2LW1A

The c-terminal domain of the uup protein is a dna-binding coiled coil motif
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
85
structure length
85
Chain Sequence
KAETVKRSSSKLSYKLQRELEQLPQLLEDLEAKLEALQTQVADASFFSQPHEQTQKVLADMAAAEQELEQAFERWEYLEALKNGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords ABC transporter ATP-binding protein uup
publication title The C-terminal domain of the Uup protein is a DNA-binding coiled coil motif.
pubmed doi rcsb
source organism Escherichia coli
total genus 32
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16326 ABC_tran_CTD ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.380 Mainly Alpha Orthogonal Bundle Helix Hairpins Valyl-tRNA synthetase, C-terminal domain 2lw1A00
1GAXA 2LW1A 1IVSA
chains in the Genus database with same CATH superfamily
3CX5F 4BR6A 3ASNC 2MK3A 4D6TH 3ABMB 1WP8A 1VF6C 1MSWD 5CA0B 3AEIA 1BCCH 4NYKA 3BRCA 1MNGA 4J80A 4JI7B 1N0JA 2L6LA 1VF6A 1TVKA 2VRZA 2DE0X 2R70A 3LSUA 2CTPA 2F43G 3RT3C 2QGNA 4B7KA 1K4CC 2KG7B 4X89A 3QTCA 2V7QG 4IT5A 3LDEA 2CUGA 4OX9O 5JVDA 2E5LO 1BT8A 5H5NA 2ZR3A 4IHJB 1DGSA 1N34O 1WP7A 2YSUB 3W7WA 4OX9B 2P7TC 2Z5UA 2WLHA 1HP8A 4X62O 3FB6C 1M57B 4FFKA 5IDJA 2QKSA 2CE4A 4TWKA 4J7KA 4X62B 2PZSA 3OE7G 4B3MO 5JH7A 1H2NA 1W0JG 1VMGA 1MMMA 1S5HC 4B3MB 2ZE7A 1TUBB 2UXXA 3E22B 3ABUA 4JYCA 2HJFC 4GX0A 1Q90D 3LDCA 1IBMO 4GKKB 5IWAB 5GTIZ 3BCCH 3UM7A 3ZHQA 2IW5A 2YXLA 1K3EA 4HNAB 3B2EE 3CCLV 1M56C 1HR0O 4QPKA 5IY5B 2RMKB 1HNZO 2JJ1G 4G27B 1HR0B 3CE2A 4DRXA 1HNZB 1YZBA 4N23A 3K5NA 1FS0G 4CH4A 2RDCA 4RAIA 1H2GA 3GB7C 1XDCA 1VQ8V 1I5YA 3E8GA 1MZFA 3QO5A 4X1YB 4AILC 3TCUA 4NXNO 3QO8A 4DR6O 1HNWO 1AP6A 2EZPA 4NXNB 1YEWA 1HNWB 4WF9V 2UXDO 1U97A 1NH2B 2OIEA 4DR5O 4BIUA 2UXDB 4PDVA 3OTOB 4DR5B 4XBFA 1BZKA 4JTDB 3DC5A 1IX9A 3D8CA 4U3FH 1YIJV 3Q4HB 1RM1C 5CB4B 4I50A 1B6QA 4F6EA 5LXTA 4JAUA 2D2CB 1BQ0A 2PI4A 5A9GA 2E75B 3R65A 3ZMUA 1S5LZ 4QJFB 3RN4A 2Q68A 2BTQB 5A2QN 2ZR2A 4PD4F 1FJGB 4U3JA 3CCQV 3DSQA 3ASOB 4LCUC 3OT7A 4ASUG 1WPXA 1LUVA 2EIMB 1YF2A 2UXCO 1VF5B 2DN9A 1SETA 3AG2B 4PV1B 2CTRA 1SQVH 4EKWA 2PY5A 4BIZA 5CMUA 1WN7A 5LA6B 1ZL8B 1ZLZA 2X6AA 1CPYA 1OCCC 2HVKC 4EFEA 3CJHA 2AGAA 2Q7GA 1K9MW 4MVQA 3AG3C 4TQFA 4J41A 1N33B 3UO2A 3WB0A 4P2ZA 1R1BA 1O9GA 4KHPO 2XNDG 4KFMA 3W7UA 1L1FA 4UVBA 1HWYA 2JGUA 3ABMC 2ZINA 5CN0A 4KHPB 4L8JA 1ZSPA 4HAMA 3E8FA 2E3CA 5EK0A 3L72H 3OGCC 1EM1A 5CA0A 1WA8B 4MTGA 2UU9O 3JARA 5JCOC 1N36O 1QR8A 1M90W 1NBMG 5IT9N 4B3SO 1R3IC 4XDKA 4EEQA 4PI0A 1THZA 3ZRSA 2P90A 3SPJA 5LOVA 2UU9B 1N36B 3M99B 1COWG 1W59A 5JCOA 3N27A 4X65O 1XNQO 2H94A 2ZT9B 4IHJA 1TGOA 3J7AU 4UCTA 4X65B 3E2EA 4JYBA 2WLIB 2EIJC 4FZ1A 3P32A 3I55V 1YVWA 1AILA 4FLUA 3CMEV 4RQEA 2Q4PA 2FB5A 4LF7O 3HKDA 2HHHO 3CCMV 1HW7A 5LHIA 4LF7B 5BMVB 1K4DC 1SRYA 1CP9A 4G2KA 1JJOA 2QWQB 4W4LA 4TV8B 4NTXA 3D3IA 1HNXO 2ZXWB 5B5EZ 1PKXA 2L35A 1W0KG 1QBZA 4FJCC 2JS3A 4I55B 5KUMA 1BQZA 2XAFA 4MTFA 1PL4A 3CRAA 5IJ9B 4MT8A 3LNNA 1S77D 1HDJA 4PI2A 3ZCCA 1H2SB 1BE3H 3K03A 5FNVA 2Q69A 4X1KA 2EINC 4JI2O 3E8HA 1GM7A 1AI4A 2DYRC 1YJWV 1F4MA 4YJ2B 2Q7EA 5IYCO 4X1YA 4ABMA 4JI5O 1N4CA 4X66O 5EC1C 3H1KH 3EFFK 5EYPB 2OCHA 2EILC 1S76D 4X66B 3X2QB 3J80N 3HPLC 2WLLA 3U11A 4UV9A 1V54B 2QSAA 2LQTA 4MS2A 1IVSA 5B3SC 3OMIB 5CA1B 2JJ2G 3BAAA 4F4LA 4FFBB 1SQFA 2JRIA 4PJ0Z 1OCZC 4UVAA 4YXWG 2XAJA 4LNUB 3UT5B 4EB6B 4OGQB 4ZOLB 4MVSA 3CCSV 4FLXA 4DV2O 3SGIA 4FIPC 1G8MA 2P22C 1FAFA 1Q43A 1L8DA 4NXMO 2CGNA 4DV2B 3ASOC 1SQGA 1VARA 2RQ6A 2EULA 2BTQA 2LFRA 1FFXA 2CH7A 3D36C 2ATKC 5ITZB 4H33A 4WBNB 1KU9A 3FD9A 1VQ5V 1VP7A 3SYPA 4TOIA 3JATB 3C90A 1E79G 4U7NA 2QM7A 1H2LA 2HP8A 4DUYO 5C8YB 2AZ2A 4WCEV 1JMKC 5B1NA 2OIGA 3K04A 3SPCA 3I56V 1AI5A 3ZRWB 2Z3YA 3CP1A 4J7JA 2YEVA 3JD2A 1Q81W 3B8NA 2WA3A 3ABKC 1Q86W 1U96A 3T1HO 1BSMA 3RVZA 4YIPA 3WU2Z 5LMNB 2QA4V 3IAYA 4Q20A 3OEEG 4ZI7A 5KHKA 1GKFA 3K0DA 4I4TB 2B1IA 2P4VA 2EJRA 3FB8C 1PP9H 5H2FZ 2E76B 5K1PA 1K73W 4FM1A 4GT1A 4P9OA 4H44B 2XHBA 3SPHA 3TGUH 1MG1A 2ZQMA 4LFCB 4RWUA 2DJVA 4TV9B 5GONB 2HJDA 1VQPV 1FXVA 4MW8A 2WLIA 4UUJC 1EZJA 3HKEB 2G38A 1WB8A 4GUNA 5KHJA 3LUTB 1QLEC 2EIKB 2P4KA 2F4VB 1BHBA 1SA0A 2BCCH 4DV1O 1YITV 1KP2A 4OPHA 5KHHA 2B5UA 3RYFB 3L9DA 1AR1B 3A2FA 4ZHQB 1E1QG 1X4TA 4CS4A 1J95A 2YICA 2Y4TA 5KHGA 2LJ2A 1PD3A 1Y66A 2QWRB 1EN6A 3A8TA 4DV3O 5HFLA 1F51A 2Y69B 3CD6V 3G80A 4H37A 1BHAA 4NKGB 4DV3B 2JS5A 2XUMA 3SJCC 2HFEC 3ZMVA 4JI3B 4RUFA 4JI8O 1JPXA 3OR6C 3IFXA 3RYCB 1JA8A 2QM4A 4FVMA 1IBLO 3IJ4A 4JI8B 1GRJA 3H1HH 2OYQA 2CDYA 1RP3B 1FXHA 3E35A 3EXAA 1D5AA 4JPRA 5KMGA 1IBLB 5GW7A 4EFBA 2Y0PA 2EZOA 1VQMV 1OCRB 1SQQH 4YJ2A 5TISZ 2EX3A 4JZGA 3H1LH 5J2TB 2DYSB 1PM9A 1QVGU 3ZRVA 4JI7O 5FPOA 3BFRA 2UUAB 3KZIZ 4I0XA 2IH1C 4GX5A 1ROPA 4NTYA 1R6NA 2A9HA 3FYEB 3GWOA 1G4YB 5CA1A 3AG4C 1YXBA 5B66Z 2UUBB 2VQEO 1Y4MA 2IJHA 5LYJA 3IC7A 1NS1A 2IM9A 4JV5O 3ABLC 2ZE6A 3HKBB 3K08A 4X20B 1PPJH 2VQEB 4JV5B 2W6IG 1I0HA 3RGBA 3ZJZA 3SPGA 1VQOV 2QWNB 3SJBC 3STZC 1VQNV 3ZMTA 1YJ9V 2VWJA 2IU3A 2DWEC 5IYZB 3BHPA 5B1OA 2ADPA 1T5EA 3JAKB 2BSKB 2LGWA 4K3AA 1Q82W 3G67A 4DR3B 5LP6C 2ODMA 4WFGA 1IURA 2B9ZA 3A0BZ 3MAQA 4GKKO 5E79Z 5IWAO 3SDLA 2M7WA 2VQFB 3TK1A 5LP6A 1XMOO 1NU1H 4GYCB 1EN4A 1V55C 5FPRA 3SJAC 5KA6A 1K7DA 4X64O 1XMOB 2PUSA 1H2KA 4YJ3B 5E1AC 4LWSA 5B1AC 5LMUB 4AHCA 1Z5WA 3B4SA 1FXKC 4X64B 5J9PC 4JI0O 1NZ6A 2QWPB 3WFVA 4JI0B 1KP3A 4H0LB 1FXKA 4DV6O 2QEXV 1N32O 2RNBA 2DMXA 4JI6O 1R6KA 2X7RB 2P5OA 4GZRB 4LH6A 2YIDA 3WG7C 5JWPA 4DV6B 2KSDA 1N32B 4DR4B 4JI6B 4IL6Z 3QF7A 1IBKB 3KG2A 4JAAA 4H13B 5JQGB 3JASB 4GX2A 1Q6UA 4J42A 5EBLC 1RPRA 2YXHA 4GX1A 4PDMA 4A5UB 4LF6O 2IJIA 2E74B 3OTOO 3F5TA 1VF7A 3OD4A 3CC2V 2Y48A 3ZHTA 2H8PC 4QGPA 1KMIZ 1NQTA 4LF6B 5LBQA 1TA8A 2K9PA 3SYQA 1AVMA 3L71H 3D3QA 4C7UA 3AG1B 3F5WC 1O9HA 2Q67A 4DW0A 4O4IA 1V9PA 2X6BA 4LFBO 3BA8A 4O4HB 1S3JA 1P7BA 2QTSA 4LFBB 1XNRO 1H8HG 4HBNA 4B3RB 4CS2A 1FJGO 4Z1MG 1MA1A 4WFFA 3T2MA 2HVJC 4P30A 1XNRB 3ZBHA 2IH3C 3BPZA 3VQVA 5KA5A 2OTJV 5B1BB 2ADQB 1KB9F 2BOCC 1QLNA 2JGDA 3RYHB 2JDIG 4LF9B 4J7ZA 4W4KA 2WWWA 4K8ZA 4O2AA 4X1IB 2WA4A 3RYCA 1AJNA 3L75H 1DTOA 1N33O 2WLNA 4O4JA 4MTOA 4RQFA 2CK3G 2FTKA 5JJEB 3JD3A 1WB7A 4UCOA 4FM0A 3ZEDA 2WLKA 3TXSA 4RO2A 4AQYB 4N21A 2LO1A 5J2TA 3OM3B 1YHQV 1Y76B 4DW1A 3DC6A 2AHYA 3K9AA 3P30A 1Q8IA 2AZ0A 5D5PA 1GMGA 4UCVA 4BWAA 1IXMA 5JJJB 1US6A 3CCEV 3CCVV 1P4RA 1UFIA 2HG5C 4JYAO 5H6QA 1WJZA 1X59A 4DR1B 4JYAB 4HZ3A 5D5QA 1Q6HA 4MSWC 2OCCB 5EBWC 2KG7A 3THOA 3U10A 1GN6A 1XBLA 4FMTA 2ARHA 5EZYB 4JI4B 4FLZA 1M57C 3CCJV 4IYHA 1S72V 1AI6A 4GKJO 5KLVH 4LBEC 3G6EV 2N04A 2GTAA 2ZE8A 4GKJB 3H1JH 1GO3F 3G4SV 3LSSA 3M8AA 1AROP 2ZDIC 3ZHUA 4DV0O 5CBGA 4DUZO 1SZXA 3CRRA 5KUKA 1BS3A 3BVOA 4JI1O 1GM9A 1TUBA 1QHTA 2F66C 2DQ0A 4I5SA 4DV0B 4DUZB 3E22A 2ZDIA 1AJQA 2BTOA 4JI1B 5CBFA 1GN2A 1D5NA 3BY6A 5IY5C 3T4DA 1YJNV 4HNAA 1SF9A 4OXSA 3O65A 4NTWA 2MW2B 2RN9A 1YSCA 5BZBA 1D2DA 2CAZC 3KCYA 3P3PA 4DV7O 2F1MA 2IJKA 4QE7A 4PA9A 5AG2A 4RUEA 3EHBB 3MDSA 4DV7B 2XAHA 2GUZB 1OV9A 3BA9A 1DF5A 2FL4A 3E83A 4AI8A 2BOBC 2K1EA 2PI5A 1WLEA 3M7MX 5JQGA 1OCOB 2XOKG 3B8MA 1K34A 5KAIZ 2KQXA 3QVNA 4K0KO 4MW3A 3CXCU 1Q3EA 2W0XA 4UB8Z 4K0KB 2HLDG 4TT3G 2O57A 2KKWA 3K5OA 1JJ2U 1LR1A 4UV8A 4Z2WA 2LW7A 1SESA 1NVPB 1TAEA 4IYIA 3AK3A 1Y67A 4WFEA 3FX7A 1B3QA 3ASNB 3Q4HA 5IYBO 5CB4A 5L3EA 1FD9A 1DLBA 3K0GA 1TVKB 3E8BA 1XQ8A 3LSQA 2GTSA 4LF4O 5JVDB 2EIMC 4CH3A 3AG2C 1XOUA 4UCSA 4LF4B 2ZKOA 2LFSA 4DV5O 3OMNB 1ZX3A 4J11A 1SKVA 2HKOA 3K59A 4DR2B 3B40A 5LA6A 3AG7A 1ZL8A 1SS3A 4DV5B 4BW9A 2V1DA 5JH7B 4I9QA 1UPGA 1K97A 4F6RB 2IJJA 4J9YB 1WAZA 2GV9A 2H3OA 3P3NA 2OTLV 3STLC 3OW2U 1CEZA 1KBHA 2ZIOA 4YHHB 2QKCA 1RPOA 3K58A 5LMNO 4LF5O 3T1YB 4PDRA 1J5EO 1PNLA 2EJ7A 1S0VA 4LF5B 4X8AA 4JF3A 1F23A 5DN6G 1XI1A 3CEIA 2OCCC 4IIJB 3N2KB 1J5EB 1FFTB 1JQ0A 1WA8A 2R9IA 4I7ZB 5L3GA 4DRXB 4XDJA 3AK1A 4R6ZA 1NJIW 2ZE5A 4LFCO 1A32A 3W7SA 3AK2A 4D7TA 1FPOA 1YDXA 4ICGA 3ZN1A 3UKMA 1Y74B 2GBOA 1I94O 2QM8A 1SQBH 3ETEA 2F4VO 3UO3A 4I9WA 1I94B 2NN4A 2JVDA 4TSFG 1NR7A 1Q6IA 1ZAUA 1R3LC 2DW4A 2IU0A 2XAQA 3ZS8C 2PGGA 1CXZB 3PJSK 1ZWIC 1OZ0A 4CH5A 3MD0A 5BMVA 2ZXWC 4B3TB 4QNHB 4X88A 4TV8A 1JX9A 3H9VA 1NTKH 4I50B 4B7EA 3QG5A 2JIZG 2ZIMA 4JI3O 2R72A 4LR3A 3H1IH 3VQXA 1RM1B 1VQ7V 4I55A 3NXSA 1VIBA 3IGAC 4JGSA 5IJ9A 3ZRXA 2GDSA 2ITCC 1FYJA 4O4LB 1MOFA 4PA6A 3W7XA 4ZBMA 2PTMA 5LGUA 3G71V 3JYCA 4DO2A 4LF8B 1KECA 1OCOC 4WFHA 2ZD9A 2AHZA 3CJHB 4DK0A 4WFBV 4PA7A 3X2QC 3T4ZA 3APQA 2UUAO 1NH2D 3ML0A 1V54C 2EBOA 1OCCB 5EYPA 3FFQA 4HYOA 1M4UA 1GTOA 1QCEA 3AG3B 2A3QA 5CBHA 5KX5B 2QJ1A 4JYYA 2UUBO 2HR3A 2PYLA 5J2UB 1JR9A 1K5QA 4FLWA 3CHXA 4PDLA 4KL1A 5LHGA 4FFBA 3E89A 2ZNJA 4FLYA 3UCSC 4FLVA 4Z1VA 1FKAO 3L74H 3OGIB 1LUWA 4LNUA 4MVMA 3UT5A 4EB6A 4ZOLA 3DXRB 2D3OW 4MVUA 3F7VC 3JARB 3K5MA 1PNKA 3K57A 1PV0A 5IJ0B 1SZTA 2F95B 4PHZA 3RYIB 3FB7C 2NNUA 5LOVB 2Q73A 2YI8A 5FLXN 1ENVA 4DR3O 2OWOA 5CA3A 2X0LA 3R66A 4D7SA 5ITZA 4FLTA 4WBNA 2Q0OC 2E5LB 3L73H 2VQFO 1AJPA 2N05A 1N34B 1IDSA 3JATA 2BE3A 4MVOA 3ETDA 3ZMSA 4LP8A 3HKDB 3WB2A 5C8YA 5FL7G 2EIJB 4L87A 1VEWA 1SC5B 2P6JA 5BXZA 5BR8O 5LMUO 4F6RA 4QPJA 1XREA 4JTCB 4PA3A 4CS3A 5BR8B 3ZRWA 2ZCEA 1YTFB 3FAVB 3JSLA 2Q0AA 4ZKIA 2W0FC 1YI2V 2QR4A 3T1CA 4K8XA 4QE9A 1G6UA 1AP5A 1IBMB 5L3FA 4UFZA 3FYIB 3ZHRA 4DR4O 1KYOF 2F93B 3C3SA 3N2GB 1IBKO 3RVYA 2DWDC 2WPDG 5IYDO 4CH6A 4IIJA 3N2KA 4I4TA 4DXWA 2QKAA 2WLJA 2AW9A 3VQYA 4TQDA 3CRMA 1AR4A 3HKCB 5FNVB 3SYAA 1K5SA 1NT2B 4X1KB 4JTAB 1TUEB 1Z2GA 2V4DA 3FKSG 1VQ9V 1QQCA 1Y74A 4TV9A 5GONA 3W7TA 2EINB 1XEQA 2EIKC 3SYCA 1RSOB 2DYRB 4CZZA 1R73A 2FMLA 2UUCO 3TETA 2LW1A 3HKEA 5L3CA 4DR6B 2WLLB 2UUCB 4B3RO 1M93A 1L0LH 5LGTA 1F4NA 1MABG 3L70H 1DF4A 1IZ3A 2EILB 3RYFA 1RFYA 4JAVA 4ZHQA 1B06A 3WB1A 3CS5A 2Y69C 3SPIA 2A0LA 3HB3B 2N74A 3RW0A 4XDLA 2YIAA 2YDEA 4CC6A 5B3SB 3O9OA 1EFRG 2QDOA 3OTFA 4TUYB 3JAWB 4LF9O 1QVFU 1OCZB 4UCUA 3BEHA 3DGEA 1XUQA 2C2AA 2LGQA 3ZHSA 4E2LA 3CRQA 1FFXB 2CH7B 5C93A 5KAFZ 1MSDA 1PNMA 2R9RB 2P06A 2QTOA 5IE9A 1OCRC 4O4LA 4G28B 1OJHA 3U0ZA 4AQYO 1ZUQA 2DOSA 3A0RA 2DYSC 2Q6AA 2JEXA 1E1RG 2UXCB 1BGYH 2YIBA 1EZVH 2M6YA 3FB5C 1G1XB 2ETNA 1W2BU 5EC2C 1N8RW 1UJWB 1I7FA 4QIWF 2YEVB 5LHHA 4DR1O 3QNEA 3JD1A 5KX5A 1XMQO 1URFA 4ZIBA 5J2UA 1NVPD 4JI4O 1XMQB 5GTHZ 3ABKB 4UVCA 3JALB 5KHIA 1VQLV 3HKBA 4ZI7B 2CGOA 1NKDA 4X20A 3DXRA 2ZNIA 5IJ0A 4O2BB 3RYIA 2PF4E 2JEUA 2CTQA 2YC0A 1VQ6V 1AI7A 4B3SB 3B77A 1P7GA 2VS0A 1LNQA 5H9CA 5IYZA 4LC1A 3JAKA 2BSKA 2VWKA 1XNQB 1P49A 1M9NA 4BIOA 3KKYA 1K92A 2CTWA 1XL6A 1SA0B 2WSSG 4K35A 3CXHF 3VOUA 4NB5A 3DTUB 2Q9LA 2XAGA 1NTZH 3H01A 4GLXA 5HFMA 1JFFB 3ZMZA 2A79B 1JCHA 1QLEB 2Q7HA 5DECA 2HHHB 1KD1W 1Z5VA 4YJ3A 1NR1A 2QWOB 5EIBC 1I5XA 3QO7A 4DYLA 3FAVA 4X9QA 4J10A 1L0NH 1NI8A 1PL0A 3VQWA 1Y6XA 4BW5A 1HNXB 3RWRD 2FKXA 1ORQC 2FYUH 2Y0IA 4U7OA 3JAMN 4CC5A 3N2GA 3JD0A 4B08A 2HEPA 1GN4A 3PN1A 1AR5A 2ITDC 5H6RA 2UXBO 1JVMA 3JASA 3ICXA 5KMGB 2GHYA 3ZIAG 3HKCA 1NTMH 2UXBB 2XASA 4FPPA 3MHSC 3LDDA 3AG1C 3CWBH 1H8EG 3OMAB 1R6TA 4R8CA 3S3XA 4JI2B 2WAMA 2LP7A 1RSOA 3CSXA 3ETGA 3K3WA 2ZM6O 4MVRA 4YY3O 2PYJA 3G6BA 4P9PA 5DEDA 2ZM6B 1OHHG 4JI5B 1GK9A 4YY3B 4I0XB 2JK5C 4O4HA 5LL6Y 3NR7A 3MHHC 1SQPH 2WLMA 1GAXA 5B1BC 1R3KC 5LYJB 1KUQA 4PA4A 2YUAA 1KQSU 1QR9A 4E4EA 1WPBA 5L3DA 3AG4B 4YIOA 4BAYA 4TUYA 3JAWA 1XHZA 4DR2O 1BMFG 3ABLB 4PELA 3RYHA 1H38A 1EN5A 3TJTA 1P84F 3K9SA 1VQ4V 2RCVA 3EVKA 2X6CA 3OAAG 2Q5ZA 1XL4A 4X1IA 4NXMB 4FZ0A 3CCRV 5DM6V 3UQ8A 2Z0AA 3TXQA 2GSMB 2B1GA 4FM2A 4FK5C 3CPWU 1Q5OA 2XTAA 1YCIA 2YIBD 4R7CA 5L3BA 4YHHO 3D36A 3OEHG 2AXTZ 1KC8W 1QNMA 3K06A 3HR0A 4IGGA 2IBZH 1M5IA 5LP6B 4JASA 3T1YO 1GH6A 3CB2A 4DUYB 1JOYA 3BABA 1N0NA 4Q6GA 3CCUV 1Y76A 1WNSA 4KXRA 4LWSB 3RBZA 3SYOA 1IXBA 3K79A 3J81N 1H2MA 1V55B 2A7WA 1XILA 3JD4A 2Y4UA 3A0HZ 1M56B 5B1AB 4JZ2A 1R3JC 4MTXA 1FXKB 3T1HB 3ZX6A 2A06H 3VBBA 1K33A 3JALA 3JSNA 5JJNB 5EBMC 5EZYA 3CRCA 5F2VO 4LFAO 1VQKV 2YS8A 3I5DA 3KCXA 4DV4O 3C3TA 1B04A 4WFAV 1DK1A 4LFAB 3WG7B 3SR2C 2NLJC 2OT5A 4O2BA 4DV4B 4MVZA 2DQ3A 5LGNA 4DR7O 4GCZA 2NR5A 2RJZA 4B3TO 1QU7A 4DR7B 3CMAV 3B09A 3OUSA 3K5LA 2Q8VA 2XT9A 4KP4A 1AB3A 4O4IB 1S5JA 1SERA 1K8AW 3LNMB 4KUMA 3GWKC 4LH7A 3SJQC 3JCZA 3CC7V 3ZN0A 2YI9A 5LXTB 1I08A 2R9AA 2KB1A 2F23A 1M1KW 2W6JG 1EBOA 1JFFA 3S3WA 4DV1B 1YTFD 1GN3A 3IC9A 3OR7C 2YXYA 1GM8A 4U3JB 5EIBD 4UXNA 1F7YA 3F7YC 4R50A 2JGDB 5BY1A 4LF8O 3APOA 5K1XA 4UB6Z 3RFRA 3OUFA 3JCUZ 2GUZA 4J9ZB 4NR1A 1KKDA 3ABTA 4O2AB 3ZHVA 3ETQA 4NVPA 2P67A 2ILMA 1MZEA 4UCRA 4O4JB 3OFNG 3GVMA 2UXNA 3CYOA 2QE7G 4OPAA 4DK1A 1KKCA 1XHXA 3E86A 4CBCA 1ZTEA 3CC4V 1SQXH 1Q7YW 1BL8A
chains in the Genus database with same CATH topology
1GAXA 2LW1A 1IVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GAX A;  2LW1 A;  1IVS A; 
#chains in the Genus database with same CATH topology
 3CX5 F;  4BR6 A;  3ASN C;  2MK3 A;  4D6T H;  3ABM B;  1WP8 A;  1VF6 C;  1MSW D;  5CA0 B;  3AEI A;  1BCC H;  4NYK A;  3BRC A;  1MNG A;  4J80 A;  4JI7 B;  1N0J A;  2L6L A;  1VF6 A;  1TVK A;  2VRZ A;  2DE0 X;  2R70 A;  3LSU A;  2CTP A;  2F43 G;  3RT3 C;  2QGN A;  4B7K A;  1K4C C;  2KG7 B;  4X89 A;  3QTC A;  2V7Q G;  4IT5 A;  3LDE A;  2CUG A;  4OX9 O;  5JVD A;  2E5L O;  1BT8 A;  5H5N A;  2ZR3 A;  4IHJ B;  1DGS A;  1N34 O;  1WP7 A;  2YSU B;  3W7W A;  4OX9 B;  2P7T C;  2Z5U A;  2WLH A;  1HP8 A;  4X62 O;  3FB6 C;  1M57 B;  4FFK A;  5IDJ A;  2QKS A;  2CE4 A;  4TWK A;  4J7K A;  4X62 B;  2PZS A;  3OE7 G;  4B3M O;  5JH7 A;  1H2N A;  1W0J G;  1VMG A;  1MMM A;  1S5H C;  4B3M B;  2ZE7 A;  1TUB B;  2UXX A;  3E22 B;  3ABU A;  4JYC A;  2HJF C;  4GX0 A;  1Q90 D;  3LDC A;  1IBM O;  4GKK B;  5IWA B;  5GTI Z;  3BCC H;  3UM7 A;  3ZHQ A;  2IW5 A;  2YXL A;  1K3E A;  4HNA B;  3B2E E;  3CCL V;  1M56 C;  1HR0 O;  4QPK A;  5IY5 B;  2RMK B;  1HNZ O;  2JJ1 G;  4G27 B;  1HR0 B;  3CE2 A;  4DRX A;  1HNZ B;  1YZB A;  4N23 A;  3K5N A;  1FS0 G;  4CH4 A;  2RDC A;  4RAI A;  1H2G A;  3GB7 C;  1XDC A;  1VQ8 V;  1I5Y A;  3E8G A;  1MZF A;  3QO5 A;  4X1Y B;  4AIL C;  3TCU A;  4NXN O;  3QO8 A;  4DR6 O;  1HNW O;  1AP6 A;  2EZP A;  4NXN B;  1YEW A;  1HNW B;  4WF9 V;  2UXD O;  1U97 A;  1NH2 B;  2OIE A;  4DR5 O;  4BIU A;  2UXD B;  4PDV A;  3OTO B;  4DR5 B;  4XBF A;  1BZK A;  4JTD B;  3DC5 A;  1IX9 A;  3D8C A;  4U3F H;  1YIJ V;  3Q4H B;  1RM1 C;  5CB4 B;  4I50 A;  1B6Q A;  4F6E A;  5LXT A;  4JAU A;  2D2C B;  1BQ0 A;  2PI4 A;  5A9G A;  2E75 B;  3R65 A;  3ZMU A;  1S5L Z;  4QJF B;  3RN4 A;  2Q68 A;  2BTQ B;  5A2Q N;  2ZR2 A;  4PD4 F;  1FJG B;  4U3J A;  3CCQ V;  3DSQ A;  3ASO B;  4LCU C;  3OT7 A;  4ASU G;  1WPX A;  1LUV A;  2EIM B;  1YF2 A;  2UXC O;  1VF5 B;  2DN9 A;  1SET A;  3AG2 B;  4PV1 B;  2CTR A;  1SQV H;  4EKW A;  2PY5 A;  4BIZ A;  5CMU A;  1WN7 A;  5LA6 B;  1ZL8 B;  1ZLZ A;  2X6A A;  1CPY A;  1OCC C;  2HVK C;  4EFE A;  3CJH A;  2AGA A;  2Q7G A;  1K9M W;  4MVQ A;  3AG3 C;  4TQF A;  4J41 A;  1N33 B;  3UO2 A;  3WB0 A;  4P2Z A;  1R1B A;  1O9G A;  4KHP O;  2XND G;  4KFM A;  3W7U A;  1L1F A;  4UVB A;  1HWY A;  2JGU A;  3ABM C;  2ZIN A;  5CN0 A;  4KHP B;  4L8J A;  1ZSP A;  4HAM A;  3E8F A;  2E3C A;  5EK0 A;  3L72 H;  3OGC C;  1EM1 A;  5CA0 A;  1WA8 B;  4MTG A;  2UU9 O;  3JAR A;  5JCO C;  1N36 O;  1QR8 A;  1M90 W;  1NBM G;  5IT9 N;  4B3S O;  1R3I C;  4XDK A;  4EEQ A;  4PI0 A;  1THZ A;  3ZRS A;  2P90 A;  3SPJ A;  5LOV A;  2UU9 B;  1N36 B;  3M99 B;  1COW G;  1W59 A;  5JCO A;  3N27 A;  4X65 O;  1XNQ O;  2H94 A;  2ZT9 B;  4IHJ A;  1TGO A;  3J7A U;  4UCT A;  4X65 B;  3E2E A;  4JYB A;  2WLI B;  2EIJ C;  4FZ1 A;  3P32 A;  3I55 V;  1YVW A;  1AIL A;  4FLU A;  3CME V;  4RQE A;  2Q4P A;  2FB5 A;  4LF7 O;  3HKD A;  2HHH O;  3CCM V;  1HW7 A;  5LHI A;  4LF7 B;  5BMV B;  1K4D C;  1SRY A;  1CP9 A;  4G2K A;  1JJO A;  2QWQ B;  4W4L A;  4TV8 B;  4NTX A;  3D3I A;  1HNX O;  2ZXW B;  5B5E Z;  1PKX A;  2L35 A;  1W0K G;  1QBZ A;  4FJC C;  2JS3 A;  4I55 B;  5KUM A;  1BQZ A;  2XAF A;  4MTF A;  1PL4 A;  3CRA A;  5IJ9 B;  4MT8 A;  3LNN A;  1S77 D;  1HDJ A;  4PI2 A;  3ZCC A;  1H2S B;  1BE3 H;  3K03 A;  5FNV A;  2Q69 A;  4X1K A;  2EIN C;  4JI2 O;  3E8H A;  1GM7 A;  1AI4 A;  2DYR C;  1YJW V;  1F4M A;  4YJ2 B;  2Q7E A;  5IYC O;  4X1Y A;  4ABM A;  4JI5 O;  1N4C A;  4X66 O;  5EC1 C;  3H1K H;  3EFF K;  5EYP B;  2OCH A;  2EIL C;  1S76 D;  4X66 B;  3X2Q B;  3J80 N;  3HPL C;  2WLL A;  3U11 A;  4UV9 A;  1V54 B;  2QSA A;  2LQT A;  4MS2 A;  1IVS A;  5B3S C;  3OMI B;  5CA1 B;  2JJ2 G;  3BAA A;  4F4L A;  4FFB B;  1SQF A;  2JRI A;  4PJ0 Z;  1OCZ C;  4UVA A;  4YXW G;  2XAJ A;  4LNU B;  3UT5 B;  4EB6 B;  4OGQ B;  4ZOL B;  4MVS A;  3CCS V;  4FLX A;  4DV2 O;  3SGI A;  4FIP C;  1G8M A;  2P22 C;  1FAF A;  1Q43 A;  1L8D A;  4NXM O;  2CGN A;  4DV2 B;  3ASO C;  1SQG A;  1VAR A;  2RQ6 A;  2EUL A;  2BTQ A;  2LFR A;  1FFX A;  2CH7 A;  3D36 C;  2ATK C;  5ITZ B;  4H33 A;  4WBN B;  1KU9 A;  3FD9 A;  1VQ5 V;  1VP7 A;  3SYP A;  4TOI A;  3JAT B;  3C90 A;  1E79 G;  4U7N A;  2QM7 A;  1H2L A;  2HP8 A;  4DUY O;  5C8Y B;  2AZ2 A;  4WCE V;  1JMK C;  5B1N A;  2OIG A;  3K04 A;  3SPC A;  3I56 V;  1AI5 A;  3ZRW B;  2Z3Y A;  3CP1 A;  4J7J A;  2YEV A;  3JD2 A;  1Q81 W;  3B8N A;  2WA3 A;  3ABK C;  1Q86 W;  1U96 A;  3T1H O;  1BSM A;  3RVZ A;  4YIP A;  3WU2 Z;  5LMN B;  2QA4 V;  3IAY A;  4Q20 A;  3OEE G;  4ZI7 A;  5KHK A;  1GKF A;  3K0D A;  4I4T B;  2B1I A;  2P4V A;  2EJR A;  3FB8 C;  1PP9 H;  5H2F Z;  2E76 B;  5K1P A;  1K73 W;  4FM1 A;  4GT1 A;  4P9O A;  4H44 B;  2XHB A;  3SPH A;  3TGU H;  1MG1 A;  2ZQM A;  4LFC B;  4RWU A;  2DJV A;  4TV9 B;  5GON B;  2HJD A;  1VQP V;  1FXV A;  4MW8 A;  2WLI A;  4UUJ C;  1EZJ A;  3HKE B;  2G38 A;  1WB8 A;  4GUN A;  5KHJ A;  3LUT B;  1QLE C;  2EIK B;  2P4K A;  2F4V B;  1BHB A;  1SA0 A;  2BCC H;  4DV1 O;  1YIT V;  1KP2 A;  4OPH A;  5KHH A;  2B5U A;  3RYF B;  3L9D A;  1AR1 B;  3A2F A;  4ZHQ B;  1E1Q G;  1X4T A;  4CS4 A;  1J95 A;  2YIC A;  2Y4T A;  5KHG A;  2LJ2 A;  1PD3 A;  1Y66 A;  2QWR B;  1EN6 A;  3A8T A;  4DV3 O;  5HFL A;  1F51 A;  2Y69 B;  3CD6 V;  3G80 A;  4H37 A;  1BHA A;  4NKG B;  4DV3 B;  2JS5 A;  2XUM A;  3SJC C;  2HFE C;  3ZMV A;  4JI3 B;  4RUF A;  4JI8 O;  1JPX A;  3OR6 C;  3IFX A;  3RYC B;  1JA8 A;  2QM4 A;  4FVM A;  1IBL O;  3IJ4 A;  4JI8 B;  1GRJ A;  3H1H H;  2OYQ A;  2CDY A;  1RP3 B;  1FXH A;  3E35 A;  3EXA A;  1D5A A;  4JPR A;  5KMG A;  1IBL B;  5GW7 A;  4EFB A;  2Y0P A;  2EZO A;  1VQM V;  1OCR B;  1SQQ H;  4YJ2 A;  5TIS Z;  2EX3 A;  4JZG A;  3H1L H;  5J2T B;  2DYS B;  1PM9 A;  1QVG U;  3ZRV A;  4JI7 O;  5FPO A;  3BFR A;  2UUA B;  3KZI Z;  4I0X A;  2IH1 C;  4GX5 A;  1ROP A;  4NTY A;  1R6N A;  2A9H A;  3FYE B;  3GWO A;  1G4Y B;  5CA1 A;  3AG4 C;  1YXB A;  5B66 Z;  2UUB B;  2VQE O;  1Y4M A;  2IJH A;  5LYJ A;  3IC7 A;  1NS1 A;  2IM9 A;  4JV5 O;  3ABL C;  2ZE6 A;  3HKB B;  3K08 A;  4X20 B;  1PPJ H;  2VQE B;  4JV5 B;  2W6I G;  1I0H A;  3RGB A;  3ZJZ A;  3SPG A;  1VQO V;  2QWN B;  3SJB C;  3STZ C;  1VQN V;  3ZMT A;  1YJ9 V;  2VWJ A;  2IU3 A;  2DWE C;  5IYZ B;  3BHP A;  5B1O A;  2ADP A;  1T5E A;  3JAK B;  2BSK B;  2LGW A;  4K3A A;  1Q82 W;  3G67 A;  4DR3 B;  5LP6 C;  2ODM A;  4WFG A;  1IUR A;  2B9Z A;  3A0B Z;  3MAQ A;  4GKK O;  5E79 Z;  5IWA O;  3SDL A;  2M7W A;  2VQF B;  3TK1 A;  5LP6 A;  1XMO O;  1NU1 H;  4GYC B;  1EN4 A;  1V55 C;  5FPR A;  3SJA C;  5KA6 A;  1K7D A;  4X64 O;  1XMO B;  2PUS A;  1H2K A;  4YJ3 B;  5E1A C;  4LWS A;  5B1A C;  5LMU B;  4AHC A;  1Z5W A;  3B4S A;  1FXK C;  4X64 B;  5J9P C;  4JI0 O;  1NZ6 A;  2QWP B;  3WFV A;  4JI0 B;  1KP3 A;  4H0L B;  1FXK A;  4DV6 O;  2QEX V;  1N32 O;  2RNB A;  2DMX A;  4JI6 O;  1R6K A;  2X7R B;  2P5O A;  4GZR B;  4LH6 A;  2YID A;  3WG7 C;  5JWP A;  4DV6 B;  2KSD A;  1N32 B;  4DR4 B;  4JI6 B;  4IL6 Z;  3QF7 A;  1IBK B;  3KG2 A;  4JAA A;  4H13 B;  5JQG B;  3JAS B;  4GX2 A;  1Q6U A;  4J42 A;  5EBL C;  1RPR A;  2YXH A;  4GX1 A;  4PDM A;  4A5U B;  4LF6 O;  2IJI A;  2E74 B;  3OTO O;  3F5T A;  1VF7 A;  3OD4 A;  3CC2 V;  2Y48 A;  3ZHT A;  2H8P C;  4QGP A;  1KMI Z;  1NQT A;  4LF6 B;  5LBQ A;  1TA8 A;  2K9P A;  3SYQ A;  1AVM A;  3L71 H;  3D3Q A;  4C7U A;  3AG1 B;  3F5W C;  1O9H A;  2Q67 A;  4DW0 A;  4O4I A;  1V9P A;  2X6B A;  4LFB O;  3BA8 A;  4O4H B;  1S3J A;  1P7B A;  2QTS A;  4LFB B;  1XNR O;  1H8H G;  4HBN A;  4B3R B;  4CS2 A;  1FJG O;  4Z1M G;  1MA1 A;  4WFF A;  3T2M A;  2HVJ C;  4P30 A;  1XNR B;  3ZBH A;  2IH3 C;  3BPZ A;  3VQV A;  5KA5 A;  2OTJ V;  5B1B B;  2ADQ B;  1KB9 F;  2BOC C;  1QLN A;  2JGD A;  3RYH B;  2JDI G;  4LF9 B;  4J7Z A;  4W4K A;  2WWW A;  4K8Z A;  4O2A A;  4X1I B;  2WA4 A;  3RYC A;  1AJN A;  3L75 H;  1DTO A;  1N33 O;  2WLN A;  4O4J A;  4MTO A;  4RQF A;  2CK3 G;  2FTK A;  5JJE B;  3JD3 A;  1WB7 A;  4UCO A;  4FM0 A;  3ZED A;  2WLK A;  3TXS A;  4RO2 A;  4AQY B;  4N21 A;  2LO1 A;  5J2T A;  3OM3 B;  1YHQ V;  1Y76 B;  4DW1 A;  3DC6 A;  2AHY A;  3K9A A;  3P30 A;  1Q8I A;  2AZ0 A;  5D5P A;  1GMG A;  4UCV A;  4BWA A;  1IXM A;  5JJJ B;  1US6 A;  3CCE V;  3CCV V;  1P4R A;  1UFI A;  2HG5 C;  4JYA O;  5H6Q A;  1WJZ A;  1X59 A;  4DR1 B;  4JYA B;  4HZ3 A;  5D5Q A;  1Q6H A;  4MSW C;  2OCC B;  5EBW C;  2KG7 A;  3THO A;  3U10 A;  1GN6 A;  1XBL A;  4FMT A;  2ARH A;  5EZY B;  4JI4 B;  4FLZ A;  1M57 C;  3CCJ V;  4IYH A;  1S72 V;  1AI6 A;  4GKJ O;  5KLV H;  4LBE C;  3G6E V;  2N04 A;  2GTA A;  2ZE8 A;  4GKJ B;  3H1J H;  1GO3 F;  3G4S V;  3LSS A;  3M8A A;  1ARO P;  2ZDI C;  3ZHU A;  4DV0 O;  5CBG A;  4DUZ O;  1SZX A;  3CRR A;  5KUK A;  1BS3 A;  3BVO A;  4JI1 O;  1GM9 A;  1TUB A;  1QHT A;  2F66 C;  2DQ0 A;  4I5S A;  4DV0 B;  4DUZ B;  3E22 A;  2ZDI A;  1AJQ A;  2BTO A;  4JI1 B;  5CBF A;  1GN2 A;  1D5N A;  3BY6 A;  5IY5 C;  3T4D A;  1YJN V;  4HNA A;  1SF9 A;  4OXS A;  3O65 A;  4NTW A;  2MW2 B;  2RN9 A;  1YSC A;  5BZB A;  1D2D A;  2CAZ C;  3KCY A;  3P3P A;  4DV7 O;  2F1M A;  2IJK A;  4QE7 A;  4PA9 A;  5AG2 A;  4RUE A;  3EHB B;  3MDS A;  4DV7 B;  2XAH A;  2GUZ B;  1OV9 A;  3BA9 A;  1DF5 A;  2FL4 A;  3E83 A;  4AI8 A;  2BOB C;  2K1E A;  2PI5 A;  1WLE A;  3M7M X;  5JQG A;  1OCO B;  2XOK G;  3B8M A;  1K34 A;  5KAI Z;  2KQX A;  3QVN A;  4K0K O;  4MW3 A;  3CXC U;  1Q3E A;  2W0X A;  4UB8 Z;  4K0K B;  2HLD G;  4TT3 G;  2O57 A;  2KKW A;  3K5O A;  1JJ2 U;  1LR1 A;  4UV8 A;  4Z2W A;  2LW7 A;  1SES A;  1NVP B;  1TAE A;  4IYI A;  3AK3 A;  1Y67 A;  4WFE A;  3FX7 A;  1B3Q A;  3ASN B;  3Q4H A;  5IYB O;  5CB4 A;  5L3E A;  1FD9 A;  1DLB A;  3K0G A;  1TVK B;  3E8B A;  1XQ8 A;  3LSQ A;  2GTS A;  4LF4 O;  5JVD B;  2EIM C;  4CH3 A;  3AG2 C;  1XOU A;  4UCS A;  4LF4 B;  2ZKO A;  2LFS A;  4DV5 O;  3OMN B;  1ZX3 A;  4J11 A;  1SKV A;  2HKO A;  3K59 A;  4DR2 B;  3B40 A;  5LA6 A;  3AG7 A;  1ZL8 A;  1SS3 A;  4DV5 B;  4BW9 A;  2V1D A;  5JH7 B;  4I9Q A;  1UPG A;  1K97 A;  4F6R B;  2IJJ A;  4J9Y B;  1WAZ A;  2GV9 A;  2H3O A;  3P3N A;  2OTL V;  3STL C;  3OW2 U;  1CEZ A;  1KBH A;  2ZIO A;  4YHH B;  2QKC A;  1RPO A;  3K58 A;  5LMN O;  4LF5 O;  3T1Y B;  4PDR A;  1J5E O;  1PNL A;  2EJ7 A;  1S0V A;  4LF5 B;  4X8A A;  4JF3 A;  1F23 A;  5DN6 G;  1XI1 A;  3CEI A;  2OCC C;  4IIJ B;  3N2K B;  1J5E B;  1FFT B;  1JQ0 A;  1WA8 A;  2R9I A;  4I7Z B;  5L3G A;  4DRX B;  4XDJ A;  3AK1 A;  4R6Z A;  1NJI W;  2ZE5 A;  4LFC O;  1A32 A;  3W7S A;  3AK2 A;  4D7T A;  1FPO A;  1YDX A;  4ICG A;  3ZN1 A;  3UKM A;  1Y74 B;  2GBO A;  1I94 O;  2QM8 A;  1SQB H;  3ETE A;  2F4V O;  3UO3 A;  4I9W A;  1I94 B;  2NN4 A;  2JVD A;  4TSF G;  1NR7 A;  1Q6I A;  1ZAU A;  1R3L C;  2DW4 A;  2IU0 A;  2XAQ A;  3ZS8 C;  2PGG A;  1CXZ B;  3PJS K;  1ZWI C;  1OZ0 A;  4CH5 A;  3MD0 A;  5BMV A;  2ZXW C;  4B3T B;  4QNH B;  4X88 A;  4TV8 A;  1JX9 A;  3H9V A;  1NTK H;  4I50 B;  4B7E A;  3QG5 A;  2JIZ G;  2ZIM A;  4JI3 O;  2R72 A;  4LR3 A;  3H1I H;  3VQX A;  1RM1 B;  1VQ7 V;  4I55 A;  3NXS A;  1VIB A;  3IGA C;  4JGS A;  5IJ9 A;  3ZRX A;  2GDS A;  2ITC C;  1FYJ A;  4O4L B;  1MOF A;  4PA6 A;  3W7X A;  4ZBM A;  2PTM A;  5LGU A;  3G71 V;  3JYC A;  4DO2 A;  4LF8 B;  1KEC A;  1OCO C;  4WFH A;  2ZD9 A;  2AHZ A;  3CJH B;  4DK0 A;  4WFB V;  4PA7 A;  3X2Q C;  3T4Z A;  3APQ A;  2UUA O;  1NH2 D;  3ML0 A;  1V54 C;  2EBO A;  1OCC B;  5EYP A;  3FFQ A;  4HYO A;  1M4U A;  1GTO A;  1QCE A;  3AG3 B;  2A3Q A;  5CBH A;  5KX5 B;  2QJ1 A;  4JYY A;  2UUB O;  2HR3 A;  2PYL A;  5J2U B;  1JR9 A;  1K5Q A;  4FLW A;  3CHX A;  4PDL A;  4KL1 A;  5LHG A;  4FFB A;  3E89 A;  2ZNJ A;  4FLY A;  3UCS C;  4FLV A;  4Z1V A;  1FKA O;  3L74 H;  3OGI B;  1LUW A;  4LNU A;  4MVM A;  3UT5 A;  4EB6 A;  4ZOL A;  3DXR B;  2D3O W;  4MVU A;  3F7V C;  3JAR B;  3K5M A;  1PNK A;  3K57 A;  1PV0 A;  5IJ0 B;  1SZT A;  2F95 B;  4PHZ A;  3RYI B;  3FB7 C;  2NNU A;  5LOV B;  2Q73 A;  2YI8 A;  5FLX N;  1ENV A;  4DR3 O;  2OWO A;  5CA3 A;  2X0L A;  3R66 A;  4D7S A;  5ITZ A;  4FLT A;  4WBN A;  2Q0O C;  2E5L B;  3L73 H;  2VQF O;  1AJP A;  2N05 A;  1N34 B;  1IDS A;  3JAT A;  2BE3 A;  4MVO A;  3ETD A;  3ZMS A;  4LP8 A;  3HKD B;  3WB2 A;  5C8Y A;  5FL7 G;  2EIJ B;  4L87 A;  1VEW A;  1SC5 B;  2P6J A;  5BXZ A;  5BR8 O;  5LMU O;  4F6R A;  4QPJ A;  1XRE A;  4JTC B;  4PA3 A;  4CS3 A;  5BR8 B;  3ZRW A;  2ZCE A;  1YTF B;  3FAV B;  3JSL A;  2Q0A A;  4ZKI A;  2W0F C;  1YI2 V;  2QR4 A;  3T1C A;  4K8X A;  4QE9 A;  1G6U A;  1AP5 A;  1IBM B;  5L3F A;  4UFZ A;  3FYI B;  3ZHR A;  4DR4 O;  1KYO F;  2F93 B;  3C3S A;  3N2G B;  1IBK O;  3RVY A;  2DWD C;  2WPD G;  5IYD O;  4CH6 A;  4IIJ A;  3N2K A;  4I4T A;  4DXW A;  2QKA A;  2WLJ A;  2AW9 A;  3VQY A;  4TQD A;  3CRM A;  1AR4 A;  3HKC B;  5FNV B;  3SYA A;  1K5S A;  1NT2 B;  4X1K B;  4JTA B;  1TUE B;  1Z2G A;  2V4D A;  3FKS G;  1VQ9 V;  1QQC A;  1Y74 A;  4TV9 A;  5GON A;  3W7T A;  2EIN B;  1XEQ A;  2EIK C;  3SYC A;  1RSO B;  2DYR B;  4CZZ A;  1R73 A;  2FML A;  2UUC O;  3TET A;  2LW1 A;  3HKE A;  5L3C A;  4DR6 B;  2WLL B;  2UUC B;  4B3R O;  1M93 A;  1L0L H;  5LGT A;  1F4N A;  1MAB G;  3L70 H;  1DF4 A;  1IZ3 A;  2EIL B;  3RYF A;  1RFY A;  4JAV A;  4ZHQ A;  1B06 A;  3WB1 A;  3CS5 A;  2Y69 C;  3SPI A;  2A0L A;  3HB3 B;  2N74 A;  3RW0 A;  4XDL A;  2YIA A;  2YDE A;  4CC6 A;  5B3S B;  3O9O A;  1EFR G;  2QDO A;  3OTF A;  4TUY B;  3JAW B;  4LF9 O;  1QVF U;  1OCZ B;  4UCU A;  3BEH A;  3DGE A;  1XUQ A;  2C2A A;  2LGQ A;  3ZHS A;  4E2L A;  3CRQ A;  1FFX B;  2CH7 B;  5C93 A;  5KAF Z;  1MSD A;  1PNM A;  2R9R B;  2P06 A;  2QTO A;  5IE9 A;  1OCR C;  4O4L A;  4G28 B;  1OJH A;  3U0Z A;  4AQY O;  1ZUQ A;  2DOS A;  3A0R A;  2DYS C;  2Q6A A;  2JEX A;  1E1R G;  2UXC B;  1BGY H;  2YIB A;  1EZV H;  2M6Y A;  3FB5 C;  1G1X B;  2ETN A;  1W2B U;  5EC2 C;  1N8R W;  1UJW B;  1I7F A;  4QIW F;  2YEV B;  5LHH A;  4DR1 O;  3QNE A;  3JD1 A;  5KX5 A;  1XMQ O;  1URF A;  4ZIB A;  5J2U A;  1NVP D;  4JI4 O;  1XMQ B;  5GTH Z;  3ABK B;  4UVC A;  3JAL B;  5KHI A;  1VQL V;  3HKB A;  4ZI7 B;  2CGO A;  1NKD A;  4X20 A;  3DXR A;  2ZNI A;  5IJ0 A;  4O2B B;  3RYI A;  2PF4 E;  2JEU A;  2CTQ A;  2YC0 A;  1VQ6 V;  1AI7 A;  4B3S B;  3B77 A;  1P7G A;  2VS0 A;  1LNQ A;  5H9C A;  5IYZ A;  4LC1 A;  3JAK A;  2BSK A;  2VWK A;  1XNQ B;  1P49 A;  1M9N A;  4BIO A;  3KKY A;  1K92 A;  2CTW A;  1XL6 A;  1SA0 B;  2WSS G;  4K35 A;  3CXH F;  3VOU A;  4NB5 A;  3DTU B;  2Q9L A;  2XAG A;  1NTZ H;  3H01 A;  4GLX A;  5HFM A;  1JFF B;  3ZMZ A;  2A79 B;  1JCH A;  1QLE B;  2Q7H A;  5DEC A;  2HHH B;  1KD1 W;  1Z5V A;  4YJ3 A;  1NR1 A;  2QWO B;  5EIB C;  1I5X A;  3QO7 A;  4DYL A;  3FAV A;  4X9Q A;  4J10 A;  1L0N H;  1NI8 A;  1PL0 A;  3VQW A;  1Y6X A;  4BW5 A;  1HNX B;  3RWR D;  2FKX A;  1ORQ C;  2FYU H;  2Y0I A;  4U7O A;  3JAM N;  4CC5 A;  3N2G A;  3JD0 A;  4B08 A;  2HEP A;  1GN4 A;  3PN1 A;  1AR5 A;  2ITD C;  5H6R A;  2UXB O;  1JVM A;  3JAS A;  3ICX A;  5KMG B;  2GHY A;  3ZIA G;  3HKC A;  1NTM H;  2UXB B;  2XAS A;  4FPP A;  3MHS C;  3LDD A;  3AG1 C;  3CWB H;  1H8E G;  3OMA B;  1R6T A;  4R8C A;  3S3X A;  4JI2 B;  2WAM A;  2LP7 A;  1RSO A;  3CSX A;  3ETG A;  3K3W A;  2ZM6 O;  4MVR A;  4YY3 O;  2PYJ A;  3G6B A;  4P9P A;  5DED A;  2ZM6 B;  1OHH G;  4JI5 B;  1GK9 A;  4YY3 B;  4I0X B;  2JK5 C;  4O4H A;  5LL6 Y;  3NR7 A;  3MHH C;  1SQP H;  2WLM A;  1GAX A;  5B1B C;  1R3K C;  5LYJ B;  1KUQ A;  4PA4 A;  2YUA A;  1KQS U;  1QR9 A;  4E4E A;  1WPB A;  5L3D A;  3AG4 B;  4YIO A;  4BAY A;  4TUY A;  3JAW A;  1XHZ A;  4DR2 O;  1BMF G;  3ABL B;  4PEL A;  3RYH A;  1H38 A;  1EN5 A;  3TJT A;  1P84 F;  3K9S A;  1VQ4 V;  2RCV A;  3EVK A;  2X6C A;  3OAA G;  2Q5Z A;  1XL4 A;  4X1I A;  4NXM B;  4FZ0 A;  3CCR V;  5DM6 V;  3UQ8 A;  2Z0A A;  3TXQ A;  2GSM B;  2B1G A;  4FM2 A;  4FK5 C;  3CPW U;  1Q5O A;  2XTA A;  1YCI A;  2YIB D;  4R7C A;  5L3B A;  4YHH O;  3D36 A;  3OEH G;  2AXT Z;  1KC8 W;  1QNM A;  3K06 A;  3HR0 A;  4IGG A;  2IBZ H;  1M5I A;  5LP6 B;  4JAS A;  3T1Y O;  1GH6 A;  3CB2 A;  4DUY B;  1JOY A;  3BAB A;  1N0N A;  4Q6G A;  3CCU V;  1Y76 A;  1WNS A;  4KXR A;  4LWS B;  3RBZ A;  3SYO A;  1IXB A;  3K79 A;  3J81 N;  1H2M A;  1V55 B;  2A7W A;  1XIL A;  3JD4 A;  2Y4U A;  3A0H Z;  1M56 B;  5B1A B;  4JZ2 A;  1R3J C;  4MTX A;  1FXK B;  3T1H B;  3ZX6 A;  2A06 H;  3VBB A;  1K33 A;  3JAL A;  3JSN A;  5JJN B;  5EBM C;  5EZY A;  3CRC A;  5F2V O;  4LFA O;  1VQK V;  2YS8 A;  3I5D A;  3KCX A;  4DV4 O;  3C3T A;  1B04 A;  4WFA V;  1DK1 A;  4LFA B;  3WG7 B;  3SR2 C;  2NLJ C;  2OT5 A;  4O2B A;  4DV4 B;  4MVZ A;  2DQ3 A;  5LGN A;  4DR7 O;  4GCZ A;  2NR5 A;  2RJZ A;  4B3T O;  1QU7 A;  4DR7 B;  3CMA V;  3B09 A;  3OUS A;  3K5L A;  2Q8V A;  2XT9 A;  4KP4 A;  1AB3 A;  4O4I B;  1S5J A;  1SER A;  1K8A W;  3LNM B;  4KUM A;  3GWK C;  4LH7 A;  3SJQ C;  3JCZ A;  3CC7 V;  3ZN0 A;  2YI9 A;  5LXT B;  1I08 A;  2R9A A;  2KB1 A;  2F23 A;  1M1K W;  2W6J G;  1EBO A;  1JFF A;  3S3W A;  4DV1 B;  1YTF D;  1GN3 A;  3IC9 A;  3OR7 C;  2YXY A;  1GM8 A;  4U3J B;  5EIB D;  4UXN A;  1F7Y A;  3F7Y C;  4R50 A;  2JGD B;  5BY1 A;  4LF8 O;  3APO A;  5K1X A;  4UB6 Z;  3RFR A;  3OUF A;  3JCU Z;  2GUZ A;  4J9Z B;  4NR1 A;  1KKD A;  3ABT A;  4O2A B;  3ZHV A;  3ETQ A;  4NVP A;  2P67 A;  2ILM A;  1MZE A;  4UCR A;  4O4J B;  3OFN G;  3GVM A;  2UXN A;  3CYO A;  2QE7 G;  4OPA A;  4DK1 A;  1KKC A;  1XHX A;  3E86 A;  4CBC A;  1ZTE A;  3CC4 V;  1SQX H;  1Q7Y W;  1BL8 A; 
#chains in the Genus database with same CATH homology
 1GAX A;  2LW1 A;  1IVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...