1PPJH

Bovine cytochrome bc1 complex with stigmatellin and antimycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
66
structure length
66
Chain Sequence
LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
total genus 25
structure length 66
sequence length 66
chains with identical sequence U
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1ppjH00
1BGYH 1SQQH 3BCCH 2FYUH 3L70H 4U3FH 1SQBH 3L75H 3CX5F 3CWBH 3L73H 3H1LH 3CXHF 3TGUH 1KYOF 1P84F 4D6TH 4PD4F 1SQVH 3L71H 1NTZH 2BCCH 3H1KH 1NU1H 1L0NH 2IBZH 3L72H 3H1JH 1NTMH 5KLVH 3L74H 1EZVH 1PP9H 1SQXH 1L0LH 1SQPH 1KB9F 1PPJH 1BCCH 1BE3H 3H1HH 2A06H 3H1IH 1NTKH
chains in the Genus database with same CATH superfamily
2IU0A 4J9ZB 5JWPA 1W0KG 2LGQA 4I7ZB 3L9DA 3J80N 2Q0OC 2ZIMA 3A8TA 3ZN1A 4YHHB 4PDRA 5GTIZ 4JYCA 1MOFA 4HYOA 1YDXA 4X1YB 2WLIB 2ZQMA 3CC2V 5JVDB 3CYOA 1AI6A 2EINC 3OGIB 1G1XB 5J9PC 4O4HB 2XTAA 3KG2A 1XNRB 4JYAB 1TUEB 5J2TB 3RYCA 1VQ9V 5CN0A 1XNQB 1N8RW 1KQSU 1VF6C 1P4RA 4GX0A 1BE3H 4TV9A 1QHTA 1KP3A 3VOUA 4DR4O 3W7TA 1BHAA 1P7GA 2JS5A 1BQ0A 3AG2C 3BY6A 2JGUA 3WU2Z 3OTOB 3T1YB 1Q3EA 4EKWA 5LGNA 2XASA 2XAFA 4G28B 1MABG 4X8AA 1VQMV 4UXNA 1EZVH 4I55A 3CRAA 2GTSA 3OUSA 4LF7O 5LP6C 4MVMA 1V54B 1VF7A 3ZRVA 1R6NA 2GBOA 2Q8VA 4JI5O 2JGDA 1S76D 4JI6O 4TSFG 1QR9A 5L3DA 1KB9F 4QPKA 1AJQA 4TV9B 1GO3F 1K9MW 3LNMB 5JQGA 1FXVA 2CK3G 3JD4A 1SZTA 1BMFG 2IJJA 4LF9B 5LOVA 2F1MA 2WSSG 1URFA 4BAYA 1NTKH 4LR3A 3A0BZ 5KAFZ 1GH6A 4I55B 2PZSA 4OGQB 4ZOLA 1Y4MA 3R65A 3CXHF 3QG5A 3D3IA 1EN5A 4ZKIA 2JEXA 3APOA 3J81N 4FM2A 1Q90D 3DSQA 1VQ8V 2JGDB 2LW1A 4JPRA 2YC0A 2YIBA 5L3EA 2IH3C 2XAJA 2QTOA 4QNHB 4JI4B 2WWWA 1SQGA 5JQGB 5LMNB 2L6LA 4JTDB 4PA4A 1K7DA 3AG3B 3OGCC 2DW4A 3VBBA 3JCUZ 2XAGA 4X65O 1Z5WA 4X62B 4JI1B 2IU3A 5LOVB 4FM0A 2HVKC 4E2LA 1LNQA 2YXHA 2Q69A 1QVGU 3T1HO 2OT5A 1NS1A 1W59A 4ZOLB 1IVSA 1FJGB 2G38A 2UUAO 3TJTA 1NTMH 2FMLA 3L74H 2B1IA 1R6TA 1EBOA 2EZPA 2ADQB 1ZAUA 3CX5F 1OCZB 3LNNA 2QM8A 1R6KA 3HKEA 2QKSA 3ML0A 2YIDA 4FZ0A 2XT9A 4CH3A 4P9PA 4DV2B 1X4TA 3ZMSA 3L72H 1HNXO 4K35A 2OWOA 4D7SA 5FLXN 2PI5A 4BIOA 1NH2D 2LFRA 5IWAO 2DN9A 3UKMA 4RWUA 4D6TH 3OFNG 1H8HG 3STLC 4DR7B 1J5EB 1WAZA 4RQEA 2HFEC 1WB8A 4IL6Z 4GX2A 3RN4A 2QWOB 3ETQA 3UCSC 3ZMZA 2OIGA 5HFMA 1V54C 1PNLA 3HKEB 4LP8A 3AK2A 5BXZA 1HDJA 1WNSA 4R6ZA 2Y4UA 3BHPA 4LBEC 4BWAA 4UB8Z 4WFFA 5CA0B 2VQEO 3ZRSA 1PP9H 3DC5A 1HW7A 4DK1A 1N34B 5IYBO 4O2AA 1VMGA 1S5JA 2MW2B 2AXTZ 2EULA 1UJWB 4J9YB 4ZIBA 3LDEA 4JI3O 4PV1B 1KC8W 4DV6B 2RJZA 3O9OA 4MTFA 4YY3B 1H2NA 2Q7EA 2C2AA 2HHHB 3LSSA 1AVMA 3K06A 5EC2C 2QWNB 1TVKA 1VQ4V 5L3CA 3C90A 4QPJA 5CB4A 4B3TO 2F95B 3AK3A 2W6JG 2WLJA 4LFCB 3CCSV 5GTHZ 3ZRWA 3B40A 1R1BA 1GN4A 2Q0AA 3E89A 1JJ2U 3CS5A 1UPGA 1PPJH 4DR1B 3ZHTA 1SQQH 2FYUH 4O2AB 3K0DA 4NXNO 3BA9A 1N0JA 1S5HC 2VWKA 3MHSC 2OIEA 4X64B 4PDVA 1DTOA 1FYJA 1E79G 4CZZA 5IY5B 3RYFA 3AG4B 3OM3B 5B5EZ 4U3JA 3ZS8C 1I5XA 1TVKB 3G4SV 1KP2A 4DV5O 2CGNA 2Q5ZA 4FLUA 3F5WC 5CB4B 3VQVA 1IBMO 3RYIA 2PF4E 2PTMA 5IYDO 1N36B 2X6CA 1Z5VA 3E2EA 3AEIA 3R66A 3B77A 5TISZ 5B3SB 3ZRWB 4K0KO 2BOCC 2ZKOA 3IC9A 3FB6C 4MSWC 2E3CA 1I08A 5GONA 1OCZC 2VS0A 3JARA 3FB5C 1FPOA 2BTQA 2LGWA 3K59A 1KU9A 1PKXA 5GW7A 4K8ZA 3N2GA 2LP7A 2H94A 2Q68A 2BTOA 1GRJA 2XUMA 3FB7C 2HP8A 3F5TA 3RYFB 4N23A 4JAAA 1XNQO 3JASA 4DV3B 2PGGA 2OCCB 3STZC 1KKCA 1QLEB 2H3OA 1DF4A 1E1RG 4U3JB 3HKCA 1KKDA 4X1KA 2ZXWB 3ABLB 1N33B 4LWSB 1IURA 2DMXA 3RYIB 3EFFK 3JAWA 2KG7A 2YUAA 4DXWA 2ZR2A 3S3XA 3K79A 5EBWC 4J11A 3Q4HA 1AP5A 3GWOA 1NBMG 1ZTEA 2RN9A 3CMAV 4TOIA 4IYHA 4JI8O 2GDSA 4D7TA 5GONB 2ZD9A 4FLWA 3JARB 2LW7A 4X20A 1JJOA 1R3IC 3LUTB 2BTQB 3JSLA 4XBFA 4JYBA 3N2GB 2Q6AA 3QO5A 4Z2WA 4DV4B 1Y6XA 4OX9B 2KQXA 5KHIA 3JASB 4J10A 2LO1A 4MVQA 2IW5A 4MVOA 4UFZA 4JI7B 3TXSA 2RNBA 3HKCB 1NH2B 2PYLA 4QGPA 1DLBA 1KECA 1SKVA 3PJSK 4X1KB 1CXZB 4YIOA 4JAUA 3JAWB 2KG7B 2CDYA 1EFRG 2R70A 3Q4HB 3K5MA 5B1NA 1YI2V 1JR9A 3H1HH 1VARA 3UO2A 3OMIB 1Q81W 1JCHA 1YCIA 2Y0IA 3L75H 2LFSA 2DYSB 4FJCC 4JTCB 4X20B 1US6A 4H13B 1VQ7V 4LH6A 4LNUA 1V9PA 1NJIW 1FXKC 2E74B 2UUBB 2YIBD 4LF4O 4CS2A 4LH7A 5KUMA 3CRCA 1HNWO 5JCOA 4LF6B 3OW2U 4KHPB 2JRIA 4YJ3A 3HPLC 2YXLA 4B3MB 5LMNO 2JDIG 1S5LZ 2AW9A 3THOA 4LFAB 5IY5C 2EJ7A 2Y69B 3AG4C 5CBHA 4X62O 4IHJA 1YXBA 4I9WA 3B09A 4DV7B 1IX9A 4IT5A 2A79B 4UCOA 2Q7GA 2UU9O 3WG7B 2YXYA 5EC1C 4CS3A 4F6EA 3H9VA 5DN6G 5B1OA 1F4MA 2UXCB 1R3JC 5CMUA 4BW9A 4DR2B 1R3LC 3CMEV 2UXBB 5BZBA 5JJJB 1FJGO 1WA8A 1ZWIC 4X89A 5B3SC 1GAXA 2D2CB 3S3WA 4LNUB 2BE3A 1MSWD 4NVPA 4LF8B 1J95A 2XNDG 4IIJA 2K1EA 3JD0A 2Y4TA 4JTAB 2ZNJA 4PA9A 4UCRA 5LL6Y 3HB3B 2L35A 1OV9A 4PDMA 2RQ6A 2WPDG 3UO3A 3TCUA 4YJ3B 1PM9A 1N32O 3ABTA 1P7BA 4DV2O 3HKBA 1SRYA 1EN4A 4B3RB 4OXSA 1PL0A 1A32A 5FNVA 2Y0PA 3MAQA 2IBZH 5LGUA 4JV5O 4IHJB 4G2KA 2OCCC 4QJFB 1QLEC 2QM7A 5KHGA 1PL4A 1Q5OA 3CE2A 4PJ0Z 4EEQA 5KUKA 3ZEDA 2DE0X 2ZXWC 3ABLC 3DGEA 1M1KW 2GUZA 4FFBA 2ATKC 4I0XA 4FLZA 1NI8A 1WA8B 2PY5A 4NTXA 1VQPV 3N2KA 1T5EA 1RFYA 4MTOA 3SDLA 3SPJA 4IIJB 5IE9A 1LUVA 5B1AB 2ZINA 1M57B 1IBLB 4DUZO 3K57A 2VRZA 5C93A 1PNMA 4LF5B 1MSDA 5LHGA 4WFHA 1RM1C 3E8GA 4R8CA 2E75B 5FNVB 1S72V 4WFEA 3G80A 4DK0A 3TXQA 3RYCB 2HKOA 1NZ6A 4GKKO 2Y48A 1EZJA 2XOKG 3QNEA 1GM9A 3E83A 2HEPA 4X1IA 4DR5B 3T2MA 4Z1MG 2EILB 5A2QN 4L87A 4AQYO 2QA4V 1P49A 1YIJV 4FLVA 3JD2A 3M7MX 4H37A 2GUZB 4KP4A 4FFBB 4I0XB 2R9IA 4MVUA 3ETEA 1F7YA 2HHHO 1I94B 1U97A 2DWEC 3N2KB 3TETA 3K04A 3P32A 4DV1O 2RMKB 1XHZA 1GN3A 2DYSC 2JJ1G 3AK1A 1XREA 1G8MA 4FMTA 3ZMUA 5BY1A 3OMAB 1SF9A 1Q6HA 4LFCO 1WPXA 2GHYA 1BZKA 1NR7A 2M7WA 1D5NA 1Y66A 3OE7G 1SQXH 4B7KA 4DR1O 2NLJC 2A9HA 1XMQO 4CC6A 2RCVA 4X1IB 4PA6A 1AJNA 4X64O 2Y69C 5JH7A 4UCUA 4DW1A 5IYZA 4F6RA 4MVZA 3F7YC 3GVMA 2CTPA 5LXTA 3CCJV 2AHYA 3LDCA 3ASOB 4H44B 3CRMA 3N27A 3WG7C 3CCEV 3G71V 1YHQV 5LHIA 4W4LA 2EIJB 3H1LH 4BIZA 1S3JA 4ZHQA 4GZRB 2V7QG 3K03A 3LSQA 1AR5A 3SPHA 1YTFB 1F23A 3WB0A 1HNZO 4KUMA 2P90A 1XMOO 4DYLA 3SJBC 2IJHA 2HVJC 2Q4PA 2HG5C 1H2SB 5JCOC 3D36A 3K5NA 1KUQA 3E86A 4QE9A 5IDJA 5JH7B 5IYZB 2YS8A 1K33A 1NU1H 1L0NH 3P30A 4WF9V 2E5LO 4J42A 4I4TA 1GN2A 4RUFA 1M5IA 5LXTB 4DV3O 3ETGA 3OUFA 1YZBA 2WA4A 1K97A 1BGYH 3BA8A 2UXXA 3TK1A 4PHZA 4GKJO 1F4NA 2LQTA 4ZHQB 5BMVA 2DQ0A 4DW0A 4JASA 5CA1A 4B7EA 4B08A 3UQ8A 2E76B 4PA7A 2M6YA 4DV0O 5KX5A 3VQXA 3PN1A 1L0LH 5B1AC 5ITZA 2YDEA 1M57C 2WLLA 2OCHA 3C3TA 1I0HA 2P5OA 1S0VA 1H2LA 1ROPA 1H2MA 2ZE7A 3E22A 3OT7A 2B1GA 4L8JA 1ZSPA 4UCTA 2VQFO 3FX7A 4TQDA 4DV4O 4OX9O 5KA5A 1PD3A 4TT3G 3QF7A 3CRRA 4I4TB 4I9QA 1NR1A 4O4JA 2ODMA 5LGTA 1NQTA 1Q8IA 2BOBC 1AR1B 5KA6A 1QU7A 2JJ2G 2EILC 1RSOA 2MK3A 1Q86W 3OAAG 4JI5B 5J2UA 5BMVB 5CA1B 3SYPA 1VIBA 1Q6UA 3ZN0A 4MW8A 4DR3B 2A7WA 1QR8A 2EJRA 3CCMV 5KX5B 2QGNA 5ITZB 2YSUB 2WLLB 4AI8A 5F2VO 4ZBMA 3WB2A 3QTCA 3FKSG 2CTWA 3HKDA 1XILA 3K9SA 3E22B 3CCVV 1HR0O 4AILC 1AP6A 2ZR3A 2QEXV 1CP9A 4CH6A 4GYCB 1VEWA 4X66B 2EBOA 4O4JB 2P4KA 5B66Z 4U3FH 5BR8B 4LF6O 3T4ZA 3W7WA 4B3MO 2OTJV 2UXDB 2A0LA 4LFAO 4DUYB 1RSOB 2QWQB 3AG3C 2ETNA 1L8DA 2UUCO 5J2UB 4LCUC 1YF2A 1Y76A 4LFBO 1JFFA 3HR0A 4CH5A 4DR6O 2KSDA 3ASOC 3K08A 3SJAC 3ZHRA 1DK1A 2CTRA 3SYQA 3L70H 4JI2O 4H0LB 3U0ZA 2EIJC 5EBMC 3CP1A 2IJKA 3HKDB 1K92A 4P9OA 4YHHO 4B3SB 2P4VA 1FAFA 2QWPB 3CB2A 1M93A 1YVWA 1I5YA 3LDDA 3ZIAG 2A06H 5D5QA 4YJ2A 1H8EG 4WFBV 4UVBA 3IGAC 2EIMB 1YJNV 4B3RO 3KCYA 1TUBA 4CS4A 1XNRO 4JYAO 4R7CA 5KHJA 1JFFB 2YIAA 4ASUG 1K8AW 4JYYA 2EINB 1BL8A 4FLYA 1IZ3A 4TUYA 1ZLZA 2ZE6A 5LYJA 2CTQA 4XDJA 2Z0AA 3UT5A 3ABMB 4AHCA 5CA3A 1B6QA 3RVYA 1N0NA 3CEIA 4TV8A 2N74A 2ZDIA 2B5UA 2Q7HA 3ZHSA 2JVDA 3OTOO 3T1YO 4X9QA 3JD3A 2QWRB 1XEQA 4EB6A 4XDKA 1IBLO 1AI5A 2Z3YA 4YJ2B 3D3QA 4HAMA 4QE7A 2QKCA 2ZM6B 2EIKB 1VQNV 4EFEA 4MTGA 1E1QG 1TUBB 4NTYA 3RWRD 1MA1A 2BSKA 1SQPH 5DECA 3F7VC 1VQKV 4TUYB 1YJ9V 1W0JG 5LYJB 2DOSA 4JI0B 2WLMA 3UT5B 4JZ2A 3AG1B 3JATA 4RAIA 3SPIA 4TV8B 4BR6A 2VQEB 1VQ6V 2PUSA 4LF9O 2QE7G 4LC1A 1AILA 2AZ0A 4JI3B 5H2FZ 4X88A 1VQLV 4EB6B 3ETDA 3SJQC 1B3QA 4PI0A 2F43G 2PYJA 4I50A 1P84F 1NVPB 1AR4A 1YTFD 5H9CA 1FFXA 4KFMA 4MW3A 3ZJZA 2ZT9B 1BQZA 1Y74A 2JIZG 2BSKB 2JEUA 2DWDC 4RQFA 4ICGA 4NXMB 3JSNA 4B3TB 1OJHA 3ZHUA 3ASNB 4NTWA 4JI4O 2R9AA 1IXMA 2YICA 3JATB 1MZEA 3K9AA 3RBZA 1MG1A 3D8CA 3ZBHA 4JI1O 3JCZA 1MNGA 3ZHQA 3ABKB 4NXNB 3QO7A 3BVOA 3ZCCA 1K5SA 5EZYA 5JJEB 1SZXA 4O4IA 3I55V 2FKXA 1IBKB 4UUJC 3JYCA 4FLTA 3NXSA 4I50B 4FFKA 5J2TA 4PA3A 1HWYA 1Q7YW 2YEVA 3CJHA 1FFXB 3ZHVA 1VQ5V 1U96A 1SA0A 1Y74B 2QR4A 4DV5B 1AI4A 3J7AU 3K5LA 1Y67A 5H6RA 1IBMB 2EIMC 4PDLA 1K5QA 1FFTB 4ABMA 1VP7A 4JGSA 4K0KB 3SJCC 2ITDC 2KB1A 1K4DC 2P22C 2UXNA 1N4CA 3CXCU 2V4DA 4CBCA 3ABMC 2ZIOA 2X7RB 3BRCA 5EZYB 1GMGA 4O4IB 3K0GA 4DR7O 1J5EO 1AROP 5C8YA 2F4VB 4J7ZA 1I7FA 1G6UA 2QSAA 3SYAA 2YEVB 3CJHB 2EZOA 2P06A 2N05A 4H33A 1UFIA 1SA0B 1G4YB 2X6AA 2DYRB 3K58A 1K73W 2JS3A 3TGUH 4MVSA 1V55B 5IJ0A 5L3BA 2EIKC 4GCZA 3HKBB 4QIWF 3VQYA 4UVAA 3UM7A 1BT8A 4JI8B 2K9PA 1N34O 3ZX6A 1QQCA 5H5NA 3BCCH 4E4EA 1IXBA 2NNUA 3OR6C 1VF5B 4Q6GA 4HBNA 2GV9A 1KYOF 2Q9LA 3AG1C 1NT2B 3LSUA 4DV6O 3ABUA 4UV9A 1K3EA 3U10A 3WB1A 2BCCH 1YJWV 4YY3O 2ZDIC 3IJ4A 1SETA 1M56B 5C8YB 4DR3O 1O9GA 1OHHG 3CCUV 1GM8A 5CBGA 2KKWA 1Q43A 2V1DA 5LMUB 1RPOA 2WLHA 2YI8A 4JZGA 3G67A 2RDCA 5L3FA 4MS2A 3FD9A 4P30A 5E79Z 3P3PA 1M9NA 2AGAA 5HFLA 5IJ0B 3KCXA 2CH7A 1R73A 4O4LA 5EIBC 3IC7A 1WP8A 2Q67A 3DC6A 4FPPA 1SERA 1SC5B 4X66O 2ITCC 5KAIZ 2ILMA 3EHBB 1W2BU 3SGIA 4IGGA 3I56V 5BR8O 4TWKA 3WFVA 3ASNC 1XUQA 1KBHA 2UXDO 3RYHA 4FM1A 3IFXA 4DUYO 3EXAA 2OTLV 4UCSA 2PI4A 1RPRA 3ZRXA 4CH4A 2FB5A 3K5OA 4WFGA 4LF4B 1NKDA 1RP3B 2W0XA 3ABKC 3A0RA 5IJ9A 1HNWB 4NR1A 3B8MA 3SR2C 1EN6A 1XL4A 1GK9A 4PD4F 4Z1VA 1SQVH 5KHHA 4B3SO 1N36O 3CC7V 2CAZC 2ZNIA 5LHHA 2CH7B 1M4UA 4O4LB 4G27B 3B2EE 4N21A 2CE4A 2WLNA 2HJDA 2UU9B 1ZL8A 1SS3A 4BIUA 3NR7A 2QTSA 1B06A 4C7UA 1SQFA 3RYHB 2O57A 1D2DA 3CSXA 3ZMTA 4IYIA 3RGBA 4A5UB 2LJ2A 4F6RB 2EX3A 1XBLA 1FD9A 4FLXA 3I5DA 4R50A 4KXRA 4GT1A 1LUWA 1HP8A 5EYPA 3OMNB 2ARHA 3C3SA 5IJ9B 3GWKC 1OCOB 4W4KA 1QLNA 1COWG 5KHKA 1O9HA 1N32B 4U7OA 2CUGA 1N33O 2B9ZA 5CA0A 4J80A 1PNKA 3M8AA 3AG7A 4JV5B 3CD6V 3ZMVA 1THZA 4DRXA 3MHHC 3ICXA 1BCCH 5IYCO 4DR4B 1ZL8B 2DYRC 3W7SA 1KD1W 1WN7A 4GUNA 3T1CA 1V55C 1TGOA 3RT3C 2ZM6O 2X6BA 4FK5C 1NVPD 3M99B 4GX1A 1XDCA 5EIBD 3JALA 5KLVH 3JD1A 4WFAV 4DUZB 1SQBH 3QO8A 1XOUA 4LF7B 2XAHA 5EYPB 4JI7O 2GTAA 2ZCEA 3RVZA 1S77D 1D5AA 1OCCB 4JI0O 2W0FC 3DXRA 1JVMA 3BPZA 3A2FA 3L71H 4GLXA 5DEDA 1JMKC 1X59A 4K3AA 2Q73A 1FXKA 1M56C 4JI6B 4PELA 4GKKB 3X2QB 4DRXB 5K1PA 1WLEA 5FL7G 3E8HA 3BFRA 1JOYA 3W7UA 4DO2A 4AQYB 2R72A 3DTUB 1XI1A 4NKGB 1MZFA 4MVRA 2WA3A 4FIPC 5B1BB 3SYCA 3JALB 4NB5A 1KMIZ 2UUBO 4F4LA 3CCQV 4HNAA 1YITV 1ORQC 5H6QA 4DV1B 5FPRA 2IH1C 2IJIA 3GB7C 4NXMO 1QVFU 3L73H 1Q82W 4KHPO 1JX9A 2WAMA 3DXRB 3JAMN 3FAVA 2JK5C 5D5PA 3E8BA 2FTKA 3APQA 1OCRB 1FXKB 1ZX3A 1MMMA 1M90W 4DV7O 2XAQA 3FYEB 4TQFA 1GTOA 1XMQB 1XL6A 2QDOA 3BABA 1R3KC 1VQOV 3MD0A 3O65A 3FFQA 2UXCO 1IBKO 2HJFC 4DR2O 4U7NA 3OEEG 2UXBO 5IT9N 4X65B 2F66C 5FPOA 3G6EV 5L3GA 5CBFA 1ENVA 3BEHA 4P2ZA 4LF8O 1VF6A 1BS3A 4UVCA 4HNAB 2YI9A 3CHXA 4KL1A 1QCEA 1AJPA 4MT8A 4CC5A 3T1HB 4LWSA 4UB6Z 3IAYA 1YEWA 5EK0A 4YIPA 3P3NA 1FS0G 3OD4A 2FL4A 2AZ2A 1JPXA 2N04A 4K8XA 1H2GA 3FAVB 2UUAB 1XQ8A 4XDLA 3VQWA 3CCRV 2H8PC 2Z5UA 1HNZB 1FKAO 2P6JA 4NYKA 1Y76B 1XMOB 4PI2A 1LR1A 4JAVA 1OCOC 1K4CC 5LP6A 1JQ0A 2NR5A 2CGOA 1JA8A 1H38A 3CC4V 5E1AC 1BHBA 4WCEV 4BW5A 1K34A 3E8FA 4O2BA 4EFBA 2WLKA 3FB8C 2ZE5A 1GM7A 4GX5A 2E5LB 2F4VO 4MTXA 3CRQA 1Z2GA 1HNXB 1AB3A 5DM6V 3QVNA 2NN4A 4GKJB 5IWAB 4LF5O 3D36C 1DF5A 3AG2B 2HLDG 1L1FA 1NTZH 1CPYA 3RFRA 4DV0B 2IM9A 3E35A 5A9GA 1IDSA 3W7XA 4WBNA 2P67A 1GN6A 4J7KA 4ZI7A 4FZ1A 1OCCC 3B8NA 5LP6B 4OPHA 4DR5O 1DGSA 1QNMA 1RM1B 2VQFB 1WJZA 3JAKA 2P7TC 4O2BB 2DQ3A 3CCLV 3K3WA 5KMGA 3X2QC 1I94O 1XHXA 4I5SA 2QKAA 5LMUO 3FYIB 5AG2A 1FXHA 5K1XA 1QBZA 3CWBH 3OTFA 2XHBA 3BAAA 5LA6A 1BSMA 2F93B 3KKYA 1H2KA 1WPBA 5B1BC 5JJNB 4UCVA 4RUEA 5EBLC 2D3OW 3CPWU 3T4DA 4J7JA 3H1IH 3H1JH 2F23A 1OZ0A 2ADPA 4WBNB 1ZUQA 1PV0A 4UV8A 4ZI7B 2VWJA 2DJVA 2W6IG 2QM4A 2QJ1A 3OEHG 4YXWG 2GSMB 1HR0B 2AHZA 1SESA 1OCRC 2R9RB 3A0HZ 3H1KH 4X1YA 2WLIA 3JAKB 5LBQA 1AI7A 4J41A 5JVDA 3U11A 1EM1A 3OR7C 5KMGB 4HZ3A 2X0LA 4JF3A 3H01A 2HR3A 4OPAA 4Q20A 4FVMA 4O4HA 1B04A 3MDSA 3B4SA 1WP7A 3EVKA 1WB7A 1YSCA 4RO2A 3RW0A 2UUCB 1GKFA 5LA6B 3KZIZ 4LFBB 1F51A 4DR6B 3SYOA 1CEZA 2OYQA 3G6BA 3SPCA 3SPGA 1Q6IA 1TA8A 2ZE8A 1TAEA 2A3QA 4JI2B
chains in the Genus database with same CATH topology
1BGYH 1SQQH 3BCCH 2FYUH 3L70H 4U3FH 1SQBH 3L75H 3CX5F 3CWBH 3L73H 3H1LH 3CXHF 3TGUH 1KYOF 1P84F 4D6TH 4PD4F 1SQVH 3L71H 1NTZH 2BCCH 3H1KH 1NU1H 1L0NH 2IBZH 3L72H 3H1JH 1NTMH 5KLVH 3L74H 1EZVH 1PP9H 1SQXH 1L0LH 1SQPH 1KB9F 1PPJH 1BCCH 1BE3H 3H1HH 2A06H 3H1IH 1NTKH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY H;  1SQQ H;  3BCC H;  2FYU H;  3L70 H;  4U3F H;  1SQB H;  3L75 H;  3CX5 F;  3CWB H;  3L73 H;  3H1L H;  3CXH F;  3TGU H;  1KYO F;  1P84 F;  4D6T H;  4PD4 F;  1SQV H;  3L71 H;  1NTZ H;  2BCC H;  3H1K H;  1NU1 H;  1L0N H;  2IBZ H;  3L72 H;  3H1J H;  1NTM H;  5KLV H;  3L74 H;  1EZV H;  1PP9 H;  1SQX H;  1L0L H;  1SQP H;  1KB9 F;  1PPJ H;  1BCC H;  1BE3 H;  3H1H H;  2A06 H;  3H1I H;  1NTK H; 
#chains in the Genus database with same CATH topology
 2IU0 A;  4J9Z B;  5JWP A;  1W0K G;  2LGQ A;  4I7Z B;  3L9D A;  3J80 N;  2Q0O C;  2ZIM A;  3A8T A;  3ZN1 A;  4YHH B;  4PDR A;  5GTI Z;  4JYC A;  1MOF A;  4HYO A;  1YDX A;  4X1Y B;  2WLI B;  2ZQM A;  3CC2 V;  5JVD B;  3CYO A;  1AI6 A;  2EIN C;  3OGI B;  1G1X B;  5J9P C;  4O4H B;  2XTA A;  3KG2 A;  1XNR B;  4JYA B;  1TUE B;  5J2T B;  3RYC A;  1VQ9 V;  5CN0 A;  1XNQ B;  1N8R W;  1KQS U;  1VF6 C;  1P4R A;  4GX0 A;  1BE3 H;  4TV9 A;  1QHT A;  1KP3 A;  3VOU A;  4DR4 O;  3W7T A;  1BHA A;  1P7G A;  2JS5 A;  1BQ0 A;  3AG2 C;  3BY6 A;  2JGU A;  3WU2 Z;  3OTO B;  3T1Y B;  1Q3E A;  4EKW A;  5LGN A;  2XAS A;  2XAF A;  4G28 B;  1MAB G;  4X8A A;  1VQM V;  4UXN A;  1EZV H;  4I55 A;  3CRA A;  2GTS A;  3OUS A;  4LF7 O;  5LP6 C;  4MVM A;  1V54 B;  1VF7 A;  3ZRV A;  1R6N A;  2GBO A;  2Q8V A;  4JI5 O;  2JGD A;  1S76 D;  4JI6 O;  4TSF G;  1QR9 A;  5L3D A;  1KB9 F;  4QPK A;  1AJQ A;  4TV9 B;  1GO3 F;  1K9M W;  3LNM B;  5JQG A;  1FXV A;  2CK3 G;  3JD4 A;  1SZT A;  1BMF G;  2IJJ A;  4LF9 B;  5LOV A;  2F1M A;  2WSS G;  1URF A;  4BAY A;  1NTK H;  4LR3 A;  3A0B Z;  5KAF Z;  1GH6 A;  4I55 B;  2PZS A;  4OGQ B;  4ZOL A;  1Y4M A;  3R65 A;  3CXH F;  3QG5 A;  3D3I A;  1EN5 A;  4ZKI A;  2JEX A;  3APO A;  3J81 N;  4FM2 A;  1Q90 D;  3DSQ A;  1VQ8 V;  2JGD B;  2LW1 A;  4JPR A;  2YC0 A;  2YIB A;  5L3E A;  2IH3 C;  2XAJ A;  2QTO A;  4QNH B;  4JI4 B;  2WWW A;  1SQG A;  5JQG B;  5LMN B;  2L6L A;  4JTD B;  4PA4 A;  1K7D A;  3AG3 B;  3OGC C;  2DW4 A;  3VBB A;  3JCU Z;  2XAG A;  4X65 O;  1Z5W A;  4X62 B;  4JI1 B;  2IU3 A;  5LOV B;  4FM0 A;  2HVK C;  4E2L A;  1LNQ A;  2YXH A;  2Q69 A;  1QVG U;  3T1H O;  2OT5 A;  1NS1 A;  1W59 A;  4ZOL B;  1IVS A;  1FJG B;  2G38 A;  2UUA O;  3TJT A;  1NTM H;  2FML A;  3L74 H;  2B1I A;  1R6T A;  1EBO A;  2EZP A;  2ADQ B;  1ZAU A;  3CX5 F;  1OCZ B;  3LNN A;  2QM8 A;  1R6K A;  3HKE A;  2QKS A;  3ML0 A;  2YID A;  4FZ0 A;  2XT9 A;  4CH3 A;  4P9P A;  4DV2 B;  1X4T A;  3ZMS A;  3L72 H;  1HNX O;  4K35 A;  2OWO A;  4D7S A;  5FLX N;  2PI5 A;  4BIO A;  1NH2 D;  2LFR A;  5IWA O;  2DN9 A;  3UKM A;  4RWU A;  4D6T H;  3OFN G;  1H8H G;  3STL C;  4DR7 B;  1J5E B;  1WAZ A;  4RQE A;  2HFE C;  1WB8 A;  4IL6 Z;  4GX2 A;  3RN4 A;  2QWO B;  3ETQ A;  3UCS C;  3ZMZ A;  2OIG A;  5HFM A;  1V54 C;  1PNL A;  3HKE B;  4LP8 A;  3AK2 A;  5BXZ A;  1HDJ A;  1WNS A;  4R6Z A;  2Y4U A;  3BHP A;  4LBE C;  4BWA A;  4UB8 Z;  4WFF A;  5CA0 B;  2VQE O;  3ZRS A;  1PP9 H;  3DC5 A;  1HW7 A;  4DK1 A;  1N34 B;  5IYB O;  4O2A A;  1VMG A;  1S5J A;  2MW2 B;  2AXT Z;  2EUL A;  1UJW B;  4J9Y B;  4ZIB A;  3LDE A;  4JI3 O;  4PV1 B;  1KC8 W;  4DV6 B;  2RJZ A;  3O9O A;  4MTF A;  4YY3 B;  1H2N A;  2Q7E A;  2C2A A;  2HHH B;  3LSS A;  1AVM A;  3K06 A;  5EC2 C;  2QWN B;  1TVK A;  1VQ4 V;  5L3C A;  3C90 A;  4QPJ A;  5CB4 A;  4B3T O;  2F95 B;  3AK3 A;  2W6J G;  2WLJ A;  4LFC B;  3CCS V;  5GTH Z;  3ZRW A;  3B40 A;  1R1B A;  1GN4 A;  2Q0A A;  3E89 A;  1JJ2 U;  3CS5 A;  1UPG A;  1PPJ H;  4DR1 B;  3ZHT A;  1SQQ H;  2FYU H;  4O2A B;  3K0D A;  4NXN O;  3BA9 A;  1N0J A;  1S5H C;  2VWK A;  3MHS C;  2OIE A;  4X64 B;  4PDV A;  1DTO A;  1FYJ A;  1E79 G;  4CZZ A;  5IY5 B;  3RYF A;  3AG4 B;  3OM3 B;  5B5E Z;  4U3J A;  3ZS8 C;  1I5X A;  1TVK B;  3G4S V;  1KP2 A;  4DV5 O;  2CGN A;  2Q5Z A;  4FLU A;  3F5W C;  5CB4 B;  3VQV A;  1IBM O;  3RYI A;  2PF4 E;  2PTM A;  5IYD O;  1N36 B;  2X6C A;  1Z5V A;  3E2E A;  3AEI A;  3R66 A;  3B77 A;  5TIS Z;  5B3S B;  3ZRW B;  4K0K O;  2BOC C;  2ZKO A;  3IC9 A;  3FB6 C;  4MSW C;  2E3C A;  1I08 A;  5GON A;  1OCZ C;  2VS0 A;  3JAR A;  3FB5 C;  1FPO A;  2BTQ A;  2LGW A;  3K59 A;  1KU9 A;  1PKX A;  5GW7 A;  4K8Z A;  3N2G A;  2LP7 A;  2H94 A;  2Q68 A;  2BTO A;  1GRJ A;  2XUM A;  3FB7 C;  2HP8 A;  3F5T A;  3RYF B;  4N23 A;  4JAA A;  1XNQ O;  3JAS A;  4DV3 B;  2PGG A;  2OCC B;  3STZ C;  1KKC A;  1QLE B;  2H3O A;  1DF4 A;  1E1R G;  4U3J B;  3HKC A;  1KKD A;  4X1K A;  2ZXW B;  3ABL B;  1N33 B;  4LWS B;  1IUR A;  2DMX A;  3RYI B;  3EFF K;  3JAW A;  2KG7 A;  2YUA A;  4DXW A;  2ZR2 A;  3S3X A;  3K79 A;  5EBW C;  4J11 A;  3Q4H A;  1AP5 A;  3GWO A;  1NBM G;  1ZTE A;  2RN9 A;  3CMA V;  4TOI A;  4IYH A;  4JI8 O;  2GDS A;  4D7T A;  5GON B;  2ZD9 A;  4FLW A;  3JAR B;  2LW7 A;  4X20 A;  1JJO A;  1R3I C;  3LUT B;  2BTQ B;  3JSL A;  4XBF A;  4JYB A;  3N2G B;  2Q6A A;  3QO5 A;  4Z2W A;  4DV4 B;  1Y6X A;  4OX9 B;  2KQX A;  5KHI A;  3JAS B;  4J10 A;  2LO1 A;  4MVQ A;  2IW5 A;  4MVO A;  4UFZ A;  4JI7 B;  3TXS A;  2RNB A;  3HKC B;  1NH2 B;  2PYL A;  4QGP A;  1DLB A;  1KEC A;  1SKV A;  3PJS K;  4X1K B;  1CXZ B;  4YIO A;  4JAU A;  3JAW B;  2KG7 B;  2CDY A;  1EFR G;  2R70 A;  3Q4H B;  3K5M A;  5B1N A;  1YI2 V;  1JR9 A;  3H1H H;  1VAR A;  3UO2 A;  3OMI B;  1Q81 W;  1JCH A;  1YCI A;  2Y0I A;  3L75 H;  2LFS A;  2DYS B;  4FJC C;  4JTC B;  4X20 B;  1US6 A;  4H13 B;  1VQ7 V;  4LH6 A;  4LNU A;  1V9P A;  1NJI W;  1FXK C;  2E74 B;  2UUB B;  2YIB D;  4LF4 O;  4CS2 A;  4LH7 A;  5KUM A;  3CRC A;  1HNW O;  5JCO A;  4LF6 B;  3OW2 U;  4KHP B;  2JRI A;  4YJ3 A;  3HPL C;  2YXL A;  4B3M B;  5LMN O;  2JDI G;  1S5L Z;  2AW9 A;  3THO A;  4LFA B;  5IY5 C;  2EJ7 A;  2Y69 B;  3AG4 C;  5CBH A;  4X62 O;  4IHJ A;  1YXB A;  4I9W A;  3B09 A;  4DV7 B;  1IX9 A;  4IT5 A;  2A79 B;  4UCO A;  2Q7G A;  2UU9 O;  3WG7 B;  2YXY A;  5EC1 C;  4CS3 A;  4F6E A;  3H9V A;  5DN6 G;  5B1O A;  1F4M A;  2UXC B;  1R3J C;  5CMU A;  4BW9 A;  4DR2 B;  1R3L C;  3CME V;  2UXB B;  5BZB A;  5JJJ B;  1FJG O;  1WA8 A;  1ZWI C;  4X89 A;  5B3S C;  1GAX A;  2D2C B;  3S3W A;  4LNU B;  2BE3 A;  1MSW D;  4NVP A;  4LF8 B;  1J95 A;  2XND G;  4IIJ A;  2K1E A;  3JD0 A;  2Y4T A;  4JTA B;  2ZNJ A;  4PA9 A;  4UCR A;  5LL6 Y;  3HB3 B;  2L35 A;  1OV9 A;  4PDM A;  2RQ6 A;  2WPD G;  3UO3 A;  3TCU A;  4YJ3 B;  1PM9 A;  1N32 O;  3ABT A;  1P7B A;  4DV2 O;  3HKB A;  1SRY A;  1EN4 A;  4B3R B;  4OXS A;  1PL0 A;  1A32 A;  5FNV A;  2Y0P A;  3MAQ A;  2IBZ H;  5LGU A;  4JV5 O;  4IHJ B;  4G2K A;  2OCC C;  4QJF B;  1QLE C;  2QM7 A;  5KHG A;  1PL4 A;  1Q5O A;  3CE2 A;  4PJ0 Z;  4EEQ A;  5KUK A;  3ZED A;  2DE0 X;  2ZXW C;  3ABL C;  3DGE A;  1M1K W;  2GUZ A;  4FFB A;  2ATK C;  4I0X A;  4FLZ A;  1NI8 A;  1WA8 B;  2PY5 A;  4NTX A;  1VQP V;  3N2K A;  1T5E A;  1RFY A;  4MTO A;  3SDL A;  3SPJ A;  4IIJ B;  5IE9 A;  1LUV A;  5B1A B;  2ZIN A;  1M57 B;  1IBL B;  4DUZ O;  3K57 A;  2VRZ A;  5C93 A;  1PNM A;  4LF5 B;  1MSD A;  5LHG A;  4WFH A;  1RM1 C;  3E8G A;  4R8C A;  2E75 B;  5FNV B;  1S72 V;  4WFE A;  3G80 A;  4DK0 A;  3TXQ A;  3RYC B;  2HKO A;  1NZ6 A;  4GKK O;  2Y48 A;  1EZJ A;  2XOK G;  3QNE A;  1GM9 A;  3E83 A;  2HEP A;  4X1I A;  4DR5 B;  3T2M A;  4Z1M G;  2EIL B;  5A2Q N;  4L87 A;  4AQY O;  2QA4 V;  1P49 A;  1YIJ V;  4FLV A;  3JD2 A;  3M7M X;  4H37 A;  2GUZ B;  4KP4 A;  4FFB B;  4I0X B;  2R9I A;  4MVU A;  3ETE A;  1F7Y A;  2HHH O;  1I94 B;  1U97 A;  2DWE C;  3N2K B;  3TET A;  3K04 A;  3P32 A;  4DV1 O;  2RMK B;  1XHZ A;  1GN3 A;  2DYS C;  2JJ1 G;  3AK1 A;  1XRE A;  1G8M A;  4FMT A;  3ZMU A;  5BY1 A;  3OMA B;  1SF9 A;  1Q6H A;  4LFC O;  1WPX A;  2GHY A;  1BZK A;  1NR7 A;  2M7W A;  1D5N A;  1Y66 A;  3OE7 G;  1SQX H;  4B7K A;  4DR1 O;  2NLJ C;  2A9H A;  1XMQ O;  4CC6 A;  2RCV A;  4X1I B;  4PA6 A;  1AJN A;  4X64 O;  2Y69 C;  5JH7 A;  4UCU A;  4DW1 A;  5IYZ A;  4F6R A;  4MVZ A;  3F7Y C;  3GVM A;  2CTP A;  5LXT A;  3CCJ V;  2AHY A;  3LDC A;  3ASO B;  4H44 B;  3CRM A;  3N27 A;  3WG7 C;  3CCE V;  3G71 V;  1YHQ V;  5LHI A;  4W4L A;  2EIJ B;  3H1L H;  4BIZ A;  1S3J A;  4ZHQ A;  4GZR B;  2V7Q G;  3K03 A;  3LSQ A;  1AR5 A;  3SPH A;  1YTF B;  1F23 A;  3WB0 A;  1HNZ O;  4KUM A;  2P90 A;  1XMO O;  4DYL A;  3SJB C;  2IJH A;  2HVJ C;  2Q4P A;  2HG5 C;  1H2S B;  5JCO C;  3D36 A;  3K5N A;  1KUQ A;  3E86 A;  4QE9 A;  5IDJ A;  5JH7 B;  5IYZ B;  2YS8 A;  1K33 A;  1NU1 H;  1L0N H;  3P30 A;  4WF9 V;  2E5L O;  4J42 A;  4I4T A;  1GN2 A;  4RUF A;  1M5I A;  5LXT B;  4DV3 O;  3ETG A;  3OUF A;  1YZB A;  2WA4 A;  1K97 A;  1BGY H;  3BA8 A;  2UXX A;  3TK1 A;  4PHZ A;  4GKJ O;  1F4N A;  2LQT A;  4ZHQ B;  5BMV A;  2DQ0 A;  4DW0 A;  4JAS A;  5CA1 A;  4B7E A;  4B08 A;  3UQ8 A;  2E76 B;  4PA7 A;  2M6Y A;  4DV0 O;  5KX5 A;  3VQX A;  3PN1 A;  1L0L H;  5B1A C;  5ITZ A;  2YDE A;  1M57 C;  2WLL A;  2OCH A;  3C3T A;  1I0H A;  2P5O A;  1S0V A;  1H2L A;  1ROP A;  1H2M A;  2ZE7 A;  3E22 A;  3OT7 A;  2B1G A;  4L8J A;  1ZSP A;  4UCT A;  2VQF O;  3FX7 A;  4TQD A;  4DV4 O;  4OX9 O;  5KA5 A;  1PD3 A;  4TT3 G;  3QF7 A;  3CRR A;  4I4T B;  4I9Q A;  1NR1 A;  4O4J A;  2ODM A;  5LGT A;  1NQT A;  1Q8I A;  2BOB C;  1AR1 B;  5KA6 A;  1QU7 A;  2JJ2 G;  2EIL C;  1RSO A;  2MK3 A;  1Q86 W;  3OAA G;  4JI5 B;  5J2U A;  5BMV B;  5CA1 B;  3SYP A;  1VIB A;  1Q6U A;  3ZN0 A;  4MW8 A;  4DR3 B;  2A7W A;  1QR8 A;  2EJR A;  3CCM V;  5KX5 B;  2QGN A;  5ITZ B;  2YSU B;  2WLL B;  4AI8 A;  5F2V O;  4ZBM A;  3WB2 A;  3QTC A;  3FKS G;  2CTW A;  3HKD A;  1XIL A;  3K9S A;  3E22 B;  3CCV V;  1HR0 O;  4AIL C;  1AP6 A;  2ZR3 A;  2QEX V;  1CP9 A;  4CH6 A;  4GYC B;  1VEW A;  4X66 B;  2EBO A;  4O4J B;  2P4K A;  5B66 Z;  4U3F H;  5BR8 B;  4LF6 O;  3T4Z A;  3W7W A;  4B3M O;  2OTJ V;  2UXD B;  2A0L A;  4LFA O;  4DUY B;  1RSO B;  2QWQ B;  3AG3 C;  2ETN A;  1L8D A;  2UUC O;  5J2U B;  4LCU C;  1YF2 A;  1Y76 A;  4LFB O;  1JFF A;  3HR0 A;  4CH5 A;  4DR6 O;  2KSD A;  3ASO C;  3K08 A;  3SJA C;  3ZHR A;  1DK1 A;  2CTR A;  3SYQ A;  3L70 H;  4JI2 O;  4H0L B;  3U0Z A;  2EIJ C;  5EBM C;  3CP1 A;  2IJK A;  3HKD B;  1K92 A;  4P9O A;  4YHH O;  4B3S B;  2P4V A;  1FAF A;  2QWP B;  3CB2 A;  1M93 A;  1YVW A;  1I5Y A;  3LDD A;  3ZIA G;  2A06 H;  5D5Q A;  4YJ2 A;  1H8E G;  4WFB V;  4UVB A;  3IGA C;  2EIM B;  1YJN V;  4B3R O;  3KCY A;  1TUB A;  4CS4 A;  1XNR O;  4JYA O;  4R7C A;  5KHJ A;  1JFF B;  2YIA A;  4ASU G;  1K8A W;  4JYY A;  2EIN B;  1BL8 A;  4FLY A;  1IZ3 A;  4TUY A;  1ZLZ A;  2ZE6 A;  5LYJ A;  2CTQ A;  4XDJ A;  2Z0A A;  3UT5 A;  3ABM B;  4AHC A;  5CA3 A;  1B6Q A;  3RVY A;  1N0N A;  3CEI A;  4TV8 A;  2N74 A;  2ZDI A;  2B5U A;  2Q7H A;  3ZHS A;  2JVD A;  3OTO O;  3T1Y O;  4X9Q A;  3JD3 A;  2QWR B;  1XEQ A;  4EB6 A;  4XDK A;  1IBL O;  1AI5 A;  2Z3Y A;  4YJ2 B;  3D3Q A;  4HAM A;  4QE7 A;  2QKC A;  2ZM6 B;  2EIK B;  1VQN V;  4EFE A;  4MTG A;  1E1Q G;  1TUB B;  4NTY A;  3RWR D;  1MA1 A;  2BSK A;  1SQP H;  5DEC A;  3F7V C;  1VQK V;  4TUY B;  1YJ9 V;  1W0J G;  5LYJ B;  2DOS A;  4JI0 B;  2WLM A;  3UT5 B;  4JZ2 A;  3AG1 B;  3JAT A;  4RAI A;  3SPI A;  4TV8 B;  4BR6 A;  2VQE B;  1VQ6 V;  2PUS A;  4LF9 O;  2QE7 G;  4LC1 A;  1AIL A;  2AZ0 A;  4JI3 B;  5H2F Z;  4X88 A;  1VQL V;  4EB6 B;  3ETD A;  3SJQ C;  1B3Q A;  4PI0 A;  2F43 G;  2PYJ A;  4I50 A;  1P84 F;  1NVP B;  1AR4 A;  1YTF D;  5H9C A;  1FFX A;  4KFM A;  4MW3 A;  3ZJZ A;  2ZT9 B;  1BQZ A;  1Y74 A;  2JIZ G;  2BSK B;  2JEU A;  2DWD C;  4RQF A;  4ICG A;  4NXM B;  3JSN A;  4B3T B;  1OJH A;  3ZHU A;  3ASN B;  4NTW A;  4JI4 O;  2R9A A;  1IXM A;  2YIC A;  3JAT B;  1MZE A;  3K9A A;  3RBZ A;  1MG1 A;  3D8C A;  3ZBH A;  4JI1 O;  3JCZ A;  1MNG A;  3ZHQ A;  3ABK B;  4NXN B;  3QO7 A;  3BVO A;  3ZCC A;  1K5S A;  5EZY A;  5JJE B;  1SZX A;  4O4I A;  3I55 V;  2FKX A;  1IBK B;  4UUJ C;  3JYC A;  4FLT A;  3NXS A;  4I50 B;  4FFK A;  5J2T A;  4PA3 A;  1HWY A;  1Q7Y W;  2YEV A;  3CJH A;  1FFX B;  3ZHV A;  1VQ5 V;  1U96 A;  1SA0 A;  1Y74 B;  2QR4 A;  4DV5 B;  1AI4 A;  3J7A U;  3K5L A;  1Y67 A;  5H6R A;  1IBM B;  2EIM C;  4PDL A;  1K5Q A;  1FFT B;  4ABM A;  1VP7 A;  4JGS A;  4K0K B;  3SJC C;  2ITD C;  2KB1 A;  1K4D C;  2P22 C;  2UXN A;  1N4C A;  3CXC U;  2V4D A;  4CBC A;  3ABM C;  2ZIO A;  2X7R B;  3BRC A;  5EZY B;  1GMG A;  4O4I B;  3K0G A;  4DR7 O;  1J5E O;  1ARO P;  5C8Y A;  2F4V B;  4J7Z A;  1I7F A;  1G6U A;  2QSA A;  3SYA A;  2YEV B;  3CJH B;  2EZO A;  2P06 A;  2N05 A;  4H33 A;  1UFI A;  1SA0 B;  1G4Y B;  2X6A A;  2DYR B;  3K58 A;  1K73 W;  2JS3 A;  3TGU H;  4MVS A;  1V55 B;  5IJ0 A;  5L3B A;  2EIK C;  4GCZ A;  3HKB B;  4QIW F;  3VQY A;  4UVA A;  3UM7 A;  1BT8 A;  4JI8 B;  2K9P A;  1N34 O;  3ZX6 A;  1QQC A;  5H5N A;  3BCC H;  4E4E A;  1IXB A;  2NNU A;  3OR6 C;  1VF5 B;  4Q6G A;  4HBN A;  2GV9 A;  1KYO F;  2Q9L A;  3AG1 C;  1NT2 B;  3LSU A;  4DV6 O;  3ABU A;  4UV9 A;  1K3E A;  3U10 A;  3WB1 A;  2BCC H;  1YJW V;  4YY3 O;  2ZDI C;  3IJ4 A;  1SET A;  1M56 B;  5C8Y B;  4DR3 O;  1O9G A;  1OHH G;  3CCU V;  1GM8 A;  5CBG A;  2KKW A;  1Q43 A;  2V1D A;  5LMU B;  1RPO A;  2WLH A;  2YI8 A;  4JZG A;  3G67 A;  2RDC A;  5L3F A;  4MS2 A;  3FD9 A;  4P30 A;  5E79 Z;  3P3P A;  1M9N A;  2AGA A;  5HFL A;  5IJ0 B;  3KCX A;  2CH7 A;  1R73 A;  4O4L A;  5EIB C;  3IC7 A;  1WP8 A;  2Q67 A;  3DC6 A;  4FPP A;  1SER A;  1SC5 B;  4X66 O;  2ITC C;  5KAI Z;  2ILM A;  3EHB B;  1W2B U;  3SGI A;  4IGG A;  3I56 V;  5BR8 O;  4TWK A;  3WFV A;  3ASN C;  1XUQ A;  1KBH A;  2UXD O;  3RYH A;  4FM1 A;  3IFX A;  4DUY O;  3EXA A;  2OTL V;  4UCS A;  2PI4 A;  1RPR A;  3ZRX A;  4CH4 A;  2FB5 A;  3K5O A;  4WFG A;  4LF4 B;  1NKD A;  1RP3 B;  2W0X A;  3ABK C;  3A0R A;  5IJ9 A;  1HNW B;  4NR1 A;  3B8M A;  3SR2 C;  1EN6 A;  1XL4 A;  1GK9 A;  4PD4 F;  4Z1V A;  1SQV H;  5KHH A;  4B3S O;  1N36 O;  3CC7 V;  2CAZ C;  2ZNI A;  5LHH A;  2CH7 B;  1M4U A;  4O4L B;  4G27 B;  3B2E E;  4N21 A;  2CE4 A;  2WLN A;  2HJD A;  2UU9 B;  1ZL8 A;  1SS3 A;  4BIU A;  3NR7 A;  2QTS A;  1B06 A;  4C7U A;  1SQF A;  3RYH B;  2O57 A;  1D2D A;  3CSX A;  3ZMT A;  4IYI A;  3RGB A;  4A5U B;  2LJ2 A;  4F6R B;  2EX3 A;  1XBL A;  1FD9 A;  4FLX A;  3I5D A;  4R50 A;  4KXR A;  4GT1 A;  1LUW A;  1HP8 A;  5EYP A;  3OMN B;  2ARH A;  3C3S A;  5IJ9 B;  3GWK C;  1OCO B;  4W4K A;  1QLN A;  1COW G;  5KHK A;  1O9H A;  1N32 B;  4U7O A;  2CUG A;  1N33 O;  2B9Z A;  5CA0 A;  4J80 A;  1PNK A;  3M8A A;  3AG7 A;  4JV5 B;  3CD6 V;  3ZMV A;  1THZ A;  4DRX A;  3MHH C;  3ICX A;  1BCC H;  5IYC O;  4DR4 B;  1ZL8 B;  2DYR C;  3W7S A;  1KD1 W;  1WN7 A;  4GUN A;  3T1C A;  1V55 C;  1TGO A;  3RT3 C;  2ZM6 O;  2X6B A;  4FK5 C;  1NVP D;  3M99 B;  4GX1 A;  1XDC A;  5EIB D;  3JAL A;  5KLV H;  3JD1 A;  4WFA V;  4DUZ B;  1SQB H;  3QO8 A;  1XOU A;  4LF7 B;  2XAH A;  5EYP B;  4JI7 O;  2GTA A;  2ZCE A;  3RVZ A;  1S77 D;  1D5A A;  1OCC B;  4JI0 O;  2W0F C;  3DXR A;  1JVM A;  3BPZ A;  3A2F A;  3L71 H;  4GLX A;  5DED A;  1JMK C;  1X59 A;  4K3A A;  2Q73 A;  1FXK A;  1M56 C;  4JI6 B;  4PEL A;  4GKK B;  3X2Q B;  4DRX B;  5K1P A;  1WLE A;  5FL7 G;  3E8H A;  3BFR A;  1JOY A;  3W7U A;  4DO2 A;  4AQY B;  2R72 A;  3DTU B;  1XI1 A;  4NKG B;  1MZF A;  4MVR A;  2WA3 A;  4FIP C;  5B1B B;  3SYC A;  3JAL B;  4NB5 A;  1KMI Z;  2UUB O;  4F4L A;  3CCQ V;  4HNA A;  1YIT V;  1ORQ C;  5H6Q A;  4DV1 B;  5FPR A;  2IH1 C;  2IJI A;  3GB7 C;  4NXM O;  1QVF U;  3L73 H;  1Q82 W;  4KHP O;  1JX9 A;  2WAM A;  3DXR B;  3JAM N;  3FAV A;  2JK5 C;  5D5P A;  3E8B A;  2FTK A;  3APQ A;  1OCR B;  1FXK B;  1ZX3 A;  1MMM A;  1M90 W;  4DV7 O;  2XAQ A;  3FYE B;  4TQF A;  1GTO A;  1XMQ B;  1XL6 A;  2QDO A;  3BAB A;  1R3K C;  1VQO V;  3MD0 A;  3O65 A;  3FFQ A;  2UXC O;  1IBK O;  2HJF C;  4DR2 O;  4U7N A;  3OEE G;  2UXB O;  5IT9 N;  4X65 B;  2F66 C;  5FPO A;  3G6E V;  5L3G A;  5CBF A;  1ENV A;  3BEH A;  4P2Z A;  4LF8 O;  1VF6 A;  1BS3 A;  4UVC A;  4HNA B;  2YI9 A;  3CHX A;  4KL1 A;  1QCE A;  1AJP A;  4MT8 A;  4CC5 A;  3T1H B;  4LWS A;  4UB6 Z;  3IAY A;  1YEW A;  5EK0 A;  4YIP A;  3P3N A;  1FS0 G;  3OD4 A;  2FL4 A;  2AZ2 A;  1JPX A;  2N04 A;  4K8X A;  1H2G A;  3FAV B;  2UUA B;  1XQ8 A;  4XDL A;  3VQW A;  3CCR V;  2H8P C;  2Z5U A;  1HNZ B;  1FKA O;  2P6J A;  4NYK A;  1Y76 B;  1XMO B;  4PI2 A;  1LR1 A;  4JAV A;  1OCO C;  1K4C C;  5LP6 A;  1JQ0 A;  2NR5 A;  2CGO A;  1JA8 A;  1H38 A;  3CC4 V;  5E1A C;  1BHB A;  4WCE V;  4BW5 A;  1K34 A;  3E8F A;  4O2B A;  4EFB A;  2WLK A;  3FB8 C;  2ZE5 A;  1GM7 A;  4GX5 A;  2E5L B;  2F4V O;  4MTX A;  3CRQ A;  1Z2G A;  1HNX B;  1AB3 A;  5DM6 V;  3QVN A;  2NN4 A;  4GKJ B;  5IWA B;  4LF5 O;  3D36 C;  1DF5 A;  3AG2 B;  2HLD G;  1L1F A;  1NTZ H;  1CPY A;  3RFR A;  4DV0 B;  2IM9 A;  3E35 A;  5A9G A;  1IDS A;  3W7X A;  4WBN A;  2P67 A;  1GN6 A;  4J7K A;  4ZI7 A;  4FZ1 A;  1OCC C;  3B8N A;  5LP6 B;  4OPH A;  4DR5 O;  1DGS A;  1QNM A;  1RM1 B;  2VQF B;  1WJZ A;  3JAK A;  2P7T C;  4O2B B;  2DQ3 A;  3CCL V;  3K3W A;  5KMG A;  3X2Q C;  1I94 O;  1XHX A;  4I5S A;  2QKA A;  5LMU O;  3FYI B;  5AG2 A;  1FXH A;  5K1X A;  1QBZ A;  3CWB H;  3OTF A;  2XHB A;  3BAA A;  5LA6 A;  1BSM A;  2F93 B;  3KKY A;  1H2K A;  1WPB A;  5B1B C;  5JJN B;  4UCV A;  4RUE A;  5EBL C;  2D3O W;  3CPW U;  3T4D A;  4J7J A;  3H1I H;  3H1J H;  2F23 A;  1OZ0 A;  2ADP A;  4WBN B;  1ZUQ A;  1PV0 A;  4UV8 A;  4ZI7 B;  2VWJ A;  2DJV A;  2W6I G;  2QM4 A;  2QJ1 A;  3OEH G;  4YXW G;  2GSM B;  1HR0 B;  2AHZ A;  1SES A;  1OCR C;  2R9R B;  3A0H Z;  3H1K H;  4X1Y A;  2WLI A;  3JAK B;  5LBQ A;  1AI7 A;  4J41 A;  5JVD A;  3U11 A;  1EM1 A;  3OR7 C;  5KMG B;  4HZ3 A;  2X0L A;  4JF3 A;  3H01 A;  2HR3 A;  4OPA A;  4Q20 A;  4FVM A;  4O4H A;  1B04 A;  3MDS A;  3B4S A;  1WP7 A;  3EVK A;  1WB7 A;  1YSC A;  4RO2 A;  3RW0 A;  2UUC B;  1GKF A;  5LA6 B;  3KZI Z;  4LFB B;  1F51 A;  4DR6 B;  3SYO A;  1CEZ A;  2OYQ A;  3G6B A;  3SPC A;  3SPG A;  1Q6I A;  1TA8 A;  2ZE8 A;  1TAE A;  2A3Q A;  4JI2 B; 
#chains in the Genus database with same CATH homology
 1BGY H;  1SQQ H;  3BCC H;  2FYU H;  3L70 H;  4U3F H;  1SQB H;  3L75 H;  3CX5 F;  3CWB H;  3L73 H;  3H1L H;  3CXH F;  3TGU H;  1KYO F;  1P84 F;  4D6T H;  4PD4 F;  1SQV H;  3L71 H;  1NTZ H;  2BCC H;  3H1K H;  1NU1 H;  1L0N H;  2IBZ H;  3L72 H;  3H1J H;  1NTM H;  5KLV H;  3L74 H;  1EZV H;  1PP9 H;  1SQX H;  1L0L H;  1SQP H;  1KB9 F;  1PPJ H;  1BCC H;  1BE3 H;  3H1H H;  2A06 H;  3H1I H;  1NTK H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...