2CGNA

Factor inhibiting hif-1 alpha with succinate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
338
Chain Sequence
ATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFNREEMKFHEFVEKLQDIQQREERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Studies on the Inhibition of the Hypoxia-Inducible Transcription Factor Hydroxylases by Tricarboxylic Acid Cycle Intermediates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
total genus 107
structure length 338
sequence length 347
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2cgnA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgnA01
2YC0A 4AI8A 1H2MA 2WA3A 4B7KA 5JWPA 4QU2A 3KCYA 1MZEA 3KCXA 4B7EA 2ILMA 1MZFA 2XUMA 3D8CA 3P3PA 4BIOA 2CGOA 1H2NA 2Y0IA 3P3NA 4Z1VA 3OD4A 4Z2WA 2CGNA 1H2LA 2YDEA 4NR1A 1YCIA 2WA4A 4JAAA 1IZ3A 2W0XA 1H2KA
chains in the Genus database with same CATH superfamily
1NG0A 1XREA 5IFPA 2Q5ZA 1BK1A 3SPCA 4OHZA 4IGPA 4FQ4A 4WM8C 4R4XA 1AJNA 1H2SB 4Z07A 2D3SA 3WNXA 5K1XA 1VAVA 5DZEA 3IN9A 5LGUA 3WP3A 2LQTA 4GKJB 2GZWA 4FPOB 2VG9A 1YTFB 2O57A 4IIJB 4NIIA 2VRZA 3O1UA 5BNPB 1M1KW 3VL8A 2QWQB 1FFXB 2HKOA 4XCBA 5BNNA 4CS4A 4JYCA 4V2WA 2KSDA 1UOBA 2RMU2 1VBE3 4QU1A 4DUZB 2GMPA 1KXGA 4OHWA 5FYYA 1TNRA 1W6MA 4D6QA 2R7EB 1FI2A 3JB8A 3NR7A 4K3AA 3N7JA 3DPRB 1HJGA 3OM3B 4JTDB 4XHBA 1US2A 3EVKA 3QLQA 1QDOA 1K5JA 1ASJ1 1W8FA 3RI8A 2X0LA 4LKFA 3J81N 1QH7A 2JDYA 4OXSA 5J96B 3ACFA 4CP0A 4F83A 5T3NA 2N74A 4MHUA 1Q5OA 1VQ8V 5IVFA 5J2TA 2VY0A 3AFGA 1BXHA 4CDUB 5JOXA 1ONAA 2BUKA 1AJPA 1KKDA 5KBFA 4YZ3A 1UZYA 2VJXA 2RVAA 1GZWA 1KFUL 3LEGA 4QPGC 4RFT0 5F3CA 2CTPA 2G38A 4DNYA 4CH4A 4MLOA 5L3FA 1ZNPA 3WF0A 4D6RA 2X5IA 3KZIZ 2P3YA 3I56V 3LOIA 3ZMOA 2PHRA 5DUUA 1UZ0A 4FPCA 1YFXA 2VMDA 4NHMA 5LZ6A 2NR5A 4XDPA 3ZYRA 4GD4A 1HRI2 3MAQA 3V0AA 1JH5A 2CTQA 2VMEA 1LGCA 1LU2A 3TWIA 3SJAC 5ABJB 4UWDA 3ZXFA 4EFEA 1NCRB 2FDJA 4PJYA 2ZCWA 3J7MA 2V5YA 5FAXA 3AMMA 2BYVE 1GN6A 3J7AU 1D0HA 2XXZA 1UCXA 4CP2A 4BH9A 3VHNA 3ZMSA 3QO5A 3UGFA 4IYHA 4TZDA 1ZM1A 4COZA 3OJBA 2ZPXA 4LBQD 2V4AA 3USUB 4B3MB 1UFIA 4XEZA 4W65A 2AACA 5B1BC 3RI9A 4E8DA 2QQMA 1M56C 4QPGA 2R9IA 1ENXA 1RXGA 3FUOA 3UJQA 2GUZA 2RMU3 5LP6C 3O1VA 4DK1A 4XFFA 4YVSB 3ELNA 4Y4RA 1G9FA 3SKVA 2VZTA 1QIQA 1EV11 3TYJA 5H6RA 3LAGA 1HNWB 1Y4WA 5CKMA 2AXTZ 2PYTA 1OLQA 4GT1A 3N9LA 3RYHA 4IV1B 5FZGA 1BS3A 3IMMA 4AHXA 2RJ2A 2DUPA 1AR92 5FP9A 2RJKA 5A7QA 5EC1C 3MLKA 2BZDA 1E1QG 1SESA 1LENA 2QVSB 4I01A 3AG2B 4BR6A 1S0EA 4N23A 1PO21 1ZBE3 4MZUA 2HJIA 4HZ3A 5IAVA 2E5LB 4V1PA 3K03A 1BVP1 2ZGPA 5L9BA 4YHHO 1NZIA 1WLCA 4NXNB 2XUEA 4AR2A 4IE4A 1H9WA 5FREA 1H30A 1ULEA 2G19A 1FJGO 4AFDA 3K0DA 5BUVA 4UVAA 4R50A 3PUIA 4GXLA 4NWWA 2HWD1 4AHYA 1RXFA 3H1LH 2XKPA 4WFFA 3UESA 5CZKA 1WAZA 1IVSA 3WNLA 3OUSA 4RHV3 3HKCB 3NKTA 5ERLA 3FN9A 3APBA 5LY1A 5SV8A 2YBPA 1ZYBA 2IZWA 3WINE 1OCCB 4F3JA 1KKCA 4JAAA 2FDFA 1JN2P 5A3LA 2E6VA 1LHUA 4X8NA 1WLWA 3HJRA 3LZZA 1K7DA 2EIMB 2CTVA 5B3SB 2Q7HA 3BPSA 2DCKA 4NXMO 5FO8B 5EQUA 1OA4A 2JD9A 4P9XA 4NR1A 2ORXA 3ZHTA 2OA2A 2EIKB 3C8XA 1V6LA 1CX1A 1E5SA 2R6QA 3KB5A 4K8XA 2YBSA 3E6BA 2CHHA 4XTMA 4LLOA 1QJY2 3SCFA 1N32B 4FLXA 2VR4A 1QQCA 3K3OA 1JJOA 1R082 2A70A 2QKCA 5DUWA 1NZCA 1ZREA 4YHHB 3V0BA 4BQ4A 2ITDC 1UF2C 2XGXA 2Y0IA 2YXLA 2F6BA 4ES8A 5FZ0A 2DFCA 1WW4A 3LFIA 3QBQA 2QGNA 2A7WA 5JUVA 5ACA1 1UO9A 5D21A 2ZKLA 3WY6A 4BQ2A 4XZPA 4R7CA 2AYHA 2ADPA 1Q7YW 2JIZG 3BCCH 3KHBA 4CUAA 1UAIA 3RDIA 4EKWA 2Q8EA 4H55A 4L92A 4A6OA 5FOBB 5BY1A 4YXWG 4JHTA 4DV6B 1W03A 4LE4A 1AI6A 1WCSA 5LP6B 2DFBA 2YIDA 2C0ZA 4FLTA 5JPNB 1U0AA 5H9QA 5FP8A 3I59A 2DV9A 4PQQA 1EYBA 1RUE1 2VMCA 2WIIB 4Y20A 4UW6A 2WQ8A 5JLVA 1BK0A 4GUNA 1G4YB 4E2GA 2X09A 1WUVA 2OPWA 1NCRA 4DV2B 1UKRA 2BGOA 3TGUH 1FX5A 2ETEA 3H0OA 4EROA 3WXPA 2JEXA 4RSUA 4QQPA 4YM1A 1OKQA 2CL2A 4GAZA 4YGEA 3H7YA 5JCTA 3P3NA 3SITA 3I2GA 4I9WA 4H37A 1YJ9V 2GU9A 4LPLA 2Q8CA 4LF7B 4DR7B 2VNRA 2GC2A 2WO2A 1WW7A 3I3DA 1WNSA 2HLDG 5C70A 1OA2A 4FLYA 2WN3A 4AK3A 3MUZ1 3LFMA 1IKQA 4CDXA 4CUCA 1OOPB 1GM9A 3RYKA 5LEKA 1ZL8B 1JI6A 4XDOA 5HXMA 3CJIB 3RRDA 3ZRSA 4UB6Z 2HWC2 2ZXQA 5BNOC 3LNNA 4HSJA 4ZU7A 4MADA 4BA6A 1CP9A 3GALA 2HWB3 2IXHA 2ZEYA 2RM21 1AL21 4X6QB 4UYBA 3RG0A 1RM1C 1OF4A 2DCZA 3JARB 2YS8A 5A33A 3ZN5A 2VOWA 4CS3A 2VZQA 1SPPB 5T52A 2W39A 2FKXA 1VIWB 1S2EA 5J48A 5LA2A 1JCHA 2XHBA 2WJSA 3NVCA 1F2NA 1WBLA 3M8AA 4AG4A 4XMAA 2HH9A 2B5UA 3OTFA 3RYCB 1H1MA 3RVYA 4XFCA 1ASJ3 1A34A 4OVEA 1NUKA 3AFKA 4YM3A 4CC6A 4O9EA 3WG3A 1FPOA 2WBKA 1X8MA 2JEMA 4JYAO 4LO5B 5CFCB 2ZT9B 5E16A 5GZFA 1JOYA 5DAVA 1HN1A 4Q4X2 4KXRA 3K48A 1BGYH 2ZCEA 2WPDG 3P3PA 1D7PM 1N36B 4QGNA 4EFBA 1NH2B 4OUEA 2C1FA 1REEA 2AUYA 4U2AA 4XBLA 1YITV 2W0FC 3OYWA 5LXTB 2EIEA 2ES3A 1BMV1 1R6KA 4IEOA 5FMCA 4ATEA 4DY5A 3I2KA 2ZKNA 4I2OA 2WUHA 5CFDB 2YHJA 1J3RA 3JD4A 3VKFC 3RW0A 2WQ4A 4CCEA 3WDWA 4B3RO 4DUYB 2FDHA 3R4UA 1CAXB 1M93A 1W39A 2ZGSA 3WCRA 1EBOA 5B1AB 1WD3A 1RB8G 3LSEA 3NRUA 3AMQA 1KJRA 1JZ4A 3FB7C 1N3QA 3KF5A 4Q2FA 3E8HA 4DV4O 4BB3A 1VQ6V 2WWWA 1UKGA 1P4RA 4DIQA 1CAWA 1QQP1 2A3QA 1IS6A 4UFMA 3MF9A 1AR1B 2Q5TA 4JX0A 3WF3A 4H44B 3AKSA 2D6PA 4RD7A 2OKXA 2Y8KA 1N8RW 3RMXA 3CRQA 4N43C 3CCSV 2WZR2 5IVYA 4PIZA 5FKBA 2IVJA 1R083 1TME2 3BFRA 3AYDA 3W7SA 3QG5A 4CH6A 1S0JA 5ABJA 4ABMA 3ZYFA 1BVVA 3J7HA 3MIFA 2WKKA 1HRI1 5FY0A 2E3CA 2UUAO 4ZOLB 2QKSA 3CRMA 2WO3A 5DUXA 4ZKTB 3JD1A 4I9QA 4MH0E 3VBOB 2PXJA 3HAGA 4NIHA 1PIV3 4ZKIA 1IBKB 5FWJA 4W4ZA 1RUI2 3KT7A 1FJGB 2WNVB 4MOAA 1W9TA 3PURA 4JDMA 1ST8A 4LOTA 4YY3O 1VQKV 4DR6O 2BU9A 2XMLA 1PK6B 2NN8A 1NBMG 2UU8A 2JE8A 1SDWA 4FBFA 1JXNA 5DM6V 2UWBA 2Q4PA 1WGPA 1RINA 3OUFA 2IXJA 5FPOA 4AEDC 4UW5A 5C9AC 3A0BZ 4QE9A 5B66Z 2JS3A 4JRAA 3ETQA 4LWSA 4CH3A 1OFSA 3KKYA 5FZIA 1GFF2 2AH2A 3OR6C 4NWVA 4KG0A 5EBMC 4JTCB 2IXLA 4NTYA 4WCEV 2EJRA 1R093 5JOWA 5FY5A 1ACCA 1FMD2 1PGSA 2WNUA 1Q6IA 4DR3B 4K1ZA 4L9BA 3FYEB 1E57A 4LFAB 3CCQV 1GP5A 2WT0A 4O4JA 1ZUQA 1POV3 4ONUA 4WFHA 1KQSU 2ZQMA 1L3JA 5J98B 2GALA 1EPWA 1A78A 5CN0A 5APAA 1YO8A 3RZLA 5J2UB 3VKLA 4YFZA 1PGL1 2DU1A 1REFA 2ZE7A 1NQJA 1ZSPA 2ZNIA 2EILC 2JE9A 4I02A 3POGA 4K9SA 1JX9A 5FYBA 1VBA1 5C8CC 3GYDA 3ILNA 4G9SB 2WLIA 1MACA 2QJVA 4OI0A 1AJOA 3A2FA 5C8YB 4FXGB 3D6EA 3U1XA 2CDPA 1NA1C 1WB8A 4YW7A 1VQNV 3NMBA 4WVZA 3AK1A 3VD5A 4IERA 4BQXA 4O4JB 2WLNA 2JDNA 1VQ9V 5FZFA 4U3JB 1R1A1 5JJEB 2PHFA 5JWPA 3BU7A 2YUAA 5BV6A 2E75B 4QKFA 1XNQO 5T5JA 3LNMB 4NAMA 2VU9A 5FFOC 3SH3A 4XUTA 1AUYA 4I3PA 3AMNA 4MVTA 4JZGA 2VMHA 2PF4E 3AC0A 4LE3A 4YGCA 1YHFA 3VD7A 2QQOA 3O9OA 1LGNA 2VQTA 5K8SA 4UV8A 2RDNA 2D7FA 1FPN1 2WT1A 2E32A 2RMU1 4LO7A 2H8PC 2KB1A 3IKWA 1AR5A 3LE0A 2VO5A 4XURA 4LUKA 5JIAA 2J1EA 1MZ6A 4N9IA 5LEJA 1W8HA 1OCZB 1PNGA 3T2TA 1XILA 2J1AA 2VQEB 2MEV2 3WNPA 1ODNA 1R092 1B09A 1WCUA 2D40A 4YVSA 1HR0O 1PGW1 4I09A 3HQUA 4DV0B 4MT8A 4S2HA 2P4EA 2BDRA 3O0WA 5EC2C 5EJZB 2IU3A 4PI2A 2JEUA 2ZR2A 3DYMA 5DMYA 3P30A 4QM9A 3WB0A 1BLZA 5IFTA 3K57A 3HT2A 1AYN2 3C3TA 3GWKC 1PKXA 1XE7A 5EHDA 2TEPA 4O7XA 1BSMA 1Y76B 4FK5C 3ZLIA 2WNVC 2HLEA 5FZ4A 4YIOA 1YI2V 4FFKA 1IBLB 2JE7A 5FZ6A 1BHGA 4Q4X3 5DN2A 3U11A 2N04A 1CIYA 1QJU2 5LBFA 1AYM1 1OD3A 2Q1MA 5JZGC 1BBT2 2VNVA 1AXKA 2BCCH 1OHHG 2WINB 4W6XA 2WYSA 1EV12 2WLQA 4W4KA 4I0XB 2WR9A 3FAVB 2HFEC 3CRAA 5IVCA 3POJA 4AQ6A 1Z7S1 3AJZA 2E76B 2DCTA 4Q0UA 3MUY1 5IJ0A 3EXUA 2VECA 2X29A 3ZMVA 1I5ZA 4CE8A 4OMCA 2EIKC 3T0BA 1PMHX 4HSLA 3T2QA 3ZXAC 4ZHQB 3ASOB 1ENRA 2OZ6A 4QJFB 4KHPB 3OTOO 4OI1A 5FUIA 4UBHA 2O8OA 4UUJC 5FZDA 1XQNA 3ZCCA 4LR3A 2KG7B 4JI3B 2RDCA 3E89A 3SYOA 3E8BA 4BWAA 2PA7A 4NAOA 4M3CB 1R091 1X7NA 2NPIA 5FYSA 1D4M3 1S0DA 5KXDA 1OHFA 3ZR5A 2FTKA 1Y9GA 4N53B 4JDOA 2Y6KA 2PN5A 2X6AA 5LASA 1VIBA 4JI5O 2EINC 1XBLA 4NXNO 4A3ZA 3ZHUA 1B35A 5LMUO 5IJ0B 1DF0A 1DP0A 1RYYA 3H8UA 1M4UA 1K8AW 1N3OA 1NCQA 2FL4A 3RT3C 3POBA 2Z5WA 4HK8A 3CRCA 1TVKA 1DDLA 4Q5OA 2HR3A 2WZPP 5C3RA 1FOD3 1I7FA 4D7YA 2RV9A 1PL4A 2HEWF 2Y48A 4IUGA 4Y24A 1H2KA 1IBMO 1AL22 2WFF2 1IDSA 3LDCA 1OQDA 1MS9A 3LDRA 4AI9A 1RUJ2 3UYJA 5E88A 3ZVXA 2ZHMA 2ZS6B 2D43A 4GLXA 3RJ2X 5KMGA 2R16A 4M01A 4OI2A 1J1LA 1LU1A 4B7EA 4IV1A 1QJY1 5AC91 2B7YA 1IBLO 2NQYA 2JX9A 3ENRA 3VDAA 2LP7A 4R9BA 2ZM6O 4B3SB 4UFLA 5K1PA 1RVF1 4WM8B 2Y64A 1O59A 5KR7A 4JGYC 1OLME 4LF7O 3W7UA 3I59B 4NYKA 1FMD3 2YZ4A 4YG6A 4PDVA 4PLOA 5L3GA 5C8CA 3MO4A 1LHWA 4MUVA 2O1QA 5DECA 1XMOB 1IOAA 4LF6O 3OGCC 4NOTA 1NVPD 3D4KA 5C9AA 3ZS8C 2AREA 2Q68A 1MS3A 2B9UA 4Q8LA 4HN1A 5L7OC 4EN7B 3QO8A 3CNAA 3HKCA 4FXKB 5JQGA 2VWKA 3BODA 1ENSA 2QWOB 2D6MA 5FPXA 4HG6B 1YFWA 4YRDA 5CEHA 2GSYA 1YIJV 3NV2A 3ZRVA 1H2GA 3KF3A 1JZ3A 3ABMC 5EXOA 4INDA 1UD1A 1WPBA 1AR83 4IE0A 4UB8Z 5LMUB 4ASUG 3SPIA 5F9TA 1CPNA 4FVVA 2H0VA 3IFXA 4H13B 4JV4A 2JRIA 1MS4A 2DVBA 2WSUA 2WZEA 1PGW2 2JKXA 3DV8A 3O0VA 4UCRA 4I50A 2VUDA 4GZ9A 5DDJ1 5BNOA 1V54B 4DV5B 1QLEB 5F6KA 2VQEO 3X2QC 3NV1A 1LOFC 1CIWA 1D2DA 3ILRA 1W2OA 4JAVA 5FZ3A 2BNNA 2I07B 4JGZA 4Q0QA 5A1AA 2ZGOA 2ZIOA 1F15A 3OF1A 2VNGA 2SLIA 4M3CA 3QOPA 3WDYA 5FTTC 3AZXA 4P14A 2HWC1 5IT6A 2Y34A 5GLWA 2IJIA 4LBKA 1NY72 2WO7A 4COVA 2C9AA 2DYCA 2Z5UA 4AQYB 4XFBA 4GYCB 4LH6A 3VD4A 5LBEA 3P6BA 1S2BA 3MPPG 3T0AA 1N33O 4U3FH 2BOJA 4MSVA 4XBFA 4OI4A 2KD7A 4ZPIA 3VQXA 1FAYA 1XNTA 1DGWA 1DGRN 1JHJA 3GZTB 2EXJA 3DKQA 3ON7A 2JJ1G 4CCJA 4RFRB 2BV4A 2PI5A 3KVBA 3ZFGB 5FL7G 1QJZA 3K9SA 1K12A 1R1A3 4RQPC 1ZA7A 3N4MA 1AI7A 3CP1A 5GKAC 2PHLA 1DIWA 4PQ9A 1YJLA 3ILFA 1OJHA 3VKNA 4JKKA 1K5QA 1P49A 1DQ2A 1J58A 4Q4W1 3J9SA 2WRAA 3RMYA 2DTYA 1F9KA 5FY7A 1W8WA 2CWSA 4HONA 2J22A 3LA7A 4QGLA 5JSOA 3RN4A 2NMOA 4LBQB 5B1OA 4XC9A 4BQYA 3AYAA 4FFBB 4F6RB 2DUOA 5J37A 5JCOA 1V9U2 4ATFA 2CAVA 3OY8B 3MIHA 3S3WA 1YHQV 5B1NA 1YIFA 5DAPA 4DXWA 5FXWA 1RM1B 4LF6B 2CE4A 4CDUC 1SQFA 5F39A 4UCTA 3CCRV 2P5BA 3DGEA 3R6SA 3M70A 2RJLA 1G1XB 1WW6A 3EBRA 5FXVA 1HDKA 4PDMA 2B4KA 1VBB3 4XF4A 4JI8O 1QH6A 3RVZA 3H3UA 4UCUA 2F23A 4YW5A 3ZSLA 2BRTA 1I5PA 3ZM8A 3PVBB 3NW4A 4P9YA 3N9OA 2IWGB 1VBE1 1QCEA 4PT6A 3B7MA 3WZ1A 1RUJ3 4OUMA 3ZX6A 4HXCA 2G1MA 1U5IA 1JOJA 1SBDA 5H6QA 3WB2A 5EJ3A 5LB6A 4FI9A 3M3CA 1IX9A 1ZL8A 5E89A 3I97A 3CX5F 3VQVA 1XB9A 4TTGA 4Y1YA 1CJPA 1W28A 3DF0A 1YEWA 2R70A 2UU9O 2NP0A 4OPAA 1O4YA 2QDNA 1VPHA 3JD71 3KS7A 1JA8A 3IPVA 1R3JC 2ZGRA 2GDFA 1NTMH 3AKQA 4RL7A 2A5ZA 1F8VA 5A33B 5I8SA 5EPAA 4DV0O 3ZYJB 3WSOA 3NL1A 1UZZA 2DURA 4LFBO 4RA0A 3JB4C 2OXBA 2W1UA 2Q6AA 2CUGA 3QH7A 3VHOA 2HWC3 1AP6A 4M3CE 1CWPA 1V55C 4HKLA 1BEV2 2RN9A 1YRZA 4AGVA 4R8CA 1IG0A 2E7QA 1VP6A 4MGSA 2XJRA 3ZSEA 5DABA 2XAJA 3DECA 3IAYA 5DDJ3 3F5WC 5BNQA 1ZBA1 4XJWA 1ZRFA 3RYCA 1CPYA 2WZR1 3OGRA 1WMDA 1VMHA 4YW1A 5FZEA 1MNGA 2WLLB 1UMHA 1G8WA 4N8MA 3BEHA 4IT5A 2EXKA 2GC1A 4W4LA 5F5CA 1LR1A 3HNYM 1G9AA 2FDIA 1EV13 3CBNA 1UZVA 2WNEA 2OCCC 2EJ7A 1ULOA 2FZ1A 3TB0A 1UOGA 4ZHNA 4HPKB 4QX5A 4UOJA 1R3KC 2FHRA 5GLUA 3BVCA 3QD6A 4UFHA 2BOCC 3W9AA 1JZ2A 3BOWA 1F31A 4QX1A 3JSLA 2DVFA 4W8JA 5A6XA 4AI8A 1XU2A 4NUBA 1OH4A 4B7KA 5C3QA 2OCHA 1SC5B 3LA3A 5C6CA 4MVZA 4JASA 1J83A 4EZ4A 2WLHA 2PLV2 3LSUA 3ZDSA 5A2QN 1EFRG 1SETA 4A7KA 2BBAA 2QZ2A 1MG1A 1S2KA 2CY6A 3VBFB 3OAAG 2VM9A 2D97A 3RYIA 1Q8QA 2VVFA 4GKYA 1X59A 2OYZA 1UU4A 3A7QA 4K8ZA 4JI2B 1G9BA 1AI4A 3DL3A 3L2HA 4C1XA 1VMGA 3L9DA 5FDBA 1NVPB 2VQFB 3TAYA 2CTRA 1G7YA 1YJKA 4CDQC 1RSOA 1KC8W 5LA0A 1MZ5A 3WD5A 2R043 4DV4B 3OD4A 2JDAA 1NCQC 1L7QA 4P9IA 4G27B 3C7OA 4A3XA 3DEMA 2XT9A 4BU2A 4DUXA 1JBCA 4BCUA 4J7JA 2HWF1 3S6PA 3PMEA 1FPN2 2Q8OA 3SISA 2DBNA 3HBZA 1JZ5A 1MQTA 3P5BA 4JGYA 2E9QA 1KB9F 1LOEA 3ZRXA 2MEV1 1SFNA 3WVJA 4L99A 1N32O 3G7DA 3FWEA 1X82A 2ZAHA 1LOAA 1GZCA 3VBBA 4Y5SA 2BJSA 4R4ZA 4Z8BA 5IVJA 2Z69A 1COV1 4QX0A 3ZHSA 3H8XA 3KWVA 4QNHB 3VZJA 4XAAA 5CA1A 3K5LA 1S0BA 5A6ZA 2W2IA 1IBMB 1W2AX 1W9YA 4WFBV 2ZGNA 1RVF2 1R1ZA 2GH2A 1AR4A 4FPLA 1ND2B 1CEZA 4OULA 2EAKA 1JU3A 1EP0A 1SCRA 2ZMKA 2QQPA 4A44A 2HBUA 1ZBA3 2HEPA 5HCAA 4UVCA 4Y3OA 4C8DA 1TUBA 1GN3A 4YW2A 3CC7V 3JATA 4U3JA 2WWUA 2F17A 2YIBD 3IC7A 2C6SA 4X8AA 4I5SA 3K08A 4LMFA 5DAWA 3AM2A 5ITZA 4RQEA 5FZOA 4FPFA 3CC4V 2YBKA 5BR8O 1RC6A 2FCVA 1UMZA 3OEHG 1OLRA 4FLWA 1LB2A 1WWYA 1UPSA 2HKXA 4PDLA 2R061 3OPTA 4GWNA 2EZPA 3U10A 4XABA 4FVMA 5FP3A 3BKZA 4AE2A 5CG8A 4IGOA 4DB5A 1XMQO 4XBQA 4N43B 4LFCO 1CZVA 1YZBA 2RS51 1QJFA 4AVTA 4FP2A 3CCUV 1AILA 1SG3A 1DQ5A 5CKQA 3H01A 1SKVA 2F66C 4GMP1 4J1WA 4QB2A 4YWAA 5A3TA 4CEYA 2D2CB 2YICA 1WMFA 3QVNA 3AK3A 2R49A 1Y74A 2XH6A 5EYYA 3WUCA 2ZACA 1VB4A 1BMFG 3CMGA 4GWMA 5EV7A 1VMFA 3LDBA 2ZMLA 4I50B 1QJX3 2UWAA 3M99B 1YQ2A 2IJHA 2H0BA 2XBO2 1S0FA 1VRBA 1RVF3 4CDQB 5C3OA 2Y69C 1S5LZ 1YDXA 2X7RB 2K0GA 2BQPA 1I9RA 1BZWA 4GX1A 1VBC3 4OUSA 3KZ4C 2IJJA 1UU6A 2Y6JA 3FZ3A 1NLSA 3GBFA 4NIDA 1VQPV 3D8CA 1PVC1 1SQPH 5C5UA 1W9WA 1NQTA 2C2AA 1D4M1 4YW6A 2ARCA 1S77D 4LF4O 4RR3C 3WNOA 2XL9A 1F4MA 1UJWB 1KS4A 2J1RA 4EN8B 2ADDA 4QWNA 2QQNA 3HKDA 1LGBA 4YSFA 4IHJB 2MEV3 2UXDO 4F8AA 4CUGA 1HXS2 4IL6Z 4LIUA 2B42B 2W6IG 2X6CA 2TBVA 4JTOA 1V9PA 4IDZA 4RQPB 4QXKA 3ZFGA 2HWB1 1POV0 1XNDA 3PUQA 2XONA 5EP9A 1M56B 1WBFA 3GF6A 1RUG3 3VBSB 2HEYF 2RR12 4GALA 1JTZX 3ETPA 1W8UA 4JTNA 1C1FA 4GB31 4AQTA 4AAPA 3WP4A 1UIJA 4DUYO 3SPJA 3WQ0A 2IH3C 5BNNB 1GQHA 3QO7A 4X1YB 1THZA 2DYSB 5AC92 4B4PA 1K33A 1NCRC 4AFMA 1GZWB 1TE1B 1VP7A 1FV2A 3WP5A 4CDWC 1Z2GA 1SLCA 4LBQA 3J80N 3ZFFB 4FZ1A 3ZYGA 1GM7A 2IBZH 1W0KG 2A9HA 3H8RA 4P9LA 4BIUA 2AEYA 1ZTEA 3OBTA 3ZSJA 1NU1H 3K0GA 3N27A 2KG7A 4HNAB 2JG9B 4Z1MG 3OPWA 4Q4V1 1RUF2 1SQ4A 4OHVA 3NXSA 5LATA 3VBSA 1CAUB 2VD7A 2X53S 4PBPA 2O0OA 2HP8A 3ZX7A 4MW8A 1GICA 1Q8OA 1SLAA 1RUD2 1XRUA 1UQXA 4CDWB 3U4SA 3JAWB 4Q4Y2 1H4HA 2ORZA 2R071 4DO0A 4QDRA 2R1BA 1JJ2U 4LFAO 1NTKH 3M3OA 3RVHA 3SQOA 4Q4V3 1RUC3 2ZX2A 3CC2V 4JI0O 3MV11 1Y9MA 4JYBA 3HN1A 1FATA 4W6WA 1SA0B 5GW7A 3TOJA 1BCXA 3JBG1 2F93B 2FCUA 2VW0A 3MHHC 5LOVB 2ZKOA 4S2DA 1NA1A 5FBZA 4LOSA 1XNRO 2GDSA 1MEC2 2DQ3A 2BBVA 4YZ2A 3PUHA 4NHKA 2ERFA 1HXS3 2XPJA 1F7YA 3KG2A 3QH6A 4JI6B 4AI0A 3K9AA 3I2JA 1PL0A 2XUMA 3NJYA 4FOYA 1TEIA 1DG6A 1BEV1 1G9CA 1DF4A 1W99A 3D82A 4K21A 3GCWA 1GQGA 4X8PA 5A7SA 2PYLA 3B69A 2KA3A 1K42A 1SQQH 4JV5O 1UL9A 3LF7A 1LNQA 5K0UB 3B02A 1QY4A 1LOFA 5D5PA 4CDXB 5E1AC 2E63A 4PA4A 5KAFZ 4YGBA 4Q4V2 3ZFEB 5L3CA 5EZYB 4HMZA 4RAIA 2W1SA 3JASA 5HV0A 2XVKA 3W20A 5FXZA 1DYPA 2RS52 1N4CA 2AW9A 2FDGA 3PN1A 1U12A 3WT3A 4J9ZB 4WVVA 2DWEC 3JARA 2SBAA 3VL9A 4UCVA 4LTAA 4X65O 4CH5A 4HBNA 3MV01 1IURA 3DYPA 4QXHA 3AB0A 5F5QA 3ZKYA 3O1PA 4E27A 1YQ5A 2QJ1A 5H9RA 1KDKA 5G04L 5KXBA 3ZHQA 1F5FA 4U7OA 5JI7A 2PAEA 3C3VA 2Z2SB 5FPAA 4QHBA 2UUCB 3OGSA 3VLBB 4I0AA 4TV9B 3ZXDA 3UO3A 5LA9A 3OB8A 4A7ZA 2AGSA 3TEZA 4O4LA 4CVUA 5BMVB 4OZOA 2EVXA 1UW8A 1LUWA 4LP8A 4X9QA 2Q30A 2BTQB 2B39A 2ZR3A 2FCTA 3DGTA 4FT8A 3USSA 4ASLA 4MSWC 2XJPA 1GSLA 3EJKA 4NROA 5L36A 1YFUA 1GNHA 5FYZA 3FMGA 2WSSG 1TQ5A 2QUOA 1W06A 3D3AA 3M3QA 1V6NA 5TSWA 4GX5A 1J3PA 1VALA 4XETA 1HP8A 4CEWC 2UUBO 4UW3A 4CUBA 5IVBA 3OG2A 4MVUA 2GNDA 2VZ1A 2ZXWC 4O2BA 4K3UA 4M3CF 5BMVA 5BR8B 2UXBO 5JMOA 1OSGA 5LY2A 1DLLA 4IEZA 1YUDA 4X89A 3WG1A 4B29A 4RYDA 3IDCB 4NPMA 3KLSA 1JQ0A 5FPUA 2V1DA 1Z7S3 1C8NA 4K0KB 1XMQB 2UU9B 1ASJ2 1W2BU 3CEWA 1AVBA 5L73A 2W68A 1HIXA 2VVDA 2N7GA 4DR5O 2YXYA 4HVRA 3SMHA 2AHYA 2W91A 3V65A 4FMTA 3Q8CA 4RS5C 3FFQA 2XB6C 2CH7B 1JYIA 4JKMA 5BY5A 3AEIA 5FZHA 2IXCA 1CAUA 2RE9A 5CB4B 3VGIA 5CB4A 1RSOB 3FYIB 4XF1A 4B3NA 4XF3A 3IC9A 2WZ8A 2GNMA 3ZMZA 2JJ2G 1VR3A 2GMMA 1I5XA 3UCSC 3VQYA 2D44A 3U07A 2E31A 2ARBA 3E1F1 5E79Z 5JOYA 1V9U3 1UOJA 2VTFA 3OGIB 3LDDA 5IVVA 5FLHA 1HB4A 4V2VA 4OGQB 5IJ9B 1ZA4A 1O9HA 2QE3A 3BIEA 2PMWB 3CMAV 1V55B 3JD0A 3VV1A 5JDBA 1K3EA 3E5UA 3STLC 1RUG1 3Q8FA 5M0TA 5F2VO 4EV0A 4KP4A 3H1WA 3CRRA 2A6WA 4M4RA 1YXWA 5CA1B 1GTOA 3KGZA 2G4IA 3GVMA 4LHKA 3LIGA 1DLBA 4JF3A 3VD9A 4AXOA 3O7OA 1V00A 1PIV2 1R3LC 2PI4A 1UYYA 4LF8B 5F2WA 4LK7A 4FSJA 4DV6O 1SHWB 2ETNA 2F4VB 1BBT3 3U78A 3ZMUA 3ZYBA 3K5NA 1HJFA 5LHIA 3ASIA 3S7EA 5LK5A 5LMNO 4C0HA 2XASA 2QFEA 4ET7A 3F7YC 3BCWA 2E5LO 1HNZB 2B8MA 1C8M2 5JCOC 4JKLA 3UT5B 2R0FA 1GZ9A 4BWOA 3FUQA 2Q69A 4HLTA 3T1HO 4LITA 1ZLZA 4AGGA 3BA8A 5FKCA 3A0HZ 2XVGA 5FIXA 4D7TA 4LHNA 5EK0A 4FP3A 4KWJA 4YZ1A 2QQJA 3BTZA 2ZZQA 5C33A 4CU7A 1E1RG 1AX2A 3G80A 1JS9A 4QX7A 2VCAA 5J9PC 5E8AA 1WPXA 4QB6A 3RSJA 1J1TA 1OUXA 1MPXA 2YSUB 1VQLV 4TYSA 4P2ZA 3CIHA 1LULA 4IEPA 2UXCB 3NNJA 1FFTB 1LEDA 2Z0AA 2JDMA 1GWLA 2JIGA 1T5EA 4NHLA 3OW2U 1H2MA 5IAXA 4XDLA 3TN91 4YJ3A 3S30A 2BEOA 2OX0A 2DBIA 2ZNJA 3DXRA 3FLTA 2M6YA 2GUZB 3FC0A 1I5YA 4ZXKA 1PZ8A 4GA9A 1K4DC 4URTA 3VZMA 2D5FA 3S5QA 1Z78A 4DV5O 1PO22 2EA7A 1BQZA 4LIVA 4WVMB 3RWNA 4IIJA 1URFA 1DYKA 5CKNA 5IK4A 4FLZA 4LKEA 5I91A 3H3LA 2WLKA 3N2KA 1ZBE2 1W2NA 5C9AB 4OPHA 4JHZA 2VPVA 3HQXA 1VF6C 4CDXC 3W5NA 2CNAA 1QEXA 4N7UA 2EZOA 1K9MW 3OSDA 4L11A 3CCEV 4GWIA 3ZYHA 2VW2A 3DPRA 4FTSA 1Z0HA 3AG2C 5JSRA 2PHTA 4F6EA 2LW7A 5H9PA 2JG9A 3CEIA 5FZKA 2W52A 5IK7A 4QX8A 3URFA 3ZHRA 2Q8VA 1AYM3 3EHKA 4D6SA 4HKOA 4XHXA 3RZHA 1O8PA 1HB3A 2YXSA 3CKHA 3E22B 4KFMA 1Q8SA 1W2TA 4FOVA 2PZSA 4BJ0A 2W95A 3E2EA 4JAUA 3I3QA 2GC0A 2EXIA 3SYPA 3HKEA 1ZWIC 4LNUB 1CX4A 2VUJA 5EYPA 2DE0X 5FP7A 2CAUA 2Q8DA 3SNMA 3JXSA 1W0NA 1NZ6A 1QR8A 4Q4W2 1IS3A 1EY2A 4WFAV 5LP6A 4NTWA 2Y26A 1COV3 2JENA 5HFMA 2XLGA 3NKGA 3VUOA 1W59A 2J1TA 2VTXA 5FPBA 1PK6A 4DQAA 1X50A 1US6A 3B00A 1X36A 5JPMB 3POEA 4ZS3A 4D94A 1YTFD 2BPA2 2JDHA 1F4HA 4IHJA 2VOKA 1XMOO 5LMNB 1SLBA 4X1YA 4R8HA 4QPJA 3AG4C 5DPNA 1W9FA 4RR3B 1AR71 4FIPC 3STZC 4X62B 3GB7C 1TUEB 3VDDA 3POSA 1H1AA 2P4KA 2IUWA 2W1WA 4AEKA 1ZRRA 3LQCA 2OW4A 2EIJB 4BW5A 4KI5M 3H9VA 1PO23 4BOWA 2PTMA 2DQ0A 3G71V 3J8F3 2P3IA 3JAKA 4CP1A 4DXTA 2QWPB 2GV9A 1DGRA 1QGLA 1WA8A 3POFA 1RHI2 3ZR6A 3G6BA 1BQ0A 4NE9A 4RS5B 5FJKA 1SZBA 4O4IB 3SCHA 4LBMA 4DFSA 4QPKA 1IPSA 1OQEA 4NN0A 4UW4A 4JDNA 3WHTA 3Q9OA 4D7SA 3HD8B 4JGYB 1Q8VA 3A21A 1NCQB 3ABLC 3ABKC 4PIXA 5LBCA 3DXTA 2ADEA 4NB5A 3DPRC 2YIBA 1PIV1 4FM1A 2VGDA 2IW5A 2NLRA 1W6PB 4OQ9A 5LYJB 3CXCU 1ND3B 2LROA 4WM7A 3WDUA 4CSWA 5T5PA 5JMCA 4FFFA 4FZ0A 2UY8A 5BZBA 2P90A 4COYA 2J7MA 2ATKC 4EZHA 1CESA 2QKDA 3WW1A 2ARAA 4DZGA 1YJNV 2VULA 2XJUA 3LSSA 2JXAA 5FYUA 5K9YA 4JI5B 5IJRA 2JDIG 1KFXL 1HQWA 5FO9B 3MZHA 4UV9A 1GAXA 5D5QA 4X20B 4X66O 1HNZO 3A8TA 5FK8A 2RHPA 3LEIA 1QOTA 1UN1A 2A6ZA 3FKSG 3A0KA 5LGTA 3SYQA 3T1HB 4IETA 1HQLA 1YI7A 3H1HH 1K5SA 4EYUA 3OMIB 2WDBA 1HB2A 4J9YB 2R30A 3SYAA 3HT1A 3RZJA 2VQ0A 3MEPA 2XOMA 3MHZA 3NNMA 1VF6A 5FP4A 2IC1A 1O9GA 2YXHA 1RHI3 3BOPA 4LBOA 4AQSA 3GJAA 2YI9A 4FPPA 2VMIA 2JKBA 4QQOA 4PDWA 5JQGB 1SPPA 2F43G 1OH3A 3BPZA 3DC6A 3ABTA 1RUH2 2JICA 5FYIA 4G3YC 1OCRC 1YCIA 4JQTA 1WMEA 3UKTA 2RS32 4JI1O 5IW0A 1LR5A 2BVBA 2E7AA 1TG7A 1MS8A 4TV9A 1AI5A 1CONA 4AHCA 4FPGA 3ES4A 3FLRA 3K3WA 3AL5A 3E97A 2DMXA 3T0DA 4J11A 4FLUA 5J1XA 1PVXA 2WZR3 4J7ZA 1RUD3 4OMDA 1O91A 4X66B 3VBHB 5FZ7A 2AC1A 3DYOA 4DW0A 1KP2A 3J7NA 3M8LA 1NLRA 3AZZA 4SBVA 1IXMA 1CD3G 1S0GA 1US3A 4CU9A 1FD9A 1OI6A 3THDA 1K5MA 2QQWA 4Z2AA 1VBD2 2Y69B 1A8MA 2JB8A 2CK3G 4JZ2A 1TMF2 4WVWA 5JVDA 3WCSA 2YGLA 4EWDA 2P67A 1FMD1 3GWOA 4OLLA 4KUMA 3GBGA 1J3QA 1RUH3 1OVSA 5AG2A 2NN4A 2BTQA 2WS92 5GTIZ 1ZZBA 1XSQA 1L8DA 4JI0B 4LC1A 3O5SA 3ZDVA 5IATA 3C7FA 4LQRA 4GH4B 4YYOA 3AP9A 4J25A 3AP5A 2IXKA 4XDJA 2IM9A 1N1VA 1CAWB 1GANA 3RQ0A 3N2GA 3BIWE 1OCZC 4CC5A 5KUKA 1VE0A 4L2NA 3ME2A 4S2GA 1S76D 5IT9N 2FZ2A 3I3EA 2ZE8A 4ZU5A 2ZDIA 3ECQA 1B06A 1QXPA 3MLLA 5ACA2 3PU3A 1SRYA 3TJTA 2WAMA 1CJDA 5HV4A 1BJQA 3WLUA 5FPLA 2DYRC 1VQMV 4I55A 1G86A 2RS12 3B3QE 3HN3A 3TEXA 4QHZA 1LOGA 2XG3A 1XOUA 4LCUC 3PJYA 5DDJ2 4A4AA 4MXVA 2C24A 5KHKA 4O65A 2PLV3 3WG7B 4E4HA 5A9GA 5K0UA 2B5HA 1G8MA 2PYJA 1OXCA 3CSXA 2XQXA 4FOQA 1GBGA 4ORFA 2WWJA 3WNKA 1SBFA 5FY8A 2JG8B 3KV5A 2EILB 3L72H 4TQFA 1H8TC 2PHDA 1VRH2 4LBJA 2E7TA 4U36A 3JU9A 4MGTA 1KECA 1STMA 3L75H 2BVVA 3UKMA 4PHZA 5JXGA 1R1A2 1WB7A 4K8FA 2YY1A 4OFGA 4XJAA 5IY5B 4QD2A 2ODMA 1H8TA 3IIAA 2VVEA 3RWKX 1Y7BA 2P4VA 1IHMA 5T50A 1ULFA 4XUPA 3R05A 2WS93 1ZRDA 1C4RA 2EALA 4OHXA 2V09A 4YJ3B 2YU1A 4PIYA 3PLQA 2HHHB 4W50A 3MDPA 2ZTNA 5CFDA 3G6JB 3B2EE 4K35A 3ICXA 4QHOA 3DC5A 4FLVA 1EZJA 1JZ8A 4FPHA 2WQZC 2RJZA 4Q29A 4BIFA 1O3RA 4TUYB 4PDWC 4MX3A 5FMOL 3W5MA 3ZSMA 3AZWA 5FXXA 1QJU1 4CBCA 2D3RA 4QU2A 2PFWA 1OA3A 1JZ6A 3UL2A 1WW5A 2XJQA 1AROP 2ET7A 2ZHLA 2YC2A 3HPNA 1AR61 1QXJA 3VBOC 2B9ZA 2LJ2A 5EYPB 4EJRA 3S57A 1EPZA 1RPRA 2OUHA 3PHMA 3ZFEA 4O4HA 1OZ0A 1FXVA 1DLCA 1J5EO 4EN0A 1A8DA 1KU9A 1SFYA 5C71A 2QDRA 1AXYA 4DR3O 1KMIZ 4ASKA 3K75B 3NNLA 2YI8A 4JYYA 3JD72 4PF5A 3FLPA 1X8EA 4AHZA 2ILMA 4I0BA 2RDSA 1HWYA 2VZUA 3FAVA 4GH4C 2VW1A 3ZRWA 4WVMA 1URXA 2RM22 4CZZA 1LODA 2H94A 1AYM2 4CXXA 4YVWA 5FYVA 1R64A 2QM4A 4DUVA 1JUHA 3G67A 3LA2A 5SV5A 3L73H 3GDBA 4LF8O 2Y6LA 5L3DA 1ND3C 5DG1A 5FK7A 4DEQA 5ANNA 5EZWA 4QXCA 3JCUZ 1OCRB 1DYOA 2CGOA 3CPWU 1AYN1 2UWCA 2FYUH 4GX2A 5JJNB 3E22A 1I3HA 1AYN3 2XNDG 1G9DA 1XYOA 1C1LA 2D6KA 3THPA 1IKPA 5ISLA 4AOCA 1RL3A 1H8VA 4C90A 5J2TB 2LS6A 2VCCA 2BGCA 5KMGB 3K58A 4QPYA 3C3SA 1BBT1 5FV3A 4YW4A 3RZZA 3IGAC 4WM7C 1I08A 4M00A 4RN5A 1C28A 4FPYA 4BE3A 5KHGA 1SCSA 4Q4Y3 1JU4A 1PZ9A 3A22A 3AG3C 4FCAA 4CXYA 4RHV2 4UI9L 4NTXA 4IEUA 4MYEA 2OPKA 3VZLA 1LHOA 2C4XA 2ARHA 3FBMA 5F7UA 5H9CA 2KKWA 5A70A 4XCAA 4LKSA 2Z4FA 1J59A 1GU3A 4J1XA 1AR81 2ZABA 3BN6A 3PTRB 1YC61 5CA6A 3H3ZA 2A73B 1Y66A 3H50A 4LHLA 2WFF1 2BGPA 3IMNA 2WA3A 5H2FZ 3ZXEA 2VQUA 3JALA 1X4TA 4XJ8A 2OIEA 3TN92 4MXWA 1Y3TA 2RS13 3SLIA 2ZE5A 5A3MA 3H1MA 4X64B 4XDKA 4J10A 1WA8B 4OX9O 4QDQA 4KBZA 2A1XA 5L9VA 4XXAA 3JZVA 1VMJA 3ZPOA 4TUYA 5J2UA 5CISA 4YPJA 3ABZA 4JI4O 3T4VA 4P08A 1GWKA 2IJKA 4GJZA 4P9PA 4Y1ZA 2JS5A 1MABG 1MSWD 2AENA 5F3IA 3AK2A 1GZTA 1N3PA 4DMIA 5CFCA 3GJBA 4AI3A 1N1TA 1JODA 4TLFA 5CADA 3JD3A 3Q8AA 3CCVV 3VBUB 4X20A 2D6NA 4I30A 1V6IA 2PHXA 4RGAA 5LGNA 1L1FA 1NTZH 4IEYA 4JTAB 2PY5A 3MHSC 4B1LA 4CCOA 2R9RB 3WB1A 3KV6A 4YM2A 1A6CA 3F2ZA 5JR2A 5FWEA 5KUMA 1FAFA 1RUH1 5T5LA 4BQ3A 1PMJX 2LGQA 1Q56A 2UYAA 1NKDA 1OT5A 1GWMA 3FHAA 3RYRA 1B35C 3WU2Z 2VWJA 3ML0A 1JOPA 3UGHA 1XXNA 4UFIA 3GM8A 2AHZA 1ROPA 3FB8C 5K7PA 3QCWA 2BFUS 4CU6A 1WZXA 3VBUA 5FBJA 1FXZA 1H8HG 2NM1A 4QPIC 3ZYPA 4NPRA 2W46A 2R32A 1S4CA 1V6JA 2XWJB 4KMQA 2RNBA 3AG1B 3LIHA 1RUC2 5EBLC 1Y67A 3I4IA 5KXCA 5DEDA 2CSGA 3T30A 2DYSC 3ZN6A 4XFHA 4JI7B 2ATFA 1D5NA 3LWCA 4ZS2A 4QQHA 3CD6V 1N33B 1GYKA 4UCSA 1GV9A 4SLIA 4IESA 4UAPA 3NV3A 4XILA 1FOD1 4Q20A 1VAKA 4LA2A 2YFZA 4YM0A 3TEWA 3Q4HA 5GONB 5GONA 3Q4HB 5JXIA 5FPRA 2OTJV 2GH8A 4YFWA 4DRRA 2K1EA 1AR72 5BNOB 1PD3A 1EM1A 1OV9A 2VXRA 5HXVA 4GWJA 2XAGA 2QQIA 1NOVA 3SCGA 2YEVA 2ZIMA 5FQ0A 5CIRA 4XBNA 3ZN6B 4YNIA 2GTSA 4RUFA 3O0XA 2Q4SA 4CPBD 4EB6A 1DQ6A 3OBAA 4K20A 4MGKE 3FJSA 3CZJA 1VF7A 3KM5A 5LBBA 4ISQA 1QQP3 1HN0A 1N47A 1TMF3 1U5YA 1M06G 4XACA 5FZ1A 2KQXA 1MVQA 5CMUA 3JYCA 1VBA2 2QBXA 3SJBC 3J4UH 1YYNA 4NVPA 3ACHA 5DAXA 3IDEA 2XAHA 2ADQB 1UOFA 1NY71 2V73A 3EXAA 1KEXA 3PVEA 2GSMB 1VAMA 1YVWA 4TLGA 4XDQA 2ZX4A 1OCOC 1QNWA 5F1RA 3ZXGA 1MZEA 1R73A 5KWRA 1LUVA 4IV3A 1UYPA 2CDOA 2RQ6A 1O7FA 4QKBA 1QOOA 1VARA 5D8AB 3PUSA 4DV3B 2JDKA 5H9SA 4XQWA 3W58A 3S7IA 1XL4A 4AAXA 2WLJA 2A6XA 2CAZC 1FOD2 4D8MA 1WA6X 4HOOA 4AI2A 2P2KA 1POQA 3AJYA 4MTGA 1LTEA 3PTYA 2YROA 3TNQA 3SJQC 3GHMA 1W3VA 4JPRA 1IQDC 2ZE6A 2RS31 5FMDA 3C7GA 4CU8A 1HW7A 5HCBA 3FL7A 2XL7A 1DGLA 3ETGA 1RITA 2Q7GA 5CYYA 2QNKA 3VBHC 4E2QA 4B4RA 2HBTA 3ZFGC 3K77A 3SPHA 3ZN0A 2XAQA 3K79A 1PVC2 4E9KA 4FO9A 1LHVA 5B1AC 2OIGA 5JR7B 3WF2A 5BNNC 5L7OB 1BEV3 3CDZB 4AFBA 1IGOA 1C8M3 4MVSA 3ZYIB 3WP6A 2XAFA 1I94O 1E79G 4MS2A 3DTUB 1AL23 3S5AA 4AEJA 1GR3A 3S0MA 3O1MA 5FUPA 3SEPA 2P5OA 5EBWC 3DXUA 2K9PA 4Q0PA 2VXJA 4LKDA 3EFFK 5DN6G 5A7WA 3E5XA 4ITCA 1CGPA 3NJZA 4ZXEA 5FNVA 5GALA 5IK8A 3BALA 4Q4X1 5BXZA 5IYCO 3IWZA 2MPFA 3QF7A 3TEYA 3P32A 1W2UA 2WO1A 4Q4Y1 4C0BA 3T1CA 3AYCA 1AR62 1GKFA 1HLCA 2ZGQA 2JJ6A 4PF1A 1Q82W 1S0CA 3A4UA 1H38A 1RUI3 3T4DA 5CA0A 3OR7C 2ZHKA 3RYHB 1Q43A 3VBFA 1FXKB 1N1SA 5CBFA 3G6EV 5A32B 4U7NA 4MVRA 1JFFA 1M57C 2W1QA 1UXXX 2JDZA 3H1KH 4DR5B 3K51A 2L35A 1OFNA 4NRQA 1RUF1 4R52A 4P9GA 5EYXA 3BYWA 5CU1A 5HCHA 4J42A 4YG0A 4BQWA 3HPLC 3BB6A 4EE2A 5FCCA 2VBDA 4JI3O 1IPKA 5E6HA 1SZXA 4G28B 1XHXA 1W8TA 1O5LA 4LORA 2R072 5FZ8A 2Q73A 3ZRWB 4I4TA 4IV1C 4ISRA 1ZRCA 3HWJA 3D36A 3LKJA 1C3HA 2GC3A 2QTWB 1ZZ9A 3ZMTA 1RUE3 3LEKA 3M7AA 2VQFO 1Y76A 3VHRA 3K5MA 5I0RA 4AI1A 3PJQA 4YW3A 2VUAA 3O1RA 1KBHA 1UYXA 2VMGA 4E4EA 1FPN3 3BUCA 4FM2A 1VLNA 5DG2A 1F23A 1XEQA 2HJFC 2HWE2 4MTFA 1W6QA 1W6QB 1M4WA 2JB4A 4Q26A 1RUJ1 4LJHA 5LA6A 3ABLB 1M9NA 2WWSA 2VNOA 4X1IB 3CCMV 1COV2 1AP5A 4OYUA 2GN3A 5FLJA 1NE4A 3D3QA 5J7MA 2ET1A 1CN1A 2OVUA 2DVDA 4CA9A 3N2GB 3HB3B 3FHIB 3WQ7A 2FMDA 2PLV1 1XQ8A 3K4AA 4NIGA 3VDDB 2JG8C 3IJ4A 3CF6E 1DGSA 1BZKA 2XQRA 3AG4B 3AX4A 2AZ2A 3L71H 2W5FA 1BCCH 2WN2A 2JD4A 2WNUC 2IFWA 3ACIA 1BKZA 4WFGA 2UXDB 4Y33A 5GTHZ 2OQ7A 5A6QA 3AVSA 4BLIA 1RUI1 1Z5WA 3IM0A 3R0RA 1H8TB 1KP3A 1NX9A 5ABJC 1W9SA 4HVOA 1WP7A 1WKYA 4B3MO 5C5TA 1QR9A 2W87A 4MGIE 4D3WA 1GMGA 4QKNA 2BNMA 3WQ1A 4COWA 1UIKA 1O8SA 3LSDA 5FRAA 2AZ0A 2YYOA 5C3SA 3AK0A 2XJSA 2ZEXA 3AYEA 2FDKA 3JATB 2R062 1AR93 1EN6A 2Y38A 2XTAA 3TRSB 1T2XA 4L8JA 3LOBA 1MS1A 4FFHA 4IV3B 4GKKO 5KAIZ 3LPGA 1K73W 4NMIA 3KHCA 3VBRC 4FAHA 4Y4YA 2Q67A 2HWE3 1NKGA 2EF6A 4OCTA 5IWFA 4HT1T 3BHPA 2EBOA 1RHI1 3V64A 3FBYA 2QQKA 1PMIA 4K0KO 1XPWA 1SZTA 3NJVA 3VKMA 2B1GA 1WMXA 2JVDA 4QQLA 3D0JA 4PA3A 4ARXA 2Y4TA 3ZIWA 4X62O 4O2AB 1S0IA 4R9CA 5HFLA 2YG0A 4XF0A 2BOBC 3B77A 4BXSV 1W6PA 1NH2D 3RBZA 5CBLA 1QJX2 2V5DA 4BK4A 4EWAA 1FS0G 2XR4A 2LO1A 5B1BB 1WP8A 3JUUA 3D36C 2A3WA 5FPVA 1W0JG 1VQ5V 1V54C 4YVWC 4QKDA 2VE1A 1OKOA 1AX1A 3QACA 5JIUA 2QDOA 4DV1B 4MVOA 4AEDB 4PJ0Z 4E8CA 5GLTA 4LBNA 3H9AA 1ENQA 1GN4A 2I74A 4DXRA 2C9KA 3IB3A 2PQSA 1ENVA 4ICGA 3VKOA 3ALQA 1YSCA 4PLMA 2B45X 1NE6A 2OWOA 5FYTA 2F1MA 3OT7A 4C7UA 2H6BA 3MGUA 1GOHA 3MIBA 2EINB 4P9OA 2CU5A 4ZU4A 2XOKG 3U4XA 2XHNA 2GP3A 3SR2C 1OC1A 3PJSK 3RYIB 5FUNA 3I2HA 5AFEA 3B8NA 4OZXA 5FZBA 3R4SA 3VDCA 3T4ZA 2VMFA 4PA6A 2ZZJA 1D4M2 1QBZA 1IG3A 2FBEA 4Q0VA 5LWBA 5CNAA 1JR9A 1W6MB 2ZXWB 1YQ6A 3DXRB 1XUQA 1QWRA 2VBPA 1QU0A 3PIGA 1JHNA 2LRPA 4HETA 1K97A 2M7WA 3AL6A 3GZEA 2EIGA 1GK9A 3O1TA 2VS0A 1RUE2 2GNTA 5EFUA 1S72V 3E86A 1UPGA 3E8GA 3OMAB 1CAXA 3LCPA 1W8NA 5EJ1B 2XBO3 2VCBA 3PVNA 3CB2A 3B09A 5FLIA 4JI7O 3PDQA 3CU7A 2NZ9A 4CP9A 3CE2A 3VBHA 2Y0OA 1CZTA 2DF7A 4XJZA 1BMV2 1S5JA 1FNYA 5CFDC 1Z7S2 3Q8EA 2OS2A 4Y20B 4BISA 4GIQA 1HRV3 2VL4A 3C7HA 2XLAA 3N9NA 3BVOA 4ZZ8A 3ZIXA 2HG5C 5D8AA 2BSKB 1HR0B 4EN9B 5LW9A 3K3NA 3SH4A 1VBC1 1KDMA 1XI1A 1Q90D 2ENRA 4MTOA 2Q1FA 5KLVH 3M7MX 1PM7A 3VZKA 3FHQA 1I0HA 1TMF1 3B93A 3MICA 1ND2A 5C7GA 2PGGA 4H0LB 4XJUA 4QMAA 3NNFA 2JECA 3ZN4A 1MZFA 4P5YA 5FZ9A 1FNZA 1P7BA 1NYWA 4DR1O 5FJHA 1XE0A 4E4DX 1BT8A 4KQ7A 4CPBA 2XWBB 3E35A 1QHDA 5HCFA 2D3PA 5K0UC 1JYNA 3L9JT 1DZRA 4TT3G 2OTLV 3NV4A 3PUAA 2ZX1A 4IGQA 3VBRB 1XNRB 4GULA 5CAZA 4D69A 3NJXA 2QTOA 3ST7A 4YLZA 4CCNA 1R1BA 2WLIB 4HVQA 1MEC1 4MVQA 3OD0A 4AFAA 4DR7O 4LO4B 1LEMA 5DUVA 2WLMA 4PELA 3SJCC 4BMEA 5LK7B 4IE5A 1PNLA 1Y9QA 4UXAA 4H7MA 5L3EA 5CB7A 5C93A 4KNCA 3M1HA 1Q8IA 5GLZA 3WDTA 2QR4A 2FB5A 2TUNA 3RZMA 1JW6A 4KHPO 2UXBB 4NHYA 1OVPA 4BM8A 2X6BA 2A75A 1DZQA 1NA1B 2LW1A 1K5MC 3PMSA 4XFGA 1VJ2A 4XPVA 4QPWA 3P1IA 2BERA 2DU0A 4GKKB 3RNSA 1AHSA 3OGGA 4H14A 5A3WA 3IAQA 4A5UB 4ZI7B 1RGSA 3RYPA 4JYAB 3MYXA 5BNPC 1ND2C 1KRIA 4N53C 1QU7A 4XUNA 2IFRA 2MK3A 4BIZA 5E1RA 5CBHA 4AEDA 2PELA 2Z3YA 1QJX1 3CCLV 1GP6A 1NS1A 4Z82A 2ZBJA 2HHHO 2DW4A 3A0RA 4OX9B 4XF9A 2PAMA 5T54A 2VTXJ 1ZZCA 1SA0A 4XAEA 4LO8A 3FX7A 2QWRB 1UYZA 2XJTA 1TGOA 1HKDA 2HJDA 2EICA 2IXIA 3OYWB 3VDDC 1IS4A 1MQTC 2YDEA 4DUZO 4LFCB 2GP5A 4A41A 3ZN1A 1N34B 2ZGTA 1MR5A 2D6OX 1XSRA 3ZHVA 2QCSB 1V6KA 3E5QA 4D0QA 1VB2A 2ARXA 4A2UA 2BTVC 2VZ3A 5AFBA 5FY9A 4COUA 2VBBA 4GB33 4H3WA 1S3JA 2YV8A 4K7JA 1H6YA 3T1MA 4AVAA 3N7MA 5A80A 4GKJO 2CYFA 1UNBA 3ACLA 2WSVA 3K59A 3CO2A 1RP3B 5J3UA 3HKEB 4GX0A 5T5OA 3KCCA 2HWF2 1FXKA 4JVAA 1DHKB 5A3OA 2XJVA 1N1YA 2P6JA 1D4VB 4CDQA 4HANA 4XQ4A 4NIAA 4KU8A 3T2PA 2X8KA 1XNKA 1AJQA 3GBWA 4LF5O 4DV7O 1TAEA 1JMKC 3O12A 4GCZA 3CL1A 3KT1A 4TQDA 3J8F1 1SQGA 4NXMB 4J6GA 3H1YA 2CH7A 4Z1VA 3MW2A 4AVBA 2R041 3T4HB 3FX3A 2Z79A 3B9IA 3SDLA 2F4VO 1AR73 5L9RA 1PV0A 1PGL2 3UKNA 1GMMA 1EAH1 2JGDA 2CGNA 2JGUA 3I2FA 1CZSA 3KV9A 1E5HA 1PNMA 2F95B 5IHRA 4GH4A 1VRH3 1ULDA 2C5DA 1SQXH 1ZZ8A 2D98A 5TISZ 2P1BA 1SACA 3K2OA 3C90A 1ULGA 3E83A 3CCJV 1I94B 4RQPA 4CS2A 4N90A 3WG7C 1YF2A 1WN7A 1K3IA 2WNVA 3SH5A 3MIGA 1G6UA 2HEVF 1PO12 3OGVA 1U97A 4N53A 2A71A 2AGAA 4Q4W3 3JAWA 1AB3A 3CMEV 4AVSA 1O4ZA 2UUAB 1S5HC 3WNMA 5BYNA 2JWPA 1GO3F 4IE7A 5FZAA 2LM3A 3I54A 2UXNA 4CDUA 4DUWA 3BABA 2UUBB 4HNAA 1AR82 2YGMA 3V0BB 1L0LH 3OEEG 1LCLA 2BWAA 1RMU3 4JV5B 3OY8A 5DAQA 4TN7A 3MFCA 1E5RA 1DK1A 3ZJZA 3ZXKA 4B3TO 3B8MA 3FB5C 2HWF3 3LB9A 5IE9A 2DDUA 2IU0A 5C8CB 3B40A 4UBGA 4X1KB 3KGLA 1DFQA 4NRMA 2UUCO 4XUQA 3AP7A 5IY5C 3U14A 2DVGA 4A7YA 2W9XA 3USUA 5LA1A 1K45A 4JI1B 1V70A 4Y22B 4FPJA 1K34A 1IBKO 1PO13 1QNYA 2P6CA 4PI0A 1XOYA 3ES1A 3W59A 1VBD1 2UURA 4LLFA 2RM23 1YI9A 4B1MA 1KJLA 4M0NA 3B4SA 4P30A 1Q6UA 1KQRA 4KG8A 4QB1A 2JDUA 4LBEC 3VDBA 1XHZA 1K4CC 5C8WA 2Z42A 1VBE2 4MTXA 3N3HA 3HNMA 2D6LX 3WW2A 1D0GA 1JYWA 5LCWL 5FZOB 1NI8A 3OUHA 3F95A 1H2LA 2J1SA 3I3MA 1DBNA 2O14A 3H42B 5AVAA 4N7IA 4UFZA 1MS0A 2DYRB 2Q9LA 2P17A 1TNFA 5IDJA 4K6BA 3CLPA 4DO2A 1OOPC 1CR7A 1TZOA 2QE7G 5KHHA 4WM8A 4Q0SA 4IXLA 4CEWA 2P06A 4NO4A 3ZIAG 5LL6Y 5FY1A 4Y5TA 2BP6A 3OCPA 5HI0A 3L2YA 4PD4F 5KA6A 4P02B 5IWAO 5IYYA 3U37A 5KXEA 3K06A 1H2NA 1WLDA 2OIIA 3RPQA 3M4FA 5GZEA 4TXWA 3BY6A 1LOCA 4PBOA 4XIOA 4OHYA 2DN9A 2ZJCA 4G4FA 1C5IA 1RMU1 3N7LA 1VQ4V 3UM7A 3LUTB 4YVWB 1W6NA 1ALYA 4META 3LEMA 2UYBA 3I8TA 5LRSA 2A3YA 5CA3A 1W0OA 4XVHA 4FTBA 3I49A 1SEFA 3T2OA 1QVGU 1VBB2 2RR13 1X9TA 1UY0A 2Q0OC 3KV4A 1XU1A 5IYBO 5FQ0B 4LXLA 4IW3A 4QAWA 2OQ6A 2P6HA 4BW9A 1Q86W 1QLNA 3ORJA 1YIPA 3KSCA 2EAAA 4TV8A 3TK1A 1P8JA 1UXZA 4TV8B 4GQ7A 5KX5A 1FXKC 3ZO0B 1SLTA 2XHKA 4YGDA 4YZ4A 3I2OA 1NT2B 4ASMB 5JVVA 2VZPA 2O8QA 1ULCA 4J80A 4RQFA 1AR91 3MD0A 4K8RB 1J95A 3CHXA 1IPJA 4FJCC 1XDCA 5IJ9A 3SYCA 2ZHNA 1NT0A 1QDCA 2QZ3A 1AJKA 3FE5A 2ZEZA 1TME1 4MG2A 4O4HB 4YARA 3B9CA 4O61A 4AF9A 5IWAB 1XL6A 4B08A 4QPIB 1LECA 3KCYA 4KGGA 2FQPA 4E4ZA 2W08A 1VQ7V 5A7OA 2DTWA 1H4GA 1NXMA 1TVGA 1HV1A 3UJOA 5KX5B 1JYXA 5LRRA 2Y6HA 2NYYA 4QDSA 4WZFA 2YMZA 4FPKA 2VH9A 3N2KB 1S0VA 3SHRA 1H9PA 5F5IA 1PNFA 3R66A 4Y22A 3UNPA 5I0DA 4AYUA 4J41A 2OZJA 1KD7A 1DQ1A 4H2AA 3JALB 4ZOLA 4IGGA 5I8YA 3KCXA 1JMUB 5KC6A 4CZSA 3E6CC 4RO2A 1PPJH 3V0AB 4EWEA 3AXDA 1MOFA 1Y43B 1CPMA 3TXQA 3AKRA 2AR6A 3I2DA 1F51A 3TETA 3RGBA 3NWKA 2L6LA 3FFZA 1CVNA 3GZAA 2HWD2 1F4AA 2MHFA 4L0PA 2J1UA 1W6OA 3OTOB 3VOUA 2P37A 3INAA 5ACA3 2ZEWA 4R9AA 1DTOA 3T1LA 1PP9H 2UXCO 2A6VA 3B5LB 2OUJA 5IK5A 4BQ5A 1N36O 3JCIA 3MIEA 1GN2A 1N0JA 2C26A 1WJZA 5LYJA 1ND3A 3JASB 3VBFC 1ZX5A 1GH6A 1V6OA 4DR1B 4K1YA 1GLHA 2V4DA 1XYPA 2WLLA 2D3OW 3ABKB 4EQVA 3MW3A 3N9PA 3R65A 4RUEA 1BHBA 2QTSA 4WF9V 3IBMA 5D1IA 4L8QA 1N34O 1AL0G 4TWKA 5I0SA 1O3TA 1E5IA 2YIAA 3WX5A 4UT5A 2CWMA 2XKOA 3I2IA 3SGIA 3GGLA 3UT0A 3E6DA 3ASNB 3ETDA 2Q1ZB 2GNBA 2VUCA 3OUIA 1M5IA 5C4WA 4RWUA 3THTA 2KM2A 3I55V 3ETEA 1R081 4AEMA 3D0SA 1HNXO 1EN4A 3WUDA 4IQPA 3MIDA 1MMMA 1RUOA 4KWLA 4PA9A 4CCCA 2E53A 3WNNA 3IPVB 5A3PA 4MV2A 5F3EA 5I0TA 2NLJC 3TN93 1QOSA 2OCCB 3UO2A 3PVOA 5HBAA 4BYYA 3POWA 4KWKA 1O3QA 1WLEA 4UF0A 3AP4A 5GZGA 2QQLA 4X88A 1HW5A 4LR4A 5B2GB 2YU2A 3TBDA 2YB7A 2ZX3A 1ULPA 3OE7G 3N9MA 3Q8BA 2IVIB 1ORQC 1N0NA 1JPXA 4HPKA 3ZBHA 1YQCA 3RS6A 2ZOEB 1CAVB 4JQRA 1NXD1 1AXZA 5LHGA 3VQWA 1FYJA 2XBO1 4HKWA 1EZVH 1REDA 3CJXA 3IT8A 4ZBMA 5CBGA 2OYQA 1YFYA 5J36A 1HRV1 1OF3A 4LFBB 4I4TB 3AKTA 2QM8A 1B6QA 4IEWA 1WLTA 4AHWA 4PLNA 1CQ9A 1U5XA 5FMBA 3CS5A 3JD2A 2WS91 2K2SA 1Q6HA 1R6NA 4MO3M 2LALA 3WQBA 4AZZA 4R6ZA 1HNXB 1PO11 4C91A 1C8M1 4MHRA 2Q7EA 2PQQA 3BRCA 3VBOA 4BPZA 5JAXA 1AVMA 1UX7A 4N9HA 1M90W 3X2QB 4LF9B 5FOJB 4NKGB 4DV7B 2VOVA 4JI6O 2ZA9A 4DEVA 1ZZ6A 3N7KA 4FTEA 4WBNB 4X1IA 4E2SA 2DWDC 5JSPA 3QNEA 5A6YA 1GP4A 2EIMC 1JOBA 5IYZA 1PK6C 2HWE1 5KHJA 5BXXA 2LW8A 5IUQA 1RUD1 4JC1A 2KXLA 1HB1A 1QMJA 2PUSA 4CYDA 4Q8KA 5JJJB 1PNKA 3MFAA 1R3IC 1RIRA 1F35A 1MQTB 1M57B 4EN6B 1ZZ7A 2G9GA 4FM0A 5GZCA 1V0AA 3VHPA 3DUIA 5I8TA 4QE7A 2XLFA 4AQYO 3PU8A 3ZFFC 2FD8A 1I1EA 4AGRA 5DXDA 4H7LA 1WD4A 3T2MA 3EMRA 2GAUA 3OMNB 3VBRA 4CDWA 2OT7A 2HYXA 3B94A 4B3RB 4XZUG 1GOGA 2ZAAA 2HVJC 4X65B 3HQRA 1ZBE1 4FAGA 1SLLA 1D2SA 4Y5Z0 5FR3A 3M3EA 3T08A 4FQZA 4DR2O 1W6OB 1IXBA 3BA9A 3MF6A 3S3XA 2NMNA 1QQP2 4WZCA 1T6GC 3OEBA 3R4DB 4JRLA 4DR4B 1VF5B 1MA1A 3BAAA 1QJY3 5AC93 5BPXA 4AVVA 3POIA 3LPFA 5CVRA 1OD5A 1OPOA 1WA4A 1ZBA2 4LF5B 1OMIA 1PZ7A 2A06H 4FFGA 4KGQA 3BTAA 5D2AA 3JBG2 3WDVA 4NHXA 2ZGUA 3OOXA 4MGYE 1YXBA 3IAPA 3V56A 2TNFA 2UXXA 3UGGA 2ZX0A 3MPBA 2JK5C 3QTCA 1QNMA 1F5JA 1TA8A 5A7PA 1XNBA 5L3BA 1LAJA 2WFF3 3RJRA 1BL8A 5C4WB 2ZINA 3EB7A 2A3XA 3GHNA 3JAKB 5FYMA 3HEIA 1LNSA 2GHYA 1TME3 5JZGA 3BGAA 1GKBA 1V6MA 2WL1A 2RS11 2JG8A 2AZ5A 2QA4V 2YPDA 2WT2A 1XBFA 2GTAA 4CEYB 4L87A 1Q8PA 4BZ4A 3ZEDA 4FPEA 3ROUA 4A42A 3KMHA 1VBB1 4C1WA 2VOTA 1FT9A 3K4ZA 2DJVA 2CGPA 3ABMB 3AXEA 4HK9A 3MW4A 5CA0B 2V4VA 1XJAA 1PM9A 5B3SC 1B04A 5F6LB 4B4QA 4PDWB 5GLVA 1B3QA 4AL9A 5C8YA 3CWBH 1QVFU 4P9JA 5L19A 2JG9C 2LFSA 4BK5A 3OBZA 4XFIA 2KR2A 4X6RB 3L70H 4JGZB 1UPIA 3DCQA 4TSVA 3SPGA 5I0UA 2EIJC 4M4PA 4JCKA 3LSQA 4FFIA 1ZAUA 4MGZE 3WOGA 4BIOA 1D2QA 1LESA 3WFVA 4MW3A 1UZWA 3ZSKA 5T55A 3W7TA 5FYCA 1VBD3 4O9GA 2DCJA 3ATGA 1OLMA 4I7ZB 3OBRA 3D3IA 4DY3A 4YZ5A 2R72A 2W3JA 3H8OA 3CYOA 3OFNG 1YJWV 1PHMA 3RYFB 1LOBA 4RGKA 1FXHA 3LD8A 4A45A 2ZD9A 3AP6A 1W8OA 4QGMA 4UVBA 4D6TH 3BI3A 1A32A 5A3UA 3KVAA 4DV2O 3HMYA 5FZCA 5EWSA 3IIIA 2QWNB 1AX0A 4I3GA 4HZFA 5EIBD 4PA7A 5A1FA 4YJ2A 5JXJA 3OEAA 3CZUA 2VZSA 4DR2B 5A1LA 1HRI3 1AR63 1OQ1A 1NR1A 3OPZA 1SFPA 4DS0A 2YC4A 5F2SA 1YNAA 4XXPA 4B3TB 4WBBA 2R073 5B4NA 4N21A 1S1AA 3WHUA 4CCLA 5B5EZ 3WEZA 5IYDO 1YLLA 2EX3A 4CXWA 5JVDB 3ABUA 3WV6A 3C2UA 2AEZA 3AG1C 2ZMNA 4RS5A 2YEVB 2QM7A 2W92A 4HYOA 1X33A 4NRPA 1ZRIA 3OGJA 4ZZ5A 5FO7B 1GM8A 4I0XA 3KD4A 1UY2A 4R9DA 4LA3A 3N9QA 1RUG2 5FPZA 4I55B 4JGSA 1EUUA 3SEEA 4Q6GA 1QF3A 3GCXA 1ZVFA 4GKXA 2VZOA 4XYXA 3ZFFA 1SDDB 4KU7A 4CCKA 4BXFA 1BQPA 3WR0A 4F6RA 4MGQA 1VQOV 5CG9A 5J09A 3DKWA 1T6BX 4P9WA 4XIKA 3BU0A 5A7WB 2EULA 3AVRA 3E8FA 2CV6A 1LHNA 5GZDA 3UV9A 5JXHA 2B9VA 1L7RA 4ZY9A 4UXNA 3HR9A 2J1VA 2CDYA 4IE6A 4PDRA 1XC6A 3ASNC 1DU3D 3A23A 3WF1A 1C57A 1RMU2 4IEVA 4IV3C 4AFCA 3EHBB 2A7AA 5FYHA 4LK6A 1POV1 4BMBA 3GZUC 4H33A 1EUTA 4CCDA 5FMOS 2Y6GA 4DINB 1NQDA 5A7NA 2Y4UA 3F5TA 5HPOA 1W05A 4CEWB 4JGZC 2HWB2 4O2AA 3MLJA 4XE9A 3PNAA 4Z92B 3JAMN 2QQUA 1HNWO 3PIJA 4S2FA 2ITCC 3FD9A 3JSNA 1EAH3 2VAUA 4QQ2A 1GUIA 1Y74B 1J5EB 2BWCA 3VD3A 4KBBA 1GNZA 1S55A 1KS5A 4HN0A 2CTWA 2WFPA 2B1IA 3HR0A 3RFRA 4E4SA 5A32A 1COWG 3VZNA 3D5OA 3O14A 4TOIA 2P3KA 4N43A 2Q0AA 3HBKA 2GBOA 4LUMA 5LHHA 2VC9A 1JYTA 1W90A 3TXSA 1SQBH 2FMLA 1EN5A 3H1JH 2W94A 3GXUA 3CJHB 2RCVA 1QLEC 1BE3H 1CAVA 5IVEA 1WCDJ 5EZYA 1QJEA 1Z5VA 1OURA 2E74B 1AF9A 4CRQA 1NR7A 3HKDB 3ZXLA 3ZOIA 2R042 4HFSA 1O4TA 5C3PA 3HIFA 4P00B 4F7ZA 3SXWA 1GOFA 2DUQA 3APOA 5I93A 5KC5A 2DOSA 4F4LA 4ES9A 2NNUA 1SF9A 4GJYA 5H5NA 2OT5A 1KITA 3VBSC 2Y6FA 3CJHA 4AWDA 5DQ0A 3O65A 2ZM6B 3K04A 4B3SO 1AZDA 1K92A 3IZOA 2I45A 1L7LA 3NAPA 4CTEA 5LBQA 4X64O 2EIDA 3LDKA 5KA5A 4DXZA 5EIYB 3J8F2 4XQDA 2MW2B 3MBWA 1UX6A 2X10A 2RMKB 1PM4A 1CXZB 4RR3A 3NNGA 1NJIW 3DN7A 3RWRD 4QGPA 2HWD3 3AMHA 2ZDIC 5JH7B 3N36A 3ZXJA 4DRXA 4DRXB 3BTXA 2RG4A 3I7DA 1JYVA 4QIWF 3K46A 1MS5A 4NJ4A 4EEQA 5KHIA 1W04A 1BHAA 4XTPA 3G4SV 2YC0A 1VRH1 1JZ7A 4O2BB 1H6XA 1RUF3 5ITZB 2Y0PA 4KH9A 1XYNA 2P7TC 4LWSB 2WABA 4XMIA 4LF9O 2P22C 5LA6B 4YJ2B 3NAPC 2E33A 4LNUA 4YG3A 3M2MA 2WC2A 1PVC3 1C5HA 2JGDB 3PL0A 3L74H 2IH1C 3THCA 1H0BA 1Y4MA 2N05A 4DV3O 1GNYA 4ZHQA 4DYLA 4DOUA 1SLIA 4FFBA 2WAOA 4QPIA 3WG2A 3UT5A 2WLPA 3TNPB 1JUIA 2X05A 2BE3A 4JI2O 1RTVA 3SKJE 1U5ZA 4ZIBA 2WAAA 1PX3A 2A0LA 3ZKUA 4EB6B 1GRJA 2EIBA 3JQXA 3I5DA 2BW8A 1OUSA 1SERA 1GQPA 2W6JG 3VB9A 1BYHA 2ID4A 1ODMA 3UQ8A 4XW3A 2R063 4XOGA 4HL0A 4DXSA 4G2KA 3AKPA 3AZYA 3H1IH 1RJ8A 3ITQA 2P34A 3F7VC 5FLXN 4QT6A 3RZGA 3U0ZA 1FYUA 4MVMA 2YFUA 2RS53 4YVSC 4WV8A 3CJIC 4CEYC 1G6NA 2B46X 4DW1A 1NLQA 2F4LA 2VZVA 5GM0A 4KL1A 2R9AA 1OOPA 4URAA 3U75A 2HVKC 2X5IC 2Y33A 4NPLA 1UY4A 4P5HA 1P7GA 2RDRA 4GMP0 3WDXA 3O1OA 3CJIA 2HYKA 3C7EA 2QEXV 1VBC2 5F5AA 3I3BA 1OBNA 1FKAO 1J84A 4TSFG 1HRV2 4QX2A 2RS33 4Y26A 5D8AC 5GJ6A 3VN4A 5JI9A 2A6YA 3HKBA 4A6SA 1Q3EA 4AILC 4LF4B 4UF0B 2VOXA 1Q81W 3EO6A 3K5OA 4GZRB 2DCYA 4AQ2A 4Q1RA 1UWWA 2XDVA 2YUEA 1Y6XA 2FMYA 2PHUA 2VQAA 4IEQA 2R0HA 4IYIA 1V9U1 1WCKA 3LDEA 1YWKA 1P84F 4IL7A 3WW3A 1I6XA 1IQAA 3HNBM 5FNVB 4RHV1 4AW7A 1HXS1 5F3GA 2PAKA 1QXRA 4ARYA 2BNOA 3ZMNA 3JQWA 2A79B 4DV1O 3TCUA 4LULA 2G9ZA 1HDJA 3NO8A 1FFXA 1RFYA 4B8EA 4K40A 4QX3A 2V7QG 4LBLA 4Y1UA 3UK9A 5BNPA 1APNA 2H6CA 4JI4B 2PHWA 1W6NB 5A3NA 4PV1B 2G9FA 3J26N 2W0XA 5C4WC 1VBA3 4UFJA 1O6UA 1K5MB 2E26A 1OCOB 3SC7X 5LXTA 4QXBA 2LFRA 1U96A 3UKVA 1ZX3A 4FOWA 3W21A 1JVMA 4Z2WA 3GNEA 3KQ4B 3M3IA 3OUJA 2F4PA 2QQVA 5F8PA 4DRVA 5F32A 4LHSA 5JOZA 2J42A 4LT5A 4XUOA 3W7XA 1IS5A 3JCZA 4DR6B 1XNCA 1FV3A 4Q1PA 1W0PA 3BTYA 4UFKA 1IZ3A 3RYFA 3THOA 1YQ8A 2X5IB 4Q27A 2RDQA 1DGWX 4GB32 4Y1VA 1XE8A 2BFUL 4WFEA 5K4LA 1L0NH 1LRHA 2DWRA 3J7LA 4LO6B 4RGGA 4BHPA 3O1SA 4DK0A 1JYCA 4XFAA 1HX6A 1UU5A 2BTOA 3VZOA 2K46A 3HOBA 3IDAA 3H7JA 5FY4A 1QJU3 3NAPB 2ZGLA 1DZTA 2GMEA 1O3SA 4L97A 2H3OA 4WBNA 4CP9B 5DZFA 2JIJA 3A0NA 1H1IA 3ACGA 1MVEA 3T1YB 4DR4O 3AG3B 2I2SA 3JBG3 4W6YA 1QHTA 2RR11 1TVKB 2WNUB 4J7KA 3ZFEC 4QPGB 2JDPA 4E2LA 3DSQA 2L9LA 1SMVA 3X29B 3WG4A 1UY3A 2GN7A 5LOVA 4KWUA 3POYA 5JH7A 3MDSA 1RUC1 3VBUC 3EQEA 2BSKA 4CCMA 2E51A 1A3KA 1D5AA 1RUNA 1H8EG 1UY1A 4ZI7A 4BAYA 5L7OA 2BOIA 3HVDA 3NSTA 1B35B 5CFCC 1KUQA 4BQ1A 1VEWA 1X9PA 1UMIA 5IYZB 4HAMA 2QSAA 1DCSA 3AZVA 1F4NA 5ANQA 2D93A 5FZMA 1KGYA 1HV0A 1R6TA 1SQVH 3CQOA 2W47A 3JD73 3APQA 3T3YA 4M0HA 3MI8A 1JFFB 3LGRA 3WW4A 1RJ7A 4PCRA 1OPMA 2VZRA 1TUBB 4XJ9A 4DPNA 1SBEA 4JZRA 2LTNA 4QM8A 4X1KA 1XNAA 1RPOA 4O4LB 1QKQA 5F37A 3ASOC 4UCOA 2R1DA 3W7WA 2P3JA 2K9ZA 2YPJA 3K4DA 5EIBC 1WCQA 4OQ8A 3B01A 5AVPA 3HKBB 3CXHF 1DQ0A 2XVLA 4O4IA 3T1YO 2WA4A 1EAH2 3ZPYA 2UY9A 4Y1XA 1HQNA 2QKAA 4LNVA 1MEC3 3KT4A 1OCCC 3IDBB 3T09A 3KQRA 4LEJA 4IEXA 4YY3B 4AVCA 4BLJA 4TWTA 3EYPA 1W3XA 3AMPA 3WF4A 1O5UA 1XNQB 5FZLA 5JZGB 4MXWB 2VCMA 3N35A 1KYOF 3UETA 1NAEA 5B4XA 3NQHA 4YIPA 2WNOA 4LH7A 3FB6C 2EXHA 4WM7B 1DQ4A 5G05L 1LKNA 4ZONA 2MNGA 1DF5A 4I0WB 2ZGMA 4JI8B 1W8ZA 3AG7A 3RZKA 2WYFA 1KD1W 1SS3A 2ZGKA 1PX4A 1MSDA 2V72A 5DZGA 2D5HA 1LJ7A 4BDVB 2LGWA 2Y60A 2LUWA 2DVAA 4GMP3
chains in the Genus database with same CATH topology
1NG0A 2FZ1A 1VBB2 4EJRA 3TB0A 1BK1A 1EPZA 2RR13 4HPKB 4QX5A 2OUHA 3PHMA 4C5WA 3ZFEA 4OHZA 4FQ4A 1XU1A 2FHRA 4WM8C 2OG5A 5FQ0B 5GLUA 1A8DA 4EN0A 4R4XA 3QD6A 1SFYA 2QDRA 3W9AA 4Z07A 4BHGA 2D3SA 3WNXA 3BOWA 1AXYA 1F31A 4BHIA 2DVFA 1VAVA 5DZEA 4AI8A 1XU2A 4B7KA 3JD72 4PF5A 3FLPA 1X8EA 1YIPA 3KSCA 2EAAA 3LA3A 5C6CA 4AHZA 2ILMA 3IN9A 4GQ7A 4I0BA 2PLV2 3WP3A 3ZDSA 2GZWA 1SLTA 2XHKA 3ZO0B 4GH4C 4YGDA 2VW1A 4FPOB 4A7KA 2VG9A 4YZ4A 4WVMA 1URXA 2QZ2A 2RM22 1S2KA 4ASMB 5JVVA 1LODA 2CY6A 5BNPB 1AYM2 3VBFB 2O8QA 1ULCA 1OS7A 2D97A 2VVFA 1Q8QA 4GKYA 3VL8A 4YVWA 2OYZA 1UU4A 1AR91 5BNNA 1G9BA 1IPJA 3DL3A 1JUHA 2RMU2 3L2HA 1VBE3 2ZHNA 1QDCA 3LA2A 5SV5A 2QZ3A 1AJKA 1KXGA 2GMPA 3FE5A 4OHWA 4C1XA 1TNRA 1W6MA 1TME1 1ND3C 5FDBA 1FI2A 3JB8A 4YARA 5DG1A 3B9CA 3N7JA 4AF9A 3DPRB 3TAYA 4QPIB 4XHBA 1G7YA 5EZWA 1LECA 1YJKA 4CDQC 3KCYA 4KGGA 2FQPA 4E4ZA 3QLQA 2W08A 1QDOA 1MZ5A 1ASJ1 3WD5A 3RI8A 2CGOA 2DTWA 1OIJB 1AYN1 2UWCA 1QH7A 1H4GA 5J96B 2R043 3OD4A 1NXMA 1HV1A 1NCQC 3UJOA 4CP0A 4P9IA 4F83A 1I3HA 5T3NA 1AYN3 4A3XA 1G9DA 1XYOA 5LRRA 1C1LA 2D6KA 3THPA 1IKPA 2NYYA 4WZFA 1Q5OA 2YMZA 4FPKA 2VY0A 1JBCA 1H8VA 1RL3A 2VH9A 3AFGA 4BCUA 4C90A 1BXHA 4CDUB 2HWF1 3S6PA 2BGCA 3SHRA 3PMEA 5JOXA 1FPN2 1ONAA 2BUKA 2Q8OA 3SISA 1H9PA 4QPYA 1BBT1 1PNFA 4YZ3A 4Y22A 3HBZA 5KBFA 1UZYA 4YW4A 3RZZA 1GZWA 1MQTA 1KFUL 4JGYA 2E9QA 4QPGC 4WM7C 4RFT0 4AYUA 4DNYA 4M00A 2OZJA 4MLOA 1C28A 1ZNPA 4FPYA 4BE3A 2X5IA 1KD7A 1LOEA 1DQ1A 5KHGA 1SCSA 4Q4Y3 2MEV1 3LOIA 5I8YA 1SFNA 3ZMOA 3KCXA 3WVJA 1PZ9A 4L99A 2PHRA 5KC6A 3G7DA 5DUUA 3FWEA 1X82A 4FPCA 1YFXA 4CZSA 2ZAHA 4NHMA 1LOAA 3E6CC 3ZYRA 1GZCA 1HRI2 3V0AB 3V0AA 1JH5A 4FCAA 4EWEA 4R4ZA 4Z8BA 2Z69A 3AXDA 4RHV2 1COV1 3SWTA 1LGCA 1Y43B 4IEUA 1CPMA 1LU2A 3AKRA 3TWIA 2AR6A 4MYEA 2OPKA 3VZLA 3VZJA 3I2DA 1LHOA 1S0BA 5ABJB 3FBMA 3ZXFA 1NCRB 1J59A 3NWKA 4PJYA 3FFZA 2ZCWA 4J1XA 1AR81 3V17A 2ZABA 2ZGNA 2V5YA 5FAXA 1CVNA 3AMMA 3GZAA 1RVF2 2BYVE 2HWD2 1D0HA 1R1ZA 2GH2A 5CA6A 3H3ZA 4FPLA 2A73B 1UCXA 4CP2A 2MHFA 3H50A 4BH9A 1ND2B 3VHNA 4LHLA 2WFF1 4OULA 1W6OA 2EAKA 3IMNA 2P37A 3INAA 2WA3A 4TZDA 1EP0A 1ZM1A 1SCRA 4COZA 5ACA3 3ZXEA 3OJBA 2ZMKA 2ZPXA 2QQPA 4LBQD 4R9AA 3USUB 4XJ8A 1ZBA3 3T1LA 4XEZA 5HCAA 4W65A 2A6VA 3RI9A 3B5LB 1VZ5A 3TN92 2OUJA 4YW2A 5IK5A 4MXWA 1Y3TA 2RS13 3JCIA 4QPGA 3MIEA 1ENXA 3FUOA 3SLIA 3UJQA 5A3MA 3H1MA 2RMU3 1ND3A