1F7YA

The crystal structure of two uucg loops highlights the role played by 2'-hydroxyl groups in its unusual stability
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
PITKEEKQKVMQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRMLIEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA FRAGMENT
publication title The crystal structure of UUCG tetraloop.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 17
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2000-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1f7yA00
1XNQO 4LFCO 4JI5O 4DUZO 4DR5O 1A32A 4LFAO 4DV2O 4DV7O 1XMOO 2HHHO 4KHPO 3SDLA 2DJVA 3R66A 3OTOO 1FJGO 1YZBA 2AGAA 4JV5O 4LF5O 4DV1O 2E5LO 2FKXA 2UXBO 1HR0O 2UUCO 4OPHA 4DR3O 1XEQA 4JI7O 2VQEO 4X64O 4DR1O 4NXMO 1IBKO 1KUQA 1FKAO 1AB3A 5A2QN 4DV6O 5H5NA 2UU9O 4X62O 1N34O 1R1BA 2Z0AA 4YHHO 3JAMN 5LL6Y 4B3TO 2DOSA 1D2DA 4YY3O 1HNZO 3J7AU 1J5EO 4DV5O 4DR6O 4GKJO 5BXZA 4B3SO 2UUBO 4K0KO 2ZKOA 2UXCO 1G1XB 4JYAO 1AILA 3T1YO 1N32O 4DV4O 4OX9O 1N36O 4NXNO 3J81N 4DV3O 2ZM6O 4GKKO 1IBMO 4DR2O 1R6TA 5IT9N 4JI4O 5FLXN 5IWAO 4DR4O 4DUYO 3RT3C 4B3RO 3M8AA 2LW7A 4OPAA 1HNWO 4LF6O 3F5TA 1X59A 2N74A 1NS1A 1XNRO 5LMUO 1XMQO 4DR7O 4X66O 4JI8O 1IBLO 2JRIA 4A5UB 5BR8O 1HNXO 3J80N 4JI1O 2UUAO 4LF7O 4JI0O 2F4VO 1FYJA 4B3MO 3O65A 4LF8O 4JI2O 5LMNO 4LF9O 4X65O 4LFBO 2UXDO 3T1HO 2VQFO 1I94O 4DV0O 5BY1A 4JI6O 1F7YA 4LF4O 4AQYO 4JI3O 1DK1A 1N33O
chains in the Genus database with same CATH superfamily
3ETQA 5LP6C 1S5HC 4P2ZA 4EB6A 1AJPA 3N27A 3AEIA 3BA9A 3BHPA 3L75H 3NXSA 2EIJC 5JQGB 3M7MX 4I7ZB 3I56V 4YY3B 5CA0B 5LBQA 4X64O 1S5LZ 4I0XB 4R8CA 2E5LB 4PI2A 2CTWA 2ZIMA 2YC0A 1Q6UA 1FPOA 2F43G 1EN4A 2DWEC 3OUSA 2R9IA 3OT7A 4JI7B 3ZHRA 1NR7A 2LQTA 4NKGB 4U3JA 4D7TA 3HKBA 4HZ3A 4JASA 3W7WA 1TA8A 2QWQB 3RWRD 4JYAO 3FB5C 3JAWA 3ABTA 1S3JA 5B5EZ 5CA1B 4NXNO 3AG4C 4K0KB 5FLXN 3IFXA 1JMKC 4TQDA 5KUMA 4H44B 3RT3C 5GONB 4LF6O 1IBMB 1R3JC 3R65A 4UXNA 5LMUO 1AI6A 3DTUB 3AG3C 4UCSA 2R72A 5L3EA 4ZKIA 4O4LB 1XL4A 4B08A 5IE9A 3IGAC 3SJCC 3TXQA 4B3MO 2EIKC 1ENVA 2XASA 2EZPA 2QTOA 1YJ9V 2XT9A 1QQCA 4FM2A 3RYFB 4JAVA 4I50A 5LOVA 4MSWC 3FFQA 4FK5C 1KMIZ 2P4KA 3UT5B 4DV2O 4JI6B 2AXTZ 1LNQA 4LF4B 3LDEA 2UXXA 1BL8A 5CN0A 1XNQB 2KSDA 4TWKA 5FL7G 1QU7A 4RO2A 2HFEC 1FD9A 3ETGA 1XEQA 1BHAA 3C3TA 2JK5C 4DR1O 3B4SA 4CH4A 5A2QN 4FLYA 3ABLC 2BSKB 1N34O 3OM3B 2Z0AA 4GX1A 3QO8A 1VQPV 3STLC 4J41A 1SQFA 3OR6C 4TV9B 5BXZA 2CTRA 2ZNIA 1L1FA 3OMIB 5J9PC 2ZKOA 4YHHB 3HKCB 1WP7A 3J81N 5IDJA 2P5OA 3SPIA 1GK9A 4J7ZA 4GKKO 1PV0A 2RJZA 3W7TA 5TISZ 1IDSA 1CXZB 4FVMA 5IYZB 4OX9B 2O57A 3WB2A 4WFAV 3M8AA 5KAFZ 2ZM6B 1US6A 1P4RA 4KFMA 4I9QA 4C7UA 4DUYB 1TUBB 1H2KA 4TUYB 4X66O 3X2QB 1MZFA 2OIGA 3H1IH 1SQVH 1MMMA 1T5EA 1AP6A 1AVMA 1R3IC 1M93A 4NTYA 5FNVB 3IJ4A 1ZSPA 4LNUB 4LH6A 1NTMH 3CCMV 2AW9A 1PD3A 4FLWA 5B1AC 3JASB 4GZRB 1FFXA 2WPDG 5BY1A 1F7YA 1IZ3A 3B40A 4FFBB 2ITCC 3K59A 3OFNG 2ZINA 4GX5A 1R3KC 3TXSA 2QE7G 2LGQA 5JJNB 2F93B 4CC6A 4I4TB 3VQWA 4PDVA 4RQFA 5EYPA 4DR5B 2WLIA 5LGUA 2QEXV 4N21A 1KKDA 3M99B 1YSCA 4IGGA 2YDEA 4YJ2A 4IHJA 1XL6A 1GN6A 3B2EE 2IW5A 5B1NA 1MNGA 1B3QA 4J9ZB 3RGBA 2PI5A 1NTZH 1JOYA 2Q8VA 3KKYA 3ZCCA 1J5EO 2Y4TA 4MVSA 4B3SO 4HAMA 2R70A 3LSSA 3MHSC 1RSOA 4JYBA 1HNWB 1H38A 1PKXA 4DR6B 2FYUH 1B6QA 3CCVV 1R6TA 2QWPB 3T1CA 3TCUA 1OCCB 3F7YC 5LGNA 2B9ZA 2FB5A 4YIOA 3GVMA 3E2EA 4DV4B 4O4JA 3FYEB 2LW7A 4IYIA 5EK0A 1JCHA 3O9OA 3D3QA 1GO3F 4MTXA 1XMQO 4DR7O 4TV8B 3MAQA 1H2SB 3B8NA 4G2KA 5KUKA 1F23A 3OMNB 1SKVA 1XUQA 2ITDC 2E76B 1SS3A 4JI1B 5LMNO 3OEEG 2QKCA 2WSSG 1W0JG 4UVAA 2W0FC 1W2BU 2AZ0A 4WFFA 3S3WA 4I55A 3JCUZ 1GAXA 2P67A 3IC7A 3SR2C 1QLNA 2GV9A 3LDDA 1JFFA 3P32A 5CBFA 4DV0B 3JD0A 4AQYB 3CE2A 4O2BA 3HKEB 4MS2A 1RPOA 1U97A 2KB1A 2HG5C 2ZT9B 4DV7B 2UXBO 2DMXA 2LO1A 3VQYA 4GKJB 2YUAA 2ODMA 3WG7B 1W0KG 5KHIA 5KMGB 2AZ2A 5F2VO 5L3GA 1YXBA 3AG2C 2BOBC 1H2GA 2Z5UA 3UO2A 4ZOLB 1H8EG 5IJ9B 1E79G 2DYSB 2ATKC 3JARA 2Q0AA 3RYHB 1Q6HA 2QGNA 1FXKB 1LUVA 5LA6B 1V55B 2EX3A 1P49A 1KQSU 4UV8A 1NZ6A 1HW7A 1COWG 3LNNA 1Q5OA 1K34A 5C8YA 2E75B 2XHBA 2X0LA 1IBLO 3CX5F 2EBOA 4UFZA 3EFFK 2JRIA 5IYCO 4CH6A 4FLXA 1IVSA 3SPHA 1JJOA 1OV9A 2R9RB 3E22A 1ZX3A 3A0BZ 4PA4A 1GM7A 4UVBA 3E83A 5DM6V 1NJIW 3E8HA 4PHZA 4MTGA 2UUAB 3L71H 4EB6B 3EXAA 2OTLV 1GRJA 5FPRA 4OXSA 2A9HA 1SQQH 1QCEA 4X89A 1XMOO 2PTMA 3H9VA 4HNAA 5LGTA 2VQEB 2DJVA 5EBLC 3CCSV 1Y4MA 3D36A 2QKAA 1M57B 1ZUQA 4KXRA 2CGNA 2P06A 2P6JA 5IYBO 3DSQA 2E5LO 1K97A 4J7KA 2HHHB 4FZ0A 2QM8A 1VQKV 2XAGA 1VQ6V 3VOUA 4JI7O 1BHBA 3N2KA 4U3JB 2Q7GA 1FKAO 3HKBB 4LF5B 3K3WA 3TK1A 2VWKA 3WFVA 3P3PA 2UUCB 1F51A 3ZMVA 5JWPA 3AG4B 1JVMA 2JEXA 3APOA 3JAMN 3JD1A 1Y76B 3JAWB 5B1BC 4B3TO 3K0DA 1IX9A 4H13B 2IU0A 4DV6B 1V9PA 4K0KO 4NVPA 2WAMA 2ZE5A 3T4DA 3ZN1A 2DE0X 2A0LA 2HJDA 4I9WA 2LGWA 4RAIA 1IBMO 2V1DA 1MOFA 3HPLC 4P9PA 3K03A 5L3BA 1HWYA 2OT5A 2WWWA 2EIKB 2N05A 1N0JA 1X59A 3JD2A 3BA8A 1RM1B 3QG5A 1BQ0A 5IWAB 4F6EA 3ICXA 5CBGA 1FS0G 1SRYA 4I50B 1EFRG 4CC5A 4QIWF 1DTOA 3OE7G 3RVYA 5LOVB 2YXHA 2E3CA 3AK1A 5ITZA 2Q9LA 4WFGA 2A7WA 4MVMA 1UPGA 1XQ8A 5JCOC 3OEHG 2ZDIA 2XOKG 4U7OA 4JI6O 3RVZA 4LF8B 1FXKC 3E8GA 4LF4O 5EBWC 1V55C 4TT3G 4BIZA 2QTSA 4X65B 1XNQO 2BTOA 4R50A 4X88A 2XAHA 2GTSA 3LSQA 3N2GB 1FAFA 1H2MA 1YZBA 2ZE6A 4DRXA 3IAYA 2H94A 2CTQA 1K5QA 2ZCEA 3W7SA 3HR0A 3ZHVA 5CA3A 2UXNA 2PY5A 3VBBA 3VQVA 4YHHO 2YXLA 2CH7B 4ASUG 3WU2Z 1IBKB 3J7AU 4JTDB 4UCVA 1OZ0A 5E79Z 2AHYA 3AK3A 4OX9O 1G4YB 1M9NA 1VIBA 1Y6XA 4X1YA 4DV5B 4YJ3A 2ZM6O 1FXHA 1PNMA 4UUJC 3CSXA 3T1YB 4K35A 4DUYO 2JJ1G 1M57C 1M5IA 4JI4B 5H6RA 4Z1MG 5B1AB 2Q5ZA 3HKDA 3CS5A 2B5UA 4JZGA 3ZEDA 2C2AA 1AROP 3BPZA 2YI8A 1AJQA 3ZRVA 4BIUA 1PL4A 3KCXA 3L70H 1VARA 2M7WA 2OCCB 2A3QA 2F66C 2IM9A 3K58A 1YHQV 2BE3A 1GN2A 3CC7V 4FFKA 2JGDA 2P90A 5KHJA 2OYQA 5D5QA 5EYPB 3T1HB 2HEPA 2VQFB 2WLIB 5L3FA 4F6RB 4X20A 2FTKA 1M4UA 4DR5O 4OGQB 3JATA 1E1RG 4YJ2B 4IHJB 1EN6A 1RM1C 2V7QG 2CUGA 1D5AA 2EZOA 3CMEV 1M56B 1ZAUA 4JV5B 2Q0OC 2H3OA 4X1KA 3G71V 1HR0B 5FPOA 1RSOB 1F4MA 5KHKA 1PP9H 2H8PC 3ZHSA 2EIMC 1QLEC 3ZN0A 4NXMB 5DECA 4DR6O 4GCZA 5KX5A 1BE3H 4O4HA 3K5MA 1XHZA 4O4JB 1EN5A 3NR7A 4DV4O 2X7RB 2Q4PA 2WLJA 1VEWA 1ZTEA 2UUBB 1B06A 1WNSA 3AK2A 2UXCB 2G38A 4UV9A 1ZL8B 3L72H 1KP2A 4B3RO 4GX2A 4R6ZA 4ZBMA 5B1OA 3H1HH 1NBMG 3HB3B 4JTAB 2E74B 3CJHA 5LYJA 2OWOA 3QNEA 3ZRWA 3FD9A 1YITV 1LR1A 3K9AA 4JI1O 3RYCA 2KG7A 2P22C 2ZR3A 1R3LC 1IURA 2QSAA 1SESA 1KKCA 3OW2U 1YJWV 4I55B 4ZI7A 1BT8A 4IIJA 2ZR2A 4QGPA 1JFFB 3C3SA 1Y66A 1VQOV 4DV0O 5KHHA 3QTCA 4UB6Z 4O2BB 4X8AA 4AQYO 4GX0A 4LFBB 2Q7HA 4H0LB 3EHBB 5JQGA 3CP1A 3ZHUA 2KKWA 1K4DC 4DV7O 3U10A 2WA3A 3SDLA 1QR9A 1XHXA 1KYOF 3H1LH 3AG2B 2RN9A 3A0HZ 4LFAB 2NN4A 3G80A 2N04A 4KHPB 1H8HG 1WA8B 3S3XA 4NTWA 3SPGA 1YI2V 4AILC 3U0ZA 2IBZH 2CAZC 3E35A 3K79A 4TOIA 4D6TH 4DV1B 4GUNA 4ZIBA 2OCCC 2QKSA 3JARB 1WAZA 4DR3B 5CB4A 2YEVA 1MZEA 2LW1A 2LJ2A 3FAVA 1GN4A 1SZXA 4UVCA 2UU9B 1QVGU 1NTKH 3KG2A 4UCOA 1WPXA 3SYQA 3JAKA 4ABMA 5GONA 3AG7A 1Q90D 4NTXA 1SERA 5C8YB 4E4EA 4CS2A 4B7EA 3F5WC 4JTCB 3UO3A 1S5JA 2JS5A 3TJTA 3OMAB 3ZBHA 1I5YA 2JDIG 4MT8A 5L3DA 3E22B 4DO2A 1G6UA 1NI8A 1M56C 1NS1A 4IT5A 4F4LA 1W59A 2IH3C 4O4IB 1URFA 5K1PA 1TUEB 1WPBA 1K73W 5LXTB 4RQEA 1U96A 3K0GA 4J42A 5IY5C 2UUAO 1BZKA 4X1IA 5E1AC 1VQNV 4XDKA 4FIPC 1WP8A 4JI8B 1FYJA 1L0LH 2ADQB 4MTOA 4B7KA 5KA6A 1JR9A 3BCCH 3CCEV 3MD0A 3ASOC 4HNAB 5L3CA 2FMLA 2YS8A 3ASNC 2WLHA 2Y4UA 4TQFA 3APQA 1KU9A 4CH5A 2DYRB 3E89A 2RMKB 1A32A 1YF2A 1YJNV 1H2NA 2HHHO 1X4TA 4WBNA 4L8JA 4J80A 4QE7A 3N2KB 5B1BB 5J2TA 4LF5O 2F23A 1I5XA 2FKXA 2UUCO 1Z5VA 3FB8C 2DWDC 4IYHA 3OTOB 1MSDA 2DW4A 2WLLB 4DV6O 2ZIOA 5H5NA 2HR3A 3B77A 4JPRA 5IYDO 2DOSA 1OJHA 5JJEB 2NNUA 3GWKC 3ABUA 4X62B 5IYZA 1M1KW 1KD1W 1D5NA 1SQXH 2JJ2G 4WFBV 1PL0A 1R6KA 5IT9N 3CCUV 3LDCA 3SYPA 5D5PA 5IWAO 3GWOA 3E8BA 1N32B 4L87A 4TUYA 5JH7A 2GDSA 2QM7A 2BCCH 3LNMB 1VP7A 3ZS8C 5BMVA 4DR2B 4YIPA 2WA4A 3CCRV 4NB5A 3ABKB 2LP7A 1TAEA 3TGUH 2B1GA 5CMUA 2XAQA 2HJFC 3IC9A 3WB1A 2EILB 4BAYA 4LF8O 3A2FA 4JI2O 4DK1A 4JI0B 2F4VB 4X65O 1WB8A 1IXBA 4KL1A 5EIBD 3T4ZA 5EIBC 3ZRXA 4I4TA 2DN9A 4QNHB 2YXYA 1VQ7V 2Q7EA 2F95B 1I94B 3DC5A 3H01A 4FMTA 4FLUA 2ZE8A 3BAAA 4LFCB 4DUZB 2BTQA 4QJFB 4GT1A 2GTAA 5EC2C 3DXRA 1S0VA 3F7VC 4HBNA 2GBOA 1OCOC 1L8DA 2P7TC 1IBKO 1KUQA 2X6BA 1AI7A 2MW2B 3BFRA 4X1YB 4YJ3B 3ZMSA 4YY3O 4DV5O 3K08A 1K3EA 1Y74A 3D3IA 4RWUA 4TSFG 1G1XB 3DC6A 3ZHQA 3T1YO 3D36C 1SQBH 1HNZB 2DYRC 3TETA 1RFYA 2K1EA 4JI4O 2YIBA 1GMGA 1VF6A 2YIBD 2PI4A 3HKDB 3ETDA 4MVQA 1OCRC 4DV3B 3SJAC 3W7XA 3CMAV 2Y69C 3G6BA 1CEZA 2QJ1A 4DR4B 3CRCA 3SPCA 4KP4A 3CCQV 3D8CA 2AHZA 4FJCC 1Q8IA 5JVDA 1R73A 3G4SV 2XNDG 4WF9V 3QVNA 2JGDB 2RNBA 3SYCA 1JJ2U 2X6AA 3O65A 2B1IA 4K8ZA 4LF7B 2IH1C 4X20B 3BY6A 3T1HO 1SF9A 2VQFO 1BS3A 3RFRA 1I7FA 1VQLV 3JATB 3SPJA 2PGGA 1R6NA 4LF9B 1AP5A 2IJIA 4RUEA 2Y0PA 2IJHA 2QM4A 2Y0IA 3STZC 1EZVH 3JD3A 1Q3EA 2F1MA 5H6QA 1AR4A 1O9HA 1K9MW 2EIMB 1QLEB 4JV5O 4X1KB 4MW3A 3ABKC 5KMGA 2LFSA 1HR0O 4JZ2A 3K9SA 4W4LA 2JS3A 1FJGB 3K57A 4NXMO 5KX5B 4O4HB 2ZDIC 1J95A 4J11A 4LWSA 3JALA 2EILC 4LP8A 4PDRA 3CRQA 1XBLA 1VQ9V 2CE4A 2OIEA 5EZYA 1BGYH 1QBZA 3H1KH 5LA6A 2UUBO 4PDMA 4ZHQA 2UXCO 1CPYA 5DN6G 1EM1A 3E8FA 3FKSG 3ZRSA 3G67A 3W7UA 3CJHB 1PPJH 1N8RW 5LYJB 1DF4A 5A9GA 3ZRWB 2DQ3A 3JD4A 3RYCB 2KG7B 2GUZA 2L6LA 3L73H 1NVPD 2QDOA 1VF7A 5LP6A 2NR5A 1QNMA 4Q20A 3RBZA 4A5UB 2ILMA 4ZI7B 5LHGA 3K5OA 4IIJB 4LBEC 4DW1A 3U11A 1Y67A 1UJWB 2HP8A 3QO7A 3OGIB 1GM9A 1E1QG 4CZZA 4JYYA 3BRCA 1DGSA 4HYOA 4PA6A 4LFBO 4BWAA 1XMOB 3K5LA 1Q82W 1AI4A 2ADPA 1MSWD 2A79B 4DYLA 3CC4V 1SC5B 1DK1A 2UXDB 4FM1A 1WJZA 1HP8A 2R9AA 1S76D 1WLEA 3CRRA 1FFXB 3B09A 4LFAO 5KHGA 1NH2D 4CS3A 4KHPO 2YIAA 1VQ5V 2RDCA 3CPWU 4H37A 4PV1B 2QWOB 4JI5B 4CBCA 1YTFD 4DV1O 1SQGA 4Q6GA 4B3TB 5CB4B 2YEVB 1Y76A 4OPHA 4FLZA 3A0RA 4DR3O 3FAVB 1BQZA 1RP3B 2L35A 4NYKA 2X6CA 2UU9O 5IJ0A 1R1BA 3I5DA 4O2AA 3JAKB 2WLKA 5LL6Y 3UM7A 3CC2V 1Z2GA 3I55V 2Z3YA 1VF5B 3CYOA 2WLNA 1DLBA 1N4CA 1PM9A 1SA0A 4WCEV 3BEHA 2BOCC 1L0NH 5IY5B 1KB9F 3Q4HA 5J2UA 3VQXA 1P7BA 2JEUA 5B3SB 1HNWO 4X1IB 3RW0A 2PZSA 4FZ1A 2XUMA 2DQ0A 5H2FZ 1VQ4V 3K06A 3FYIB 1QR8A 4JI8O 1TVKA 1GM8A 4WFEA 4EFBA 3THOA 3JCZA 3ASOB 2ZNJA 3ASNB 4PA7A 2A06H 5GTHZ 1XNRB 1MA1A 3RYIA 1AI5A 3QF7A 2JGUA 5BR8B 1HNXB 1MG1A 3FB6C 1JX9A 4MTFA 4P9OA 2QA4V 1K33A 1XDCA 2PYJA 1KBHA 2LFRA 4WBNB 4UCTA 2Y48A 1WN7A 2PYLA 3N2GA 1M90W 1QVFU 1MABG 2PUSA 5J2TB 3OTFA 3OGCC 1K5SA 4JI3B 3CXHF 1N36B 1N33B 1V54C 3ABMC 3R66A 1JPXA 3OTOO 3KZIZ 3CCLV 3JSLA 1ZWIC 5DEDA 1EBOA 2CH7A 1P84F 2K9PA 1Q6IA 1K92A 4WFHA 1AB3A 2QWRB 1F4NA 4X62O 2JIZG 4QPJA 3L74H 1NU1H 5CA0A 4X64B 4GKJO 4I0XA 5JJJB 4JGSA 4DXWA 4PD4F 5JH7B 1N32O 2ZE7A 2Q68A 1Q86W 5BMVB 2XAJA 3RN4A 4DR2O 3CCJV 5EC1C 5KAIZ 4JYAB 4NXNB 2CDYA 4J7JA 5CA1A 1VQ8V 3CD6V 3DGEA 1QHTA 3ZX6A 1EZJA 4K8XA 4JAUA 4R7CA 2NLJC 4LF6B 1S72V 1SZTA 3J80N 1XREA 4JI0O 2F4VO 4BR6A 3P30A 5LMUB 1RPRA 4UB8Z 1XOUA 3CHXA 1OCZB 4O4LA 4F6RA 4ICGA 3G6EV 1ORQC 1I94O 4B3MB 2VWJA 4LFCO 5LHIA 4DUZO 4NR1A 2BTQB 4XDLA 2Q6AA 2W0XA 4J9YB 3RYFA 1OCOB 1ZLZA 5B3SC 3DXRB 2CTPA 4LR3A 1WB7A 4EKWA 4JAAA 1CP9A 4N23A 3C90A 4DV2B 2YI9A 3PN1A 3UT5A 5HFLA 1LUWA 3L9DA 2VRZA 5BZBA 2VQEO 1G8MA 1Y74B 3JYCA 4XBFA 1Q7YW 2QR4A 2HVJC 1PNKA 3SJBC 1HDJA 4DR1B 1HNZO 4JYCA 4EFEA 2RQ6A 4BW9A 1GH6A 1IXMA 1OCRB 4GLXA 1N34B 1XILA 1AJNA 3WB0A 2BSKA 2EINB 2ZXWB 1AILA 1ZL8A 2HKOA 2Y69B 2D2CB 4JF3A 4B3RB 4H33A 4X9QA 1JQ0A 2Q73A 4G27B 3ZHTA 4DV3O 1KP3A 3H1JH 1NR1A 1YCIA 4TV9A 5LHHA 4DK0A 3PJSK 4DR4O 3HKCA 1SETA 3MDSA 5JVDB 4GKKB 4LC1A 4PDLA 3P3NA 3AG1B 3OR7C 1GTOA 1S77D 3K5NA 4GYCB 1GKFA 4LF7O 1NQTA 2IJKA 3EVKA 4X66B 2CK3G 1TUBA 3BVOA 3ZMTA 4UCRA 4LF9O 1Q43A 3UKMA 3X2QC 4AI8A 2MK3A 2OCHA 4QE9A 5FNVA 4Z1VA 2WLMA 4LNUA 1O9GA 3SYOA 4LH7A 5ITZB 2Q67A 3JASA 1VQMV 4XDJA 4PA9A 3OUFA 2W6IG 1WA8A 1AR1B 1I0HA 2YSUB 2M6YA 4FFBA 1FJGO 1BMFG 1BCCH 4LWSB 2EJRA 3JALB 1YIJV 3BABA 3MHHC 4MVZA 3ETEA 5EZYB 4MVUA 2FL4A 4PI0A 4DRXB 3GB7C 3UCSC 4ZHQB 1NKDA 2EULA 3FB7C 2JVDA 1N0NA 1OCZC 5AG2A 2ZQMA 2ARHA 1UFIA 3K04A 4MVOA 2XAFA 3ML0A 1ROPA 4EEQA 4DW0A 2P4VA 5K1XA 1Q81W 2XTAA 1J5EB 5EBMC 1NVPB 4B3SB 4KUMA 2V4DA 2GUZB 2IU3A 1AR5A 3LSUA 4O4IA 5LP6B 1P7GA 1K4CC 4PA3A 5LXTA 1K8AW 1Z5WA 1NT2B 3ZJZA 2HVKC 3F5TA 4J10A 3CXCU 1B04A 2N74A 1H2LA 2EIJB 4CS4A 3SYAA 4E2LA 3OD4A 4AHCA 4U3FH 1XI1A 5KLVH 1OCCC 2Q69A 3UQ8A 4FM0A 4PELA 1BSMA 1XMQB 4DR7B 3CB2A 3ZIAG 1SQPH 2IJJA 3A8TA 5CBHA 1DF5A 4TV8A 3ZMUA 4FPPA 3KCYA 5C93A 1VF6C 2UXDO 1NH2B 2CGOA 4BIOA 2YICA 1YVWA 2EINC 2ZXWC 3B8MA 2YIDA 2GHYA 1YTFB 5LMNB 1TGOA 3FX7A 3JSNA 4JI5O 5HFMA 1OHHG 4U7NA 1THZA 1KECA 1JA8A 1YDXA 3QO5A 4D7SA 2ZD9A 4K3AA 2WLLA 3AG1C 3SGIA 2AGAA 5IJ0B 3CEIA 1K7DA 4O2AB 3SJQC 5H9CA 3CRAA 3AG3B 3HKEA 4QPKA 2UXBB 1I08A 5GW7A 4FLTA 1YEWA 2QWNB 2KQXA 1D2DA 2ETNA 1SA0B 4IL6Z 3Q4HB 3LUTB 4W4KA 5J2UB 3WG7C 1FXVA 2W6JG 2RCVA 4ZOLA 5IJ9A 2PF4E 2EJ7A 1TVKB 4OPAA 3RYHA 2DYSC 5JCOA 1FXKA 2HLDG 3CWBH 3ZMZA 4I5SA 3RYIB 3CRMA 4PJ0Z 2D3OW 1XNRO 1VMGA 2OTJV 4JI2B 5GTIZ 4MVRA 1FFTB 1PNLA 5BR8O 1HNXO 4CH3A 4Z2WA 2VS0A 5KA5A 4LCUC 1IBLB 3ABLB 3OAAG 2GSMB 5B66Z 4MW8A 4G28B 1V54B 3ABMB 4BW5A 1GN3A 4UCUA 1KC8W 3T2MA 4P30A 4RUFA 4YXWG 4FLVA 4JI3O 3E86A 1N36O 1N33O
chains in the Genus database with same CATH topology
1XNQO 4LFCO 4JI5O 4DUZO 4DR5O 1A32A 4LFAO 4DV2O 4DV7O 1XMOO 2HHHO 4KHPO 3SDLA 2DJVA 3R66A 3OTOO 1FJGO 1YZBA 2AGAA 4JV5O 4LF5O 4DV1O 2E5LO 2FKXA 2UXBO 1HR0O 2UUCO 4OPHA 4DR3O 1XEQA 4JI7O 2VQEO 4X64O 4DR1O 4NXMO 1IBKO 1KUQA 1FKAO 1AB3A 5A2QN 4DV6O 5H5NA 2UU9O 4X62O 1N34O 1R1BA 2Z0AA 4YHHO 3JAMN 5LL6Y 4B3TO 2DOSA 1D2DA 4YY3O 1HNZO 3J7AU 1J5EO 4DV5O 4DR6O 4GKJO 5BXZA 4B3SO 2UUBO 4K0KO 2ZKOA 2UXCO 1G1XB 4JYAO 1AILA 3T1YO 1N32O 4DV4O 4OX9O 1N36O 4NXNO 3J81N 4DV3O 2ZM6O 4GKKO 1IBMO 4DR2O 1R6TA 5IT9N 4JI4O 5FLXN 5IWAO 4DR4O 4DUYO 3RT3C 4B3RO 3M8AA 2LW7A 4OPAA 1HNWO 4LF6O 3F5TA 1X59A 2N74A 1NS1A 1XNRO 5LMUO 1XMQO 4DR7O 4X66O 4JI8O 1IBLO 2JRIA 4A5UB 5BR8O 1HNXO 3J80N 4JI1O 2UUAO 4LF7O 4JI0O 2F4VO 1FYJA 4B3MO 3O65A 4LF8O 4JI2O 5LMNO 4LF9O 4X65O 4LFBO 2UXDO 3T1HO 2VQFO 1I94O 4DV0O 5BY1A 4JI6O 1F7YA 4LF4O 4AQYO 4JI3O 1DK1A 1N33O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ O;  4LFC O;  4JI5 O;  4DUZ O;  4DR5 O;  1A32 A;  4LFA O;  4DV2 O;  4DV7 O;  1XMO O;  2HHH O;  4KHP O;  3SDL A;  2DJV A;  3R66 A;  3OTO O;  1FJG O;  1YZB A;  2AGA A;  4JV5 O;  4LF5 O;  4DV1 O;  2E5L O;  2FKX A;  2UXB O;  1HR0 O;  2UUC O;  4OPH A;  4DR3 O;  1XEQ A;  4JI7 O;  2VQE O;  4X64 O;  4DR1 O;  4NXM O;  1IBK O;  1KUQ A;  1FKA O;  1AB3 A;  5A2Q N;  4DV6 O;  5H5N A;  2UU9 O;  4X62 O;  1N34 O;  1R1B A;  2Z0A A;  4YHH O;  3JAM N;  5LL6 Y;  4B3T O;  2DOS A;  1D2D A;  4YY3 O;  1HNZ O;  3J7A U;  1J5E O;  4DV5 O;  4DR6 O;  4GKJ O;  5BXZ A;  4B3S O;  2UUB O;  4K0K O;  2ZKO A;  2UXC O;  1G1X B;  4JYA O;  1AIL A;  3T1Y O;  1N32 O;  4DV4 O;  4OX9 O;  1N36 O;  4NXN O;  3J81 N;  4DV3 O;  2ZM6 O;  4GKK O;  1IBM O;  4DR2 O;  1R6T A;  5IT9 N;  4JI4 O;  5FLX N;  5IWA O;  4DR4 O;  4DUY O;  3RT3 C;  4B3R O;  3M8A A;  2LW7 A;  4OPA A;  1HNW O;  4LF6 O;  3F5T A;  1X59 A;  2N74 A;  1NS1 A;  1XNR O;  5LMU O;  1XMQ O;  4DR7 O;  4X66 O;  4JI8 O;  1IBL O;  2JRI A;  4A5U B;  5BR8 O;  1HNX O;  3J80 N;  4JI1 O;  2UUA O;  4LF7 O;  4JI0 O;  2F4V O;  1FYJ A;  4B3M O;  3O65 A;  4LF8 O;  4JI2 O;  5LMN O;  4LF9 O;  4X65 O;  4LFB O;  2UXD O;  3T1H O;  2VQF O;  1I94 O;  4DV0 O;  5BY1 A;  4JI6 O;  1F7Y A;  4LF4 O;  4AQY O;  4JI3 O;  1DK1 A;  1N33 O; 
#chains in the Genus database with same CATH topology
 3ETQ A;  5LP6 C;  1S5H C;  4P2Z A;  4EB6 A;  1AJP A;  3N27 A;  3AEI A;  3BA9 A;  3BHP A;  3L75 H;  3NXS A;  2EIJ C;  5JQG B;  3M7M X;  4I7Z B;  3I56 V;  4YY3 B;  5CA0 B;  5LBQ A;  4X64 O;  1S5L Z;  4I0X B;  4R8C A;  2E5L B;  4PI2 A;  2CTW A;  2ZIM A;  2YC0 A;  1Q6U A;  1FPO A;  2F43 G;  1EN4 A;  2DWE C;  3OUS A;  2R9I A;  3OT7 A;  4JI7 B;  3ZHR A;  1NR7 A;  2LQT A;  4NKG B;  4U3J A;  4D7T A;  3HKB A;  4HZ3 A;  4JAS A;  3W7W A;  1TA8 A;  2QWQ B;  3RWR D;  4JYA O;  3FB5 C;  3JAW A;  3ABT A;  1S3J A;  5B5E Z;  5CA1 B;  4NXN O;  3AG4 C;  4K0K B;  5FLX N;  3IFX A;  1JMK C;  4TQD A;  5KUM A;  4H44 B;  3RT3 C;  5GON B;  4LF6 O;  1IBM B;  1R3J C;  3R65 A;  4UXN A;  5LMU O;  1AI6 A;  3DTU B;  3AG3 C;  4UCS A;  2R72 A;  5L3E A;  4ZKI A;  4O4L B;  1XL4 A;  4B08 A;  5IE9 A;  3IGA C;  3SJC C;  3TXQ A;  4B3M O;  2EIK C;  1ENV A;  2XAS A;  2EZP A;  2QTO A;  1YJ9 V;  2XT9 A;  1QQC A;  4FM2 A;  3RYF B;  4JAV A;  4I50 A;  5LOV A;  4MSW C;  3FFQ A;  4FK5 C;  1KMI Z;  2P4K A;  3UT5 B;  4DV2 O;  4JI6 B;  2AXT Z;  1LNQ A;  4LF4 B;  3LDE A;  2UXX A;  1BL8 A;  5CN0 A;  1XNQ B;  2KSD A;  4TWK A;  5FL7 G;  1QU7 A;  4RO2 A;  2HFE C;  1FD9 A;  3ETG A;  1XEQ A;  1BHA A;  3C3T A;  2JK5 C;  4DR1 O;  3B4S A;  4CH4 A;  5A2Q N;  4FLY A;  3ABL C;  2BSK B;  1N34 O;  3OM3 B;  2Z0A A;  4GX1 A;  3QO8 A;  1VQP V;  3STL C;  4J41 A;  1SQF A;  3OR6 C;  4TV9 B;  5BXZ A;  2CTR A;  2ZNI A;  1L1F A;  3OMI B;  5J9P C;  2ZKO A;  4YHH B;  3HKC B;  1WP7 A;  3J81 N;  5IDJ A;  2P5O A;  3SPI A;  1GK9 A;  4J7Z A;  4GKK O;  1PV0 A;  2RJZ A;  3W7T A;  5TIS Z;  1IDS A;  1CXZ B;  4FVM A;  5IYZ B;  4OX9 B;  2O57 A;  3WB2 A;  4WFA V;  3M8A A;  5KAF Z;  2ZM6 B;  1US6 A;  1P4R A;  4KFM A;  4I9Q A;  4C7U A;  4DUY B;  1TUB B;  1H2K A;  4TUY B;  4X66 O;  3X2Q B;  1MZF A;  2OIG A;  3H1I H;  1SQV H;  1MMM A;  1T5E A;  1AP6 A;  1AVM A;  1R3I C;  1M93 A;  4NTY A;  5FNV B;  3IJ4 A;  1ZSP A;  4LNU B;  4LH6 A;  1NTM H;  3CCM V;  2AW9 A;  1PD3 A;  4FLW A;  5B1A C;  3JAS B;  4GZR B;  1FFX A;  2WPD G;  5BY1 A;  1F7Y A;  1IZ3 A;  3B40 A;  4FFB B;  2ITC C;  3K59 A;  3OFN G;  2ZIN A;  4GX5 A;  1R3K C;  3TXS A;  2QE7 G;  2LGQ A;  5JJN B;  2F93 B;  4CC6 A;  4I4T B;  3VQW A;  4PDV A;  4RQF A;  5EYP A;  4DR5 B;  2WLI A;  5LGU A;  2QEX V;  4N21 A;  1KKD A;  3M99 B;  1YSC A;  4IGG A;  2YDE A;  4YJ2 A;  4IHJ A;  1XL6 A;  1GN6 A;  3B2E E;  2IW5 A;  5B1N A;  1MNG A;  1B3Q A;  4J9Z B;  3RGB A;  2PI5 A;  1NTZ H;  1JOY A;  2Q8V A;  3KKY A;  3ZCC A;  1J5E O;  2Y4T A;  4MVS A;  4B3S O;  4HAM A;  2R70 A;  3LSS A;  3MHS C;  1RSO A;  4JYB A;  1HNW B;  1H38 A;  1PKX A;  4DR6 B;  2FYU H;  1B6Q A;  3CCV V;  1R6T A;  2QWP B;  3T1C A;  3TCU A;  1OCC B;  3F7Y C;  5LGN A;  2B9Z A;  2FB5 A;  4YIO A;  3GVM A;  3E2E A;  4DV4 B;  4O4J A;  3FYE B;  2LW7 A;  4IYI A;  5EK0 A;  1JCH A;  3O9O A;  3D3Q A;  1GO3 F;  4MTX A;  1XMQ O;  4DR7 O;  4TV8 B;  3MAQ A;  1H2S B;  3B8N A;  4G2K A;  5KUK A;  1F23 A;  3OMN B;  1SKV A;  1XUQ A;  2ITD C;  2E76 B;  1SS3 A;  4JI1 B;  5LMN O;  3OEE G;  2QKC A;  2WSS G;  1W0J G;  4UVA A;  2W0F C;  1W2B U;  2AZ0 A;  4WFF A;  3S3W A;  4I55 A;  3JCU Z;  1GAX A;  2P67 A;  3IC7 A;  3SR2 C;  1QLN A;  2GV9 A;  3LDD A;  1JFF A;  3P32 A;  5CBF A;  4DV0 B;  3JD0 A;  4AQY B;  3CE2 A;  4O2B A;  3HKE B;  4MS2 A;  1RPO A;  1U97 A;  2KB1 A;  2HG5 C;  2ZT9 B;  4DV7 B;  2UXB O;  2DMX A;  2LO1 A;  3VQY A;  4GKJ B;  2YUA A;  2ODM A;  3WG7 B;  1W0K G;  5KHI A;  5KMG B;  2AZ2 A;  5F2V O;  5L3G A;  1YXB A;  3AG2 C;  2BOB C;  1H2G A;  2Z5U A;  3UO2 A;  4ZOL B;  1H8E G;  5IJ9 B;  1E79 G;  2DYS B;  2ATK C;  3JAR A;  2Q0A A;  3RYH B;  1Q6H A;  2QGN A;  1FXK B;  1LUV A;  5LA6 B;  1V55 B;  2EX3 A;  1P49 A;  1KQS U;  4UV8 A;  1NZ6 A;  1HW7 A;  1COW G;  3LNN A;  1Q5O A;  1K34 A;  5C8Y A;  2E75 B;  2XHB A;  2X0L A;  1IBL O;  3CX5 F;  2EBO A;  4UFZ A;  3EFF K;  2JRI A;  5IYC O;  4CH6 A;  4FLX A;  1IVS A;  3SPH A;  1JJO A;  1OV9 A;  2R9R B;  3E22 A;  1ZX3 A;  3A0B Z;  4PA4 A;  1GM7 A;  4UVB A;  3E83 A;  5DM6 V;  1NJI W;  3E8H A;  4PHZ A;  4MTG A;  2UUA B;  3L71 H;  4EB6 B;  3EXA A;  2OTL V;  1GRJ A;  5FPR A;  4OXS A;  2A9H A;  1SQQ H;  1QCE A;  4X89 A;  1XMO O;  2PTM A;  3H9V A;  4HNA A;  5LGT A;  2VQE B;  2DJV A;  5EBL C;  3CCS V;  1Y4M A;  3D36 A;  2QKA A;  1M57 B;  1ZUQ A;  4KXR A;  2CGN A;  2P06 A;  2P6J A;  5IYB O;  3DSQ A;  2E5L O;  1K97 A;  4J7K A;  2HHH B;  4FZ0 A;  2QM8 A;  1VQK V;  2XAG A;  1VQ6 V;  3VOU A;  4JI7 O;  1BHB A;  3N2K A;  4U3J B;  2Q7G A;  1FKA O;  3HKB B;  4LF5 B;  3K3W A;  3TK1 A;  2VWK A;  3WFV A;  3P3P A;  2UUC B;  1F51 A;  3ZMV A;  5JWP A;  3AG4 B;  1JVM A;  2JEX A;  3APO A;  3JAM N;  3JD1 A;  1Y76 B;  3JAW B;  5B1B C;  4B3T O;  3K0D A;  1IX9 A;  4H13 B;  2IU0 A;  4DV6 B;  1V9P A;  4K0K O;  4NVP A;  2WAM A;  2ZE5 A;  3T4D A;  3ZN1 A;  2DE0 X;  2A0L A;  2HJD A;  4I9W A;  2LGW A;  4RAI A;  1IBM O;  2V1D A;  1MOF A;  3HPL C;  4P9P A;  3K03 A;  5L3B A;  1HWY A;  2OT5 A;  2WWW A;  2EIK B;  2N05 A;  1N0J A;  1X59 A;  3JD2 A;  3BA8 A;  1RM1 B;  3QG5 A;  1BQ0 A;  5IWA B;  4F6E A;  3ICX A;  5CBG A;  1FS0 G;  1SRY A;  4I50 B;  1EFR G;  4CC5 A;  4QIW F;  1DTO A;  3OE7 G;  3RVY A;  5LOV B;  2YXH A;  2E3C A;  3AK1 A;  5ITZ A;  2Q9L A;  4WFG A;  2A7W A;  4MVM A;  1UPG A;  1XQ8 A;  5JCO C;  3OEH G;  2ZDI A;  2XOK G;  4U7O A;  4JI6 O;  3RVZ A;  4LF8 B;  1FXK C;  3E8G A;  4LF4 O;  5EBW C;  1V55 C;  4TT3 G;  4BIZ A;  2QTS A;  4X65 B;  1XNQ O;  2BTO A;  4R50 A;  4X88 A;  2XAH A;  2GTS A;  3LSQ A;  3N2G B;  1FAF A;  1H2M A;  1YZB A;  2ZE6 A;  4DRX A;  3IAY A;  2H94 A;  2CTQ A;  1K5Q A;  2ZCE A;  3W7S A;  3HR0 A;  3ZHV A;  5CA3 A;  2UXN A;  2PY5 A;  3VBB A;  3VQV A;  4YHH O;  2YXL A;  2CH7 B;  4ASU G;  3WU2 Z;  1IBK B;  3J7A U;  4JTD B;  4UCV A;  1OZ0 A;  5E79 Z;  2AHY A;  3AK3 A;  4OX9 O;  1G4Y B;  1M9N A;  1VIB A;  1Y6X A;  4X1Y A;  4DV5 B;  4YJ3 A;  2ZM6 O;  1FXH A;  1PNM A;  4UUJ C;  3CSX A;  3T1Y B;  4K35 A;  4DUY O;  2JJ1 G;  1M57 C;  1M5I A;  4JI4 B;  5H6R A;  4Z1M G;  5B1A B;  2Q5Z A;  3HKD A;  3CS5 A;  2B5U A;  4JZG A;  3ZED A;  2C2A A;  1ARO P;  3BPZ A;  2YI8 A;  1AJQ A;  3ZRV A;  4BIU A;  1PL4 A;  3KCX A;  3L70 H;  1VAR A;  2M7W A;  2OCC B;  2A3Q A;  2F66 C;  2IM9 A;  3K58 A;  1YHQ V;  2BE3 A;  1GN2 A;  3CC7 V;  4FFK A;  2JGD A;  2P90 A;  5KHJ A;  2OYQ A;  5D5Q A;  5EYP B;  3T1H B;  2HEP A;  2VQF B;  2WLI B;  5L3F A;  4F6R B;  4X20 A;  2FTK A;  1M4U A;  4DR5 O;  4OGQ B;  3JAT A;  1E1R G;  4YJ2 B;  4IHJ B;  1EN6 A;  1RM1 C;  2V7Q G;  2CUG A;  1D5A A;  2EZO A;  3CME V;  1M56 B;  1ZAU A;  4JV5 B;  2Q0O C;  2H3O A;  4X1K A;  3G71 V;  1HR0 B;  5FPO A;  1RSO B;  1F4M A;  5KHK A;  1PP9 H;  2H8P C;  3ZHS A;  2EIM C;  1QLE C;  3ZN0 A;  4NXM B;  5DEC A;  4DR6 O;  4GCZ A;  5KX5 A;  1BE3 H;  4O4H A;  3K5M A;  1XHZ A;  4O4J B;  1EN5 A;  3NR7 A;  4DV4 O;  2X7R B;  2Q4P A;  2WLJ A;  1VEW A;  1ZTE A;  2UUB B;  1B06 A;  1WNS A;  3AK2 A;  2UXC B;  2G38 A;  4UV9 A;  1ZL8 B;  3L72 H;  1KP2 A;  4B3R O;  4GX2 A;  4R6Z A;  4ZBM A;  5B1O A;  3H1H H;  1NBM G;  3HB3 B;  4JTA B;  2E74 B;  3CJH A;  5LYJ A;  2OWO A;  3QNE A;  3ZRW A;  3FD9 A;  1YIT V;  1LR1 A;  3K9A A;  4JI1 O;  3RYC A;  2KG7 A;  2P22 C;  2ZR3 A;  1R3L C;  1IUR A;  2QSA A;  1SES A;  1KKC A;  3OW2 U;  1YJW V;  4I55 B;  4ZI7 A;  1BT8 A;  4IIJ A;  2ZR2 A;  4QGP A;  1JFF B;  3C3S A;  1Y66 A;  1VQO V;  4DV0 O;  5KHH A;  3QTC A;  4UB6 Z;  4O2B B;  4X8A A;  4AQY O;  4GX0 A;  4LFB B;  2Q7H A;  4H0L B;  3EHB B;  5JQG A;  3CP1 A;  3ZHU A;  2KKW A;  1K4D C;  4DV7 O;  3U10 A;  2WA3 A;  3SDL A;  1QR9 A;  1XHX A;  1KYO F;  3H1L H;  3AG2 B;  2RN9 A;  3A0H Z;  4LFA B;  2NN4 A;  3G80 A;  2N04 A;  4KHP B;  1H8H G;  1WA8 B;  3S3X A;  4NTW A;  3SPG A;  1YI2 V;  4AIL C;  3U0Z A;  2IBZ H;  2CAZ C;  3E35 A;  3K79 A;  4TOI A;  4D6T H;  4DV1 B;  4GUN A;  4ZIB A;  2OCC C;  2QKS A;  3JAR B;  1WAZ A;  4DR3 B;  5CB4 A;  2YEV A;  1MZE A;  2LW1 A;  2LJ2 A;  3FAV A;  1GN4 A;  1SZX A;  4UVC A;  2UU9 B;  1QVG U;  1NTK H;  3KG2 A;  4UCO A;  1WPX A;  3SYQ A;  3JAK A;  4ABM A;  5GON A;  3AG7 A;  1Q90 D;  4NTX A;  1SER A;  5C8Y B;  4E4E A;  4CS2 A;  4B7E A;  3F5W C;  4JTC B;  3UO3 A;  1S5J A;  2JS5 A;  3TJT A;  3OMA B;  3ZBH A;  1I5Y A;  2JDI G;  4MT8 A;  5L3D A;  3E22 B;  4DO2 A;  1G6U A;  1NI8 A;  1M56 C;  1NS1 A;  4IT5 A;  4F4L A;  1W59 A;  2IH3 C;  4O4I B;  1URF A;  5K1P A;  1TUE B;  1WPB A;  1K73 W;  5LXT B;  4RQE A;  1U96 A;  3K0G A;  4J42 A;  5IY5 C;  2UUA O;  1BZK A;  4X1I A;  5E1A C;  1VQN V;  4XDK A;  4FIP C;  1WP8 A;  4JI8 B;  1FYJ A;  1L0L H;  2ADQ B;  4MTO A;  4B7K A;  5KA6 A;  1JR9 A;  3BCC H;  3CCE V;  3MD0 A;  3ASO C;  4HNA B;  5L3C A;  2FML A;  2YS8 A;  3ASN C;  2WLH A;  2Y4U A;  4TQF A;  3APQ A;  1KU9 A;  4CH5 A;  2DYR B;  3E89 A;  2RMK B;  1A32 A;  1YF2 A;  1YJN V;  1H2N A;  2HHH O;  1X4T A;  4WBN A;  4L8J A;  4J80 A;  4QE7 A;  3N2K B;  5B1B B;  5J2T A;  4LF5 O;  2F23 A;  1I5X A;  2FKX A;  2UUC O;  1Z5V A;  3FB8 C;  2DWD C;  4IYH A;  3OTO B;  1MSD A;  2DW4 A;  2WLL B;  4DV6 O;  2ZIO A;  5H5N A;  2HR3 A;  3B77 A;  4JPR A;  5IYD O;  2DOS A;  1OJH A;  5JJE B;  2NNU A;  3GWK C;  3ABU A;  4X62 B;  5IYZ A;  1M1K W;  1KD1 W;  1D5N A;  1SQX H;  2JJ2 G;  4WFB V;  1PL0 A;  1R6K A;  5IT9 N;  3CCU V;  3LDC A;  3SYP A;  5D5P A;  5IWA O;  3GWO A;  3E8B A;  1N32 B;  4L87 A;  4TUY A;  5JH7 A;  2GDS A;  2QM7 A;  2BCC H;  3LNM B;  1VP7 A;  3ZS8 C;  5BMV A;  4DR2 B;  4YIP A;  2WA4 A;  3CCR V;  4NB5 A;  3ABK B;  2LP7 A;  1TAE A;  3TGU H;  2B1G A;  5CMU A;  2XAQ A;  2HJF C;  3IC9 A;  3WB1 A;  2EIL B;  4BAY A;  4LF8 O;  3A2F A;  4JI2 O;  4DK1 A;  4JI0 B;  2F4V B;  4X65 O;  1WB8 A;  1IXB A;  4KL1 A;  5EIB D;  3T4Z A;  5EIB C;  3ZRX A;  4I4T A;  2DN9 A;  4QNH B;  2YXY A;  1VQ7 V;  2Q7E A;  2F95 B;  1I94 B;  3DC5 A;  3H01 A;  4FMT A;  4FLU A;  2ZE8 A;  3BAA A;  4LFC B;  4DUZ B;  2BTQ A;  4QJF B;  4GT1 A;  2GTA A;  5EC2 C;  3DXR A;  1S0V A;  3F7V C;  4HBN A;  2GBO A;  1OCO C;  1L8D A;  2P7T C;  1IBK O;  1KUQ A;  2X6B A;  1AI7 A;  2MW2 B;  3BFR A;  4X1Y B;  4YJ3 B;  3ZMS A;  4YY3 O;  4DV5 O;  3K08 A;  1K3E A;  1Y74 A;  3D3I A;  4RWU A;  4TSF G;  1G1X B;  3DC6 A;  3ZHQ A;  3T1Y O;  3D36 C;  1SQB H;  1HNZ B;  2DYR C;  3TET A;  1RFY A;  2K1E A;  4JI4 O;  2YIB A;  1GMG A;  1VF6 A;  2YIB D;  2PI4 A;  3HKD B;  3ETD A;  4MVQ A;  1OCR C;  4DV3 B;  3SJA C;  3W7X A;  3CMA V;  2Y69 C;  3G6B A;  1CEZ A;  2QJ1 A;  4DR4 B;  3CRC A;  3SPC A;  4KP4 A;  3CCQ V;  3D8C A;  2AHZ A;  4FJC C;  1Q8I A;  5JVD A;  1R73 A;  3G4S V;  2XND G;  4WF9 V;  3QVN A;  2JGD B;  2RNB A;  3SYC A;  1JJ2 U;  2X6A A;  3O65 A;  2B1I A;  4K8Z A;  4LF7 B;  2IH1 C;  4X20 B;  3BY6 A;  3T1H O;  1SF9 A;  2VQF O;  1BS3 A;  3RFR A;  1I7F A;  1VQL V;  3JAT B;  3SPJ A;  2PGG A;  1R6N A;  4LF9 B;  1AP5 A;  2IJI A;  4RUE A;  2Y0P A;  2IJH A;  2QM4 A;  2Y0I A;  3STZ C;  1EZV H;  3JD3 A;  1Q3E A;  2F1M A;  5H6Q A;  1AR4 A;  1O9H A;  1K9M W;  2EIM B;  1QLE B;  4JV5 O;  4X1K B;  4MW3 A;  3ABK C;  5KMG A;  2LFS A;  1HR0 O;  4JZ2 A;  3K9S A;  4W4L A;  2JS3 A;  1FJG B;  3K57 A;  4NXM O;  5KX5 B;  4O4H B;  2ZDI C;  1J95 A;  4J11 A;  4LWS A;  3JAL A;  2EIL C;  4LP8 A;  4PDR A;  3CRQ A;  1XBL A;  1VQ9 V;  2CE4 A;  2OIE A;  5EZY A;  1BGY H;  1QBZ A;  3H1K H;  5LA6 A;  2UUB O;  4PDM A;  4ZHQ A;  2UXC O;  1CPY A;  5DN6 G;  1EM1 A;  3E8F A;  3FKS G;  3ZRS A;  3G67 A;  3W7U A;  3CJH B;  1PPJ H;  1N8R W;  5LYJ B;  1DF4 A;  5A9G A;  3ZRW B;  2DQ3 A;  3JD4 A;  3RYC B;  2KG7 B;  2GUZ A;  2L6L A;  3L73 H;  1NVP D;  2QDO A;  1VF7 A;  5LP6 A;  2NR5 A;  1QNM A;  4Q20 A;  3RBZ A;  4A5U B;  2ILM A;  4ZI7 B;  5LHG A;  3K5O A;  4IIJ B;  4LBE C;  4DW1 A;  3U11 A;  1Y67 A;  1UJW B;  2HP8 A;  3QO7 A;  3OGI B;  1GM9 A;  1E1Q G;  4CZZ A;  4JYY A;  3BRC A;  1DGS A;  4HYO A;  4PA6 A;  4LFB O;  4BWA A;  1XMO B;  3K5L A;  1Q82 W;  1AI4 A;  2ADP A;  1MSW D;  2A79 B;  4DYL A;  3CC4 V;  1SC5 B;  1DK1 A;  2UXD B;  4FM1 A;  1WJZ A;  1HP8 A;  2R9A A;  1S76 D;  1WLE A;  3CRR A;  1FFX B;  3B09 A;  4LFA O;  5KHG A;  1NH2 D;  4CS3 A;  4KHP O;  2YIA A;  1VQ5 V;  2RDC A;  3CPW U;  4H37 A;  4PV1 B;  2QWO B;  4JI5 B;  4CBC A;  1YTF D;  4DV1 O;  1SQG A;  4Q6G A;  4B3T B;  5CB4 B;  2YEV B;  1Y76 A;  4OPH A;  4FLZ A;  3A0R A;  4DR3 O;  3FAV B;  1BQZ A;  1RP3 B;  2L35 A;  4NYK A;  2X6C A;  2UU9 O;  5IJ0 A;  1R1B A;  3I5D A;  4O2A A;  3JAK B;  2WLK A;  5LL6 Y;  3UM7 A;  3CC2 V;  1Z2G A;  3I55 V;  2Z3Y A;  1VF5 B;  3CYO A;  2WLN A;  1DLB A;  1N4C A;  1PM9 A;  1SA0 A;  4WCE V;  3BEH A;  2BOC C;  1L0N H;  5IY5 B;  1KB9 F;  3Q4H A;  5J2U A;  3VQX A;  1P7B A;  2JEU A;  5B3S B;  1HNW O;  4X1I B;  3RW0 A;  2PZS A;  4FZ1 A;  2XUM A;  2DQ0 A;  5H2F Z;  1VQ4 V;  3K06 A;  3FYI B;  1QR8 A;  4JI8 O;  1TVK A;  1GM8 A;  4WFE A;  4EFB A;  3THO A;  3JCZ A;  3ASO B;  2ZNJ A;  3ASN B;  4PA7 A;  2A06 H;  5GTH Z;  1XNR B;  1MA1 A;  3RYI A;  1AI5 A;  3QF7 A;  2JGU A;  5BR8 B;  1HNX B;  1MG1 A;  3FB6 C;  1JX9 A;  4MTF A;  4P9O A;  2QA4 V;  1K33 A;  1XDC A;  2PYJ A;  1KBH A;  2LFR A;  4WBN B;  4UCT A;  2Y48 A;  1WN7 A;  2PYL A;  3N2G A;  1M90 W;  1QVF U;  1MAB G;  2PUS A;  5J2T B;  3OTF A;  3OGC C;  1K5S A;  4JI3 B;  3CXH F;  1N36 B;  1N33 B;  1V54 C;  3ABM C;  3R66 A;  1JPX A;  3OTO O;  3KZI Z;  3CCL V;  3JSL A;  1ZWI C;  5DED A;  1EBO A;  2CH7 A;  1P84 F;  2K9P A;  1Q6I A;  1K92 A;  4WFH A;  1AB3 A;  2QWR B;  1F4N A;  4X62 O;  2JIZ G;  4QPJ A;  3L74 H;  1NU1 H;  5CA0 A;  4X64 B;  4GKJ O;  4I0X A;  5JJJ B;  4JGS A;  4DXW A;  4PD4 F;  5JH7 B;  1N32 O;  2ZE7 A;  2Q68 A;  1Q86 W;  5BMV B;  2XAJ A;  3RN4 A;  4DR2 O;  3CCJ V;  5EC1 C;  5KAI Z;  4JYA B;  4NXN B;  2CDY A;  4J7J A;  5CA1 A;  1VQ8 V;  3CD6 V;  3DGE A;  1QHT A;  3ZX6 A;  1EZJ A;  4K8X A;  4JAU A;  4R7C A;  2NLJ C;  4LF6 B;  1S72 V;  1SZT A;  3J80 N;  1XRE A;  4JI0 O;  2F4V O;  4BR6 A;  3P30 A;  5LMU B;  1RPR A;  4UB8 Z;  1XOU A;  3CHX A;  1OCZ B;  4O4L A;  4F6R A;  4ICG A;  3G6E V;  1ORQ C;  1I94 O;  4B3M B;  2VWJ A;  4LFC O;  5LHI A;  4DUZ O;  4NR1 A;  2BTQ B;  4XDL A;  2Q6A A;  2W0X A;  4J9Y B;  3RYF A;  1OCO B;  1ZLZ A;  5B3S C;  3DXR B;  2CTP A;  4LR3 A;  1WB7 A;  4EKW A;  4JAA A;  1CP9 A;  4N23 A;  3C90 A;  4DV2 B;  2YI9 A;  3PN1 A;  3UT5 A;  5HFL A;  1LUW A;  3L9D A;  2VRZ A;  5BZB A;  2VQE O;  1G8M A;  1Y74 B;  3JYC A;  4XBF A;  1Q7Y W;  2QR4 A;  2HVJ C;  1PNK A;  3SJB C;  1HDJ A;  4DR1 B;  1HNZ O;  4JYC A;  4EFE A;  2RQ6 A;  4BW9 A;  1GH6 A;  1IXM A;  1OCR B;  4GLX A;  1N34 B;  1XIL A;  1AJN A;  3WB0 A;  2BSK A;  2EIN B;  2ZXW B;  1AIL A;  1ZL8 A;  2HKO A;  2Y69 B;  2D2C B;  4JF3 A;  4B3R B;  4H33 A;  4X9Q A;  1JQ0 A;  2Q73 A;  4G27 B;  3ZHT A;  4DV3 O;  1KP3 A;  3H1J H;  1NR1 A;  1YCI A;  4TV9 A;  5LHH A;  4DK0 A;  3PJS K;  4DR4 O;  3HKC A;  1SET A;  3MDS A;  5JVD B;  4GKK B;  4LC1 A;  4PDL A;  3P3N A;  3AG1 B;  3OR7 C;  1GTO A;  1S77 D;  3K5N A;  4GYC B;  1GKF A;  4LF7 O;  1NQT A;  2IJK A;  3EVK A;  4X66 B;  2CK3 G;  1TUB A;  3BVO A;  3ZMT A;  4UCR A;  4LF9 O;  1Q43 A;  3UKM A;  3X2Q C;  4AI8 A;  2MK3 A;  2OCH A;  4QE9 A;  5FNV A;  4Z1V A;  2WLM A;  4LNU A;  1O9G A;  3SYO A;  4LH7 A;  5ITZ B;  2Q67 A;  3JAS A;  1VQM V;  4XDJ A;  4PA9 A;  3OUF A;  2W6I G;  1WA8 A;  1AR1 B;  1I0H A;  2YSU B;  2M6Y A;  4FFB A;  1FJG O;  1BMF G;  1BCC H;  4LWS B;  2EJR A;  3JAL B;  1YIJ V;  3BAB A;  3MHH C;  4MVZ A;  3ETE A;  5EZY B;  4MVU A;  2FL4 A;  4PI0 A;  4DRX B;  3GB7 C;  3UCS C;  4ZHQ B;  1NKD A;  2EUL A;  3FB7 C;  2JVD A;  1N0N A;  1OCZ C;  5AG2 A;  2ZQM A;  2ARH A;  1UFI A;  3K04 A;  4MVO A;  2XAF A;  3ML0 A;  1ROP A;  4EEQ A;  4DW0 A;  2P4V A;  5K1X A;  1Q81 W;  2XTA A;  1J5E B;  5EBM C;  1NVP B;  4B3S B;  4KUM A;  2V4D A;  2GUZ B;  2IU3 A;  1AR5 A;  3LSU A;  4O4I A;  5LP6 B;  1P7G A;  1K4C C;  4PA3 A;  5LXT A;  1K8A W;  1Z5W A;  1NT2 B;  3ZJZ A;  2HVK C;  3F5T A;  4J10 A;  3CXC U;  1B04 A;  2N74 A;  1H2L A;  2EIJ B;  4CS4 A;  3SYA A;  4E2L A;  3OD4 A;  4AHC A;  4U3F H;  1XI1 A;  5KLV H;  1OCC C;  2Q69 A;  3UQ8 A;  4FM0 A;  4PEL A;  1BSM A;  1XMQ B;  4DR7 B;  3CB2 A;  3ZIA G;  1SQP H;  2IJJ A;  3A8T A;  5CBH A;  1DF5 A;  4TV8 A;  3ZMU A;  4FPP A;  3KCY A;  5C93 A;  1VF6 C;  2UXD O;  1NH2 B;  2CGO A;  4BIO A;  2YIC A;  1YVW A;  2EIN C;  2ZXW C;  3B8M A;  2YID A;  2GHY A;  1YTF B;  5LMN B;  1TGO A;  3FX7 A;  3JSN A;  4JI5 O;  5HFM A;  1OHH G;  4U7N A;  1THZ A;  1KEC A;  1JA8 A;  1YDX A;  3QO5 A;  4D7S A;  2ZD9 A;  4K3A A;  2WLL A;  3AG1 C;  3SGI A;  2AGA A;  5IJ0 B;  3CEI A;  1K7D A;  4O2A B;  3SJQ C;  5H9C A;  3CRA A;  3AG3 B;  3HKE A;  4QPK A;  2UXB B;  1I08 A;  5GW7 A;  4FLT A;  1YEW A;  2QWN B;  2KQX A;  1D2D A;  2ETN A;  1SA0 B;  4IL6 Z;  3Q4H B;  3LUT B;  4W4K A;  5J2U B;  3WG7 C;  1FXV A;  2W6J G;  2RCV A;  4ZOL A;  5IJ9 A;  2PF4 E;  2EJ7 A;  1TVK B;  4OPA A;  3RYH A;  2DYS C;  5JCO A;  1FXK A;  2HLD G;  3CWB H;  3ZMZ A;  4I5S A;  3RYI B;  3CRM A;  4PJ0 Z;  2D3O W;  1XNR O;  1VMG A;  2OTJ V;  4JI2 B;  5GTI Z;  4MVR A;  1FFT B;  1PNL A;  5BR8 O;  1HNX O;  4CH3 A;  4Z2W A;  2VS0 A;  5KA5 A;  4LCU C;  1IBL B;  3ABL B;  3OAA G;  2GSM B;  5B66 Z;  4MW8 A;  4G28 B;  1V54 B;  3ABM B;  4BW5 A;  1GN3 A;  4UCU A;  1KC8 W;  3T2M A;  4P30 A;  4RUF A;  4YXW G;  4FLV A;  4JI3 O;  3E86 A;  1N36 O;  1N33 O; 
#chains in the Genus database with same CATH homology
 1XNQ O;  4LFC O;  4JI5 O;  4DUZ O;  4DR5 O;  1A32 A;  4LFA O;  4DV2 O;  4DV7 O;  1XMO O;  2HHH O;  4KHP O;  3SDL A;  2DJV A;  3R66 A;  3OTO O;  1FJG O;  1YZB A;  2AGA A;  4JV5 O;  4LF5 O;  4DV1 O;  2E5L O;  2FKX A;  2UXB O;  1HR0 O;  2UUC O;  4OPH A;  4DR3 O;  1XEQ A;  4JI7 O;  2VQE O;  4X64 O;  4DR1 O;  4NXM O;  1IBK O;  1KUQ A;  1FKA O;  1AB3 A;  5A2Q N;  4DV6 O;  5H5N A;  2UU9 O;  4X62 O;  1N34 O;  1R1B A;  2Z0A A;  4YHH O;  3JAM N;  5LL6 Y;  4B3T O;  2DOS A;  1D2D A;  4YY3 O;  1HNZ O;  3J7A U;  1J5E O;  4DV5 O;  4DR6 O;  4GKJ O;  5BXZ A;  4B3S O;  2UUB O;  4K0K O;  2ZKO A;  2UXC O;  1G1X B;  4JYA O;  1AIL A;  3T1Y O;  1N32 O;  4DV4 O;  4OX9 O;  1N36 O;  4NXN O;  3J81 N;  4DV3 O;  2ZM6 O;  4GKK O;  1IBM O;  4DR2 O;  1R6T A;  5IT9 N;  4JI4 O;  5FLX N;  5IWA O;  4DR4 O;  4DUY O;  3RT3 C;  4B3R O;  3M8A A;  2LW7 A;  4OPA A;  1HNW O;  4LF6 O;  3F5T A;  1X59 A;  2N74 A;  1NS1 A;  1XNR O;  5LMU O;  1XMQ O;  4DR7 O;  4X66 O;  4JI8 O;  1IBL O;  2JRI A;  4A5U B;  5BR8 O;  1HNX O;  3J80 N;  4JI1 O;  2UUA O;  4LF7 O;  4JI0 O;  2F4V O;  1FYJ A;  4B3M O;  3O65 A;  4LF8 O;  4JI2 O;  5LMN O;  4LF9 O;  4X65 O;  4LFB O;  2UXD O;  3T1H O;  2VQF O;  1I94 O;  4DV0 O;  5BY1 A;  4JI6 O;  1F7Y A;  4LF4 O;  4AQY O;  4JI3 O;  1DK1 A;  1N33 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...