  4K8X A;  3IFX A;  4DRX A;  2CTR A;  2CTW A;  4IIJ B;  1R6T A;  3HKB A;  1SET A;  1QQC A;  4DK1 A;  2FKX A;  2A79 B;  1MZF A;  1MOF A;  3WG7 C;  5J2T A;  4B3S B;  4LFA B;  1AI7 A;  3E8H A;  1FS0 G;  4O4L B;  4WF9 V;  4DUZ O;  3BEH A;  4O4J B;  5FPR A;  1RSO A;  2EIK C;  2LGQ A;  4JV5 B;  4DYL A;  4PA7 A;  3OTO B;  3SYO A;  1XIL A;  1AJP A;  4FFB A;  5K1P A;  3SJA C;  2OT5 A;  4X64 B;  3S3X A;  2QE7 G;  3UKM A;  4ASU G;  3CS5 A;  3DC5 A;  4JI6 B;  2EJR A;  4IYI A;  1VQN V;  3SYC A;  1H2S B;  1SER A;  1JJO A;  2M7W A;  4KHP O;  2GTS A;  3CRM A;  2ADQ B;  1VP7 A;  3KKY A;  3CB2 A;  1ENV A;  1RM1 C;  4DR2 B;  2HHH O;  2WLL A;  1O9H A;  2QTO A;  4HNA A;  1M56 C;  3K5L A;  3APO A;  4LWS A;  2W0X A;  1NI8 A;  3CD6 V;  4CS2 A;  2OIG A;  5KHI A;  3LNN A;  3G71 V;  5DN6 G;  3HKE A;  1ZLZ A;  2R9R B;  3BHP A;  2OCC C;  3UO2 A;  5JJJ B;  3SYA A;  2E74 B;  3HKB B;  4KXR A;  3HKC B;  4MVS A;  1R3K C;  4B3M O;  4WFF A;  3CRR A;  3D8C A;  4GKJ B;  1WJZ A;  2Y0I A;  4LFB B;  2Y0P A;  3M7M X;  2Q73 A;  4PI2 A;  1VQO V;  1KKC A;  4CH6 A;  4LNU B;  1AI4 A;  5EZY A;  1G1X B;  4KL1 A;  1Q5O A;  4O4J A;  4X89 A;  3AK2 A;  1IBK O;  4JI1 O;  4CBC A;  3IGA C;  4JAV A;  3FAV B;  3RT3 C;  4IL6 Z;  4FM0 A;  2N05 A;  3PN1 A;  1YJ9 V;  5GW7 A;  1FFX B;  2X6A A;  2EUL A;  4OX9 O;  3ABK B;  1D5A A;  3NR7 A;  2P4V A;  3ICX A;  4RAI A;  5F2V O;  5FPO A;  1HP8 A;  2N74 A;  4WBN A;  5EBM C;  1S5J A;  1SF9 A;  2BSK B;  1F4M A;  4EB6 A;  2DJV A;  4A5U B;  4WCE V;  4ZBM A;  2PZS A;  1PNL A;  3X2Q B;  4B3R O;  5EBL C;  1PL4 A;  4GLX A;  1R6N A;  4MVR A;  1KQS U;  4GCZ A;  5BXZ A;  3P3P A;  1M56 B;  4WFA V;  3JCU Z;  1SA0 A;  1N8R W;  1SZX A;  1H38 A;  1US6 A;  5BZB A;  5LHG A;  1ORQ C;  1BT8 A;  1VAR A;  1KBH A;  2JK5 C;  4PA4 A;  4PEL A;  1F51 A;  4JI2 B;  1GM8 A;  1XI1 A;  5KHG A;  4DR4 B;  3CP1 A;  3ZS8 C;  4GX1 A;  4F6R B;  3DC6 A;  4DR7 O;  3FYI B;  1WB7 A;  4JAA A;  2QWP B;  3AEI A;  4TWK A;  3BRC A;  4ABM A;  2HP8 A;  2UUB O;  2VS0 A;  1Q82 W;  1GN3 A;  2QJ1 A;  4X20 A;  1KP2 A;  1M1K W;  1VQ4 V;  1VQL V;  4PV1 B;  3OW2 U;  2ZXW C;  1A32 A;  2AHZ A;  3OFN G;  4IGG A;  1K5S A;  4X1I A;  1NBM G;  1JFF A;  4LF7 B;  3R65 A;  5KAI Z;  5L3C A;  1FFX A;  3CXH F;  2WA3 A;  1IBL O;  2AZ2 A;  3F7Y C;  4LF8 O;  1JQ0 A;  5GTI Z;  3UQ8 A;  3N2G B;  2A3Q A;  1KEC A;  4J7Z A;  1K9M W;  3OEH G;  4HAM A;  3RYH B;  2P6J A;  3AG3 B;  4WFG A;  2YXH A;  1F7Y A;  1BQ0 A;  5L3D A;  4UCU A;  5CBG A;  1DF5 A;  1P7G A;  3L72 H;  3CC4 V;  2ZE5 A;  1B6Q A;  4H37 A;  4LF6 O;  3JAS A;  1G4Y B;  2UXN A;  2QKS A;  5CN0 A;  2HR3 A;  3F7V C;  1IUR A;  1BSM A;  3CJH A;  2GSM B;  4JYA B;  2R9A A;  1S76 D;  1MAB G;  3IJ4 A;  3K06 A;  3ABL C;  2JGD B;  1E1R G;  4JI2 O;  4WFB V;  3B2E E;  5KHK A;  2ZE6 A;  4K0K B;  3H1J H;  4TQF A;  1D2D A;  5LP6 A;  2JJ1 G;  3HKE B;  4LFA O;  4CH5 A;  4I4T A;  1NVP D;  4X1K A;  1HR0 B;  3BA8 A;  3ETG A;  3E35 A;  3ABM B;  5IYZ B;  4P9O A;  4JTA B;  3W7U A;  3AG1 C;  2ZKO A;  1N0J A;  3G80 A;  4FMT A;  1D5N A;  1V54 B;  2YSU B;  2P4K A;  5LP6 B;  2QM7 A;  3U0Z A;  2IJJ A;  2IM9 A;  5JJE B;  2EX3 A;  2GBO A;  5LXT B;  2UXC B;  2JEU A;  2KG7 A;  2ZD9 A;  3LSS A;  1M9N A;  3K9A A;  2DQ0 A;  2F4V O;  1DTO A;  5KAF Z;  3WG7 B;  2PF4 E;  3NXS A;  5CA0 A;  4KHP B;  3CRC A;  3OE7 G;  3T4Z A;  5H2F Z;  2XHB A;  5LXT A;  4FM1 A;  3DSQ A;  3KZI Z;  4B3T O;  4FJC C;  4UVB A;  4LF9 B;  4DV1 O;  2BTQ B;  2HJF C;  1AI5 A;  4YJ2 B;  1V9P A;  3TJT A;  5KUK A;  1IZ3 A;  1SQG A;  2Q8V A;  5B5E Z;  2ITD C;  1L0L H;  4ZI7 B;  3EXA A;  3JD0 A;  3W7W A;  2WLJ A;  4WBN B;  3HR0 A;  1WPB A;  2IU0 A;  3K58 A;  4K8Z A;  1HNX B;  4ZHQ A;  5LHH A;  2H3O A;  4O4H A;  1NVP B;  4PA6 A;  2ZIM A;  4Q20 A;  4O2A A;  3AG3 C;  3K79 A;  3RYI A;  2DOS A;  1NTM H;  4NTX A;  4FZ1 A;  2EZO A;  3ZHQ A;  2H8P C;  3B8N A;  4TUY B;  4JI4 O;  1Y66 A;  1KD1 W;  4TV8 A;  4PI0 A;  1H2L A;  4GUN A;  1GAX A;  3CJH B;  1Y74 B;  4TUY A;  3CCQ V;  1PL0 A;  3SDL A;  1RPR A;  2R9I A;  1AP6 A;  2ATK C;  2F4V B;  1J95 A;  4DO2 A;  5JH7 A;  3BAA A;  3ASO B;  4FIP C;  1N32 B;  3P32 A;  3IC9 A;  5KX5 B;  5FNV B;  5CB4 B;  3RYC B;  1K97 A;  3ZBH A;  5LOV A;  4ZIB A;  4UV9 A;  1JCH A;  4D6T H;  4TV8 B;  3N2K B;  5IJ9 A;  5KX5 A;  4JF3 A;  4P30 A;  5DM6 V;  1YJW V;  1YTF B;  1OCC B;  5IDJ A;  2P5O A;  1VF7 A;  3JYC A;  3SR2 C;  1I94 O;  3SPI A;  4B3S O;  4CC6 A;  4P9P A;  4YJ3 A;  2L35 A;  1JJ2 U;  3M99 B;  4LNU A;  2HEP A;  5DED A;  2PUS A;  4E2L A;  1YTF D;  2P7T C;  2UXX A;  1XNR O;  1QBZ A;  2BOC C;  1TGO A;  4JI8 O;  2YXY A;  3UT5 B;  2CDY A;  1K3E A;  2W6J G;  4MW3 A;  5GTH Z;  4B7K A;  1G8M A;  2BCC H;  4JV5 O;  4DV2 O;  3JD1 A;  1Y4M A;  4JI0 B;  3CE2 A;  5E79 Z;  5FL7 G;  1XMQ B;  3D3Q A;  5D5P A;  3SPC A;  4X1Y B;  2W6I G;  4NTW A;  4JI6 O;  4NXN B;  4MTO A;  1SC5 B;  5KUM A;  2RJZ A;  2AHY A;  2BE3 A;  1MSD A;  1N36 B;  5ITZ A;  3LDC A;  3RN4 A;  1XL4 A;  3S3W A;  3CHX A;  3SYP A;  3JAK B;  2WLN A;  3E22 B;  3CPW U;  2HHH B;  4O2B A;  4L8J A;  3LSQ A;  2RMK B;  3E8G A;  2XAQ A;  4NKG B;  2IBZ H;  1F4N A;  3L74 H;  4R7C A;  3OMN B;  2OWO A;  2EIK B;  3ZRW A;  1CEZ A;  4RQE A;  1IXM A;  3D3I A;  2DE0 X;  4GKJ O;  1I5X A;  1MZE A;  4O2B B;  2YIB D;  5B3S B;  1IVS A;  4IHJ A;  4FLT A;  3GB7 C;  1ARO P;  2WLK A;  1QVF U;  1Y6X A;  3HPL C;  2XAJ A;  3RYH A;  1VIB A;  1J5E O;  1DK1 A;  1SRY A;  1QLE B;  3CCM V;  1FYJ A;  3ABL B;  2RCV A;  3JAR A;  1Q90 D;  1NH2 B;  3A8T A;  1HR0 O;  4DUY B;  2LW7 A;  2AXT Z;  2OCC B;  2QSA A;  5JJN B;  2KB1 A;  1KU9 A;  2X7R B;  1HNZ O;  1BZK A;  1RM1 B;  1Q6U A;  4O2A B;  2CE4 A;  2Y48 A;  5B1B B;  3B40 A;  2ZR2 A;  3RYC A;  4F6R A;  1BL8 A;  3K59 A;  2P06 A;  4O4I A;  4X62 O;  3FB7 C;  4DR3 O;  3UO3 A;  2DMX A;  4DV5 O;  3BA9 A;  1OJH A;  5DEC A;  5EBW C;  1GMG A;  3WFV A;  3I5D A;  4K3A A;  3ZJZ A;  2JVD A;  4WFE A;  4QGP A;  5BY1 A;  1BGY H;  5LP6 C;  4YY3 B;  3L75 H;  3AK1 A;  4LFC O;  4X65 O;  2YEV A;  4BR6 A;  5BR8 B;  1AP5 A;  4LF9 O;  1W0K G;  5KHJ A;  3ABM C;  1SQX H;  3OAA G;  4OPH A;  3QNE A;  1N0N A;  2JIZ G;  4JI0 O;  4JI5 B;  1XMQ O;  4MS2 A;  3SPG A;  5C8Y B;  4DR4 O;  2EIN C;  4K35 A;  4IT5 A;  4GZR B;  2QA4 V;  1ZL8 A;  3ZRS A;  1NH2 D;  1T5E A;  4NTY A;  1WN7 A;  2GHY A;  5J2T B;  3J7A U;  1SQF A;  1QU7 A;  3STL C;  1OCR B;  2XND G;  1XNQ B;  2ZNI A;  3CYO A;  1GM7 A;  4I5S A;  4TOI A;  1S72 V;  4TT3 G;  2KQX A;  1Q81 W;  1ZUQ A;  4LF8 B;  3PJS K;  2ADP A;  4NR1 A;  3E8B A;  1NR7 A;  3CCS V;  5C8Y A;  4DV5 B;  1Q86 W;  5J2U A;  5LA6 A;  1RFY A;  4I0X B;  1FXK C;  3CRA A;  4X88 A;  3OR7 C;  2E5L O;  4UCS A;  2ZE7 A;  2Q7H A;  1MA1 A;  2IW5 A;  2YS8 A;  4JTD B;  3RW0 A;  2VWJ A;  1N34 B;  2JJ2 G;  3MHS C;  4TSF G;  4W4L A;  2HFE C;  2YEV B;  3ABT A;  5LGN A;  2ZIN A;  1XL6 A;  4DXW A;  1GM9 A;  3JAM N;  2ZXW B;  5EIB C;  1RP3 B;  4I0X A;  4BW5 A;  4OPA A;  3JD2 A;  1J5E B;  4JI5 O;  2Y4U A;  5IYB O;  2ZR3 A;  4ZOL B;  4MVQ A;  1VF6 C;  1NR1 A;  4HYO A;  4MSW C;  1I0H A;  1VEW A;  5J2U B;  1BHB A;  4FLY A;  1HWY A;  2OTL V;  1R3J C;  3OT7 A;  2OTJ V;  1L8D A;  1XNR B;  1OHH G;  4HZ3 A;  1WP8 A;  4JAS A;  3K3W A;  1FKA O;  1AR5 A;  4JYY A;  1L0N H;  3D36 A;  4ZOL A;  3KG2 A;  2ILM A;  2WWW A;  3BAB A;  1HDJ A;  1FXK A;  2FTK A;  2HVK C;  1Y67 A;  3ZMT A;  4LF5 B;  4XBF A;  4FFK A;  5H5N A;  4GYC B;  4U3F H;  4U7N A;  5A9G A;  1VQM V;  3VOU A;  1OCR C;  4NB5 A;  3A0R A;  2E5L B;  2WLI A;  4LFC B;  4DR6 B;  5BR8 O;  2KG7 B;  4J10 A;  3RBZ A;  1N33 B;  2HVJ C;  4YIO A;  1VMG A;  2YID A;  3ZRX A;  4CZZ A;  3CRQ A;  1JFF B;  5BMV B;  4DW1 A;  4JAU A;  1OZ0 A;  4MVZ A;  3CEI A;  2BSK A;  3MAQ A;  5LMN B;  2YDE A;  3BFR A;  5JVD B;  1P84 F;  2QKC A;  3FD9 A;  3HB3 B;  1OCO B;  1TAE A;  5L3F A;  3C3T A;  1IX9 A;  2X0L A;  4RWU A;  3J80 N;  2PY5 A;  3W7T A;  2E3C A;  2XUM A;  3QO7 A;  2ZCE A;  4DV7 B;  3JSN A;  1YEW A;  3MHH C;  1XBL A;  4PDM A;  3FB6 C;  2E75 B;  2Q6A A;  1KKD A;  1V54 C;  1FJG O;  2CAZ C;  1NU1 H;  4JI3 B;  5B66 Z;  2Z5U A;  2YI8 A;  3CMA V;  4I50 B;  3LDD A;  2YIA A;  2N04 A;  1K33 A;  1SZT A;  5KLV H;  3E86 A;  1IBM O;  3WB1 A;  2WA4 A;  4JGS A;  4O4L A;  1Q43 A;  2B9Z A;  2QR4 A;  3I56 V;  3ZRV A;  4UB6 Z;  5JQG B;  3TXQ A;  1F23 A;  1GN6 A;  1FXH A;  5K1X A;  3BVO A;  4J80 A;  3UT5 A;  1N34 O;  4ZKI A;  3T1Y B;  3B77 A;  4B3T B;  1TVK B;  1GRJ A;  3G6B A;  2CK3 G;  2UUC B;  3ZHS A;  4IIJ A;  4B08 A;  2DWE C;  2PTM A;  1TUB B;  3K0D A;  1S3J A;  2ZM6 B;  2XAH A;  5B1A C;  1YVW A;  2CGO A;  1QHT A;  2QM8 A;  1EZV H;  5BMV A;  5EYP B;  4E4E A;  4UXN A;  4MTG A;  4BAY A;  4UCR A;  2EZP A;  2YXL A;  2ZDI A;  3EFF K;  4X20 B;  5LGT A;  2KSD A;  4G2K A;  1PV0 A;  1GN4 A;  1PNM A;  2A06 H;  4JI3 O;  2DWD C;  3F5T A;  4H13 B;  2X6C A;  3J81 N;  1AIL A;  1EFR G;  1FXK B;  5GON A;  5CB4 A;  1BS3 A;  4P2Z A;  3OMA B;  2QWQ B;  3HKD B;  4LH6 A;  4DR6 O;  2F66 C;  2Q7G A;  3FKS G;  1TA8 A;  4EFB A;  1UFI A;  4MVU A;  2RQ6 A;  3MDS A;  2A0L A;  4I55 B;  1K8A W;  4X8A A;  1JMK C;  3RWR D;  1VQK V;  4QE7 A;  5LMU O;  2VQF B;  2AZ0 A;  3WB0 A;  4FLX A;  1AI6 A;  3A2F A;  2NNU A;  5LMN O;  1TUB A;  5EC1 C;  2CTQ A;  5IY5 B;  4DV4 B;  1AR4 A;  3K57 A;  4U7O A;  4B7E A;  2QEX V;  4UB8 Z;  2ZDI C;  5CA0 B;  3OR6 C;  3Q4H A;  4YHH B;  3FB8 C;  1CPY A;  2RNB A;  4I7Z B;  5FNV A;  4RQF A;  3CX5 F;  3K03 A;  2UXB O;  1Y76 B;  4DR5 B;  2Q9L A;  4UCO A;  3K04 A;  1I5Y A;  4FLV A;  3SPJ A;  3DXR A;  2DYS C;  1LUV A;  1THZ A;  2Q5Z A;  3JCZ A;  5C93 A;  5LHI A;  2MK3 A;  4UV8 A;  4LF4 B;  4DR1 B;  4DUY O;  2R72 A;  1M57 C;  2JGU A;  5CA3 A;  4ICG A;  4AI8 A;  1FPO A;  4J9Z B;  1YDX A;  1YF2 A;  4GX0 A;  2FYU H;  5CBH A;  1IBL B;  3OGC C;  3JAR B;  4C7U A;  3U10 A;  1QR9 A;  3H01 A;  2Y4T A;  5CA1 B;  1B3Q A;  3UM7 A;  2EJ7 A;  1YI2 V;  4CS4 A;  5EYP A;  1KYO F;  2NLJ C;  1QLE C;  2ZQM A;  1EM1 A;  3CCV V;  1BQZ A;  3OUS A;  4U3J A;  3OD4 A;  5LYJ B;  3JSL A;  1URF A;  4DUZ B;  3TK1 A;  1OCC C;  3ZCC A;  2G38 A;  2AGA A;  2HJD A;  1WLE A;  1JOY A;  3A0H Z;  4F4L A;  3QG5 A;  1Q6I A;  4UVA A;  3LUT B;  3M8A A;  3C90 A;  5HFM A;  3SYQ A;  5CA1 A;  5EC2 C;  3K5O A;  1OCZ B;  3E83 A;  1MNG A;  3T1H O;  3IC7 A;  4GX2 A;  2YUA A;  1HNZ B;  3ASO C;  5HFL A;  5AG2 A;  1PP9 H;  2P22 C;  3CWB H;  1FJG B;  2A9H A;  5A2Q N;  3O9O A;  5KMG B;  4DV6 B;  3ETD A;  5IE9 A;  1AJQ A;  3JAL B;  4W4K A;  4X1K B;  3JAT A;  1LNQ A;  4N23 A;  4DV4 O;  3L70 H;  4MTF A;  5JWP A;  3K5M A;  4CH3 A;  2PYL A;  1K7D A;  4RUE A;  1SES A;  4DW0 A;  4YY3 O;  4JZ2 A;  3E89 A;  1M90 W;  4BWA A;  4J41 A;  2JGD A;  5JCO A;  2B5U A;  2GDS A;  2Q68 A;  3ASN B;  2CUG A;  4F6E A;  1MSW D;  1H2N A;  1ZSP A;  3OM3 B;  5B3S C;  1I08 A;  1JA8 A;  2DYS B;  1NQT A;  4H33 A;  3JAT B;  1FAF A;  3THO A;  2GUZ A;  4LF4 O;  2F23 A;  5B1B C;  2QGN A;  2LW1 A;  2VWK A;  3GWO A;  3R66 A;  5FLX N;  1N36 O;  4PDR A;  1VQ6 V;  4QPK A;  1R3L C;  1PM9 A;  4Q6G A;  1P7B A;  2FB5 A;  3VQV A;  4JI7 O;  3G6E V;  2Z0A A;  4X1I B;  3SJC C;  2F1M A;  1XHX A;  3F5W C;  2Q0A A;  1JVM A;  3LNM B;  1S77 D;  5E1A C;  3ZN0 A;  1XQ8 A;  1YHQ V;  3JD4 A;  2P67 A;  4DV3 O;  3K5N A;  2F95 B;  4MT8 A;  1ZL8 B;  3AK3 A;  1W0J G;  3L73 H;  4RUF A;  4DV1 B;  4WFH A;  4FLU A;  3ZHR A;  3T1C A;  1M5I A;  3RYF B;  1SA0 B;  3CSX A;  1B06 A;  4ZHQ B;  4JI1 B;  2E76 B;  4LBE C;  2DN9 A;  5JCO C;  2QWN B;  1AB3 A;  3CCL V;  4GT1 A;  3AG2 C;  2EIN B;  3E2E A;  3FAV A;  5L3E A;  4I55 A;  4JYB A;  1Q7Y W;  3HKC A;  4YHH O;  3CC2 V;  4X66 B;  5L3G A;  1ZX3 A;  3GWK C;  1DGS A;  2H94 A;  2HKO A;  4JI7 B;  3SGI A;  1KMI Z;  5IT9 N;  1VQ7 V;  1ZWI C;  5EK0 A;  1EBO A;  4FK5 C;  4X64 O;  3BY6 A;  2LFR A;  1XHZ A;  2WLH A;  2L6L A;  4X1Y A;  3ZMV A;  3FX7 A;  1Z5W A;  2EIM C;  3CME V;  2WAM A;  1Z5V A;  3T2M A;  5D5Q A;  5IY5 C;  1WNS A;  4DR1 O;  4IHJ B;  3QO8 A;  2YIC A;  4FVM A;  2PGG A;  4XDL A;  2DYR C;  4DR2 O;  2QKA A;  4QE9 A;  4JYA O;  5GON B;  1YJN V;  2Q67 A;  5LBQ A;  4FLZ A;  4LP8 A;  1K4C C;  2ZM6 O;  2ITC C;  3ML0 A;  1QVG U;  2K1E A;  4DR7 B;  1QR8 A;  1WP7 A;  4J42 A;  1NKD A;  4PDL A;  3H9V A;  4AHC A;  3E22 A;  4J7K A;  3KCX A;  4LCU C;  2GUZ B;  2EIL C;  3K0G A;  3VQW A;  2FML A;  1UPG A;  4X9Q A;  4YXW G;  4I9Q A;  1XRE A;  2NN4 A;  3B4S A;  1SQP H;  3BPZ A;  3ZMZ A;  3AG4 B;  1K92 A;  3H1H H;  4CS3 A;  4UCT A;  4G27 B;  1JPX A;  1NZ6 A;  5IYD O;  4DV0 B;  3DGE A;  4NXN O;  1CXZ B;  1YXB A;  4DK0 A;  5LA6 B;  3LDE A;  2YIB A;  4OX9 B;  1HNW B;  4OXS A;  2Y69 C;  4UUJ C;  1V55 B;  1BCC H;  2Q0O C;  2LO1 A;  1EN4 A;  3SPH A;  2VQF O;  2R70 A;  2UUA B;  2B1I A;  3RGB A;  2XAF A;  1KP3 A;  4PA9 A;  4GKK O;  2ZIO A;  2IH3 C;  3ZN1 A;  2IU3 A;  4TQD A;  3TET A;  4DRX B;  1VF5 B;  2XAS A;  5KHH A;  1H2M A;  1E1Q G;  4UVC A;  4LH7 A;  5KA5 A;  4QJF B;  2C2A A;  4G28 B;  3ETE A;  3N2K A;  2JRI A;  1GH6 A;  4PA3 A;  5ITZ B;  2ZE8 A;  4NVP A;  3C3S A;  3H1K H;  1OV9 A;  2D3O W;  3JAW A;  2UXB B;  4LR3 A;  2CH7 A;  4DR5 O;  4J7J A;  3RVY A;  4Z2W A;  3ZIA G;  4AQY B;  1ZAU A;  4I50 A;  1NTK H;  1UJW B;  2CGN A;  5IYC O;  2XTA A;  3FYE B;  2DYR B;  5EIB D;  4YJ3 B;  2EIJ C;  2X6B A;  1COW G;  4LF7 O;  2UXD O;  1S5H C;  4HNA B;  1YIT V;  3JD3 A;  2LFS A;  4MVO A;  3G67 A;  1XUQ A;  1QNM A;  3ABK C;  3A0B Z;  3AG2 B;  2HLD G;  1QLN A;  3B09 A; 
#chains in the Genus database with same CATH homology
 1AB3 A;  4DV4 O;  1D2D A;  3SDL A;  4B3R O;  4LFA O;  4NXN O;  4YY3 O;  3J7A U;  5LL6 Y;  5BR8 O;  4KHP O;  4YHH O;  5BXZ A;  4GKJ O;  4DUY O;  4LFB O;  2UUC O;  2VQE O;  4DV7 O;  1YZB A;  2HHH O;  2ZKO A;  3O65 A;  1R1B A;  4JI3 O;  3F5T A;  2VQF O;  5IT9 N;  3J81 N;  1AIL A;  4X64 O;  1J5E O;  1DK1 A;  4DR7 O;  1NS1 A;  1FYJ A;  2UUB O;  4GKK O;  1HNX O;  4DV0 O;  4AQY O;  1I94 O;  2F4V O;  2E5L O;  4DR6 O;  4B3S O;  4LF4 O;  5IWA O;  4B3M O;  1HR0 O;  1N32 O;  4DR1 O;  1A32 A;  3J80 N;  2LW7 A;  1XNQ O;  1N33 O;  4X66 O;  1HNW O;  1HNZ O;  3T1Y O;  3R66 A;  5FLX N;  1N36 O;  4B3T O;  1XNR O;  4DR2 O;  4JI8 O;  4DV1 O;  2JRI A;  4JYA O;  5LMU O;  1IBL O;  4JI7 O;  1FJG O;  2AGA A;  2Z0A A;  1G1X B;  4JV5 O;  3JAM N;  4DV2 O;  4LF8 O;  1XEQ A;  4X62 O;  4DV6 O;  3OTO O;  1R6T A;  2ZM6 O;  4DR3 O;  4OPA A;  5LMN O;  4JI5 O;  1KUQ A;  1IBK O;  1IBM O;  4LF5 O;  4JI1 O;  4NXM O;  3M8A A;  4DV5 O;  4DR5 O;  2FKX A;  2UXC O;  4K0K O;  1XMO O;  1F7Y A;  5BY1 A;  3RT3 C;  3T1H O;  4JI6 O;  4DV3 O;  4LF6 O;  4LFC O;  4X65 O;  1N34 O;  2DOS A;  1X59 A;  4OX9 O;  4LF9 O;  4LF7 O;  2UXD O;  4DUZ O;  1FKA O;  4JI4 O;  4OPH A;  5A2Q N;  2N74 A;  4JI0 O;  4JI2 O;  1XMQ O;  2UUA O;  2DJV A;  2UU9 O;  2UXB O;  4DR4 O;  4A5U B;  5H5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...