2CGNA

Factor inhibiting hif-1 alpha with succinate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
338
Chain Sequence
b'ATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFNREEMKFHEFVEKLQDIQQREERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
publication title Structural and Mechanistic Studies on the Inhibition of the Hypoxia-Inducible Transcription Factor Hydroxylases by Tricarboxylic Acid Cycle Intermediates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 107
structure length 338
sequence length 347
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2cgnA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgnA01
1H2NA 1H2MA 3P3NA 2WA3A 4B7EA 1MZFA 2YC0A 2ILMA 2Y0IA 2YDEA 4Z2WA 1MZEA 2W0XA 4QU2A 2WA4A 2CGOA 1YCIA 4NR1A 4B7KA 4Z1VA 2CGNA 3KCYA 1H2LA 4AI8A 5JWPA 4BIOA 3KCXA 1H2KA 3P3PA 3D8CA 1IZ3A 3OD4A 2XUMA 4JAAA
chains in the Genus database with same CATH superfamily
4KWKA 3K77A 4XF0A 1LJ7A 1BQPA 1OZ0A 1NKDA 2JDNA 4FP3A 5GONA 4HZFA 2EZPA 2CGNA 4QX0A 3OM3B 1X8MA 2W1UA 3JBG2 1SEFA 4NKGB 3X2QB 1BMV1 1NCRC 1OCCB 1H8TC 1W28A 1M06G 2UWCA 4X65B 1VBA3 2AUYA 1DGSA 3C3SA 5LWBA 5J36A 5HCBA 2DCYA 1SDWA 5ABJB 1I6XA 3WDWA 4JI5B 5BNPC 2UUCB 4ZKTB 2JVDA 1ULEA 1K3IA 4TTGA 1AR72 4DR4O 2D40A 3HKDA 2A6VA 4AE2A 3AKTA 3M3IA 1QQCA 4UFHA 4IYHA 4YLZA 4CEYB 4OXSA 4PT6A 2VW1A 5KC5A 2RDQA 2EILC 2BOJA 4UVCA 1WA4A 4ZU4A 1QR9A 4DUVA 3ME2A 3RBZA 1FS0G 3WR0A 1HW7A 3G6EV 5FZGA 5LEJA 2H0BA 4QKBA 4CCOA 1JJOA 1ULPA 2K1EA 4DUZO 4I55B 4NTXA 2XOMA 1HR0B 3NRUA 1R1BA 2O57A 4UVAA 1OHHG 2OXBA 4R8HA 2JJ2G 3ECQA 1RUC2 5JR7B 3A23A 3U37A 3GJAA 4E2GA 2HWF3 1TAEA 3MIBA 5A9GA 4WZFA 4DEVA 4MZUA 3LOBA 1OQDA 3E1F1 4EFEA 4R50A 5CAZA 2WAAA 4H7MA 4LPLA 2NYYA 4P14A 1W03A 4D8MA 5CB4A 4RHV1 3WP5A 3K75B 5DAWA 2UWAA 3PVEA 4EFBA 1POV3 4OHYA 3U11A 3GYDA 4O4HA 1KS4A 2Y0PA 1JZ7A 1LB2A 4Q4V2 1EP0A 4LHSA 3UJOA 5E16A 3AG2B 4GCZA 3V0AA 5CBGA 3WEZA 4YW6A 4JI3O 5LASA 2ZXQA 3M3CA 2B42B 4KU7A 4WBBA 1YFYA 3PUIA 3WB2A 3IAPA 5LW9A 4BIOA 1I3HA 1VARA 2PAKA 1F5JA 4LORA 2RQ6A 1WLEA 1CIYA 2EICA 1WBLA 5GKAC 1W6MA 2RDRA 3N3HA 1UQXA 2Q1MA 3CMEV 1SFPA 2VG9A 3VQYA 4I09A 4XF3A 4RSUA 3A0BZ 1DQ1A 3ZXGA 5HFMA 3ACLA 1C5IA 2VMDA 5LBFA 3POIA 4Y1ZA 3SPHA 4HFSA 1VB4A 3GHNA 3M2MA 2TEPA 4W4LA 4RAIA 4QE9A 5JR2A 2W08A 4B1MA 3D36A 1SPPB 1D5AA 3JATB 1NU1H 5CMUA 1FMD3 1IKPA 1ZBE3 5KX5B 3O1RA 1IBKO 2YB7A 5A7NA 1PM4A 3K5OA 4N23A 2Q4SA 1F4HA 3MDPA 4CDXC 2X5IA 2XDVA 3HAGA 3BIWE 3QO7A 3F95A 4BMBA 1ZA4A 3SJBC 1R081 1JPXA 1NTKH 3FWEA 3P6BA 2WNUA 1OA3A 3Q4HB 3SYPA 4K8XA 4URTA 4FPJA 3G7DA 5DAVA 3IIIA 2A6ZA 3CS5A 2UXCB 1SFYA 1CVNA 1WD4A 2OPWA 3RYIA 1YDXA 1N0JA 3N2GB 4IXLA 5KXBA 3VQVA 2ZMNA 3K51A 2ATKC 2UU8A 4IUGA 2XNDG 5DXDA 1U97A 3HKCA 3T0BA 4MTFA 4QPIC 3DXTA 4UWDA 4I3GA 5L3DA 4HPKB 4NIDA 3OBAA 2JDKA 1XSRA 3LSUA 5DN6G 3K4ZA 4ZOLA 1XE8A 3R4SA 1D2SA 4LE4A 4TV8B 4BQWA 1K33A 2W91A 3TEZA 4BXFA 4YZ2A 3K08A 1W3XA 5GLZA 4ASKA 4TOIA 4YW2A 1VPHA 5FYZA 5FZFA 2XLGA 2FB5A 3ES4A 1VMJA 2WFPA 5LBQA 2QFEA 4MGYE 3ASIA 2CTRA 3WT3A 3EXAA 4LF6O 2ZX2A 1BBT2 1I94O 5FZKA 1DGRA 3HBKA 2AZ2A 1MEC1 2X05A 4AK3A 4CCCA 1GZCA 4WVZA 4YIOA 1P7GA 3FKSG 1EV11 3KT1A 4COUA 4FM2A 4XQ4A 1W05A 5B1AB 3WNMA 4FLVA 2Y64A 3TN92 4QU2A 1YHFA 4AQ2A 1YQ8A 5BMVB 1ENRA 4JC1A 3KLSA 1UYYA 3CDZB 1UX6A 1UZZA 1MS8A 1OSGA 3FFZA 2ZR2A 1D0HA 4W4ZA 4YG6A 5LY2A 2QQOA 3BTXA 5A1LA 4ZZ8A 2RM21 3SCFA 3L2YA 2HWE2 4CU9A 2EINB 5F3EA 2RR13 4NIAA 1VBD1 2D43A 3PNAA 4JI1O 2LP7A 2VNRA 2BSKA 2D6OX 4A7KA 5FR3A 2BUKA 2LUWA 2Y4UA 2KG7A 4WV8A 4FTEA 2C6SA 4JGZC 3LNMB 2RMU2 1QLEB 4XOGA 3H7YA 5ABJA 5G04L 1R1A1 3B09A 4I4TB 4K3UA 4KH9A 1NLSA 1S3JA 3CJIB 4CEYA 4RQEA 3SJQC 3A8TA 1KD1W 4CDUA 4PIYA 3FUOA 4L99A 4R9CA 1DCSA 4O2BB 2BZDA 4K0KB 2CHHA 2AREA 2ATFA 3ETDA 4P9XA 2PGGA 3T30A 1R093 5K4LA 5L9BA 3FLRA 1RMU2 3KHCA 1AYN2 1WCKA 4NWWA 3LF7A 3KV6A 3ZVXA 4I50B 4FBFA 4UF0B 3OG2A 4BK4A 3T4ZA 2KA3A 1OA2A 5FFOC 3W58A 2C9AA 3RFRA 3WXPA 2HR3A 3WDTA 2Q67A 1NQDA 3UM7A 4DV7O 4AVBA 5KUKA 2DVGA 5BUVA 1COWG 3POWA 4NXMO 4RQPA 1CPNA 3ZMNA 1JZ2A 4WM8C 2GH8A 3VBUC 1C8M2 1YF2A 2DYCA 4QHBA 3IZOA 4DXSA 2C0ZA 1JOPA 5SV8A 3R0RA 1PNMA 2W87A 5JOZA 5A80A 1QJX2 3UV9A 2VCCA 3AG1B 2Z5WA 1LR5A 5ITZB 3WUDA 4YW7A 4RFT0 4Z82A 4LF9O 4E4ZA 1UIJA 4HN0A 2R072 4B3TO 4RR3C 2P3KA 4YHHB 1R3KC 2FDKA 2JDYA 4K8RB 3O1TA 1KP3A 4TUYB 1SQPH 5A7QA 4FFBB 4HKLA 4ZU5A 1QXJA 1MQTC 1AX0A 2BGOA 5LMNB 2R49A 4N53A 3ON7A 3T2PA 4AHZA 4P9JA 4XFAA 1K7DA 5CBHA 1RUC1 5IVCA 4WM7C 4OPAA 3CJHB 5DUUA 2PHXA 3ZKUA 4O9EA 1K9MW 1JOYA 3ML0A 2ILMA 4U3FH 2Q8OA 4BW9A 5FRAA 1A8DA 4JKLA 2ZEZA 1QJU3 4XAAA 5GM0A 4PF1A 4JI4O 1QBZA 1W8NA 1XOYA 3FD9A 2QWQB 3ZJZA 4TSFG 1G8MA 2H3OA 3ASOB 2A9HA 4UXAA 5KUMA 4Q4V1 3LB9A 2XQRA 3BGAA 3J7LA 1L7RA 2WZPP 1DK1A 1N1SA 4Q0SA 2VU9A 3AP4A 1V6OA 4WBNA 2VVFA 5ACA3 3Q4HA 4LA2A 2O1QA 2E26A 4XIOA 1TUBB 1BK0A 1W8WA 2CAVA 3C3VA 3U78A 2GUZB 2P2KA 3N2GA 1P8JA 2YC4A 4J10A 4LR4A 4UW3A 1AROP 2GV9A 4CEWC 2B5UA 1H2NA 2CYFA 1UXXX 1JZ8A 1SACA 5DZGA 1XNBA 1FPN3 3WV6A 3POBA 4BM8A 4AL9A 2XHNA 4TV8A 5J1XA 4M0HA 5FZ8A 2BNMA 3BALA 1WLCA 3VKMA 3ASNC 2B8MA 5FYIA 4GXLA 4CDQC 4CPBD 3RS6A 5H2FZ 4HYOA 2YU1A 5J48A 4N9IA 2E7AA 4FAHA 5FO9B 1WKYA 2IXKA 3CP1A 1BK1A 4EB6A 4COYA 1JFFB 1NVPD 3QO5A 1MS0A 3QH7A 3M99B 3VBFB 2HBTA 1PGSA 1UOJA 4YGBA 4X1YA 1KP2A 2A75A 4GKKB 2X6CA 1S5JA 4XDQA 3WNXA 3J7AU 2EXJA 4AEKA 3HEIA 1ENXA 1KRIA 5BMVA 4LK7A 2ARXA 5BNOC 1NR1A 1GOHA 1COV2 2E76B 1P7BA 4H14A 5JXGA 3WU2Z 1U96A 2IW5A 1H2MA 5CG9A 3CU7A 1ENSA 5LRRA 1L3JA 2R6QA 2YFUA 4D7YA 3P5BA 2BRTA 3IDAA 2BNOA 1FXKA 1VRH1 5FYYA 1TQ5A 1XHZA 2DYRB 1HQNA 1ZX5A 5FZEA 1OQEA 2P6HA 1BEV3 5LP6B 3IGAC 4YFZA 1ZZ7A 5CA0B 4P9LA 2VNOA 3DECA 1PIV3 1E79G 1VF6C 4N7IA 1BBT1 4I4TA 1E5RA 3FAVB 5B66Z 3BPZA 3CJIA 4ARXA 3E6CC 5EIBC 4HMZA 1CQ9A 3LE0A 2ZZQA 2RS53 3ILNA 1RUD3 2HYKA 5B3SC 1IS3A 3B77A 5B5EZ 3E8HA 3RJRA 4CP0A 2DBIA 4GKJB 1S2EA 1R6NA 3SDLA 1MOFA 3OUSA 2G1MA 2W0FC 4E27A 4AQYB 1XMOB 1LEDA 3ZSLA 3WNKA 4XFBA 1YFXA 4X89A 3ORJA 3AZXA 4KGGA 4CCDA 3AL5A 1I5XA 1RVF3 5GLVA 2Y6GA 1WUVA 2VUCA 1HLCA 3TXQA 2B5HA 1AL22 1ZUQA 2WWJA 3BU0A 2W3JA 1BJQA 2HBUA 5FNVB 3VD3A 1JR9A 2Z0AA 3KVBA 2Q8VA 4QPGC 4TWKA 1QJY2 3SCGA 3OY8B 2DMXA 2GSYA 3J8F2 1Q6UA 1DQ4A 4WFEA 4W50A 4JGYC 2ZE6A 2A70A 1B09A 1C1FA 2TBVA 2E32A 2L9LA 2FQPA 2WN2A 4U7NA 4EV0A 4QXBA 4K1ZA 3OEAA 4I02A 3JD4A 4HKWA 5FK7A 4A2UA 3AKRA 5JMOA 4FFBA 4XCAA 2FDIA 1HR0O 4GX1A 2ZGTA 4AHWA 2P34A 4DYLA 1UMIA 1JZ3A 4OCTA 3VKOA 1PVC2 4DV1B 4UT5A 4PD4F 2XJTA 5KAFZ 3B94A 4UI9L 1AI4A 4R4ZA 2C4XA 4OPHA 4XXPA 1GN2A 2EIMC 4IGOA 2HVKC 4UW6A 4OHXA 3ATGA 1JYVA 4EJRA 3WF3A 3CE2A 1SERA 1RP3B 1PK6A 3UKVA 1CGPA 4H44B 5F6KA 4CCLA 3BVCA 1HX6A 5FMDA 3NAPB 1W6OB 4KUMA 2M6YA 4JDOA 4J9ZB 1SFNA 3IMMA 1IQDC 4PDWB 2PN5A 3N7LA 3VZJA 1UZYA 1UOBA 2DCJA 2R071 3C7EA 3QVNA 1QU7A 1S0BA 4OX9O 1AXZA 1ULFA 5FYHA 5FYMA 3MD0A 5EBWC 2D7FA 4BYYA 3DF0A 2DUQA 1TUBA 1Q8SA 1W8ZA 2XASA 3WW2A 2OCCB 4YM1A 3VUOA 1HIXA 4XFHA 3OBRA 5IDJA 4PJ0Z 2YU2A 4D3WA 2IUWA 4OULA 1MPXA 4G9SB 4PDVA 3CL1A 3D0SA 4ET7A 1VQNV 3OPWA 5L9VA 2A6WA 5FWEA 4N7UA 5FLXN 1Q3EA 4TLFA 5LOVB 4RYDA 3GCWA 1R64A 2W47A 4XABA 1W6NA 5IK7A 4UFMA 4DQAA 2D5FA 4GB31 3OGJA 1IHMA 1UXZA 3KB5A 1ASJ2 3WNNA 5H5NA 1XU1A 4LR3A 5FKCA 4ONUA 5FZ4A 1NH2D 1BKZA 2EIKB 1W0PA 1S0CA 2AENA 2A3QA 1NVPB 4ZKIA 5GZEA 4XFIA 2VRZA 4DR3B 2CTVA 5B4NA 5C71A 1Y7BA 4JI7B 2R0FA 3VBHC 4N21A 1LOBA 3CLPA 2JE8A 3QO8A 4GD4A 2ZBJA 1R083 1JFFA 2Y6KA 3LFMA 2ZX1A 4AVSA 5IK4A 2MEV1 1MA1A 5LYJA 3ABLC 1KYOF 1CPYA 4IE7A 3K04A 4YNIA 5JIAA 4GH4A 4LH6A 3NKGA 2YIDA 2EALA 4GMP0 4M4RA 3CYOA 1HNZO 2Q7EA 2VQAA 4JAVA 2ZACA 4NYKA 4LBOA 1S4CA 1TMF2 2JG9B 3WB0A 4LO5B 1JN2P 4GMP1 3SNMA 1PNKA 4NN0A 2BJSA 3VD7A 5LMUB 4HAMA 2VOKA 3VL9A 1GN6A 4I01A 3ST7A 4Y22B 2WZ8A 1NR7A 5EIYB 4C7UA 1IOAA 1NCRB 1H8TB 3U10A 3LEKA 2BYVE 3T08A 3PN1A 4YGCA 2YIBA 2XXZA 2Q8DA 2VL4A 3N9OA 4JYAB 2WFF2 4CDWB 2YBKA 1FAYA 4CP9B 1MNGA 3AK3A 1IZ3A 5A7SA 4JAAA 3GZEA 4X62B 1NS1A 2HKOA 3FHQA 1IPKA 5A33B 1UZ0A 5E6HA 2IVJA 3WW4A 3H8XA 1HNWO 1MEC3 1PL4A 1N34O 4MH0E 3HB3B 4JKMA 1EV13 1X59A 1GQGA 2FCUA 2Y69C 1AJQA 2IXCA 4U3JB 1COV1 4Y4RA 3OEHG 4X20B 3SJCC 4BE3A 1TNRA 5EZYB 1KD7A 4LFAB 3AYEA 2RM23 1BQ0A 1PNFA 4MGZE 2H8PC 2IVIB 4GX0A 4B3RB 3HQXA 2JECA 1RHI2 5JJJB 3FBYA 2D2CB 3E8GA 1XSQA 1MSWD 5FNVA 4LF8B 2YHJA 4JQTA 4XTMA 1ZBA2 3AL6A 3DYPA 3O7OA 3LPFA 1PGL1 4X1IB 1JQ0A 1ONAA 3THPA 2P90A 2YXLA 4NIGA 4EKWA 1R1A3 3P32A 3ZYJB 1O3QA 4O2AA 4AFMA 2B1IA 3OPTA 2W92A 2P5BA 1PNGA 4K40A 5C8YB 4UFKA 2C26A 4NMIA 5T54A 5LCWL 1R6TA 3AYCA 3ZIAG 5GLWA 3TETA 3IBMA 1FX5A 4CUBA 4BHPA 4DOUA 4AGGA 3JALB 2EXKA 1D0GA 2W2IA 2VS0A 1UPGA 4S2DA 1OLRA 4XUQA 4CS4A 4AVTA 2EVXA 3OR7C 2EULA 4XDLA 4CXWA 4XHBA 2R30A 4JZRA 3SPGA 1J3PA 4OMDA 3KD4A 4PLMA 2WZEA 5KR7A 4YM3A 2EZOA 1F8VA 4JI2B 4NIIA 5JQGB 1KKCA 1H38A 1ENVA 1N1YA 2WRAA 4DR6O 5L9RA 1NCQA 2DCKA 3INAA 4DV3B 5K0UB 2BTQA 4D7SA 2Y33A 4AQTA 1VBB2 3R4DB 2VQFB 4AILC 2X6BA 3UYJA 1QJY1 3UNPA 3I2FA 1VQMV 1G86A 1GP4A 3J8F1 4N43A 5IFTA 4IEVA 4DB5A 1HQLA 3T1LA 4CDXB 2VBDA 1FFXB 1WAZA 1WMEA 2HWC1 2GC3A 2D44A 3JD72 5HBAA 2A3XA 5KMGA 1C28A 2Y8KA 1Q90D 1SA0A 2AGAA 4YHHO 5C3RA 3LQCA 5B1BC 2QWOB 2FDHA 1D4M1 4DV0B 4PQQA 1DLBA 2P6JA 3VHOA 1XNRO 3D36C 1AL0G 1X82A 4LF5O 5CFDA 1AP6A 1U5YA 4IE6A 5LMNO 1WLDA 5L3EA 4YVSB 4QJFB 3UQ8A 5LA1A 3BN6A 4A3XA 3FZ3A 1QJEA 1SBFA 3RZKA 4CUAA 5LBCA 1YIPA 3RYPA 2UY8A 4QPIB 4WVVA 5DUXA 1VALA 1BZWA 2QJVA 1E5SA 1RUC3 2WNUC 3WHUA 5LOVA 4DR7B 5CFCA 4C0BA 1NH2B 3JCIA 3R65A 2CE4A 3FB8C 1M57C 3DCQA 5EZWA 2BERA 4FOQA 5T5PA 4S2GA 2ZGKA 4HLTA 4Z2WA 3VBOA 3IDBB 4B4PA 4Q4X2 1OPMA 4X64O 5FOJB 1ZNPA 1WCSA 1WB7A 2K0GA 4QX8A 2XWJB 3VZMA 2RDSA 3MPBA 4KL1A 4N8MA 2A6YA 3L74H 4Q4V3 3HR9A 2BWCA 5FZ3A 5I8TA 1F51A 4O4IA 1S5LZ 2UYAA 2DOSA 4Q1RA 3H8RA 1WMDA 2ZABA 5CA6A 2XLAA 4ZHQB 4E2LA 4IEXA 1C3HA 4AZZA 5C8CA 4YG3A 5EYPB 4DK1A 1S2KA 1KXGA 4QXHA 2CAZC 4LF4B 1XMQB 4UCTA 4EN9B 4XDJA 1GN4A 5LBEA 2PTMA 3ZXJA 5ERLA 4JTAB 4HSJA 1W2NA 2Q0OC 2DTYA 2HYXA 1VE0A 1AR62 2BOBC 2Y38A 4NRMA 1SKVA 3HKBA 4FP2A 2XAHA 3E8FA 4X66O 1WP7A 5FMBA 1CJPA 1RYYA 1IG0A 1PM7A 3ZHRA 1Y74A 1Y4WA 3ZSKA 4K20A 5H9SA 1JMKC 1LENA 1RUE2 2FL4A 3GDBA 1SHWB 4CDWA 5JH7B 3T2MA 3K46A 3I3QA 2OQ7A 4M3CF 4MGTA 2VQEB 1QDOA 3POJA 5KHJA 2VOWA 3FX7A 4B4QA 2Q7GA 5BNNB 3B00A 2WA3A 4OGQB 2ENRA 4KNCA 4GZRB 2ARBA 1X33A 2LGQA 1VJ2A 1H1MA 5JDBA 5I0UA 1W04A 5FUIA 4HBNA 3I4IA 3IWZA 4FK5C 3KV9A 1OCCC 1VB2A 1Z0HA 2ZOEB 3BTYA 3SLIA 1GBGA 1ZAUA 5EIBD 4KXRA 4PA7A 3FB6C 1TMF1 2VQ0A 1MZ5A 1Z78A 4IQPA 2BEOA 1LESA 3LA7A 4MVMA 1QR8A 5ABJC 1BCXA 3PL0A 4QQLA 3ABMC 1A3KA 2QQJA 1H4GA 5JWPA 3KG2A 4ES9A 5FMCA 4CEYC 1LAJA 3CD6V 4I3PA 2GAUA 2R042 4CDUC 5J37A 2R16A 4RWUA 2ZIMA 4WM8B 3HJRA 4UFIA 1VRH3 3O9OA 4U7OA 2RS32 1VBE1 4XHXA 1H6YA 2NR5A 3SMHA 4PLNA 1S0IA 5J3UA 4K35A 5E1AC 4IERA 4AI2A 2X7RB 1A78A 1V9U2 1BVVA 2YIAA 3ZYGA 2EIBA 2ZZJA 2QKDA 1RUF1 3ZYHA 1RM1C 1BBT3 4DW0A 3BCCH 4PF5A 3RZGA 3ZRXA 1M9NA 1DF0A 4RR3B 5C8YA 2ZHNA 3MFAA 5FPZA 2WZR2 4E4DX 5DABA 4RQPC 3WQ7A 2R9IA 3OF1A 5L3GA 3ENRA 1JH5A 4MGSA 2YROA 1XI1A 3VLBB 3JALA 1WMXA 5IK8A 1WA8B 1WBFA 3H50A 1O7FA 4WM7B 2VTXA 3J7HA 5A6YA 3I3BA 4XZPA 4Z8BA 1US2A 4O4JB 2Q0AA 2JENA 4JTDB 3AJZA 4NRPA 4XFCA 2OWOA 1XNDA 3SKVA 4E4EA 2WYFA 3JASA 2VTFA 2MNGA 1MS4A 1MMMA 1XE0A 4LIUA 2HWB2 3VL8A 1EAH2 4JRAA 3IPVB 2VC9A 2EX3A 1SS3A 4J7KA 4N53C 1F9KA 1K42A 3STLC 4RN5A 2QVSB 1YLLA 3IFXA 4FXGB 4DY3A 2E5LB 3I49A 1D4VB 5GALA 5LATA 1ZVFA 3CKHA 1W06A 2BTOA 5JVDA 4EWEA 3ZRWA 4QKNA 5I8SA 4LNVA 1J83A 3VD9A 1SZTA 2XAFA 3R05A 1VQOV 4CXXA 1RUOA 2BV4A 3X29B 1KKDA 1HRV3 2BGCA 4DV1O 3A0RA 4HOOA 5LRSA 3BI3A 5FBJA 4RGKA 3SH3A 2JIZG 1NBMG 2WSVA 4EN0A 1OLME 3ZFGA 1FD9A 4NTYA 1JMUB 1CX1A 5FZAA 1PO22 3VD5A 5A3UA 1JBCA 4XUNA 1HRI2 3T0AA 3TEYA 3N36A 4Q4W2 1YQ2A 2MW2B 4A3ZA 3K9SA 2LW1A 4D6RA 4IHJB 3KGLA 4CDQB 5IT6A 2ZKLA 3BRCA 2PXJA 1LGNA 1JZ5A 3S6PA 2QA4V 2E53A 4HN1A 4DV6B 1GANA 1ENQA 1PZ9A 1GUIA 2O14A 4MYEA 2J1SA 2OYQA 4GWMA 1H1AA 2R1BA 4UXNA 1HXS1 1QCEA 3ABKB 4ICGA 3BAAA 5F1RA 4X8NA 1QXPA 4DY5A 4RQFA 2R72A 5F9TA 4LJHA 5T5LA 1F23A 4KGQA 4I9WA 2A73B 1AJOA 3HPLC 5DG1A 5BNOB 1NAEA 3CF6E 4PCRA 2ZX3A 4DR4B 1Z7S1 3BTAA 3CHXA 4UV8A 1L8DA 3A22A 1RUI3 2JD4A 3IKWA 2HJIA 2ZMLA 3NNLA 4QM9A 4PV1B 2XR4A 4NWVA 5CKQA 4V1PA 4GB33 3TNQA 3TJTA 4LQRA 4Q4X1 5E8AA 1UPSA 2RJ2A 2NP0A 5B1AC 3KHBA 3PU3A 3V0BA 3T4VA 1JTZX 1RUH1 2C24A 1W8FA 2AEYA 4DUZB 5L36A 4JI7O 4LC1A 4ISQA 5BNQA 4J41A 4MVSA 4P5YA 2PLV3 1OCRC 4D0QA 1W6QA 5BNNA 3QD6A 4LT5A 1LODA 4MHRA 2BFUS 3DKWA 2EIDA 4FQ4A 2EINC 2ARCA 3QOPA 2PHLA 1FXKC 1C57A 1S0FA 4N9HA 2ZGNA 3H3LA 5DPNA 4D94A 3MLKA 2F6BA 4ATEA 4AVVA 2NM1A 3OTOB 4QKDA 2MEV3 5JCOA 2X6AA 3POEA 3LKJA 2NPIA 1W2BU 2QKSA 3N9LA 2PYTA 3A4UA 4YW1A 3OGGA 4JHTA 5LL6Y 3N7MA 1QLEC 4JQRA 4CU8A 1WW6A 3RW0A 1L7LA 4GMP3 3WF2A 1S0DA 4YM2A 1AI7A 3VZLA 4LWSB 3CJIC 4WVWA 1LOAA 2V4DA 3GZTB 3G80A 2XPJA 5LA9A 4LUMA 2CUGA 3FJSA 4JYAO 1QQP1 1ZLZA 1Y43B 2JKBA 5EQUA 4Y1UA 2UXNA 2NQYA 3BHPA 1Y66A 1F5FA 2VAUA 2VCAA 1IBLO 1IS6A 2HKXA 1U12A 4Y20B 1UW8A 3JD2A 1WD3A 4DEQA 4UVBA 4FXKB 5SV5A 4JGYB 1FOD2 1DZRA 4Q4Y2 5EYYA 2DU0A 5LXTB 1Q8IA 2A6XA 4BMEA 1HB1A 4YYOA 1KECA 4PHZA 1XEQA 2YMZA 3ZXDA 4XTPA 5J96B 3DYOA 2VGDA 4EYUA 3K58A 2YEVB 2RS11 4UFJA 2WLIA 2VBPA 1X4TA 2ZGLA 5FZBA 3I3MA 2N05A 3LEMA 2TUNA 1RSOA 3DGTA 4QB6A 4A5UB 1COV3 5F32A 1UPIA 2HWD1 2EIMB 3AG1C 5FDBA 4QQOA 3B02A 1L7QA 5CADA 4MVOA 2R041 2H0VA 1CAWA 1Q86W 2JG8B 3I3DA 2OTLV 1JYNA 4O4JA 1KGYA 3HOBA 4MVQA 1W6PB 1CWPA 1O8PA 2ETEA 4YJ3B 4LF8O 2NN4A 3WDVA 1IXMA 2AZ0A 3V65A 3NW4A 4FVVA 1LOCA 1XRUA 2P3YA 4CCEA 1X36A 2D6KA 3K0DA 1OQ1A 4CCKA 3CCSV 4MGKE 5C8WA 3B5LB 4C1XA 3B3QE 2YI8A 4DRXA 3ZLIA 1LGBA 3AYAA 1R3IC 1PHMA 2EIGA 1PK6C 4AEDB 5GLUA 1GM7A 1CAUB 2ODMA 2D5HA 4YZ3A 3VDCA 1QEXA 1IXBA 5FLJA 3NQHA 3RYFB 4FPGA 1YJNV 1O9HA 1X7NA 1HB2A 3T0DA 4OFGA 1JCHA 3B9CA 4I0XA 2RDNA 1YFUA 5CA1B 1Y76B 1OUXA 5LGTA 2KXLA 3MW4A 2Y26A 5EC1C 2LGWA 2CSGA 4O65A 4W6WA 2XTAA 3AKPA 2IU3A 4LF6B 3VN4A 2QGNA 4LEJA 3ZHVA 3ZHTA 1XQ8A 2VQFO 4MXVA 2JJ6A 1DQ0A 5JZGB 1DLCA 4LIVA 1GOFA 4YW3A 1XQNA 3AG3C 3I2GA 1EAH1 2D97A 1DYOA 1HDJA 5FQ0A 4J25A 1QJY3 1N33O 1OD3A 1RXFA 3OMNB 2K9ZA 4OHWA 2JK5C 2PHDA 3ZN4A 4KFMA 3JAWA 3VBHB 2XBO1 2Z2SB 2HWC3 1FYJA 1UKRA 1NYWA 3WLUA 3JSNA 3ZHUA 1OH3A 5EJZB 1RUJ1 1SLAA 3E89A 3ZXEA 3ABLB 1D4M3 4E4SA 1N36O 3WP3A 1JJ2U 4JI1B 3ELNA 4GYCB 1OF4A 3ZFEA 1ND3A 4XACA 5DZEA 4OUSA 4G2KA 1B3QA 2QM7A 4Q27A 2ZIOA 1TEIA 1PO21 1STMA 1THZA 2UU9O 1EN5A 4V2WA 2W95A 3EVKA 3H0OA 4ABMA 2P5OA 2VMIA 4WVMB 3OGCC 4NXNO 4GH4C 4FPFA 4CRQA 3WUCA 2YPJA 1O3RA 5I93A 3CPWU 1I08A 1WGPA 3T3YA 4FFFA 3TEWA 1NE4A 4IEWA 4WFHA 3TEXA 2V4VA 1ZZCA 3AYDA 4I0WB 2P22C 2QKCA 5GONB 5FXXA 2XJRA 4DV7B 2GSMB 2DYRC 3ZIXA 4BQYA 4NXMB 1UMHA 1JODA 4NHMA 3MIEA 2VZUA 2Y69B 3KGZA 3Q8AA 4QWNA 2PHTA 2VCMA 4LBQA 4MX3A 1H6XA 3H3ZA 2NNUA 3T1CA 3HKDB 4R7CA 4FO9A 2TNFA 3N2KA 1W99A 3MUY1 2QQIA 1YXWA 4RUEA 3IAYA 4B08A 1W90A 4CH3A 3KT7A 5CKMA 1DTOA 4LF9B 1O8SA 2J1UA 3KV4A 3ZBHA 1YXBA 3KV5A 2D6MA 4B3TB 2GNDA 3BTZA 3M1HA 4LFBB 5H9CA 4A7YA 2YBSA 3CX5F 4X88A 2IJKA 2BCCH 4FCAA 1NE6A 1LHUA 5EWSA 5AVAA 3UL2A 4PJYA 1AXYA 2VQEO 2KSDA 4AHXA 3I2JA 1RJ8A 2VW0A 1FXZA 4QGNA 2RE9A 2BWAA 3ABZA 4LO8A 3OPZA 5EV7A 4DZGA 3TK1A 3CRMA 2XWBB 3L2HA 4KG0A 2DYSC 2GHYA 2WLNA 2R9RB 4HXCA 1ULDA 3PUSA 1LNSA 2RHPA 3TXSA 1AVBA 3DEMA 3DKQA 4QGPA 1QU0A 2GDFA 5CB4B 2ERFA 2AXTZ 1V6JA 1RIRA 3HBZA 4H3WA 1YIFA 4XBQA 4O4HB 1VBA2 2V5YA 4GULA 3F5WC 2VM9A 3MF9A 3EMRA 3NWKA 5H6QA 2C2AA 3USUB 3V0AB 2LM3A 4LA3A 5FLHA 1GM8A 4HL0A 1RUG1 1AX1A 1JI6A 5KA5A 5FZ6A 3PUAA 2CL2A 2QQMA 1VBE3 2XKOA 3THOA 3M4FA 2VZVA 1I5PA 1W6MB 2EIJB 3RWRD 1JUHA 1LTEA 4P9GA 5DN2A 1VR3A 4K9SA 5JMCA 3NR7A 2A79B 5JOXA 1RUF3 3H9AA 3OJBA 3TNPB 1ORQC 2WS91 4AFDA 1YSCA 1H2KA 5CA3A 3OGSA 5B1BB 3PJSK 2VCBA 2XUMA 4AEDA 4Z1MG 5FREA 4A6SA 4IGQA 3RYFA 2WO1A 2QWNB 2JDUA 5TSWA 1PZ8A 2ZINA 3CRQA 3MV01 2XHBA 2HWF2 5D8AA 4PBPA 4N43C 1Y76A 3LPGA 2I45A 3VBSA 3NMBA 2X5IB 2BBVA 4XJWA 1AHSA 4CU7A 2JGUA 3JQWA 1Z5VA 4M3CA 1NTMH 1XDCA 2PAEA 2WNUB 1MSDA 4AYUA 1PO11 1VAMA 3O1SA 1PP9H 3LDRA 2K2SA 4K3AA 3CEWA 1XU2A 1M57B 3RWKX 5IJ0B 3OD0A 4RUFA 3RYIB 3WCSA 1DF5A 2PQQA 1GV9A 5JZGA 3C7FA 3CRCA 4KMQA 5CFDC 4EZHA 1W8HA 2WAMA 1YHQV 4MHUA 2P6CA 2VXJA 3HKCB 3WFVA 2JDMA 5F6LB 1KFUL 2Q69A 2XOKG 3H8UA 3OYWA 3KQRA 1XL6A 5I0RA 1L1FA 4N90A 4BAYA 5CFCC 1WB8A 1DLLA 2RVAA 5KBFA 4EN8B 2ZT9B 4CUCA 4ZOLB 4URAA 4A7ZA 3FYIB 1IDSA 1U5IA 1FJGO 1SF9A 4Y1XA 1KITA 3VBOC 2WR9A 4XUTA 2WLHA 1JHJA 2QBXA 4A44A 2VUJA 1AR4A 4I0AA 2DCZA 3I59A 3AG7A 1GLHA 1C8NA 4MLOA 1R6KA 1F4NA 2JX9A 1Q6IA 3G71V 1ZBE2 2RDCA 4YXWG 4GWJA 1QVGU 4ZZ5A 5F3CA 1VQ9V 3UCSC 2VH9A 2F4LA 4Y1VA 1G1XB 1ODNA 4GWIA 3LSDA 2H6BA 4BDVB 4RFRB 1EM1A 5K7PA 1UZWA 1UYZA 3J26N 4NVPA 1YIJV 3JD0A 3CSXA 2D93A 3W7XA 4DV6O 1U5XA 1VMGA 1RUNA 4Q2FA 1CONA 2JKXA 4QB1A 3O1UA 5K1XA 2Q1FA 5FZDA 3W21A 3NKTA 3JB8A 1WJZA 1UL9A 5BR8O 1N3QA 4EZ4A 2JE7A 1BMFG 1QDCA 2GZWA 3V64A 2VNGA 5FXZA 4ISRA 2BSKB 1HXS3 2I07B 4H2AA 2KG7B 3S7IA 2R32A 3DYMA 2XJSA 4CDWC 1V55B 3KM5A 1QOOA 2WKKA 1ZSPA 4BQ4A 3ABMB 2QQWA 3ITQA 5AFBA 4B3MO 1NJIW 3WNPA 4X8PA 2P3IA 1SLCA 4XVHA 3TRSB 3SR2C 2WO2A 5JLVA 5KAIZ 3OR6C 1AI6A 1Z7S3 4LLFA 1DYKA 1S0JA 4CDUB 3ZDVA 2DTWA 1G6UA 1OT5A 1GOGA 1JYTA 2VZQA 2VBBA 5F5QA 5J2UA 1E1QG 5FYTA 3VDDA 2YXYA 4M0NA 3THDA 4HSLA 4YIPA 4NHLA 4JTCB 5DECA 4CP2A 2L6LA 1RUH3 1K5MA 1RPRA 2W52A 5AC91 1IVSA 1RM1B 5LZ6A 1LGCA 4TXWA 4LO4B 3UO3A 2ARHA 2V4AA 2BW8A 4Y4YA 3AB0A 1XYOA 4XFGA 2ORZA 3OTOO 2F93B 1NY72 4RQPB 1IS5A 5GZDA 5EHDA 1JYWA 3BCWA 4XXAA 3HT2A 4Q0QA 3BKZA 1PGW1 5FKBA 3RQ0A 4LNUB 2RR12 2F23A 3GJBA 3E83A 5GTHZ 1KMIZ 4JI8O 4AI1A 1JU4A 3DTUB 3LIGA 4GIQA 2DVAA 1B6QA 3ZMSA 2XB6C 1N3PA 1SCSA 4Q20A 2EBOA 4BIZA 2R061 1SBEA 3PTRB 3USUA 4OX9B 1S1AA 2UXDO 2V1DA 3ZYRA 4IEPA 4FLYA 3RT3C 3T2OA 1RL3A 1QQP3 2D3SA 1W9YA 4N53B 2ZDIA 3FMGA 4AAPA 2WSSG 2V72A 3VKFC 4G4FA 5LA6A 4WFAV 1R092 1FPOA 1IBMB 2E63A 2QM4A 3UESA 3JUUA 2RMKB 1DGWX 1GZWA 3FE5A 3E6DA 3NV2A 5IAVA 2FDJA 2BTVC 4CZSA 3BA9A 1E5HA 3KF3A 1URFA 1AR82 1GKBA 1H30A 4F6EA 5K0UC 3ZHSA 4MSVA 2W94A 2ZKNA 3U1XA 3ILRA 4MGQA 3I97A 1HP8A 1AZDA 1QNYA 2RS13 4NUBA 3T2TA 3LZZA 3FL7A 5FO7B 1JUIA 1WA6X 4QNHB 4XFFA 3UO2A 5J2TA 3LSSA 2HWD3 3AZYA 3MIHA 2W1WA 1Y9MA 5M0TA 5LK5A 1A8MA 4WBNB 1LHNA 3MO4A 2IFWA 3OMAB 1PX3A 5IJ0A 1VP6A 3U0ZA 1NT2B 3WX5A 2IWGB 2OVUA 5JOYA 1HNZB 3L71H 1Z5WA 4F6RB 1BGYH 3RYCA 3LOIA 5GJ6A 5I0TA 4YVSC 3WINE 1DG6A 5FTTC 1CAVA 1VF7A 2Y48A 1MVEA 1QWRA 1GQPA 2F4VO 4LKSA 3ZFGC 4JTNA 4NTWA 1N3OA 2BFUL 1O6UA 1K97A 5L3FA 4BR6A 2YI9A 1DU3D 1HN1A 3L75H 3J4UH 1Y9QA 3OW2U 3AG4B 2GH2A 1NZ6A 5FPBA 1FATA 3CCLV 3NJYA 5T5JA 5HXVA 3E5QA 3BUCA 4G27B 3UT0A 2D6PA 1W2TA 1POV0 4PIXA 2VULA 1B35B 1QJU2 1AR1B 3HT1A 1ZRCA 4EB6B 2QSAA 2BE3A 2WT0A 5FZHA 1POV1 1OI6A 4HETA 3GBWA 3HWJA 4FPEA 4BOWA 2W46A 3HNMA 4YARA 2E9QA 1CXZB 3NO8A 3O5SA 4X1YB 2IC1A 4BH9A 1HNWB 3RN4A 3OUHA 1N34B 1SG3A 2QEXV 1N4CA 4X6RB 2WLJA 5ACA2 3WG1A 3O0WA 3PMSA 1OLMA 3ZRSA 2IZWA 1SQGA 2CK3G 4DV2O 4YWAA 3VBUA 1VQ8V 1MS5A 1JU3A 4AEMA 1OCRB 2WNOA 1IPJA 3H1HH 4FFHA 2P1BA 2XBO3 2MPFA 1ZRDA 3MFCA 3GCXA 1FXKB 1NA1A 3ACIA 1RUJ3 1VIWB 2YXHA 2Z3YA 1L0LH 2WQ8A 2WLPA 4P9OA 1SDDB 4EEQA 4MVUA 1PMIA 4LE3A 1FPN2 2QDRA 1O9GA 2YIBD 4WFGA 4IGGA 3DPRA 5TISZ 1F7YA 1GNYA 1NT0A 2UWBA 1MQTA 4UW5A 5BNNC 5JPMB 1G7YA 1PO23 4O9GA 4RS5B 2UXBO 5FZCA 4AGVA 2A7WA 1O4ZA 4IEOA 1HNXB 4DFSA 1SQQH 5T50A 4FIPC 1Q8QA 4XE9A 4PA3A 1J1LA 4FZ1A 5JXJA 4LCUC 5JCOC 1QH6A 1YWKA 5IJ9B 2PHFA 4BQ3A 3RPQA 3SKJE 2VXRA 1ZREA 4FLWA 4NHXA 2H94A 4TV9A 4HANA 4B3NA 2VR4A 5IWAO 3HKEB 4QU1A 2XHKA 4M00A 2QTSA 3JBG1 2J1VA 1IG3A 4QDRA 3ACHA 4HK8A 5A1FA 2YS8A 1G9BA 4DR6B 4GJYA 1J1TA 3CCVV 5GZGA 2ZX0A 5FY7A 2ZCEA 4LNUA 3MIGA 1AR71 4BISA 1NZCA 2CGOA 2LROA 2QM8A 1WLTA 4AW7A 4DNYA 1T5EA 2OTJV 4CH5A 1EPZA 4AHYA 4IV3A 4MVTA 4GJZA 2N7GA 1YQ6A 1PIV2 3NJZA 4LFBO 2UUBB 3MF6A 1IURA 1GICA 4Q6GA 1XNRB 1T6GC 3APOA 1DQ2A 3KCCA 5JSPA 2OQ6A 4LF5B 1RJ7A 2OW4A 4ARYA 3OE7G 2RS52 2UUAO 4XEZA 1XE7A 1RUD2 1QOSA 1JVMA 4PA4A 3B8NA 4ASLA 3JD1A 1GNHA 4YSFA 5A7OA 5IT9N 4L2NA 3O12A 3A2FA 3JARB 3CRRA 1UY3A 4JYBA 1U0AA 2YYOA 2CH7A 4B29A 2Q5ZA 3GZAA 2QNKA 4QGMA 1Y9GA 4B3SO 4LMFA 1PK6B 1NY71 3VZKA 4QE7A 1LECA 1ZRIA 1Q81W 2XMLA 5EK0A 4DINB 1R3LC 4F4LA 2KM2A 5JIUA 3ZMUA 5ANQA 2B39A 4GWNA 2HEPA 1RVF2 4RD7A 4XUOA 4HZ3A 4DRRA 4X64B 1XNTA 4DMIA 5D21A 2BOCC 1BMV2 3VQWA 3LFIA 1EN4A 1VQ6V 1M4WA 4L8JA 5A1AA 3HMYA 2HFEC 4YM0A 1NG0A 3AP9A 4PLOA 3EO6A 1JYCA 4H55A 4MXWA 1F4MA 4CP1A 3AG3B 1UU6A 4W6YA 1RUG3 4XF1A 1LCLA 1R73A 4INDA 4F6RA 1MS3A 4NPRA 4JAUA 3I2KA 1OVSA 2WNEA 5F39A 2HEYF 3H9VA 2PF4E 4AXOA 1N0NA 4FLZA 5I8YA 2WC2A 1MVQA 1XBFA 1KQSU 1YQCA 4ZS3A 2WS93 1W6NB 4Q29A 3RG0A 1SZBA 1AR81 2PI4A 1SLBA 4X66B 3ZFFA 4X1KA 1FXHA 3ZCCA 3NV4A 1S5HC 2ZA9A 4GQ7A 1EZVH 1XYNA 4L8QA 4ZONA 3JSLA 3ETEA 1UOFA 1H2SB 2JDHA 5FZ0A 1AYM3 2J7MA 1VBC2 1M93A 1B35A 3JB4C 5FZOB 2RJLA 2XAJA 3S0MA 1K4CC 4HK9A 4MTXA 1PO13 4FTSA 1I5YA 1FNYA 2MHFA 2XJVA 5LYJB 3ABKC 2A06H 3HQRA 4DS0A 4GH4B 3F2ZA 3K5NA 1DFQA 2ARAA 3ZFEC 1ND3C 1XL4A 5FY4A 1YI2V 2GU9A 3K9AA 3OTFA 1TVKA 1OOPB 2VO5A 3D4KA 1HN0A 2HVJC 4J9YB 1FNZA 4MTGA 3ZN6B 5C3SA 4QPGA 2GP3A 4GX5A 4O4LA 2PYJA 2Y6JA 1UN1A 1CAXA 4LO7A 1UKGA 1ZM1A 5FPVA 3SHRA 4QPWA 1I5ZA 1ZWIC 3LAGA 5C3QA 4LKFA 4EE2A 2JWPA 4M01A 2HJFC 1UYPA 2ZAAA 3LSQA 1WCQA 3AMQA 3H7JA 5CNAA 3Q9OA 1ODMA 1D5NA 2BNNA 2GMEA 2ZE8A 4C91A 4GZ9A 1G9FA 1ULOA 3RZZA 4RS5A 1WCUA 3A0KA 3G4SV 2OCHA 1XNQB 4YGEA 2B7YA 4MW8A 3ZYIB 1QHDA 1SESA 1VMHA 1FV2A 3TN91 2DWRA 1H8EG 2EXIA 3KQ4B 4OMCA 1AXKA 5IJ9A 1R082 3Q8CA 4AVCA 1XYPA 2GN3A 5JJNB 1OXCA 1WWYA 2GBOA 2VECA 1H4HA 2F66C 1VAKA 4DR1O 1BZKA 1KC8W 2XJUA 1QGLA 2HWE1 1RFYA 1OD5A 3HKEA 4YVWB 1TNFA 1ZRFA 1R1ZA 2BOIA 2DYSB 1FYUA 4Y33A 4QX1A 4NJ4A 3SYCA 2FDGA 2GTSA 3SYQA 1T2XA 4H7LA 1H9PA 1LOFA 4QMAA 2ADEA 2RMU1 1V54C 1S0EA 1FPN1 2OUJA 1QHTA 2ADQB 4CS2A 2CNAA 4NOTA 1O5LA 2DWEC 2VVDA 4PBOA 5H6RA 4FPHA 3VHRA 1OFSA 3H1WA 2IM9A 4BIUA 4LP8A 4O2AB 2ZM6O 1PPJH 1H2LA 1DBNA 1J5EO 1J95A 3EBRA 3W20A 4JYYA 2Y4TA 4DXZA 3MV11 2XUEA 4Q8KA 3IC9A 2JD9A 5I0DA 2Q30A 3G6JB 3CCUV 1RMU1 1VIBA 1O59A 1AYN1 4Y26A 4BK5A 3K5MA 4XMIA 2WLKA 3PVNA 1MEC2 2QQNA 4P9PA 2VZRA 2VZOA 4GALA 1EV12 1YI7A 3JARA 5K8SA 5AC93 3QCWA 4ZI7A 3FLPA 3O0XA 5ISLA 1GYKA 2OZ6A 1GH6A 1ZL8A 3E86A 4QXCA 1GK9A 5LGNA 1GTOA 2JG8C 1Q8VA 2QUOA 1NCQB 5EYXA 3SYOA 1C8M1 2BTQB 3WY6A 2W0XA 1G6NA 2RM22 3AVRA 3FC0A 1QJX1 4HG6B 3WF4A 3CZUA 4XF9A 4N43B 2AACA 1TG7A 1G9DA 1OCOC 4RHV3 1NX9A 4HKOA 3O0VA 1O5UA 3K3OA 5KMGB 3E22A 4J42A 3ABTA 3S5QA 4CUGA 1OCZB 3CIHA 1SA0B 3BOPA 4YGDA 1PD3A 4C90A 4OQ8A 2R1DA 3D3IA 4AEDC 4DR5O 4JI6B 2R063 3K3NA 1NZIA 1R1A2 3VDAA 4CU6A 2WNVA 3GXUA 2QTWB 2FMLA 5CFDB 3QLQA 4Y5TA 5DDJ2 5FUPA 2E6VA 5FY8A 3A0NA 2ZHKA 3W7WA 2YGLA 2JS3A 5BZBA 5CEHA 3U75A 4OHZA 3K48A 4BWOA 3VBSC 1APNA 2VY0A 4CC5A 4MT8A 1WPBA 1IBMO 2W5FA 2AEZA 2IFRA 5IY5C 4IV1B 3ZSJA 4EQVA 5FZMA 1F35A 4KU8A 2ZEYA 4FPYA 1Q8PA 2FCVA 4R9DA 5CFCB 2E74B 5HV4A 3JAKB 4QQPA 4FOWA 2X0LA 1WZXA 1N1TA 3OBTA 5JZGC 1RVF1 3VBOB 4CSWA 1IPSA 1CZSA 4JDNA 1SLLA 2Q9LA 4K8ZA 2GC1A 1ND2A 2A3YA 2VOXA 1M56B 3LGRA 5AFEA 1FAFA 2JB8A 1DQ6A 4LF7O 4YG0A 4LBEC 5FZOA 3W9AA 2V09A 3K59A 3CBNA 4O4IB 2ZCWA 4LOSA 2EJRA 1C4RA 2WBKA 4FLXA 2IJIA 2JGDA 4MSWC 3MW2A 2AYHA 5A6XA 3EB7A 4H33A 1NI8A 3ZMVA 1QY4A 3ILFA 5C8CB 2PMWB 1UZVA 5LEKA 1BQZA 2XJQA 4RGGA 1DP0A 3CWBH 1E1RG 1LOGA 2W9XA 2E7QA 2OIEA 1P84F 1OOPA 5FWJA 4LHLA 3HKBB 3ZN6A 3OGIB 5H9PA 2WIIB 4FVMA 1YJ9V 1GZTA 1Y74B 3CC4V 4IEZA 1YEWA 1SC5B 2ITDC 3FB5C 3E5UA 1M1KW 1LUWA 2LQTA 4XF4A 2UXXA 5FP7A 3E5XA 1DGLA 1VBC1 3CJXA 4Q1PA 1IBLB 3RVYA 4HVRA 4DK0A 3P30A 1HDKA 1RTVA 3ETPA 1YZBA 5A6ZA 3T1HO 2Q8CA 5F2VO 2HEVF 4F83A 5E79Z 2JIGA 2XGXA 3ZIWA 2LW7A 1RB8G 4LITA 4E8CA 3LDCA 1EYBA 1C1LA 2RN9A 1OMIA 5KC6A 1AR5A 3JZVA 4JV5O 3MDSA 4IESA 4OZXA 2P37A 5KHKA 1JYIA 3B4SA 1REDA 4FM1A 4E2SA 4WFBV 3PVOA 3K03A 5C9AA 4YVWA 3CEIA 5FXWA 3WNLA 2SBAA 1US6A 2WT1A 3KT4A 3LUTB 3N4MA 2IH1C 3K3WA 1TZOA 1VBD3 4EWDA 1XBLA 5FYVA 3VDDC 4IT5A 1YITV 4OLLA 4FLTA 2DBNA 1WMFA 4X8AA 2Y34A 4DRVA 1QOTA 1W59A 4E8DA 3PIGA 1K5MC 4RO2A 3K4DA 4IL6Z 4NHKA 2JIJA 4X6QB 1LUVA 4BLIA 1PMJX 1UOGA 1W3VA 3C2UA 2D3PA 3AFGA 1HNXO 4M3CE 2PHUA 1UMZA 5CN0A 4R52A 5LHHA 1BS3A 2ZTNA 2D3OW 3IDEA 3ZN0A 1TME2 4ZHNA 1LHVA 3MW3A 3DL3A 5HPOA 1AJPA 1FI2A 1NKGA 3I2OA 2F43G 3MHSC 4LKDA 3VBRA 1HJGA 1MZ6A 2WLLA 5FY1A 4FFGA 2YZ4A 1US3A 3H1YA 1X9PA 3AC0A 3WDYA 3B7MA 5B1NA 3LEGA 4Y24A 3JBG3 1AL21 1F15A 3JASB 3QBQA 2XVLA 5A3PA 2ZX4A 1NLQA 5L7OB 3W5MA 1UO9A 3AK0A 4FMTA 4OI0A 2DN9A 2Z5UA 2Q1ZB 2HH9A 4HVQA 2ZDIC 2CWSA 2EIJC 1N33B 3WG7B 1AR73 1VRH2 2CU5A 2A1XA 2YPDA 3THTA 3B01A 4Z1VA 2GALA 1TGOA 3BB6A 3RI9A 3L73H 1JOBA 1M5IA 2UUBO 1H1IA 1KJLA 3VHNA 2LO1A 5JVDB 2Y6HA 4OVEA 3ZRWB 3UGFA 4FQZA 3GB7C 3OMIB 5C7GA 1YQ5A 1TUEB 1N36B 3AZWA 1PVC1 1ROPA 1GWMA 5EJ3A 2Q6AA 4QX2A 1PZ7A 1AJNA 1N32O 1M90W 3OGVA 2X5IC 5FMOL 3ZFGB 4GUNA 3H01A 1YJKA 4IV1A 3J9SA 3UT5A 1O4TA 3I2IA 3ROUA 1I1EA 3JAKA 2UU9B 4MO3M 1YJWV 4FFKA 5EJ1B 1UY4A 1Y3TA 4NXNB 3POSA 5FP8A 4I30A 4JYCA 5A6QA 5JXHA 2P67A 3HVDA 1OKQA 4WCEV 4PDMA 2LW8A 5GLTA 4J7ZA 2ZKOA 2VZPA 3DV8A 1V70A 2BDRA 3F7VC 4ZU7A 1PV0A 5BYNA 5JXIA 4TQFA 2ZAHA 2X10A 1Q43A 2Y6FA 3IJ4A 3LWCA 3VBBA 3GM8A 2WN3A 5DDJ1 1KU9A 2ET7A 2ZQMA 2XVKA 3CZJA 4AG4A 3OGRA 2ZHMA 4Q26A 1K5QA 3GZUC 5L3CA 3CO2A 2VWJA 2D3RA 3ZEDA 1CZTA 4DV5B 5FK8A 1HRV2 2M7WA 2VUDA 2WSUA 4I55A 3LSEA 3KVAA 1BXHA 1NUKA 2VW2A 1ASJ1 1SLTA 1OC1A 5FV3A 4BPZA 1AR83 3VV1A 5IJRA 5EBLC 4XDKA 2WL1A 3ZSMA 1WN7A 3V0BB 1IX9A 1A32A 3QTCA 3BYWA 2IJHA 4YPJA 4LKEA 4H13B 1MABG 2P3JA 4UB6Z 5C3PA 5DAXA 2VZ3A 1VQPV 1WW5A 1GMGA 1DGWA 1W6QB 3ZMOA 2YXSA 1OKOA 2OS2A 1L0NH 4Y5SA 1MZEA 2KR2A 1NA1C 3HPNA 5CBLA 4CS3A 3I54A 2VZSA 1W9SA 1RPOA 1GN3A 4BLJA 4FPCA 5KXEA 1P4RA 3LDEA 1V6LA 1XILA 2DU1A 4KQ7A 1EZJA 1K73W 1V55C 2DFCA 1MG1A 5APAA 1GRJA 3W5NA 1JW6A 5HXMA 5T52A 3M8AA 2VTXJ 5A3WA 1EUTA 3POFA 1XNCA 3DPRC 2N74A 2PHRA 2W39A 2BP6A 4R4XA 4JTOA 1Q5OA 1NOVA 1Q7YW 3RRDA 2CTWA 5DM6V 4LBQD 5IW0A 1D2QA 2PA7A 4IE4A 1H8VA 5D1IA 3K5LA 3BY6A 2P4KA 3PVBB 2J42A 3POYA 1YRZA 4B1LA 2JB4A 4QX5A 2WFF1 4LXLA 1SRYA 4KWLA 5IUQA 4GX2A 1AILA 4QPYA 1RUI2 5JPNB 2YY1A 4J1WA 4COVA 5LBBA 1AJKA 3CCEV 5JUVA 5CG8A 4ZBMA 1W9TA 4GB32 5JI9A 1OFNA 2E75B 3IAQA 1SPPA 5C4WB 3JATA 2R7EB 4OZOA 4P00B 5BV6A 1AR92 5KX5A 1UY1A 1AF9A 1XNQO 3LDDA 3NJXA 4A4AA 4BIFA 4LTAA 4NIHA 2DVDA 2PLV2 4XBLA 3UJQA 3CC7V 1N8RW 3V56A 1EFRG 2WLIB 3TN93 5J9PC 2DUOA 1RSOB 4UOJA 4DXTA 2WYSA 5L19A 3OAAG 3I2DA 3JXSA 2QE3A 3WDXA 2MEV2 2XL9A 2X53S 1JOJA 2VMEA 4K7JA 5FYSA 2ZGPA 3C7OA 4IV3C 2HWE3 4TWTA 1VLNA 1CAWB 3T4DA 5FIXA 1EUUA 1RHI1 4P2ZA 4LFCO 4DUYO 1VQ5V 3IDCB 4YZ5A 5DUWA 5KXCA 3WB1A 4BQ2A 4UCUA 2ITCC 1V6MA 2DDUA 1ZBA1 1B06A 4DXWA 4HPKA 3IM0A 5L7OA 4MG2A 2RMU3 4YY3O 1ZRRA 2HHHB 1SBDA 1W2AX 3OT7A 2PAMA 2ZXWC 4XIKA 3GWOA 4DRXB 4MVRA 3ZR6A 2F17A 3R4UA 3ZHQA 3PJYA 1QMJA 2DJVA 1YO8A 1TME1 4W6XA 1HW5A 4JZGA 3KF5A 1XREA 1DF4A 1OBNA 2ZMKA 2NZ9A 3ZRVA 1RMU3 1FJGB 4I0XB 2LRPA 1AYN3 3O1PA 3ZMZA 1GM9A 2XQXA 1ST8A 4XCBA 1IGOA 3MEPA 2W6JG 5JSOA 3BABA 2CGPA 2JEUA 1U5ZA 1VBB1 2YUAA 2CDPA 2Z4FA 4U36A 4L11A 1JA8A 1C8M3 2DQ0A 3N9PA 3JAMN 1GSLA 5FQ0B 5FYBA 1QJX3 1PVXA 3H1JH 1SMVA 3JD71 3DSQA 2PELA 3JAWB 5FO8B 1AI5A 2A3WA 4OYUA 2ZEWA 4TT3G 3ZS8C 5A3TA 4O7XA 3RZMA 4NB5A 4Q0VA 3WDUA 1M4UA 2R073 2ZEXA 5FZ1A 4JI6O 3ETGA 4CE8A 1PGL2 3ZFFC 2FKXA 4ITCA 5BR8B 2VMGA 3AG4C 3I55V 3S7EA 4X9QA 2ADDA 3I2HA 3ZYFA 3ZFEB 1ND3B 5IVEA 1TE1B 4QQHA 4L97A 5F3GA 4XUPA 1BYHA 3MYXA 4EN6B 4O2BA 2UY9A 4YZ1A 4BZ4A 5FPLA 3E35A 1QXRA 3UGGA 1B35C 1VQ4V 4E9KA 4HNAB 4B3MB 5L73A 4Y1YA 3Q8BA 5CYYA 4FSJA 2G19A 3QH6A 3SQOA 4FT8A 4I50A 2DV9A 4UF0A 4RA0A 1IQAA 3MI8A 4P9YA 2V7QG 2K9PA 3J81N 3AMHA 4R9BA 4AVAA 2ZGMA 1NXD1 3ZN1A 3FLTA 4SLIA 2DFBA 3N7JA 1D2DA 4X65O 1KDKA 4L92A 3SPIA 2J22A 1KQRA 1QNMA 1F31A 4JPRA 1HQWA 4PELA 5KHGA 2XT9A 5CISA 4JI5O 1K4DC 2UUCO 3AMPA 2Y0IA 3UGHA 2QR4A 5KA6A 2JEXA 3RMXA 4D6TH 2G38A 5LGUA 1HKDA 3ZYBA 2ID4A 2JXAA 2QDNA 5ITZA 3TOJA 2HWC2 2I74A 3O1OA 3NSTA 4UBHA 1FXVA 4LBQB 3W7TA 1I0HA 5KHIA 4CCMA 4DUXA 3N2KB 1D4M2 1AR61 4TUYA 3UETA 4JI8B 2D6LX 1HRV1 5F2SA 2W6IG 2P17A 5CB7A 3ZM8A 1DHKB 2B9UA 3LCPA 3CXCU 1BT8A 4RS5C 4D6QA 2KKWA 1H8HG 3BFRA 3D82A 3OBZA 2ZGRA 3C3TA 3SC7X 1BE3H 1RUE1 2PZSA 1J3QA 4PA6A 3FYEB 4OUMA 2UXDB 3CJHA 1V54B 2HLDG 3SEPA 4NHYA 4XJ8A 5C3OA 1H9WA 2OPKA 4Y5Z0 3WSOA 1W9WA 2ZE7A 1XJAA 2EAKA 3D6EA 4XQWA 4XZUG 4O61A 1VBC3 2LTNA 4B8EA 5C4WA 3H8OA 1LULA 3PMEA 2HJDA 5I0SA 3LEIA 1K34A 3ZN5A 2O0OA 4D6SA 3ZDSA 4XJAA 3E2EA 2K46A 3JU9A 4C1WA 1LOFC 5F2WA 5EXOA 1RXGA 4GLXA 4JKKA 4XC9A 4TN7A 4A42A 1ZZ8A 3BA8A 4IYIA 3P3NA 4LULA 3TCUA 3IT8A 4LBKA 3DN7A 2B9VA 1DZQA 5GZCA 2L35A 4I2OA 3O1VA 2GN7A 4BWAA 3FHAA 2WWUA 2GUZA 2ZGSA 4BCUA 3AZVA 1YUDA 4G3YC 4CVUA 3JD3A 2GC2A 3AEIA 3CCJV 2OA2A 4FI9A 3KWVA 3QNEA 1YNAA 3GBFA 2SLIA 1QLNA 4CH4A 2RS31 5BXZA 3RSJA 4XDOA 1WW7A 2CV6A 1RUI1 3WG4A 2XH6A 1KUQA 3M3EA 1YC61 4OI1A 2Q7HA 1V9U1 1X9TA 2XL7A 1OCOB 3KZ4C 1JZ4A 2DW4A 5I91A 2OUHA 4J6GA 3M3QA 3SISA 4P08A 2B1GA 1NLRA 2Q68A 2DVFA 5IYDO 3VHPA 1AR91 4PIZA 3RI8A 2F4VB 4L87A 2QTOA 2LALA 2WZR1 3L9DA 2EA7A 1LNQA 1PNLA 2OIGA 2PLV1 3H3UA 3L9JT 1VAVA 3CMGA 1J84A 1UY0A 2F1MA 1CD3G 3GVMA 4ASUG 3FX3A 3JCUZ 2UXCO 5D8AB 3RYKA 3VBSB 1VRBA 4MV2A 3K0GA 3VBFA 1G9AA 4XW3A 2QWRB 5IY5B 4M3CB 2PY5A 4U2AA 2ORXA 1SETA 4YZ4A 1BLZA 2Q73A 4OI4A 2CTQA 1NTZH 5IYCO 4AI9A 5C5TA 2QKAA 4DO2A 1OH4A 4R6ZA 4COWA 5CIRA 2E3CA 2WNVC 1AL23 5EP9A 4KBZA 2HWB1 4QHZA 3N9MA 3GNEA 3FB7C 3K79A 3WG2A 3RYHB 4FPPA 1GP5A 3J8F3 4BW5A 1T6BX 4AAXA 3B2EE 2CDYA 4DV2B 2J1AA 2G9FA 3OB8A 3OYWB 2XLFA 3NJVA 5T5OA 1VBE2 5C6CA 4LBMA 3NXSA 5LP6A 5BNPB 5CA0A 4PDRA 4UFLA 1K92A 2ZGQA 5FOBB 2C5DA 1GAXA 4KWJA 2JICA 3FAVA 3T09A 4MS2A 1RUF2 2EILB 3AMMA 1Y67A 4GT1A 3OUJA 1JXNA 2VMCA 1ND2C 4YRDA 1CR7A 4FOYA 1PVC3 3ZSEA 3I59B 4BQ1A 3S5AA 3ZXAC 2RG4A 2YC0A 3U14A 5B1OA 4HNAA 1HRI1 1CPMA 1W9FA 4QX3A 4Q4W1 3M7AA 2UXBB 4BQXA 4I0BA 1FV3A 4NPMA 4DV4B 3KCXA 4SBVA 3SJAC 1PX4A 4UCRA 3T1YB 3ZO0B 1UIKA 3VKNA 2LJ2A 3RWNA 1E57A 3T4HB 1ZTEA 4S2HA 5A2QN 1OOPC 5A70A 2ZGOA 4MW3A 4F3JA 1ZZBA 5IWAB 1VF5B 2WO7A 3OUFA 4H0LB 3OY8A 1D7PM 1S0GA 1UNBA 2IU0A 1UU4A 3WP6A 2J1EA 3R6SA 5DDJ3 4XBFA 5LHGA 3WOGA 4LO6B 4K0KO 1F2NA 3RJ2X 3B40A 5IYZB 4CC6A 1RITA 2FZ2A 4FLUA 5KXDA 2WO3A 4QAWA 3MAQA 4DV5O 1Q82W 3AFKA 1UYXA 1HV1A 2ZS6B 1GR3A 5CKNA 2V5DA 1A6CA 2Q5TA 3AX4A 2QZ3A 2YGMA 1Y6XA 1DQ5A 2ES3A 5J2UB 3WW3A 2A71A 1ASJ3 1Q6HA 1WW4A 5F7UA 3VDDB 1MACA 1SCRA 2AR6A 3CMAV 1S77D 2JE9A 2LFSA 3OSDA 4XPVA 4IGPA 1QNWA 1F4AA 2EF6A 2UUAB 1K5MB 2VOVA 3WNOA 1SQFA 3I5DA 1OPOA 3NAPA 1W6OA 2IJJA 3R66A 5C9AC 4YVWC 5A3MA 2Q4PA 4QHOA 2Y60A 4PDWA 4FM0A 4CCNA 4B3SB 2YICA 3HD8B 1W2OA 2IXLA 4DIQA 3EHKA 3U4XA 1GZ9A 3D3QA 3DXUA 4MTOA 5A7WB 2C1FA 2ET1A 4KHPB 2ZGUA 1TMF3 3CRAA 5FPAA 4YFWA 2G4IA 1HXS2 4AFCA 3ZKYA 5DMYA 4BB3A 4JZ2A 2QCSB 4PA9A 3KCYA 5FZ9A 4JI0B 5JAXA 1K45A 3ZXLA 2FD8A 5KWRA 2KD7A 5FP4A 1CESA 2WPDG 2CY6A 3S57A 2ZJCA 3EJKA 3KKYA 5A3OA 1UJWB 4XURA 2FBEA 4QB2A 4ZIBA 3MICA 2A0LA 1Z7S2 4DO0A 2WFF3 3RVHA 5FXVA 2QZ2A 3AM2A 3VBRC 4CPBA 1YI9A 2XAGA 1FOD1 4Q4Y1 5GTIZ 2FCTA 1QKQA 1HV0A 4TYSA 4XETA 5LA6B 2E33A 5LB6A 4W65A 1GZWB 3CC2V 3EHBB 2ZPXA 3M70A 3SEEA 5HCAA 1RUH2 1WCDJ 2VZTA 1EN6A 4OQ9A 3GWKC 1NCQC 1A34A 3FFQA 5FLIA 3E6BA 4AI0A 3AZZA 1JYXA 4DW1A 4ES8A 3MHHC 1KEXA 4RGAA 2WJSA 2XONA 1V6IA 4FPOB 2CAUA 1TVGA 3BIEA 4W8JA 3LDKA 4A6OA 4D69A 4FAGA 1S76D 2H6CA 5C5UA 3MHZA 3U07A 5J2TB 4Y3OA 3Q8FA 4NAOA 5F5AA 2ZR3A 3ZOIA 1OCZC 2JG9A 1OA4A 2FDFA 4WZCA 3VZOA 1AUYA 4G28B 2PYLA 1RHI3 2JDAA 1ZYBA 2DWDC 3W7SA 2NLJC 2BVVA 4NAMA 1N1VA 3M8LA 2IBZH 4Y22A 1ZBA3 1RINA 2HHHO 3RYCB 1V9PA 2D98A 1UAIA 1XUQA 3RYHA 1NCRA 1XB9A 1H8TA 5IAXA 5JI7A 1CAVB 3LA2A 3VD4A 2W68A 5EC2C 5LHIA 4KWUA 4IV1C 4JGZB 1QQP2 3J7MA 4XYXA 4AFBA 4CXYA 2BU9A 5HCFA 3WCRA 3RMYA 5BNPA 3PTYA 4CP9A 5J7MA 1CZVA 4J7JA 2KQXA 4QDSA 1TME3 3LNNA 1MZFA 2B9ZA 1S72V 3DUIA 5A33A 2IXHA 2IH3C 2UYBA 3MPPG 3L72H 2WDBA 5FY5A 3X2QC 1M56C 1BHAA 4GKKO 1NQTA 2DQ3A 1GNZA 5K1PA 3E8BA 3O14A 1FMD2 4PI2A 2EXHA 4AOCA 2RS12 4U3JA 2OIIA 5IVVA 2VMFA 3NL1A 4EWAA 3AVSA 3WW1A 3PLQA 1LR1A 4X20A 2W1QA 5DG2A 1VBB3 3CQOA 3TYJA 2HWD2 5C8CC 4IEQA 2Z69A 5EZYA 1ZZ9A 2FZ1A 5BY1A 3WQ0A 4I7ZB 2RCVA 3TGUH 3O1MA 4UW4A 2VNVA 5ANNA 3VBUB 1H2GA 3JD73 2E31A 2A7AA 4AEJA 4DR1B 5IYYA 5D5PA 4AR2A 2WLMA 5BY5A 2VPVA 3HN3A 3K4AA 2ZNIA 3MZHA 1NA1B 1TA8A 4X1IA 1GFF2 4A45A 4LHNA 2FHRA 3RDIA 2ETNA 3F5TA 3CXHF 5T55A 3JQXA 1W0NA 4DR2B 3KSCA 3NNGA 2RV9A 2FTKA 1EY2A 2QQKA 5A3LA 1UFIA 5FPOA 4JF3A 5IYZA 4Q0UA 5IVJA 4GKJO 3SGIA 3DPRB 4XJUA 4YW4A 4PDLA 3WP4A 4ORFA 1MQTB 5F8PA 4JHZA 2VMHA 2ZM6B 3SYAA 4AQYO 1B04A 1XMOO 1J5EB 1YTFD 3K2OA 3W59A 2B45X 1Q8OA 5E89A 5FY0A 1XHXA 1JHNA 3TBDA 1XNKA 2UURA 2F95B 1P49A 1AX2A 3IN9A 4AI8A 4J1XA 5IVBA 1YVWA 3MLJA 1LEMA 4IEYA 1WNSA 4Q4X3 5FY9A 3SXWA 3CCMV 3KS7A 5JQGA 3AG2C 3ICXA 2YDEA 4TV9B 5K0UA 1I7FA 4UB8Z 2MK3A 3LA3A 5DZFA 2AC1A 3I8TA 3ZMTA 3D8CA 4MVZA 4NROA 4NRQA 1LOEA 2WUHA 2WABA 1GKFA 4UV9A 4CDXA 3FHIB 1FFXA 3GBGA 1DZTA 1PM9A 4NO4A 3DXRB 4IDZA 3GHMA 1JX9A 3LIHA 3T2QA 2XBO2 3ACGA 3WF0A 5D2AA 5A7WA 2ZE5A 4QT6A 2WLQA 1RUJ2 2OYZA 2KB1A 3B93A 4QPJA 3AK2A 1AR63 3NV3A 4IV3B 4J11A 4XJ9A 4UAPA 5FZLA 1W8TA 2GP5A 4CEWB 3WD5A 4YVSA 1RC6A 1W8UA 4XDPA 3OCPA 4L0PA 2YV8A 3WG3A 5F37A 1W39A 2JRIA 1PMHX 1ULCA 4QPIA 2ZD9A 4DR5B 3EYPA 2X09A 4E2QA 1RUE3 1MS1A 4XMAA 1AB3A 2JDIG 1BCCH 4HONA 5B4XA 3APBA 1WP8A 3M7MX 3WZ1A 2HLEA 1XOUA 2VWKA 4ZXEA 2P06A 5IK5A 2CWMA 4P5HA 2ZXWB 2AGSA 2PI5A 5FYUA 1URXA 2CH7B 3EXUA 3ASNB 3D3AA 3MGUA 4JVAA 5HFLA 4IIJB 4DXRA 4META 4QD2A 5EFUA 4E4HA 4UCSA 4CA9A 4P30A 2BPA2 4OI2A 4MOAA 5H9RA 5DEDA 2VD7A 4IL7A 3EQEA 5L7OC 2B46X 1OVPA 1IS4A 4P9WA 4C0HA 5BPXA 3QACA 1CP9A 1VBA1 4UUJC 2OT7A 3RVZA 4ZHQA 2WWSA 4AGRA 3WG7C 4JV4A 1SLIA 3AP6A 3QG5A 4JASA 1QVFU 5EYPA 3UKNA 4KI5M 4FTBA 4LF7B 3I3EA 1UX7A 2R043 3NVCA 3BVOA 4CBCA 1CN1A 2OZJA 3DC6A 3C8XA 3MUZ1 3T1MA 5AG2A 4MXWB 2JS5A 1N47A 5IVFA 2GNTA 2RS33 4LLOA 4C8DA 5L3BA 4PQ9A 3B8MA 3WQBA 2J1RA 4GA9A 2QQPA 1ZA7A 2EJ7A 1V9U3 3D0JA 3AK1A 2BGPA 3AMNA 4R9AA 2R9AA 1NQJA 3AP5A 2PQSA 3ZX7A 1AR93 4JGZA 2C9KA 4GAZA 5JH7A 3MIDA 4DR3O 3USSA 1SQBH 2WZR3 3H42B 3ZFFB 2A5ZA 2Y0OA 4X1KB 2GMMA 5BXXA 3NV1A 5JCTA 2HWF1 2HG5C 3RZHA 5B3SB 5F3IA 4OUEA 2X8KA 3VKLA 4BXSV 1H0BA 3WQ1A 3OFNG 1X8EA 3ZYPA 2JJ1G 5EBMC 3O65A 3AKQA 4A41A 5LA2A 1V0AA 3T1HB 1XC6A 1J58A 5CVRA 4IETA 5FCCA 5LMUO 3HIFA 1ZX3A 3P3PA 2PHWA 4GKXA 3OOXA 1YJLA 3TB0A 5T3NA 3HQUA 1QIQA 4UCOA 2HWB3 2IXJA 1EAH3 3PIJA 2Q8EA 1Z2GA 5FAXA 3ETQA 4JV5B 1J3RA 2NN8A 3E97A 3VQXA 4JRLA 2CTPA 4Q5OA 3DC5A 4WM8A 1TVKB 1CX4A 2E7TA 3SITA 2AHYA 5FMOS 4JI3B 1RUG2 4EN7B 4WFFA 4QPGB 5CZKA 4O4LB 4AFAA 5A32B 4F7ZA 2WINB 2QDOA 1CAXB 1QJZA 1QJFA 4TLGA 3S30A 4AQSA 4AI3A 4X62O 3H1KH 4K21A 2NMNA 3CB2A 5C93A 2AZ5A 2VJXA 4LUKA 2AW9A 1ULGA 4GKYA 1PL0A 5J98B 4YW5A 1OF3A 3N9QA 3N27A 5JOWA 2CDOA 2WS92 4RR3A 3KMHA 1YTFB 4JX0A 1VP7A 3RNSA 1FMD1 1JZ6A 1ZBE1 2J1TA 4QQ2A 3HNYM 1K5SA 3FN9A 3S3XA 1Y4MA 4NPLA 4TSVA 1WA8A 1HRI3 3APQA 4DV4O 4UFZA 1IBKB 1AYM2 3LDBA 3WVJA 4Q4W3 4LFAO 1O4YA 1S2BA 1SQXH 4QX7A 3T1YO 4WM7A 3ACFA 1O3TA 1YYNA 2Z79A 4B3RO 4S2FA 1IKQA 1PO12 1OHFA 2XJPA 3POGA 3HR0A 1POQA 4NR1A 2GDSA 4EROA 1DYPA 3W7UA 1QH7A 1VQLV 4AHCA 4ASMB 3M3OA 3BOWA 1GP6A 4LBLA 2FMYA 1ZZ6A 4Z07A 3IPVA 1V6NA 5AVPA 3RGBA 4LH7A 1XPWA 4RL7A 1OJHA 3DXRA 1J59A 2XAQA 3IB3A 1LRHA 3GGLA 1KBHA 3MBWA 1Q56A 3UK9A 5IWFA 1R3JC 1W0OA 5FYCA 5DAQA 2VUAA 1LU1A 1DIWA 2WQZC 1AVMA 3L70H 1BEV2 5C4WC 5LK7B 1DGRN 5FP9A 4JCKA 3A0HZ 3S3WA 5JVVA 4CEWA 5C33A 4QIWF 3ASOC 2QQLA 1KDMA 3ZR5A 3CNAA 2HEWF 5KHHA 2OX0A 4JI2O 5LY1A 2DCTA 1RGSA 4TZDA 1I94B 5IATA 1EBOA 3PURA 5IYBO 4DV3O 4NE9A 4B4RA 1OUSA 3SH5A 5G05L 4DUWA 3KZIZ 1ACCA 1EPWA 1N32B 4ZI7B 2GNBA 1K8AW 4LBNA 2VE1A 1BL8A 5EPAA 4IHJA 1ZL8B 4XJZA 1UF2C 4CDQA 4BQ5A 4IIJA 4KBBA 3AJYA 1SQVH 3RYRA 1S55A 3VGIA 2ZNJA 2X29A 5CBFA 4Q8LA 3ZXKA 5FJKA 5FUNA 3B69A 4XQDA 3PHMA 4KHPO 5E88A 1UCXA 4CTEA 2RR11 1GQHA 4DV0O 1G4YB 1GWLA 3C7GA 3N7KA 3WF1A 3G6BA 1UWWA 5FBZA 4BJ0A 1K3EA 4FJCC 2WT2A 3ALQA 4YJ2B 4JDMA 2P7TC 5B2GB 2RJZA 5DQ0A 3B9IA 2VOTA 4JI0O 4ZS2A 3E22B 3A21A 4D7TA 2XVGA 4FPLA 1O91A 1QF3A 5BNOA 3LD8A 3I56V 3PU8A 4CYDA 1KS5A 2WNVB 2VQTA 4QM8A 4BU2A 3VDBA 1FFTB 5FJHA 2O8QA 4DR7O 3AXDA 2E51A 3ZPOA 1XXNA 2NLRA 3PUQA 2GC0A 3VBFC 1R091 1W0JG 1XNAA 1O3SA 4KP4A 1MS9A 1FOD3 3H1LH 4R8CA 2JEMA 4Q4Y3 2AH2A 2GNMA 5FPUA 3VZNA 4Z92B 1VF6A 1BHGA 1FT9A 1W2UA 3NNJA 3ZXFA 5IVYA 1G8WA 5AC92 3N35A 2ZHLA 2OKXA 3CCQV 1KJRA 3RZJA 1GU3A 1C5HA 1OURA 1ND2B 3C90A 1JS9A 1FKAO 5FZ7A 3HN1A 3UKMA 4LF4O 4QKFA 3H1MA 1XMQO 1W8OA 4P02B 4K6BA 4AQ6A 3STZC 2DUPA 5LP6C 2F4PA 1PGW2 4CCJA 2YFZA 3IC7A 4RHV2 2JGDB 5A3NA 4UCVA 3DGEA 3F7YC 4AWDA 2R0HA 3NNFA 4COZA 4ZXKA 1WLWA 4LWSA 5IFPA 3FBMA 2RJKA 2LS6A 1HB3A 4LOTA 2PFWA 2WQ4A 4UYBA 3ES1A 3TWIA 2R062 2O8OA 1SZXA 3H1IH 3IMNA 4QXKA 5DUVA 4PI0A 4B7EA 2VZ1A 3UKTA 2NMOA 4MGIE 2V73A 2LFRA 5A32A 4B7KA 5E1RA 4ZPIA 4Y20A 1REEA 2BVBA 5A7PA 2YG0A 4JGYA 3MLLA 3Q8EA 1SQ4A 2B4KA 4AF9A 3OD4A 3G67A 5LXTA 1OV9A 3THCA 5JSRA 4LBJA 4LK6A 5IE9A 2BQPA 4CH6A 4CZZA 1QJU1 3J7NA 5FL7G 4MUVA 1DDLA 3HNBM 5F5IA 1V00A 1E5IA 1W0KG 2JDPA 2ADPA 2YEVA 2QWPB 4JI4B 1AP5A 1V6KA 2YSUB 4Z2AA 2G9GA 4WF9V 3BU7A 3SCHA 2XKPA 2GTAA 3BEHA 1BHBA 5GW7A 4ZY9A 4L9BA 4IE5A 4HT1T 3PDQA 4XAEA 2BBAA 1UY2A 5ACA1 3GF6A 4FPKA 2JG8A 4Q0PA 2VVEA 3PJQA 4FFIA 2YBPA 2OT5A 2N04A 1LKNA 1W6PA 3K06A 1PKXA 3SPCA 4YJ3A 4I9QA 5C9AB 4W4KA 3J80N 4K1YA 2QE7G 4ATFA 3EFFK 5D5QA 3RZLA 2G9ZA 5FP3A 3I7DA 3VB9A 1GWKA 1NXMA 4IE0A 1KB9F 1BVP1 3ZPYA 3FUQA 4LFCB 2Y6LA 1VQ7V 3SH4A 4DR2O 4DUYB 4TQDA 1HJFA 2DE0X 4K8FA 1VMFA 1CAUA 2QQUA 5HCHA 4XILA 1S0VA 1LHOA 4YY3B 3D5OA 1ALYA 3NAPC 4HVOA 1UU5A 1GMMA 1I9RA 3IIAA 3AP7A 2QQVA 5J09A 5K9YA 4QPKA 3CCRV 4PDWC 1AYM1 3OEBA 5CA1A 1HWYA 1HB4A 5GZFA 4BA6A 5F5CA 1OLQA 4OHVA 4QGLA 2WA4A 3C7HA 2AHZA 2R70A 3BODA 4JGSA 2GMPA 5DAPA 2DF7A 4XBNA 4P9IA 1CIWA 3OUIA 3VBRB 1VEWA 1CEZA 3QF7A 2WLLB 3AKSA 5CU1A 1REFA 1YCIA 3TAYA 5HV0A 2JDZA 2OCCC 5FZIA 5FPRA 1CJDA 2WAOA 4FOVA 5HI0A 2XG3A 5FPXA 2WWWA 4M4PA 3SPJA 2P4EA 3URFA 1LHWA 2EAAA 4LHKA 2QJ1A 1K12A 5JJEB 4IEUA 2DURA 3VBHA 2D6NA 2E5LO 5LA0A 1BSMA 2YC2A 1X50A 4I5SA 1VQKV 2FYUH 3BPSA 1KFXL 4YJ2A 2W1SA 1VBD2 2RNBA 1BEV1 4QDQA 3P1IA 3VOUA 4FZ0A 1G9CA 4UBGA 4DPNA 1PIV1 4H37A 2YUEA 2EIKC 2I2SA 4V2VA 3AXEA 3U4SA 5H9QA 2FMDA 3A7QA 3NNMA 4IW3A 1GO3F 3WHTA 3N9NA 1YFWA 2VQUA 2EIEA 5IHRA 2RS51 3OEEG 1RUD1 3PUHA 2Z42A 5D8AC 5KLVH 1K5JA 1LU2A 2DVBA 4WVMA 2HP8A 3JYCA 3K57A 2P4VA 4KG8A 4J80A 3ABUA 1MR5A 3JCZA 3UT5B 5C70A 3MIFA 3GALA 1UD1A 2IXIA 3ZX6A 2JG9C 1WPXA 2PUSA 4F8AA 4MADA
chains in the Genus database with same CATH topology
4CEYC 2PLV1 3H3UA 1PIV2 3L9JT 3NJZA 4KWKA 4XF0A 1LJ7A 1VAVA 1BQPA 4I3PA 2GAUA 2R042 3MF6A 4CDUC 5J37A 1GICA 1CD3G 4FP3A 2R16A 4HZFA 2CGNA 1X8MA 3FX3A 4WM8B 3JBG2 1SEFA 1T6GC 1BMV1 1NCRC 1VRH3 1H8TC 1DQ2A 3KCCA 5D8AB 3RYKA 2RS32 5JSPA 1VBE1 2OW4A 1RJ7A 4XHXA 2RS52 1M06G 2UWCA 3VBSB 1VBA3 4XEZA 1XE7A 1RUD2 4MV2A 3VBFA 1QOSA 1G9AA 4XW3A 2AUYA 3SMHA 4PLNA 1S0IA 5J3UA 4ASLA 4IERA 1GNHA 4YSFA 4M3CB 4AI2A 5J36A 1A78A 3PVJA 1V9U2 3O12A 1BVVA 4L2NA 4U2AA 2DCYA 1SDWA 4YZ4A 5HCBA 5ABJB 1I6XA 3WDWA 3ZYGA 5BNPC 4ZKTB 1ULEA 2ZZJA 2QKDA 4OI4A 2YYOA 1U0AA 1RUF1 4B29A 1AR72 3GZAA 2D40A 2A6VA 4AE2A 3AKTA 2QNKA 3M3IA 1BBT3 4QGMA 4PF5A 1PK6B 1NY71 3VZKA 4YLZA 4M26A 4CEYB 2VW1A 4COWA 1LECA 5CIRA 5KC5A 1DF0A 4RR3B 2WNVC 1AL23 2ZHNA 3MFAA 5FPZA 4DINB 2HWB1 2WZR2 4E4DX 4J5IA 1WA4A 4ZU4A 3GNEA 2KM2A 3ME2A 4RQPC 5JIUA 3WQ7A 3WR0A 3OF1A 3WG2A 2B39A 4GWNA 3ENRA 1JH5A 1RVF2 2YROA 4RD7A 2H0BA 5LEJA 3VLBB 4DRRA 3J8F3 4DMIA 5IK8A 1BMV2 2G9FA 1WBFA 3OYWB 2XLFA 3H50A 5T5OA 1VBE2 4FFAA 5C6CA 4LBMA 1O7FA 5BNPB 1M4WA 4WM7B 3HMYA 4R8HA 4YM0A 2ZGQA 5FOBB 2C5DA 1NG0A 3AP9A 4XZPA 4Z8BA 4KWJA 3ECQA 4PLOA 2JICA 1RUC2 1DS0A 3EO6A 2Q0AA 1JYCA 2JENA 1RUF2 4H55A 3AJZA 4MXWA 5JR7B 4XFCA 4CP1A 3AMMA 1XNDA 4E2GA 1UU6A 2HWF3 3MIBA 4W6YA 4WZFA 1RUG3 4XF1A 2MNGA 1JXNA 4MZUA 1MS4A 1ND2C 1LCLA 4YRDA 1CR7A 4FOYA 1PVC3 4INDA 3LOBA 3ZSEA 1OQDA 3I59B 2HWB2 3VL8A 1MS3A 4NPRA 5CAZA 1EAH2 4JRAA 4BQ1A 4H7MA 2NYYA 3IPVB 4P14A 2WNEA 3ZXAC 2YC0A 4N53C 4RHV1 2HEYF 3WP5A 1HRI1 4AXOA 1CPMA 2UWAA 3PVEA 1POV3 4OHYA 1F9KA 5I8YA 2WC2A 3U11A 3GYDA 1MVQA 4Q4W1 1KS4A 3M7AA 4I0BA 2QVSB 1FV3A 4M2EA 2WS93 1W6NB 1YLLA 4Q29A 3RG0A 4FXGB 3KCXA 1LB2A 4SBVA 1AR81 1SLBA 4DY3A 4Q4V2 1D4VB 5GALA 3ZFFA 1EP0A 1ZVFA 1DRYA 3NV4A 3UJOA 3ZO0B 1UIKA 5E16A 2ZA9A 3VKNA 4EWEA 5I8SA 3V0AA 4GQ7A 4LNVA 3RWNA 3R05A 1E57A 1RUOA 3M3CA 4KU7A 2B42B 3X29B 4WBBA 1XYNA 1YFYA 4L8QA 1HRV3 1OIIA 4BIOA 2BGCA 4S2HA 1I3HA 5LRSA 1OOPC 2PAKA 1AYM3 1F5JA 3SH3A 2ZGOA 1VBC2 4F3JA 1B35A 1WBLA 1ZZBA 3JB4C 5GKAC 1W6MA 2WSVA 3N3HA 2Q1MA 4EN0A 3ZFGA 2RJLA 2VG9A 3S0MA 3OY8A 4I09A 4XF3A 4RSUA 1S0GA 4HK9A 1PO22 1PO13 4FTSA 1DQ1A 1JBCA 3ZXGA 1FNYA 2MHFA 2XJVA 1UU4A 3ACLA 3WP6A 1HRI2 1C5IA 3R6SA 4DS0A 4GH4B 5DDJ3 3N36A 4Q4W2 4Y1ZA 4HFSA 3WOGA 1VB4A 3GHNA 3M2MA 2TEPA 1DFQA 4LO6B 2W08A 3ZFEC 1F2NA 1ND3C 3RJ2X 1RITA 2FZ2A 5KXDA 3KGLA