2LW1A

The c-terminal domain of the uup protein is a dna-binding coiled coil motif
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
85
structure length
85
Chain Sequence
KAETVKRSSSKLSYKLQRELEQLPQLLEDLEAKLEALQTQVADASFFSQPHEQTQKVLADMAAAEQELEQAFERWEYLEALKNGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The C-terminal domain of the Uup protein is a DNA-binding coiled coil motif.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords ABC transporter ATP-binding protein uup
total genus 32
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16326 ABC_tran_CTD ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.380 Mainly Alpha Orthogonal Bundle Helix Hairpins Valyl-tRNA synthetase, C-terminal domain 2lw1A00
2LW1A 1IVSA 1GAXA
chains in the Genus database with same CATH superfamily
4PD4F 3UO3A 3AG7A 2UU9B 5JCOA 2Q7GA 5J2TA 1YZBA 1CEZA 1TA8A 4RUEA 3PN1A 4LFAB 4ZOLA 2HR3A 1L1FA 2DQ0A 2ADQB 3BA9A 4W4LA 3ZJZA 4TV8A 2JS3A 1KP3A 2GBOA 2AXTZ 4U3FH 3JD1A 4F4LA 1AJPA 5EC2C 1EZVH 5IJ0B 4I50B 1O9HA 2B1IA 4J7KA 4K3AA 4DR1B 2CTRA 2P22C 2Z3YA 1FJGB 2EULA 4JYCA 4AHCA 2FB5A 4JI3O 1N33O 1R3KC 2X6BA 4X1YB 1YCIA 4U7NA 1K5SA 1SA0A 3AG1C 4Z2WA 4WFHA 4DV6B 1AJQA 1Q5OA 1GN6A 4MT8A 4B3RB 4JAVA 4TWKA 1E1RG 1SESA 5B3SB 1NTMH 4CS2A 5FPRA 4YJ2A 4B3TO 5IY5B 2ZM6O 4FZ1A 4LF9O 3SYCA 1T5EA 3SYOA 4JV5B 2IJHA 1XDCA 1G4YB 3G6BA 4O4JB 1OCRB 3JATA 2QEXV 1KUQA 1ZAUA 4BAYA 1GN2A 4B3MB 3EVKA 2E75B 3UO2A 1N0JA 4GKKB 1P7BA 3SYQA 3I55V 4LF6O 2BTQB 1Y6XA 1G1XB 4MW3A 1UPGA 2FTKA 3M99B 5B5EZ 4JI2O 4BIUA 1NJIW 4F6EA 1SS3A 3K5LA 5CB4B 3EXAA 1L0LH 4PI2A 3ASOB 4FLXA 3UT5B 4ZBMA 1DGSA 4DV7O 5J2TB 3JSNA 3H1LH 3KCXA 5A9GA 3JYCA 3WB2A 1SQXH 4DV4B 1RPRA 1KB9F 1Z5WA 1WPBA 5LXTA 2IJJA 1JCHA 3H1IH 1WAZA 3K5NA 4NXNB 4UB6Z 3SPJA 1P84F 1SQGA 2WSSG 4RAIA 4C7UA 2VWJA 1QU7A 4DV5O 1IDSA 3CS5A 2V1DA 1WP8A 1BGYH 3CE2A 2Q0AA 4KUMA 3JD3A 1YVWA 1TUEB 1OCRC 1IVSA 1SQFA 2QSAA 3AG2B 1AJNA 1VQ5V 1FXKB 4GKJO 1IBLB 1JOYA 2Q9LA 1V54B 3F5WC 4TUYB 2CGNA 4K35A 3OR7C 2WLIA 1K4CC 2Y48A 3OTOO 3H1KH 3OD4A 1PM9A 5GW7A 5EYPB 1NR7A 3E8GA 4DUZO 2HFEC 1K73W 1NQTA 1FYJA 1RP3B 4X20B 4LH6A 5FNVB 1G6UA 4E4EA 3OM3B 4DR6B 1AI4A 4I55B 2CAZC 2ZNIA 4LF4O 1SQPH 4GX5A 1W59A 4X65B 1XMQO 2WLNA 4LP8A 4MVOA 4X66B 4JI5B 2K1EA 3HR0A 4NTYA 4JYAB 4X8AA 5KAFZ 2V4DA 3E35A 3HKCA 4JTCB 1VQPV 1VF5B 3HB3B 1SF9A 3ABMB 4DR4O 4HAMA 1M5IA 3IJ4A 5C8YA 4MVRA 1SERA 3J81N 4BWAA 2OCCC 2RDCA 2QA4V 2DOSA 1JJOA 1I5XA 4IHJB 2ZNJA 1R3IC 2YICA 3HKBB 4QJFB 5H6QA 3FKSG 2ZE7A 2AGAA 2UUCB 1YTFB 3QO7A 2QWPB 2Y4UA 3QO8A 1OCCB 3L74H 5E1AC 4JI2B 3C3TA 1B06A 4LCUC 2YC0A 4PV1B 3GVMA 2W6IG 4PDRA 5BR8B 4J42A 4X1IB 4HNAA 2DYSB 2PZSA 2YSUB 1D5AA 1Y66A 5LXTB 4DUYB 2OT5A 5JWPA 2ZE8A 4JI1B 2OTLV 2QKSA 3CC7V 4CH5A 4FZ0A 4JTAB 2ZDIC 1JVMA 5LMUO 1FAFA 4TQDA 4WFBV 4LNUA 4AQYO 1XHXA 1HNWB 1V55C 3ABKB 3ZS8C 4G2KA 4KP4A 2BE3A 2OWOA 3EHBB 4LF4B 4A5UB 2UXXA 3FAVA 5IYCO 4UB8Z 2X6AA 2Q7HA 2ZIMA 3LUTB 5ITZA 1MABG 2XOKG 1GN3A 3MHHC 5LBQA 1S76D 3BCCH 4IYIA 3W7XA 1PL4A 2VQEB 4W4KA 1Y76A 1GKFA 3I5DA 2W0FC 5FLXN 5EYPA 1Z5VA 2UXBB 4O4IB 3ZRWB 4X20A 2PI4A 2ZT9B 1YI2V 1BHBA 3NXSA 4FLYA 3CCLV 4O4HB 2KQXA 3BABA 2F1MA 3RYHB 1JFFA 4U3JB 4X64B 2FL4A 1PNMA 4B3MO 1NZ6A 4X62O 2HG5C 4FMTA 2QM7A 2R9RB 5JH7A 4I50A 5E79Z 2DMXA 3ETGA 1YJ9V 5K1PA 1H2SB 5H6RA 2LW1A 3MAQA 3JALB 2Q0OC 4MVSA 2Q7EA 3CD6V 3AK1A 4PDVA 4UV8A 2F23A 2JEUA 2IJIA 1K8AW 4I0XA 2P67A 3CHXA 4DR7O 1ORQC 1TGOA 3HKBA 5IJ9A 2CDYA 3RBZA 2EX3A 3QF7A 1F7YA 1XILA 1YEWA 2NLJC 2BSKA 1QVFU 1OV9A 3UKMA 1BCCH 2B5UA 3AG4B 4X65O 3T1YB 1Q6HA 5IT9N 2XAQA 3BEHA 3E8FA 4NXNO 4BIOA 3B09A 1S5JA 1L8DA 1GH6A 3B77A 1PKXA 2ZR2A 2Z5UA 1HR0O 4HYOA 4DV2B 1N34B 1BMFG 1Q8IA 5ITZB 1Y74A 3CRQA 5B1AC 1AB3A 3ABTA 1QR9A 3U0ZA 2F43G 1TVKB 2W6JG 1QHTA 4PDMA 3ETDA 3W7SA 3DXRA 1HDJA 2A7WA 5L3DA 5B1AB 1YJWV 1N34O 1Q90D 1SQQH 1K4DC 3G80A 2QE7G 4DV3B 1D2DA 1V55B 3ABKC 1E1QG 4TOIA 1KKDA 4B3RO 2ZIOA 3OT7A 3ZIAG 3K03A 2NN4A 2X0LA 4DR4B 3QNEA 3E89A 4J9ZB 2BTQA 3C90A 2DE0X 4X1KB 5EIBC 3BVOA 3OEEG 2C2AA 4JI1O 3X2QC 3CC4V 1BHAA 4R50A 2Z0AA 1IBMB 3MDSA 1KQSU 3CP1A 4H33A 1R6KA 4KL1A 3C3SA 5EIBD 3ZRSA 4DR5O 2OIGA 2R70A 2Y69C 3ASNB 4NKGB 2PTMA 4O4HA 1GM9A 2XAJA 4DW0A 5HFMA 4D7TA 1VQKV 3VQYA 3HKDA 1RPOA 3L73H 1NVPB 4UCTA 3HKEB 5CA0B 2ZE5A 5EBLC 2CH7B 1XOUA 3DC5A 1J5EO 2N04A 4GCZA 3JARA 1XNRO 4NTWA 5DM6V 1XL4A 2ITCC 2JDIG 4WFGA 5A2QN 1Q86W 3F7YC 1JPXA 1WPXA 1GTOA 5LMNB 4RQEA 3VQVA 1U97A 5IYZA 2UXCB 3H01A 3SYAA 1Q6IA 1FS0G 1EN6A 5B1BB 2WLIB 4JI0O 4DV1B 2EIJC 4DR3B 1IZ3A 5B1NA 1VEWA 3SPHA 4LBEC 1RM1C 3ETEA 3H1HH 3QO5A 1X59A 1QCEA 1NVPD 4J7ZA 1OCOB 3AEIA 4XBFA 3RFRA 4JAAA 2VS0A 3A0BZ 2GHYA 2DN9A 4R6ZA 4LR3A 3K0DA 2BCCH 3S3WA 4EB6A 3JCUZ 1R73A 2LQTA 3CXHF 3E8BA 5KA5A 1ZSPA 3P3NA 1VQ4V 2BOBC 5JVDB 3GB7C 1DTOA 2GUZB 3P32A 2DJVA 4P9PA 3Q4HB 5JJEB 4UCSA 1B3QA 4HNAB 2LP7A 2YEVA 3CWBH 2JK5C 2ILMA 1SA0B 4JPRA 1S77D 3K0GA 4R7CA 2Y0IA 1VQLV 3HKDB 1FKAO 4QIWF 3K3WA 3ZMZA 3SPGA 2A06H 1B04A 1WB7A 2YDEA 1VF6A 2BTOA 2IJKA 2QR4A 1KBHA 4TQFA 5BMVA 2XTAA 4YJ2B 2CTPA 3ZN1A 3R65A 4LF8B 4GX2A 1J95A 1XBLA 1S3JA 3BFRA 4QGPA 3E86A 2YIDA 5KX5A 4MVUA 2P90A 1M57C 3U10A 5IE9A 3VQXA 4O4JA 2E5LB 4TV8B 4NB5A 4NYKA 1VQ9V 1FJGO 3G71V 2YIBD 3CRMA 2H8PC 2Q73A 4UCRA 1GM8A 1QBZA 4CS3A 2EZPA 1PD3A 5B3SC 1N33B 1XEQA 4PA7A 3SJCC 5CA3A 1V9PA 2D3OW 2Q6AA 1JX9A 3N2KA 4LF5O 5HFLA 1WA8A 1OCZC 3QTCA 1TAEA 2EIJB 4B3TB 5LGNA 1MZFA 4PJ0Z 1SZTA 2RQ6A 1OCZB 3UT5A 5IYBO 4YY3B 1XI1A 3MHSC 3ETQA 1M56C 4GYCB 3BY6A 2JRIA 3CCSV 1QLEB 3TXQA 3JAKB 1DF5A 1NI8A 5FPOA 2X6CA 3U11A 1LUWA 3RW0A 4Q20A 1BE3H 4RQFA 2YI9A 3AG2C 3DC6A 4TV9A 3LDEA 3K58A 1H8EG 3ZRWA 4PA6A 4JYYA 3QG5A 2UXDO 2OTJV 1F4MA 2FYUH 5J9PC 4WBNB 3HPLC 4CZZA 2QM8A 1VMGA 2F4VO 5KHIA 1O9GA 3Q4HA 1JJ2U 1MSWD 4FLWA 3AK3A 1WB8A 3ICXA 3OMNB 2P7TC 3IC9A 4U3JA 4DV1O 1WJZA 4JI0B 3J80N 3PJSK 3P3PA 3CCQV 5LMNO 4WFFA 2MK3A 1XUQA 1YF2A 1HR0B 3ABLB 4H44B 1CXZB 1N36B 4IIJB 3JAWA 2RN9A 3T4ZA 4YIPA 4K0KO 5FL7G 3FD9A 3FB7C 1IX9A 2ZD9A 1N8RW 3SPIA 4UFZA 3APOA 3WFVA 2ZDIA 2YXYA 3CCJV 2Q68A 2WLLA 4IL6Z 3WG7B 5B1OA 2ZKOA 4I5SA 4B7EA 3FB6C 4KXRA 3ZMTA 4LFAO 3AG3C 3L75H 5D5PA 1W2BU 1MNGA 5LP6C 1PNLA 3H1JH 3CEIA 5DECA 4EEQA 4MS2A 3ML0A 2X7RB 4YXWG 1EFRG 4I4TB 3ABUA 3IC7A 1NU1H 5CMUA 1JA8A 4ABMA 3CRAA 2HLDG 4LH7A 1I7FA 3WU2Z 1M56B 1CPYA 3DTUB 4OGQB 4DK1A 1NH2D 2IM9A 3L72H 2LGQA 1Q7YW 2ADPA 2F4VB 1N32B 5KMGB 2EJRA 2UXCO 3SGIA 5AG2A 3CC2V 1XMQB 2UUBB 4GZRB 4K8XA 1SETA 3E83A 3UM7A 2Q4PA 1K5QA 4I55A 4D7SA 4AI8A 3WG7C 2KB1A 3RYCA 2UUAO 4MTFA 5KA6A 4JTDB 1N36O 3DGEA 2A9HA 4ZHQB 2HKOA 1VQNV 2GSMB 4LF7B 3D3QA 1M93A 4F6RB 1BS3A 3M8AA 5L3BA 3A8TA 4IGGA 1DLBA 2XHBA 2HVKC 1AP6A 2KSDA 5C8YB 2K9PA 2OYQA 5JQGA 3NR7A 1WN7A 4X1IA 3TK1A 2UU9O 2A0LA 3QVNA 4PA9A 1R1BA 4TT3G 4B7KA 4L8JA 5LYJA 2E5LO 2WLKA 4JV5O 1MSDA 1ENVA 1CP9A 3K5OA 2XT9A 5LHGA 1Q6UA 3EFFK 2M7WA 1KECA 4UVAA 2OCHA 3K08A 3OFNG 4OPAA 3W7UA 1Y76B 3K9SA 2A79B 4X1YA 4MTXA 2Q5ZA 1NR1A 5IDJA 3THOA 2JIZG 4FLZA 3B40A 1MMMA 3FB8C 4FLTA 3D8CA 3OEHG 3N2GB 5CN0A 1B6QA 3O65A 3ZMSA 1BQ0A 3VOUA 3W7WA 3CPWU 2WLLB 3FFQA 3RYFB 2L6LA 4I4TA 4FFBB 1JMKC 5J2UB 2AW9A 3CJHA 3FX7A 4EB6B 4UCOA 3SJQC 1FXKC 3ZHSA 2EIMC 2VRZA 2IH1C 2BOCC 1HWYA 2HP8A 3F7VC 4AILC 4LC1A 3SR2C 1Q82W 1BQZA 3ZBHA 1GK9A 1L0NH 1M90W 1F4NA 3BHPA 3T2MA 1XNQB 1PPJH 5EZYA 2UXBO 1XQ8A 1XNRB 2YEVB 2CTWA 1NTZH 2YXLA 3N27A 3OAAG 4JZGA 2EIMB 3FYEB 2P4KA 1K7DA 4DUYO 4X9QA 3APQA 1AVMA 4B3SO 1ZLZA 2HJFC 1VQMV 2XAGA 1VP7A 4DR6O 2N05A 3ZMVA 2KKWA 2EINB 3LSQA 4FLVA 4YHHB 3JD2A 3A0HZ 2CUGA 1P4RA 2D2CB 4FFKA 3J7AU 4X66O 1Q3EA 1AR4A 4DYLA 4FPPA 4AQYB 3T1CA 1N32O 4J9YB 5GONA 4JI8O 3AK2A 3ABMC 4I7ZB 3ZHRA 5H5NA 4TUYA 4EFEA 3JALA 2P5OA 4DR7B 2NR5A 2ZXWB 4OX9O 5LHIA 3STLC 4JASA 3TETA 5LP6B 1FPOA 3JD4A 4I0XB 3DSQA 4KHPO 5CBGA 4UVBA 4JI8B 2ATKC 2VQEO 5IY5C 3TJTA 2N74A 2CGOA 2E76B 4G27B 4GX0A 1QLNA 5J2UA 4CH4A 2R72A 3LNNA 4O4LA 1ZL8B 3SJAC 1PL0A 1AR1B 4DV4O 1KP2A 3OGCC 2PI5A 3RVZA 3E2EA 2WLMA 5LOVA 1IBKB 1GO3F 2ARHA 1WA8B 1ZTEA 3OMIB 1OZ0A 2RCVA 1S5LZ 2EIKB 2LGWA 2EINC 1BSMA 2JGUA 3TGUH 2ZM6B 2W0XA 2DQ3A 2QKCA 1H2NA 3ZEDA 1P49A 4LFBO 2HEPA 4QE9A 3JASB 4QPKA 3ZMUA 3STZC 1DF4A 4ZI7A 4J11A 3T1YO 1VQOV 3DXRB 3O9OA 1VF7A 4LFBB 2P06A 3RVYA 4WCEV 2A3QA 1YJNV 4UXNA 2F93B 3G4SV 4DR2B 2CK3G 5BR8O 3KG2A 2EIKC 4BW9A 4IT5A 1W0JG 3RT3C 2IBZH 5B66Z 3OUSA 4JI7O 4CH3A 5KLVH 1URFA 3RYIA 4QE7A 3SPCA 4CBCA 3ZHTA 5KUKA 1R6NA 1P7GA 4UCUA 1LR1A 2EILB 1VQ8V 4XDKA 1H2LA 5LHHA 3IAYA 2XASA 4NXMO 4KHPB 3JAWB 2GDSA 3CCUV 1JQ0A 1EN4A 2B9ZA 4PDLA 3S3XA 4MTOA 1ROPA 3CCVV 1K97A 4WFAV 1FXVA 4PI0A 1N0NA 1TUBB 4JI5O 1YXBA 4O2AA 3RWRD 3RN4A 4LF9B 1IBMO 2CTQA 4B3SB 3G6EV 3HKEA 5CA0A 1UFIA 5LGTA 2UUCO 4FIPC 2WA3A 1PNKA 1R3LC 4N23A 3D36C 3SDLA 1Q81W 1K34A 4PELA 2EJ7A 1AR5A 4QPJA 5L3FA 3OUFA 1XMOO 4HBNA 5EK0A 2KG7A 2HVJC 3B8NA 1YHQV 2WLJA 1LNQA 4P30A 1MOFA 4CH6A 1VF6C 4JYAO 5IYZB 1DK1A 4YJ3A 5L3CA 1H2MA 4J10A 2P6JA 3JSLA 3KZIZ 4O4LB 3KKYA 2OIEA 4B08A 4EKWA 3RYHA 1THZA 5EBWC 3FYIB 1Z2GA 4RUFA 1Y4MA 5D5QA 4K0KB 1NT2B 3JATB 4FVMA 4MVZA 4GUNA 1BT8A 3E8HA 4OPHA 2F66C 5TISZ 5JVDA 1HNXO 3OR6C 4KFMA 2DYSC 3CCEV 2UXNA 1YTFD 4MVQA 5L3EA 2HJDA 4ASUG 3OMAB 1YIJV 4JZ2A 1D5NA 3RYIB 5C93A 2QWOB 2RMKB 4ZKIA 2JS5A 4IYHA 4K8ZA 5CBFA 3I56V 1XHZA 2M6YA 3G67A 1LUVA 3CCRV 4JI4O 2PF4E 2H3OA 5JH7B 2XNDG 3T1HO 2VWKA 4MSWC 3E22B 4X64O 2BSKB 5BMVB 3LSSA 3H9VA 2PY5A 4DRXA 4J41A 1SKVA 1HP8A 3N2KB 4DV2O 3T1HB 2FKXA 4FM1A 4JYBA 2ODMA 1TUBA 4JI4B 3KCYA 4H0LB 1KKCA 5LYJB 3L71H 3LDDA 4X89A 1RSOA 2AHYA 3RYFA 4DW1A 2EBOA 3W7TA 3OGIB 1FXKA 2Y4TA 2WA4A 1VARA 1I94B 1XNQO 2QWQB 1S72V 3MD0A 4DV0B 3JAMN 1YDXA 2UUAB 4O2BB 1YSCA 4N21A 4MVMA 1GM7A 4RWUA 1MG1A 2Q67A 1NH2B 1KMIZ 4DR5B 3ZHVA 1GAXA 5K1XA 3CX5F 3D36A 4JAUA 2HHHO 1BL8A 2LO1A 4XDLA 5IWAB 4UVCA 1Y74B 3K5MA 4LF5B 5KAIZ 3CJHB 1AI6A 3K57A 4X1KA 2H94A 1K3EA 2GTAA 4MW8A 1IBLO 3L9DA 3RGBA 4E2LA 3K9AA 2KG7B 5FNVA 2DW4A 3HKCB 5LMUB 3R66A 1HNZO 3BPZA 2VQFB 1QNMA 2MW2B 4YJ3B 2ZR3A 3AG4C 2XUMA 4Z1VA 4LF8O 5BY1A 5KHJA 5BXZA 2RJZA 5BZBA 1HNWO 1COWG 1R6TA 1VQ6V 2NNUA 3B8MA 3UQ8A 4GT1A 5KHHA 1QLEC 3ZRVA 4FM0A 1VIBA 2LW7A 4YHHO 1EZJA 1HNZB 2QGNA 2IW5A 3BA8A 3ZHUA 2ZQMA 1M4UA 4ICGA 4X62B 4BIZA 4J7JA 5LP6A 1GN4A 1OHHG 1W0KG 3CYOA 4IHJA 4HZ3A 4DR2O 4LF7O 4UCVA 5KUMA 1KYOF 1SQBH 5GONB 3E22A 1QQCA 3GWKC 4DV5B 3B4SA 1FXHA 1US6A 4IIJA 4ZIBA 3CB2A 1ZL8A 3CMAV 1XL6A 5CBHA 4Q6GA 2UUBO 3LSUA 3K79A 1G8MA 5GTIZ 5LOVB 4GLXA 4R8CA 1WLEA 4WF9V 1IXMA 4H37A 3VQWA 5IYDO 4GX1A 5EC1C 3ASOC 2YUAA 3D3IA 4CS4A 2ITDC 1XMOB 3K04A 2DWDC 2QTSA 1IBKO 2LJ2A 2PGGA 1U96A 2PYLA 1UJWB 3ZRXA 1EN5A 5CA1B 1AILA 1FFTB 2DYRB 3IFXA 4O2BA 2WLHA 5CB4A 2P4VA 4O4IA 5KMGA 3ASNC 4MTGA 1QVGU 4P2ZA 3A0RA 3CRRA 4G28B 1M1KW 1H8HG 2LFSA 4DR1O 1KD1W 5B1BC 1HNXB 4DV3O 2QKAA 5LA6B 4L87A 1I94O 1GMGA 3K59A 3RYCB 2G38A 3X2QB 1F51A 4ZHQA 1H2GA 1ZX3A 4BR6A 5L3GA 4PA3A 4DR3O 2YI8A 3WB1A 4F6RA 4LFCB 3B2EE 1MZEA 1AI7A 2DYRC 2R9IA 2LFRA 1A32A 1MA1A 2JJ1G 1K33A 5KX5B 3SYPA 2EZOA 4X88A 1KC8W 1JFFB 5GTHZ 2E3CA 3N2GA 1GRJA 1RM1B 4LFCO 5JJNB 5IJ9B 4TSFG 3OTFA 3JCZA 2ZINA 5KHGA 5KHKA 1IURA 4FFBA 4DV7B 2UXDB 3OE7G 2YXHA 4XDJA 2AZ2A 1Q43A 5DEDA 2QDOA 1SZXA 4JI6O 1K92A 4GKKO 4UV9A 5JQGB 1F23A 2AZ0A 1SRYA 2E74B 2FMLA 4O2AB 2IH3C 5JJJB 1AP5A 1XREA 2IU3A 4J80A 1SQVH 4FJCC 5H9CA 1R3JC 4P9OA 4LWSB 1HW7A 1NKDA 5IWAO 2OCCB 4I9QA 1TVKA 1FFXA 4DUZB 4D6TH 2CE4A 2QM4A 1YITV 1EBOA 2YS8A 1I5YA 4DXWA 4TV9B 2L35A 2Y0PA 2JEXA 4OXSA 2JJ2G 3ZHQA 2YIBA 4GKJB 2B1GA 1K9MW 3LDCA 3ZN0A 3JD0A 4WBNA 3CXCU 1PV0A 2XAHA 4NXMB 2JGDB 2QWRB 1OJHA 2EILC 2PUSA 3GWOA 5EBMC 1KU9A 3JAKA 2O57A 4DO2A 5JCOC 4PA4A 1V54C 4NVPA 1N4CA 4YY3O 2ZCEA 2DWEC 3CRCA 5CA1A 3L70H 1OCOC 3CCMV 2HHHB 3AG1B 5IJ0A 1QR8A 4NR1A 4YIOA 1Y67A 2XAFA 3M7MX 1SC5B 4U7OA 3K06A 4QNHB 1WNSA 3LNMB 4FLUA 4ZOLB 5EZYB 2GTSA 2ZE6A 5LA6A 2QJ1A 2V7QG 4JGSA 1ZWIC 2R9AA 3T4DA 1VQ7V 1NS1A 1NBMG 5H2FZ 1AI5A 1RFYA 3TCUA 3BRCA 1AROP 1H2KA 3BAAA 1X4TA 2Q69A 3CSXA 2JVDA 1M57B 2QTOA 1H38A 3JARB 3WB0A 4DRXB 4LF6B 4I9WA 4RO2A 3ZX6A 3UCSC 2Q8VA 4EFBA 4Z1MG 2ETNA 1E79G 3OW2U 1S5HC 3A2FA 1ZUQA 3P30A 1S0VA 2WPDG 3ABLC 4UUJC 4DV0O 2WWWA 1RSOB 2IU0A 4FK5C 4JI3B 3ZCCA 4OX9B 1JR9A 1BZKA 4LWSA 3AG3B 3VBBA 4JI7B 2F95B 3OTOB 1WP7A 2CH7A 1FD9A 1OCCC 4CC6A 2VQFO 4LNUB 3CMEV 3IGAC 2YIAA 4DK0A 1M9NA 1PP9H 2Y69B 5DN6G 1I0HA 4BW5A 2ZXWC 3SJBC 4PHZA 2GV9A 3FAVB 2WAMA 1NTKH 2QWNB 4FM2A 2GUZA 1I08A 3JASA 2JGDA 4JF3A 4DV6O 3TXSA 4ZI7B 2AHZA 4CC5A 4WFEA 1FFXB 4JI6B 2RNBA 3FB5C 5F2VO 3F5TA 1IXBA 1J5EB 4NTXA 5LL6Y 2PYJA 4H13B 1EM1A 5LGUA
chains in the Genus database with same CATH topology
2LW1A 1IVSA 1GAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LW1 A;  1IVS A;  1GAX A; 
#chains in the Genus database with same CATH topology
 4PD4 F;  3UO3 A;  3AG7 A;  2UU9 B;  5JCO A;  2Q7G A;  5J2T A;  1YZB A;  1CEZ A;  1TA8 A;  4RUE A;  3PN1 A;  4LFA B;  4ZOL A;  2HR3 A;  1L1F A;  2DQ0 A;  2ADQ B;  3BA9 A;  4W4L A;  3ZJZ A;  4TV8 A;  2JS3 A;  1KP3 A;  2GBO A;  2AXT Z;  4U3F H;  3JD1 A;  4F4L A;  1AJP A;  5EC2 C;  1EZV H;  5IJ0 B;  4I50 B;  1O9H A;  2B1I A;  4J7K A;  4K3A A;  4DR1 B;  2CTR A;  2P22 C;  2Z3Y A;  1FJG B;  2EUL A;  4JYC A;  4AHC A;  2FB5 A;  4JI3 O;  1N33 O;  1R3K C;  2X6B A;  4X1Y B;  1YCI A;  4U7N A;  1K5S A;  1SA0 A;  3AG1 C;  4Z2W A;  4WFH A;  4DV6 B;  1AJQ A;  1Q5O A;  1GN6 A;  4MT8 A;  4B3R B;  4JAV A;  4TWK A;  1E1R G;  1SES A;  5B3S B;  1NTM H;  4CS2 A;  5FPR A;  4YJ2 A;  4B3T O;  5IY5 B;  2ZM6 O;  4FZ1 A;  4LF9 O;  3SYC A;  1T5E A;  3SYO A;  4JV5 B;  2IJH A;  1XDC A;  1G4Y B;  3G6B A;  4O4J B;  1OCR B;  3JAT A;  2QEX V;  1KUQ A;  1ZAU A;  4BAY A;  1GN2 A;  4B3M B;  3EVK A;  2E75 B;  3UO2 A;  1N0J A;  4GKK B;  1P7B A;  3SYQ A;  3I55 V;  4LF6 O;  2BTQ B;  1Y6X A;  1G1X B;  4MW3 A;  1UPG A;  2FTK A;  3M99 B;  5B5E Z;  4JI2 O;  4BIU A;  1NJI W;  4F6E A;  1SS3 A;  3K5L A;  5CB4 B;  3EXA A;  1L0L H;  4PI2 A;  3ASO B;  4FLX A;  3UT5 B;  4ZBM A;  1DGS A;  4DV7 O;  5J2T B;  3JSN A;  3H1L H;  3KCX A;  5A9G A;  3JYC A;  3WB2 A;  1SQX H;  4DV4 B;  1RPR A;  1KB9 F;  1Z5W A;  1WPB A;  5LXT A;  2IJJ A;  1JCH A;  3H1I H;  1WAZ A;  3K5N A;  4NXN B;  4UB6 Z;  3SPJ A;  1P84 F;  1SQG A;  2WSS G;  4RAI A;  4C7U A;  2VWJ A;  1QU7 A;  4DV5 O;  1IDS A;  3CS5 A;  2V1D A;  1WP8 A;  1BGY H;  3CE2 A;  2Q0A A;  4KUM A;  3JD3 A;  1YVW A;  1TUE B;  1OCR C;  1IVS A;  1SQF A;  2QSA A;  3AG2 B;  1AJN A;  1VQ5 V;  1FXK B;  4GKJ O;  1IBL B;  1JOY A;  2Q9L A;  1V54 B;  3F5W C;  4TUY B;  2CGN A;  4K35 A;  3OR7 C;  2WLI A;  1K4C C;  2Y48 A;  3OTO O;  3H1K H;  3OD4 A;  1PM9 A;  5GW7 A;  5EYP B;  1NR7 A;  3E8G A;  4DUZ O;  2HFE C;  1K73 W;  1NQT A;  1FYJ A;  1RP3 B;  4X20 B;  4LH6 A;  5FNV B;  1G6U A;  4E4E A;  3OM3 B;  4DR6 B;  1AI4 A;  4I55 B;  2CAZ C;  2ZNI A;  4LF4 O;  1SQP H;  4GX5 A;  1W59 A;  4X65 B;  1XMQ O;  2WLN A;  4LP8 A;  4MVO A;  4X66 B;  4JI5 B;  2K1E A;  3HR0 A;  4NTY A;  4JYA B;  4X8A A;  5KAF Z;  2V4D A;  3E35 A;  3HKC A;  4JTC B;  1VQP V;  1VF5 B;  3HB3 B;  1SF9 A;  3ABM B;  4DR4 O;  4HAM A;  1M5I A;  3IJ4 A;  5C8Y A;  4MVR A;  1SER A;  3J81 N;  4BWA A;  2OCC C;  2RDC A;  2QA4 V;  2DOS A;  1JJO A;  1I5X A;  4IHJ B;  2ZNJ A;  1R3I C;  2YIC A;  3HKB B;  4QJF B;  5H6Q A;  3FKS G;  2ZE7 A;  2AGA A;  2UUC B;  1YTF B;  3QO7 A;  2QWP B;  2Y4U A;  3QO8 A;  1OCC B;  3L74 H;  5E1A C;  4JI2 B;  3C3T A;  1B06 A;  4LCU C;  2YC0 A;  4PV1 B;  3GVM A;  2W6I G;  4PDR A;  5BR8 B;  4J42 A;  4X1I B;  4HNA A;  2DYS B;  2PZS A;  2YSU B;  1D5A A;  1Y66 A;  5LXT B;  4DUY B;  2OT5 A;  5JWP A;  2ZE8 A;  4JI1 B;  2OTL V;  2QKS A;  3CC7 V;  4CH5 A;  4FZ0 A;  4JTA B;  2ZDI C;  1JVM A;  5LMU O;  1FAF A;  4TQD A;  4WFB V;  4LNU A;  4AQY O;  1XHX A;  1HNW B;  1V55 C;  3ABK B;  3ZS8 C;  4G2K A;  4KP4 A;  2BE3 A;  2OWO A;  3EHB B;  4LF4 B;  4A5U B;  2UXX A;  3FAV A;  5IYC O;  4UB8 Z;  2X6A A;  2Q7H A;  2ZIM A;  3LUT B;  5ITZ A;  1MAB G;  2XOK G;  1GN3 A;  3MHH C;  5LBQ A;  1S76 D;  3BCC H;  4IYI A;  3W7X A;  1PL4 A;  2VQE B;  4W4K A;  1Y76 A;  1GKF A;  3I5D A;  2W0F C;  5FLX N;  5EYP A;  1Z5V A;  2UXB B;  4O4I B;  3ZRW B;  4X20 A;  2PI4 A;  2ZT9 B;  1YI2 V;  1BHB A;  3NXS A;  4FLY A;  3CCL V;  4O4H B;  2KQX A;  3BAB A;  2F1M A;  3RYH B;  1JFF A;  4U3J B;  4X64 B;  2FL4 A;  1PNM A;  4B3M O;  1NZ6 A;  4X62 O;  2HG5 C;  4FMT A;  2QM7 A;  2R9R B;  5JH7 A;  4I50 A;  5E79 Z;  2DMX A;  3ETG A;  1YJ9 V;  5K1P A;  1H2S B;  5H6R A;  2LW1 A;  3MAQ A;  3JAL B;  2Q0O C;  4MVS A;  2Q7E A;  3CD6 V;  3AK1 A;  4PDV A;  4UV8 A;  2F23 A;  2JEU A;  2IJI A;  1K8A W;  4I0X A;  2P67 A;  3CHX A;  4DR7 O;  1ORQ C;  1TGO A;  3HKB A;  5IJ9 A;  2CDY A;  3RBZ A;  2EX3 A;  3QF7 A;  1F7Y A;  1XIL A;  1YEW A;  2NLJ C;  2BSK A;  1QVF U;  1OV9 A;  3UKM A;  1BCC H;  2B5U A;  3AG4 B;  4X65 O;  3T1Y B;  1Q6H A;  5IT9 N;  2XAQ A;  3BEH A;  3E8F A;  4NXN O;  4BIO A;  3B09 A;  1S5J A;  1L8D A;  1GH6 A;  3B77 A;  1PKX A;  2ZR2 A;  2Z5U A;  1HR0 O;  4HYO A;  4DV2 B;  1N34 B;  1BMF G;  1Q8I A;  5ITZ B;  1Y74 A;  3CRQ A;  5B1A C;  1AB3 A;  3ABT A;  1QR9 A;  3U0Z A;  2F43 G;  1TVK B;  2W6J G;  1QHT A;  4PDM A;  3ETD A;  3W7S A;  3DXR A;  1HDJ A;  2A7W A;  5L3D A;  5B1A B;  1YJW V;  1N34 O;  1Q90 D;  1SQQ H;  1K4D C;  3G80 A;  2QE7 G;  4DV3 B;  1D2D A;  1V55 B;  3ABK C;  1E1Q G;  4TOI A;  1KKD A;  4B3R O;  2ZIO A;  3OT7 A;  3ZIA G;  3K03 A;  2NN4 A;  2X0L A;  4DR4 B;  3QNE A;  3E89 A;  4J9Z B;  2BTQ A;  3C90 A;  2DE0 X;  4X1K B;  5EIB C;  3BVO A;  3OEE G;  2C2A A;  4JI1 O;  3X2Q C;  3CC4 V;  1BHA A;  4R50 A;  2Z0A A;  1IBM B;  3MDS A;  1KQS U;  3CP1 A;  4H33 A;  1R6K A;  4KL1 A;  3C3S A;  5EIB D;  3ZRS A;  4DR5 O;  2OIG A;  2R70 A;  2Y69 C;  3ASN B;  4NKG B;  2PTM A;  4O4H A;  1GM9 A;  2XAJ A;  4DW0 A;  5HFM A;  4D7T A;  1VQK V;  3VQY A;  3HKD A;  1RPO A;  3L73 H;  1NVP B;  4UCT A;  3HKE B;  5CA0 B;  2ZE5 A;  5EBL C;  2CH7 B;  1XOU A;  3DC5 A;  1J5E O;  2N04 A;  4GCZ A;  3JAR A;  1XNR O;  4NTW A;  5DM6 V;  1XL4 A;  2ITC C;  2JDI G;  4WFG A;  5A2Q N;  1Q86 W;  3F7Y C;  1JPX A;  1WPX A;  1GTO A;  5LMN B;  4RQE A;  3VQV A;  1U97 A;  5IYZ A;  2UXC B;  3H01 A;  3SYA A;  1Q6I A;  1FS0 G;  1EN6 A;  5B1B B;  2WLI B;  4JI0 O;  4DV1 B;  2EIJ C;  4DR3 B;  1IZ3 A;  5B1N A;  1VEW A;  3SPH A;  4LBE C;  1RM1 C;  3ETE A;  3H1H H;  3QO5 A;  1X59 A;  1QCE A;  1NVP D;  4J7Z A;  1OCO B;  3AEI A;  4XBF A;  3RFR A;  4JAA A;  2VS0 A;  3A0B Z;  2GHY A;  2DN9 A;  4R6Z A;  4LR3 A;  3K0D A;  2BCC H;  3S3W A;  4EB6 A;  3JCU Z;  1R73 A;  2LQT A;  3CXH F;  3E8B A;  5KA5 A;  1ZSP A;  3P3N A;  1VQ4 V;  2BOB C;  5JVD B;  3GB7 C;  1DTO A;  2GUZ B;  3P32 A;  2DJV A;  4P9P A;  3Q4H B;  5JJE B;  4UCS A;  1B3Q A;  4HNA B;  2LP7 A;  2YEV A;  3CWB H;  2JK5 C;  2ILM A;  1SA0 B;  4JPR A;  1S77 D;  3K0G A;  4R7C A;  2Y0I A;  1VQL V;  3HKD B;  1FKA O;  4QIW F;  3K3W A;  3ZMZ A;  3SPG A;  2A06 H;  1B04 A;  1WB7 A;  2YDE A;  1VF6 A;  2BTO A;  2IJK A;  2QR4 A;  1KBH A;  4TQF A;  5BMV A;  2XTA A;  4YJ2 B;  2CTP A;  3ZN1 A;  3R65 A;  4LF8 B;  4GX2 A;  1J95 A;  1XBL A;  1S3J A;  3BFR A;  4QGP A;  3E86 A;  2YID A;  5KX5 A;  4MVU A;  2P90 A;  1M57 C;  3U10 A;  5IE9 A;  3VQX A;  4O4J A;  2E5L B;  4TV8 B;  4NB5 A;  4NYK A;  1VQ9 V;  1FJG O;  3G71 V;  2YIB D;  3CRM A;  2H8P C;  2Q73 A;  4UCR A;  1GM8 A;  1QBZ A;  4CS3 A;  2EZP A;  1PD3 A;  5B3S C;  1N33 B;  1XEQ A;  4PA7 A;  3SJC C;  5CA3 A;  1V9P A;  2D3O W;  2Q6A A;  1JX9 A;  3N2K A;  4LF5 O;  5HFL A;  1WA8 A;  1OCZ C;  3QTC A;  1TAE A;  2EIJ B;  4B3T B;  5LGN A;  1MZF A;  4PJ0 Z;  1SZT A;  2RQ6 A;  1OCZ B;  3UT5 A;  5IYB O;  4YY3 B;  1XI1 A;  3MHS C;  3ETQ A;  1M56 C;  4GYC B;  3BY6 A;  2JRI A;  3CCS V;  1QLE B;  3TXQ A;  3JAK B;  1DF5 A;  1NI8 A;  5FPO A;  2X6C A;  3U11 A;  1LUW A;  3RW0 A;  4Q20 A;  1BE3 H;  4RQF A;  2YI9 A;  3AG2 C;  3DC6 A;  4TV9 A;  3LDE A;  3K58 A;  1H8E G;  3ZRW A;  4PA6 A;  4JYY A;  3QG5 A;  2UXD O;  2OTJ V;  1F4M A;  2FYU H;  5J9P C;  4WBN B;  3HPL C;  4CZZ A;  2QM8 A;  1VMG A;  2F4V O;  5KHI A;  1O9G A;  3Q4H A;  1JJ2 U;  1MSW D;  4FLW A;  3AK3 A;  1WB8 A;  3ICX A;  3OMN B;  2P7T C;  3IC9 A;  4U3J A;  4DV1 O;  1WJZ A;  4JI0 B;  3J80 N;  3PJS K;  3P3P A;  3CCQ V;  5LMN O;  4WFF A;  2MK3 A;  1XUQ A;  1YF2 A;  1HR0 B;  3ABL B;  4H44 B;  1CXZ B;  1N36 B;  4IIJ B;  3JAW A;  2RN9 A;  3T4Z A;  4YIP A;  4K0K O;  5FL7 G;  3FD9 A;  3FB7 C;  1IX9 A;  2ZD9 A;  1N8R W;  3SPI A;  4UFZ A;  3APO A;  3WFV A;  2ZDI A;  2YXY A;  3CCJ V;  2Q68 A;  2WLL A;  4IL6 Z;  3WG7 B;  5B1O A;  2ZKO A;  4I5S A;  4B7E A;  3FB6 C;  4KXR A;  3ZMT A;  4LFA O;  3AG3 C;  3L75 H;  5D5P A;  1W2B U;  1MNG A;  5LP6 C;  1PNL A;  3H1J H;  3CEI A;  5DEC A;  4EEQ A;  4MS2 A;  3ML0 A;  2X7R B;  4YXW G;  1EFR G;  4I4T B;  3ABU A;  3IC7 A;  1NU1 H;  5CMU A;  1JA8 A;  4ABM A;  3CRA A;  2HLD G;  4LH7 A;  1I7F A;  3WU2 Z;  1M56 B;  1CPY A;  3DTU B;  4OGQ B;  4DK1 A;  1NH2 D;  2IM9 A;  3L72 H;  2LGQ A;  1Q7Y W;  2ADP A;  2F4V B;  1N32 B;  5KMG B;  2EJR A;  2UXC O;  3SGI A;  5AG2 A;  3CC2 V;  1XMQ B;  2UUB B;  4GZR B;  4K8X A;  1SET A;  3E83 A;  3UM7 A;  2Q4P A;  1K5Q A;  4I55 A;  4D7S A;  4AI8 A;  3WG7 C;  2KB1 A;  3RYC A;  2UUA O;  4MTF A;  5KA6 A;  4JTD B;  1N36 O;  3DGE A;  2A9H A;  4ZHQ B;  2HKO A;  1VQN V;  2GSM B;  4LF7 B;  3D3Q A;  1M93 A;  4F6R B;  1BS3 A;  3M8A A;  5L3B A;  3A8T A;  4IGG A;  1DLB A;  2XHB A;  2HVK C;  1AP6 A;  2KSD A;  5C8Y B;  2K9P A;  2OYQ A;  5JQG A;  3NR7 A;  1WN7 A;  4X1I A;  3TK1 A;  2UU9 O;  2A0L A;  3QVN A;  4PA9 A;  1R1B A;  4TT3 G;  4B7K A;  4L8J A;  5LYJ A;  2E5L O;  2WLK A;  4JV5 O;  1MSD A;  1ENV A;  1CP9 A;  3K5O A;  2XT9 A;  5LHG A;  1Q6U A;  3EFF K;  2M7W A;  1KEC A;  4UVA A;  2OCH A;  3K08 A;  3OFN G;  4OPA A;  3W7U A;  1Y76 B;  3K9S A;  2A79 B;  4X1Y A;  4MTX A;  2Q5Z A;  1NR1 A;  5IDJ A;  3THO A;  2JIZ G;  4FLZ A;  3B40 A;  1MMM A;  3FB8 C;  4FLT A;  3D8C A;  3OEH G;  3N2G B;  5CN0 A;  1B6Q A;  3O65 A;  3ZMS A;  1BQ0 A;  3VOU A;  3W7W A;  3CPW U;  2WLL B;  3FFQ A;  3RYF B;  2L6L A;  4I4T A;  4FFB B;  1JMK C;  5J2U B;  2AW9 A;  3CJH A;  3FX7 A;  4EB6 B;  4UCO A;  3SJQ C;  1FXK C;  3ZHS A;  2EIM C;  2VRZ A;  2IH1 C;  2BOC C;  1HWY A;  2HP8 A;  3F7V C;  4AIL C;  4LC1 A;  3SR2 C;  1Q82 W;  1BQZ A;  3ZBH A;  1GK9 A;  1L0N H;  1M90 W;  1F4N A;  3BHP A;  3T2M A;  1XNQ B;  1PPJ H;  5EZY A;  2UXB O;  1XQ8 A;  1XNR B;  2YEV B;  2CTW A;  1NTZ H;  2YXL A;  3N27 A;  3OAA G;  4JZG A;  2EIM B;  3FYE B;  2P4K A;  1K7D A;  4DUY O;  4X9Q A;  3APQ A;  1AVM A;  4B3S O;  1ZLZ A;  2HJF C;  1VQM V;  2XAG A;  1VP7 A;  4DR6 O;  2N05 A;  3ZMV A;  2KKW A;  2EIN B;  3LSQ A;  4FLV A;  4YHH B;  3JD2 A;  3A0H Z;  2CUG A;  1P4R A;  2D2C B;  4FFK A;  3J7A U;  4X66 O;  1Q3E A;  1AR4 A;  4DYL A;  4FPP A;  4AQY B;  3T1C A;  1N32 O;  4J9Y B;  5GON A;  4JI8 O;  3AK2 A;  3ABM C;  4I7Z B;  3ZHR A;  5H5N A;  4TUY A;  4EFE A;  3JAL A;  2P5O A;  4DR7 B;  2NR5 A;  2ZXW B;  4OX9 O;  5LHI A;  3STL C;  4JAS A;  3TET A;  5LP6 B;  1FPO A;  3JD4 A;  4I0X B;  3DSQ A;  4KHP O;  5CBG A;  4UVB A;  4JI8 B;  2ATK C;  2VQE O;  5IY5 C;  3TJT A;  2N74 A;  2CGO A;  2E76 B;  4G27 B;  4GX0 A;  1QLN A;  5J2U A;  4CH4 A;  2R72 A;  3LNN A;  4O4L A;  1ZL8 B;  3SJA C;  1PL0 A;  1AR1 B;  4DV4 O;  1KP2 A;  3OGC C;  2PI5 A;  3RVZ A;  3E2E A;  2WLM A;  5LOV A;  1IBK B;  1GO3 F;  2ARH A;  1WA8 B;  1ZTE A;  3OMI B;  1OZ0 A;  2RCV A;  1S5L Z;  2EIK B;  2LGW A;  2EIN C;  1BSM A;  2JGU A;  3TGU H;  2ZM6 B;  2W0X A;  2DQ3 A;  2QKC A;  1H2N A;  3ZED A;  1P49 A;  4LFB O;  2HEP A;  4QE9 A;  3JAS B;  4QPK A;  3ZMU A;  3STZ C;  1DF4 A;  4ZI7 A;  4J11 A;  3T1Y O;  1VQO V;  3DXR B;  3O9O A;  1VF7 A;  4LFB B;  2P06 A;  3RVY A;  4WCE V;  2A3Q A;  1YJN V;  4UXN A;  2F93 B;  3G4S V;  4DR2 B;  2CK3 G;  5BR8 O;  3KG2 A;  2EIK C;  4BW9 A;  4IT5 A;  1W0J G;  3RT3 C;  2IBZ H;  5B66 Z;  3OUS A;  4JI7 O;  4CH3 A;  5KLV H;  1URF A;  3RYI A;  4QE7 A;  3SPC A;  4CBC A;  3ZHT A;  5KUK A;  1R6N A;  1P7G A;  4UCU A;  1LR1 A;  2EIL B;  1VQ8 V;  4XDK A;  1H2L A;  5LHH A;  3IAY A;  2XAS A;  4NXM O;  4KHP B;  3JAW B;  2GDS A;  3CCU V;  1JQ0 A;  1EN4 A;  2B9Z A;  4PDL A;  3S3X A;  4MTO A;  1ROP A;  3CCV V;  1K97 A;  4WFA V;  1FXV A;  4PI0 A;  1N0N A;  1TUB B;  4JI5 O;  1YXB A;  4O2A A;  3RWR D;  3RN4 A;  4LF9 B;  1IBM O;  2CTQ A;  4B3S B;  3G6E V;  3HKE A;  5CA0 A;  1UFI A;  5LGT A;  2UUC O;  4FIP C;  2WA3 A;  1PNK A;  1R3L C;  4N23 A;  3D36 C;  3SDL A;  1Q81 W;  1K34 A;  4PEL A;  2EJ7 A;  1AR5 A;  4QPJ A;  5L3F A;  3OUF A;  1XMO O;  4HBN A;  5EK0 A;  2KG7 A;  2HVJ C;  3B8N A;  1YHQ V;  2WLJ A;  1LNQ A;  4P30 A;  1MOF A;  4CH6 A;  1VF6 C;  4JYA O;  5IYZ B;  1DK1 A;  4YJ3 A;  5L3C A;  1H2M A;  4J10 A;  2P6J A;  3JSL A;  3KZI Z;  4O4L B;  3KKY A;  2OIE A;  4B08 A;  4EKW A;  3RYH A;  1THZ A;  5EBW C;  3FYI B;  1Z2G A;  4RUF A;  1Y4M A;  5D5Q A;  4K0K B;  1NT2 B;  3JAT B;  4FVM A;  4MVZ A;  4GUN A;  1BT8 A;  3E8H A;  4OPH A;  2F66 C;  5TIS Z;  5JVD A;  1HNX O;  3OR6 C;  4KFM A;  2DYS C;  3CCE V;  2UXN A;  1YTF D;  4MVQ A;  5L3E A;  2HJD A;  4ASU G;  3OMA B;  1YIJ V;  4JZ2 A;  1D5N A;  3RYI B;  5C93 A;  2QWO B;  2RMK B;  4ZKI A;  2JS5 A;  4IYH A;  4K8Z A;  5CBF A;  3I56 V;  1XHZ A;  2M6Y A;  3G67 A;  1LUV A;  3CCR V;  4JI4 O;  2PF4 E;  2H3O A;  5JH7 B;  2XND G;  3T1H O;  2VWK A;  4MSW C;  3E22 B;  4X64 O;  2BSK B;  5BMV B;  3LSS A;  3H9V A;  2PY5 A;  4DRX A;  4J41 A;  1SKV A;  1HP8 A;  3N2K B;  4DV2 O;  3T1H B;  2FKX A;  4FM1 A;  4JYB A;  2ODM A;  1TUB A;  4JI4 B;  3KCY A;  4H0L B;  1KKC A;  5LYJ B;  3L71 H;  3LDD A;  4X89 A;  1RSO A;  2AHY A;  3RYF A;  4DW1 A;  2EBO A;  3W7T A;  3OGI B;  1FXK A;  2Y4T A;  2WA4 A;  1VAR A;  1I94 B;  1XNQ O;  2QWQ B;  1S72 V;  3MD0 A;  4DV0 B;  3JAM N;  1YDX A;  2UUA B;  4O2B B;  1YSC A;  4N21 A;  4MVM A;  1GM7 A;  4RWU A;  1MG1 A;  2Q67 A;  1NH2 B;  1KMI Z;  4DR5 B;  3ZHV A;  1GAX A;  5K1X A;  3CX5 F;  3D36 A;  4JAU A;  2HHH O;  1BL8 A;  2LO1 A;  4XDL A;  5IWA B;  4UVC A;  1Y74 B;  3K5M A;  4LF5 B;  5KAI Z;  3CJH B;  1AI6 A;  3K57 A;  4X1K A;  2H94 A;  1K3E A;  2GTA A;  4MW8 A;  1IBL O;  3L9D A;  3RGB A;  4E2L A;  3K9A A;  2KG7 B;  5FNV A;  2DW4 A;  3HKC B;  5LMU B;  3R66 A;  1HNZ O;  3BPZ A;  2VQF B;  1QNM A;  2MW2 B;  4YJ3 B;  2ZR3 A;  3AG4 C;  2XUM A;  4Z1V A;  4LF8 O;  5BY1 A;  5KHJ A;  5BXZ A;  2RJZ A;  5BZB A;  1HNW O;  1COW G;  1R6T A;  1VQ6 V;  2NNU A;  3B8M A;  3UQ8 A;  4GT1 A;  5KHH A;  1QLE C;  3ZRV A;  4FM0 A;  1VIB A;  2LW7 A;  4YHH O;  1EZJ A;  1HNZ B;  2QGN A;  2IW5 A;  3BA8 A;  3ZHU A;  2ZQM A;  1M4U A;  4ICG A;  4X62 B;  4BIZ A;  4J7J A;  5LP6 A;  1GN4 A;  1OHH G;  1W0K G;  3CYO A;  4IHJ A;  4HZ3 A;  4DR2 O;  4LF7 O;  4UCV A;  5KUM A;  1KYO F;  1SQB H;  5GON B;  3E22 A;  1QQC A;  3GWK C;  4DV5 B;  3B4S A;  1FXH A;  1US6 A;  4IIJ A;  4ZIB A;  3CB2 A;  1ZL8 A;  3CMA V;  1XL6 A;  5CBH A;  4Q6G A;  2UUB O;  3LSU A;  3K79 A;  1G8M A;  5GTI Z;  5LOV B;  4GLX A;  4R8C A;  1WLE A;  4WF9 V;  1IXM A;  4H37 A;  3VQW A;  5IYD O;  4GX1 A;  5EC1 C;  3ASO C;  2YUA A;  3D3I A;  4CS4 A;  2ITD C;  1XMO B;  3K04 A;  2DWD C;  2QTS A;  1IBK O;  2LJ2 A;  2PGG A;  1U96 A;  2PYL A;  1UJW B;  3ZRX A;  1EN5 A;  5CA1 B;  1AIL A;  1FFT B;  2DYR B;  3IFX A;  4O2B A;  2WLH A;  5CB4 A;  2P4V A;  4O4I A;  5KMG A;  3ASN C;  4MTG A;  1QVG U;  4P2Z A;  3A0R A;  3CRR A;  4G28 B;  1M1K W;  1H8H G;  2LFS A;  4DR1 O;  1KD1 W;  5B1B C;  1HNX B;  4DV3 O;  2QKA A;  5LA6 B;  4L87 A;  1I94 O;  1GMG A;  3K59 A;  3RYC B;  2G38 A;  3X2Q B;  1F51 A;  4ZHQ A;  1H2G A;  1ZX3 A;  4BR6 A;  5L3G A;  4PA3 A;  4DR3 O;  2YI8 A;  3WB1 A;  4F6R A;  4LFC B;  3B2E E;  1MZE A;  1AI7 A;  2DYR C;  2R9I A;  2LFR A;  1A32 A;  1MA1 A;  2JJ1 G;  1K33 A;  5KX5 B;  3SYP A;  2EZO A;  4X88 A;  1KC8 W;  1JFF B;  5GTH Z;  2E3C A;  3N2G A;  1GRJ A;  1RM1 B;  4LFC O;  5JJN B;  5IJ9 B;  4TSF G;  3OTF A;  3JCZ A;  2ZIN A;  5KHG A;  5KHK A;  1IUR A;  4FFB A;  4DV7 B;  2UXD B;  3OE7 G;  2YXH A;  4XDJ A;  2AZ2 A;  1Q43 A;  5DED A;  2QDO A;  1SZX A;  4JI6 O;  1K92 A;  4GKK O;  4UV9 A;  5JQG B;  1F23 A;  2AZ0 A;  1SRY A;  2E74 B;  2FML A;  4O2A B;  2IH3 C;  5JJJ B;  1AP5 A;  1XRE A;  2IU3 A;  4J80 A;  1SQV H;  4FJC C;  5H9C A;  1R3J C;  4P9O A;  4LWS B;  1HW7 A;  1NKD A;  5IWA O;  2OCC B;  4I9Q A;  1TVK A;  1FFX A;  4DUZ B;  4D6T H;  2CE4 A;  2QM4 A;  1YIT V;  1EBO A;  2YS8 A;  1I5Y A;  4DXW A;  4TV9 B;  2L35 A;  2Y0P A;  2JEX A;  4OXS A;  2JJ2 G;  3ZHQ A;  2YIB A;  4GKJ B;  2B1G A;  1K9M W;  3LDC A;  3ZN0 A;  3JD0 A;  4WBN A;  3CXC U;  1PV0 A;  2XAH A;  4NXM B;  2JGD B;  2QWR B;  1OJH A;  2EIL C;  2PUS A;  3GWO A;  5EBM C;  1KU9 A;  3JAK A;  2O57 A;  4DO2 A;  5JCO C;  4PA4 A;  1V54 C;  4NVP A;  1N4C A;  4YY3 O;  2ZCE A;  2DWE C;  3CRC A;  5CA1 A;  3L70 H;  1OCO C;  3CCM V;  2HHH B;  3AG1 B;  5IJ0 A;  1QR8 A;  4NR1 A;  4YIO A;  1Y67 A;  2XAF A;  3M7M X;  1SC5 B;  4U7O A;  3K06 A;  4QNH B;  1WNS A;  3LNM B;  4FLU A;  4ZOL B;  5EZY B;  2GTS A;  2ZE6 A;  5LA6 A;  2QJ1 A;  2V7Q G;  4JGS A;  1ZWI C;  2R9A A;  3T4D A;  1VQ7 V;  1NS1 A;  1NBM G;  5H2F Z;  1AI5 A;  1RFY A;  3TCU A;  3BRC A;  1ARO P;  1H2K A;  3BAA A;  1X4T A;  2Q69 A;  3CSX A;  2JVD A;  1M57 B;  2QTO A;  1H38 A;  3JAR B;  3WB0 A;  4DRX B;  4LF6 B;  4I9W A;  4RO2 A;  3ZX6 A;  3UCS C;  2Q8V A;  4EFB A;  4Z1M G;  2ETN A;  1E79 G;  3OW2 U;  1S5H C;  3A2F A;  1ZUQ A;  3P30 A;  1S0V A;  2WPD G;  3ABL C;  4UUJ C;  4DV0 O;  2WWW A;  1RSO B;  2IU0 A;  4FK5 C;  4JI3 B;  3ZCC A;  4OX9 B;  1JR9 A;  1BZK A;  4LWS A;  3AG3 B;  3VBB A;  4JI7 B;  2F95 B;  3OTO B;  1WP7 A;  2CH7 A;  1FD9 A;  1OCC C;  4CC6 A;  2VQF O;  4LNU B;  3CME V;  3IGA C;  2YIA A;  4DK0 A;  1M9N A;  1PP9 H;  2Y69 B;  5DN6 G;  1I0H A;  4BW5 A;  2ZXW C;  3SJB C;  4PHZ A;  2GV9 A;  3FAV B;  2WAM A;  1NTK H;  2QWN B;  4FM2 A;  2GUZ A;  1I08 A;  3JAS A;  2JGD A;  4JF3 A;  4DV6 O;  3TXS A;  4ZI7 B;  2AHZ A;  4CC5 A;  4WFE A;  1FFX B;  4JI6 B;  2RNB A;  3FB5 C;  5F2V O;  3F5T A;  1IXB A;  1J5E B;  4NTX A;  5LL6 Y;  2PYJ A;  4H13 B;  1EM1 A;  5LGU A; 
#chains in the Genus database with same CATH homology
 2LW1 A;  1IVS A;  1GAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...