5FL7G

Structure of the f1c10 complex from yarrowia lipolytica atp synthase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
270
structure length
267
Chain Sequence
TLREIEMRLKSIKNIEKITNTMKIVASTKLGKAQRAMATSKVYNEASEKVFENSETAVPENIEKRLWVVVSSDKGLCGSIHSQLARTVRRKLLDGEKLIDIVAVGEKIKAQLGRSNPEQMRLSFGGTGKEAPTFEEAAHIADEILALDTQYDDIEIVYNKVLSGISFEPIMKESYSAKAIEDAPKFGQYELEDDVVKNLADFSLANTIYAAMAEGHAAEISARRNAMDNASKNASDMINKYSILYNRTRQAVITNELVDIITGASSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Complete ATP Synthase Dimer Reveals the Molecular Basis of Inner Mitochondrial Membrane Morphology.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA
total genus 63
structure length 267
sequence length 270
ec nomenclature
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00231 ATP-synt ATP synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5fl7G01
3.40.1380.10 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate Kinase; Chain: A, domain 1 5fl7G02
2JDIG 1NBMG 5FL7G 2R9IA 5LGUA 1W0JG 5LGTA 4Z1MG 2XAQA 2XAHA 3ZN1A 1H8HG 3OAAG 2XAFA 2XAGA 4TT3G 1FS0G 3OFNG 4TSFG 2UXXA 2Y48A 2HLDG 5LBQA 2XAJA 4YXWG 2CK3G 5H6QA 3ABTA 5L3BA 1W0KG 2V1DA 5L3CA 3ZMTA 1H8EG 2JJ1G 4UV8A 5L3FA 2JJ2G 2XOKG 2EJRA 2W6JG 4UVBA 2DW4A 3ZMSA 4KUMA 2W6IG 2HKOA 5LHHA 2XASA 2X0LA 4UVAA 1E1QG 2Z3YA 2H94A 5LHIA 4XBFA 2F43G 5LHGA 1EFRG 5LGNA 4UXNA 1OHHG 3ZIAG 3OE7G 4ASUG 4CZZA 3OEEG 4UVCA 5L3DA 4BAYA 1MABG 2XNDG 1COWG 1BMFG 3ZN0A 3ABUA 4UV9A 3ZMZA 5DN6G 1E1RG 1E79G 2IW5A 5L3GA 5L3EA 3ZMUA 2JIZG 2V7QG 3ZMVA 3FKSG 5H6RA 2WPDG 2Z5UA 2QE7G 2WSSG 2UXNA 3OEHG
chains in the Genus database with same CATH superfamily
1PKXA 1Y4MA 2H3OA 4PA9A 3PP7A 1WPXA 2HP8A 4IL6Z 1ROPA 4PA7A 1SZXA 2M6YA 3GWOA 3JCUZ 1K73W 3PN1A 1XILA 3LDDA 1EZJA 4LF4B 3IJ4A 5GTHZ 3FFQA 2EZPA 4DV5B 1W0KG 5EBMC 3SYAA 3CSXA 1M56C 2QDOA 2IM9A 3BAAA 1R1BA 1TUBB 1K34A 1BL8A 3AG4B 3D36C 3CHXA 1H2NA 3A8TA 2ZIMA 3K5MA 4R7CA 5E1AC 4CS2A 1I5XA 3W7SA 1QU7A 2BOCC 3SPGA 1CPYA 1K9MW 3A0RA 1PNKA 1VIBA 1S5JA 1YITV 4I50B 4G2KA 2VWJA 3CJHA 2YIBA 1QVGU 4TQDA 1HNZO 2QEXV 1U97A 3OTOB 1N34O 2F4VB 4LH7A 1A5UA 1QNMA 1V55C 2BSKA 4UCRA 3RT3C 4IYIA 4PDVA 4BWAA 3CEIA 1MZEA 4IHJA 2CGOA 4P2ZA 5LXTA 2UXBB 2LO1A 2YXHA 4DV7B 4LFCO 2ZDIA 5ITZA 1RFYA 3FKSG 4JTDB 3IFXA 4P9PA 4I5SA 2AHZA 4DR3O 1S0VA 2ZE6A 5LGTA 4Z1MG 4CH6A 3CX5F 3OGIB 1QR8A 3KKYA 4TT3G 1SQGA 1SKVA 3N2GB 2HEPA 2JS3A 2ZE8A 4O2AB 2HLDG 4IHJB 3OTOO 1N36B 1Q3EA 4TV8A 3ABKB 2EIMC 1VQMV 1XI1A 2BSKB 2LQTA 4DRXB 4G27B 4PHZA 3JARA 2CE4A 2QGNA 3J80N 2PYLA 1FXHA 2JVDA 3F5TA 3K03A 3PJSK 1LUWA 2P67A 4OGQB 1HWYA 1TUEB 2XASA 4DRSA 3OW2U 4X1IA 2H94A 3OMIB 2VS0A 4YIPA 2BCCH 3OMAB 1H2SB 1Z5VA 2GUZB 3ZHVA 1H2GA 4ASUG 5KHJA 2EX3A 1Q81W 4DUYO 1HP8A 2AXTZ 3SRKA 2WLHA 1KC8W 5KHHA 1SQPH 2WWWA 1Y6XA 3FB8C 4RWUA 4O4IB 3QV8A 5AG2A 1XUQA 4JZ2A 2G50A 4KCVA 4MTOA 3E86A 5EIBD 1E1RG 4DR2B 4TUYB 3RYIA 1Y66A 1M57C 5L3GA 5KAFZ 2OYQA 2EINC 5CB4B 3RWRD 3IS4A 5IE9A 1VP8A 1XMQO 1ZLZA 2X7RB 2N74A 2VGGA 4IYHA 4DR4O 2ZIOA 2GSMB 1UFIA 4FK5C 2WPDG 2QE7G 2PZSA 3TXSA 3QV9A 5CA1B 5JQGA 4HYOA 3WU2Z 3HKCA 4GX5A 2JDIG 4PDLA 5LGUA 2Q67A 3JASA 4HZ3A 2CAZC 3ETGA 3FB7C 1MSDA 1HNWB 3CCSV 2ZE7A 4DR1B 3SYPA 3ZHUA 1DF5A 1AB3A 3ME3A 2YSUB 4TUYA 4X1YA 4L8JA 5L3CA 3X2QB 1H8EG 3ASOC 3P3NA 4K3AA 4DR7B 5LMUB 1K92A 4OX9O 1JCHA 3E8HA 4I9QA 2W6JG 4Q6GA 2ITDC 1NH2B 5B1AB 3BA8A 3E22B 2E5LB 3T05A 3UT5B 1JA8A 5K1XA 1QLNA 2MW2B 3ZJZA 1E1QG 2NNUA 3OD4A 4O2BA 4TOIA 3SPCA 1WPBA 1H2MA 1NU1H 3QNEA 4U7NA 4UXNA 3WB1A 3ETEA 1ENVA 1DF4A 2EIJC 1KB9F 2LFSA 1GM8A 1FYJA 3KHDA 3F7VC 3CCVV 2X6CA 4HYVA 1R6NA 2EIKB 2IU0A 1G6UA 4J80A 2HJDA 3JATA 1ZWIC 5IY5C 3CRAA 1TAEA 4JPGA 1JFFB 1XOUA 4EB6A 2RN9A 4N23A 1NS1A 4DUZO 4JTAB 1VP7A 3HPLC 4JAAA 5J2TB 4DR7O 3C3SA 2QA4V 4X64O 3AG3C 4LFAB 3FB5C 1RP3B 2UXNA 1CXZB 1B06A 1TUBA 1M57B 1KKCA 2CTWA 4B3MB 4PI0A 4X8AA 5FNVA 1JOYA 5HFMA 1O9HA 1OCOC 4N21A 2DN9A 3CCRV 1HNXB 3HKDB 1EM1A 1GMGA 4J11A 3K58A 1M56B 3D3QA 3KCXA 2GV9A 3L9DA 3ABTA 1QVFU 4PA4A 2V1DA 1XL4A 4UCTA 2QWNB 2DOSA 5BY1A 1QLEC 2K1EA 3CCJV 3T0TA 2YIBD 3CCUV 2C2AA 1N0JA 3ASNC 5EK0A 3ZMSA 2IJKA 2RNBA 1VQ8V 4MT8A 1QCEA 2GUZA 5LHGA 1P84F 4FLVA 3CE2A 4X66B 5GTIZ 4DUYB 3HQNA 3T4DA 3APOA 5JH7B 1WB7A 2XTAA 1COWG 4PDMA 1WP7A 3L75H 3FAVA 1NTMH 5KHGA 4WF9V 4GYCB 3W7WA 3ZMZA 1JR9A 1T5AA 1IBLO 3ZBHA 3QG5A 5C8YA 4JI3O 3SPIA 2PY5A 3ABMC 3ETQA 1A49A 4QG8A 2KG7A 4CC6A 2HHHO 5EC1C 1RPOA 1T5EA 3C90A 4JYBA 3CCMV 1LR1A 3F5WC 3OGCC 1TGOA 1SF9A 3DC5A 4HAMA 2Q68A 1MG1A 1SA0B 2F23A 3UO3A 4DK1A 2PTMA 2YIAA 3QF7A 3AG7A 4DR3B 3BJFA 1K5SA 5ITZB 3ZN1A 2R9RB 1F3XA 1PKLA 2WA3A 4TQFA 2XAGA 4RO2A 3APQA 1YI2V 4GCZA 2OTJV 1J95A 3O9OA 1EN5A 1FXKA 2DJVA 2RCVA 1ZL8A 5LA6A 1UJWB 4Z1VA 2H8PC 3ZCCA 5L3BA 5CBHA 1ZUQA 2UUCB 4K35A 1AI6A 4E2LA 4UV8A 1S5HC 5B3SB 2B5UA 4DV7O 3VQXA 1AI4A 2VRZA 2WA4A 3K06A 3RBZA 4H0LB 1Q6UA 4QG6A 1A32A 3CJHB 2E75B 1ZAUA 4I50A 2WLJA 2F66C 3S3WA 4JYYA 4XBFA 3I5DA 3CC7V 4JI1B 1B6QA 3VQYA 1YF2A 4LF6B 5KUMA 4O2BB 3KCYA 1S5LZ 5B1BB 1AR4A 3LNMB 3WG7C 3RYIB 1A3XA 2QSAA 2NR5A 1FKAO 1VQLV 4JGSA 4B3SO 3AG2C 1BE3H 4O4IA 1Q86W 3K08A 1IBLB 4W4KA 5KHIA 4IP7A 2CTPA 5KLVH 1SQVH 4HBNA 4HNAA 1XMOO 1NVPB 4ICGA 3CPWU 4MVQA 2F93B 2QM4A 3K3WA 5E79Z 4LF4O 4YHHB 2JIZG 4XDKA 4JYCA 4ZHQA 3LSSA 1K4DC 2YS8A 1VQ4V 2VQEO 4FIPC 2LGQA 3SJAC 5LMNB 1GN3A 3FB6C 1FFXA 4NTYA 3LDCA 1XDCA 1KQSU 3JD0A 1V54C 4NVPA 3HKCB 3B40A 4QNHB 1NJIW 4K8XA 1PL4A 3ZHTA 1SETA 1VQPV 1N8RW 4B3TO 2L35A 3BHPA 3JARB 1R73A 3ETDA 4DV4O 4PELA 3W7UA 1WLEA 2EBOA 4U7OA 1H8HG 2WLNA 4PA6A 3U2ZA 2EJ7A 3OFNG 2EZOA 3R65A 4DW1A 3STLC 4NXNB 1BHBA 4DV0B 1I94B 4LFBB 4YJ2B 1GH6A 3GWKC 1XHZA 3N2GA 2CK3G 4DV4B 1BQZA 1EZVH 2B1GA 5LP6B 3DXRB 5JJJB 1AR1B 5TISZ 4H13B 1YSCA 1SA0A 2VQFB 2YXLA 4JAUA 1RPRA 1ORQC 3E0VA 4UB8Z 3T2MA 2HFEC 2HKOA 5JCOC 3QO5A 1GN2A 4UVAA 5H5NA 1BCCH 1YTFB 4EFEA 3TJTA 4B2DD 3K0GA 1Y76A 3ZHRA 3WB0A 1Q6IA 3ASOB 3E8FA 2QTOA 4MSWC 1BT8A 2ZINA 4KHPO 4JAVA 4H44B 4GLXA 1PKNA 4IMAA 3ABUA 2OIGA 3SRFA 1IXBA 4FM1A 2W0XA 3D36A 4UV9A 3K57A 3EFFK 2IJJA 4LH6A 1KD1W 1FXKB 3TGUH 4H33A 2YEVA 3OMNB 4JTCB 3HKEB 3L72H 5CA0A 2VGFA 2GBOA 1IBKO 4LF7O 1PM9A 3H1LH 2FB5A 4ZOLA 1AJNA 1HR0B 2NN4A 3JAWB 2F95B 2A06H 3VBBA 1XNQO 1JJ2U 4LP8A 4LWSB 3WB2A 3ZHSA 1N33O 4I55B 4BIUA 5KX5A 3OEHG 4PD4F 2R9IA 3N2KA 4OXSA 3K5LA 4MVSA 4DV3O 1W0JG 4PJ0Z 3ZRXA 3DXRA 1XL6A 1BS3A 2XAHA 2PGGA 2EINB 1GTOA 5KUKA 3RW0A 1PKMA 1G4YB 2VQEB 1DK1A 4KHPB 3B77A 4JI7O 3AEIA 4YY3O 3ABLB 2Q8VA 2IH3C 1NH2D 5H6QA 3WFVA 5LYJB 2LW1A 1PV0A 1AJQA 2ZD9A 4JI4O 4WFBV 1VQ5V 2ZNJA 3CRQA 5JQGB 1GKFA 5KHKA 4J9ZB 1I7FA 4O4LA 3RVYA 3GG8A 2Z3YA 3FYEB 4D6TH 3E8GA 4MVMA 1S76D 5BR8O 3JYCA 1SQQH 2EULA 2UUBB 1W59A 4O4LB 4TV9A 3HQPA 4DXWA 2UU9B 4GX1A 4PA3A 2BTQB 3LUTB 4QPKA 4IT5A 3HR0A 3D3IA 2YI8A 3CYOA 5LP6A 1AQFA 2LGWA 4MS2A 1R6KA 2ZXWB 3SPHA 2CTRA 4QGPA 2ZT9B 2FKXA 2NLJC 1P7GA 2D3OW 3CRMA 3MHSC 2Y4UA 4LF5O 1N4CA 3UT5A 2PI4A 1VQOV 2Q4PA 2WLIA 3CCLV 4FXFA 1RM1B 4D7SA 3CRRA 2ZR2A 4LWSA 1MZFA 4JYAO 3QVNA 3G71V 4LC1A 5BZBA 3BEHA 3JCZA 5FPOA 2M7WA 1FXKC 2VGBA 4X1YB 4R6ZA 5J2TA 4IIJA 5IJ0A 1FS0G 2ZQMA 1YXBA 1SERA 5JJNB 4B3SB 3JALB 1VQ7V 2EILC 1AILA 2AW9A 1Z5WA 1D5AA 5KMGB 3EVKA 2PYJA 3JATB 3AK2A 1Y74B 4FLWA 3ZMTA 2ZE5A 3CMAV 1FPOA 1OCCB 2XOKG 2EJRA 3E8BA 1OCZC 4FLTA 4GZRB 1I08A 3SR2C 1N0NA 1GK9A 4EKWA 4JI8O 3B2EE 1AROP 3MHHC 1YHQV 5BXZA 2VWKA 1OHHG 3H6OA 3OE7G 4WBNA 1TVKA 1BSMA 4CZZA 1MMMA 2BE3A 1VF7A 1AJPA 4FZ1A 1LNQA 4A5UB 5B3SC 2DWDC 5J9PC 3SDLA 2JEUA 2XUMA 4KP4A 3HQOA 2A0LA 2WLLB 1IZ3A 3CS5A 1F4MA 5A9GA 2UXCB 2CTQA 4EFBA 3JSLA 3Q4HA 1MOFA 4RAIA 2PI5A 3LSUA 1J5EB 1ZJHA 4FLXA 2P4KA 3VQWA 2P90A 2ADQB 5IWAO 1ZL8B 1SQXH 3L73H 4RPPA 2P4VA 1NR1A 4WFEA 5IT9N 1VMGA 2Y0IA 2KSDA 4JYAB 3JASB 1HW7A 4OPAA 5LMUO 1AI7A 2JGUA 2CDYA 5CA1A 1PNMA 1OCRC 1NBMG 4DV5O 1GN4A 5B1AC 5J2UA 4KCWA 3QV6A 3M99B 4F4LA 4UCOA 5JWPA 2E74B 4O4JA 1YVWA 2PUSA 4LBEC 3VQVA 2P22C 4H37A 3ABLC 2IJHA 4I0XB 3QTGA 4O4JB 1IVSA 1R6TA 4ZI7B 4L87A 3UCSC 4RQFA 1GN6A 2A7WA 1Q43A 5A2QN 3OM3B 2JJ2G 4X89A 5IWAB 3OT7A 4KUMA 3UKMA 2QM7A 4RQEA 4ZOLB 1Q8IA 1Z2GA 3HKEA 2Y69C 1GM7A 5CA0B 3ZHQA 4XDLA 3OUFA 1R3KC 2OCCB 4EB6B 2LFRA 1MABG 1QLEB 4FJCC 1TA8A 2QKSA 4LFCB 1GO3F 3UM7A 1FFTB 3ZN0A 2DYSB 1NKDA 2YUAA 3HKBB 1YJ9V 1VQKV 1HDJA 1AP5A 4QJFB 4CBCA 4ZIBA 3AG1C 3K04A 4LNUB 1QQCA 4WBNB 4WFGA 4B3RB 3T1YB 3DSQA 3W7XA 1JPXA 2F4VO 2KKWA 1R3JC 1KUQA 1M90W 2V4DA 3CXCU 4DR1O 3B09A 1Q90D 2PF4E 3P30A 1L0NH 4YJ5A 2X6AA 3RN4A 4CS4A 3QV7A 4B3RO 4JI5B 2LJ2A 1NT2B 2JS5A 4FFBA 5FL7G 3T07A 1U96A 2HHHB 2AHYA 2XAQA 3ABMB 2QR4A 4DR5O 5CBGA 4B3TB 3N25A 1BGYH 5H2FZ 5LP6C 3G80A 1YJNV 1H38A 4I4TA 1F7YA 1YZBA 2Q73A 3J7AU 3DGEA 1HNZB 4AQYO 2FMLA 4FPPA 4YXWG 4UCVA 3UO2A 3THOA 4DV0O 4LFBO 3CMEV 3BA9A 3A2FA 4FM0A 1BHAA 4JASA 4LF7B 1M1KW 4GKKO 3OUSA 1FJGO 4MVOA 1WNSA 2RDCA 1AI5A 5EZYA 4LF9B 1HNWO 4MTXA 1KECA 2ITCC 3DC6A 3FYIB 1OCRB 1KP3A 4IGGA 3ZRWA 3G2GA 1F23A 5LMNO 4OPHA 3T1CA 4F6RA 2HR3A 5JJEB 1EBOA 3E83A 3NXSA 4JV5O 3CWBH 1SQFA 4I9WA 3RYFA 2WAMA 2FYUH 1L0LH 4MW8A 3RYHB 1UPGA 4NTWA 2N04A 4DW0A 1URFA 3MA8A 5DN6G 3H1HH 4DV6B 4AI8A 5LL6Y 4TV9B 2ETNA 1HNXO 3DTUB 3B8NA 3JAKB 3O65A 4X9QA 4DYLA 4U3JA 1NQTA 2ADPA 2JGDA 1AR5A 4RUEA 4RUFA 1T57A 3ZMVA 1I5YA 1N36O 3T1HO 3G4SV 4KS0A 4G1NA 1R3LC 3SRDA 5EZYB 1X59A 3B4SA 2WSSG 1KYOF 4BW5A 2Q0OC 1XBLA 3N27A 5CA3A 5KA5A 1G8MA 4NXNO 3BRCA 1DTOA 1FFXB 2AZ2A 5EIBC 4JI8B 2CGNA 2Q5ZA 4LFAO 2AZ0A 4CH3A 1Y74A 3CXHF 3IGAC 3ZRSA 4JI4B 4LF8O 3W7TA 1KU9A 1SC5B 5CMUA 4X65O 1IBMB 4QPJA 4FFKA 1WAZA 5LA6B 3EHBB 4U3JB 2OIEA 4O2AA 5CB4A 5GONB 4PI2A 1B04A 2XAJA 2GHYA 4DUZB 2UXDO 1MNGA 3AK3A 1FXVA 2EILB 2ILMA 4UUJC 4FFBB 1IX9A 1EN4A 3VOUA 3S3XA 5KA6A 1PP9H 1SS3A 2X6BA 3H1KH 2OCCC 4Q20A 3CP1A 3EOEA 1RSOB 1F3WA 2B9ZA 4JPRA 1XQ8A 1VQ9V 4BR6A 2L6LA 3CC4V 1N32O 4B7EA 3SYQA 4X20A 3G67A 2YEVB 1K5QA 2BOBC 5CN0A 4UVCA 1XNRO 3NR7A 5L3DA 4I7ZB 4BAYA 1XHXA 1O9GA 4MW3A 3IAYA 2D2CB 2XNDG 2RMKB 3M8AA 1OJHA 5EBWC 3GB7C 3RYCA 3R66A 4K8ZA 1E79G 3AG1B 2KQXA 1F4NA 1GM9A 3P3PA 4KFMA 1CEZA 5HFLA 5LOVA 2QWRB 4MTGA 4BW9A 4NR1A 1YCIA 2OWOA 3RGBA 2Y4TA 3JD3A 2QJ1A 3RVZA 2F1MA 2AGAA 1M4UA 4QE7A 2E76B 4GUNA 3QO7A 1E0TA 4J42A 2DE0X 4WJ8A 1WB8A 1A3WA 5K1PA 1THZA 4LF8B 1PL0A 3KZIZ 1NTKH 2Y0PA 2IBZH 3BCCH 5KAIZ 1S72V 4HYWA 4KXRA 5IJ9B 4DR4B 2Y48A 1H2LA 3MD0A 4LNUA 3G6BA 1JVMA 2UU9O 3K5OA 4NB5A 2QKAA 1XMQB 4JI6O 1K8AW 3CRCA 2GTSA 4F6EA 2QTSA 2LW7A 4DV6O 2DQ0A 3FAVB 4J9YB 2WLMA 3N2KB 2BTQA 2K9PA 2FL4A 3U11A 2JEXA 5B1OA 3AAGA 5IYBO 5LHHA 1LUVA 3JAWA 1WA8B 5IYDO 3M7MX 3BVOA 3L74H 4E4EA 1EFRG 3CCQV 1NI8A 5LGNA 4O4HA 3EXAA 1YDXA 3QO8A 1ZX3A 1XNQB 2HG5C 4JI2B 1HR0O 3JAMN 5IY5B 2BTOA 4J7ZA 2QWPB 4KRZA 3E89A 1V9PA 2Z0AA 4FMTA 4AQYB 2G38A 4UB6Z 3TCUA 4ZI7A 1P7BA 3QTCA 4DV2O 2QWOB 3P32A 3I56V 4DV3B 3IC7A 4FXJA 5BR8B 4K0KB 3MAQA 2UXCO 5IJ9A 4ZKIA 5EBLC 3HKDA 3SPJA 4MVUA 4B3MO 1VQ6V 2DYRB 2Q6AA 2IJIA 5FNVB 1RSOA 5IYZA 3OTFA 2YIDA 2E28A 3LNNA 2Y69B 2UUCO 4B08A 1P49A 1YEWA 1KKDA 4QIWF 5EYPB 2UUAO 4DV1B 3ZX6A 3K59A 3MDSA 5LXTB 2UXXA 2R70A 4QE9A 4D7TA 2VQFO 2OTLV 3CB2A 3UQ8A 1JFFA 1MA1A 4IIJB 5IJ0B 1NVPD 4X64B 3T1HB 4X65B 1IBMO 1RM1C 2ZM6O 4PDRA 4K0KO 5L3FA 1IURA 2MK3A 1GRJA 2FTKA 3OR6C 1S77D 3HB3B 3T1YO 2W6IG 2N05A 4CH4A 1US6A 2HJFC 5IYZB 1WJZA 4JI0B 1H2KA 1XEQA 1PKYA 2W0FC 1F51A 1M9NA 4JI2O 3OEEG 2ZR3A 2DYRC 5IYCO 4J41A 1OCCC 4FM2A 3ICXA 4JI3B 2EIKC 2RJZA 1V55B 5BMVB 3A0HZ 4PV1B 1Y67A 1YIJV 3FX7A 4C7UA 5L3EA 1OCOB 2RQ6A 1BZKA 5DM6V 2Q69A 1VF6A 1K33A 4NKGB 2E5LO 5FLXN 1V54B 2A9HA 5B1NA 4F6RB 3STZC 3SGIA 5B1BC 4X66O 5D5PA 1Q7YW 1IXMA 4LF5B 1WA8A 4X88A 1DLBA 2QM8A 1OV9A 4JF3A 2IU3A 4YJ3B 1D2DA 1K7DA 2WLIB 5D5QA 3X2QC 1QR9A 4JI1O 1VARA 4R50A 3JD1A 4QG9A 4JI0O 2R9AA 3OAAG 3B8MA 4GX2A 3ZRVA 3C3TA 2Q9LA 1QHTA 4JI5O 2YICA 1PPJH 4TV8B 3SJQC 4B7KA 4P30A 4DR2O 1X4TA 1ZSPA 5LBQA 1R3IC 3U10A 4HNAB 3G6EV 2ZKOA 3I55V 1VF6C 4NXMB 4X62B 2UXBO 2WLLA 3K9AA 1MSWD 1J5EO 4ABMA 4MVZA 3BJTA 3GR4A 1Q5OA 4B2DA 2JK5C 4JI7B 2DMXA 3RYFB 3KG2A 4U3FH 5DECA 1P4RA 1OCZB 2HVJC 3BY6A 3K9SA 2YC0A 1XREA 2B1IA 2Q7GA 4LF9O 3E2EA 5LOVB 1EN6A 1NR7A 4X1IB 3ZIAG 1XNRB 5C8YB 2XHBA 4J10A 2Q7HA 1Q6HA 4BIZA 3SRHA 1SQBH 1D5NA 1BMFG 1FAFA 4DV1O 4FVMA 4DRXA 2Q7EA 2JRIA 4GKJB 5LYJA 5B66Z 3RFRA 3A0BZ 2IW5A 3FD9A 1FD9A 3CD6V 1WN7A 1E0UA 4FZ0A 4GKJO 3E35A 1CP9A 1M93A 3OR7C 4KL1A 4X20B 1N33B 2LP7A 1FJGB 1I94O 3H9VA 5EYPA 4KCTA 1SESA 5CBFA 1YJWV 3ZS8C 4UCUA 4WFAV 2ATKC 3E22A 2ZM6B 4FLYA 1DGSA 3AG4C 2UXDB 5H9CA 4UCSA 2E3CA 3TK1A 3L70H 2KG7B 4TSFG 2OT5A 1AP6A 4DK0A 4I0XA 3D8CA 4FLUA 2UUAB 2CUGA 3K5NA 3H1IH 4YIOA 4WCEV 2P6JA 4X62O 2P5OA 1Q82W 2P06A 4ZBMA 1L8DA 1K3EA 1SRYA 3HKBA 3IC9A 3JD4A 4FLZA 1IDSA 5J2UB 2JJ1G 3AG2B 3K79A 4YJ3A 4UVBA 4X1KB 1KP2A 1WP8A 2ZDIC 4KCUA 1W2BU 4G28B 4UFZA 2F43G 4O4HB 4J7JA 2ODMA 1YTFD 2P7TC 4TWKA 4X1KA 2DWEC 2VGIA 2A3QA 2ZCEA 4R8CA 4XDJA 5JVDB 3ASNB 2UUBO 3L71H 1I0HA 2EIMB 4Z2WA 4YHHO 1NTZH 2DQ3A 1G1XB 3WG7B 1SZTA 2GTAA 2XT9A 3F7YC 1K97A 3ZMUA 2OCHA 3SJCC 1VQNV 4MTFA 3CC2V 2GDSA 3TXQA 4GT1A 4LCUC 1OZ0A 4JZGA 2YDEA 3BFRA 1JX9A 1BQ0A 3GQYA 1VEWA 4CH5A 2R72A 4I55A 2CH7B 5KX5B 4YY3B 3SYCA 2O57A 1N32B 1IBKB 4WFHA 1XMOB 4GKKB 2XAFA 3AG3B 4DO2A 3H01A 5KMGA 3K0DA 4ZHQB 1JMKC 4OX9B 1PD3A 3LDEA 3JALA 5EC2C 4I4TB 5F2VO 3TETA 3U0ZA 3RYCB 5FPRA 2ZXWC 5BMVA 3Q4HB 4AHCA 1QBZA 2KB1A 3BABA 2HVKC 4LF6O 2Q0AA 4GX0A 5DEDA 4DR5B 3ABKC 4DR6O 3ML0A 2QWQB 3GVMA 2DW4A 4WFFA 1JQ0A 2IH1C 2X0LA 3SJBC 1TVKB 1Y76B 3T4ZA 5LHIA 1NZ6A 2YXYA 5B5EZ 4YNGA 2EIJB 2ARHA 3ZEDA 1KBHA 3CCEV 3SYOA 3H1JH 4MVRA 3KTXA 5C93A 3BPZA 2JGDB 3LSQA 1ZTEA 4AILC 1K4CC 3JAKA 1AVMA 1JJOA 4BIOA 5JCOA 4NTXA 3AK1A 1KMIZ 4CS3A 1N34B 4J7KA 4EEQA 3JSNA 3E0WA 2ZNIA 1PNLA 3RYHA 5JVDA 4W4LA 1VF5B 5JH7A 1B3QA 1M5IA 2DYSC 5GONA 4YJ2A 4DV2B 2YI9A 2A79B 2QKCA 1GAXA 5GW7A 4JI6B 5IDJA 2WLKA 1S3JA 1L1FA 2V7QG 4DR6B 4NYKA 3ZRWB 4LR3A 4NXMO 5H6RA 4CC5A 4JV5B 2Z5UA 3J81N 3JD2A 2CH7A 4P9OA 4QGCA
chains in the Genus database with same CATH topology
1PNMA 1OCRC 1PKXA 1NBMG 1Y4MA 1KKDA 4PA9A 5B1AC 1WPXA 4QIWF 1K5SA 3ZN1A 2R9RB 3M99B 1ROPA 4PA7A 4F4LA 2XAGA 4RO2A 1YI2V 4GCZA 2OTJV 1J95A 2UXXA 4LBEC 4QE9A 4H37A 3ABLC 1FXKA 2IJHA 3GWOA 2OTLV 1UJWB 1K73W 3LDDA 1EZJA 1NVPD 2H8PC 4L87A 2EZPA 3ZCCA 5L3BA 4RQFA 1W0KG 5CBHA 5EBMC 1RM1C 3SYAA 1AI6A 4E2LA 4PDRA 1M56C 4UV8A 1S5HC 5B3SB 2B5UA 3OM3B 1AI4A 3K06A 5L3FA 2JJ2G 2MK3A 4X89A 3RBZA 2FTKA 1K34A 3OR6C 1BL8A 3AG4B 1S77D 3HB3B 4R7CA 5E1AC 4KUMA 2W6IG 2WLJA 2HJFC 3UKMA 1I5XA 2QM7A 3W7SA 4RQEA 2BOCC 4XBFA 3CC7V 3SPGA 1CPYA 1K9MW 1B6QA 1F51A 2W0FC 3A0RA 1M9NA 1GM7A 2Y69C 1PNKA 5KUMA 5B1BB 4XDLA 3LNMB 3OEEG 3OUFA 1R3KC 2OCCB 3WG7C 1YITV 2ZR3A 2DYRC 4G2KA 2LFRA 5IYCO 1MABG 1QVGU 1QLEB 4FJCC 1OCCC 2QEXV 2QKSA 1GO3F 3UM7A 1VQLV 4JGSA 1FFTB 3AG2C 3ZN0A 2DYSB 1Q86W 1NKDA 3K08A 2EIKC 1V55B 1YJ9V 1VQKV 1V55C 1YIJV 4QJFB 4CBCA 1NVPB 4PDVA 5L3EA 1OCOB 3CPWU 4MVQA 2Q69A 3AG1C 5DM6V 3K04A 3K3WA 1K33A 4WFGA 1V54B 2A9HA 4P2ZA 5B1NA 2JIZG 4XDKA 4JYCA 3STZC 3W7XA 1JPXA 5B1BC 1R3JC 3LSSA 1K4DC 2ZDIA 1VQ4V 1Q7YW 1IXMA 1M90W 3FKSG 4FIPC 1DLBA 4X88A 2QM8A 4JTDB 3CXCU 3FB6C 3IFXA 3LDCA 1KQSU 3JD0A 4JF3A 4P9PA 1V54C 3P30A 2IU3A 2AHZA 4I5SA 1NJIW 4QNHB 2X6AA 1K7DA 1SETA 1S0VA 2WLIB 1VQPV 5FL7G 1N8RW 3X2QC 1QR9A 5LGTA 4Z1MG 1R73A 3ETDA 2AHYA 3JD1A 4R50A 2XAQA 4PELA 3W7UA 3ABMB 1WLEA 2EBOA 4U7OA 1H8HG 2WLNA 3OAAG 5CBGA 1QR8A 3B8MA 4GX2A 4PA6A 3ZRVA 4TT3G 3OFNG 2EZOA 1YJNV 1H38A 3R65A 3SJQC 4P30A 3STLC 1BHBA 2HLDG 5LBQA 3DGEA 3ABKB 2EIMC 1R3IC 4FPPA 4YXWG 1VQMV 2CK3G 2B1GA 3G6EV 4G27B 3I55V 3CMEV 2WLLA 3K9AA 1MSWD 1BHAA 4JASA 4MVZA 1AR1B 3AAGA 1M1KW 1YSCA 2JK5C 3OUSA 1FXHA 3K03A 3PJSK 4JAUA 3KG2A 4MVOA 1RPRA 1ORQC 3T2MA 2P67A 1AI5A 2HFEC 2HKOA 1HWYA 1TUEB 1P4RA 2XASA 1OCZB 3QO5A 3OW2U 2HVJC 3BY6A 4MTXA 4UVAA 2H94A 1KECA 2ITCC 3OMIB 2B1IA 1YTFB 3FYIB 3ZRWA 1OCRB 1KP3A 1F23A 3T1CA 3OMAB 3E2EA 2HR3A 3K0GA 1NR7A 3ZIAG 1H2GA 4ASUG 1EBOA 3E83A 3NXSA 1Q81W 4BIZA 3ASOB 3E8FA 4I9WA 2QTOA 4MSWC 2WLHA 2WAMA 1KC8W 2WWWA 1BMFG 3FB8C 4MW8A 4JAVA 3ABUA 4MTOA 3D36A 3E86A 4UV9A 5DN6G 1E1RG 2IW5A 1Y66A 1M57C 5L3GA 3DTUB 3CD6V 3B8NA 2EINC 3EFFK 2IJJA 1KD1W 1NQTA 1FXKB 3E35A 4RUEA 4H33A 4RUFA 1CP9A 2YEVA 3OMNB 3OR7C 4JTCB 2LP7A 3ZMVA 1I5YA 2X7RB 3G4SV 1SESA 1R3LC 2GSMB 5CBFA 1YJWV 1AJNA 4FK5C 2WPDG 3VBBA 4WFAV 2ATKC 2QE7G 2WSSG 1JJ2U 4LP8A 4BIUA 3OEHG 4HYOA 4BW5A 4GX5A 2JDIG 4PDLA 5CA3A 5KA5A 1G8MA 3AG4C 2R9IA 4OXSA 4MVSA 5LGUA 1DTOA 1W0JG 2Q67A 5H9CA 4HZ3A 3ZRXA 1XL6A 2XAHA 3TK1A 3ETGA 3FB7C 3IGAC 3CCSV 3ZRSA 2EINB 1GTOA 3SYPA 3RW0A 4TSFG 5KUKA 3W7TA 1G4YB 2OT5A 5CMUA 4QPJA 1DF5A 3B77A 3AEIA 3EHBB 2YSUB 3ABLB 2XAJA 4WCEV 2GHYA 2P6JA 2IH3C 1NH2D 1Q82W 5H6QA 3WFVA 4ZBMA 1K3EA 1SRYA 3JD4A 5L3CA 1FXVA 2EILB 3X2QB 3ASOC 1AJQA 1H8EG 2ZD9A 4UUJC 2JJ1G 4WFBV 1VQ5V 3AG2B 1K92A 3VOUA 1JCHA 3E8HA 3K79A 1GKFA 2W6JG 4J9ZB 2ITDC 5KA6A 5B1AB 1NH2B 4UVBA 1KP2A 2X6BA 3RVYA 2ZDIC 2OCCC 4Q20A 1W2BU 4G28B 3CP1A 1QLNA 3ZJZA 1E1QG 2Z3YA 2NNUA 3FYEB 2F43G 4JPRA 3E8GA 4MVMA 3SPCA 1VQ9V 1S76D 3CC4V 3JYCA 3QNEA 3SYQA 1YTFD 4U7NA 2YEVB 2P7TC 1K5QA 4UXNA 4TWKA 3ETEA 1ENVA 1DF4A 2BOBC 5CN0A 2EIJC 4HAMA 4UVCA 5L3DA 2LFSA 1GM8A 4BAYA 2DWEC 4MW3A 4XDJA 4R8CA 3F7VC 4DXWA 3CCVV 2X6CA 4GX1A 4PA3A 3LUTB 4QPKA 2XNDG 1R6NA 2EIKB 2IU0A 3ASNB 2EIMB 3D3IA 5EBWC 3GB7C 2DQ3A 3CYOA 3WG7B 1ZWIC 4MS2A 1R6KA 2ZXWB 1E79G 3SPHA 5IY5C 1SZTA 3AG1B 1F4NA 1GM9A 4KFMA 3F7YC 1K97A 4N23A 3ZMUA 1CEZA 2NLJC 4JTAB 5HFLA 2D3OW 1VQNV 3HPLC 4MTFA 3CC2V 4GT1A 4MTGA 4LCUC 1OZ0A 3JD3A 3MHSC 3RVZA 1JX9A 4QE7A 2PI4A 2QA4V 1VQOV 3AG3C 2WLIA 3CCLV 3FB5C 3QO7A 2UXNA 1RM1B 2ZR2A 3SYCA 3G71V 1M57B 4LC1A 4X8AA 5BZBA 4WFHA 3BEHA 1THZA 3JCZA 2M7WA 1FXKC 1PL0A 1JOYA 5HFMA 2XAFA 3AG3B 4R6ZA 4DO2A 1OCOC 3H01A 1FS0G 4N21A 3K0DA 2ZQMA 3CCRV 1SERA 1S72V 2Y48A 1VQ7V 3MD0A 1GMGA 1JVMA 1PD3A 2EILC 3LDEA 5EC2C 1K8AW 1M56B 3TETA 3ABTA 2ZXWC 1QVFU 4PA4A 2V1DA 1QBZA 1XL4A 3ZMTA 2KB1A 2HVKC 2DQ0A 4J9YB 1QLEC 2K1EA 2WLMA 3CMAV 3CCJV 1OCCB 4GX0A 2XOKG 3CCUV 3ABKC 3ML0A 2EJRA 3E8BA 2C2AA 1OCZC 3ASNC 2JEXA 2DW4A 5B1OA 5EK0A 4WFFA 1GK9A 2IJKA 1JQ0A 5IYBO 3ZMSA 5LHHA 4EKWA 2IH1C 4MT8A 1VQ8V 2X0LA 1QCEA 3T4ZA 5IYDO 5LHIA 1AROP 3MHHC 1YHQV 2EIJB 1EFRG 5LHGA 3CCQV 3CCEV 3SYOA 5LGNA 4MVRA 5C93A 1OHHG 3LSQA 3OE7G 4CZZA 3QO8A 1K4CC 2HG5C 1AJPA 1LNQA 5B3SC 3T4DA 2DWDC 5J9PC 1COWG 4PDMA 5IY5B 2JEUA 4KP4A 3E89A 2A0LA 2WLLB 1PNLA 1F4MA 4FMTA 4WF9V 3W7WA 3TCUA 1MOFA 1P7BA 4RAIA 3ZMZA 2PI5A 3P32A 3I56V 2DYSC 2P90A 3IC7A 3SPIA 2A79B 3ABMC 5GW7A 4ZKIA 5EBLC 5IDJA 1NR1A 2WLKA 1S3JA 4WFEA 1L1FA 2V7QG 3SPJA 4MVUA 1VQ6V 3ZRWB 2DYRB 5EC1C 1RPOA 2Q6AA 2IJIA 4JYBA 3CCMV 5H6RA 3F5WC 2Z5UA 3OGCC 3JD2A 1AI7A 4P9OA 2Q68A 2Y69B 1MG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JDI G;  1NBM G;  5FL7 G;  2R9I A;  5LGU A;  1W0J G;  5LGT A;  4Z1M G;  2XAQ A;  2XAH A;  3ZN1 A;  1H8H G;  3OAA G;  2XAF A;  2XAG A;  4TT3 G;  1FS0 G;  3OFN G;  4TSF G;  2UXX A;  2Y48 A;  2HLD G;  5LBQ A;  2XAJ A;  4YXW G;  2CK3 G;  5H6Q A;  3ABT A;  5L3B A;  1W0K G;  2V1D A;  5L3C A;  3ZMT A;  1H8E G;  2JJ1 G;  4UV8 A;  5L3F A;  2JJ2 G;  2XOK G;  2EJR A;  2W6J G;  4UVB A;  2DW4 A;  3ZMS A;  4KUM A;  2W6I G;  2HKO A;  5LHH A;  2XAS A;  2X0L A;  4UVA A;  1E1Q G;  2Z3Y A;  2H94 A;  5LHI A;  4XBF A;  2F43 G;  5LHG A;  1EFR G;  5LGN A;  4UXN A;  1OHH G;  3ZIA G;  3OE7 G;  4ASU G;  4CZZ A;  3OEE G;  4UVC A;  5L3D A;  4BAY A;  1MAB G;  2XND G;  1COW G;  1BMF G;  3ZN0 A;  3ABU A;  4UV9 A;  3ZMZ A;  5DN6 G;  1E1R G;  1E79 G;  2IW5 A;  5L3G A;  5L3E A;  3ZMU A;  2JIZ G;  2V7Q G;  3ZMV A;  3FKS G;  5H6R A;  2WPD G;  2Z5U A;  2QE7 G;  2WSS G;  2UXN A;  3OEH G; 
#chains in the Genus database with same CATH topology
 1PKX A;  1Y4M A;  2H3O A;  4PA9 A;  3PP7 A;  1WPX A;  2HP8 A;  4IL6 Z;  1ROP A;  4PA7 A;  1SZX A;  2M6Y A;  3GWO A;  3JCU Z;  1K73 W;  3PN1 A;  1XIL A;  3LDD A;  1EZJ A;  4LF4 B;  3IJ4 A;  5GTH Z;  3FFQ A;  2EZP A;  4DV5 B;  1W0K G;  5EBM C;  3SYA A;  3CSX A;  1M56 C;  2QDO A;  2IM9 A;  3BAA A;  1R1B A;  1TUB B;  1K34 A;  1BL8 A;  3AG4 B;  3D36 C;  3CHX A;  1H2N A;  3A8T A;  2ZIM A;  3K5M A;  4R7C A;  5E1A C;  4CS2 A;  1I5X A;  3W7S A;  1QU7 A;  2BOC C;  3SPG A;  1CPY A;  1K9M W;  3A0R A;  1PNK A;  1VIB A;  1S5J A;  1YIT V;  4I50 B;  4G2K A;  2VWJ A;  3CJH A;  2YIB A;  1QVG U;  4TQD A;  1HNZ O;  2QEX V;  1U97 A;  3OTO B;  1N34 O;  2F4V B;  4LH7 A;  1A5U A;  1QNM A;  1V55 C;  2BSK A;  4UCR A;  3RT3 C;  4IYI A;  4PDV A;  4BWA A;  3CEI A;  1MZE A;  4IHJ A;  2CGO A;  4P2Z A;  5LXT A;  2UXB B;  2LO1 A;  2YXH A;  4DV7 B;  4LFC O;  2ZDI A;  5ITZ A;  1RFY A;  3FKS G;  4JTD B;  3IFX A;  4P9P A;  4I5S A;  2AHZ A;  4DR3 O;  1S0V A;  2ZE6 A;  5LGT A;  4Z1M G;  4CH6 A;  3CX5 F;  3OGI B;  1QR8 A;  3KKY A;  4TT3 G;  1SQG A;  1SKV A;  3N2G B;  2HEP A;  2JS3 A;  2ZE8 A;  4O2A B;  2HLD G;  4IHJ B;  3OTO O;  1N36 B;  1Q3E A;  4TV8 A;  3ABK B;  2EIM C;  1VQM V;  1XI1 A;  2BSK B;  2LQT A;  4DRX B;  4G27 B;  4PHZ A;  3JAR A;  2CE4 A;  2QGN A;  3J80 N;  2PYL A;  1FXH A;  2JVD A;  3F5T A;  3K03 A;  3PJS K;  1LUW A;  2P67 A;  4OGQ B;  1HWY A;  1TUE B;  2XAS A;  4DRS A;  3OW2 U;  4X1I A;  2H94 A;  3OMI B;  2VS0 A;  4YIP A;  2BCC H;  3OMA B;  1H2S B;  1Z5V A;  2GUZ B;  3ZHV A;  1H2G A;  4ASU G;  5KHJ A;  2EX3 A;  1Q81 W;  4DUY O;  1HP8 A;  2AXT Z;  3SRK A;  2WLH A;  1KC8 W;  5KHH A;  1SQP H;  2WWW A;  1Y6X A;  3FB8 C;  4RWU A;  4O4I B;  3QV8 A;  5AG2 A;  1XUQ A;  4JZ2 A;  2G50 A;  4KCV A;  4MTO A;  3E86 A;  5EIB D;  1E1R G;  4DR2 B;  4TUY B;  3RYI A;  1Y66 A;  1M57 C;  5L3G A;  5KAF Z;  2OYQ A;  2EIN C;  5CB4 B;  3RWR D;  3IS4 A;  5IE9 A;  1VP8 A;  1XMQ O;  1ZLZ A;  2X7R B;  2N74 A;  2VGG A;  4IYH A;  4DR4 O;  2ZIO A;  2GSM B;  1UFI A;  4FK5 C;  2WPD G;  2QE7 G;  2PZS A;  3TXS A;  3QV9 A;  5CA1 B;  5JQG A;  4HYO A;  3WU2 Z;  3HKC A;  4GX5 A;  2JDI G;  4PDL A;  5LGU A;  2Q67 A;  3JAS A;  4HZ3 A;  2CAZ C;  3ETG A;  3FB7 C;  1MSD A;  1HNW B;  3CCS V;  2ZE7 A;  4DR1 B;  3SYP A;  3ZHU A;  1DF5 A;  1AB3 A;  3ME3 A;  2YSU B;  4TUY A;  4X1Y A;  4L8J A;  5L3C A;  3X2Q B;  1H8E G;  3ASO C;  3P3N A;  4K3A A;  4DR7 B;  5LMU B;  1K92 A;  4OX9 O;  1JCH A;  3E8H A;  4I9Q A;  2W6J G;  4Q6G A;  2ITD C;  1NH2 B;  5B1A B;  3BA8 A;  3E22 B;  2E5L B;  3T05 A;  3UT5 B;  1JA8 A;  5K1X A;  1QLN A;  2MW2 B;  3ZJZ A;  1E1Q G;  2NNU A;  3OD4 A;  4O2B A;  4TOI A;  3SPC A;  1WPB A;  1H2M A;  1NU1 H;  3QNE A;  4U7N A;  4UXN A;  3WB1 A;  3ETE A;  1ENV A;  1DF4 A;  2EIJ C;  1KB9 F;  2LFS A;  1GM8 A;  1FYJ A;  3KHD A;  3F7V C;  3CCV V;  2X6C A;  4HYV A;  1R6N A;  2EIK B;  2IU0 A;  1G6U A;  4J80 A;  2HJD A;  3JAT A;  1ZWI C;  5IY5 C;  3CRA A;  1TAE A;  4JPG A;  1JFF B;  1XOU A;  4EB6 A;  2RN9 A;  4N23 A;  1NS1 A;  4DUZ O;  4JTA B;  1VP7 A;  3HPL C;  4JAA A;  5J2T B;  4DR7 O;  3C3S A;  2QA4 V;  4X64 O;  3AG3 C;  4LFA B;  3FB5 C;  1RP3 B;  2UXN A;  1CXZ B;  1B06 A;  1TUB A;  1M57 B;  1KKC A;  2CTW A;  4B3M B;  4PI0 A;  4X8A A;  5FNV A;  1JOY A;  5HFM A;  1O9H A;  1OCO C;  4N21 A;  2DN9 A;  3CCR V;  1HNX B;  3HKD B;  1EM1 A;  1GMG A;  4J11 A;  3K58 A;  1M56 B;  3D3Q A;  3KCX A;  2GV9 A;  3L9D A;  3ABT A;  1QVF U;  4PA4 A;  2V1D A;  1XL4 A;  4UCT A;  2QWN B;  2DOS A;  5BY1 A;  1QLE C;  2K1E A;  3CCJ V;  3T0T A;  2YIB D;  3CCU V;  2C2A A;  1N0J A;  3ASN C;  5EK0 A;  3ZMS A;  2IJK A;  2RNB A;  1VQ8 V;  4MT8 A;  1QCE A;  2GUZ A;  5LHG A;  1P84 F;  4FLV A;  3CE2 A;  4X66 B;  5GTI Z;  4DUY B;  3HQN A;  3T4D A;  3APO A;  5JH7 B;  1WB7 A;  2XTA A;  1COW G;  4PDM A;  1WP7 A;  3L75 H;  3FAV A;  1NTM H;  5KHG A;  4WF9 V;  4GYC B;  3W7W A;  3ZMZ A;  1JR9 A;  1T5A A;  1IBL O;  3ZBH A;  3QG5 A;  5C8Y A;  4JI3 O;  3SPI A;  2PY5 A;  3ABM C;  3ETQ A;  1A49 A;  4QG8 A;  2KG7 A;  4CC6 A;  2HHH O;  5EC1 C;  1RPO A;  1T5E A;  3C90 A;  4JYB A;  3CCM V;  1LR1 A;  3F5W C;  3OGC C;  1TGO A;  1SF9 A;  3DC5 A;  4HAM A;  2Q68 A;  1MG1 A;  1SA0 B;  2F23 A;  3UO3 A;  4DK1 A;  2PTM A;  2YIA A;  3QF7 A;  3AG7 A;  4DR3 B;  3BJF A;  1K5S A;  5ITZ B;  3ZN1 A;  2R9R B;  1F3X A;  1PKL A;  2WA3 A;  4TQF A;  2XAG A;  4RO2 A;  3APQ A;  1YI2 V;  4GCZ A;  2OTJ V;  1J95 A;  3O9O A;  1EN5 A;  1FXK A;  2DJV A;  2RCV A;  1ZL8 A;  5LA6 A;  1UJW B;  4Z1V A;  2H8P C;  3ZCC A;  5L3B A;  5CBH A;  1ZUQ A;  2UUC B;  4K35 A;  1AI6 A;  4E2L A;  4UV8 A;  1S5H C;  5B3S B;  2B5U A;  4DV7 O;  3VQX A;  1AI4 A;  2VRZ A;  2WA4 A;  3K06 A;  3RBZ A;  4H0L B;  1Q6U A;  4QG6 A;  1A32 A;  3CJH B;  2E75 B;  1ZAU A;  4I50 A;  2WLJ A;  2F66 C;  3S3W A;  4JYY A;  4XBF A;  3I5D A;  3CC7 V;  4JI1 B;  1B6Q A;  3VQY A;  1YF2 A;  4LF6 B;  5KUM A;  4O2B B;  3KCY A;  1S5L Z;  5B1B B;  1AR4 A;  3LNM B;  3WG7 C;  3RYI B;  1A3X A;  2QSA A;  2NR5 A;  1FKA O;  1VQL V;  4JGS A;  4B3S O;  3AG2 C;  1BE3 H;  4O4I A;  1Q86 W;  3K08 A;  1IBL B;  4W4K A;  5KHI A;  4IP7 A;  2CTP A;  5KLV H;  1SQV H;  4HBN A;  4HNA A;  1XMO O;  1NVP B;  4ICG A;  3CPW U;  4MVQ A;  2F93 B;  2QM4 A;  3K3W A;  5E79 Z;  4LF4 O;  4YHH B;  2JIZ G;  4XDK A;  4JYC A;  4ZHQ A;  3LSS A;  1K4D C;  2YS8 A;  1VQ4 V;  2VQE O;  4FIP C;  2LGQ A;  3SJA C;  5LMN B;  1GN3 A;  3FB6 C;  1FFX A;  4NTY A;  3LDC A;  1XDC A;  1KQS U;  3JD0 A;  1V54 C;  4NVP A;  3HKC B;  3B40 A;  4QNH B;  1NJI W;  4K8X A;  1PL4 A;  3ZHT A;  1SET A;  1VQP V;  1N8R W;  4B3T O;  2L35 A;  3BHP A;  3JAR B;  1R73 A;  3ETD A;  4DV4 O;  4PEL A;  3W7U A;  1WLE A;  2EBO A;  4U7O A;  1H8H G;  2WLN A;  4PA6 A;  3U2Z A;  2EJ7 A;  3OFN G;  2EZO A;  3R65 A;  4DW1 A;  3STL C;  4NXN B;  1BHB A;  4DV0 B;  1I94 B;  4LFB B;  4YJ2 B;  1GH6 A;  3GWK C;  1XHZ A;  3N2G A;  2CK3 G;  4DV4 B;  1BQZ A;  1EZV H;  2B1G A;  5LP6 B;  3DXR B;  5JJJ B;  1AR1 B;  5TIS Z;  4H13 B;  1YSC A;  1SA0 A;  2VQF B;  2YXL A;  4JAU A;  1RPR A;  1ORQ C;  3E0V A;  4UB8 Z;  3T2M A;  2HFE C;  2HKO A;  5JCO C;  3QO5 A;  1GN2 A;  4UVA A;  5H5N A;  1BCC H;  1YTF B;  4EFE A;  3TJT A;  4B2D D;  3K0G A;  1Y76 A;  3ZHR A;  3WB0 A;  1Q6I A;  3ASO B;  3E8F A;  2QTO A;  4MSW C;  1BT8 A;  2ZIN A;  4KHP O;  4JAV A;  4H44 B;  4GLX A;  1PKN A;  4IMA A;  3ABU A;  2OIG A;  3SRF A;  1IXB A;  4FM1 A;  2W0X A;  3D36 A;  4UV9 A;  3K57 A;  3EFF K;  2IJJ A;  4LH6 A;  1KD1 W;  1FXK B;  3TGU H;  4H33 A;  2YEV A;  3OMN B;  4JTC B;  3HKE B;  3L72 H;  5CA0 A;  2VGF A;  2GBO A;  1IBK O;  4LF7 O;  1PM9 A;  3H1L H;  2FB5 A;  4ZOL A;  1AJN A;  1HR0 B;  2NN4 A;  3JAW B;  2F95 B;  2A06 H;  3VBB A;  1XNQ O;  1JJ2 U;  4LP8 A;  4LWS B;  3WB2 A;  3ZHS A;  1N33 O;  4I55 B;  4BIU A;  5KX5 A;  3OEH G;  4PD4 F;  2R9I A;  3N2K A;  4OXS A;  3K5L A;  4MVS A;  4DV3 O;  1W0J G;  4PJ0 Z;  3ZRX A;  3DXR A;  1XL6 A;  1BS3 A;  2XAH A;  2PGG A;  2EIN B;  1GTO A;  5KUK A;  3RW0 A;  1PKM A;  1G4Y B;  2VQE B;  1DK1 A;  4KHP B;  3B77 A;  4JI7 O;  3AEI A;  4YY3 O;  3ABL B;  2Q8V A;  2IH3 C;  1NH2 D;  5H6Q A;  3WFV A;  5LYJ B;  2LW1 A;  1PV0 A;  1AJQ A;  2ZD9 A;  4JI4 O;  4WFB V;  1VQ5 V;  2ZNJ A;  3CRQ A;  5JQG B;  1GKF A;  5KHK A;  4J9Z B;  1I7F A;  4O4L A;  3RVY A;  3GG8 A;  2Z3Y A;  3FYE B;  4D6T H;  3E8G A;  4MVM A;  1S76 D;  5BR8 O;  3JYC A;  1SQQ H;  2EUL A;  2UUB B;  1W59 A;  4O4L B;  4TV9 A;  3HQP A;  4DXW A;  2UU9 B;  4GX1 A;  4PA3 A;  2BTQ B;  3LUT B;  4QPK A;  4IT5 A;  3HR0 A;  3D3I A;  2YI8 A;  3CYO A;  5LP6 A;  1AQF A;  2LGW A;  4MS2 A;  1R6K A;  2ZXW B;  3SPH A;  2CTR A;  4QGP A;  2ZT9 B;  2FKX A;  2NLJ C;  1P7G A;  2D3O W;  3CRM A;  3MHS C;  2Y4U A;  4LF5 O;  1N4C A;  3UT5 A;  2PI4 A;  1VQO V;  2Q4P A;  2WLI A;  3CCL V;  4FXF A;  1RM1 B;  4D7S A;  3CRR A;  2ZR2 A;  4LWS A;  1MZF A;  4JYA O;  3QVN A;  3G71 V;  4LC1 A;  5BZB A;  3BEH A;  3JCZ A;  5FPO A;  2M7W A;  1FXK C;  2VGB A;  4X1Y B;  4R6Z A;  5J2T A;  4IIJ A;  5IJ0 A;  1FS0 G;  2ZQM A;  1YXB A;  1SER A;  5JJN B;  4B3S B;  3JAL B;  1VQ7 V;  2EIL C;  1AIL A;  2AW9 A;  1Z5W A;  1D5A A;  5KMG B;  3EVK A;  2PYJ A;  3JAT B;  3AK2 A;  1Y74 B;  4FLW A;  3ZMT A;  2ZE5 A;  3CMA V;  1FPO A;  1OCC B;  2XOK G;  2EJR A;  3E8B A;  1OCZ C;  4FLT A;  4GZR B;  1I08 A;  3SR2 C;  1N0N A;  1GK9 A;  4EKW A;  4JI8 O;  3B2E E;  1ARO P;  3MHH C;  1YHQ V;  5BXZ A;  2VWK A;  1OHH G;  3H6O A;  3OE7 G;  4WBN A;  1TVK A;  1BSM A;  4CZZ A;  1MMM A;  2BE3 A;  1VF7 A;  1AJP A;  4FZ1 A;  1LNQ A;  4A5U B;  5B3S C;  2DWD C;  5J9P C;  3SDL A;  2JEU A;  2XUM A;  4KP4 A;  3HQO A;  2A0L A;  2WLL B;  1IZ3 A;  3CS5 A;  1F4M A;  5A9G A;  2UXC B;  2CTQ A;  4EFB A;  3JSL A;  3Q4H A;  1MOF A;  4RAI A;  2PI5 A;  3LSU A;  1J5E B;  1ZJH A;  4FLX A;  2P4K A;  3VQW A;  2P90 A;  2ADQ B;  5IWA O;  1ZL8 B;  1SQX H;  3L73 H;  4RPP A;  2P4V A;  1NR1 A;  4WFE A;  5IT9 N;  1VMG A;  2Y0I A;  2KSD A;  4JYA B;  3JAS B;  1HW7 A;  4OPA A;  5LMU O;  1AI7 A;  2JGU A;  2CDY A;  5CA1 A;  1PNM A;  1OCR C;  1NBM G;  4DV5 O;  1GN4 A;  5B1A C;  5J2U A;  4KCW A;  3QV6 A;  3M99 B;  4F4L A;  4UCO A;  5JWP A;  2E74 B;  4O4J A;  1YVW A;  2PUS A;  4LBE C;  3VQV A;  2P22 C;  4H37 A;  3ABL C;  2IJH A;  4I0X B;  3QTG A;  4O4J B;  1IVS A;  1R6T A;  4ZI7 B;  4L87 A;  3UCS C;  4RQF A;  1GN6 A;  2A7W A;  1Q43 A;  5A2Q N;  3OM3 B;  2JJ2 G;  4X89 A;  5IWA B;  3OT7 A;  4KUM A;  3UKM A;  2QM7 A;  4RQE A;  4ZOL B;  1Q8I A;  1Z2G A;  3HKE A;  2Y69 C;  1GM7 A;  5CA0 B;  3ZHQ A;  4XDL A;  3OUF A;  1R3K C;  2OCC B;  4EB6 B;  2LFR A;  1MAB G;  1QLE B;  4FJC C;  1TA8 A;  2QKS A;  4LFC B;  1GO3 F;  3UM7 A;  1FFT B;  3ZN0 A;  2DYS B;  1NKD A;  2YUA A;  3HKB B;  1YJ9 V;  1VQK V;  1HDJ A;  1AP5 A;  4QJF B;  4CBC A;  4ZIB A;  3AG1 C;  3K04 A;  4LNU B;  1QQC A;  4WBN B;  4WFG A;  4B3R B;  3T1Y B;  3DSQ A;  3W7X A;  1JPX A;  2F4V O;  2KKW A;  1R3J C;  1KUQ A;  1M90 W;  2V4D A;  3CXC U;  4DR1 O;  3B09 A;  1Q90 D;  2PF4 E;  3P30 A;  1L0N H;  4YJ5 A;  2X6A A;  3RN4 A;  4CS4 A;  3QV7 A;  4B3R O;  4JI5 B;  2LJ2 A;  1NT2 B;  2JS5 A;  4FFB A;  5FL7 G;  3T07 A;  1U96 A;  2HHH B;  2AHY A;  2XAQ A;  3ABM B;  2QR4 A;  4DR5 O;  5CBG A;  4B3T B;  3N25 A;  1BGY H;  5H2F Z;  5LP6 C;  3G80 A;  1YJN V;  1H38 A;  4I4T A;  1F7Y A;  1YZB A;  2Q73 A;  3J7A U;  3DGE A;  1HNZ B;  4AQY O;  2FML A;  4FPP A;  4YXW G;  4UCV A;  3UO2 A;  3THO A;  4DV0 O;  4LFB O;  3CME V;  3BA9 A;  3A2F A;  4FM0 A;  1BHA A;  4JAS A;  4LF7 B;  1M1K W;  4GKK O;  3OUS A;  1FJG O;  4MVO A;  1WNS A;  2RDC A;  1AI5 A;  5EZY A;  4LF9 B;  1HNW O;  4MTX A;  1KEC A;  2ITC C;  3DC6 A;  3FYI B;  1OCR B;  1KP3 A;  4IGG A;  3ZRW A;  3G2G A;  1F23 A;  5LMN O;  4OPH A;  3T1C A;  4F6R A;  2HR3 A;  5JJE B;  1EBO A;  3E83 A;  3NXS A;  4JV5 O;  3CWB H;  1SQF A;  4I9W A;  3RYF A;  2WAM A;  2FYU H;  1L0L H;  4MW8 A;  3RYH B;  1UPG A;  4NTW A;  2N04 A;  4DW0 A;  1URF A;  3MA8 A;  5DN6 G;  3H1H H;  4DV6 B;  4AI8 A;  5LL6 Y;  4TV9 B;  2ETN A;  1HNX O;  3DTU B;  3B8N A;  3JAK B;  3O65 A;  4X9Q A;  4DYL A;  4U3J A;  1NQT A;  2ADP A;  2JGD A;  1AR5 A;  4RUE A;  4RUF A;  1T57 A;  3ZMV A;  1I5Y A;  1N36 O;  3T1H O;  3G4S V;  4KS0 A;  4G1N A;  1R3L C;  3SRD A;  5EZY B;  1X59 A;  3B4S A;  2WSS G;  1KYO F;  4BW5 A;  2Q0O C;  1XBL A;  3N27 A;  5CA3 A;  5KA5 A;  1G8M A;  4NXN O;  3BRC A;  1DTO A;  1FFX B;  2AZ2 A;  5EIB C;  4JI8 B;  2CGN A;  2Q5Z A;  4LFA O;  2AZ0 A;  4CH3 A;  1Y74 A;  3CXH F;  3IGA C;  3ZRS A;  4JI4 B;  4LF8 O;  3W7T A;  1KU9 A;  1SC5 B;  5CMU A;  4X65 O;  1IBM B;  4QPJ A;  4FFK A;  1WAZ A;  5LA6 B;  3EHB B;  4U3J B;  2OIE A;  4O2A A;  5CB4 A;  5GON B;  4PI2 A;  1B04 A;  2XAJ A;  2GHY A;  4DUZ B;  2UXD O;  1MNG A;  3AK3 A;  1FXV A;  2EIL B;  2ILM A;  4UUJ C;  4FFB B;  1IX9 A;  1EN4 A;  3VOU A;  3S3X A;  5KA6 A;  1PP9 H;  1SS3 A;  2X6B A;  3H1K H;  2OCC C;  4Q20 A;  3CP1 A;  3EOE A;  1RSO B;  1F3W A;  2B9Z A;  4JPR A;  1XQ8 A;  1VQ9 V;  4BR6 A;  2L6L A;  3CC4 V;  1N32 O;  4B7E A;  3SYQ A;  4X20 A;  3G67 A;  2YEV B;  1K5Q A;  2BOB C;  5CN0 A;  4UVC A;  1XNR O;  3NR7 A;  5L3D A;  4I7Z B;  4BAY A;  1XHX A;  1O9G A;  4MW3 A;  3IAY A;  2D2C B;  2XND G;  2RMK B;  3M8A A;  1OJH A;  5EBW C;  3GB7 C;  3RYC A;  3R66 A;  4K8Z A;  1E79 G;  3AG1 B;  2KQX A;  1F4N A;  1GM9 A;  3P3P A;  4KFM A;  1CEZ A;  5HFL A;  5LOV A;  2QWR B;  4MTG A;  4BW9 A;  4NR1 A;  1YCI A;  2OWO A;  3RGB A;  2Y4T A;  3JD3 A;  2QJ1 A;  3RVZ A;  2F1M A;  2AGA A;  1M4U A;  4QE7 A;  2E76 B;  4GUN A;  3QO7 A;  1E0T A;  4J42 A;  2DE0 X;  4WJ8 A;  1WB8 A;  1A3W A;  5K1P A;  1THZ A;  4LF8 B;  1PL0 A;  3KZI Z;  1NTK H;  2Y0P A;  2IBZ H;  3BCC H;  5KAI Z;  1S72 V;  4HYW A;  4KXR A;  5IJ9 B;  4DR4 B;  2Y48 A;  1H2L A;  3MD0 A;  4LNU A;  3G6B A;  1JVM A;  2UU9 O;  3K5O A;  4NB5 A;  2QKA A;  1XMQ B;  4JI6 O;  1K8A W;  3CRC A;  2GTS A;  4F6E A;  2QTS A;  2LW7 A;  4DV6 O;  2DQ0 A;  3FAV B;  4J9Y B;  2WLM A;  3N2K B;  2BTQ A;  2K9P A;  2FL4 A;  3U11 A;  2JEX A;  5B1O A;  3AAG A;  5IYB O;  5LHH A;  1LUV A;  3JAW A;  1WA8 B;  5IYD O;  3M7M X;  3BVO A;  3L74 H;  4E4E A;  1EFR G;  3CCQ V;  1NI8 A;  5LGN A;  4O4H A;  3EXA A;  1YDX A;  3QO8 A;  1ZX3 A;  1XNQ B;  2HG5 C;  4JI2 B;  1HR0 O;  3JAM N;  5IY5 B;  2BTO A;  4J7Z A;  2QWP B;  4KRZ A;  3E89 A;  1V9P A;  2Z0A A;  4FMT A;  4AQY B;  2G38 A;  4UB6 Z;  3TCU A;  4ZI7 A;  1P7B A;  3QTC A;  4DV2 O;  2QWO B;  3P32 A;  3I56 V;  4DV3 B;  3IC7 A;  4FXJ A;  5BR8 B;  4K0K B;  3MAQ A;  2UXC O;  5IJ9 A;  4ZKI A;  5EBL C;  3HKD A;  3SPJ A;  4MVU A;  4B3M O;  1VQ6 V;  2DYR B;  2Q6A A;  2IJI A;  5FNV B;  1RSO A;  5IYZ A;  3OTF A;  2YID A;  2E28 A;  3LNN A;  2Y69 B;  2UUC O;  4B08 A;  1P49 A;  1YEW A;  1KKD A;  4QIW F;  5EYP B;  2UUA O;  4DV1 B;  3ZX6 A;  3K59 A;  3MDS A;  5LXT B;  2UXX A;  2R70 A;  4QE9 A;  4D7T A;  2VQF O;  2OTL V;  3CB2 A;  3UQ8 A;  1JFF A;  1MA1 A;  4IIJ B;  5IJ0 B;  1NVP D;  4X64 B;  3T1H B;  4X65 B;  1IBM O;  1RM1 C;  2ZM6 O;  4PDR A;  4K0K O;  5L3F A;  1IUR A;  2MK3 A;  1GRJ A;  2FTK A;  3OR6 C;  1S77 D;  3HB3 B;  3T1Y O;  2W6I G;  2N05 A;  4CH4 A;  1US6 A;  2HJF C;  5IYZ B;  1WJZ A;  4JI0 B;  1H2K A;  1XEQ A;  1PKY A;  2W0F C;  1F51 A;  1M9N A;  4JI2 O;  3OEE G;  2ZR3 A;  2DYR C;  5IYC O;  4J41 A;  1OCC C;  4FM2 A;  3ICX A;  4JI3 B;  2EIK C;  2RJZ A;  1V55 B;  5BMV B;  3A0H Z;  4PV1 B;  1Y67 A;  1YIJ V;  3FX7 A;  4C7U A;  5L3E A;  1OCO B;  2RQ6 A;  1BZK A;  5DM6 V;  2Q69 A;  1VF6 A;  1K33 A;  4NKG B;  2E5L O;  5FLX N;  1V54 B;  2A9H A;  5B1N A;  4F6R B;  3STZ C;  3SGI A;  5B1B C;  4X66 O;  5D5P A;  1Q7Y W;  1IXM A;  4LF5 B;  1WA8 A;  4X88 A;  1DLB A;  2QM8 A;  1OV9 A;  4JF3 A;  2IU3 A;  4YJ3 B;  1D2D A;  1K7D A;  2WLI B;  5D5Q A;  3X2Q C;  1QR9 A;  4JI1 O;  1VAR A;  4R50 A;  3JD1 A;  4QG9 A;  4JI0 O;  2R9A A;  3OAA G;  3B8M A;  4GX2 A;  3ZRV A;  3C3T A;  2Q9L A;  1QHT A;  4JI5 O;  2YIC A;  1PPJ H;  4TV8 B;  3SJQ C;  4B7K A;  4P30 A;  4DR2 O;  1X4T A;  1ZSP A;  5LBQ A;  1R3I C;  3U10 A;  4HNA B;  3G6E V;  2ZKO A;  3I55 V;  1VF6 C;  4NXM B;  4X62 B;  2UXB O;  2WLL A;  3K9A A;  1MSW D;  1J5E O;  4ABM A;  4MVZ A;  3BJT A;  3GR4 A;  1Q5O A;  4B2D A;  2JK5 C;  4JI7 B;  2DMX A;  3RYF B;  3KG2 A;  4U3F H;  5DEC A;  1P4R A;  1OCZ B;  2HVJ C;  3BY6 A;  3K9S A;  2YC0 A;  1XRE A;  2B1I A;  2Q7G A;  4LF9 O;  3E2E A;  5LOV B;  1EN6 A;  1NR7 A;  4X1I B;  3ZIA G;  1XNR B;  5C8Y B;  2XHB A;  4J10 A;  2Q7H A;  1Q6H A;  4BIZ A;  3SRH A;  1SQB H;  1D5N A;  1BMF G;  1FAF A;  4DV1 O;  4FVM A;  4DRX A;  2Q7E A;  2JRI A;  4GKJ B;  5LYJ A;  5B66 Z;  3RFR A;  3A0B Z;  2IW5 A;  3FD9 A;  1FD9 A;  3CD6 V;  1WN7 A;  1E0U A;  4FZ0 A;  4GKJ O;  3E35 A;  1CP9 A;  1M93 A;  3OR7 C;  4KL1 A;  4X20 B;  1N33 B;  2LP7 A;  1FJG B;  1I94 O;  3H9V A;  5EYP A;  4KCT A;  1SES A;  5CBF A;  1YJW V;  3ZS8 C;  4UCU A;  4WFA V;  2ATK C;  3E22 A;  2ZM6 B;  4FLY A;  1DGS A;  3AG4 C;  2UXD B;  5H9C A;  4UCS A;  2E3C A;  3TK1 A;  3L70 H;  2KG7 B;  4TSF G;  2OT5 A;  1AP6 A;  4DK0 A;  4I0X A;  3D8C A;  4FLU A;  2UUA B;  2CUG A;  3K5N A;  3H1I H;  4YIO A;  4WCE V;  2P6J A;  4X62 O;  2P5O A;  1Q82 W;  2P06 A;  4ZBM A;  1L8D A;  1K3E A;  1SRY A;  3HKB A;  3IC9 A;  3JD4 A;  4FLZ A;  1IDS A;  5J2U B;  2JJ1 G;  3AG2 B;  3K79 A;  4YJ3 A;  4UVB A;  4X1K B;  1KP2 A;  1WP8 A;  2ZDI C;  4KCU A;  1W2B U;  4G28 B;  4UFZ A;  2F43 G;  4O4H B;  4J7J A;  2ODM A;  1YTF D;  2P7T C;  4TWK A;  4X1K A;  2DWE C;  2VGI A;  2A3Q A;  2ZCE A;  4R8C A;  4XDJ A;  5JVD B;  3ASN B;  2UUB O;  3L71 H;  1I0H A;  2EIM B;  4Z2W A;  4YHH O;  1NTZ H;  2DQ3 A;  1G1X B;  3WG7 B;  1SZT A;  2GTA A;  2XT9 A;  3F7Y C;  1K97 A;  3ZMU A;  2OCH A;  3SJC C;  1VQN V;  4MTF A;  3CC2 V;  2GDS A;  3TXQ A;  4GT1 A;  4LCU C;  1OZ0 A;  4JZG A;  2YDE A;  3BFR A;  1JX9 A;  1BQ0 A;  3GQY A;  1VEW A;  4CH5 A;  2R72 A;  4I55 A;  2CH7 B;  5KX5 B;  4YY3 B;  3SYC A;  2O57 A;  1N32 B;  1IBK B;  4WFH A;  1XMO B;  4GKK B;  2XAF A;  3AG3 B;  4DO2 A;  3H01 A;  5KMG A;  3K0D A;  4ZHQ B;  1JMK C;  4OX9 B;  1PD3 A;  3LDE A;  3JAL A;  5EC2 C;  4I4T B;  5F2V O;  3TET A;  3U0Z A;  3RYC B;  5FPR A;  2ZXW C;  5BMV A;  3Q4H B;  4AHC A;  1QBZ A;  2KB1 A;  3BAB A;  2HVK C;  4LF6 O;  2Q0A A;  4GX0 A;  5DED A;  4DR5 B;  3ABK C;  4DR6 O;  3ML0 A;  2QWQ B;  3GVM A;  2DW4 A;  4WFF A;  1JQ0 A;  2IH1 C;  2X0L A;  3SJB C;  1TVK B;  1Y76 B;  3T4Z A;  5LHI A;  1NZ6 A;  2YXY A;  5B5E Z;  4YNG A;  2EIJ B;  2ARH A;  3ZED A;  1KBH A;  3CCE V;  3SYO A;  3H1J H;  4MVR A;  3KTX A;  5C93 A;  3BPZ A;  2JGD B;  3LSQ A;  1ZTE A;  4AIL C;  1K4C C;  3JAK A;  1AVM A;  1JJO A;  4BIO A;  5JCO A;  4NTX A;  3AK1 A;  1KMI Z;  4CS3 A;  1N34 B;  4J7K A;  4EEQ A;  3JSN A;  3E0W A;  2ZNI A;  1PNL A;  3RYH A;  5JVD A;  4W4L A;  1VF5 B;  5JH7 A;  1B3Q A;  1M5I A;  2DYS C;  5GON A;  4YJ2 A;  4DV2 B;  2YI9 A;  2A79 B;  2QKC A;  1GAX A;  5GW7 A;  4JI6 B;  5IDJ A;  2WLK A;  1S3J A;  1L1F A;  2V7Q G;  4DR6 B;  4NYK A;  3ZRW B;  4LR3 A;  4NXM O;  5H6R A;  4CC5 A;  4JV5 B;  2Z5U A;  3J81 N;  3JD2 A;  2CH7 A;  4P9O A;  4QGC A; 
#chains in the Genus database with same CATH homology
 1PNM A;  1OCR C;  1PKX A;  1NBM G;  1Y4M A;  1KKD A;  4PA9 A;  5B1A C;  1WPX A;  4QIW F;  1K5S A;  3ZN1 A;  2R9R B;  3M99 B;  1ROP A;  4PA7 A;  4F4L A;  2XAG A;  4RO2 A;  1YI2 V;  4GCZ A;  2OTJ V;  1J95 A;  2UXX A;  4LBE C;  4QE9 A;  4H37 A;  3ABL C;  1FXK A;  2IJH A;  3GWO A;  2OTL V;  1UJW B;  1K73 W;  3LDD A;  1EZJ A;  1NVP D;  2H8P C;  4L87 A;  2EZP A;  3ZCC A;  5L3B A;  4RQF A;  1W0K G;  5CBH A;  5EBM C;  1RM1 C;  3SYA A;  1AI6 A;  4E2L A;  4PDR A;  1M56 C;  4UV8 A;  1S5H C;  5B3S B;  2B5U A;  3OM3 B;  1AI4 A;  3K06 A;  5L3F A;  2JJ2 G;  2MK3 A;  4X89 A;  3RBZ A;  2FTK A;  1K34 A;  3OR6 C;  1BL8 A;  3AG4 B;  1S77 D;  3HB3 B;  4R7C A;  5E1A C;  4KUM A;  2W6I G;  2WLJ A;  2HJF C;  3UKM A;  1I5X A;  2QM7 A;  3W7S A;  4RQE A;  2BOC C;  4XBF A;  3CC7 V;  3SPG A;  1CPY A;  1K9M W;  1B6Q A;  1F51 A;  2W0F C;  3A0R A;  1M9N A;  1GM7 A;  2Y69 C;  1PNK A;  5KUM A;  5B1B B;  4XDL A;  3LNM B;  3OEE G;  3OUF A;  1R3K C;  2OCC B;  3WG7 C;  1YIT V;  2ZR3 A;  2DYR C;  4G2K A;  2LFR A;  5IYC O;  1MAB G;  1QVG U;  1QLE B;  4FJC C;  1OCC C;  2QEX V;  2QKS A;  1GO3 F;  3UM7 A;  1VQL V;  4JGS A;  1FFT B;  3AG2 C;  3ZN0 A;  2DYS B;  1Q86 W;  1NKD A;  3K08 A;  2EIK C;  1V55 B;  1YJ9 V;  1VQK V;  1V55 C;  1YIJ V;  4QJF B;  4CBC A;  1NVP B;  4PDV A;  5L3E A;  1OCO B;  3CPW U;  4MVQ A;  2Q69 A;  3AG1 C;  5DM6 V;  3K04 A;  3K3W A;  1K33 A;  4WFG A;  1V54 B;  2A9H A;  4P2Z A;  5B1N A;  2JIZ G;  4XDK A;  4JYC A;  3STZ C;  3W7X A;  1JPX A;  5B1B C;  1R3J C;  3LSS A;  1K4D C;  2ZDI A;  1VQ4 V;  1Q7Y W;  1IXM A;  1M90 W;  3FKS G;  4FIP C;  1DLB A;  4X88 A;  2QM8 A;  4JTD B;  3CXC U;  3FB6 C;  3IFX A;  3LDC A;  1KQS U;  3JD0 A;  4JF3 A;  4P9P A;  1V54 C;  3P30 A;  2IU3 A;  2AHZ A;  4I5S A;  1NJI W;  4QNH B;  2X6A A;  1K7D A;  1SET A;  1S0V A;  2WLI B;  1VQP V;  5FL7 G;  1N8R W;  3X2Q C;  1QR9 A;  5LGT A;  4Z1M G;  1R73 A;  3ETD A;  2AHY A;  3JD1 A;  4R50 A;  2XAQ A;  4PEL A;  3W7U A;  3ABM B;  1WLE A;  2EBO A;  4U7O A;  1H8H G;  2WLN A;  3OAA G;  5CBG A;  1QR8 A;  3B8M A;  4GX2 A;  4PA6 A;  3ZRV A;  4TT3 G;  3OFN G;  2EZO A;  1YJN V;  1H38 A;  3R65 A;  3SJQ C;  4P30 A;  3STL C;  1BHB A;  2HLD G;  5LBQ A;  3DGE A;  3ABK B;  2EIM C;  1R3I C;  4FPP A;  4YXW G;  1VQM V;  2CK3 G;  2B1G A;  3G6E V;  4G27 B;  3I55 V;  3CME V;  2WLL A;  3K9A A;  1MSW D;  1BHA A;  4JAS A;  4MVZ A;  1AR1 B;  3AAG A;  1M1K W;  1YSC A;  2JK5 C;  3OUS A;  1FXH A;  3K03 A;  3PJS K;  4JAU A;  3KG2 A;  4MVO A;  1RPR A;  1ORQ C;  3T2M A;  2P67 A;  1AI5 A;  2HFE C;  2HKO A;  1HWY A;  1TUE B;  1P4R A;  2XAS A;  1OCZ B;  3QO5 A;  3OW2 U;  2HVJ C;  3BY6 A;  4MTX A;  4UVA A;  2H94 A;  1KEC A;  2ITC C;  3OMI B;  2B1I A;  1YTF B;  3FYI B;  3ZRW A;  1OCR B;  1KP3 A;  1F23 A;  3T1C A;  3OMA B;  3E2E A;  2HR3 A;  3K0G A;  1NR7 A;  3ZIA G;  1H2G A;  4ASU G;  1EBO A;  3E83 A;  3NXS A;  1Q81 W;  4BIZ A;  3ASO B;  3E8F A;  4I9W A;  2QTO A;  4MSW C;  2WLH A;  2WAM A;  1KC8 W;  2WWW A;  1BMF G;  3FB8 C;  4MW8 A;  4JAV A;  3ABU A;  4MTO A;  3D36 A;  3E86 A;  4UV9 A;  5DN6 G;  1E1R G;  2IW5 A;  1Y66 A;  1M57 C;  5L3G A;  3DTU B;  3CD6 V;  3B8N A;  2EIN C;  3EFF K;  2IJJ A;  1KD1 W;  1NQT A;  1FXK B;  3E35 A;  4RUE A;  4H33 A;  4RUF A;  1CP9 A;  2YEV A;  3OMN B;  3OR7 C;  4JTC B;  2LP7 A;  3ZMV A;  1I5Y A;  2X7R B;  3G4S V;  1SES A;  1R3L C;  2GSM B;  5CBF A;  1YJW V;  1AJN A;  4FK5 C;  2WPD G;  3VBB A;  4WFA V;  2ATK C;  2QE7 G;  2WSS G;  1JJ2 U;  4LP8 A;  4BIU A;  3OEH G;  4HYO A;  4BW5 A;  4GX5 A;  2JDI G;  4PDL A;  5CA3 A;  5KA5 A;  1G8M A;  3AG4 C;  2R9I A;  4OXS A;  4MVS A;  5LGU A;  1DTO A;  1W0J G;  2Q67 A;  5H9C A;  4HZ3 A;  3ZRX A;  1XL6 A;  2XAH A;  3TK1 A;  3ETG A;  3FB7 C;  3IGA C;  3CCS V;  3ZRS A;  2EIN B;  1GTO A;  3SYP A;  3RW0 A;  4TSF G;  5KUK A;  3W7T A;  1G4Y B;  2OT5 A;  5CMU A;  4QPJ A;  1DF5 A;  3B77 A;  3AEI A;  3EHB B;  2YSU B;  3ABL B;  2XAJ A;  4WCE V;  2GHY A;  2P6J A;  2IH3 C;  1NH2 D;  1Q82 W;  5H6Q A;  3WFV A;  4ZBM A;  1K3E A;  1SRY A;  3JD4 A;  5L3C A;  1FXV A;  2EIL B;  3X2Q B;  3ASO C;  1AJQ A;  1H8E G;  2ZD9 A;  4UUJ C;  2JJ1 G;  4WFB V;  1VQ5 V;  3AG2 B;  1K92 A;  3VOU A;  1JCH A;  3E8H A;  3K79 A;  1GKF A;  2W6J G;  4J9Z B;  2ITD C;  5KA6 A;  5B1A B;  1NH2 B;  4UVB A;  1KP2 A;  2X6B A;  3RVY A;  2ZDI C;  2OCC C;  4Q20 A;  1W2B U;  4G28 B;  3CP1 A;  1QLN A;  3ZJZ A;  1E1Q G;  2Z3Y A;  2NNU A;  3FYE B;  2F43 G;  4JPR A;  3E8G A;  4MVM A;  3SPC A;  1VQ9 V;  1S76 D;  3CC4 V;  3JYC A;  3QNE A;  3SYQ A;  1YTF D;  4U7N A;  2YEV B;  2P7T C;  1K5Q A;  4UXN A;  4TWK A;  3ETE A;  1ENV A;  1DF4 A;  2BOB C;  5CN0 A;  2EIJ C;  4HAM A;  4UVC A;  5L3D A;  2LFS A;  1GM8 A;  4BAY A;  2DWE C;  4MW3 A;  4XDJ A;  4R8C A;  3F7V C;  4DXW A;  3CCV V;  2X6C A;  4GX1 A;  4PA3 A;  3LUT B;  4QPK A;  2XND G;  1R6N A;  2EIK B;  2IU0 A;  3ASN B;  2EIM B;  3D3I A;  5EBW C;  3GB7 C;  2DQ3 A;  3CYO A;  3WG7 B;  1ZWI C;  4MS2 A;  1R6K A;  2ZXW B;  1E79 G;  3SPH A;  5IY5 C;  1SZT A;  3AG1 B;  1F4N A;  1GM9 A;  4KFM A;  3F7Y C;  1K97 A;  4N23 A;  3ZMU A;  1CEZ A;  2NLJ C;  4JTA B;  5HFL A;  2D3O W;  1VQN V;  3HPL C;  4MTF A;  3CC2 V;  4GT1 A;  4MTG A;  4LCU C;  1OZ0 A;  3JD3 A;  3MHS C;  3RVZ A;  1JX9 A;  4QE7 A;  2PI4 A;  2QA4 V;  1VQO V;  3AG3 C;  2WLI A;  3CCL V;  3FB5 C;  3QO7 A;  2UXN A;  1RM1 B;  2ZR2 A;  3SYC A;  3G71 V;  1M57 B;  4LC1 A;  4X8A A;  5BZB A;  4WFH A;  3BEH A;  1THZ A;  3JCZ A;  2M7W A;  1FXK C;  1PL0 A;  1JOY A;  5HFM A;  2XAF A;  3AG3 B;  4R6Z A;  4DO2 A;  1OCO C;  3H01 A;  1FS0 G;  4N21 A;  3K0D A;  2ZQM A;  3CCR V;  1SER A;  1S72 V;  2Y48 A;  1VQ7 V;  3MD0 A;  1GMG A;  1JVM A;  1PD3 A;  2EIL C;  3LDE A;  5EC2 C;  1K8A W;  1M56 B;  3TET A;  3ABT A;  2ZXW C;  1QVF U;  4PA4 A;  2V1D A;  1QBZ A;  1XL4 A;  3ZMT A;  2KB1 A;  2HVK C;  2DQ0 A;  4J9Y B;  1QLE C;  2K1E A;  2WLM A;  3CMA V;  3CCJ V;  1OCC B;  4GX0 A;  2XOK G;  3CCU V;  3ABK C;  3ML0 A;  2EJR A;  3E8B A;  2C2A A;  1OCZ C;  3ASN C;  2JEX A;  2DW4 A;  5B1O A;  5EK0 A;  4WFF A;  1GK9 A;  2IJK A;  1JQ0 A;  5IYB O;  3ZMS A;  5LHH A;  4EKW A;  2IH1 C;  4MT8 A;  1VQ8 V;  2X0L A;  1QCE A;  3T4Z A;  5IYD O;  5LHI A;  1ARO P;  3MHH C;  1YHQ V;  2EIJ B;  1EFR G;  5LHG A;  3CCQ V;  3CCE V;  3SYO A;  5LGN A;  4MVR A;  5C93 A;  1OHH G;  3LSQ A;  3OE7 G;  4CZZ A;  3QO8 A;  1K4C C;  2HG5 C;  1AJP A;  1LNQ A;  5B3S C;  3T4D A;  2DWD C;  5J9P C;  1COW G;  4PDM A;  5IY5 B;  2JEU A;  4KP4 A;  3E89 A;  2A0L A;  2WLL B;  1PNL A;  1F4M A;  4FMT A;  4WF9 V;  3W7W A;  3TCU A;  1MOF A;  1P7B A;  4RAI A;  3ZMZ A;  2PI5 A;  3P32 A;  3I56 V;  2DYS C;  2P90 A;  3IC7 A;  3SPI A;  2A79 B;  3ABM C;  5GW7 A;  4ZKI A;  5EBL C;  5IDJ A;  1NR1 A;  2WLK A;  1S3J A;  4WFE A;  1L1F A;  2V7Q G;  3SPJ A;  4MVU A;  1VQ6 V;  3ZRW B;  2DYR B;  5EC1 C;  1RPO A;  2Q6A A;  2IJI A;  4JYB A;  3CCM V;  5H6R A;  3F5W C;  2Z5U A;  3OGC C;  3JD2 A;  1AI7 A;  4P9O A;  2Q68 A;  2Y69 B;  1MG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...