5FL7G

Structure of the f1c10 complex from yarrowia lipolytica atp synthase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
270
structure length
267
Chain Sequence
b'TLREIEMRLKSIKNIEKITNTMKIVASTKLGKAQRAMATSKVYNEASEKVFENSETAVPENIEKRLWVVVSSDKGLCGSIHSQLARTVRRKLLDGEKLIDIVAVGEKIKAQLGRSNPEQMRLSFGGTGKEAPTFEEAAHIADEILALDTQYDDIEIVYNKVLSGISFEPIMKESYSAKAIEDAPKFGQYELEDDVVKNLADFSLANTIYAAMAEGHAAEISARRNAMDNASKNASDMINKYSILYNRTRQAVITNELVDIITGASSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE SUBUNIT ALPHA
publication title Structure of a Complete ATP Synthase Dimer Reveals the Molecular Basis of Inner Mitochondrial Membrane Morphology.
pubmed doi rcsb
molecule tags Hydrolase
total genus 63
structure length 267
sequence length 270
ec nomenclature
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00231 ATP-synt ATP synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5fl7G01
3.40.1380.10 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate Kinase; Chain: A, domain 1 5fl7G02
2HKOA 4TT3G 2UXXA 5L3BA 5L3FA 2W6JG 2XAHA 2JJ2G 2W6IG 2WSSG 1W0KG 3OAAG 1E1RG 3ABUA 3ZMTA 4CZZA 3ZMSA 2XAQA 2DW4A 3ABTA 3ZMVA 3ZIAG 1EFRG 2XAFA 2XNDG 2JJ1G 5LGUA 2WPDG 2V7QG 3OEHG 2QE7G 3OE7G 5LGNA 4UXNA 4TSFG 4UVBA 2R9IA 3ZMZA 3ZN0A 5FL7G 3OFNG 4ASUG 3FKSG 5L3EA 4UVAA 4KUMA 1NBMG 5H6RA 3OEEG 2CK3G 2V1DA 5LHIA 2X0LA 4XBFA 1E1QG 5LBQA 5L3GA 2XAGA 5LHHA 5H6QA 2HLDG 3ZN1A 2Y48A 2XAJA 2IW5A 4YXWG 2F43G 5LGTA 5L3DA 2UXNA 2XOKG 1H8HG 2XASA 1E79G 1OHHG 4UV8A 2JDIG 3ZMUA 2Z3YA 5DN6G 1W0JG 1BMFG 1MABG 5L3CA 1COWG 4UVCA 2Z5UA 4Z1MG 4UV9A 2EJRA 2H94A 1H8EG 1FS0G 5LHGA 2JIZG 4BAYA
chains in the Genus database with same CATH superfamily
1F4MA 1HNWO 1M1KW 1FPOA 3SPCA 5KHKA 1VQ9V 1Q90D 4GKKO 3P3PA 1KD1W 5FNVB 4UCTA 5B3SB 2VQEB 4DR1O 1XNRB 2N04A 4PA3A 5A2QN 3FFQA 4FLVA 3N2GB 3RN4A 1MZFA 1VQ4V 1G8MA 3BEHA 4X1KB 4YJ2A 1Z5WA 4TSFG 4B08A 3A0RA 2EIKB 5J2TA 5LA6A 4GKJO 1JFFA 4MTXA 3OGIB 2YSUB 2UUCB 2YUAA 4DV5B 1XHZA 2W0XA 4DV6O 2Q5ZA 4IT5A 4OPAA 1R73A 3DSQA 4JZ2A 2OIEA 2NN4A 4R50A 2P06A 1AR5A 3W7UA 1XL4A 3WB0A 4LFCB 1K7DA 4KCVA 2UXDB 4GYCB 3SRFA 2CAZC 3H1LH 4KP4A 2UXBO 1FXVA 4J80A 1OHHG 2F95B 5EBMC 5FNVA 2GTSA 5JQGB 1IBMB 2QM7A 2EIMB 4FFKA 3MHSC 1RP3B 3HQPA 2Y69B 3N2GA 4JI0O 1G6UA 3OR6C 3OTOB 1GTOA 2EJRA 1VF6A 4K35A 1FXKA 3KKYA 4CH5A 3CC7V 4NXNB 2X6AA 3FX7A 4FLYA 3CRQA 1UPGA 3HQOA 1OCZC 1WJZA 3ZCCA 1R3LC 2JGDB 4DR7B 4KHPB 3NR7A 5LL6Y 4JI6O 3C3TA 4OXSA 1Y74B 4P30A 5LMNB 1L0NH 4DR3B 3AG2C 3GB7C 1QHTA 4GUNA 2DOSA 2DYSC 4OX9O 3AK3A 2BE3A 4YY3O 4LF8O 3HB3B 3B8MA 1BS3A 4NXMO 2UUAO 3J7AU 5JQGA 4YHHO 3BAAA 4MVSA 1AJNA 2L35A 4EEQA 2YC0A 4Z2WA 2DYRC 3OD4A 4AQYB 2X0LA 1K97A 3ZRWB 5L3GA 2LP7A 2ARHA 5BR8B 1Q7YW 1B06A 5EK0A 3OGCC 3JARB 2F4VO 2RN9A 3ZN1A 1FJGB 3HKCB 3SYOA 5CA0B 3RYHB 1EBOA 1JQ0A 2F43G 1K33A 3CD6V 5LMUB 2JGDA 3E8GA 4DK0A 2PYLA 4UB6Z 3SJQC 1OCOC 4JI8B 1SQQH 4DV0O 5DN6G 1Y74A 3CS5A 4MVMA 4EKWA 1ENVA 1SQGA 1UJWB 1SESA 3ASOC 3ABKC 3H1IH 3ZBHA 5L3CA 1YDXA 4JAUA 2UU9O 3RYCB 3C90A 2C2AA 5CMUA 4JI3O 1KKCA 1S3JA 3UM7A 2YIDA 3HQNA 1VQLV 3JD2A 2QTOA 3X2QC 1KMIZ 4ZI7B 3K5OA 2ZM6B 4JTAB 3K57A 1ZUQA 3A8TA 3ZRWA 3LDDA 2YIAA 3JSNA 2BTOA 5L3BA 5L3FA 4LH7A 1XNQO 1NTKH 1OCZB 1BSMA 4O4IB 2IH1C 3JARA 3ZHTA 5CA0A 1M4UA 3RYHA 4DV1B 4PA9A 4NR1A 4JI2B 3I55V 1BZKA 3AG2B 3BVOA 2FKXA 1WA8B 4ABMA 2UUBB 4LF7B 3OUSA 1YJNV 2ZE8A 2NR5A 2DYSB 1PL4A 5C93A 2ZDIC 4RPPA 3PJSK 4DV2B 3SPIA 2ZE5A 1XMQO 2JEXA 2ZIOA 4K0KB 4DV7B 2IJKA 3FKSG 3ZHRA 2DWEC 4X89A 1QLEC 1XI1A 4JYAO 3RYCA 2DYRB 2YDEA 1VQNV 3L72H 3L71H 1GAXA 4EFEA 2XTAA 4RQFA 1S72V 4IP7A 1JA8A 4ZI7A 2Q73A 2IW5A 1GH6A 5IYZA 2LJ2A 3SJBC 5L3DA 4IHJB 3JYCA 3K79A 3J80N 4U3JA 2HR3A 1ZJHA 3SDLA 1SQVH 2WLLA 4O4IA 1TUEB 2Y0PA 4J7JA 4X65O 4DUZB 4F6RB 1S0VA 1OCOB 2R9RB 2ZT9B 4CC6A 4L87A 2NLJC 1KKDA 2B1GA 1AP6A 4LWSB 3QG5A 3E8HA 5EBWC 3U11A 1O9GA 1SA0B 5H5NA 4UVCA 1WA8A 3WU2Z 3K08A 3ABKB 2YXLA 3E22A 1AI5A 1BHAA 2RNBA 1N34B 4I5SA 3L73H 1SZXA 2E3CA 1Y76A 4I55B 1I5YA 1AROP 1X4TA 4BW5A 1HR0O 3X2QB 3H01A 2LGQA 1SKVA 2F93B 2W6JG 2W6IG 3ABMC 3T1YB 1E1RG 2YI9A 5J2UB 2DN9A 5J9PC 4O2AB 2Q69A 1HNWB 1AR1B 1Q6IA 5EIBD 1O9HA 1GN6A 1U96A 2JJ1G 3M99B 3G71V 3SJAC 4GKKB 4F6RA 1E0TA 4DR1B 1URFA 3IC7A 4LWSA 1ZL8A 3VQVA 3FD9A 1WN7A 4J10A 1R1BA 3ZX6A 3ZRXA 1VP7A 3G67A 4XBFA 2KSDA 3CRRA 3STZC 5LBQA 2YI8A 2QM8A 1Y66A 2QA4V 4GKJB 4PDLA 5IYBO 2E75B 1PKXA 5JCOC 5IT9N 2EINC 4DRXA 2ZXWC 4I55A 4KS0A 2LO1A 2WLMA 2WLJA 4DV6B 2Q4PA 4YXWG 1DK1A 2VGBA 1J5EO 2OT5A 5J2UA 4O2AA 4N21A 1MSWD 1VQOV 3W7TA 1G4YB 1I5XA 3W7WA 2ZNJA 2UXBB 3GWKC 3TETA 2H94A 5A9GA 1Q43A 2ZDIA 5JJNB 1RPRA 1K5SA 1NTMH 4I9WA 3AG7A 4JI0B 1K4CC 4JASA 2WWWA 3KCXA 4JGSA 1IBLO 2ITDC 1VP8A 3T07A 3G2GA 3LDCA 4QGCA 4YIPA 1CPYA 4FJCC 1DTOA 1AR4A 3ABMB 4B3SO 4Z1VA 3QNEA 1DF5A 4FLXA 5GTHZ 1KQSU 3FB8C 2HG5C 1K92A 2FMLA 5KHGA 3T2MA 2A06H 3ZRVA 1S5JA 4L8JA 4JI6B 3T4DA 4UVBA 4I9QA 2Y4UA 2LQTA 4O2BA 3MAQA 1UFIA 1NKDA 1WNSA 3HPLC 4OX9B 1Q6HA 4YY3B 1T5AA 4LF8B 4X1YB 3CP1A 3RYIB 4DYLA 4NXMB 2UUAB 4EFBA 3FB6C 4YHHB 4G28B 2YEVB 3WB1A 3WFVA 2CTRA 1A32A 3P3NA 1SQXH 2E74B 2Q6AA 2EINB 3CRCA 2ZXWB 4PD4F 2WLNA 3TK1A 2CH7B 1A49A 2YS8A 1HNZO 1YF2A 3CE2A 4KCUA 4NB5A 1KECA 4PI2A 2OYQA 4FLTA 3BA9A 2F4VB 1AQFA 2FYUH 3CCRV 2B9ZA 1BQ0A 2QGNA 5KA6A 1PM9A 1A3XA 3AG4C 2BOBC 3TJTA 3K9AA 3VOUA 4J41A 2Q67A 1VF7A 4Q20A 1VARA 4FLWA 4H13B 3GWOA 3B8NA 3CX5F 4UCSA 3BFRA 4UCVA 1K73W 1CEZA 4DV0B 2JIZG 1ORQC 4IMAA 2UXCO 4YJ2B 1P4RA 4MW3A 2UU9B 3AG3C 1BHBA 4X1YA 1M90W 2ZR3A 3IC9A 4JI3B 4P2ZA 3RYIA 1NQTA 3E8FA 1PV0A 2YEVA 1M9NA 3JAWB 3ABUA 3LDEA 3KZIZ 5EIBC 3CMAV 4JI1O 2QKAA 5JCOA 3ZMSA 3K9SA 1V55C 3H9VA 1XNQB 1VQMV 2XUMA 2R9AA 3G6EV 2VWKA 4MVUA 4YNGA 2CTWA 3OEHG 2QE7G 1R3KC 4X1IA 2RMKB 4UFZA 1EN5A 4DR4O 4P9PA 5L3EA 1L8DA 3IGAC 1VQ7V 1GKFA 5LHIA 3DTUB 4XDLA 2KQXA 5D5PA 1Q5OA 2QKCA 3U10A 4UB8Z 4JTCB 3ETEA 3RVYA 2H8PC 4E4EA 1ZLZA 1XILA 1XMQB 2WLKA 4JYAB 1LUWA 1FXKB 3K04A 3VBBA 2F23A 5LGTA 4O4LA 2XOKG 1YI2V 3OW2U 3RWRD 2HHHO 1WB7A 4K3AA 1Z2GA 4ZOLA 2JDIG 3JAWA 3UKMA 1QQCA 4YIOA 2QKSA 4HYVA 2PGGA 3O65A 3AG4B 3LSSA 4YJ3B 1GMGA 4JYYA 2CUGA 3E0WA 2ZR2A 4DV4O 4X65B 3SPGA 4O4HB 1F7YA 1VQPV 5DM6V 3ICXA 2P67A 1I0HA 4JF3A 2WA3A 2Q9LA 3SRHA 4NTYA 3AG3B 1JVMA 1D5AA 2JK5C 3QTCA 3CPWU 3OT7A 2PUSA 2X7RB 2Q7GA 4CS2A 1AJQA 4X88A 4MW8A 3KCYA 2YICA 1KC8W 2QWPB 1QU7A 3H6OA 1W0KG 3G80A 5E1AC 4PDRA 1S77D 1HR0B 1FAFA 4GCZA 5H9CA 5GONB 2CGOA 4JV5O 1NTZH 3EHBB 3FYEB 5BZBA 3DC5A 3CWBH 1K5QA 2LFRA 3CCSV 2ZQMA 1V55B 3G4SV 1NT2B 3SYCA 2RCVA 4I4TB 1AILA 4J9YB 1RM1C 2ZCEA 5EYPB 5LGUA 3OMIB 2ZD9A 1SETA 1L0LH 1YZBA 3JD3A 4KFMA 1FKAO 2CTPA 3DGEA 5KUKA 1AI4A 3CSXA 3OTFA 4ASUG 1X59A 4GT1A 4YJ3A 5B5EZ 3IAYA 2P4KA 4O4HA 4H0LB 2ADPA 1K34A 5IJ0B 5LHHA 3K0GA 2VGFA 4TV8B 1IX9A 2D2CB 4UCUA 1Q82W 2F66C 1DF4A 3B2EE 2BCCH 3VQYA 4W4KA 4TOIA 4DO2A 1NR7A 4WFAV 1XQ8A 1PKNA 1BGYH 2DQ0A 3BA8A 3C3SA 2VQFO 3B40A 1W0JG 5GONA 5D5QA 2JGUA 1R3JC 3EXAA 3BJTA 1OZ0A 3L70H 3RFRA 1J5EB 4QJFB 1TUBB 4I4TA 4JYBA 5EYPA 3SYQA 1Q81W 5CBHA 3JD4A 1MZEA 3M8AA 3OMNB 3BABA 2B5UA 3ETQA 3GQYA 5C8YB 2R70A 1QR8A 1XOUA 5LYJB 2HKOA 3GR4A 1GN3A 1SF9A 4F6EA 3KG2A 4CH4A 3E0VA 3FYIB 5IJ0A 2ZNIA 4TV8A 2XAHA 4O4JB 2QWQB 4PDMA 1AI6A 1EN4A 1THZA 1QBZA 1IBLB 4PV1B 2HJFC 1VF5B 3LSQA 3ZMVA 1R6NA 5IYCO 1EFRG 3P30A 1BL8A 2BSKB 4LH6A 2XNDG 5IYZB 4CS4A 4B3SB 2R9IA 1T5EA 2E76B 4MVOA 4PA4A 4U3JB 3K5MA 2WLLB 1JPXA 1NBMG 4JPRA 4QPKA 3BRCA 2CK3G 4TQDA 4KCTA 1GM9A 1TUBA 3RW0A 2P90A 4LF5O 2Z0AA 4B3MO 1KU9A 2OTJV 3E22B 5C8YA 3ZHSA 3ABLC 3AEIA 1R6KA 5LYJA 4K8XA 3E83A 3WG7C 3APOA 4HBNA 2G38A 1HWYA 1KP2A 1Y76B 1H8HG 5KAFZ 4MT8A 2EIJC 4O4JA 4RQEA 4J42A 2IJIA 5IE9A 4PA7A 5HFMA 3O9OA 1XREA 4GX2A 1HNZB 1K3EA 1MABG 1FD9A 4MVZA 3SPJA 2BSKA 1TGOA 3JASB 1N8RW 5BXZA 5K1XA 1OJHA 4NKGB 5LHGA 2M6YA 2PF4E 4EB6B 3K5NA 4XDKA 2EX3A 1ZL8B 3MD0A 4W4LA 3SR2C 1GN4A 4FLZA 5BY1A 3ASOB 2UXCB 4WFGA 3JD0A 4WJ8A 2Q68A 4LNUB 1WPBA 2R72A 4D6TH 4QG6A 4LF9O 2ZKOA 3MHHC 1S76D 3ABTA 4JZGA 5FPRA 3BPZA 1QVGU 1AJPA 2RJZA 4TUYB 4DRXB 2XAFA 2RQ6A 3W7SA 4BIUA 4X62O 4JI1B 2GDSA 3CXHF 4TQFA 1PKLA 1PNLA 1ZX3A 5CBFA 5GTIZ 4LFAO 1BT8A 3RBZA 4RUFA 3KTXA 1GRJA 1AP5A 5H6RA 2V1DA 1M5IA 4LCUC 4LP8A 3WB2A 4KCWA 3JASA 2OWOA 2D3OW 3PN1A 2YIBD 3D3IA 3ETGA 4FMTA 1JJ2U 4QG9A 2E28A 2IJHA 5JVDB 4WF9V 4DR4B 1P49A 2Q7EA 1NVPD 2N05A 3P32A 4EB6A 2ADQB 4U7NA 1YVWA 1KP3A 1LNQA 4K8ZA 1VEWA 3ZEDA 3KHDA 3WG7B 3AK1A 1E79G 1SS3A 1QLEB 2AW9A 4NTXA 4UV8A 2EIJB 5EZYA 1WLEA 2Z3YA 5IDJA 4BR6A 4LNUA 2AHZA 2EZOA 3D36C 1I08A 3E86A 1PPJH 1H38A 2X6BA 2HHHB 5KUMA 3GG8A 4TUYA 4UUJC 4Z1MG 1K4DC 1H2GA 2CE4A 1DLBA 1F3WA 1HW7A 2QR4A 3LNMB 2CGNA 2FTKA 2XT9A 4GX1A 1S5HC 2CDYA 4DV4B 3HKBB 1NZ6A 1W2BU 4O2BB 2KB1A 4XDJA 5FPOA 4QG8A 5JVDA 3FB7C 3FAVB 1NU1H 2IU3A 1L1FA 4DUYO 4DR5O 4DK1A 3QTGA 2XAQA 1U97A 2OTLV 3RT3C 4QE9A 5KHJA 1NR1A 4JI5O 4JI4O 4UXNA 4JV5B 2DJVA 4QPJA 1YTFB 5IY5C 4G27B 1M57C 3S3XA 1SQBH 2QTSA 4X9QA 3NXSA 5CA1B 2WA4A 1Y67A 3CC2V 1IVSA 1YJWV 2AZ0A 3E35A 4CH6A 2WAMA 2WLIB 3K0DA 1WP8A 3OR7C 4GX5A 2Q8VA 1PL0A 5LP6C 3SJCC 3HKBA 4ZKIA 1YJ9V 1EN6A 4IL6Z 4U3FH 3QO7A 4FZ0A 2GTAA 2OIGA 1H2KA 3R66A 1SZTA 2XASA 3N2KA 3CHXA 1AI7A 3CRMA 3FAVA 5IJ9A 2ODMA 1QCEA 4KRZA 5JH7A 3I5DA 2OCCC 2XHBA 4B2DA 4G1NA 3HKEB 2AXTZ 3ZHUA 3BJFA 2JS3A 5B66Z 3T05A 5IYDO 3A0BZ 1YEWA 2VQFB 4FK5C 3QV8A 1V54C 1FXHA 3CEIA 3LSUA 1IDSA 2AZ2A 3IS4A 1AVMA 5CA1A 4X1IB 3CXCU 4U7OA 1NJIW 4JYCA 3AG1C 4IYIA 4P9OA 4J7ZA 5JWPA 2BTQB 2WLIA 1VQ6V 4N23A 4X20B 2WSSG 2HVJC 2GHYA 3D3QA 4ICGA 4B7EA 3ZMTA 3IFXA 2HVKC 4B7KA 4AI8A 3CCUV 1MSDA 2P5OA 3JAKB 3TCUA 2BOCC 1PD3A 3THOA 3CCQV 3D8CA 4FZ1A 1P84F 4O4LB 5KHHA 4ZHQB 2H3OA 5ITZB 3ZMZA 5JJEB 1JX9A 5HFLA 3D36A 3JD1A 4PA6A 2IBZH 4ZOLB 4LC1A 3OEEG 4LFBO 1N32O 4DV3O 3HKEA 4B3RO 2LW7A 5H6QA 3CCJV 4RUEA 1K8AW 2JVDA 4A5UB 3CCMV 2HP8A 4YJ5A 1YSCA 1SC5B 3CCEV 4LF5B 3QV6A 5KLVH 3UQ8A 4TWKA 5LP6B 2A9HA 3FB5C 4B3MB 3QO8A 1PNKA 2BTQA 3QV9A 3ZRSA 4X20A 3T4ZA 3B77A 4FM1A 4MTFA 1N36O 4MVQA 1BMFG 2OCHA 3CC4V 4JAVA 1Y4MA 1F3XA 1XEQA 1N33O 3R65A 3JAKA 1D5NA 2A3QA 2OCCB 1US6A 3UO2A 3CYOA 3MA8A 3PP7A 3SPHA 4ZHQA 5ITZA 1H8EG 2LW1A 2A79B 1M93A 1V54B 2MW2B 1HNXO 4RAIA 4BAYA 3TGUH 4WFEA 1FFXA 2DMXA 3HKDB 4TT3G 4DR2O 1TA8A 1I7FA 3EOEA 4MTOA 2EJ7A 3AG1B 1QVFU 2B1IA 2EULA 1MMMA 1BE3H 4UCOA 4WFBV 3F5WC 1B6QA 4QGPA 1FFTB 5LP6A 4IGGA 2FL4A 1WP7A 3ZIAG 1XDCA 1JJOA 3K5LA 2QEXV 4LF4O 5KX5B 1LR1A 1H2LA 1EM1A 3Q4HA 1N0JA 4QE7A 2EZPA 1JMKC 1CP9A 2QJ1A 4LF9B 5EC1C 1JCHA 1NI8A 1GK9A 2ZINA 4B3TO 1JR9A 1JOYA 1KUQA 1IBKO 1E1QG 3K03A 1GM7A 4X62B 2K1EA 4FXFA 1MG1A 4LFAB 4J7KA 3ML0A 1NVPB 4Q6GA 4BIZA 4JI7O 4B2DD 3CJHB 1XBLA 4LBEC 2Y48A 1ROPA 2FB5A 4X1KA 3HKDA 1G1XB 1CXZB 2HEPA 1YTFD 3TXQA 2W0FC 3QO5A 3CCVV 4WCEV 4AHCA 1WPXA 2WLHA 3ME3A 4MVRA 2PI5A 1NH2D 3EFFK 1GM8A 1GO3F 1Q3EA 2AHYA 4X64O 1HDJA 3GVMA 2Z5UA 5KA5A 1IURA 4FM2A 5KX5A 3IJ4A 1QLNA 4I50B 3U2ZA 4MS2A 4NVPA 3JAMN 1VMGA 4OGQB 2PI4A 4FVMA 4H33A 3U0ZA 2YXHA 1OV9A 4WFFA 4HZ3A 2YIBA 4CH3A 3K06A 2UXXA 3F7VC 2PTMA 4NTWA 4R8CA 4H37A 2JJ2G 1ZTEA 3CJHA 3N25A 3MDSA 3SGIA 3T0TA 4C7UA 2ETNA 2VS0A 2QWOB 5GW7A 2GBOA 4DR6O 1PNMA 3T1HO 3RGBA 4PELA 1M56C 2EBOA 4DUYB 4DR5B 4I0XB 1XMOO 5AG2A 3S3WA 3H1KH 2EILC 2DE0X 3ZN0A 2L6LA 3HR0A 1B3QA 3UT5B 1VIBA 1Q86W 2QDOA 3F7YC 4JI5B 4JI4B 1EZJA 4KL1A 4I50A 3K58A 2XAGA 1IXBA 2CTQA 3ASNC 1Q6UA 2ITCC 5BMVB 2HLDG 1I94O 3M7MX 1RM1B 4GX0A 3CB2A 1YCIA 2HJDA 2XAJA 2E5LO 4WFHA 4LF6O 4NYKA 5TISZ 3JALB 1GN2A 3OM3B 3VQWA 1J95A 3QVNA 5CA3A 3ZMUA 1ZWIC 4KXRA 2IM9A 4X66O 3L75H 1BQZA 5B1BC 5IWAO 4CC5A 4MSWC 5CBGA 2VGIA 1DGSA 4I7ZB 4FFBB 1XL6A 1EZVH 3HKCA 3DXRB 1KYOF 4HYOA 5JJJB 5F2VO 4I0XA 1R6TA 2ILMA 2QWNB 3N27A 1F23A 3UT5A 4DW0A 2ZE7A 4JTDB 4X8AA 2VQEO 2RDCA 4UCRA 1XNRO 1KBHA 3AAGA 5BMVA 1P7GA 5FLXN 4CZZA 1K9MW 4FPPA 2Y0IA 3OMAB 4R6ZA 1YITV 1XHXA 4QIWF 2KG7B 4WBNB 4FXJA 3JALA 1P7BA 3ETDA 4TV9B 2UUCO 4BIOA 4DV5O 1M56B 2V7QG 2JS5A 3OE7G 1H2SB 2N74A 5B1OA 3W7XA 1PP9H 2EILB 4ZIBA 2Q7HA 5EZYB 4BW9A 4FFBA 4LFCO 1MNGA 4HYWA 4PJ0Z 2UXDO 1IZ3A 3DXRA 4G2KA 2P4VA 3ASNB 3K59A 1BCCH 1VQ8V 1SQFA 2VWJA 4LFBB 1N32B 4RO2A 4DV3B 4B3RB 1IBMO 2ATKC 2QSAA 1Z5VA 1ZSPA 3L74H 2G50A 2M7WA 1YIJV 1YHQV 3E89A 2HFEC 3OTOO 2A0LA 4IIJB 3CRAA 3F5TA 1F4NA 4PDVA 5B1NA 3LUTB 5B1BB 4F4LA 2KG7A 4WBNA 4HNAB 4NXNO 4TV9A 3ABLB 2NNUA 3DC6A 4PI0A 3J81N 1N36B 3STLC 4DR7O 4IHJA 1N33B 3I56V 4GLXA 4KHPO 1T57A 5LMNO 2PYJA 3JCUZ 4DR3O 3BHPA 2GSMB 4R7CA 2P6JA 3OUFA 5EC2C 3A2FA 4GZRB 1OCCC 3OAAG 3ZHQA 1SA0A 1HNXB 2DQ3A 3CMEV 4DR2B 2DW4A 3H1JH 1VQKV 2Q0OC 4FIPC 3SYPA 4DRSA 4AQYO 4MTGA 2IH3C 2PY5A 4IIJA 5B1AC 3UCSC 4CBCA 5LGNA 3BCCH 3B09A 2AGAA 4CS3A 5BR8O 1AB3A 4JPGA 5FL7G 2VRZA 3EVKA 3N2KB 2Y4TA 4UVAA 3SRDA 1YXBA 2IU0A 3JATB 5IJ9B 4HNAA 4LF4B 1FJGO 5JH7B 4J9ZB 2PZSA 1QR9A 2QWRB 1N4CA 3L9DA 1HP8A 2V4DA 1TAEA 1OCRC 1A5UA 4LR3A 2JEUA 3SYAA 5LMUO 3G6BA 2P22C 3K3WA 4B3TB 4JI8O 1ZAUA 4H44B 1IBKB 3H1HH 1E0UA 2UXNA 4BWAA 4JI7B 2QM4A 2IJJA 2GV9A 5KMGB 1NH2B 1SERA 1MA1A 1F51A 2ZM6O 3QV7A 5LXTB 1V9PA 2MK3A 3SRKA 1NS1A 3VQXA 1Y6XA 1Q8IA 4X64B 1RSOB 2ZE6A 5CN0A 1PKYA 4J11A 3B4SA 1B04A 1WAZA 3TXSA 3JATA 5CB4B 3RYFB 4PHZA 1S5LZ 2YXYA 4E2LA 4DV1O 4JI2O 1SRYA 2KKWA 2DWDC 4AILC 2UUBO 1RPOA 4LF7O 1FYJA 5B3SC 5K1PA 1OCCB 1QNMA 2LFSA 4DV2O 2LGWA 4K0KO 4DV7O 3AK2A 1SQPH 5LOVB 1W59A 2F1MA 1H2MA 3T1CA 1TVKB 1VF6C 2WPDG 4RWUA 2O57A 1D2DA 2X6CA 1LUVA 3ZS8C 5KMGA 1FXKC 2EIKC 3A0HZ 5B1AB 3JCZA 1A3WA 4FM0A 3QF7A 1XUQA 3OFNG 3APQA 2GUZB 4DXWA 4DR6B 4KUMA 2P7TC 3T1HB 3ZHVA 2ZIMA 4OPHA 5KAIZ 5LXTA 1R3IC 2Q0AA 1XMOB 2VGGA 3UO3A 1OCRB 1RSOA 5DECA 4IYHA 4DUZO 5E79Z 3E8BA 3E2EA 5CB4A 3ZJZA 4HAMA 3RYFA 3CCLV 5DEDA 4ZBMA 2K9PA 5IY5B 4D7SA 4FLUA 1M57B 1I94B 1FFXB 3JSLA 3RVZA 3BY6A 4D7TA 5KHIA 5EBLC 1H2NA 2EIMC 1N34O 2E5LB 5J2TB 2Y69C 5LA6B 1MOFA 4LF6B 1PKMA 1JFFB 1RFYA 1COWG 5LOVA 1TVKA 4DW1A 1WB8A 2JRIA 4UV9A 2A7WA 1VQ5V 4X66B 4QNHB 1FS0G 1N0NA 5IWAB 1KB9F 1IXMA 2CH7A 2GUZA 3T1YO 3LNNA 3Q4HB 5H2FZ 4JAAA
chains in the Genus database with same CATH topology
1F4MA 3K06A 2UXXA 3LDCA 3MD0A 1M1KW 3F7VC 1CPYA 4R8CA 3SPCA 4H37A 4FJCC 3ASOB 2JJ2G 1DTOA 1VQ9V 4WFGA 3ABMB 1KD1W 3JD0A 5B3SB 2Q68A 3QNEA 4PA3A 1DF5A 1KQSU 3MHHC 3FB8C 3ABTA 1S76D 2HG5C 1K92A 5GW7A 1QVGU 1AJPA 1PNMA 1VQ4V 2XAFA 3T2MA 4PELA 1G8MA 3BEHA 1M56C 2EBOA 3ZRVA 3W7SA 4BIUA 3T4DA 4TSFG 4UVBA 1PNLA 3A0RA 5CBFA 2EIKB 2EILC 3ZN0A 3RBZA 4RUFA 1NKDA 3HPLC 5H6RA 4MTXA 2V1DA 2YSUB 4LCUC 4LP8A 1Q86W 3F7YC 3CP1A 1EZJA 2D3OW 3D3IA 3ETGA 4FMTA 2XAGA 1JJ2U 2IJHA 3ASNC 3FB6C 4G28B 1R73A 2ITCC 2YEVB 4WF9V 3WFVA 1NVPD 2HLDG 3P32A 1RM1B 4GX0A 4R50A 4U7NA 3W7UA 1KP3A 2Q6AA 2EINB 2XAJA 1LNQA 1XL4A 2ZXWB 1K7DA 2WLNA 3TK1A 4WFHA 3WG7B 3OM3B 4KP4A 1KECA 1FXVA 1E79G 1J95A 1OHHG 1QLEB 4UV8A 5EBMC 2EIJB 3CCRV 5CA3A 1WLEA 3ZMUA 2Z3YA 5IDJA 1ZWIC 5KA6A 2QM7A 2AHZA 2EIMB 2EZOA 2BOBC 3AG4C 3K9AA 5B1BC 3MHSC 3E86A 3VOUA 1H38A 2Q67A 2Y69B 2X6BA 4Q20A 4MSWC 5KUMA 5CBGA 3GWOA 3B8NA 4UUJC 3OR6C 4Z1MG 1K73W 1K4DC 1CEZA 1GTOA 1H2GA 1DLBA 1XL6A 2EJRA 4HYOA 1FXKA 3LNMB 2JIZG 1ORQC 1F23A 3CC7V 2FTKA 1P4RA 2X6AA 4GX1A 4MW3A 1S5HC 3AG3C 4JTDB 4X8AA 1BHBA 1M90W 2ZR3A 1W2BU 4P2ZA 1NQTA 3E8FA 1OCZC 2KB1A 4XDJA 3ZCCA 3AAGA 1R3LC 2YEVA 1M9NA 3FB7C 3ABUA 3LDEA 4CZZA 2IU3A 3CMAV 1K9MW 1L1FA 4OXSA 4FPPA 3OMAB 4P30A 4R6ZA 3ZMSA 1YITV 2XAQA 3AG2C 1V55C 3GB7C 4QIWF 2OTLV 1VQMV 1P7BA 2DYSC 3ETDA 4QE9A 3G6EV 4MVUA 1NR1A 1M56B 2V7QG 3OEHG 2QE7G 3HB3B 3OE7G 4UXNA 3B8MA 1R3KC 4QPJA 5B1OA 3W7XA 1YTFB 5IY5C 4P9PA 4G27B 4MVSA 2EILB 5L3EA 1AJNA 1M57C 3IGAC 2DYRC 3NXSA 1VQ7V 1GKFA 5LHIA 2X0LA 3DTUB 4XDLA 1K97A 3CC2V 3ZRWB 1YJWV 5L3GA 2LP7A 3E35A 4JTCB 3ETEA 3RVYA 2H8PC 4G2KA 2WAMA 2WLIB 1Q7YW 5EK0A 3K0DA 3ASNB 3OGCC 3OR7C 4GX5A 1VQ8V 3ZN1A 2WLKA 3SYOA 4RO2A 1EBOA 1PL0A 1FXKB 3K04A 1JQ0A 2ATKC 2F43G 3VBBA 1K33A 4ZKIA 5LGTA 1YJ9V 3QO7A 2XOKG 1YI2V 3CD6V 3OW2U 2M7WA 1YIJV 1YHQV 3E8GA 3E89A 2XASA 1SZTA 3SJQC 2HFEC 1OCOC 1AI7A 2A0LA 2JDIG 5DN6G 1QCEA 3UKMA 4MVMA 1F4NA 4PDVA 4EKWA 5B1NA 2QKSA 1ENVA 3LUTB 1UJWB 3AG4B 3LSSA 1GMGA 5B1BB 1SESA 4F4LA 3ASOC 3ABKC 5L3CA 2OCCC 4JAUA 2ZR2A 3ABLB 2C2AA 3SPGA 5CMUA 2NNUA 5IYDO 1VQPV 1S3JA 4FK5C 3STLC 5DM6V 3UM7A 1V54C 1FXHA 2P67A 1VQLV 4JF3A 3JD2A 2QTOA 3I56V 3X2QC 4JTAB 3CXCU 4U7OA 1NJIW 3AG3B 1JVMA 4JYCA 2JK5C 3ZRWA 3CPWU 3LDDA 3AG1C 2X7RB 4P9OA 5L3BA 5L3FA 1AJQA 4X88A 4MW8A 1OCZB 2WLIA 2GSMB 1KC8W 4N23A 4R7CA 1VQ6V 2P6JA 2HVJC 2WSSG 3OUFA 2GHYA 5EC2C 1W0KG 2IH1C 1OCCC 4PDRA 3OAAG 5E1AC 1S77D 3ZMTA 3IFXA 2DQ3A 3CMEV 4GCZA 5H9CA 2HVKC 3EHBB 3FYEB 5BZBA 4PA9A 2DW4A 3CCUV 1VQKV 1K5QA 2LFRA 3I55V 4FIPC 3SYPA 3CCSV 3AG2B 2ZQMA 1V55B 2BOCC 3TCUA 3G4SV 3SYCA 1PD3A 4J9YB 1RM1C 3OUSA 1YJNV 4MTGA 3CCQV 5LGUA 2DYSB 2IH3C 3OMIB 2ZD9A 1SETA 5B1AC 2ZDIC 5C93A 4CBCA 5LGNA 3PJSK 3JD3A 4KFMA 3DGEA 3SPIA 3ZMZA 5KUKA 1JX9A 2JEXA 1AI4A 5FL7G 5HFLA 3D36A 2IJKA 3FKSG 3JD1A 4GT1A 4PA6A 4UVAA 4ASUG 4LC1A 2DWEC 2IU0A 3OEEG 4X89A 1QLEC 2DYRB 4J9ZB 1VQNV 1QR9A 1K34A 5LHHA 1OCRC 5H6QA 3CCJV 2JEUA 3SYAA 3K0GA 4RUEA 4RQFA 1K8AW 3CCMV 1Q82W 3K3WA 1S72V 1DF4A 1YSCA 3CCEV 2IW5A 4TWKA 5L3DA 2A9HA 2UXNA 3FB5C 3JYCA 4DO2A 3K79A 1NR7A 3QO8A 4WFAV 1PNKA 2HR3A 3ZRSA 2WLLA 3T4ZA 1TUEB 2IJJA 3B77A 2DQ0A 1S0VA 1NH2B 1OCOB 2R9RB 4MTFA 4L87A 2NLJC 4MVQA 1W0JG 2B1GA 1SERA 1KKDA 1BMFG 1R3JC 3CC4V 3E8HA 4JAVA 1Y4MA 5EBWC 1F51A 1OZ0A 3R65A 4QJFB 4UVCA 3K08A 3ABKB 2OCCB 4JYBA 3CYOA 1AI5A 1BHAA 3SYQA 2MK3A 1Q81W 5CBHA 3JD4A 3SPHA 3OMNB 1H8EG 2A79B 2B5UA 4I5SA 5CN0A 1V54B 1QR8A 1I5YA 1AROP 4RAIA 4BW5A 4BAYA 4WFEA 3X2QB 3H01A 2HKOA 4E2LA 4TT3G 3KG2A 4MTOA 3AG1B 3FYIB 1SRYA 1QVFU 2B1IA 2DWDC 1RPOA 2W6JG 2XAHA 2W6IG 3ABMC 4PDMA 1AI6A 5B3SC 1E1RG 1THZA 1QBZA 1OCCB 5J9PC 2Q69A 4WFBV 3F5WC 2LFSA 1B6QA 1AR1B 2HJFC 1FFTB 3LSQA 3ZMVA 3ZIAG 1R6NA 2QEXV 5IYCO 1EFRG 3P30A 1BL8A 3T1CA 2XNDG 2JJ1G 3M99B 3G71V 2WPDG 2X6CA 1FXKC 2EIKC 4QE7A 2EZPA 3IC7A 1CP9A 3JCZA 5B1AB 2R9IA 4PA4A 4MVOA 5EC1C 1JCHA 3OFNG 2WLLB 4DXWA 1JPXA 4KUMA 1NBMG 4JPRA 1GK9A 2P7TC 4QPKA 2CK3G 1JOYA 1GM9A 3RW0A 3ZRXA 2P90A 1E1QG 4XBFA 3K03A 1GM7A 3STZC 5LBQA 1R3IC 2K1EA 2QM8A 1MG1A 1Y66A 3ML0A 1NVPB 2OTJV 2QA4V 4PDLA 1OCRB 4BIZA 5IYBO 1PKXA 4LBEC 2EINC 2Y48A 1ROPA 3ABLC 2ZXWC 3E8BA 3AEIA 3E2EA 2WLMA 1R6KA 2WLJA 3ZJZA 4HAMA 4YXWG 3CCLV 3E83A 4ZBMA 3WG7C 1YTFD 2W0FC 3QO5A 5IY5B 3CCVV 1HWYA 1KP2A 1H8HG 1M57B 4WCEV 4MT8A 2OT5A 2EIJC 3RVZA 1WPXA 2WLHA 3BY6A 4MVRA 4RQEA 2IJIA 5EBLC 2PI5A 4PA7A 2EIMC 1NH2D 4N21A 5HFMA 3EFFK 1GM8A 1GO3F 2Y69C 2AHYA 1MOFA 1MSWD 4GX2A 1VQOV 1K3EA 3W7TA 1G4YB 1I5XA 1MABG 1COWG 4MVZA 2Z5UA 5KA5A 3W7WA 3SPJA 1QLNA 3TETA 1N8RW 4UV9A 2H94A 1VQ5V 2ZDIA 4QNHB 4MS2A 1FS0G 5LHGA 1K5SA 1RPRA 4I9WA 1IXMA 1K4CC 4JASA 2PI4A 2WWWA 4H33A 4JGSA 4WFFA 4XDKA 4HZ3A 2ITDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKO A;  4TT3 G;  2UXX A;  5L3B A;  5L3F A;  2W6J G;  2XAH A;  2JJ2 G;  2W6I G;  2WSS G;  1W0K G;  3OAA G;  1E1R G;  3ABU A;  3ZMT A;  4CZZ A;  3ZMS A;  2XAQ A;  2DW4 A;  3ABT A;  3ZMV A;  3ZIA G;  1EFR G;  2XAF A;  2XND G;  2JJ1 G;  5LGU A;  2WPD G;  2V7Q G;  3OEH G;  2QE7 G;  3OE7 G;  5LGN A;  4UXN A;  4TSF G;  4UVB A;  2R9I A;  3ZMZ A;  3ZN0 A;  5FL7 G;  3OFN G;  4ASU G;  3FKS G;  5L3E A;  4UVA A;  4KUM A;  1NBM G;  5H6R A;  3OEE G;  2CK3 G;  2V1D A;  5LHI A;  2X0L A;  4XBF A;  1E1Q G;  5LBQ A;  5L3G A;  2XAG A;  5LHH A;  5H6Q A;  2HLD G;  3ZN1 A;  2Y48 A;  2XAJ A;  2IW5 A;  4YXW G;  2F43 G;  5LGT A;  5L3D A;  2UXN A;  2XOK G;  1H8H G;  2XAS A;  1E79 G;  1OHH G;  4UV8 A;  2JDI G;  3ZMU A;  2Z3Y A;  5DN6 G;  1W0J G;  1BMF G;  1MAB G;  5L3C A;  1COW G;  4UVC A;  2Z5U A;  4Z1M G;  4UV9 A;  2EJR A;  2H94 A;  1H8E G;  1FS0 G;  5LHG A;  2JIZ G;  4BAY A; 
#chains in the Genus database with same CATH topology
 1F4M A;  1HNW O;  1M1K W;  1FPO A;  3SPC A;  5KHK A;  1VQ9 V;  1Q90 D;  4GKK O;  3P3P A;  1KD1 W;  5FNV B;  4UCT A;  5B3S B;  2VQE B;  4DR1 O;  1XNR B;  2N04 A;  4PA3 A;  5A2Q N;  3FFQ A;  4FLV A;  3N2G B;  3RN4 A;  1MZF A;  1VQ4 V;  1G8M A;  3BEH A;  4X1K B;  4YJ2 A;  1Z5W A;  4TSF G;  4B08 A;  3A0R A;  2EIK B;  5J2T A;  5LA6 A;  4GKJ O;  1JFF A;  4MTX A;  3OGI B;  2YSU B;  2UUC B;  2YUA A;  4DV5 B;  1XHZ A;  2W0X A;  4DV6 O;  2Q5Z A;  4IT5 A;  4OPA A;  1R73 A;  3DSQ A;  4JZ2 A;  2OIE A;  2NN4 A;  4R50 A;  2P06 A;  1AR5 A;  3W7U A;  1XL4 A;  3WB0 A;  4LFC B;  1K7D A;  4KCV A;  2UXD B;  4GYC B;  3SRF A;  2CAZ C;  3H1L H;  4KP4 A;  2UXB O;  1FXV A;  4J80 A;  1OHH G;  2F95 B;  5EBM C;  5FNV A;  2GTS A;  5JQG B;  1IBM B;  2QM7 A;  2EIM B;  4FFK A;  3MHS C;  1RP3 B;  3HQP A;  2Y69 B;  3N2G A;  4JI0 O;  1G6U A;  3OR6 C;  3OTO B;  1GTO A;  2EJR A;  1VF6 A;  4K35 A;  1FXK A;  3KKY A;  4CH5 A;  3CC7 V;  4NXN B;  2X6A A;  3FX7 A;  4FLY A;  3CRQ A;  1UPG A;  3HQO A;  1OCZ C;  1WJZ A;  3ZCC A;  1R3L C;  2JGD B;  4DR7 B;  4KHP B;  3NR7 A;  5LL6 Y;  4JI6 O;  3C3T A;  4OXS A;  1Y74 B;  4P30 A;  5LMN B;  1L0N H;  4DR3 B;  3AG2 C;  3GB7 C;  1QHT A;  4GUN A;  2DOS A;  2DYS C;  4OX9 O;  3AK3 A;  2BE3 A;  4YY3 O;  4LF8 O;  3HB3 B;  3B8M A;  1BS3 A;  4NXM O;  2UUA O;  3J7A U;  5JQG A;  4YHH O;  3BAA A;  4MVS A;  1AJN A;  2L35 A;  4EEQ A;  2YC0 A;  4Z2W A;  2DYR C;  3OD4 A;  4AQY B;  2X0L A;  1K97 A;  3ZRW B;  5L3G A;  2LP7 A;  2ARH A;  5BR8 B;  1Q7Y W;  1B06 A;  5EK0 A;  3OGC C;  3JAR B;  2F4V O;  2RN9 A;  3ZN1 A;  1FJG B;  3HKC B;  3SYO A;  5CA0 B;  3RYH B;  1EBO A;  1JQ0 A;  2F43 G;  1K33 A;  3CD6 V;  5LMU B;  2JGD A;  3E8G A;  4DK0 A;  2PYL A;  4UB6 Z;  3SJQ C;  1OCO C;  4JI8 B;  1SQQ H;  4DV0 O;  5DN6 G;  1Y74 A;  3CS5 A;  4MVM A;  4EKW A;  1ENV A;  1SQG A;  1UJW B;  1SES A;  3ASO C;  3ABK C;  3H1I H;  3ZBH A;  5L3C A;  1YDX A;  4JAU A;  2UU9 O;  3RYC B;  3C90 A;  2C2A A;  5CMU A;  4JI3 O;  1KKC A;  1S3J A;  3UM7 A;  2YID A;  3HQN A;  1VQL V;  3JD2 A;  2QTO A;  3X2Q C;  1KMI Z;  4ZI7 B;  3K5O A;  2ZM6 B;  4JTA B;  3K57 A;  1ZUQ A;  3A8T A;  3ZRW A;  3LDD A;  2YIA A;  3JSN A;  2BTO A;  5L3B A;  5L3F A;  4LH7 A;  1XNQ O;  1NTK H;  1OCZ B;  1BSM A;  4O4I B;  2IH1 C;  3JAR A;  3ZHT A;  5CA0 A;  1M4U A;  3RYH A;  4DV1 B;  4PA9 A;  4NR1 A;  4JI2 B;  3I55 V;  1BZK A;  3AG2 B;  3BVO A;  2FKX A;  1WA8 B;  4ABM A;  2UUB B;  4LF7 B;  3OUS A;  1YJN V;  2ZE8 A;  2NR5 A;  2DYS B;  1PL4 A;  5C93 A;  2ZDI C;  4RPP A;  3PJS K;  4DV2 B;  3SPI A;  2ZE5 A;  1XMQ O;  2JEX A;  2ZIO A;  4K0K B;  4DV7 B;  2IJK A;  3FKS G;  3ZHR A;  2DWE C;  4X89 A;  1QLE C;  1XI1 A;  4JYA O;  3RYC A;  2DYR B;  2YDE A;  1VQN V;  3L72 H;  3L71 H;  1GAX A;  4EFE A;  2XTA A;  4RQF A;  1S72 V;  4IP7 A;  1JA8 A;  4ZI7 A;  2Q73 A;  2IW5 A;  1GH6 A;  5IYZ A;  2LJ2 A;  3SJB C;  5L3D A;  4IHJ B;  3JYC A;  3K79 A;  3J80 N;  4U3J A;  2HR3 A;  1ZJH A;  3SDL A;  1SQV H;  2WLL A;  4O4I A;  1TUE B;  2Y0P A;  4J7J A;  4X65 O;  4DUZ B;  4F6R B;  1S0V A;  1OCO B;  2R9R B;  2ZT9 B;  4CC6 A;  4L87 A;  2NLJ C;  1KKD A;  2B1G A;  1AP6 A;  4LWS B;  3QG5 A;  3E8H A;  5EBW C;  3U11 A;  1O9G A;  1SA0 B;  5H5N A;  4UVC A;  1WA8 A;  3WU2 Z;  3K08 A;  3ABK B;  2YXL A;  3E22 A;  1AI5 A;  1BHA A;  2RNB A;  1N34 B;  4I5S A;  3L73 H;  1SZX A;  2E3C A;  1Y76 A;  4I55 B;  1I5Y A;  1ARO P;  1X4T A;  4BW5 A;  1HR0 O;  3X2Q B;  3H01 A;  2LGQ A;  1SKV A;  2F93 B;  2W6J G;  2W6I G;  3ABM C;  3T1Y B;  1E1R G;  2YI9 A;  5J2U B;  2DN9 A;  5J9P C;  4O2A B;  2Q69 A;  1HNW B;  1AR1 B;  1Q6I A;  5EIB D;  1O9H A;  1GN6 A;  1U96 A;  2JJ1 G;  3M99 B;  3G71 V;  3SJA C;  4GKK B;  4F6R A;  1E0T A;  4DR1 B;  1URF A;  3IC7 A;  4LWS A;  1ZL8 A;  3VQV A;  3FD9 A;  1WN7 A;  4J10 A;  1R1B A;  3ZX6 A;  3ZRX A;  1VP7 A;  3G67 A;  4XBF A;  2KSD A;  3CRR A;  3STZ C;  5LBQ A;  2YI8 A;  2QM8 A;  1Y66 A;  2QA4 V;  4GKJ B;  4PDL A;  5IYB O;  2E75 B;  1PKX A;  5JCO C;  5IT9 N;  2EIN C;  4DRX A;  2ZXW C;  4I55 A;  4KS0 A;  2LO1 A;  2WLM A;  2WLJ A;  4DV6 B;  2Q4P A;  4YXW G;  1DK1 A;  2VGB A;  1J5E O;  2OT5 A;  5J2U A;  4O2A A;  4N21 A;  1MSW D;  1VQO V;  3W7T A;  1G4Y B;  1I5X A;  3W7W A;  2ZNJ A;  2UXB B;  3GWK C;  3TET A;  2H94 A;  5A9G A;  1Q43 A;  2ZDI A;  5JJN B;  1RPR A;  1K5S A;  1NTM H;  4I9W A;  3AG7 A;  4JI0 B;  1K4C C;  4JAS A;  2WWW A;  3KCX A;  4JGS A;  1IBL O;  2ITD C;  1VP8 A;  3T07 A;  3G2G A;  3LDC A;  4QGC A;  4YIP A;  1CPY A;  4FJC C;  1DTO A;  1AR4 A;  3ABM B;  4B3S O;  4Z1V A;  3QNE A;  1DF5 A;  4FLX A;  5GTH Z;  1KQS U;  3FB8 C;  2HG5 C;  1K92 A;  2FML A;  5KHG A;  3T2M A;  2A06 H;  3ZRV A;  1S5J A;  4L8J A;  4JI6 B;  3T4D A;  4UVB A;  4I9Q A;  2Y4U A;  2LQT A;  4O2B A;  3MAQ A;  1UFI A;  1NKD A;  1WNS A;  3HPL C;  4OX9 B;  1Q6H A;  4YY3 B;  1T5A A;  4LF8 B;  4X1Y B;  3CP1 A;  3RYI B;  4DYL A;  4NXM B;  2UUA B;  4EFB A;  3FB6 C;  4YHH B;  4G28 B;  2YEV B;  3WB1 A;  3WFV A;  2CTR A;  1A32 A;  3P3N A;  1SQX H;  2E74 B;  2Q6A A;  2EIN B;  3CRC A;  2ZXW B;  4PD4 F;  2WLN A;  3TK1 A;  2CH7 B;  1A49 A;  2YS8 A;  1HNZ O;  1YF2 A;  3CE2 A;  4KCU A;  4NB5 A;  1KEC A;  4PI2 A;  2OYQ A;  4FLT A;  3BA9 A;  2F4V B;  1AQF A;  2FYU H;  3CCR V;  2B9Z A;  1BQ0 A;  2QGN A;  5KA6 A;  1PM9 A;  1A3X A;  3AG4 C;  2BOB C;  3TJT A;  3K9A A;  3VOU A;  4J41 A;  2Q67 A;  1VF7 A;  4Q20 A;  1VAR A;  4FLW A;  4H13 B;  3GWO A;  3B8N A;  3CX5 F;  4UCS A;  3BFR A;  4UCV A;  1K73 W;  1CEZ A;  4DV0 B;  2JIZ G;  1ORQ C;  4IMA A;  2UXC O;  4YJ2 B;  1P4R A;  4MW3 A;  2UU9 B;  3AG3 C;  1BHB A;  4X1Y A;  1M90 W;  2ZR3 A;  3IC9 A;  4JI3 B;  4P2Z A;  3RYI A;  1NQT A;  3E8F A;  1PV0 A;  2YEV A;  1M9N A;  3JAW B;  3ABU A;  3LDE A;  3KZI Z;  5EIB C;  3CMA V;  4JI1 O;  2QKA A;  5JCO A;  3ZMS A;  3K9S A;  1V55 C;  3H9V A;  1XNQ B;  1VQM V;  2XUM A;  2R9A A;  3G6E V;  2VWK A;  4MVU A;  4YNG A;  2CTW A;  3OEH G;  2QE7 G;  1R3K C;  4X1I A;  2RMK B;  4UFZ A;  1EN5 A;  4DR4 O;  4P9P A;  5L3E A;  1L8D A;  3IGA C;  1VQ7 V;  1GKF A;  5LHI A;  3DTU B;  4XDL A;  2KQX A;  5D5P A;  1Q5O A;  2QKC A;  3U10 A;  4UB8 Z;  4JTC B;  3ETE A;  3RVY A;  2H8P C;  4E4E A;  1ZLZ A;  1XIL A;  1XMQ B;  2WLK A;  4JYA B;  1LUW A;  1FXK B;  3K04 A;  3VBB A;  2F23 A;  5LGT A;  4O4L A;  2XOK G;  1YI2 V;  3OW2 U;  3RWR D;  2HHH O;  1WB7 A;  4K3A A;  1Z2G A;  4ZOL A;  2JDI G;  3JAW A;  3UKM A;  1QQC A;  4YIO A;  2QKS A;  4HYV A;  2PGG A;  3O65 A;  3AG4 B;  3LSS A;  4YJ3 B;  1GMG A;  4JYY A;  2CUG A;  3E0W A;  2ZR2 A;  4DV4 O;  4X65 B;  3SPG A;  4O4H B;  1F7Y A;  1VQP V;  5DM6 V;  3ICX A;  2P67 A;  1I0H A;  4JF3 A;  2WA3 A;  2Q9L A;  3SRH A;  4NTY A;  3AG3 B;  1JVM A;  1D5A A;  2JK5 C;  3QTC A;  3CPW U;  3OT7 A;  2PUS A;  2X7R B;  2Q7G A;  4CS2 A;  1AJQ A;  4X88 A;  4MW8 A;  3KCY A;  2YIC A;  1KC8 W;  2QWP B;  1QU7 A;  3H6O A;  1W0K G;  3G80 A;  5E1A C;  4PDR A;  1S77 D;  1HR0 B;  1FAF A;  4GCZ A;  5H9C A;  5GON B;  2CGO A;  4JV5 O;  1NTZ H;  3EHB B;  3FYE B;  5BZB A;  3DC5 A;  3CWB H;  1K5Q A;  2LFR A;  3CCS V;  2ZQM A;  1V55 B;  3G4S V;  1NT2 B;  3SYC A;  2RCV A;  4I4T B;  1AIL A;  4J9Y B;  1RM1 C;  2ZCE A;  5EYP B;  5LGU A;  3OMI B;  2ZD9 A;  1SET A;  1L0L H;  1YZB A;  3JD3 A;  4KFM A;  1FKA O;  2CTP A;  3DGE A;  5KUK A;  1AI4 A;  3CSX A;  3OTF A;  4ASU G;  1X59 A;  4GT1 A;  4YJ3 A;  5B5E Z;  3IAY A;  2P4K A;  4O4H A;  4H0L B;  2ADP A;  1K34 A;  5IJ0 B;  5LHH A;  3K0G A;  2VGF A;  4TV8 B;  1IX9 A;  2D2C B;  4UCU A;  1Q82 W;  2F66 C;  1DF4 A;  3B2E E;  2BCC H;  3VQY A;  4W4K A;  4TOI A;  4DO2 A;  1NR7 A;  4WFA V;  1XQ8 A;  1PKN A;  1BGY H;  2DQ0 A;  3BA8 A;  3C3S A;  2VQF O;  3B40 A;  1W0J G;  5GON A;  5D5Q A;  2JGU A;  1R3J C;  3EXA A;  3BJT A;  1OZ0 A;  3L70 H;  3RFR A;  1J5E B;  4QJF B;  1TUB B;  4I4T A;  4JYB A;  5EYP A;  3SYQ A;  1Q81 W;  5CBH A;  3JD4 A;  1MZE A;  3M8A A;  3OMN B;  3BAB A;  2B5U A;  3ETQ A;  3GQY A;  5C8Y B;  2R70 A;  1QR8 A;  1XOU A;  5LYJ B;  2HKO A;  3GR4 A;  1GN3 A;  1SF9 A;  4F6E A;  3KG2 A;  4CH4 A;  3E0V A;  3FYI B;  5IJ0 A;  2ZNI A;  4TV8 A;  2XAH A;  4O4J B;  2QWQ B;  4PDM A;  1AI6 A;  1EN4 A;  1THZ A;  1QBZ A;  1IBL B;  4PV1 B;  2HJF C;  1VF5 B;  3LSQ A;  3ZMV A;  1R6N A;  5IYC O;  1EFR G;  3P30 A;  1BL8 A;  2BSK B;  4LH6 A;  2XND G;  5IYZ B;  4CS4 A;  4B3S B;  2R9I A;  1T5E A;  2E76 B;  4MVO A;  4PA4 A;  4U3J B;  3K5M A;  2WLL B;  1JPX A;  1NBM G;  4JPR A;  4QPK A;  3BRC A;  2CK3 G;  4TQD A;  4KCT A;  1GM9 A;  1TUB A;  3RW0 A;  2P90 A;  4LF5 O;  2Z0A A;  4B3M O;  1KU9 A;  2OTJ V;  3E22 B;  5C8Y A;  3ZHS A;  3ABL C;  3AEI A;  1R6K A;  5LYJ A;  4K8X A;  3E83 A;  3WG7 C;  3APO A;  4HBN A;  2G38 A;  1HWY A;  1KP2 A;  1Y76 B;  1H8H G;  5KAF Z;  4MT8 A;  2EIJ C;  4O4J A;  4RQE A;  4J42 A;  2IJI A;  5IE9 A;  4PA7 A;  5HFM A;  3O9O A;  1XRE A;  4GX2 A;  1HNZ B;  1K3E A;  1MAB G;  1FD9 A;  4MVZ A;  3SPJ A;  2BSK A;  1TGO A;  3JAS B;  1N8R W;  5BXZ A;  5K1X A;  1OJH A;  4NKG B;  5LHG A;  2M6Y A;  2PF4 E;  4EB6 B;  3K5N A;  4XDK A;  2EX3 A;  1ZL8 B;  3MD0 A;  4W4L A;  3SR2 C;  1GN4 A;  4FLZ A;  5BY1 A;  3ASO B;  2UXC B;  4WFG A;  3JD0 A;  4WJ8 A;  2Q68 A;  4LNU B;  1WPB A;  2R72 A;  4D6T H;  4QG6 A;  4LF9 O;  2ZKO A;  3MHH C;  1S76 D;  3ABT A;  4JZG A;  5FPR A;  3BPZ A;  1QVG U;  1AJP A;  2RJZ A;  4TUY B;  4DRX B;  2XAF A;  2RQ6 A;  3W7S A;  4BIU A;  4X62 O;  4JI1 B;  2GDS A;  3CXH F;  4TQF A;  1PKL A;  1PNL A;  1ZX3 A;  5CBF A;  5GTI Z;  4LFA O;  1BT8 A;  3RBZ A;  4RUF A;  3KTX A;  1GRJ A;  1AP5 A;  5H6R A;  2V1D A;  1M5I A;  4LCU C;  4LP8 A;  3WB2 A;  4KCW A;  3JAS A;  2OWO A;  2D3O W;  3PN1 A;  2YIB D;  3D3I A;  3ETG A;  4FMT A;  1JJ2 U;  4QG9 A;  2E28 A;  2IJH A;  5JVD B;  4WF9 V;  4DR4 B;  1P49 A;  2Q7E A;  1NVP D;  2N05 A;  3P32 A;  4EB6 A;  2ADQ B;  4U7N A;  1YVW A;  1KP3 A;  1LNQ A;  4K8Z A;  1VEW A;  3ZED A;  3KHD A;  3WG7 B;  3AK1 A;  1E79 G;  1SS3 A;  1QLE B;  2AW9 A;  4NTX A;  4UV8 A;  2EIJ B;  5EZY A;  1WLE A;  2Z3Y A;  5IDJ A;  4BR6 A;  4LNU A;  2AHZ A;  2EZO A;  3D36 C;  1I08 A;  3E86 A;  1PPJ H;  1H38 A;  2X6B A;  2HHH B;  5KUM A;  3GG8 A;  4TUY A;  4UUJ C;  4Z1M G;  1K4D C;  1H2G A;  2CE4 A;  1DLB A;  1F3W A;  1HW7 A;  2QR4 A;  3LNM B;  2CGN A;  2FTK A;  2XT9 A;  4GX1 A;  1S5H C;  2CDY A;  4DV4 B;  3HKB B;  1NZ6 A;  1W2B U;  4O2B B;  2KB1 A;  4XDJ A;  5FPO A;  4QG8 A;  5JVD A;  3FB7 C;  3FAV B;  1NU1 H;  2IU3 A;  1L1F A;  4DUY O;  4DR5 O;  4DK1 A;  3QTG A;  2XAQ A;  1U97 A;  2OTL V;  3RT3 C;  4QE9 A;  5KHJ A;  1NR1 A;  4JI5 O;  4JI4 O;  4UXN A;  4JV5 B;  2DJV A;  4QPJ A;  1YTF B;  5IY5 C;  4G27 B;  1M57 C;  3S3X A;  1SQB H;  2QTS A;  4X9Q A;  3NXS A;  5CA1 B;  2WA4 A;  1Y67 A;  3CC2 V;  1IVS A;  1YJW V;  2AZ0 A;  3E35 A;  4CH6 A;  2WAM A;  2WLI B;  3K0D A;  1WP8 A;  3OR7 C;  4GX5 A;  2Q8V A;  1PL0 A;  5LP6 C;  3SJC C;  3HKB A;  4ZKI A;  1YJ9 V;  1EN6 A;  4IL6 Z;  4U3F H;  3QO7 A;  4FZ0 A;  2GTA A;  2OIG A;  1H2K A;  3R66 A;  1SZT A;  2XAS A;  3N2K A;  3CHX A;  1AI7 A;  3CRM A;  3FAV A;  5IJ9 A;  2ODM A;  1QCE A;  4KRZ A;  5JH7 A;  3I5D A;  2OCC C;  2XHB A;  4B2D A;  4G1N A;  3HKE B;  2AXT Z;  3ZHU A;  3BJF A;  2JS3 A;  5B66 Z;  3T05 A;  5IYD O;  3A0B Z;  1YEW A;  2VQF B;  4FK5 C;  3QV8 A;  1V54 C;  1FXH A;  3CEI A;  3LSU A;  1IDS A;  2AZ2 A;  3IS4 A;  1AVM A;  5CA1 A;  4X1I B;  3CXC U;  4U7O A;  1NJI W;  4JYC A;  3AG1 C;  4IYI A;  4P9O A;  4J7Z A;  5JWP A;  2BTQ B;  2WLI A;  1VQ6 V;  4N23 A;  4X20 B;  2WSS G;  2HVJ C;  2GHY A;  3D3Q A;  4ICG A;  4B7E A;  3ZMT A;  3IFX A;  2HVK C;  4B7K A;  4AI8 A;  3CCU V;  1MSD A;  2P5O A;  3JAK B;  3TCU A;  2BOC C;  1PD3 A;  3THO A;  3CCQ V;  3D8C A;  4FZ1 A;  1P84 F;  4O4L B;  5KHH A;  4ZHQ B;  2H3O A;  5ITZ B;  3ZMZ A;  5JJE B;  1JX9 A;  5HFL A;  3D36 A;  3JD1 A;  4PA6 A;  2IBZ H;  4ZOL B;  4LC1 A;  3OEE G;  4LFB O;  1N32 O;  4DV3 O;  3HKE A;  4B3R O;  2LW7 A;  5H6Q A;  3CCJ V;  4RUE A;  1K8A W;  2JVD A;  4A5U B;  3CCM V;  2HP8 A;  4YJ5 A;  1YSC A;  1SC5 B;  3CCE V;  4LF5 B;  3QV6 A;  5KLV H;  3UQ8 A;  4TWK A;  5LP6 B;  2A9H A;  3FB5 C;  4B3M B;  3QO8 A;  1PNK A;  2BTQ A;  3QV9 A;  3ZRS A;  4X20 A;  3T4Z A;  3B77 A;  4FM1 A;  4MTF A;  1N36 O;  4MVQ A;  1BMF G;  2OCH A;  3CC4 V;  4JAV A;  1Y4M A;  1F3X A;  1XEQ A;  1N33 O;  3R65 A;  3JAK A;  1D5N A;  2A3Q A;  2OCC B;  1US6 A;  3UO2 A;  3CYO A;  3MA8 A;  3PP7 A;  3SPH A;  4ZHQ A;  5ITZ A;  1H8E G;  2LW1 A;  2A79 B;  1M93 A;  1V54 B;  2MW2 B;  1HNX O;  4RAI A;  4BAY A;  3TGU H;  4WFE A;  1FFX A;  2DMX A;  3HKD B;  4TT3 G;  4DR2 O;  1TA8 A;  1I7F A;  3EOE A;  4MTO A;  2EJ7 A;  3AG1 B;  1QVF U;  2B1I A;  2EUL A;  1MMM A;  1BE3 H;  4UCO A;  4WFB V;  3F5W C;  1B6Q A;  4QGP A;  1FFT B;  5LP6 A;  4IGG A;  2FL4 A;  1WP7 A;  3ZIA G;  1XDC A;  1JJO A;  3K5L A;  2QEX V;  4LF4 O;  5KX5 B;  1LR1 A;  1H2L A;  1EM1 A;  3Q4H A;  1N0J A;  4QE7 A;  2EZP A;  1JMK C;  1CP9 A;  2QJ1 A;  4LF9 B;  5EC1 C;  1JCH A;  1NI8 A;  1GK9 A;  2ZIN A;  4B3T O;  1JR9 A;  1JOY A;  1KUQ A;  1IBK O;  1E1Q G;  3K03 A;  1GM7 A;  4X62 B;  2K1E A;  4FXF A;  1MG1 A;  4LFA B;  4J7K A;  3ML0 A;  1NVP B;  4Q6G A;  4BIZ A;  4JI7 O;  4B2D D;  3CJH B;  1XBL A;  4LBE C;  2Y48 A;  1ROP A;  2FB5 A;  4X1K A;  3HKD A;  1G1X B;  1CXZ B;  2HEP A;  1YTF D;  3TXQ A;  2W0F C;  3QO5 A;  3CCV V;  4WCE V;  4AHC A;  1WPX A;  2WLH A;  3ME3 A;  4MVR A;  2PI5 A;  1NH2 D;  3EFF K;  1GM8 A;  1GO3 F;  1Q3E A;  2AHY A;  4X64 O;  1HDJ A;  3GVM A;  2Z5U A;  5KA5 A;  1IUR A;  4FM2 A;  5KX5 A;  3IJ4 A;  1QLN A;  4I50 B;  3U2Z A;  4MS2 A;  4NVP A;  3JAM N;  1VMG A;  4OGQ B;  2PI4 A;  4FVM A;  4H33 A;  3U0Z A;  2YXH A;  1OV9 A;  4WFF A;  4HZ3 A;  2YIB A;  4CH3 A;  3K06 A;  2UXX A;  3F7V C;  2PTM A;  4NTW A;  4R8C A;  4H37 A;  2JJ2 G;  1ZTE A;  3CJH A;  3N25 A;  3MDS A;  3SGI A;  3T0T A;  4C7U A;  2ETN A;  2VS0 A;  2QWO B;  5GW7 A;  2GBO A;  4DR6 O;  1PNM A;  3T1H O;  3RGB A;  4PEL A;  1M56 C;  2EBO A;  4DUY B;  4DR5 B;  4I0X B;  1XMO O;  5AG2 A;  3S3W A;  3H1K H;  2EIL C;  2DE0 X;  3ZN0 A;  2L6L A;  3HR0 A;  1B3Q A;  3UT5 B;  1VIB A;  1Q86 W;  2QDO A;  3F7Y C;  4JI5 B;  4JI4 B;  1EZJ A;  4KL1 A;  4I50 A;  3K58 A;  2XAG A;  1IXB A;  2CTQ A;  3ASN C;  1Q6U A;  2ITC C;  5BMV B;  2HLD G;  1I94 O;  3M7M X;  1RM1 B;  4GX0 A;  3CB2 A;  1YCI A;  2HJD A;  2XAJ A;  2E5L O;  4WFH A;  4LF6 O;  4NYK A;  5TIS Z;  3JAL B;  1GN2 A;  3OM3 B;  3VQW A;  1J95 A;  3QVN A;  5CA3 A;  3ZMU A;  1ZWI C;  4KXR A;  2IM9 A;  4X66 O;  3L75 H;  1BQZ A;  5B1B C;  5IWA O;  4CC5 A;  4MSW C;  5CBG A;  2VGI A;  1DGS A;  4I7Z B;  4FFB B;  1XL6 A;  1EZV H;  3HKC A;  3DXR B;  1KYO F;  4HYO A;  5JJJ B;  5F2V O;  4I0X A;  1R6T A;  2ILM A;  2QWN B;  3N27 A;  1F23 A;  3UT5 A;  4DW0 A;  2ZE7 A;  4JTD B;  4X8A A;  2VQE O;  2RDC A;  4UCR A;  1XNR O;  1KBH A;  3AAG A;  5BMV A;  1P7G A;  5FLX N;  4CZZ A;  1K9M W;  4FPP A;  2Y0I A;  3OMA B;  4R6Z A;  1YIT V;  1XHX A;  4QIW F;  2KG7 B;  4WBN B;  4FXJ A;  3JAL A;  1P7B A;  3ETD A;  4TV9 B;  2UUC O;  4BIO A;  4DV5 O;  1M56 B;  2V7Q G;  2JS5 A;  3OE7 G;  1H2S B;  2N74 A;  5B1O A;  3W7X A;  1PP9 H;  2EIL B;  4ZIB A;  2Q7H A;  5EZY B;  4BW9 A;  4FFB A;  4LFC O;  1MNG A;  4HYW A;  4PJ0 Z;  2UXD O;  1IZ3 A;  3DXR A;  4G2K A;  2P4V A;  3ASN B;  3K59 A;  1BCC H;  1VQ8 V;  1SQF A;  2VWJ A;  4LFB B;  1N32 B;  4RO2 A;  4DV3 B;  4B3R B;  1IBM O;  2ATK C;  2QSA A;  1Z5V A;  1ZSP A;  3L74 H;  2G50 A;  2M7W A;  1YIJ V;  1YHQ V;  3E89 A;  2HFE C;  3OTO O;  2A0L A;  4IIJ B;  3CRA A;  3F5T A;  1F4N A;  4PDV A;  5B1N A;  3LUT B;  5B1B B;  4F4L A;  2KG7 A;  4WBN A;  4HNA B;  4NXN O;  4TV9 A;  3ABL B;  2NNU A;  3DC6 A;  4PI0 A;  3J81 N;  1N36 B;  3STL C;  4DR7 O;  4IHJ A;  1N33 B;  3I56 V;  4GLX A;  4KHP O;  1T57 A;  5LMN O;  2PYJ A;  3JCU Z;  4DR3 O;  3BHP A;  2GSM B;  4R7C A;  2P6J A;  3OUF A;  5EC2 C;  3A2F A;  4GZR B;  1OCC C;  3OAA G;  3ZHQ A;  1SA0 A;  1HNX B;  2DQ3 A;  3CME V;  4DR2 B;  2DW4 A;  3H1J H;  1VQK V;  2Q0O C;  4FIP C;  3SYP A;  4DRS A;  4AQY O;  4MTG A;  2IH3 C;  2PY5 A;  4IIJ A;  5B1A C;  3UCS C;  4CBC A;  5LGN A;  3BCC H;  3B09 A;  2AGA A;  4CS3 A;  5BR8 O;  1AB3 A;  4JPG A;  5FL7 G;  2VRZ A;  3EVK A;  3N2K B;  2Y4T A;  4UVA A;  3SRD A;  1YXB A;  2IU0 A;  3JAT B;  5IJ9 B;  4HNA A;  4LF4 B;  1FJG O;  5JH7 B;  4J9Z B;  2PZS A;  1QR9 A;  2QWR B;  1N4C A;  3L9D A;  1HP8 A;  2V4D A;  1TAE A;  1OCR C;  1A5U A;  4LR3 A;  2JEU A;  3SYA A;  5LMU O;  3G6B A;  2P22 C;  3K3W A;  4B3T B;  4JI8 O;  1ZAU A;  4H44 B;  1IBK B;  3H1H H;  1E0U A;  2UXN A;  4BWA A;  4JI7 B;  2QM4 A;  2IJJ A;  2GV9 A;  5KMG B;  1NH2 B;  1SER A;  1MA1 A;  1F51 A;  2ZM6 O;  3QV7 A;  5LXT B;  1V9P A;  2MK3 A;  3SRK A;  1NS1 A;  3VQX A;  1Y6X A;  1Q8I A;  4X64 B;  1RSO B;  2ZE6 A;  5CN0 A;  1PKY A;  4J11 A;  3B4S A;  1B04 A;  1WAZ A;  3TXS A;  3JAT A;  5CB4 B;  3RYF B;  4PHZ A;  1S5L Z;  2YXY A;  4E2L A;  4DV1 O;  4JI2 O;  1SRY A;  2KKW A;  2DWD C;  4AIL C;  2UUB O;  1RPO A;  4LF7 O;  1FYJ A;  5B3S C;  5K1P A;  1OCC B;  1QNM A;  2LFS A;  4DV2 O;  2LGW A;  4K0K O;  4DV7 O;  3AK2 A;  1SQP H;  5LOV B;  1W59 A;  2F1M A;  1H2M A;  3T1C A;  1TVK B;  1VF6 C;  2WPD G;  4RWU A;  2O57 A;  1D2D A;  2X6C A;  1LUV A;  3ZS8 C;  5KMG A;  1FXK C;  2EIK C;  3A0H Z;  5B1A B;  3JCZ A;  1A3W A;  4FM0 A;  3QF7 A;  1XUQ A;  3OFN G;  3APQ A;  2GUZ B;  4DXW A;  4DR6 B;  4KUM A;  2P7T C;  3T1H B;  3ZHV A;  2ZIM A;  4OPH A;  5KAI Z;  5LXT A;  1R3I C;  2Q0A A;  1XMO B;  2VGG A;  3UO3 A;  1OCR B;  1RSO A;  5DEC A;  4IYH A;  4DUZ O;  5E79 Z;  3E8B A;  3E2E A;  5CB4 A;  3ZJZ A;  4HAM A;  3RYF A;  3CCL V;  5DED A;  4ZBM A;  2K9P A;  5IY5 B;  4D7S A;  4FLU A;  1M57 B;  1I94 B;  1FFX B;  3JSL A;  3RVZ A;  3BY6 A;  4D7T A;  5KHI A;  5EBL C;  1H2N A;  2EIM C;  1N34 O;  2E5L B;  5J2T B;  2Y69 C;  5LA6 B;  1MOF A;  4LF6 B;  1PKM A;  1JFF B;  1RFY A;  1COW G;  5LOV A;  1TVK A;  4DW1 A;  1WB8 A;  2JRI A;  4UV9 A;  2A7W A;  1VQ5 V;  4X66 B;  4QNH B;  1FS0 G;  1N0N A;  5IWA B;  1KB9 F;  1IXM A;  2CH7 A;  2GUZ A;  3T1Y O;  3LNN A;  3Q4H B;  5H2F Z;  4JAA A; 
#chains in the Genus database with same CATH homology
 1F4M A;  3K06 A;  2UXX A;  3LDC A;  3MD0 A;  1M1K W;  3F7V C;  1CPY A;  4R8C A;  3SPC A;  4H37 A;  4FJC C;  3ASO B;  2JJ2 G;  1DTO A;  1VQ9 V;  4WFG A;  3ABM B;  1KD1 W;  3JD0 A;  5B3S B;  2Q68 A;  3QNE A;  4PA3 A;  1DF5 A;  1KQS U;  3MHH C;  3FB8 C;  3ABT A;  1S76 D;  2HG5 C;  1K92 A;  5GW7 A;  1QVG U;  1AJP A;  1PNM A;  1VQ4 V;  2XAF A;  3T2M A;  4PEL A;  1G8M A;  3BEH A;  1M56 C;  2EBO A;  3ZRV A;  3W7S A;  4BIU A;  3T4D A;  4TSF G;  4UVB A;  1PNL A;  3A0R A;  5CBF A;  2EIK B;  2EIL C;  3ZN0 A;  3RBZ A;  4RUF A;  1NKD A;  3HPL C;  5H6R A;  4MTX A;  2V1D A;  2YSU B;  4LCU C;  4LP8 A;  1Q86 W;  3F7Y C;  3CP1 A;  1EZJ A;  2D3O W;  3D3I A;  3ETG A;  4FMT A;  2XAG A;  1JJ2 U;  2IJH A;  3ASN C;  3FB6 C;  4G28 B;  1R73 A;  2ITC C;  2YEV B;  4WF9 V;  3WFV A;  1NVP D;  2HLD G;  3P32 A;  1RM1 B;  4GX0 A;  4R50 A;  4U7N A;  3W7U A;  1KP3 A;  2Q6A A;  2EIN B;  2XAJ A;  1LNQ A;  1XL4 A;  2ZXW B;  1K7D A;  2WLN A;  3TK1 A;  4WFH A;  3WG7 B;  3OM3 B;  4KP4 A;  1KEC A;  1FXV A;  1E79 G;  1J95 A;  1OHH G;  1QLE B;  4UV8 A;  5EBM C;  2EIJ B;  3CCR V;  5CA3 A;  1WLE A;  3ZMU A;  2Z3Y A;  5IDJ A;  1ZWI C;  5KA6 A;  2QM7 A;  2AHZ A;  2EIM B;  2EZO A;  2BOB C;  3AG4 C;  3K9A A;  5B1B C;  3MHS C;  3E86 A;  3VOU A;  1H38 A;  2Q67 A;  2Y69 B;  2X6B A;  4Q20 A;  4MSW C;  5KUM A;  5CBG A;  3GWO A;  3B8N A;  4UUJ C;  3OR6 C;  4Z1M G;  1K73 W;  1K4D C;  1CEZ A;  1GTO A;  1H2G A;  1DLB A;  1XL6 A;  2EJR A;  4HYO A;  1FXK A;  3LNM B;  2JIZ G;  1ORQ C;  1F23 A;  3CC7 V;  2FTK A;  1P4R A;  2X6A A;  4GX1 A;  4MW3 A;  1S5H C;  3AG3 C;  4JTD B;  4X8A A;  1BHB A;  1M90 W;  2ZR3 A;  1W2B U;  4P2Z A;  1NQT A;  3E8F A;  1OCZ C;  2KB1 A;  4XDJ A;  3ZCC A;  3AAG A;  1R3L C;  2YEV A;  1M9N A;  3FB7 C;  3ABU A;  3LDE A;  4CZZ A;  2IU3 A;  3CMA V;  1K9M W;  1L1F A;  4OXS A;  4FPP A;  3OMA B;  4P30 A;  4R6Z A;  3ZMS A;  1YIT V;  2XAQ A;  3AG2 C;  1V55 C;  3GB7 C;  4QIW F;  2OTL V;  1VQM V;  1P7B A;  2DYS C;  3ETD A;  4QE9 A;  3G6E V;  4MVU A;  1NR1 A;  1M56 B;  2V7Q G;  3OEH G;  2QE7 G;  3HB3 B;  3OE7 G;  4UXN A;  3B8M A;  1R3K C;  4QPJ A;  5B1O A;  3W7X A;  1YTF B;  5IY5 C;  4P9P A;  4G27 B;  4MVS A;  2EIL B;  5L3E A;  1AJN A;  1M57 C;  3IGA C;  2DYR C;  3NXS A;  1VQ7 V;  1GKF A;  5LHI A;  2X0L A;  3DTU B;  4XDL A;  1K97 A;  3CC2 V;  3ZRW B;  1YJW V;  5L3G A;  2LP7 A;  3E35 A;  4JTC B;  3ETE A;  3RVY A;  2H8P C;  4G2K A;  2WAM A;  2WLI B;  1Q7Y W;  5EK0 A;  3K0D A;  3ASN B;  3OGC C;  3OR7 C;  4GX5 A;  1VQ8 V;  3ZN1 A;  2WLK A;  3SYO A;  4RO2 A;  1EBO A;  1PL0 A;  1FXK B;  3K04 A;  1JQ0 A;  2ATK C;  2F43 G;  3VBB A;  1K33 A;  4ZKI A;  5LGT A;  1YJ9 V;  3QO7 A;  2XOK G;  1YI2 V;  3CD6 V;  3OW2 U;  2M7W A;  1YIJ V;  1YHQ V;  3E8G A;  3E89 A;  2XAS A;  1SZT A;  3SJQ C;  2HFE C;  1OCO C;  1AI7 A;  2A0L A;  2JDI G;  5DN6 G;  1QCE A;  3UKM A;  4MVM A;  1F4N A;  4PDV A;  4EKW A;  5B1N A;  2QKS A;  1ENV A;  3LUT B;  1UJW B;  3AG4 B;  3LSS A;  1GMG A;  5B1B B;  1SES A;  4F4L A;  3ASO C;  3ABK C;  5L3C A;  2OCC C;  4JAU A;  2ZR2 A;  3ABL B;  2C2A A;  3SPG A;  5CMU A;  2NNU A;  5IYD O;  1VQP V;  1S3J A;  4FK5 C;  3STL C;  5DM6 V;  3UM7 A;  1V54 C;  1FXH A;  2P67 A;  1VQL V;  4JF3 A;  3JD2 A;  2QTO A;  3I56 V;  3X2Q C;  4JTA B;  3CXC U;  4U7O A;  1NJI W;  3AG3 B;  1JVM A;  4JYC A;  2JK5 C;  3ZRW A;  3CPW U;  3LDD A;  3AG1 C;  2X7R B;  4P9O A;  5L3B A;  5L3F A;  1AJQ A;  4X88 A;  4MW8 A;  1OCZ B;  2WLI A;  2GSM B;  1KC8 W;  4N23 A;  4R7C A;  1VQ6 V;  2P6J A;  2HVJ C;  2WSS G;  3OUF A;  2GHY A;  5EC2 C;  1W0K G;  2IH1 C;  1OCC C;  4PDR A;  3OAA G;  5E1A C;  1S77 D;  3ZMT A;  3IFX A;  2DQ3 A;  3CME V;  4GCZ A;  5H9C A;  2HVK C;  3EHB B;  3FYE B;  5BZB A;  4PA9 A;  2DW4 A;  3CCU V;  1VQK V;  1K5Q A;  2LFR A;  3I55 V;  4FIP C;  3SYP A;  3CCS V;  3AG2 B;  2ZQM A;  1V55 B;  2BOC C;  3TCU A;  3G4S V;  3SYC A;  1PD3 A;  4J9Y B;  1RM1 C;  3OUS A;  1YJN V;  4MTG A;  3CCQ V;  5LGU A;  2DYS B;  2IH3 C;  3OMI B;  2ZD9 A;  1SET A;  5B1A C;  2ZDI C;  5C93 A;  4CBC A;  5LGN A;  3PJS K;  3JD3 A;  4KFM A;  3DGE A;  3SPI A;  3ZMZ A;  5KUK A;  1JX9 A;  2JEX A;  1AI4 A;  5FL7 G;  5HFL A;  3D36 A;  2IJK A;  3FKS G;  3JD1 A;  4GT1 A;  4PA6 A;  4UVA A;  4ASU G;  4LC1 A;  2DWE C;  2IU0 A;  3OEE G;  4X89 A;  1QLE C;  2DYR B;  4J9Z B;  1VQN V;  1QR9 A;  1K34 A;  5LHH A;  1OCR C;  5H6Q A;  3CCJ V;  2JEU A;  3SYA A;  3K0G A;  4RUE A;  4RQF A;  1K8A W;  3CCM V;  1Q82 W;  3K3W A;  1S72 V;  1DF4 A;  1YSC A;  3CCE V;  2IW5 A;  4TWK A;  5L3D A;  2A9H A;  2UXN A;  3FB5 C;  3JYC A;  4DO2 A;  3K79 A;  1NR7 A;  3QO8 A;  4WFA V;  1PNK A;  2HR3 A;  3ZRS A;  2WLL A;  3T4Z A;  1TUE B;  2IJJ A;  3B77 A;  2DQ0 A;  1S0V A;  1NH2 B;  1OCO B;  2R9R B;  4MTF A;  4L87 A;  2NLJ C;  4MVQ A;  1W0J G;  2B1G A;  1SER A;  1KKD A;  1BMF G;  1R3J C;  3CC4 V;  3E8H A;  4JAV A;  1Y4M A;  5EBW C;  1F51 A;  1OZ0 A;  3R65 A;  4QJF B;  4UVC A;  3K08 A;  3ABK B;  2OCC B;  4JYB A;  3CYO A;  1AI5 A;  1BHA A;  3SYQ A;  2MK3 A;  1Q81 W;  5CBH A;  3JD4 A;  3SPH A;  3OMN B;  1H8E G;  2A79 B;  2B5U A;  4I5S A;  5CN0 A;  1V54 B;  1QR8 A;  1I5Y A;  1ARO P;  4RAI A;  4BW5 A;  4BAY A;  4WFE A;  3X2Q B;  3H01 A;  2HKO A;  4E2L A;  4TT3 G;  3KG2 A;  4MTO A;  3AG1 B;  3FYI B;  1SRY A;  1QVF U;  2B1I A;  2DWD C;  1RPO A;  2W6J G;  2XAH A;  2W6I G;  3ABM C;  4PDM A;  1AI6 A;  5B3S C;  1E1R G;  1THZ A;  1QBZ A;  1OCC B;  5J9P C;  2Q69 A;  4WFB V;  3F5W C;  2LFS A;  1B6Q A;  1AR1 B;  2HJF C;  1FFT B;  3LSQ A;  3ZMV A;  3ZIA G;  1R6N A;  2QEX V;  5IYC O;  1EFR G;  3P30 A;  1BL8 A;  3T1C A;  2XND G;  2JJ1 G;  3M99 B;  3G71 V;  2WPD G;  2X6C A;  1FXK C;  2EIK C;  4QE7 A;  2EZP A;  3IC7 A;  1CP9 A;  3JCZ A;  5B1A B;  2R9I A;  4PA4 A;  4MVO A;  5EC1 C;  1JCH A;  3OFN G;  2WLL B;  4DXW A;  1JPX A;  4KUM A;  1NBM G;  4JPR A;  1GK9 A;  2P7T C;  4QPK A;  2CK3 G;  1JOY A;  1GM9 A;  3RW0 A;  3ZRX A;  2P90 A;  1E1Q G;  4XBF A;  3K03 A;  1GM7 A;  3STZ C;  5LBQ A;  1R3I C;  2K1E A;  2QM8 A;  1MG1 A;  1Y66 A;  3ML0 A;  1NVP B;  2OTJ V;  2QA4 V;  4PDL A;  1OCR B;  4BIZ A;  5IYB O;  1PKX A;  4LBE C;  2EIN C;  2Y48 A;  1ROP A;  3ABL C;  2ZXW C;  3E8B A;  3AEI A;  3E2E A;  2WLM A;  1R6K A;  2WLJ A;  3ZJZ A;  4HAM A;  4YXW G;  3CCL V;  3E83 A;  4ZBM A;  3WG7 C;  1YTF D;  2W0F C;  3QO5 A;  5IY5 B;  3CCV V;  1HWY A;  1KP2 A;  1H8H G;  1M57 B;  4WCE V;  4MT8 A;  2OT5 A;  2EIJ C;  3RVZ A;  1WPX A;  2WLH A;  3BY6 A;  4MVR A;  4RQE A;  2IJI A;  5EBL C;  2PI5 A;  4PA7 A;  2EIM C;  1NH2 D;  4N21 A;  5HFM A;  3EFF K;  1GM8 A;  1GO3 F;  2Y69 C;  2AHY A;  1MOF A;  1MSW D;  4GX2 A;  1VQO V;  1K3E A;  3W7T A;  1G4Y B;  1I5X A;  1MAB G;  1COW G;  4MVZ A;  2Z5U A;  5KA5 A;  3W7W A;  3SPJ A;  1QLN A;  3TET A;  1N8R W;  4UV9 A;  2H94 A;  1VQ5 V;  2ZDI A;  4QNH B;  4MS2 A;  1FS0 G;  5LHG A;  1K5S A;  1RPR A;  4I9W A;  1IXM A;  1K4C C;  4JAS A;  2PI4 A;  2WWW A;  4H33 A;  4JGS A;  4WFF A;  4XDK A;  4HZ3 A;  2ITD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...