5FL7G

Structure of the f1c10 complex from yarrowia lipolytica atp synthase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
270
structure length
267
Chain Sequence
TLREIEMRLKSIKNIEKITNTMKIVASTKLGKAQRAMATSKVYNEASEKVFENSETAVPENIEKRLWVVVSSDKGLCGSIHSQLARTVRRKLLDGEKLIDIVAVGEKIKAQLGRSNPEQMRLSFGGTGKEAPTFEEAAHIADEILALDTQYDDIEIVYNKVLSGISFEPIMKESYSAKAIEDAPKFGQYELEDDVVKNLADFSLANTIYAAMAEGHAAEISARRNAMDNASKNASDMINKYSILYNRTRQAVITNELVDIITGASSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA
publication title Structure of a Complete ATP Synthase Dimer Reveals the Molecular Basis of Inner Mitochondrial Membrane Morphology.
pubmed doi rcsb
total genus 63
structure length 267
sequence length 270
ec nomenclature
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00231 ATP-synt ATP synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5fl7G01
3.40.1380.10 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate Kinase; Chain: A, domain 1 5fl7G02
1W0KG 4UV8A 5L3GA 4CZZA 4UVCA 4Z1MG 4BAYA 3ABTA 3OE7G 5LBQA 2EJRA 4UV9A 2QE7G 2XNDG 3OFNG 2W6IG 2HLDG 5LHHA 1MABG 4YXWG 1NBMG 2XAJA 2WPDG 2Z3YA 2WSSG 2JJ2G 5FL7G 2X0LA 1W0JG 5L3EA 5LHIA 5LGTA 4UXNA 2XASA 2Z5UA 2F43G 1H8EG 5L3DA 2UXXA 5L3BA 5LGNA 4TSFG 1EFRG 3ZMSA 2XAGA 3ZMZA 3ZN0A 3OEEG 2R9IA 3ZIAG 2CK3G 5H6RA 1FS0G 3OEHG 5LHGA 2UXNA 3ABUA 2DW4A 2XAFA 4UVBA 2W6JG 5L3CA 2V1DA 4KUMA 2XOKG 5L3FA 1H8HG 1BMFG 2HKOA 2V7QG 3ZMTA 2H94A 2Y48A 2XAQA 4XBFA 5DN6G 3ZMVA 4TT3G 4ASUG 2JIZG 3OAAG 2JDIG 5LGUA 4UVAA 3ZMUA 3ZN1A 1E1QG 1OHHG 1E1RG 3FKSG 2IW5A 1COWG 5H6QA 2XAHA 2JJ1G 1E79G
chains in the Genus database with same CATH superfamily
1DF4A 1HNXO 4H44B 1L0NH 3KTXA 2M6YA 5GW7A 1VQ9V 4DV2B 4LF4B 1VP7A 3PJSK 2IU3A 2R9AA 4BR6A 3FFQA 4DR5B 4PV1B 1KP2A 4B3RO 4O2AB 2HJFC 1WB8A 2WA3A 1JOYA 3ETEA 3K58A 5LHIA 3GWKC 2ZE6A 2IU0A 4BW9A 2G38A 3OR6C 3FB7C 1NH2D 3KG2A 2CTPA 3E0VA 5GTHZ 3OEEG 4BWAA 1G8MA 2O57A 3ZRXA 3J7AU 3RGBA 3T4DA 3UKMA 1SERA 3LNMB 3W7SA 3SYAA 1FAFA 1KMIZ 3CYOA 1D5AA 5KX5A 4FFKA 3K57A 3IS4A 3D36C 5ITZA 2XAQA 4DV6B 4DR4O 2BTOA 1VQOV 4CH5A 4R6ZA 4ZKIA 1RM1C 4TQDA 3BJFA 3E8BA 2HJDA 1TUBA 3QNEA 3FKSG 4TUYA 4DUZO 3GG8A 3E22B 3QTGA 4U3FH 1NKDA 3GQYA 3FB5C 4QE9A 1YJNV 3DXRA 3SRDA 1NR1A 4X65B 5F2VO 1VF6C 1JQ0A 4D7TA 4LH7A 4MVRA 2E5LB 1ZUQA 5GONB 2YEVB 3D8CA 2GTAA 1F51A 1VQPV 1S76D 1Y67A 3HR0A 2R9RB 4IYHA 1IURA 4C7UA 3DC6A 4P9OA 1L8DA 1XBLA 2WAMA 2Q69A 3U0ZA 4MSWC 5JCOA 4I0XA 1AI6A 1M56C 4MVOA 1E0UA 4GKJB 1GM8A 2CAZC 2ZDIC 1JFFA 1N8RW 2YXHA 3UCSC 1XQ8A 4J42A 1PNLA 1GN3A 3K06A 1J95A 3ICXA 3UO2A 3CPWU 3SJQC 2RN9A 2BE3A 4JGSA 4FLTA 1T57A 3JATA 3QO5A 4JI8B 4YNGA 4F6RB 4YJ3A 5CMUA 3BA8A 2UXCB 3VQYA 2ZM6B 3AG3C 2DE0X 3STLC 1UFIA 1R6TA 2NLJC 3AG2C 1MMMA 2Y48A 2GUZA 2HEPA 2ZR2A 2C2AA 5DN6G 2OCCC 2JGDB 3CCSV 2AHYA 1HR0B 3K5LA 5EBLC 5LP6A 4UCUA 4KHPB 4DV4B 3K5NA 2EIMB 1K8AW 2N04A 3TGUH 1BS3A 2ZCEA 4HZ3A 4JZGA 1SF9A 5KA5A 4NYKA 1NVPB 5IJ9B 1US6A 1PKMA 3M8AA 2LGWA 2VRZA 3JARB 5LMNB 3X2QC 2FYUH 2FL4A 5BR8O 4GX0A 3LDCA 4LFAB 3RYFB 2OWOA 1S77D 4YIPA 2P4VA 1RP3B 1BT8A 2MK3A 3IFXA 2PY5A 5LHHA 2YI8A 1VARA 3QF7A 1IBLO 4DV5O 1V55B 3SPGA 4MVMA 3A8TA 4YY3O 1O9GA 2CUGA 5CBFA 4DR1O 2CTQA 1FXKA 4RO2A 2RJZA 1R3KC 1A32A 1XDCA 1RM1B 1IBKB 4J10A 1JJ2U 3I56V 4WFEA 1F4MA 2ZD9A 1VF5B 4DV1B 4O4JB 3CS5A 1THZA 2ZIMA 3MHSC 5IYZB 5D5PA 4DV2O 3GVMA 3K9SA 3ABKC 4LF4O 3AEIA 3MHHC 1H2LA 5KHKA 1DLBA 2PYJA 3U2ZA 3JD4A 4D6TH 3E8HA 3SYOA 4DR5O 5B3SC 3MA8A 1JMKC 1PP9H 4B7KA 1TVKA 4K8ZA 3SRFA 4JYYA 3ZMTA 5BMVB 4PA3A 5B1AB 4OX9B 3N2GA 2H8PC 3G80A 1SQQH 1ZL8B 3OAAG 3N27A 1F4NA 1S0VA 3Q4HB 2RCVA 3L70H 2X6CA 4EEQA 3L75H 2IBZH 3HQNA 1Y76A 4X20A 2Y0IA 2F23A 1WP7A 4KFMA 3BEHA 2WLJA 2QDOA 1U97A 1SQXH 2NN4A 5JH7A 2HP8A 5KA6A 2WLLB 2KSDA 4J80A 2WLHA 1VQLV 2YICA 3AG3B 4AHCA 4RQEA 1T5AA 5LYJB 3ZEDA 4DV6O 4LBEC 3JD1A 3AG4B 4QG9A 1HP8A 4RUEA 2CGOA 5FL7G 3CRMA 3HKCB 4JAAA 4JZ2A 3K03A 3I55V 1GN4A 3UQ8A 3O65A 3WG7C 3ZRWB 3OMNB 3K79A 4PELA 4JTCB 3CCMV 3ZJZA 1ZWIC 2CH7A 4X1IA 1FFXB 1H2KA 2QKSA 3OGCC 5JCOC 4JV5B 1Z5WA 3UT5B 4L87A 5KHGA 1MZEA 5BXZA 1RSOA 3OEHG 2HHHB 3E2EA 4X65O 2ZNIA 3ABUA 4DYLA 3UM7A 3IGAC 2W6JG 2E5LO 4JI2B 3PP7A 1HNZB 3LSQA 5BY1A 4DRXA 2OYQA 5L3FA 4JYBA 1H8HG 1SA0A 1ZJHA 1RPRA 1VQ7V 2ZNJA 4TOIA 1Z5VA 1EN4A 1GMGA 2Y0PA 4U7OA 4GKJO 2PTMA 1KYOF 1IVSA 2B5UA 3JAWA 1WPXA 1S5JA 5LGUA 3JALB 3SRHA 2EX3A 1KB9F 4GCZA 3SYCA 4PA7A 3E83A 1DF5A 3RYCA 5FNVA 1X59A 5IY5C 2Q67A 3OGIB 2EIKB 2JJ1G 5LP6C 5IJ0A 4FM1A 2GV9A 1WP8A 2A3QA 3AK1A 4X1YA 4QG8A 3FB8C 3I5DA 2VS0A 4CH3A 4JI8O 3ZHTA 5LBQA 5IDJA 2UXCO 2ZM6O 2UXDB 1Q8IA 1UJWB 1URFA 4MVQA 2Q7EA 2IJKA 4DW1A 1NBMG 2MW2B 3VQXA 4B3MB 1WLEA 5JQGA 3BA9A 3A0BZ 2CTRA 1HR0O 1VF6A 2DQ3A 2Y69C 4KHPO 2E3CA 4DV4O 4FFBB 1AVMA 5KX5B 3C3SA 4A5UB 5ITZB 2DWDC 2Q68A 5J2TB 2ZXWC 1F7YA 5KUKA 4JI1B 1FXKC 4OPAA 1ENVA 2BSKA 4XDJA 5D5QA 1VQ8V 3CCLV 2X7RB 2XAGA 1AR1B 1GKFA 3T1YB 5LMNO 4B7EA 4LH6A 5DM6V 4KCTA 2QWQB 2AW9A 2Y4UA 4LFAO 1TUEB 1SETA 3AK2A 4P2ZA 1Y6XA 4IT5A 4TUYB 3IJ4A 1S72V 1BL8A 1OJHA 1XOUA 3E86A 2QJ1A 1B6QA 1W59A 2KG7A 4JF3A 2VWKA 1Q43A 3ZCCA 2A06H 2EBOA 2Q5ZA 4L8JA 3OM3B 1IBKO 1IZ3A 4JI6B 3H1LH 4DV1O 4BIUA 3ZMUA 1CXZB 4IIJA 2VGFA 1B06A 1BSMA 3P3NA 3SJAC 4MTGA 1PNKA 1SS3A 3BY6A 5H6QA 1D5NA 5KMGB 3CB2A 4I0XB 2E28A 1Q6HA 4FLWA 4P9PA 1YJWV 1MSWD 3BHPA 3CCJV 4UVCA 1OCOB 2YXLA 2P67A 3ASNC 2VQFB 2QKCA 4LFCB 4HNAA 2Q6AA 4AI8A 1YJ9V 5CBHA 3OFNG 3JAKA 2IH1C 1U96A 2HLDG 3HKBB 3CE2A 4YXWG 2ZE5A 4LNUB 2AZ2A 4OX9O 1AR4A 3RFRA 1XNRB 3C90A 3JATB 4U3JA 4YJ3B 4I5SA 4O4LB 5EBMC 3CJHA 2IM9A 3P32A 1GM9A 5CBGA 1NTKH 1M93A 2IJIA 3CC7V 2XASA 1MNGA 3C3TA 5JWPA 3N2KA 3KCXA 4LF9B 1FXHA 1PNMA 3RN4A 1XMQB 1H2NA 5DEDA 2JEUA 4PDRA 4J9ZB 3ZMSA 3ZMZA 3OW2U 5CN0A 4R7CA 3HPLC 4KCWA 4I55B 2N05A 1YSCA 2EILB 4PHZA 4GX1A 5EBWC 4RUFA 5HFLA 3OR7C 2VWJA 3ETGA 3L74H 2V1DA 5KAIZ 4JI4B 1FD9A 2BTQB 4FVMA 1JCHA 1Z2GA 1V54C 4PDVA 1VMGA 2YUAA 4WJ8A 3S3WA 2ZR3A 1XL6A 4GLXA 3K5MA 3RBZA 5LA6B 1JPXA 1JA8A 3ZBHA 1BHAA 3RT3C 2A79B 2AHZA 1XMOB 4JV5O 1JX9A 4GX5A 4DO2A 1H2MA 5E79Z 1AP5A 4PDMA 2HHHO 3SR2C 4GT1A 3A0HZ 3FB6C 5H2FZ 2LGQA 1NZ6A 5LOVA 1BQ0A 2JEXA 3DGEA 4JI2O 3AG1B 1HNZO 5C8YB 3CEIA 4I4TA 1PKXA 1QLEC 1S3JA 1XHXA 2PUSA 3K3WA 3W7WA 2A7WA 3W7UA 1VQ4V 3UO3A 4UCVA 1I94B 3N25A 2XUMA 5JVDB 2OT5A 1SKVA 4RQFA 4ZHQA 2EINB 1W0JG 2DYSB 5LMUB 1TVKB 4JI7B 2F1MA 1GN6A 4FXFA 3B4SA 1TGOA 4LWSB 4NTYA 1YDXA 4K0KB 4Z1VA 4MW3A 1FJGB 5L3BA 5FPRA 4IP7A 1XUQA 1AJNA 4WBNB 4YJ2A 3SPCA 3CRAA 4ZOLB 2YIAA 3ASNB 4J7ZA 1PM9A 2UXDO 5E1AC 3QO8A 4FK5C 3ML0A 1Y76B 4X20B 4P30A 1G6UA 2JGUA 2DW4A 4O2BB 1HDJA 3LDEA 4B3MO 1M57C 4E2LA 2YSUB 2XTAA 3PN1A 5B1BB 1K7DA 1R3IC 1SQBH 4DR3B 5JH7B 1XREA 1K9MW 4YIOA 3NR7A 4LF5B 4G27B 3SDLA 1M9NA 4GZRB 4CBCA 2RMKB 1NVPD 3CC4V 3CP1A 2JIZG 5EIBD 5EYPA 5JJEB 2DYRC 4ZIBA 5FLXN 1HW7A 1MSDA 2YS8A 1OCZC 3F5TA 4JI1O 1TAEA 1DK1A 4IHJB 3CSXA 3CCVV 2LO1A 4NXNB 2WWWA 1I0HA 3FYEB 1SRYA 3T1YO 2QM4A 3ZHVA 5LL6Y 1IBMB 4O4HA 1W0KG 2FB5A 1PKYA 4MVUA 3CRCA 2YXYA 2UXBB 1WA8A 4QPJA 4I9WA 4JPRA 4UV9A 2XNDG 4PD4F 3RYHB 1K5QA 4HBNA 3H1KH 5IT9N 3JASB 2WLMA 1MABG 4JYAB 1PPJH 3DTUB 3LUTB 4FPPA 1RSOB 3DC5A 3CCQV 4EFEA 1B04A 2OIEA 4JI6O 2X0LA 2ODMA 1EZVH 2DWEC 4DRXB 4JTDB 4TV8B 2Y4TA 1Y74B 4O2AA 4QJFB 1SA0B 2PI4A 2E74B 2ZE7A 3FX7A 1YITV 1F3WA 1SQGA 1N34B 3ZX6A 2K1EA 2UUBB 1AROP 4BIZA 1QCEA 2X6BA 1N33B 5TISZ 3JAWB 3M7MX 3LDDA 2VQFO 4LFCO 1YZBA 4FLUA 5FNVB 2UXNA 1SZTA 1GK9A 2W0FC 4JAVA 3J80N 2ZE8A 4X1YB 4X62B 2H3OA 3JD2A 1XNRO 3EVKA 3IC9A 1VP8A 3SPHA 4KP4A 1YHQV 1Q81W 3HKEA 4I50B 2HR3A 4PA9A 1QR9A 1N32B 4X66B 4IGGA 4LF9O 1K4DC 1XMQO 1KU9A 4I9QA 1SZXA 1Q86W 4DUYB 4ZI7A 4DR7B 3H1JH 3SYQA 1COWG 1M4UA 2YIBD 4B3TB 2Q7GA 4Q6GA 1E0TA 2KKWA 4UV8A 1KQSU 4DK0A 3SYPA 5L3GA 3VOUA 1YTFD 2OTLV 2CE4A 4JI0B 2AZ0A 1M56B 3ABTA 2IJHA 4MW8A 4JI4O 5IYDO 4WCEV 2QR4A 1OV9A 1MA1A 4U7NA 3T0TA 3HKDB 1N0JA 1JJOA 4J11A 5CB4B 2WPDG 1QNMA 4MTXA 3ZHUA 4XDLA 1BGYH 5LXTB 5L3EA 2YEVA 3KKYA 2B1IA 2L6LA 1AJQA 3BPZA 5CA1A 2VGGA 1PD3A 5H9CA 3R66A 1XMOO 4W4LA 1YEWA 3THOA 3SJBC 2ZKOA 3AG2B 3QVNA 4NTWA 1JVMA 2QGNA 3ZN0A 2ITDC 2OCCB 3ABMC 4I7ZB 5EK0A 4X89A 4IIJB 4K3AA 3RYIB 3T1HB 4B3SB 1FS0G 3WB0A 4QGPA 2Q0AA 4MT8A 1CP9A 4HYVA 4FLXA 5L3CA 1HNWB 1K33A 1I94O 5EZYA 1BMFG 3ASOC 5K1PA 3B8MA 4F6RA 4HNAB 5LMUO 3T07A 3APOA 4JI7O 5IYCO 3RWRD 3X2QB 4NTXA 1I7FA 4R8CA 1ZX3A 3P30A 4K0KO 5K1XA 4O4IA 4UVAA 1FJGO 4U3JB 2R70A 3JCZA 2WLNA 1R6NA 3DSQA 3ABLC 1RFYA 4LFBB 4X64B 4WF9V 1YVWA 2QWOB 2EZPA 1OCRC 3N2KB 4H33A 1Q6UA 3H1IH 2QEXV 5KHHA 5IJ9A 1QHTA 4KL1A 1BHBA 5B5EZ 1M1KW 2ATKC 4NR1A 3WB2A 4DR3O 1G4YB 4LP8A 3VQVA 3RYFA 1NS1A 4LF5O 2HVKC 1K3EA 2EIJC 2WSSG 3JSLA 4LF6B 1L1FA 2XHBA 2KB1A 4MS2A 3ABKB 2LFSA 1QVFU 3HQOA 3ZHSA 2AXTZ 3L9DA 4NXNO 4X1KA 1ROPA 4YJ5A 5B3SB 1QLNA 1Y4MA 2D3OW 5L3DA 2B9ZA 1IBMO 4J9YB 1GAXA 3CXCU 3CRQA 1NT2B 5IE9A 1LUVA 4DW0A 2UXBO 2ZINA 3WU2Z 2R9IA 1VF7A 1Q7YW 4KCUA 2ADPA 5H6RA 3H9VA 5IYZA 4J7KA 5BZBA 4FLZA 4G1NA 3B77A 3TCUA 4JYAO 4UCRA 3OD4A 2P90A 3ETDA 5KAFZ 2ZIOA 2UUAB 4J41A 2Q7HA 2XOKG 1KBHA 5IWAB 2V7QG 2WLIA 5LOVB 1NU1H 2ETNA 4QGCA 3B8NA 4J7JA 4G28B 3CHXA 1WPBA 1Q3EA 1TUBB 4IMAA 3L71H 3S3XA 1QQCA 2QTOA 1Q82W 3FYIB 1N34O 5B66Z 1I08A 3CCRV 2UUBO 1N36B 4TQFA 1LUWA 3CD6V 2CGNA 4ZHQB 4XDKA 2ADQB 3R65A 1N33O 2JS3A 4GKKB 3Q4HA 3DXRB 3JSNA 2YIDA 2F66C 1K4CC 4GUNA 3U11A 2VQEB 2FKXA 4WFHA 4CC5A 2GBOA 3WG7B 1LNQA 3QTCA 4X62O 2L35A 1P4RA 3SJCC 1CEZA 2YIBA 1A49A 4ICGA 2WLLA 1IX9A 1R6KA 5CA0A 3BVOA 4LC1A 4EB6A 1N32O 4KS0A 4X66O 2JJ2G 5LYJA 1JFFB 3AAGA 4BIOA 1WAZA 4DUYO 5J2UA 2Z5UA 4DR7O 2NR5A 4ZBMA 4B3TO 1OCCC 3K04A 1H8EG 1NJIW 4DV0B 3OUSA 3FAVA 1WNSA 2P22C 3G4SV 3OUFA 4FMTA 4E4EA 4JI0O 3NXSA 4CH4A 2HFEC 4OGQB 1GRJA 2BOCC 3UT5A 2JK5C 5A9GA 2CDYA 2GUZB 2WA4A 3CMAV 1YXBA 4LF8B 4WFAV 2PF4E 5IY5B 2EIJB 4UCSA 1EN5A 2P06A 3K08A 2H94A 5LP6B 3TXQA 1K34A 4JAUA 4N23A 3F7VC 4JI5B 5CA3A 3P3PA 1K97A 1H2SB 1AR5A 1M90W 3K9AA 4ASUG 2ILMA 4IYIA 1RPOA 4OPHA 1E1QG 3K0GA 4HAMA 1GM7A 2BCCH 3G6EV 3ME3A 2P5OA 1PV0A 3JALA 3T2MA 3JAMN 3T1HO 4B3SO 2Y69B 3BJTA 1WN7A 1WJZA 2E75B 4JTAB 2EJ7A 2OCHA 2PGGA 1HWYA 3K0DA 1HNWO 2PI5A 1XEQA 2EIMC 1BQZA 2UU9B 2ZXWB 1PL0A 4K8XA 1FXKB 4EKWA 1O9HA 4TV9A 1VQKV 4DR2B 1UPGA 2F4VB 1NTMH 5AG2A 1Y66A 4CC6A 5EIBC 4B2DD 4QPKA 4D7SA 5FPOA 1VQNV 4Q20A 4FZ0A 1OZ0A 4DXWA 2FMLA 4UXNA 3W7TA 4YHHB 4NXMB 2AGAA 3TK1A 1Q90D 4FFBA 3HKEB 2EULA 4X64O 4LFBO 3CCEV 4DK1A 3JYCA 1MG1A 2RQ6A 5LGNA 1V55C 4MVSA 4RAIA 5J2TA 1J5EB 1ZAUA 3LSUA 4WFFA 3JD3A 4ZI7B 1NH2B 4X8AA 1AJPA 4DV3B 2WLKA 3OMIB 3F5WC 4DR6B 4UCTA 1IDSA 4FM0A 3A2FA 4LF6O 3N2GB 3TETA 1VQ6V 1XNQB 2LQTA 4BW5A 1KUQA 3ZRVA 4RWUA 1K73W 4TT3G 1ORQC 3BABA 2M7WA 3D3IA 4GX2A 2Q4PA 2QWRB 4EFBA 3MAQA 3T4ZA 4GYCB 1OCCB 2Q9LA 4FLVA 2W0XA 1R73A 4FM2A 3ZS8C 2V4DA 3GWOA 1F23A 2QTSA 2F95B 4RPPA 5CA1B 5B1AC 1E79G 1PKLA 2YI9A 4F4LA 4UUJC 2B1GA 5KMGA 1KECA 3HB3B 2UUAO 2QE7G 4NB5A 4WFBV 1P7GA 2W6IG 5IWAO 1SESA 1GTOA 1EZJA 1F3XA 1NR7A 2Z3YA 4Z2WA 3HKBA 1DGSA 4LNUA 4KRZA 2VGBA 5EZYB 2CH7B 4X1IB 1N36O 1MZFA 4O4LA 4GKKO 3KHDA 3ZHRA 3LSSA 2JS5A 1VQMV 1V54B 2YC0A 2GDSA 3AG4C 2VQEO 4F6EA 4O4IB 4FLYA 4QG6A 3G71V 1VQ5V 4CH6A 4I55A 2XAFA 4WFGA 1NTZH 2DN9A 3W7XA 3IAYA 2DMXA 4H0LB 3VQWA 2Q73A 3KCYA 3ZMVA 2BTQA 3AG7A 2DQ0A 1PL4A 3RYCB 1A5UA 1B3QA 2LJ2A 3B09A 3OTOB 3KZIZ 1KP3A 2XT9A 2JDIG 4DV0O 1EM1A 5IJ0B 1QLEB 1QR8A 1SQFA 4AQYB 3CX5F 1AI5A 3QV9A 2IW5A 5LA6A 1WB7A 1XILA 3APQA 3QV6A 4DV7B 1CPYA 3K5OA 4X1KB 4JI3B 4FIPC 3HQPA 4FXJA 4CZZA 1G1XB 1QBZA 1NQTA 3STZC 2UUCB 1P84F 5KHJA 5JQGB 2LW7A 1X4TA 4LF8O 1GN2A 3WFVA 2N74A 4MVZA 4JI5O 1JR9A 5C8YA 3E89A 3B40A 2EIKC 1S5LZ 1AP6A 3J81N 3T1CA 2P4KA 4G2KA 4DRSA 3EOEA 5LGTA 4R50A 1SQPH 1W2BU 2BSKB 2WLIB 2OIGA 3ZRSA 2F43G 3E22A 5JVDA 1KKDA 3G67A 1FXVA 1MOFA 3L72H 3G6BA 1YCIA 1M57B 3QV8A 3H01A 3E8GA 1EFRG 1QU7A 4LWSA 3MDSA 4B2DA 2LP7A 4LF7B 4WBNA 1HNXB 1XI1A 5KUMA 5GONA 2DYRB 2UU9O 2KG7B 5LHGA 4KXRA 1SQVH 1OCZB 2HG5C 1H2GA 4DR2O 2F4VO 1GO3F 4N21A 4PI2A 4ZOLA 4QE7A 4HYWA 3MD0A 5B1OA 3LNNA 3U10A 1KKCA 3SRKA 5KLVH 3EFFK 3T05A 3CRRA 4O2BA 2LFRA 5EC2C 4B3RB 4FZ1A 1M5IA 4YHHO 4NXMO 5JJNB 1FYJA 3B2EE 1S5HC 4OXSA 3H6OA 2A9HA 3QV7A 5CA0B 4EB6B 2IH3C 4H13B 4UB8Z 2F93B 2RNBA 1YTFB 1J5EO 4NKGB 3F7YC 1ZLZA 4IHJA 5A2QN 3RW0A 3FD9A 3H1HH 5J2UB 2QKAA 1VIBA 1L0LH 2ARHA 4DV3O 3BRCA 3JAKB 4DR6O 2R72A 4Z1MG 1ZSPA 3A0RA 3CWBH 3FAVB 2EJRA 1N0NA 2PZSA 2JGDA 1T5EA 4ABMA 1XNQO 3SPIA 3CJHB 4PA6A 3SPJA 1AI4A 2KQXA 4HYOA 3RYHA 3VBBA 3JASA 4AILC 1BZKA 2CTWA 4DR4B 3QG5A 3BAAA 4W4KA 5KHIA 1OCOC 3EXAA 3G2GA 2K9PA 3CC2V 3E8FA 2QA4V 3CXHF 1N4CA 2ITCC 3JARA 2QM7A 4H37A 4MTFA 2QWPB 4TV8A 1Y74A 2UXXA 4UCOA 3RVZA 4X88A 3GB7C 1IXMA 1FPOA 2ZQMA 1H38A 1AQFA 3E0WA 4DUZB 3QO7A 3ZIAG 4IL6Z 5H5NA 3D36A 2YDEA 4UB6Z 2P6JA 1I5YA 4PDLA 3BCCH 2JRIA 5DECA 2QWNB 1R3JC 2EZOA 1AILA 1BE3H 1KD1W 1XL4A 1KC8W 4QIWF 3GR4A 2HKOA 4X9QA 1P49A 4XBFA 4JPGA 2FTKA 3JCUZ 2QM8A 4O4JA 4JYCA 2JVDA 5C93A 1BCCH 4TV9B 3L73H 4JASA 2D2CB 2EILC 2P7TC 1AI7A 4I50A 1QVGU 1EN6A 1OHHG 4LCUC 2DJVA 1YIJV 4PJ0Z 4LR3A 1E1RG 4NVPA 5JJJB 2XAHA 1D2DA 3D3QA 3K59A 1K92A 1FKAO 4QNHB 2BOBC 1YF2A 2ZT9B 4I4TB 3AK3A 2GTSA 3CMEV 4BAYA 2G50A 5BMVA 3OE7G 4MTOA 1AB3A 3M99B 5B1NA 2PYLA 1ZTEA 1TA8A 5J9PC 1A3WA 2QSAA 3IC7A 2VGIA 4KCVA 1V9PA 2XAJA 2Q8VA 1ZL8A 3JD0A 1XHZA 3RVYA 1P7BA 1SC5B 2ZDIA 4CS3A 5GTIZ 3ABMB 1R1BA 3ETQA 2A0LA 3HKDA 3OTOO 5CB4A 3SGIA 2GHYA 3CCUV 3AG1C 4AQYO 3TXSA 5LXTA 4YJ2B 2DOSA 4PI0A 3ZHQA 4DV7O 3ASOB 4UFZA 4TSFG 2X6AA 4JI3O 1IXBA 1YI2V 2NNUA 2OTJV 2E76B 1EBOA 5HFMA 1R3LC 2UUCO 2CK3G 4K35A 4FJCC 2EINC 3OMAB 1LR1A 1Q5OA 2DYSC 4CS2A 1A3XA 1GH6A 4TWKA 3WB1A 3OT7A 3EHBB 5BR8B 3HKCA 4UVBA 3OTFA 4CS4A 3RYIA 4B08A 3O9OA 1Q6IA 2HVJC 4KUMA 3ABLB 2GSMB 2LW1A 3ZRWA 5EYPB 3BFRA 1I5XA 1IBLB 1OCRB 2Q0OC 4DV5B 4PA4A 4YY3B 4DR1B 1FFXA 3E35A 5EC1C 1K5SA 3TJTA 1DTOA 3ZN1A 4O4HB 2Z0AA 5IYBO 1PKNA 1VEWA 1FFTB 1WA8B 5B1BC 1NI8A 2RDCA 4LF7O 2IJJA
chains in the Genus database with same CATH topology
4F4LA 1DF4A 4UV8A 4UUJC 1KQSU 2B1GA 3FB8C 5GW7A 3SYPA 5L3GA 1VQ9V 3VOUA 1YTFD 2OTLV 1KECA 3HB3B 1M56B 3ABTA 5LBQA 5IDJA 2IJHA 4MW8A 2QE7G 5IYDO 4WFBV 3PJSK 2IU3A 4WCEV 1UJWB 4MVQA 2W6IG 2IJKA 4U7NA 1SESA 1GTOA 1NBMG 1EZJA 1KP2A 1NR7A 1WLEA 2WPDG 2Z3YA 2HJFC 4MTXA 2DQ3A 2Y69C 4XDLA 1JOYA 3ETEA 5L3EA 2YEVA 5LHIA 2B1IA 1AJQA 1PD3A 2IU0A 2DWDC 2Q68A 5H9CA 2ZXWC 3OR6C 3FB7C 5KUKA 1NH2D 3KG2A 1FXKC 3LSSA 1VQMV 1ENVA 1V54B 4XDJA 3AG2B 1VQ8V 3CCLV 2X7RB 2XAGA 1JVMA 1AR1B 1GKFA 3AG4C 3ZN0A 2ITDC 3OEEG 2OCCB 3ABMC 5EK0A 5DM6V 4X89A 3G71V 1VQ5V 1G8MA 3ZRXA 1TUEB 1SETA 1FS0G 3T4DA 3UKMA 1SERA 4P2ZA 3LNMB 4MT8A 1S72V 1BL8A 1CP9A 2XAFA 4WFGA 5L3CA 3W7SA 3SYAA 3E86A 3W7XA 1K33A 1B6QA 3CYOA 4JF3A 3ASOC 1BMFG 3ZCCA 3B8MA 2EBOA 2XAQA 3OM3B 1VQOV 3ZMVA 5IYCO 3X2QB 4R6ZA 4R8CA 4ZKIA 2DQ0A 1RM1C 3E8BA 3P30A 1KP3A 2JDIG 4BIUA 4UVAA 3ZMUA 1QLEB 1QR8A 3JCZA 4MTGA 2WLNA 1PNKA 1AI5A 3QNEA 3FKSG 1R6NA 3BY6A 2IW5A 3ABLC 5H6QA 4WF9V 1CPYA 2EZPA 4P9PA 1YJWV 1OCRC 1MSWD 4FIPC 4H33A 3CCJV 1NKDA 4CZZA 2QEXV 1QBZA 4UVCA 3FB5C 4QE9A 1OCOB 1YJNV 1NQTA 2P67A 3ASNC 3STZC 1BHBA 2Q6AA 1YJ9V 1NR1A 5CBHA 1M1KW 2ATKC 3OFNG 2IH1C 1JQ0A 2HLDG 3WFVA 4YXWG 1G4YB 4MVZA 4LP8A 4MVRA 2YEVB 2HVKC 1K3EA 3E89A 1F51A 2EIJC 2WSSG 1VQPV 1S76D 2EIKC 1L1FA 2R9RB 2KB1A 3T1CA 4I5SA 4MS2A 5EBMC 3ABKB 4P9OA 2LFSA 1QVFU 3P32A 1GM9A 4G2KA 5CBGA 5LGTA 2WAMA 2Q69A 2IJIA 4MSWC 4R50A 3CC7V 1W2BU 1AI6A 1M56C 2WLIB 2XASA 4MVOA 1GM8A 2F43G 3ZRSA 1ROPA 2ZDIC 1FXHA 1PNMA 1N8RW 5B3SB 1KKDA 1FXVA 1MOFA 1QLNA 1Y4MA 2D3OW 5L3DA 1M57B 4J9YB 2JEUA 3H01A 4PDRA 4J9ZB 1PNLA 1EFRG 3E8GA 3ZMSA 3CXCU 3ZMZA 3OW2U 5CN0A 4R7CA 3K06A 1J95A 3HPLC 2R9IA 1Q7YW 3CPWU 2LP7A 3SJQC 1YSCA 5H6RA 4JGSA 5KUMA 2DYRB 2EILB 4GX1A 5EBWC 5LHGA 4RUFA 5HFLA 5BZBA 1OCZB 3QO5A 3OR7C 2HG5C 3ETGA 3B77A 1H2GA 3TCUA 5CMUA 2P90A 3ETDA 1GO3F 4N21A 2V1DA 4QE7A 3AG3C 3MD0A 2XOKG 5B1OA 3STLC 1JCHA 1V54C 2NLJC 3EFFK 2V7QG 2WLIA 3AG2C 4PDVA 2Y48A 3B8NA 2ZR2A 2C2AA 2LFRA 5EC2C 5DN6G 2OCCC 4G28B 2ZR3A 3CCSV 2AHYA 1XL6A 5EBLC 3RBZA 1S5HC 4OXSA 2EIMB 2A9HA 2QTOA 1Q82W 1K8AW 1JPXA 3FYIB 2IH3C 3CCRV 4HZ3A 3CD6V 1BHAA 4XDKA 2A79B 3R65A 5KA5A 2AHZA 1YTFB 1NVPB 1JX9A 3F7YC 4GX5A 4DO2A 3RW0A 4PDMA 4GT1A 1K4CC 3FB6C 3X2QC 4GX0A 4Z1MG 3A0RA 4WFHA 2JEXA 3LDCA 3WG7B 2EJRA 3DGEA 1LNQA 3AG1B 1S77D 1PKXA 1QLEC 1S3JA 2MK3A 3IFXA 1P4RA 5LHHA 3SPIA 1CEZA 3K3WA 3W7WA 4PA6A 3W7UA 2WLLA 3SPJA 1AI4A 1VQ4V 1V55B 4HYOA 4MVMA 3SPGA 1R6KA 5CBFA 4LC1A 3VBBA 1FXKA 2JJ2G 4RO2A 2OT5A 1R3KC 4RQFA 2EINB 3AAGA 1W0JG 2DYSB 1RM1B 1OCOC 3CC2V 3E8FA 1JJ2U 3I56V 2QA4V 4WFEA 2Z5UA 4ZBMA 2ITCC 1F4MA 2ZD9A 2QM7A 4H37A 4MTFA 1OCCC 3K04A 1H8EG 1NJIW 4MW3A 3OUSA 2UXXA 5L3BA 3RVZA 1AJNA 1THZA 4X88A 3MHSC 3GB7C 1IXMA 2ZQMA 3G4SV 1H38A 3OUFA 4FMTA 3QO7A 3NXSA 3SPCA 3ZIAG 2HFEC 3ABKC 3AEIA 3MHHC 2BOCC 3ASNB 3D36A 5E1AC 3QO8A 4FK5C 1DLBA 2P6JA 3ML0A 1I5YA 4PDLA 4P30A 2JK5C 3JD4A 2DW4A 3E8HA 3SYOA 5B3SC 1R3JC 2EZOA 3LDEA 3CMAV 1M57C 4E2LA 2YSUB 1KD1W 4WFAV 1XL4A 5B1BB 1K7DA 4QIWF 1R3IC 5IY5B 2EIJB 2HKOA 1KC8W 3ZMTA 3K08A 2H94A 4PA3A 1K34A 5B1AB 4JAUA 4N23A 1K9MW 4XBFA 3F7VC 2FTKA 5CA3A 2QM8A 4G27B 1K97A 1M9NA 1M90W 4CBCA 4JYCA 1NVPD 2H8PC 3CC4V 3CP1A 5C93A 3K9AA 4ASUG 4JASA 2JIZG 1RPOA 2DYRC 2EILC 2P7TC 1AI7A 1OCZC 3OAAG 1F4NA 1S0VA 1QVGU 3CCVV 2X6CA 1E1QG 1OHHG 4LCUC 2WWWA 1YIJV 3K0GA 3FYEB 4HAMA 1GM7A 1SRYA 1E1RG 3G6EV 2XAHA 1K92A 4KFMA 4QNHB 2BOBC 1W0KG 3BEHA 2WLJA 3T2MA 2Y69B 4MVUA 4JTAB 3CMEV 4BAYA 1HWYA 3K0DA 4QPJA 4I9WA 3OE7G 4JPRA 4MTOA 4UV9A 5KA6A 2PI5A 2WLLB 2EIMC 3M99B 5B1NA 2XNDG 2ZXWB 2WLHA 1PL0A 5J9PC 1K5QA 1VQLV 3AG3B 3IC7A 4RQEA 2WLMA 1FXKB 1MABG 4EKWA 1VQKV 3LUTB 3DTUB 4FPPA 2XAJA 4LBEC 3JD0A 1Y66A 3JD1A 3RVYA 1P7BA 3AG4B 2ZDIA 3CCQV 3ABMB 4RUEA 5FL7G 4QPKA 3K03A 2A0LA 2X0LA 2DWEC 1VQNV 4Q20A 3I55V 1OZ0A 4JTDB 4DXWA 2GHYA 4UXNA 4QJFB 3W7TA 2PI4A 3WG7C 3CCUV 3ZRWB 3OMNB 3AG1C 3K79A 4PELA 3TK1A 4JTCB 1YITV 3CCMV 3ZJZA 1ZWIC 3CCEV 3JYCA 1MG1A 5LGNA 2K1EA 3ASOB 1AROP 2X6AA 4TSFG 4BIZA 1YI2V 2NNUA 2OTJV 1V55C 1QCEA 2QKSA 1EBOA 2X6BA 3OGCC 4MVSA 4RAIA 3LDDA 5HFMA 4L87A 4WFFA 3JD3A 1R3LC 2CK3G 4FJCC 2EINC 3OMAB 2DYSC 1NH2B 4X8AA 1AJPA 3OEHG 3E2EA 2WLKA 3OMIB 2UXNA 3F5WC 1SZTA 3ABUA 4TWKA 3EHBB 3UM7A 1GK9A 2W0FC 4JAVA 4UVBA 3IGAC 2W6JG 3LSQA 4KUMA 2HVJC 3JD2A 3ABLB 5L3FA 4JYBA 1H8HG 3TETA 2GSMB 1VQ6V 3ZRWA 3SPHA 4KP4A 1RPRA 4BW5A 1YHQV 1VQ7V 1I5XA 1Q81W 1OCRB 1GMGA 2HR3A 4PA4A 4PA9A 3ZRVA 1K73W 1QR9A 4TT3G 1ORQC 4U7OA 3E35A 2M7WA 3D3IA 4GX2A 5EC1C 2B5UA 3T4ZA 1K5SA 1K4DC 1WPXA 5LGUA 1DTOA 1OCCB 1Q86W 3ZN1A 4GCZA 1R73A 4PA7A 3SYCA 5IYBO 3E83A 1DF5A 3SYQA 1COWG 3GWOA 1FFTB 5B1BC 5IY5C 1F23A 2Q67A 2EIKB 2JJ1G 5B1AC 1E79G 2IJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W0K G;  4UV8 A;  5L3G A;  4CZZ A;  4UVC A;  4Z1M G;  4BAY A;  3ABT A;  3OE7 G;  5LBQ A;  2EJR A;  4UV9 A;  2QE7 G;  2XND G;  3OFN G;  2W6I G;  2HLD G;  5LHH A;  1MAB G;  4YXW G;  1NBM G;  2XAJ A;  2WPD G;  2Z3Y A;  2WSS G;  2JJ2 G;  5FL7 G;  2X0L A;  1W0J G;  5L3E A;  5LHI A;  5LGT A;  4UXN A;  2XAS A;  2Z5U A;  2F43 G;  1H8E G;  5L3D A;  2UXX A;  5L3B A;  5LGN A;  4TSF G;  1EFR G;  3ZMS A;  2XAG A;  3ZMZ A;  3ZN0 A;  3OEE G;  2R9I A;  3ZIA G;  2CK3 G;  5H6R A;  1FS0 G;  3OEH G;  5LHG A;  2UXN A;  3ABU A;  2DW4 A;  2XAF A;  4UVB A;  2W6J G;  5L3C A;  2V1D A;  4KUM A;  2XOK G;  5L3F A;  1H8H G;  1BMF G;  2HKO A;  2V7Q G;  3ZMT A;  2H94 A;  2Y48 A;  2XAQ A;  4XBF A;  5DN6 G;  3ZMV A;  4TT3 G;  4ASU G;  2JIZ G;  3OAA G;  2JDI G;  5LGU A;  4UVA A;  3ZMU A;  3ZN1 A;  1E1Q G;  1OHH G;  1E1R G;  3FKS G;  2IW5 A;  1COW G;  5H6Q A;  2XAH A;  2JJ1 G;  1E79 G; 
#chains in the Genus database with same CATH topology
 1DF4 A;  1HNX O;  4H44 B;  1L0N H;  3KTX A;  2M6Y A;  5GW7 A;  1VQ9 V;  4DV2 B;  4LF4 B;  1VP7 A;  3PJS K;  2IU3 A;  2R9A A;  4BR6 A;  3FFQ A;  4DR5 B;  4PV1 B;  1KP2 A;  4B3R O;  4O2A B;  2HJF C;  1WB8 A;  2WA3 A;  1JOY A;  3ETE A;  3K58 A;  5LHI A;  3GWK C;  2ZE6 A;  2IU0 A;  4BW9 A;  2G38 A;  3OR6 C;  3FB7 C;  1NH2 D;  3KG2 A;  2CTP A;  3E0V A;  5GTH Z;  3OEE G;  4BWA A;  1G8M A;  2O57 A;  3ZRX A;  3J7A U;  3RGB A;  3T4D A;  3UKM A;  1SER A;  3LNM B;  3W7S A;  3SYA A;  1FAF A;  1KMI Z;  3CYO A;  1D5A A;  5KX5 A;  4FFK A;  3K57 A;  3IS4 A;  3D36 C;  5ITZ A;  2XAQ A;  4DV6 B;  4DR4 O;  2BTO A;  1VQO V;  4CH5 A;  4R6Z A;  4ZKI A;  1RM1 C;  4TQD A;  3BJF A;  3E8B A;  2HJD A;  1TUB A;  3QNE A;  3FKS G;  4TUY A;  4DUZ O;  3GG8 A;  3E22 B;  3QTG A;  4U3F H;  1NKD A;  3GQY A;  3FB5 C;  4QE9 A;  1YJN V;  3DXR A;  3SRD A;  1NR1 A;  4X65 B;  5F2V O;  1VF6 C;  1JQ0 A;  4D7T A;  4LH7 A;  4MVR A;  2E5L B;  1ZUQ A;  5GON B;  2YEV B;  3D8C A;  2GTA A;  1F51 A;  1VQP V;  1S76 D;  1Y67 A;  3HR0 A;  2R9R B;  4IYH A;  1IUR A;  4C7U A;  3DC6 A;  4P9O A;  1L8D A;  1XBL A;  2WAM A;  2Q69 A;  3U0Z A;  4MSW C;  5JCO A;  4I0X A;  1AI6 A;  1M56 C;  4MVO A;  1E0U A;  4GKJ B;  1GM8 A;  2CAZ C;  2ZDI C;  1JFF A;  1N8R W;  2YXH A;  3UCS C;  1XQ8 A;  4J42 A;  1PNL A;  1GN3 A;  3K06 A;  1J95 A;  3ICX A;  3UO2 A;  3CPW U;  3SJQ C;  2RN9 A;  2BE3 A;  4JGS A;  4FLT A;  1T57 A;  3JAT A;  3QO5 A;  4JI8 B;  4YNG A;  4F6R B;  4YJ3 A;  5CMU A;  3BA8 A;  2UXC B;  3VQY A;  2ZM6 B;  3AG3 C;  2DE0 X;  3STL C;  1UFI A;  1R6T A;  2NLJ C;  3AG2 C;  1MMM A;  2Y48 A;  2GUZ A;  2HEP A;  2ZR2 A;  2C2A A;  5DN6 G;  2OCC C;  2JGD B;  3CCS V;  2AHY A;  1HR0 B;  3K5L A;  5EBL C;  5LP6 A;  4UCU A;  4KHP B;  4DV4 B;  3K5N A;  2EIM B;  1K8A W;  2N04 A;  3TGU H;  1BS3 A;  2ZCE A;  4HZ3 A;  4JZG A;  1SF9 A;  5KA5 A;  4NYK A;  1NVP B;  5IJ9 B;  1US6 A;  1PKM A;  3M8A A;  2LGW A;  2VRZ A;  3JAR B;  5LMN B;  3X2Q C;  2FYU H;  2FL4 A;  5BR8 O;  4GX0 A;  3LDC A;  4LFA B;  3RYF B;  2OWO A;  1S77 D;  4YIP A;  2P4V A;  1RP3 B;  1BT8 A;  2MK3 A;  3IFX A;  2PY5 A;  5LHH A;  2YI8 A;  1VAR A;  3QF7 A;  1IBL O;  4DV5 O;  1V55 B;  3SPG A;  4MVM A;  3A8T A;  4YY3 O;  1O9G A;  2CUG A;  5CBF A;  4DR1 O;  2CTQ A;  1FXK A;  4RO2 A;  2RJZ A;  1R3K C;  1A32 A;  1XDC A;  1RM1 B;  1IBK B;  4J10 A;  1JJ2 U;  3I56 V;  4WFE A;  1F4M A;  2ZD9 A;  1VF5 B;  4DV1 B;  4O4J B;  3CS5 A;  1THZ A;  2ZIM A;  3MHS C;  5IYZ B;  5D5P A;  4DV2 O;  3GVM A;  3K9S A;  3ABK C;  4LF4 O;  3AEI A;  3MHH C;  1H2L A;  5KHK A;  1DLB A;  2PYJ A;  3U2Z A;  3JD4 A;  4D6T H;  3E8H A;  3SYO A;  4DR5 O;  5B3S C;  3MA8 A;  1JMK C;  1PP9 H;  4B7K A;  1TVK A;  4K8Z A;  3SRF A;  4JYY A;  3ZMT A;  5BMV B;  4PA3 A;  5B1A B;  4OX9 B;  3N2G A;  2H8P C;  3G80 A;  1SQQ H;  1ZL8 B;  3OAA G;  3N27 A;  1F4N A;  1S0V A;  3Q4H B;  2RCV A;  3L70 H;  2X6C A;  4EEQ A;  3L75 H;  2IBZ H;  3HQN A;  1Y76 A;  4X20 A;  2Y0I A;  2F23 A;  1WP7 A;  4KFM A;  3BEH A;  2WLJ A;  2QDO A;  1U97 A;  1SQX H;  2NN4 A;  5JH7 A;  2HP8 A;  5KA6 A;  2WLL B;  2KSD A;  4J80 A;  2WLH A;  1VQL V;  2YIC A;  3AG3 B;  4AHC A;  4RQE A;  1T5A A;  5LYJ B;  3ZED A;  4DV6 O;  4LBE C;  3JD1 A;  3AG4 B;  4QG9 A;  1HP8 A;  4RUE A;  2CGO A;  5FL7 G;  3CRM A;  3HKC B;  4JAA A;  4JZ2 A;  3K03 A;  3I55 V;  1GN4 A;  3UQ8 A;  3O65 A;  3WG7 C;  3ZRW B;  3OMN B;  3K79 A;  4PEL A;  4JTC B;  3CCM V;  3ZJZ A;  1ZWI C;  2CH7 A;  4X1I A;  1FFX B;  1H2K A;  2QKS A;  3OGC C;  5JCO C;  4JV5 B;  1Z5W A;  3UT5 B;  4L87 A;  5KHG A;  1MZE A;  5BXZ A;  1RSO A;  3OEH G;  2HHH B;  3E2E A;  4X65 O;  2ZNI A;  3ABU A;  4DYL A;  3UM7 A;  3IGA C;  2W6J G;  2E5L O;  4JI2 B;  3PP7 A;  1HNZ B;  3LSQ A;  5BY1 A;  4DRX A;  2OYQ A;  5L3F A;  4JYB A;  1H8H G;  1SA0 A;  1ZJH A;  1RPR A;  1VQ7 V;  2ZNJ A;  4TOI A;  1Z5V A;  1EN4 A;  1GMG A;  2Y0P A;  4U7O A;  4GKJ O;  2PTM A;  1KYO F;  1IVS A;  2B5U A;  3JAW A;  1WPX A;  1S5J A;  5LGU A;  3JAL B;  3SRH A;  2EX3 A;  1KB9 F;  4GCZ A;  3SYC A;  4PA7 A;  3E83 A;  1DF5 A;  3RYC A;  5FNV A;  1X59 A;  5IY5 C;  2Q67 A;  3OGI B;  2EIK B;  2JJ1 G;  5LP6 C;  5IJ0 A;  4FM1 A;  2GV9 A;  1WP8 A;  2A3Q A;  3AK1 A;  4X1Y A;  4QG8 A;  3FB8 C;  3I5D A;  2VS0 A;  4CH3 A;  4JI8 O;  3ZHT A;  5LBQ A;  5IDJ A;  2UXC O;  2ZM6 O;  2UXD B;  1Q8I A;  1UJW B;  1URF A;  4MVQ A;  2Q7E A;  2IJK A;  4DW1 A;  1NBM G;  2MW2 B;  3VQX A;  4B3M B;  1WLE A;  5JQG A;  3BA9 A;  3A0B Z;  2CTR A;  1HR0 O;  1VF6 A;  2DQ3 A;  2Y69 C;  4KHP O;  2E3C A;  4DV4 O;  4FFB B;  1AVM A;  5KX5 B;  3C3S A;  4A5U B;  5ITZ B;  2DWD C;  2Q68 A;  5J2T B;  2ZXW C;  1F7Y A;  5KUK A;  4JI1 B;  1FXK C;  4OPA A;  1ENV A;  2BSK A;  4XDJ A;  5D5Q A;  1VQ8 V;  3CCL V;  2X7R B;  2XAG A;  1AR1 B;  1GKF A;  3T1Y B;  5LMN O;  4B7E A;  4LH6 A;  5DM6 V;  4KCT A;  2QWQ B;  2AW9 A;  2Y4U A;  4LFA O;  1TUE B;  1SET A;  3AK2 A;  4P2Z A;  1Y6X A;  4IT5 A;  4TUY B;  3IJ4 A;  1S72 V;  1BL8 A;  1OJH A;  1XOU A;  3E86 A;  2QJ1 A;  1B6Q A;  1W59 A;  2KG7 A;  4JF3 A;  2VWK A;  1Q43 A;  3ZCC A;  2A06 H;  2EBO A;  2Q5Z A;  4L8J A;  3OM3 B;  1IBK O;  1IZ3 A;  4JI6 B;  3H1L H;  4DV1 O;  4BIU A;  3ZMU A;  1CXZ B;  4IIJ A;  2VGF A;  1B06 A;  1BSM A;  3P3N A;  3SJA C;  4MTG A;  1PNK A;  1SS3 A;  3BY6 A;  5H6Q A;  1D5N A;  5KMG B;  3CB2 A;  4I0X B;  2E28 A;  1Q6H A;  4FLW A;  4P9P A;  1YJW V;  1MSW D;  3BHP A;  3CCJ V;  4UVC A;  1OCO B;  2YXL A;  2P67 A;  3ASN C;  2VQF B;  2QKC A;  4LFC B;  4HNA A;  2Q6A A;  4AI8 A;  1YJ9 V;  5CBH A;  3OFN G;  3JAK A;  2IH1 C;  1U96 A;  2HLD G;  3HKB B;  3CE2 A;  4YXW G;  2ZE5 A;  4LNU B;  2AZ2 A;  4OX9 O;  1AR4 A;  3RFR A;  1XNR B;  3C90 A;  3JAT B;  4U3J A;  4YJ3 B;  4I5S A;  4O4L B;  5EBM C;  3CJH A;  2IM9 A;  3P32 A;  1GM9 A;  5CBG A;  1NTK H;  1M93 A;  2IJI A;  3CC7 V;  2XAS A;  1MNG A;  3C3T A;  5JWP A;  3N2K A;  3KCX A;  4LF9 B;  1FXH A;  1PNM A;  3RN4 A;  1XMQ B;  1H2N A;  5DED A;  2JEU A;  4PDR A;  4J9Z B;  3ZMS A;  3ZMZ A;  3OW2 U;  5CN0 A;  4R7C A;  3HPL C;  4KCW A;  4I55 B;  2N05 A;  1YSC A;  2EIL B;  4PHZ A;  4GX1 A;  5EBW C;  4RUF A;  5HFL A;  3OR7 C;  2VWJ A;  3ETG A;  3L74 H;  2V1D A;  5KAI Z;  4JI4 B;  1FD9 A;  2BTQ B;  4FVM A;  1JCH A;  1Z2G A;  1V54 C;  4PDV A;  1VMG A;  2YUA A;  4WJ8 A;  3S3W A;  2ZR3 A;  1XL6 A;  4GLX A;  3K5M A;  3RBZ A;  5LA6 B;  1JPX A;  1JA8 A;  3ZBH A;  1BHA A;  3RT3 C;  2A79 B;  2AHZ A;  1XMO B;  4JV5 O;  1JX9 A;  4GX5 A;  4DO2 A;  1H2M A;  5E79 Z;  1AP5 A;  4PDM A;  2HHH O;  3SR2 C;  4GT1 A;  3A0H Z;  3FB6 C;  5H2F Z;  2LGQ A;  1NZ6 A;  5LOV A;  1BQ0 A;  2JEX A;  3DGE A;  4JI2 O;  3AG1 B;  1HNZ O;  5C8Y B;  3CEI A;  4I4T A;  1PKX A;  1QLE C;  1S3J A;  1XHX A;  2PUS A;  3K3W A;  3W7W A;  2A7W A;  3W7U A;  1VQ4 V;  3UO3 A;  4UCV A;  1I94 B;  3N25 A;  2XUM A;  5JVD B;  2OT5 A;  1SKV A;  4RQF A;  4ZHQ A;  2EIN B;  1W0J G;  2DYS B;  5LMU B;  1TVK B;  4JI7 B;  2F1M A;  1GN6 A;  4FXF A;  3B4S A;  1TGO A;  4LWS B;  4NTY A;  1YDX A;  4K0K B;  4Z1V A;  4MW3 A;  1FJG B;  5L3B A;  5FPR A;  4IP7 A;  1XUQ A;  1AJN A;  4WBN B;  4YJ2 A;  3SPC A;  3CRA A;  4ZOL B;  2YIA A;  3ASN B;  4J7Z A;  1PM9 A;  2UXD O;  5E1A C;  3QO8 A;  4FK5 C;  3ML0 A;  1Y76 B;  4X20 B;  4P30 A;  1G6U A;  2JGU A;  2DW4 A;  4O2B B;  1HDJ A;  3LDE A;  4B3M O;  1M57 C;  4E2L A;  2YSU B;  2XTA A;  3PN1 A;  5B1B B;  1K7D A;  1R3I C;  1SQB H;  4DR3 B;  5JH7 B;  1XRE A;  1K9M W;  4YIO A;  3NR7 A;  4LF5 B;  4G27 B;  3SDL A;  1M9N A;  4GZR B;  4CBC A;  2RMK B;  1NVP D;  3CC4 V;  3CP1 A;  2JIZ G;  5EIB D;  5EYP A;  5JJE B;  2DYR C;  4ZIB A;  5FLX N;  1HW7 A;  1MSD A;  2YS8 A;  1OCZ C;  3F5T A;  4JI1 O;  1TAE A;  1DK1 A;  4IHJ B;  3CSX A;  3CCV V;  2LO1 A;  4NXN B;  2WWW A;  1I0H A;  3FYE B;  1SRY A;  3T1Y O;  2QM4 A;  3ZHV A;  5LL6 Y;  1IBM B;  4O4H A;  1W0K G;  2FB5 A;  1PKY A;  4MVU A;  3CRC A;  2YXY A;  2UXB B;  1WA8 A;  4QPJ A;  4I9W A;  4JPR A;  4UV9 A;  2XND G;  4PD4 F;  3RYH B;  1K5Q A;  4HBN A;  3H1K H;  5IT9 N;  3JAS B;  2WLM A;  1MAB G;  4JYA B;  1PPJ H;  3DTU B;  3LUT B;  4FPP A;  1RSO B;  3DC5 A;  3CCQ V;  4EFE A;  1B04 A;  2OIE A;  4JI6 O;  2X0L A;  2ODM A;  1EZV H;  2DWE C;  4DRX B;  4JTD B;  4TV8 B;  2Y4T A;  1Y74 B;  4O2A A;  4QJF B;  1SA0 B;  2PI4 A;  2E74 B;  2ZE7 A;  3FX7 A;  1YIT V;  1F3W A;  1SQG A;  1N34 B;  3ZX6 A;  2K1E A;  2UUB B;  1ARO P;  4BIZ A;  1QCE A;  2X6B A;  1N33 B;  5TIS Z;  3JAW B;  3M7M X;  3LDD A;  2VQF O;  4LFC O;  1YZB A;  4FLU A;  5FNV B;  2UXN A;  1SZT A;  1GK9 A;  2W0F C;  4JAV A;  3J80 N;  2ZE8 A;  4X1Y B;  4X62 B;  2H3O A;  3JD2 A;  1XNR O;  3EVK A;  3IC9 A;  1VP8 A;  3SPH A;  4KP4 A;  1YHQ V;  1Q81 W;  3HKE A;  4I50 B;  2HR3 A;  4PA9 A;  1QR9 A;  1N32 B;  4X66 B;  4IGG A;  4LF9 O;  1K4D C;  1XMQ O;  1KU9 A;  4I9Q A;  1SZX A;  1Q86 W;  4DUY B;  4ZI7 A;  4DR7 B;  3H1J H;  3SYQ A;  1COW G;  1M4U A;  2YIB D;  4B3T B;  2Q7G A;  4Q6G A;  1E0T A;  2KKW A;  4UV8 A;  1KQS U;  4DK0 A;  3SYP A;  5L3G A;  3VOU A;  1YTF D;  2OTL V;  2CE4 A;  4JI0 B;  2AZ0 A;  1M56 B;  3ABT A;  2IJH A;  4MW8 A;  4JI4 O;  5IYD O;  4WCE V;  2QR4 A;  1OV9 A;  1MA1 A;  4U7N A;  3T0T A;  3HKD B;  1N0J A;  1JJO A;  4J11 A;  5CB4 B;  2WPD G;  1QNM A;  4MTX A;  3ZHU A;  4XDL A;  1BGY H;  5LXT B;  5L3E A;  2YEV A;  3KKY A;  2B1I A;  2L6L A;  1AJQ A;  3BPZ A;  5CA1 A;  2VGG A;  1PD3 A;  5H9C A;  3R66 A;  1XMO O;  4W4L A;  1YEW A;  3THO A;  3SJB C;  2ZKO A;  3AG2 B;  3QVN A;  4NTW A;  1JVM A;  2QGN A;  3ZN0 A;  2ITD C;  2OCC B;  3ABM C;  4I7Z B;  5EK0 A;  4X89 A;  4IIJ B;  4K3A A;  3RYI B;  3T1H B;  4B3S B;  1FS0 G;  3WB0 A;  4QGP A;  2Q0A A;  4MT8 A;  1CP9 A;  4HYV A;  4FLX A;  5L3C A;  1HNW B;  1K33 A;  1I94 O;  5EZY A;  1BMF G;  3ASO C;  5K1P A;  3B8M A;  4F6R A;  4HNA B;  5LMU O;  3T07 A;  3APO A;  4JI7 O;  5IYC O;  3RWR D;  3X2Q B;  4NTX A;  1I7F A;  4R8C A;  1ZX3 A;  3P30 A;  4K0K O;  5K1X A;  4O4I A;  4UVA A;  1FJG O;  4U3J B;  2R70 A;  3JCZ A;  2WLN A;  1R6N A;  3DSQ A;  3ABL C;  1RFY A;  4LFB B;  4X64 B;  4WF9 V;  1YVW A;  2QWO B;  2EZP A;  1OCR C;  3N2K B;  4H33 A;  1Q6U A;  3H1I H;  2QEX V;  5KHH A;  5IJ9 A;  1QHT A;  4KL1 A;  1BHB A;  5B5E Z;  1M1K W;  2ATK C;  4NR1 A;  3WB2 A;  4DR3 O;  1G4Y B;  4LP8 A;  3VQV A;  3RYF A;  1NS1 A;  4LF5 O;  2HVK C;  1K3E A;  2EIJ C;  2WSS G;  3JSL A;  4LF6 B;  1L1F A;  2XHB A;  2KB1 A;  4MS2 A;  3ABK B;  2LFS A;  1QVF U;  3HQO A;  3ZHS A;  2AXT Z;  3L9D A;  4NXN O;  4X1K A;  1ROP A;  4YJ5 A;  5B3S B;  1QLN A;  1Y4M A;  2D3O W;  5L3D A;  2B9Z A;  1IBM O;  4J9Y B;  1GAX A;  3CXC U;  3CRQ A;  1NT2 B;  5IE9 A;  1LUV A;  4DW0 A;  2UXB O;  2ZIN A;  3WU2 Z;  2R9I A;  1VF7 A;  1Q7Y W;  4KCU A;  2ADP A;  5H6R A;  3H9V A;  5IYZ A;  4J7K A;  5BZB A;  4FLZ A;  4G1N A;  3B77 A;  3TCU A;  4JYA O;  4UCR A;  3OD4 A;  2P90 A;  3ETD A;  5KAF Z;  2ZIO A;  2UUA B;  4J41 A;  2Q7H A;  2XOK G;  1KBH A;  5IWA B;  2V7Q G;  2WLI A;  5LOV B;  1NU1 H;  2ETN A;  4QGC A;  3B8N A;  4J7J A;  4G28 B;  3CHX A;  1WPB A;  1Q3E A;  1TUB B;  4IMA A;  3L71 H;  3S3X A;  1QQC A;  2QTO A;  1Q82 W;  3FYI B;  1N34 O;  5B66 Z;  1I08 A;  3CCR V;  2UUB O;  1N36 B;  4TQF A;  1LUW A;  3CD6 V;  2CGN A;  4ZHQ B;  4XDK A;  2ADQ B;  3R65 A;  1N33 O;  2JS3 A;  4GKK B;  3Q4H A;  3DXR B;  3JSN A;  2YID A;  2F66 C;  1K4C C;  4GUN A;  3U11 A;  2VQE B;  2FKX A;  4WFH A;  4CC5 A;  2GBO A;  3WG7 B;  1LNQ A;  3QTC A;  4X62 O;  2L35 A;  1P4R A;  3SJC C;  1CEZ A;  2YIB A;  1A49 A;  4ICG A;  2WLL A;  1IX9 A;  1R6K A;  5CA0 A;  3BVO A;  4LC1 A;  4EB6 A;  1N32 O;  4KS0 A;  4X66 O;  2JJ2 G;  5LYJ A;  1JFF B;  3AAG A;  4BIO A;  1WAZ A;  4DUY O;  5J2U A;  2Z5U A;  4DR7 O;  2NR5 A;  4ZBM A;  4B3T O;  1OCC C;  3K04 A;  1H8E G;  1NJI W;  4DV0 B;  3OUS A;  3FAV A;  1WNS A;  2P22 C;  3G4S V;  3OUF A;  4FMT A;  4E4E A;  4JI0 O;  3NXS A;  4CH4 A;  2HFE C;  4OGQ B;  1GRJ A;  2BOC C;  3UT5 A;  2JK5 C;  5A9G A;  2CDY A;  2GUZ B;  2WA4 A;  3CMA V;  1YXB A;  4LF8 B;  4WFA V;  2PF4 E;  5IY5 B;  2EIJ B;  4UCS A;  1EN5 A;  2P06 A;  3K08 A;  2H94 A;  5LP6 B;  3TXQ A;  1K34 A;  4JAU A;  4N23 A;  3F7V C;  4JI5 B;  5CA3 A;  3P3P A;  1K97 A;  1H2S B;  1AR5 A;  1M90 W;  3K9A A;  4ASU G;  2ILM A;  4IYI A;  1RPO A;  4OPH A;  1E1Q G;  3K0G A;  4HAM A;  1GM7 A;  2BCC H;  3G6E V;  3ME3 A;  2P5O A;  1PV0 A;  3JAL A;  3T2M A;  3JAM N;  3T1H O;  4B3S O;  2Y69 B;  3BJT A;  1WN7 A;  1WJZ A;  2E75 B;  4JTA B;  2EJ7 A;  2OCH A;  2PGG A;  1HWY A;  3K0D A;  1HNW O;  2PI5 A;  1XEQ A;  2EIM C;  1BQZ A;  2UU9 B;  2ZXW B;  1PL0 A;  4K8X A;  1FXK B;  4EKW A;  1O9H A;  4TV9 A;  1VQK V;  4DR2 B;  1UPG A;  2F4V B;  1NTM H;  5AG2 A;  1Y66 A;  4CC6 A;  5EIB C;  4B2D D;  4QPK A;  4D7S A;  5FPO A;  1VQN V;  4Q20 A;  4FZ0 A;  1OZ0 A;  4DXW A;  2FML A;  4UXN A;  3W7T A;  4YHH B;  4NXM B;  2AGA A;  3TK1 A;  1Q90 D;  4FFB A;  3HKE B;  2EUL A;  4X64 O;  4LFB O;  3CCE V;  4DK1 A;  3JYC A;  1MG1 A;  2RQ6 A;  5LGN A;  1V55 C;  4MVS A;  4RAI A;  5J2T A;  1J5E B;  1ZAU A;  3LSU A;  4WFF A;  3JD3 A;  4ZI7 B;  1NH2 B;  4X8A A;  1AJP A;  4DV3 B;  2WLK A;  3OMI B;  3F5W C;  4DR6 B;  4UCT A;  1IDS A;  4FM0 A;  3A2F A;  4LF6 O;  3N2G B;  3TET A;  1VQ6 V;  1XNQ B;  2LQT A;  4BW5 A;  1KUQ A;  3ZRV A;  4RWU A;  1K73 W;  4TT3 G;  1ORQ C;  3BAB A;  2M7W A;  3D3I A;  4GX2 A;  2Q4P A;  2QWR B;  4EFB A;  3MAQ A;  3T4Z A;  4GYC B;  1OCC B;  2Q9L A;  4FLV A;  2W0X A;  1R73 A;  4FM2 A;  3ZS8 C;  2V4D A;  3GWO A;  1F23 A;  2QTS A;  2F95 B;  4RPP A;  5CA1 B;  5B1A C;  1E79 G;  1PKL A;  2YI9 A;  4F4L A;  4UUJ C;  2B1G A;  5KMG A;  1KEC A;  3HB3 B;  2UUA O;  2QE7 G;  4NB5 A;  4WFB V;  1P7G A;  2W6I G;  5IWA O;  1SES A;  1GTO A;  1EZJ A;  1F3X A;  1NR7 A;  2Z3Y A;  4Z2W A;  3HKB A;  1DGS A;  4LNU A;  4KRZ A;  2VGB A;  5EZY B;  2CH7 B;  4X1I B;  1N36 O;  1MZF A;  4O4L A;  4GKK O;  3KHD A;  3ZHR A;  3LSS A;  2JS5 A;  1VQM V;  1V54 B;  2YC0 A;  2GDS A;  3AG4 C;  2VQE O;  4F6E A;  4O4I B;  4FLY A;  4QG6 A;  3G71 V;  1VQ5 V;  4CH6 A;  4I55 A;  2XAF A;  4WFG A;  1NTZ H;  2DN9 A;  3W7X A;  3IAY A;  2DMX A;  4H0L B;  3VQW A;  2Q73 A;  3KCY A;  3ZMV A;  2BTQ A;  3AG7 A;  2DQ0 A;  1PL4 A;  3RYC B;  1A5U A;  1B3Q A;  2LJ2 A;  3B09 A;  3OTO B;  3KZI Z;  1KP3 A;  2XT9 A;  2JDI G;  4DV0 O;  1EM1 A;  5IJ0 B;  1QLE B;  1QR8 A;  1SQF A;  4AQY B;  3CX5 F;  1AI5 A;  3QV9 A;  2IW5 A;  5LA6 A;  1WB7 A;  1XIL A;  3APQ A;  3QV6 A;  4DV7 B;  1CPY A;  3K5O A;  4X1K B;  4JI3 B;  4FIP C;  3HQP A;  4FXJ A;  4CZZ A;  1G1X B;  1QBZ A;  1NQT A;  3STZ C;  2UUC B;  1P84 F;  5KHJ A;  5JQG B;  2LW7 A;  1X4T A;  4LF8 O;  1GN2 A;  3WFV A;  2N74 A;  4MVZ A;  4JI5 O;  1JR9 A;  5C8Y A;  3E89 A;  3B40 A;  2EIK C;  1S5L Z;  1AP6 A;  3J81 N;  3T1C A;  2P4K A;  4G2K A;  4DRS A;  3EOE A;  5LGT A;  4R50 A;  1SQP H;  1W2B U;  2BSK B;  2WLI B;  2OIG A;  3ZRS A;  2F43 G;  3E22 A;  5JVD A;  1KKD A;  3G67 A;  1FXV A;  1MOF A;  3L72 H;  3G6B A;  1YCI A;  1M57 B;  3QV8 A;  3H01 A;  3E8G A;  1EFR G;  1QU7 A;  4LWS A;  3MDS A;  4B2D A;  2LP7 A;  4LF7 B;  4WBN A;  1HNX B;  1XI1 A;  5KUM A;  5GON A;  2DYR B;  2UU9 O;  2KG7 B;  5LHG A;  4KXR A;  1SQV H;  1OCZ B;  2HG5 C;  1H2G A;  4DR2 O;  2F4V O;  1GO3 F;  4N21 A;  4PI2 A;  4ZOL A;  4QE7 A;  4HYW A;  3MD0 A;  5B1O A;  3LNN A;  3U10 A;  1KKC A;  3SRK A;  5KLV H;  3EFF K;  3T05 A;  3CRR A;  4O2B A;  2LFR A;  5EC2 C;  4B3R B;  4FZ1 A;  1M5I A;  4YHH O;  4NXM O;  5JJN B;  1FYJ A;  3B2E E;  1S5H C;  4OXS A;  3H6O A;  2A9H A;  3QV7 A;  5CA0 B;  4EB6 B;  2IH3 C;  4H13 B;  4UB8 Z;  2F93 B;  2RNB A;  1YTF B;  1J5E O;  4NKG B;  3F7Y C;  1ZLZ A;  4IHJ A;  5A2Q N;  3RW0 A;  3FD9 A;  3H1H H;  5J2U B;  2QKA A;  1VIB A;  1L0L H;  2ARH A;  4DV3 O;  3BRC A;  3JAK B;  4DR6 O;  2R72 A;  4Z1M G;  1ZSP A;  3A0R A;  3CWB H;  3FAV B;  2EJR A;  1N0N A;  2PZS A;  2JGD A;  1T5E A;  4ABM A;  1XNQ O;  3SPI A;  3CJH B;  4PA6 A;  3SPJ A;  1AI4 A;  2KQX A;  4HYO A;  3RYH A;  3VBB A;  3JAS A;  4AIL C;  1BZK A;  2CTW A;  4DR4 B;  3QG5 A;  3BAA A;  4W4K A;  5KHI A;  1OCO C;  3EXA A;  3G2G A;  2K9P A;  3CC2 V;  3E8F A;  2QA4 V;  3CXH F;  1N4C A;  2ITC C;  3JAR A;  2QM7 A;  4H37 A;  4MTF A;  2QWP B;  4TV8 A;  1Y74 A;  2UXX A;  4UCO A;  3RVZ A;  4X88 A;  3GB7 C;  1IXM A;  1FPO A;  2ZQM A;  1H38 A;  1AQF A;  3E0W A;  4DUZ B;  3QO7 A;  3ZIA G;  4IL6 Z;  5H5N A;  3D36 A;  2YDE A;  4UB6 Z;  2P6J A;  1I5Y A;  4PDL A;  3BCC H;  2JRI A;  5DEC A;  2QWN B;  1R3J C;  2EZO A;  1AIL A;  1BE3 H;  1KD1 W;  1XL4 A;  1KC8 W;  4QIW F;  3GR4 A;  2HKO A;  4X9Q A;  1P49 A;  4XBF A;  4JPG A;  2FTK A;  3JCU Z;  2QM8 A;  4O4J A;  4JYC A;  2JVD A;  5C93 A;  1BCC H;  4TV9 B;  3L73 H;  4JAS A;  2D2C B;  2EIL C;  2P7T C;  1AI7 A;  4I50 A;  1QVG U;  1EN6 A;  1OHH G;  4LCU C;  2DJV A;  1YIJ V;  4PJ0 Z;  4LR3 A;  1E1R G;  4NVP A;  5JJJ B;  2XAH A;  1D2D A;  3D3Q A;  3K59 A;  1K92 A;  1FKA O;  4QNH B;  2BOB C;  1YF2 A;  2ZT9 B;  4I4T B;  3AK3 A;  2GTS A;  3CME V;  4BAY A;  2G50 A;  5BMV A;  3OE7 G;  4MTO A;  1AB3 A;  3M99 B;  5B1N A;  2PYL A;  1ZTE A;  1TA8 A;  5J9P C;  1A3W A;  2QSA A;  3IC7 A;  2VGI A;  4KCV A;  1V9P A;  2XAJ A;  2Q8V A;  1ZL8 A;  3JD0 A;  1XHZ A;  3RVY A;  1P7B A;  1SC5 B;  2ZDI A;  4CS3 A;  5GTI Z;  3ABM B;  1R1B A;  3ETQ A;  2A0L A;  3HKD A;  3OTO O;  5CB4 A;  3SGI A;  2GHY A;  3CCU V;  3AG1 C;  4AQY O;  3TXS A;  5LXT A;  4YJ2 B;  2DOS A;  4PI0 A;  3ZHQ A;  4DV7 O;  3ASO B;  4UFZ A;  4TSF G;  2X6A A;  4JI3 O;  1IXB A;  1YI2 V;  2NNU A;  2OTJ V;  2E76 B;  1EBO A;  5HFM A;  1R3L C;  2UUC O;  2CK3 G;  4K35 A;  4FJC C;  2EIN C;  3OMA B;  1LR1 A;  1Q5O A;  2DYS C;  4CS2 A;  1A3X A;  1GH6 A;  4TWK A;  3WB1 A;  3OT7 A;  3EHB B;  5BR8 B;  3HKC A;  4UVB A;  3OTF A;  4CS4 A;  3RYI A;  4B08 A;  3O9O A;  1Q6I A;  2HVJ C;  4KUM A;  3ABL B;  2GSM B;  2LW1 A;  3ZRW A;  5EYP B;  3BFR A;  1I5X A;  1IBL B;  1OCR B;  2Q0O C;  4DV5 B;  4PA4 A;  4YY3 B;  4DR1 B;  1FFX A;  3E35 A;  5EC1 C;  1K5S A;  3TJT A;  1DTO A;  3ZN1 A;  4O4H B;  2Z0A A;  5IYB O;  1PKN A;  1VEW A;  1FFT B;  1WA8 B;  5B1B C;  1NI8 A;  2RDC A;  4LF7 O;  2IJJ A; 
#chains in the Genus database with same CATH homology
 4F4L A;  1DF4 A;  4UV8 A;  4UUJ C;  1KQS U;  2B1G A;  3FB8 C;  5GW7 A;  3SYP A;  5L3G A;  1VQ9 V;  3VOU A;  1YTF D;  2OTL V;  1KEC A;  3HB3 B;  1M56 B;  3ABT A;  5LBQ A;  5IDJ A;  2IJH A;  4MW8 A;  2QE7 G;  5IYD O;  4WFB V;  3PJS K;  2IU3 A;  4WCE V;  1UJW B;  4MVQ A;  2W6I G;  2IJK A;  4U7N A;  1SES A;  1GTO A;  1NBM G;  1EZJ A;  1KP2 A;  1NR7 A;  1WLE A;  2WPD G;  2Z3Y A;  2HJF C;  4MTX A;  2DQ3 A;  2Y69 C;  4XDL A;  1JOY A;  3ETE A;  5L3E A;  2YEV A;  5LHI A;  2B1I A;  1AJQ A;  1PD3 A;  2IU0 A;  2DWD C;  2Q68 A;  5H9C A;  2ZXW C;  3OR6 C;  3FB7 C;  5KUK A;  1NH2 D;  3KG2 A;  1FXK C;  3LSS A;  1VQM V;  1ENV A;  1V54 B;  4XDJ A;  3AG2 B;  1VQ8 V;  3CCL V;  2X7R B;  2XAG A;  1JVM A;  1AR1 B;  1GKF A;  3AG4 C;  3ZN0 A;  2ITD C;  3OEE G;  2OCC B;  3ABM C;  5EK0 A;  5DM6 V;  4X89 A;  3G71 V;  1VQ5 V;  1G8M A;  3ZRX A;  1TUE B;  1SET A;  1FS0 G;  3T4D A;  3UKM A;  1SER A;  4P2Z A;  3LNM B;  4MT8 A;  1S72 V;  1BL8 A;  1CP9 A;  2XAF A;  4WFG A;  5L3C A;  3W7S A;  3SYA A;  3E86 A;  3W7X A;  1K33 A;  1B6Q A;  3CYO A;  4JF3 A;  3ASO C;  1BMF G;  3ZCC A;  3B8M A;  2EBO A;  2XAQ A;  3OM3 B;  1VQO V;  3ZMV A;  5IYC O;  3X2Q B;  4R6Z A;  4R8C A;  4ZKI A;  2DQ0 A;  1RM1 C;  3E8B A;  3P30 A;  1KP3 A;  2JDI G;  4BIU A;  4UVA A;  3ZMU A;  1QLE B;  1QR8 A;  3JCZ A;  4MTG A;  2WLN A;  1PNK A;  1AI5 A;  3QNE A;  3FKS G;  1R6N A;  3BY6 A;  2IW5 A;  3ABL C;  5H6Q A;  4WF9 V;  1CPY A;  2EZP A;  4P9P A;  1YJW V;  1OCR C;  1MSW D;  4FIP C;  4H33 A;  3CCJ V;  1NKD A;  4CZZ A;  2QEX V;  1QBZ A;  4UVC A;  3FB5 C;  4QE9 A;  1OCO B;  1YJN V;  1NQT A;  2P67 A;  3ASN C;  3STZ C;  1BHB A;  2Q6A A;  1YJ9 V;  1NR1 A;  5CBH A;  1M1K W;  2ATK C;  3OFN G;  2IH1 C;  1JQ0 A;  2HLD G;  3WFV A;  4YXW G;  1G4Y B;  4MVZ A;  4LP8 A;  4MVR A;  2YEV B;  2HVK C;  1K3E A;  3E89 A;  1F51 A;  2EIJ C;  2WSS G;  1VQP V;  1S76 D;  2EIK C;  1L1F A;  2R9R B;  2KB1 A;  3T1C A;  4I5S A;  4MS2 A;  5EBM C;  3ABK B;  4P9O A;  2LFS A;  1QVF U;  3P32 A;  1GM9 A;  4G2K A;  5CBG A;  5LGT A;  2WAM A;  2Q69 A;  2IJI A;  4MSW C;  4R50 A;  3CC7 V;  1W2B U;  1AI6 A;  1M56 C;  2WLI B;  2XAS A;  4MVO A;  1GM8 A;  2F43 G;  3ZRS A;  1ROP A;  2ZDI C;  1FXH A;  1PNM A;  1N8R W;  5B3S B;  1KKD A;  1FXV A;  1MOF A;  1QLN A;  1Y4M A;  2D3O W;  5L3D A;  1M57 B;  4J9Y B;  2JEU A;  3H01 A;  4PDR A;  4J9Z B;  1PNL A;  1EFR G;  3E8G A;  3ZMS A;  3CXC U;  3ZMZ A;  3OW2 U;  5CN0 A;  4R7C A;  3K06 A;  1J95 A;  3HPL C;  2R9I A;  1Q7Y W;  3CPW U;  2LP7 A;  3SJQ C;  1YSC A;  5H6R A;  4JGS A;  5KUM A;  2DYR B;  2EIL B;  4GX1 A;  5EBW C;  5LHG A;  4RUF A;  5HFL A;  5BZB A;  1OCZ B;  3QO5 A;  3OR7 C;  2HG5 C;  3ETG A;  3B77 A;  1H2G A;  3TCU A;  5CMU A;  2P90 A;  3ETD A;  1GO3 F;  4N21 A;  2V1D A;  4QE7 A;  3AG3 C;  3MD0 A;  2XOK G;  5B1O A;  3STL C;  1JCH A;  1V54 C;  2NLJ C;  3EFF K;  2V7Q G;  2WLI A;  3AG2 C;  4PDV A;  2Y48 A;  3B8N A;  2ZR2 A;  2C2A A;  2LFR A;  5EC2 C;  5DN6 G;  2OCC C;  4G28 B;  2ZR3 A;  3CCS V;  2AHY A;  1XL6 A;  5EBL C;  3RBZ A;  1S5H C;  4OXS A;  2EIM B;  2A9H A;  2QTO A;  1Q82 W;  1K8A W;  1JPX A;  3FYI B;  2IH3 C;  3CCR V;  4HZ3 A;  3CD6 V;  1BHA A;  4XDK A;  2A79 B;  3R65 A;  5KA5 A;  2AHZ A;  1YTF B;  1NVP B;  1JX9 A;  3F7Y C;  4GX5 A;  4DO2 A;  3RW0 A;  4PDM A;  4GT1 A;  1K4C C;  3FB6 C;  3X2Q C;  4GX0 A;  4Z1M G;  3A0R A;  4WFH A;  2JEX A;  3LDC A;  3WG7 B;  2EJR A;  3DGE A;  1LNQ A;  3AG1 B;  1S77 D;  1PKX A;  1QLE C;  1S3J A;  2MK3 A;  3IFX A;  1P4R A;  5LHH A;  3SPI A;  1CEZ A;  3K3W A;  3W7W A;  4PA6 A;  3W7U A;  2WLL A;  3SPJ A;  1AI4 A;  1VQ4 V;  1V55 B;  4HYO A;  4MVM A;  3SPG A;  1R6K A;  5CBF A;  4LC1 A;  3VBB A;  1FXK A;  2JJ2 G;  4RO2 A;  2OT5 A;  1R3K C;  4RQF A;  2EIN B;  3AAG A;  1W0J G;  2DYS B;  1RM1 B;  1OCO C;  3CC2 V;  3E8F A;  1JJ2 U;  3I56 V;  2QA4 V;  4WFE A;  2Z5U A;  4ZBM A;  2ITC C;  1F4M A;  2ZD9 A;  2QM7 A;  4H37 A;  4MTF A;  1OCC C;  3K04 A;  1H8E G;  1NJI W;  4MW3 A;  3OUS A;  2UXX A;  5L3B A;  3RVZ A;  1AJN A;  1THZ A;  4X88 A;  3MHS C;  3GB7 C;  1IXM A;  2ZQM A;  3G4S V;  1H38 A;  3OUF A;  4FMT A;  3QO7 A;  3NXS A;  3SPC A;  3ZIA G;  2HFE C;  3ABK C;  3AEI A;  3MHH C;  2BOC C;  3ASN B;  3D36 A;  5E1A C;  3QO8 A;  4FK5 C;  1DLB A;  2P6J A;  3ML0 A;  1I5Y A;  4PDL A;  4P30 A;  2JK5 C;  3JD4 A;  2DW4 A;  3E8H A;  3SYO A;  5B3S C;  1R3J C;  2EZO A;  3LDE A;  3CMA V;  1M57 C;  4E2L A;  2YSU B;  1KD1 W;  4WFA V;  1XL4 A;  5B1B B;  1K7D A;  4QIW F;  1R3I C;  5IY5 B;  2EIJ B;  2HKO A;  1KC8 W;  3ZMT A;  3K08 A;  2H94 A;  4PA3 A;  1K34 A;  5B1A B;  4JAU A;  4N23 A;  1K9M W;  4XBF A;  3F7V C;  2FTK A;  5CA3 A;  2QM8 A;  4G27 B;  1K97 A;  1M9N A;  1M90 W;  4CBC A;  4JYC A;  1NVP D;  2H8P C;  3CC4 V;  3CP1 A;  5C93 A;  3K9A A;  4ASU G;  4JAS A;  2JIZ G;  1RPO A;  2DYR C;  2EIL C;  2P7T C;  1AI7 A;  1OCZ C;  3OAA G;  1F4N A;  1S0V A;  1QVG U;  3CCV V;  2X6C A;  1E1Q G;  1OHH G;  4LCU C;  2WWW A;  1YIJ V;  3K0G A;  3FYE B;  4HAM A;  1GM7 A;  1SRY A;  1E1R G;  3G6E V;  2XAH A;  1K92 A;  4KFM A;  4QNH B;  2BOB C;  1W0K G;  3BEH A;  2WLJ A;  3T2M A;  2Y69 B;  4MVU A;  4JTA B;  3CME V;  4BAY A;  1HWY A;  3K0D A;  4QPJ A;  4I9W A;  3OE7 G;  4JPR A;  4MTO A;  4UV9 A;  5KA6 A;  2PI5 A;  2WLL B;  2EIM C;  3M99 B;  5B1N A;  2XND G;  2ZXW B;  2WLH A;  1PL0 A;  5J9P C;  1K5Q A;  1VQL V;  3AG3 B;  3IC7 A;  4RQE A;  2WLM A;  1FXK B;  1MAB G;  4EKW A;  1VQK V;  3LUT B;  3DTU B;  4FPP A;  2XAJ A;  4LBE C;  3JD0 A;  1Y66 A;  3JD1 A;  3RVY A;  1P7B A;  3AG4 B;  2ZDI A;  3CCQ V;  3ABM B;  4RUE A;  5FL7 G;  4QPK A;  3K03 A;  2A0L A;  2X0L A;  2DWE C;  1VQN V;  4Q20 A;  3I55 V;  1OZ0 A;  4JTD B;  4DXW A;  2GHY A;  4UXN A;  4QJF B;  3W7T A;  2PI4 A;  3WG7 C;  3CCU V;  3ZRW B;  3OMN B;  3AG1 C;  3K79 A;  4PEL A;  3TK1 A;  4JTC B;  1YIT V;  3CCM V;  3ZJZ A;  1ZWI C;  3CCE V;  3JYC A;  1MG1 A;  5LGN A;  2K1E A;  3ASO B;  1ARO P;  2X6A A;  4TSF G;  4BIZ A;  1YI2 V;  2NNU A;  2OTJ V;  1V55 C;  1QCE A;  2QKS A;  1EBO A;  2X6B A;  3OGC C;  4MVS A;  4RAI A;  3LDD A;  5HFM A;  4L87 A;  4WFF A;  3JD3 A;  1R3L C;  2CK3 G;  4FJC C;  2EIN C;  3OMA B;  2DYS C;  1NH2 B;  4X8A A;  1AJP A;  3OEH G;  3E2E A;  2WLK A;  3OMI B;  2UXN A;  3F5W C;  1SZT A;  3ABU A;  4TWK A;  3EHB B;  3UM7 A;  1GK9 A;  2W0F C;  4JAV A;  4UVB A;  3IGA C;  2W6J G;  3LSQ A;  4KUM A;  2HVJ C;  3JD2 A;  3ABL B;  5L3F A;  4JYB A;  1H8H G;  3TET A;  2GSM B;  1VQ6 V;  3ZRW A;  3SPH A;  4KP4 A;  1RPR A;  4BW5 A;  1YHQ V;  1VQ7 V;  1I5X A;  1Q81 W;  1OCR B;  1GMG A;  2HR3 A;  4PA4 A;  4PA9 A;  3ZRV A;  1K73 W;  1QR9 A;  4TT3 G;  1ORQ C;  4U7O A;  3E35 A;  2M7W A;  3D3I A;  4GX2 A;  5EC1 C;  2B5U A;  3T4Z A;  1K5S A;  1K4D C;  1WPX A;  5LGU A;  1DTO A;  1OCC B;  1Q86 W;  3ZN1 A;  4GCZ A;  1R73 A;  4PA7 A;  3SYC A;  5IYB O;  3E83 A;  1DF5 A;  3SYQ A;  1COW G;  3GWO A;  1FFT B;  5B1B C;  5IY5 C;  1F23 A;  2Q67 A;  2EIK B;  2JJ1 G;  5B1A C;  1E79 G;  2IJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...