5FL7G

Structure of the f1c10 complex from yarrowia lipolytica atp synthase
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
270
structure length
267
Chain Sequence
TLREIEMRLKSIKNIEKITNTMKIVASTKLGKAQRAMATSKVYNEASEKVFENSETAVPENIEKRLWVVVSSDKGLCGSIHSQLARTVRRKLLDGEKLIDIVAVGEKIKAQLGRSNPEQMRLSFGGTGKEAPTFEEAAHIADEILALDTQYDDIEIVYNKVLSGISFEPIMKESYSAKAIEDAPKFGQYELEDDVVKNLADFSLANTIYAAMAEGHAAEISARRNAMDNASKNASDMINKYSILYNRTRQAVITNELVDIITGASSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Complete ATP Synthase Dimer Reveals the Molecular Basis of Inner Mitochondrial Membrane Morphology.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ATP SYNTHASE SUBUNIT ALPHA
total genus 63
structure length 267
sequence length 270
ec nomenclature
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00231 ATP-synt ATP synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5fl7G01
3.40.1380.10 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate Kinase; Chain: A, domain 1 5fl7G02
4BAYA 4Z1MG 3ABTA 2XAJA 1H8EG 5LHIA 2V7QG 1E1QG 5L3DA 1W0KG 2JIZG 3ZMTA 4CZZA 2XAFA 2W6JG 3ZMUA 1MABG 5H6RA 5LGUA 2UXXA 3ABUA 3OFNG 1E1RG 5H6QA 2JJ1G 4TT3G 3ZN0A 2Y48A 2Z5UA 3OAAG 1BMFG 2WSSG 1COWG 2HKOA 5L3EA 4UV9A 4UXNA 1NBMG 2XNDG 3FKSG 4XBFA 2W6IG 5LGNA 3OE7G 3ZN1A 2XASA 2V1DA 5LHHA 5L3BA 2X0LA 1W0JG 2XAQA 4ASUG 2XOKG 3OEHG 3ZMZA 5LGTA 4UVAA 2JJ2G 5DN6G 5LHGA 2R9IA 1OHHG 2UXNA 4YXWG 2WPDG 4UVBA 4KUMA 5L3GA 4TSFG 2QE7G 2H94A 2DW4A 2IW5A 5LBQA 1FS0G 5FL7G 4UVCA 1E79G 3ZIAG 1H8HG 2HLDG 2CK3G 5L3CA 2EJRA 3ZMSA 3OEEG 2F43G 2Z3YA 4UV8A 2XAHA 5L3FA 1EFRG 2XAGA 2JDIG 3ZMVA
chains in the Genus database with same CATH superfamily
4UCVA 4WBNA 4CC5A 4X1KA 4YIOA 2ADQB 2P06A 3SPJA 5C8YB 4RWUA 3CB2A 1VQ9V 1V9PA 2B9ZA 1H2NA 1A3WA 4JV5O 3ABUA 4B2DA 1P7GA 3SRDA 3D3QA 4WFHA 3AAGA 2E5LO 5LL6Y 3APOA 5LOVB 1F3WA 2ZINA 2CH7A 1IBKB 1EN4A 2IJKA 4NR1A 4DR2O 4DR4O 1WA8B 2OIEA 1YI2V 4LF8B 2GBOA 1Y4MA 3WU2Z 4ZOLA 4GKJB 1KB9F 4KHPO 4K8XA 4ZHQA 2IJIA 4ZI7B 1EZJA 5LP6A 2DJVA 5L3BA 1HNZB 3ZS8C 1OCCC 1WP8A 2KKWA 2R9AA 4X64B 5LXTB 1HW7A 4QNHB 3RYIA 2ZXWB 4JV5B 3SR2C 3SPGA 3APQA 2CUGA 2ZT9B 3D3IA 3CP1A 3IAYA 1FXVA 3VQYA 3OMNB 1BHBA 1HNXB 3LUTB 3CC4V 4YXWG 4JTCB 4TUYA 3RYHB 2LFRA 3B09A 2EIMB 3AK2A 3ZRSA 1VF6A 2GDSA 1OCRB 5CMUA 4PI0A 1ZSPA 4MVOA 4X1KB 4JI0O 1FS0G 1TAEA 4DR5O 4WF9V 4IIJB 4KCVA 4LF6B 3ZMSA 4JI0B 1EN6A 3T1YB 5KHKA 4LF6O 4GUNA 3FB8C 4RPPA 2OT5A 2CGOA 5B1AC 3F7YC 4W4LA 1ZWIC 1H2MA 2VGBA 3FX7A 4CS2A 1XMOB 3ASNB 4DV5B 1GMGA 4GCZA 2GSMB 4FLXA 3JATB 2Q5ZA 2CTRA 3ABLC 1P7BA 4UUJC 1Y76B 3ABKB 2YIDA 4O4HB 1COWG 2Y0IA 3E86A 4FVMA 1YJNV 2A0LA 3E35A 3N2KA 4X1YA 1VP7A 3UT5B 2NNUA 1AVMA 2KG7B 1VQPV 2YICA 2V1DA 3R66A 3QTGA 1R3JC 1H38A 1RM1C 2YXYA 5KHJA 3J7AU 5CN0A 4ZIBA 4EEQA 4MSWC 1IBMB 1JA8A 4R6ZA 4CH3A 2VGGA 2EIKC 1K4DC 2IU3A 1A49A 4B3TO 3WB1A 2FMLA 2E74B 2QA4V 2W0XA 3TCUA 1FXHA 4LH6A 2FYUH 5KUMA 2YXHA 2E5LB 2JGDB 2JS5A 1UJWB 3ML0A 3F5WC 5LYJB 1YITV 1AI4A 5AG2A 2ILMA 4DYLA 1BHAA 5BZBA 4A5UB 2XAHA 1J5EB 4O4IB 4LNUB 3IS4A 1SQQH 3ZMVA 4GKJO 4BWAA 5B1BC 3FYEB 3SJQC 1RM1B 4YHHO 4HBNA 4RQEA 2UXDB 1I5YA 2OCHA 1PP9H 4U3JA 1YCIA 4CZZA 2JGUA 5GW7A 1QQCA 5LP6C 1L0LH 3SPIA 3AG2C 5E1AC 1J95A 2CTQA 4GZRB 4DV3B 3HKBB 4ICGA 4LNUA 2MK3A 4MTOA 1X4TA 4UB8Z 5LMUB 1TVKB 2RJZA 4TQDA 1Q43A 3GWOA 5CB4B 4MVRA 3G67A 5GONB 1A5UA 1JOYA 1MA1A 2WLJA 5LMUO 1AR1B 1AJNA 4KP4A 2K1EA 1NBMG 1IDSA 2DYRB 1XUQA 3GB7C 4UB6Z 5BMVB 3ASNC 1I5XA 3E0WA 3B8MA 2XASA 3UM7A 5JQGB 2RMKB 1N32O 1XL4A 4H13B 4LR3A 2AZ2A 1Q90D 2K9PA 3RT3C 4JZ2A 4IHJA 3CRMA 4FM2A 1XHZA 4JTAB 2Q7GA 4EB6A 3CCSV 1YVWA 1URFA 3LNMB 4DV0B 4Z1VA 1H2SB 3ABMB 5KA6A 3A0HZ 3G6BA 1DLBA 1OHHG 1SA0A 3CXHF 3PJSK 3JSNA 4MVSA 3AG4C 3JAKB 3K9SA 4O4IA 2RCVA 1GN2A 1ORQC 4TV9A 3WFVA 2QKSA 4YJ2A 3EVKA 4J10A 4QE7A 3G6EV 2N05A 2Q6AA 1H8HG 3DGEA 1N36B 1NR1A 2W0FC 1GN3A 2A9HA 4O2AA 1XILA 4JAUA 4N21A 2WLLB 5D5QA 2ITCC 2LP7A 2LGWA 1M1KW 5FPRA 5DM6V 2QWOB 1QVFU 2PF4E 4J42A 3OR6C 5LHIA 2Q0AA 1D5AA 1NH2D 2JIZG 3AG4B 4NYKA 5IDJA 1N34B 2Y69B 2OYQA 5ITZB 3I56V 1VQ4V 4JF3A 1MZEA 4DW0A 1R3IC 3KCXA 5E79Z 1SERA 5JVDB 3SGIA 2WLMA 1CXZB 4DR2B 4X20B 5EYPA 4X65O 5CBGA 4IIJA 3ZRXA 1OCOC 1Q3EA 3BPZA 4JTDB 4DV7O 4JI5B 3TETA 4BIUA 4U3FH 5A9GA 4WFGA 2P4KA 1U97A 3SYPA 5J2TB 3IJ4A 4PA3A 2PY5A 4UXNA 3LDDA 2DYRC 3SYOA 2Y4TA 4JYYA 3M8AA 2W6IG 1SA0B 1QLEC 4FZ1A 3HQPA 1EBOA 4IYIA 3HKCB 2V4DA 2YEVB 5B1BB 3ZMZA 1JFFA 1QBZA 3STZC 4LF7B 3ASOB 4JI1B 2E28A 2OTJV 5LP6B 3OTOO 1NJIW 3ICXA 2AHYA 3A8TA 3LDEA 2XHBA 4JI4O 4X62B 1W2BU 2EBOA 3UT5A 3D8CA 5LBQA 4LF4O 2GV9A 1U96A 2EINB 1N32B 2HLDG 4BW9A 5FLXN 3GG8A 3TXSA 3K5NA 3E83A 2G50A 3RYHA 2YS8A 1KQSU 3A2FA 5EYPB 3F5TA 1P4RA 1NVPB 4G28B 1KECA 3AG3C 2XAJA 3CCQV 1DTOA 2EJ7A 5L3DA 3RYCB 4X66B 2UUCB 2HP8A 1M5IA 4H44B 5H6RA 3H9VA 4QPKA 1WB8A 4IMAA 2LW1A 4MVZA 5BR8B 4CBCA 1MSWD 1NI8A 1FJGO 3QV7A 5B3SB 4YJ5A 5EBWC 3BAAA 3R65A 1L0NH 3GWKC 3NXSA 1NT2B 4X89A 2QSAA 1GM9A 2QM7A 4DK0A 3CPWU 2BE3A 1G4YB 4NTXA 1XNQO 4WCEV 2XUMA 1Q6UA 3E8FA 5B1AB 1J5EO 1GN4A 1RP3B 1XMOO 3N27A 3OEHG 1M56B 1JR9A 2OCCC 4YY3B 4UVAA 2BTQB 2UXDO 5DN6G 4WFAV 2AHZA 3T07A 4P2ZA 1WN7A 4QGPA 2EIJC 2UUAB 1WA8A 2JVDA 4B3RO 4GX1A 1VEWA 3SYQA 4AILC 1CEZA 5KMGA 3HKEB 1OCZC 4HNAA 1SESA 2EZPA 3FD9A 1XHXA 5LOVA 4B3SB 1UFIA 3ZBHA 2EIMC 4I4TA 2IJHA 4NXNB 3E89A 1G8MA 5IJ9A 1TA8A 2VWKA 2HFEC 4OXSA 2Z3YA 4UV8A 2QTOA 2Z0AA 3S3XA 2JDIG 2OCCB 1K33A 4EB6B 1AI6A 2E75B 2ZXWC 4Z1MG 2B1GA 1WAZA 3Q4HA 4J7ZA 3T1CA 3K59A 3BA8A 1F23A 4PA7A 2CTPA 1SC5B 4G27B 1MABG 1XI1A 4DV1O 3EFFK 3JD4A 3CXCU 1I94B 1F4NA 2A3QA 1NH2B 4NTWA 4DR4B 2GUZA 4DV5O 1Q6HA 3UKMA 2E76B 4NKGB 3T4DA 4FLUA 1VQKV 1A3XA 2VGIA 5FNVB 1SZTA 3VQXA 4X1IB 1YJWV 3FAVA 1ZL8B 1YHQV 3CCLV 3PN1A 3K58A 1FKAO 3HKBA 3EOEA 1Y74A 3M7MX 3K5OA 5EIBC 4P30A 2JRIA 1T5EA 3CRQA 3T05A 4O4LA 2JEUA 1K9MW 1YDXA 2L35A 2QJ1A 2YI8A 2XAQA 3TJTA 4JPRA 2XOKG 4KL1A 1HNXO 3E22B 3K08A 3OUSA 3O65A 2GHYA 3ZRWB 1R3KC 2EINC 3QO5A 1Q7YW 4ZOLB 2DMXA 5KUKA 4JI8O 3E8GA 5IYCO 3JASB 3SJAC 2ZIMA 5J2UA 4GKKB 3ABMC 1WPXA 4UCRA 3PP7A 4R7CA 4FLVA 1IXBA 4NXMO 2ZIOA 1FFXB 2AW9A 2KG7A 1FYJA 1E0UA 5CA0A 1N33B 3ABTA 4DV6O 4KCUA 1W0KG 4R8CA 1VIBA 4X1IA 3JARB 1BE3H 2B1IA 4O4HA 1AJPA 3W7UA 3K57A 3B40A 4F6EA 1NKDA 4FXFA 3OFNG 4B3SO 3GQYA 3CSXA 3L71H 1PKXA 3ZX6A 1S5HC 4JI6O 4EKWA 4LF5O 4NXNO 4ABMA 3JALB 1RPRA 4RQFA 2QTSA 4JYBA 3RYCA 4YJ3B 4JI2B 3ETQA 1KMIZ 3U11A 4TV8B 3B77A 1IVSA 3D36C 3CMAV 5D5PA 3CJHB 4JI2O 2WLHA 4FXJA 1JCHA 4RUFA 4QG8A 4GT1A 1YTFB 4JI1O 1Z5VA 4KFMA 4DO2A 2P7TC 4QGCA 2F4VO 4LH7A 5B1OA 5IWAB 1P84F 2RQ6A 3W7XA 3DSQA 1KP2A 1Y76A 1HR0B 2WLIA 2QWQB 3W7SA 4LF7O 1PPJH 4O4JA 1R6KA 5CB4A 2DQ0A 2EX3A 4DV1B 2BCCH 3N2KB 5EZYA 2L6LA 2QR4A 3KZIZ 3N2GA 2PTMA 5DECA 2BOCC 3C3SA 1GM7A 3FFQA 4K0KO 2JS3A 2Q67A 1EM1A 5IYZB 3ZHSA 4TQFA 1K5SA 3RGBA 4BAYA 4CC6A 1N34O 4E2LA 4F6RA 3SYAA 2P4VA 2XAFA 2ZE6A 2EIJB 4DRXB 1Z2GA 1XL6A 4TV9B 4B3MO 1JJOA 3O9OA 4DV4O 1H2GA 2Q7HA 2LGQA 3CE2A 3JATA 2ZNIA 2Q0OC 3CCRV 1TUEB 4IYHA 1O9GA 1XQ8A 5H5NA 4QG6A 3FYIB 1S72V 1XNRO 2CE4A 4LWSB 1KKCA 3UO3A 3K5LA 3OTOB 2XTAA 1E0TA 4DV3O 3MHHC 2CGNA 3JAWB 5LA6A 2YIAA 4JGSA 4XDLA 2VQFB 3AG2B 2OTLV 1SQVH 1ZUQA 4G1NA 5B3SC 3RYIB 2ARHA 5EZYB 1TUBB 2QKCA 4JYAO 2WAMA 1R1BA 4LP8A 4IP7A 2ZR3A 5KLVH 3S3WA 1O9HA 1S3JA 4XDKA 1SQFA 1V54C 4DV7B 3HKDA 4CH4A 1PKNA 2UXCO 3SRKA 4PDMA 3E8BA 1Q6IA 2PI4A 1HWYA 4LC1A 4I50A 5IYZA 3SPHA 1K73W 3MHSC 1NS1A 4TSFG 4JI3O 4DR1B 2RNBA 1VF6C 5KHHA 4GKKO 4TWKA 4P9OA 4LCUC 3DXRB 4FPPA 2A06H 4QJFB 4B2DD 5JJEB 1Z5WA 3JCUZ 2IH1C 5HFMA 4J7JA 5KMGB 1ROPA 2ETNA 2XAGA 4U7OA 2AXTZ 1BS3A 3AG1B 3CD6V 1AP6A 3LDCA 2IH3C 5KHGA 1XREA 5KAIZ 3DXRA 1AR4A 4U3JB 1Y6XA 2QM8A 4D7SA 4YHHB 2F95B 3CCUV 3JAWA 3ZMUA 2D2CB 4PI2A 2RN9A 3DC6A 1GO3F 1B6QA 2M6YA 2P5OA 4JI8B 4B3MB 3ETEA 3Q4HB 5J2UB 2P22C 4JYCA 4ZI7A 2A79B 1NTMH 3ABKC 2R72A 3U0ZA 5IJ0A 5EIBD 1LUVA 2ZM6O 4ZKIA 5GONA 3ABLB 4UFZA 1T57A 3MD0A 1YZBA 2Q68A 3OE7G 3ZN1A 1DF5A 1WPBA 1A32A 3VOUA 4JAVA 1W0JG 4YY3O 3ZHQA 3AG3B 4LFCB 4ASUG 1JJ2U 4RO2A 4WFBV 3A0BZ 3B4SA 4DR7B 1FAFA 2JJ2G 4LFAO 4I55A 1HNWB 3U2ZA 1MZFA 4LF5B 1KU9A 1ZX3A 4PDLA 1FD9A 2Y69C 4KS0A 2HEPA 3ZCCA 1KBHA 1K34A 2LW7A 1SF9A 4ZBMA 2JGDA 4UVCA 4JI7B 2UU9B 1R3LC 3JD2A 4DW1A 2PZSA 4LF4B 2F43G 1VMGA 1XEQA 2F93B 3LSUA 5CA1A 1RSOB 3KTXA 1WJZA 4GLXA 1SETA 4B7KA 3G2GA 1WLEA 3L72H 1BCCH 1PL0A 2ZDIC 3IGAC 1H8EG 2X6CA 4AQYB 1F51A 1HNWO 1VQ8V 1TGOA 4B7EA 2N04A 3JAMN 4DUYB 3AK1A 3EXAA 4FFKA 2HVKC 2DOSA 1T5AA 1BQZA 1FFXA 1XDCA 2FB5A 1S0VA 4O2BB 4B08A 4XDJA 4HAMA 1GM8A 1SQPH 2WSSG 3K04A 1M93A 5L3EA 4K3AA 3C90A 4IL6Z 1GK9A 3WB0A 2M7WA 2EILC 1OJHA 1PV0A 4X9QA 2UUBO 3K79A 1MNGA 2WLNA 4AHCA 2RDCA 4H37A 1IX9A 4NB5A 5CBHA 1X59A 3T1YO 3MAQA 3RVYA 3FB6C 2ZNJA 2WA4A 4HNAB 2GTSA 2P6JA 2QKAA 2ZQMA 1DGSA 5LHGA 1SZXA 5JJJB 2WA3A 4DV6B 2NN4A 1QHTA 1THZA 1VQMV 2UXBO 1VF7A 3F7VC 2BSKB 4GX5A 5K1XA 2ZM6B 1XMQB 1RSOA 1NQTA 3G4SV 2ADPA 1VQ7V 4O2AB 2NLJC 3H1LH 3CC7V 3SRFA 1SKVA 3IC9A 5DEDA 5FL7G 5IYDO 2QEXV 2ITDC 4FLTA 3K03A 5JWPA 3BJTA 5L3CA 4NXMB 4FFBA 4MTFA 4HYVA 1I08A 3OTFA 2VRZA 1JQ0A 1L1FA 3VQVA 4HZ3A 1EFRG 2MW2B 2P67A 1AR5A 3THOA 3N2GB 3RW0A 1VQLV 4D7TA 5EBMC 1FPOA 5LYJA 5C8YA 1PL4A 2X6AA 3OGCC 2CTWA 3A0RA 4FLWA 3BHPA 4IHJB 3N25A 5FNVA 4B3TB 2UXXA 1BQ0A 2LO1A 4FM0A 3SJCC 2X7RB 4X20A 1CPYA 4U7NA 5BR8O 3K5MA 5IE9A 1IBMO 3ZRWA 1I94O 4JPGA 2VQFO 4LFBB 3VBBA 4KCWA 1PD3A 1Y66A 1N0JA 4Q6GA 2F66C 2DWEC 3WG7C 2YDEA 3H1HH 1F7YA 3JASA 4JI4B 5KAFZ 4LBEC 4L8JA 4PA4A 3MA8A 1M57C 4G2KA 3CRCA 3BY6A 4RUEA 4JYAB 5C93A 2WLLA 4LWSA 4MW3A 3ZJZA 4FK5C 2YEVA 3BRCA 5LA6B 1WP7A 3CWBH 1OZ0A 2ZD9A 5IY5C 4FJCC 4YIPA 3LNNA 5J9PC 4YJ2B 4LF9O 5KHIA 4WBNB 5CA3A 4AI8A 3M99B 1VQ6V 2HR3A 1NU1H 4LFAB 3JD1A 4FIPC 1ZL8A 4UVBA 1FXKB 2JEXA 1JVMA 1TUBA 4KCTA 2QWRB 2DW4A 3CMEV 2IW5A 2VGFA 3SPCA 2Y0PA 1FFTB 3ETGA 1VQNV 4PV1B 3QV6A 4UCUA 4GYCB 3STLC 1R6TA 2EJRA 4OPAA 4LF8O 4OX9B 4JI3B 1KKDA 1KD1W 1M90W 1IURA 4I50B 3OGIB 2G38A 1VQ5V 1FXKA 4I55B 1P49A 4PDRA 5JVDA 2ZE8A 2YC0A 4KXRA 3IFXA 4J7KA 4DV2O 4KRZA 2YUAA 3HPLC 2YIBA 2Q4PA 4J11A 1KUQA 4JI6B 5JH7B 1FJGB 5CA1B 5BY1A 3HB3B 4BIOA 2Y48A 3OT7A 4L87A 4LF9B 3JCZA 3CC2V 1S5JA 4FMTA 1M9NA 1LR1A 4CS4A 2F23A 2DE0X 3RN4A 2XNDG 1JFFB 1PNKA 2ZKOA 3X2QB 4WFFA 4QPJA 3WG7B 2HG5C 2F4VB 3QVNA 5B66Z 1NR7A 4P9PA 1F4MA 2WLIB 3J80N 4O4LB 4EFEA 3HKDB 4ZHQB 2AGAA 2D3OW 1W59A 4RAIA 4PA6A 1GTOA 4MTGA 3TXQA 4X62O 4PA9A 4X65B 3EHBB 3CHXA 4PD4F 3HKCA 4FLYA 4DR6B 1F3XA 1ENVA 1N0NA 1PKYA 3RYFB 4JI5O 3OMAB 4BW5A 4TV8A 1BGYH 3H1KH 3VQWA 2H94A 2PUSA 1N8RW 4K0KB 4I4TB 3G71V 5KX5A 5B1NA 1AB3A 3ZIAG 4QIWF 1PKMA 2CK3G 1SS3A 1CP9A 3OEEG 3L9DA 4X66O 4DR3B 2UUCO 3ASOC 2EZOA 3RFRA 4X1YB 1B3QA 1VARA 2Y4UA 3B2EE 4K8ZA 2BSKA 3T4ZA 2H3OA 2PYJA 3KKYA 5ITZA 4X8AA 2YIBD 1AROP 5LGUA 5LXTA 5KA5A 1VQOV 4Z2WA 3K06A 3ZHTA 3BCCH 1US6A 4JZGA 2X6BA 1AI7A 1E1RG 2BTOA 3UQ8A 3QV9A 3OAAG 3CCEV 3I5DA 3KG2A 1GH6A 4PJ0Z 5EC2C 3ZHVA 4FZ0A 3I55V 3DC5A 4QE9A 2HJFC 3SJBC 3GR4A 2Q69A 3BVOA 1S77D 1QLEB 1JPXA 2LJ2A 4JASA 3BFRA 3CEIA 2CH7B 3FKSG 5BMVA 1YXBA 2YI9A 1OV9A 1Q5OA 1YSCA 2ZE7A 3OMIB 2UUBB 2HVJC 1PKLA 4NVPA 2YXLA 1NTKH 1XBLA 3BA9A 2CAZC 1I0HA 3BABA 2VQEB 4IT5A 3L73H 1QNMA 5EK0A 5LGTA 4I0XA 1Q8IA 1AJQA 3LSQA 1N33O 4HYOA 1M4UA 4N23A 4F4LA 4UCOA 1RFYA 4I9WA 5IJ0B 5H2FZ 1MMMA 3ZHUA 4KHPB 4DV0O 5JCOA 1XMQO 2QE7G 1NTZH 2PI5A 4GX0A 4CH6A 1Q86W 3L70H 3W7WA 1QR8A 3CYOA 4DR5B 3TGUH 2JK5C 4LFCO 2Q8VA 1EZVH 4HYWA 2OWOA 4WFEA 3RVZA 2IBZH 5CA0B 1H2LA 2WLKA 5LMNO 1G6UA 1OCZB 1HR0O 4TOIA 2IU0A 2GTAA 4MW8A 2HJDA 1BZKA 5IT9N 3K0DA 2W6JG 2OIGA 3E22A 3CRRA 4MVUA 4YJ3A 1SQXH 4JAAA 1PM9A 3QF7A 1AP5A 4DUZB 1Q82W 4DV2B 1AI5A 3OD4A 1LNQA 4I5SA 5H6QA 3AK3A 3CCMV 2Z5UA 1K8AW 3T1HO 1IXMA 1EN5A 1Y74B 1S76D 4D6TH 1KYOF 2DYSB 2VWJA 2UXBB 3OUFA 3E0VA 3K3WA 2DWDC 2A7WA 4UCSA 4J9ZB 5CBFA 5IYBO 4B3RB 3QO8A 1BSMA 1NZ6A 4MTXA 4J41A 4FM1A 1QCEA 1JX9A 4UCTA 3QTCA 1K92A 2KQXA 3ZEDA 3OM3B 3FAVB 1V55B 1BL8A 2H8PC 2F1MA 5EBLC 1ZTEA 1ZLZA 4R50A 1XNQB 2KB1A 4IGGA 5F2VO 1D5NA 2IM9A 4NTYA 3W7TA 4DUZO 1HNZO 4O2BA 1UPGA 2IJJA 1AILA 5JQGA 2R9IA 1BT8A 5TISZ 3T1HB 2GUZB 1K4CC 4C7UA 1QU7A 1LUWA 1G1XB 4DR1O 1R6NA 2R70A 1SQBH 1IBLO 1K7DA 1GKFA 2FL4A 3JD0A 2BTQA 3HKEA 3J81N 1N4CA 2QGNA 1KC8W 3SDLA 5JJNB 3E2EA 1FXKC 3OW2U 1WB7A 2N74A 3P3NA 4W4KA 4DR6O 1MG1A 1YF2A 3FB7C 4H0LB 3P32A 1TVKA 5B5EZ 1L8DA 5GTIZ 5GTHZ 2XT9A 1HP8A 2DQ3A 1QVGU 1GAXA 5IY5B 3B8NA 1OCRC 3IC7A 1MSDA 4QG9A 2ZR2A 2V7QG 2HHHB 1E1QG 2Q7EA 3ZMTA 5KX5B 5LMNB 4H33A 1DK1A 3U10A 2EIKB 2DN9A 1V54B 3X2QC 3ME3A 1IBKO 3E8HA 1IBLB 3CCJV 1I7FA 5JCOC 4X88A 3JYCA 2JJ1G 4TT3G 3ZN0A 1JMKC 4I7ZB 1BMFG 2CDYA 1B04A 3QV8A 3UO2A 2E3CA 3JARA 4E4EA 1K3EA 2Q9LA 2HKOA 2QWPB 2YSUB 2UUAO 1SQGA 1YJ9V 1QLNA 3P3PA 3JSLA 3HQOA 4UV9A 1M57B 3K0GA 3LSSA 1B06A 3T2MA 3JALA 4BIZA 4CS3A 4XBFA 1KP3A 3QG5A 4WJ8A 4TUYB 3T0TA 4EFBA 2AZ0A 2X0LA 2DYSC 4O4JB 1OCOB 2QWNB 2VS0A 3AG1C 2BOBC 3D36A 1PNLA 2R9RB 4F6RB 1YIJV 3CJHA 3KHDA 4AQYO 4DRSA 5A2QN 4DR7O 2UXNA 4DXWA 4Q20A 2LFSA 3L75H 2LQTA 1AQFA 3WB2A 2WPDG 1VP8A 3TK1A 5IWAO 2UU9O 3ETDA 3CRAA 1DF4A 3CCVV 1ZAUA 1WNSA 1E79G 4OPHA 3JD3A 3JAKA 3L74H 1QR9A 1S5LZ 4K35A 2ZDIA 3RYFA 5J2TA 1M56C 4OGQB 4I0XB 5JH7A 1PNMA 4DR3O 2ZE5A 4MS2A 2ATKC 4I9QA 2ZCEA 4MT8A 1D2DA 2NR5A 1SRYA 1K5QA 2QDOA 3CS5A 4FLZA 3BEHA 2FKXA 1R73A 3RBZA 2KSDA 2EILB 2QM4A 1K97A 5BXZA 1YTFD 1RPOA 2FTKA 3C3TA 2PGGA 4CH5A 1V55C 3H1IH 3QNEA 1OCCB 4FFBB 4GX2A 5H9CA 2PYLA 1NVPD 1HDJA 3SRHA 1GN6A 2Q73A 3DTUB 1ZJHA 4BR6A 2O57A 5LGNA 1N36O 2P90A 4X64O 3AEIA 3HR0A 5IJ9B 5LHHA 4OX9O 4DUYO 3SYCA 3KCYA 1XOUA 4DRXA 2UXCB 1IZ3A 1Y67A 4PHZA 3BJFA 3CX5F 4PDVA 1VF5B 3ZHRA 3ZRVA 2VQEO 1XNRB 3MDSA 4LFBO 2WWWA 3GVMA 1H2KA 3K9AA 3H01A 3H6OA 4DK1A 4MVQA 2C2AA 4KUMA 1GRJA 4JI7O 5L3GA 1MOFA 3FB5C 4DV4B 4YNGA 2EULA 5FPOA 3HQNA 5HFLA 1YEWA 3RWRD 3AG7A 3UCSC 4J80A 2B5UA 3H1JH 4MVMA 3OR7C 3NR7A 3P30A 5L3FA 4PELA 5EC1C 5K1PA 1Q81W 3G80A 2HHHO 4J9YB 2ODMA 3QO7A
chains in the Genus database with same CATH topology
4G28B 1KECA 3AG1B 3CD6V 3AG3C 2XAJA 3CCQV 1DTOA 3LDCA 5L3DA 2IH3C 3SPJA 3T4ZA 2QM8A 3CCUV 1VQ9V 4X8AA 3ZMUA 1AROP 5H6RA 4QPKA 5LGUA 5KA5A 1GO3F 3ABUA 4MVZA 1VQOV 1B6QA 3K06A 4CBCA 1MSWD 2X6BA 1AI7A 1E1RG 4WFHA 3AAGA 3OAAG 3CCEV 3ETEA 3KG2A 5EC2C 5B3SB 4JYCA 3I55V 4QE9A 2A79B 3ABKC 2EZOA 2HJFC 5EBWC 2IJKA 3R65A 2Q69A 3NXSA 4ZKIA 1S77D 1YI2V 3ABLB 1QLEB 1Y4MA 1JPXA 4X89A 4JASA 3MD0A 1GM9A 2IJIA 2QM7A 3FKSG 3CPWU 1EZJA 1G4YB 2Q68A 3OE7G 3ZN1A 1YSCA 1DF5A 3OMIB 2HVJC 4WCEV 5L3BA 3VOUA 1OCCC 4JAVA 1W0JG 3E8FA 5B1AB 3AG3B 4QNHB 4ASUG 1JJ2U 4RO2A 4WFBV 2ZXWB 3OEHG 1M56B 2OCCC 5EK0A 5LGTA 4UVAA 2JJ2G 5DN6G 3SPGA 1AJQA 4WFAV 3LSQA 4HYOA 3D3IA 2AHZA 3CP1A 4P2ZA 4PDLA 1FXVA 4N23A 4F4LA 3OMNB 1BHBA 2EIJC 4I9WA 3LUTB 3CC4V 2Y69C 4YXWG 4JTCB 4GX1A 3SYQA 3ZCCA 2LFRA 1CEZA 2EIMB 1K34A 1OCZC 3ZRSA 1SESA 1OCRB 2EZPA 5CMUA 4ZBMA 2QE7G 4MVOA 1FS0G 2PI5A 2EIMC 4UVCA 4GX0A 1Q86W 4WF9V 2IJHA 3W7WA 3E89A 1QR8A 1G8MA 3CYOA 1R3LC 3JD2A 3ZMSA 2JK5C 2HFEC 2F43G 2Z3YA 4OXSA 4UV8A 2QTOA 4WFEA 1SETA 2JDIG 2OCCB 1K33A 3RVZA 2ZXWC 1AI6A 2WLKA 2B1GA 1WLEA 4Z1MG 3FB8C 1PL0A 2ZDIC 3IGAC 1H8EG 2X6CA 2OT5A 1OCZB 1F51A 5B1AC 3T1CA 1VQ8V 2IU0A 1F23A 4MW8A 3F7YC 1ZWIC 4PA7A 3K0DA 2W6JG 4G27B 1MABG 3ASNB 3EFFK 3JD4A 3CXCU 1F4NA 4MVUA 2HVKC 1GMGA 4GCZA 2GSMB 1NH2B 1Q82W 1AI5A 1LNQA 4I5SA 5H6QA 3CCMV 2Z5UA 1K8AW 1S0VA 3ABLC 1IXMA 1P7BA 4UUJC 4XDJA 4HAMA 1GM8A 3UKMA 1S76D 2DYSB 3T4DA 3ABKB 2WSSG 1COWG 3K3WA 3OUFA 1VQKV 2DWDC 3K04A 3E86A 1SZTA 5L3EA 4J9ZB 5CBFA 5IYBO 1YJNV 1YJWV 3QO8A 2A0LA 3E35A 1GK9A 4MTXA 1YHQV 2M7WA 2EILC 3CCLV 3K79A 2WLNA 2NNUA 1QCEA 4H37A 1JX9A 1K92A 4P30A 1VQPV 5CBHA 2V1DA 3OM3B 1R3JC 2JEUA 1K9MW 1V55B 1BL8A 2H8PC 5EBLC 4R50A 2XAQA 1RM1C 1H38A 2KB1A 3RVYA 3FB6C 4JPRA 2XOKG 5CN0A 3W7TA 3K08A 4MSWC 2P6JA 3OUSA 2ZQMA 2IJJA 5LHGA 2R9IA 1K4CC 4R6ZA 2GHYA 1THZA 1VQMV 2EIKC 3F7VC 1K4DC 1R6NA 4GX5A 2IU3A 3ZRWB 1R3KC 2EINC 3QO5A 3G4SV 1NQTA 1K7DA 1Q7YW 1GKFA 1VQ7V 3JD0A 2QA4V 1KC8W 5KUKA 3TCUA 1FXHA 2NLJC 3E2EA 1FXKC 3OW2U 3E8GA 3CC7V 5IYCO 5KUMA 1MG1A 5FL7G 5IYDO 2QEXV 3FB7C 2ITDC 1UJWB 3P32A 3K03A 3ML0A 3F5WC 5L3CA 1YITV 1AI4A 3ABMC 1BHAA 4MTFA 5BZBA 1WPXA 1JQ0A 1L1FA 2XAHA 2DQ3A 1QVGU 4HZ3A 1EFRG 4R7CA 5IY5B 2P67A 3ZMVA 5B1BC 3B8NA 3FYEB 3SJQC 3ABTA 1RM1B 4RQEA 1OCRC 3IC7A 1I5YA 2ZR2A 3RW0A 1VQLV 2V7QG 1E1QG 5EBMC 1W0KG 3ZMTA 4R8CA 4H33A 4CZZA 2X6AA 3OGCC 2B1IA 3A0RA 5GW7A 2EIKB 1AJPA 3W7UA 1V54B 3X2QC 3SPIA 3E8HA 1NKDA 2UXXA 3AG2C 3CCJV 5E1AC 1J95A 3OFNG 4X88A 3JYCA 2JJ1G 2X7RB 1PKXA 4TT3G 3ZN0A 1S5HC 1CPYA 2MK3A 4EKWA 4MTOA 1BMFG 4U7NA 3ZRWA 1RPRA 4RQFA 3VBBA 4JYBA 1K3EA 1PD3A 3GWOA 1Y66A 2HKOA 2YSUB 4MVRA 1YJ9V 1QLNA 2DWEC 1JOYA 3WG7C 2WLJA 3B77A 1AJNA 4KP4A 1AR1B 4UV9A 1M57B 2K1EA 1NBMG 2DYRB 4LBEC 4PA4A 3K0GA 1M57C 3LSSA 3CMAV 3GB7C 3T2MA 4BIZA 4G2KA 4XBFA 1KP3A 2WLHA 3BY6A 3ASNC 1I5XA 4RUEA 3B8MA 2XASA 3UM7A 1JCHA 5C93A 4RUFA 2WLLA 4GT1A 1XL4A 4MW3A 3ZJZA 1YTFB 4KFMA 2X0LA 2DYSC 4DO2A 1OCOB 4FK5C 2P7TC 2YEVA 3AG1C 2BOBC 3D36A 1PNLA 2R9RB 1YIJV 1OZ0A 2ZD9A 5IY5C 4JTAB 4FJCC 3CCSV 5J9PC 5B1OA 3LNMB 3W7XA 1KP2A 5CA3A 3ABMB 5KA6A 1DLBA 1OHHG 2WLIA 3W7SA 2UXNA 3M99B 1VQ6V 4DXWA 3PJSK 1R6KA 4Q20A 4MVSA 2LFSA 2DQ0A 2HR3A 3AG4C 2WPDG 3JD1A 3TK1A 4FIPC 1ORQC 4UVBA 3ETDA 1FXKB 2JEXA 3WFVA 2QKSA 1JVMA 1DF4A 3CCVV 2DW4A 3CMEV 2IW5A 4QE7A 3SPCA 3G6EV 2Q6AA 2BOCC 1FFTB 3ETGA 1E79G 1VQNV 1GM7A 1H8HG 3DGEA 3JD3A 3STLC 1NR1A 1QR9A 2EJRA 2W0FC 2Q67A 2A9HA 1KKDA 2ZDIA 4JAUA 4N21A 2WLLB 1M90W 1KD1W 2ITCC 2LP7A 1VQ5V 1M1KW 1M56C 1FXKA 1K5SA 4PDRA 5DM6V 4BAYA 1QVFU 1PNMA 3OR6C 4E2LA 3SYAA 4MS2A 2ATKC 5LHIA 4MT8A 1NH2D 3IFXA 2JIZG 3AG4B 5IDJA 1SRYA 2XAFA 2Y69B 1K5QA 3HPLC 2EIJB 3I56V 1VQ4V 4JF3A 3BEHA 1XL6A 1R3IC 1SERA 2WLMA 1H2GA 1R73A 3RBZA 3CCRV 3HB3B 1TUEB 2EILB 2Y48A 1K97A 1YTFD 1RPOA 5CBGA 2FTKA 4L87A 3JCZA 3CC2V 3FYIB 3ZRXA 1OCOC 1S72V 4FMTA 1V55C 4JTDB 3QNEA 1OCCB 1M9NA 4GX2A 5H9CA 3TETA 3MHHC 4BIUA 1NVPD 4WFGA 4JGSA 3SYPA 4XDLA 4PA3A 4UXNA 3LDDA 2DYRC 2XNDG 3SYOA 3AG2B 2OTLV 1PNKA 2W6IG 3X2QB 3DTUB 4WFFA 4QPJA 5LGNA 3WG7B 1QLEC 2HG5C 2P90A 1EBOA 1NR7A 3AEIA 5LHHA 4P9PA 1F4MA 2WLIB 3SYCA 5B3SC 2YEVB 5B1BB 2D3OW 2WAMA 3ZMZA 4LP8A 1QBZA 3STZC 2ZR3A 3ASOB 4RAIA 4PDVA 4PA6A 1GTOA 4MTGA 1S3JA 4PA9A 4XDKA 2OTJV 3EHBB 1V54C 3ZRVA 1NJIW 2AHYA 4PDMA 3E8BA 1ENVA 2WWWA 1HWYA 3K9AA 2PI4A 4LC1A 3H01A 3LDEA 3OMAB 4BW5A 3SPHA 1K73W 4MVQA 2C2AA 4KUMA 1W2BU 2EBOA 5L3GA 3MHSC 1MOFA 4TSFG 3FB5C 2H94A 5LBQA 1N8RW 3G71V 4TWKA 5B1NA 5HFLA 4P9OA 2EINB 4LCUC 3ZIAG 4FPPA 2HLDG 4QIWF 2B5UA 2CK3G 4QJFB 1CP9A 4MVMA 3OEEG 3OR7C 3E83A 2IH1C 3P30A 5HFMA 5L3FA 4PELA 5EC1C 1KQSU 1ROPA 3ASOC 2XAGA 1Q81W 4U7OA 4J9YB 1P4RA 1NVPB 3QO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BAY A;  4Z1M G;  3ABT A;  2XAJ A;  1H8E G;  5LHI A;  2V7Q G;  1E1Q G;  5L3D A;  1W0K G;  2JIZ G;  3ZMT A;  4CZZ A;  2XAF A;  2W6J G;  3ZMU A;  1MAB G;  5H6R A;  5LGU A;  2UXX A;  3ABU A;  3OFN G;  1E1R G;  5H6Q A;  2JJ1 G;  4TT3 G;  3ZN0 A;  2Y48 A;  2Z5U A;  3OAA G;  1BMF G;  2WSS G;  1COW G;  2HKO A;  5L3E A;  4UV9 A;  4UXN A;  1NBM G;  2XND G;  3FKS G;  4XBF A;  2W6I G;  5LGN A;  3OE7 G;  3ZN1 A;  2XAS A;  2V1D A;  5LHH A;  5L3B A;  2X0L A;  1W0J G;  2XAQ A;  4ASU G;  2XOK G;  3OEH G;  3ZMZ A;  5LGT A;  4UVA A;  2JJ2 G;  5DN6 G;  5LHG A;  2R9I A;  1OHH G;  2UXN A;  4YXW G;  2WPD G;  4UVB A;  4KUM A;  5L3G A;  4TSF G;  2QE7 G;  2H94 A;  2DW4 A;  2IW5 A;  5LBQ A;  1FS0 G;  5FL7 G;  4UVC A;  1E79 G;  3ZIA G;  1H8H G;  2HLD G;  2CK3 G;  5L3C A;  2EJR A;  3ZMS A;  3OEE G;  2F43 G;  2Z3Y A;  4UV8 A;  2XAH A;  5L3F A;  1EFR G;  2XAG A;  2JDI G;  3ZMV A; 
#chains in the Genus database with same CATH topology
 4UCV A;  4WBN A;  4CC5 A;  4X1K A;  4YIO A;  2ADQ B;  2P06 A;  3SPJ A;  5C8Y B;  4RWU A;  3CB2 A;  1VQ9 V;  1V9P A;  2B9Z A;  1H2N A;  1A3W A;  4JV5 O;  3ABU A;  4B2D A;  1P7G A;  3SRD A;  3D3Q A;  4WFH A;  3AAG A;  2E5L O;  5LL6 Y;  3APO A;  5LOV B;  1F3W A;  2ZIN A;  2CH7 A;  1IBK B;  1EN4 A;  2IJK A;  4NR1 A;  4DR2 O;  4DR4 O;  1WA8 B;  2OIE A;  1YI2 V;  4LF8 B;  2GBO A;  1Y4M A;  3WU2 Z;  4ZOL A;  4GKJ B;  1KB9 F;  4KHP O;  4K8X A;  4ZHQ A;  2IJI A;  4ZI7 B;  1EZJ A;  5LP6 A;  2DJV A;  5L3B A;  1HNZ B;  3ZS8 C;  1OCC C;  1WP8 A;  2KKW A;  2R9A A;  4X64 B;  5LXT B;  1HW7 A;  4QNH B;  3RYI A;  2ZXW B;  4JV5 B;  3SR2 C;  3SPG A;  3APQ A;  2CUG A;  2ZT9 B;  3D3I A;  3CP1 A;  3IAY A;  1FXV A;  3VQY A;  3OMN B;  1BHB A;  1HNX B;  3LUT B;  3CC4 V;  4YXW G;  4JTC B;  4TUY A;  3RYH B;  2LFR A;  3B09 A;  2EIM B;  3AK2 A;  3ZRS A;  1VF6 A;  2GDS A;  1OCR B;  5CMU A;  4PI0 A;  1ZSP A;  4MVO A;  4X1K B;  4JI0 O;  1FS0 G;  1TAE A;  4DR5 O;  4WF9 V;  4IIJ B;  4KCV A;  4LF6 B;  3ZMS A;  4JI0 B;  1EN6 A;  3T1Y B;  5KHK A;  4LF6 O;  4GUN A;  3FB8 C;  4RPP A;  2OT5 A;  2CGO A;  5B1A C;  3F7Y C;  4W4L A;  1ZWI C;  1H2M A;  2VGB A;  3FX7 A;  4CS2 A;  1XMO B;  3ASN B;  4DV5 B;  1GMG A;  4GCZ A;  2GSM B;  4FLX A;  3JAT B;  2Q5Z A;  2CTR A;  3ABL C;  1P7B A;  4UUJ C;  1Y76 B;  3ABK B;  2YID A;  4O4H B;  1COW G;  2Y0I A;  3E86 A;  4FVM A;  1YJN V;  2A0L A;  3E35 A;  3N2K A;  4X1Y A;  1VP7 A;  3UT5 B;  2NNU A;  1AVM A;  2KG7 B;  1VQP V;  2YIC A;  2V1D A;  3R66 A;  3QTG A;  1R3J C;  1H38 A;  1RM1 C;  2YXY A;  5KHJ A;  3J7A U;  5CN0 A;  4ZIB A;  4EEQ A;  4MSW C;  1IBM B;  1JA8 A;  4R6Z A;  4CH3 A;  2VGG A;  2EIK C;  1K4D C;  2IU3 A;  1A49 A;  4B3T O;  3WB1 A;  2FML A;  2E74 B;  2QA4 V;  2W0X A;  3TCU A;  1FXH A;  4LH6 A;  2FYU H;  5KUM A;  2YXH A;  2E5L B;  2JGD B;  2JS5 A;  1UJW B;  3ML0 A;  3F5W C;  5LYJ B;  1YIT V;  1AI4 A;  5AG2 A;  2ILM A;  4DYL A;  1BHA A;  5BZB A;  4A5U B;  2XAH A;  1J5E B;  4O4I B;  4LNU B;  3IS4 A;  1SQQ H;  3ZMV A;  4GKJ O;  4BWA A;  5B1B C;  3FYE B;  3SJQ C;  1RM1 B;  4YHH O;  4HBN A;  4RQE A;  2UXD B;  1I5Y A;  2OCH A;  1PP9 H;  4U3J A;  1YCI A;  4CZZ A;  2JGU A;  5GW7 A;  1QQC A;  5LP6 C;  1L0L H;  3SPI A;  3AG2 C;  5E1A C;  1J95 A;  2CTQ A;  4GZR B;  4DV3 B;  3HKB B;  4ICG A;  4LNU A;  2MK3 A;  4MTO A;  1X4T A;  4UB8 Z;  5LMU B;  1TVK B;  2RJZ A;  4TQD A;  1Q43 A;  3GWO A;  5CB4 B;  4MVR A;  3G67 A;  5GON B;  1A5U A;  1JOY A;  1MA1 A;  2WLJ A;  5LMU O;  1AR1 B;  1AJN A;  4KP4 A;  2K1E A;  1NBM G;  1IDS A;  2DYR B;  1XUQ A;  3GB7 C;  4UB6 Z;  5BMV B;  3ASN C;  1I5X A;  3E0W A;  3B8M A;  2XAS A;  3UM7 A;  5JQG B;  2RMK B;  1N32 O;  1XL4 A;  4H13 B;  4LR3 A;  2AZ2 A;  1Q90 D;  2K9P A;  3RT3 C;  4JZ2 A;  4IHJ A;  3CRM A;  4FM2 A;  1XHZ A;  4JTA B;  2Q7G A;  4EB6 A;  3CCS V;  1YVW A;  1URF A;  3LNM B;  4DV0 B;  4Z1V A;  1H2S B;  3ABM B;  5KA6 A;  3A0H Z;  3G6B A;  1DLB A;  1OHH G;  1SA0 A;  3CXH F;  3PJS K;  3JSN A;  4MVS A;  3AG4 C;  3JAK B;  3K9S A;  4O4I A;  2RCV A;  1GN2 A;  1ORQ C;  4TV9 A;  3WFV A;  2QKS A;  4YJ2 A;  3EVK A;  4J10 A;  4QE7 A;  3G6E V;  2N05 A;  2Q6A A;  1H8H G;  3DGE A;  1N36 B;  1NR1 A;  2W0F C;  1GN3 A;  2A9H A;  4O2A A;  1XIL A;  4JAU A;  4N21 A;  2WLL B;  5D5Q A;  2ITC C;  2LP7 A;  2LGW A;  1M1K W;  5FPR A;  5DM6 V;  2QWO B;  1QVF U;  2PF4 E;  4J42 A;  3OR6 C;  5LHI A;  2Q0A A;  1D5A A;  1NH2 D;  2JIZ G;  3AG4 B;  4NYK A;  5IDJ A;  1N34 B;  2Y69 B;  2OYQ A;  5ITZ B;  3I56 V;  1VQ4 V;  4JF3 A;  1MZE A;  4DW0 A;  1R3I C;  3KCX A;  5E79 Z;  1SER A;  5JVD B;  3SGI A;  2WLM A;  1CXZ B;  4DR2 B;  4X20 B;  5EYP A;  4X65 O;  5CBG A;  4IIJ A;  3ZRX A;  1OCO C;  1Q3E A;  3BPZ A;  4JTD B;  4DV7 O;  4JI5 B;  3TET A;  4BIU A;  4U3F H;  5A9G A;  4WFG A;  2P4K A;  1U97 A;  3SYP A;  5J2T B;  3IJ4 A;  4PA3 A;  2PY5 A;  4UXN A;  3LDD A;  2DYR C;  3SYO A;  2Y4T A;  4JYY A;  3M8A A;  2W6I G;  1SA0 B;  1QLE C;  4FZ1 A;  3HQP A;  1EBO A;  4IYI A;  3HKC B;  2V4D A;  2YEV B;  5B1B B;  3ZMZ A;  1JFF A;  1QBZ A;  3STZ C;  4LF7 B;  3ASO B;  4JI1 B;  2E28 A;  2OTJ V;  5LP6 B;  3OTO O;  1NJI W;  3ICX A;  2AHY A;  3A8T A;  3LDE A;  2XHB A;  4JI4 O;  4X62 B;  1W2B U;  2EBO A;  3UT5 A;  3D8C A;  5LBQ A;  4LF4 O;  2GV9 A;  1U96 A;  2EIN B;  1N32 B;  2HLD G;  4BW9 A;  5FLX N;  3GG8 A;  3TXS A;  3K5N A;  3E83 A;  2G50 A;  3RYH A;  2YS8 A;  1KQS U;  3A2F A;  5EYP B;  3F5T A;  1P4R A;  1NVP B;  4G28 B;  1KEC A;  3AG3 C;  2XAJ A;  3CCQ V;  1DTO A;  2EJ7 A;  5L3D A;  3RYC B;  4X66 B;  2UUC B;  2HP8 A;  1M5I A;  4H44 B;  5H6R A;  3H9V A;  4QPK A;  1WB8 A;  4IMA A;  2LW1 A;  4MVZ A;  5BR8 B;  4CBC A;  1MSW D;  1NI8 A;  1FJG O;  3QV7 A;  5B3S B;  4YJ5 A;  5EBW C;  3BAA A;  3R65 A;  1L0N H;  3GWK C;  3NXS A;  1NT2 B;  4X89 A;  2QSA A;  1GM9 A;  2QM7 A;  4DK0 A;  3CPW U;  2BE3 A;  1G4Y B;  4NTX A;  1XNQ O;  4WCE V;  2XUM A;  1Q6U A;  3E8F A;  5B1A B;  1J5E O;  1GN4 A;  1RP3 B;  1XMO O;  3N27 A;  3OEH G;  1M56 B;  1JR9 A;  2OCC C;  4YY3 B;  4UVA A;  2BTQ B;  2UXD O;  5DN6 G;  4WFA V;  2AHZ A;  3T07 A;  4P2Z A;  1WN7 A;  4QGP A;  2EIJ C;  2UUA B;  1WA8 A;  2JVD A;  4B3R O;  4GX1 A;  1VEW A;  3SYQ A;  4AIL C;  1CEZ A;  5KMG A;  3HKE B;  1OCZ C;  4HNA A;  1SES A;  2EZP A;  3FD9 A;  1XHX A;  5LOV A;  4B3S B;  1UFI A;  3ZBH A;  2EIM C;  4I4T A;  2IJH A;  4NXN B;  3E89 A;  1G8M A;  5IJ9 A;  1TA8 A;  2VWK A;  2HFE C;  4OXS A;  2Z3Y A;  4UV8 A;  2QTO A;  2Z0A A;  3S3X A;  2JDI G;  2OCC B;  1K33 A;  4EB6 B;  1AI6 A;  2E75 B;  2ZXW C;  4Z1M G;  2B1G A;  1WAZ A;  3Q4H A;  4J7Z A;  3T1C A;  3K59 A;  3BA8 A;  1F23 A;  4PA7 A;  2CTP A;  1SC5 B;  4G27 B;  1MAB G;  1XI1 A;  4DV1 O;  3EFF K;  3JD4 A;  3CXC U;  1I94 B;  1F4N A;  2A3Q A;  1NH2 B;  4NTW A;  4DR4 B;  2GUZ A;  4DV5 O;  1Q6H A;  3UKM A;  2E76 B;  4NKG B;  3T4D A;  4FLU A;  1VQK V;  1A3X A;  2VGI A;  5FNV B;  1SZT A;  3VQX A;  4X1I B;  1YJW V;  3FAV A;  1ZL8 B;  1YHQ V;  3CCL V;  3PN1 A;  3K58 A;  1FKA O;  3HKB A;  3EOE A;  1Y74 A;  3M7M X;  3K5O A;  5EIB C;  4P30 A;  2JRI A;  1T5E A;  3CRQ A;  3T05 A;  4O4L A;  2JEU A;  1K9M W;  1YDX A;  2L35 A;  2QJ1 A;  2YI8 A;  2XAQ A;  3TJT A;  4JPR A;  2XOK G;  4KL1 A;  1HNX O;  3E22 B;  3K08 A;  3OUS A;  3O65 A;  2GHY A;  3ZRW B;  1R3K C;  2EIN C;  3QO5 A;  1Q7Y W;  4ZOL B;  2DMX A;  5KUK A;  4JI8 O;  3E8G A;  5IYC O;  3JAS B;  3SJA C;  2ZIM A;  5J2U A;  4GKK B;  3ABM C;  1WPX A;  4UCR A;  3PP7 A;  4R7C A;  4FLV A;  1IXB A;  4NXM O;  2ZIO A;  1FFX B;  2AW9 A;  2KG7 A;  1FYJ A;  1E0U A;  5CA0 A;  1N33 B;  3ABT A;  4DV6 O;  4KCU A;  1W0K G;  4R8C A;  1VIB A;  4X1I A;  3JAR B;  1BE3 H;  2B1I A;  4O4H A;  1AJP A;  3W7U A;  3K57 A;  3B40 A;  4F6E A;  1NKD A;  4FXF A;  3OFN G;  4B3S O;  3GQY A;  3CSX A;  3L71 H;  1PKX A;  3ZX6 A;  1S5H C;  4JI6 O;  4EKW A;  4LF5 O;  4NXN O;  4ABM A;  3JAL B;  1RPR A;  4RQF A;  2QTS A;  4JYB A;  3RYC A;  4YJ3 B;  4JI2 B;  3ETQ A;  1KMI Z;  3U11 A;  4TV8 B;  3B77 A;  1IVS A;  3D36 C;  3CMA V;  5D5P A;  3CJH B;  4JI2 O;  2WLH A;  4FXJ A;  1JCH A;  4RUF A;  4QG8 A;  4GT1 A;  1YTF B;  4JI1 O;  1Z5V A;  4KFM A;  4DO2 A;  2P7T C;  4QGC A;  2F4V O;  4LH7 A;  5B1O A;  5IWA B;  1P84 F;  2RQ6 A;  3W7X A;  3DSQ A;  1KP2 A;  1Y76 A;  1HR0 B;  2WLI A;  2QWQ B;  3W7S A;  4LF7 O;  1PPJ H;  4O4J A;  1R6K A;  5CB4 A;  2DQ0 A;  2EX3 A;  4DV1 B;  2BCC H;  3N2K B;  5EZY A;  2L6L A;  2QR4 A;  3KZI Z;  3N2G A;  2PTM A;  5DEC A;  2BOC C;  3C3S A;  1GM7 A;  3FFQ A;  4K0K O;  2JS3 A;  2Q67 A;  1EM1 A;  5IYZ B;  3ZHS A;  4TQF A;  1K5S A;  3RGB A;  4BAY A;  4CC6 A;  1N34 O;  4E2L A;  4F6R A;  3SYA A;  2P4V A;  2XAF A;  2ZE6 A;  2EIJ B;  4DRX B;  1Z2G A;  1XL6 A;  4TV9 B;  4B3M O;  1JJO A;  3O9O A;  4DV4 O;  1H2G A;  2Q7H A;  2LGQ A;  3CE2 A;  3JAT A;  2ZNI A;  2Q0O C;  3CCR V;  1TUE B;  4IYH A;  1O9G A;  1XQ8 A;  5H5N A;  4QG6 A;  3FYI B;  1S72 V;  1XNR O;  2CE4 A;  4LWS B;  1KKC A;  3UO3 A;  3K5L A;  3OTO B;  2XTA A;  1E0T A;  4DV3 O;  3MHH C;  2CGN A;  3JAW B;  5LA6 A;  2YIA A;  4JGS A;  4XDL A;  2VQF B;  3AG2 B;  2OTL V;  1SQV H;  1ZUQ A;  4G1N A;  5B3S C;  3RYI B;  2ARH A;  5EZY B;  1TUB B;  2QKC A;  4JYA O;  2WAM A;  1R1B A;  4LP8 A;  4IP7 A;  2ZR3 A;  5KLV H;  3S3W A;  1O9H A;  1S3J A;  4XDK A;  1SQF A;  1V54 C;  4DV7 B;  3HKD A;  4CH4 A;  1PKN A;  2UXC O;  3SRK A;  4PDM A;  3E8B A;  1Q6I A;  2PI4 A;  1HWY A;  4LC1 A;  4I50 A;  5IYZ A;  3SPH A;  1K73 W;  3MHS C;  1NS1 A;  4TSF G;  4JI3 O;  4DR1 B;  2RNB A;  1VF6 C;  5KHH A;  4GKK O;  4TWK A;  4P9O A;  4LCU C;  3DXR B;  4FPP A;  2A06 H;  4QJF B;  4B2D D;  5JJE B;  1Z5W A;  3JCU Z;  2IH1 C;  5HFM A;  4J7J A;  5KMG B;  1ROP A;  2ETN A;  2XAG A;  4U7O A;  2AXT Z;  1BS3 A;  3AG1 B;  3CD6 V;  1AP6 A;  3LDC A;  2IH3 C;  5KHG A;  1XRE A;  5KAI Z;  3DXR A;  1AR4 A;  4U3J B;  1Y6X A;  2QM8 A;  4D7S A;  4YHH B;  2F95 B;  3CCU V;  3JAW A;  3ZMU A;  2D2C B;  4PI2 A;  2RN9 A;  3DC6 A;  1GO3 F;  1B6Q A;  2M6Y A;  2P5O A;  4JI8 B;  4B3M B;  3ETE A;  3Q4H B;  5J2U B;  2P22 C;  4JYC A;  4ZI7 A;  2A79 B;  1NTM H;  3ABK C;  2R72 A;  3U0Z A;  5IJ0 A;  5EIB D;  1LUV A;  2ZM6 O;  4ZKI A;  5GON A;  3ABL B;  4UFZ A;  1T57 A;  3MD0 A;  1YZB A;  2Q68 A;  3OE7 G;  3ZN1 A;  1DF5 A;  1WPB A;  1A32 A;  3VOU A;  4JAV A;  1W0J G;  4YY3 O;  3ZHQ A;  3AG3 B;  4LFC B;  4ASU G;  1JJ2 U;  4RO2 A;  4WFB V;  3A0B Z;  3B4S A;  4DR7 B;  1FAF A;  2JJ2 G;  4LFA O;  4I55 A;  1HNW B;  3U2Z A;  1MZF A;  4LF5 B;  1KU9 A;  1ZX3 A;  4PDL A;  1FD9 A;  2Y69 C;  4KS0 A;  2HEP A;  3ZCC A;  1KBH A;  1K34 A;  2LW7 A;  1SF9 A;  4ZBM A;  2JGD A;  4UVC A;  4JI7 B;  2UU9 B;  1R3L C;  3JD2 A;  4DW1 A;  2PZS A;  4LF4 B;  2F43 G;  1VMG A;  1XEQ A;  2F93 B;  3LSU A;  5CA1 A;  1RSO B;  3KTX A;  1WJZ A;  4GLX A;  1SET A;  4B7K A;  3G2G A;  1WLE A;  3L72 H;  1BCC H;  1PL0 A;  2ZDI C;  3IGA C;  1H8E G;  2X6C A;  4AQY B;  1F51 A;  1HNW O;  1VQ8 V;  1TGO A;  4B7E A;  2N04 A;  3JAM N;  4DUY B;  3AK1 A;  3EXA A;  4FFK A;  2HVK C;  2DOS A;  1T5A A;  1BQZ A;  1FFX A;  1XDC A;  2FB5 A;  1S0V A;  4O2B B;  4B08 A;  4XDJ A;  4HAM A;  1GM8 A;  1SQP H;  2WSS G;  3K04 A;  1M93 A;  5L3E A;  4K3A A;  3C90 A;  4IL6 Z;  1GK9 A;  3WB0 A;  2M7W A;  2EIL C;  1OJH A;  1PV0 A;  4X9Q A;  2UUB O;  3K79 A;  1MNG A;  2WLN A;  4AHC A;  2RDC A;  4H37 A;  1IX9 A;  4NB5 A;  5CBH A;  1X59 A;  3T1Y O;  3MAQ A;  3RVY A;  3FB6 C;  2ZNJ A;  2WA4 A;  4HNA B;  2GTS A;  2P6J A;  2QKA A;  2ZQM A;  1DGS A;  5LHG A;  1SZX A;  5JJJ B;  2WA3 A;  4DV6 B;  2NN4 A;  1QHT A;  1THZ A;  1VQM V;  2UXB O;  1VF7 A;  3F7V C;  2BSK B;  4GX5 A;  5K1X A;  2ZM6 B;  1XMQ B;  1RSO A;  1NQT A;  3G4S V;  2ADP A;  1VQ7 V;  4O2A B;  2NLJ C;  3H1L H;  3CC7 V;  3SRF A;  1SKV A;  3IC9 A;  5DED A;  5FL7 G;  5IYD O;  2QEX V;  2ITD C;  4FLT A;  3K03 A;  5JWP A;  3BJT A;  5L3C A;  4NXM B;  4FFB A;  4MTF A;  4HYV A;  1I08 A;  3OTF A;  2VRZ A;  1JQ0 A;  1L1F A;  3VQV A;  4HZ3 A;  1EFR G;  2MW2 B;  2P67 A;  1AR5 A;  3THO A;  3N2G B;  3RW0 A;  1VQL V;  4D7T A;  5EBM C;  1FPO A;  5LYJ A;  5C8Y A;  1PL4 A;  2X6A A;  3OGC C;  2CTW A;  3A0R A;  4FLW A;  3BHP A;  4IHJ B;  3N25 A;  5FNV A;  4B3T B;  2UXX A;  1BQ0 A;  2LO1 A;  4FM0 A;  3SJC C;  2X7R B;  4X20 A;  1CPY A;  4U7N A;  5BR8 O;  3K5M A;  5IE9 A;  1IBM O;  3ZRW A;  1I94 O;  4JPG A;  2VQF O;  4LFB B;  3VBB A;  4KCW A;  1PD3 A;  1Y66 A;  1N0J A;  4Q6G A;  2F66 C;  2DWE C;  3WG7 C;  2YDE A;  3H1H H;  1F7Y A;  3JAS A;  4JI4 B;  5KAF Z;  4LBE C;  4L8J A;  4PA4 A;  3MA8 A;  1M57 C;  4G2K A;  3CRC A;  3BY6 A;  4RUE A;  4JYA B;  5C93 A;  2WLL A;  4LWS A;  4MW3 A;  3ZJZ A;  4FK5 C;  2YEV A;  3BRC A;  5LA6 B;  1WP7 A;  3CWB H;  1OZ0 A;  2ZD9 A;  5IY5 C;  4FJC C;  4YIP A;  3LNN A;  5J9P C;  4YJ2 B;  4LF9 O;  5KHI A;  4WBN B;  5CA3 A;  4AI8 A;  3M99 B;  1VQ6 V;  2HR3 A;  1NU1 H;  4LFA B;  3JD1 A;  4FIP C;  1ZL8 A;  4UVB A;  1FXK B;  2JEX A;  1JVM A;  1TUB A;  4KCT A;  2QWR B;  2DW4 A;  3CME V;  2IW5 A;  2VGF A;  3SPC A;  2Y0P A;  1FFT B;  3ETG A;  1VQN V;  4PV1 B;  3QV6 A;  4UCU A;  4GYC B;  3STL C;  1R6T A;  2EJR A;  4OPA A;  4LF8 O;  4OX9 B;  4JI3 B;  1KKD A;  1KD1 W;  1M90 W;  1IUR A;  4I50 B;  3OGI B;  2G38 A;  1VQ5 V;  1FXK A;  4I55 B;  1P49 A;  4PDR A;  5JVD A;  2ZE8 A;  2YC0 A;  4KXR A;  3IFX A;  4J7K A;  4DV2 O;  4KRZ A;  2YUA A;  3HPL C;  2YIB A;  2Q4P A;  4J11 A;  1KUQ A;  4JI6 B;  5JH7 B;  1FJG B;  5CA1 B;  5BY1 A;  3HB3 B;  4BIO A;  2Y48 A;  3OT7 A;  4L87 A;  4LF9 B;  3JCZ A;  3CC2 V;  1S5J A;  4FMT A;  1M9N A;  1LR1 A;  4CS4 A;  2F23 A;  2DE0 X;  3RN4 A;  2XND G;  1JFF B;  1PNK A;  2ZKO A;  3X2Q B;  4WFF A;  4QPJ A;  3WG7 B;  2HG5 C;  2F4V B;  3QVN A;  5B66 Z;  1NR7 A;  4P9P A;  1F4M A;  2WLI B;  3J80 N;  4O4L B;  4EFE A;  3HKD B;  4ZHQ B;  2AGA A;  2D3O W;  1W59 A;  4RAI A;  4PA6 A;  1GTO A;  4MTG A;  3TXQ A;  4X62 O;  4PA9 A;  4X65 B;  3EHB B;  3CHX A;  4PD4 F;  3HKC A;  4FLY A;  4DR6 B;  1F3X A;  1ENV A;  1N0N A;  1PKY A;  3RYF B;  4JI5 O;  3OMA B;  4BW5 A;  4TV8 A;  1BGY H;  3H1K H;  3VQW A;  2H94 A;  2PUS A;  1N8R W;  4K0K B;  4I4T B;  3G71 V;  5KX5 A;  5B1N A;  1AB3 A;  3ZIA G;  4QIW F;  1PKM A;  2CK3 G;  1SS3 A;  1CP9 A;  3OEE G;  3L9D A;  4X66 O;  4DR3 B;  2UUC O;  3ASO C;  2EZO A;  3RFR A;  4X1Y B;  1B3Q A;  1VAR A;  2Y4U A;  3B2E E;  4K8Z A;  2BSK A;  3T4Z A;  2H3O A;  2PYJ A;  3KKY A;  5ITZ A;  4X8A A;  2YIB D;  1ARO P;  5LGU A;  5LXT A;  5KA5 A;  1VQO V;  4Z2W A;  3K06 A;  3ZHT A;  3BCC H;  1US6 A;  4JZG A;  2X6B A;  1AI7 A;  1E1R G;  2BTO A;  3UQ8 A;  3QV9 A;  3OAA G;  3CCE V;  3I5D A;  3KG2 A;  1GH6 A;  4PJ0 Z;  5EC2 C;  3ZHV A;  4FZ0 A;  3I55 V;  3DC5 A;  4QE9 A;  2HJF C;  3SJB C;  3GR4 A;  2Q69 A;  3BVO A;  1S77 D;  1QLE B;  1JPX A;  2LJ2 A;  4JAS A;  3BFR A;  3CEI A;  2CH7 B;  3FKS G;  5BMV A;  1YXB A;  2YI9 A;  1OV9 A;  1Q5O A;  1YSC A;  2ZE7 A;  3OMI B;  2UUB B;  2HVJ C;  1PKL A;  4NVP A;  2YXL A;  1NTK H;  1XBL A;  3BA9 A;  2CAZ C;  1I0H A;  3BAB A;  2VQE B;  4IT5 A;  3L73 H;  1QNM A;  5EK0 A;  5LGT A;  4I0X A;  1Q8I A;  1AJQ A;  3LSQ A;  1N33 O;  4HYO A;  1M4U A;  4N23 A;  4F4L A;  4UCO A;  1RFY A;  4I9W A;  5IJ0 B;  5H2F Z;  1MMM A;  3ZHU A;  4KHP B;  4DV0 O;  5JCO A;  1XMQ O;  2QE7 G;  1NTZ H;  2PI5 A;  4GX0 A;  4CH6 A;  1Q86 W;  3L70 H;  3W7W A;  1QR8 A;  3CYO A;  4DR5 B;  3TGU H;  2JK5 C;  4LFC O;  2Q8V A;  1EZV H;  4HYW A;  2OWO A;  4WFE A;  3RVZ A;  2IBZ H;  5CA0 B;  1H2L A;  2WLK A;  5LMN O;  1G6U A;  1OCZ B;  1HR0 O;  4TOI A;  2IU0 A;  2GTA A;  4MW8 A;  2HJD A;  1BZK A;  5IT9 N;  3K0D A;  2W6J G;  2OIG A;  3E22 A;  3CRR A;  4MVU A;  4YJ3 A;  1SQX H;  4JAA A;  1PM9 A;  3QF7 A;  1AP5 A;  4DUZ B;  1Q82 W;  4DV2 B;  1AI5 A;  3OD4 A;  1LNQ A;  4I5S A;  5H6Q A;  3AK3 A;  3CCM V;  2Z5U A;  1K8A W;  3T1H O;  1IXM A;  1EN5 A;  1Y74 B;  1S76 D;  4D6T H;  1KYO F;  2DYS B;  2VWJ A;  2UXB B;  3OUF A;  3E0V A;  3K3W A;  2DWD C;  2A7W A;  4UCS A;  4J9Z B;  5CBF A;  5IYB O;  4B3R B;  3QO8 A;  1BSM A;  1NZ6 A;  4MTX A;  4J41 A;  4FM1 A;  1QCE A;  1JX9 A;  4UCT A;  3QTC A;  1K92 A;  2KQX A;  3ZED A;  3OM3 B;  3FAV B;  1V55 B;  1BL8 A;  2H8P C;  2F1M A;  5EBL C;  1ZTE A;  1ZLZ A;  4R50 A;  1XNQ B;  2KB1 A;  4IGG A;  5F2V O;  1D5N A;  2IM9 A;  4NTY A;  3W7T A;  4DUZ O;  1HNZ O;  4O2B A;  1UPG A;  2IJJ A;  1AIL A;  5JQG A;  2R9I A;  1BT8 A;  5TIS Z;  3T1H B;  2GUZ B;  1K4C C;  4C7U A;  1QU7 A;  1LUW A;  1G1X B;  4DR1 O;  1R6N A;  2R70 A;  1SQB H;  1IBL O;  1K7D A;  1GKF A;  2FL4 A;  3JD0 A;  2BTQ A;  3HKE A;  3J81 N;  1N4C A;  2QGN A;  1KC8 W;  3SDL A;  5JJN B;  3E2E A;  1FXK C;  3OW2 U;  1WB7 A;  2N74 A;  3P3N A;  4W4K A;  4DR6 O;  1MG1 A;  1YF2 A;  3FB7 C;  4H0L B;  3P32 A;  1TVK A;  5B5E Z;  1L8D A;  5GTI Z;  5GTH Z;  2XT9 A;  1HP8 A;  2DQ3 A;  1QVG U;  1GAX A;  5IY5 B;  3B8N A;  1OCR C;  3IC7 A;  1MSD A;  4QG9 A;  2ZR2 A;  2V7Q G;  2HHH B;  1E1Q G;  2Q7E A;  3ZMT A;  5KX5 B;  5LMN B;  4H33 A;  1DK1 A;  3U10 A;  2EIK B;  2DN9 A;  1V54 B;  3X2Q C;  3ME3 A;  1IBK O;  3E8H A;  1IBL B;  3CCJ V;  1I7F A;  5JCO C;  4X88 A;  3JYC A;  2JJ1 G;  4TT3 G;  3ZN0 A;  1JMK C;  4I7Z B;  1BMF G;  2CDY A;  1B04 A;  3QV8 A;  3UO2 A;  2E3C A;  3JAR A;  4E4E A;  1K3E A;  2Q9L A;  2HKO A;  2QWP B;  2YSU B;  2UUA O;  1SQG A;  1YJ9 V;  1QLN A;  3P3P A;  3JSL A;  3HQO A;  4UV9 A;  1M57 B;  3K0G A;  3LSS A;  1B06 A;  3T2M A;  3JAL A;  4BIZ A;  4CS3 A;  4XBF A;  1KP3 A;  3QG5 A;  4WJ8 A;  4TUY B;  3T0T A;  4EFB A;  2AZ0 A;  2X0L A;  2DYS C;  4O4J B;  1OCO B;  2QWN B;  2VS0 A;  3AG1 C;  2BOB C;  3D36 A;  1PNL A;  2R9R B;  4F6R B;  1YIJ V;  3CJH A;  3KHD A;  4AQY O;  4DRS A;  5A2Q N;  4DR7 O;  2UXN A;  4DXW A;  4Q20 A;  2LFS A;  3L75 H;  2LQT A;  1AQF A;  3WB2 A;  2WPD G;  1VP8 A;  3TK1 A;  5IWA O;  2UU9 O;  3ETD A;  3CRA A;  1DF4 A;  3CCV V;  1ZAU A;  1WNS A;  1E79 G;  4OPH A;  3JD3 A;  3JAK A;  3L74 H;  1QR9 A;  1S5L Z;  4K35 A;  2ZDI A;  3RYF A;  5J2T A;  1M56 C;  4OGQ B;  4I0X B;  5JH7 A;  1PNM A;  4DR3 O;  2ZE5 A;  4MS2 A;  2ATK C;  4I9Q A;  2ZCE A;  4MT8 A;  1D2D A;  2NR5 A;  1SRY A;  1K5Q A;  2QDO A;  3CS5 A;  4FLZ A;  3BEH A;  2FKX A;  1R73 A;  3RBZ A;  2KSD A;  2EIL B;  2QM4 A;  1K97 A;  5BXZ A;  1YTF D;  1RPO A;  2FTK A;  3C3T A;  2PGG A;  4CH5 A;  1V55 C;  3H1I H;  3QNE A;  1OCC B;  4FFB B;  4GX2 A;  5H9C A;  2PYL A;  1NVP D;  1HDJ A;  3SRH A;  1GN6 A;  2Q73 A;  3DTU B;  1ZJH A;  4BR6 A;  2O57 A;  5LGN A;  1N36 O;  2P90 A;  4X64 O;  3AEI A;  3HR0 A;  5IJ9 B;  5LHH A;  4OX9 O;  4DUY O;  3SYC A;  3KCY A;  1XOU A;  4DRX A;  2UXC B;  1IZ3 A;  1Y67 A;  4PHZ A;  3BJF A;  3CX5 F;  4PDV A;  1VF5 B;  3ZHR A;  3ZRV A;  2VQE O;  1XNR B;  3MDS A;  4LFB O;  2WWW A;  3GVM A;  1H2K A;  3K9A A;  3H01 A;  3H6O A;  4DK1 A;  4MVQ A;  2C2A A;  4KUM A;  1GRJ A;  4JI7 O;  5L3G A;  1MOF A;  3FB5 C;  4DV4 B;  4YNG A;  2EUL A;  5FPO A;  3HQN A;  5HFL A;  1YEW A;  3RWR D;  3AG7 A;  3UCS C;  4J80 A;  2B5U A;  3H1J H;  4MVM A;  3OR7 C;  3NR7 A;  3P30 A;  5L3F A;  4PEL A;  5EC1 C;  5K1P A;  1Q81 W;  3G80 A;  2HHH O;  4J9Y B;  2ODM A;  3QO7 A; 
#chains in the Genus database with same CATH homology
 4G28 B;  1KEC A;  3AG1 B;  3CD6 V;  3AG3 C;  2XAJ A;  3CCQ V;  1DTO A;  3LDC A;  5L3D A;  2IH3 C;  3SPJ A;  3T4Z A;  2QM8 A;  3CCU V;  1VQ9 V;  4X8A A;  3ZMU A;  1ARO P;  5H6R A;  4QPK A;  5LGU A;  5KA5 A;  1GO3 F;  3ABU A;  4MVZ A;  1VQO V;  1B6Q A;  3K06 A;  4CBC A;  1MSW D;  2X6B A;  1AI7 A;  1E1R G;  4WFH A;  3AAG A;  3OAA G;  3CCE V;  3ETE A;  3KG2 A;  5EC2 C;  5B3S B;  4JYC A;  3I55 V;  4QE9 A;  2A79 B;  3ABK C;  2EZO A;  2HJF C;  5EBW C;  2IJK A;  3R65 A;  2Q69 A;  3NXS A;  4ZKI A;  1S77 D;  1YI2 V;  3ABL B;  1QLE B;  1Y4M A;  1JPX A;  4X89 A;  4JAS A;  3MD0 A;  1GM9 A;  2IJI A;  2QM7 A;  3FKS G;  3CPW U;  1EZJ A;  1G4Y B;  2Q68 A;  3OE7 G;  3ZN1 A;  1YSC A;  1DF5 A;  3OMI B;  2HVJ C;  4WCE V;  5L3B A;  3VOU A;  1OCC C;  4JAV A;  1W0J G;  3E8F A;  5B1A B;  3AG3 B;  4QNH B;  4ASU G;  1JJ2 U;  4RO2 A;  4WFB V;  2ZXW B;  3OEH G;  1M56 B;  2OCC C;  5EK0 A;  5LGT A;  4UVA A;  2JJ2 G;  5DN6 G;  3SPG A;  1AJQ A;  4WFA V;  3LSQ A;  4HYO A;  3D3I A;  2AHZ A;  3CP1 A;  4P2Z A;  4PDL A;  1FXV A;  4N23 A;  4F4L A;  3OMN B;  1BHB A;  2EIJ C;  4I9W A;  3LUT B;  3CC4 V;  2Y69 C;  4YXW G;  4JTC B;  4GX1 A;  3SYQ A;  3ZCC A;  2LFR A;  1CEZ A;  2EIM B;  1K34 A;  1OCZ C;  3ZRS A;  1SES A;  1OCR B;  2EZP A;  5CMU A;  4ZBM A;  2QE7 G;  4MVO A;  1FS0 G;  2PI5 A;  2EIM C;  4UVC A;  4GX0 A;  1Q86 W;  4WF9 V;  2IJH A;  3W7W A;  3E89 A;  1QR8 A;  1G8M A;  3CYO A;  1R3L C;  3JD2 A;  3ZMS A;  2JK5 C;  2HFE C;  2F43 G;  2Z3Y A;  4OXS A;  4UV8 A;  2QTO A;  4WFE A;  1SET A;  2JDI G;  2OCC B;  1K33 A;  3RVZ A;  2ZXW C;  1AI6 A;  2WLK A;  2B1G A;  1WLE A;  4Z1M G;  3FB8 C;  1PL0 A;  2ZDI C;  3IGA C;  1H8E G;  2X6C A;  2OT5 A;  1OCZ B;  1F51 A;  5B1A C;  3T1C A;  1VQ8 V;  2IU0 A;  1F23 A;  4MW8 A;  3F7Y C;  1ZWI C;  4PA7 A;  3K0D A;  2W6J G;  4G27 B;  1MAB G;  3ASN B;  3EFF K;  3JD4 A;  3CXC U;  1F4N A;  4MVU A;  2HVK C;  1GMG A;  4GCZ A;  2GSM B;  1NH2 B;  1Q82 W;  1AI5 A;  1LNQ A;  4I5S A;  5H6Q A;  3CCM V;  2Z5U A;  1K8A W;  1S0V A;  3ABL C;  1IXM A;  1P7B A;  4UUJ C;  4XDJ A;  4HAM A;  1GM8 A;  3UKM A;  1S76 D;  2DYS B;  3T4D A;  3ABK B;  2WSS G;  1COW G;  3K3W A;  3OUF A;  1VQK V;  2DWD C;  3K04 A;  3E86 A;  1SZT A;  5L3E A;  4J9Z B;  5CBF A;  5IYB O;  1YJN V;  1YJW V;  3QO8 A;  2A0L A;  3E35 A;  1GK9 A;  4MTX A;  1YHQ V;  2M7W A;  2EIL C;  3CCL V;  3K79 A;  2WLN A;  2NNU A;  1QCE A;  4H37 A;  1JX9 A;  1K92 A;  4P30 A;  1VQP V;  5CBH A;  2V1D A;  3OM3 B;  1R3J C;  2JEU A;  1K9M W;  1V55 B;  1BL8 A;  2H8P C;  5EBL C;  4R50 A;  2XAQ A;  1RM1 C;  1H38 A;  2KB1 A;  3RVY A;  3FB6 C;  4JPR A;  2XOK G;  5CN0 A;  3W7T A;  3K08 A;  4MSW C;  2P6J A;  3OUS A;  2ZQM A;  2IJJ A;  5LHG A;  2R9I A;  1K4C C;  4R6Z A;  2GHY A;  1THZ A;  1VQM V;  2EIK C;  3F7V C;  1K4D C;  1R6N A;  4GX5 A;  2IU3 A;  3ZRW B;  1R3K C;  2EIN C;  3QO5 A;  3G4S V;  1NQT A;  1K7D A;  1Q7Y W;  1GKF A;  1VQ7 V;  3JD0 A;  2QA4 V;  1KC8 W;  5KUK A;  3TCU A;  1FXH A;  2NLJ C;  3E2E A;  1FXK C;  3OW2 U;  3E8G A;  3CC7 V;  5IYC O;  5KUM A;  1MG1 A;  5FL7 G;  5IYD O;  2QEX V;  3FB7 C;  2ITD C;  1UJW B;  3P32 A;  3K03 A;  3ML0 A;  3F5W C;  5L3C A;  1YIT V;  1AI4 A;  3ABM C;  1BHA A;  4MTF A;  5BZB A;  1WPX A;  1JQ0 A;  1L1F A;  2XAH A;  2DQ3 A;  1QVG U;  4HZ3 A;  1EFR G;  4R7C A;  5IY5 B;  2P67 A;  3ZMV A;  5B1B C;  3B8N A;  3FYE B;  3SJQ C;  3ABT A;  1RM1 B;  4RQE A;  1OCR C;  3IC7 A;  1I5Y A;  2ZR2 A;  3RW0 A;  1VQL V;  2V7Q G;  1E1Q G;  5EBM C;  1W0K G;  3ZMT A;  4R8C A;  4H33 A;  4CZZ A;  2X6A A;  3OGC C;  2B1I A;  3A0R A;  5GW7 A;  2EIK B;  1AJP A;  3W7U A;  1V54 B;  3X2Q C;  3SPI A;  3E8H A;  1NKD A;  2UXX A;  3AG2 C;  3CCJ V;  5E1A C;  1J95 A;  3OFN G;  4X88 A;  3JYC A;  2JJ1 G;  2X7R B;  1PKX A;  4TT3 G;  3ZN0 A;  1S5H C;  1CPY A;  2MK3 A;  4EKW A;  4MTO A;  1BMF G;  4U7N A;  3ZRW A;  1RPR A;  4RQF A;  3VBB A;  4JYB A;  1K3E A;  1PD3 A;  3GWO A;  1Y66 A;  2HKO A;  2YSU B;  4MVR A;  1YJ9 V;  1QLN A;  2DWE C;  1JOY A;  3WG7 C;  2WLJ A;  3B77 A;  1AJN A;  4KP4 A;  1AR1 B;  4UV9 A;  1M57 B;  2K1E A;  1NBM G;  2DYR B;  4LBE C;  4PA4 A;  3K0G A;  1M57 C;  3LSS A;  3CMA V;  3GB7 C;  3T2M A;  4BIZ A;  4G2K A;  4XBF A;  1KP3 A;  2WLH A;  3BY6 A;  3ASN C;  1I5X A;  4RUE A;  3B8M A;  2XAS A;  3UM7 A;  1JCH A;  5C93 A;  4RUF A;  2WLL A;  4GT1 A;  1XL4 A;  4MW3 A;  3ZJZ A;  1YTF B;  4KFM A;  2X0L A;  2DYS C;  4DO2 A;  1OCO B;  4FK5 C;  2P7T C;  2YEV A;  3AG1 C;  2BOB C;  3D36 A;  1PNL A;  2R9R B;  1YIJ V;  1OZ0 A;  2ZD9 A;  5IY5 C;  4JTA B;  4FJC C;  3CCS V;  5J9P C;  5B1O A;  3LNM B;  3W7X A;  1KP2 A;  5CA3 A;  3ABM B;  5KA6 A;  1DLB A;  1OHH G;  2WLI A;  3W7S A;  2UXN A;  3M99 B;  1VQ6 V;  4DXW A;  3PJS K;  1R6K A;  4Q20 A;  4MVS A;  2LFS A;  2DQ0 A;  2HR3 A;  3AG4 C;  2WPD G;  3JD1 A;  3TK1 A;  4FIP C;  1ORQ C;  4UVB A;  3ETD A;  1FXK B;  2JEX A;  3WFV A;  2QKS A;  1JVM A;  1DF4 A;  3CCV V;  2DW4 A;  3CME V;  2IW5 A;  4QE7 A;  3SPC A;  3G6E V;  2Q6A A;  2BOC C;  1FFT B;  3ETG A;  1E79 G;  1VQN V;  1GM7 A;  1H8H G;  3DGE A;  3JD3 A;  3STL C;  1NR1 A;  1QR9 A;  2EJR A;  2W0F C;  2Q67 A;  2A9H A;  1KKD A;  2ZDI A;  4JAU A;  4N21 A;  2WLL B;  1M90 W;  1KD1 W;  2ITC C;  2LP7 A;  1VQ5 V;  1M1K W;  1M56 C;  1FXK A;  1K5S A;  4PDR A;  5DM6 V;  4BAY A;  1QVF U;  1PNM A;  3OR6 C;  4E2L A;  3SYA A;  4MS2 A;  2ATK C;  5LHI A;  4MT8 A;  1NH2 D;  3IFX A;  2JIZ G;  3AG4 B;  5IDJ A;  1SRY A;  2XAF A;  2Y69 B;  1K5Q A;  3HPL C;  2EIJ B;  3I56 V;  1VQ4 V;  4JF3 A;  3BEH A;  1XL6 A;  1R3I C;  1SER A;  2WLM A;  1H2G A;  1R73 A;  3RBZ A;  3CCR V;  3HB3 B;  1TUE B;  2EIL B;  2Y48 A;  1K97 A;  1YTF D;  1RPO A;  5CBG A;  2FTK A;  4L87 A;  3JCZ A;  3CC2 V;  3FYI B;  3ZRX A;  1OCO C;  1S72 V;  4FMT A;  1V55 C;  4JTD B;  3QNE A;  1OCC B;  1M9N A;  4GX2 A;  5H9C A;  3TET A;  3MHH C;  4BIU A;  1NVP D;  4WFG A;  4JGS A;  3SYP A;  4XDL A;  4PA3 A;  4UXN A;  3LDD A;  2DYR C;  2XND G;  3SYO A;  3AG2 B;  2OTL V;  1PNK A;  2W6I G;  3X2Q B;  3DTU B;  4WFF A;  4QPJ A;  5LGN A;  3WG7 B;  1QLE C;  2HG5 C;  2P90 A;  1EBO A;  1NR7 A;  3AEI A;  5LHH A;  4P9P A;  1F4M A;  2WLI B;  3SYC A;  5B3S C;  2YEV B;  5B1B B;  2D3O W;  2WAM A;  3ZMZ A;  4LP8 A;  1QBZ A;  3STZ C;  2ZR3 A;  3ASO B;  4RAI A;  4PDV A;  4PA6 A;  1GTO A;  4MTG A;  1S3J A;  4PA9 A;  4XDK A;  2OTJ V;  3EHB B;  1V54 C;  3ZRV A;  1NJI W;  2AHY A;  4PDM A;  3E8B A;  1ENV A;  2WWW A;  1HWY A;  3K9A A;  2PI4 A;  4LC1 A;  3H01 A;  3LDE A;  3OMA B;  4BW5 A;  3SPH A;  1K73 W;  4MVQ A;  2C2A A;  4KUM A;  1W2B U;  2EBO A;  5L3G A;  3MHS C;  1MOF A;  4TSF G;  3FB5 C;  2H94 A;  5LBQ A;  1N8R W;  3G71 V;  4TWK A;  5B1N A;  5HFL A;  4P9O A;  2EIN B;  4LCU C;  3ZIA G;  4FPP A;  2HLD G;  4QIW F;  2B5U A;  2CK3 G;  4QJF B;  1CP9 A;  4MVM A;  3OEE G;  3OR7 C;  3E83 A;  2IH1 C;  3P30 A;  5HFM A;  5L3F A;  4PEL A;  5EC1 C;  1KQS U;  1ROP A;  3ASO C;  2XAG A;  1Q81 W;  4U7O A;  4J9Y B;  1P4R A;  1NVP B;  3QO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...