2LW1A

The c-terminal domain of the uup protein is a dna-binding coiled coil motif
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
85
structure length
85
Chain Sequence
KAETVKRSSSKLSYKLQRELEQLPQLLEDLEAKLEALQTQVADASFFSQPHEQTQKVLADMAAAEQELEQAFERWEYLEALKNGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The C-terminal domain of the Uup protein is a DNA-binding coiled coil motif.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords ABC transporter ATP-binding protein uup
total genus 32
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16326 ABC_tran_CTD ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.380 Mainly Alpha Orthogonal Bundle Helix Hairpins Valyl-tRNA synthetase, C-terminal domain 2lw1A00
1IVSA 2LW1A 1GAXA
chains in the Genus database with same CATH superfamily
1EN6A 1K3EA 4DR4B 4X9QA 2Z3YA 4KP4A 4MVMA 3G6BA 1Q81W 1GKFA 2HHHO 2VWJA 5LMUO 2K9PA 3LDDA 4PA3A 1ZTEA 4BW9A 1AVMA 2FTKA 4I4TA 5DN6G 3L9DA 4CH4A 4DW1A 3VQXA 2OWOA 1A32A 5J2TB 1VF6A 1S72V 4X20B 4GLXA 2Q8VA 4L8JA 4WBNB 4KFMA 3STZC 4GKJB 2W0XA 3OTOB 1AI7A 3K58A 1FFXA 3AG7A 4XDKA 2F4VB 5KX5B 4BAYA 3R65A 1IBKO 2BSKA 1I5YA 1VQPV 1XHXA 1G6UA 4JYCA 4DUYO 2GHYA 3D8CA 2ZQMA 3HKEA 3UKMA 4JGSA 5LL6Y 1ZL8A 1FJGB 3DSQA 5LGUA 3G67A 2Q68A 5EZYB 1WLEA 2EJRA 2N05A 4IHJB 5EIBD 1XEQA 1Y76B 1CP9A 2DYSB 3OEHG 3UQ8A 2GUZA 2UXCO 3DXRB 4LF6O 4X65B 3SYAA 2LQTA 1VQ4V 1K5QA 4KUMA 5BMVA 4RO2A 1FYJA 1M93A 4WFAV 4JYAO 4LH7A 3CRQA 3BFRA 4LBEC 1DF5A 2OCCC 1QVGU 1JJ2U 5E79Z 3CS5A 3WFVA 4J11A 4PELA 5K1PA 3K59A 4B3RB 1G8MA 5KMGA 4DV1O 4IL6Z 2HP8A 2OYQA 5CBGA 4DV3O 4YJ2B 2HKOA 2HEPA 3CP1A 2QE7G 1SQVH 1US6A 4FLUA 4PDVA 1ROPA 4J10A 4HYOA 1Z5VA 1S0VA 2XAJA 3E8GA 2F43G 1GN6A 3ZHSA 2ZM6B 3SGIA 3JATA 1IXMA 5EBWC 2A9HA 1MSWD 5L3BA 2P90A 1EFRG 1OCOC 1HNZB 4U3JA 2X0LA 5KHGA 4JAVA 1GMGA 3IGAC 1K5SA 2VQEO 2Y4UA 5A2QN 3IFXA 3OMNB 4JAUA 4EKWA 4E2LA 2JIZG 4LF4B 4FZ1A 3ZMVA 4JI1O 5FPOA 1WJZA 4FJCC 3CSXA 1YIJV 1JFFB 2ZIMA 5JCOC 4TV8A 4FLYA 1HNXB 1D2DA 3ZS8C 4O2AB 1J95A 1UPGA 2Y0IA 1R73A 3I55V 4K8XA 1MA1A 4EFEA 2K1EA 1AJQA 5GW7A 1Y74B 3PJSK 3OUFA 2JRIA 1YTFD 3B09A 1WP8A 4DR6O 1U97A 3T1HB 2F1MA 4JI8B 4OXSA 3OUSA 3T1YO 2NLJC 2LGWA 3ASNB 4O4HB 3ZN0A 5B1NA 1MMMA 3CC2V 1WPXA 3U11A 2AZ0A 4O4JB 4PDLA 1BS3A 2JGUA 1F4MA 2EX3A 4BIZA 4W4KA 3HR0A 2DN9A 4MVSA 3CX5F 5BR8O 4YY3B 2X6AA 1QQCA 3T4DA 2ZDIC 3K79A 2QEXV 3CCQV 2X6CA 5IYZB 3RYIA 1HR0O 2Y69B 1N8RW 4WFBV 1Q6HA 3CXHF 2XOKG 1SRYA 2P4VA 3MHSC 3BRCA 1H2NA 4AILC 4JPRA 4IGGA 3F5TA 4QJFB 1YEWA 4JZGA 2XT9A 1H2LA 1NBMG 1OHHG 4TUYA 4AQYO 2FB5A 1TUBA 3UO3A 4Z2WA 2M6YA 1IZ3A 4DV0B 3SYCA 4LFCO 2A06H 1NTKH 4IIJA 3ABLC 2AHZA 2NNUA 3B8NA 3ZCCA 1N32O 2WLIB 1KP3A 1CPYA 4B3SO 3DGEA 3RN4A 1M4UA 4RAIA 3W7UA 1Q82W 3JD3A 2IJJA 5LGTA 5H6QA 4QE9A 1SERA 3ZMUA 4PJ0Z 2CAZC 2QWNB 3LSQA 3EFFK 1M57C 2E5LO 1LUWA 2YSUB 1K97A 5B1OA 1UFIA 3K04A 3P3PA 5KHKA 4UVCA 2UXDO 2RQ6A 2XTAA 1TVKA 1VQ9V 1Y67A 2RCVA 1F4NA 1P84F 4W4LA 5BXZA 2QKCA 1PL0A 4DUYB 1AR5A 3W7XA 2DOSA 4DW0A 1FFTB 1N36B 4P2ZA 4B08A 3ASNC 1XBLA 5C8YB 4GYCB 2VWKA 4UB8Z 3THOA 1KBHA 2KG7A 1WA8A 2WA3A 5FL7G 1D5NA 4CS3A 2UXNA 4LF6B 1M9NA 4LF7O 3ZRWB 2WPDG 4CS4A 1K33A 3QO8A 4UCTA 4K0KB 2E75B 4LH6A 3ZRXA 3ZMSA 1PNMA 2WLLB 2ZR3A 4LR3A 2ZIOA 3CWBH 1SKVA 2YXLA 4JI4B 4FFKA 1SZXA 2JS5A 3I56V 1NI8A 1AP5A 3TJTA 1JR9A 4GT1A 3OT7A 4JAAA 3SDLA 2PYJA 2JEXA 1T5EA 2PI4A 4LF9B 1OCZC 1PPJH 2O57A 4CH6A 2QA4V 4DV1B 3AEIA 2JDIG 1RSOA 2HJDA 3H1LH 3WB1A 4TV9A 3M99B 3QTCA 2UU9B 4F4LA 5CBFA 1KECA 4DR2B 2Q4PA 4TT3G 1JVMA 2ZDIA 1JPXA 2YXHA 1Q3EA 4ZHQA 4TQFA 2E3CA 2QTOA 3JCUZ 4EFBA 2IM9A 3AK1A 1BCCH 4ZOLB 5KHIA 2QTSA 1VQMV 5IJ9B 4WFHA 4GX1A 2WWWA 5D5QA 4ABMA 4DR3B 5DM6V 5JH7A 3OD4A 1NT2B 4JI3O 4YIOA 4LCUC 4DV4B 3K08A 4NVPA 3CJHB 1GTOA 2QM7A 5KLVH 5GONA 2QKAA 3CEIA 3WG7C 1OCRB 3E35A 5F2VO 2E74B 4ZKIA 2WLHA 3SPGA 1XNQB 1RPOA 4LNUA 2ZNJA 2V1DA 4QIWF 5KMGB 2FKXA 4RUEA 3L75H 4GX5A 3T1YB 1QR8A 1S5HC 4DK1A 4ZHQB 5L3GA 4IYIA 1VQNV 5LMNO 2EIKC 2YEVB 3ZRVA 1F7YA 4PI0A 2YICA 1M90W 1PNKA 3JALA 4YY3O 1QU7A 2DMXA 2OIGA 4JYBA 3CRRA 1HDJA 2F95B 1YZBA 3AG4B 2BOBC 1XHZA 3R66A 2BTQB 3JAWA 3K06A 3GWKC 4X1IB 2VS0A 2ETNA 4U3JB 4X1KB 4A5UB 1F51A 2JJ2G 3FYEB 3RBZA 2HR3A 3CJHA 4DV7B 5AG2A 2JJ1G 4AHCA 3P30A 3J81N 2ITCC 3KCYA 3RYFA 4QPJA 4R50A 1SA0A 3E83A 2FL4A 4WFGA 1M56C 1K4DC 1FKAO 4FZ0A 5LBQA 2WLNA 3APQA 1Q90D 3E22A 5E1AC 4X64O 2B1IA 2P06A 2Q7HA 3ICXA 4G28B 5EBLC 3B8MA 4XBFA 1K4CC 1Q5OA 1LNQA 3RGBA 1BHAA 3M7MX 3SPCA 1XILA 3ABTA 4MVRA 1S3JA 1N32B 3A0HZ 3OR6C 1JA8A 1IBMB 3W7WA 5CA0B 2HVJC 1I08A 3A0RA 1NR7A 3CXCU 3CC7V 1I94O 5LA6A 3QO7A 5JJJB 2ZE8A 4RWUA 2WA4A 3RYHA 2HG5C 4JI0O 4MVOA 5IY5C 3K03A 2HJFC 4H44B 5LYJB 3BABA 4IT5A 4MSWC 4GKJO 4UVAA 3E8FA 3F7VC 4LFBB 2F66C 4H0LB 1FPOA 1BHBA 1IBKB 4RQFA 1V55C 4J9ZB 3JAMN 3OMAB 1PL4A 5CA3A 4NXNB 5IYZA 5IYCO 3RYIB 1SQXH 1YCIA 1FJGO 1YI2V 5HFLA 3G4SV 3MAQA 3JASA 5IYBO 2CTRA 2H3OA 2CGOA 4I7ZB 1H2SB 1H38A 1K8AW 3GB7C 5ITZB 2UXCB 4R8CA 2HLDG 3T4ZA 3BEHA 3LNNA 3S3XA 1DLBA 2BCCH 2ZE7A 1N34O 1H8EG 5B5EZ 2ILMA 4R7CA 1RFYA 2ODMA 1TUBB 4KHPO 1E1QG 4PDRA 1VQLV 4UB6Z 1S77D 2MK3A 2YI9A 4JI4O 4QPKA 4MTFA 3UO2A 1L8DA 3LDCA 4GX0A 4J7JA 3WB2A 4F6RB 4IHJA 3SPJA 4ICGA 4O4IA 1JCHA 1VARA 3UT5A 1TUEB 3STLC 2DQ0A 2QJ1A 2ZNIA 3UM7A 2ZM6O 3UCSC 1N0NA 5BMVB 2DE0X 2ZE5A 4NKGB 2F93B 5LGNA 1MSDA 5ITZA 1N33O 4JI2O 3OTFA 4I0XA 1GRJA 2EULA 3HKBB 3GWOA 1SZTA 4C7UA 5LHIA 1IBLB 1FXVA 1URFA 3LDEA 2XHBA 2LW7A 1GO3F 2CK3G 3CCEV 1NQTA 4YJ2A 4K3AA 2EIJB 3CD6V 2RNBA 2LGQA 2LO1A 3H01A 3C3SA 4JI7O 2E76B 4DR3O 1K9MW 4RUFA 4XDJA 1RM1C 3JATB 2D2CB 2LP7A 4B3MO 2Q7GA 2ZD9A 4DV5B 4Q20A 3C90A 3SPHA 1AI6A 3CRMA 1H2MA 4UUJC 2VQFB 1M1KW 2DYSC 5HFMA 1VQOV 4JI5B 1GM9A 4B7EA 4JTAB 3ZBHA 1XNQO 1ENVA 4YHHO 2MW2B 4TOIA 4LC1A 3HKCB 1ZWIC 2LFSA 3HKDA 2Y48A 5KUKA 2Q67A 3O9OA 4EEQA 5JQGA 4TV8B 4JYYA 3TETA 2N74A 3E8HA 3EHBB 2EBOA 1SESA 5TISZ 2QWQB 1SQBH 3RW0A 1R3LC 2DWDC 4JZ2A 1SQQH 4UCSA 2YDEA 4K35A 3AG4C 3CCUV 3K3WA 3FD9A 4N21A 1BL8A 5EBMC 2GTSA 3JYCA 1JMKC 2YC0A 5JVDA 4HBNA 5L3FA 2AW9A 4O4HA 2ZINA 1Y76A 4H13B 4O4LB 4X66O 1XMQB 4O4JA 5IJ9A 3O65A 4I5SA 1MZFA 3ZHRA 3F5WC 2OTJV 2LJ2A 1AP6A 3ML0A 2X7RB 4DV6B 2HHHB 1NZ6A 2CUGA 2RMKB 2EIJC 4NTWA 5GTHZ 1VQ7V 1DF4A 2R70A 3CYOA 4HNAB 2HFEC 1IDSA 1V55B 2QM8A 3G80A 4X1YB 3MDSA 2EIKB 1NJIW 4PHZA 1JJOA 3B4SA 3DC6A 5B3SC 2YUAA 1L0NH 4UVBA 2IU0A 4HZ3A 1KC8W 1QBZA 1YJWV 1HNXO 3OW2U 2ZCEA 4J7ZA 4JI0B 1AROP 2OIEA 1HWYA 1NKDA 1H8HG 2WSSG 3RYCB 1VF7A 1BQ0A 2UXDB 2A79B 1VQ8V 2QKSA 1V54C 3SJCC 2WLIA 4LF5B 2GTAA 3K0DA 4OGQB 3VQWA 4CZZA 3OM3B 3C3TA 2PY5A 1M56B 4H37A 4X1KA 5KHHA 2GV9A 5LXTB 4WFFA 3SYQA 3CB2A 4HNAA 4UCVA 3AK2A 1NH2D 1VP7A 1JFFA 3RYFB 4DR1B 4QGPA 3NXSA 4Z1VA 1SA0B 1EBOA 2CGNA 3JD2A 3AK3A 2JVDA 4KHPB 3QO5A 4N23A 1E79G 3FB8C 5IYDO 2RJZA 3W7TA 4MTXA 4UCOA 5FNVA 3WU2Z 1HW7A 5J2UA 2XAGA 5CBHA 4X89A 4JI6O 3H1JH 3Q4HA 5EYPA 2WLMA 3BCCH 5LOVB 1Y66A 2W6JG 3OR7C 1W0KG 1QLEC 3CE2A 2Z0AA 2OT5A 4J42A 3RVZA 2NR5A 1B3QA 4LFCB 4GCZA 2GSMB 3L71H 5IT9N 1KB9F 5IE9A 5IY5B 3FAVA 3L74H 1NVPD 4Q6GA 1DK1A 3H1IH 5LXTA 4DR5B 1L0LH 4GKKB 4FPPA 4UXNA 2WLKA 2QSAA 1K73W 1WNSA 1YTFB 2UXBB 2A7WA 3BA8A 3ABMC 4U3FH 2ZKOA 1G1XB 1RPRA 4GX2A 1AB3A 2YIAA 3K5OA 4LF8B 1RSOB 2QGNA 2E5LB 4D7TA 4TV9B 1PP9H 5CB4B 3TXSA 1AJNA 1ZUQA 5J2UB 2JGDA 2CTQA 1S76D 5JCOA 1YF2A 2R9AA 4F6EA 3HB3B 3X2QC 1XNRB 2CH7A 3CMEV 1ZLZA 5KA6A 1R3JC 3AG3B 2P7TC 2FMLA 4ZI7B 3B2EE 4FMTA 1LUVA 5A9GA 4I55B 4LFAB 5JJEB 4PA9A 1NR1A 4GUNA 3A8TA 5LP6C 4MVQA 2XASA 3ZHTA 5B66Z 4K0KO 3VBBA 2ATKC 2BTOA 3SJAC 3RVYA 5JH7B 1V54B 3L70H 4R6ZA 2DWEC 4P30A 3ZJZA 1TGOA 1Q6UA 4JV5B 2H94A 3VQYA 4B3TB 4YJ3A 1JX9A 4NTXA 5KUMA 2KQXA 3FB5C 5D5PA 4X62B 1TVKB 2DW4A 3TGUH 4DUZO 2KB1A 5CB4A 1BE3H 1YJ9V 5CN0A 1COWG 3SR2C 4YIPA 4WBNA 3G71V 4LNUB 3ETEA 3J80N 1I7FA 3RWRD 1K7DA 5IWAO 4JASA 2QDOA 3CC4V 2CH7B 4FVMA 3ZRWA 2QR4A 3QG5A 4DR4O 1VQ6V 1XMOB 2PZSA 2YIBA 4Z1MG 4UCUA 4X88A 3JARA 4JTCB 5K1XA 2Q6AA 3SPIA 3ABKC 1NVPB 4DV2O 2IU3A 3BVOA 4JI1B 4NR1A 3ZN1A 3DXRA 2UUBO 3E2EA 4J41A 1GH6A 3EVKA 4CS2A 1EM1A 2PGGA 1SS3A 1XOUA 1BSMA 1KYOF 5CMUA 2A0LA 4YJ3B 4G2KA 1N4CA 3FYIB 3CCMV 1SQFA 1M57B 3BA9A 4DV4O 2PTMA 3AG1C 2EJ7A 3HKDB 5IJ0A 5EK0A 4TSFG 2F4VO 3K5MA 2G38A 2Q73A 3QF7A 2IH1C 2OCHA 2B5UA 3P32A 2P5OA 2JS3A 2X6BA 1KKCA 1R3KC 1QHTA 2ZR2A 4D7SA 1IVSA 1X59A 2N04A 4JI8O 1HNWO 3ABLB 4FM1A 1N36O 1WB8A 1FXKC 4D6TH 2P22C 1BZKA 2GBOA 1GN4A 3EXAA 1B04A 1I0HA 3N2KB 4X65O 1Y6XA 3JAKB 3JARB 3VQVA 5BR8B 1KD1W 4H33A 3ZEDA 1N34B 1Q43A 3FX7A 2QWPB 3ZHUA 5LP6B 1AR4A 4JYAB 4J9YB 3K9SA 2V7QG 3SYOA 4I4TB 1J5EB 4B3RO 3X2QB 4NXMO 1X4TA 2QWOB 3LSSA 1QNMA 3LSUA 4BIUA 5IJ0B 4CC5A 3MHHC 4AI8A 4FLZA 2W0FC 1SF9A 1EN4A 4JI6B 1IXBA 3JASB 1KKDA 3ABMB 4AQYB 3FB6C 1H2GA 2YXYA 1VIBA 4DV0O 2UU9O 1XQ8A 2IJHA 4L87A 2UUCO 4I50A 2YEVA 1MZEA 2YI8A 3K9AA 3QNEA 5L3CA 1W59A 1PM9A 3JALB 1CXZB 1WN7A 4EB6B 1KU9A 3RYCA 3CPWU 3N2KA 2LFRA 1KMIZ 2AZ2A 3CMAV 4UFZA 4DR5O 1N33B 1R6NA 4GKKO 2CE4A 3K0GA 4QNHB 3JAWB 3ZRSA 1OCCB 4MT8A 1FD9A 4MTOA 3QVNA 4UV9A 3KKYA 1P7BA 5B1BC 3KZIZ 1IX9A 5C93A 4JTDB 2EZOA 1VQKV 1Z5WA 1OV9A 4MW3A 3OTOO 4LF8O 3P3NA 2JEUA 2P4KA 3JD1A 4WFEA 1ORQC 1KP2A 1OJHA 2ZXWC 1NS1A 4JI7B 4DRXB 5EC1C 1NH2B 5BY1A 2YS8A 4FK5C 5JWPA 2DYRB 4K8ZA 4PA7A 5DECA 2L6LA 3RT3C 4NTYA 1SQGA 2EIMC 1RP3B 1EZVH 2YIDA 2B9ZA 1XNRO 5FLXN 2HVKC 3BY6A 4TUYB 4JI5O 2BOCC 5LA6B 1UJWB 5FNVB 2EZPA 2W6IG 3K5LA 5CA1B 5B1AC 4LFAO 2DYRC 2Q69A 3T1CA 4U7OA 4IIJB 3DTUB 2Q9LA 2CTPA 3IAYA 2UUAB 1U96A 2AHYA 4FFBA 1SETA 4O2BB 3OGIB 4JV5O 4J80A 2ADQB 2ARHA 3L72H 5GTIZ 3CCJV 4DR7B 4UCRA 4B3TO 4LF9O 2KSDA 1FAFA 3FAVB 1AR1B 3GVMA 4GZRB 4DV3B 4DUZB 2XAQA 1BQZA 2ZT9B 1YHQV 2C2AA 4OX9B 4BIOA 1KQSU 4DK0A 3I5DA 3HKCA 1Q6IA 1FXKA 3CRCA 3D3QA 1IURA 4P9OA 2L35A 4LWSB 5JQGB 3H9VA 4PA6A 4X64B 1Y74A 4OPHA 2AGAA 4X8AA 1XMOO 2VQEB 3ASOB 4QE7A 1QLEB 4JI2B 1QLNA 4B3SB 3D36C 1MOFA 1NU1H 4MW8A 4LF4O 1N0JA 1XUQA 1IBMO 1ZSPA 3TCUA 4FLVA 4PD4F 2KG7B 1WA8B 3TK1A 4P9PA 4DV2B 1Q7YW 5IDJA 2XNDG 4FFBB 3IC9A 1S5LZ 5B1AB 5JVDB 4F6RA 5L3DA 2BE3A 3TXQA 2CTWA 1Q86W 2P67A 1OCOB 1GN3A 1VF6C 1FS0G 5H9CA 4BW5A 2Y4TA 2D3OW 1PV0A 3OGCC 4DV5O 2DJVA 1P4RA 1QR9A 3CHXA 1B06A 2Y0PA 1WP7A 3LNMB 1P49A 1FXKB 4LF5O 4X20A 3FFQA 4X1YA 1HNWB 4I0XB 3HKBA 3N2GB 1R1BA 3ZHVA 4WF9V 1FFXB 3K5NA 2YIBD 5KX5A 3JCZA 1THZA 2KKWA 1SQPH 5H6RA 2H8PC 1VEWA 3JSLA 3CCLV 4ZBMA 2JK5C 4IYHA 3DC5A 2IJIA 1QVFU 1ZL8B 3ZMZA 2PI5A 4XDLA 1RM1B 1R6TA 1I5XA 2AXTZ 5EZYA 5KA5A 3CCRV 1NTMH 1O9GA 4ZOLA 3G6EV 1PNLA 3BHPA 2GUZB 2PF4E 4DV7O 4G27B 1YDXA 1XL6A 2P6JA 3W7SA 1NTZH 2XAFA 3WG7B 2IJKA 4NXMB 1MG1A 3IC7A 4BR6A 3BAAA 1TAEA 3D3IA 2PYLA 1R6KA 1YXBA 1AILA 4KXRA 1E1RG 1SC5B 4MVZA 3U0ZA 1CEZA 5GONB 3JD4A 1O9HA 4LP8A 4DR2O 2UUCB 5LMUB 5JJNB 1M5IA 1KUQA 3N2GA 2ZE6A 4DV6O 3H1HH 1TA8A 1DGSA 3KG2A 2GDSA 2WAMA 3ZMTA 1Z2GA 3U10A 4DYLA 3E8BA 3SJQC 4UV8A 2RN9A 5C8YA 1WB7A 3FKSG 1ZAUA 2NN4A 3ZX6A 3E89A 5L3EA 1W2BU 4CBCA 1XDCA 2ZXWB 4PA4A 1AI4A 5KHJA 4DO2A 4BWAA 4O4LA 1H2KA 3K57A 3KCXA 4J7KA 1BGYH 3JSNA 1GN2A 2EIMB 4JI3B 4E4EA 4LFBO 3JAKA 1FXHA 5B1BB 3ETQA 3MD0A 2EINC 2BTQA 2Z5UA 2IH3C 1EZJA 1YSCA 4CH5A 1OCCC 5LP6A 4B3MB 2IW5A 5KAFZ 1OCZB 4KL1A 3D36A 4PDMA 2VQFO 4FM2A 3OAAG 1JOYA 3L73H 4B7KA 2M7WA 4NB5A 5H2FZ 1DTOA 1GM7A 4O2AA 4LF7B 1P7GA 2Y69C 1R3IC 5LMNB 1G4YB 3CCSV 4HAMA 2CDYA 1LR1A 3AG2C 1AI5A 2UUAO 2XUMA 4PI2A 4I50B 2Q5ZA 3J7AU 5CA0A 3SJBC 3S3WA 4FLXA 4U7NA 1WPBA 3OE7G 2Q7EA 2ITDC 2OCCB 4DR7O 4EB6A 4MTGA 3AG2B 4CC6A 3RYHB 4ZI7A 1YJNV 4I9WA 4I55A 1QCEA 2R72A 1BMFG 4OX9O 5LHGA 5LYJA 3B77A 4X66B 1XMQO 2QWRB 3OMIB 5IWAB 2Q0AA 4YXWG 3ETGA 2Q0OC 1HNZO 4TWKA 4MVUA 2B1GA 2V4DA 4MS2A 1Q8IA 2FYUH 2DQ3A 2EILC 1K92A 4DRXA 1VF5B 1XREA 3FB7C 1GAXA 2UXBO 1IBLO 1VQ5V 2F23A 4ZIBA 1VMGA 5LHHA 1B6QA 3T2MA 1I94B 3WB0A 4TQDA 3A2FA 3LUTB 2UUBB 3SYPA 4I9QA 3HPLC 2EILB 1L1FA 3Q4HB 5EYPB 1YVWA 5LOVA 4ASUG 5CA1A 4FM0A 3AG3C 3E86A 1OZ0A 2RDCA 2LW1A 4OPAA 4RQEA 1YITV 1AJPA 1HP8A 1JQ0A 3ZHQA 3RFRA 5EC2C 4PV1B 3NR7A 5KAIZ 2XAHA 3VOUA 3F7YC 4X1IA 1MABG 4DR6B 3AG1B 1GK9A 3IJ4A 3T1HO 4NXNO 2R9IA 4O2BA 3ABKB 4NYKA 5BZBA 3ZIAG 1PD3A 4O4IB 3CCVV 4CH3A 3UT5B 2IBZH 4YHHB 3B40A 1W0JG 3ABUA 2OTLV 3CRAA 1WAZA 2VRZA 1XI1A 5FPRA 3E22B 4WCEV 3H1KH 4DXWA 1Y4MA 1EN5A 1V9PA 3JD0A 3APOA 3ASOC 4DR1O 1HR0B 5EIBC 5J2TA 1D5AA 2PUSA 2JGDB 3PN1A 4LWSA 2A3QA 3BPZA 4X62O 1K34A 1BT8A 5DEDA 2UXXA 2ADPA 4FLWA 3A0BZ 5J9PC 5B3SB 2WLJA 5H5NA 2QM4A 1PKXA 1J5EO 1OCRC 1GM8A 1ZX3A 2R9RB 1XL4A 1F23A 1S5JA 2BSKB 3OEEG 1MNGA 4FIPC 4FLTA 3M8AA 3HKEB 2WLLA 3N27A 2EINB 4JF3A 3OFNG 3ETDA
chains in the Genus database with same CATH topology
1IVSA 2LW1A 1GAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IVS A;  2LW1 A;  1GAX A; 
#chains in the Genus database with same CATH topology
 1EN6 A;  1K3E A;  4DR4 B;  4X9Q A;  2Z3Y A;  4KP4 A;  4MVM A;  3G6B A;  1Q81 W;  1GKF A;  2HHH O;  2VWJ A;  5LMU O;  2K9P A;  3LDD A;  4PA3 A;  1ZTE A;  4BW9 A;  1AVM A;  2FTK A;  4I4T A;  5DN6 G;  3L9D A;  4CH4 A;  4DW1 A;  3VQX A;  2OWO A;  1A32 A;  5J2T B;  1VF6 A;  1S72 V;  4X20 B;  4GLX A;  2Q8V A;  4L8J A;  4WBN B;  4KFM A;  3STZ C;  4GKJ B;  2W0X A;  3OTO B;  1AI7 A;  3K58 A;  1FFX A;  3AG7 A;  4XDK A;  2F4V B;  5KX5 B;  4BAY A;  3R65 A;  1IBK O;  2BSK A;  1I5Y A;  1VQP V;  1XHX A;  1G6U A;  4JYC A;  4DUY O;  2GHY A;  3D8C A;  2ZQM A;  3HKE A;  3UKM A;  4JGS A;  5LL6 Y;  1ZL8 A;  1FJG B;  3DSQ A;  5LGU A;  3G67 A;  2Q68 A;  5EZY B;  1WLE A;  2EJR A;  2N05 A;  4IHJ B;  5EIB D;  1XEQ A;  1Y76 B;  1CP9 A;  2DYS B;  3OEH G;  3UQ8 A;  2GUZ A;  2UXC O;  3DXR B;  4LF6 O;  4X65 B;  3SYA A;  2LQT A;  1VQ4 V;  1K5Q A;  4KUM A;  5BMV A;  4RO2 A;  1FYJ A;  1M93 A;  4WFA V;  4JYA O;  4LH7 A;  3CRQ A;  3BFR A;  4LBE C;  1DF5 A;  2OCC C;  1QVG U;  1JJ2 U;  5E79 Z;  3CS5 A;  3WFV A;  4J11 A;  4PEL A;  5K1P A;  3K59 A;  4B3R B;  1G8M A;  5KMG A;  4DV1 O;  4IL6 Z;  2HP8 A;  2OYQ A;  5CBG A;  4DV3 O;  4YJ2 B;  2HKO A;  2HEP A;  3CP1 A;  2QE7 G;  1SQV H;  1US6 A;  4FLU A;  4PDV A;  1ROP A;  4J10 A;  4HYO A;  1Z5V A;  1S0V A;  2XAJ A;  3E8G A;  2F43 G;  1GN6 A;  3ZHS A;  2ZM6 B;  3SGI A;  3JAT A;  1IXM A;  5EBW C;  2A9H A;  1MSW D;  5L3B A;  2P90 A;  1EFR G;  1OCO C;  1HNZ B;  4U3J A;  2X0L A;  5KHG A;  4JAV A;  1GMG A;  3IGA C;  1K5S A;  2VQE O;  2Y4U A;  5A2Q N;  3IFX A;  3OMN B;  4JAU A;  4EKW A;  4E2L A;  2JIZ G;  4LF4 B;  4FZ1 A;  3ZMV A;  4JI1 O;  5FPO A;  1WJZ A;  4FJC C;  3CSX A;  1YIJ V;  1JFF B;  2ZIM A;  5JCO C;  4TV8 A;  4FLY A;  1HNX B;  1D2D A;  3ZS8 C;  4O2A B;  1J95 A;  1UPG A;  2Y0I A;  1R73 A;  3I55 V;  4K8X A;  1MA1 A;  4EFE A;  2K1E A;  1AJQ A;  5GW7 A;  1Y74 B;  3PJS K;  3OUF A;  2JRI A;  1YTF D;  3B09 A;  1WP8 A;  4DR6 O;  1U97 A;  3T1H B;  2F1M A;  4JI8 B;  4OXS A;  3OUS A;  3T1Y O;  2NLJ C;  2LGW A;  3ASN B;  4O4H B;  3ZN0 A;  5B1N A;  1MMM A;  3CC2 V;  1WPX A;  3U11 A;  2AZ0 A;  4O4J B;  4PDL A;  1BS3 A;  2JGU A;  1F4M A;  2EX3 A;  4BIZ A;  4W4K A;  3HR0 A;  2DN9 A;  4MVS A;  3CX5 F;  5BR8 O;  4YY3 B;  2X6A A;  1QQC A;  3T4D A;  2ZDI C;  3K79 A;  2QEX V;  3CCQ V;  2X6C A;  5IYZ B;  3RYI A;  1HR0 O;  2Y69 B;  1N8R W;  4WFB V;  1Q6H A;  3CXH F;  2XOK G;  1SRY A;  2P4V A;  3MHS C;  3BRC A;  1H2N A;  4AIL C;  4JPR A;  4IGG A;  3F5T A;  4QJF B;  1YEW A;  4JZG A;  2XT9 A;  1H2L A;  1NBM G;  1OHH G;  4TUY A;  4AQY O;  2FB5 A;  1TUB A;  3UO3 A;  4Z2W A;  2M6Y A;  1IZ3 A;  4DV0 B;  3SYC A;  4LFC O;  2A06 H;  1NTK H;  4IIJ A;  3ABL C;  2AHZ A;  2NNU A;  3B8N A;  3ZCC A;  1N32 O;  2WLI B;  1KP3 A;  1CPY A;  4B3S O;  3DGE A;  3RN4 A;  1M4U A;  4RAI A;  3W7U A;  1Q82 W;  3JD3 A;  2IJJ A;  5LGT A;  5H6Q A;  4QE9 A;  1SER A;  3ZMU A;  4PJ0 Z;  2CAZ C;  2QWN B;  3LSQ A;  3EFF K;  1M57 C;  2E5L O;  1LUW A;  2YSU B;  1K97 A;  5B1O A;  1UFI A;  3K04 A;  3P3P A;  5KHK A;  4UVC A;  2UXD O;  2RQ6 A;  2XTA A;  1TVK A;  1VQ9 V;  1Y67 A;  2RCV A;  1F4N A;  1P84 F;  4W4L A;  5BXZ A;  2QKC A;  1PL0 A;  4DUY B;  1AR5 A;  3W7X A;  2DOS A;  4DW0 A;  1FFT B;  1N36 B;  4P2Z A;  4B08 A;  3ASN C;  1XBL A;  5C8Y B;  4GYC B;  2VWK A;  4UB8 Z;  3THO A;  1KBH A;  2KG7 A;  1WA8 A;  2WA3 A;  5FL7 G;  1D5N A;  4CS3 A;  2UXN A;  4LF6 B;  1M9N A;  4LF7 O;  3ZRW B;  2WPD G;  4CS4 A;  1K33 A;  3QO8 A;  4UCT A;  4K0K B;  2E75 B;  4LH6 A;  3ZRX A;  3ZMS A;  1PNM A;  2WLL B;  2ZR3 A;  4LR3 A;  2ZIO A;  3CWB H;  1SKV A;  2YXL A;  4JI4 B;  4FFK A;  1SZX A;  2JS5 A;  3I56 V;  1NI8 A;  1AP5 A;  3TJT A;  1JR9 A;  4GT1 A;  3OT7 A;  4JAA A;  3SDL A;  2PYJ A;  2JEX A;  1T5E A;  2PI4 A;  4LF9 B;  1OCZ C;  1PPJ H;  2O57 A;  4CH6 A;  2QA4 V;  4DV1 B;  3AEI A;  2JDI G;  1RSO A;  2HJD A;  3H1L H;  3WB1 A;  4TV9 A;  3M99 B;  3QTC A;  2UU9 B;  4F4L A;  5CBF A;  1KEC A;  4DR2 B;  2Q4P A;  4TT3 G;  1JVM A;  2ZDI A;  1JPX A;  2YXH A;  1Q3E A;  4ZHQ A;  4TQF A;  2E3C A;  2QTO A;  3JCU Z;  4EFB A;  2IM9 A;  3AK1 A;  1BCC H;  4ZOL B;  5KHI A;  2QTS A;  1VQM V;  5IJ9 B;  4WFH A;  4GX1 A;  2WWW A;  5D5Q A;  4ABM A;  4DR3 B;  5DM6 V;  5JH7 A;  3OD4 A;  1NT2 B;  4JI3 O;  4YIO A;  4LCU C;  4DV4 B;  3K08 A;  4NVP A;  3CJH B;  1GTO A;  2QM7 A;  5KLV H;  5GON A;  2QKA A;  3CEI A;  3WG7 C;  1OCR B;  3E35 A;  5F2V O;  2E74 B;  4ZKI A;  2WLH A;  3SPG A;  1XNQ B;  1RPO A;  4LNU A;  2ZNJ A;  2V1D A;  4QIW F;  5KMG B;  2FKX A;  4RUE A;  3L75 H;  4GX5 A;  3T1Y B;  1QR8 A;  1S5H C;  4DK1 A;  4ZHQ B;  5L3G A;  4IYI A;  1VQN V;  5LMN O;  2EIK C;  2YEV B;  3ZRV A;  1F7Y A;  4PI0 A;  2YIC A;  1M90 W;  1PNK A;  3JAL A;  4YY3 O;  1QU7 A;  2DMX A;  2OIG A;  4JYB A;  3CRR A;  1HDJ A;  2F95 B;  1YZB A;  3AG4 B;  2BOB C;  1XHZ A;  3R66 A;  2BTQ B;  3JAW A;  3K06 A;  3GWK C;  4X1I B;  2VS0 A;  2ETN A;  4U3J B;  4X1K B;  4A5U B;  1F51 A;  2JJ2 G;  3FYE B;  3RBZ A;  2HR3 A;  3CJH A;  4DV7 B;  5AG2 A;  2JJ1 G;  4AHC A;  3P30 A;  3J81 N;  2ITC C;  3KCY A;  3RYF A;  4QPJ A;  4R50 A;  1SA0 A;  3E83 A;  2FL4 A;  4WFG A;  1M56 C;  1K4D C;  1FKA O;  4FZ0 A;  5LBQ A;  2WLN A;  3APQ A;  1Q90 D;  3E22 A;  5E1A C;  4X64 O;  2B1I A;  2P06 A;  2Q7H A;  3ICX A;  4G28 B;  5EBL C;  3B8M A;  4XBF A;  1K4C C;  1Q5O A;  1LNQ A;  3RGB A;  1BHA A;  3M7M X;  3SPC A;  1XIL A;  3ABT A;  4MVR A;  1S3J A;  1N32 B;  3A0H Z;  3OR6 C;  1JA8 A;  1IBM B;  3W7W A;  5CA0 B;  2HVJ C;  1I08 A;  3A0R A;  1NR7 A;  3CXC U;  3CC7 V;  1I94 O;  5LA6 A;  3QO7 A;  5JJJ B;  2ZE8 A;  4RWU A;  2WA4 A;  3RYH A;  2HG5 C;  4JI0 O;  4MVO A;  5IY5 C;  3K03 A;  2HJF C;  4H44 B;  5LYJ B;  3BAB A;  4IT5 A;  4MSW C;  4GKJ O;  4UVA A;  3E8F A;  3F7V C;  4LFB B;  2F66 C;  4H0L B;  1FPO A;  1BHB A;  1IBK B;  4RQF A;  1V55 C;  4J9Z B;  3JAM N;  3OMA B;  1PL4 A;  5CA3 A;  4NXN B;  5IYZ A;  5IYC O;  3RYI B;  1SQX H;  1YCI A;  1FJG O;  1YI2 V;  5HFL A;  3G4S V;  3MAQ A;  3JAS A;  5IYB O;  2CTR A;  2H3O A;  2CGO A;  4I7Z B;  1H2S B;  1H38 A;  1K8A W;  3GB7 C;  5ITZ B;  2UXC B;  4R8C A;  2HLD G;  3T4Z A;  3BEH A;  3LNN A;  3S3X A;  1DLB A;  2BCC H;  2ZE7 A;  1N34 O;  1H8E G;  5B5E Z;  2ILM A;  4R7C A;  1RFY A;  2ODM A;  1TUB B;  4KHP O;  1E1Q G;  4PDR A;  1VQL V;  4UB6 Z;  1S77 D;  2MK3 A;  2YI9 A;  4JI4 O;  4QPK A;  4MTF A;  3UO2 A;  1L8D A;  3LDC A;  4GX0 A;  4J7J A;  3WB2 A;  4F6R B;  4IHJ A;  3SPJ A;  4ICG A;  4O4I A;  1JCH A;  1VAR A;  3UT5 A;  1TUE B;  3STL C;  2DQ0 A;  2QJ1 A;  2ZNI A;  3UM7 A;  2ZM6 O;  3UCS C;  1N0N A;  5BMV B;  2DE0 X;  2ZE5 A;  4NKG B;  2F93 B;  5LGN A;  1MSD A;  5ITZ A;  1N33 O;  4JI2 O;  3OTF A;  4I0X A;  1GRJ A;  2EUL A;  3HKB B;  3GWO A;  1SZT A;  4C7U A;  5LHI A;  1IBL B;  1FXV A;  1URF A;  3LDE A;  2XHB A;  2LW7 A;  1GO3 F;  2CK3 G;  3CCE V;  1NQT A;  4YJ2 A;  4K3A A;  2EIJ B;  3CD6 V;  2RNB A;  2LGQ A;  2LO1 A;  3H01 A;  3C3S A;  4JI7 O;  2E76 B;  4DR3 O;  1K9M W;  4RUF A;  4XDJ A;  1RM1 C;  3JAT B;  2D2C B;  2LP7 A;  4B3M O;  2Q7G A;  2ZD9 A;  4DV5 B;  4Q20 A;  3C90 A;  3SPH A;  1AI6 A;  3CRM A;  1H2M A;  4UUJ C;  2VQF B;  1M1K W;  2DYS C;  5HFM A;  1VQO V;  4JI5 B;  1GM9 A;  4B7E A;  4JTA B;  3ZBH A;  1XNQ O;  1ENV A;  4YHH O;  2MW2 B;  4TOI A;  4LC1 A;  3HKC B;  1ZWI C;  2LFS A;  3HKD A;  2Y48 A;  5KUK A;  2Q67 A;  3O9O A;  4EEQ A;  5JQG A;  4TV8 B;  4JYY A;  3TET A;  2N74 A;  3E8H A;  3EHB B;  2EBO A;  1SES A;  5TIS Z;  2QWQ B;  1SQB H;  3RW0 A;  1R3L C;  2DWD C;  4JZ2 A;  1SQQ H;  4UCS A;  2YDE A;  4K35 A;  3AG4 C;  3CCU V;  3K3W A;  3FD9 A;  4N21 A;  1BL8 A;  5EBM C;  2GTS A;  3JYC A;  1JMK C;  2YC0 A;  5JVD A;  4HBN A;  5L3F A;  2AW9 A;  4O4H A;  2ZIN A;  1Y76 A;  4H13 B;  4O4L B;  4X66 O;  1XMQ B;  4O4J A;  5IJ9 A;  3O65 A;  4I5S A;  1MZF A;  3ZHR A;  3F5W C;  2OTJ V;  2LJ2 A;  1AP6 A;  3ML0 A;  2X7R B;  4DV6 B;  2HHH B;  1NZ6 A;  2CUG A;  2RMK B;  2EIJ C;  4NTW A;  5GTH Z;  1VQ7 V;  1DF4 A;  2R70 A;  3CYO A;  4HNA B;  2HFE C;  1IDS A;  1V55 B;  2QM8 A;  3G80 A;  4X1Y B;  3MDS A;  2EIK B;  1NJI W;  4PHZ A;  1JJO A;  3B4S A;  3DC6 A;  5B3S C;  2YUA A;  1L0N H;  4UVB A;  2IU0 A;  4HZ3 A;  1KC8 W;  1QBZ A;  1YJW V;  1HNX O;  3OW2 U;  2ZCE A;  4J7Z A;  4JI0 B;  1ARO P;  2OIE A;  1HWY A;  1NKD A;  1H8H G;  2WSS G;  3RYC B;  1VF7 A;  1BQ0 A;  2UXD B;  2A79 B;  1VQ8 V;  2QKS A;  1V54 C;  3SJC C;  2WLI A;  4LF5 B;  2GTA A;  3K0D A;  4OGQ B;  3VQW A;  4CZZ A;  3OM3 B;  3C3T A;  2PY5 A;  1M56 B;  4H37 A;  4X1K A;  5KHH A;  2GV9 A;  5LXT B;  4WFF A;  3SYQ A;  3CB2 A;  4HNA A;  4UCV A;  3AK2 A;  1NH2 D;  1VP7 A;  1JFF A;  3RYF B;  4DR1 B;  4QGP A;  3NXS A;  4Z1V A;  1SA0 B;  1EBO A;  2CGN A;  3JD2 A;  3AK3 A;  2JVD A;  4KHP B;  3QO5 A;  4N23 A;  1E79 G;  3FB8 C;  5IYD O;  2RJZ A;  3W7T A;  4MTX A;  4UCO A;  5FNV A;  3WU2 Z;  1HW7 A;  5J2U A;  2XAG A;  5CBH A;  4X89 A;  4JI6 O;  3H1J H;  3Q4H A;  5EYP A;  2WLM A;  3BCC H;  5LOV B;  1Y66 A;  2W6J G;  3OR7 C;  1W0K G;  1QLE C;  3CE2 A;  2Z0A A;  2OT5 A;  4J42 A;  3RVZ A;  2NR5 A;  1B3Q A;  4LFC B;  4GCZ A;  2GSM B;  3L71 H;  5IT9 N;  1KB9 F;  5IE9 A;  5IY5 B;  3FAV A;  3L74 H;  1NVP D;  4Q6G A;  1DK1 A;  3H1I H;  5LXT A;  4DR5 B;  1L0L H;  4GKK B;  4FPP A;  4UXN A;  2WLK A;  2QSA A;  1K73 W;  1WNS A;  1YTF B;  2UXB B;  2A7W A;  3BA8 A;  3ABM C;  4U3F H;  2ZKO A;  1G1X B;  1RPR A;  4GX2 A;  1AB3 A;  2YIA A;  3K5O A;  4LF8 B;  1RSO B;  2QGN A;  2E5L B;  4D7T A;  4TV9 B;  1PP9 H;  5CB4 B;  3TXS A;  1AJN A;  1ZUQ A;  5J2U B;  2JGD A;  2CTQ A;  1S76 D;  5JCO A;  1YF2 A;  2R9A A;  4F6E A;  3HB3 B;  3X2Q C;  1XNR B;  2CH7 A;  3CME V;  1ZLZ A;  5KA6 A;  1R3J C;  3AG3 B;  2P7T C;  2FML A;  4ZI7 B;  3B2E E;  4FMT A;  1LUV A;  5A9G A;  4I55 B;  4LFA B;  5JJE B;  4PA9 A;  1NR1 A;  4GUN A;  3A8T A;  5LP6 C;  4MVQ A;  2XAS A;  3ZHT A;  5B66 Z;  4K0K O;  3VBB A;  2ATK C;  2BTO A;  3SJA C;  3RVY A;  5JH7 B;  1V54 B;  3L70 H;  4R6Z A;  2DWE C;  4P30 A;  3ZJZ A;  1TGO A;  1Q6U A;  4JV5 B;  2H94 A;  3VQY A;  4B3T B;  4YJ3 A;  1JX9 A;  4NTX A;  5KUM A;  2KQX A;  3FB5 C;  5D5P A;  4X62 B;  1TVK B;  2DW4 A;  3TGU H;  4DUZ O;  2KB1 A;  5CB4 A;  1BE3 H;  1YJ9 V;  5CN0 A;  1COW G;  3SR2 C;  4YIP A;  4WBN A;  3G71 V;  4LNU B;  3ETE A;  3J80 N;  1I7F A;  3RWR D;  1K7D A;  5IWA O;  4JAS A;  2QDO A;  3CC4 V;  2CH7 B;  4FVM A;  3ZRW A;  2QR4 A;  3QG5 A;  4DR4 O;  1VQ6 V;  1XMO B;  2PZS A;  2YIB A;  4Z1M G;  4UCU A;  4X88 A;  3JAR A;  4JTC B;  5K1X A;  2Q6A A;  3SPI A;  3ABK C;  1NVP B;  4DV2 O;  2IU3 A;  3BVO A;  4JI1 B;  4NR1 A;  3ZN1 A;  3DXR A;  2UUB O;  3E2E A;  4J41 A;  1GH6 A;  3EVK A;  4CS2 A;  1EM1 A;  2PGG A;  1SS3 A;  1XOU A;  1BSM A;  1KYO F;  5CMU A;  2A0L A;  4YJ3 B;  4G2K A;  1N4C A;  3FYI B;  3CCM V;  1SQF A;  1M57 B;  3BA9 A;  4DV4 O;  2PTM A;  3AG1 C;  2EJ7 A;  3HKD B;  5IJ0 A;  5EK0 A;  4TSF G;  2F4V O;  3K5M A;  2G38 A;  2Q73 A;  3QF7 A;  2IH1 C;  2OCH A;  2B5U A;  3P32 A;  2P5O A;  2JS3 A;  2X6B A;  1KKC A;  1R3K C;  1QHT A;  2ZR2 A;  4D7S A;  1IVS A;  1X59 A;  2N04 A;  4JI8 O;  1HNW O;  3ABL B;  4FM1 A;  1N36 O;  1WB8 A;  1FXK C;  4D6T H;  2P22 C;  1BZK A;  2GBO A;  1GN4 A;  3EXA A;  1B04 A;  1I0H A;  3N2K B;  4X65 O;  1Y6X A;  3JAK B;  3JAR B;  3VQV A;  5BR8 B;  1KD1 W;  4H33 A;  3ZED A;  1N34 B;  1Q43 A;  3FX7 A;  2QWP B;  3ZHU A;  5LP6 B;  1AR4 A;  4JYA B;  4J9Y B;  3K9S A;  2V7Q G;  3SYO A;  4I4T B;  1J5E B;  4B3R O;  3X2Q B;  4NXM O;  1X4T A;  2QWO B;  3LSS A;  1QNM A;  3LSU A;  4BIU A;  5IJ0 B;  4CC5 A;  3MHH C;  4AI8 A;  4FLZ A;  2W0F C;  1SF9 A;  1EN4 A;  4JI6 B;  1IXB A;  3JAS B;  1KKD A;  3ABM B;  4AQY B;  3FB6 C;  1H2G A;  2YXY A;  1VIB A;  4DV0 O;  2UU9 O;  1XQ8 A;  2IJH A;  4L87 A;  2UUC O;  4I50 A;  2YEV A;  1MZE A;  2YI8 A;  3K9A A;  3QNE A;  5L3C A;  1W59 A;  1PM9 A;  3JAL B;  1CXZ B;  1WN7 A;  4EB6 B;  1KU9 A;  3RYC A;  3CPW U;  3N2K A;  2LFR A;  1KMI Z;  2AZ2 A;  3CMA V;  4UFZ A;  4DR5 O;  1N33 B;  1R6N A;  4GKK O;  2CE4 A;  3K0G A;  4QNH B;  3JAW B;  3ZRS A;  1OCC B;  4MT8 A;  1FD9 A;  4MTO A;  3QVN A;  4UV9 A;  3KKY A;  1P7B A;  5B1B C;  3KZI Z;  1IX9 A;  5C93 A;  4JTD B;  2EZO A;  1VQK V;  1Z5W A;  1OV9 A;  4MW3 A;  3OTO O;  4LF8 O;  3P3N A;  2JEU A;  2P4K A;  3JD1 A;  4WFE A;  1ORQ C;  1KP2 A;  1OJH A;  2ZXW C;  1NS1 A;  4JI7 B;  4DRX B;  5EC1 C;  1NH2 B;  5BY1 A;  2YS8 A;  4FK5 C;  5JWP A;  2DYR B;  4K8Z A;  4PA7 A;  5DEC A;  2L6L A;  3RT3 C;  4NTY A;  1SQG A;  2EIM C;  1RP3 B;  1EZV H;  2YID A;  2B9Z A;  1XNR O;  5FLX N;  2HVK C;  3BY6 A;  4TUY B;  4JI5 O;  2BOC C;  5LA6 B;  1UJW B;  5FNV B;  2EZP A;  2W6I G;  3K5L A;  5CA1 B;  5B1A C;  4LFA O;  2DYR C;  2Q69 A;  3T1C A;  4U7O A;  4IIJ B;  3DTU B;  2Q9L A;  2CTP A;  3IAY A;  2UUA B;  1U96 A;  2AHY A;  4FFB A;  1SET A;  4O2B B;  3OGI B;  4JV5 O;  4J80 A;  2ADQ B;  2ARH A;  3L72 H;  5GTI Z;  3CCJ V;  4DR7 B;  4UCR A;  4B3T O;  4LF9 O;  2KSD A;  1FAF A;  3FAV B;  1AR1 B;  3GVM A;  4GZR B;  4DV3 B;  4DUZ B;  2XAQ A;  1BQZ A;  2ZT9 B;  1YHQ V;  2C2A A;  4OX9 B;  4BIO A;  1KQS U;  4DK0 A;  3I5D A;  3HKC A;  1Q6I A;  1FXK A;  3CRC A;  3D3Q A;  1IUR A;  4P9O A;  2L35 A;  4LWS B;  5JQG B;  3H9V A;  4PA6 A;  4X64 B;  1Y74 A;  4OPH A;  2AGA A;  4X8A A;  1XMO O;  2VQE B;  3ASO B;  4QE7 A;  1QLE B;  4JI2 B;  1QLN A;  4B3S B;  3D36 C;  1MOF A;  1NU1 H;  4MW8 A;  4LF4 O;  1N0J A;  1XUQ A;  1IBM O;  1ZSP A;  3TCU A;  4FLV A;  4PD4 F;  2KG7 B;  1WA8 B;  3TK1 A;  4P9P A;  4DV2 B;  1Q7Y W;  5IDJ A;  2XND G;  4FFB B;  3IC9 A;  1S5L Z;  5B1A B;  5JVD B;  4F6R A;  5L3D A;  2BE3 A;  3TXQ A;  2CTW A;  1Q86 W;  2P67 A;  1OCO B;  1GN3 A;  1VF6 C;  1FS0 G;  5H9C A;  4BW5 A;  2Y4T A;  2D3O W;  1PV0 A;  3OGC C;  4DV5 O;  2DJV A;  1P4R A;  1QR9 A;  3CHX A;  1B06 A;  2Y0P A;  1WP7 A;  3LNM B;  1P49 A;  1FXK B;  4LF5 O;  4X20 A;  3FFQ A;  4X1Y A;  1HNW B;  4I0X B;  3HKB A;  3N2G B;  1R1B A;  3ZHV A;  4WF9 V;  1FFX B;  3K5N A;  2YIB D;  5KX5 A;  3JCZ A;  1THZ A;  2KKW A;  1SQP H;  5H6R A;  2H8P C;  1VEW A;  3JSL A;  3CCL V;  4ZBM A;  2JK5 C;  4IYH A;  3DC5 A;  2IJI A;  1QVF U;  1ZL8 B;  3ZMZ A;  2PI5 A;  4XDL A;  1RM1 B;  1R6T A;  1I5X A;  2AXT Z;  5EZY A;  5KA5 A;  3CCR V;  1NTM H;  1O9G A;  4ZOL A;  3G6E V;  1PNL A;  3BHP A;  2GUZ B;  2PF4 E;  4DV7 O;  4G27 B;  1YDX A;  1XL6 A;  2P6J A;  3W7S A;  1NTZ H;  2XAF A;  3WG7 B;  2IJK A;  4NXM B;  1MG1 A;  3IC7 A;  4BR6 A;  3BAA A;  1TAE A;  3D3I A;  2PYL A;  1R6K A;  1YXB A;  1AIL A;  4KXR A;  1E1R G;  1SC5 B;  4MVZ A;  3U0Z A;  1CEZ A;  5GON B;  3JD4 A;  1O9H A;  4LP8 A;  4DR2 O;  2UUC B;  5LMU B;  5JJN B;  1M5I A;  1KUQ A;  3N2G A;  2ZE6 A;  4DV6 O;  3H1H H;  1TA8 A;  1DGS A;  3KG2 A;  2GDS A;  2WAM A;  3ZMT A;  1Z2G A;  3U10 A;  4DYL A;  3E8B A;  3SJQ C;  4UV8 A;  2RN9 A;  5C8Y A;  1WB7 A;  3FKS G;  1ZAU A;  2NN4 A;  3ZX6 A;  3E89 A;  5L3E A;  1W2B U;  4CBC A;  1XDC A;  2ZXW B;  4PA4 A;  1AI4 A;  5KHJ A;  4DO2 A;  4BWA A;  4O4L A;  1H2K A;  3K57 A;  3KCX A;  4J7K A;  1BGY H;  3JSN A;  1GN2 A;  2EIM B;  4JI3 B;  4E4E A;  4LFB O;  3JAK A;  1FXH A;  5B1B B;  3ETQ A;  3MD0 A;  2EIN C;  2BTQ A;  2Z5U A;  2IH3 C;  1EZJ A;  1YSC A;  4CH5 A;  1OCC C;  5LP6 A;  4B3M B;  2IW5 A;  5KAF Z;  1OCZ B;  4KL1 A;  3D36 A;  4PDM A;  2VQF O;  4FM2 A;  3OAA G;  1JOY A;  3L73 H;  4B7K A;  2M7W A;  4NB5 A;  5H2F Z;  1DTO A;  1GM7 A;  4O2A A;  4LF7 B;  1P7G A;  2Y69 C;  1R3I C;  5LMN B;  1G4Y B;  3CCS V;  4HAM A;  2CDY A;  1LR1 A;  3AG2 C;  1AI5 A;  2UUA O;  2XUM A;  4PI2 A;  4I50 B;  2Q5Z A;  3J7A U;  5CA0 A;  3SJB C;  3S3W A;  4FLX A;  4U7N A;  1WPB A;  3OE7 G;  2Q7E A;  2ITD C;  2OCC B;  4DR7 O;  4EB6 A;  4MTG A;  3AG2 B;  4CC6 A;  3RYH B;  4ZI7 A;  1YJN V;  4I9W A;  4I55 A;  1QCE A;  2R72 A;  1BMF G;  4OX9 O;  5LHG A;  5LYJ A;  3B77 A;  4X66 B;  1XMQ O;  2QWR B;  3OMI B;  5IWA B;  2Q0A A;  4YXW G;  3ETG A;  2Q0O C;  1HNZ O;  4TWK A;  4MVU A;  2B1G A;  2V4D A;  4MS2 A;  1Q8I A;  2FYU H;  2DQ3 A;  2EIL C;  1K92 A;  4DRX A;  1VF5 B;  1XRE A;  3FB7 C;  1GAX A;  2UXB O;  1IBL O;  1VQ5 V;  2F23 A;  4ZIB A;  1VMG A;  5LHH A;  1B6Q A;  3T2M A;  1I94 B;  3WB0 A;  4TQD A;  3A2F A;  3LUT B;  2UUB B;  3SYP A;  4I9Q A;  3HPL C;  2EIL B;  1L1F A;  3Q4H B;  5EYP B;  1YVW A;  5LOV A;  4ASU G;  5CA1 A;  4FM0 A;  3AG3 C;  3E86 A;  1OZ0 A;  2RDC A;  2LW1 A;  4OPA A;  4RQE A;  1YIT V;  1AJP A;  1HP8 A;  1JQ0 A;  3ZHQ A;  3RFR A;  5EC2 C;  4PV1 B;  3NR7 A;  5KAI Z;  2XAH A;  3VOU A;  3F7Y C;  4X1I A;  1MAB G;  4DR6 B;  3AG1 B;  1GK9 A;  3IJ4 A;  3T1H O;  4NXN O;  2R9I A;  4O2B A;  3ABK B;  4NYK A;  5BZB A;  3ZIA G;  1PD3 A;  4O4I B;  3CCV V;  4CH3 A;  3UT5 B;  2IBZ H;  4YHH B;  3B40 A;  1W0J G;  3ABU A;  2OTL V;  3CRA A;  1WAZ A;  2VRZ A;  1XI1 A;  5FPR A;  3E22 B;  4WCE V;  3H1K H;  4DXW A;  1Y4M A;  1EN5 A;  1V9P A;  3JD0 A;  3APO A;  3ASO C;  4DR1 O;  1HR0 B;  5EIB C;  5J2T A;  1D5A A;  2PUS A;  2JGD B;  3PN1 A;  4LWS A;  2A3Q A;  3BPZ A;  4X62 O;  1K34 A;  1BT8 A;  5DED A;  2UXX A;  2ADP A;  4FLW A;  3A0B Z;  5J9P C;  5B3S B;  2WLJ A;  5H5N A;  2QM4 A;  1PKX A;  1J5E O;  1OCR C;  1GM8 A;  1ZX3 A;  2R9R B;  1XL4 A;  1F23 A;  1S5J A;  2BSK B;  3OEE G;  1MNG A;  4FIP C;  4FLT A;  3M8A A;  3HKE B;  2WLL A;  3N27 A;  2EIN B;  4JF3 A;  3OFN G;  3ETD A; 
#chains in the Genus database with same CATH homology
 1IVS A;  2LW1 A;  1GAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...