1PPJH

Bovine cytochrome bc1 complex with stigmatellin and antimycin
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
66
structure length
66
Chain Sequence
LVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 25
structure length 66
sequence length 66
chains with identical sequence U
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1ppjH00
3L70H 3L74H 2A06H 1PP9H 3H1KH 3CXHF 3L75H 5KLVH 1KYOF 1NTKH 1PPJH 1SQBH 3L72H 2IBZH 1BCCH 3L73H 3BCCH 1SQVH 3CX5F 4D6TH 2FYUH 1KB9F 3H1HH 1NTZH 1L0LH 1NU1H 3H1IH 3H1LH 1SQPH 1P84F 1SQQH 2BCCH 3TGUH 1BGYH 3H1JH 1EZVH 1SQXH 3L71H 1NTMH 4PD4F 4U3FH 3CWBH 1L0NH 1BE3H
chains in the Genus database with same CATH superfamily
3JD0A 4NR1A 1XNQO 4C7UA 3M99B 4DV6O 1D5AA 2Q5ZA 2DQ0A 3RYCB 2EINB 4AQYO 4CH5A 1I0HA 4DW1A 2P6JA 1N33B 4ZHQA 4UCOA 4J7JA 5IWAO 1QLEB 2Z5UA 1SQPH 3D3QA 3QTCA 4GX0A 5FPRA 2M6YA 2Q4PA 5BR8O 1G6UA 5LHHA 4NVPA 4DV0O 2P22C 1XL4A 2ARHA 4MTGA 1OHHG 2WLLB 4ZI7B 4FFKA 2CE4A 4FLWA 1B6QA 1B06A 4LF6O 5TISZ 3AG3C 5B1AB 4DR3O 1SETA 3HKDA 1G1XB 2FB5A 1FAFA 3GB7C 3BHPA 4WCEV 4B3TB 3JAKB 1N32O 1F23A 3ZHQA 3B09A 2R9RB 1THZA 5D5PA 1IVSA 1VQ6V 2NR5A 2JGDA 4ZHQB 3JD4A 5CN0A 1Q7YW 4N23A 3ETQA 3W7WA 4U3FH 4DR5B 1XMOB 4BAYA 4FZ0A 3ZX6A 1KUQA 3Q4HB 1AJPA 5LOVA 3ZMZA 1VQ8V 3ETGA 4X8AA 4MW8A 4YHHO 1YDXA 3NXSA 1WNSA 3SYOA 2P4KA 1W0KG 1N36O 1NU1H 4I55B 2A9HA 3K04A 4YIOA 2F1MA 3AK1A 4EFBA 2QSAA 2ZIMA 2Q69A 5LBQA 4TT3G 5K1PA 2LGWA 2ADQB 4JI7O 4GCZA 2HHHO 4LFBB 4DR7O 5GTIZ 1F7YA 4LCUC 4BIZA 3THOA 4FJCC 3R66A 3RT3C 2JS3A 3N2KA 1QVGU 4UXNA 3P30A 2EIMB 1K3EA 2GSMB 3C3SA 3QF7A 2ZDIA 2Z3YA 1HNZB 2LFRA 5DEDA 1GN3A 2WLJA 5LOVB 1M56B 2H3OA 3UQ8A 1ZX3A 4U7OA 4X1IA 4QE9A 3G6BA 5J2TB 2WLIB 3AK3A 4O4JA 4LF9O 2EILC 2JK5C 4NKGB 1JPXA 4O4IB 3RWRD 1RPOA 2AHZA 3B8MA 1GMGA 2H94A 5FNVB 1H2KA 5H6QA 3WG7B 3CWBH 1I94O 5B1BC 4DR1B 2YXLA 1SC5B 4W4LA 4JI2B 3FYEB 3SGIA 3G80A 3E2EA 2D3OW 2ZM6B 1BCCH 4LF8O 4ZKIA 4F6RA 4JGSA 1RSOA 3S3WA 1M93A 2JJ1G 4JZ2A 4PA6A 2DWEC 1KU9A 2CK3G 2VWKA 2CUGA 1VIBA 3W7SA 1SZTA 5KA5A 1KC8W 1RPRA 1H2GA 5LP6B 3DXRA 2LQTA 2JDIG 2ZR3A 4NXMB 1JR9A 2QGNA 4AILC 4K0KO 3I56V 1FXKA 3ZIAG 3A8TA 2W0XA 2EX3A 1BHAA 3TXSA 1JVMA 2F43G 1V55B 4DV3B 1EN6A 4GKJB 2PF4E 5IYCO 3RYCA 2F23A 3ABMB 1U97A 2ILMA 2A0LA 2ZE7A 3GWKC 1EBOA 2AGAA 2LW1A 1VF5B 4F6RB 1AI4A 3C3TA 3ETDA 2Q68A 1FXKC 3K06A 3QO8A 5EK0A 1HNWB 5B5EZ 1UFIA 4K35A 4RO2A 3RYIB 4DR7B 3ABKB 5EIBC 3LDCA 3SPJA 2OTLV 2ZKOA 4I5SA 5KMGB 1KQSU 4ZI7A 5AG2A 4DV0B 4P9PA 2Y69C 3B4SA 1CPYA 1NI8A 2XAGA 4FK5C 3UO2A 2FTKA 2BOBC 1P4RA 2BTOA 4J9YB 2QWOB 3T4DA 3CCMV 3ZMUA 2V7QG 3D36C 4UVCA 3UKMA 1P7BA 4B7KA 3K5OA 2FKXA 5CBFA 2EJ7A 3IC9A 1KKCA 2F93B 4E2LA 3WG7C 3N2GA 3AG1C 4JASA 5KX5B 5B1OA 4LP8A 4PA4A 2CH7B 1S3JA 3UT5B 1VQOV 3RYIA 4LC1A 3BCCH 3CE2A 1XMQO 1XDCA 1Q6UA 1WLEA 2IH3C 3CRQA 3CRCA 4R6ZA 3BPZA 4BIOA 4WBNB 4LFCB 3B2EE 2GTAA 3OGCC 1GKFA 5HFMA 3I5DA 1GO3F 4I0XA 4X62O 2YXHA 4OX9B 3CCJV 3TXQA 1R73A 2IW5A 2Q67A 2PYJA 4K8ZA 1FJGO 5B3SB 1AVMA 4RUEA 3BA9A 1JCHA 5IWAB 4PD4F 2VRZA 1NS1A 4KXRA 5J2TA 1VQ4V 4OPAA 3CP1A 5KMGA 3PN1A 1PM9A 5KLVH 2F95B 3LDEA 4UVBA 2FL4A 2UU9O 2YI9A 2UUBO 4O2BB 2P06A 4CC5A 2R9IA 5LMUO 1NVPD 4GX1A 5FL7G 4DV5O 1K8AW 1RSOB 1G8MA 5LHIA 1Y74B 1P7GA 2QKSA 3JCZA 1Z5VA 3JASA 3N27A 4XDJA 1Q6IA 1L8DA 3B8NA 1KD1W 2DYRC 4PA3A 4IIJB 2L35A 2KSDA 4TV9B 3T1HB 4MVZA 1COWG 4O4JB 1MG1A 3KCYA 4UVAA 1Y4MA 4GKJO 2JGUA 2LJ2A 2YS8A 3ZHVA 1SQQH 3RBZA 3J80N 4H37A 1MMMA 4GX2A 4JI4O 3K58A 4X1KA 2JVDA 1K34A 2ZXWB 4Z2WA 2BOCC 2AW9A 3QNEA 2ZT9B 1JFFB 2YIBA 3CPWU 1FS0G 1WP7A 1NH2B 3I55V 1PNLA 3JAKA 4MVQA 2HP8A 1QBZA 2E3CA 4ASUG 2BE3A 1QLNA 1NVPB 3E8BA 2BSKB 4LNUB 4PELA 2IJIA 2ATKC 1LUWA 2ZR2A 4X65B 3JCUZ 5B1BB 4DUZB 2A06H 1PL4A 5JVDA 5BXZA 1IURA 4OPHA 4FLVA 5L3EA 3Q4HA 4DR6O 4JV5O 3T1YO 4I9QA 2OYQA 1YXBA 3E8FA 2YIBD 3RYFA 3GWOA 4K8XA 1AILA 4LF9B 1RP3B 3B40A 1N34O 2KG7B 4K0KB 1PD3A 3RVZA 1B3QA 3ML0A 2QWQB 4EKWA 2GDSA 2ADPA 3VOUA 1SF9A 2W0FC 1FXKB 2UXXA 4FM1A 5FPOA 3BY6A 2QWPB 5IE9A 4KP4A 1B04A 3U11A 3HB3B 4O2AA 5KA6A 2ZE8A 1RM1C 1K4DC 2UU9B 1Y74A 4FMTA 3WFVA 1M57B 5DM6V 1ZLZA 4DR4O 4EFEA 4LWSB 2X6AA 4IYHA 2F66C 1XREA 4A5UB 5EZYA 3P3NA 3T1HO 2OTJV 1PV0A 1EM1A 5HFLA 1BQZA 4ZBMA 2WA4A 5CBGA 2EJRA 1XHZA 1FXVA 2N05A 3CXCU 4IHJB 5JWPA 1FKAO 4F4LA 4OX9O 3K5LA 1GM8A 1EZJA 2EIJC 2PZSA 1N0NA 1HWYA 2QM7A 3H1JH 3IFXA 1SQXH 2ETNA 5KHHA 3GVMA 1M56C 2QKAA 3U0ZA 4DR5O 1OCZC 5A9GA 1NJIW 4D7SA 2GTSA 5CA0A 4B3TO 2JIZG 4I0XB 2H8PC 4YY3O 5BMVB 2UUCB 2Q7HA 4X65O 2YEVB 1L0LH 3L9DA 3DC6A 1NR7A 2CGOA 1HNZO 5LL6Y 1BGYH 3K5MA 4Q6GA 2WLNA 1WA8A 1AROP 1R3LC 3S3XA 2EZPA 3SJAC 4I50B 1TGOA 1KBHA 3D36A 3JD3A 4ICGA 3EHBB 1OV9A 2ZNIA 2ZCEA 3JYCA 3L73H 4IGGA 3SPGA 1UJWB 4LFAB 2PGGA 2VQFB 1XBLA 1R6TA 4BWAA 1QR8A 1V54B 2XAHA 3MAQA 3K3WA 1AR4A 3CS5A 3OM3B 2P5OA 2AZ2A 4MVUA 2ZE6A 3LSQA 3OMNB 2JGDB 5JJNB 3ZN1A 4J41A 5CA0B 1NH2D 1N33O 1IX9A 4X1YA 1KB9F 1URFA 3R65A 5EYPA 2UUAO 3FAVB 1R3JC 3EXAA 2UUAB 4JI0O 2DW4A 1H2SB 1FFXA 1GRJA 1HDJA 4B3RO 4UB8Z 4W4KA 1VF7A 4DR1O 3K9SA 5J2UA 1ORQC 1JA8A 1R6NA 1I94B 3K0GA 4WFEA 1NT2B 3D8CA 4OXSA 1R1BA 3K9AA 4TUYA 5L3DA 4DR4B 2QJ1A 3KZIZ 3OEHG 4JAUA 3HKEA 2DYRB 3OAAG 3L70H 4LH6A 1MZFA 4JI0B 3AG1B 4X1KB 5BMVA 1FD9A 1W0JG 5ITZB 1N36B 5E79Z 2YIAA 3OD4A 4UV9A 1H2LA 4MSWC 4JI6B 2WAMA 4B3SO 3ABTA 3FB8C 3N2GB 1VQ9V 4IT5A 2RQ6A 1FFTB 1H8EG 5D5QA 2WLKA 3ZHUA 3ZMTA 5CB4A 2RJZA 2MW2B 1BMFG 2OT5A 4LF5B 1FFXB 3HKCA 1YTFB 4B7EA 1XNRB 2W6IG 3CEIA 1ZUQA 3HKBA 3P32A 3M7MX 3O9OA 3OTFA 4I7ZB 1PNMA 1R3IC 4TUYB 4DK0A 3E8GA 5LA6B 2CGNA 2QA4V 1YI2V 1S5JA 2QEXV 1AP5A 1DGSA 4JI7B 1PPJH 1Q3EA 2Y4TA 2L6LA 3JSNA 4LFAO 4GUNA 1Y76B 1BS3A 4FVMA 5H9CA 3H9VA 4LF4B 4RUFA 4BR6A 1FYJA 2XAQA 1AR1B 3WB2A 4JI4B 2WWWA 3FB5C 1XQ8A 1V55C 5J2UB 4PDLA 2Y0PA 4QE7A 3L75H 1M57C 1MNGA 1LNQA 2E5LO 2ZXWC 3BRCA 1VARA 1XMQB 3SYAA 3ZMSA 4J11A 3CD6V 4MTOA 3B77A 4JI3B 1LR1A 5EC1C 5J9PC 5L3GA 2VQEB 3P3PA 5IY5C 4LF4O 4WF9V 3HKEB 4KHPB 1Y76A 2IBZH 5IJ9B 4HNAB 5JJEB 5JJJB 4KL1A 1M4UA 3IGAC 3T1CA 3H1HH 2JEUA 2V1DA 5IJ0B 5LYJB 4TV8A 1F4NA 3DC5A 2XNDG 5LGNA 1BE3H 1WB7A 2OCCC 3L74H 4RQFA 1EN4A 1YVWA 4E4EA 2RCVA 2ZDIC 3A0BZ 3SPIA 2V4DA 2WSSG 2OIEA 4K3AA 1RM1B 4CZZA 4DUZO 3E22B 1OJHA 4TSFG 3TETA 3D3IA 2B5UA 2Y0IA 3ABLB 1SQFA 1WP8A 4KUMA 4H33A 3RYHB 5LMNB 1XI1A 3ZRXA 3TK1A 2JS5A 1GN6A 3WB1A 1IZ3A 2QKCA 2PY5A 4X88A 2HVKC 1J5EB 4CH6A 2XHBA 1AB3A 3CCLV 2UUCO 1XNRO 2AHYA 4MT8A 4HYOA 3H1IH 3ICXA 5K1XA 3FFQA 4AI8A 4R7CA 2QR4A 3AG4B 4LF7B 1PL0A 3SDLA 4B3MO 1OCOB 5E1AC 4LF8B 1NZ6A 3QO7A 2X7RB 3MHHC 4JYAB 3H1KH 2DYSC 5H6RA 3OT7A 4TOIA 3CX5F 4G28B 2CH7A 2CAZC 1AJQA 3UT5A 4DV3O 2YDEA 4ZIBA 3EVKA 4L8JA 1ZAUA 1WJZA 1DLBA 3ABUA 2DN9A 4DV4B 2RDCA 1CXZB 1D5NA 1E1QG 3OTOO 2HFEC 2DE0X 3H01A 4X89A 4DRXA 3QG5A 1VQKV 1SQGA 1V9PA 2ITCC 1Q86W 4X66B 2UXBB 1O9HA 2QTOA 1AI7A 1YZBA 1I7FA 4F6EA 4YXWG 5FLXN 1K5QA 5EZYB 4DXWA 1US6A 2R72A 2JRIA 4PI0A 4MVSA 3JSLA 3CRRA 3CCUV 5JH7B 5JQGA 3C90A 3KG2A 1TA8A 4PV1B 1PNKA 4O2BA 1VF6C 4G2KA 1K9MW 2HVJC 1J95A 1S72V 2MK3A 4H44B 1NTKH 1IDSA 2HG5C 2GUZA 5C93A 3QO5A 4CH4A 3DTUB 1H8HG 5GONA 4BW9A 1WPXA 1HNWO 1IBKB 5CA1A 2GV9A 3E86A 1Q5OA 4H13B 4TV9A 1KKDA 4ABMA 4MTXA 1GN2A 3L72H 3ZRVA 4JAVA 4IHJA 2AXTZ 4FLYA 1YJWV 3JALA 1T5EA 2PYLA 3K0DA 2YSUB 1BQ0A 1YF2A 5JCOA 4HZ3A 4HBNA 3L71H 1JFFA 4JI8B 3QVNA 4JV5B 1PP9H 5LA6A 3OMIB 2CTRA 4ZOLA 2BSKA 1YTFD 4TV8B 4I4TA 1QR9A 4FLZA 1P84F 1M5IA 5EYPB 3FAVA 4LF6B 1MA1A 2EZOA 2RMKB 4NXNO 5EC2C 1DF5A 2KG7A 1YHQV 4NB5A 2WPDG 1K4CC 3UO3A 3E22A 1TUBB 4WFFA 3A2FA 2DWDC 3LDDA 4J80A 1P49A 3K03A 2YICA 1U96A 2KQXA 1K33A 1HP8A 1W59A 2B1GA 4FLXA 3T1YB 4PDRA 1IBKO 1GH6A 2ZD9A 4ZOLB 3W7TA 5IJ9A 3JD1A 1QHTA 3SYPA 1BZKA 2FMLA 2WLLA 5EBWC 1DTOA 2YIDA 3OR6C 5KAIZ 4NYKA 4YHHB 4DV2B 1XL6A 3CYOA 2VS0A 5B3SC 4MVOA 5IYZA 5LMNO 1KP3A 4NTXA 4LF7O 3OTOB 4AQYB 3ZHTA 3JD2A 2BCCH 3AG7A 2QM4A 3LNNA 4WFBV 4JPRA 1TUBA 1G4YB 4XDLA 1XMOO 4LFCO 2NLJC 1OCRB 3A0HZ 5LGTA 4WFHA 4DRXB 4P30A 4O4HA 4N21A 5GTHZ 5LP6C 5C8YB 2ZIOA 4JI1O 2Q0OC 1N0JA 4B3SB 4JI1B 4JYAO 2N04A 2PI5A 1GTOA 1JOYA 3SR2C 5B66Z 4FLUA 4LFBO 1MZEA 3SJBC 3EFFK 4I50A 2F4VB 2EINC 2WLHA 2A3QA 3MD0A 4GX5A 3RGBA 5JQGB 1J5EO 2OCHA 4FM0A 3ABMC 1E79G 4PA9A 4JTAB 3HKBB 1X59A 3K59A 2VWJA 1HR0B 3E89A 4O4HB 1EN5A 2XTAA 3LSUA 2R70A 2EIKB 3WU2Z 1A32A 2XUMA 3CC2V 2CTQA 2C2AA 2EILB 2BTQB 4D6TH 3FD9A 1JMKC 3F5TA 2LFSA 4JI3O 1M90W 2HLDG 2Q0AA 4U3JB 1H38A 3DGEA 2RN9A 3ABLC 4DW0A 3JAMN 5JVDB 4LNUA 1IXMA 5EBMC 2GHYA 3BAAA 1WN7A 1X4TA 4TQDA 3CRMA 4GT1A 1QCEA 4DV1O 2FYUH 2YI8A 3OUSA 2E76B 4CS4A 1IBMB 2IJHA 2Y48A 2DQ3A 3STLC 5DECA 1NKDA 1SS3A 5IT9N 2VQEO 1E1RG 4YJ2B 4DUYO 1TVKA 3IAYA 1YSCA 3HPLC 2E75B 2PTMA 1N32B 2EBOA 5C8YA 1JJ2U 3BFRA 1Z5WA 4UCTA 3TJTA 1SQBH 1IXBA 1HW7A 3ASNC 1H2MA 3ABKC 1R3KC 2P90A 3OE7G 4UB6Z 3VQWA 4YJ3A 5F2VO 4DR3B 1MSWD 4X1YB 2N74A 2EIJB 1PKXA 3VBBA 2PUSA 2JEXA 1S77D 3SYQA 4FIPC 3X2QB 3FKSG 2XT9A 1UPGA 4UCSA 2X6BA 2ODMA 1TUEB 1SQVH 3ZEDA 2EULA 4RQEA 1Q6HA 3K5NA 1FJGB 5KHGA 5EIBD 5B1NA 1QQCA 4UUJC 3LUTB 2D2CB 3OW2U 3SJQC 5IYBO 3CMAV 2YEVA 5LXTA 4UFZA 2QTSA 4DK1A 2P4VA 3JATB 4MVMA 3WB0A 3AG2B 2XAJA 1XUQA 1GN4A 2BTQA 2XASA 2XAFA 4P9OA 2WA3A 1W2BU 1DF4A 1XHXA 3ZHSA 4L87A 4QPJA 4DV4O 5L3CA 3KCXA 1YJ9V 5H5NA 4PDMA 2HJDA 2DJVA 4Q20A 1JX9A 1VQNV 2E74B 5CB4B 4CH3A 2X6CA 1ZL8A 2EIMC 1SERA 1DK1A 5KUMA 4WFGA 3CCQV 1NR1A 4DR2B 5EBLC 1Q82W 4B3MB 3BA8A 4U7NA 4JI2O 1YJNV 4CS3A 4GZRB 4J7KA 1YITV 1BHBA 1TVKB 3N2KB 1KP2A 4MW3A 4DV1B 3DSQA 4CBCA 1K5SA 4HNAA 2YUAA 3K08A 2HEPA 1Q8IA 2Y4UA 4B3RB 5LYJA 4PDVA 1IBLO 1WAZA 1I5YA 1V54C 3ZMVA 4X64B 2KKWA 3BEHA 1ZL8B 3SJCC 2IU0A 4X1IB 2UXCO 3SYCA 1WB8A 1K7DA 5FNVA 4JTCB 3RYHA 4O4IA 1NQTA 4GKKO 1M1KW 2Q7GA 3FX7A 4UCRA 5L3FA 1IBLB 4YY3B 3ZJZA 3HR0A 5KHIA 4Z1MG 4WBNA 1F4MA 3RN4A 3SPCA 5CA3A 4X66O 2UXBO 4DV2O 1N4CA 2UUBB 4I4TB 2LW7A 2W6JG 2DMXA 1RFYA 1HNXB 5LXTB 3CCVV 4HAMA 1S0VA 4TQFA 2HHHB 4QNHB 1XILA 4MVRA 4FM2A 1WPBA 1CP9A 2LP7A 1ZTEA 1XOUA 2IM9A 2OIGA 3CSXA 2UXNA 5KAFZ 3CJHB 3CMEV 3ETEA 3E8HA 4J10A 4JTDB 4R8CA 1BSMA 1NBMG 3CC4V 3F5WC 2HR3A 4UCVA 1S5LZ 1N8RW 4X62B 2ZE5A 4DV6B 2CTWA 1HNXO 3AG4C 4JI8O 3LNMB 5KHKA 2UXCB 1VQPV 4G27B 2NN4A 3G67A 2IH1C 4JI5O 3PJSK 3RFRA 1K92A 4YJ3B 5L3BA 1OCCC 4RWUA 1BT8A 2QWNB 3TCUA 2P7TC 3ZCCA 4XBFA 1GM7A 1MSDA 3U10A 1Y66A 5CBHA 1YEWA 3OFNG 3CJHA 4DR6B 3JARB 4QIWF 3O65A 1AR5A 1OCRC 4NXNB 4CS2A 1Y6XA 1OZ0A 4LF5O 2R9AA 1KYOF 3K79A 5JH7A 2QE7G 1FXHA 2DOSA 2G38A 2Z0AA 3NR7A 4FFBB 3CRAA 3CCRV 4RAIA 5KHJA 1O9GA 5BR8B 2KB1A 1K73W 1GAXA 4I55A 4KFMA 1S76D 4R50A 4YIPA 4O4LB 4KHPO 1BL8A 3W7UA 4JI6O 2LO1A 3ZBHA 2Y69B 5GONB 3ASOB 4GYCB 3ZN0A 2GUZB 5B1AC 3ZRSA 1IBMO 1EZVH 3FB6C 1TAEA 1QU7A 2QWRB 1QVFU 1MOFA 4X9QA 2Q7EA 3VQVA 1M9NA 5LP6A 3APOA 3ZHRA 3VQXA 4QGPA 4X20B 5BZBA 4QJFB 1EFRG 4FLTA 2ZQMA 4JYBA 3E35A 3G6EV 4BIUA 4UCUA 3CCSV 3J7AU 1AJNA 3HKDB 4NTWA 3T4ZA 3CCEV 3JALB 1H2NA 4FFBA 1SA0A 1VP7A 4DYLA 1CEZA 1XEQA 2XOKG 1AI6A 2K9PA 2P67A 3JAWA 2DYSB 3ZRWB 4JYCA 1OCOC 3F7VC 2JJ2G 2Q73A 3LSSA 4J9ZB 3RVYA 3BVOA 4PJ0Z 1Y67A 4OGQB 4CC6A 1VQMV 3J81N 4U3JA 1NTZH 4O2AB 2NNUA 3BABA 4PHZA 1ZSPA 3CHXA 4QPKA 1LUVA 4IL6Z 3FYIB 3MHSC 1SKVA 4LH7A 3SPHA 2UXDO 5JCOC 3G4SV 3HKCB 1ZWIC 4IIJA 2HJFC 3G71V 5CA1B 3DXRB 2O57A 3A0RA 4DO2A 3OUFA 3UM7A 3IC7A 4PI2A 2VQFO 1SESA 2RNBA 3VQYA 4JZGA 2X0LA 2Q9LA 2Q6AA 3OMAB 4BW5A 3E83A 1QLEC 3JAWB 4PA7A 4GLXA 4UV8A 1L1FA 1YIJV 4H0LB 1KMIZ 4O4LA 2Q8VA 3STZC 1SA0B 2A79B 3T2MA 1HR0O 3K57A 2E5LB 4NTYA 1SRYA 2WLMA 3X2QC 3ZS8C 4LR3A 1VF6A 1Q81W 3OGIB 2M7WA 3AEIA 2YC0A 3AG3B 4EB6A 4DV7O 4FZ1A 4X64O 5KX5A 1QNMA 4X20A 4DR2O 2IJKA 2WLIA 2AZ0A 3IJ4A 5A2QN 2QM8A 1WA8B 4FPPA 3AG2C 2B9ZA 1GK9A 3RYFB 5DN6G 4MS2A 3APQA 5GW7A 1JJOA 3ASOC 3OR7C 4DV7B 5IYZB 4D7TA 2OCCB 2A7WA 3F7YC 5IDJA 4DV5B 1VMGA 4XDKA 1K97A 1VEWA 3ZRWA 4J7ZA 1YCIA 4I9WA 4YJ2A 3JATA 3CC7V 5IJ0A 1S5HC 3UCSC 4LWSA 2UXDB 3AK2A 2LGQA 1I08A 4JF3A 1N34B 3KKYA 1OCZB 3JARA 1JQ0A 5LMUB 4MTFA 2PI4A 2HKOA 4GKKB 3MDSA 2EIKC 2F4VO 3ASNB 3CXHF 5LGUA 2B1IA 5BY1A 5IY5B 5CMUA 4JYYA 4IYIA 5IYDO 4DUYB 4JAAA 3CB2A 2CTPA 1AI5A 4P2ZA 1ENVA 3TGUH 3H1LH 4LBEC 4EEQA 1GM9A 2CDYA 1MABG 4JI5B 3W7XA 3RW0A 1SZXA 1Q90D 4J42A 4EB6B 4AHCA 5H2FZ 3OEEG 4B08A 5ITZA 2IU3A 2GBOA 3JASB 2YXYA 1VQ5V 3M8AA 1AP6A 1Z2GA 4NXMO 1I5XA 1NTMH 1D2DA 1L0NH 5KUKA 2ITDC 2ZM6O 2ZNJA 3FB7C 2QDOA 1VQ7V 1FPOA 4TWKA 1ROPA 4WFAV 1OCCB 1Q43A 1KECA 1F51A 5LHGA 1VQLV 2IJJA 2K1EA 1R6KA 4Z1VA 1XNQB 2ZINA 2OWOA
chains in the Genus database with same CATH topology
3L70H 3L74H 2A06H 1PP9H 3H1KH 3CXHF 3L75H 5KLVH 1KYOF 1NTKH 1PPJH 1SQBH 3L72H 2IBZH 1BCCH 3L73H 3BCCH 1SQVH 3CX5F 4D6TH 2FYUH 1KB9F 3H1HH 1NTZH 1L0LH 1NU1H 3H1IH 3H1LH 1SQPH 1P84F 1SQQH 2BCCH 3TGUH 1BGYH 3H1JH 1EZVH 1SQXH 3L71H 1NTMH 4PD4F 4U3FH 3CWBH 1L0NH 1BE3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L70 H;  3L74 H;  2A06 H;  1PP9 H;  3H1K H;  3CXH F;  3L75 H;  5KLV H;  1KYO F;  1NTK H;  1PPJ H;  1SQB H;  3L72 H;  2IBZ H;  1BCC H;  3L73 H;  3BCC H;  1SQV H;  3CX5 F;  4D6T H;  2FYU H;  1KB9 F;  3H1H H;  1NTZ H;  1L0L H;  1NU1 H;  3H1I H;  3H1L H;  1SQP H;  1P84 F;  1SQQ H;  2BCC H;  3TGU H;  1BGY H;  3H1J H;  1EZV H;  1SQX H;  3L71 H;  1NTM H;  4PD4 F;  4U3F H;  3CWB H;  1L0N H;  1BE3 H; 
#chains in the Genus database with same CATH topology
 3JD0 A;  4NR1 A;  1XNQ O;  4C7U A;  3M99 B;  4DV6 O;  1D5A A;  2Q5Z A;  2DQ0 A;  3RYC B;  2EIN B;  4AQY O;  4CH5 A;  1I0H A;  4DW1 A;  2P6J A;  1N33 B;  4ZHQ A;  4UCO A;  4J7J A;  5IWA O;  1QLE B;  2Z5U A;  1SQP H;  3D3Q A;  3QTC A;  4GX0 A;  5FPR A;  2M6Y A;  2Q4P A;  5BR8 O;  1G6U A;  5LHH A;  4NVP A;  4DV0 O;  2P22 C;  1XL4 A;  2ARH A;  4MTG A;  1OHH G;  2WLL B;  4ZI7 B;  4FFK A;  2CE4 A;  4FLW A;  1B6Q A;  1B06 A;  4LF6 O;  5TIS Z;  3AG3 C;  5B1A B;  4DR3 O;  1SET A;  3HKD A;  1G1X B;  2FB5 A;  1FAF A;  3GB7 C;  3BHP A;  4WCE V;  4B3T B;  3JAK B;  1N32 O;  1F23 A;  3ZHQ A;  3B09 A;  2R9R B;  1THZ A;  5D5P A;  1IVS A;  1VQ6 V;  2NR5 A;  2JGD A;  4ZHQ B;  3JD4 A;  5CN0 A;  1Q7Y W;  4N23 A;  3ETQ A;  3W7W A;  4U3F H;  4DR5 B;  1XMO B;  4BAY A;  4FZ0 A;  3ZX6 A;  1KUQ A;  3Q4H B;  1AJP A;  5LOV A;  3ZMZ A;  1VQ8 V;  3ETG A;  4X8A A;  4MW8 A;  4YHH O;  1YDX A;  3NXS A;  1WNS A;  3SYO A;  2P4K A;  1W0K G;  1N36 O;  1NU1 H;  4I55 B;  2A9H A;  3K04 A;  4YIO A;  2F1M A;  3AK1 A;  4EFB A;  2QSA A;  2ZIM A;  2Q69 A;  5LBQ A;  4TT3 G;  5K1P A;  2LGW A;  2ADQ B;  4JI7 O;  4GCZ A;  2HHH O;  4LFB B;  4DR7 O;  5GTI Z;  1F7Y A;  4LCU C;  4BIZ A;  3THO A;  4FJC C;  3R66 A;  3RT3 C;  2JS3 A;  3N2K A;  1QVG U;  4UXN A;  3P30 A;  2EIM B;  1K3E A;  2GSM B;  3C3S A;  3QF7 A;  2ZDI A;  2Z3Y A;  1HNZ B;  2LFR A;  5DED A;  1GN3 A;  2WLJ A;  5LOV B;  1M56 B;  2H3O A;  3UQ8 A;  1ZX3 A;  4U7O A;  4X1I A;  4QE9 A;  3G6B A;  5J2T B;  2WLI B;  3AK3 A;  4O4J A;  4LF9 O;  2EIL C;  2JK5 C;  4NKG B;  1JPX A;  4O4I B;  3RWR D;  1RPO A;  2AHZ A;  3B8M A;  1GMG A;  2H94 A;  5FNV B;  1H2K A;  5H6Q A;  3WG7 B;  3CWB H;  1I94 O;  5B1B C;  4DR1 B;  2YXL A;  1SC5 B;  4W4L A;  4JI2 B;  3FYE B;  3SGI A;  3G80 A;  3E2E A;  2D3O W;  2ZM6 B;  1BCC H;  4LF8 O;  4ZKI A;  4F6R A;  4JGS A;  1RSO A;  3S3W A;  1M93 A;  2JJ1 G;  4JZ2 A;  4PA6 A;  2DWE C;  1KU9 A;  2CK3 G;  2VWK A;  2CUG A;  1VIB A;  3W7S A;  1SZT A;  5KA5 A;  1KC8 W;  1RPR A;  1H2G A;  5LP6 B;  3DXR A;  2LQT A;  2JDI G;  2ZR3 A;  4NXM B;  1JR9 A;  2QGN A;  4AIL C;  4K0K O;  3I56 V;  1FXK A;  3ZIA G;  3A8T A;  2W0X A;  2EX3 A;  1BHA A;  3TXS A;  1JVM A;  2F43 G;  1V55 B;  4DV3 B;  1EN6 A;  4GKJ B;  2PF4 E;  5IYC O;  3RYC A;  2F23 A;  3ABM B;  1U97 A;  2ILM A;  2A0L A;  2ZE7 A;  3GWK C;  1EBO A;  2AGA A;  2LW1 A;  1VF5 B;  4F6R B;  1AI4 A;  3C3T A;  3ETD A;  2Q68 A;  1FXK C;  3K06 A;  3QO8 A;  5EK0 A;  1HNW B;  5B5E Z;  1UFI A;  4K35 A;  4RO2 A;  3RYI B;  4DR7 B;  3ABK B;  5EIB C;  3LDC A;  3SPJ A;  2OTL V;  2ZKO A;  4I5S A;  5KMG B;  1KQS U;  4ZI7 A;  5AG2 A;  4DV0 B;  4P9P A;  2Y69 C;  3B4S A;  1CPY A;  1NI8 A;  2XAG A;  4FK5 C;  3UO2 A;  2FTK A;  2BOB C;  1P4R A;  2BTO A;  4J9Y B;  2QWO B;  3T4D A;  3CCM V;  3ZMU A;  2V7Q G;  3D36 C;  4UVC A;  3UKM A;  1P7B A;  4B7K A;  3K5O A;  2FKX A;  5CBF A;  2EJ7 A;  3IC9 A;  1KKC A;  2F93 B;  4E2L A;  3WG7 C;  3N2G A;  3AG1 C;  4JAS A;  5KX5 B;  5B1O A;  4LP8 A;  4PA4 A;  2CH7 B;  1S3J A;  3UT5 B;  1VQO V;  3RYI A;  4LC1 A;  3BCC H;  3CE2 A;  1XMQ O;  1XDC A;  1Q6U A;  1WLE A;  2IH3 C;  3CRQ A;  3CRC A;  4R6Z A;  3BPZ A;  4BIO A;  4WBN B;  4LFC B;  3B2E E;  2GTA A;  3OGC C;  1GKF A;  5HFM A;  3I5D A;  1GO3 F;  4I0X A;  4X62 O;  2YXH A;  4OX9 B;  3CCJ V;  3TXQ A;  1R73 A;  2IW5 A;  2Q67 A;  2PYJ A;  4K8Z A;  1FJG O;  5B3S B;  1AVM A;  4RUE A;  3BA9 A;  1JCH A;  5IWA B;  4PD4 F;  2VRZ A;  1NS1 A;  4KXR A;  5J2T A;  1VQ4 V;  4OPA A;  3CP1 A;  5KMG A;  3PN1 A;  1PM9 A;  5KLV H;  2F95 B;  3LDE A;  4UVB A;  2FL4 A;  2UU9 O;  2YI9 A;  2UUB O;  4O2B B;  2P06 A;  4CC5 A;  2R9I A;  5LMU O;  1NVP D;  4GX1 A;  5FL7 G;  4DV5 O;  1K8A W;  1RSO B;  1G8M A;  5LHI A;  1Y74 B;  1P7G A;  2QKS A;  3JCZ A;  1Z5V A;  3JAS A;  3N27 A;  4XDJ A;  1Q6I A;  1L8D A;  3B8N A;  1KD1 W;  2DYR C;  4PA3 A;  4IIJ B;  2L35 A;  2KSD A;  4TV9 B;  3T1H B;  4MVZ A;  1COW G;  4O4J B;  1MG1 A;  3KCY A;  4UVA A;  1Y4M A;  4GKJ O;  2JGU A;  2LJ2 A;  2YS8 A;  3ZHV A;  1SQQ H;  3RBZ A;  3J80 N;  4H37 A;  1MMM A;  4GX2 A;  4JI4 O;  3K58 A;  4X1K A;  2JVD A;  1K34 A;  2ZXW B;  4Z2W A;  2BOC C;  2AW9 A;  3QNE A;  2ZT9 B;  1JFF B;  2YIB A;  3CPW U;  1FS0 G;  1WP7 A;  1NH2 B;  3I55 V;  1PNL A;  3JAK A;  4MVQ A;  2HP8 A;  1QBZ A;  2E3C A;  4ASU G;  2BE3 A;  1QLN A;  1NVP B;  3E8B A;  2BSK B;  4LNU B;  4PEL A;  2IJI A;  2ATK C;  1LUW A;  2ZR2 A;  4X65 B;  3JCU Z;  5B1B B;  4DUZ B;  2A06 H;  1PL4 A;  5JVD A;  5BXZ A;  1IUR A;  4OPH A;  4FLV A;  5L3E A;  3Q4H A;  4DR6 O;  4JV5 O;  3T1Y O;  4I9Q A;  2OYQ A;  1YXB A;  3E8F A;  2YIB D;  3RYF A;  3GWO A;  4K8X A;  1AIL A;  4LF9 B;  1RP3 B;  3B40 A;  1N34 O;  2KG7 B;  4K0K B;  1PD3 A;  3RVZ A;  1B3Q A;  3ML0 A;  2QWQ B;  4EKW A;  2GDS A;  2ADP A;  3VOU A;  1SF9 A;  2W0F C;  1FXK B;  2UXX A;  4FM1 A;  5FPO A;  3BY6 A;  2QWP B;  5IE9 A;  4KP4 A;  1B04 A;  3U11 A;  3HB3 B;  4O2A A;  5KA6 A;  2ZE8 A;  1RM1 C;  1K4D C;  2UU9 B;  1Y74 A;  4FMT A;  3WFV A;  1M57 B;  5DM6 V;  1ZLZ A;  4DR4 O;  4EFE A;  4LWS B;  2X6A A;  4IYH A;  2F66 C;  1XRE A;  4A5U B;  5EZY A;  3P3N A;  3T1H O;  2OTJ V;  1PV0 A;  1EM1 A;  5HFL A;  1BQZ A;  4ZBM A;  2WA4 A;  5CBG A;  2EJR A;  1XHZ A;  1FXV A;  2N05 A;  3CXC U;  4IHJ B;  5JWP A;  1FKA O;  4F4L A;  4OX9 O;  3K5L A;  1GM8 A;  1EZJ A;  2EIJ C;  2PZS A;  1N0N A;  1HWY A;  2QM7 A;  3H1J H;  3IFX A;  1SQX H;  2ETN A;  5KHH A;  3GVM A;  1M56 C;  2QKA A;  3U0Z A;  4DR5 O;  1OCZ C;  5A9G A;  1NJI W;  4D7S A;  2GTS A;  5CA0 A;  4B3T O;  2JIZ G;  4I0X B;  2H8P C;  4YY3 O;  5BMV B;  2UUC B;  2Q7H A;  4X65 O;  2YEV B;  1L0L H;  3L9D A;  3DC6 A;  1NR7 A;  2CGO A;  1HNZ O;  5LL6 Y;  1BGY H;  3K5M A;  4Q6G A;  2WLN A;  1WA8 A;  1ARO P;  1R3L C;  3S3X A;  2EZP A;  3SJA C;  4I50 B;  1TGO A;  1KBH A;  3D36 A;  3JD3 A;  4ICG A;  3EHB B;  1OV9 A;  2ZNI A;  2ZCE A;  3JYC A;  3L73 H;  4IGG A;  3SPG A;  1UJW B;  4LFA B;  2PGG A;  2VQF B;  1XBL A;  1R6T A;  4BWA A;  1QR8 A;  1V54 B;  2XAH A;  3MAQ A;  3K3W A;  1AR4 A;  3CS5 A;  3OM3 B;  2P5O A;  2AZ2 A;  4MVU A;  2ZE6 A;  3LSQ A;  3OMN B;  2JGD B;  5JJN B;  3ZN1 A;  4J41 A;  5CA0 B;  1NH2 D;  1N33 O;  1IX9 A;  4X1Y A;  1KB9 F;  1URF A;  3R65 A;  5EYP A;  2UUA O;  3FAV B;  1R3J C;  3EXA A;  2UUA B;  4JI0 O;  2DW4 A;  1H2S B;  1FFX A;  1GRJ A;  1HDJ A;  4B3R O;  4UB8 Z;  4W4K A;  1VF7 A;  4DR1 O;  3K9S A;  5J2U A;  1ORQ C;  1JA8 A;  1R6N A;  1I94 B;  3K0G A;  4WFE A;  1NT2 B;  3D8C A;  4OXS A;  1R1B A;  3K9A A;  4TUY A;  5L3D A;  4DR4 B;  2QJ1 A;  3KZI Z;  3OEH G;  4JAU A;  3HKE A;  2DYR B;  3OAA G;  3L70 H;  4LH6 A;  1MZF A;  4JI0 B;  3AG1 B;  4X1K B;  5BMV A;  1FD9 A;  1W0J G;  5ITZ B;  1N36 B;  5E79 Z;  2YIA A;  3OD4 A;  4UV9 A;  1H2L A;  4MSW C;  4JI6 B;  2WAM A;  4B3S O;  3ABT A;  3FB8 C;  3N2G B;  1VQ9 V;  4IT5 A;  2RQ6 A;  1FFT B;  1H8E G;  5D5Q A;  2WLK A;  3ZHU A;  3ZMT A;  5CB4 A;  2RJZ A;  2MW2 B;  1BMF G;  2OT5 A;  4LF5 B;  1FFX B;  3HKC A;  1YTF B;  4B7E A;  1XNR B;  2W6I G;  3CEI A;  1ZUQ A;  3HKB A;  3P32 A;  3M7M X;  3O9O A;  3OTF A;  4I7Z B;  1PNM A;  1R3I C;  4TUY B;  4DK0 A;  3E8G A;  5LA6 B;  2CGN A;  2QA4 V;  1YI2 V;  1S5J A;  2QEX V;  1AP5 A;  1DGS A;  4JI7 B;  1PPJ H;  1Q3E A;  2Y4T A;  2L6L A;  3JSN A;  4LFA O;  4GUN A;  1Y76 B;  1BS3 A;  4FVM A;  5H9C A;  3H9V A;  4LF4 B;  4RUF A;  4BR6 A;  1FYJ A;  2XAQ A;  1AR1 B;  3WB2 A;  4JI4 B;  2WWW A;  3FB5 C;  1XQ8 A;  1V55 C;  5J2U B;  4PDL A;  2Y0P A;  4QE7 A;  3L75 H;  1M57 C;  1MNG A;  1LNQ A;  2E5L O;  2ZXW C;  3BRC A;  1VAR A;  1XMQ B;  3SYA A;  3ZMS A;  4J11 A;  3CD6 V;  4MTO A;  3B77 A;  4JI3 B;  1LR1 A;  5EC1 C;  5J9P C;  5L3G A;  2VQE B;  3P3P A;  5IY5 C;  4LF4 O;  4WF9 V;  3HKE B;  4KHP B;  1Y76 A;  2IBZ H;  5IJ9 B;  4HNA B;  5JJE B;  5JJJ B;  4KL1 A;  1M4U A;  3IGA C;  3T1C A;  3H1H H;  2JEU A;  2V1D A;  5IJ0 B;  5LYJ B;  4TV8 A;  1F4N A;  3DC5 A;  2XND G;  5LGN A;  1BE3 H;  1WB7 A;  2OCC C;  3L74 H;  4RQF A;  1EN4 A;  1YVW A;  4E4E A;  2RCV A;  2ZDI C;  3A0B Z;  3SPI A;  2V4D A;  2WSS G;  2OIE A;  4K3A A;  1RM1 B;  4CZZ A;  4DUZ O;  3E22 B;  1OJH A;  4TSF G;  3TET A;  3D3I A;  2B5U A;  2Y0I A;  3ABL B;  1SQF A;  1WP8 A;  4KUM A;  4H33 A;  3RYH B;  5LMN B;  1XI1 A;  3ZRX A;  3TK1 A;  2JS5 A;  1GN6 A;  3WB1 A;  1IZ3 A;  2QKC A;  2PY5 A;  4X88 A;  2HVK C;  1J5E B;  4CH6 A;  2XHB A;  1AB3 A;  3CCL V;  2UUC O;  1XNR O;  2AHY A;  4MT8 A;  4HYO A;  3H1I H;  3ICX A;  5K1X A;  3FFQ A;  4AI8 A;  4R7C A;  2QR4 A;  3AG4 B;  4LF7 B;  1PL0 A;  3SDL A;  4B3M O;  1OCO B;  5E1A C;  4LF8 B;  1NZ6 A;  3QO7 A;  2X7R B;  3MHH C;  4JYA B;  3H1K H;  2DYS C;  5H6R A;  3OT7 A;  4TOI A;  3CX5 F;  4G28 B;  2CH7 A;  2CAZ C;  1AJQ A;  3UT5 A;  4DV3 O;  2YDE A;  4ZIB A;  3EVK A;  4L8J A;  1ZAU A;  1WJZ A;  1DLB A;  3ABU A;  2DN9 A;  4DV4 B;  2RDC A;  1CXZ B;  1D5N A;  1E1Q G;  3OTO O;  2HFE C;  2DE0 X;  3H01 A;  4X89 A;  4DRX A;  3QG5 A;  1VQK V;  1SQG A;  1V9P A;  2ITC C;  1Q86 W;  4X66 B;  2UXB B;  1O9H A;  2QTO A;  1AI7 A;  1YZB A;  1I7F A;  4F6E A;  4YXW G;  5FLX N;  1K5Q A;  5EZY B;  4DXW A;  1US6 A;  2R72 A;  2JRI A;  4PI0 A;  4MVS A;  3JSL A;  3CRR A;  3CCU V;  5JH7 B;  5JQG A;  3C90 A;  3KG2 A;  1TA8 A;  4PV1 B;  1PNK A;  4O2B A;  1VF6 C;  4G2K A;  1K9M W;  2HVJ C;  1J95 A;  1S72 V;  2MK3 A;  4H44 B;  1NTK H;  1IDS A;  2HG5 C;  2GUZ A;  5C93 A;  3QO5 A;  4CH4 A;  3DTU B;  1H8H G;  5GON A;  4BW9 A;  1WPX A;  1HNW O;  1IBK B;  5CA1 A;  2GV9 A;  3E86 A;  1Q5O A;  4H13 B;  4TV9 A;  1KKD A;  4ABM A;  4MTX A;  1GN2 A;  3L72 H;  3ZRV A;  4JAV A;  4IHJ A;  2AXT Z;  4FLY A;  1YJW V;  3JAL A;  1T5E A;  2PYL A;  3K0D A;  2YSU B;  1BQ0 A;  1YF2 A;  5JCO A;  4HZ3 A;  4HBN A;  3L71 H;  1JFF A;  4JI8 B;  3QVN A;  4JV5 B;  1PP9 H;  5LA6 A;  3OMI B;  2CTR A;  4ZOL A;  2BSK A;  1YTF D;  4TV8 B;  4I4T A;  1QR9 A;  4FLZ A;  1P84 F;  1M5I A;  5EYP B;  3FAV A;  4LF6 B;  1MA1 A;  2EZO A;  2RMK B;  4NXN O;  5EC2 C;  1DF5 A;  2KG7 A;  1YHQ V;  4NB5 A;  2WPD G;  1K4C C;  3UO3 A;  3E22 A;  1TUB B;  4WFF A;  3A2F A;  2DWD C;  3LDD A;  4J80 A;  1P49 A;  3K03 A;  2YIC A;  1U96 A;  2KQX A;  1K33 A;  1HP8 A;  1W59 A;  2B1G A;  4FLX A;  3T1Y B;  4PDR A;  1IBK O;  1GH6 A;  2ZD9 A;  4ZOL B;  3W7T A;  5IJ9 A;  3JD1 A;  1QHT A;  3SYP A;  1BZK A;  2FML A;  2WLL A;  5EBW C;  1DTO A;  2YID A;  3OR6 C;  5KAI Z;  4NYK A;  4YHH B;  4DV2 B;  1XL6 A;  3CYO A;  2VS0 A;  5B3S C;  4MVO A;  5IYZ A;  5LMN O;  1KP3 A;  4NTX A;  4LF7 O;  3OTO B;  4AQY B;  3ZHT A;  3JD2 A;  2BCC H;  3AG7 A;  2QM4 A;  3LNN A;  4WFB V;  4JPR A;  1TUB A;  1G4Y B;  4XDL A;  1XMO O;  4LFC O;  2NLJ C;  1OCR B;  3A0H Z;  5LGT A;  4WFH A;  4DRX B;  4P30 A;  4O4H A;  4N21 A;  5GTH Z;  5LP6 C;  5C8Y B;  2ZIO A;  4JI1 O;  2Q0O C;  1N0J A;  4B3S B;  4JI1 B;  4JYA O;  2N04 A;  2PI5 A;  1GTO A;  1JOY A;  3SR2 C;  5B66 Z;  4FLU A;  4LFB O;  1MZE A;  3SJB C;  3EFF K;  4I50 A;  2F4V B;  2EIN C;  2WLH A;  2A3Q A;  3MD0 A;  4GX5 A;  3RGB A;  5JQG B;  1J5E O;  2OCH A;  4FM0 A;  3ABM C;  1E79 G;  4PA9 A;  4JTA B;  3HKB B;  1X59 A;  3K59 A;  2VWJ A;  1HR0 B;  3E89 A;  4O4H B;  1EN5 A;  2XTA A;  3LSU A;  2R70 A;  2EIK B;  3WU2 Z;  1A32 A;  2XUM A;  3CC2 V;  2CTQ A;  2C2A A;  2EIL B;  2BTQ B;  4D6T H;  3FD9 A;  1JMK C;  3F5T A;  2LFS A;  4JI3 O;  1M90 W;  2HLD G;  2Q0A A;  4U3J B;  1H38 A;  3DGE A;  2RN9 A;  3ABL C;  4DW0 A;  3JAM N;  5JVD B;  4LNU A;  1IXM A;  5EBM C;  2GHY A;  3BAA A;  1WN7 A;  1X4T A;  4TQD A;  3CRM A;  4GT1 A;  1QCE A;  4DV1 O;  2FYU H;  2YI8 A;  3OUS A;  2E76 B;  4CS4 A;  1IBM B;  2IJH A;  2Y48 A;  2DQ3 A;  3STL C;  5DEC A;  1NKD A;  1SS3 A;  5IT9 N;  2VQE O;  1E1R G;  4YJ2 B;  4DUY O;  1TVK A;  3IAY A;  1YSC A;  3HPL C;  2E75 B;  2PTM A;  1N32 B;  2EBO A;  5C8Y A;  1JJ2 U;  3BFR A;  1Z5W A;  4UCT A;  3TJT A;  1SQB H;  1IXB A;  1HW7 A;  3ASN C;  1H2M A;  3ABK C;  1R3K C;  2P90 A;  3OE7 G;  4UB6 Z;  3VQW A;  4YJ3 A;  5F2V O;  4DR3 B;  1MSW D;  4X1Y B;  2N74 A;  2EIJ B;  1PKX A;  3VBB A;  2PUS A;  2JEX A;  1S77 D;  3SYQ A;  4FIP C;  3X2Q B;  3FKS G;  2XT9 A;  1UPG A;  4UCS A;  2X6B A;  2ODM A;  1TUE B;  1SQV H;  3ZED A;  2EUL A;  4RQE A;  1Q6H A;  3K5N A;  1FJG B;  5KHG A;  5EIB D;  5B1N A;  1QQC A;  4UUJ C;  3LUT B;  2D2C B;  3OW2 U;  3SJQ C;  5IYB O;  3CMA V;  2YEV A;  5LXT A;  4UFZ A;  2QTS A;  4DK1 A;  2P4V A;  3JAT B;  4MVM A;  3WB0 A;  3AG2 B;  2XAJ A;  1XUQ A;  1GN4 A;  2BTQ A;  2XAS A;  2XAF A;  4P9O A;  2WA3 A;  1W2B U;  1DF4 A;  1XHX A;  3ZHS A;  4L87 A;  4QPJ A;  4DV4 O;  5L3C A;  3KCX A;  1YJ9 V;  5H5N A;  4PDM A;  2HJD A;  2DJV A;  4Q20 A;  1JX9 A;  1VQN V;  2E74 B;  5CB4 B;  4CH3 A;  2X6C A;  1ZL8 A;  2EIM C;  1SER A;  1DK1 A;  5KUM A;  4WFG A;  3CCQ V;  1NR1 A;  4DR2 B;  5EBL C;  1Q82 W;  4B3M B;  3BA8 A;  4U7N A;  4JI2 O;  1YJN V;  4CS3 A;  4GZR B;  4J7K A;  1YIT V;  1BHB A;  1TVK B;  3N2K B;  1KP2 A;  4MW3 A;  4DV1 B;  3DSQ A;  4CBC A;  1K5S A;  4HNA A;  2YUA A;  3K08 A;  2HEP A;  1Q8I A;  2Y4U A;  4B3R B;  5LYJ A;  4PDV A;  1IBL O;  1WAZ A;  1I5Y A;  1V54 C;  3ZMV A;  4X64 B;  2KKW A;  3BEH A;  1ZL8 B;  3SJC C;  2IU0 A;  4X1I B;  2UXC O;  3SYC A;  1WB8 A;  1K7D A;  5FNV A;  4JTC B;  3RYH A;  4O4I A;  1NQT A;  4GKK O;  1M1K W;  2Q7G A;  3FX7 A;  4UCR A;  5L3F A;  1IBL B;  4YY3 B;  3ZJZ A;  3HR0 A;  5KHI A;  4Z1M G;  4WBN A;  1F4M A;  3RN4 A;  3SPC A;  5CA3 A;  4X66 O;  2UXB O;  4DV2 O;  1N4C A;  2UUB B;  4I4T B;  2LW7 A;  2W6J G;  2DMX A;  1RFY A;  1HNX B;  5LXT B;  3CCV V;  4HAM A;  1S0V A;  4TQF A;  2HHH B;  4QNH B;  1XIL A;  4MVR A;  4FM2 A;  1WPB A;  1CP9 A;  2LP7 A;  1ZTE A;  1XOU A;  2IM9 A;  2OIG A;  3CSX A;  2UXN A;  5KAF Z;  3CJH B;  3CME V;  3ETE A;  3E8H A;  4J10 A;  4JTD B;  4R8C A;  1BSM A;  1NBM G;  3CC4 V;  3F5W C;  2HR3 A;  4UCV A;  1S5L Z;  1N8R W;  4X62 B;  2ZE5 A;  4DV6 B;  2CTW A;  1HNX O;  3AG4 C;  4JI8 O;  3LNM B;  5KHK A;  2UXC B;  1VQP V;  4G27 B;  2NN4 A;  3G67 A;  2IH1 C;  4JI5 O;  3PJS K;  3RFR A;  1K92 A;  4YJ3 B;  5L3B A;  1OCC C;  4RWU A;  1BT8 A;  2QWN B;  3TCU A;  2P7T C;  3ZCC A;  4XBF A;  1GM7 A;  1MSD A;  3U10 A;  1Y66 A;  5CBH A;  1YEW A;  3OFN G;  3CJH A;  4DR6 B;  3JAR B;  4QIW F;  3O65 A;  1AR5 A;  1OCR C;  4NXN B;  4CS2 A;  1Y6X A;  1OZ0 A;  4LF5 O;  2R9A A;  1KYO F;  3K79 A;  5JH7 A;  2QE7 G;  1FXH A;  2DOS A;  2G38 A;  2Z0A A;  3NR7 A;  4FFB B;  3CRA A;  3CCR V;  4RAI A;  5KHJ A;  1O9G A;  5BR8 B;  2KB1 A;  1K73 W;  1GAX A;  4I55 A;  4KFM A;  1S76 D;  4R50 A;  4YIP A;  4O4L B;  4KHP O;  1BL8 A;  3W7U A;  4JI6 O;  2LO1 A;  3ZBH A;  2Y69 B;  5GON B;  3ASO B;  4GYC B;  3ZN0 A;  2GUZ B;  5B1A C;  3ZRS A;  1IBM O;  1EZV H;  3FB6 C;  1TAE A;  1QU7 A;  2QWR B;  1QVF U;  1MOF A;  4X9Q A;  2Q7E A;  3VQV A;  1M9N A;  5LP6 A;  3APO A;  3ZHR A;  3VQX A;  4QGP A;  4X20 B;  5BZB A;  4QJF B;  1EFR G;  4FLT A;  2ZQM A;  4JYB A;  3E35 A;  3G6E V;  4BIU A;  4UCU A;  3CCS V;  3J7A U;  1AJN A;  3HKD B;  4NTW A;  3T4Z A;  3CCE V;  3JAL B;  1H2N A;  4FFB A;  1SA0 A;  1VP7 A;  4DYL A;  1CEZ A;  1XEQ A;  2XOK G;  1AI6 A;  2K9P A;  2P67 A;  3JAW A;  2DYS B;  3ZRW B;  4JYC A;  1OCO C;  3F7V C;  2JJ2 G;  2Q73 A;  3LSS A;  4J9Z B;  3RVY A;  3BVO A;  4PJ0 Z;  1Y67 A;  4OGQ B;  4CC6 A;  1VQM V;  3J81 N;  4U3J A;  1NTZ H;  4O2A B;  2NNU A;  3BAB A;  4PHZ A;  1ZSP A;  3CHX A;  4QPK A;  1LUV A;  4IL6 Z;  3FYI B;  3MHS C;  1SKV A;  4LH7 A;  3SPH A;  2UXD O;  5JCO C;  3G4S V;  3HKC B;  1ZWI C;  4IIJ A;  2HJF C;  3G71 V;  5CA1 B;  3DXR B;  2O57 A;  3A0R A;  4DO2 A;  3OUF A;  3UM7 A;  3IC7 A;  4PI2 A;  2VQF O;  1SES A;  2RNB A;  3VQY A;  4JZG A;  2X0L A;  2Q9L A;  2Q6A A;  3OMA B;  4BW5 A;  3E83 A;  1QLE C;  3JAW B;  4PA7 A;  4GLX A;  4UV8 A;  1L1F A;  1YIJ V;  4H0L B;  1KMI Z;  4O4L A;  2Q8V A;  3STZ C;  1SA0 B;  2A79 B;  3T2M A;  1HR0 O;  3K57 A;  2E5L B;  4NTY A;  1SRY A;  2WLM A;  3X2Q C;  3ZS8 C;  4LR3 A;  1VF6 A;  1Q81 W;  3OGI B;  2M7W A;  3AEI A;  2YC0 A;  3AG3 B;  4EB6 A;  4DV7 O;  4FZ1 A;  4X64 O;  5KX5 A;  1QNM A;  4X20 A;  4DR2 O;  2IJK A;  2WLI A;  2AZ0 A;  3IJ4 A;  5A2Q N;  2QM8 A;  1WA8 B;  4FPP A;  3AG2 C;  2B9Z A;  1GK9 A;  3RYF B;  5DN6 G;  4MS2 A;  3APQ A;  5GW7 A;  1JJO A;  3ASO C;  3OR7 C;  4DV7 B;  5IYZ B;  4D7T A;  2OCC B;  2A7W A;  3F7Y C;  5IDJ A;  4DV5 B;  1VMG A;  4XDK A;  1K97 A;  1VEW A;  3ZRW A;  4J7Z A;  1YCI A;  4I9W A;  4YJ2 A;  3JAT A;  3CC7 V;  5IJ0 A;  1S5H C;  3UCS C;  4LWS A;  2UXD B;  3AK2 A;  2LGQ A;  1I08 A;  4JF3 A;  1N34 B;  3KKY A;  1OCZ B;  3JAR A;  1JQ0 A;  5LMU B;  4MTF A;  2PI4 A;  2HKO A;  4GKK B;  3MDS A;  2EIK C;  2F4V O;  3ASN B;  3CXH F;  5LGU A;  2B1I A;  5BY1 A;  5IY5 B;  5CMU A;  4JYY A;  4IYI A;  5IYD O;  4DUY B;  4JAA A;  3CB2 A;  2CTP A;  1AI5 A;  4P2Z A;  1ENV A;  3TGU H;  3H1L H;  4LBE C;  4EEQ A;  1GM9 A;  2CDY A;  1MAB G;  4JI5 B;  3W7X A;  3RW0 A;  1SZX A;  1Q90 D;  4J42 A;  4EB6 B;  4AHC A;  5H2F Z;  3OEE G;  4B08 A;  5ITZ A;  2IU3 A;  2GBO A;  3JAS B;  2YXY A;  1VQ5 V;  3M8A A;  1AP6 A;  1Z2G A;  4NXM O;  1I5X A;  1NTM H;  1D2D A;  1L0N H;  5KUK A;  2ITD C;  2ZM6 O;  2ZNJ A;  3FB7 C;  2QDO A;  1VQ7 V;  1FPO A;  4TWK A;  1ROP A;  4WFA V;  1OCC B;  1Q43 A;  1KEC A;  1F51 A;  5LHG A;  1VQL V;  2IJJ A;  2K1E A;  1R6K A;  4Z1V A;  1XNQ B;  2ZIN A;  2OWO A; 
#chains in the Genus database with same CATH homology
 3L70 H;  3L74 H;  2A06 H;  1PP9 H;  3H1K H;  3CXH F;  3L75 H;  5KLV H;  1KYO F;  1NTK H;  1PPJ H;  1SQB H;  3L72 H;  2IBZ H;  1BCC H;  3L73 H;  3BCC H;  1SQV H;  3CX5 F;  4D6T H;  2FYU H;  1KB9 F;  3H1H H;  1NTZ H;  1L0L H;  1NU1 H;  3H1I H;  3H1L H;  1SQP H;  1P84 F;  1SQQ H;  2BCC H;  3TGU H;  1BGY H;  3H1J H;  1EZV H;  1SQX H;  3L71 H;  1NTM H;  4PD4 F;  4U3F H;  3CWB H;  1L0N H;  1BE3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...