1F7YA

The crystal structure of two uucg loops highlights the role played by 2'-hydroxyl groups in its unusual stability
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
86
structure length
86
Chain Sequence
PITKEEKQKVMQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRMLIEKLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of UUCG tetraloop.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA FRAGMENT
total genus 17
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2000-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1f7yA00
4OX9O 3J80N 4DV0O 1N36O 4JI1O 4K0KO 4DR1O 1HNZO 1HNXO 2LW7A 4DUYO 4B3TO 4GKJO 1XNRO 1IBKO 4JI8O 5BXZA 2VQEO 1DK1A 4DR7O 5BY1A 4JI0O 3OTOO 2DOSA 4LFAO 1FJGO 4JI6O 4B3RO 2AGAA 3O65A 4JYAO 3JAMN 4DV1O 1R6TA 4JI2O 1FYJA 4DR5O 4DV3O 2UUBO 4DR4O 4DV2O 4DR6O 4JI4O 2F4VO 5IWAO 5LMNO 4JV5O 4B3MO 1G1XB 5H5NA 3J7AU 1XMQO 4LF8O 5LL6Y 4X64O 2DJVA 4B3SO 4JI7O 4LF5O 1J5EO 4OPAA 1R1BA 2UUCO 4NXMO 2HHHO 4YHHO 2ZKOA 1HNWO 1YZBA 1D2DA 2JRIA 1N34O 4LF4O 4LF9O 1IBMO 4KHPO 4LF6O 1AB3A 2UXDO 3RT3C 4OPHA 1X59A 4DV4O 1NS1A 4DR3O 4DUZO 2UU9O 2UXBO 4GKKO 4X65O 3F5TA 3T1YO 4NXNO 1KUQA 1FKAO 2VQFO 4DR2O 4A5UB 1N33O 5FLXN 2UUAO 1IBLO 4JI3O 3R66A 3T1HO 1N32O 1I94O 4LFBO 4AQYO 4DV5O 1AILA 1XEQA 5LMUO 4DV7O 4JI5O 1XNQO 4X62O 2ZM6O 4X66O 1F7YA 3SDLA 2N74A 4YY3O 3J81N 5IT9N 3M8AA 4LFCO 4DV6O 1HR0O 2UXCO 1XMOO 5BR8O 5A2QN 2Z0AA 4LF7O 2E5LO 2FKXA 1A32A
chains in the Genus database with same CATH superfamily
2P90A 4RQEA 3WFVA 1SQFA 4TV8B 4DUYO 1H2MA 2JIZG 4X1IB 3RBZA 2GBOA 3JD0A 4JI0O 5CMUA 4LFAO 3ZMUA 3K5MA 2X6AA 3FFQA 5CN0A 3CCUV 4JI4O 5EZYB 4DO2A 5KMGA 2P7TC 2ZINA 1ENVA 4FK5C 4DV5B 3CRQA 1YTFB 4RAIA 4NTYA 3K5LA 2Y4TA 1FAFA 3MHHC 1XREA 2OIEA 1RPOA 4Z2WA 4GT1A 1IBLB 2Q9LA 3AG3B 3B8MA 3ZHVA 5FNVB 4C7UA 5LGNA 3JAWB 4FMTA 3RYCB 2XAGA 4DR7B 4JTCB 1JFFA 1GK9A 4OXSA 1XQ8A 3T4ZA 4DR6B 5L3DA 5EK0A 3ZMSA 1FPOA 3H01A 1HR0B 2QJ1A 4GKJB 1JQ0A 3N27A 1D5NA 1AILA 4ICGA 4MW8A 4DV7O 1I08A 1KYOF 2A0LA 1Y4MA 3IAYA 4PDLA 1UPGA 4IYHA 1W0KG 1YVWA 4WF9V 1N0JA 2HFEC 1SQQH 4NVPA 4UB6Z 3ASNB 1Q6IA 2HR3A 4X88A 3UQ8A 2ADPA 1HNWB 3CC4V 3LUTB 2EULA 1PNMA 1SA0B 1CPYA 1EZVH 3GB7C 1B06A 1Q6HA 3E8HA 4TV9B 4U7NA 5DEDA 3J80N 3TXQA 1OJHA 2ARHA 1XNRO 1SKVA 5LBQA 3UT5A 2DWDC 1K5SA 4FZ1A 3H1JH 4UCRA 1XNQB 1S5HC 1VQ5V 2AXTZ 1IXBA 5CA0B 2WLIA 4E4EA 1HWYA 3BCCH 3DTUB 4CS2A 3K06A 4JAAA 5JQGA 4BR6A 1N32B 4HYOA 4JAVA 1US6A 3K9AA 5J2TA 3J7AU 3JSNA 4X1KB 1BS3A 3DGEA 3LNNA 4YHHO 2UUBB 2GSMB 1N36B 4RUEA 3OGIB 1AB3A 2EINB 2FB5A 1F23A 2XASA 2Q67A 3ETDA 4DUZO 2Q4PA 1Y74A 1NTMH 3T1YO 1WA8B 3OEEG 4NXNO 2CTRA 3DXRB 5FPRA 2Q7HA 1JMKC 1TVKA 2YEVA 2GUZA 2EINC 4KUMA 4IYIA 1XOUA 1L8DA 2K1EA 3HKDB 4MTGA 3CSXA 3BA9A 2Y69B 2QR4A 4LF4B 3CE2A 4CS4A 3PN1A 2IU0A 1V54C 2H94A 4HZ3A 1PNKA 1GH6A 1ZLZA 4I55B 5H2FZ 1PD3A 1R6NA 2LJ2A 2CH7A 1JJOA 2ZR2A 5B1BB 4K8ZA 2CAZC 3HKDA 2Y69C 4CC5A 5JJEB 3QO8A 1OCOB 5FPOA 5LGUA 2ILMA 5BZBA 3K5NA 4TSFG 3JD2A 5CA1B 2FL4A 5J9PC 3CX5F 2XAHA 1YCIA 3ABUA 2XAJA 3ZHRA 1UFIA 1E79G 2VS0A 4PDMA 3P30A 2QE7G 4J9ZB 4LC1A 4DR6O 3FYIB 5IYBO 2E75B 3LSQA 4BIOA 3E8BA 4LF5O 1J95A 3FB6C 1QU7A 2BTQB 2N04A 4GX5A 4DV6B 2LP7A 1DGSA 3SR2C 4LBEC 3JD1A 2E3CA 1BE3H 4AI8A 1IBKB 2RNBA 5JCOC 3FB5C 1KQSU 3E8GA 3NR7A 1IURA 3ABMB 4MVMA 1K34A 2CE4A 4NTWA 4O4JA 4GLXA 3IC9A 4F6RB 2KG7B 4PV1B 2BE3A 2WAMA 1N32O 5AG2A 1WLEA 4JYAB 1YJWV 1SA0A 1Z2GA 3K57A 2UXNA 3FYEB 2W6IG 4H37A 4P9OA 4LWSA 3WB1A 1XMOB 5J2UB 5JJNB 4X89A 1F7YA 2FMLA 1HDJA 3MD0A 3K0GA 4DV4B 1VQ4V 1R73A 2QGNA 4FM1A 2N05A 3T1HB 4JV5B 1VQ7V 3SJBC 2VQEB 3UO2A 3ZHSA 5CB4A 2IJIA 4FPPA 2EJRA 1NI8A 3T1YB 4WFEA 1N36O 3ZCCA 4UVCA 4JI1O 4PA7A 2RN9A 1PV0A 2R72A 1I7FA 1PL0A 2CTPA 2ZNIA 4LFBB 4UCUA 4FM2A 5DECA 5LHGA 2LGQA 3ASOB 2W6JG 1K73W 2Y0PA 1R6TA 1VQ9V 1S76D 2A3QA 3F7VC 1RFYA 4FZ0A 2E74B 1XNRB 3LNMB 3GWKC 5B3SB 5LL6Y 4Z1VA 1K4CC 1YEWA 2JRIA 3VQXA 3QO5A 1VARA 5IYZB 4J7JA 3CCJV 3TETA 4DRXB 3CC7V 3DXRA 1FXKB 3SPCA 2ZE7A 1P84F 1H8HG 1THZA 3L73H 1VQ8V 4YY3B 4UVBA 3H1LH 4JI3B 1Y67A 2WLMA 4GKKO 1MG1A 5C8YB 1BCCH 1G4YB 4LCUC 1EN6A 2K9PA 3I55V 2JGDA 1K92A 4Q20A 1XHZA 1JX9A 3CB2A 3ETEA 1P7BA 1Q3EA 2XNDG 3BEHA 4LFCB 2KB1A 4DR3B 4I4TB 4EKWA 5A9GA 3N2KB 2Q68A 2AHZA 1K5QA 4IT5A 3RYIB 1Q7YW 1WPBA 2CK3G 1SC5B 1TUBB 4TT3G 1T5EA 3M8AA 1COWG 2DWEC 2YIBA 2CGNA 4O2BA 3ABKB 4ZKIA 2Z0AA 2EILC 3JASA 1O9GA 1VF5B 4FLZA 4JGSA 3OM3B 4OX9O 3OMNB 1EN4A 2GUZB 5IWAB 3E2EA 4WCEV 1KKDA 1TAEA 4JI8O 1K9MW 2H8PC 4K35A 1NT2B 4JTAB 1P49A 2YXLA 3W7TA 1EFRG 1SESA 4B3MB 1Y76A 1I94B 4I7ZB 1IBMB 1YSCA 1SZXA 2F66C 4PELA 1FD9A 1NH2D 4B08A 3OR7C 2DN9A 2V7QG 4CH5A 3HKBB 1QBZA 2IBZH 1ZTEA 1XMQO 2EJ7A 2DJVA 5C93A 4IIJA 4O4HB 4OPAA 4NXMO 3SGIA 1M5IA 3LDEA 4J41A 2ZKOA 3U10A 5B3SC 2XOKG 3OR6C 3T1CA 2L6LA 1Z5VA 2JVDA 1H2NA 1IBMO 1WP7A 5LXTB 4LF6O 2YS8A 2VQFB 2WWWA 4I9WA 4PA3A 2JK5C 2XUMA 5B1BC 5IJ0A 2JJ2G 1EM1A 2PTMA 3JARA 3BY6A 1OCZC 3AEIA 3HKEB 3B4SA 3CS5A 3FD9A 3H1KH 2YI9A 2PF4E 4K3AA 4AHCA 2YIDA 4WBNB 3AG1B 4JI1B 4TQDA 3P32A 2Z5UA 5CBHA 5EBWC 5LMUO 4BW5A 4LF7B 3JD3A 2F4VB 2QDOA 4X1KA 4EB6B 1QCEA 2DW4A 5IY5B 2R9AA 1XI1A 4DK1A 2N74A 2ZNJA 1ZL8B 2ITDC 5LMUB 1IVSA 1UJWB 3OD4A 4CBCA 4X1IA 3H9VA 1VMGA 1QR9A 2YICA 3ZIAG 1F4MA 1ZX3A 2NNUA 1EZJA 4NB5A 1VP7A 2ZM6B 4JYBA 1L0LH 4ZIBA 1XDCA 2Q8VA 1I5XA 1VIBA 3ABLC 4MW3A 4DRXA 4HNAB 1NTKH 2P4KA 2EIJB 3VQWA 1M1KW 1CXZB 4F6EA 1HW7A 3TCUA 1OZ0A 4I55A 4QNHB 4LF8O 2ZXWB 4JI0B 2HKOA 4QJFB 4LFAB 2ZIOA 4H44B 3TK1A 4RQFA 2IH3C 3S3XA 4DW1A 5L3BA 4XBFA 1QQCA 1K4DC 2EIKC 4J80A 1R3LC 1GRJA 3OAAG 3H1IH 3RYCA 4B7EA 2HJFC 4X65O 3AG2B 1B3QA 2IU3A 4HNAA 1GMGA 1YXBA 4TV8A 3RWRD 1FJGB 4LNUB 1QVGU 1KD1W 5FLXN 3CEIA 1R3JC 4ZHQB 1VF6A 3T1HO 2XTAA 1QHTA 4GZRB 3L9DA 2ZR3A 5JJJB 3SYPA 3Q4HA 1NVPB 1XNQO 5IY5C 3IC7A 5IJ9A 3KKYA 2X6CA 2UUAB 1K8AW 4XDLA 4PD4F 4IGGA 1GN2A 5CA3A 5IYDO 2OCCC 1PNLA 2YC0A 5JH7B 1MA1A 4LFCO 2AW9A 2Q7GA 3HB3B 4H0LB 3K0DA 4KL1A 4ZI7A 3WG7B 2BOCC 2IJHA 1P7GA 1GN6A 3HKBA 1WPXA 4LF9B 4EFEA 4UVAA 2LW7A 4U3FH 2CDYA 3CMEV 3KCXA 3OUSA 3AK3A 4X20B 4OGQB 2P4VA 3T2MA 4JI5B 4OX9B 2YSUB 4AQYB 2AGAA 4TUYA 4DV0B 2Q69A 2G38A 3P3PA 4NTXA 3JAMN 4DV1O 3BPZA 4GUNA 1NKDA 5IYCO 3EHBB 2F4VO 4G27B 1CP9A 3CCRV 2RDCA 1SS3A 1G1XB 3D3QA 2DYSB 4DYLA 3W7XA 1R1BA 4Z1MG 3CC2V 2JEUA 5EYPA 1WP8A 1S3JA 3G4SV 4J42A 2PGGA 3ZMTA 5CA1A 3CJHB 3SYOA 4LH6A 4DV2B 4DR3O 1MNGA 1ROPA 3F5WC 1BSMA 3F5TA 4I0XA 2DE0X 2YXHA 1SERA 2VQFO 4DR2O 1B6QA 3UM7A 4O4HA 4UCTA 4DV5O 4IL6Z 2BSKA 1BHBA 2X0LA 2IJJA 2D2CB 3MAQA 2OCCB 2HP8A 3BRCA 4NYKA 1N0NA 2ZE6A 4X8AA 1JCHA 1FXKC 2WSSG 3FAVB 1K97A 4PDRA 5JVDB 1QVFU 4CC6A 3CXHF 3ZRSA 3WG7C 2BSKB 2EIMC 3N2GA 3CCLV 3EXAA 1KECA 1RSOA 1IZ3A 2Y48A 3OEHG 3Q4HB 3OFNG 1ORQC 3M7MX 1RM1B 3SYAA 5B1OA 4GX0A 1IBKO 1XILA 1ZUQA 2L35A 1RSOB 3STLC 2Y4UA 2UXXA 1SQGA 2E76B 1GN4A 2GTAA 4LF6B 3CD6V 5JQGB 3THOA 3NXSA 5KAFZ 4PA9A 4R50A 2JGUA 3ETGA 4JI4B 5DM6V 4AILC 1GKFA 2ZQMA 5C8YA 1L0NH 2UXDO 1NR7A 1Y76B 3IFXA 3I56V 1LR1A 2HHHB 4NKGB 3ML0A 1AI6A 4PJ0Z 1NZ6A 1CEZA 1MABG 3QF7A 4JI8B 4DR5B 2KG7A 1GN3A 1SF9A 4JZGA 4JASA 1I94O 3UKMA 1S72V 1QLNA 5CBGA 1S5LZ 3ZHTA 3AG2C 1OHHG 2R9IA 3SYQA 1O9HA 2AHYA 3ABLB 1P4RA 3F7YC 1FFTB 4BW9A 2HG5C 1QNMA 1OV9A 4J11A 2QWOB 1V9PA 2PYLA 1QLEC 2Q73A 1AI4A 3D36A 5L3GA 4LF7O 2YI8A 1NBMG 3ABMC 1TVKB 2DYRB 4LNUA 5FNVA 5LYJA 3W7UA 4J9YB 3QO7A 3TXSA 2VQEO 1J5EB 1PM9A 3QNEA 4DUZB 3JSLA 2Q5ZA 1VQKV 1DTOA 3TGUH 2CGOA 4EB6A 2YIBD 1Z5WA 1N33B 1YHQV 3I5DA 1ZL8A 5B1NA 4X64O 3CPWU 4B3SO 3DC5A 5IDJA 2JS3A 1HNZB 5LA6A 1YTFD 1RPRA 3ZRWB 1XHXA 1KUQA 1Q8IA 2E5LB 5HFLA 4D6TH 3CRCA 1N33O 4ABMA 1BGYH 2MW2B 1Q81W 1OCRB 3N2GB 4CH4A 1OCZB 5LP6A 3SJQC 2IW5A 3JAKB 5LXTA 1XL4A 4R7CA 2HLDG 4LH7A 3OE7G 3K79A 3AK1A 4NXMB 4WFBV 4JI2B 4N23A 1RM1C 3B2EE 2ZD9A 4MTOA 5H9CA 3G6EV 3KCYA 1HR0O 2ZDIA 2QTOA 4PI2A 5BR8O 3ABKC 1NJIW 1GTOA 4I50A 2LFSA 1FFXB 1HNXO 2JGDB 1PKXA 1ZSPA 2W0FC 3JD4A 1W59A 3BA8A 1WB7A 2PZSA 4YJ2B 3A0BZ 3CCEV 4J7KA 3UT5B 1AJPA 1D5AA 4O2AB 3RYIA 4MVZA 2QKCA 4YIPA 1G6UA 1EN5A 1FFXA 4DR5O 2JS5A 3LDCA 4DV2O 3ZHQA 4MT8A 5IWAO 2PYJA 5DN6G 4UCVA 1L1FA 2HVKC 1JPXA 4FLYA 2Q6AA 3GVMA 2WA3A 3SJAC 3QTCA 1BL8A 2X7RB 5KHHA 1IDSA 4J10A 2QTSA 5D5PA 5FL7G 4TWKA 3RN4A 1KKCA 1NS1A 4L87A 4R6ZA 4LF5B 4YJ3A 3LSSA 1YJ9V 2GTSA 2P67A 4X20A 5CA0A 2EIMB 2KKWA 5B1AB 1KC8W 1TGOA 4DUYB 3OMIB 1PL4A 4YIOA 1JJ2U 1QLEB 2A7WA 4B7KA 2ZIMA 3ZBHA 3DC6A 3K3WA 3MDSA 5KAIZ 3M99B 1KP2A 3DSQA 3OTFA 2WLLA 3SJCC 5K1PA 2QSAA 3CP1A 2BCCH 2HJDA 5HFMA 5IYZA 2PI4A 1OCOC 1NH2B 4WFHA 1BMFG 1VQMV 1AP5A 2RMKB 2AZ2A 4B3SB 4UB8Z 1Q82W 1YF2A 2M6YA 1XMOO 4RO2A 1OCCB 4FLWA 1A32A 5LP6B 4I0XB 4PA4A 5B66Z 1AROP 4FM0A 3ZEDA 1E1QG 3B40A 4EEQA 3R65A 2NLJC 1WA8A 4I9QA 2DYSC 4O4JB 4R8CA 2PI5A 2DOSA 1KU9A 4YJ3B 3UO3A 1FJGO 2LW1A 5EYPB 3ZS8C 4LP8A 4UFZA 4JI2O 4JYCA 4DW0A 4DV3O 1FYJA 5JWPA 2EX3A 2UUBO 4QIWF 2BTOA 2Q7EA 4BWAA 2ITCC 4GX1A 5EZYA 2YDEA 5KHJA 3AG4C 3ZRVA 4JPRA 5KUKA 1N34O 4DR1B 5BMVA 2EIKB 5EBLC 1W2BU 2Q0OC 4DV4O 4MVQA 1NVPD 3AG4B 1VQPV 2PUSA 1S5JA 5EC1C 3ZN1A 2UXBO 2A9HA 3UCSC 3IJ4A 3AG7A 1GAXA 4MS2A 3X2QC 3VQVA 4A5UB 4ZHQA 4DV3B 3ZN0A 5L3FA 2B5UA 5GTHZ 2IJKA 1IBLO 4JI3O 4TV9A 2CTQA 1VF6C 4WFGA 4CH3A 4RUFA 4AQYO 4MTXA 5L3EA 1VQ6V 4BIZA 4MVRA 4FLVA 4JI5O 3FAVA 1Q86W 2UXCB 4DR4B 1V54B 2ZM6O 3BAAA 4QPJA 4IIJB 5E79Z 2LGWA 2OCHA 2WLKA 2UUCB 1B04A 2RQ6A 2OWOA 4QGPA 1H2GA 1PP9H 3TJTA 3E22B 4G2KA 4PDVA 1VEWA 4UV8A 1M4UA 4FFKA 4GX2A 4FVMA 2WLLB 4ASUG 4P30A 3D8CA 1E1RG 3L75H 2CH7B 1LUWA 1MSWD 3E89A 5GONB 3KZIZ 1AR4A 3OTOO 2UU9B 4B3RO 4YXWG 3O65A 4MVSA 1H2LA 3CCMV 4I5SA 2JDIG 1AVMA 1V55B 4X62B 2NN4A 2BOBC 1DLBA 1SQBH 1YITV 5CBFA 4JV5O 3E83A 5J2UA 5ITZB 1BQ0A 4P9PA 3K08A 4F4LA 4DR2B 3ZMZA 2LO1A 5KMGB 3E8FA 5JVDA 2PY5A 4LF4O 4I4TA 1SRYA 1AR5A 1BHAA 4X1YB 2V4DA 3C3SA 3JCUZ 3CWBH 1NQTA 3JALA 1Q43A 1VF7A 3GWOA 4MVOA 3P3NA 1FKAO 3G80A 4HBNA 1MMMA 2OYQA 2OT5A 5LOVB 2KSDA 2B1GA 3JATA 3SPJA 1R6KA 3JALB 3EVKA 1QR8A 4JYYA 3FX7A 2GDSA 1GM7A 1YJNV 2WLJA 2HVJC 2DMXA 5EBMC 5LGTA 3CCSV 4JI7B 1K7DA 2ZE8A 4YY3O 4ZBMA 3K9SA 4YJ2A 1WJZA 2O57A 4DV6O 1M90W 1U97A 4H13B 3L70H 3WB0A 4JTDB 4DV7B 2E5LO 3HKEA 4I50B 1M9NA 1M56C 3QG5A 4W4KA 4DV0O 2OIGA 4B3TO 4DV1B 1WNSA 3G6BA 4IHJB 4TUYB 4FFBB 1VQNV 4QE9A 4DR7O 1JA8A 4PA6A 2QM4A 5KA6A 2QEXV 2ZCEA 3VBBA 5K1XA 1TUBA 4YHHB 3RFRA 1KB9F 4DR4O 4UCOA 5LA6B 2KQXA 2R9RB 1ZAUA 3CXCU 5EIBC 4B3MO 3B09A 3A2FA 3ETQA 2EZOA 4FLXA 1JR9A 2F43G 1YZBA 3ZX6A 4X9QA 1D2DA 2QM7A 4XDJA 3U0ZA 4ZOLB 3G67A 1SQPH 3VQYA 3W7WA 1SZTA 3JATB 4P2ZA 2QWNB 3RYFB 4EFBA 1BZKA 4W4LA 1DF4A 4DK0A 4B3RB 5LMNB 4FLTA 1JFFB 2QM8A 4Q6GA 1Y74B 2EIJC 1N34B 4PHZA 4JAUA 2RCVA 3AK2A 3L74H 4PI0A 2ZDIC 4LFBO 3E22A 1DF5A 1FXVA 2IM9A 3K04A 4UV9A 2NR5A 5KHGA 4N21A 1XUQA 4UCSA 1AJNA 1KP3A 1XL6A 1LUVA 1R3KC 3L72H 3W7SA 2BTQA 3OT7A 3A8TA 1FXKA 3SPIA 1BT8A 1WAZA 4LWSB 3AG1C 1M57B 5B1AC 2ODMA 1U96A 3BABA 3BHPA 2OTLV 4GKKB 2UXCO 5LOVA 2Z3YA 1JOYA 3C90A 1OCRC 4WBNA 3HKCB 4WFAV 1TUEB 3ZRXA 2QA4V 3A0RA 1HNZO 4ZI7B 5B5EZ 1FS0G 3APOA 3RW0A 2YIAA 3JAWA 1N4CA 4LR3A 5BY1A 1YDXA 4JF3A 3HR0A 4JI6O 3RVZA 4MVUA 4GYCB 4KP4A 3FKSG 3APQA 3B77A 1Q6UA 5BMVB 4ZOLA 1EBOA 1H2KA 3E86A 3OMAB 4J7ZA 3KG2A 2EBOA 1K33A 1S0VA 4D7TA 4FIPC 1K3EA 2DYRC 3ABTA 1J5EO 1HNWO 4FJCC 3CRRA 3WU2Z 3BVOA 3EFFK 2DQ0A 1MZEA 3RT3C 3MHSC 5JCOA 1Q90D 2ETNA 2JEXA 1H2SB 2IH1C 3CCVV 5GTIZ 4LF8B 1TA8A 4B3TB 4JZ2A 5CB4B 5KA5A 4MSWC 4F6RA 4K0KB 3RYHA 3K59A 4K8XA 3T4DA 1GO3F 5LP6C 5EIBD 2LFRA 4WFFA 2X6BA 4CZZA 2RJZA 1OCCC 4HAMA 3LSUA 1ZWIC 4KFMA 2P22C 2XT9A 4X65B 3RYFA 2OTJV 1M93A 2HEPA 1G8MA 3J81N 5J2TB 1H38A 3CYOA 2ATKC 4O4LA 4QPKA 1S77D 4KXRA 5L3CA 4O4IA 2FTKA 1WN7A 1VQOV 1AR1B 3WB2A 2B9ZA 1RP3B 1NTZH 2ADQB 3JCZA 4NR1A 4K0KO 2ZT9B 3H1HH 3X2QB 5LYJB 4L8JA 2UXDB 3STZC 5BXZA 5BR8B 1DK1A 1HP8A 2YXYA 1MOFA 2F93B 3SYCA 2VRZA 2QWQB 5EC2C 3BFRA 4JYAO 2B1IA 2EILB 3QVNA 4U3JA 1AI7A 2GV9A 3CHXA 5IE9A 3AG3C 2GHYA 2UUCO 2P06A 2MK3A 1IXMA 4TQFA 1H8EG 4LF9O 4X66B 4KHPO 1FXHA 3SPGA 2WLHA 4FFBA 2V1DA 5GW7A 3JARB 3OTOB 1N8RW 2UU9O 5H6RA 4JI6B 1YIJV 2QWPB 1GM8A 1M56B 3CJHA 1XMQB 2M7WA 1F4NA 4QE7A 4UUJC 3A0HZ 3S3WA 2F95B 3ASOC 4O2BB 2YEVB 2UUAO 5TISZ 4RWUA 1I5YA 3K58A 1NU1H 3O9OA 1SQVH 2VWKA 3SPHA 3CCQV 4E2LA 1XEQA 2XAQA 4U7OA 3ZJZA 3ASNC 3D36C 2P6JA 1PPJH 2FYUH 4O4IB 3JYCA 4X64B 4UXNA 4X1YA 3SDLA 1MSDA 1LNQA 5LHIA 5F2VO 5JH7A 2WLNA 1SETA 5IT9N 3HPLC 2WLIB 4U3JB 2CUGA 3FB7C 1URFA 1GM9A 4IHJA 1MZFA 4O2AA 5A2QN 2A06H 4GCZA 4TOIA 1M57C 2FKXA 2XAFA 2LQTA 2UXBB 1AJQA 2CTWA 4XDKA 1V55C 1AP6A 2ZE5A 4DR1O 1KBHA 1XBLA 2XHBA 3JASB 3CRAA 4GKJO 2P5OA 3LDDA 3CMAV 1YI2V 1F51A 3C3TA 1R3IC 4CS3A 4DXWA 3RGBA 2C2AA 1W0JG 2ZXWC 5GONA 5IJ0B 2EZPA 3OGCC 3OW2U 3D3IA 5H6QA 5ITZA 4H33A 4MTFA 5LMNO 3FB8C 3G71V 3K5OA 2F1MA 5H5NA 2DQ3A 2JJ1G 4BIUA 3PJSK 3U11A 1JVMA 5D5QA 4BAYA 4JI7O 3ZHUA 1Q5OA 3JAKA 2HHHO 3VOUA 5IJ9B 5KUMA 3IGAC 1WB8A 4OPHA 1X59A 1NR1A 2W0XA 1HNXB 1AI5A 2F23A 2QKSA 2QWRB 1Y6XA 3ZRWA 3RVYA 2YUAA 1VQLV 2A79B 5KHIA 4CH6A 4D7SA 5LHHA 2Y0IA 3R66A 1I0HA 4FLUA 2QKAA 3L71H 5KX5B 2AZ0A 3E35A 3K03A 3HKCA 3OUFA 4G28B 1X4TA 1SQXH 2VWJA 2R70A 3ICXA 1Y66A 4O4LB 3B8NA 3CRMA 3ZMVA 4X62O 5KLVH 4X66O 4KHPB 2Q0AA 2H3OA 2WA4A 5KHKA 1BQZA 2WPDG 1KMIZ 3N2KA 1IX9A 5E1AC 5KX5A 2D3OW 4NXNB 3RYHB
chains in the Genus database with same CATH topology
4OX9O 3J80N 4DV0O 1N36O 4JI1O 4K0KO 4DR1O 1HNZO 1HNXO 2LW7A 4DUYO 4B3TO 4GKJO 1XNRO 1IBKO 4JI8O 5BXZA 2VQEO 1DK1A 4DR7O 5BY1A 4JI0O 3OTOO 2DOSA 4LFAO 1FJGO 4JI6O 4B3RO 2AGAA 3O65A 4JYAO 3JAMN 4DV1O 1R6TA 4JI2O 1FYJA 4DR5O 4DV3O 2UUBO 4DR4O 4DV2O 4DR6O 4JI4O 2F4VO 5IWAO 5LMNO 4JV5O 4B3MO 1G1XB 5H5NA 3J7AU 1XMQO 4LF8O 5LL6Y 4X64O 2DJVA 4B3SO 4JI7O 4LF5O 1J5EO 4OPAA 1R1BA 2UUCO 4NXMO 2HHHO 4YHHO 2ZKOA 1HNWO 1YZBA 1D2DA 2JRIA 1N34O 4LF4O 4LF9O 1IBMO 4KHPO 4LF6O 1AB3A 2UXDO 3RT3C 4OPHA 1X59A 4DV4O 1NS1A 4DR3O 4DUZO 2UU9O 2UXBO 4GKKO 4X65O 3F5TA 3T1YO 4NXNO 1KUQA 1FKAO 2VQFO 4DR2O 4A5UB 1N33O 5FLXN 2UUAO 1IBLO 4JI3O 3R66A 3T1HO 1N32O 1I94O 4LFBO 4AQYO 4DV5O 1AILA 1XEQA 5LMUO 4DV7O 4JI5O 1XNQO 4X62O 2ZM6O 4X66O 1F7YA 3SDLA 2N74A 4YY3O 3J81N 5IT9N 3M8AA 4LFCO 4DV6O 1HR0O 2UXCO 1XMOO 5BR8O 5A2QN 2Z0AA 4LF7O 2E5LO 2FKXA 1A32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OX9 O;  3J80 N;  4DV0 O;  1N36 O;  4JI1 O;  4K0K O;  4DR1 O;  1HNZ O;  1HNX O;  2LW7 A;  4DUY O;  4B3T O;  4GKJ O;  1XNR O;  1IBK O;  4JI8 O;  5BXZ A;  2VQE O;  1DK1 A;  4DR7 O;  5BY1 A;  4JI0 O;  3OTO O;  2DOS A;  4LFA O;  1FJG O;  4JI6 O;  4B3R O;  2AGA A;  3O65 A;  4JYA O;  3JAM N;  4DV1 O;  1R6T A;  4JI2 O;  1FYJ A;  4DR5 O;  4DV3 O;  2UUB O;  4DR4 O;  4DV2 O;  4DR6 O;  4JI4 O;  2F4V O;  5IWA O;  5LMN O;  4JV5 O;  4B3M O;  1G1X B;  5H5N A;  3J7A U;  1XMQ O;  4LF8 O;  5LL6 Y;  4X64 O;  2DJV A;  4B3S O;  4JI7 O;  4LF5 O;  1J5E O;  4OPA A;  1R1B A;  2UUC O;  4NXM O;  2HHH O;  4YHH O;  2ZKO A;  1HNW O;  1YZB A;  1D2D A;  2JRI A;  1N34 O;  4LF4 O;  4LF9 O;  1IBM O;  4KHP O;  4LF6 O;  1AB3 A;  2UXD O;  3RT3 C;  4OPH A;  1X59 A;  4DV4 O;  1NS1 A;  4DR3 O;  4DUZ O;  2UU9 O;  2UXB O;  4GKK O;  4X65 O;  3F5T A;  3T1Y O;  4NXN O;  1KUQ A;  1FKA O;  2VQF O;  4DR2 O;  4A5U B;  1N33 O;  5FLX N;  2UUA O;  1IBL O;  4JI3 O;  3R66 A;  3T1H O;  1N32 O;  1I94 O;  4LFB O;  4AQY O;  4DV5 O;  1AIL A;  1XEQ A;  5LMU O;  4DV7 O;  4JI5 O;  1XNQ O;  4X62 O;  2ZM6 O;  4X66 O;  1F7Y A;  3SDL A;  2N74 A;  4YY3 O;  3J81 N;  5IT9 N;  3M8A A;  4LFC O;  4DV6 O;  1HR0 O;  2UXC O;  1XMO O;  5BR8 O;  5A2Q N;  2Z0A A;  4LF7 O;  2E5L O;  2FKX A;  1A32 A; 
#chains in the Genus database with same CATH topology
 2P90 A;  4RQE A;  3WFV A;  1SQF A;  4TV8 B;  4DUY O;  1H2M A;  2JIZ G;  4X1I B;  3RBZ A;  2GBO A;  3JD0 A;  4JI0 O;  5CMU A;  4LFA O;  3ZMU A;  3K5M A;  2X6A A;  3FFQ A;  5CN0 A;  3CCU V;  4JI4 O;  5EZY B;  4DO2 A;  5KMG A;  2P7T C;  2ZIN A;  1ENV A;  4FK5 C;  4DV5 B;  3CRQ A;  1YTF B;  4RAI A;  4NTY A;  3K5L A;  2Y4T A;  1FAF A;  3MHH C;  1XRE A;  2OIE A;  1RPO A;  4Z2W A;  4GT1 A;  1IBL B;  2Q9L A;  3AG3 B;  3B8M A;  3ZHV A;  5FNV B;  4C7U A;  5LGN A;  3JAW B;  4FMT A;  3RYC B;  2XAG A;  4DR7 B;  4JTC B;  1JFF A;  1GK9 A;  4OXS A;  1XQ8 A;  3T4Z A;  4DR6 B;  5L3D A;  5EK0 A;  3ZMS A;  1FPO A;  3H01 A;  1HR0 B;  2QJ1 A;  4GKJ B;  1JQ0 A;  3N27 A;  1D5N A;  1AIL A;  4ICG A;  4MW8 A;  4DV7 O;  1I08 A;  1KYO F;  2A0L A;  1Y4M A;  3IAY A;  4PDL A;  1UPG A;  4IYH A;  1W0K G;  1YVW A;  4WF9 V;  1N0J A;  2HFE C;  1SQQ H;  4NVP A;  4UB6 Z;  3ASN B;  1Q6I A;  2HR3 A;  4X88 A;  3UQ8 A;  2ADP A;  1HNW B;  3CC4 V;  3LUT B;  2EUL A;  1PNM A;  1SA0 B;  1CPY A;  1EZV H;  3GB7 C;  1B06 A;  1Q6H A;  3E8H A;  4TV9 B;  4U7N A;  5DED A;  3J80 N;  3TXQ A;  1OJH A;  2ARH A;  1XNR O;  1SKV A;  5LBQ A;  3UT5 A;  2DWD C;  1K5S A;  4FZ1 A;  3H1J H;  4UCR A;  1XNQ B;  1S5H C;  1VQ5 V;  2AXT Z;  1IXB A;  5CA0 B;  2WLI A;  4E4E A;  1HWY A;  3BCC H;  3DTU B;  4CS2 A;  3K06 A;  4JAA A;  5JQG A;  4BR6 A;  1N32 B;  4HYO A;  4JAV A;  1US6 A;  3K9A A;  5J2T A;  3J7A U;  3JSN A;  4X1K B;  1BS3 A;  3DGE A;  3LNN A;  4YHH O;  2UUB B;  2GSM B;  1N36 B;  4RUE A;  3OGI B;  1AB3 A;  2EIN B;  2FB5 A;  1F23 A;  2XAS A;  2Q67 A;  3ETD A;  4DUZ O;  2Q4P A;  1Y74 A;  1NTM H;  3T1Y O;  1WA8 B;  3OEE G;  4NXN O;  2CTR A;  3DXR B;  5FPR A;  2Q7H A;  1JMK C;  1TVK A;  2YEV A;  2GUZ A;  2EIN C;  4KUM A;  4IYI A;  1XOU A;  1L8D A;  2K1E A;  3HKD B;  4MTG A;  3CSX A;  3BA9 A;  2Y69 B;  2QR4 A;  4LF4 B;  3CE2 A;  4CS4 A;  3PN1 A;  2IU0 A;  1V54 C;  2H94 A;  4HZ3 A;  1PNK A;  1GH6 A;  1ZLZ A;  4I55 B;  5H2F Z;  1PD3 A;  1R6N A;  2LJ2 A;  2CH7 A;  1JJO A;  2ZR2 A;  5B1B B;  4K8Z A;  2CAZ C;  3HKD A;  2Y69 C;  4CC5 A;  5JJE B;  3QO8 A;  1OCO B;  5FPO A;  5LGU A;  2ILM A;  5BZB A;  3K5N A;  4TSF G;  3JD2 A;  5CA1 B;  2FL4 A;  5J9P C;  3CX5 F;  2XAH A;  1YCI A;  3ABU A;  2XAJ A;  3ZHR A;  1UFI A;  1E79 G;  2VS0 A;  4PDM A;  3P30 A;  2QE7 G;  4J9Z B;  4LC1 A;  4DR6 O;  3FYI B;  5IYB O;  2E75 B;  3LSQ A;  4BIO A;  3E8B A;  4LF5 O;  1J95 A;  3FB6 C;  1QU7 A;  2BTQ B;  2N04 A;  4GX5 A;  4DV6 B;  2LP7 A;  1DGS A;  3SR2 C;  4LBE C;  3JD1 A;  2E3C A;  1BE3 H;  4AI8 A;  1IBK B;  2RNB A;  5JCO C;  3FB5 C;  1KQS U;  3E8G A;  3NR7 A;  1IUR A;  3ABM B;  4MVM A;  1K34 A;  2CE4 A;  4NTW A;  4O4J A;  4GLX A;  3IC9 A;  4F6R B;  2KG7 B;  4PV1 B;  2BE3 A;  2WAM A;  1N32 O;  5AG2 A;  1WLE A;  4JYA B;  1YJW V;  1SA0 A;  1Z2G A;  3K57 A;  2UXN A;  3FYE B;  2W6I G;  4H37 A;  4P9O A;  4LWS A;  3WB1 A;  1XMO B;  5J2U B;  5JJN B;  4X89 A;  1F7Y A;  2FML A;  1HDJ A;  3MD0 A;  3K0G A;  4DV4 B;  1VQ4 V;  1R73 A;  2QGN A;  4FM1 A;  2N05 A;  3T1H B;  4JV5 B;  1VQ7 V;  3SJB C;  2VQE B;  3UO2 A;  3ZHS A;  5CB4 A;  2IJI A;  4FPP A;  2EJR A;  1NI8 A;  3T1Y B;  4WFE A;  1N36 O;  3ZCC A;  4UVC A;  4JI1 O;  4PA7 A;  2RN9 A;  1PV0 A;  2R72 A;  1I7F A;  1PL0 A;  2CTP A;  2ZNI A;  4LFB B;  4UCU A;  4FM2 A;  5DEC A;  5LHG A;  2LGQ A;  3ASO B;  2W6J G;  1K73 W;  2Y0P A;  1R6T A;  1VQ9 V;  1S76 D;  2A3Q A;  3F7V C;  1RFY A;  4FZ0 A;  2E74 B;  1XNR B;  3LNM B;  3GWK C;  5B3S B;  5LL6 Y;  4Z1V A;  1K4C C;  1YEW A;  2JRI A;  3VQX A;  3QO5 A;  1VAR A;  5IYZ B;  4J7J A;  3CCJ V;  3TET A;  4DRX B;  3CC7 V;  3DXR A;  1FXK B;  3SPC A;  2ZE7 A;  1P84 F;  1H8H G;  1THZ A;  3L73 H;  1VQ8 V;  4YY3 B;  4UVB A;  3H1L H;  4JI3 B;  1Y67 A;  2WLM A;  4GKK O;  1MG1 A;  5C8Y B;  1BCC H;  1G4Y B;  4LCU C;  1EN6 A;  2K9P A;  3I55 V;  2JGD A;  1K92 A;  4Q20 A;  1XHZ A;  1JX9 A;  3CB2 A;  3ETE A;  1P7B A;  1Q3E A;  2XND G;  3BEH A;  4LFC B;  2KB1 A;  4DR3 B;  4I4T B;  4EKW A;  5A9G A;  3N2K B;  2Q68 A;  2AHZ A;  1K5Q A;  4IT5 A;  3RYI B;  1Q7Y W;  1WPB A;  2CK3 G;  1SC5 B;  1TUB B;  4TT3 G;  1T5E A;  3M8A A;  1COW G;  2DWE C;  2YIB A;  2CGN A;  4O2B A;  3ABK B;  4ZKI A;  2Z0A A;  2EIL C;  3JAS A;  1O9G A;  1VF5 B;  4FLZ A;  4JGS A;  3OM3 B;  4OX9 O;  3OMN B;  1EN4 A;  2GUZ B;  5IWA B;  3E2E A;  4WCE V;  1KKD A;  1TAE A;  4JI8 O;  1K9M W;  2H8P C;  4K35 A;  1NT2 B;  4JTA B;  1P49 A;  2YXL A;  3W7T A;  1EFR G;  1SES A;  4B3M B;  1Y76 A;  1I94 B;  4I7Z B;  1IBM B;  1YSC A;  1SZX A;  2F66 C;  4PEL A;  1FD9 A;  1NH2 D;  4B08 A;  3OR7 C;  2DN9 A;  2V7Q G;  4CH5 A;  3HKB B;  1QBZ A;  2IBZ H;  1ZTE A;  1XMQ O;  2EJ7 A;  2DJV A;  5C93 A;  4IIJ A;  4O4H B;  4OPA A;  4NXM O;  3SGI A;  1M5I A;  3LDE A;  4J41 A;  2ZKO A;  3U10 A;  5B3S C;  2XOK G;  3OR6 C;  3T1C A;  2L6L A;  1Z5V A;  2JVD A;  1H2N A;  1IBM O;  1WP7 A;  5LXT B;  4LF6 O;  2YS8 A;  2VQF B;  2WWW A;  4I9W A;  4PA3 A;  2JK5 C;  2XUM A;  5B1B C;  5IJ0 A;  2JJ2 G;  1EM1 A;  2PTM A;  3JAR A;  3BY6 A;  1OCZ C;  3AEI A;  3HKE B;  3B4S A;  3CS5 A;  3FD9 A;  3H1K H;  2YI9 A;  2PF4 E;  4K3A A;  4AHC A;  2YID A;  4WBN B;  3AG1 B;  4JI1 B;  4TQD A;  3P32 A;  2Z5U A;  5CBH A;  5EBW C;  5LMU O;  4BW5 A;  4LF7 B;  3JD3 A;  2F4V B;  2QDO A;  4X1K A;  4EB6 B;  1QCE A;  2DW4 A;  5IY5 B;  2R9A A;  1XI1 A;  4DK1 A;  2N74 A;  2ZNJ A;  1ZL8 B;  2ITD C;  5LMU B;  1IVS A;  1UJW B;  3OD4 A;  4CBC A;  4X1I A;  3H9V A;  1VMG A;  1QR9 A;  2YIC A;  3ZIA G;  1F4M A;  1ZX3 A;  2NNU A;  1EZJ A;  4NB5 A;  1VP7 A;  2ZM6 B;  4JYB A;  1L0L H;  4ZIB A;  1XDC A;  2Q8V A;  1I5X A;  1VIB A;  3ABL C;  4MW3 A;  4DRX A;  4HNA B;  1NTK H;  2P4K A;  2EIJ B;  3VQW A;  1M1K W;  1CXZ B;  4F6E A;  1HW7 A;  3TCU A;  1OZ0 A;  4I55 A;  4QNH B;  4LF8 O;  2ZXW B;  4JI0 B;  2HKO A;  4QJF B;  4LFA B;  2ZIO A;  4H44 B;  3TK1 A;  4RQF A;  2IH3 C;  3S3X A;  4DW1 A;  5L3B A;  4XBF A;  1QQC A;  1K4D C;  2EIK C;  4J80 A;  1R3L C;  1GRJ A;  3OAA G;  3H1I H;  3RYC A;  4B7E A;  2HJF C;  4X65 O;  3AG2 B;  1B3Q A;  2IU3 A;  4HNA A;  1GMG A;  1YXB A;  4TV8 A;  3RWR D;  1FJG B;  4LNU B;  1QVG U;  1KD1 W;  5FLX N;  3CEI A;  1R3J C;  4ZHQ B;  1VF6 A;  3T1H O;  2XTA A;  1QHT A;  4GZR B;  3L9D A;  2ZR3 A;  5JJJ B;  3SYP A;  3Q4H A;  1NVP B;  1XNQ O;  5IY5 C;  3IC7 A;  5IJ9 A;  3KKY A;  2X6C A;  2UUA B;  1K8A W;  4XDL A;  4PD4 F;  4IGG A;  1GN2 A;  5CA3 A;  5IYD O;  2OCC C;  1PNL A;  2YC0 A;  5JH7 B;  1MA1 A;  4LFC O;  2AW9 A;  2Q7G A;  3HB3 B;  4H0L B;  3K0D A;  4KL1 A;  4ZI7 A;  3WG7 B;  2BOC C;  2IJH A;  1P7G A;  1GN6 A;  3HKB A;  1WPX A;  4LF9 B;  4EFE A;  4UVA A;  2LW7 A;  4U3F H;  2CDY A;  3CME V;  3KCX A;  3OUS A;  3AK3 A;  4X20 B;  4OGQ B;  2P4V A;  3T2M A;  4JI5 B;  4OX9 B;  2YSU B;  4AQY B;  2AGA A;  4TUY A;  4DV0 B;  2Q69 A;  2G38 A;  3P3P A;  4NTX A;  3JAM N;  4DV1 O;  3BPZ A;  4GUN A;  1NKD A;  5IYC O;  3EHB B;  2F4V O;  4G27 B;  1CP9 A;  3CCR V;  2RDC A;  1SS3 A;  1G1X B;  3D3Q A;  2DYS B;  4DYL A;  3W7X A;  1R1B A;  4Z1M G;  3CC2 V;  2JEU A;  5EYP A;  1WP8 A;  1S3J A;  3G4S V;  4J42 A;  2PGG A;  3ZMT A;  5CA1 A;  3CJH B;  3SYO A;  4LH6 A;  4DV2 B;  4DR3 O;  1MNG A;  1ROP A;  3F5W C;  1BSM A;  3F5T A;  4I0X A;  2DE0 X;  2YXH A;  1SER A;  2VQF O;  4DR2 O;  1B6Q A;  3UM7 A;  4O4H A;  4UCT A;  4DV5 O;  4IL6 Z;  2BSK A;  1BHB A;  2X0L A;  2IJJ A;  2D2C B;  3MAQ A;  2OCC B;  2HP8 A;  3BRC A;  4NYK A;  1N0N A;  2ZE6 A;  4X8A A;  1JCH A;  1FXK C;  2WSS G;  3FAV B;  1K97 A;  4PDR A;  5JVD B;  1QVF U;  4CC6 A;  3CXH F;  3ZRS A;  3WG7 C;  2BSK B;  2EIM C;  3N2G A;  3CCL V;  3EXA A;  1KEC A;  1RSO A;  1IZ3 A;  2Y48 A;  3OEH G;  3Q4H B;  3OFN G;  1ORQ C;  3M7M X;  1RM1 B;  3SYA A;  5B1O A;  4GX0 A;  1IBK O;  1XIL A;  1ZUQ A;  2L35 A;  1RSO B;  3STL C;  2Y4U A;  2UXX A;  1SQG A;  2E76 B;  1GN4 A;  2GTA A;  4LF6 B;  3CD6 V;  5JQG B;  3THO A;  3NXS A;  5KAF Z;  4PA9 A;  4R50 A;  2JGU A;  3ETG A;  4JI4 B;  5DM6 V;  4AIL C;  1GKF A;  2ZQM A;  5C8Y A;  1L0N H;  2UXD O;  1NR7 A;  1Y76 B;  3IFX A;  3I56 V;  1LR1 A;  2HHH B;  4NKG B;  3ML0 A;  1AI6 A;  4PJ0 Z;  1NZ6 A;  1CEZ A;  1MAB G;  3QF7 A;  4JI8 B;  4DR5 B;  2KG7 A;  1GN3 A;  1SF9 A;  4JZG A;  4JAS A;  1I94 O;  3UKM A;  1S72 V;  1QLN A;  5CBG A;  1S5L Z;  3ZHT A;  3AG2 C;  1OHH G;  2R9I A;  3SYQ A;  1O9H A;  2AHY A;  3ABL B;  1P4R A;  3F7Y C;  1FFT B;  4BW9 A;  2HG5 C;  1QNM A;  1OV9 A;  4J11 A;  2QWO B;  1V9P A;  2PYL A;  1QLE C;  2Q73 A;  1AI4 A;  3D36 A;  5L3G A;  4LF7 O;  2YI8 A;  1NBM G;  3ABM C;  1TVK B;  2DYR B;  4LNU A;  5FNV A;  5LYJ A;  3W7U A;  4J9Y B;  3QO7 A;  3TXS A;  2VQE O;  1J5E B;  1PM9 A;  3QNE A;  4DUZ B;  3JSL A;  2Q5Z A;  1VQK V;  1DTO A;  3TGU H;  2CGO A;  4EB6 A;  2YIB D;  1Z5W A;  1N33 B;  1YHQ V;  3I5D A;  1ZL8 A;  5B1N A;  4X64 O;  3CPW U;  4B3S O;  3DC5 A;  5IDJ A;  2JS3 A;  1HNZ B;  5LA6 A;  1YTF D;  1RPR A;  3ZRW B;  1XHX A;  1KUQ A;  1Q8I A;  2E5L B;  5HFL A;  4D6T H;  3CRC A;  1N33 O;  4ABM A;  1BGY H;  2MW2 B;  1Q81 W;  1OCR B;  3N2G B;  4CH4 A;  1OCZ B;  5LP6 A;  3SJQ C;  2IW5 A;  3JAK B;  5LXT A;  1XL4 A;  4R7C A;  2HLD G;  4LH7 A;  3OE7 G;  3K79 A;  3AK1 A;  4NXM B;  4WFB V;  4JI2 B;  4N23 A;  1RM1 C;  3B2E E;  2ZD9 A;  4MTO A;  5H9C A;  3G6E V;  3KCY A;  1HR0 O;  2ZDI A;  2QTO A;  4PI2 A;  5BR8 O;  3ABK C;  1NJI W;  1GTO A;  4I50 A;  2LFS A;  1FFX B;  1HNX O;  2JGD B;  1PKX A;  1ZSP A;  2W0F C;  3JD4 A;  1W59 A;  3BA8 A;  1WB7 A;  2PZS A;  4YJ2 B;  3A0B Z;  3CCE V;  4J7K A;  3UT5 B;  1AJP A;  1D5A A;  4O2A B;  3RYI A;  4MVZ A;  2QKC A;  4YIP A;  1G6U A;  1EN5 A;  1FFX A;  4DR5 O;  2JS5 A;  3LDC A;  4DV2 O;  3ZHQ A;  4MT8 A;  5IWA O;  2PYJ A;  5DN6 G;  4UCV A;  1L1F A;  2HVK C;  1JPX A;  4FLY A;  2Q6A A;  3GVM A;  2WA3 A;  3SJA C;  3QTC A;  1BL8 A;  2X7R B;  5KHH A;  1IDS A;  4J10 A;  2QTS A;  5D5P A;  5FL7 G;  4TWK A;  3RN4 A;  1KKC A;  1NS1 A;  4L87 A;  4R6Z A;  4LF5 B;  4YJ3 A;  3LSS A;  1YJ9 V;  2GTS A;  2P67 A;  4X20 A;  5CA0 A;  2EIM B;  2KKW A;  5B1A B;  1KC8 W;  1TGO A;  4DUY B;  3OMI B;  1PL4 A;  4YIO A;  1JJ2 U;  1QLE B;  2A7W A;  4B7K A;  2ZIM A;  3ZBH A;  3DC6 A;  3K3W A;  3MDS A;  5KAI Z;  3M99 B;  1KP2 A;  3DSQ A;  3OTF A;  2WLL A;  3SJC C;  5K1P A;  2QSA A;  3CP1 A;  2BCC H;  2HJD A;  5HFM A;  5IYZ A;  2PI4 A;  1OCO C;  1NH2 B;  4WFH A;  1BMF G;  1VQM V;  1AP5 A;  2RMK B;  2AZ2 A;  4B3S B;  4UB8 Z;  1Q82 W;  1YF2 A;  2M6Y A;  1XMO O;  4RO2 A;  1OCC B;  4FLW A;  1A32 A;  5LP6 B;  4I0X B;  4PA4 A;  5B66 Z;  1ARO P;  4FM0 A;  3ZED A;  1E1Q G;  3B40 A;  4EEQ A;  3R65 A;  2NLJ C;  1WA8 A;  4I9Q A;  2DYS C;  4O4J B;  4R8C A;  2PI5 A;  2DOS A;  1KU9 A;  4YJ3 B;  3UO3 A;  1FJG O;  2LW1 A;  5EYP B;  3ZS8 C;  4LP8 A;  4UFZ A;  4JI2 O;  4JYC A;  4DW0 A;  4DV3 O;  1FYJ A;  5JWP A;  2EX3 A;  2UUB O;  4QIW F;  2BTO A;  2Q7E A;  4BWA A;  2ITC C;  4GX1 A;  5EZY A;  2YDE A;  5KHJ A;  3AG4 C;  3ZRV A;  4JPR A;  5KUK A;  1N34 O;  4DR1 B;  5BMV A;  2EIK B;  5EBL C;  1W2B U;  2Q0O C;  4DV4 O;  4MVQ A;  1NVP D;  3AG4 B;  1VQP V;  2PUS A;  1S5J A;  5EC1 C;  3ZN1 A;  2UXB O;  2A9H A;  3UCS C;  3IJ4 A;  3AG7 A;  1GAX A;  4MS2 A;  3X2Q C;  3VQV A;  4A5U B;  4ZHQ A;  4DV3 B;  3ZN0 A;  5L3F A;  2B5U A;  5GTH Z;  2IJK A;  1IBL O;  4JI3 O;  4TV9 A;  2CTQ A;  1VF6 C;  4WFG A;  4CH3 A;  4RUF A;  4AQY O;  4MTX A;  5L3E A;  1VQ6 V;  4BIZ A;  4MVR A;  4FLV A;  4JI5 O;  3FAV A;  1Q86 W;  2UXC B;  4DR4 B;  1V54 B;  2ZM6 O;  3BAA A;  4QPJ A;  4IIJ B;  5E79 Z;  2LGW A;  2OCH A;  2WLK A;  2UUC B;  1B04 A;  2RQ6 A;  2OWO A;  4QGP A;  1H2G A;  1PP9 H;  3TJT A;  3E22 B;  4G2K A;  4PDV A;  1VEW A;  4UV8 A;  1M4U A;  4FFK A;  4GX2 A;  4FVM A;  2WLL B;  4ASU G;  4P30 A;  3D8C A;  1E1R G;  3L75 H;  2CH7 B;  1LUW A;  1MSW D;  3E89 A;  5GON B;  3KZI Z;  1AR4 A;  3OTO O;  2UU9 B;  4B3R O;  4YXW G;  3O65 A;  4MVS A;  1H2L A;  3CCM V;  4I5S A;  2JDI G;  1AVM A;  1V55 B;  4X62 B;  2NN4 A;  2BOB C;  1DLB A;  1SQB H;  1YIT V;  5CBF A;  4JV5 O;  3E83 A;  5J2U A;  5ITZ B;  1BQ0 A;  4P9P A;  3K08 A;  4F4L A;  4DR2 B;  3ZMZ A;  2LO1 A;  5KMG B;  3E8F A;  5JVD A;  2PY5 A;  4LF4 O;  4I4T A;  1SRY A;  1AR5 A;  1BHA A;  4X1Y B;  2V4D A;  3C3S A;  3JCU Z;  3CWB H;  1NQT A;  3JAL A;  1Q43 A;  1VF7 A;  3GWO A;  4MVO A;  3P3N A;  1FKA O;  3G80 A;  4HBN A;  1MMM A;  2OYQ A;  2OT5 A;  5LOV B;  2KSD A;  2B1G A;  3JAT A;  3SPJ A;  1R6K A;  3JAL B;  3EVK A;  1QR8 A;  4JYY A;  3FX7 A;  2GDS A;  1GM7 A;  1YJN V;  2WLJ A;  2HVJ C;  2DMX A;  5EBM C;  5LGT A;  3CCS V;  4JI7 B;  1K7D A;  2ZE8 A;  4YY3 O;  4ZBM A;  3K9S A;  4YJ2 A;  1WJZ A;  2O57 A;  4DV6 O;  1M90 W;  1U97 A;  4H13 B;  3L70 H;  3WB0 A;  4JTD B;  4DV7 B;  2E5L O;  3HKE A;  4I50 B;  1M9N A;  1M56 C;  3QG5 A;  4W4K A;  4DV0 O;  2OIG A;  4B3T O;  4DV1 B;  1WNS A;  3G6B A;  4IHJ B;  4TUY B;  4FFB B;  1VQN V;  4QE9 A;  4DR7 O;  1JA8 A;  4PA6 A;  2QM4 A;  5KA6 A;  2QEX V;  2ZCE A;  3VBB A;  5K1X A;  1TUB A;  4YHH B;  3RFR A;  1KB9 F;  4DR4 O;  4UCO A;  5LA6 B;  2KQX A;  2R9R B;  1ZAU A;  3CXC U;  5EIB C;  4B3M O;  3B09 A;  3A2F A;  3ETQ A;  2EZO A;  4FLX A;  1JR9 A;  2F43 G;  1YZB A;  3ZX6 A;  4X9Q A;  1D2D A;  2QM7 A;  4XDJ A;  3U0Z A;  4ZOL B;  3G67 A;  1SQP H;  3VQY A;  3W7W A;  1SZT A;  3JAT B;  4P2Z A;  2QWN B;  3RYF B;  4EFB A;  1BZK A;  4W4L A;  1DF4 A;  4DK0 A;  4B3R B;  5LMN B;  4FLT A;  1JFF B;  2QM8 A;  4Q6G A;  1Y74 B;  2EIJ C;  1N34 B;  4PHZ A;  4JAU A;  2RCV A;  3AK2 A;  3L74 H;  4PI0 A;  2ZDI C;  4LFB O;  3E22 A;  1DF5 A;  1FXV A;  2IM9 A;  3K04 A;  4UV9 A;  2NR5 A;  5KHG A;  4N21 A;  1XUQ A;  4UCS A;  1AJN A;  1KP3 A;  1XL6 A;  1LUV A;  1R3K C;  3L72 H;  3W7S A;  2BTQ A;  3OT7 A;  3A8T A;  1FXK A;  3SPI A;  1BT8 A;  1WAZ A;  4LWS B;  3AG1 C;  1M57 B;  5B1A C;  2ODM A;  1U96 A;  3BAB A;  3BHP A;  2OTL V;  4GKK B;  2UXC O;  5LOV A;  2Z3Y A;  1JOY A;  3C90 A;  1OCR C;  4WBN A;  3HKC B;  4WFA V;  1TUE B;  3ZRX A;  2QA4 V;  3A0R A;  1HNZ O;  4ZI7 B;  5B5E Z;  1FS0 G;  3APO A;  3RW0 A;  2YIA A;  3JAW A;  1N4C A;  4LR3 A;  5BY1 A;  1YDX A;  4JF3 A;  3HR0 A;  4JI6 O;  3RVZ A;  4MVU A;  4GYC B;  4KP4 A;  3FKS G;  3APQ A;  3B77 A;  1Q6U A;  5BMV B;  4ZOL A;  1EBO A;  1H2K A;  3E86 A;  3OMA B;  4J7Z A;  3KG2 A;  2EBO A;  1K33 A;  1S0V A;  4D7T A;  4FIP C;  1K3E A;  2DYR C;  3ABT A;  1J5E O;  1HNW O;  4FJC C;  3CRR A;  3WU2 Z;  3BVO A;  3EFF K;  2DQ0 A;  1MZE A;  3RT3 C;  3MHS C;  5JCO A;  1Q90 D;  2ETN A;  2JEX A;  1H2S B;  2IH1 C;  3CCV V;  5GTI Z;  4LF8 B;  1TA8 A;  4B3T B;  4JZ2 A;  5CB4 B;  5KA5 A;  4MSW C;  4F6R A;  4K0K B;  3RYH A;  3K59 A;  4K8X A;  3T4D A;  1GO3 F;  5LP6 C;  5EIB D;  2LFR A;  4WFF A;  2X6B A;  4CZZ A;  2RJZ A;  1OCC C;  4HAM A;  3LSU A;  1ZWI C;  4KFM A;  2P22 C;  2XT9 A;  4X65 B;  3RYF A;  2OTJ V;  1M93 A;  2HEP A;  1G8M A;  3J81 N;  5J2T B;  1H38 A;  3CYO A;  2ATK C;  4O4L A;  4QPK A;  1S77 D;  4KXR A;  5L3C A;  4O4I A;  2FTK A;  1WN7 A;  1VQO V;  1AR1 B;  3WB2 A;  2B9Z A;  1RP3 B;  1NTZ H;  2ADQ B;  3JCZ A;  4NR1 A;  4K0K O;  2ZT9 B;  3H1H H;  3X2Q B;  5LYJ B;  4L8J A;  2UXD B;  3STZ C;  5BXZ A;  5BR8 B;  1DK1 A;  1HP8 A;  2YXY A;  1MOF A;  2F93 B;  3SYC A;  2VRZ A;  2QWQ B;  5EC2 C;  3BFR A;  4JYA O;  2B1I A;  2EIL B;  3QVN A;  4U3J A;  1AI7 A;  2GV9 A;  3CHX A;  5IE9 A;  3AG3 C;  2GHY A;  2UUC O;  2P06 A;  2MK3 A;  1IXM A;  4TQF A;  1H8E G;  4LF9 O;  4X66 B;  4KHP O;  1FXH A;  3SPG A;  2WLH A;  4FFB A;  2V1D A;  5GW7 A;  3JAR B;  3OTO B;  1N8R W;  2UU9 O;  5H6R A;  4JI6 B;  1YIJ V;  2QWP B;  1GM8 A;  1M56 B;  3CJH A;  1XMQ B;  2M7W A;  1F4N A;  4QE7 A;  4UUJ C;  3A0H Z;  3S3W A;  2F95 B;  3ASO C;  4O2B B;  2YEV B;  2UUA O;  5TIS Z;  4RWU A;  1I5Y A;  3K58 A;  1NU1 H;  3O9O A;  1SQV H;  2VWK A;  3SPH A;  3CCQ V;  4E2L A;  1XEQ A;  2XAQ A;  4U7O A;  3ZJZ A;  3ASN C;  3D36 C;  2P6J A;  1PPJ H;  2FYU H;  4O4I B;  3JYC A;  4X64 B;  4UXN A;  4X1Y A;  3SDL A;  1MSD A;  1LNQ A;  5LHI A;  5F2V O;  5JH7 A;  2WLN A;  1SET A;  5IT9 N;  3HPL C;  2WLI B;  4U3J B;  2CUG A;  3FB7 C;  1URF A;  1GM9 A;  4IHJ A;  1MZF A;  4O2A A;  5A2Q N;  2A06 H;  4GCZ A;  4TOI A;  1M57 C;  2FKX A;  2XAF A;  2LQT A;  2UXB B;  1AJQ A;  2CTW A;  4XDK A;  1V55 C;  1AP6 A;  2ZE5 A;  4DR1 O;  1KBH A;  1XBL A;  2XHB A;  3JAS B;  3CRA A;  4GKJ O;  2P5O A;  3LDD A;  3CMA V;  1YI2 V;  1F51 A;  3C3T A;  1R3I C;  4CS3 A;  4DXW A;  3RGB A;  2C2A A;  1W0J G;  2ZXW C;  5GON A;  5IJ0 B;  2EZP A;  3OGC C;  3OW2 U;  3D3I A;  5H6Q A;  5ITZ A;  4H33 A;  4MTF A;  5LMN O;  3FB8 C;  3G71 V;  3K5O A;  2F1M A;  5H5N A;  2DQ3 A;  2JJ1 G;  4BIU A;  3PJS K;  3U11 A;  1JVM A;  5D5Q A;  4BAY A;  4JI7 O;  3ZHU A;  1Q5O A;  3JAK A;  2HHH O;  3VOU A;  5IJ9 B;  5KUM A;  3IGA C;  1WB8 A;  4OPH A;  1X59 A;  1NR1 A;  2W0X A;  1HNX B;  1AI5 A;  2F23 A;  2QKS A;  2QWR B;  1Y6X A;  3ZRW A;  3RVY A;  2YUA A;  1VQL V;  2A79 B;  5KHI A;  4CH6 A;  4D7S A;  5LHH A;  2Y0I A;  3R66 A;  1I0H A;  4FLU A;  2QKA A;  3L71 H;  5KX5 B;  2AZ0 A;  3E35 A;  3K03 A;  3HKC A;  3OUF A;  4G28 B;  1X4T A;  1SQX H;  2VWJ A;  2R70 A;  3ICX A;  1Y66 A;  4O4L B;  3B8N A;  3CRM A;  3ZMV A;  4X62 O;  5KLV H;  4X66 O;  4KHP B;  2Q0A A;  2H3O A;  2WA4 A;  5KHK A;  1BQZ A;  2WPD G;  1KMI Z;  3N2K A;  1IX9 A;  5E1A C;  5KX5 A;  2D3O W;  4NXN B;  3RYH B; 
#chains in the Genus database with same CATH homology
 4OX9 O;  3J80 N;  4DV0 O;  1N36 O;  4JI1 O;  4K0K O;  4DR1 O;  1HNZ O;  1HNX O;  2LW7 A;  4DUY O;  4B3T O;  4GKJ O;  1XNR O;  1IBK O;  4JI8 O;  5BXZ A;  2VQE O;  1DK1 A;  4DR7 O;  5BY1 A;  4JI0 O;  3OTO O;  2DOS A;  4LFA O;  1FJG O;  4JI6 O;  4B3R O;  2AGA A;  3O65 A;  4JYA O;  3JAM N;  4DV1 O;  1R6T A;  4JI2 O;  1FYJ A;  4DR5 O;  4DV3 O;  2UUB O;  4DR4 O;  4DV2 O;  4DR6 O;  4JI4 O;  2F4V O;  5IWA O;  5LMN O;  4JV5 O;  4B3M O;  1G1X B;  5H5N A;  3J7A U;  1XMQ O;  4LF8 O;  5LL6 Y;  4X64 O;  2DJV A;  4B3S O;  4JI7 O;  4LF5 O;  1J5E O;  4OPA A;  1R1B A;  2UUC O;  4NXM O;  2HHH O;  4YHH O;  2ZKO A;  1HNW O;  1YZB A;  1D2D A;  2JRI A;  1N34 O;  4LF4 O;  4LF9 O;  1IBM O;  4KHP O;  4LF6 O;  1AB3 A;  2UXD O;  3RT3 C;  4OPH A;  1X59 A;  4DV4 O;  1NS1 A;  4DR3 O;  4DUZ O;  2UU9 O;  2UXB O;  4GKK O;  4X65 O;  3F5T A;  3T1Y O;  4NXN O;  1KUQ A;  1FKA O;  2VQF O;  4DR2 O;  4A5U B;  1N33 O;  5FLX N;  2UUA O;  1IBL O;  4JI3 O;  3R66 A;  3T1H O;  1N32 O;  1I94 O;  4LFB O;  4AQY O;  4DV5 O;  1AIL A;  1XEQ A;  5LMU O;  4DV7 O;  4JI5 O;  1XNQ O;  4X62 O;  2ZM6 O;  4X66 O;  1F7Y A;  3SDL A;  2N74 A;  4YY3 O;  3J81 N;  5IT9 N;  3M8A A;  4LFC O;  4DV6 O;  1HR0 O;  2UXC O;  1XMO O;  5BR8 O;  5A2Q N;  2Z0A A;  4LF7 O;  2E5L O;  2FKX A;  1A32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...