1Q86W

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1q86W00
3CCSV 3CCJV 3CMAV 1VQPV 1K8AW 1YJNV 1QVGU 1KQSU 2OTJV 1Q81W 3OW2U 1YJ9V 2D3OW 3G71V 1YHQV 3CXCU 3CCMV 1Q82W 3CCLV 3G6EV 3CCEV 4WFAV 1YI2V 1VQMV 4WFBV 1W2BU 1K73W 1Q7YW 1M90W 1QVFU 1VQLV 1VQNV 1VQ8V 3I56V 5DM6V 3CC2V 3CC7V 1VQKV 1YITV 1JJ2U 1VQ5V 2QEXV 3CCVV 1KD1W 4WF9V 1M1KW 2OTLV 3I55V 3CC4V 1Q86W 1YIJV 1KC8W 1VQ6V 1VQOV 3CPWU 1VQ9V 3CD6V 3G4SV 4WCEV 3CMEV 1N8RW 3CCRV 3CCUV 2QA4V 3CCQV 1VQ4V 1S72V 1K9MW 1NJIW 1YJWV 1VQ7V 1R73A
chains in the Genus database with same CATH superfamily
3L71H 3JAWA 2ZE8A 2D2CB 3AK3A 1QR9A 3MAQA 2EINC 5FPOA 4FLZA 3FB6C 2B9ZA 3HKBA 2W6IG 4PDMA 2WSSG 4WFHA 2A79B 2P7TC 3CP1A 2D3OW 4LH7A 4QGPA 1TVKA 1OZ0A 2RNBA 2PGGA 4I4TB 2WA3A 1MG1A 4JZ2A 1Y74B 4I0XB 4LCUC 4LF5O 4O2BB 5KUMA 3SPJA 1GN4A 4DR3B 1U96A 1BHAA 2PY5A 5B1OA 3FB5C 5KMGA 2JDIG 2L6LA 4IIJB 4PA3A 3AG7A 3TJTA 4PDLA 3CC2V 4J9YB 3G67A 2Q7EA 4HYOA 1IBKO 3M8AA 3UM7A 5J2UB 5H9CA 3JASA 4XBFA 5GONB 5JH7A 5BZBA 1O9HA 3CCJV 3ZRWB 3LDCA 1BS3A 4QE9A 2P67A 2QTOA 4LF8O 2Q68A 1T5EA 3OTFA 4KHPB 4UCRA 5JVDA 1MSDA 5IJ9B 1XNRO 4JASA 4X62B 1Y4MA 4YJ3A 3UT5A 4K8XA 4U3JB 1IX9A 4EKWA 4LP8A 2NLJC 2QWPB 3ZRXA 5KLVH 1Q81W 2ZE5A 1CPYA 4ZIBA 1XNQB 1N32O 4JZGA 5AG2A 2CTQA 2GTAA 3VQYA 4NXMO 2EIKC 4LWSA 2CK3G 2RCVA 4EFBA 1VARA 4FK5C 2Q73A 3ABLC 4DV1B 4I55A 1RSOB 1KYOF 1W0KG 3SGIA 2UU9B 3SYPA 4JAVA 1OHHG 4R7CA 1PNMA 1DLBA 1PM9A 1QNMA 5L3FA 4AQYO 2VRZA 3PN1A 2JJ1G 3CYOA 1D5NA 1HW7A 4KXRA 2OWOA 4DUZO 2X6CA 2Q9LA 5JQGB 4NYKA 1S5HC 3KCYA 1AI4A 4NKGB 1AR1B 3I5DA 2AW9A 2RJZA 1VQPV 2V7QG 3DSQA 5LYJB 3RFRA 3ZCCA 4K3AA 1QHTA 3OGIB 4DK0A 3F7YC 3T1YB 5L3BA 1YXBA 4L8JA 5KUKA 2ZQMA 1FPOA 1GH6A 4JI7B 1OCCB 3FB8C 2F23A 4HNAA 1H8HG 1VF7A 5LXTB 4YJ2B 2LP7A 3K59A 3JD2A 2DYSC 4I4TA 4FM1A 1GK9A 3T1HB 1Y74A 4I0XA 1WP7A 4O2BA 5CMUA 3N2KB 5JCOA 2LJ2A 2YIAA 4DV5B 4NTWA 3HB3B 5B1AB 4EB6B 4IIJA 4RWUA 5BMVB 2WWWA 4R50A 3FYIB 1VQ7V 2F4VB 5J2UA 3K0GA 5GONA 4DV4B 5LP6C 3JSLA 3K5NA 3SYQA 4NTXA 3OR6C 1MZEA 2H8PC 2CGOA 4B3SB 4DR5O 3RYCB 3ZRWA 2ZDIC 2H3OA 2K1EA 1NTZH 4N23A 1AJPA 3RN4A 4IGGA 4B3TO 3D36A 4QIWF 1JR9A 3SJCC 5IJ9A 2OIEA 4MW3A 4O2AA 3G6EV 1HNZB 4L87A 4U3JA 3EVKA 3RWRD 1V55B 1UFIA 5KHHA 3ASNC 2Q4PA 1GRJA 2HJFC 5IE9A 4JPRA 1PPJH 3CPWU 3ZN0A 3AG1C 1BSMA 3RT3C 1S3JA 1NJIW 3GVMA 3E22B 1K8AW 1XL6A 2F95B 1RSOA 4Z1VA 4W4LA 3K3WA 4DV7B 1VQLV 1S76D 2JRIA 2Y0IA 4RUEA 3IAYA 4N21A 2ZNIA 2EZOA 2DQ0A 2V1DA 1Q43A 2AHYA 4KHPO 1QVGU 1YCIA 1JMKC 1FJGB 4U7OA 5JQGA 3C3SA 2XUMA 1EN5A 2WLHA 4X62O 1SERA 2EIJC 3MDSA 3QF7A 3OM3B 5H2FZ 4UVCA 3BHPA 1JVMA 5BR8B 5LHGA 4J11A 4HBNA 2YXLA 4TUYB 2VQFB 2ZE7A 3T2MA 2GHYA 2YXYA 3A8TA 1RM1B 4TWKA 1XNQO 3ETEA 4PA4A 4BWAA 1F7YA 2UXDO 4MVZA 3CD6V 1H8EG 3T4DA 4PA6A 5LXTA 4YJ2A 1N36B 2ITCC 4B7EA 2CDYA 1KUQA 4B7KA 3JAMN 4DV6B 2UU9O 2GSMB 1JQ0A 3N2KA 2OCHA 1MA1A 5F2VO 3QG5A 3K04A 4AI8A 4EB6A 2KKWA 1GAXA 1ROPA 4B08A 5BMVA 2ETNA 4LNUB 2IBZH 2XNDG 2N04A 5E79Z 1M9NA 2GUZA 4F6EA 3RYHB 1Y76B 2BE3A 1B6QA 3F5WC 5EK0A 1NR1A 1SQFA 4JI3B 4J41A 3CRMA 3APQA 1GM7A 2LQTA 4LH6A 1X59A 4FLYA 1ENVA 5GTHZ 5CBHA 5KAFZ 4J7KA 4X8AA 1MZFA 1PL4A 1M90W 3G71V 2ZIOA 1YF2A 3T1YO 2M6YA 3FYEB 1Q7YW 1L1FA 1B3QA 4P9OA 1SQQH 2ZNJA 3BA8A 2HHHB 2A7WA 4JI7O 2JJ2G 1OCOC 4JI2B 5EC1C 1M1KW 4RQFA 2IU3A 4ZKIA 5LGUA 2DJVA 4PD4F 2DE0X 2R70A 3RYFB 3BEHA 3JCUZ 2EJRA 2FKXA 4O4HB 4D7TA 1OCRC 3E89A 2QSAA 2RDCA 3ETDA 5KX5B 4WBNB 1PL0A 3STZC 3E22A 1Q6UA 1PNKA 3L74H 3PJSK 3WFVA 3JSNA 3HKEB 3OR7C 5CA0B 2F4VO 2KB1A 4DV4O 3DTUB 1SQGA 5D5PA 2DN9A 3CMAV 4JYYA 3CEIA 1IXBA 4DV0B 2CTRA 4UV9A 3CCLV 2JEXA 3AK1A 1G4YB 2QM7A 4JV5B 3CRRA 3H01A 3NR7A 2XOKG 4JI0O 4QNHB 5DECA 2P90A 4UXNA 3KCXA 2DYRB 3R66A 3AEIA 3BPZA 4U7NA 2OT5A 1FXKB 4TUYA 1TVKB 3ETQA 3W7SA 1SESA 1VQNV 3DC6A 4EEQA 1IURA 3ABMB 2KG7B 1Q3EA 4MVSA 4DV7O 3CRCA 2YIBA 2ADQB 1R6NA 3LDEA 1E1QG 3KKYA 5EYPA 4BIOA 5TISZ 4LF9B 3JASB 4RQEA 3JD3A 1ZL8B 1S0VA 4BIUA 1AILA 3RYHA 1Y76A 3KZIZ 4JI8O 2QA4V 5HFMA 4IL6Z 1AJNA 1VQ4V 1HNWO 4YIPA 1H38A 1BGYH 1YJNV 5JVDB 4GLXA 1SQPH 2XAHA 1LNQA 2EULA 3OW2U 3RYIB 3WG7B 1VF6C 1JA8A 3EXAA 2IJIA 4FLXA 2QKSA 5BR8O 3I56V 2CUGA 1AI5A 1HR0B 2DWDC 2VQFO 3OMIB 5LHHA 1R3JC 4LF7O 1V9PA 5LBQA 1VQ9V 3CCUV 3K08A 4BW9A 2L35A 4I7ZB 2VQEB 2A06H 5CN0A 1N34B 1L0LH 1N36O 1SETA 1D5AA 1NR7A 4X65O 2ZKOA 3RYFA 1W2BU 5C8YB 5LMNB 4DV6O 4O4HA 4JAAA 3T1CA 2QWQB 4NXNB 3CS5A 1BCCH 1NU1H 2CE4A 3MHSC 3ASOC 4WBNA 5KX5A 1M56C 3FKSG 4NTYA 4PJ0Z 2LGQA 3X2QC 3HKEA 2OIGA 5CA0A 4GX0A 4DR7B 3ZHSA 1U97A 3BY6A 2EIMC 1SZTA 3GB7C 5A2QN 1AI7A 2FMLA 1OCZC 1XUQA 5HFLA 1YITV 2NR5A 3QO5A 4FZ0A 1N33B 2IH1C 3VBBA 2Y4TA 5KHJA 1KC8W 1FFTB 1NBMG 3LNNA 2EJ7A 5JWPA 1AI6A 2UUBB 2PUSA 4G28B 3KG2A 5GTIZ 1YHQV 1Q82W 4JI2O 1K73W 2YC0A 3BABA 1ZLZA 4BIZA 2ITDC 1M5IA 4J9ZB 3ZHRA 2P22C 1TUBB 1YTFB 1FXKA 2E74B 4HNAB 3E2EA 2M7WA 1OJHA 4GX5A 5IDJA 4ABMA 2BTQB 2DMXA 5JJNB 1GN3A 2FL4A 3CCSV 5EC2C 3LSUA 4MT8A 5IJ0B 1EFRG 4QE7A 1WJZA 2ZXWB 1VF5B 3ML0A 2KG7A 2F43G 4F6RA 4JAUA 2FYUH 4X66O 2UXCB 3IFXA 4KL1A 3I55V 5EIBD 3CRAA 2QKAA 1I0HA 4JI1B 1ZL8A 1K9MW 3JAKB 2YI9A 5J9PC 3CE2A 2HVKC 1RPRA 2OCCB 2P06A 3EHBB 1OV9A 5IY5C 1VIBA 3RYIA 2UUAO 5B1BB 3CC4V 4RAIA 1M93A 4C7UA 3G6BA 4O4JB 4FLTA 3LSSA 4O2AB 5LMUO 4JTAB 1IBLB 1W0JG 3LUTB 1DF5A 4FIPC 4OPHA 2OTLV 1R6KA 3A0BZ 2ZINA 1K7DA 3D3QA 1VQMV 1K4DC 1URFA 2JGUA 2Q0AA 2BCCH 2EILB 5H6RA 5LOVB 2CGNA 4GX1A 4AILC 3L70H 3DXRA 4JYCA 5C8YA 1VQ6V 1GTOA 4X20B 3ABKC 4CBCA 4LR3A 2JS3A 2YUAA 4YY3B 3C3TA 2AXTZ 4XDKA 1H2LA 2R9RB 4LFBB 4FM0A 5FLXN 2WLNA 3G80A 3LSQA 2IJJA 2LW7A 1E1RG 4YHHB 4CC5A 1ORQC 4DR1O 1GMGA 2BTOA 4I50B 1FD9A 3TXSA 4X88A 5FNVB 3L9DA 1AROP 3ZHVA 1XQ8A 4LF6O 2P6JA 1MABG 2WLLB 5EZYB 3FFQA 4TOIA 1HR0O 4DR6B 3ZHUA 5B3SB 2X7RB 3K06A 4JF3A 1FYJA 4DK1A 3NXSA 3BRCA 1FS0G 2LFSA 2QR4A 3W7TA 2VQEO 1N34O 1TUBA 5KAIZ 2Q67A 5LMNO 2BTQA 1ZSPA 2QM4A 1QBZA 5IT9N 2Z5UA 5JCOC 2Q7HA 2JS5A 4LFAB 5IJ0A 4OX9O 2EX3A 4D7SA 3K9AA 3CMEV 3UKMA 1Z5WA 2GUZB 3P32A 3MD0A 4R6ZA 1G8MA 2HKOA 1I08A 2CH7A 1EN6A 1B06A 3UO2A 1P7GA 3S3WA 3JAKA 5EIBC 3O65A 2PI4A 1WPXA 1NT2B 3D36C 5LL6Y 5JJEB 2UUBO 1R3KC 3E8HA 5JJJB 2JGDB 4O4JA 4RUFA 1IBMB 3U0ZA 3W7UA 4FLUA 1X4TA 3JATB 1F4NA 1M4UA 2Y69B 5DM6V 3F7VC 2X0LA 3AG3B 2XAQA 3OMAB 4FFBA 1P4RA 3RW0A 5IYBO 3ZN1A 3TETA 2AZ0A 4H13B 2GV9A 3N2GB 1P84F 4UB6Z 3E8FA 1VQOV 1NZ6A 5LOVA 3K79A 4DV2B 1KKDA 3E83A 4DR3O 3K5OA 4CC6A 5EBMC 4YXWG 4X20A 4KP4A 4JI5B 2UXCO 4KUMA 3ZMZA 2IW5A 4LF4B 4HAMA 2GBOA 1FXHA 3SYCA 1XILA 3FX7A 1KMIZ 4FPPA 3GWOA 3SPGA 3ZMUA 3BAAA 3CB2A 1VP7A 2P5OA 3OUSA 4MVMA 4I50A 4MTOA 4Z1MG 2Y4UA 4UCVA 1LR1A 4UV8A 5FNVA 4TSFG 4DUYB 2WLLA 4QJFB 4FMTA 1IBLO 5EZYA 1WLEA 4K8ZA 4PV1B 1QQCA 1YVWA 1YZBA 2ODMA 2R9AA 1K97A 1R73A 3RVZA 4X1IB 1M57B 1OCCC 3UO3A 2ZM6B 2YIBD 1GKFA 4UVBA 1FKAO 1WP8A 1UJWB 4DV1O 2ARHA 1SC5B 4YY3O 2IJHA 2E5LB 2QJ1A 4H37A 5EYPB 1H2GA 2E76B 4DR2B 1MSWD 1K34A 4ZI7B 5B1AC 2PYJA 4QPJA 3CCEV 4PELA 1PD3A 5LGNA 1R3IC 2ILMA 2WLMA 1PV0A 2UXNA 1I94B 1DGSA 4H44B 1BQ0A 3H1HH 4JYAB 3D3IA 1S72V 3JD1A 1RP3B 1XHXA 4DR6O 3HKDB 5A9GA 1WB7A 2BOCC 2O57A 2QWRB 4WFBV 1SS3A 3JD0A 1DF4A 4P2ZA 4GX2A 2C2AA 2JGDA 2QWNB 5L3EA 1BT8A 2NNUA 1NH2D 3JATA 3UQ8A 2QTSA 2Y69C 3TK1A 1A32A 4B3MB 2HEPA 3ABTA 1V55C 5IYZA 4U3FH 1IDSA 3T1HO 3N2GA 2E3CA 1NH2B 5FL7G 2WLJA 3FD9A 2HG5C 4DV5O 4LFAO 1VMGA 3JALB 2A0LA 2QEXV 3ZS8C 4GKJB 4IYIA 1QLEB 2XAJA 4TV9A 5CB4B 1PP9H 3OEHG 3WU2Z 2YS8A 2ZCEA 1XMQB 4UCOA 4B3SO 4UVAA 1GN6A 4LBEC 1Y66A 3IC9A 4K0KB 1TAEA 4R8CA 2ZE6A 3VQWA 3E8BA 1L0NH 3ICXA 5CBFA 1GO3F 2YICA 5EBLC 4P9PA 2E75B 2Q5ZA 5B5EZ 1BZKA 4J7ZA 2HR3A 1JPXA 1BQZA 2EINB 3SDLA 1ZWIC 4MTXA 1HNZO 4JI4B 3P30A 5CA1B 3R65A 2HVJC 4FLWA 4X1IA 1RM1C 4LF8B 3CWBH 4FLVA 3OTOB 1I5YA 1XMOB 1K4CC 4J80A 1XNRB 4K35A 5E1AC 3G4SV 1N8RW 1SQBH 3CSXA 4W4KA 4JI5O 4XDJA 1KU9A 2WLIA 4F6RB 2YXHA 5KHKA 1YJ9V 2LFRA 2PF4E 3BA9A 1JOYA 4FM2A 1AVMA 1ZTEA 4CS2A 4ZI7A 3H1KH 3P3NA 4ASUG 2P4KA 1JJOA 4CS3A 2QWOB 3LDDA 1LUVA 1V54B 4WCEV 2Y48A 1F4MA 2XHBA 5IYCO 1YJWV 1FJGO 4J10A 4I9QA 2GDSA 4DUYO 2PYLA 4Q20A 3HKDA 1AJQA 1NTMH 4AQYB 4LFCB 5J2TB 3CXHF 5KHGA 4I5SA 3ZMSA 1K5SA 4JYBA 1HDJA 5KA5A 2ZM6O 2QKCA 1CEZA 2HJDA 1NTKH 4WFAV 1EZJA 2BOBC 3DXRB 4WFEA 4AHCA 1VEWA 2E5LO 4MTFA 3JALA 2V4DA 4MVOA 1P49A 3RGBA 4PDVA 3U11A 1BHBA 2BSKB 2MW2B 4KFMA 5CB4A 1WA8B 3H9VA 1IXMA 2EIKB 2JEUA 4DXWA 1HNXB 2FTKA 3CXCU 2ZIMA 3APOA 3ZJZA 3ABLB 3B09A 1I94O 1S5LZ 3ZHTA 2K9PA 1MOFA 4JI3O 1JJ2U 2B1GA 3FB7C 3VQXA 4J7JA 3SPCA 2HP8A 1Z5VA 2YI8A 1K92A 1MNGA 3M7MX 1THZA 3K58A 4GKKB 2W0XA 1YTFD 2PI5A 3QTCA 1EBOA 2HHHO 3W7XA 3J80N 2UXXA 2ZR3A 2IJKA 2DYRC 5CA1A 1GM9A 5IYDO 5BY1A 4DR5B 5LA6B 1S77D 1FXKC 4B3MO 1K5QA 1N0NA 4JGSA 2XTAA 4OXSA 4B3TB 4DW1A 1G6UA 4BAYA 3SJBC 2DQ3A 2LGWA 1W59A 2ATKC 3ZIAG 4GKJO 4DRXB 3E8GA 2B1IA 3ABMC 3SPHA 1YEWA 4JTDB 4X1KB 1IVSA 2YEVB 2DOSA 4ZHQB 1QU7A 2DYSB 1E79G 1WPBA 4CZZA 3J81N 2W0FC 1XMQO 2CH7B 4MSWC 1TGOA 3B77A 3L72H 4DV0O 4MVUA 1UPGA 1RPOA 2WAMA 4K0KO 4X89A 5BXZA 1V54C 3CX5F 5IWAB 2CTPA 2VS0A 1PNLA 4TV8A 3A0RA 4JV5O 4O4IA 4IHJA 2Z3YA 1Q6HA 1Y67A 3AG2B 5LP6B 3WG7C 4IT5A 4JI4O 1H2MA 3ABUA 5J2TA 3CJHB 4FFBB 3RVYA 3K57A 3OTOO 5CA3A 4UB8Z 1QCEA 1XMOO 1SQVH 2PTMA 1HWYA 1EM1A 1IZ3A 4NVPA 3TGUH 1SA0B 1BE3H 5H6QA 1TA8A 3K9SA 2OTJV 3IGAC 4LF9O 4CH3A 2YIDA 4FFKA 3ASNB 3ETGA 5K1XA 4OGQB 4DV3B 3IJ4A 2DW4A 2UXDB 2BSKA 2JK5C 3AG1B 1AB3A 1WA8A 2XT9A 1SF9A 4TQDA 3OFNG 1H2SB 1WNSA 4ZOLA 4MVQA 3M99B 1FAFA 3CCRV 3BCCH 5B1NA 4WFGA 2JVDA 2UUCB 4MW8A 4TQFA 1RFYA 3SYOA 1I7FA 4LFCO 4GT1A 1ZX3A 4WF9V 3TXQA 3U10A 1MMMA 5L3CA 3P3PA 1BMFG 3L73H 3SYAA 2EIJB 5LA6A 3HKCB 3BVOA 2WLKA 1F51A 4X1YB 1AR5A 2QGNA 4BW5A 2QE7G 4JI6B 4PA9A 4CH4A 2UXBB 4G2KA 1N0JA 4NXNO 2W6JG 2EZPA 2KQXA 1O9GA 1PKXA 3GWKC 4DRXA 2ZXWC 1JFFB 2AGAA 5B66Z 4X1KA 2YEVA 2RN9A 4ZHQA 1JCHA 1HNXO 3OEEG 4DR7O 2ZT9B 1COWG 3OGCC 3RBZA 1N33O 3SJQC 4B3RB 4YIOA 3ZBHA 1ZUQA 1QLNA 3B8NA 1J5EB 2OCCC 4GKKO 4FJCC 3SR2C 1R3LC 3ZRSA 2CTWA 2H94A 3JCZA 3B2EE 2HFEC 3VQVA 5LP6A 3AG2C 1XL4A 5B1BC 3W7WA 5CBGA 3EFFK 4O4LB 2ZDIA 2Q0OC 3CJHA 4G27B 1XOUA 4IYHA 3K5MA 2F93B 1AP6A 4PI2A 2YDEA 2R9IA 5IYZB 4DR4B 1DTOA 3TCUA 2AHZA 4EFEA 1HP8A 2EILC 5C93A 1FFXB 2Q69A 2Q6AA 4PA7A 4PI0A 1OCOB 1Q90D 4JI0B 2GTSA 1SA0A 4X64B 1CP9A 3CCMV 4TV9B 2X6AA 4A5UB 1S5JA 2QDOA 2RQ6A 4H0LB 4MVRA 4JI1O 4GCZA 5L3DA 3A0HZ 4D6TH 3C90A 3ZMVA 3ZEDA 1OCRB 1D2DA 5FPRA 1Q8IA 3CCQV 5IWAO 4NR1A 3K0DA 4Q6GA 4UCTA 4DO2A 2F66C 1F23A 1I5XA 3CRQA 4J42A 4QPKA 1P7BA 1Y6XA 5ITZB 1GN2A 1QVFU 2LO1A 4P30A 2IU0A 4X9QA 2NN4A 3OUFA 3OMNB 1NS1A 2P4VA 1Q86W 4ICGA 2QM8A 2Y0PA 5B3SC 3HPLC 5LHIA 3WB1A 2IH3C 4JI8B 1HNWB 5K1PA 1YI2V 1TUEB 2WA4A 1H2NA 4UCSA 3S3XA 3HKCA 1SKVA 5LYJA 4X1YA 1SRYA 4TT3G 3F5TA 3SPIA 4MS2A 3AG4B 2WLIB 1DK1A 5DN6G 1WB8A 2WPDG 4PDRA 1AP5A 5DEDA 4BR6A 4CS4A 4LF7B 3QO8A 4DV3O 1B04A 2G38A 4LFBO 1Q5OA 1JFFA 4DYLA 4OPAA 1R6TA 3T4ZA 2XASA 2N05A 4YHHO 2ADPA 4X65B 1N4CA 5LGTA 2UUCO 3VOUA 3HR0A 2LW1A 2YSUB 1NVPD 3L75H 3QNEA 5D5QA 5KA6A 4RO2A 1XHZA 1Q6IA 1AR4A 4XDLA 1NVPB 3O9OA 1XREA 2A9HA 3N27A 1XEQA 3DGEA 1ZAUA 3B4SA 4O4LA 3RYCA 2R72A 3E86A 2FB5A 3STLC 2ZD9A 3JARB 3AG3C 3AK2A 4JI6O 2UXBO 1YSCA 3OAAG 3JYCA 2RMKB 4FZ1A 3Q4HB 4F4LA 2KSDA 1FFXA 3SJAC 2Z0AA 1BL8A 4DW0A 1WN7A 3WB2A 1KD1W 4H33A 1G1XB 3OE7G 1YIJV 1Z2GA 4I9WA 4WFFA 2JIZG 1LUWA 2N74A 4GUNA 1EN4A 2VWKA 4LF5B 4B3RO 3ASOB 3LNMB 1M56B 3FAVB 1J5EO 3UCSC 1NKDA 3X2QB 4CH6A 1WAZA 1QR8A 3CCVV 3BFRA 5ITZA 2IM9A 3QO7A 4X66B 3JAWB 3ZHQA 1CXZB 5EBWC 5H5NA 2VWJA 1IBKB 2EIMB 1JX9A 4E4EA 1J95A 4MTGA 2DWEC 1OCZB 1IBMO 3ZRVA 1US6A 1KQSU 4Z2WA 5GW7A 3HKBB 5L3GA 1SQXH 4DR4O 1SZXA 4GYCB 1VQ5V 3OD4A 1M57C 3THOA 3H1IH 4DV2O 2CAZC 3J7AU 4GZRB 2UUAB 3A2FA 4X64O 2OYQA 3CHXA 5LMUB 3AG4C 1K3EA 3OT7A 3K03A 4LF4O 1EZVH 2HLDG 4ZBMA 1YDXA 1R1BA 3CC7V 2X6BA 3IC7A 1N32B 1K33A 2MK3A 3H1JH 4E2LA 4NXMB 5KMGB 4NB5A 4TV8B 3JD4A 1KP2A 4O4IB 4UFZA 1XI1A 4IHJB 4UCUA 5JH7B 1L8DA 4LNUA 2Q8VA 1KP3A 3B8MA 1KKCA 2EBOA 1XBLA 3H1LH 4DUZB 4DR1B 4FVMA 5IY5B 1NQTA 1VF6A 1GM8A 4JTCB 3JARA 4YJ3B 3UT5B 3ZX6A 4LF6B 3D8CA 3ZMTA 4CH5A 2PZSA 1H2KA 2AZ2A 3Q4HA 4LC1A 5KHIA 3DC5A 4PHZA 4DR2O 3E35A 2Q7GA 2XAGA 4UUJC 1QLEC 1FXVA 3QVNA 3MHHC 4LWSB 3K5LA 2XAFA 2B5UA 2F1MA 2ZR2A 1VQ8V 4I55B 1XDCA 3ABKB 4ZOLB 1VQKV 4JYAO 1KECA 4HZ3A 3FAVA 3B40A 3WB0A 2A3QA 4OX9B 1KB9F 1NI8A 1KBHA
chains in the Genus database with same CATH topology
3SPGA 3CMAV 3ZMUA 3SYOA 4UV9A 3OUSA 4MVMA 3CCLV 4MTOA 4Z1MG 1QR9A 2JEXA 4GT1A 4UV8A 4TSFG 2EINC 4WF9V 3FB6C 2WLLA 4QJFB 4FMTA 5L3CA 2W6IG 1G4YB 2QM7A 1WLEA 3H01A 4PDMA 2XOKG 2WSSG 1BMFG 4QNHB 3SYAA 2EIJB 4WFHA 1K97A 2A79B 1R73A 2P90A 4UXNA 3RVZA 2DYRB 2P7TC 2WLKA 1M57B 1F51A 3AEIA 4U7NA 1OCCC 2OT5A 1FXKB 4BW5A 3CP1A 2D3OW 2QE7G 4PA9A 3W7SA 4G2KA 1SESA 2W6JG 1GKFA 4UVBA 1VQNV 2EZPA 1UJWB 1PKXA 1OZ0A 1MG1A 2ZXWC 2IJHA 2YEVA 3ABMB 4LCUC 1JCHA 4H37A 5KUMA 3OEEG 1H2GA 1MSWD 1K34A 4MVSA 5B1AC 3SPJA 1COWG 3OGCC 1R6NA 4QPJA 1BHAA 3LDEA 1E1QG 5B1OA 3FB5C 3RBZA 3CCEV 4PELA 2JDIG 4PA3A 1PD3A 5LGNA 4PDLA 3CC2V 1R3IC 3SJQC 2WLMA 3JD3A 4J9YB 4RQEA 1S0VA 2UXNA 4HYOA 1QLNA 4BIUA 3B8NA 3UM7A 5H9CA 4XBFA 2OCCC 4FJCC 1R3LC 3ZRSA 2H94A 5BZBA 2QA4V 3JCZA 5HFMA 1AJNA 3D3IA 1S72V 1VQ4V 3JD1A 2HFEC 3CCJV 3ZRWB 3AG2C 1H38A 3LDCA 1YJNV 1XL4A 5B1BC 2XAHA 4QE9A 2P67A 3W7WA 5B1NA 1LNQA 2QTOA 2BOCC 3OW2U 2Q68A 3WG7B 5CBGA 4WFBV 3EFFK 2IJIA 2QKSA 2ZDIA 3JD0A 3I56V 1DF4A 4G27B 1AI5A 4P2ZA 4GX2A 2C2AA 2DWDC 4JASA 3OMIB 5L3EA 2R9IA 5LHHA 1Y4MA 2NNUA 1NH2D 1R3JC 1DTOA 3TCUA 5LBQA 2AHZA 2Y69C 1VQ9V 3TK1A 2EILC 5C93A 3K08A 3CCUV 3ABTA 1V55C 2Q69A 2Q6AA 4PA7A 4EKWA 1OCOB 4LP8A 2NLJC 5CN0A 3ZRXA 1NH2B 1SETA 1Q81W 5FL7G 1CP9A 2WLJA 1NR7A 3CCMV 2HG5C 2X6AA 1W2BU 1CPYA 2A0LA 4MVRA 2QEXV 4GCZA 3T1CA 5L3DA 3MHSC 1QLEB 2XAJA 2EIKC 2CK3G 3ZMVA 3OEHG 1OCRB 3ASOC 4FK5C 3ABLC 1M56C 3FKSG 1W0KG 3CCQV 3K0DA 3X2QC 4DO2A 1F23A 1I5XA 3SYPA 4UVAA 4JAVA 4QPKA 4LBEC 1OHHG 1Y66A 1P7BA 4GX0A 4R7CA 1PNMA 3BY6A 2EIMC 1SZTA 3GB7C 1DLBA 5L3FA 1QVFU 4R8CA 1AI7A 4P30A 2IU0A 1OCZC 5HFLA 1YITV 2JJ1G 3CYOA 3OUFA 3OMNB 3E8BA 5CBFA 1GO3F 3QO5A 2IH1C 3VBBA 1Q86W 2X6CA 5EBLC 4P9PA 1KC8W 1FFTB 2QM8A 1NBMG 1S5HC 5B3SC 1AI4A 3HPLC 1AR1B 5LHIA 2HR3A 1JPXA 2EINB 1VQPV 2IH3C 1AI6A 1ZWIC 2V7QG 4MTXA 3P30A 4G28B 3KG2A 3R65A 3ZCCA 1YHQV 1Q82W 1K73W 1YI2V 1TUEB 2HVJC 4BIZA 2ITDC 4J9ZB 1RM1C 1SRYA 1YTFB 1FXKA 3F7YC 5L3BA 4TT3G 3E2EA 3SPIA 4MS2A 5KUKA 1I5YA 2M7WA 2ZQMA 3AG4B 1OCCB 2WLIB 1K4CC 5DN6G 4PDRA 2WPDG 4GX5A 3FB8C 5E1AC 5IDJA 3G4SV 1N8RW 1H8HG 3QO8A 4XDJA 2LP7A 2WLIA 3CCSV 3JD2A 5EC2C 2DYSC 4MT8A 1YJ9V 1GK9A 2LFRA 1EFRG 4QE7A 3ML0A 2ZXWB 3T4ZA 5CMUA 1JOYA 2F43G 2XASA 4JAUA 4ASUG 3IFXA 3HB3B 5LGTA 3LDDA 5B1AB 3I55V 1V54B 3VOUA 4WCEV 2YSUB 2Y48A 1NVPD 1F4MA 2WWWA 1K9MW 4R50A 5IYCO 1YJWV 3FYIB 3QNEA 1VQ7V 5J9PC 5KA6A 3K0GA 4RO2A 2HVKC 3SYQA 3OR6C 2H8PC 1RPRA 4XDLA 2OCCB 1NVPB 3EHBB 4Q20A 2ZDIC 3ZRWA 2A9HA 1AJQA 5IY5C 2K1EA 4N23A 1AJPA 3DGEA 5B1BB 3CC4V 4RAIA 3D36A 4QIWF 4I5SA 3ZMSA 3E86A 3LSSA 1K5SA 4JTAB 3STLC 2ZD9A 4JYBA 1W0JG 3AG3C 1DF5A 3LUTB 4FIPC 5KA5A 1R6KA 2OTLV 1YSCA 3OAAG 4MW3A 3JYCA 1CEZA 4F4LA 1K7DA 3G6EV 4WFAV 1EZJA 2BOBC 1VQMV 1K4DC 4L87A 4WFEA 1BL8A 2EILB 5H6RA 4GX1A 1V55B 1KD1W 4H33A 3ASNC 3OE7G 1YIJV 4MTFA 4JYCA 2HJFC 1VQ6V 4JPRA 1GTOA 3CPWU 3ZN0A 3AG1C 4MVOA 3ABKC 4PDVA 4CBCA 1S3JA 4I9WA 4WFFA 1NJIW 1BHBA 2JIZG 4KFMA 1K8AW 4XDKA 1IXMA 1XL6A 2EIKB 2JEUA 2R9RB 4DXWA 2FTKA 3CXCU 3ASOB 3K3WA 3ABLB 3ZJZA 3LNMB 1M56B 1VQLV 1S76D 1MOFA 2WLNA 1JJ2U 3LSQA 1NKDA 3X2QB 3CCVV 1QR8A 2B1GA 2IJJA 3FB7C 3SPCA 4RUEA 1E1RG 1K92A 1ORQC 3QO7A 1THZA 4N21A 5EBWC 1GMGA 2EZOA 2EIMB 2DQ0A 1JX9A 2V1DA 1J95A 4MTGA 2DWEC 1OCZB 4X88A 3ZRVA 1AROP 2AHYA 1QVGU 1KQSU 1YTFD 2PI5A 4U7OA 1EBOA 2P6JA 1MABG 2WLLB 5GW7A 3W7XA 5L3GA 2WLHA 2UXXA 1SERA 2EIJC 5B3SB 2ZR3A 3OM3B 2X7RB 2IJKA 3K06A 2DYRC 4JF3A 4UVCA 1VQ5V 1GM9A 5IYDO 1M57C 3NXSA 1JVMA 1FS0G 1FXKC 2LFSA 1S77D 1K5QA 5LHGA 4JGSA 3W7TA 4OXSA 3T2MA 2GHYA 2Q67A 1RM1B 4TWKA 3AG4C 4BAYA 1K3EA 3ETEA 4PA4A 2DQ3A 2ATKC 4MVZA 3K03A 3CD6V 3ZIAG 1H8EG 3T4DA 3E8GA 4PA6A 2B1IA 2HLDG 3ABMC 1QBZA 4ZBMA 3SPHA 2Z5UA 2ITCC 4JTDB 2YEVB 3CC7V 2X6BA 3IC7A 2DYSB 1E79G 1K33A 2MK3A 4CZZA 2GSMB 2W0FC 4E2LA 1JQ0A 4MSWC 3K9AA 3CMEV 3UKMA 3B77A 3K04A 3P32A 4MVUA 3MD0A 4R6ZA 1G8MA 1RPOA 2WAMA 2HKOA 3JD4A 1KP2A 4X89A 1ROPA 1V54C 2XNDG 1M9NA 1PNLA 1B6QA 3A0RA 3F5WC 5EK0A 1NR1A 2PI4A 1WPXA 2Z3YA 1KP3A 3B8MA 1GM7A 3AG2B 2EBOA 3WG7C 1ENVA 3ABUA 1R3KC 5CBHA 3E8HA 4X8AA 5IY5B 1NQTA 1M90W 1GM8A 4JTCB 3G71V 4RUFA 3RVYA 3W7UA 5CA3A 3FYEB 1Q7YW 1QCEA 3ZMTA 1L1FA 1F4NA 2Y69B 4P9OA 5DM6V 2JJ2G 1OCOC 3F7VC 2X0LA 3AG3B 2XAQA 3OMAB 5EC1C 1P4RA 3RW0A 5IYBO 3ZN1A 4RQFA 1M1KW 1HWYA 2IU3A 4ZKIA 4LC1A 5LGUA 3TETA 3E8FA 1VQOV 5H6QA 3E35A 3K79A 1KKDA 3E83A 3BEHA 2XAGA 2OTJV 4UUJC 1QLEC 1FXVA 2EJRA 5EBMC 4YXWG 3IGAC 1OCRC 3E89A 3MHHC 3ASNB 3ETGA 3ETDA 4KP4A 2XAFA 2B5UA 2DW4A 2ZR2A 1PL0A 2JK5C 3AG1B 4KUMA 3ZMZA 1VQ8V 2IW5A 3ABKB 3STZC 4HAMA 1PNKA 1VQKV 3PJSK 1FXHA 3SYCA 1KECA 3WFVA 3OFNG 4HZ3A 3OR7C 2KB1A 4MVQA 3DTUB 3M99B 4FPPA 3CCRV 4WFGA 3GWOA 4MW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS V;  3CCJ V;  3CMA V;  1VQP V;  1K8A W;  1YJN V;  1QVG U;  1KQS U;  2OTJ V;  1Q81 W;  3OW2 U;  1YJ9 V;  2D3O W;  3G71 V;  1YHQ V;  3CXC U;  3CCM V;  1Q82 W;  3CCL V;  3G6E V;  3CCE V;  4WFA V;  1YI2 V;  1VQM V;  4WFB V;  1W2B U;  1K73 W;  1Q7Y W;  1M90 W;  1QVF U;  1VQL V;  1VQN V;  1VQ8 V;  3I56 V;  5DM6 V;  3CC2 V;  3CC7 V;  1VQK V;  1YIT V;  1JJ2 U;  1VQ5 V;  2QEX V;  3CCV V;  1KD1 W;  4WF9 V;  1M1K W;  2OTL V;  3I55 V;  3CC4 V;  1Q86 W;  1YIJ V;  1KC8 W;  1VQ6 V;  1VQO V;  3CPW U;  1VQ9 V;  3CD6 V;  3G4S V;  4WCE V;  3CME V;  1N8R W;  3CCR V;  3CCU V;  2QA4 V;  3CCQ V;  1VQ4 V;  1S72 V;  1K9M W;  1NJI W;  1YJW V;  1VQ7 V;  1R73 A; 
#chains in the Genus database with same CATH topology
 3L71 H;  3JAW A;  2ZE8 A;  2D2C B;  3AK3 A;  1QR9 A;  3MAQ A;  2EIN C;  5FPO A;  4FLZ A;  3FB6 C;  2B9Z A;  3HKB A;  2W6I G;  4PDM A;  2WSS G;  4WFH A;  2A79 B;  2P7T C;  3CP1 A;  2D3O W;  4LH7 A;  4QGP A;  1TVK A;  1OZ0 A;  2RNB A;  2PGG A;  4I4T B;  2WA3 A;  1MG1 A;  4JZ2 A;  1Y74 B;  4I0X B;  4LCU C;  4LF5 O;  4O2B B;  5KUM A;  3SPJ A;  1GN4 A;  4DR3 B;  1U96 A;  1BHA A;  2PY5 A;  5B1O A;  3FB5 C;  5KMG A;  2JDI G;  2L6L A;  4IIJ B;  4PA3 A;  3AG7 A;  3TJT A;  4PDL A;  3CC2 V;  4J9Y B;  3G67 A;  2Q7E A;  4HYO A;  1IBK O;  3M8A A;  3UM7 A;  5J2U B;  5H9C A;  3JAS A;  4XBF A;  5GON B;  5JH7 A;  5BZB A;  1O9H A;  3CCJ V;  3ZRW B;  3LDC A;  1BS3 A;  4QE9 A;  2P67 A;  2QTO A;  4LF8 O;  2Q68 A;  1T5E A;  3OTF A;  4KHP B;  4UCR A;  5JVD A;  1MSD A;  5IJ9 B;  1XNR O;  4JAS A;  4X62 B;  1Y4M A;  4YJ3 A;  3UT5 A;  4K8X A;  4U3J B;  1IX9 A;  4EKW A;  4LP8 A;  2NLJ C;  2QWP B;  3ZRX A;  5KLV H;  1Q81 W;  2ZE5 A;  1CPY A;  4ZIB A;  1XNQ B;  1N32 O;  4JZG A;  5AG2 A;  2CTQ A;  2GTA A;  3VQY A;  4NXM O;  2EIK C;  4LWS A;  2CK3 G;  2RCV A;  4EFB A;  1VAR A;  4FK5 C;  2Q73 A;  3ABL C;  4DV1 B;  4I55 A;  1RSO B;  1KYO F;  1W0K G;  3SGI A;  2UU9 B;  3SYP A;  4JAV A;  1OHH G;  4R7C A;  1PNM A;  1DLB A;  1PM9 A;  1QNM A;  5L3F A;  4AQY O;  2VRZ A;  3PN1 A;  2JJ1 G;  3CYO A;  1D5N A;  1HW7 A;  4KXR A;  2OWO A;  4DUZ O;  2X6C A;  2Q9L A;  5JQG B;  4NYK A;  1S5H C;  3KCY A;  1AI4 A;  4NKG B;  1AR1 B;  3I5D A;  2AW9 A;  2RJZ A;  1VQP V;  2V7Q G;  3DSQ A;  5LYJ B;  3RFR A;  3ZCC A;  4K3A A;  1QHT A;  3OGI B;  4DK0 A;  3F7Y C;  3T1Y B;  5L3B A;  1YXB A;  4L8J A;  5KUK A;  2ZQM A;  1FPO A;  1GH6 A;  4JI7 B;  1OCC B;  3FB8 C;  2F23 A;  4HNA A;  1H8H G;  1VF7 A;  5LXT B;  4YJ2 B;  2LP7 A;  3K59 A;  3JD2 A;  2DYS C;  4I4T A;  4FM1 A;  1GK9 A;  3T1H B;  1Y74 A;  4I0X A;  1WP7 A;  4O2B A;  5CMU A;  3N2K B;  5JCO A;  2LJ2 A;  2YIA A;  4DV5 B;  4NTW A;  3HB3 B;  5B1A B;  4EB6 B;  4IIJ A;  4RWU A;  5BMV B;  2WWW A;  4R50 A;  3FYI B;  1VQ7 V;  2F4V B;  5J2U A;  3K0G A;  5GON A;  4DV4 B;  5LP6 C;  3JSL A;  3K5N A;  3SYQ A;  4NTX A;  3OR6 C;  1MZE A;  2H8P C;  2CGO A;  4B3S B;  4DR5 O;  3RYC B;  3ZRW A;  2ZDI C;  2H3O A;  2K1E A;  1NTZ H;  4N23 A;  1AJP A;  3RN4 A;  4IGG A;  4B3T O;  3D36 A;  4QIW F;  1JR9 A;  3SJC C;  5IJ9 A;  2OIE A;  4MW3 A;  4O2A A;  3G6E V;  1HNZ B;  4L87 A;  4U3J A;  3EVK A;  3RWR D;  1V55 B;  1UFI A;  5KHH A;  3ASN C;  2Q4P A;  1GRJ A;  2HJF C;  5IE9 A;  4JPR A;  1PPJ H;  3CPW U;  3ZN0 A;  3AG1 C;  1BSM A;  3RT3 C;  1S3J A;  1NJI W;  3GVM A;  3E22 B;  1K8A W;  1XL6 A;  2F95 B;  1RSO A;  4Z1V A;  4W4L A;  3K3W A;  4DV7 B;  1VQL V;  1S76 D;  2JRI A;  2Y0I A;  4RUE A;  3IAY A;  4N21 A;  2ZNI A;  2EZO A;  2DQ0 A;  2V1D A;  1Q43 A;  2AHY A;  4KHP O;  1QVG U;  1YCI A;  1JMK C;  1FJG B;  4U7O A;  5JQG A;  3C3S A;  2XUM A;  1EN5 A;  2WLH A;  4X62 O;  1SER A;  2EIJ C;  3MDS A;  3QF7 A;  3OM3 B;  5H2F Z;  4UVC A;  3BHP A;  1JVM A;  5BR8 B;  5LHG A;  4J11 A;  4HBN A;  2YXL A;  4TUY B;  2VQF B;  2ZE7 A;  3T2M A;  2GHY A;  2YXY A;  3A8T A;  1RM1 B;  4TWK A;  1XNQ O;  3ETE A;  4PA4 A;  4BWA A;  1F7Y A;  2UXD O;  4MVZ A;  3CD6 V;  1H8E G;  3T4D A;  4PA6 A;  5LXT A;  4YJ2 A;  1N36 B;  2ITC C;  4B7E A;  2CDY A;  1KUQ A;  4B7K A;  3JAM N;  4DV6 B;  2UU9 O;  2GSM B;  1JQ0 A;  3N2K A;  2OCH A;  1MA1 A;  5F2V O;  3QG5 A;  3K04 A;  4AI8 A;  4EB6 A;  2KKW A;  1GAX A;  1ROP A;  4B08 A;  5BMV A;  2ETN A;  4LNU B;  2IBZ H;  2XND G;  2N04 A;  5E79 Z;  1M9N A;  2GUZ A;  4F6E A;  3RYH B;  1Y76 B;  2BE3 A;  1B6Q A;  3F5W C;  5EK0 A;  1NR1 A;  1SQF A;  4JI3 B;  4J41 A;  3CRM A;  3APQ A;  1GM7 A;  2LQT A;  4LH6 A;  1X59 A;  4FLY A;  1ENV A;  5GTH Z;  5CBH A;  5KAF Z;  4J7K A;  4X8A A;  1MZF A;  1PL4 A;  1M90 W;  3G71 V;  2ZIO A;  1YF2 A;  3T1Y O;  2M6Y A;  3FYE B;  1Q7Y W;  1L1F A;  1B3Q A;  4P9O A;  1SQQ H;  2ZNJ A;  3BA8 A;  2HHH B;  2A7W A;  4JI7 O;  2JJ2 G;  1OCO C;  4JI2 B;  5EC1 C;  1M1K W;  4RQF A;  2IU3 A;  4ZKI A;  5LGU A;  2DJV A;  4PD4 F;  2DE0 X;  2R70 A;  3RYF B;  3BEH A;  3JCU Z;  2EJR A;  2FKX A;  4O4H B;  4D7T A;  1OCR C;  3E89 A;  2QSA A;  2RDC A;  3ETD A;  5KX5 B;  4WBN B;  1PL0 A;  3STZ C;  3E22 A;  1Q6U A;  1PNK A;  3L74 H;  3PJS K;  3WFV A;  3JSN A;  3HKE B;  3OR7 C;  5CA0 B;  2F4V O;  2KB1 A;  4DV4 O;  3DTU B;  1SQG A;  5D5P A;  2DN9 A;  3CMA V;  4JYY A;  3CEI A;  1IXB A;  4DV0 B;  2CTR A;  4UV9 A;  3CCL V;  2JEX A;  3AK1 A;  1G4Y B;  2QM7 A;  4JV5 B;  3CRR A;  3H01 A;  3NR7 A;  2XOK G;  4JI0 O;  4QNH B;  5DEC A;  2P90 A;  4UXN A;  3KCX A;  2DYR B;  3R66 A;  3AEI A;  3BPZ A;  4U7N A;  2OT5 A;  1FXK B;  4TUY A;  1TVK B;  3ETQ A;  3W7S A;  1SES A;  1VQN V;  3DC6 A;  4EEQ A;  1IUR A;  3ABM B;  2KG7 B;  1Q3E A;  4MVS A;  4DV7 O;  3CRC A;  2YIB A;  2ADQ B;  1R6N A;  3LDE A;  1E1Q G;  3KKY A;  5EYP A;  4BIO A;  5TIS Z;  4LF9 B;  3JAS B;  4RQE A;  3JD3 A;  1ZL8 B;  1S0V A;  4BIU A;  1AIL A;  3RYH A;  1Y76 A;  3KZI Z;  4JI8 O;  2QA4 V;  5HFM A;  4IL6 Z;  1AJN A;  1VQ4 V;  1HNW O;  4YIP A;  1H38 A;  1BGY H;  1YJN V;  5JVD B;  4GLX A;  1SQP H;  2XAH A;  1LNQ A;  2EUL A;  3OW2 U;  3RYI B;  3WG7 B;  1VF6 C;  1JA8 A;  3EXA A;  2IJI A;  4FLX A;  2QKS A;  5BR8 O;  3I56 V;  2CUG A;  1AI5 A;  1HR0 B;  2DWD C;  2VQF O;  3OMI B;  5LHH A;  1R3J C;  4LF7 O;  1V9P A;  5LBQ A;  1VQ9 V;  3CCU V;  3K08 A;  4BW9 A;  2L35 A;  4I7Z B;  2VQE B;  2A06 H;  5CN0 A;  1N34 B;  1L0L H;  1N36 O;  1SET A;  1D5A A;  1NR7 A;  4X65 O;  2ZKO A;  3RYF A;  1W2B U;  5C8Y B;  5LMN B;  4DV6 O;  4O4H A;  4JAA A;  3T1C A;  2QWQ B;  4NXN B;  3CS5 A;  1BCC H;  1NU1 H;  2CE4 A;  3MHS C;  3ASO C;  4WBN A;  5KX5 A;  1M56 C;  3FKS G;  4NTY A;  4PJ0 Z;  2LGQ A;  3X2Q C;  3HKE A;  2OIG A;  5CA0 A;  4GX0 A;  4DR7 B;  3ZHS A;  1U97 A;  3BY6 A;  2EIM C;  1SZT A;  3GB7 C;  5A2Q N;  1AI7 A;  2FML A;  1OCZ C;  1XUQ A;  5HFL A;  1YIT V;  2NR5 A;  3QO5 A;  4FZ0 A;  1N33 B;  2IH1 C;  3VBB A;  2Y4T A;  5KHJ A;  1KC8 W;  1FFT B;  1NBM G;  3LNN A;  2EJ7 A;  5JWP A;  1AI6 A;  2UUB B;  2PUS A;  4G28 B;  3KG2 A;  5GTI Z;  1YHQ V;  1Q82 W;  4JI2 O;  1K73 W;  2YC0 A;  3BAB A;  1ZLZ A;  4BIZ A;  2ITD C;  1M5I A;  4J9Z B;  3ZHR A;  2P22 C;  1TUB B;  1YTF B;  1FXK A;  2E74 B;  4HNA B;  3E2E A;  2M7W A;  1OJH A;  4GX5 A;  5IDJ A;  4ABM A;  2BTQ B;  2DMX A;  5JJN B;  1GN3 A;  2FL4 A;  3CCS V;  5EC2 C;  3LSU A;  4MT8 A;  5IJ0 B;  1EFR G;  4QE7 A;  1WJZ A;  2ZXW B;  1VF5 B;  3ML0 A;  2KG7 A;  2F43 G;  4F6R A;  4JAU A;  2FYU H;  4X66 O;  2UXC B;  3IFX A;  4KL1 A;  3I55 V;  5EIB D;  3CRA A;  2QKA A;  1I0H A;  4JI1 B;  1ZL8 A;  1K9M W;  3JAK B;  2YI9 A;  5J9P C;  3CE2 A;  2HVK C;  1RPR A;  2OCC B;  2P06 A;  3EHB B;  1OV9 A;  5IY5 C;  1VIB A;  3RYI A;  2UUA O;  5B1B B;  3CC4 V;  4RAI A;  1M93 A;  4C7U A;  3G6B A;  4O4J B;  4FLT A;  3LSS A;  4O2A B;  5LMU O;  4JTA B;  1IBL B;  1W0J G;  3LUT B;  1DF5 A;  4FIP C;  4OPH A;  2OTL V;  1R6K A;  3A0B Z;  2ZIN A;  1K7D A;  3D3Q A;  1VQM V;  1K4D C;  1URF A;  2JGU A;  2Q0A A;  2BCC H;  2EIL B;  5H6R A;  5LOV B;  2CGN A;  4GX1 A;  4AIL C;  3L70 H;  3DXR A;  4JYC A;  5C8Y A;  1VQ6 V;  1GTO A;  4X20 B;  3ABK C;  4CBC A;  4LR3 A;  2JS3 A;  2YUA A;  4YY3 B;  3C3T A;  2AXT Z;  4XDK A;  1H2L A;  2R9R B;  4LFB B;  4FM0 A;  5FLX N;  2WLN A;  3G80 A;  3LSQ A;  2IJJ A;  2LW7 A;  1E1R G;  4YHH B;  4CC5 A;  1ORQ C;  4DR1 O;  1GMG A;  2BTO A;  4I50 B;  1FD9 A;  3TXS A;  4X88 A;  5FNV B;  3L9D A;  1ARO P;  3ZHV A;  1XQ8 A;  4LF6 O;  2P6J A;  1MAB G;  2WLL B;  5EZY B;  3FFQ A;  4TOI A;  1HR0 O;  4DR6 B;  3ZHU A;  5B3S B;  2X7R B;  3K06 A;  4JF3 A;  1FYJ A;  4DK1 A;  3NXS A;  3BRC A;  1FS0 G;  2LFS A;  2QR4 A;  3W7T A;  2VQE O;  1N34 O;  1TUB A;  5KAI Z;  2Q67 A;  5LMN O;  2BTQ A;  1ZSP A;  2QM4 A;  1QBZ A;  5IT9 N;  2Z5U A;  5JCO C;  2Q7H A;  2JS5 A;  4LFA B;  5IJ0 A;  4OX9 O;  2EX3 A;  4D7S A;  3K9A A;  3CME V;  3UKM A;  1Z5W A;  2GUZ B;  3P32 A;  3MD0 A;  4R6Z A;  1G8M A;  2HKO A;  1I08 A;  2CH7 A;  1EN6 A;  1B06 A;  3UO2 A;  1P7G A;  3S3W A;  3JAK A;  5EIB C;  3O65 A;  2PI4 A;  1WPX A;  1NT2 B;  3D36 C;  5LL6 Y;  5JJE B;  2UUB O;  1R3K C;  3E8H A;  5JJJ B;  2JGD B;  4O4J A;  4RUF A;  1IBM B;  3U0Z A;  3W7U A;  4FLU A;  1X4T A;  3JAT B;  1F4N A;  1M4U A;  2Y69 B;  5DM6 V;  3F7V C;  2X0L A;  3AG3 B;  2XAQ A;  3OMA B;  4FFB A;  1P4R A;  3RW0 A;  5IYB O;  3ZN1 A;  3TET A;  2AZ0 A;  4H13 B;  2GV9 A;  3N2G B;  1P84 F;  4UB6 Z;  3E8F A;  1VQO V;  1NZ6 A;  5LOV A;  3K79 A;  4DV2 B;  1KKD A;  3E83 A;  4DR3 O;  3K5O A;  4CC6 A;  5EBM C;  4YXW G;  4X20 A;  4KP4 A;  4JI5 B;  2UXC O;  4KUM A;  3ZMZ A;  2IW5 A;  4LF4 B;  4HAM A;  2GBO A;  1FXH A;  3SYC A;  1XIL A;  3FX7 A;  1KMI Z;  4FPP A;  3GWO A;  3SPG A;  3ZMU A;  3BAA A;  3CB2 A;  1VP7 A;  2P5O A;  3OUS A;  4MVM A;  4I50 A;  4MTO A;  4Z1M G;  2Y4U A;  4UCV A;  1LR1 A;  4UV8 A;  5FNV A;  4TSF G;  4DUY B;  2WLL A;  4QJF B;  4FMT A;  1IBL O;  5EZY A;  1WLE A;  4K8Z A;  4PV1 B;  1QQC A;  1YVW A;  1YZB A;  2ODM A;  2R9A A;  1K97 A;  1R73 A;  3RVZ A;  4X1I B;  1M57 B;  1OCC C;  3UO3 A;  2ZM6 B;  2YIB D;  1GKF A;  4UVB A;  1FKA O;  1WP8 A;  1UJW B;  4DV1 O;  2ARH A;  1SC5 B;  4YY3 O;  2IJH A;  2E5L B;  2QJ1 A;  4H37 A;  5EYP B;  1H2G A;  2E76 B;  4DR2 B;  1MSW D;  1K34 A;  4ZI7 B;  5B1A C;  2PYJ A;  4QPJ A;  3CCE V;  4PEL A;  1PD3 A;  5LGN A;  1R3I C;  2ILM A;  2WLM A;  1PV0 A;  2UXN A;  1I94 B;  1DGS A;  4H44 B;  1BQ0 A;  3H1H H;  4JYA B;  3D3I A;  1S72 V;  3JD1 A;  1RP3 B;  1XHX A;  4DR6 O;  3HKD B;  5A9G A;  1WB7 A;  2BOC C;  2O57 A;  2QWR B;  4WFB V;  1SS3 A;  3JD0 A;  1DF4 A;  4P2Z A;  4GX2 A;  2C2A A;  2JGD A;  2QWN B;  5L3E A;  1BT8 A;  2NNU A;  1NH2 D;  3JAT A;  3UQ8 A;  2QTS A;  2Y69 C;  3TK1 A;  1A32 A;  4B3M B;  2HEP A;  3ABT A;  1V55 C;  5IYZ A;  4U3F H;  1IDS A;  3T1H O;  3N2G A;  2E3C A;  1NH2 B;  5FL7 G;  2WLJ A;  3FD9 A;  2HG5 C;  4DV5 O;  4LFA O;  1VMG A;  3JAL B;  2A0L A;  2QEX V;  3ZS8 C;  4GKJ B;  4IYI A;  1QLE B;  2XAJ A;  4TV9 A;  5CB4 B;  1PP9 H;  3OEH G;  3WU2 Z;  2YS8 A;  2ZCE A;  1XMQ B;  4UCO A;  4B3S O;  4UVA A;  1GN6 A;  4LBE C;  1Y66 A;  3IC9 A;  4K0K B;  1TAE A;  4R8C A;  2ZE6 A;  3VQW A;  3E8B A;  1L0N H;  3ICX A;  5CBF A;  1GO3 F;  2YIC A;  5EBL C;  4P9P A;  2E75 B;  2Q5Z A;  5B5E Z;  1BZK A;  4J7Z A;  2HR3 A;  1JPX A;  1BQZ A;  2EIN B;  3SDL A;  1ZWI C;  4MTX A;  1HNZ O;  4JI4 B;  3P30 A;  5CA1 B;  3R65 A;  2HVJ C;  4FLW A;  4X1I A;  1RM1 C;  4LF8 B;  3CWB H;  4FLV A;  3OTO B;  1I5Y A;  1XMO B;  1K4C C;  4J80 A;  1XNR B;  4K35 A;  5E1A C;  3G4S V;  1N8R W;  1SQB H;  3CSX A;  4W4K A;  4JI5 O;  4XDJ A;  1KU9 A;  2WLI A;  4F6R B;  2YXH A;  5KHK A;  1YJ9 V;  2LFR A;  2PF4 E;  3BA9 A;  1JOY A;  4FM2 A;  1AVM A;  1ZTE A;  4CS2 A;  4ZI7 A;  3H1K H;  3P3N A;  4ASU G;  2P4K A;  1JJO A;  4CS3 A;  2QWO B;  3LDD A;  1LUV A;  1V54 B;  4WCE V;  2Y48 A;  1F4M A;  2XHB A;  5IYC O;  1YJW V;  1FJG O;  4J10 A;  4I9Q A;  2GDS A;  4DUY O;  2PYL A;  4Q20 A;  3HKD A;  1AJQ A;  1NTM H;  4AQY B;  4LFC B;  5J2T B;  3CXH F;  5KHG A;  4I5S A;  3ZMS A;  1K5S A;  4JYB A;  1HDJ A;  5KA5 A;  2ZM6 O;  2QKC A;  1CEZ A;  2HJD A;  1NTK H;  4WFA V;  1EZJ A;  2BOB C;  3DXR B;  4WFE A;  4AHC A;  1VEW A;  2E5L O;  4MTF A;  3JAL A;  2V4D A;  4MVO A;  1P49 A;  3RGB A;  4PDV A;  3U11 A;  1BHB A;  2BSK B;  2MW2 B;  4KFM A;  5CB4 A;  1WA8 B;  3H9V A;  1IXM A;  2EIK B;  2JEU A;  4DXW A;  1HNX B;  2FTK A;  3CXC U;  2ZIM A;  3APO A;  3ZJZ A;  3ABL B;  3B09 A;  1I94 O;  1S5L Z;  3ZHT A;  2K9P A;  1MOF A;  4JI3 O;  1JJ2 U;  2B1G A;  3FB7 C;  3VQX A;  4J7J A;  3SPC A;  2HP8 A;  1Z5V A;  2YI8 A;  1K92 A;  1MNG A;  3M7M X;  1THZ A;  3K58 A;  4GKK B;  2W0X A;  1YTF D;  2PI5 A;  3QTC A;  1EBO A;  2HHH O;  3W7X A;  3J80 N;  2UXX A;  2ZR3 A;  2IJK A;  2DYR C;  5CA1 A;  1GM9 A;  5IYD O;  5BY1 A;  4DR5 B;  5LA6 B;  1S77 D;  1FXK C;  4B3M O;  1K5Q A;  1N0N A;  4JGS A;  2XTA A;  4OXS A;  4B3T B;  4DW1 A;  1G6U A;  4BAY A;  3SJB C;  2DQ3 A;  2LGW A;  1W59 A;  2ATK C;  3ZIA G;  4GKJ O;  4DRX B;  3E8G A;  2B1I A;  3ABM C;  3SPH A;  1YEW A;  4JTD B;  4X1K B;  1IVS A;  2YEV B;  2DOS A;  4ZHQ B;  1QU7 A;  2DYS B;  1E79 G;  1WPB A;  4CZZ A;  3J81 N;  2W0F C;  1XMQ O;  2CH7 B;  4MSW C;  1TGO A;  3B77 A;  3L72 H;  4DV0 O;  4MVU A;  1UPG A;  1RPO A;  2WAM A;  4K0K O;  4X89 A;  5BXZ A;  1V54 C;  3CX5 F;  5IWA B;  2CTP A;  2VS0 A;  1PNL A;  4TV8 A;  3A0R A;  4JV5 O;  4O4I A;  4IHJ A;  2Z3Y A;  1Q6H A;  1Y67 A;  3AG2 B;  5LP6 B;  3WG7 C;  4IT5 A;  4JI4 O;  1H2M A;  3ABU A;  5J2T A;  3CJH B;  4FFB B;  3RVY A;  3K57 A;  3OTO O;  5CA3 A;  4UB8 Z;  1QCE A;  1XMO O;  1SQV H;  2PTM A;  1HWY A;  1EM1 A;  1IZ3 A;  4NVP A;  3TGU H;  1SA0 B;  1BE3 H;  5H6Q A;  1TA8 A;  3K9S A;  2OTJ V;  3IGA C;  4LF9 O;  4CH3 A;  2YID A;  4FFK A;  3ASN B;  3ETG A;  5K1X A;  4OGQ B;  4DV3 B;  3IJ4 A;  2DW4 A;  2UXD B;  2BSK A;  2JK5 C;  3AG1 B;  1AB3 A;  1WA8 A;  2XT9 A;  1SF9 A;  4TQD A;  3OFN G;  1H2S B;  1WNS A;  4ZOL A;  4MVQ A;  3M99 B;  1FAF A;  3CCR V;  3BCC H;  5B1N A;  4WFG A;  2JVD A;  2UUC B;  4MW8 A;  4TQF A;  1RFY A;  3SYO A;  1I7F A;  4LFC O;  4GT1 A;  1ZX3 A;  4WF9 V;  3TXQ A;  3U10 A;  1MMM A;  5L3C A;  3P3P A;  1BMF G;  3L73 H;  3SYA A;  2EIJ B;  5LA6 A;  3HKC B;  3BVO A;  2WLK A;  1F51 A;  4X1Y B;  1AR5 A;  2QGN A;  4BW5 A;  2QE7 G;  4JI6 B;  4PA9 A;  4CH4 A;  2UXB B;  4G2K A;  1N0J A;  4NXN O;  2W6J G;  2EZP A;  2KQX A;  1O9G A;  1PKX A;  3GWK C;  4DRX A;  2ZXW C;  1JFF B;  2AGA A;  5B66 Z;  4X1K A;  2YEV A;  2RN9 A;  4ZHQ A;  1JCH A;  1HNX O;  3OEE G;  4DR7 O;  2ZT9 B;  1COW G;  3OGC C;  3RBZ A;  1N33 O;  3SJQ C;  4B3R B;  4YIO A;  3ZBH A;  1ZUQ A;  1QLN A;  3B8N A;  1J5E B;  2OCC C;  4GKK O;  4FJC C;  3SR2 C;  1R3L C;  3ZRS A;  2CTW A;  2H94 A;  3JCZ A;  3B2E E;  2HFE C;  3VQV A;  5LP6 A;  3AG2 C;  1XL4 A;  5B1B C;  3W7W A;  5CBG A;  3EFF K;  4O4L B;  2ZDI A;  2Q0O C;  3CJH A;  4G27 B;  1XOU A;  4IYH A;  3K5M A;  2F93 B;  1AP6 A;  4PI2 A;  2YDE A;  2R9I A;  5IYZ B;  4DR4 B;  1DTO A;  3TCU A;  2AHZ A;  4EFE A;  1HP8 A;  2EIL C;  5C93 A;  1FFX B;  2Q69 A;  2Q6A A;  4PA7 A;  4PI0 A;  1OCO B;  1Q90 D;  4JI0 B;  2GTS A;  1SA0 A;  4X64 B;  1CP9 A;  3CCM V;  4TV9 B;  2X6A A;  4A5U B;  1S5J A;  2QDO A;  2RQ6 A;  4H0L B;  4MVR A;  4JI1 O;  4GCZ A;  5L3D A;  3A0H Z;  4D6T H;  3C90 A;  3ZMV A;  3ZED A;  1OCR B;  1D2D A;  5FPR A;  1Q8I A;  3CCQ V;  5IWA O;  4NR1 A;  3K0D A;  4Q6G A;  4UCT A;  4DO2 A;  2F66 C;  1F23 A;  1I5X A;  3CRQ A;  4J42 A;  4QPK A;  1P7B A;  1Y6X A;  5ITZ B;  1GN2 A;  1QVF U;  2LO1 A;  4P30 A;  2IU0 A;  4X9Q A;  2NN4 A;  3OUF A;  3OMN B;  1NS1 A;  2P4V A;  1Q86 W;  4ICG A;  2QM8 A;  2Y0P A;  5B3S C;  3HPL C;  5LHI A;  3WB1 A;  2IH3 C;  4JI8 B;  1HNW B;  5K1P A;  1YI2 V;  1TUE B;  2WA4 A;  1H2N A;  4UCS A;  3S3X A;  3HKC A;  1SKV A;  5LYJ A;  4X1Y A;  1SRY A;  4TT3 G;  3F5T A;  3SPI A;  4MS2 A;  3AG4 B;  2WLI B;  1DK1 A;  5DN6 G;  1WB8 A;  2WPD G;  4PDR A;  1AP5 A;  5DED A;  4BR6 A;  4CS4 A;  4LF7 B;  3QO8 A;  4DV3 O;  1B04 A;  2G38 A;  4LFB O;  1Q5O A;  1JFF A;  4DYL A;  4OPA A;  1R6T A;  3T4Z A;  2XAS A;  2N05 A;  4YHH O;  2ADP A;  4X65 B;  1N4C A;  5LGT A;  2UUC O;  3VOU A;  3HR0 A;  2LW1 A;  2YSU B;  1NVP D;  3L75 H;  3QNE A;  5D5Q A;  5KA6 A;  4RO2 A;  1XHZ A;  1Q6I A;  1AR4 A;  4XDL A;  1NVP B;  3O9O A;  1XRE A;  2A9H A;  3N27 A;  1XEQ A;  3DGE A;  1ZAU A;  3B4S A;  4O4L A;  3RYC A;  2R72 A;  3E86 A;  2FB5 A;  3STL C;  2ZD9 A;  3JAR B;  3AG3 C;  3AK2 A;  4JI6 O;  2UXB O;  1YSC A;  3OAA G;  3JYC A;  2RMK B;  4FZ1 A;  3Q4H B;  4F4L A;  2KSD A;  1FFX A;  3SJA C;  2Z0A A;  1BL8 A;  4DW0 A;  1WN7 A;  3WB2 A;  1KD1 W;  4H33 A;  1G1X B;  3OE7 G;  1YIJ V;  1Z2G A;  4I9W A;  4WFF A;  2JIZ G;  1LUW A;  2N74 A;  4GUN A;  1EN4 A;  2VWK A;  4LF5 B;  4B3R O;  3ASO B;  3LNM B;  1M56 B;  3FAV B;  1J5E O;  3UCS C;  1NKD A;  3X2Q B;  4CH6 A;  1WAZ A;  1QR8 A;  3CCV V;  3BFR A;  5ITZ A;  2IM9 A;  3QO7 A;  4X66 B;  3JAW B;  3ZHQ A;  1CXZ B;  5EBW C;  5H5N A;  2VWJ A;  1IBK B;  2EIM B;  1JX9 A;  4E4E A;  1J95 A;  4MTG A;  2DWE C;  1OCZ B;  1IBM O;  3ZRV A;  1US6 A;  1KQS U;  4Z2W A;  5GW7 A;  3HKB B;  5L3G A;  1SQX H;  4DR4 O;  1SZX A;  4GYC B;  1VQ5 V;  3OD4 A;  1M57 C;  3THO A;  3H1I H;  4DV2 O;  2CAZ C;  3J7A U;  4GZR B;  2UUA B;  3A2F A;  4X64 O;  2OYQ A;  3CHX A;  5LMU B;  3AG4 C;  1K3E A;  3OT7 A;  3K03 A;  4LF4 O;  1EZV H;  2HLD G;  4ZBM A;  1YDX A;  1R1B A;  3CC7 V;  2X6B A;  3IC7 A;  1N32 B;  1K33 A;  2MK3 A;  3H1J H;  4E2L A;  4NXM B;  5KMG B;  4NB5 A;  4TV8 B;  3JD4 A;  1KP2 A;  4O4I B;  4UFZ A;  1XI1 A;  4IHJ B;  4UCU A;  5JH7 B;  1L8D A;  4LNU A;  2Q8V A;  1KP3 A;  3B8M A;  1KKC A;  2EBO A;  1XBL A;  3H1L H;  4DUZ B;  4DR1 B;  4FVM A;  5IY5 B;  1NQT A;  1VF6 A;  1GM8 A;  4JTC B;  3JAR A;  4YJ3 B;  3UT5 B;  3ZX6 A;  4LF6 B;  3D8C A;  3ZMT A;  4CH5 A;  2PZS A;  1H2K A;  2AZ2 A;  3Q4H A;  4LC1 A;  5KHI A;  3DC5 A;  4PHZ A;  4DR2 O;  3E35 A;  2Q7G A;  2XAG A;  4UUJ C;  1QLE C;  1FXV A;  3QVN A;  3MHH C;  4LWS B;  3K5L A;  2XAF A;  2B5U A;  2F1M A;  2ZR2 A;  1VQ8 V;  4I55 B;  1XDC A;  3ABK B;  4ZOL B;  1VQK V;  4JYA O;  1KEC A;  4HZ3 A;  3FAV A;  3B40 A;  3WB0 A;  2A3Q A;  4OX9 B;  1KB9 F;  1NI8 A;  1KBH A; 
#chains in the Genus database with same CATH homology
 3SPG A;  3CMA V;  3ZMU A;  3SYO A;  4UV9 A;  3OUS A;  4MVM A;  3CCL V;  4MTO A;  4Z1M G;  1QR9 A;  2JEX A;  4GT1 A;  4UV8 A;  4TSF G;  2EIN C;  4WF9 V;  3FB6 C;  2WLL A;  4QJF B;  4FMT A;  5L3C A;  2W6I G;  1G4Y B;  2QM7 A;  1WLE A;  3H01 A;  4PDM A;  2XOK G;  2WSS G;  1BMF G;  4QNH B;  3SYA A;  2EIJ B;  4WFH A;  1K97 A;  2A79 B;  1R73 A;  2P90 A;  4UXN A;  3RVZ A;  2DYR B;  2P7T C;  2WLK A;  1M57 B;  1F51 A;  3AEI A;  4U7N A;  1OCC C;  2OT5 A;  1FXK B;  4BW5 A;  3CP1 A;  2D3O W;  2QE7 G;  4PA9 A;  3W7S A;  4G2K A;  1SES A;  2W6J G;  1GKF A;  4UVB A;  1VQN V;  2EZP A;  1UJW B;  1PKX A;  1OZ0 A;  1MG1 A;  2ZXW C;  2IJH A;  2YEV A;  3ABM B;  4LCU C;  1JCH A;  4H37 A;  5KUM A;  3OEE G;  1H2G A;  1MSW D;  1K34 A;  4MVS A;  5B1A C;  3SPJ A;  1COW G;  3OGC C;  1R6N A;  4QPJ A;  1BHA A;  3LDE A;  1E1Q G;  5B1O A;  3FB5 C;  3RBZ A;  3CCE V;  4PEL A;  2JDI G;  4PA3 A;  1PD3 A;  5LGN A;  4PDL A;  3CC2 V;  1R3I C;  3SJQ C;  2WLM A;  3JD3 A;  4J9Y B;  4RQE A;  1S0V A;  2UXN A;  4HYO A;  1QLN A;  4BIU A;  3B8N A;  3UM7 A;  5H9C A;  4XBF A;  2OCC C;  4FJC C;  1R3L C;  3ZRS A;  2H94 A;  5BZB A;  2QA4 V;  3JCZ A;  5HFM A;  1AJN A;  3D3I A;  1S72 V;  1VQ4 V;  3JD1 A;  2HFE C;  3CCJ V;  3ZRW B;  3AG2 C;  1H38 A;  3LDC A;  1YJN V;  1XL4 A;  5B1B C;  2XAH A;  4QE9 A;  2P67 A;  3W7W A;  5B1N A;  1LNQ A;  2QTO A;  2BOC C;  3OW2 U;  2Q68 A;  3WG7 B;  5CBG A;  4WFB V;  3EFF K;  2IJI A;  2QKS A;  2ZDI A;  3JD0 A;  3I56 V;  1DF4 A;  4G27 B;  1AI5 A;  4P2Z A;  4GX2 A;  2C2A A;  2DWD C;  4JAS A;  3OMI B;  5L3E A;  2R9I A;  5LHH A;  1Y4M A;  2NNU A;  1NH2 D;  1R3J C;  1DTO A;  3TCU A;  5LBQ A;  2AHZ A;  2Y69 C;  1VQ9 V;  3TK1 A;  2EIL C;  5C93 A;  3K08 A;  3CCU V;  3ABT A;  1V55 C;  2Q69 A;  2Q6A A;  4PA7 A;  4EKW A;  1OCO B;  4LP8 A;  2NLJ C;  5CN0 A;  3ZRX A;  1NH2 B;  1SET A;  1Q81 W;  5FL7 G;  1CP9 A;  2WLJ A;  1NR7 A;  3CCM V;  2HG5 C;  2X6A A;  1W2B U;  1CPY A;  2A0L A;  4MVR A;  2QEX V;  4GCZ A;  3T1C A;  5L3D A;  3MHS C;  1QLE B;  2XAJ A;  2EIK C;  2CK3 G;  3ZMV A;  3OEH G;  1OCR B;  3ASO C;  4FK5 C;  3ABL C;  1M56 C;  3FKS G;  1W0K G;  3CCQ V;  3K0D A;  3X2Q C;  4DO2 A;  1F23 A;  1I5X A;  3SYP A;  4UVA A;  4JAV A;  4QPK A;  4LBE C;  1OHH G;  1Y66 A;  1P7B A;  4GX0 A;  4R7C A;  1PNM A;  3BY6 A;  2EIM C;  1SZT A;  3GB7 C;  1DLB A;  5L3F A;  1QVF U;  4R8C A;  1AI7 A;  4P30 A;  2IU0 A;  1OCZ C;  5HFL A;  1YIT V;  2JJ1 G;  3CYO A;  3OUF A;  3OMN B;  3E8B A;  5CBF A;  1GO3 F;  3QO5 A;  2IH1 C;  3VBB A;  1Q86 W;  2X6C A;  5EBL C;  4P9P A;  1KC8 W;  1FFT B;  2QM8 A;  1NBM G;  1S5H C;  5B3S C;  1AI4 A;  3HPL C;  1AR1 B;  5LHI A;  2HR3 A;  1JPX A;  2EIN B;  1VQP V;  2IH3 C;  1AI6 A;  1ZWI C;  2V7Q G;  4MTX A;  3P30 A;  4G28 B;  3KG2 A;  3R65 A;  3ZCC A;  1YHQ V;  1Q82 W;  1K73 W;  1YI2 V;  1TUE B;  2HVJ C;  4BIZ A;  2ITD C;  4J9Z B;  1RM1 C;  1SRY A;  1YTF B;  1FXK A;  3F7Y C;  5L3B A;  4TT3 G;  3E2E A;  3SPI A;  4MS2 A;  5KUK A;  1I5Y A;  2M7W A;  2ZQM A;  3AG4 B;  1OCC B;  2WLI B;  1K4C C;  5DN6 G;  4PDR A;  2WPD G;  4GX5 A;  3FB8 C;  5E1A C;  5IDJ A;  3G4S V;  1N8R W;  1H8H G;  3QO8 A;  4XDJ A;  2LP7 A;  2WLI A;  3CCS V;  3JD2 A;  5EC2 C;  2DYS C;  4MT8 A;  1YJ9 V;  1GK9 A;  2LFR A;  1EFR G;  4QE7 A;  3ML0 A;  2ZXW B;  3T4Z A;  5CMU A;  1JOY A;  2F43 G;  2XAS A;  4JAU A;  4ASU G;  3IFX A;  3HB3 B;  5LGT A;  3LDD A;  5B1A B;  3I55 V;  1V54 B;  3VOU A;  4WCE V;  2YSU B;  2Y48 A;  1NVP D;  1F4M A;  2WWW A;  1K9M W;  4R50 A;  5IYC O;  1YJW V;  3FYI B;  3QNE A;  1VQ7 V;  5J9P C;  5KA6 A;  3K0G A;  4RO2 A;  2HVK C;  3SYQ A;  3OR6 C;  2H8P C;  1RPR A;  4XDL A;  2OCC B;  1NVP B;  3EHB B;  4Q20 A;  2ZDI C;  3ZRW A;  2A9H A;  1AJQ A;  5IY5 C;  2K1E A;  4N23 A;  1AJP A;  3DGE A;  5B1B B;  3CC4 V;  4RAI A;  3D36 A;  4QIW F;  4I5S A;  3ZMS A;  3E86 A;  3LSS A;  1K5S A;  4JTA B;  3STL C;  2ZD9 A;  4JYB A;  1W0J G;  3AG3 C;  1DF5 A;  3LUT B;  4FIP C;  5KA5 A;  1R6K A;  2OTL V;  1YSC A;  3OAA G;  4MW3 A;  3JYC A;  1CEZ A;  4F4L A;  1K7D A;  3G6E V;  4WFA V;  1EZJ A;  2BOB C;  1VQM V;  1K4D C;  4L87 A;  4WFE A;  1BL8 A;  2EIL B;  5H6R A;  4GX1 A;  1V55 B;  1KD1 W;  4H33 A;  3ASN C;  3OE7 G;  1YIJ V;  4MTF A;  4JYC A;  2HJF C;  1VQ6 V;  4JPR A;  1GTO A;  3CPW U;  3ZN0 A;  3AG1 C;  4MVO A;  3ABK C;  4PDV A;  4CBC A;  1S3J A;  4I9W A;  4WFF A;  1NJI W;  1BHB A;  2JIZ G;  4KFM A;  1K8A W;  4XDK A;  1IXM A;  1XL6 A;  2EIK B;  2JEU A;  2R9R B;  4DXW A;  2FTK A;  3CXC U;  3ASO B;  3K3W A;  3ABL B;  3ZJZ A;  3LNM B;  1M56 B;  1VQL V;  1S76 D;  1MOF A;  2WLN A;  1JJ2 U;  3LSQ A;  1NKD A;  3X2Q B;  3CCV V;  1QR8 A;  2B1G A;  2IJJ A;  3FB7 C;  3SPC A;  4RUE A;  1E1R G;  1K92 A;  1ORQ C;  3QO7 A;  1THZ A;  4N21 A;  5EBW C;  1GMG A;  2EZO A;  2EIM B;  2DQ0 A;  1JX9 A;  2V1D A;  1J95 A;  4MTG A;  2DWE C;  1OCZ B;  4X88 A;  3ZRV A;  1ARO P;  2AHY A;  1QVG U;  1KQS U;  1YTF D;  2PI5 A;  4U7O A;  1EBO A;  2P6J A;  1MAB G;  2WLL B;  5GW7 A;  3W7X A;  5L3G A;  2WLH A;  2UXX A;  1SER A;  2EIJ C;  5B3S B;  2ZR3 A;  3OM3 B;  2X7R B;  2IJK A;  3K06 A;  2DYR C;  4JF3 A;  4UVC A;  1VQ5 V;  1GM9 A;  5IYD O;  1M57 C;  3NXS A;  1JVM A;  1FS0 G;  1FXK C;  2LFS A;  1S77 D;  1K5Q A;  5LHG A;  4JGS A;  3W7T A;  4OXS A;  3T2M A;  2GHY A;  2Q67 A;  1RM1 B;  4TWK A;  3AG4 C;  4BAY A;  1K3E A;  3ETE A;  4PA4 A;  2DQ3 A;  2ATK C;  4MVZ A;  3K03 A;  3CD6 V;  3ZIA G;  1H8E G;  3T4D A;  3E8G A;  4PA6 A;  2B1I A;  2HLD G;  3ABM C;  1QBZ A;  4ZBM A;  3SPH A;  2Z5U A;  2ITC C;  4JTD B;  2YEV B;  3CC7 V;  2X6B A;  3IC7 A;  2DYS B;  1E79 G;  1K33 A;  2MK3 A;  4CZZ A;  2GSM B;  2W0F C;  4E2L A;  1JQ0 A;  4MSW C;  3K9A A;  3CME V;  3UKM A;  3B77 A;  3K04 A;  3P32 A;  4MVU A;  3MD0 A;  4R6Z A;  1G8M A;  1RPO A;  2WAM A;  2HKO A;  3JD4 A;  1KP2 A;  4X89 A;  1ROP A;  1V54 C;  2XND G;  1M9N A;  1PNL A;  1B6Q A;  3A0R A;  3F5W C;  5EK0 A;  1NR1 A;  2PI4 A;  1WPX A;  2Z3Y A;  1KP3 A;  3B8M A;  1GM7 A;  3AG2 B;  2EBO A;  3WG7 C;  1ENV A;  3ABU A;  1R3K C;  5CBH A;  3E8H A;  4X8A A;  5IY5 B;  1NQT A;  1M90 W;  1GM8 A;  4JTC B;  3G71 V;  4RUF A;  3RVY A;  3W7U A;  5CA3 A;  3FYE B;  1Q7Y W;  1QCE A;  3ZMT A;  1L1F A;  1F4N A;  2Y69 B;  4P9O A;  5DM6 V;  2JJ2 G;  1OCO C;  3F7V C;  2X0L A;  3AG3 B;  2XAQ A;  3OMA B;  5EC1 C;  1P4R A;  3RW0 A;  5IYB O;  3ZN1 A;  4RQF A;  1M1K W;  1HWY A;  2IU3 A;  4ZKI A;  4LC1 A;  5LGU A;  3TET A;  3E8F A;  1VQO V;  5H6Q A;  3E35 A;  3K79 A;  1KKD A;  3E83 A;  3BEH A;  2XAG A;  2OTJ V;  4UUJ C;  1QLE C;  1FXV A;  2EJR A;  5EBM C;  4YXW G;  3IGA C;  1OCR C;  3E89 A;  3MHH C;  3ASN B;  3ETG A;  3ETD A;  4KP4 A;  2XAF A;  2B5U A;  2DW4 A;  2ZR2 A;  1PL0 A;  2JK5 C;  3AG1 B;  4KUM A;  3ZMZ A;  1VQ8 V;  2IW5 A;  3ABK B;  3STZ C;  4HAM A;  1PNK A;  1VQK V;  3PJS K;  1FXH A;  3SYC A;  1KEC A;  3WFV A;  3OFN G;  4HZ3 A;  3OR7 C;  2KB1 A;  4MVQ A;  3DTU B;  3M99 B;  4FPP A;  3CCR V;  4WFG A;  3GWO A;  4MW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...