1PPJH

Bovine cytochrome bc1 complex with stigmatellin and antimycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
66
structure length
66
Chain Sequence
b'LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 66
sequence length 66
chains with identical sequence U
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1ppjH00
3L70H 3L75H 3CXHF 1NTKH 1BGYH 1KYOF 1L0NH 1BE3H 3H1IH 2A06H 1EZVH 2BCCH 4U3FH 1P84F 1SQXH 1PPJH 3L72H 1KB9F 3BCCH 2IBZH 3H1KH 4PD4F 1NU1H 1SQQH 3CX5F 3H1JH 1BCCH 5KLVH 3L73H 3CWBH 3L71H 1NTMH 2FYUH 1PP9H 3L74H 1SQPH 3TGUH 1SQBH 3H1HH 1SQVH 1NTZH 3H1LH 4D6TH 1L0LH
chains in the Genus database with same CATH superfamily
1FXKB 1H8EG 2WLHA 4TT3G 4DR7B 2FKXA 1SC5B 4MVQA 2JJ1G 1YJNV 3VOUA 4Z1MG 2ZDIC 2E74B 3THOA 3BCCH 3EFFK 2IBZH 4RWUA 5EYPB 3FB8C 3STZC 4LF4B 3B4SA 2Q7EA 4K35A 1SQVH 3LSUA 5BMVA 3K03A 4I7ZB 3TXQA 3K04A 4DR4B 3Q4HA 3BAAA 4D7TA 1BL8A 4FLTA 2E5LB 3JD3A 2X6AA 3ETDA 3FB7C 1COWG 1AILA 2YI8A 1HNWO 4FM1A 1HP8A 1Y66A 3ZHTA 1TAEA 4EFBA 1BCCH 4IGGA 1EN4A 1M90W 4J9ZB 4K0KB 3ZEDA 5EK0A 4IIJA 3JARA 3DXRA 5J2UA 3K3WA 3NR7A 1WNSA 3OGIB 3LSQA 4YIOA 4O2AA 3AG3B 2ZKOA 2YIAA 2DWEC 4WFGA 1N34O 3BA9A 2QM4A 3ABMB 3JALA 4AQYO 4GYCB 1YI2V 3H9VA 1ZAUA 2Q0OC 3M99B 4DR7O 2EJRA 1RM1B 2HHHB 2NN4A 4PA6A 1X4TA 2CH7A 4O4LB 1I08A 1AVMA 3UO3A 4D6TH 5JJNB 5JJJB 4TV9A 5FL7G 1I5XA 1PL4A 3SJBC 1M56B 4LF4O 1GRJA 2AHYA 2IM9A 4EB6A 4YJ2A 3OW2U 4MW3A 3OMAB 4O4HB 1IDSA 2QTOA 1V54B 4CS3A 1QQCA 1DF5A 4DR4O 3ZMZA 5LMUB 1Z5VA 2QGNA 4YXWG 2E5LO 1SETA 4NXNO 2H3OA 2FYUH 1JQ0A 3EVKA 4FM2A 5J2TA 4TV8B 4PA7A 4LF8B 4X1KA 3APQA 2QTSA 4K0KO 2ETNA 3LUTB 5FLXN 1M1KW 1PPJH 2CTQA 4LF5B 4PELA 4O4JB 3FB5C 4NYKA 2PF4E 5K1PA 2Y4TA 2E76B 3R66A 1JMKC 1HNZB 4DV1B 1GTOA 3K59A 2W0FC 4YHHB 1OCRB 2HKOA 2OWOA 1S5JA 1YIJV 1T5EA 3CCQV 1I5YA 5B1OA 3B77A 2QA4V 3F5TA 4J41A 2IU0A 4JI0O 2UXXA 1GM8A 4DR5O 5F2VO 5EIBD 2FTKA 1VQMV 1YJWV 4JI1B 2XAFA 2GBOA 1HW7A 1QR8A 4XDJA 1UFIA 5IJ0B 1MMMA 1HDJA 5LMUO 1JFFA 1FXVA 2V1DA 4DYLA 2EJ7A 3TXSA 3CRCA 3AK1A 3E35A 1Q6UA 1H8HG 2WA3A 1J5EB 1WJZA 5KUMA 3RWRD 5KAFZ 2W6IG 4DR6B 1KKDA 4LF5O 3HKEB 2ZR2A 4JAVA 4UUJC 3ZHQA 1JX9A 4YIPA 2MW2B 1SERA 4DV1O 5L3EA 1AR5A 1JA8A 1ZUQA 2HJFC 3HKDA 5L3CA 4TQFA 3ZHRA 3GWKC 5TISZ 3JAKA 3CCUV 1GMGA 5E79Z 5IYBO 3UT5A 4FM0A 1WA8B 4R50A 3HKEA 2PYLA 4R6ZA 4KXRA 2LP7A 4JI8O 4DO2A 1AROP 1ZL8B 2XASA 3H1IH 3J81N 2CAZC 3BHPA 2Y4UA 5IY5B 4OPHA 5CA0B 1WN7A 1AI6A 2LW7A 4LFCB 2ILMA 2VS0A 1OHHG 3JATA 3JD1A 4DR3B 1Q7YW 2DOSA 5L3GA 4WFFA 4LF6O 1BQZA 1RSOA 3N2KA 4KFMA 4MVSA 1J5EO 3KCXA 4OX9O 1M5IA 4CH5A 1VP7A 4I9WA 4ZHQA 4LH6A 3UM7A 3MAQA 1BT8A 4DV4B 1EZJA 3APOA 2HVKC 2UUCO 3FX7A 4PDRA 3IGAC 2Y0PA 4ZI7B 4RO2A 3B09A 4RQEA 3CC7V 1VQ7V 4DW0A 1Q6HA 2GHYA 1EN5A 3BPZA 4BW9A 2JS3A 3L70H 2Z3YA 2VRZA 5BR8B 3H01A 5KX5A 3OEHG 3RT3C 3KCYA 4LNUA 2YEVA 1B3QA 2HP8A 1AI5A 3P32A 1F23A 4ZOLA 2QM7A 4LR3A 5LYJB 3C3TA 5IYZB 1N4CA 4X65B 3AG1B 2ZXWB 3RYIA 2YXHA 4LF9B 4WBNA 5C8YA 3E22A 3JAMN 4WFAV 4LFAB 3OT7A 1M9NA 3W7SA 3H1JH 4DV5O 2LGWA 3C3SA 3STLC 3GWOA 4JZGA 2EIKC 1PP9H 4X1IA 2C2AA 4EKWA 5B1AC 1Z2GA 1V55B 1AJQA 4HAMA 4OPAA 5LHGA 2D3OW 4BR6A 3R65A 5H5NA 3OFNG 1K97A 2WLLB 5KHJA 1MG1A 1QLEB 2LQTA 3K5LA 1NU1H 1N32O 1UJWB 4FMTA 1HNXO 3SR2C 3FYEB 3T1HB 3QO8A 1XMQB 1WB8A 2YI9A 3UCSC 4TUYA 4J7KA 1VQ6V 2Z0AA 1Z5WA 2LO1A 4KP4A 3VBBA 5LXTB 2F93B 1ZX3A 1SZTA 3OTOO 3W7WA 1VQKV 3KZIZ 1HR0O 2PYJA 1LUWA 4X65O 2DJVA 1XL6A 3T1YB 4LF9O 5LHHA 1CEZA 2E3CA 3OEEG 3ZMSA 1OCCC 4PDLA 3WB0A 4I0XA 2IU3A 3FFQA 1P7GA 3SYAA 4FLVA 3QVNA 4GZRB 4U3FH 4UCTA 3OAAG 1BQ0A 3FKSG 1SZXA 3OUSA 1BS3A 3JD2A 2B5UA 3RYFA 1JR9A 3TJTA 4DV6O 5JVDB 1WLEA 2IJJA 2P06A 4I50B 2KSDA 3ABUA 1XMQO 4JI6B 1VQLV 3AK3A 1S76D 5GONB 3CRRA 4PDVA 3FD9A 1H2MA 2QWOB 2JK5C 2EX3A 5ITZB 3G67A 3VQWA 5DECA 2WLJA 4WFEA 5JCOC 1G8MA 3U11A 3SYCA 2F4VB 1GM7A 4NTYA 5E1AC 3ZRSA 5H9CA 3DC6A 2PZSA 4JYBA 1KKCA 1QCEA 3LNMB 5CN0A 1NZ6A 3WB1A 1THZA 4I55B 4GLXA 2BOCC 1X59A 3IAYA 1W0JG 1K5QA 2K9PA 1VF6C 2DMXA 1MZFA 3CHXA 5IJ9B 3SJQC 1GN6A 1XDCA 1CPYA 1BE3H 4UVCA 4PI0A 3ZN0A 4YJ3B 4H0LB 4IYHA 2YIBD 4AHCA 2YSUB 4U7OA 3A8TA 5BZBA 1WP8A 2D2CB 3MDSA 2UXNA 5H2FZ 4UXNA 3G4SV 4NTWA 1SQPH 5DEDA 4JI6O 4QE7A 4DW1A 4GKKO 1K4CC 1U97A 4LP8A 2H94A 1GN2A 5LBQA 2XAQA 1R3KC 1ENVA 2QWQB 1SKVA 1BSMA 2NR5A 4BIZA 1O9GA 4HZ3A 2X6CA 2A0LA 3ZHUA 3J80N 4UVAA 4X9QA 1W0KG 3I5DA 3H1LH 1R6KA 1PL0A 4P30A 3LNNA 1L0NH 1NH2D 2GTSA 4NKGB 2BCCH 5EBWC 5JQGA 5LOVA 4OGQB 3DTUB 1R3IC 4FFBA 4FVMA 1YZBA 3N2GB 1YHQV 1FXHA 2GTAA 5FNVB 1Q82W 3WB2A 3RYHB 3VQXA 2QWPB 3S3XA 3W7XA 2JGDA 2Q73A 1BHAA 1LNQA 3G6EV 1VEWA 3HKBB 2UUBB 4MS2A 3ML0A 1US6A 2Q6AA 4JI3B 1S3JA 1XNRO 1D2DA 4DR2O 1EBOA 3QNEA 4MVUA 1IZ3A 3K79A 4PD4F 4UCVA 3M7MX 1M57B 2HFEC 4JASA 3JSNA 3L71H 2EIMC 4QE9A 1JVMA 4FLYA 5HFMA 3ABLC 3CRQA 4CH6A 3ETEA 1QVGU 3JD4A 5BMVB 3T1CA 3L75H 4GX5A 4MVRA 3Q4HB 5CA1B 1FAFA 1ZLZA 1L8DA 5LGTA 2WWWA 3P30A 3I55V 1R6TA 3ZIAG 1Y74A 5KMGA 2R9AA 4CS2A 1SA0A 3U10A 3CD6V 4UB6Z 3OTFA 2Q8VA 2RQ6A 1XMOO 4DK0A 2JJ2G 4IIJB 3X2QC 1K9MW 3JARB 3DXRB 5J2UB 1MZEA 2P6JA 5CA1A 2QWNB 4DV3O 4NXNB 3D36A 2HLDG 4O2AB 1AB3A 4NVPA 3T2MA 1OCZC 2UUBO 1Q3EA 3JALB 1H2KA 4JI3O 4EFEA 2YICA 3RW0A 2WLNA 2F66C 1LUVA 2CH7B 3SYOA 3D36C 2ADPA 4TV9B 5LP6A 3FB6C 5IT9N 5CB4A 3CB2A 3SJCC 1XI1A 2N74A 4EB6B 2BTOA 4YJ2B 1JJOA 3HKCA 2EULA 5B5EZ 3CMAV 4JZ2A 2XUMA 4H44B 4J10A 2Q5ZA 4U3JA 2JRIA 1FFXA 1FXKC 2BTQA 5EIBC 1K73W 1IBKO 2PTMA 4JI0B 5GW7A 4DR5B 2A79B 5LP6C 1K33A 1YTFD 3DGEA 1K8AW 3KG2A 5J2TB 4IYIA 3A2FA 3CCJV 2WA4A 2GUZA 4X1KB 2AZ0A 1K7DA 3LDDA 1AJPA 1S77D 1B06A 2A7WA 3OMIB 1YITV 4MW8A 3O9OA 1F7YA 1U96A 3DC5A 5B1BC 4X64O 1VQ5V 5KUKA 2DWDC 3A0HZ 1ZWIC 1R3JC 1YDXA 1CXZB 1Q90D 3ETQA 1SF9A 2QEXV 3ZRVA 4TOIA 1PM9A 2BOBC 2JEUA 1QHTA 1MSDA 5IYDO 4DV2B 2EIJC 1XQ8A 1XL4A 2CE4A 4D7SA 2YDEA 1R6NA 2DYSB 2G38A 4MT8A 1XREA 1AP5A 4NXMO 3T4ZA 3ZRXA 2DYRC 3HB3B 3RGBA 2QKCA 4CS4A 3E86A 3AG3C 2N04A 2JDIG 2ZQMA 1PD3A 3ABMC 5CBHA 3CRAA 3O65A 4X8AA 1H2SB 3BY6A 1JFFB 2P4VA 1NT2B 3K9SA 3ZMTA 4LH7A 4E2LA 4JI8B 2MK3A 1UPGA 2OTJV 1PNLA 1NVPB 5LGNA 1M56C 4PV1B 2R9RB 3BRCA 3TK1A 4LWSA 3AG4B 1EZVH 3G80A 4FZ0A 2RJZA 4JTDB 3WG7C 4LF6B 1VQPV 3HKDB 4ICGA 4OX9B 2ITDC 4O2BA 3JAKB 5JH7A 5B3SB 4HNAA 1JCHA 1SQGA 3JD0A 4DV2O 3UT5B 1JPXA 2UUCB 1GKFA 1WAZA 2ZR3A 4FFKA 3OE7G 3HR0A 5IYCO 1N8RW 1Q86W 1TVKA 1DF4A 3JCZA 1OCRC 3OMNB 1K92A 4IL6Z 2ZE8A 3RYCA 2F23A 1OV9A 3ASOB 2QDOA 5HFLA 1NQTA 3JATB 5A9GA 2ARHA 1RSOB 4WF9V 3N2KB 3RVYA 1MOFA 4FK5C 3F7VC 1NI8A 4ZHQB 2YUAA 2QE7G 5H6QA 4N21A 1L1FA 1SQFA 2W0XA 4FIPC 1E1QG 3GB7C 3MD0A 4H33A 1IX9A 3ZRWA 5EBMC 4DV5B 5KX5B 2RNBA 4X1YA 4LF7B 5L3DA 1IVSA 2ITCC 3L72H 5IE9A 4LNUB 4FZ1A 2YEVB 2PUSA 1P4RA 3VQYA 1R73A 2YS8A 2WLIA 4PJ0Z 2Q7GA 3ETGA 2RDCA 4ZOLB 3RN4A 5LL6Y 2UXBB 1N32B 1HNXB 1QLNA 4JI4B 2F1MA 1W2BU 2IH1C 2B9ZA 4QPJA 3FAVA 3RYIB 4WBNB 5C8YB 3E22B 1E1RG 1S0VA 2LGQA 2WSSG 4CC6A 1MNGA 2AW9A 4UCOA 3B8MA 3ZMVA 2YIDA 4G28B 1SQBH 1D5AA 1PKXA 4ZBMA 4FLXA 4X1IB 3OTOB 1QR9A 4X20A 1IBLO 1AR1B 3ZMUA 2UXDB 1HR0B 2IJIA 3W7UA 1XOUA 2AGAA 3J7AU 4R7CA 2EILB 3AG7A 2QKSA 3ZX6A 3IJ4A 2V4DA 4DUZB 4MTXA 3WU2Z 1KMIZ 4QNHB 1NR7A 2K1EA 4LF7O 3B2EE 5J9PC 4TUYB 4JI7B 1OCCB 4IT5A 2X0LA 3OR7C 4UCRA 1TGOA 1KUQA 3UKMA 3RVZA 2YXLA 1XNQO 4DV6B 1I0HA 2UXBO 3P3NA 2JIZG 3L9DA 3K5OA 1YSCA 1Q81W 4JI4O 5CMUA 1K5SA 4MVMA 3ZBHA 5EC1C 5D5PA 4B3MO 3CE2A 3G71V 1PNMA 4I0XB 4IHJA 3OGCC 1OCOB 4ZIBA 3OM3B 2UXDO 3ABKB 3N27A 2Q68A 4QPKA 2E75B 3AG1C 5LA6A 5K1XA 2KQXA 2ZXWC 1IBMO 4JI5O 3RYFB 1ORQC 4K3AA 2P7TC 2RMKB 1N36B 2P5OA 2CUGA 1GN4A 4DUZO 1GO3F 1XUQA 4YY3B 2VQEB 5IDJA 2HVJC 4JI2O 2UU9O 4JI7O 1V55C 2EBOA 2R72A 4ABMA 1YVWA 1VIBA 1WPBA 2M6YA 3MHHC 1KQSU 3SDLA 5LMNO 1TUBA 4PA9A 1PNKA 1QLEC 2H8PC 1VQOV 5JCOA 4I4TA 1IURA 1F4MA 1DLBA 1BHBA 4GKKB 3AG2B 1Y76A 4UCUA 1IXMA 2DE0X 2OIEA 3LDEA 1AR4A 2XAHA 4JAAA 3BFRA 1KP3A 3A0BZ 4DR1O 2JVDA 1FD9A 3D3IA 3CXCU 1VF6A 1Q5OA 1BGYH 1G4YB 2Y69B 1HWYA 1ROPA 3BABA 1N36O 2OCCB 3CCLV 3TCUA 4L8JA 3MHSC 4YY3O 2ZNIA 2VQEO 2Q67A 4UV8A 3JASA 1K4DC 3UO2A 1NTKH 4DRXA 2Y48A 3AEIA 3OR6C 3ICXA 2JS5A 2HEPA 4AILC 3QO7A 4LBEC 4MTOA 4X66B 2NLJC 1XNRB 5BY1A 4DR2B 3FYIB 5AG2A 5KHKA 5GTHZ 2ATKC 3CJHA 4BIUA 3ASNC 1M4UA 3C90A 5JQGB 4R8CA 5LOVB 4HBNA 4GKJO 3SGIA 4FFBB 4DV7B 4WFHA 1V9PA 2Q0AA 1VQ9V 2JGDB 1XHZA 4P2ZA 2EIMB 2FMLA 3A0RA 2LFRA 1RP3B 1FFTB 1WPXA 3ABLB 1XMOB 3CC2V 2XT9A 1KECA 2ZE6A 3PN1A 4TWKA 3CCVV 2EINC 4DV3B 1Q8IA 1JOYA 3F7YC 2OTLV 5JJEB 2Q4PA 4X66O 4Q20A 2L35A 1EM1A 1QU7A 2KB1A 3IC7A 2KG7A 2R9IA 1Y74B 5KMGB 1DK1A 2LJ2A 2CGOA 1SA0B 3OD4A 2XAJA 2WLMA 2GDSA 4LC1A 4DV7O 2AXTZ 4B3SO 2P4KA 1QNMA 1IBKB 3TETA 4FJCC 2UUAO 1F51A 1FYJA 3JAWA 1A32A 3CPWU 4B3TB 4JTAB 4MVOA 2KKWA 1K34A 1KBHA 3K58A 2OCHA 4X64B 5LGUA 5LP6B 1FPOA 5CB4B 3SJAC 1ZSPA 2PI4A 3LSSA 3HKCB 4UB8Z 2Q69A 3DSQA 4KUMA 3B8NA 4F6RB 3E8BA 5KLVH 3L73H 2BSKA 5B1BB 4U3JB 1FFXB 3CS5A 2BTQB 5KA6A 2A9HA 1YEWA 4NB5A 1FXKA 2PGGA 3E8HA 1B6QA 2QKAA 3JSLA 1KD1W 2FB5A 3CEIA 1NKDA 2XAGA 3S3WA 4X88A 4NXMB 1M57C 2GUZB 3CP1A 1N33O 5EYPA 4F6RA 2EIJB 1FJGB 3L74H 1XILA 1KP2A 2PI5A 2DN9A 2DYRB 3E2EA 1KYOF 1VMGA 1I94B 2A06H 2B1IA 3CCMV 1F4NA 1RFYA 4UFZA 3CCEV 4B3TO 1H2NA 1IXBA 1WB7A 5EC2C 3CMEV 1P7BA 2QWRB 5EZYB 3CWBH 4FLZA 2ZIMA 2ZCEA 4KL1A 1S5LZ 2QR4A 2XHBA 2O57A 4A5UB 2EZOA 4B3RB 1H38A 4MTGA 3CSXA 3K5NA 4I9QA 5EZYA 3WG7B 4J80A 1NJIW 4PHZA 4O4LA 2ZM6B 4LCUC 1RPOA 3CXHF 4LWSB 2F95B 2DQ3A 1FJGO 2ZE7A 2OT5A 4O4HA 4L87A 1YCIA 1AP6A 1EFRG 1RM1C 5L3BA 4DV0B 4PI2A 4PA4A 1Y67A 1I94O 4BW5A 1QVFU 4O2BB 5JH7B 4HNAB 1Q43A 4TV8A 4GX0A 1FS0G 4XBFA 1OJHA 2DQ0A 3ZHVA 2ZE5A 4DUYB 2ODMA 3CYOA 2HHHO 1V54C 4B7EA 2UXCB 4O4JA 1GN3A 4HYOA 2FL4A 1TVKB 5KAIZ 3CX5F 2ADQB 3U0ZA 4B3RO 2Q9LA 1R3LC 2L6LA 2NNUA 4X62B 3RYCB 4E4EA 5IWAB 1VQ4V 4RQFA 4XDLA 3G6BA 2DYSC 2ZM6O 3W7TA 1S72V 4G27B 4NR1A 4LF8O 1VF5B 4P9PA 4CBCA 2IH3C 3BVOA 2Z5UA 3ZHSA 3H1HH 5IJ0A 4JYYA 3ZRWB 4FLWA 4DV0O 4LFBB 1HNZO 2IJHA 4X1YB 4YHHO 3ZS8C 1IBLB 4K8XA 2CDYA 4DUYO 3OUFA 2M7WA 3AG4C 1FKAO 2WLIB 5A2QN 2UXCO 1GM9A 2CTRA 4RUFA 1PV0A 1D5NA 4JTCB 4GCZA 2DW4A 4JI1O 3D3QA 2LW1A 4X62O 2EZPA 3FAVB 5IWAO 3H1KH 1URFA 5B3SC 3K0GA 4DK1A 4NTXA 4O4IB 1TA8A 3K0DA 1E79G 1WA8A 5EBLC 1J95A 2HJDA 5B1NA 1XNQB 2IW5A 3ZJZA 2EIKB 4X20B 1ZL8A 5B1AB 2P22C 3SYQA 2B1GA 1BZKA 4W4KA 2OYQA 4DR6O 1NBMG 1B04A 5CA0A 1ZTEA 3ASOC 5KA5A 2VQFB 4B3MB 4O4IA 3CC4V 4JAUA 4LFBO 5KHHA 1XBLA 2WAMA 3KKYA 3I56V 2QM8A 1DGSA 4TQDA 4P9OA 5IY5C 1NVPD 1P84F 3ZN1A 2WPDG 1H2GA 1CP9A 1IBMB 4JI5B 4J9YB 5GTIZ 1LR1A 4ZI7A 3EHBB 2JGUA 5FPOA 4B7KA 4C7UA 1KC8W 3E83A 4CZZA 3NXSA 3M8AA 4QJFB 4QIWF 4JI2B 2ZIOA 2UU9B 4LFCO 2F43G 1I7FA 3CRMA 1GK9A 2Q7HA 4DR3O 4IHJB 3CCRV 2ZNJA 1N0JA 5LMNB 1M93A 3IC9A 5JWPA 5KHGA 3QF7A 5LYJA 3TGUH 5LA6B 3B40A 5IYZA 4DV4O 4CH3A 3QG5A 2VQFO 4Z1VA 2HG5C 1SS3A 1QBZA 5B66Z 4MVZA 4EEQA 1VQ8V 4DR1B 4W4LA 1SQQH 2W6JG 4H37A 5BR8O 3CCSV 3BA8A 4OXSA 3SPJA 4KHPB 2QSAA 5KHIA 3JYCA 4PDMA 2ZT9B 2YIBA 3SPHA 1L0LH 1Q6IA 5DM6V 1TUBB 2EILC 2A3QA 4F4LA 4J7ZA 4Q6GA 2WLLA 4UVBA 1SRYA 4I4TB 2JEXA 1GH6A 2AHZA 1EN6A 3SYPA 4CC5A 1Y76B 1TUEB 1NH2B 4LFAO 2X7RB 3F5WC 4GT1A 4J42A 1JJ2U 1OZ0A 2AZ2A 3IFXA 4Z2WA 3E8FA 5LXTA 2IJKA 2OIGA 2LFSA 1GAXA 3GVMA 3ZCCA 4AI8A 5L3FA 4TSFG 2R70A 1AJNA 4JYCA 4PA3A 3RFRA 4GKJB 2N05A 4H13B 4BIOA 4G2KA 1OCOC 3T1HO 3JASB 1XHXA 5BXZA 5FPRA 4DRXB 1AI4A 4KHPO 3E89A 3ABKC 5D5QA 2P67A 5H6RA 3ASNB 1XEQA 4J11A 4BWAA 4JYAB 1NS1A 5JVDA 3EXAA 4JPRA 2YC0A 3LDCA 4I50A 5DN6G 4UV9A 1R1BA 3T1YO 5CBFA 1KU9A 4U7NA 1DTOA 1SQXH 3CJHB 4JF3A 2WLKA 3K06A 5GONA 4XDKA 4CH4A 3QO5A 3WFVA 1AI7A 5ITZA 1NR1A 4UCSA 3T4DA 4WFBV 4BAYA 3E8GA 5LHIA 1YF2A 1Y6XA 4MTFA 2EINB 3UQ8A 2BE3A 2GSMB 1YXBA 3QTCA 2CK3G 3AG2C 2VWKA 1P49A 4JV5B 1VARA 1KB9F 4GUNA 1MABG 4I55A 3SPCA 4MSWC 1WP7A 3D8CA 4B3SB 1BMFG 5CA3A 4FLUA 3K08A 5IJ9A 2XOKG 2Y69C 2XNDG 4B08A 3SPIA 2UUAB 2Y0IA 4N23A 2CGNA 4K8ZA 4JGSA 4YJ3A 3HPLC 4JYAO 2OCCC 4WCEV 4QGPA 3K5MA 2V7QG 4ASUG 4X89A 1YTFB 1RPRA 3PJSK 2F4VO 2KG7B 5C93A 4F6EA 2XTAA 3ABTA 3RBZA 3K9AA 1Y4MA 1H2LA 3X2QB 1VQNV 4I5SA 3JCUZ 4RAIA 2RN9A 2X6BA 2ZINA 1MSWD 1N0NA 1SESA 3BEHA 2CTPA 1O9HA 4GX1A 3JAWB 1HNWB 1MA1A 1OCZB 4FPPA 2CTWA 4JV5O 1N33B 1NTZH 3SPGA 1W59A 4ZKIA 1G6UA 2RCVA 2VWJA 4DXWA 3K57A 2GV9A 2PY5A 3AK2A 4GX2A 3VQVA 3N2GA 1YJ9V 5CBGA 2YXYA 2QJ1A 1VF7A 4J7JA 2ZDIA 4RUEA 5FNVA 2P90A 3RYHA 1S5HC 1NTMH 3P3PA 1K3EA 1N34B 1G1XB 2BSKB 3HKBA 2HR3A 4AQYB 2ZD9A
chains in the Genus database with same CATH topology
3L70H 3L75H 3CXHF 1NTKH 1BGYH 1KYOF 1L0NH 1BE3H 3H1IH 2A06H 1EZVH 2BCCH 4U3FH 1P84F 1SQXH 1PPJH 3L72H 1KB9F 3BCCH 2IBZH 3H1KH 4PD4F 1NU1H 1SQQH 3CX5F 3H1JH 1BCCH 5KLVH 3L73H 3CWBH 3L71H 1NTMH 2FYUH 1PP9H 3L74H 1SQPH 3TGUH 1SQBH 3H1HH 1SQVH 1NTZH 3H1LH 4D6TH 1L0LH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L70 H;  3L75 H;  3CXH F;  1NTK H;  1BGY H;  1KYO F;  1L0N H;  1BE3 H;  3H1I H;  2A06 H;  1EZV H;  2BCC H;  4U3F H;  1P84 F;  1SQX H;  1PPJ H;  3L72 H;  1KB9 F;  3BCC H;  2IBZ H;  3H1K H;  4PD4 F;  1NU1 H;  1SQQ H;  3CX5 F;  3H1J H;  1BCC H;  5KLV H;  3L73 H;  3CWB H;  3L71 H;  1NTM H;  2FYU H;  1PP9 H;  3L74 H;  1SQP H;  3TGU H;  1SQB H;  3H1H H;  1SQV H;  1NTZ H;  3H1L H;  4D6T H;  1L0L H; 
#chains in the Genus database with same CATH topology
 1FXK B;  1H8E G;  2WLH A;  4TT3 G;  4DR7 B;  2FKX A;  1SC5 B;  4MVQ A;  2JJ1 G;  1YJN V;  3VOU A;  4Z1M G;  2ZDI C;  2E74 B;  3THO A;  3BCC H;  3EFF K;  2IBZ H;  4RWU A;  5EYP B;  3FB8 C;  3STZ C;  4LF4 B;  3B4S A;  2Q7E A;  4K35 A;  1SQV H;  3LSU A;  5BMV A;  3K03 A;  4I7Z B;  3TXQ A;  3K04 A;  4DR4 B;  3Q4H A;  3BAA A;  4D7T A;  1BL8 A;  4FLT A;  2E5L B;  3JD3 A;  2X6A A;  3ETD A;  3FB7 C;  1COW G;  1AIL A;  2YI8 A;  1HNW O;  4FM1 A;  1HP8 A;  1Y66 A;  3ZHT A;  1TAE A;  4EFB A;  1BCC H;  4IGG A;  1EN4 A;  1M90 W;  4J9Z B;  4K0K B;  3ZED A;  5EK0 A;  4IIJ A;  3JAR A;  3DXR A;  5J2U A;  3K3W A;  3NR7 A;  1WNS A;  3OGI B;  3LSQ A;  4YIO A;  4O2A A;  3AG3 B;  2ZKO A;  2YIA A;  2DWE C;  4WFG A;  1N34 O;  3BA9 A;  2QM4 A;  3ABM B;  3JAL A;  4AQY O;  4GYC B;  1YI2 V;  3H9V A;  1ZAU A;  2Q0O C;  3M99 B;  4DR7 O;  2EJR A;  1RM1 B;  2HHH B;  2NN4 A;  4PA6 A;  1X4T A;  2CH7 A;  4O4L B;  1I08 A;  1AVM A;  3UO3 A;  4D6T H;  5JJN B;  5JJJ B;  4TV9 A;  5FL7 G;  1I5X A;  1PL4 A;  3SJB C;  1M56 B;  4LF4 O;  1GRJ A;  2AHY A;  2IM9 A;  4EB6 A;  4YJ2 A;  3OW2 U;  4MW3 A;  3OMA B;  4O4H B;  1IDS A;  2QTO A;  1V54 B;  4CS3 A;  1QQC A;  1DF5 A;  4DR4 O;  3ZMZ A;  5LMU B;  1Z5V A;  2QGN A;  4YXW G;  2E5L O;  1SET A;  4NXN O;  2H3O A;  2FYU H;  1JQ0 A;  3EVK A;  4FM2 A;  5J2T A;  4TV8 B;  4PA7 A;  4LF8 B;  4X1K A;  3APQ A;  2QTS A;  4K0K O;  2ETN A;  3LUT B;  5FLX N;  1M1K W;  1PPJ H;  2CTQ A;  4LF5 B;  4PEL A;  4O4J B;  3FB5 C;  4NYK A;  2PF4 E;  5K1P A;  2Y4T A;  2E76 B;  3R66 A;  1JMK C;  1HNZ B;  4DV1 B;  1GTO A;  3K59 A;  2W0F C;  4YHH B;  1OCR B;  2HKO A;  2OWO A;  1S5J A;  1YIJ V;  1T5E A;  3CCQ V;  1I5Y A;  5B1O A;  3B77 A;  2QA4 V;  3F5T A;  4J41 A;  2IU0 A;  4JI0 O;  2UXX A;  1GM8 A;  4DR5 O;  5F2V O;  5EIB D;  2FTK A;  1VQM V;  1YJW V;  4JI1 B;  2XAF A;  2GBO A;  1HW7 A;  1QR8 A;  4XDJ A;  1UFI A;  5IJ0 B;  1MMM A;  1HDJ A;  5LMU O;  1JFF A;  1FXV A;  2V1D A;  4DYL A;  2EJ7 A;  3TXS A;  3CRC A;  3AK1 A;  3E35 A;  1Q6U A;  1H8H G;  2WA3 A;  1J5E B;  1WJZ A;  5KUM A;  3RWR D;  5KAF Z;  2W6I G;  4DR6 B;  1KKD A;  4LF5 O;  3HKE B;  2ZR2 A;  4JAV A;  4UUJ C;  3ZHQ A;  1JX9 A;  4YIP A;  2MW2 B;  1SER A;  4DV1 O;  5L3E A;  1AR5 A;  1JA8 A;  1ZUQ A;  2HJF C;  3HKD A;  5L3C A;  4TQF A;  3ZHR A;  3GWK C;  5TIS Z;  3JAK A;  3CCU V;  1GMG A;  5E79 Z;  5IYB O;  3UT5 A;  4FM0 A;  1WA8 B;  4R50 A;  3HKE A;  2PYL A;  4R6Z A;  4KXR A;  2LP7 A;  4JI8 O;  4DO2 A;  1ARO P;  1ZL8 B;  2XAS A;  3H1I H;  3J81 N;  2CAZ C;  3BHP A;  2Y4U A;  5IY5 B;  4OPH A;  5CA0 B;  1WN7 A;  1AI6 A;  2LW7 A;  4LFC B;  2ILM A;  2VS0 A;  1OHH G;  3JAT A;  3JD1 A;  4DR3 B;  1Q7Y W;  2DOS A;  5L3G A;  4WFF A;  4LF6 O;  1BQZ A;  1RSO A;  3N2K A;  4KFM A;  4MVS A;  1J5E O;  3KCX A;  4OX9 O;  1M5I A;  4CH5 A;  1VP7 A;  4I9W A;  4ZHQ A;  4LH6 A;  3UM7 A;  3MAQ A;  1BT8 A;  4DV4 B;  1EZJ A;  3APO A;  2HVK C;  2UUC O;  3FX7 A;  4PDR A;  3IGA C;  2Y0P A;  4ZI7 B;  4RO2 A;  3B09 A;  4RQE A;  3CC7 V;  1VQ7 V;  4DW0 A;  1Q6H A;  2GHY A;  1EN5 A;  3BPZ A;  4BW9 A;  2JS3 A;  3L70 H;  2Z3Y A;  2VRZ A;  5BR8 B;  3H01 A;  5KX5 A;  3OEH G;  3RT3 C;  3KCY A;  4LNU A;  2YEV A;  1B3Q A;  2HP8 A;  1AI5 A;  3P32 A;  1F23 A;  4ZOL A;  2QM7 A;  4LR3 A;  5LYJ B;  3C3T A;  5IYZ B;  1N4C A;  4X65 B;  3AG1 B;  2ZXW B;  3RYI A;  2YXH A;  4LF9 B;  4WBN A;  5C8Y A;  3E22 A;  3JAM N;  4WFA V;  4LFA B;  3OT7 A;  1M9N A;  3W7S A;  3H1J H;  4DV5 O;  2LGW A;  3C3S A;  3STL C;  3GWO A;  4JZG A;  2EIK C;  1PP9 H;  4X1I A;  2C2A A;  4EKW A;  5B1A C;  1Z2G A;  1V55 B;  1AJQ A;  4HAM A;  4OPA A;  5LHG A;  2D3O W;  4BR6 A;  3R65 A;  5H5N A;  3OFN G;  1K97 A;  2WLL B;  5KHJ A;  1MG1 A;  1QLE B;  2LQT A;  3K5L A;  1NU1 H;  1N32 O;  1UJW B;  4FMT A;  1HNX O;  3SR2 C;  3FYE B;  3T1H B;  3QO8 A;  1XMQ B;  1WB8 A;  2YI9 A;  3UCS C;  4TUY A;  4J7K A;  1VQ6 V;  2Z0A A;  1Z5W A;  2LO1 A;  4KP4 A;  3VBB A;  5LXT B;  2F93 B;  1ZX3 A;  1SZT A;  3OTO O;  3W7W A;  1VQK V;  3KZI Z;  1HR0 O;  2PYJ A;  1LUW A;  4X65 O;  2DJV A;  1XL6 A;  3T1Y B;  4LF9 O;  5LHH A;  1CEZ A;  2E3C A;  3OEE G;  3ZMS A;  1OCC C;  4PDL A;  3WB0 A;  4I0X A;  2IU3 A;  3FFQ A;  1P7G A;  3SYA A;  4FLV A;  3QVN A;  4GZR B;  4U3F H;  4UCT A;  3OAA G;  1BQ0 A;  3FKS G;  1SZX A;  3OUS A;  1BS3 A;  3JD2 A;  2B5U A;  3RYF A;  1JR9 A;  3TJT A;  4DV6 O;  5JVD B;  1WLE A;  2IJJ A;  2P06 A;  4I50 B;  2KSD A;  3ABU A;  1XMQ O;  4JI6 B;  1VQL V;  3AK3 A;  1S76 D;  5GON B;  3CRR A;  4PDV A;  3FD9 A;  1H2M A;  2QWO B;  2JK5 C;  2EX3 A;  5ITZ B;  3G67 A;  3VQW A;  5DEC A;  2WLJ A;  4WFE A;  5JCO C;  1G8M A;  3U11 A;  3SYC A;  2F4V B;  1GM7 A;  4NTY A;  5E1A C;  3ZRS A;  5H9C A;  3DC6 A;  2PZS A;  4JYB A;  1KKC A;  1QCE A;  3LNM B;  5CN0 A;  1NZ6 A;  3WB1 A;  1THZ A;  4I55 B;  4GLX A;  2BOC C;  1X59 A;  3IAY A;  1W0J G;  1K5Q A;  2K9P A;  1VF6 C;  2DMX A;  1MZF A;  3CHX A;  5IJ9 B;  3SJQ C;  1GN6 A;  1XDC A;  1CPY A;  1BE3 H;  4UVC A;  4PI0 A;  3ZN0 A;  4YJ3 B;  4H0L B;  4IYH A;  2YIB D;  4AHC A;  2YSU B;  4U7O A;  3A8T A;  5BZB A;  1WP8 A;  2D2C B;  3MDS A;  2UXN A;  5H2F Z;  4UXN A;  3G4S V;  4NTW A;  1SQP H;  5DED A;  4JI6 O;  4QE7 A;  4DW1 A;  4GKK O;  1K4C C;  1U97 A;  4LP8 A;  2H94 A;  1GN2 A;  5LBQ A;  2XAQ A;  1R3K C;  1ENV A;  2QWQ B;  1SKV A;  1BSM A;  2NR5 A;  4BIZ A;  1O9G A;  4HZ3 A;  2X6C A;  2A0L A;  3ZHU A;  3J80 N;  4UVA A;  4X9Q A;  1W0K G;  3I5D A;  3H1L H;  1R6K A;  1PL0 A;  4P30 A;  3LNN A;  1L0N H;  1NH2 D;  2GTS A;  4NKG B;  2BCC H;  5EBW C;  5JQG A;  5LOV A;  4OGQ B;  3DTU B;  1R3I C;  4FFB A;  4FVM A;  1YZB A;  3N2G B;  1YHQ V;  1FXH A;  2GTA A;  5FNV B;  1Q82 W;  3WB2 A;  3RYH B;  3VQX A;  2QWP B;  3S3X A;  3W7X A;  2JGD A;  2Q73 A;  1BHA A;  1LNQ A;  3G6E V;  1VEW A;  3HKB B;  2UUB B;  4MS2 A;  3ML0 A;  1US6 A;  2Q6A A;  4JI3 B;  1S3J A;  1XNR O;  1D2D A;  4DR2 O;  1EBO A;  3QNE A;  4MVU A;  1IZ3 A;  3K79 A;  4PD4 F;  4UCV A;  3M7M X;  1M57 B;  2HFE C;  4JAS A;  3JSN A;  3L71 H;  2EIM C;  4QE9 A;  1JVM A;  4FLY A;  5HFM A;  3ABL C;  3CRQ A;  4CH6 A;  3ETE A;  1QVG U;  3JD4 A;  5BMV B;  3T1C A;  3L75 H;  4GX5 A;  4MVR A;  3Q4H B;  5CA1 B;  1FAF A;  1ZLZ A;  1L8D A;  5LGT A;  2WWW A;  3P30 A;  3I55 V;  1R6T A;  3ZIA G;  1Y74 A;  5KMG A;  2R9A A;  4CS2 A;  1SA0 A;  3U10 A;  3CD6 V;  4UB6 Z;  3OTF A;  2Q8V A;  2RQ6 A;  1XMO O;  4DK0 A;  2JJ2 G;  4IIJ B;  3X2Q C;  1K9M W;  3JAR B;  3DXR B;  5J2U B;  1MZE A;  2P6J A;  5CA1 A;  2QWN B;  4DV3 O;  4NXN B;  3D36 A;  2HLD G;  4O2A B;  1AB3 A;  4NVP A;  3T2M A;  1OCZ C;  2UUB O;  1Q3E A;  3JAL B;  1H2K A;  4JI3 O;  4EFE A;  2YIC A;  3RW0 A;  2WLN A;  2F66 C;  1LUV A;  2CH7 B;  3SYO A;  3D36 C;  2ADP A;  4TV9 B;  5LP6 A;  3FB6 C;  5IT9 N;  5CB4 A;  3CB2 A;  3SJC C;  1XI1 A;  2N74 A;  4EB6 B;  2BTO A;  4YJ2 B;  1JJO A;  3HKC A;  2EUL A;  5B5E Z;  3CMA V;  4JZ2 A;  2XUM A;  4H44 B;  4J10 A;  2Q5Z A;  4U3J A;  2JRI A;  1FFX A;  1FXK C;  2BTQ A;  5EIB C;  1K73 W;  1IBK O;  2PTM A;  4JI0 B;  5GW7 A;  4DR5 B;  2A79 B;  5LP6 C;  1K33 A;  1YTF D;  3DGE A;  1K8A W;  3KG2 A;  5J2T B;  4IYI A;  3A2F A;  3CCJ V;  2WA4 A;  2GUZ A;  4X1K B;  2AZ0 A;  1K7D A;  3LDD A;  1AJP A;  1S77 D;  1B06 A;  2A7W A;  3OMI B;  1YIT V;  4MW8 A;  3O9O A;  1F7Y A;  1U96 A;  3DC5 A;  5B1B C;  4X64 O;  1VQ5 V;  5KUK A;  2DWD C;  3A0H Z;  1ZWI C;  1R3J C;  1YDX A;  1CXZ B;  1Q90 D;  3ETQ A;  1SF9 A;  2QEX V;  3ZRV A;  4TOI A;  1PM9 A;  2BOB C;  2JEU A;  1QHT A;  1MSD A;  5IYD O;  4DV2 B;  2EIJ C;  1XQ8 A;  1XL4 A;  2CE4 A;  4D7S A;  2YDE A;  1R6N A;  2DYS B;  2G38 A;  4MT8 A;  1XRE A;  1AP5 A;  4NXM O;  3T4Z A;  3ZRX A;  2DYR C;  3HB3 B;  3RGB A;  2QKC A;  4CS4 A;  3E86 A;  3AG3 C;  2N04 A;  2JDI G;  2ZQM A;  1PD3 A;  3ABM C;  5CBH A;  3CRA A;  3O65 A;  4X8A A;  1H2S B;  3BY6 A;  1JFF B;  2P4V A;  1NT2 B;  3K9S A;  3ZMT A;  4LH7 A;  4E2L A;  4JI8 B;  2MK3 A;  1UPG A;  2OTJ V;  1PNL A;  1NVP B;  5LGN A;  1M56 C;  4PV1 B;  2R9R B;  3BRC A;  3TK1 A;  4LWS A;  3AG4 B;  1EZV H;  3G80 A;  4FZ0 A;  2RJZ A;  4JTD B;  3WG7 C;  4LF6 B;  1VQP V;  3HKD B;  4ICG A;  4OX9 B;  2ITD C;  4O2B A;  3JAK B;  5JH7 A;  5B3S B;  4HNA A;  1JCH A;  1SQG A;  3JD0 A;  4DV2 O;  3UT5 B;  1JPX A;  2UUC B;  1GKF A;  1WAZ A;  2ZR3 A;  4FFK A;  3OE7 G;  3HR0 A;  5IYC O;  1N8R W;  1Q86 W;  1TVK A;  1DF4 A;  3JCZ A;  1OCR C;  3OMN B;  1K92 A;  4IL6 Z;  2ZE8 A;  3RYC A;  2F23 A;  1OV9 A;  3ASO B;  2QDO A;  5HFL A;  1NQT A;  3JAT B;  5A9G A;  2ARH A;  1RSO B;  4WF9 V;  3N2K B;  3RVY A;  1MOF A;  4FK5 C;  3F7V C;  1NI8 A;  4ZHQ B;  2YUA A;  2QE7 G;  5H6Q A;  4N21 A;  1L1F A;  1SQF A;  2W0X A;  4FIP C;  1E1Q G;  3GB7 C;  3MD0 A;  4H33 A;  1IX9 A;  3ZRW A;  5EBM C;  4DV5 B;  5KX5 B;  2RNB A;  4X1Y A;  4LF7 B;  5L3D A;  1IVS A;  2ITC C;  3L72 H;  5IE9 A;  4LNU B;  4FZ1 A;  2YEV B;  2PUS A;  1P4R A;  3VQY A;  1R73 A;  2YS8 A;  2WLI A;  4PJ0 Z;  2Q7G A;  3ETG A;  2RDC A;  4ZOL B;  3RN4 A;  5LL6 Y;  2UXB B;  1N32 B;  1HNX B;  1QLN A;  4JI4 B;  2F1M A;  1W2B U;  2IH1 C;  2B9Z A;  4QPJ A;  3FAV A;  3RYI B;  4WBN B;  5C8Y B;  3E22 B;  1E1R G;  1S0V A;  2LGQ A;  2WSS G;  4CC6 A;  1MNG A;  2AW9 A;  4UCO A;  3B8M A;  3ZMV A;  2YID A;  4G28 B;  1SQB H;  1D5A A;  1PKX A;  4ZBM A;  4FLX A;  4X1I B;  3OTO B;  1QR9 A;  4X20 A;  1IBL O;  1AR1 B;  3ZMU A;  2UXD B;  1HR0 B;  2IJI A;  3W7U A;  1XOU A;  2AGA A;  3J7A U;  4R7C A;  2EIL B;  3AG7 A;  2QKS A;  3ZX6 A;  3IJ4 A;  2V4D A;  4DUZ B;  4MTX A;  3WU2 Z;  1KMI Z;  4QNH B;  1NR7 A;  2K1E A;  4LF7 O;  3B2E E;  5J9P C;  4TUY B;  4JI7 B;  1OCC B;  4IT5 A;  2X0L A;  3OR7 C;  4UCR A;  1TGO A;  1KUQ A;  3UKM A;  3RVZ A;  2YXL A;  1XNQ O;  4DV6 B;  1I0H A;  2UXB O;  3P3N A;  2JIZ G;  3L9D A;  3K5O A;  1YSC A;  1Q81 W;  4JI4 O;  5CMU A;  1K5S A;  4MVM A;  3ZBH A;  5EC1 C;  5D5P A;  4B3M O;  3CE2 A;  3G71 V;  1PNM A;  4I0X B;  4IHJ A;  3OGC C;  1OCO B;  4ZIB A;  3OM3 B;  2UXD O;  3ABK B;  3N27 A;  2Q68 A;  4QPK A;  2E75 B;  3AG1 C;  5LA6 A;  5K1X A;  2KQX A;  2ZXW C;  1IBM O;  4JI5 O;  3RYF B;  1ORQ C;  4K3A A;  2P7T C;  2RMK B;  1N36 B;  2P5O A;  2CUG A;  1GN4 A;  4DUZ O;  1GO3 F;  1XUQ A;  4YY3 B;  2VQE B;  5IDJ A;  2HVJ C;  4JI2 O;  2UU9 O;  4JI7 O;  1V55 C;  2EBO A;  2R72 A;  4ABM A;  1YVW A;  1VIB A;  1WPB A;  2M6Y A;  3MHH C;  1KQS U;  3SDL A;  5LMN O;  1TUB A;  4PA9 A;  1PNK A;  1QLE C;  2H8P C;  1VQO V;  5JCO A;  4I4T A;  1IUR A;  1F4M A;  1DLB A;  1BHB A;  4GKK B;  3AG2 B;  1Y76 A;  4UCU A;  1IXM A;  2DE0 X;  2OIE A;  3LDE A;  1AR4 A;  2XAH A;  4JAA A;  3BFR A;  1KP3 A;  3A0B Z;  4DR1 O;  2JVD A;  1FD9 A;  3D3I A;  3CXC U;  1VF6 A;  1Q5O A;  1BGY H;  1G4Y B;  2Y69 B;  1HWY A;  1ROP A;  3BAB A;  1N36 O;  2OCC B;  3CCL V;  3TCU A;  4L8J A;  3MHS C;  4YY3 O;  2ZNI A;  2VQE O;  2Q67 A;  4UV8 A;  3JAS A;  1K4D C;  3UO2 A;  1NTK H;  4DRX A;  2Y48 A;  3AEI A;  3OR6 C;  3ICX A;  2JS5 A;  2HEP A;  4AIL C;  3QO7 A;  4LBE C;  4MTO A;  4X66 B;  2NLJ C;  1XNR B;  5BY1 A;  4DR2 B;  3FYI B;  5AG2 A;  5KHK A;  5GTH Z;  2ATK C;  3CJH A;  4BIU A;  3ASN C;  1M4U A;  3C90 A;  5JQG B;  4R8C A;  5LOV B;  4HBN A;  4GKJ O;  3SGI A;  4FFB B;  4DV7 B;  4WFH A;  1V9P A;  2Q0A A;  1VQ9 V;  2JGD B;  1XHZ A;  4P2Z A;  2EIM B;  2FML A;  3A0R A;  2LFR A;  1RP3 B;  1FFT B;  1WPX A;  3ABL B;  1XMO B;  3CC2 V;  2XT9 A;  1KEC A;  2ZE6 A;  3PN1 A;  4TWK A;  3CCV V;  2EIN C;  4DV3 B;  1Q8I A;  1JOY A;  3F7Y C;  2OTL V;  5JJE B;  2Q4P A;  4X66 O;  4Q20 A;  2L35 A;  1EM1 A;  1QU7 A;  2KB1 A;  3IC7 A;  2KG7 A;  2R9I A;  1Y74 B;  5KMG B;  1DK1 A;  2LJ2 A;  2CGO A;  1SA0 B;  3OD4 A;  2XAJ A;  2WLM A;  2GDS A;  4LC1 A;  4DV7 O;  2AXT Z;  4B3S O;  2P4K A;  1QNM A;  1IBK B;  3TET A;  4FJC C;  2UUA O;  1F51 A;  1FYJ A;  3JAW A;  1A32 A;  3CPW U;  4B3T B;  4JTA B;  4MVO A;  2KKW A;  1K34 A;  1KBH A;  3K58 A;  2OCH A;  4X64 B;  5LGU A;  5LP6 B;  1FPO A;  5CB4 B;  3SJA C;  1ZSP A;  2PI4 A;  3LSS A;  3HKC B;  4UB8 Z;  2Q69 A;  3DSQ A;  4KUM A;  3B8N A;  4F6R B;  3E8B A;  5KLV H;  3L73 H;  2BSK A;  5B1B B;  4U3J B;  1FFX B;  3CS5 A;  2BTQ B;  5KA6 A;  2A9H A;  1YEW A;  4NB5 A;  1FXK A;  2PGG A;  3E8H A;  1B6Q A;  2QKA A;  3JSL A;  1KD1 W;  2FB5 A;  3CEI A;  1NKD A;  2XAG A;  3S3W A;  4X88 A;  4NXM B;  1M57 C;  2GUZ B;  3CP1 A;  1N33 O;  5EYP A;  4F6R A;  2EIJ B;  1FJG B;  3L74 H;  1XIL A;  1KP2 A;  2PI5 A;  2DN9 A;  2DYR B;  3E2E A;  1KYO F;  1VMG A;  1I94 B;  2A06 H;  2B1I A;  3CCM V;  1F4N A;  1RFY A;  4UFZ A;  3CCE V;  4B3T O;  1H2N A;  1IXB A;  1WB7 A;  5EC2 C;  3CME V;  1P7B A;  2QWR B;  5EZY B;  3CWB H;  4FLZ A;  2ZIM A;  2ZCE A;  4KL1 A;  1S5L Z;  2QR4 A;  2XHB A;  2O57 A;  4A5U B;  2EZO A;  4B3R B;  1H38 A;  4MTG A;  3CSX A;  3K5N A;  4I9Q A;  5EZY A;  3WG7 B;  4J80 A;  1NJI W;  4PHZ A;  4O4L A;  2ZM6 B;  4LCU C;  1RPO A;  3CXH F;  4LWS B;  2F95 B;  2DQ3 A;  1FJG O;  2ZE7 A;  2OT5 A;  4O4H A;  4L87 A;  1YCI A;  1AP6 A;  1EFR G;  1RM1 C;  5L3B A;  4DV0 B;  4PI2 A;  4PA4 A;  1Y67 A;  1I94 O;  4BW5 A;  1QVF U;  4O2B B;  5JH7 B;  4HNA B;  1Q43 A;  4TV8 A;  4GX0 A;  1FS0 G;  4XBF A;  1OJH A;  2DQ0 A;  3ZHV A;  2ZE5 A;  4DUY B;  2ODM A;  3CYO A;  2HHH O;  1V54 C;  4B7E A;  2UXC B;  4O4J A;  1GN3 A;  4HYO A;  2FL4 A;  1TVK B;  5KAI Z;  3CX5 F;  2ADQ B;  3U0Z A;  4B3R O;  2Q9L A;  1R3L C;  2L6L A;  2NNU A;  4X62 B;  3RYC B;  4E4E A;  5IWA B;  1VQ4 V;  4RQF A;  4XDL A;  3G6B A;  2DYS C;  2ZM6 O;  3W7T A;  1S72 V;  4G27 B;  4NR1 A;  4LF8 O;  1VF5 B;  4P9P A;  4CBC A;  2IH3 C;  3BVO A;  2Z5U A;  3ZHS A;  3H1H H;  5IJ0 A;  4JYY A;  3ZRW B;  4FLW A;  4DV0 O;  4LFB B;  1HNZ O;  2IJH A;  4X1Y B;  4YHH O;  3ZS8 C;  1IBL B;  4K8X A;  2CDY A;  4DUY O;  3OUF A;  2M7W A;  3AG4 C;  1FKA O;  2WLI B;  5A2Q N;  2UXC O;  1GM9 A;  2CTR A;  4RUF A;  1PV0 A;  1D5N A;  4JTC B;  4GCZ A;  2DW4 A;  4JI1 O;  3D3Q A;  2LW1 A;  4X62 O;  2EZP A;  3FAV B;  5IWA O;  3H1K H;  1URF A;  5B3S C;  3K0G A;  4DK1 A;  4NTX A;  4O4I B;  1TA8 A;  3K0D A;  1E79 G;  1WA8 A;  5EBL C;  1J95 A;  2HJD A;  5B1N A;  1XNQ B;  2IW5 A;  3ZJZ A;  2EIK B;  4X20 B;  1ZL8 A;  5B1A B;  2P22 C;  3SYQ A;  2B1G A;  1BZK A;  4W4K A;  2OYQ A;  4DR6 O;  1NBM G;  1B04 A;  5CA0 A;  1ZTE A;  3ASO C;  5KA5 A;  2VQF B;  4B3M B;  4O4I A;  3CC4 V;  4JAU A;  4LFB O;  5KHH A;  1XBL A;  2WAM A;  3KKY A;  3I56 V;  2QM8 A;  1DGS A;  4TQD A;  4P9O A;  5IY5 C;  1NVP D;  1P84 F;  3ZN1 A;  2WPD G;  1H2G A;  1CP9 A;  1IBM B;  4JI5 B;  4J9Y B;  5GTI Z;  1LR1 A;  4ZI7 A;  3EHB B;  2JGU A;  5FPO A;  4B7K A;  4C7U A;  1KC8 W;  3E83 A;  4CZZ A;  3NXS A;  3M8A A;  4QJF B;  4QIW F;  4JI2 B;  2ZIO A;  2UU9 B;  4LFC O;  2F43 G;  1I7F A;  3CRM A;  1GK9 A;  2Q7H A;  4DR3 O;  4IHJ B;  3CCR V;  2ZNJ A;  1N0J A;  5LMN B;  1M93 A;  3IC9 A;  5JWP A;  5KHG A;  3QF7 A;  5LYJ A;  3TGU H;  5LA6 B;  3B40 A;  5IYZ A;  4DV4 O;  4CH3 A;  3QG5 A;  2VQF O;  4Z1V A;  2HG5 C;  1SS3 A;  1QBZ A;  5B66 Z;  4MVZ A;  4EEQ A;  1VQ8 V;  4DR1 B;  4W4L A;  1SQQ H;  2W6J G;  4H37 A;  5BR8 O;  3CCS V;  3BA8 A;  4OXS A;  3SPJ A;  4KHP B;  2QSA A;  5KHI A;  3JYC A;  4PDM A;  2ZT9 B;  2YIB A;  3SPH A;  1L0L H;  1Q6I A;  5DM6 V;  1TUB B;  2EIL C;  2A3Q A;  4F4L A;  4J7Z A;  4Q6G A;  2WLL A;  4UVB A;  1SRY A;  4I4T B;  2JEX A;  1GH6 A;  2AHZ A;  1EN6 A;  3SYP A;  4CC5 A;  1Y76 B;  1TUE B;  1NH2 B;  4LFA O;  2X7R B;  3F5W C;  4GT1 A;  4J42 A;  1JJ2 U;  1OZ0 A;  2AZ2 A;  3IFX A;  4Z2W A;  3E8F A;  5LXT A;  2IJK A;  2OIG A;  2LFS A;  1GAX A;  3GVM A;  3ZCC A;  4AI8 A;  5L3F A;  4TSF G;  2R70 A;  1AJN A;  4JYC A;  4PA3 A;  3RFR A;  4GKJ B;  2N05 A;  4H13 B;  4BIO A;  4G2K A;  1OCO C;  3T1H O;  3JAS B;  1XHX A;  5BXZ A;  5FPR A;  4DRX B;  1AI4 A;  4KHP O;  3E89 A;  3ABK C;  5D5Q A;  2P67 A;  5H6R A;  3ASN B;  1XEQ A;  4J11 A;  4BWA A;  4JYA B;  1NS1 A;  5JVD A;  3EXA A;  4JPR A;  2YC0 A;  3LDC A;  4I50 A;  5DN6 G;  4UV9 A;  1R1B A;  3T1Y O;  5CBF A;  1KU9 A;  4U7N A;  1DTO A;  1SQX H;  3CJH B;  4JF3 A;  2WLK A;  3K06 A;  5GON A;  4XDK A;  4CH4 A;  3QO5 A;  3WFV A;  1AI7 A;  5ITZ A;  1NR1 A;  4UCS A;  3T4D A;  4WFB V;  4BAY A;  3E8G A;  5LHI A;  1YF2 A;  1Y6X A;  4MTF A;  2EIN B;  3UQ8 A;  2BE3 A;  2GSM B;  1YXB A;  3QTC A;  2CK3 G;  3AG2 C;  2VWK A;  1P49 A;  4JV5 B;  1VAR A;  1KB9 F;  4GUN A;  1MAB G;  4I55 A;  3SPC A;  4MSW C;  1WP7 A;  3D8C A;  4B3S B;  1BMF G;  5CA3 A;  4FLU A;  3K08 A;  5IJ9 A;  2XOK G;  2Y69 C;  2XND G;  4B08 A;  3SPI A;  2UUA B;  2Y0I A;  4N23 A;  2CGN A;  4K8Z A;  4JGS A;  4YJ3 A;  3HPL C;  4JYA O;  2OCC C;  4WCE V;  4QGP A;  3K5M A;  2V7Q G;  4ASU G;  4X89 A;  1YTF B;  1RPR A;  3PJS K;  2F4V O;  2KG7 B;  5C93 A;  4F6E A;  2XTA A;  3ABT A;  3RBZ A;  3K9A A;  1Y4M A;  1H2L A;  3X2Q B;  1VQN V;  4I5S A;  3JCU Z;  4RAI A;  2RN9 A;  2X6B A;  2ZIN A;  1MSW D;  1N0N A;  1SES A;  3BEH A;  2CTP A;  1O9H A;  4GX1 A;  3JAW B;  1HNW B;  1MA1 A;  1OCZ B;  4FPP A;  2CTW A;  4JV5 O;  1N33 B;  1NTZ H;  3SPG A;  1W59 A;  4ZKI A;  1G6U A;  2RCV A;  2VWJ A;  4DXW A;  3K57 A;  2GV9 A;  2PY5 A;  3AK2 A;  4GX2 A;  3VQV A;  3N2G A;  1YJ9 V;  5CBG A;  2YXY A;  2QJ1 A;  1VF7 A;  4J7J A;  2ZDI A;  4RUE A;  5FNV A;  2P90 A;  3RYH A;  1S5H C;  1NTM H;  3P3P A;  1K3E A;  1N34 B;  1G1X B;  2BSK B;  3HKB A;  2HR3 A;  4AQY B;  2ZD9 A; 
#chains in the Genus database with same CATH homology
 3L70 H;  3L75 H;  3CXH F;  1NTK H;  1BGY H;  1KYO F;  1L0N H;  1BE3 H;  3H1I H;  2A06 H;  1EZV H;  2BCC H;  4U3F H;  1P84 F;  1SQX H;  1PPJ H;  3L72 H;  1KB9 F;  3BCC H;  2IBZ H;  3H1K H;  4PD4 F;  1NU1 H;  1SQQ H;  3CX5 F;  3H1J H;  1BCC H;  5KLV H;  3L73 H;  3CWB H;  3L71 H;  1NTM H;  2FYU H;  1PP9 H;  3L74 H;  1SQP H;  3TGU H;  1SQB H;  3H1H H;  1SQV H;  1NTZ H;  3H1L H;  4D6T H;  1L0L H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...