1Q86W

Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p-site of the the 50s ribosomal subunit.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural insights into peptide bond formation.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2003-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1q86W00
3CCRV 1K73W 1VQ7V 1Q86W 1VQKV 1VQMV 3I55V 1KD1W 1VQ4V 1VQ5V 1VQ9V 1Q81W 3CC2V 2OTLV 1Q82W 3CMAV 3CPWU 3G71V 1M1KW 3CD6V 2D3OW 1VQ6V 3G4SV 3CCJV 5DM6V 4WF9V 1VQOV 1W2BU 1VQLV 1M90W 3CC4V 1KQSU 2OTJV 3CCMV 1YJWV 1JJ2U 1QVFU 3CMEV 1YJ9V 3CCQV 4WFAV 4WCEV 3CCSV 1YIJV 1K8AW 1R73A 1YHQV 1N8RW 2QEXV 3CCLV 3OW2U 1K9MW 4WFBV 3CCUV 3CXCU 2QA4V 1KC8W 1VQPV 3CCEV 1Q7YW 3CCVV 1QVGU 1YJNV 1S72V 1YI2V 1NJIW 1VQNV 1YITV 1VQ8V 3I56V 3CC7V 3G6EV
chains in the Genus database with same CATH superfamily
1OZ0A 4HNAB 4J42A 1VQ7V 3IJ4A 4F6RA 5BR8O 4DV1B 3C90A 1XILA 3BHPA 3E8BA 2CTRA 3K5MA 1QVFU 2QTOA 2ADPA 2F93B 2HLDG 1N0NA 3MDSA 3A0BZ 1HWYA 2EBOA 3JCUZ 1AI6A 3CCVV 1ZAUA 2E5LB 1JOYA 2M7WA 4O4HB 4UV8A 1V54B 4LFCO 3QO7A 4MSWC 4DK1A 4MTOA 4O4IB 3UO3A 1M1KW 3CD6V 1Q90D 1FD9A 5KLVH 4HBNA 5LXTB 2QR4A 2V4DA 5DN6G 1N34O 4MVQA 3K9AA 2XAJA 5J2UA 2HJFC 5CA1B 1G1XB 4IHJB 3FD9A 1OCZC 3SGIA 4DR6B 4HZ3A 1U96A 3T1HO 3E22B 1JFFB 2A79B 4HAMA 3HKEA 2ZIOA 1I7FA 4OXSA 4DV3O 2OCCC 1KQSU 4WBNA 4GUNA 1BCCH 3U11A 1TUBB 3K58A 4J11A 2RNBA 3MD0A 3AG2B 2WLIB 3ABMB 4OGQB 1FXKB 3K59A 3H1LH 1KBHA 2W0XA 1EFRG 3ZRWA 1VQ5V 1N0JA 4FM1A 4LR3A 2LJ2A 2F1MA 1TGOA 2A0LA 2Q73A 3N2GA 4FMTA 4IIJA 4WFEA 2JJ1G 3SPJA 3C3TA 2OYQA 2AW9A 3AG4C 1YJNV 2IJIA 4UV9A 5C8YA 2VQFO 2BOBC 2JGUA 2P7TC 3SJBC 2QKCA 4CH6A 3UM7A 4P9PA 4JI0B 4PA9A 4ZI7B 1H2MA 2UUBB 5L3EA 1Q6HA 2L35A 2YEVB 5CN0A 3IFXA 1GTOA 3UCSC 4DR7B 1W59A 4I55A 4JI4B 3APQA 2ODMA 2P22C 3OEEG 3X2QC 2KKWA 4GX2A 3FAVA 2EINC 4GCZA 4X1KB 2K1EA 4FJCC 1DTOA 1H2GA 2OCCB 3ETQA 4DRXB 2R72A 3LNNA 5IJ9A 5B1NA 4F6RB 3HR0A 1K9MW 1D2DA 4JI2B 5LMNB 2UXBO 1MABG 3P3PA 1YXBA 3MAQA 1K4CC 4EEQA 3H1KH 2EULA 4P9OA 2DOSA 2PGGA 3D3IA 2F95B 1BSMA 4DV6O 2DWDC 2F23A 4JAVA 3A2FA 5B5EZ 4XDJA 1OJHA 1KECA 5K1PA 1BS3A 4U3FH 3AG4B 5J2UB 3S3WA 4FLXA 2FKXA 2VWKA 3E89A 5LHGA 3EVKA 1E1QG 2A06H 2QEXV 4DR1O 2IJJA 2YC0A 3HKEB 4H33A 3CCUV 3ZRVA 4DR3O 1MZFA 3B40A 4DV2B 2PI4A 4WBNB 3HKDA 4DV5B 4JPRA 3K9SA 2QDOA 1ZX3A 1V9PA 3ZHRA 4LC1A 2KG7A 1SC5B 2P6JA 3AEIA 3JCZA 1BT8A 4FZ0A 1AR4A 4AI8A 1Q82W 3X2QB 2EINB 1EZJA 3UT5B 1JJ2U 3ZRWB 3I5DA 1WAZA 4X66B 3OGCC 5H6RA 4K35A 3AK3A 3HKBB 2H8PC 4KL1A 1M56C 3ABLB 3N2GB 4RQFA 4IIJB 1GMGA 1NJIW 2EJ7A 3K0GA 2W6JG 2VS0A 2N04A 3CP1A 5LP6B 2JS5A 3FB7C 3K5OA 5C8YB 1BHBA 2WLJA 3ZEDA 4HYOA 4YY3B 2EIJC 3CCRV 1DF4A 3OTOO 2JDIG 4J7JA 1F23A 2R9AA 4FZ1A 2O57A 5B3SC 4I55B 3OTFA 4JTCB 3G67A 3TGUH 4J80A 4AQYO 5C93A 1R3KC 3FAVB 2LQTA 3OMAB 1IBKB 2HVJC 4FFBB 1I5XA 5IJ9B 3I56V 1AI7A 1YITV 1AI4A 4R6ZA 2AXTZ 1VF7A 1Q81W 3CJHA 2QWPB 5KAIZ 1OCCC 3PN1A 1MNGA 4X20A 5IJ0A 5KHKA 2B1GA 4UVBA 3ZN1A 3RW0A 2OWOA 1AR1B 4K0KB 3MHSC 4NXMB 3RN4A 1Y4MA 1AI5A 1WN7A 1NR7A 2Q68A 1I08A 1UJWB 4DW0A 4ZIBA 1L8DA 4NXNB 3DTUB 1NTMH 4ABMA 1FFXA 1AVMA 1SQPH 5DECA 3ABTA 4MW3A 1QLEB 4FK5C 3SJAC 3DXRA 2PI5A 4H13B 1GRJA 5KHIA 4GT1A 2ILMA 1YVWA 4WFGA 1Z5VA 1N32O 1VF6A 4J41A 2UU9B 5CBFA 4CS3A 2EIJB 3HKDB 5JQGA 2KG7B 3RGBA 5B3SB 3B2EE 2VRZA 1S3JA 1M57B 3H9VA 5IE9A 3K3WA 4JI6B 1FS0G 4EFEA 2JK5C 3ZMUA 1H38A 4O2BA 2DN9A 5CBHA 4OX9B 3M8AA 4LF4O 2QM7A 3VQYA 1VIBA 3FFQA 5GTIZ 3P3NA 4I7ZB 3CS5A 5KHGA 1HNWO 1Z5WA 4QE7A 1CXZB 4X62O 1GN6A 4MVZA 3DGEA 4DV7O 1OCRC 3VQWA 3OGIB 1YI2V 4LF7B 1U97A 3OMIB 4FVMA 3THOA 1VF6C 3CC4V 4PV1B 3EHBB 2N74A 1QNMA 1PNLA 2PTMA 2X6AA 1NT2B 4LF9B 3NR7A 1H2LA 2WAMA 3K06A 3ASNC 3LSSA 4TWKA 3RFRA 1PNKA 2WLLA 5LMUO 4X1YA 3UQ8A 2Q0AA 3JATA 4UCVA 2C2AA 4DR5B 2HHHB 2NN4A 3K79A 3UKMA 5KMGA 1NBMG 1SQVH 5LHHA 5B1AB 4JYCA 3CJHB 4X65O 3IC9A 5IYZA 1XI1A 4PA4A 4RWUA 4X20B 4JZ2A 1T5EA 4GKJB 3CRRA 1HNZO 1HNXB 4U7NA 2JGDB 1VQ9V 1AR5A 2LGQA 4I9QA 2MW2B 3Q4HA 5EYPA 3JALA 5IYBO 3BVOA 3ICXA 2PF4E 3QF7A 5F2VO 1P49A 1LNQA 2YI8A 1AJPA 4KHPO 1EN4A 4DK0A 3BFRA 2DWEC 3T1YO 4CC6A 3OEHG 3LDCA 1FFXB 3DXRB 2DYSC 3MHHC 4LF8B 2QM4A 2UUCB 3ZHQA 4PHZA 4DR4B 2BTQA 4CBCA 2OTJV 4IYIA 1GK9A 3CCSV 4EB6A 1ZL8B 2IU0A 1UPGA 3CXCU 4I9WA 5JQGB 1R6KA 4R8CA 1BGYH 3ASNB 1QQCA 1IBMB 3WFVA 4GX5A 1R1BA 4AHCA 4DV1O 1S77D 3FYIB 3B77A 2FTKA 2QKSA 3ASOC 4DW1A 3FX7A 3OD4A 2ZR3A 4O2BB 1VMGA 1SETA 2FL4A 2Y0PA 1JMKC 2P4KA 4GZRB 5L3BA 3ZS8C 1IDSA 4E4EA 3TK1A 4YJ3A 3RT3C 2Y0IA 4DO2A 2D2CB 4IL6Z 1K73W 1KB9F 1KD1W 2RCVA 4K3AA 1QLNA 4LFAB 1S76D 2NLJC 3D8CA 1IX9A 4U3JA 4QJFB 1SQQH 5JWPA 5IYCO 4BIOA 3CCMV 4J10A 3J7AU 4FLVA 2JEUA 3CSXA 4D7TA 1IZ3A 2E75B 4BWAA 5LOVA 4DV0B 3AG3C 3BA8A 1XMQB 2QWRB 2PY5A 4K8XA 5EBWC 1R3LC 3OE7G 4UCOA 3W7SA 2PUSA 2WLLB 4WF9V 4QGPA 1PV0A 4X1YB 4B3RO 4LNUA 1AP5A 2Q67A 5KA5A 2X0LA 4GX1A 3N2KA 5IY5C 1L0LH 2HKOA 4MVSA 5FPRA 4JTDB 2PYJA 5KMGB 2GBOA 4O4JA 5LGNA 4AILC 2ETNA 5J9PC 3ZRSA 5IWAO 3F7YC 4DV4B 5IYZB 4E2LA 2ZINA 3C3SA 2UUAB 1HW7A 3LSUA 1B06A 4RQEA 2DW4A 3TJTA 1Y6XA 1GO3F 4CH3A 3OR7C 4JI5O 3Q4HB 1AROP 5EYPB 5IDJA 4MTFA 3JALB 3CCEV 2ZXWB 2UXXA 4PD4F 4DUYB 4KP4A 3RVYA 1K4DC 1R6TA 1R6NA 2EJRA 1V55C 3WB2A 2UUBO 3BA9A 1F4NA 3ZHTA 4FFKA 1XNRO 1W0KG 4UCRA 2Q6AA 1FPOA 3A8TA 3OAAG 1TA8A 4DR7O 5E1AC 3D36A 4JI4O 2BTQB 3LDDA 4MVMA 3D3QA 4PA3A 4YIOA 5B1BC 2QE7G 3JAWA 3JYCA 2BSKA 1R3JC 4EB6B 1HR0O 1O9GA 1IBLB 2WLHA 2YXLA 3AG3B 5BR8B 1XREA 5EBLC 1FKAO 3AK2A 2IU3A 3SYCA 5KX5B 3ZX6A 4LF6O 2PZSA 1JA8A 2ZIMA 5IY5B 1EM1A 4PA6A 4WFFA 4JI2O 1S5JA 2JS3A 4RUFA 4YXWG 1VQ8V 5TISZ 3CWBH 4XBFA 4JTAB 4LFCB 3CB2A 5BZBA 5LGTA 1SESA 1KP2A 3TXSA 2IBZH 4YJ3B 1ZSPA 2LW1A 5CA3A 2NNUA 3KCXA 5HFMA 3CRAA 4X64O 1N8RW 4U3JB 5IYDO 4RAIA 2V7QG 3LUTB 3E8GA 2GSMB 1A32A 1PL4A 1URFA 1NH2D 4MVRA 3D36C 1FJGO 1OCZB 3E8HA 2L6LA 4MVUA 2DQ0A 5L3GA 1WLEA 3IC7A 4DV2O 4QPKA 4H44B 3HKCA 4LNUB 2R70A 1FFTB 3G6EV 5B1BB 1QR9A 3CRMA 4O4JB 4B3TB 3KKYA 1XDCA 3GB7C 1WP8A 2ZNIA 1AB3A 1LR1A 1XL6A 2ZE6A 2P90A 2RDCA 2JIZG 3SYOA 3LDEA 2VWJA 3L71H 3OFNG 2VQFB 2RJZA 4W4LA 4FLZA 1DLBA 3WB1A 1H8HG 1KKDA 3ABUA 4JYAB 3JAKA 3SPHA 4JI8O 4UXNA 1M5IA 2LP7A 4KFMA 2CUGA 2YI9A 4YY3O 1XHZA 4LF5O 3DC5A 1RP3B 2P4VA 4PELA 3CPWU 2XNDG 3P32A 3T4DA 1Y76A 5E79Z 4DR2B 3JAWB 2BSKB 4PDLA 2VQEB 4LFBO 1NVPD 1THZA 4L8JA 4D7SA 2WPDG 4NVPA 1UFIA 2CK3G 5JJEB 1QR8A 5LL6Y 2A9HA 3DC6A 4PDVA 2BCCH 5D5PA 2ZQMA 1QU7A 1IURA 2E3CA 2G38A 5CB4A 2CAZC 3CMEV 1Y74A 4K0KO 1XEQA 3IGAC 4TOIA 4NXMO 4L87A 5GONA 2RMKB 3OUFA 3M99B 2HP8A 3QVNA 3AK1A 3VBBA 3W7WA 2ZCEA 1VQMV 3CE2A 2IH3C 1ZUQA 3WG7C 4OPHA 4GX0A 1W2BU 4B3MO 1NKDA 1GH6A 4LH7A 2ADQB 2K9PA 4DR1B 1FYJA 1AP6A 4BIUA 4DR3B 1JJOA 4KUMA 3K5LA 2AGAA 3ZHUA 1KKCA 2EZPA 4R7CA 2ZDIA 3HKCB 2ZNJA 3OUSA 2CTQA 3E86A 2B5UA 3S3XA 4WFAV 2UXNA 2BTOA 1NTKH 3ZIAG 3JD4A 5D5QA 4R50A 1VF5B 3SPIA 2WLNA 4YHHO 1S5HC 2AZ0A 1US6A 1L0NH 1M56B 2B9ZA 1ROPA 4B3SB 3TETA 3F5WC 2F43G 3VQXA 3JD3A 1Q6UA 2P67A 3H01A 4UUJC 2OCHA 3SR2C 3ZHSA 2ITDC 3K03A 2QGNA 4B7EA 4DUZB 1K8AW 1LUVA 2DJVA 2XAQA 3AG7A 1HDJA 3KCYA 1Y67A 4GKKO 2Y4TA 3OTOB 5HFLA 4JI7O 3CCJV 4A5UB 4X8AA 1TAEA 1ENVA 2EILC 3WG7B 1VARA 3CRQA 2CTWA 4X1IA 2ZDIC 3JASA 1H2NA 3B09A 4AQYB 3K0DA 5DEDA 1SRYA 1Y76B 4CS4A 1G8MA 2WWWA 1RM1C 1VQPV 1I94B 2ZM6O 1WJZA 5IT9N 2GHYA 4FM2A 1NZ6A 2F4VB 3FB6C 4FLWA 2WA4A 1N36O 4FLTA 1M90W 2ZE8A 2X7RB 5EBMC 1YTFD 1OCCB 2XHBA 2EIMC 4ZKIA 3L72H 1J5EB 4BW9A 4JI3B 1Q3EA 2ZD9A 4DYLA 5CB4B 1HNXO 1CP9A 3QNEA 1SZTA 1S72V 4BW5A 1PD3A 5EC1C 2Q5ZA 1Y74B 1N33B 4K8ZA 4O2AA 4PI2A 1P7GA 3EFFK 1NH2B 3DSQA 2MK3A 1AJQA 2YIBD 3CCQV 3ZMSA 1YIJV 2QWNB 2LW7A 2XOKG 2KSDA 5FL7G 3G6BA 2P06A 1ZWIC 4NTWA 1AILA 1JCHA 3L75H 2YUAA 4TUYA 4DR4O 3CYOA 2QSAA 1VQOV 5LYJA 4O4LA 2EILB 1OV9A 5ITZA 2UXCB 4U7OA 4LH6A 1TUEB 5BMVA 1FAFA 2E76B 5IJ0B 2RQ6A 4EFBA 4D6TH 4JV5B 4Z1VA 3CX5F 2GUZA 4LF4B 2IJHA 2ZKOA 1RFYA 3W7XA 4O4HA 5KHJA 5LBQA 1XBLA 2RN9A 5JJNB 2EX3A 3CCLV 1XNQO 2ARHA 4O4IA 2EIMB 2QWOB 1BMFG 3U0ZA 4LFAO 1OCRB 3JD0A 2X6BA 4JYYA 3B8NA 1YF2A 1B6QA 1EZVH 4I0XA 1F4MA 1JPXA 4YJ2A 1E1RG 1SA0A 2Q4PA 3WB0A 3JD1A 1W0JG 1NVPB 1MSDA 4ZOLA 4DV0O 4C7UA 4UCUA 4MT8A 1XMOB 4X1IB 2LFSA 1XMQO 3JASB 3AG1C 3I55V 3JSLA 4X9QA 4FIPC 2ZE7A 5H5NA 5EC2C 3WU2Z 3PJSK 3JD2A 4Q6GA 1Z2GA 3E35A 2YICA 3E8FA 3HPLC 3O65A 4EKWA 2H3OA 1NI8A 4X65B 1V54C 2E5LO 2UXDB 5H2FZ 1HP8A 2YSUB 4N21A 1HNZB 2UUAO 2BE3A 2QM8A 1VQ6V 3ZN0A 2GTAA 2YIBA 1XOUA 3BPZA 4OPAA 2EIKC 2Z3YA 1Q8IA 1P84F 3ABKC 4KHPB 3P30A 4TT3G 2GTSA 3OMNB 4DUYO 2YXYA 3T1YB 1QVGU 4NYKA 1E79G 4JI1B 4DR6O 1K97A 2H94A 2YEVA 2IW5A 1I0HA 2IM9A 2JRIA 2W6IG 2DYSB 2YDEA 3AG2C 3B8MA 1YCIA 3JATB 4TUYB 3ABMC 2WA3A 3W7UA 1FXKC 2JJ2G 4MTXA 5LYJB 2LO1A 4PJ0Z 1SQFA 2Q0OC 2QKAA 2ATKC 4O4LB 1KU9A 5ITZB 4TV9A 4DRXA 1MG1A 3K04A 3F5TA 1PPJH 3RYFA 3AG1B 3CC2V 5BMVB 1JX9A 4H0LB 3ASOB 4WFHA 1D5AA 4YIPA 2GUZB 3W7TA 3K57A 2QA4V 3G80A 3R65A 1KC8W 4RO2A 2ITCC 2Q8VA 1GM8A 3RYHA 4JI0O 3L9DA 5LA6A 5CMUA 2YXHA 3JARA 3SPGA 3E2EA 3HB3B 1AJNA 1DK1A 1M9NA 4I0XB 3KZIZ 2EIKB 4YJ2B 5J2TA 1SA0B 3ABKB 1S5LZ 2CTPA 2HVKC 2HFEC 1KUQA 3A0HZ 3CC7V 1BE3H 2PYLA 3B4SA 3SYPA 3CHXA 3FB5C 4QNHB 5KAFZ 4ZOLB 2D3OW 3G4SV 2Y48A 5H9CA 4ICGA 1H2KA 2QWQB 1MOFA 4B3RB 2Y4UA 3OM3B 2XAFA 3H1JH 5EZYA 1YTFB 3OT7A 5JJJB 5LMNO 2XTAA 4PDMA 3UT5A 1X59A 5LGUA 5IWAB 4B3TO 4JASA 3HKBA 2Y69C 4LBEC 1QCEA 4IGGA 1M4UA 1N34B 2AZ2A 1K3EA 5GTHZ 3UO2A 1B3QA 4JI5B 4F4LA 3QO5A 1Q7YW 5LP6A 5JCOA 3FB8C 1RSOA 5H6QA 2DQ3A 5JVDA 1YZBA 1CEZA 4P30A 3T1HB 3ETGA 4JYAO 3CRCA 3JAMN 2B1IA 4DV3B 5LOVB 4NTXA 2HR3A 2F66C 1V55B 2WSSG 5CA0A 1XNRB 3QTCA 4P2ZA 4PDRA 2XT9A 3RYCA 2P5OA 3A0RA 4DV5O 3SJCC 1VEWA 1HR0B 3N2KB 3L74H 4JZGA 1VQKV 1YSCA 2DYRC 4DR2O 2FB5A 4UB6Z 2VQEO 4NR1A 3TXQA 4UVCA 3BCCH 1PKXA 1Q6IA 4TV9B 3RYFB 4FFBA 4X66O 3E83A 1R73A 1YHQV 1YDXA 1Y66A 3ABLC 4LF6B 4XDLA 1H2SB 5B66Z 3KG2A 1I5YA 4G27B 2EZOA 1GM7A 5LP6C 4N23A 5JCOC 2HEPA 4PI0A 2GV9A 1VQLV 4G2KA 3RYHB 2Y69B 3ZMTA 3LSQA 2CH7A 4X64B 3SYQA 5LA6B 1GAXA 1WA8A 1NU1H 3VOUA 3JARB 1MMMA 1YEWA 3BAAA 1FJGB 2AHYA 1SF9A 5FNVA 1OCOC 5J2TB 3VQVA 2KQXA 2DMXA 4Q20A 1X4TA 5FLXN 3QO8A 4ZBMA 4CC5A 5CBGA 3OR6C 4J7KA 3OW2U 1WB8A 2JEXA 1WPBA 1PNMA 3RWRD 1NS1A 4IT5A 4JAUA 4J7ZA 1QBZA 4BR6A 1IBKO 4I50A 4UCTA 3QG5A 4J9YB 3F7VC 2UXBB 1P7BA 1KP3A 5EZYB 4NKGB 2DYRB 3O9OA 3J81N 4DV6B 1K33A 1COWG 5L3CA 1G4YB 4FPPA 2NR5A 4TQFA 5B1OA 3RBZA 4B3SO 1SQXH 4RUEA 1CPYA 1GM9A 4F6EA 1DF5A 1FXVA 3ML0A 3GWKC 4DXWA 4UB8Z 1BHAA 4NXNO 1SZXA 5LHIA 4DUZO 1YJWV 1RSOB 1WP7A 1QLEC 5JVDB 4LWSA 5AG2A 3L70H 4QPJA 2HJDA 3NXSA 1M93A 4JI8B 3T4ZA 3R66A 4PA7A 5CA0B 4LF5B 2DE0X 2UU9O 3RYCB 2GDSA 1XHXA 2FYUH 1JVMA 1K34A 1GN2A 4I4TA 2Q9LA 1OCOB 1M57C 4LP8A 5KUMA 4LFBB 4JI6O 1I94O 1NTZH 2Q7HA 4QE9A 4FM0A 4OX9O 5KUKA 5JH7A 5A2QN 1K5QA 2LFRA 2F4VO 2YS8A 3ETEA 1F7YA 3T1CA 4FLUA 1G6UA 5K1XA 1WNSA 2Q7EA 3STZC 1J5EO 2JGDA 5BXZA 4JI3O 5GW7A 1MSWD 2XAGA 1SS3A 1GN3A 2OIGA 4TV8A 5EIBD 3JAKB 4LF7O 2CH7B 2R9IA 4B7KA 1N33O 1XL4A 4W4KA 4MS2A 1WA8B 2LGWA 3BRCA 4ZHQA 2CDYA 1DGSA 4KXRA 5BY1A 4UVAA 4B3MB 2CGNA 4QIWF 5FNVB 2IJKA 4LF9O 2M6YA 3FYEB 3K08A 1PP9H 4WFBV 3GVMA 3SJQC 4GYCB 1K92A 5FPOA 1NR1A 4J9ZB 1ZL8A 4CH4A 4DR5O 2OIEA 1Q86W 2HHHO 2W0FC 4I50B 4CS2A 5B1AC 3ZBHA 1P4RA 3SPCA 2UXCO 2ZT9B 4MW8A 2BOCC 4X88A 3BABA 4UCSA 4GKJO 4YHHB 4JV5O 4MVOA 4JF3A 5GONB 3SYAA 3RYIA 1FXHA 2CGOA 5KHHA 1MA1A 4JYBA 1GN4A 2ZR2A 4Z2WA 3M7MX 1TVKA 1Q43A 3STLC 1EN5A 2AHZA 1BQ0A 1EBOA 4LWSB 2V1DA 2IH1C 4B08A 4GKKB 1QHTA 3SDLA 1N32B 4JAAA 4LF8O 1JR9A 4CH5A 2UUCO 1R3IC 4NTYA 4UFZA 4JI7B 3LNMB 1BL8A 3ZRXA 4HNAA 4I4TB 2FMLA 1XMOO 4XDKA 3ZHVA 1IBMO 1RPRA 3CEIA 5L3FA 2WLMA 1RM1B 4IYHA 2ZM6B 1J95A 4I5SA 2Z5UA 4MTGA 2Q7GA 3T2MA 2E74B 3TCUA 4LCUC 2WLKA 3CMAV 5L3DA 1JQ0A 2QJ1A 1ZTEA 5JH7B 1N36B 2Q69A 2KB1A 1HNWB 1N4CA 1BZKA 1D5NA 2UXDO 2R9RB 3RVZA 4X62B 3ZCCA 1IXBA 2XAHA 2ZE5A 1VP7A 4DV7B 3J80N 1VQNV 5LXTA 2YIDA 3K5NA 3H1HH 2A3QA 5CA1A 1SERA 4IHJA 5EK0A 5KA6A 4TV8B 1YJ9V 2XUMA 1IVSA 1LUWA 1S0VA 1GKFA 4CZZA 4ZHQB 3E22A 1JFFA 2HG5C 3BEHA 4JI1O 1B04A 2OT5A 1KMIZ 3CXHF 3FKSG 4BIZA 1ORQC 1OHHG 2QTSA 1O9HA 3ZMZA 5LMUB 3APOA 1TUBA 1Q5OA 4NB5A 2OTLV 5A9GA 4TQDA 2WLIA 4GLXA 1SQBH 1MZEA 1FXKA 1WPXA 1NQTA 4JGSA 1L1FA 1RPOA 3JSNA 1KYOF 5KX5A 3L73H 4H37A 4DV4O 1VQ4V 5EIBC 3BY6A 1EN6A 3IAYA 1ZLZA 1K5SA 3G71V 3ZMVA 1SQGA 1SKVA 2A7WA 4TSFG 1XUQA 2JVDA 3GWOA 2ZXWC 1XNQB 4O2AB 3U10A 4X89A 2YIAA 3RYIB 4ZI7A 2X6CA 3H1IH 2N05A 3ZJZA 4ASUG 3ETDA 1PM9A 1F51A 1H8EG 2Z0AA 1TVKB 1XQ8A 3N27A 1K7DA 1WB7A 5DM6V 1IXMA 4FLYA 4WCEV 3EXAA 4Z1MG 2CE4A 4BAYA 2XASA 1PL0A 1BQZA 4X1KA 1IBLO 4G28B
chains in the Genus database with same CATH topology
1OZ0A 1VQ7V 1VQKV 2C2AA 1YSCA 2DYRC 3K79A 3UKMA 2EZPA 4R7CA 2ZDIA 3OUSA 4UVCA 3E8BA 3E86A 1PKXA 1NBMG 2B5UA 5LHHA 2QTOA 1QVFU 4WFAV 2UXNA 3E83A 5B1AB 1R73A 1YHQV 4JYCA 3ZIAG 2HLDG 1Y66A 3ABLC 3JD4A 4XDLA 4R50A 1HWYA 2EBOA 4PA4A 1AI6A 3SPIA 2WLNA 3KG2A 3CCVV 1I5YA 1S5HC 1JOYA 2M7WA 4G27B 4UV8A 1V54B 2EZOA 1GM7A 1M56B 3QO7A 4MSWC 4U7NA 1VQ9V 4N23A 4MTOA 1ROPA 3TETA 1M1KW 3F5WC 3CD6V 2F43G 3JD3A 5IYBO 1VQLV 2P67A 4G2KA 3H01A 4UUJC 5DN6G 4MVQA 3K9AA 2ITDC 2XAJA 2Y69B 3K03A 1K8AW 3ZMTA 2HJFC 3LSQA 1LNQA 1AJPA 2XAQA 3SYQA 2DWEC 3VOUA 3OEHG 1OCZC 3LDCA 4HZ3A 2A79B 2AHYA 4HAMA 2DYSC 3MHHC 1OCOC 4OXSA 5HFLA 2OCCC 4Q20A 3CCJV 4X8AA 1ENVA 2EILC 3QO8A 3WG7B 4ZBMA 4CBCA 1KQSU 2OTJV 1GK9A 5CBGA 3OR6C 3CCSV 2ZDIC 2IU0A 3OW2U 2JEXA 3K0DA 3MD0A 3AG2B 1PNMA 1SRYA 3CXCU 1G8MA 2WWWA 1RM1C 4I9WA 1R6KA 4JAUA 4R8CA 1QBZA 2WLIB 1VQPV 3ABMB 3ASNB 1FXKB 4J9YB 3WFVA 4GX5A 3F7VC 1EFRG 3ZRWA 1VQ5V 2GHYA 1P7BA 1S77D 1KP3A 3FYIB 3B77A 2FTKA 2QKSA 3ASOC 3FB6C 2DYRB 2ZR3A 1M90W 1SETA 2A0LA 4FMTA 2X7RB 5EBMC 4WFEA 1YTFD 1K33A 1OCCB 2JJ1G 1COWG 3SPJA 2EIMC 5L3CA 5L3BA 4ZKIA 1G4YB 3TK1A 2ZD9A 3AG4C 1CP9A 4FPPA 3QNEA 1SZTA 1YJNV 4BW5A 1S72V 2IJIA 5B1OA 4DO2A 4UV9A 1PD3A 3RBZA 5EC1C 2BOBC 1K73W 1KD1W 2P7TC 1QLNA 1S76D 4RUEA 1CPYA 2NLJC 1GM9A 1DF5A 1FXVA 3ML0A 4P9PA 3UM7A 4QJFB 3EFFK 4DXWA 4PA9A 5IYCO 1NH2B 2MK3A 1BHAA 1AJQA 5LHIA 3CCMV 1YJWV 5L3EA 3CCQV 1QLEC 3ZMSA 1YIJV 4QPJA 2YEVB 2XOKG 3NXSA 5CN0A 3T4ZA 2JEUA 3IFXA 5FL7G 1GTOA 4PA7A 1ZWIC 3AG3C 3OEEG 3X2QC 1JCHA 4GX2A 1JVMA 1K34A 5EBWC 2EINC 4GCZA 1R3LC 3CYOA 3OE7G 2K1EA 3W7SA 2WLLB 4WF9V 1VQOV 4FJCC 1OCOB 1M57C 1DTOA 1H2GA 4LP8A 2OCCB 5KUMA 2Q67A 5KA5A 2X0LA 2EILB 4GX1A 5IY5C 5B1NA 2HKOA 4MVSA 1K9MW 4JTDB 4U7OA 1TUEB 5LGNA 5J9PC 4QE9A 3ZRSA 5KUKA 1MABG 3F7YC 1K4CC 1K5QA 2LFRA 2IJHA 4E2LA 3ETEA 4P9OA 3D3IA 3T1CA 2DWDC 4RQEA 3W7XA 2DW4A 5LBQA 3STZC 4JAVA 3CCLV 1GO3F 3OR7C 4XDJA 1AROP 1KECA 5IDJA 5GW7A 1MSWD 2EIMB 4MTFA 2XAGA 1BMFG 3CCEV 2ZXWB 2UXXA 3AG4B 2R9IA 1OCRB 1XL4A 4KP4A 3JD0A 2X6BA 3RVYA 1K4DC 4MS2A 3B8NA 1R6NA 1B6QA 2EJRA 1V55C 1F4MA 1JPXA 1F4NA 3E89A 5LHGA 1E1RG 1E1QG 4UVAA 1W0KG 4QIWF 2Q6AA 2IJKA 3OAAG 2QEXV 2IJJA 3FYEB 3K08A 4WFBV 4H33A 3JD1A 3CCUV 1W0JG 3ZRVA 1NVPB 5E1AC 3SJQC 3D36A 3LDDA 1K92A 2PI4A 4MVMA 4MT8A 4PA3A 1NR1A 4JPRA 5B1BC 2QE7G 3JYCA 2LFSA 1R3JC 4LC1A 3AG1C 2P6JA 3AEIA 3JCZA 4J9ZB 1Q86W 3I55V 2WLHA 3AG3B 4FIPC 2W0FC 1Q82W 3X2QB 5EC2C 5EBLC 5B1AC 3PJSK 2EINB 1EZJA 2IU3A 3JD2A 3SYCA 1P4RA 1JJ2U 3SPCA 3E35A 4MW8A 3ZRWB 3E8FA 3HPLC 2BOCC 3OGCC 4EKWA 5H6RA 4X88A 5IY5B 4PA6A 4WFFA 1V54C 2H8PC 1M56C 3ABLB 4RQFA 1GMGA 4RUFA 4YXWG 1NJIW 1VQ8V 2YSUB 4XBFA 4N21A 3K0GA 4JTAB 2W6JG 4MVOA 5BZBA 4JF3A 5LGTA 1SESA 1KP2A 2QM8A 3CP1A 3SYAA 1VQ6V 3ZN0A 3FB7C 5CA3A 1FXHA 1BHBA 2NNUA 5HFMA 4JYBA 2EIKC 2Z3YA 2ZR2A 1N8RW 2WLJA 5IYDO 3ABKC 4RAIA 2V7QG 3LUTB 3E8GA 3P30A 4TT3G 3OMNB 3STLC 4HYOA 2GSMB 1QVGU 1E79G 2AHZA 1EBOA 1NH2D 1K97A 2V1DA 2EIJC 2H94A 2IH1C 4MVRA 3CCRV 1DF4A 2JDIG 1OCZB 1F23A 2YEVA 2IW5A 3E8HA 1R3IC 5B3SC 2W6IG 2DYSB 4MVUA 2DQ0A 4JTCB 5L3GA 3LNMB 3AG2C 3B8MA 1BL8A 1WLEA 3ZRXA 1R3KC 5C93A 3IC7A 3ABMC 4QPKA 3W7UA 1FXKC 2JJ2G 4MTXA 3OMAB 4XDKA 2ATKC 1RPRA 2HVJC 5L3FA 2WLMA 1RM1B 1I5XA 1YITV 1FFTB 1AI7A 3I56V 3G6EV 1AI4A 1MG1A 3K04A 4R6ZA 5B1BB 1J95A 1QR9A 4I5SA 3AG1B 2Z5UA 4MTGA 1Q81W 3CC2V 3T2MA 3TCUA 4LCUC 2WLKA 3CMAV 1OCCC 1JX9A 5L3DA 3GB7C 1JQ0A 3ASOB 4WFHA 2Q69A 2KB1A 1XL6A 3W7TA 2B1GA 4UVBA 3ZN1A 3RW0A 2P90A 2QA4V 2R9RB 3RVZA 3R65A 1KC8W 2JIZG 1AR1B 3MHSC 3ZCCA 3SYOA 3LDEA 2XAHA 4RO2A 2ITCC 1VQNV 1GM8A 1Y4MA 3OFNG 1AI5A 1NR7A 1DLBA 1H8HG 2Q68A 1UJWB 5CMUA 1SERA 5EK0A 5KA6A 1KKDA 3ABUA 3DTUB 3SPGA 1YJ9V 3E2EA 3HB3B 3SPHA 1AJNA 1S0VA 1GKFA 1M9NA 4CZZA 3ABTA 4MW3A 4UXNA 2LP7A 1QLEB 2EIKB 2HG5C 4FK5C 4KFMA 3BEHA 2PI5A 3ABKB 2OT5A 4GT1A 2HVKC 2HFEC 3FKSG 3CC7V 4WFGA 4BIZA 1ORQC 1OHHG 3ZMZA 3SYPA 4PELA 5CBFA 2EIJB 3FB5C 4QNHB 2OTLV 3CPWU 2XNDG 3P32A 3T4DA 2D3OW 3G4SV 2Y48A 5H9CA 4PDLA 2WLIA 5B3SB 1NVPD 1THZA 1MOFA 1FXKA 1WPXA 2WPDG 3OM3B 1S3JA 1M57B 2XAFA 1NQTA 2CK3G 3K3WA 4JGSA 1FS0G 1YTFB 1QR8A 1L1FA 2JK5C 1RPOA 3ZMUA 4PDMA 1H38A 4H37A 5CBHA 2A9HA 5LGUA 4PDVA 2QM7A 1VQ4V 3BY6A 2ZQMA 1K5SA 4JASA 3G71V 3ZMVA 2Y69C 4LBEC 3CMEV 1QCEA 4TSFG 4QE7A 1K3EA 3GWOA 2ZXWC 4F4LA 3QO5A 3IGAC 4MVZA 3DGEA 4L87A 4X89A 1Q7YW 1OCRC 3OUFA 2X6CA 3FB8C 3M99B 3ZJZA 1YI2V 3VBBA 3W7WA 4ASUG 1VQMV 3ETDA 5H6QA 2DQ3A 1F51A 1CEZA 2IH3C 1H8EG 3OMIB 4P30A 3ETGA 3WG7C 1K7DA 4GX0A 5DM6V 1W2BU 1IXMA 2B1IA 1NKDA 3CC4V 3EHBB 2HR3A 1V55B 2WSSG 4WCEV 4Z1MG 1PNLA 2X6AA 4P2ZA 4PDRA 2WAMA 4BAYA 2XASA 1PL0A 3ASNC 3K06A 3LSSA 4TWKA 4BIUA 1PNKA 3A0RA 2WLLA 4KUMA 4G28B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR V;  1K73 W;  1VQ7 V;  1Q86 W;  1VQK V;  1VQM V;  3I55 V;  1KD1 W;  1VQ4 V;  1VQ5 V;  1VQ9 V;  1Q81 W;  3CC2 V;  2OTL V;  1Q82 W;  3CMA V;  3CPW U;  3G71 V;  1M1K W;  3CD6 V;  2D3O W;  1VQ6 V;  3G4S V;  3CCJ V;  5DM6 V;  4WF9 V;  1VQO V;  1W2B U;  1VQL V;  1M90 W;  3CC4 V;  1KQS U;  2OTJ V;  3CCM V;  1YJW V;  1JJ2 U;  1QVF U;  3CME V;  1YJ9 V;  3CCQ V;  4WFA V;  4WCE V;  3CCS V;  1YIJ V;  1K8A W;  1R73 A;  1YHQ V;  1N8R W;  2QEX V;  3CCL V;  3OW2 U;  1K9M W;  4WFB V;  3CCU V;  3CXC U;  2QA4 V;  1KC8 W;  1VQP V;  3CCE V;  1Q7Y W;  3CCV V;  1QVG U;  1YJN V;  1S72 V;  1YI2 V;  1NJI W;  1VQN V;  1YIT V;  1VQ8 V;  3I56 V;  3CC7 V;  3G6E V; 
#chains in the Genus database with same CATH topology
 1OZ0 A;  4HNA B;  4J42 A;  1VQ7 V;  3IJ4 A;  4F6R A;  5BR8 O;  4DV1 B;  3C90 A;  1XIL A;  3BHP A;  3E8B A;  2CTR A;  3K5M A;  1QVF U;  2QTO A;  2ADP A;  2F93 B;  2HLD G;  1N0N A;  3MDS A;  3A0B Z;  1HWY A;  2EBO A;  3JCU Z;  1AI6 A;  3CCV V;  1ZAU A;  2E5L B;  1JOY A;  2M7W A;  4O4H B;  4UV8 A;  1V54 B;  4LFC O;  3QO7 A;  4MSW C;  4DK1 A;  4MTO A;  4O4I B;  3UO3 A;  1M1K W;  3CD6 V;  1Q90 D;  1FD9 A;  5KLV H;  4HBN A;  5LXT B;  2QR4 A;  2V4D A;  5DN6 G;  1N34 O;  4MVQ A;  3K9A A;  2XAJ A;  5J2U A;  2HJF C;  5CA1 B;  1G1X B;  4IHJ B;  3FD9 A;  1OCZ C;  3SGI A;  4DR6 B;  4HZ3 A;  1U96 A;  3T1H O;  3E22 B;  1JFF B;  2A79 B;  4HAM A;  3HKE A;  2ZIO A;  1I7F A;  4OXS A;  4DV3 O;  2OCC C;  1KQS U;  4WBN A;  4GUN A;  1BCC H;  3U11 A;  1TUB B;  3K58 A;  4J11 A;  2RNB A;  3MD0 A;  3AG2 B;  2WLI B;  3ABM B;  4OGQ B;  1FXK B;  3K59 A;  3H1L H;  1KBH A;  2W0X A;  1EFR G;  3ZRW A;  1VQ5 V;  1N0J A;  4FM1 A;  4LR3 A;  2LJ2 A;  2F1M A;  1TGO A;  2A0L A;  2Q73 A;  3N2G A;  4FMT A;  4IIJ A;  4WFE A;  2JJ1 G;  3SPJ A;  3C3T A;  2OYQ A;  2AW9 A;  3AG4 C;  1YJN V;  2IJI A;  4UV9 A;  5C8Y A;  2VQF O;  2BOB C;  2JGU A;  2P7T C;  3SJB C;  2QKC A;  4CH6 A;  3UM7 A;  4P9P A;  4JI0 B;  4PA9 A;  4ZI7 B;  1H2M A;  2UUB B;  5L3E A;  1Q6H A;  2L35 A;  2YEV B;  5CN0 A;  3IFX A;  1GTO A;  3UCS C;  4DR7 B;  1W59 A;  4I55 A;  4JI4 B;  3APQ A;  2ODM A;  2P22 C;  3OEE G;  3X2Q C;  2KKW A;  4GX2 A;  3FAV A;  2EIN C;  4GCZ A;  4X1K B;  2K1E A;  4FJC C;  1DTO A;  1H2G A;  2OCC B;  3ETQ A;  4DRX B;  2R72 A;  3LNN A;  5IJ9 A;  5B1N A;  4F6R B;  3HR0 A;  1K9M W;  1D2D A;  4JI2 B;  5LMN B;  2UXB O;  1MAB G;  3P3P A;  1YXB A;  3MAQ A;  1K4C C;  4EEQ A;  3H1K H;  2EUL A;  4P9O A;  2DOS A;  2PGG A;  3D3I A;  2F95 B;  1BSM A;  4DV6 O;  2DWD C;  2F23 A;  4JAV A;  3A2F A;  5B5E Z;  4XDJ A;  1OJH A;  1KEC A;  5K1P A;  1BS3 A;  4U3F H;  3AG4 B;  5J2U B;  3S3W A;  4FLX A;  2FKX A;  2VWK A;  3E89 A;  5LHG A;  3EVK A;  1E1Q G;  2A06 H;  2QEX V;  4DR1 O;  2IJJ A;  2YC0 A;  3HKE B;  4H33 A;  3CCU V;  3ZRV A;  4DR3 O;  1MZF A;  3B40 A;  4DV2 B;  2PI4 A;  4WBN B;  3HKD A;  4DV5 B;  4JPR A;  3K9S A;  2QDO A;  1ZX3 A;  1V9P A;  3ZHR A;  4LC1 A;  2KG7 A;  1SC5 B;  2P6J A;  3AEI A;  3JCZ A;  1BT8 A;  4FZ0 A;  1AR4 A;  4AI8 A;  1Q82 W;  3X2Q B;  2EIN B;  1EZJ A;  3UT5 B;  1JJ2 U;  3ZRW B;  3I5D A;  1WAZ A;  4X66 B;  3OGC C;  5H6R A;  4K35 A;  3AK3 A;  3HKB B;  2H8P C;  4KL1 A;  1M56 C;  3ABL B;  3N2G B;  4RQF A;  4IIJ B;  1GMG A;  1NJI W;  2EJ7 A;  3K0G A;  2W6J G;  2VS0 A;  2N04 A;  3CP1 A;  5LP6 B;  2JS5 A;  3FB7 C;  3K5O A;  5C8Y B;  1BHB A;  2WLJ A;  3ZED A;  4HYO A;  4YY3 B;  2EIJ C;  3CCR V;  1DF4 A;  3OTO O;  2JDI G;  4J7J A;  1F23 A;  2R9A A;  4FZ1 A;  2O57 A;  5B3S C;  4I55 B;  3OTF A;  4JTC B;  3G67 A;  3TGU H;  4J80 A;  4AQY O;  5C93 A;  1R3K C;  3FAV B;  2LQT A;  3OMA B;  1IBK B;  2HVJ C;  4FFB B;  1I5X A;  5IJ9 B;  3I56 V;  1AI7 A;  1YIT V;  1AI4 A;  4R6Z A;  2AXT Z;  1VF7 A;  1Q81 W;  3CJH A;  2QWP B;  5KAI Z;  1OCC C;  3PN1 A;  1MNG A;  4X20 A;  5IJ0 A;  5KHK A;  2B1G A;  4UVB A;  3ZN1 A;  3RW0 A;  2OWO A;  1AR1 B;  4K0K B;  3MHS C;  4NXM B;  3RN4 A;  1Y4M A;  1AI5 A;  1WN7 A;  1NR7 A;  2Q68 A;  1I08 A;  1UJW B;  4DW0 A;  4ZIB A;  1L8D A;  4NXN B;  3DTU B;  1NTM H;  4ABM A;  1FFX A;  1AVM A;  1SQP H;  5DEC A;  3ABT A;  4MW3 A;  1QLE B;  4FK5 C;  3SJA C;  3DXR A;  2PI5 A;  4H13 B;  1GRJ A;  5KHI A;  4GT1 A;  2ILM A;  1YVW A;  4WFG A;  1Z5V A;  1N32 O;  1VF6 A;  4J41 A;  2UU9 B;  5CBF A;  4CS3 A;  2EIJ B;  3HKD B;  5JQG A;  2KG7 B;  3RGB A;  5B3S B;  3B2E E;  2VRZ A;  1S3J A;  1M57 B;  3H9V A;  5IE9 A;  3K3W A;  4JI6 B;  1FS0 G;  4EFE A;  2JK5 C;  3ZMU A;  1H38 A;  4O2B A;  2DN9 A;  5CBH A;  4OX9 B;  3M8A A;  4LF4 O;  2QM7 A;  3VQY A;  1VIB A;  3FFQ A;  5GTI Z;  3P3N A;  4I7Z B;  3CS5 A;  5KHG A;  1HNW O;  1Z5W A;  4QE7 A;  1CXZ B;  4X62 O;  1GN6 A;  4MVZ A;  3DGE A;  4DV7 O;  1OCR C;  3VQW A;  3OGI B;  1YI2 V;  4LF7 B;  1U97 A;  3OMI B;  4FVM A;  3THO A;  1VF6 C;  3CC4 V;  4PV1 B;  3EHB B;  2N74 A;  1QNM A;  1PNL A;  2PTM A;  2X6A A;  1NT2 B;  4LF9 B;  3NR7 A;  1H2L A;  2WAM A;  3K06 A;  3ASN C;  3LSS A;  4TWK A;  3RFR A;  1PNK A;  2WLL A;  5LMU O;  4X1Y A;  3UQ8 A;  2Q0A A;  3JAT A;  4UCV A;  2C2A A;  4DR5 B;  2HHH B;  2NN4 A;  3K79 A;  3UKM A;  5KMG A;  1NBM G;  1SQV H;  5LHH A;  5B1A B;  4JYC A;  3CJH B;  4X65 O;  3IC9 A;  5IYZ A;  1XI1 A;  4PA4 A;  4RWU A;  4X20 B;  4JZ2 A;  1T5E A;  4GKJ B;  3CRR A;  1HNZ O;  1HNX B;  4U7N A;  2JGD B;  1VQ9 V;  1AR5 A;  2LGQ A;  4I9Q A;  2MW2 B;  3Q4H A;  5EYP A;  3JAL A;  5IYB O;  3BVO A;  3ICX A;  2PF4 E;  3QF7 A;  5F2V O;  1P49 A;  1LNQ A;  2YI8 A;  1AJP A;  4KHP O;  1EN4 A;  4DK0 A;  3BFR A;  2DWE C;  3T1Y O;  4CC6 A;  3OEH G;  3LDC A;  1FFX B;  3DXR B;  2DYS C;  3MHH C;  4LF8 B;  2QM4 A;  2UUC B;  3ZHQ A;  4PHZ A;  4DR4 B;  2BTQ A;  4CBC A;  2OTJ V;  4IYI A;  1GK9 A;  3CCS V;  4EB6 A;  1ZL8 B;  2IU0 A;  1UPG A;  3CXC U;  4I9W A;  5JQG B;  1R6K A;  4R8C A;  1BGY H;  3ASN B;  1QQC A;  1IBM B;  3WFV A;  4GX5 A;  1R1B A;  4AHC A;  4DV1 O;  1S77 D;  3FYI B;  3B77 A;  2FTK A;  2QKS A;  3ASO C;  4DW1 A;  3FX7 A;  3OD4 A;  2ZR3 A;  4O2B B;  1VMG A;  1SET A;  2FL4 A;  2Y0P A;  1JMK C;  2P4K A;  4GZR B;  5L3B A;  3ZS8 C;  1IDS A;  4E4E A;  3TK1 A;  4YJ3 A;  3RT3 C;  2Y0I A;  4DO2 A;  2D2C B;  4IL6 Z;  1K73 W;  1KB9 F;  1KD1 W;  2RCV A;  4K3A A;  1QLN A;  4LFA B;  1S76 D;  2NLJ C;  3D8C A;  1IX9 A;  4U3J A;  4QJF B;  1SQQ H;  5JWP A;  5IYC O;  4BIO A;  3CCM V;  4J10 A;  3J7A U;  4FLV A;  2JEU A;  3CSX A;  4D7T A;  1IZ3 A;  2E75 B;  4BWA A;  5LOV A;  4DV0 B;  3AG3 C;  3BA8 A;  1XMQ B;  2QWR B;  2PY5 A;  4K8X A;  5EBW C;  1R3L C;  3OE7 G;  4UCO A;  3W7S A;  2PUS A;  2WLL B;  4WF9 V;  4QGP A;  1PV0 A;  4X1Y B;  4B3R O;  4LNU A;  1AP5 A;  2Q67 A;  5KA5 A;  2X0L A;  4GX1 A;  3N2K A;  5IY5 C;  1L0L H;  2HKO A;  4MVS A;  5FPR A;  4JTD B;  2PYJ A;  5KMG B;  2GBO A;  4O4J A;  5LGN A;  4AIL C;  2ETN A;  5J9P C;  3ZRS A;  5IWA O;  3F7Y C;  4DV4 B;  5IYZ B;  4E2L A;  2ZIN A;  3C3S A;  2UUA B;  1HW7 A;  3LSU A;  1B06 A;  4RQE A;  2DW4 A;  3TJT A;  1Y6X A;  1GO3 F;  4CH3 A;  3OR7 C;  4JI5 O;  3Q4H B;  1ARO P;  5EYP B;  5IDJ A;  4MTF A;  3JAL B;  3CCE V;  2ZXW B;  2UXX A;  4PD4 F;  4DUY B;  4KP4 A;  3RVY A;  1K4D C;  1R6T A;  1R6N A;  2EJR A;  1V55 C;  3WB2 A;  2UUB O;  3BA9 A;  1F4N A;  3ZHT A;  4FFK A;  1XNR O;  1W0K G;  4UCR A;  2Q6A A;  1FPO A;  3A8T A;  3OAA G;  1TA8 A;  4DR7 O;  5E1A C;  3D36 A;  4JI4 O;  2BTQ B;  3LDD A;  4MVM A;  3D3Q A;  4PA3 A;  4YIO A;  5B1B C;  2QE7 G;  3JAW A;  3JYC A;  2BSK A;  1R3J C;  4EB6 B;  1HR0 O;  1O9G A;  1IBL B;  2WLH A;  2YXL A;  3AG3 B;  5BR8 B;  1XRE A;  5EBL C;  1FKA O;  3AK2 A;  2IU3 A;  3SYC A;  5KX5 B;  3ZX6 A;  4LF6 O;  2PZS A;  1JA8 A;  2ZIM A;  5IY5 B;  1EM1 A;  4PA6 A;  4WFF A;  4JI2 O;  1S5J A;  2JS3 A;  4RUF A;  4YXW G;  1VQ8 V;  5TIS Z;  3CWB H;  4XBF A;  4JTA B;  4LFC B;  3CB2 A;  5BZB A;  5LGT A;  1SES A;  1KP2 A;  3TXS A;  2IBZ H;  4YJ3 B;  1ZSP A;  2LW1 A;  5CA3 A;  2NNU A;  3KCX A;  5HFM A;  3CRA A;  4X64 O;  1N8R W;  4U3J B;  5IYD O;  4RAI A;  2V7Q G;  3LUT B;  3E8G A;  2GSM B;  1A32 A;  1PL4 A;  1URF A;  1NH2 D;  4MVR A;  3D36 C;  1FJG O;  1OCZ B;  3E8H A;  2L6L A;  4MVU A;  2DQ0 A;  5L3G A;  1WLE A;  3IC7 A;  4DV2 O;  4QPK A;  4H44 B;  3HKC A;  4LNU B;  2R70 A;  1FFT B;  3G6E V;  5B1B B;  1QR9 A;  3CRM A;  4O4J B;  4B3T B;  3KKY A;  1XDC A;  3GB7 C;  1WP8 A;  2ZNI A;  1AB3 A;  1LR1 A;  1XL6 A;  2ZE6 A;  2P90 A;  2RDC A;  2JIZ G;  3SYO A;  3LDE A;  2VWJ A;  3L71 H;  3OFN G;  2VQF B;  2RJZ A;  4W4L A;  4FLZ A;  1DLB A;  3WB1 A;  1H8H G;  1KKD A;  3ABU A;  4JYA B;  3JAK A;  3SPH A;  4JI8 O;  4UXN A;  1M5I A;  2LP7 A;  4KFM A;  2CUG A;  2YI9 A;  4YY3 O;  1XHZ A;  4LF5 O;  3DC5 A;  1RP3 B;  2P4V A;  4PEL A;  3CPW U;  2XND G;  3P32 A;  3T4D A;  1Y76 A;  5E79 Z;  4DR2 B;  3JAW B;  2BSK B;  4PDL A;  2VQE B;  4LFB O;  1NVP D;  1THZ A;  4L8J A;  4D7S A;  2WPD G;  4NVP A;  1UFI A;  2CK3 G;  5JJE B;  1QR8 A;  5LL6 Y;  2A9H A;  3DC6 A;  4PDV A;  2BCC H;  5D5P A;  2ZQM A;  1QU7 A;  1IUR A;  2E3C A;  2G38 A;  5CB4 A;  2CAZ C;  3CME V;  1Y74 A;  4K0K O;  1XEQ A;  3IGA C;  4TOI A;  4NXM O;  4L87 A;  5GON A;  2RMK B;  3OUF A;  3M99 B;  2HP8 A;  3QVN A;  3AK1 A;  3VBB A;  3W7W A;  2ZCE A;  1VQM V;  3CE2 A;  2IH3 C;  1ZUQ A;  3WG7 C;  4OPH A;  4GX0 A;  1W2B U;  4B3M O;  1NKD A;  1GH6 A;  4LH7 A;  2ADQ B;  2K9P A;  4DR1 B;  1FYJ A;  1AP6 A;  4BIU A;  4DR3 B;  1JJO A;  4KUM A;  3K5L A;  2AGA A;  3ZHU A;  1KKC A;  2EZP A;  4R7C A;  2ZDI A;  3HKC B;  2ZNJ A;  3OUS A;  2CTQ A;  3E86 A;  2B5U A;  3S3X A;  4WFA V;  2UXN A;  2BTO A;  1NTK H;  3ZIA G;  3JD4 A;  5D5Q A;  4R50 A;  1VF5 B;  3SPI A;  2WLN A;  4YHH O;  1S5H C;  2AZ0 A;  1US6 A;  1L0N H;  1M56 B;  2B9Z A;  1ROP A;  4B3S B;  3TET A;  3F5W C;  2F43 G;  3VQX A;  3JD3 A;  1Q6U A;  2P67 A;  3H01 A;  4UUJ C;  2OCH A;  3SR2 C;  3ZHS A;  2ITD C;  3K03 A;  2QGN A;  4B7E A;  4DUZ B;  1K8A W;  1LUV A;  2DJV A;  2XAQ A;  3AG7 A;  1HDJ A;  3KCY A;  1Y67 A;  4GKK O;  2Y4T A;  3OTO B;  5HFL A;  4JI7 O;  3CCJ V;  4A5U B;  4X8A A;  1TAE A;  1ENV A;  2EIL C;  3WG7 B;  1VAR A;  3CRQ A;  2CTW A;  4X1I A;  2ZDI C;  3JAS A;  1H2N A;  3B09 A;  4AQY B;  3K0D A;  5DED A;  1SRY A;  1Y76 B;  4CS4 A;  1G8M A;  2WWW A;  1RM1 C;  1VQP V;  1I94 B;  2ZM6 O;  1WJZ A;  5IT9 N;  2GHY A;  4FM2 A;  1NZ6 A;  2F4V B;  3FB6 C;  4FLW A;  2WA4 A;  1N36 O;  4FLT A;  1M90 W;  2ZE8 A;  2X7R B;  5EBM C;  1YTF D;  1OCC B;  2XHB A;  2EIM C;  4ZKI A;  3L72 H;  1J5E B;  4BW9 A;  4JI3 B;  1Q3E A;  2ZD9 A;  4DYL A;  5CB4 B;  1HNX O;  1CP9 A;  3QNE A;  1SZT A;  1S72 V;  4BW5 A;  1PD3 A;  5EC1 C;  2Q5Z A;  1Y74 B;  1N33 B;  4K8Z A;  4O2A A;  4PI2 A;  1P7G A;  3EFF K;  1NH2 B;  3DSQ A;  2MK3 A;  1AJQ A;  2YIB D;  3CCQ V;  3ZMS A;  1YIJ V;  2QWN B;  2LW7 A;  2XOK G;  2KSD A;  5FL7 G;  3G6B A;  2P06 A;  1ZWI C;  4NTW A;  1AIL A;  1JCH A;  3L75 H;  2YUA A;  4TUY A;  4DR4 O;  3CYO A;  2QSA A;  1VQO V;  5LYJ A;  4O4L A;  2EIL B;  1OV9 A;  5ITZ A;  2UXC B;  4U7O A;  4LH6 A;  1TUE B;  5BMV A;  1FAF A;  2E76 B;  5IJ0 B;  2RQ6 A;  4EFB A;  4D6T H;  4JV5 B;  4Z1V A;  3CX5 F;  2GUZ A;  4LF4 B;  2IJH A;  2ZKO A;  1RFY A;  3W7X A;  4O4H A;  5KHJ A;  5LBQ A;  1XBL A;  2RN9 A;  5JJN B;  2EX3 A;  3CCL V;  1XNQ O;  2ARH A;  4O4I A;  2EIM B;  2QWO B;  1BMF G;  3U0Z A;  4LFA O;  1OCR B;  3JD0 A;  2X6B A;  4JYY A;  3B8N A;  1YF2 A;  1B6Q A;  1EZV H;  4I0X A;  1F4M A;  1JPX A;  4YJ2 A;  1E1R G;  1SA0 A;  2Q4P A;  3WB0 A;  3JD1 A;  1W0J G;  1NVP B;  1MSD A;  4ZOL A;  4DV0 O;  4C7U A;  4UCU A;  4MT8 A;  1XMO B;  4X1I B;  2LFS A;  1XMQ O;  3JAS B;  3AG1 C;  3I55 V;  3JSL A;  4X9Q A;  4FIP C;  2ZE7 A;  5H5N A;  5EC2 C;  3WU2 Z;  3PJS K;  3JD2 A;  4Q6G A;  1Z2G A;  3E35 A;  2YIC A;  3E8F A;  3HPL C;  3O65 A;  4EKW A;  2H3O A;  1NI8 A;  4X65 B;  1V54 C;  2E5L O;  2UXD B;  5H2F Z;  1HP8 A;  2YSU B;  4N21 A;  1HNZ B;  2UUA O;  2BE3 A;  2QM8 A;  1VQ6 V;  3ZN0 A;  2GTA A;  2YIB A;  1XOU A;  3BPZ A;  4OPA A;  2EIK C;  2Z3Y A;  1Q8I A;  1P84 F;  3ABK C;  4KHP B;  3P30 A;  4TT3 G;  2GTS A;  3OMN B;  4DUY O;  2YXY A;  3T1Y B;  1QVG U;  4NYK A;  1E79 G;  4JI1 B;  4DR6 O;  1K97 A;  2H94 A;  2YEV A;  2IW5 A;  1I0H A;  2IM9 A;  2JRI A;  2W6I G;  2DYS B;  2YDE A;  3AG2 C;  3B8M A;  1YCI A;  3JAT B;  4TUY B;  3ABM C;  2WA3 A;  3W7U A;  1FXK C;  2JJ2 G;  4MTX A;  5LYJ B;  2LO1 A;  4PJ0 Z;  1SQF A;  2Q0O C;  2QKA A;  2ATK C;  4O4L B;  1KU9 A;  5ITZ B;  4TV9 A;  4DRX A;  1MG1 A;  3K04 A;  3F5T A;  1PPJ H;  3RYF A;  3AG1 B;  3CC2 V;  5BMV B;  1JX9 A;  4H0L B;  3ASO B;  4WFH A;  1D5A A;  4YIP A;  2GUZ B;  3W7T A;  3K57 A;  2QA4 V;  3G80 A;  3R65 A;  1KC8 W;  4RO2 A;  2ITC C;  2Q8V A;  1GM8 A;  3RYH A;  4JI0 O;  3L9D A;  5LA6 A;  5CMU A;  2YXH A;  3JAR A;  3SPG A;  3E2E A;  3HB3 B;  1AJN A;  1DK1 A;  1M9N A;  4I0X B;  3KZI Z;  2EIK B;  4YJ2 B;  5J2T A;  1SA0 B;  3ABK B;  1S5L Z;  2CTP A;  2HVK C;  2HFE C;  1KUQ A;  3A0H Z;  3CC7 V;  1BE3 H;  2PYL A;  3B4S A;  3SYP A;  3CHX A;  3FB5 C;  4QNH B;  5KAF Z;  4ZOL B;  2D3O W;  3G4S V;  2Y48 A;  5H9C A;  4ICG A;  1H2K A;  2QWQ B;  1MOF A;  4B3R B;  2Y4U A;  3OM3 B;  2XAF A;  3H1J H;  5EZY A;  1YTF B;  3OT7 A;  5JJJ B;  5LMN O;  2XTA A;  4PDM A;  3UT5 A;  1X59 A;  5LGU A;  5IWA B;  4B3T O;  4JAS A;  3HKB A;  2Y69 C;  4LBE C;  1QCE A;  4IGG A;  1M4U A;  1N34 B;  2AZ2 A;  1K3E A;  5GTH Z;  3UO2 A;  1B3Q A;  4JI5 B;  4F4L A;  3QO5 A;  1Q7Y W;  5LP6 A;  5JCO A;  3FB8 C;  1RSO A;  5H6Q A;  2DQ3 A;  5JVD A;  1YZB A;  1CEZ A;  4P30 A;  3T1H B;  3ETG A;  4JYA O;  3CRC A;  3JAM N;  2B1I A;  4DV3 B;  5LOV B;  4NTX A;  2HR3 A;  2F66 C;  1V55 B;  2WSS G;  5CA0 A;  1XNR B;  3QTC A;  4P2Z A;  4PDR A;  2XT9 A;  3RYC A;  2P5O A;  3A0R A;  4DV5 O;  3SJC C;  1VEW A;  1HR0 B;  3N2K B;  3L74 H;  4JZG A;  1VQK V;  1YSC A;  2DYR C;  4DR2 O;  2FB5 A;  4UB6 Z;  2VQE O;  4NR1 A;  3TXQ A;  4UVC A;  3BCC H;  1PKX A;  1Q6I A;  4TV9 B;  3RYF B;  4FFB A;  4X66 O;  3E83 A;  1R73 A;  1YHQ V;  1YDX A;  1Y66 A;  3ABL C;  4LF6 B;  4XDL A;  1H2S B;  5B66 Z;  3KG2 A;  1I5Y A;  4G27 B;  2EZO A;  1GM7 A;  5LP6 C;  4N23 A;  5JCO C;  2HEP A;  4PI0 A;  2GV9 A;  1VQL V;  4G2K A;  3RYH B;  2Y69 B;  3ZMT A;  3LSQ A;  2CH7 A;  4X64 B;  3SYQ A;  5LA6 B;  1GAX A;  1WA8 A;  1NU1 H;  3VOU A;  3JAR B;  1MMM A;  1YEW A;  3BAA A;  1FJG B;  2AHY A;  1SF9 A;  5FNV A;  1OCO C;  5J2T B;  3VQV A;  2KQX A;  2DMX A;  4Q20 A;  1X4T A;  5FLX N;  3QO8 A;  4ZBM A;  4CC5 A;  5CBG A;  3OR6 C;  4J7K A;  3OW2 U;  1WB8 A;  2JEX A;  1WPB A;  1PNM A;  3RWR D;  1NS1 A;  4IT5 A;  4JAU A;  4J7Z A;  1QBZ A;  4BR6 A;  1IBK O;  4I50 A;  4UCT A;  3QG5 A;  4J9Y B;  3F7V C;  2UXB B;  1P7B A;  1KP3 A;  5EZY B;  4NKG B;  2DYR B;  3O9O A;  3J81 N;  4DV6 B;  1K33 A;  1COW G;  5L3C A;  1G4Y B;  4FPP A;  2NR5 A;  4TQF A;  5B1O A;  3RBZ A;  4B3S O;  1SQX H;  4RUE A;  1CPY A;  1GM9 A;  4F6E A;  1DF5 A;  1FXV A;  3ML0 A;  3GWK C;  4DXW A;  4UB8 Z;  1BHA A;  4NXN O;  1SZX A;  5LHI A;  4DUZ O;  1YJW V;  1RSO B;  1WP7 A;  1QLE C;  5JVD B;  4LWS A;  5AG2 A;  3L70 H;  4QPJ A;  2HJD A;  3NXS A;  1M93 A;  4JI8 B;  3T4Z A;  3R66 A;  4PA7 A;  5CA0 B;  4LF5 B;  2DE0 X;  2UU9 O;  3RYC B;  2GDS A;  1XHX A;  2FYU H;  1JVM A;  1K34 A;  1GN2 A;  4I4T A;  2Q9L A;  1OCO B;  1M57 C;  4LP8 A;  5KUM A;  4LFB B;  4JI6 O;  1I94 O;  1NTZ H;  2Q7H A;  4QE9 A;  4FM0 A;  4OX9 O;  5KUK A;  5JH7 A;  5A2Q N;  1K5Q A;  2LFR A;  2F4V O;  2YS8 A;  3ETE A;  1F7Y A;  3T1C A;  4FLU A;  1G6U A;  5K1X A;  1WNS A;  2Q7E A;  3STZ C;  1J5E O;  2JGD A;  5BXZ A;  4JI3 O;  5GW7 A;  1MSW D;  2XAG A;  1SS3 A;  1GN3 A;  2OIG A;  4TV8 A;  5EIB D;  3JAK B;  4LF7 O;  2CH7 B;  2R9I A;  4B7K A;  1N33 O;  1XL4 A;  4W4K A;  4MS2 A;  1WA8 B;  2LGW A;  3BRC A;  4ZHQ A;  2CDY A;  1DGS A;  4KXR A;  5BY1 A;  4UVA A;  4B3M B;  2CGN A;  4QIW F;  5FNV B;  2IJK A;  4LF9 O;  2M6Y A;  3FYE B;  3K08 A;  1PP9 H;  4WFB V;  3GVM A;  3SJQ C;  4GYC B;  1K92 A;  5FPO A;  1NR1 A;  4J9Z B;  1ZL8 A;  4CH4 A;  4DR5 O;  2OIE A;  1Q86 W;  2HHH O;  2W0F C;  4I50 B;  4CS2 A;  5B1A C;  3ZBH A;  1P4R A;  3SPC A;  2UXC O;  2ZT9 B;  4MW8 A;  2BOC C;  4X88 A;  3BAB A;  4UCS A;  4GKJ O;  4YHH B;  4JV5 O;  4MVO A;  4JF3 A;  5GON B;  3SYA A;  3RYI A;  1FXH A;  2CGO A;  5KHH A;  1MA1 A;  4JYB A;  1GN4 A;  2ZR2 A;  4Z2W A;  3M7M X;  1TVK A;  1Q43 A;  3STL C;  1EN5 A;  2AHZ A;  1BQ0 A;  1EBO A;  4LWS B;  2V1D A;  2IH1 C;  4B08 A;  4GKK B;  1QHT A;  3SDL A;  1N32 B;  4JAA A;  4LF8 O;  1JR9 A;  4CH5 A;  2UUC O;  1R3I C;  4NTY A;  4UFZ A;  4JI7 B;  3LNM B;  1BL8 A;  3ZRX A;  4HNA A;  4I4T B;  2FML A;  1XMO O;  4XDK A;  3ZHV A;  1IBM O;  1RPR A;  3CEI A;  5L3F A;  2WLM A;  1RM1 B;  4IYH A;  2ZM6 B;  1J95 A;  4I5S A;  2Z5U A;  4MTG A;  2Q7G A;  3T2M A;  2E74 B;  3TCU A;  4LCU C;  2WLK A;  3CMA V;  5L3D A;  1JQ0 A;  2QJ1 A;  1ZTE A;  5JH7 B;  1N36 B;  2Q69 A;  2KB1 A;  1HNW B;  1N4C A;  1BZK A;  1D5N A;  2UXD O;  2R9R B;  3RVZ A;  4X62 B;  3ZCC A;  1IXB A;  2XAH A;  2ZE5 A;  1VP7 A;  4DV7 B;  3J80 N;  1VQN V;  5LXT A;  2YID A;  3K5N A;  3H1H H;  2A3Q A;  5CA1 A;  1SER A;  4IHJ A;  5EK0 A;  5KA6 A;  4TV8 B;  1YJ9 V;  2XUM A;  1IVS A;  1LUW A;  1S0V A;  1GKF A;  4CZZ A;  4ZHQ B;  3E22 A;  1JFF A;  2HG5 C;  3BEH A;  4JI1 O;  1B04 A;  2OT5 A;  1KMI Z;  3CXH F;  3FKS G;  4BIZ A;  1ORQ C;  1OHH G;  2QTS A;  1O9H A;  3ZMZ A;  5LMU B;  3APO A;  1TUB A;  1Q5O A;  4NB5 A;  2OTL V;  5A9G A;  4TQD A;  2WLI A;  4GLX A;  1SQB H;  1MZE A;  1FXK A;  1WPX A;  1NQT A;  4JGS A;  1L1F A;  1RPO A;  3JSN A;  1KYO F;  5KX5 A;  3L73 H;  4H37 A;  4DV4 O;  1VQ4 V;  5EIB C;  3BY6 A;  1EN6 A;  3IAY A;  1ZLZ A;  1K5S A;  3G71 V;  3ZMV A;  1SQG A;  1SKV A;  2A7W A;  4TSF G;  1XUQ A;  2JVD A;  3GWO A;  2ZXW C;  1XNQ B;  4O2A B;  3U10 A;  4X89 A;  2YIA A;  3RYI B;  4ZI7 A;  2X6C A;  3H1I H;  2N05 A;  3ZJZ A;  4ASU G;  3ETD A;  1PM9 A;  1F51 A;  1H8E G;  2Z0A A;  1TVK B;  1XQ8 A;  3N27 A;  1K7D A;  1WB7 A;  5DM6 V;  1IXM A;  4FLY A;  4WCE V;  3EXA A;  4Z1M G;  2CE4 A;  4BAY A;  2XAS A;  1PL0 A;  1BQZ A;  4X1K A;  1IBL O;  4G28 B; 
#chains in the Genus database with same CATH homology
 1OZ0 A;  1VQ7 V;  1VQK V;  2C2A A;  1YSC A;  2DYR C;  3K79 A;  3UKM A;  2EZP A;  4R7C A;  2ZDI A;  3OUS A;  4UVC A;  3E8B A;  3E86 A;  1PKX A;  1NBM G;  2B5U A;  5LHH A;  2QTO A;  1QVF U;  4WFA V;  2UXN A;  3E83 A;  5B1A B;  1R73 A;  1YHQ V;  4JYC A;  3ZIA G;  2HLD G;  1Y66 A;  3ABL C;  3JD4 A;  4XDL A;  4R50 A;  1HWY A;  2EBO A;  4PA4 A;  1AI6 A;  3SPI A;  2WLN A;  3KG2 A;  3CCV V;  1I5Y A;  1S5H C;  1JOY A;  2M7W A;  4G27 B;  4UV8 A;  1V54 B;  2EZO A;  1GM7 A;  1M56 B;  3QO7 A;  4MSW C;  4U7N A;  1VQ9 V;  4N23 A;  4MTO A;  1ROP A;  3TET A;  1M1K W;  3F5W C;  3CD6 V;  2F43 G;  3JD3 A;  5IYB O;  1VQL V;  2P67 A;  4G2K A;  3H01 A;  4UUJ C;  5DN6 G;  4MVQ A;  3K9A A;  2ITD C;  2XAJ A;  2Y69 B;  3K03 A;  1K8A W;  3ZMT A;  2HJF C;  3LSQ A;  1LNQ A;  1AJP A;  2XAQ A;  3SYQ A;  2DWE C;  3VOU A;  3OEH G;  1OCZ C;  3LDC A;  4HZ3 A;  2A79 B;  2AHY A;  4HAM A;  2DYS C;  3MHH C;  1OCO C;  4OXS A;  5HFL A;  2OCC C;  4Q20 A;  3CCJ V;  4X8A A;  1ENV A;  2EIL C;  3QO8 A;  3WG7 B;  4ZBM A;  4CBC A;  1KQS U;  2OTJ V;  1GK9 A;  5CBG A;  3OR6 C;  3CCS V;  2ZDI C;  2IU0 A;  3OW2 U;  2JEX A;  3K0D A;  3MD0 A;  3AG2 B;  1PNM A;  1SRY A;  3CXC U;  1G8M A;  2WWW A;  1RM1 C;  4I9W A;  1R6K A;  4JAU A;  4R8C A;  1QBZ A;  2WLI B;  1VQP V;  3ABM B;  3ASN B;  1FXK B;  4J9Y B;  3WFV A;  4GX5 A;  3F7V C;  1EFR G;  3ZRW A;  1VQ5 V;  2GHY A;  1P7B A;  1S77 D;  1KP3 A;  3FYI B;  3B77 A;  2FTK A;  2QKS A;  3ASO C;  3FB6 C;  2DYR B;  2ZR3 A;  1M90 W;  1SET A;  2A0L A;  4FMT A;  2X7R B;  5EBM C;  4WFE A;  1YTF D;  1K33 A;  1OCC B;  2JJ1 G;  1COW G;  3SPJ A;  2EIM C;  5L3C A;  5L3B A;  4ZKI A;  1G4Y B;  3TK1 A;  2ZD9 A;  3AG4 C;  1CP9 A;  4FPP A;  3QNE A;  1SZT A;  1YJN V;  4BW5 A;  1S72 V;  2IJI A;  5B1O A;  4DO2 A;  4UV9 A;  1PD3 A;  3RBZ A;  5EC1 C;  2BOB C;  1K73 W;  1KD1 W;  2P7T C;  1QLN A;  1S76 D;  4RUE A;  1CPY A;  2NLJ C;  1GM9 A;  1DF5 A;  1FXV A;  3ML0 A;  4P9P A;  3UM7 A;  4QJF B;  3EFF K;  4DXW A;  4PA9 A;  5IYC O;  1NH2 B;  2MK3 A;  1BHA A;  1AJQ A;  5LHI A;  3CCM V;  1YJW V;  5L3E A;  3CCQ V;  1QLE C;  3ZMS A;  1YIJ V;  4QPJ A;  2YEV B;  2XOK G;  3NXS A;  5CN0 A;  3T4Z A;  2JEU A;  3IFX A;  5FL7 G;  1GTO A;  4PA7 A;  1ZWI C;  3AG3 C;  3OEE G;  3X2Q C;  1JCH A;  4GX2 A;  1JVM A;  1K34 A;  5EBW C;  2EIN C;  4GCZ A;  1R3L C;  3CYO A;  3OE7 G;  2K1E A;  3W7S A;  2WLL B;  4WF9 V;  1VQO V;  4FJC C;  1OCO B;  1M57 C;  1DTO A;  1H2G A;  4LP8 A;  2OCC B;  5KUM A;  2Q67 A;  5KA5 A;  2X0L A;  2EIL B;  4GX1 A;  5IY5 C;  5B1N A;  2HKO A;  4MVS A;  1K9M W;  4JTD B;  4U7O A;  1TUE B;  5LGN A;  5J9P C;  4QE9 A;  3ZRS A;  5KUK A;  1MAB G;  3F7Y C;  1K4C C;  1K5Q A;  2LFR A;  2IJH A;  4E2L A;  3ETE A;  4P9O A;  3D3I A;  3T1C A;  2DWD C;  4RQE A;  3W7X A;  2DW4 A;  5LBQ A;  3STZ C;  4JAV A;  3CCL V;  1GO3 F;  3OR7 C;  4XDJ A;  1ARO P;  1KEC A;  5IDJ A;  5GW7 A;  1MSW D;  2EIM B;  4MTF A;  2XAG A;  1BMF G;  3CCE V;  2ZXW B;  2UXX A;  3AG4 B;  2R9I A;  1OCR B;  1XL4 A;  4KP4 A;  3JD0 A;  2X6B A;  3RVY A;  1K4D C;  4MS2 A;  3B8N A;  1R6N A;  1B6Q A;  2EJR A;  1V55 C;  1F4M A;  1JPX A;  1F4N A;  3E89 A;  5LHG A;  1E1R G;  1E1Q G;  4UVA A;  1W0K G;  4QIW F;  2Q6A A;  2IJK A;  3OAA G;  2QEX V;  2IJJ A;  3FYE B;  3K08 A;  4WFB V;  4H33 A;  3JD1 A;  3CCU V;  1W0J G;  3ZRV A;  1NVP B;  5E1A C;  3SJQ C;  3D36 A;  3LDD A;  1K92 A;  2PI4 A;  4MVM A;  4MT8 A;  4PA3 A;  1NR1 A;  4JPR A;  5B1B C;  2QE7 G;  3JYC A;  2LFS A;  1R3J C;  4LC1 A;  3AG1 C;  2P6J A;  3AEI A;  3JCZ A;  4J9Z B;  1Q86 W;  3I55 V;  2WLH A;  3AG3 B;  4FIP C;  2W0F C;  1Q82 W;  3X2Q B;  5EC2 C;  5EBL C;  5B1A C;  3PJS K;  2EIN B;  1EZJ A;  2IU3 A;  3JD2 A;  3SYC A;  1P4R A;  1JJ2 U;  3SPC A;  3E35 A;  4MW8 A;  3ZRW B;  3E8F A;  3HPL C;  2BOC C;  3OGC C;  4EKW A;  5H6R A;  4X88 A;  5IY5 B;  4PA6 A;  4WFF A;  1V54 C;  2H8P C;  1M56 C;  3ABL B;  4RQF A;  1GMG A;  4RUF A;  4YXW G;  1NJI W;  1VQ8 V;  2YSU B;  4XBF A;  4N21 A;  3K0G A;  4JTA B;  2W6J G;  4MVO A;  5BZB A;  4JF3 A;  5LGT A;  1SES A;  1KP2 A;  2QM8 A;  3CP1 A;  3SYA A;  1VQ6 V;  3ZN0 A;  3FB7 C;  5CA3 A;  1FXH A;  1BHB A;  2NNU A;  5HFM A;  4JYB A;  2EIK C;  2Z3Y A;  2ZR2 A;  1N8R W;  2WLJ A;  5IYD O;  3ABK C;  4RAI A;  2V7Q G;  3LUT B;  3E8G A;  3P30 A;  4TT3 G;  3OMN B;  3STL C;  4HYO A;  2GSM B;  1QVG U;  1E79 G;  2AHZ A;  1EBO A;  1NH2 D;  1K97 A;  2V1D A;  2EIJ C;  2H94 A;  2IH1 C;  4MVR A;  3CCR V;  1DF4 A;  2JDI G;  1OCZ B;  1F23 A;  2YEV A;  2IW5 A;  3E8H A;  1R3I C;  5B3S C;  2W6I G;  2DYS B;  4MVU A;  2DQ0 A;  4JTC B;  5L3G A;  3LNM B;  3AG2 C;  3B8M A;  1BL8 A;  1WLE A;  3ZRX A;  1R3K C;  5C93 A;  3IC7 A;  3ABM C;  4QPK A;  3W7U A;  1FXK C;  2JJ2 G;  4MTX A;  3OMA B;  4XDK A;  2ATK C;  1RPR A;  2HVJ C;  5L3F A;  2WLM A;  1RM1 B;  1I5X A;  1YIT V;  1FFT B;  1AI7 A;  3I56 V;  3G6E V;  1AI4 A;  1MG1 A;  3K04 A;  4R6Z A;  5B1B B;  1J95 A;  1QR9 A;  4I5S A;  3AG1 B;  2Z5U A;  4MTG A;  1Q81 W;  3CC2 V;  3T2M A;  3TCU A;  4LCU C;  2WLK A;  3CMA V;  1OCC C;  1JX9 A;  5L3D A;  3GB7 C;  1JQ0 A;  3ASO B;  4WFH A;  2Q69 A;  2KB1 A;  1XL6 A;  3W7T A;  2B1G A;  4UVB A;  3ZN1 A;  3RW0 A;  2P90 A;  2QA4 V;  2R9R B;  3RVZ A;  3R65 A;  1KC8 W;  2JIZ G;  1AR1 B;  3MHS C;  3ZCC A;  3SYO A;  3LDE A;  2XAH A;  4RO2 A;  2ITC C;  1VQN V;  1GM8 A;  1Y4M A;  3OFN G;  1AI5 A;  1NR7 A;  1DLB A;  1H8H G;  2Q68 A;  1UJW B;  5CMU A;  1SER A;  5EK0 A;  5KA6 A;  1KKD A;  3ABU A;  3DTU B;  3SPG A;  1YJ9 V;  3E2E A;  3HB3 B;  3SPH A;  1AJN A;  1S0V A;  1GKF A;  1M9N A;  4CZZ A;  3ABT A;  4MW3 A;  4UXN A;  2LP7 A;  1QLE B;  2EIK B;  2HG5 C;  4FK5 C;  4KFM A;  3BEH A;  2PI5 A;  3ABK B;  2OT5 A;  4GT1 A;  2HVK C;  2HFE C;  3FKS G;  3CC7 V;  4WFG A;  4BIZ A;  1ORQ C;  1OHH G;  3ZMZ A;  3SYP A;  4PEL A;  5CBF A;  2EIJ B;  3FB5 C;  4QNH B;  2OTL V;  3CPW U;  2XND G;  3P32 A;  3T4D A;  2D3O W;  3G4S V;  2Y48 A;  5H9C A;  4PDL A;  2WLI A;  5B3S B;  1NVP D;  1THZ A;  1MOF A;  1FXK A;  1WPX A;  2WPD G;  3OM3 B;  1S3J A;  1M57 B;  2XAF A;  1NQT A;  2CK3 G;  3K3W A;  4JGS A;  1FS0 G;  1YTF B;  1QR8 A;  1L1F A;  2JK5 C;  1RPO A;  3ZMU A;  4PDM A;  1H38 A;  4H37 A;  5CBH A;  2A9H A;  5LGU A;  4PDV A;  2QM7 A;  1VQ4 V;  3BY6 A;  2ZQM A;  1K5S A;  4JAS A;  3G71 V;  3ZMV A;  2Y69 C;  4LBE C;  3CME V;  1QCE A;  4TSF G;  4QE7 A;  1K3E A;  3GWO A;  2ZXW C;  4F4L A;  3QO5 A;  3IGA C;  4MVZ A;  3DGE A;  4L87 A;  4X89 A;  1Q7Y W;  1OCR C;  3OUF A;  2X6C A;  3FB8 C;  3M99 B;  3ZJZ A;  1YI2 V;  3VBB A;  3W7W A;  4ASU G;  1VQM V;  3ETD A;  5H6Q A;  2DQ3 A;  1F51 A;  1CEZ A;  2IH3 C;  1H8E G;  3OMI B;  4P30 A;  3ETG A;  3WG7 C;  1K7D A;  4GX0 A;  5DM6 V;  1W2B U;  1IXM A;  2B1I A;  1NKD A;  3CC4 V;  3EHB B;  2HR3 A;  1V55 B;  2WSS G;  4WCE V;  4Z1M G;  1PNL A;  2X6A A;  4P2Z A;  4PDR A;  2WAM A;  4BAY A;  2XAS A;  1PL0 A;  3ASN C;  3K06 A;  3LSS A;  4TWK A;  4BIU A;  1PNK A;  3A0R A;  2WLL A;  4KUM A;  4G28 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...