2CGNA

Factor inhibiting hif-1 alpha with succinate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
338
Chain Sequence
ATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFNREEMKFHEFVEKLQDIQQREERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
publication title Structural and Mechanistic Studies on the Inhibition of the Hypoxia-Inducible Transcription Factor Hydroxylases by Tricarboxylic Acid Cycle Intermediates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 107
structure length 338
sequence length 347
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2cgnA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgnA01
4BIOA 2XUMA 4NR1A 1MZFA 5JWPA 1IZ3A 2ILMA 1H2MA 4Z2WA 2YDEA 3KCYA 4JAAA 1H2LA 4AI8A 3KCXA 2CGOA 2W0XA 2Y0IA 2WA4A 4B7EA 3P3NA 1YCIA 2WA3A 3P3PA 1MZEA 2CGNA 3OD4A 1H2NA 4B7KA 1H2KA 3D8CA 4QU2A 4Z1VA 2YC0A
chains in the Genus database with same CATH superfamily
1RUE2 1WA4A 2XBO2 1JX9A 5LL6Y 1ZRFA 1F9KA 1IDSA 1UMIA 3ILFA 4B1LA 4AGVA 3NKGA 4L0PA 4XEZA 3MUY1 1QKQA 2YC4A 4JI1B 3S3WA 4KH9A 2J22A 3DUIA 1S76D 3Q9OA 4PDWA 4X66O 5FMDA 4QMAA 5JXIA 5KHIA 5CU1A 1SETA 3CCVV 3K3WA 3N9NA 4X8PA 1SPPB 2WNVC 1CESA 3APOA 4CCCA 1X36A 4CC5A 2XT9A 3BIEA 3DYOA 4P9GA 1VARA 3UT5A 3T0DA 1NTZH 4LWSA 5C8YA 4F3JA 1UYZA 2QQLA 3ZFEB 2HHHO 2GP5A 1LENA 1S0IA 3SR2C 3PVEA 2ODMA 1RUJ2 1OURA 3W7UA 2WLKA 2VC9A 2VOWA 3Q8EA 4X6QB 2B46X 4K3AA 3MICA 3G67A 4I01A 1VBD2 1W2UA 1NT0A 4MADA 3IGAC 3TB0A 4DXWA 1NZIA 4WFBV 3LUTB 2X6BA 2VUCA 4JZ2A 1KFUL 2FZ1A 3UKVA 5CA6A 4X66B 5C4WB 1JH5A 1N3PA 2B8MA 2G19A 2YMZA 4PDRA 2DTWA 2Y33A 3FFQA 2BPA2 3GGLA 1S0BA 1VB4A 1HWYA 3P3PA 1L0LH 3BTAA 3GYDA 1JOJA 2Q0AA 1STMA 5LXTB 5KC6A 4J1WA 1FOD3 2FD8A 3H8XA 1XEQA 4G3YC 1V9U1 1L1FA 5AVAA 5L9RA 5BNNC 1AR5A 1BK0A 4JASA 4LQRA 4AI0A 4NROA 3VBOC 2NMNA 5BY1A 2ZPXA 4J41A 1U0AA 3DV8A 4XXPA 2A3XA 4FJCC 5LCWL 3K06A 1VBE1 3HN3A 4J80A 4XFGA 3EHBB 2ARAA 4JAAA 1JUHA 5CA3A 2VTXA 1N4CA 2VTXJ 4Q4X3 4CDWB 3ZFFA 1YITV 3I3EA 1YVWA 3LGRA 3EBRA 3DC5A 1SA0A 2MNGA 1EZJA 2IUWA 1OCRB 1V9PA 4JTNA 1VQNV 5GONB 3ZSJA 4CUGA 3PTYA 1NVPD 3PIJA 2A06H 1SS3A 4M4RA 1UQXA 1DLBA 1NLRA 2EIJC 4GIQA 4AVSA 3CNAA 1AJNA 3V0AB 4XDOA 4BZ4A 2Q5ZA 1OD5A 1CIWA 4XPVA 5FYVA 5IVVA 2LW8A 2BTQA 5LBFA 5FY5A 1BT8A 3FB5C 1NE6A 2ZKLA 1N33O 2R1BA 3ICXA 3VV1A 2QM7A 2WZR2 1Q8SA 1BHAA 1ZBA3 4B8EA 5CFDB 2VCAA 1EUUA 3I59B 2OIGA 4K8XA 2JGDB 1SLCA 3PVNA 4KXRA 2RHPA 5D8AB 4CDXA 3RQ0A 4GH4A 5F2WA 4DINB 4JQTA 3PUHA 5GJ6A 2VQEO 3TOJA 1RL3A 5KXEA 3TEWA 3E8FA 1EP0A 4MVZA 4N43A 1M57B 3ZYJB 2DQ3A 5FY1A 1M93A 1SZTA 2KR2A 2XAQA 1J1LA 3STLC 3B93A 4ISQA 4Q4Y2 5HPOA 5KBFA 1JYVA 4RQPC 1OMIA 3ZR6A 2MEV3 4URTA 3WG1A 5JIUA 2ORZA 5FPLA 4CCOA 1COV3 4F4LA 1NJIW 2BV4A 5FDBA 2JB4A 1I08A 2ORXA 3HT2A 5KA5A 2ZZQA 1ZRRA 4DK1A 1AR1B 3D3QA 4CDUA 1W6PA 4CYDA 1N32B 1AL21 2UY9A 2O1QA 3L2YA 2EF6A 2VECA 4GMP1 4QQLA 3BPZA 3VBRA 5FYZA 1X59A 3ZHQA 3HVDA 4CUBA 4LA2A 2JDUA 5FMOL 1QJEA 2EILC 5DMYA 3JYCA 2GMMA 3BGAA 1O4TA 1O59A 3I2FA 2MW2B 2PAKA 2XR4A 2YHJA 3AXDA 2V1DA 2XJVA 5L36A 4JTCB 3S5AA 1GLHA 3LFIA 2BJSA 3PTRB 2XH6A 4ATEA 3CMAV 1GZWA 1Q8VA 4Y5Z0 1HDKA 1S0DA 2R9IA 4W4KA 4R9BA 3HQUA 5LMUO 2KA3A 1AHSA 4UF0A 5BXXA 2WLMA 4JI2B 2AEZA 4PDLA 4FXGB 1CZTA 3VBFA 2YPJA 1FOD2 1KU9A 1E5IA 2BSKA 5B1OA 3NAPA 3FHIB 3I49A 4QQOA 1RUD3 3AZVA 3ZPOA 3TNPB 2FDGA 2UXBO 4RS5C 5DZEA 3FD9A 3THTA 3E8HA 1XE0A 1ZAUA 4JTDB 3NRUA 3QO8A 4MGSA 3UCSC 1YZBA 2CK3G 1HP8A 3C2UA 3UO3A 1KQRA 2XVLA 1AILA 1THZA 5FPAA 4MSVA 2IXHA 1V55B 4Y20B 4WM7C 1KD1W 3VUOA 3AP4A 3NKTA 2VOTA 5BNOC 3SPCA 4QX0A 1OT5A 1PZ8A 1JU4A 2CUGA 3H1JH 2DDUA 3BIWE 1JJ2U 1ND2C 1ULOA 1PO11 2WSUA 3S7IA 3KD4A 5ABJB 5FYMA 5F1RA 3M1HA 4X1IA 3UT0A 4QXKA 1NXMA 2VNGA 3KV4A 4A7KA 3WFVA 3CJIA 5B3SB 3JSLA 1XNBA 4AI1A 2VGDA 1KD7A 5F3CA 3GALA 1GSLA 4MXWB 4P9XA 4W65A 1VQ4V 1JMKC 5LYJB 2NLRA 4WBNA 4NTXA 1YFYA 5C9AA 4LF5B 2UXBB 2GDFA 1B06A 3IFXA 3LEGA 5JSOA 2UWAA 5IVJA 1LGNA 2ZKOA 1ZBA2 3PU8A 2P34A 5FK7A 3PHMA 1F51A 4YM0A 4ZKTB 3MIEA 5AFEA 3VBHB 4IT5A 1VQ5V 1QOTA 3FWEA 3SLIA 1MZEA 4W6YA 3KGLA 4PI0A 2A6VA 2ZGSA 2LW7A 1U5IA 3ZKYA 3GXUA 2D6OX 3K5OA 2Z79A 3M3EA 1OHFA 4IV1B 2JDIG 5JH7A 3VBSB 3ZN6A 5F37A 3FUOA 2ZGTA 1A34A 4O2BA 5F8PA 2BBAA 1RUOA 5C5UA 4XJ8A 4AEJA 4COZA 4DR3O 4XCAA 4W4ZA 1QHDA 4BXFA 2AREA 4Y22A 5DG1A 3JU9A 5J3UA 2MEV2 1CIYA 1HNZO 3RZZA 3CWBH 3AZZA 4DR5B 2VZ3A 1AJKA 3T2PA 1ZNPA 4O4LA 1SFPA 5C33A 1JHNA 4OLLA 2ZZJA 1AF9A 4HLTA 5DEDA 1DG6A 3E5QA 1W8FA 4FPHA 4QDSA 2NPIA 4JQRA 4AVCA 2VMCA 2A9HA 4LFBB 4QPJA 3T1CA 4RGAA 2EINB 1K4CC 1IPKA 5JQGB 1YUDA 3T1LA 5LHHA 4GKKB 1HR0B 1C1LA 4DXTA 4IL7A 1AI6A 4K7JA 4PELA 2DOSA 3N2GB 3T1HO 2UXDB 1YHQV 3W5NA 5J98B 1GO3F 2VW0A 3ZN4A 2P3YA 2GAUA 4XAAA 1KRIA 3RWKX 1HQWA 1APNA 1BMFG 1P7GA 4EZ4A 4SLIA 4J7ZA 1SBFA 3P5BA 4S2DA 4BR6A 4Y1UA 3NJVA 4OI1A 4YGBA 1YCIA 1VBA1 1WA8B 3HN1A 2XTAA 2J1EA 3CC4V 3Q8CA 5J48A 4N9HA 4JV4A 5KR7A 2VUJA 4ZU7A 4MTOA 2PHRA 2HWC3 3FBYA 1YJ9V 4ZOLA 3SPHA 2J1VA 2RDNA 1VP7A 1H2GA 1HN1A 3J81N 4AQSA 2WZEA 2JVDA 2DFBA 4Z1MG 1JU3A 2BW8A 2ARCA 3T1HB 4XFHA 5K9YA 4GWJA 3GCWA 3ZVXA 2WUHA 3U75A 2D40A 2RJ2A 4CXXA 4LO4B 2R7EB 1N3OA 4XBQA 1CZVA 1C8NA 4R4ZA 3MIFA 4ZXEA 4DXZA 1C5HA 3AG1C 5E1AC 4RA0A 2K9PA 4XFBA 4N8MA 3MF6A 3SPJA 4EN0A 4AZZA 4JKMA 1MACA 1QGLA 3I2JA 4IHJB 3KT4A 4UFKA 1XQ8A 3VDDC 3JD0A 3SJQC 1DYKA 1UY1A 2GP3A 4CDWA 1MSDA 4DO2A 1UKGA 1YQ8A 5EIYB 1KDMA 5BNPA 4QPGC 4FO9A 1QR8A 3H9VA 4LF4B 4FLZA 3E5XA 3D0JA 2Q8EA 4XILA 3W7TA 3RYKA 1PM9A 2ATFA 2RNBA 4BIFA 1QJY3 2MHFA 1AXYA 5T5JA 3S0MA 2TUNA 3SDLA 4FPJA 3ABMB 2AHZA 3K2OA 3CLPA 3ZMVA 1R6TA 3H3LA 1Y9GA 3GHMA 1OLMA 2ZCWA 1FXVA 1UJWB 2O0OA 5LOVB 1O3SA 3QF7A 2QQUA 2CHHA 4PA9A 2HP8A 1C1FA 4O4IA 2RS33 2QQJA 4M3CF 1OQDA 3C7GA 4CP9B 1V0AA 4YGDA 5ITZB 2D44A 1GR3A 1OXCA 2FDFA 1Y74A 4JI5O 3CCUV 4X8AA 3B9IA 4OPHA 5DAQA 2WAMA 4WVVA 4DUYB 2JGDA 4MGYE 2E74B 2VZVA 5B1BC 3CP1A 2YU1A 1I5PA 5D8AA 3BN6A 2DYRC 4O4HB 4LA3A 3AKTA 2RQ6A 4EN8B 3WQ0A 5C70A 1I94B 3WNMA 2WNOA 2W0XA 4KHPB 2HWF1 3A21A 5DZGA 1VQLV 2HVJC 4MS2A 5HCFA 4BDVB 4COVA 1YWKA 1PVC1 4LF8B 4F6EA 4CUAA 5A9GA 4JHZA 1XNAA 1ULCA 5FFOC 1SLTA 2WO3A 3CL1A 5A1FA 4AFMA 4WZCA 3N2KA 3KHBA 2ITCC 3AKSA 3MYXA 1F7YA 3BB6A 5SV5A 1XC6A 1CR7A 2HEYF 3ZMOA 1V54B 1GQHA 4LLOA 1H6XA 5FZ8A 1N1SA 2Y6HA 3AZXA 4JI5B 2OT7A 3A0RA 3AYEA 4OHWA 4UOJA 4DR6O 2UU8A 4YIOA 5IYCO 3LSEA 3JAMN 3WW1A 2VZRA 3O1SA 1YDXA 3RGBA 1RUNA 3SHRA 3U0ZA 2ZS6B 1D7PM 3N27A 2XXZA 1AL0G 2NZ9A 1D4M1 2CH7B 3UO2A 2JIJA 1PO12 2BNMA 3GJAA 1IXMA 3B4SA 4CEYB 5JZGC 2W47A 4CH3A 4AVBA 5HCAA 3U11A 1H0BA 3LDKA 2UWCA 3KSCA 2ZAAA 1EZVH 3L72H 1YIPA 4YW1A 2HWC2 1YRZA 3ASOC 2WJSA 2ZXWC 2C2AA 2P4VA 3OBTA 2XHKA 1N0NA 4LT5A 3BABA 3VLBB 1P7BA 2ZJCA 5CA0A 4CS4A 3IBMA 3P6BA 1Y6XA 4C1WA 5CISA 4M3CB 3ST7A 4LH6A 1LHOA 3CEWA 4LJHA 1D2QA 4FZ0A 1RJ8A 5EBMC 1OQ1A 4F7ZA 3RVZA 3T2TA 3AG2C 2Y6JA 3M3QA 4KBZA 2W1UA 4D69A 3EB7A 1C5IA 4K1ZA 5GTIZ 2EAAA 1TA8A 2FQPA 2ETEA 2W39A 4O2AA 4FOVA 3AK2A 1OLME 1VP6A 1GZ9A 4ZU5A 4C0BA 5LATA 3ZHSA 4TV9A 2HEPA 4Q4V3 2GC2A 1AROP 1NTKH 1LESA 4NPRA 1CQ9A 4GB33 4FFGA 3H1MA 4OX9O 1A78A 1MPXA 4OI0A 2Y6FA 1Q8PA 1FT9A 3RI9A 5FO7B 4ITCA 3D3IA 1QJY2 1S5JA 1QQP3 3WDYA 1UPIA 2AUYA 5ABJA 4DS0A 1H2NA 1N47A 1UZ0A 4JDMA 2EIKB 4Q4X1 1JI6A 5GALA 3RYFA 2CV6A 4G28B 1SG3A 1ULDA 1PGSA 2ZHKA 5FP8A 3MO4A 1O8SA 4YW5A 5KMGB 5CIRA 4UFIA 2JK5C 2RS32 5L7OC 2PYLA 3VBUC 4OPAA 5FQ0B 1U97A 2AC1A 4NIDA 4QB6A 4UVCA 1TUBB 3N36A 3ZYBA 2OCCB 1FATA 4DRXB 2Q8OA 5KXDA 3QACA 4LBKA 4JPRA 4YWAA 4OUSA 2CSGA 1EN5A 3ZDSA 4MW3A 5J9PC 5L3DA 3VZOA 3C7FA 3DKQA 4O9EA 3L71H 4L9BA 1C57A 2LTNA 1N34B 4Y1XA 4PLOA 1GV9A 3T2QA 1JTZX 1E79G 5JSPA 3DPRB 1GTOA 4XFCA 1RHI3 2UYBA 4TUYB 2XPJA 1HV1A 4KP4A 2QJVA 4QM9A 3E97A 5HCHA 4CP2A 2SBAA 4XF1A 4X8NA 4YHHO 3WB1A 5H6RA 1UZZA 1HRV1 1BYHA 1NE4A 1GQPA 2PY5A 4XOGA 2ET7A 3RYIB 5FZAA 1CX4A 5FYIA 4AOCA 3KWVA 2UUCB 3GHNA 5JVVA 2JDHA 2GUZB 1EYBA 4LOTA 2D6LX 3CMEV 1JUIA 1BS3A 3ZXFA 2WKKA 4KWUA 4IXLA 4FFBB 4OHYA 1S0GA 4JGYC 1ASJ1 5E16A 3EMRA 2WNUC 3K9SA 1GAXA 2WLIB 2RM23 3A2FA 4HONA 1UXZA 3SPGA 2BGPA 1H6YA 4X1KB 1LOAA 2JDYA 5J2UA 3ZKUA 2IBZH 4Z2WA 5BNNB 1G9FA 4YFWA 5GLTA 4JI6O 2JEUA 4LKEA 2PHUA 4LF6O 4K1YA 4DZGA 1W6QB 5IT9N 2CL2A 1FKAO 1LOEA 2DBIA 4NPLA 1EAH1 2PMWB 3RRDA 2QVSB 2JDMA 1F5JA 3PURA 4RWUA 4GX2A 2IXJA 2RN9A 2VXJA 2H6CA 2FZ2A 2J1AA 2J1RA 3O9OA 5IJ9A 1YF2A 1YXWA 5LEKA 1YTFD 1OUSA 3RI8A 2P37A 1QVFU 4MO3M 4ZONA 2ZXQA 2CGNA 4GH4C 3M70A 3T4ZA 4LITA 4NWWA 3HKDB 2PAEA 1NY72 5JXHA 3E22A 3AMPA 3LSUA 1MVEA 2VUAA 5LHIA 1RUC2 3TXQA 3DCQA 2M6YA 3MDPA 2J7MA 5KX5B 1Y3TA 5B4XA 1GN6A 4I50A 4FPLA 4JI7O 1EBOA 2RS13 4I9WA 1RUD1 3R4DB 4GB32 2EBOA 1PD3A 3IMMA 3VGIA 4DY3A 1GZTA 2X5IC 4IEQA 3S3XA 5L3FA 1RIRA 3GVMA 3BKZA 1OV9A 5LMNO 2DYCA 2W1WA 2LGQA 1QQP2 4XTPA 4FAGA 1LNQA 4NIIA 1CONA 5A6QA 3R05A 4ZY9A 1Y7BA 2ARBA 3PNAA 4D6RA 4BQ1A 4WVMB 4LH7A 4YVSB 4DUVA 3ABLB 2N05A 4LC1A 1OSGA 1ZA7A 5F7UA 2W68A 2VQAA 1VPHA 3JASB 2XHBA 1PMHX 3BCWA 1DGLA 4YVWA 4BLIA 3GZAA 5LA2A 3NJYA 4HK9A 1UYYA 3E83A 1Q8OA 4Y4YA 5LP6C 1YJWV 2WIIB 3J7HA 3SCHA 4Q4W1 2BWCA 4JI7B 3PVBB 3AYDA 4UCRA 1HDJA 4JRAA 2P7TC 1LOFC 2BVBA 5CFCB 3WXPA 1GBGA 3ZRWB 3T0BA 3CCRV 3RNSA 4X65B 2GC1A 4CEWB 1H9WA 2VBBA 3WW4A 3ZO0B 3HOBA 4JGSA 4E4HA 1DU3D 4GKJB 4PCRA 1M5IA 2ZA9A 4L8JA 5JXGA 3ZJZA 1BBT3 1W59A 1NCRC 4HYOA 4PIXA 3NO8A 4CPBD 5ACA3 1OCZC 4OQ9A 1W6OA 2XOKG 3OTFA 4W4LA 1LOBA 4AHWA 4QHOA 5J96B 1UPGA 4WFHA 5C8CC 4BW5A 4QXBA 2F6BA 1ULFA 1OBNA 1AR93 2QQVA 4QPKA 4RD7A 4RO2A 1AR63 4GXLA 5A2QN 3CDZB 1K73W 3IJ4A 4XBLA 5EQUA 1GANA 3O0XA 2EJRA 1IBMB 3LAGA 2LS6A 3WNNA 4CP1A 2Y38A 3AFGA 3SNMA 1Z0HA 3RSJA 2RM22 4WBBA 5IE9A 4HOOA 2UUBO 1VQMV 2HVKC 2VMEA 3RYPA 4BIOA 4CC6A 3UGFA 1PK6A 1I5ZA 2Z2SB 3J7AU 3N9MA 4D94A 5IHRA 3AG3B 4GCZA 5I0TA 4RR3C 5CA1A 4BCUA 2D98A 1VMGA 3DYMA 1ORQC 4PDMA 2VVDA 2J1UA 1U5XA 1DFQA 5CYYA 4TOIA 1W2BU 1JYXA 4IYIA 3D36A 1RUH1 3LSSA 2V4VA 4LE4A 1G8WA 3I2KA 2P17A 3FAVB 2EXKA 4IV3B 3CZUA 5C9AC 2B1IA 2WT2A 1Q5OA 1FFXB 2IJIA 1R3JC 4COWA 5CBLA 2QTSA 3HPLC 1ND2B 5AC91 1RUG1 2EA7A 2RJLA 5FY9A 4IQPA 1GNZA 2QQNA 4R52A 4DUWA 2E7QA 4M3CA 2RR13 1Y66A 5CZKA 3VD3A 3BEHA 3I97A 5J7MA 2KG7A 3ELNA 1AJOA 3PN1A 4BK4A 1WA6X 2Z0AA 3CJXA 2HWB3 4ARXA 2YXLA 4LO6B 1MEC3 3ZIWA 1MS5A 4B29A 3KVBA 1GM7A 3KF5A 1D2DA 1JZ7A 2Q4SA 2BGOA 1ST8A 3ORJA 4NHLA 1QY4A 5L3CA 5IY5B 1UOJA 3ZXLA 2X8KA 3FL7A 3I2OA 1HB3A 3IC9A 2D6KA 2W6IG 1FXHA 2DU1A 5FNVB 1PNKA 1DQ1A 5FLHA 1RM1C 1V70A 5FYCA 5JJEB 2WAAA 1PO21 2QE7G 5LBQA 4LHLA 4EFBA 4I0XA 3ZSMA 1OOPB 5A33B 4GALA 2Q7GA 5A3UA 5AVPA 4H37A 1RGSA 4AFDA 4MYEA 1UY0A 4UCVA 3BALA 4CS3A 3WB0A 4B7EA 3GDBA 2CTQA 4JI8B 1H8TA 4UVBA 3FLTA 4BA6A 3U14A 4FLYA 1S1AA 1IZ3A 4O61A 2V5YA 1YI9A 5AFBA 1BCXA 4DXRA 1BMV1 1S5HC 3OR7C 2HJFC 2ZR2A 3USUA 4W50A 3J8F3 1N36B 3BCCH 4PI2A 1HNXB 3WCSA 4O7XA 1ZBE3 1H2KA 1RSOA 3WD5A 3ZHTA 1REDA 4AE2A 4I02A 2Q7HA 4DIQA 5T52A 2QQMA 2FMDA 4M4PA 4X89A 2UUAO 4MLOA 1JYNA 2PLV2 3UETA 3JAKB 1BHBA 2VCMA 1TUBA 3U37A 3I8TA 3CCSV 2GN7A 3ZFEC 1CAXB 2ZX4A 4I0BA 4UBGA 3VKMA 2ZQMA 2RS53 2R071 1SCRA 4H13B 4QX2A 5B4NA 1LUWA 4CA9A 2PHTA 5A7WB 4QQPA 5A6ZA 3RZKA 5CN0A 1BBT2 1GOHA 2VMHA 5EYPA 1RMU1 3U4SA 3FN9A 2WN2A 2D6NA 4DV0B 1EV13 3HQXA 2WNVA 4E4DX 3CXCU 1PL4A 3CC2V 1YFWA 3EO6A 3OGVA 1PKXA 1G9AA 3O1MA 3KT1A 1TZOA 5C4WC 2RJZA 3HBKA 5J2TA 1A8MA 1RUI3 4JDOA 4PIZA 3BOWA 4CU6A 1UYPA 1NVPB 3WG4A 1AR92 4K0KO 1W06A 1H4GA 1Q7YW 1M1KW 3HKBB 2P90A 3ASNB 3WHUA 3WV6A 4D6TH 2ZGOA 3T4HB 1WNSA 1MS3A 2WS93 5JOWA 4FFBA 3L75H 4IE6A 3DXUA 1LULA 5F9TA 5FZ4A 2P3JA 3WINE 2OUHA 2ZD9A 4I3PA 1VBC1 3V64A 1K34A 4P9JA 3W7XA 1JHJA 1A32A 1UX6A 4Q1PA 2EVXA 4AILC 1DZQA 3IPVA 5FLJA 1W0KG 3WG7B 3UL2A 5JVDA 1OCRC 3AL5A 4WVWA 1XL4A 5BNNA 4AG4A 1N0JA 5A7SA 4EWAA 4XZPA 4BQ4A 4CZSA 3VBOA 5EV7A 3TXSA 1FX5A 4L2NA 1W6QA 1ZLZA 4HKLA 3OBZA 4GQ7A 4OUMA 3I5DA 1OI6A 4DO0A 2ZGLA 4AEMA 4MTFA 3MV01 3O1UA 1UPSA 2B5HA 4Q4W2 2ZR3A 2RR12 4OZOA 2JJ1G 2IC1A 3WUDA 4LUKA 1M90W 4UUJC 1LR5A 4B3RB 4Q8LA 1V6JA 1R1BA 3ACGA 5JWPA 2RJKA 4Q26A 5CKQA 2HWB2 1D5AA 2E3CA 5CFDC 5A7OA 3O14A 2Y0IA 1NG0A 3AX4A 3F5TA 1H9PA 3I3BA 5IWAO 5LGUA 3JD4A 1J3RA 5I8TA 2X53S 3VDBA 5D8AC 3GBFA 3ZHUA 1W9WA 1SFNA 2Y6LA 3MIGA 1PIV1 3HKDA 4H0LB 2VXRA 1VBB1 1KKCA 1K3EA 2XLFA 2KB1A 2DE0X 1XYOA 3RYHB 5KX5A 5EC2C 5IJRA 1VAVA 2VUDA 1LUVA 3DSQA 3FYEB 5EHDA 4CSWA 4AVTA 2CE4A 3T1YO 3MI8A 5IJ0B 2D93A 3OM3B 4GZ9A 3OUIA 3HAGA 1QLNA 1XMOO 3ZEDA 3VKLA 4Q4V1 1WD3A 4YM3A 1KMIZ 3SJCC 4DUZB 4V2VA 1R1ZA 4X1YB 4B3NA 5A6YA 4U36A 4NO4A 2WO7A 3UJOA 1ENVA 3J8F2 4WVMA 3HKCA 1NA1B 4UI9L 3OBAA 2Q6AA 5IWAB 1XRUA 1JZ8A 4KUMA 1Q43A 3DYPA 4IE7A 4RQEA 2BOJA 2BBVA 1HLCA 4R9DA 4RQPA 4GD4A 5KA6A 3JATA 5JI9A 3TK1A 3LIGA 4XDQA 1RINA 2XAJA 5FPRA 1BE3H 4WVZA 2DCYA 2Q1ZB 3HNYM 2RS52 1XU2A 2IWGB 1PZ9A 4TZDA 3HMYA 1FMD2 5LBCA 2WDBA 3ZRWA 3AEIA 4XBFA 3RYCA 1MZ5A 1N1YA 5EYXA 3T1YB 1CN1A 1RXGA 2UWBA 3USSA 4P9PA 1EV12 2DCZA 1ZRCA 4DV5O 2V72A 2QWQB 4J11A 4AK3A 5AC92 2XAHA 4Y4RA 3AK3A 2UY8A 1FPN1 1QR9A 4COYA 1QJU3 1FV2A 1HKDA 1DQ4A 1TQ5A 1R1A1 2PFWA 1R73A 2OX0A 4TV8A 3TWIA 2GH8A 4AI2A 4GJZA 2QEXV 1K33A 2QDRA 4AEDB 2V7QG 2ZIMA 3T4VA 3OMIB 5IAVA 4DR1B 3WEZA 4B3TO 3WSOA 1IURA 2WS92 3FYIB 4LO7A 1PO22 4RHV3 1C3HA 4DR2B 3TJTA 4X62B 3I2DA 4E2LA 5L3GA 4N90A 4LNUB 4DB5A 1O5UA 4IEPA 4E2GA 1V55C 3T1MA 4YW6A 2A7AA 4CCKA 4UFLA 1W05A 1KFXL 3OEAA 1W6MB 1QCEA 4QU1A 3H3ZA 3NNJA 3AB0A 2OIEA 4PBPA 1NXD1 4RS5A 5FPOA 3VQXA 5B66Z 1AZDA 1YLLA 1QLEB 4JI3B 3NNMA 1BMV2 3ES1A 1ENSA 1UU5A 5BMVA 1SLAA 2QR4A 4MW8A 1HB4A 2DVFA 4QXCA 4XCBA 1HB2A 3FAVA 2UU9O 4WM7A 1TUEB 1ZZ9A 2CWSA 3MD0A 3VQVA 5BNOA 2ZGUA 3T2OA 1HB1A 1RVF1 3H8RA 5KHKA 3ZPYA 1G9BA 2GHYA 3CJHB 1OPOA 3X29B 3L70H 5ANQA 1ND2A 2HWD3 3VBHC 3B7MA 4CXWA 5H9PA 1VEWA 3OPTA 1KDKA 4J7KA 2OKXA 3H42B 4ICGA 2W91A 2XMLA 2P06A 3GB7C 3W7SA 4AEKA 1Y76B 4BAYA 3RZJA 4IV1C 3VBSC 1V6IA 4UB8Z 5L7OB 4A7ZA 4IEVA 4H2AA 4AQYB 4WF9V 1W90A 5CNAA 1YIFA 1W3XA 4BHPA 3PUQA 3SKJE 1SQBH 2V09A 1XNQO 1AYN2 1NOVA 4QGLA 1JJOA 1AR82 4ZZ5A 4YW3A 3L2HA 1OOPA 1CAWA 3JALA 3JB8A 2C9AA 3TNQA 4YJ3A 2QM4A 1R093 2BCCH 1D0HA 2EINC 3NNGA 1NR7A 1ZL8B 4MV2A 2WWUA 1VF6C 1C8M2 4IEYA 3T2MA 4MGKE 1VBC2 2QQWA 4QX7A 1E5HA 2DU0A 3IMNA 2WC2A 4EZHA 2ZBJA 1WLCA 4I5SA 1J95A 1L7RA 5KAFZ 3QD6A 2QQPA 2K9ZA 1VRBA 4MGQA 2XLGA 3F5WC 1F15A 3BUCA 5BR8O 1EUTA 4G27B 1K8AW 3WOGA 1BGYH 2Q5TA 1GP4A 2IXCA 5A3NA 3A0NA 4UFJA 2EICA 4NAOA 1MA1A 4CCDA 3ZYPA 3BPSA 2Q8CA 4Z1VA 4YPJA 4XBNA 1XNQB 2W1QA 2BOBC 2YGMA 5BPXA 4G2KA 2WAOA 3E6BA 2OS2A 4WZFA 3WF2A 2BYVE 3H3UA 1QJFA 4RFT0 2QZ3A 3K5NA 1QJU2 2FDJA 4A3XA 3WW2A 3VL9A 4S2FA 3J7NA 1KYOF 2Q1FA 4YM1A 4F83A 4B3MB 1X9PA 4ZI7A 2AZ2A 2X05A 1TMF3 1AX1A 1AR73 2P3KA 2WA4A 2WWSA 2C1FA 4FPKA 4KI5M 2ZNIA 1FI2A 2KXLA 2W1SA 3CCQV 1ZZ8A 5ACA1 4HFSA 1GN3A 4GT1A 2ZEYA 4N53B 2CTRA 3GF6A 4RHV2 3F95A 1CVNA 1W8TA 2DYSB 2VMGA 5A70A 2FMLA 3CQOA 3BFRA 4EYUA 2EULA 3BY6A 1MS4A 2EIBA 1AR61 5E88A 1LTEA 3O0VA 1PP9H 1VF5B 1LHNA 4R6ZA 3OB8A 2R061 4KGGA 4TXWA 5DG2A 1YIJV 1BL8A 2OVUA 1F4AA 1UMZA 1M4UA 5EYYA 4I0WB 1GM8A 4YY3B 1K92A 4XFIA 5IFPA 2ITDC 2HWE1 2AHYA 4R8CA 1UZYA 3CZJA 1CD3G 2ZMLA 4X64O 4BIZA 3T0AA 4LFAO 4LKDA 2FTKA 5K1XA 1SQGA 4OHXA 1XNRO 3ABMC 3SCGA 2YXYA 4CVUA 2EZPA 1WCKA 3VDDA 1QJX3 3ZMNA 1O3QA 2LP7A 4DV1B 3WQ1A 5EIBD 2F23A 2VOXA 3P3NA 1J5EO 4Q0PA 4INDA 5BV6A 5FZ3A 1VMJA 1F5FA 3EJKA 4QPGA 1CJPA 3MFAA 4NWVA 4NPMA 2ERFA 1IOAA 4LBQA 3TN91 2C0ZA 2I2SA 1NBMG 5EFUA 1BJQA 1V6KA 1LHUA 2Q4PA 3WUCA 2BP6A 4P9IA 1D2SA 4XF9A 2O8QA 1BKZA 1RITA 4EJRA 1VMFA 4HZFA 4MHUA 4J7JA 4DR4B 5LP6B 3FBMA 5L73A 1VF7A 5FPUA 1EPWA 1ZREA 2WZ8A 3UJQA 1MEC1 4NYKA 1RUF1 1Y43B 3G71V 3OCPA 3K4ZA 4RAIA 1R1A2 3H7JA 1S2EA 1PNLA 3AZWA 4AHXA 5T5OA 2N04A 2IXLA 3UGHA 1R092 4Y33A 1XILA 4LORA 4EN6B 4XQ4A 3C7OA 3DEMA 4QPWA 3LSDA 1J5EB 4YZ2A 1IBKB 1UWWA 3B40A 2W87A 5FY0A 2DCKA 1V54C 1IKQA 1Q6IA 1X7NA 1VBD3 3W9AA 4X1YA 1OCZB 2E5LB 1X8MA 5HBAA 2F4VB 4EEQA 1FYJA 3I3QA 1A6CA 4NN0A 2LJ2A 2WLJA 5FZGA 3ABKB 2YEVA 3RWNA 3WG2A 1I3HA 5CB4A 4AFCA 5C8CB 4GUNA 3H1KH 2E6VA 1ZRDA 4TSFG 1KJRA 3CMGA 1U5YA 4CEYC 1XSQA 3B00A 4Q0SA 3WNKA 1ULGA 3LNMB 3FJSA 2XJUA 3H8UA 5JI7A 4AHYA 5IFTA 1DQ0A 2W3JA 1HN0A 2ILMA 1ONAA 4YJ2B 1ZBE1 1H2LA 1YJKA 4E8CA 3DC6A 4N7UA 5HV4A 2MK3A 1K5SA 1H1MA 2HEVF 1JZ4A 2PHWA 1UOGA 2ZGMA 4F8AA 4DV7O 2DQ0A 4FLTA 1XDCA 4PQQA 4MXVA 3MW4A 1H1IA 5EXOA 2JG8B 3MIDA 1UZWA 1PM7A 5JZGA 4LF7B 3JARB 2BTVC 1IS4A 4QU2A 3KKYA 5HFLA 1D4VB 4PA7A 5FXZA 2AXTZ 1W6NB 4FOYA 1KQSU 2A5ZA 2CWMA 1AJQA 3WHTA 3R4SA 3M3IA 2Z3YA 1SZBA 5BYNA 2RDRA 2QKCA 4CDQB 2JWPA 4OVEA 3JD71 3D3AA 1UXXX 5JPMB 3AK0A 3QO7A 3AMMA 2O8OA 4I2OA 1LOGA 4NRMA 4A6OA 4HT1T 2VCBA 1TME1 1NH2B 4AI9A 1W8HA 3VD7A 2HR3A 5EZWA 3JQXA 2VJXA 2R041 3N7LA 4O9GA 3G4SV 2XQRA 5GZGA 4JAUA 3CPWU 2ZGNA 4XABA 5DUVA 2Y26A 2FHRA 3JB4C 3I2HA 2PI5A 3DTUB 1VRH2 3BU0A 2EIKC 3BHPA 4YZ5A 4FFKA 1QJX2 4UFHA 4UFZA 2H0VA 3F7VC 1K5MB 5H9QA 1O5LA 2E7TA 3RT3C 3H8OA 4MH0E 2RE9A 1JYTA 3ILRA 1W8WA 4EWDA 4Q4Y3 4E8DA 1CEZA 3AL6A 1SQ4A 2FMYA 2G9GA 2OQ6A 3J9SA 5DUWA 1FJGB 3CJHA 4KFMA 2OCCC 4FTSA 1GOGA 4DEVA 5GZCA 2O57A 1X82A 3IN9A 4OUEA 3PUAA 4LBLA 5FZ0A 2D7FA 1KBHA 3QBQA 3TRSB 5DDJ1 3NNFA 2CTWA 3ABUA 3BU7A 4LFCO 2IH3C 2HJIA 1I0HA 2J1TA 5FOBB 5L7OA 3T09A 4DPNA 3VBUA 4XYXA 4UAPA 1BQZA 2D5HA 4WM8C 3DPRC 4NHYA 1E57A 1YQCA 4FP3A 1DYPA 4B3SB 3S57A 3WY6A 2QE3A 4YW4A 2BNOA 2G4IA 3G7DA 3ZHRA 5LA6B 3OY8B 4GWIA 3TEYA 3VZJA 2VY0A 3UGGA 4ZBMA 4ZKIA 2Y64A 1IQDC 5FP9A 1JFFB 3VKNA 2CDYA 4HNAA 3OAAG 2ZACA 5FK8A 5CKMA 4JCKA 3LEKA 4JI4O 1GP5A 1I5YA 2PYTA 1ND3C 2AACA 2FYUH 4XJ9A 4QT6A 1YTFB 1WW5A 4EB6A 4MX3A 2W94A 2UYAA 2GSYA 5D2AA 1ZTEA 3WF3A 2KSDA 2HWE2 4DV6O 2AH2A 3DN7A 2Y69B 3AP7A 3B01A 1MSWD 5FZOB 1MQTB 1AYM3 4QPIB 2YI8A 3IDBB 2XGXA 4FCAA 3Q4HB 4HPKB 5FV3A 3ZRSA 2HHHB 3NV2A 4NHXA 1POV0 4JGYA 1GKFA 1JPXA 1GK9A 1AI4A 4GA9A 2WNUA 3M7AA 1JQ0A 3I3DA 5I8SA 3IZOA 1G1XB 1FXKB 1VIBA 1W0JG 2ADDA 2JS3A 5EIBC 2GDSA 4ZZ8A 4OCTA 3R0RA 5TISZ 2JE7A 4Z2AA 1JZ3A 1JYCA 4OI2A 4K8ZA 4QDRA 2CGPA 1LOCA 2JJ6A 3K9AA 3ES4A 1XJAA 3FLRA 4WFAV 2QKAA 1XNTA 1CAUA 3GCXA 3NW4A 4I4TA 2JG9B 4LHSA 1LKNA 2OQ7A 1RUF2 4N9IA 5BY5A 5C8WA 1NCQB 4LBNA 1OLRA 3MHHC 2C9KA 4IGQA 2R0HA 5C3RA 3INAA 1BQPA 5SV8A 4U3JB 2FCTA 1HRI1 1YEWA 1W39A 2X29A 4QKFA 3SH5A 1WP8A 3L74H 3ZFGB 1WB8A 3ZN5A 4UBHA 3K58A 1MOFA 4D7YA 2W2IA 4BQWA 1MS9A 4B4QA 4P9YA 4MOAA 3OGSA 1LGBA 5HI0A 3GZTB 3QLQA 2ZINA 4KWJA 4UV9A 3FUQA 5I0RA 4YVSC 1J58A 2D97A 3ABLC 3B3QE 1T6GC 3BVOA 1DLLA 1DQ2A 1G6UA 1XE7A 4MVUA 4LF9O 3ZYRA 3FX3A 2JIZG 2A7WA 4AFBA 2HKXA 3KZ4C 2X5IA 1RXFA 4DUXA 2LFSA 1GICA 2EXHA 4AL9A 1BEV1 2J42A 3ZXKA 4ASKA 1N33B 3MW2A 4IGPA 1MS8A 1G7YA 3BA8A 3O1PA 4Q29A 5F3GA 1Q8IA 2B4KA 3CKHA 3VL8A 4XJUA 3JQWA 1AVMA 3OT7A 3NXSA 1VQPV 5CFCC 4YGEA 4HVOA 4CEWC 2F93B 2YIBA 5KUKA 1VBE3 4PQ9A 5JLVA 4XUNA 2HWD1 4IIJB 2OYZA 4YLZA 2VQEB 4LXLA 3V65A 4F6RB 3M8LA 1JYWA 2UXNA 3ZDVA 1H30A 5FZFA 1R3IC 5LP6A 2A3QA 5KAIZ 4NAMA 4HVQA 3JBG1 1OPMA 1JMUB 4UCTA 2SLIA 2JJ2G 1SQPH 5GLWA 3ZM8A 3AYAA 1XREA 3B02A 1LOFA 2JKBA 3VHOA 2X0LA 4XC9A 1WJZA 5H9RA 5CMUA 3SC7X 3B5LB 2JEMA 5KLVH 1W03A 4DXSA 2A1XA 1H4HA 4NR1A 1NLQA 1CAVB 3JD72 4QPYA 3SCFA 4EV0A 4RUEA 4FPPA 1NCRA 2K46A 1WBLA 3OFNG 2R042 1UL9A 4KWKA 2ZHLA 3EVKA 1K5QA 1VAKA 4IE4A 4RGKA 5C8CA 3M99B 3AG3C 1AYM2 4QD2A 4BIUA 2A6XA 2NN8A 5EPAA 3P32A 1LEDA 4GAZA 3CE2A 4FPYA 3AG4B 5IATA 2VAUA 3OJBA 4HN1A 4YZ1A 2R32A 2BRTA 4G9SB 4DV2O 3OUHA 4OI4A 3HKEA 4K20A 2VOKA 4IV3C 2QA4V 4GYCB 4QKNA 4EFEA 1X8EA 4LCUC 3W58A 3NMBA 2DCTA 4A4AA 4TTGA 5LMUB 3R65A 1KUQA 4RR3A 1W0PA 3ZX6A 4XFFA 3GJBA 1O8PA 1NLSA 1BVVA 5EP9A 3JARA 1T2XA 1X9TA 2QFEA 3HEIA 5DDJ2 2OWOA 3CC7V 4GMP3 3OEEG 1EY2A 5HXMA 5IY5C 4V2WA 3ETQA 4HG6B 1DP0A 1ALYA 5EBLC 4PDWB 3DECA 5A7PA 3WR0A 1YQ5A 5KC5A 1S4CA 3H1IH 3B09A 2BUKA 2BDRA 5DABA 5JCOC 1W8OA 4Q27A 2CDPA 4KL1A 1W28A 1HXS1 5FYSA 1B6QA 4QGPA 4R8HA 4CU7A 1OOPC 4M01A 2CTVA 1RFYA 4FLXA 1DF0A 1Q8QA 2CY6A 3IAPA 2RMU1 5DAWA 4LWSB 5C8YB 4KWLA 4KU8A 4L99A 1R081 3ZHVA 5HCBA 3O1VA 2ZHMA 2ZGKA 4ZIBA 1DBNA 2XL9A 2YICA 2Q68A 1VQ8V 1MVQA 2GV9A 2VM9A 2WFF1 5LBBA 4JYAO 2WLLA 4QAWA 3S6PA 1V9U2 3LQCA 1S0EA 2ZM6O 3MPBA 1HV0A 4DY5A 3JUUA 1SEFA 3KB5A 3POJA 5FYYA 4C91A 4FPFA 4UW5A 4CTEA 4JI0O 2P1BA 2Q8DA 5DN2A 2GU9A 4JTAB 1VBE2 4IE5A 1Z7S1 2Y0OA 3WDUA 2WBKA 2DUQA 1IPSA 5LEJA 4DYLA 1RUE1 1WCQA 1Z78A 2XBO1 3THOA 1WB7A 2D3OW 4BW9A 3OMAB 1XHZA 4C0HA 2D5FA 2VNRA 1SPPA 2GNMA 4CBCA 4DMIA 4DR3B 3FB6C 4I09A 1PO13 2AGAA 4GX1A 1W2AX 3P30A 2XWJB 1HNZB 1FFTB 1NI8A 3ZFFB 3QH6A 3LPFA 3ZFEA 1US3A 3NNLA 1P84F 5FLXN 4RFRB 3ACFA 5JAXA 2IJHA 2ZMNA 3AVSA 1SA0B 5A7NA 1MNGA 4MUVA 2PQQA 4JYCA 2ZM6B 1H38A 4XUOA 3VQWA 1RPOA 3ASNC 2OZ6A 5C3SA 1IS3A 3QTCA 4QM8A 2PTMA 4NUBA 5K0UC 1JZ2A 1S0CA 5GKAC 1LU2A 4XDJA 5FUNA 1S0JA 1C28A 4GKXA 5C4WA 1Q6UA 4Y1VA 4D7TA 4UCSA 2BTQB 4P9OA 4QB1A 3POWA 1RUJ1 3M7MX 1BZWA 5JOYA 5FJHA 3SJAC 1VBD1 4Z82A 3WDXA 5FZBA 4XDLA 1UAIA 5LXTA 5IVFA 1J83A 1O9HA 3WG7C 1WW4A 2CAVA 4NVPA 5FXWA 2CAZC 4L87A 4DV4O 3N9PA 4ZS2A 1ZZ6A 3TAYA 4P5YA 2GSMB 1QHTA 2E76B 1FPOA 4CCLA 1B35C 2C24A 4N43B 3WZ1A 5A80A 4FXKB 5KHJA 1LRHA 3ZYHA 2ETNA 5F5QA 1POV1 1UFIA 2QTWB 1F2NA 4J1XA 4RQFA 3FX7A 1SBEA 2PHLA 2V73A 4XW3A 2EX3A 4UV8A 2BVVA 3HR9A 5LY2A 1AL22 3PVOA 2QWPB 3ALQA 5GONA 1U12A 4E27A 4A7YA 4PT6A 1W8UA 1XYPA 3PJQA 1CXZB 4GMP0 3ZX7A 4LR4A 3ETEA 3V0AA 4FQZA 3MDSA 5FUPA 2HKOA 1UU4A 2YFUA 1VLNA 4BU2A 2YZ4A 3POSA 2QJ1A 4CDUB 1W6PB 3MIHA 2VZUA 2E75B 2FCVA 5LW9A 3PJYA 4UT5A 3MBWA 3K5MA 3VBRB 3JCIA 2JB8A 1O4YA 2IU3A 3VHNA 4FLWA 5CFDA 1VBA3 3ZN1A 2P67A 3K04A 3I59A 2BOCC 3L9DA 2LROA 3DXTA 3WU2Z 3GNEA 3ZMUA 3EXUA 2XAGA 3VD4A 2JDNA 2P3IA 1OCOC 2WZR1 2ZE6A 2QDNA 1SKVA 2YXHA 5E8AA 2BFUS 5FMBA 4G4FA 2IVJA 2DWDC 2XAFA 1XXNA 2E63A 1NA1C 3NJXA 2C4XA 4GJYA 3UYJA 1GZWB 4LKFA 3OR6C 3E5UA 1HW7A 4ORFA 3RYRA 3ABZA 3MFCA 4CZZA 4IESA 2D3PA 4LUMA 2WR9A 3SH4A 3VBFB 3ACHA 3MHSC 3K0GA 3PUIA 4QX8A 2DFCA 3OF1A 2BSKB 4IUGA 3TETA 4R9CA 4FLVA 1TE1B 4Q4Y1 3NAPB 4N21A 3AXEA 2OT5A 5IAXA 4NRPA 3MLJA 5B5EZ 1W9SA 5GW7A 3OPZA 1F4HA 4C7UA 2ZGRA 2VWJA 3VBBA 3IDCB 4NHMA 1DGWA 3RMXA 4YM2A 1UNBA 2ZKNA 4QGMA 1XU1A 4NKGB 4UXNA 1W8NA 1OVPA 2HJDA 2JDZA 3NV4A 1K42A 1YO8A 4OGQB 3I3MA 4I55B 5FZIA 4AEDC 4X1IB 3K3OA 2YBSA 4QQHA 1EPZA 4XDPA 3PLQA 2JXAA 3CRMA 4BISA 2JICA 2VD7A 4A3ZA 1BZKA 2P6HA 2RG4A 4DR6B 4WBNB 1PL0A 1HW5A 4TQDA 4OZXA 1A3KA 1CGPA 1WPBA 1QDCA 2AEYA 1LCLA 3L9JT 2YDEA 2ZMKA 3LDBA 2ADEA 2F43G 3K5LA 5EC1C 1OF4A 4JI1O 4RL7A 2JGUA 1EN6A 4HL0A 5CKNA 1QLEC 4B4RA 2HWF3 4FBFA 1RUC3 5JH7B 2VQTA 3ZN6B 1US6A 2OPWA 4SBVA 1FOD1 4XF0A 5IDJA 1J59A 1PVC3 2FDKA 2F95B 2YROA 4O2BB 4EWEA 1NX9A 4Y20A 4B7KA 2X6AA 3ZOIA 2XNDG 4QQ2A 4Y22B 1GFF2 4D7SA 1PNFA 3C3VA 3DKWA 3RG0A 5FJKA 3ZBHA 4L92A 4P14A 3WNOA 3A0KA 1IGOA 4P00B 1W0OA 2ARHA 3NVCA 2ZNJA 3T3YA 3JD2A 3HJRA 4BM8A 1YHFA 2BNNA 5EJZB 4MXWA 2DWEC 5CG8A 5FL7G 1GUIA 2OXBA 5J37A 2VTFA 2HBTA 3AM2A 5LYJA 1D4M3 3MLLA 3SH3A 3I7DA 2EIEA 2E9QA 5JPNB 3WQBA 1IKPA 2QGNA 2K1EA 2FDHA 1VBA2 4U3FH 1IHMA 2NYYA 3VBHA 1NH2D 5FKBA 2PUSA 3OUFA 3B8NA 2UXXA 2IW5A 1LGCA 1QBZA 1NZCA 1JS9A 5C7GA 4JC1A 2R49A 5HV0A 4NTWA 4OX9B 1VQ6V 4HMZA 4IV1A 2GTSA 2W0FC 3VBSA 1ZBA1 5A1AA 4XIKA 2XJQA 4YG3A 4BJ0A 4MVRA 3V0BB 2WABA 3FHAA 4X88A 1Q82W 4TN7A 2DBNA 4WM8B 3AMQA 3JD3A 4XUTA 3RFRA 1UCXA 3CCMV 2BZDA 2D6MA 2CGOA 5FIXA 3C3TA 4ZOLB 1Y67A 2C5DA 4FP2A 1LJ7A 3FE5A 1UYXA 5FO8B 3JCZA 2EALA 4NJ4A 4NXNO 3MUZ1 1VMHA 2XVGA 1TNRA 2CTPA 3BTXA 4AHCA 1QXRA 4YIPA 1M06G 5F6KA 1VJ2A 2MEV1 2Z69A 4IEWA 5JQGA 1Q6HA 2GMPA 5LWBA 1VF6A 1ND3B 4XMAA 3IIIA 1COV1 1LNSA 4FFIA 1B04A 2BU9A 3SKVA 3W59A 1RTVA 1OLQA 4OFGA 3N2GA 2YUAA 3UESA 3CRAA 4YG0A 3K77A 2FKXA 1H8HG 1POQA 2D3RA 1U5ZA 3MLKA 1W2OA 5LGTA 3KG2A 1AI5A 2JECA 2QQOA 4S2GA 1E1RG 4U7NA 2DUOA 4YHHB 1J3PA 1PV0A 5BNPB 1WA8A 5T54A 2YU2A 4FZ1A 4FM1A 4U7OA 5FUIA 2B45X 4J42A 4GX5A 4NXNB 1ZRIA 4K40A 1TNFA 3K46A 2GALA 4N53C 1WLWA 3WNLA 2DYSC 5GTHZ 5J09A 1PMIA 5IUQA 3AJZA 2OTJV 3VOUA 4KBBA 2ZHNA 4QJFB 5JMOA 5DUUA 1FS0G 3WNPA 3SISA 3UKNA 3RMYA 1OA2A 3A7QA 4O4IB 4JGZC 5FP7A 1G86A 3LKJA 4META 1OD3A 1AI7A 5HFMA 5FY4A 2ZX0A 3N3HA 1Y74B 2L6LA 1W9TA 4XURA 1QJZA 2HWF2 3G6JB 5IT6A 3H1LH 3LFMA 1AJPA 4JI6B 1CPMA 1OKQA 1N32O 3M4FA 1PVC2 2PQSA 5F6LB 3WQ7A 4UW4A 4O65A 2LQTA 3CEIA 1IQAA 4LF6B 4BQ3A 1R3KC 1S2KA 1JVMA 1M9NA 1O6UA 4IHJA 3HWJA 1S5LZ 1HRV3 1X33A 2E7AA 3HBZA 2JENA 5DAPA 1CPNA 3JXSA 2B42B 3LA3A 4GZRB 1SQVH 4Y24A 3I2IA 4CH5A 2VZ1A 5F2SA 3PMSA 3UV9A 2VQUA 5F3EA 2YUEA 4PV1B 5IYZB 4NIHA 1ZSPA 3N2KB 2EJ7A 1XHXA 5E6HA 1XI1A 1ASJ3 1WLTA 3OE7G 3F2ZA 1BLZA 1D4M2 4LBQD 5C71A 3UQ8A 5FZKA 3D0SA 1S3JA 1H8EG 3DXRB 3AVRA 2PHFA 3KZIZ 1ODMA 5LOVA 2VPVA 2DURA 2Y0PA 4JI2O 2Q8VA 3PJSK 4P9WA 3LEMA 4CP9A 5DAXA 5T5LA 2Q69A 5ITZA 4LNVA 4P2ZA 4FFFA 2F17A 2PLV3 4BQYA 2PHDA 3MV11 5FMOS 1US2A 1O4ZA 1L7LA 1DZRA 2WN3A 2B5UA 5LMNB 2YY1A 4CE8A 1K5JA 3O65A 1EAH3 4O4HA 3ILNA 1R64A 2Y4UA 2ZDIC 3HR0A 1ENQA 3AZYA 2WO2A 4BWAA 2NN4A 2F4LA 3ABKC 2VH9A 4NE9A 2X7RB 5CA0B 4BPZA 1G9CA 2KKWA 2QKSA 1XYNA 1N3QA 2RCVA 3ZIXA 1WCUA 1VB2A 2NMOA 4X20B 4MT8A 4FIPC 5FO9B 3GBGA 4XJZA 2E32A 2GNDA 4UFMA 4FPCA 3RDIA 4ZXKA 3OGJA 4RN5A 3ECQA 4XDKA 1WCDJ 2BEOA 3LA7A 3IDEA 1LHWA 2PF4E 4OMDA 1QNYA 3HIFA 3VDAA 4LF5O 1UY3A 1UY2A 3NR7A 3RJ2X 4ES9A 4O2AB 4I9QA 4BQ2A 2CH7A 3K0DA 3LDRA 1NZ6A 5FBZA 3ZLIA 5C93A 3KQRA 4TV9B 2JG8C 4CEYA 4Q4X2 3KMHA 3FB8C 1WGPA 5FY8A 4IEUA 4BOWA 2GH2A 2JDAA 4DK0A 3QO5A 3WB2A 1KS4A 3BYWA 3OEBA 4PDVA 5LB6A 4IETA 3EYPA 4I55A 3VHPA 1YC61 3CBNA 3ZRVA 2YSUB 3RYFB 4HZ3A 2OUJA 1RJ7A 2CNAA 1TAEA 4CDQC 1JODA 5IVEA 2ZE5A 1ULPA 4DR5O 4Q4W3 2ATKC 5JJJB 3TEZA 2WA3A 2UUBB 2WLQA 2HWC1 1XOYA 1S55A 4J10A 4NIGA 2VVFA 5B1AB 3R4UA 5BXZA 1XOUA 3G6EV 4TWKA 4LFBO 4K8RB 2VQ0A 3SYAA 5FPBA 1UY4A 4J9YB 5FLIA 4XTMA 4GKKO 1HR0O 2B9ZA 4M00A 3H7YA 2QBXA 4MTXA 1KITA 5FZ1A 1H2SB 3ROUA 2D2CB 1HRV2 4AQ2A 2UXDO 1Q56A 1K5MC 1JW6A 2DN9A 1QF3A 3SYCA 1QIQA 4R7CA 2Y6GA 2YG0A 3LB9A 3M3CA 3C7EA 1O3RA 3LSQA 1KXGA 3QG5A 2Q67A 1MG1A 3A22A 2PA7A 5KWRA 2CDOA 2NM1A 1ZZCA 3RN4A 1ASJ2 3U10A 1JA8A 5KXCA 3LZZA 1COV2 1W04A 1OCCB 4UW6A 3BRCA 3ETGA 1WUVA 4ZU4A 5KMGA 4TLFA 5JCTA 4IYHA 4HXCA 3POFA 4IEZA 4HAMA 3RVHA 4HETA 2H3OA 4LMFA 2KD7A 2J1SA 2ZEWA 4QHZA 1QJY1 3HNMA 3PMEA 4Y1YA 2LUWA 5FQ0A 4WCEV 1SDWA 3KQ4B 3TGUH 1VE0A 2DWRA 5A32B 4AW7A 3N9QA 2DF7A 4QX5A 4FTBA 2ZOEB 2VZTA 2VR4A 3D82A 2XG3A 2A3YA 3OEHG 1HNWO 1JZ5A 1SF9A 1SQQH 3W21A 4DRXA 1RUH3 5J2UB 3NL1A 2XUMA 2RS31 1EAH2 1XBFA 2BQPA 4BK5A 4XJAA 4OHVA 5ANNA 1FMD3 1BHGA 4TSVA 2VMDA 5H5NA 3ZR5A 3N9OA 3E8GA 2LW1A 4TQFA 1CJDA 1E5RA 4MSWC 3ZSEA 2ZABA 5I8YA 4K9SA 3CRQA 1H8VA 3APBA 1JOYA 3V0BA 5AC93 1HQNA 1RUG3 1MMMA 2VS0A 3QVNA 4WM8A 3DPRA 2AENA 1QDOA 4TUYA 2R72A 4S2HA 4J6GA 2JD9A 2P4EA 1JBCA 3AKPA 2JDKA 3UK9A 1YFUA 1SLIA 4PIYA 4JRLA 3E89A 2CU5A 5IJ9B 1K97A 2I74A 3WF0A 2A6YA 4Z92B 4LF4O 4E2QA 2Y69C 2VMFA 3RYIA 1V6OA 4HVRA 3R66A 3URFA 3GM8A 3ATGA 2UUAB 2E53A 1MQTC 3ZYGA 4QPIC 5K0UB 1HNWB 4YGCA 2GUZA 1RUD2 1BXHA 4UB6Z 5FP4A 1NQJA 2IM9A 4XETA 1OZ0A 3OD0A 5JJNB 1PO23 3E22B 1ND3A 1COWG 4QE7A 1W2TA 4HSJA 1D5NA 1Y4MA 2WLIA 5F3IA 5CADA 4I50B 4M3CE 1FXKC 3MPPG 3GZEA 4X1KA 1B3QA 5I0DA 2YS8A 1J84A 4QXHA 2PGGA 1EM1A 4DUYO 3LD8A 3FZ3A 3THPA 5FZHA 2DMXA 4TLGA 4CRQA 4Y5SA 3E2EA 2YPDA 4K0KB 1UKRA 5GZEA 4IDZA 1B35B 1I94O 2JG9C 3VZKA 3CCLV 5LHGA 3C90A 4Q20A 4KHPO 3Q8FA 5IK4A 3WP5A 1NCQC 3K48A 4HK8A 5DXDA 4XHXA 3SQOA 1LB2A 4LF8O 3ZXEA 5T3NA 4YVWB 4A6SA 1AP6A 2VBPA 3MIBA 2Y60A 4E4ZA 5LA0A 2R073 2JE9A 3ZFGC 1H1AA 2WRAA 3APQA 4BYYA 4EROA 4GLXA 2XVKA 4NRQA 1RMU3 3KV9A 5FMCA 2A79B 1NUKA 4A2UA 4K6BA 1DGWX 5LZ6A 4ABMA 2WSVA 3C7HA 1VR3A 3BTYA 5A3WA 1AUYA 1NS1A 2HYXA 1Z2GA 2AGSA 4JKKA 2RMKB 3IC7A 1NKGA 2YYOA 1SRYA 4E2SA 1NY71 2K0GA 2DV9A 1FAYA 5D21A 4YSFA 1RUC1 1AYN3 1W6OB 1AR83 3IB3A 5FZLA 4P30A 2XJRA 3STZC 3K51A 1OCOB 2IFWA 2QM8A 1UW8A 4GB31 1SDDB 5IYZA 4UCOA 1GN2A 4RSUA 3K03A 3K59A 4YVSA 3GBWA 4R9AA 4OULA 1DGRN 2YI9A 1C8M3 1NQDA 3CYOA 1VBC3 1QQP1 5ERLA 2JE8A 3JASA 5IWFA 2YIBD 2VZOA 4JTOA 3DXRA 3WDTA 2RVAA 3PU3A 4LO5B 3VKOA 4MVTA 1RUH2 3JCUZ 3BI3A 3F7YC 4L8QA 3HD8B 1PK6B 3J80N 2DVAA 3CB2A 4JZGA 1QQCA 4XMIA 5CA1B 5CFCA 3CRRA 3ZXDA 3LA2A 4CEWA 2YGLA 4UW3A 1GN4A 4YNIA 2P5BA 3X2QB 2XASA 3R6SA 5EK0A 2Y8KA 3CO2A 1Q86W 2AR6A 2R1DA 2X10A 1QXJA 1RUG2 4LBJA 1XMOB 2OW4A 1W3VA 3VZMA 5IYDO 1ZUQA 4DR7O 1P8JA 4BH9A 5B1NA 1WBFA 3FC0A 4MVQA 1MS0A 3ZRXA 1I7FA 1QOOA 2JX9A 4XACA 3KHCA 2EIMB 2WLPA 5EWSA 3D6EA 3MF9A 4A5UB 4BWOA 2A0LA 3AG7A 1RHI1 1YNAA 3MAQA 2X6CA 2GTAA 3NV1A 2KG7B 1F35A 1PIV3 3T08A 4X20A 3VHRA 2Y34A 5IVYA 1VBB3 1QEXA 5TSWA 1RB8G 2Y4TA 4TYSA 3BAAA 5T55A 1UIJA 1UF2C 2DW4A 4PJYA 3AG4C 4BLJA 2WWJA 2LRPA 3CXHF 5FPXA 2VVEA 3TBDA 1DTOA 1QNWA 3MZHA 4FFHA 2AYHA 4PHZA 2BE3A 1SCSA 4DV5B 2XB6C 4JV5O 2A75A 1G6NA 1VAMA 1Y9MA 4YW2A 2G9FA 3WP6A 4W8JA 3J4UH 4DR7B 5FZ6A 1OHHG 4U2AA 3WVJA 1KJLA 1T6BX 5E79Z 4I0XB 1GMGA 2RM21 2QQIA 1KB9F 4UVAA 1IG0A 3POBA 4DRVA 5KUMA 4OMCA 1RYYA 3LPGA 4FPEA 1N34O 5C3OA 3W20A 4IV3A 2VW2A 2XQXA 1XNCA 1H8TB 4XUPA 2JRIA 4B3TB 1FFXA 4M0NA 4MVOA 3UKMA 3OYWB 3PDQA 4PDWC 3LDDA 3USUB 2R072 5K7PA 1SLBA 3POYA 1M56B 1RSOB 2XOMA 4NB5A 1ZA4A 3IT8A 5JR2A 1P49A 1XE8A 4JV5B 4WFFA 4DW0A 1RMU2 3RW0A 2UUCO 1GYKA 2H6BA 5LA1A 2R6QA 1PHMA 3B9CA 4UXAA 1OVSA 4QHBA 3AP9A 1FPN3 2VZPA 1K3IA 1GWLA 3BODA 1DYOA 2VL4A 5FNVA 3OSDA 5EYPB 4OQ8A 1R1A3 2WNVB 5JCOA 2UU9B 1J1TA 5A33A 2QKDA 4NIAA 2HH9A 2RS11 4E4EA 5IVCA 5J2TB 2LO1A 5FBJA 3KCCA 5FY7A 5FCCA 3HT1A 4B1MA 2ZGPA 5LRRA 5A6XA 4Q6GA 1RC6A 3Q8AA 5IK7A 1XNKA 1WAZA 5GZFA 3B8MA 2G38A 1E1QG 3PUSA 1G8MA 1GP6A 2LM3A 3RBZA 5GZDA 1WMXA 2VZSA 4JYYA 4KQ7A 2XKOA 1I6XA 2WQ8A 5A32A 4CCEA 3JAKA 1HIXA 3ZFFC 3QOPA 2XJPA 3H01A 2Z5WA 2WLNA 1V6NA 4DFSA 1K7DA 1CAXA 1SBDA 1GKBA 3WNXA 1L8DA 1WMEA 3IPVB 5FZEA 5JVDB 1OQEA 4FMTA 2ZX2A 3O1TA 2QDOA 5A7WA 1IX9A 1W8ZA 2VBDA 4PLMA 3VBOB 2PLV1 3CD6V 2IH1C 2KQXA 4DQAA 1RVF3 2QUOA 2WFPA 4PJ0Z 1YSCA 2Q0OC 4QX1A 2FB5A 5LASA 3UKTA 2WT1A 3VDCA 4JDNA 1TG7A 3EQEA 1PIV2 1REFA 1BBT1 5I0UA 5DAVA 5A3PA 1VBB2 1AX0A 4Q0VA 3HKBA 4FT8A 5CEHA 2QSAA 2PI4A 2JEXA 2IZWA 5BR8B 3B77A 3SYOA 2XHNA 2ZT9B 2ID4A 5GLZA 3ZSKA 3RZMA 5K0UA 2A70A 2EIJB 4CDXC 2TNFA 2R70A 4CU9A 1O9GA 4H55A 2VCCA 1ZVFA 1RP3B 2P22C 5JSRA 2P6CA 3D4KA 1K9MW 2BERA 2Q30A 2YB7A 1AR91 1PVXA 2PAMA 4EE2A 4I30A 4JGZB 2N7GA 4N43C 5H9CA 4XHBA 3SYPA 1WZXA 2WSSG 3IM0A 4JX0A 5CVRA 2C6SA 1V6MA 2WPDG 2NLJC 4JAVA 4Q4V2 2RDCA 3NV3A 2VMIA 3HQRA 4NOTA 2GNTA 4CCNA 4X65O 3IKWA 5M0TA 1WLEA 4Q1RA 2HEWF 3WDWA 1P4RA 4D8MA 4QKDA 1IPJA 5FYTA 2WYFA 1VRH3 1JN2P 4AVVA 4GKJO 3I56V 1OFNA 2YBKA 3VN4A 1B35A 5C3QA 3KCYA 4B4PA 1MZ6A 2WLHA 2H8PC 4CDUC 4UYBA 3HKCB 3K3NA 1ENRA 2VW1A 4E9KA 1LODA 3VBRC 1F8VA 5A1LA 3CSXA 3N35A 4RQPB 1FD9A 1CPYA 3JATB 4Y26A 1PGL1 3J7LA 5F2VO 1OJHA 5F32A 5FP3A 1SMVA 3O12A 1DHKB 3O1RA 2ADQB 4P9LA 4OXSA 3MHZA 4PD4F 4ZPIA 3OUSA 2OCHA 3K79A 2RR11 4CH6A 1IBMO 1MZFA 4MG2A 1FPN2 1BK1A 1K12A 4X64B 1QMJA 5JOZA 1UO9A 3E35A 4HKWA 1NR1A 1GNYA 4A44A 1AX2A 3RYCB 4LFAB 2HWB1 1CX1A 4DEQA 4FQ4A 3RYHA 1XNRB 2WQ4A 3N7MA 1SFYA 2NNUA 1WN7A 3P1IA 4QGNA 2HLEA 1DIWA 2A73B 2RDSA 2GNBA 1RHI2 2IJKA 4OHZA 2D43A 4ONUA 2EILB 1K4DC 2I07B 3NWKA 3SPIA 4WFEA 2OZJA 1R6NA 5IJ0A 2ZEXA 4D3WA 2GN3A 2PHXA 2IXKA 1W9YA 1NKDA 1ZYBA 3VBFC 3VQYA 2YBPA 4LE3A 5IK5A 4WV8A 4TV8B 3B94A 3W7WA 4URAA 3DGEA 2YFZA 1PX3A 3N7KA 1FV3A 5BNQA 4XUQA 2ZIOA 3NAPC 1KP2A 1NA1A 4IERA 1Q90D 1S0FA 2ZEZA 2UURA 1XB9A 2R063 2IU0A 3NQHA 1VQ7V 3ETPA 4LR3A 3RZHA 1GM9A 4FAHA 2V4DA 4AI3A 4B08A 1REEA 3ACIA 2HWE3 4PA6A 3ABTA 5JXJA 3J8F1 1DF4A 4XAEA 3N7JA 3N4MA 3PL0A 2W9XA 4DW1A 1ZZ7A 3JD1A 5J1XA 1M4WA 3POGA 5JR7B 4RS5B 3L73H 3ZMZA 1RVF2 3CJIC 4H7MA 2XL7A 2DUPA 2QZ2A 2RS51 5BMVB 3TYJA 1MABG 3ENRA 2HG5C 3BTZA 1YQ2A 1WMFA 3RVYA 4WM7B 1FMD1 3H1YA 1VQOV 2XONA 3OD4A 4O4JB 5BNOB 3TN93 3JAWB 1SQFA 3GWOA 3H9AA 2ET1A 4EN9B 1EV11 4N23A 4Y3OA 3MW3A 2MPFA 2PN5A 1XUQA 4AEDA 4IEOA 4JI8O 1S77D 2Q7EA 2PYJA 3U07A 1RUI1 3S30A 4NXMO 2W52A 1RUF3 5FZ9A 3LE0A 3I4IA 4XIOA 5CBGA 1N36O 1YXBA 1HNXO 4LNUA 3E6CC 2JDPA 1KP3A 2DVGA 4ET7A 5H9SA 4PLNA 3UM7A 4DV7B 2VWKA 1N1TA 2RS12 1QNMA 1PGW1 1IG3A 3K75B 2B39A 5EBWC 1YJNV 5DUXA 2WS91 4QB2A 1W6MA 2UXCO 4CCJA 2QWRB 2P6JA 5JMCA 4LEJA 1F23A 1VALA 5T50A 4GWNA 2X09A 3POEA 4XFAA 3HPNA 1VIWB 3KT7A 1CAWB 3JALB 1AB3A 3WP3A 4YJ3B 3B69A 3AMHA 4P02B 2QCSB 3VZNA 4DV0O 4QX3A 3G80A 5CBFA 2WZPP 2YXSA 4XE9A 3WF1A 4LBMA 3OYWA 5A3OA 1HJFA 4NXMB 2Z42A 4LIVA 1JR9A 5FWEA 3RS6A 4YYOA 3SEPA 4Q8KA 4D6SA 4LULA 1SQXH 3OBRA 2AW9A 3OW2U 4FTEA 2ARXA 4FOQA 2EXJA 1Y76A 4A45A 5A7QA 1QH6A 4KG0A 4HN0A 2UXCB 3NJZA 3HNBM 1IBLO 2XJTA 5BZBA 4H44B 3M3OA 2VQFO 3LF7A 5FPVA 3SITA 2XUEA 3K4AA 3OOXA 3ML0A 4X6RB 1FNYA 3A23A 2FDIA 3BVCA 4H3WA 4IEXA 4LLFA 1SZXA 3THDA 5ACA2 4XXAA 5IK8A 4C8DA 1OA3A 3I54A 3WT3A 1IVSA 4CU8A 4FVMA 1XQNA 4ZI7B 1SERA 2I45A 3O0WA 4KU7A 2WNEA 2RDQA 4C90A 4MTGA 2R9RB 1FAFA 5L9BA 1OA4A 3Q8BA 5FYUA 3AC0A 5FZ7A 1AXZA 1AR62 2YC0A 1ZL8A 3JD73 3T30A 2LGWA 3GWKC 1AYN1 2R062 5K4LA 3KM5A 1AR81 3S5QA 2XDVA 1TME3 4LFCB 2C26A 2B7YA 3LIHA 2R043 2YC2A 1LAJA 3CHXA 4B3RO 4ZHNA 1IBLB 2RV9A 5FZMA 5G04L 5JOXA 2VQFB 1G9DA 1C8M1 4AI8A 1PMJX 4RUFA 4K3UA 1ZX5A 5H6QA 4CDWC 5F39A 2QTOA 3D8CA 5BNPC 1TVGA 1KEXA 4I0AA 3A0HZ 4W6XA 4Q0QA 4LHNA 2N74A 1QU7A 2BOIA 2FBEA 5C6CA 3AG1B 3IAQA 4FSJA 3I2GA 1NQTA 4RGGA 4K8FA 2TEPA 1YI7A 2Z5UA 3QCWA 4MGIE 5FPZA 4ASLA 2EIDA 2G9ZA 3OGCC 1PGL2 1LECA 5DQ0A 1AVBA 3TN92 4JI4B 3VDDB 2WYSA 3FLPA 1PNMA 2PELA 1PPJH 1MR5A 2OPKA 3KS7A 1JZ6A 4R4XA 2GMEA 4LBOA 4AXOA 2R16A 4QPGB 4XVHA 5DDJ3 4DV6B 5D5PA 1QJU1 5FREA 2AZ5A 4QE9A 4LBQB 1Z5WA 1TVKB 4DUZO 1MEC2 1KGYA 3KCXA 4LP8A 1IXBA 2ADPA 2BWAA 3QH7A 4N53A 4QIWF 2OA2A 1BSMA 4HBNA 5DECA 3SJBC 1V6LA 1Z5VA 1NAEA 4LPLA 5I93A 2W46A 3A8TA 3WW3A 4HSLA 2VG9A 4E4SA 1R3LC 1OUXA 3FHQA 4Y5TA 1I1EA 4JGZA 2WWWA 3JZVA 1M57C 4QDQA 4YXWG 4ZHQB 1GRJA 4AVAA 1YJLA 3OGGA 4RHV1 5J36A 1QXPA 4XJWA 3ME2A 1UZVA 3OGIB 2DVDA 5APAA 2JS5A 1GQGA 5ISLA 3THCA 4PA4A 1FYUA 4YRDA 2F4PA 5B1BB 1XPWA 2GC0A 4Z8BA 2DYRB 4XZUG 2IFRA 1ZX3A 2CYFA 4FLUA 3K4DA 4PBOA 2E31A 1WMDA 3OPWA 2WL1A 4AGGA 2D6PA 3KVAA 2OIIA 3N9LA 2ZAHA 4Z07A 5I91A 5CAZA 1RPRA 1V9U3 2F66C 2HFEC 2ZGQA 2AZ0A 2YEVB 2Z4FA 1ZBE2 5CB4B 1ENXA 1KECA 3H0OA 3LOBA 3TEXA 2IVIB 4A42A 4D0QA 4EN7B 1XMQO 4ZS3A 4YARA 1V00A 4DR1O 4AYUA 3RPQA 4PF1A 5FOJB 2A71A 4GKYA 4AFAA 3WDVA 2DJVA 2NP0A 3ZMTA 1SLLA 1NU1H 3EFFK 2EIGA 5GM0A 4DR2O 4X62O 3PIGA 1DDLA 3LOIA 4C1XA 1XL6A 3VB9A 1QWRA 1WW7A 5LRSA 1CZSA 5FWJA 3ZIAG 4EQVA 5EJ3A 5IVBA 3FMGA 1NYWA 4LF9B 3O1OA 1UMHA 1VQKV 1YI2V 1QH7A 2P5OA 5JZGB 5E1RA 5K1PA 3I55V 5FAXA 1Q3EA 4HKOA 4GX0A 1J3QA 2E33A 1URFA 3E8BA 2Q73A 3DGTA 1RUI2 2TBVA 1JYIA 4AAXA 4JI3O 3CIHA 1IS6A 2B9VA 4YZ4A 2PXJA 2ZDIA 5FXVA 5G05L 1ULEA 3ASOB 5EZYB 3K57A 1QVGU 2ZXWB 3IDAA 1DZTA 1TME2 1PM4A 3WP4A 4I3GA 1XMQB 2VO5A 1HRI3 1R091 1N1VA 3SMHA 1PGW2 2DCJA 2FCUA 4MVSA 5LY1A 4IGGA 1UX7A 3A4UA 4QNHB 3LEIA 4FVVA 1HJGA 4LTAA 2W5FA 5L3BA 5A3MA 1OH4A 4IL6Z 1OF3A 2VZQA 3MGUA 3CCJV 4CUCA 3ZYFA 5B2GB 4AQ6A 3AG2B 4YJ2A 3A0BZ 4N7IA 4UWDA 5ABJC 4YZ3A 2ENRA 5E89A 2Y48A 4HANA 1PZ7A 4AQYO 4K35A 2EXIA 5LBEA 1BEV3 3FKSG 4KGQA 5B3SC 1GZCA 1NTMH 4JF3A 3ACLA 1WCSA 3RZLA 3ZCCA 2JG8A 3ZN0A 3RWRD 1O3TA 2FL4A 3SYQA 2HBUA 4O4JA 1B09A 5KXBA 1SESA 2VNVA 1MS1A 4XQDA 3JAWA 1AL23 5B1AC 5JUVA 3LDEA 1W6NA 5F5AA 2EAKA 1QOSA 2VE1A 4M0HA 4IGOA 3NSTA 1W2NA 1TMF1 3OG2A 4LK6A 1AR71 2ZX1A 4BMEA 4FM0A 1GNHA 3KV5A 2XJSA 3WF4A 4EKWA 4CDQA 1DLCA 4AF9A 1DGRA 5JDBA 1JOBA 3JBG3 3T4DA 2WT0A 4AWDA 4DV2B 4LIUA 3ITQA 4Q0UA 2ZX3A 5KHHA 2VNOA 1WW6A 3VBUB 5A3TA 3WG3A 2XKPA 5FRAA 3AYCA 4Q2FA 3UT5B 1ZZBA 4FPGA 4MGZE 5LGNA 3W5MA 2L35A 4QWNA 4H7LA 1SC5B 5T5PA 1Y4WA 2DVBA 5BUVA 4YW7A 3H50A 3ZYIB 4NHKA 3HB3B 2YV8A 4K21A 1OCCC 1SACA 4ISRA 1H2MA 4TT3G 3VD9A 4KNCA 1HQLA 3DF0A 2O14A 1K5MA 1I9RA 4HNAB 1X4TA 3OGRA 3B2EE 1SHWB 4XQWA 2VRZA 2F1MA 5CG9A 4X9QA 5H2FZ 4ATFA 1XBLA 4YG6A 4CXYA 4B3MO 2VU9A 3ZXJA 1VQ9V 1VRH1 1UOBA 3KF3A 4CH4A 3H1WA 5L9VA 3C3SA 4RYDA 4EB6B 2A3WA 2OTLV 1QJX1 5FKCA 3ZXGA 3AJYA 1AP5A 2OYQA 1WP7A 5FZDA 1OKOA 2LALA 3V56A 5FYHA 5C3PA 1OH3A 2QNKA 5DN6G 1WWYA 1W99A 2EZOA 2PZSA 1TEIA 3CU7A 3LDCA 3ZS8C 1ZM1A 1L7QA 5C5TA 1JXNA 1BVP1 3ZSLA 4JGYB 4BMBA 4DV3O 5D5QA 1LHVA 2WNUB 3J7MA 1EFRG 4ES8A 4IW3A 1WKYA 1I5XA 3POIA 3AFKA 5FTTC 1AXKA 1DGSA 4JYAB 1S2BA 4GWMA 1F31A 4MHRA 4YY3O 5LA6A 3OY8A 1PX4A 5L3EA 2BTOA 4FPOB 1R6KA 1CWPA 4BQ5A 3U4XA 1UN1A 1JFFA 1S0VA 4JI0B 3IIAA 1Q81W 2A6ZA 3EXAA 2P2KA 2Q1MA 1HRI2 5DZFA 2LFRA 4FK5C 2B9UA 1LR1A 1CAUB 4WFGA 1OC1A 4I4TB 4LBEC 2XLAA 4DV1O 4QKBA 1XSRA 3E6DA 3G6BA 1WD4A 4AQTA 1A8DA 1HXS3 3CX5F 1GWKA 5KHGA 2ZE7A 4L11A 4KG8A 2H94A 1HX6A 2RMU3 3DL3A 3WLUA 4DV3B 5LK5A 1R083 1Y9QA 1CP9A 5FZCA 3D5OA 4TWTA 1LEMA 5FZOA 3TCUA 1MQTA 1ZWIC 3IWZA 4QPIA 4XF3A 3Q4HA 4HPKA 4CDXB 3AKRA 4GH4B 4V1PA 1KC8W 3FB7C 2V5DA 4ASMB 1C4RA 1TGOA 3O5SA 3ETDA 2WFF3 4OYUA 1BEV2 4DR4O 3M8AA 2V4AA 3E1F1 4H33A 5FR3A 1GWMA 2XWBB 4PA3A 1FXKA 1URXA 5GLUA 3K08A 2HLDG 3AK1A 2X5IB 4YVWC 4YFZA 3J26N 4R50A 1Z7S3 1U96A 3E86A 2NQYA 2WO1A 2HWD2 3U1XA 4BQXA 1IBKO 1RUE3 1BCCH 4NTYA 4BB3A 2XBO3 5DM6V 5CBHA 2HYKA 4W6WA 4AR2A 5FXXA 2JG9A 3RJRA 1TVKA 5JIAA 1GMMA 1XNDA 2E5LO 3JBG2 4DV4B 1NCQA 2F4VO 4CS2A 2GZWA 4BE3A 2W92A 1G4YB 4JYBA 2L9LA 4J9ZB 2YIDA 4U3JA 4COUA 1DF5A 2VULA 2ZCEA 3SGIA 3QNEA 1GH6A 3FFZA 3ZFGA 1FNZA 1DCSA 4ZHQA 4LHKA 5CB7A 3WX5A 1OFSA 3LCPA 3ASIA 1YYNA 3RZGA 3CRCA 4Y1ZA 1GOFA 3GZUC 3VKFC 5F5CA 4LKSA 2DTYA 4L97A 5A3LA 3BA9A 2E51A 3OTOO 2QQKA 3CF6E 4A41A 2W6JG 1E5SA 2BFUL 2IJJA 4AGRA 1YQ6A 4DNYA 5IW0A 4CPBA 2D3SA 1RUJ3 2JD4A 5AG2A 3AMNA 4UF0B 1NCRB 1UD1A 2IXIA 1NT2B 4LF7O 4J25A 1DQ6A 4H14A 2G1MA 1S72V 4JHTA 1PK6C 1IS5A 3H1HH 3ON7A 3S7EA 4MZUA 5HXVA 5DPNA 4DRRA 3OUJA 2YIAA 5LK7B 5I0SA 1YFXA 3KLSA 2NR5A 3AKQA 3X2QC 4GULA 4P5HA 4FOWA 1WLDA 2QWOB 4IIJA 1K45A 2R9AA 3D36C 1POV3 1UU6A 1N8RW 4F6RA 3SXWA 3HKEB 1DK1A 3C8XA 4IE0A 3SEEA 3OTOB 3BOPA 2R0FA 3VD5A 4LOSA 1F4NA 5D1IA 3KV6A 2EIMC 2Y6KA 2BGCA 4FI9A 4AAPA 4CP0A 3CCEV 4RR3B 4LO8A 4JVAA 2JIGA 4LK7A 1TMF2 1AR72 3VZLA 1ACCA 4PF5A 5EJ1B 1ODNA 5LA9A 2Q9LA 4CCMA 2K2SA 4ASUG 3CJIB 3EHKA 2B1GA 2WINB 4D6QA 5GLVA 5K8SA 1CAVA 1O91A 1KS5A 4ARYA 4BXSV 1JCHA 2JKXA 4NMIA 2QWNB 2ZTNA 4DOUA 1HXS2 5C9AB 1L3JA 5EZYA 1LU1A 1X50A 3KGZA 4P08A 1AR4A 2ES3A 4JZRA 2W08A 3LNNA 2RMU2 5IYBO 1W0NA 2KM2A 1R082 1PNGA 1L0NH 3ZMSA 4KMQA 1FJGO 1KKDA 1EN4A 1F4MA 2CAUA 3O7OA 3AP6A 5FYBA 4MGTA 2H0BA 1GU3A 3M2MA 3OMNB 2GBOA 3LWCA 2W95A 3JSNA 2WZR3 4XF4A 3MEPA 3IAYA 4FM2A 4JKLA 2VOVA 4AHZA 2WFF2 3UNPA 1O7FA 1W9FA 3ZXAC 5L19A 2E26A 1D0GA 3AP5A 2P4KA 1AYM1 1QU0A 1ROPA 1H8TC 5F5IA 1BQ0A 4UCUA 3U78A 1JOPA 4B3SO 2WQZC 2R30A 4I7ZB 1UIKA 1WPXA 3WCRA 1T5EA 1RM1B 2GC3A 1Z7S2 3CS5A 1DQ5A 4O4LB 1FXZA 2WLLB 1UOFA 2M7WA 4MVMA 5IYYA 1M56C 2ZE8A 2A6WA 4Q5OA
chains in the Genus database with same CATH topology
1RUE2 1WA4A 1OOPB 1ZA4A 3IT8A 2XBO2 4R8HA 5A33B 4GALA 1OOPC 1ZRFA 4M01A 1XE8A 2CTVA 5AVPA 1Q8QA 1DF0A 2CY6A 1F9KA 1RMU2 2RMU1 1RGSA 4AFDA 4MYEA 4KWLA 1GYKA 2H6BA 3BALA 3ILFA 4KU8A 4L99A 4AGVA 3NKGA 4XEZA 1QKQA 1R081 2R6QA 5HCBA 4B7EA 1NX4A 1PHMA 2ZHMA 1H8TA 2ZGKA 1DBNA 3B9CA 4UXAA 4KH9A 3FLTA 4BA6A 4QHBA 3AP9A 2XL9A 1FPN3 3DUIA 3Q9OA 4PDWA 1S1AA 1IZ3A 4QMAA 2V5YA 3BODA 5KHIA 1YI9A 5CU1A 5AFBA 1BCXA 1BMV1 1MVQA 3USUA 3J8F3 2WFF1 1R1A3 4X8PA 2WNVB 3WCSA 2WNVC 1CESA 3S6PA 1ZBE3 1H2KA 1J1TA 3WD5A 1REDA 4AE2A 1V9U2 4I02A 1S0EA 5T52A 1X36A 2FMDA 4CWDA 5A33A 2QKDA 4P9GA 3MPBA 1HV0A 4DY5A 3JUUA 1SEFA 4MLOA 2RS11 2PLV2 3KB5A 4C91A 4FPFA 4UW5A 4CTEA 4F3JA 3I8TA 3ZFEB 2GU9A 2GN7A 3KCCA 3ZFEC 1VBE2 1CAXB 2ZX4A 4I0BA 1Z7S1 4UBGA 5FCCA 1LENA 3VKMA 2Y0OA 1S0IA 2RS53 2R071 1SCRA 3WDUA 3HT1A 3PVEA 2DUQA 5LEJA 2ZGPA 5LRRA 1RUJ2 2PHTA 1RUE1 1RC6A 1Z78A 4QQPA 2XBO1 2VOWA 4X6QB 2B46X 1XNKA 1BBT2 5IK7A 5GZFA 3MICA 1OIJB 1VBD2 2VMHA 4I01A 1RMU1 4C0HA 1OIJC 2D5FA 1W2UA 2VNRA 2D6NA 1DRYA 1EV13 2LM3A 2GNMA 2WNVA 3HQXA 4E4DX 3TB0A 1YFWA 3EO6A 5GZDA 1G9AA 4DMIA 4I09A 1PO13 1KFUL 4KQ7A 2FZ1A 2XKOA 3KT1A 3UKVA 1I6XA 5C4WB 1JH5A 5CA6A 2XWJB 1N3PA 2B8MA 5C4WC 5A32A 2YMZA 1HIXA 2DTWA 3FFQA 3ZFFB 2BPA2 3ZFFC 1A8MA 1RUI3 3QOPA 3QH6A 4JDOA 1S0BA 1VB4A 4PIZA 2XJPA 3P3PA 3BOWA 3ZFEA 4Y0EA 2Z5WA 1V6NA 3BTAA 3GYDA 4DFSA 3WG4A 1AR92 1JOJA 1CAXA 1H4GA 1SBDA 2ZMNA 5JAXA 1GKBA 2Q0AA 3WNXA 4MUVA 2PQQA 1WMEA 3IPVB 5KC6A 4J1WA 1FOD3 1OQEA 4G3YC 1Y0ZA 1V9U1 2ZX2A 5AVAA 1DRTA 2OZ6A 1IS3A 3WHUA 5BNNC 3WV6A 4PLMA 4QM8A 4AI0A 2ZGOA 3VBOB 2PTMA 3VBOC 2PLV1 2NMNA 5K0UC 4DQAA 2ZPXA 1S0CA 5GKAC 1LU2A 1U0AA 1RVF3 3DV8A 1MS3A 4XXPA 2A3XA 2QUOA 2WFPA 1VBE1 2WS93 5JOWA 1S0JA 1C28A 1LULA 5F9TA 4XFGA 2P3JA 4JAAA 1JUHA 3WINE 4GKXA 5C4WA 2OUHA 4Y1VA 3UKTA 4D7TA 2WT1A 1VBC1 4I3PA 3V64A 4Q4X3 4NE0A 4CDWB 3POWA 1RUJ1 4JDNA 1BZWA 4P9JA 3ZFFA 3EQEA 1UX6A 1PIV2 5JOYA 1REFA 1BBT1 5I0UA 4Q1PA 3LGRA 2EVXA 3EBRA 1VBD1 4Z82A 1DZQA 3WDXA 1VBB2 1AX0A 2MNGA 4Q0VA 1UAIA 3IPVA 4FT8A 5FLJA 3UL2A 1WW4A 4JTNA 4WVWA 2IZWA 2CAVA 3ZSJA 4NVPA 5BNNA 3PTYA 4AG4A 5GLZA 4EWAA 3ZSKA 4XZPA 4CZSA 1ZZ6A 3VBOA 5K0UA 2A70A 5EV7A 4CDXC 2TNFA 1NLRA 4GIQA 3TAYA 4H55A 1FX5A 1ZVFA 4AVSA 3CNAA 3V0AB 5JSRA 4L2NA 3D4KA 4BZ4A 2Q30A 1AR91 1W6QA 4HKLA 1PVXA 4GQ7A 4OUMA 1OD5A 2PAMA 1B35C 1CIWA 1OI6A 4N43B 4I30A