2CGNA

Factor inhibiting hif-1 alpha with succinate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
338
Chain Sequence
ATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFNREEMKFHEFVEKLQDIQQREERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Studies on the Inhibition of the Hypoxia-Inducible Transcription Factor Hydroxylases by Tricarboxylic Acid Cycle Intermediates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
total genus 107
structure length 338
sequence length 347
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2cgnA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgnA01
2XUMA 1H2KA 2CGNA 3OD4A 4AI8A 4JAAA 2Y0IA 1MZEA 4BIOA 1YCIA 1IZ3A 1MZFA 2WA4A 4B7KA 1H2NA 4QU2A 2W0XA 2WA3A 4B7EA 2CGOA 3KCXA 1H2LA 3P3NA 4Z2WA 5JWPA 2ILMA 3P3PA 4Z1VA 3KCYA 2YC0A 3D8CA 4NR1A 2YDEA 1H2MA
chains in the Genus database with same CATH superfamily
4RQPA 3B00A 2ENRA 3O1SA 4IEQA 3WCSA 4RD7A 2RS12 2BNNA 3OUIA 2OTLV 1GBGA 3ZSKA 2MK3A 3RNSA 2RN9A 2XKOA 3J9SA 1VE0A 1H4HA 4DR6B 3C2UA 1DGSA 2Q5TA 3X2QC 4JI6B 1JZ4A 3ZDSA 2NNUA 4HKWA 2NLRA 1MS1A 3GBGA 4K1YA 1YUDA 5CKMA 2EILB 4YW2A 5FZ6A 1QNMA 2B1GA 4U3JB 4IT5A 4YGCA 2G1MA 3ASNB 3VBRA 4FMTA 3E83A 4XDQA 3T30A 2IVIB 1H2MA 4ZHNA 3H3LA 3CJXA 4DXZA 3MFAA 1HDKA 2HWC1 1FXKC 2YMZA 3U75A 4TV9B 1UOFA 2C5DA 4BQWA 1OHFA 1YC61 2K9PA 3KQRA 2PI5A 5K7PA 3KCYA 4Y5SA 4QXKA 3N2GB 1VQKV 1VIWB 4FTSA 1GN4A 2P3KA 3ZSLA 1H2SB 3W7WA 1FMD2 4IHJA 4ASLA 1KS5A 1IPSA 2ZHKA 4QPWA 2P3IA 2W9XA 3N7LA 3ZFEC 3B93A 3GYDA 5IVFA 1WW7A 3RFRA 5E79Z 2F23A 1IX9A 2XL7A 4CU8A 1DBNA 5L3CA 2VVEA 2IWGB 2JDUA 5FYTA 1XL4A 2IU3A 1NH2D 1HNXO 3OAAG 1OT5A 5IAVA 4UVAA 5FYVA 4E2SA 2Q9LA 5H9SA 1RP3B 1AP6A 1BQPA 2OA2A 3RYIB 4PI0A 4HPKA 4P00B 4GAZA 2E3CA 3W5MA 4FVMA 1FX5A 1G9DA 1T6BX 4CEWB 2AGSA 3URFA 5J36A 3OT7A 3N2KB 4RO2A 4DNYA 1A6CA 2VWKA 3PJSK 1CJDA 4SLIA 3LDBA 2W92A 2HKXA 3WCRA 2A3XA 1ZBE1 4ASUG 4HFSA 4BQ3A 2QTWB 5A3OA 2ZT9B 5EJ3A 1NR1A 3W5NA 1W8FA 4HN1A 5AFEA 3R66A 1JVMA 2Q1FA 3LA3A 1RUC2 2D93A 2OCHA 4TWKA 4IIJA 5KHHA 3T4ZA 5JDBA 4GYCB 5JCOA 5ERLA 5GLUA 2WLKA 1BJQA 5FZ1A 2QTOA 4BWOA 3N9MA 3RI8A 1HR0O 4I4TA 3BN6A 4WM7A 1FI2A 2NN4A 1MZFA 4YIOA 4MHRA 5C9AC 2AZ5A 2Y60A 1H8TC 3K4ZA 2VOTA 1B3QA 1JZ6A 2DYCA 1H1IA 4H44B 2HWE1 2Y6HA 2CH7B 4B3MO 3HOBA 5JXHA 3CNAA 3JSNA 3R65A 2D6MA 1Q8OA 5JOZA 1RSOA 2NYYA 5LHGA 2GH2A 2JDZA 3ETPA 5LYJA 3D0SA 2R16A 1SZXA 3H1JH 4AGVA 2IBZH 5A32B 3MF6A 4KWUA 3LDDA 2BNMA 4HN0A 5C9AB 1J5EO 2D44A 2JE8A 3ZMTA 1LTEA 1QDOA 2HVJC 4NB5A 1CJPA 3ABUA 1JHJA 1NKDA 1POV0 4XFBA 3A7QA 2ARHA 4COVA 1CAXB 1V9U3 2GV9A 3BU7A 5DZFA 3JARB 4IL7A 2F93B 3JATB 2JDHA 5F2VO 3AKQA 1S77D 2G9ZA 3K46A 1QJU2 3POIA 2E33A 2LGWA 4LFBO 1GZTA 1GH6A 3VBHB 3D8CA 2Q8VA 3Q8EA 1QEXA 2J1SA 1FS0G 3DC6A 1TME3 2PHXA 3ILFA 3RS6A 4LF7O 2EVXA 4ZS3A 3HKCA 2Q5ZA 2B46X 1K7DA 1S0FA 2WBKA 4IERA 1F4MA 3LE0A 4HLTA 2W3JA 3ZMSA 1S0GA 3VBUC 5A33B 4G28B 5IK5A 1OCRC 1IVSA 5J37A 1HNXB 4H55A 3PLQA 4I50B 2GBOA 5L9BA 1DQ1A 1LR5A 4LUMA 2EIEA 3PMEA 2RNBA 3UGGA 2FB5A 4PHZA 4ZHQA 2OUHA 1YTFD 5EIYB 4DR7B 1NVPD 2E5LB 3ZN4A 3E8HA 4Y22A 2JGDA 4XETA 2LALA 3POSA 5FQ0B 1S0EA 3PU3A 2QQLA 2ZCWA 2A75A 1ENRA 3UK9A 3MAQA 1MMMA 3SKJE 4XQ4A 4YZ4A 3U4XA 1F15A 1S5JA 4LWSB 4LF4B 4FFGA 4XUOA 3NV3A 4MG2A 1R3KC 2V5DA 4R50A 4PF5A 1AJQA 2DU1A 3ZOIA 4QQPA 2C1FA 1TAEA 4NVPA 5A3UA 2H94A 4LK6A 2OKXA 4GWMA 2GSMB 5A2QN 3AG2B 4CH5A 2DVBA 3GZTB 2D5FA 3ZFEB 4CA9A 2HWB1 1AJPA 1LOFC 4FPLA 4I5SA 1LEDA 3G71V 5G05L 3GZAA 1KBHA 1OFSA 2BBAA 3SC7X 4K20A 2PXJA 3TN93 1BHGA 4P08A 1XMQB 5FZDA 1W6OB 1K45A 1F8VA 1F51A 3USUA 4MSWC 2YI9A 5FLHA 2WLQA 3NR7A 2UXXA 1C5HA 4BMEA 4B3RO 4CEYB 3AG3C 4M3CB 4I30A 4AQSA 3JSLA 5KMGA 1PO22 2PN5A 3ZSMA 1QXRA 1IURA 4WBNA 4X62B 3VZJA 1QMJA 2O57A 4XFIA 3NNFA 4QPGC 3EO6A 3VBSC 4U7NA 4W4LA 4XJUA 1NXD1 1WW6A 4A5UB 1BGYH 2VZUA 1R091 2VZRA 3O65A 1Q8IA 2WFF1 2CAZC 1XNRO 2J1RA 3USSA 3E2EA 2E7AA 1VP7A 1EYBA 3ZXFA 3E5XA 3HKEB 3T2PA 3RZZA 2UU9O 5IYZA 4P9XA 2J1VA 3V65A 2XGXA 5CA0B 2ZGSA 2P5BA 3QO5A 1HNZO 1Z5WA 1UAIA 4HXCA 3LOIA 1RXFA 2GU9A 4HNAA 5JOXA 2VNRA 4NPMA 3ASIA 3K77A 1QJY2 4Z2WA 1VBD1 3KV4A 2ZABA 4HK9A 2R073 5FZIA 4FPPA 5CFDA 3AG4B 1H8TB 5J96B 2H0VA 4GMP3 4CXWA 4NXNB 2WZR1 2F1MA 1UPGA 5GONB 1G8MA 1MR5A 2JDMA 3CBNA 2IFRA 4ZI7A 5IWAB 2ZGTA 4Q6GA 4NUBA 4AAXA 1O3RA 1KD1W 1K5MB 2V5YA 2R49A 1AR93 1QJZA 1ZRFA 2B5HA 5IVCA 1N32B 1WN7A 3IAQA 2PQQA 4BXFA 5ABJA 3HPNA 2D97A 3SISA 2JS3A 1U5ZA 4D6QA 2PA7A 4GX2A 2WLIA 3CWBH 4GCZA 1SCSA 4HG6B 4I2OA 3HKEA 3A4UA 4XXAA 5FZBA 3U07A 5JAXA 4GX5A 1UYPA 5LCWL 3WF1A 2XOMA 2ET7A 3I59B 3TJTA 4MVSA 1FNZA 1HN0A 5IFTA 3UGHA 3AK3A 5FP8A 4QPJA 3T4HB 4AHWA 1GWLA 2EIGA 4X88A 3KSCA 1GQHA 4FT8A 2JRIA 5L3GA 3VHOA 1W2UA 2XJVA 1ZRRA 1H2GA 4WBNB 4CS3A 4JI3O 4JGZA 2EIKB 1FPN1 5KMGB 2UXBO 1T6GC 3B9IA 1N32O 2WS91 1VQ7V 1GM7A 3KHBA 1C3HA 2AXTZ 1YRZA 4M4RA 1I08A 3ZSEA 1U96A 1OC1A 1R6TA 4MGKE 2WRAA 2ZDIA 1TMF1 2ILMA 1KQSU 2VZ1A 1UXZA 5AC91 1PL4A 1XXNA 1FV2A 1S1AA 1J59A 3K48A 2B9VA 2EIKC 1HXS2 2RDQA 3SLIA 2Q1ZB 1N0JA 3ZMNA 2D6KA 3SPHA 3J80N 2HWB3 4XUQA 4IDZA 4EFBA 3O12A 4KMQA 4LF5B 2DU0A 1Y74A 4UFKA 1N36O 3WDWA 5FY9A 2N04A 3VGIA 2Q8EA 3PN1A 1UY4A 5KUMA 2OPKA 4JKMA 3ABMC 1DTOA 5FBJA 2DCKA 4UXAA 4Q4W2 3ALQA 1UO9A 1WLTA 3C90A 4DV4O 2FCTA 1HW7A 3CXHF 5BNOA 3F5TA 3RPQA 4L87A 3SXWA 1FOD3 1TGOA 4AFDA 1AI6A 5J1XA 4TSFG 4K8XA 3CCJV 1GN3A 2VE1A 2X10A 5D2AA 1OCZC 4EN9B 1RPRA 2ORXA 1E5IA 3SYCA 4QM9A 2ZPXA 1B06A 4KNCA 3WNMA 1IKQA 5CMUA 3WHTA 2DYSB 5B4XA 4Q4X2 4F8AA 4AEKA 3ZXDA 3POJA 1AROP 1GMGA 1DF5A 4PJYA 1GP6A 3MF9A 1AYN1 3AP5A 5CA1B 1ZLZA 2YROA 1R1A2 4XJWA 1S72V 3LFIA 4ZS2A 1UNBA 3L74H 4EWDA 3E1F1 1NS1A 4E2QA 2JEMA 3VHNA 4A4AA 1N3QA 1Z0HA 5CA1A 2ZHMA 1J83A 2DYRB 3ETQA 4L2NA 3I97A 4Q4X3 2GC1A 4XIKA 4X9QA 2WFPA 4JI1O 2ORZA 3AL6A 1ND3B 3BABA 4O9EA 5IWAO 1WLDA 3CQOA 3I2JA 4X6RB 4N7UA 5JVDB 4AQYO 3EHBB 1RVF3 5EIBC 1GM8A 3KV9A 4KP4A 2JIZG 1WCQA 1KECA 5HV4A 2A9HA 4PDWC 3STLC 1QJY1 3RMYA 5IWFA 1VBD2 1SLBA 4X1IA 3L2HA 4IYIA 4O4HA 4DV2O 3TNQA 1O3QA 3ITQA 2C4XA 1UYXA 1I94B 2LJ2A 2ZIMA 5LYJB 3CF6E 4AZZA 5HXMA 2WNUA 1W99A 3DXRB 4Q1PA 4L8QA 4LKFA 1F2NA 3AG1B 1QLNA 3LA2A 4LR3A 3CCUV 4BQ4A 3W7TA 2CGNA 2L9LA 5JOYA 3FC0A 4MW8A 4MVTA 4WVZA 4OMDA 3LDEA 3L9DA 3CCQV 2YC0A 4B3TB 1UU4A 4X1KB 3HR9A 3NV2A 4ES8A 4MTFA 2ITCC 3ETEA 5FYCA 1FJGO 4HETA 1XE7A 3B01A 2LFSA 4IIJB 3OB8A 2Y6GA 2Y6LA 5HCHA 5IJ0A 1LOCA 1KJLA 4FOYA 4J41A 3AZXA 3D36C 3PIGA 3JB8A 2QWNB 3APQA 5CVRA 2VQEO 4CCNA 1GOGA 4JYAO 3I2IA 2VOVA 2XHBA 1JTZX 1SBEA 2X05A 3IC9A 4QQOA 3C8XA 4C91A 5GM0A 1PK6C 2X5IC 2RR11 5LA1A 1HRV1 3J7HA 5J9PC 1THZA 5KA6A 2QDRA 5IVEA 5CB4A 3BRCA 2BZDA 3ML0A 1IKPA 1AJKA 1C4RA 1Z78A 4XUNA 1EZVH 5FZCA 4P9JA 2ID4A 2QTSA 4ITCA 1R083 4IL6Z 1DQ2A 3P32A 2IH3C 1REEA 2DMXA 3TWIA 3VDAA 1UWWA 2QQPA 3I55V 1YSCA 3VQXA 3OGJA 4WVVA 4I55A 1AR92 3K04A 1LOEA 2JECA 1PVC3 2OT7A 5ABJB 3OTOO 3ASOC 3UO3A 2GNMA 4B08A 4LO4B 5FYZA 5K4LA 4DV5O 2JDKA 4LO8A 4LLOA 3TB0A 1RUI1 2VD7A 2B5UA 4CP9A 4A41A 4WFHA 4LE4A 1JPXA 4ZI7B 1BEV1 1GU3A 1E79G 1RITA 2YV8A 4V2WA 3DV8A 4H14A 1H8TA 5JSOA 3LFMA 3K4DA 3H01A 5TISZ 5GLVA 4R4XA 4DB5A 4TV9A 3B9CA 4MVMA 4Q20A 1ASJ3 5C4WA 1D0GA 4LBQA 4CDQB 1RJ7A 3SJCC 4OZXA 2E26A 2ADQB 3FMGA 4XEZA 4JGSA 4MVZA 3M3QA 1C5IA 2P90A 1CR7A 3ZYHA 3E97A 2B4KA 4FZ1A 1QOSA 1UYYA 2VW1A 4DV3O 1GR3A 2WJSA 5ANNA 5JZGA 3U0ZA 2ZGKA 1R6NA 5DECA 1IHMA 2VWJA 1M9NA 1AVBA 1AJNA 3ZPOA 1SQ4A 2RDNA 4INDA 2ZEZA 4I02A 1VF6C 2JEUA 1VEWA 5FKBA 3KMHA 2VMEA 1R3IC 3KT7A 2P17A 2A6WA 4QDRA 1W8NA 4OHZA 3E8FA 4ZZ8A 1BBT2 4AQ6A 3SR2C 3AM2A 3SDLA 2WWWA 1Y76A 4WV8A 4M3CF 1TEIA 1W6OA 2R061 1DZQA 2FDKA 1VARA 4A3ZA 3MBWA 1KB9F 1BT8A 4UWDA 4HKOA 5F8PA 4QPGA 3B7MA 3LCPA 4KBBA 1XC6A 3GWOA 3WG7C 2E75B 4NIGA 2J1TA 2ET1A 3E22B 2W5FA 2XMLA 1EN5A 1YFXA 2P3JA 4K9SA 4OMCA 2A0LA 5CYYA 4LR4A 2GMPA 4AEDC 3OGCC 4NE9A 4QXBA 2LM3A 4NXMB 2DOSA 4DY5A 4W6YA 2LO1A 3PUHA 2P4VA 1VBC2 5CG8A 2WUHA 3ZFFA 2QZ2A 1LCLA 2ETNA 1EBOA 4AI9A 4FAHA 4NROA 3KV6A 3CRCA 4YFZA 3AMMA 1AR82 1F31A 1WP7A 4AEDB 4LOTA 4PDLA 4XMIA 5A1AA 1ZRCA 4EN8B 3DEMA 2RS31 4QB2A 3OTOB 1ZZ9A 2Y4TA 4R9CA 1RB8G 2G9GA 1JYTA 1AJOA 3CDZB 1APNA 3RYHB 5GZFA 2NMNA 2Q30A 1HRI2 3AXDA 2E7TA 1D4M3 4WVMB 4TV8A 5LA2A 1BMV2 2Q6AA 2QQNA 1OD5A 5F39A 5J2TA 5FIXA 1X59A 2ZXQA 1ZZ8A 2HWD1 5FY0A 4JAVA 1VRH1 5C93A 1IZ3A 2R041 1YZBA 1Q43A 4PA7A 1CZSA 2E51A 4XVHA 2XJUA 3DKWA 5JWPA 2Z42A 4YJ2A 2QKDA 3AZVA 1FPN2 4TUYB 2BEOA 4NAMA 3ZFGA 2CWSA 1NCRB 1TVGA 5LBFA 2KA3A 4NHLA 1W04A 5EP9A 3OMIB 3AJYA 4LBQD 1GNHA 1RINA 5CFCA 3K9AA 3X2QB 1XSQA 3AFKA 1W0JG 3EBRA 3ZYFA 2EXIA 1TMF2 3D3AA 3OG2A 4QD2A 4YM3A 5CBHA 4RGKA 4K3AA 4N21A 1Z7S2 2IJKA 5LA0A 2ADDA 3EJKA 5LL6Y 5A7PA 2BTOA 3ASNC 4J80A 5JI9A 1FYJA 2W1QA 1BLZA 4YGEA 2G38A 3AG2C 4UOJA 4F3JA 1NQTA 1MEC2 5C3QA 4OHXA 4LF7B 3FAVB 3ZM8A 3KVBA 1ODNA 3NKTA 3ZXEA 1JJOA 2R9AA 2WIIB 4OHWA 4EV0A 5LMNB 3ZYJB 2GUZB 4JI1B 4M4PA 1HN1A 3BTZA 1DGRN 4CP0A 4AI2A 1KITA 3SPCA 2D6OX 4OI2A 3UT5A 4DXSA 3ZS8C 1Y9GA 5FPRA 4XF0A 3FBYA 2LQTA 5DN6G 2CHHA 1Q6IA 1IBLB 2EIBA 5L19A 2AREA 3AJZA 3O1TA 5CIRA 4YW5A 3UJQA 3UKMA 1K9MW 1XQ8A 2XAQA 5L3BA 2E5LO 2DCTA 4EZ4A 2N7GA 4DV2B 2BGCA 3I2KA 4CDQC 1EZJA 4IV3B 3DKQA 5A3PA 4DV6O 2XTAA 5LBBA 5EYPB 1SA0A 1JMKC 2Y69B 4LJHA 3ENRA 1W05A 1QY4A 2CDYA 1OLQA 2DQ3A 3ZXAC 1VMFA 5I8SA 3OOXA 4YRDA 2YBSA 5EYXA 3SEPA 4BE3A 2BPA2 1TQ5A 4GXLA 2UURA 4FAGA 2P67A 4P9WA 5DG1A 4OCTA 1JZ8A 5C5UA 1L0NH 1LUWA 5IYCO 1QJEA 4IEOA 5CKQA 2MHFA 4D94A 5GALA 4XQDA 4ABMA 1Q81W 2D40A 1TA8A 2ZR3A 4XQWA 4WM8A 1HIXA 4XZPA 4TOIA 4CZZA 4RL7A 3PHMA 1O5LA 4YVSB 4E4SA 1UZZA 2WC2A 4TZDA 2KG7A 2XG3A 1GSLA 5I0RA 3O1RA 4FPJA 2WZPP 5FZGA 3POEA 2ZNIA 4BYYA 3TEYA 3NQHA 3K03A 4Y1XA 3BI3A 4OI0A 2FZ1A 4DUZB 1H6YA 4AQTA 4PDWA 4IHJB 2VCBA 5D8AB 5APAA 1PKXA 4WF9V 4JI8O 4O4IB 4GULA 2DURA 4B7KA 4Q0VA 1D2QA 1KJRA 1KS4A 1PGL2 5FYUA 1L7RA 1VMGA 3AYDA 4BIUA 2ZAHA 1I5XA 1MSDA 1NAEA 1R1BA 3U14A 4K35A 1J1TA 3ATGA 3DUIA 3N9NA 2EINC 5A6ZA 1NZIA 5JJNB 1JZ5A 5A70A 4AEMA 4Q27A 3JALA 5CKNA 2RMKB 3VDBA 1OPOA 5EC2C 4LF6O 5DZGA 3IDBB 4R9AA 2DYRC 1PMJX 3VQWA 4U3JA 3AK0A 1K33A 4CRQA 4JI7B 1VBC1 3JYCA 4HVRA 1XBFA 1QJX3 1EFRG 2IC1A 4Q29A 2WA3A 1GQPA 4MGZE 2JDNA 2DVFA 4KHPO 3A23A 1QWRA 3NMBA 3JASB 5EZYA 4LNUB 1QJU1 3L73H 3NSTA 5DDJ2 2Y6FA 1ZZCA 1LHUA 3MUZ1 1NY71 2GNBA 3NJZA 1IBLO 3T4DA 3MHSC 4X64B 3KM5A 4Q4V2 2JX9A 2HHHO 5E6HA 3EVKA 2YUAA 1V6KA 1DLBA 1H1MA 1ZWIC 3RYCB 4CCOA 1LHOA 2HWF3 5JUVA 3PURA 4NHMA 4E4DX 1NR7A 3QF7A 3SYOA 5GTIZ 4FPFA 1NT0A 3AKRA 4QKNA 3ZRWB 1VRH2 1ZUQA 4AHZA 4Q4Y2 4URAA 5C4WC 1I6XA 2EAAA 3TXQA 3O1PA 4GWNA 1OCZB 1V54B 1S76D 4QX3A 2X09A 1YYNA 2AEYA 3LA7A 3CSXA 2XHNA 4TLFA 1O8PA 1ZX3A 4YG0A 2XNDG 5F5AA 3GALA 2H6BA 2DYSC 2NQYA 4Z1VA 1Y4WA 1RUF3 1LGNA 2PELA 1I3HA 4FLWA 1S0IA 2WNVA 4IEYA 4JCKA 2XUMA 2CTPA 1ACCA 3W9AA 2PTMA 5FPUA 1W9SA 1OA4A 3BOWA 2MEV1 3WQ1A 4MHUA 2VPVA 3V0AA 1CEZA 1PIV3 4A3XA 3LAGA 1VQ5V 3IDCB 4FIPC 1VBB2 1SESA 4PJ0Z 5FLJA 1JYVA 3JUUA 3P3NA 4RN5A 3CCVV 1DQ5A 4COUA 4DIQA 4A6SA 2WQZC 2YFUA 2VBDA 1YITV 4DOUA 3SPGA 1HKDA 4WZFA 2JD4A 1K42A 2VCMA 5LEJA 3ZYBA 2QA4V 1B35B 3H9VA 3FKSG 4P9LA 1T5EA 1N8RW 2W87A 4JI5B 5T5OA 4CEYC 4PT6A 1PNFA 1RMU2 1M4WA 2BERA 4LC1A 1JYCA 4FXGB 2EXHA 1HWYA 4ZOLB 5DEDA 3VBOC 1S0JA 1JJ2U 1DGWX 4PDMA 1QKQA 2GMEA 1N3PA 4E8CA 3E35A 1XYOA 2ATFA 3AG1C 4JZGA 3LSSA 1GK9A 2V4AA 5DAXA 4L8JA 3P6BA 2UWBA 4LF8O 2VTFA 1ZVFA 3BCWA 3AYCA 5BR8O 2IXHA 2VZVA 4Q0UA 3NXSA 1UY1A 1K92A 1O8SA 4B29A 3BODA 5IYBO 1EN4A 3U10A 3Q8FA 3I7DA 3DC5A 2X53S 4UB6Z 4LBJA 2VULA 5L36A 1PGL1 5DZEA 2YEVB 2JENA 3JBG3 3N3HA 2HH9A 4NTYA 1AYM2 2UXDO 1OPMA 3J7MA 2EJ7A 2ZE7A 3E89A 4X1YA 4K1ZA 1H30A 2BE3A 4QU1A 2CGPA 3CJIA 3VL9A 4RR3C 3V0BA 2XDVA 2PMWB 4EE2A 3R05A 1VALA 1KFUL 5BY5A 5BY1A 4GJZA 4FLZA 1Y7BA 3QNEA 3ZRSA 1NVPB 3HN3A 4A7ZA 1I94O 3KZ4C 3JCUZ 5F2WA 4XE9A 3CZUA 2QQVA 4IGPA 2HKOA 3OYWA 2ADEA 1G8WA 2XQRA 2Y8KA 4RYDA 4AVAA 3WR0A 4OYUA 3WT3A 1SCRA 3ZFGC 2P3YA 5EXOA 4MW3A 4C90A 5BUVA 1C8M3 4YGBA 1PZ9A 1FD9A 3I3BA 4MXWA 2VTXA 3H0OA 3ZLIA 2XVLA 5FKCA 2A6YA 1GV9A 5FZOB 5FP9A 3ZEDA 2YU2A 4QX1A 1JFFB 3BOPA 1UZWA 4OUSA 1H8VA 1V0AA 5IVYA 5A7OA 3MIHA 3JQXA 3E8BA 1PM9A 1O9GA 2ZINA 3AK1A 3PUQA 4NRMA 4KU7A 5LGNA 3AL5A 1C28A 3CZJA 1Q56A 3J8F3 3DPRB 2ZXWB 5C71A 2YHJA 1MVEA 1COV3 5F1RA 2PY5A 1AR61 3WD5A 3QO7A 5DDJ1 3IT8A 2NP0A 4XBFA 3WNLA 2RDSA 1F9KA 5FPZA 2BQPA 4CXYA 2EF6A 2WS92 4KWKA 5T54A 3IJ4A 1XE8A 2QKSA 2VL4A 2WLLA 3OPTA 4QX0A 3ABKC 5J48A 3ZR5A 2VNOA 1HXS1 2PZSA 1I1EA 2Q8OA 3DPRC 3I4IA 2VECA 4N8MA 3WP3A 5A6YA 5GJ6A 3L75H 3H1MA 2RS52 1VQPV 1NE6A 4O61A 2VXRA 1RUD2 5JQGB 2QJ1A 1Q8QA 5AC92 4HBNA 2IJHA 4EWAA 4W50A 3VKLA 1MABG 1UF2C 1WMDA 4JTNA 3Q4HA 2Y38A 2MEV2 3MPPG 3AFGA 4IESA 1DCSA 2JD9A 2P7TC 1A34A 4LP8A 1CGPA 4CDWB 2IXJA 3VHRA 3HB3B 2XONA 1SFPA 2ZGOA 2GP3A 4CS4A 4DV5B 1NCRC 3W7UA 5LGUA 1JOJA 2UUAB 5LOVA 3OFNG 1ZBA1 2V1DA 2NN8A 1JUIA 2BUKA 1FXKB 1HB2A 1YEWA 1X50A 4H37A 4J9ZB 5I0UA 3PMSA 2M6YA 3EMRA 5C6CA 3M3IA 3ZMVA 3E6DA 4JRLA 4CDWC 2Y64A 2R1BA 1PIV1 1GYKA 2YC2A 2Q8CA 5ITZA 2AH2A 3NJYA 2YIBA 2VVDA 3M3CA 2IJJA 4UW4A 4A7YA 1B35C 1V55C 1JYWA 2VC9A 3V0BB 3LSUA 1HV1A 2VG9A 1ND2B 1P84F 3A0KA 2LS6A 4ASKA 4IE5A 3U37A 4X66B 1HRV2 5DUUA 4KXRA 4NIAA 3RVHA 4AVCA 5FZ8A 1JZ2A 1RUE1 3T1HB 1D0HA 4H0LB 3FJSA 5IE9A 1KC8W 4PA6A 1Q82W 1R1A1 1JOBA 5E89A 3ZHRA 3JAKA 3K59A 1AYM3 5FYBA 3RZJA 1SQPH 1RMU1 1ND2C 4FM0A 3OMAB 3SPIA 1H38A 4FOWA 4I09A 1LOBA 2I74A 3L71H 2ZA9A 1V6OA 4GZRB 1ONAA 3UKNA 1J3QA 1XNKA 2QR4A 1DP0A 3CRQA 3EQEA 2NZ9A 1PNKA 5EJ1B 5C8WA 1S0DA 3RW0A 3A8TA 2DVAA 5A7QA 2LW7A 2A6VA 5LATA 1RUG3 2OPWA 1V70A 3DSQA 3AG3B 5CA3A 3OE7G 4LBMA 4CH3A 4MXVA 1PO12 4CDUA 2AHYA 5CBFA 5BXZA 5GTHZ 2AZ2A 3LF7A 2ZEYA 2P6CA 2ZM6O 4AL9A 1RYYA 3I56V 3E8GA 5IVBA 3SYAA 4GWJA 2O0OA 2W1UA 1D4VB 2BW8A 1JU4A 2HBTA 2WNEA 1ZA7A 4P14A 1CWPA 2BOIA 1SDDB 2ZOEB 2VAUA 2O8OA 1QJX1 3T0BA 2QZ3A 1WCKA 4TTGA 4RHV1 3BPSA 5KAFZ 1ZZ7A 4AGGA 2XAGA 1S55A 3CIHA 5BNPA 4E4ZA 1VF7A 4NHKA 1RUG1 5IT9N 3BY6A 5C8YA 1VIBA 3OY8B 1FMD1 3O5SA 1WP8A 3BYWA 4ARXA 2PHDA 1PK6B 4OX9B 3ACFA 2BFUS 2JKBA 4M0HA 4Y26A 3LPFA 4CCMA 3HKDB 2F4VO 3D4KA 4LHSA 1RUJ2 1RXGA 3LWCA 1LKNA 4DR5B 1Z2GA 5H9CA 5FFOC 4HVOA 1URXA 4E2GA 1VLNA 2V7QG 2YFZA 3TEXA 2HEPA 3KLSA 5FZ4A 3H1WA 2XASA 1S2KA 5KLVH 1SPPB 2RR12 5B3SB 2ZGQA 4FFKA 1W8OA 1O3TA 4YVWC 4XJAA 5JXGA 1PNLA 3H1YA 5KHKA 1WLWA 4PA4A 1NG0A 4RA0A 2VMIA 4RS5B 1L0LH 1RUE3 2P1BA 4YM0A 2QE7G 2ARCA 4ET7A 4BQ1A 4P2ZA 2W91A 1IG0A 2VQUA 1NJIW 2VTXJ 3LSDA 4OUMA 2ZTNA 3UT0A 1VBE3 1QHDA 4AVBA 5M0TA 1BHAA 2DFCA 2RS51 1OCRB 5FNVB 4DMIA 3AP4A 4QKBA 2J1UA 3SNMA 2DN9A 4Y3OA 1TUEB 5CZKA 2EICA 3SCFA 3LGRA 1QH6A 2X5IA 3MLLA 1LGCA 5BR8B 4Z82A 3B3QE 4JRAA 2WSUA 1JI6A 5FPVA 2CAUA 3VBBA 3LEGA 1US3A 3G67A 1CAUB 1RUD1 3CS5A 4JI2O 1G9BA 5LP6A 1N47A 2KB1A 4EN6B 4R9BA 5L7OB 2JDPA 5H6RA 1NBMG 3B69A 4FP2A 1I5ZA 3ZRVA 1Q6HA 2J1AA 4KH9A 4UYBA 1CPYA 3D3IA 2KSDA 5L3DA 1LULA 4K21A 2MW2B 1RUH3 1I5PA 3RYFA 3ELNA 5FPBA 4JDMA 3STZC 1LESA 5AVPA 1BXHA 5LXTB 3JB4C 3RRDA 2RMU2 1QOTA 1GN2A 1QH7A 3GCWA 5FZLA 3E6CC 5E16A 4K3UA 5FJHA 4CP1A 1SBFA 4JQTA 2WN2A 5JQGA 2LGQA 3KQ4B 1DK1A 5GZGA 1U12A 5DXDA 4FQ4A 1OKOA 4P02B 2JG8A 1SLIA 1ULPA 1U5YA 4COZA 3HAGA 2A3WA 2CYFA 2WLLB 2ZGNA 3ST7A 1LGBA 1IBMB 2W2IA 3I54A 4YXWG 1LNSA 2I07B 5FZ7A 4YZ5A 2X6AA 2WN3A 1AF9A 1UXXX 1COWG 5I8YA 5FY5A 4EKWA 5FAXA 1YI7A 1A32A 2TNFA 4C0HA 5JPMB 2A70A 2PLV1 1HR0B 4C1XA 4TLGA 2Y0PA 1J84A 2EIMC 2R72A 4LIUA 5AG2A 4XAEA 1OI6A 4JGYA 1GFF2 1ENQA 4A42A 4LLFA 2A6XA 4NXMO 2QWQB 2QQWA 4JPRA 1CIWA 3OBTA 1U5IA 5IJ9B 3MIEA 2M7WA 1LU2A 4F4LA 1PGW1 1AP5A 1XNBA 2X8KA 3RT3C 3SCHA 2C2AA 4YNIA 1FXVA 1LJ7A 3PJQA 1ND3C 4B3NA 1WAZA 1DQ4A 1X82A 1OJHA 1W9FA 4OQ9A 3VUOA 3APOA 4H13B 4YZ2A 3KKYA 4AILC 1XYPA 1EV11 2WT1A 3AG4C 4IEUA 4EWEA 2ZD9A 2RS33 1YIPA 1L7LA 2FMLA 2LW8A 4BQ2A 1Q8VA 4PIZA 1F4AA 4JGZC 3HN1A 4IEZA 3FL7A 3HIFA 4P9YA 2BVBA 3CJIB 1ZTEA 4XYXA 1UD1A 1UYZA 4FM1A 1FT9A 5KXDA 1W6NB 4GB31 1G6NA 4J6GA 2ZE5A 5J98B 4AK3A 2Q7GA 2ZE8A 3WSOA 5D5PA 1P4RA 4UBGA 5FJKA 3SCGA 5LRRA 5L73A 3IGAC 2UWAA 4XFGA 5HFMA 1GICA 2BU9A 1QNYA 4Y5TA 3VBOA 4QWNA 4FP3A 2VW0A 4D7YA 3M99B 2G4IA 3APBA 1A8MA 3ACHA 3WUCA 2GTAA 4XILA 1U0AA 5LMUO 4DUYO 3WP6A 4GD4A 1COV2 3SYPA 3K06A 4HZFA 4Y5Z0 3FX7A 3K58A 3GBWA 3RZMA 2WWSA 1RL3A 1EAH1 3VKOA 3ZFGB 1ZREA 2TEPA 4TN7A 4DR1O 4YJ2B 1HQLA 2A06H 2C9AA 3M3OA 1O59A 4K8RB 5H5NA 1MEC1 3T1MA 1OURA 4IV1B 3FLPA 4AOCA 4FSJA 2RJLA 3QD6A 4UCRA 3EB7A 4LUKA 4LBLA 1Z7S1 3CMGA 3FWEA 1ZNPA 5IJ9A 1XNQB 5FPOA 4JTOA 4FO9A 5LHIA 1G9AA 4LFAO 4N53C 3MLKA 4XBLA 4CH6A 4RGAA 3AMQA 3VZKA 4CPBA 4JGYB 5KX5B 4EB6B 5TSWA 3NJVA 3DGTA 3ZFFC 4Q0SA 3ZN1A 2R32A 4XW3A 1NA1A 2XWJB 4B7EA 1SQQH 1DLLA 3RZGA 2VBPA 3SHRA 4DV6B 1JOYA 3PNAA 4BDVB 4DXRA 5EIBD 2O8QA 4D7SA 4LO5B 4QPIB 3MV01 3QBQA 1OLME 1NH2B 1GWMA 3K3OA 2JEXA 2VQFB 1VMJA 2WNVB 2DCYA 1SZBA 4Q0PA 1PVXA 2EJRA 1XB9A 4I9QA 4YSFA 3VDCA 3ZN6A 5EZWA 1CAWB 4M00A 4OXSA 3V64A 3ZFFB 4NWWA 4HSJA 2JG8B 3S30A 4X8NA 4LE3A 3MV11 3CCMV 3FUOA 2CWMA 2BRTA 1G9FA 4PBOA 4YVSC 2BGPA 5EJZB 1R1ZA 3CCSV 3AKSA 3O14A 3E5UA 4LBKA 1XDCA 1XPWA 3S3XA 1ULEA 3POWA 1V6MA 1HNWO 1Z5VA 2UXNA 2P4EA 4ISRA 1WNSA 3IDAA 3HKBB 5K0UB 3DGEA 3D3QA 4IYHA 1HX6A 1YDXA 1Y76B 4V2VA 3VDDA 4FOVA 5C3SA 4CDXC 4W6WA 3GB7C 3L2YA 1GOFA 3K0GA 4EJRA 1MQTA 3L70H 1JCHA 2QWOB 3TRSB 5GLWA 5LP6B 4J7KA 1YFYA 2XAJA 1SETA 4HANA 3A21A 1PO11 3ZCCA 1W3XA 3SKVA 5EZYB 3PU8A 3CRMA 3H50A 2JIJA 2JG9A 3K79A 1YWKA 5LMUB 2MPFA 1OD3A 1PGSA 3KWVA 1REFA 2JDIG 2XUEA 1Y9QA 4XACA 2BV4A 3UQ8A 3THCA 3OR7C 2ZQMA 3H1LH 2Z69A 4M3CE 1AX2A 5ACA2 1OQDA 5K0UA 3VBFB 2JDYA 4A6OA 3HKBA 4UF0A 2KQXA 1KMIZ 4DUYB 3R4DB 4AF9A 1RUH1 5BNNA 2E53A 5CB7A 4NAOA 2GTSA 4LH7A 4IEWA 1RUNA 4WVWA 4HONA 1XU2A 4NPLA 3CJIC 1V6NA 4AVVA 4Q4V1 1IS4A 2R9IA 4GWIA 1G86A 2K9ZA 5AVAA 3K08A 1EV12 4CXXA 3S57A 3NV1A 4LFAB 1IDSA 4CP9B 1DDLA 2EAKA 1RUD3 4NOTA 4LFCO 1YF2A 1UJWB 1BS3A 3H8UA 4I3PA 4IQPA 4FPEA 3RJRA 1VMHA 4QT6A 4L11A 1AYN2 2VQ0A 4LK7A 1CZTA 4Z1MG 4KWLA 1NY72 1FAFA 3NNMA 1W2NA 4CCDA 2ZR2A 4UVCA 3B8MA 1CN1A 2WWJA 1K5QA 4N9IA 4EB6A 3HQXA 3FHQA 3QTCA 3SQOA 1OVPA 4ATFA 2CGOA 5JI7A 2JICA 4D6RA 2D5HA 2VY0A 4O4LA 3JD73 4CUBA 4N43B 1OVSA 2LRPA 1ORQC 5F6LB 2A7WA 1AR72 4KI5M 5D5QA 4FCAA 2JE9A 3UCSC 1QQP3 1LECA 1VP6A 4A2UA 4IEPA 2UXCO 3HNMA 1SMVA 4PV1B 3S7IA 4JYYA 2JJ6A 5LRSA 4DS0A 3GVMA 3BALA 2Q1MA 4YG3A 4LBNA 5KR7A 4BQ5A 5CG9A 2IZWA 1Y67A 5KUKA 2PHRA 5FMOS 5FO7B 5ACA1 1HQWA 1L8DA 4MVRA 3CLPA 5C33A 2OUJA 4HK8A 4XFFA 5EFUA 1YI9A 5JH7A 3VBOB 4X89A 3O1OA 3WG4A 3VHPA 4B1LA 1LUVA 3JAKB 5A3NA 3UO2A 1OHHG 1BE3H 1ZZ6A 2NMOA 2VCAA 5GZEA 1NU1H 4NIIA 3T2QA 4PA9A 5FLXN 4RQFA 3WDXA 4XDJA 4B4QA 4KFMA 5EBLC 5EHDA 4RAIA 1MSWD 4D0QA 2B8MA 5FZMA 4KGQA 2XR4A 1W6NA 3M4FA 2CNAA 4X1IB 2D98A 4X6QB 1YLLA 5FYMA 3CL1A 3CD6V 1VBA1 2E74B 3R6SA 4LKSA 1GQGA 1R64A 4MGYE 1YQ6A 1LODA 4J1WA 5CFCB 3AMPA 4L9BA 5ITZB 1YJKA 5BV6A 4DW1A 4XJ8A 2G19A 3KV5A 1YTFB 1I7FA 2ZKLA 2FDGA 2F6BA 4PDVA 2HWD3 3QG5A 3FBMA 1OFNA 1HV0A 4ZU5A 5FWEA 4DZGA 2A3YA 2QDOA 4FTBA 4ICGA 1CXZB 4QGNA 1ULFA 3O7OA 4DV1O 3MDPA 1RMU3 3SEEA 2OYQA 1WZXA 5A3LA 4CDWA 2BP6A 4AR2A 4XPVA 1VBA3 1EP0A 1R1A3 4H2AA 3RYHA 1UMZA 4GKKB 4MS2A 2XOKG 1CP9A 3O1UA 2RG4A 4UT5A 3C3TA 4PELA 4DYLA 4OGQB 3MW3A 3PVBB 3RVYA 1OUXA 2QQJA 2P06A 4X65B 1PD3A 3KZIZ 1IBKB 2RMU3 2WDBA 1NZCA 3QCWA 4FFFA 2OCCB 4I0BA 5FY8A 3PUIA 3K9SA 1RUH2 2PHLA 4CTEA 1GZ9A 2WZR3 1HP8A 4GMP1 1KD7A 1QGLA 1ZX5A 1FFXB 3NAPA 1SFYA 3VZMA 4YW6A 1Y74B 2BNOA 1PHMA 3F7YC 3ZHUA 1JU3A 1QQCA 2AGAA 3WXPA 3FN9A 2Y4UA 2X0LA 1MEC3 1K4CC 2PAEA 3ES4A 4BB3A 4Y20A 2RVAA 1H2NA 4JI5O 2HWB2 4AVSA 4Y1YA 3LD8A 3ZYGA 3JD3A 3RYFB 2VRZA 2IUWA 3GJAA 4Q8LA 2Y48A 4U2AA 3H1HH 1XMOB 4ASMB 1SBDA 4MVOA 2ZJCA 4NPRA 2FCUA 2CTVA 2VCCA 4QDSA 5FXVA 3VBUB 5IHRA 1E5SA 4HOOA 1FFXA 2WFF3 3NAPB 1BK1A 1R093 4P5YA 4Z8BA 4XDLA 4QIWF 4Q0QA 4DUZO 1P49A 4PD4F 5IUQA 4FTEA 1VQ9V 1J5EB 1JYXA 1KU9A 4JI8B 4D7TA 1POV1 2RE9A 5A9GA 3AP9A 3TNPB 2JK5C 4G3YC 4JGZB 3GJBA 4XJZA 5AFBA 1FYUA 1Y3TA 3H1KH 2UU8A 4JV5O 2XAHA 2XWBB 5FR3A 4GH4B 1U5XA 2ES3A 5A3TA 1XEQA 4AFMA 2K46A 3QO8A 1HRI3 1ODMA 2W08A 4DQAA 3ETGA 2WT0A 2OQ7A 3I2HA 4O9GA 2W52A 4XTPA 4J1XA 4JI7O 2VNVA 4LBQB 4DUWA 3VQYA 2WZR2 1R092 2Q0OC 2HWF2 3ZMZA 2WFF2 3NNLA 4LA2A 4IE0A 4LF5O 4RFT0 4F83A 1OV9A 4YW7A 2L6LA 1RUJ3 1UN1A 3MGUA 3UNPA 3ZMUA 1GWKA 1RUG2 2GZWA 4Q4V3 2BSKA 2OIEA 4DRXA 2K1EA 1C8M1 5KBFA 4BMBA 4FLXA 2EZOA 4TXWA 1W0NA 1SS3A 1SQXH 2WAAA 2Y34A 2WWUA 5I93A 4IV3C 4EN7B 1PVC1 3LB9A 2ZX0A 3B8NA 3FE5A 1DLCA 1BZKA 1O91A 4KU8A 2YY1A 1BHBA 4ZOLA 2PAKA 3I5DA 4BOWA 2AC1A 5A6XA 2HWD2 4AI0A 3HT2A 5CA0A 4UVBA 1MQTC 5H9QA 4CU6A 5KHGA 3K75B 4XCAA 1WMXA 3OY8A 4CDXA 4PIXA 1PMIA 1W9WA 5D1IA 2PLV3 4AEJA 1SLAA 2TBVA 3R4SA 5FZ3A 5BNPB 1SG3A 3O0VA 2ZX3A 2UWCA 4UFIA 1A8DA 1HRV3 4QAWA 2YZ4A 2PYTA 2HEWF 2AW9A 3J7AU 1WPBA 3RZKA 4I7ZB 4E4HA 4K7JA 5B66Z 3VD3A 4DK1A 3DECA 2VMDA 1WJZA 1JBCA 4PQ9A 1YJ9V 2Y26A 2Y0OA 1VBA2 3K3NA 4PF1A 2PQSA 4Q5OA 4QPIC 3MO4A 1J1LA 3ZIAG 2FMYA 5BNPC 4K6BA 4Q2FA 5B1BB 4LORA 2VQEB 4JASA 2IM9A 2VUAA 1XQNA 1W2AX 4UW3A 4WFEA 1O4YA 2FDIA 4BQXA 3L72H 4DV7B 1AR5A 2LTNA 1DQ0A 2P4KA 3T09A 1NOVA 5ISLA 4H33A 2DQ0A 4KL1A 3RGBA 1EM1A 1QDCA 2IU0A 5DQ0A 1UCXA 5DABA 4MYEA 4O65A 1K12A 4BLJA 1GNZA 4KG8A 1PL0A 3AX4A 4G4FA 1RHI1 2RV9A 3SITA 5F3IA 4HZ3A 2OZ6A 5K0UC 3QLQA 2OCCC 3ZRWA 4CCKA 4W6XA 2NR5A 3OD0A 2RCVA 2CTRA 4QKFA 3JAMN 4LF9B 4LITA 1HRI1 3DYMA 5F3GA 2OTJV 2E63A 2GC0A 1QU7A 2CDOA 5IW0A 5LP6C 3ZHQA 1BCXA 3AZZA 4QXCA 1DGWA 1S0BA 4CDUC 1JN2P 4RS5C 4DUVA 1KP3A 1POV3 1UX7A 5FMOL 3RJ2X 3ABZA 5A80A 4BA6A 1RUF1 1XOYA 2W94A 3VN4A 3WF2A 1Y43B 1ROPA 4MLOA 4N53B 2HEYF 4LTAA 2VOWA 2GN7A 4Q8KA 4JQRA 5A33A 3LEKA 1N33B 1AYN3 4HT1T 1BVP1 2R70A 4LF9O 1MVQA 3D0JA 2Z79A 4XCBA 4P9PA 5BNNB 4XBQA 4LFCB 1ENXA 3PL0A 3IFXA 5A3MA 3MHHC 1AILA 3TEZA 4XOGA 5A1FA 1SQGA 5E1AC 5C5TA 3B09A 1KFXL 3VZLA 2WAMA 2Z5WA 1HB1A 4IGQA 2WNVC 1US2A 2PF4E 1ZRIA 4I0XB 3LNMB 4BU2A 1V54C 4CUAA 2JJ2G 2FDFA 2YPJA 3B5LB 4AWDA 1FOD1 4BIFA 5LA6B 2JG9B 4RQPC 2DV9A 5DUVA 4GH4A 2H6CA 3GM8A 5EC1C 4YIPA 3UKVA 4IGOA 4O4IA 4XUTA 2HVKC 4NYKA 4E27A 4FLTA 3CC2V 1VR3A 1O4TA 1Q90D 3E5QA 2YXSA 3UYJA 3SMHA 4NTWA 3B2EE 1V6IA 4IGGA 5H2FZ 1RC6A 1O3SA 1Q7YW 2WABA 4DV1B 4AXOA 2P22C 4UAPA 5LB6A 5FOBB 1YFUA 1RFYA 4HYOA 3NL1A 2D2CB 2JJ1G 1ZM1A 1FNYA 4BIOA 4MTXA 3IPVB 4DO0A 5IVVA 2QDNA 1KKDA 1WCUA 4MH0E 3T1CA 4FLYA 1OF4A 1AL0G 1EV13 3AG7A 3ZIXA 4DR3B 4CS2A 4JZRA 3JCIA 5T5PA 1JA8A 5L9VA 2CK3G 3H8XA 2HP8A 4KQ7A 4DV3B 3WW4A 2VUCA 4XBNA 1H9PA 1JFFA 1M06G 4DV0B 1YXBA 4A45A 1GOHA 1UX6A 1RVF2 4GT1A 2W39A 3VD9A 2E32A 5F3CA 1A3KA 4MVUA 2PLV2 2R30A 3WF0A 3POGA 1CD3G 3BHPA 5CAZA 2GSYA 1W3VA 2LUWA 3B94A 2OWOA 4UI9L 3RZLA 3IIAA 5B1OA 5EYPA 3WP4A 3WV6A 3HJRA 3DL3A 3WDYA 1SC5B 1LU1A 1EUUA 1UY2A 4XFAA 1NTZH 4QXHA 2OT5A 4P5HA 1WB7A 3THTA 5CN0A 1XMOO 2VO5A 4C0BA 3RYIA 4HPKB 2FBEA 1LHNA 1EY2A 1S4CA 3K0DA 5H6QA 3CRAA 3UETA 4JKLA 1J58A 4I3GA 3ILNA 3JD1A 2RJ2A 3CU7A 2VH9A 4HKLA 4ONUA 1Q3EA 3T4VA 1YJLA 1HB4A 3ZYRA 1N33O 4KG0A 3OR6C 4N23A 3N35A 4UFHA 1SFNA 3WFVA 3KD4A 3AKTA 1QVFU 3OBAA 1UOGA 1ZBA3 2HLDG 5A7NA 5KAIZ 3OGRA 3UV9A 3HNYM 5LY2A 3NW4A 3EFFK 3OSDA 2QQKA 1VQLV 3RYKA 5FXWA 1H2LA 1IOAA 2DBIA 4BW5A 4HNAB 2B45X 2WR9A 3ZXGA 2YGLA 4GALA 1XHZA 3HQRA 5FZHA 5T5JA 4AFCA 3VBRB 3CCLV 4N43C 2QM8A 4S2FA 5IK8A 4ZY9A 5LMNO 1PIV2 4COYA 3FLTA 2W1SA 3D5OA 3JU9A 4UUJC 1Q8SA 1W8HA 2VZ3A 4GX1A 4C8DA 4I0WB 4QB1A 4WVMA 5JH7B 5LGTA 2EZPA 5FXXA 1JUHA 2ZACA 4RFRB 2ZXWC 1P7GA 4PLMA 4ZZ5A 4GQ7A 1MNGA 1SHWB 1B09A 1SLTA 3G6BA 1MS5A 4K0KB 3VKNA 3QACA 3ZHTA 2QKCA 3T0DA 5DDJ3 2P2KA 4QX5A 1KXGA 1LRHA 2V72A 4CCEA 5FP4A 3C3VA 3GCXA 3KHCA 5C3OA 3TK1A 2OX0A 1F4HA 3TEWA 1X33A 1U97A 4EYUA 4EN0A 3ZXJA 1AXZA 1UOBA 1QR8A 2ZM6B 3U1XA 2QBXA 1UPIA 2ZGLA 3R0RA 1QHTA 1PM4A 4Y1VA 4WBBA 4OI4A 3PTYA 2DJVA 2WNUC 3MUY1 2XPJA 3RI9A 1BBT1 1R082 3AYAA 3RSJA 5IATA 3WQ0A 1Q5OA 4META 3CCEV 5FZAA 4N43A 4MVQA 2VM9A 5FREA 4P30A 1W2OA 4O4LB 3G6JB 3WEZA 2W0XA 3HBZA 1WW4A 2VBBA 3KF5A 2AEZA 2QGNA 1XNRB 2VZQA 3D6EA 3AMNA 3K4AA 4URTA 5CFCC 5F5IA 1SQFA 2B1IA 2RS32 4PCRA 4CSWA 4YZ3A 1M57C 3ZIWA 3VDDC 4QGPA 2UXCB 5H9PA 4DO2A 3I8TA 4JI0O 5DAPA 1N3OA 1W8WA 1QJX2 1S2BA 2PFWA 4QJFB 1VAKA 4ES9A 3GZEA 3GGLA 2FD8A 1PO13 4JYAB 3M1HA 2I45A 3VQVA 4S2HA 1V55B 2WYSA 3UM7A 4X20A 1VRBA 5F2SA 1TUBB 2JKXA 2XJTA 1YO8A 1F35A 3JZVA 2Z2SB 3MI8A 2VVFA 4B4RA 4F6EA 2AUYA 4NIHA 3J81N 2RQ6A 2Y0IA 3THDA 1N4CA 3GBFA 1GZWA 1BL8A 4TQFA 1W2BU 4U36A 5IY5B 4LF6B 4LULA 1JYIA 2C26A 3WNKA 2B42B 4AHXA 4IEVA 4Y1ZA 4XHBA 5CNAA 3JALB 4JHZA 3BTXA 2WAOA 2YXLA 3VKFC 4LBEC 2Z5UA 1OUSA 1DYOA 1IGOA 1TE1B 2ZKNA 1GZWB 3PTRB 1JZ3A 2HR3A 4HSLA 1VQOV 2BBVA 2W1WA 4ZIBA 3JARA 2E6VA 5L7OA 1CAXA 1GRJA 3M2MA 2KKWA 3KT1A 2WLHA 5HCAA 4XUPA 5DAWA 1EPZA 4N53A 5JLVA 1CAUA 3ETDA 4JI3B 5IY5C 4GLXA 3TOJA 2FMDA 1D5AA 2D6PA 4X20B 2HHHB 4XC9A 1M90W 3M8LA 5A32A 4WM7C 5B1AC 3T08A 3ME2A 2WLNA 1VF6A 5FZFA 1MQTB 3WB2A 4Q26A 2H8PC 4GKJO 3VD5A 5LK7B 5DM6V 1O9HA 2A5ZA 4I55B 1UW8A 3BCCH 2PUSA 4OFGA 4OHYA 2F43G 3ORJA 1K73W 1QQP2 3KVAA 1NX9A 4P9IA 2HJDA 1AR71 3C7GA 1NTKH 1AR73 4GKKO 2KXLA 5B1NA 2EIJC 1GZCA 2AHZA 2EXKA 5B1AB 4WM7B 1X4TA 1Z7S3 1YQ2A 1ZAUA 4XF3A 3JQWA 1PV0A 2R9RB 4RWUA 2D43A 3HR0A 3FB6C 1QVGU 2OS2A 2EX3A 1PMHX 4GH4C 4BQYA 1NA1C 4OUEA 2VUJA 1P7BA 4DV4B 1D2SA 1RHI3 4JV4A 1WWYA 1CAWA 3NRUA 1V6LA 1MA1A 3BB6A 3ZN6B 5GW7A 3OBRA 4IETA 2QSAA 1X8EA 3K3WA 4CC5A 3RWRD 4UFJA 1YIJV 1EPWA 5IJ0B 1V00A 4XF1A 3CX5F 1VAMA 2OXBA 4IE7A 5BXXA 1NA1B 2CY6A 4R7CA 2DWEC 1GO3F 3IBMA 3O0WA 5K1XA 1SQBH 2HFEC 1WW5A 3BA9A 4PA3A 2LP7A 1XL6A 4QQ2A 1N1TA 2WNOA 3UT5B 1B04A 1R081 1RPOA 3S5AA 2UUCO 1K3EA 2WSVA 3PJYA 2GUZA 2JIGA 4J9YB 1W6MA 3ECQA 3I2GA 5JOWA 4AGRA 2SBAA 2K2SA 3CXCU 2WNUB 2FHRA 2ZGMA 2GC3A 3NJXA 3FAVA 3J8F1 4J7ZA 2E9QA 4UFMA 3WNXA 2VZSA 4O4HB 4AQYB 3SYQA 1H9WA 1H8EG 4YGDA 3IDEA 2DWRA 1VBC3 4NRQA 5JIAA 2WLPA 4BXSV 1R3LC 3W59A 4GX0A 1M5IA 5EWSA 4CVUA 5HFLA 1ZBA2 4K40A 4B8EA 3KF3A 2BCCH 2XLFA 4E4EA 5L7OC 3BVOA 4QX8A 1TG7A 4TSVA 3WINE 5FTTC 3DYPA 2A71A 2R072 1WA6X 2UUBB 4QU2A 3NO8A 4XDOA 1XBLA 3G6EV 3AC0A 3A0BZ 1WD4A 5A3WA 3FFZA 4DRXB 2BSKB 5C7GA 4S2GA 5IAXA 2ZKOA 1G9CA 2JDAA 4DR2B 4YG6A 1B6QA 1R6KA 5J2TB 4MUVA 4ATEA 5JJEB 1AR83 1BBT3 4FPGA 3CP1A 3CB2A 3ILRA 4UFZA 1RUJ1 3C7EA 5JSRA 3W21A 1UY0A 3M70A 1HW5A 2FTKA 3UL2A 2ZIOA 1QLEB 1NKGA 4RQPB 5HXVA 4CZSA 1W0PA 2ZX2A 4AVTA 3E86A 1W0OA 3M7MX 1CX1A 2WYFA 4DR3O 2WQ4A 5FZ0A 2GP5A 2CUGA 2GC2A 1OQ1A 2V4VA 4MGQA 3JBG1 1KUQA 1QJY3 3N7JA 3S3WA 3WOGA 2J7MA 4HAMA 3K57A 1OLMA 2BWCA 3HT1A 5C70A 3N9LA 4KWJA 5LOVB 2ZMLA 2F95B 5JMCA 1TNFA 4Q4Y1 4PDRA 2EIMB 5EBMC 3WF3A 1VAVA 1MG1A 2WINB 2VXJA 1E1QG 2H0BA 2R6QA 4MGTA 3M3EA 3X29B 1ULOA 3W20A 4XXPA 2ZHNA 3MIBA 2V73A 3GNEA 3ZJZA 3E22A 2AYHA 4IE4A 3DYOA 4Y33A 3Q4HB 3I3EA 3ZN5A 4Y20B 5T3NA 2ZX1A 1E57A 2C6SA 5KC6A 4F6RA 3IPVA 4YWAA 4OPAA 2F4VB 1KGYA 1BVVA 1ST8A 1SLCA 4BZ4A 3P5BA 3SH5A 1OH4A 2JWPA 1Q6UA 3WLUA 3B40A 4BR6A 2TUNA 2DF7A 3FUQA 3FFQA 5BNNC 4GJYA 3ZYIB 5F5QA 1PNMA 1W6QA 1L1FA 4AI8A 5L9RA 5F9TA 4GKXA 1VBB1 2XHKA 3N7MA 1SF9A 3ACLA 4Z92B 3WVJA 5B5EZ 2RS53 2RMU1 5FPXA 3OD4A 1STMA 5LA6A 4YZ1A 2FCVA 2MEV3 4BAYA 3NAPC 1AI4A 3I3DA 3WP5A 1RTVA 5BYNA 4QNHB 1X8MA 5HCFA 4I0XA 4FPYA 3CE2A 4JHTA 3WY6A 2UUBO 4U3FH 3WDVA 1PVC2 4UCOA 3H42B 4RGGA 1K34A 4QKDA 5JXIA 5C4WB 4LHLA 4KBZA 2EULA 5IFPA 3O1VA 4CP2A 1AHSA 5I0SA 4ZBMA 5FZ9A 2VOKA 4YVWA 5IDJA 2XH6A 3JD72 2J42A 2VR4A 5D21A 2ZGUA 3DXTA 4DY3A 3S0MA 4WFFA 1TMF3 3AEIA 2VQTA 5JCTA 5JIUA 1O4ZA 2GDFA 3ES1A 1ZSPA 1C8NA 2ITDC 3ABLC 2CDPA 2QWRB 4XFCA 1IPKA 3BUCA 3HNBM 2FKXA 2X5IB 1DZRA 1LOAA 4AW7A 4XF9A 1ENVA 1NT2B 2SLIA 4FBFA 4ISQA 4YLZA 1LB2A 3F2ZA 1RM1B 3JD0A 2O14A 3OUJA 4A7KA 3PVOA 5EBWC 4QDQA 4HMZA 1VQNV 4BK4A 1VB2A 5FP3A 4NKGB 4CU7A 3BGAA 1UMHA 2FYUH 4LFBB 1AUYA 3IIIA 1JW6A 2VS0A 3THPA 4Q1RA 1GLHA 3LQCA 2B39A 4RS5A 1QOOA 1D2DA 2UUAO 2XKPA 1HDJA 1BKZA 4ARYA 4X65O 5ABJC 4MGIE 1YIFA 3DCQA 1IBKO 4H7LA 1KDKA 4JTCB 2VMFA 5HCBA 4GZ9A 2HJFC 3E6BA 1WB8A 1POQA 5FUPA 3M8AA 2YPDA 1XILA 2ERFA 3PUAA 1W8UA 2D3SA 5ACA3 3ACGA 2ARAA 3KB5A 5FMBA 4UCTA 4QX2A 2R071 5FYHA 4B1MA 1W9YA 1WPXA 5JJJB 1NUKA 1AX0A 4UCVA 1QIQA 1XJAA 4FFBB 4N7IA 5C8YB 1XREA 1K5JA 3MYXA 5J2UB 3WQ7A 2WLMA 4RSUA 3ZHVA 5FV3A 1B35A 3NKGA 4MV2A 5I91A 1MOFA 2Z3YA 2JB8A 4W65A 1IS5A 1WLCA 5B1BC 3F7VC 3G7DA 1AR62 2GNDA 3N7KA 5DG2A 4C1WA 1YQCA 2Q7HA 3C7HA 3BEHA 4CCLA 4S2DA 3JD71 1S2EA 3ZMOA 4CUGA 1D7PM 4FPKA 4MGSA 1BQ0A 2FZ2A 5SV8A 2E31A 1FOD2 4CDXB 3OUSA 2RDCA 3LNNA 3ZYPA 1REDA 4M01A 4ZXKA 3LDRA 5FQ0A 2AENA 1YVWA 2BGOA 1XHXA 3CMAV 2IH1C 1C57A 1EUTA 3CMEV 1OA2A 3R4UA 2R0HA 4AHYA 5FYSA 5L3FA 4OQ8A 1ASJ1 2NLJC 4I50A 2DWDC 1AR4A 2ZBJA 4OPHA 1XU1A 1JH5A 4HL0A 1ND3A 1UIJA 2QWPB 2ZGRA 1NQDA 1AB3A 1N1VA 1DF0A 1RUOA 3MICA 1KP2A 4YYOA 3A2FA 1H0BA 2VJXA 3GDBA 1Y4MA 2BWAA 4QQHA 4FLUA 1W6PA 3WG1A 2R0FA 4XABA 4JKKA 4CE8A 1O7FA 1N1SA 2QEXV 1VBE2 3Q8BA 4UF0B 1K5SA 2FDJA 2OQ6A 3A0NA 2QE3A 3VBFA 4N9HA 3WX5A 4OX9O 3POYA 3ZO0B 1RUF2 2Q69A 1WMFA 2QM4A 1RUE2 1K97A 3JATA 3SJAC 4QQLA 3ZX6A 1YI2V 4JDOA 5J7MA 5KXEA 3C7FA 3FB8C 1M4UA 2OZJA 2BFUL 3I2DA 1HXS3 3H8OA 5EK0A 3AB0A 4A44A 2ZX4A 1VQ4V 2ZHLA 1WCDJ 4LNUA 3UKTA 3ABKB 1Y66A 3Q9OA 2HG5C 1OQEA 5BNOB 5GZCA 1WCSA 1CX4A 3CC7V 3WNOA 4LO6B 1BMFG 3OGVA 1AR1B 1RSOB 4ZXEA 3VDDB 1DGLA 4DFSA 2CH7A 5FUIA 4JZ2A 3VBUA 2JG9C 4QPKA 2XJQA 4K0KO 4MX3A 2UYAA 1MPXA 5GZDA 4QX7A 1QJFA 1ULGA 2YIBD 2R043 3EHKA 1VRH3 2DDUA 4G27B 4NHXA 3T1YO 1O6UA 4NTXA 1OA3A 4D6SA 2ZEXA 1WD3A 2Q4PA 5BMVA 1V9U1 2UUCB 5D8AA 3I3MA 1MZ6A 1YXWA 4H3WA 2BYVE 5A6QA 4I9WA 1CAVB 1GNYA 2QQOA 1CVNA 1VJ2A 1D4M1 3SJBC 1AXYA 3RYRA 5BNQA 5JSPA 4V1PA 3JAWA 3RWNA 2E7QA 2PAMA 4PLNA 3CJHB 4QPIA 4RR3A 2YIAA 1NI8A 5FP7A 4YVSA 2ZZJA 2Q68A 4PBPA 3CEWA 5IJRA 3TETA 2JB4A 4SBVA 4XHXA 1ALYA 4JI4B 1OF3A 2HWE3 2QQIA 5KX5A 5GLTA 3MZHA 2XT9A 1WA4A 4DV0O 1GKBA 4QHOA 4OLLA 4AG4A 2IJIA 4JVAA 1CESA 2DUQA 4R6ZA 3BPZA 2YSUB 3CYOA 4CPBD 4FOQA 2WLIB 1RVF1 4YHHO 1D5NA 4MXWB 4FQZA 1TZOA 4MTOA 2FL4A 3GWKC 3MIDA 4CCCA 5C8CA 2RJKA 2XVGA 4BK5A 3PUSA 1K5MA 2GN3A 3OYWB 3HBKA 3OEHG 4JV5B 4EEQA 2K0GA 4YM2A 1R73A 4IV3A 1QBZA 4E2LA 4O2BA 1DYPA 3N2GA 1XNAA 4JI4O 1F7YA 4JX0A 2XXZA 1CIYA 2EIJB 2NM1A 1OCCB 5JVVA 1BQZA 1NQJA 4LOSA 3AYEA 3OPWA 3OF1A 2ADPA 1EN6A 2J22A 1DG6A 4FFIA 2B9UA 1PO23 4O2AA 3IKWA 2XJSA 1PX3A 4XDKA 3UJOA 5IYYA 2YEVA 3WUDA 3OUFA 3NVCA 4R8CA 1A78A 4N90A 3DXUA 2IW5A 3P30A 5LZ6A 3CEIA 4JDNA 5DMYA 3LEMA 2XVKA 4IE6A 2XLAA 1LOGA 1MS3A 1PX4A 5HPOA 4GUNA 4LHNA 1M56B 1W90A 4AYUA 3VBRC 1GP4A 2DCZA 2VUDA 5CU1A 1W28A 1HJGA 4EROA 2N05A 5FY1A 2W6JG 4M3CA 5FK7A 4GB33 4EQVA 5SV5A 4Q4W1 1H4GA 2VU9A 3MHZA 4NR1A 4DR1B 2YU1A 2WL1A 3OPZA 3T1YB 1YQ8A 4X66O 4QM8A 3IN9A 2EINB 3BAAA 4HVQA 2OIIA 4FXKB 5B3SC 2C24A 3T1HO 1TME2 3ZFEA 1BEV3 2PHWA 3Q8CA 1H2KA 4YY3O 2P37A 4JAAA 1W06A 2CAVA 1LHWA 4QPYA 1W9TA 2YICA 4TV8B 1VPHA 3T1LA 1DFQA 3FX3A 3LDCA 1KYOF 2WPDG 1FPN3 4LA3A 4XURA 2PHTA 4FM2A 1RJ8A 2XB6C 1PO21 4WFAV 4UCSA 5A7WA 5F32A 4LWSA 5F3EA 1X36A 3UESA 4QMAA 1F23A 3QH7A 3MW4A 1KQRA 4AEDA 3KGLA 3V56A 2A79B 3WNPA 5CBLA 1FJGB 5HV0A 2FDHA 5JMOA 2YC4A 2ZAAA 3OMNB 4NJ4A 1NLSA 5E1RA 4B4PA 1WBFA 1GKFA 2WO7A 5F5CA 4CCJA 1DQ6A 1QJU3 2H3OA 3I2FA 4E8DA 4L92A 2ARXA 1JS9A 3N9PA 1S5HC 4GKYA 3HPLC 4B3RB 1G7YA 1JXNA 1T2XA 5F6KA 3Q8AA 2AR6A 3AKPA 1D4M2 1PPJH 4K8ZA 4L99A 3HEIA 3HD8B 1HJFA 4UBHA 3A22A 2W95A 1XI1A 4YJ3A 4UXNA 3FHIB 1OOPA 2BOBC 1OSGA 3AP7A 5H9RA 5GLZA 3IC7A 3TGUH 3ZPYA 4AQ2A 2F66C 5LXTA 5T55A 1JOPA 5LWBA 3F5WC 4X8PA 2RS11 2QVSB 5EPAA 5CA6A 3VBHA 3K5OA 5FMDA 1LR1A 3ZVXA 5KWRA 4O7XA 1HNZB 4B3MB 3RYCA 2RDRA 5FZEA 4J25A 5B2GB 5T50A 4DXTA 2X6BA 1W8TA 1GM9A 4QGMA 5FPAA 4DPNA 2VQFO 2V09A 4DUXA 4JC1A 1X7NA 2LFRA 1QQP1 5FZKA 1JR9A 4BLIA 2UYBA 1DU3D 1E5HA 2C9KA 4LT5A 2XBO3 2OVUA 1OMIA 1DZTA 1VQMV 3VLBB 5E8AA 3SPJA 1W39A 4OVEA 5GKAC 1M1KW 1CONA 3PVEA 1NXMA 3IMMA 3WZ1A 3TXSA 5FYIA 5DAVA 2A73B 1HNWB 1N0NA 3CO2A 5FRAA 1YHFA 4O2AB 3T2MA 1VQ6V 4WZCA 2WZEA 1QXJA 3J4UH 4CDQA 5JPNB 2W46A 1TVKA 1UL9A 4LXLA 3VBSA 2WO1A 4W4KA 4B3SO 4DEQA 1V9PA 3H8RA 3BU0A 3QOPA 4BM8A 2A6ZA 3O0XA 1V6JA 2PYLA 1FKAO 4YY3B 3EYPA 5FDBA 2ZS6B 2HEVF 4D8MA 1AI5A 1PP9H 2PYJA 3OJBA 3T3YA 2WA4A 4PDWB 2ZZQA 4FFHA 3LSEA 1LAJA 4JI2B 4R52A 2YXYA 2UXBB 3NV4A 2N74A 1I0HA 3B77A 5I0TA 4LMFA 1YFWA 3AVRA 2KG7B 2W0FC 4H7MA 1PK6A 4AAPA 1WLEA 2BVVA 2CE4A 4NRPA 3P3PA 1XUQA 2BTQB 2BJSA 2YDEA 2QQUA 4WM8B 1Y9MA 3N9OA 1ZL8A 1PNGA 4CEWA 5DPNA 2X29A 3H9AA 2QCSB 4QGLA 1ZL8B 2EXJA 5KHJA 1XNDA 3ABLB 2A1XA 5A1LA 4RR3B 2DTWA 1PZ7A 5F37A 3CJHA 3EXAA 2DBNA 2FQPA 2ARBA 5IK7A 5KA5A 1UIKA 1US6A 4KHPB 3FD9A 4IV1A 1CAVA 4CDUB 1OZ0A 2X7RB 2HYKA 4PLOA 3FZ3A 1ZRDA 3BTAA 2F4LA 3WHUA 1OLRA 4CYDA 1XMQO 3NNJA 4GMP0 4LO7A 3KCXA 2G9FA 5LBQA 3ACIA 4FI9A 4X64O 1XE0A 1TME1 2MNGA 2XAFA 3LOBA 4X1KA 3L9JT 1G1XB 1JQ0A 2YXHA 3OGSA 3ZXLA 1OCOB 3MFCA 4QHZA 3SH3A 1WUVA 3K5MA 1YJNV 4X62O 3W7SA 5FWJA 1TVKB 1E5RA 1AL21 4XTMA 1KEXA 1FXHA 4YARA 2QFEA 3C3SA 2WZ8A 2R062 3RVZA 3MEPA 3HQUA 1WA8A 5I8TA 3KS7A 4DR6O 4Y4YA 2Q67A 3OEBA 4EFEA 4I0AA 3DXRA 3K51A 5K8SA 2XBO1 2VMCA 4NHYA 1AYM1 4WFBV 1V9U2 3J8F2 2QJVA 3VBHC 1CPNA 2W6IG 2ETEA 2VMGA 1NCQA 3I2OA 1ND2A 1SQVH 4XMAA 3VZNA 4MADA 4IEXA 3FB7C 4B3SB 3ZKUA 1N1YA 2XLGA 4GKJB 4CBCA 1OOPC 5JVDA 2D7FA 4UV8A 2D3PA 1C8M2 1UKRA 1DYKA 3CCRV 4R9DA 4LF8B 4XFHA 2ZCEA 1TNRA 3IZOA 4NXNO 2CV6A 1CPMA 1LNQA 4LPLA 4RUEA 3C7OA 2GAUA 2QKAA 1YQ5A 4LKEA 1FXKA 2XJPA 1QLEC 5DN2A 4LH6A 4KUMA 1X9PA 3VD4A 5EQUA 3LDKA 5B4NA 4MSVA 4CC6A 1SZTA 3LSQA 1OOPB 2DVGA 4TT3G 2JE7A 4YJ3B 4OI1A 5CADA 2EBOA 4UV9A 2YS8A 1BSMA 2Y33A 2PHFA 2YI8A 1M57B 2Y6JA 3HMYA 1JODA 1ZBE3 5FY4A 1JZ7A 3FHAA 3VD7A 2WQ8A 2XQXA 4ZKIA 4BPZA 3THOA 3B02A 3LIGA 3POFA 2ZDIC 4DW0A 1EAH3 4EZHA 4D6TH 2YBKA 2Q73A 1UU6A 5LBEA 2EILC 5FL7G 4NO4A 5IT6A 4BJ0A 2GDSA 3JBG2 3GHMA 4J42A 3RMXA 2VNGA 5T5LA 5DUWA 1MACA 1S3JA 2GNTA 4R8HA 3PDQA 1AVMA 4UW6A 1QNWA 4G9SB 3G4SV 1L7QA 3WW2A 2XL9A 2I2SA 2Q8DA 3U4SA 3KT4A 1RIRA 3WB1A 4ZPIA 4JAUA 2VMHA 2IXLA 1GP5A 3S5QA 2OW4A 4E9KA 1WKYA 1QXPA 1XNQO 4ZU4A 3DPRA 1AR63 4AI3A 2XBO2 5J2UA 2VQAA 2UXDB 4MO3M 3GF6A 1S5LZ 2DW4A 1NCQC 4OHVA 1URFA 4FFBA 4LHKA 4QPGB 5FMCA 4JI0B 3JCZA 4Q4W3 2GALA 2YUEA 2YG0A 2V4DA 5LHHA 3CC4V 1NYWA 2VW2A 1N36B 4M0NA 2HWC3 2EA7A 1WBLA 3LZZA 5JZGC 3SJQC 3BVCA 2WT2A 5FY7A 4AI1A 1UKGA 2BOJA 2QQMA 1YNAA 4Y4RA 2WO3A 4DR5O 1RUI3 3ZBHA 2QUOA 4BH9A 2PI4A 1VBB3 3OGGA 5A7SA 3GXUA 1CZVA 1C1LA 1ENSA 2J1EA 1JX9A 1ZYBA 1DIWA 2JGUA 2Q4SA 1MS8A 5JZGB 1AI7A 1VQ8V 4XZUG 1FFTB 4FK5C 5FNVA 4X1YB 1MS9A 2P34A 1IS3A 3GZUC 2B7YA 1DF4A 3HWJA 4FVVA 1XRUA 4BCUA 4KGGA 2B9ZA 5EYYA 5C8CC 5JXJA 3J7NA 4CU9A 2O1QA 3N9QA 3T2TA 4IW3A 1M56C 2ODMA 3ZRXA 3N4MA 4ZONA 4YFWA 1H8HG 4DINB 2RR13 4AHCA 2IFWA 2YYOA 3IM0A 4LBOA 3VOUA 2YBPA 4MOAA 1F5FA 3ASOB 5KXCA 4Q4Y3 5C3PA 4O2BB 3JD2A 5FCCA 5GONA 5FBZA 1SPPA 2P6JA 5ANQA 1AL22 5FYYA 5F7UA 3OUHA 3KCCA 3PIJA 3O1MA 5C8CB 2GH8A 5K9YA 3WDUA 3RWKX 3SH4A 1IQAA 2UU9B 2L35A 4YVWB 2KD7A 2RM23 3INAA 1HLCA 3HKDA 4DR7O 2WO2A 2OIGA 3IAPA 5BPXA 5LA9A 3AZWA 4LIVA 1UU5A 5IYZB 4TYSA 3MDSA 5BZBA 2P5OA 4BISA 4QHBA 4LF4O 5LY1A 4D3WA 4FPCA 1YJWV 2KR2A 4NMIA 3WDTA 1AR81 2Q0AA 3K5NA 2ZNJA 2WSSG 3D36A 3RQ0A 2DUOA 2VGDA 3GHNA 3FLRA 1MZEA 5CB4B 1OH3A 5T52A 3U78A 3DN7A 1QU0A 5FK8A 2DUPA 3LUTB 1LOFA 4XIOA 1C1FA 3K2OA 5CEHA 4YW3A 1FXZA 2AZ0A 1W0KG 3JAWB 1VB4A 1W6QB 4B3TO 2R7EB 1XSRA 4CEYA 3ZXKA 3ZSJA 3ZN0A 4TQDA 2R1DA 1O5UA 1X9TA 1GUIA 4R4ZA 4IUGA 3N36A 3USUB 4DV7O 5BMVB 1IXMA 2Y69C 4RHV2 2W68A 2X6CA 4XAAA 1NLRA 3H1IH 4COWA 4LKDA 1SKVA 3AMHA 4BIZA 1W2TA 1SLLA 3JXSA 1ZZBA 1VBE1 1XNTA 4Q4X1 3F95A 3OW2U 1XOUA 3LEIA 1PZ8A 4BWAA 2KM2A 3MD0A 1N34B 1S0CA 1QR9A 3VV1A 3AP6A 2ZEWA 3IWZA 5FUNA 4MTGA 3T0AA 2WLJA 4P9GA 5FO9B 3TN92 3JD4A 3A0RA 1AX1A 2GHYA 4JI6O 4PIYA 2Z0AA 4FPOB 4YM1A 4FPHA 3G80A 3CRRA 2QM7A 2BDRA 3WF4A 3SGIA 2RHPA 1UZ0A 3ZKYA 1ASJ2 4XDPA 4DRRA 1BCCH 4W8JA 2C0ZA 5FLIA 2IVJA 4O4JA 3TCUA 4XJ9A 4Y22B 2D3RA 3LKJA 2ZGPA 2RJZA 1RGSA 3OEEG 3CPWU 2D6NA 2HWF1 3FYIB 1NZ6A 1YCIA 4X8AA 3OEAA 4AE2A 4RUFA 4JYBA 2CSGA 1L3JA 3RYPA 4YPJA 1FMD3 2ZE6A 1NCQB 1DGRA 3RG0A 1W03A 4O4JB 3JASA 5C3RA 1F5JA 3POBA 1NTMH 5HBAA 3B4SA 4RHV3 4NWVA 3N27A 3J26N 2W47A 5IVJA 1Q8PA 1W6PB 5LBCA 4DR2O 2JXAA 3A0HZ 3HKCB 1ZA4A 3AK2A 4LEJA 1WA8B 3ICXA 3T2OA 3VB9A 1SERA 3KGZA 5DUXA 2CTWA 3BFRA 4PI2A 4DK0A 5KC5A 1BYHA 1S0VA 3AVSA 1VF5B 5AC93 2EIDA 3H3ZA 2ZMNA 2PGGA 3U11A 2DFBA 3RZHA 2VOXA 2BOCC 4MT8A 4ZKTB 1AZDA 3I3QA 1UZVA 3K5LA 5J3UA 2CTQA 3FB5C 2WS93 5C9AA 1WGPA 1IPJA 4J10A 5FOJB 5IYDO 5L3EA 2XJRA 2PHUA 3WW3A 2RM22 2WKKA 3OM3B 1I9RA 5JCOC 1SACA 4MZUA 1MS4A 1UZYA 5LW9A 1FAYA 1W6MB 3QH6A 1CQ9A 4DR4O 1WMEA 5LEKA 5KXBA 1FV3A 1UPSA 4ORFA 3TYJA 3ROUA 2HLEA 1AXKA 5KHIA 1PGW2 4GIQA 4UFLA 3MW2A 3IMNA 4Y1UA 3OBZA 4UW5A 5IK4A 1UFIA 2JVDA 4L97A 1K5MC 2DTYA 4P9OA 1AL23 3H7YA 4I4TB 1JMUB 2E76B 2BTQA 1HQNA 3ZHSA 1KKCA 4OULA 4LCUC 1I5YA 1LENA 1AR91 5FZOA 1BEV2 3NWKA 3W58A 2CU5A 1LHVA 4LNVA 2HWC2 3MPBA 3PVNA 2IXIA 2EALA 3NNGA 4FLVA 4AFAA 3VKMA 5FPLA 3RN4A 4UCUA 1SA0B 4CUCA 3RDIA 4RQEA 4YW1A 3LIHA 5CISA 1VBD3 1GN6A 4OZOA 1OCOC 4BW9A 4IV1C 3LPGA 3H3UA 4GB32 1RHI2 1GANA 1RM1C 2YB7A 3MIFA 1SRYA 4J11A 3N2KA 5HI0A 4W4ZA 3H7JA 1RUI2 2VZPA 1XNCA 3I59A 3P1IA 3VBSB 1MZ5A 4TWTA 2BTVC 1RUC3 2AACA 1M93A 4J7JA 1K4DC 3ZDVA 4F7ZA 2HJIA 4JGYC 5CFDC 1H1AA 3RBZA 1FPOA 1SEFA 2DVDA 5K1PA 3AXEA 4UB8Z 2YGMA 4ZU7A 5FO8B 1W59A 2P6HA 3O9OA 4NIDA 3MLJA 3KG2A 1OCCC 3BKZA 5J09A 3TAYA 3IB3A 5E88A 3IAYA 2UY9A 4G2KA 3W7XA 3WG2A 2ZMKA 1EAH2 1E1RG 1J3PA 1GTOA 1JHNA 1XYNA 1BK0A 1QF3A 4WM8C 1PM7A 1ZBE2 3WW1A 2UY8A 1K3IA 5CFDB 1KDMA 2JG8C 2LW1A 4JTAB 3ABMB 1OKQA 5D8AC 1COV1 4CEWC 3ZX7A 5LK5A 3TN91 1ULDA 1ULCA 1J95A 1W8ZA 3ON7A 1OBNA 3FYEB 4YW4A 3WB0A 1NCRA 4TUYA 3WU2Z 4WCEV 1FATA 2D6LX 3D82A 2D3OW 1UY3A 4AFBA 3BTYA 3DTUB 2HBUA 2YIDA 4JF3A 2VZTA 1Q86W 4JTDB 2JS5A 2IXKA 4FJCC 1GMMA 3ABTA 4LQRA 1K8AW 3J7LA 2A7AA 1QCEA 2A3QA 1BZWA 3WG3A 4C7UA 3EXUA 2HWE2 2CL2A 1TUBA 4JYCA 1R3JC 1OXCA 3VZOA 4I01A 1J3RA 3QVNA 2OYZA 3WG7B 5LASA 1F4NA 2HYXA 3CHXA 2F17A 1Y6XA 2F4PA 1RUC1 4NN0A 3ZR6A 3V0AB 3OGIB 3S6PA 1IBMO 4DR4B 4PQQA 3M7AA 4CH4A 1G6UA 3MIGA 1IXBA 1UOJA 4QE7A 4F6RB 4Z07A 5DAQA 5JR7B 5A7WB 1UMIA 1GAXA 3UGFA 1G4YB 4U7OA 2Y6KA 3VBFC 1P8JA 3BIEA 2DCJA 1H6XA 3WNNA 1DHKB 3BIWE 3TBDA 2R042 2RS13 5EV7A 2DE0X 3HVDA 2RM21 1NLQA 4IXLA 4FZ0A 2Q7EA 5I0DA 4Y24A 3OCPA 4DXWA 4BHPA 4YHHB 1LEMA 2LROA 2QNKA 4QB6A 4DRVA 1YHQV 1IG3A 3WQBA 1HB3A 4XF4A 3S7EA 1IS6A 3BA8A 3OTFA 2ATKC 4L0PA 4DEVA 3CKHA 2VZOA 4QE9A 1SDWA 4WFGA 1JYNA 1MS0A 5JR2A 3AZYA 1BMV1 4D69A 2NPIA 4Z2AA 1IQDC 4GA9A 1UQXA 2Z4FA 5FXZA 2JGDB 1NE4A 5CBGA 3I49A 4ZHQB 4K8FA 2IXCA 5G04L 2R063 3VL8A 2GMMA 1KRIA 3DF0A 5BNOC 1N34O
chains in the Genus database with same CATH topology
5GZDA 4AFMA 4RQPA 1YYNA 3B00A 2ENRA 3LA7A 4IEQA 1ULGA 3WCSA 4RD7A 2RS12 4TLFA 2BNNA 1HRI3 2R043 4YG0A 1GBGA 3ZSKA 3EHKA 1VRH3 3RNSA 2W08A 3GALA 2H6BA 2XKOA 3J9SA 4DQAA 1H4HA 1OA3A 2NQYA 2WT0A 4Z1VA 1WD3A 2Q5TA 3C2UA 1RUF3 1LGNA 3ZDSA 1V9U1 2PELA 5D8AA 4HKWA 1I3HA 1S0IA 2NLRA 2WNVA 1MS1A 2W52A 4IEYA 4JCKA 1MZ6A 1YXWA 4H3WA 3GBGA 2XUMA 2BYVE 4K1YA 4XTPA 3W9AA 4J1XA 1YUDA 2PTMA 1CAVB 4LBQB 1CVNA 1VJ2A 2WZR2 1R092 4YW2A 1D4M1 2HWF2 2WFF2 4YGCA 4LA2A 4RFT0 1AXYA 3RYRA 5BNQA 5JSPA 1OA4A 4V1PA 4F83A 3BOWA 2MEV1 3VBRA 3RWNA 2E7QA 1RUJ3 1UN1A 3MGUA 3WQ1A 2PAMA 4PLNA 2VPVA 3V0AA 4QPIA 1PIV3 4A3XA 4XDQA 3LAGA 1RUG2 2GZWA 4Q4V3 1H2MA 4RR3A 3IDCB 3CJXA 4DXZA 3MFAA 1HDKA 2HWC1 4YVSA 1C8M1 2ZZJA 1VBB2 4PBPA 5KBFA 3CEWA 2YMZA 2C5DA 4BMBA 5FLJA 1OHFA 3JUUA 3P3NA 4SBVA 4XHXA 3KQRA 1ALYA 1DQ5A 4COUA 5K7PA 5I93A 2WQZC 3KCYA 2HWE3 4IV3C 4EN7B 1PVC1 4QXKA 1HKDA 4DOUA 5GLTA 3MZHA 1WA4A 3LB9A 1VIWB 2JD4A 2ZX0A 4WZFA 4FTSA 4J5IA 3FE5A 2P3KA 3ZSLA 5LEJA 1GKBA 1FMD2 4OLLA 4AG4A 4JVAA 1B35B 1CESA 1KS5A 2DUQA 4ASLA 4P9LA 1O91A 4KU8A 3BPZA 2ZHKA 2YY1A 4FOQA 5T5OA 4CEYC 2P3IA 1PNFA 1RVF1 3N7LA 3ZFEC 3B93A 2PAKA 4BOWA 4MXWB 3GYDA 4FQZA 2HWD2 1RMU2 1WW7A 4AI0A 1M4WA 3HT2A 1JYCA 4FXGB 1MQTC 2EXHA 5H9QA 2XL7A 5KHGA 3MIDA 3OY8A 4CDXA 4PIXA 3VBOC 4M2FA 5C8CA 2RJKA 1S0JA 2XVGA 1PMIA 1K5MA 1DBNA 2GN3A 2VVEA 2IWGB 1DGWX 3OYWB 5D1IA 2PLV3 1QKQA 2GMEA 4AEJA 4Y0EA 1SLAA 2TBVA 3R4SA 5BNPB 3O0VA 2ZX3A 1N3PA 2K0GA 4E2SA 4YM2A 5H9SA 2UWCA 1XYOA 1BQPA 1A8DA 2OA2A 1HRV3 2ATFA 4HPKA 2YZ4A 4IV3A 2PYTA 2HEWF 1DYPA 1FX5A 1G9DA 2UWBA 4CEWB 2AGSA 3URFA 4K7JA 1ZVFA 5J36A 2NM1A 3BCWA 3AYCA 5JVVA 1JBCA 4PQ9A 2IXHA 4Q0UA 1NQJA 3AYEA 2Y26A 3OF1A 2Y0OA 1VBA2 4B29A 3BODA 4DNYA 4QPIC 3U10A 1A6CA 1J1LA 1CJDA 3I7DA 4SLIA 1DG6A 2X53S 2HKXA 4LBJA 2FMYA 5BNPC 3WCRA 4K6BA 2VULA 4Q2FA 4CWDA 2A3XA 2B9UA 5L36A 1PGL1 1ZBE1 1PO23 1OIIA 5DZEA 4HFSA 2JENA 2VUAA 3JBG3 3N3HA 1XQNA 3IKWA 2XJSA 4UW3A 1O4YA 1AYM2 3UJOA 4M25A 1OPMA 1NX4A 5EJ3A 3WUDA 2LTNA 1DQ0A 3NVCA 4HN1A 5AFEA 4K1ZA 1A78A 4N90A 1H30A 1NOVA 4JDNA 3LA3A 1RUC2 2D93A 2CGPA 3CJIA 4KL1A 2XVKA 5KHHA 5JDBA 3VL9A 4RR3C 3V0BA 1QDCA 2XLAA 1LOGA 5GLUA 1MS3A 1BJQA 3R05A 4M2GA 1UCXA 4BWOA 4LHNA 4MYEA 3RI8A 1VALA 4AYUA 1KFUL 5BY5A 4BLJA 1GNZA 3VBRC 4KG8A 1Y7BA 2DCZA 3AX4A 4WM7A 1FI2A 5CU1A 3EATX 4G4FA 1RHI1 1MZFA 4EROA 4M3CA 5C9AC