2CGNA

Factor inhibiting hif-1 alpha with succinate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
338
Chain Sequence
ATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFNREEMKFHEFVEKLQDIQQREERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
publication title Structural and Mechanistic Studies on the Inhibition of the Hypoxia-Inducible Transcription Factor Hydroxylases by Tricarboxylic Acid Cycle Intermediates.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 338
sequence length 347
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2cgnA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgnA01
4Z2WA 1H2MA 2YC0A 1H2KA 4JAAA 4NR1A 1H2LA 3OD4A 5JWPA 4Z1VA 1H2NA 3KCYA 2YDEA 3P3PA 4BIOA 1MZEA 4QU2A 3D8CA 4B7KA 2WA4A 2XUMA 4AI8A 2CGNA 2W0XA 2WA3A 3KCXA 4B7EA 1MZFA 2ILMA 2Y0IA 1IZ3A 2CGOA 1YCIA 3P3NA
chains in the Genus database with same CATH superfamily
2RV9A 3LDKA 4LIVA 5A32B 1XOUA 5JMCA 3LDDA 5CVRA 3IDAA 5FP3A 5A3LA 1UMZA 1CZTA 3CCJV 4PA4A 4AHYA 2ZIOA 4RQFA 2OCCB 4BQ2A 3WDWA 5BPXA 1NT2B 2CH7B 2H8PC 5BZBA 5LHGA 4LFCB 3SISA 1VQPV 3B93A 4PIYA 3LEKA 2ZA9A 4LK6A 3ZHTA 4IGPA 4YPJA 1AYM3 1EY2A 5EC2C 1H1AA 4B3MB 4LHKA 1W0OA 2AEYA 1WCKA 1YFUA 1V9U1 1FJGO 5A1AA 4JI7B 2C0ZA 2GSYA 3HIFA 3D3IA 3C7HA 4RS5B 3W7TA 1RB8G 2CU5A 2BQPA 3I2OA 1QJU3 3C3SA 2DJVA 3UGFA 4QXHA 3W5MA 2R72A 4R9DA 3C7EA 1COV2 3V56A 2V4AA 1ZBA1 3BYWA 2Q8CA 2KSDA 1OHHG 5BXZA 3VBOC 2VH9A 5GLZA 2AEZA 4XUTA 2ZMNA 2VO5A 4DV0B 2NZ9A 4NWVA 1SS3A 4FLZA 1TMF3 1OMIA 2F1MA 4JYCA 4BCUA 4CH4A 4QPGA 1W8UA 4ZZ5A 3NJXA 5C8YB 1Z5VA 1NLSA 2WT0A 4DV5B 2CE4A 1XREA 3H7JA 4NHXA 3ZSMA 2Q8VA 2GH2A 4JPRA 2H3OA 3AXEA 2FQPA 3W20A 3SEPA 1NOVA 5I8TA 2XLFA 3CYOA 1LR1A 4C0HA 4EFEA 1E5SA 1A8MA 1CVNA 2CTVA 1CIWA 1ENVA 1NVPD 1YLLA 4YVWB 1U5ZA 2R49A 4I0AA 4J7JA 3HQRA 1PMIA 4CXXA 2QEXV 4XFGA 2WINB 3VBBA 5FZLA 1HKDA 5FXWA 5JXJA 1RXFA 3JXSA 3POBA 4AGRA 5BNPC 1VP6A 2Q0AA 4OVEA 3PVBB 4RHV3 5IYBO 1GZTA 2A3QA 1HLCA 2X7RB 3ZSEA 3POJA 4UFZA 3RN4A 5J3UA 1ND2B 1OKQA 3I2FA 5JJEB 2UUBO 5F2SA 1HW5A 4OCTA 2UWBA 1PKXA 4GAZA 1LAJA 5JXIA 2W95A 1WLEA 2YIBD 4UT5A 1W6MA 4OULA 1XXNA 1UQXA 4JRLA 3MI8A 4K8RB 4ASLA 5A7PA 4LBKA 1YITV 1AJNA 4CP2A 2FBEA 4IEQA 2Z0AA 2F23A 5KHHA 4IGOA 3ETQA 2GHYA 4GX1A 3KGZA 3H1KH 4LHLA 4OMDA 4A7KA 1KS4A 5B1AB 2CGNA 3GCXA 2NMNA 2R6QA 4OYUA 2BGOA 2ZOEB 5JZGB 4CP1A 3QCWA 5BNOB 4R9BA 2VMIA 1NY71 2E51A 2EZOA 3WP5A 1HXS1 2XAJA 2CNAA 4FFKA 1PGL1 2PQQA 4K35A 1PNGA 3K57A 4FPKA 1T5EA 3AG3B 1D4M1 2YY1A 2PHFA 3ZFFC 2VY0A 1O4TA 1NA1C 2BDRA 3KM5A 5I0DA 5LY2A 1JZ8A 3IKWA 2DBNA 4E9KA 4YY3O 4C0BA 4I5SA 4XJWA 1SZTA 4OZXA 1OVPA 2IU3A 5IAVA 4NPLA 3ABTA 4O4JA 2UUCO 1PVXA 3TAYA 4BPZA 4UVCA 3E6BA 1HIXA 4XCAA 1REFA 3BALA 4JI6B 2VRZA 3DPRA 4U2AA 3UT5B 1EV12 1UOJA 3WG1A 1VQKV 4QU2A 3JD2A 1POV1 1C3HA 3ILRA 5IYZA 3MUZ1 4H13B 5FO8B 4FPGA 1BKZA 2H6BA 2JJ6A 1GN4A 1QR9A 2WZR2 2W1UA 4JQTA 2YHJA 5E89A 2YGMA 3QVNA 3AMPA 3S30A 2RMKB 2WZPP 4J1WA 3DUIA 4HSLA 3HKEB 3PUSA 3K48A 5DQ0A 1JW6A 3AP4A 3AVSA 5GZDA 3OBAA 5FRAA 1KKCA 3ON7A 1AR63 1UYZA 4LH6A 3MPBA 4MXVA 1GM9A 2NN4A 4UW4A 4COWA 2HG5C 4KBZA 3DXRB 4FT8A 1K12A 2W2IA 1GYKA 5IJ9B 5C4WB 4BQWA 3ZHRA 5I0UA 2FDIA 3O9OA 3WDTA 2ARBA 3UK9A 4H14A 2OT5A 1MACA 2HEPA 3O0VA 4H37A 1Q8VA 1L0NH 1Z0HA 3K3WA 1F35A 2P37A 1CPYA 3J8F2 1W8TA 3BY6A 5FYVA 2VOXA 4G27B 1S5HC 4CDQC 1PD3A 4JI8O 5EXOA 2VZRA 3N2KA 1HNWO 4R8HA 4QX1A 2D6LX 4M3CF 1TQ5A 1OZ0A 2X10A 1QVGU 2VBBA 3RDIA 4ZHNA 1RITA 3OBTA 4LFAB 1JXNA 2A3XA 4FXKB 3ASOC 1S5LZ 5FPRA 3M3OA 4K8FA 4X89A 3MHSC 4NVPA 3FYEB 4O4LA 1VF6C 4K8XA 3ETGA 1OKOA 4QKFA 4X1IA 2XBO3 4GH4A 2HHHB 1K34A 3JATA 2LTNA 5C8CB 3AX4A 1PK6B 1C8M3 1XNBA 4IEYA 4DOUA 3KT1A 1NVPB 3MZHA 2Y26A 3ZXKA 4DV2O 5LK5A 4XACA 1RPOA 4JI2O 2VQAA 2W0FC 3SKVA 1OT5A 1XBLA 3ABLC 2OPKA 2DN9A 5K0UB 4B29A 1BK1A 1RUJ2 2KB1A 4BK4A 4MW3A 5BMVB 3M7AA 2ARCA 3UKVA 2ZCEA 2EIBA 1VJ2A 4GWMA 4XTMA 4RGKA 2P67A 3CQOA 4KGGA 1FPN1 3A22A 1NT0A 1SDDB 3TNQA 1H2SB 2J1AA 3SQOA 5I91A 3NV2A 1O3RA 5EHDA 5FZKA 1OPMA 4DEQA 3V0BA 3CCSV 5J36A 4YJ2A 1KEXA 5GALA 3VBRC 2OIGA 2QWQB 3WG3A 3AYDA 4DR4O 3SKJE 3QTCA 4QHOA 4IEVA 3ZYIB 1VIWB 3NJYA 1CONA 1CAUB 2LW7A 1RHI2 4LFCO 1N0NA 1K4DC 4FTSA 2UWCA 2X5IC 3U75A 3CJHB 2B1GA 4W4KA 4OI0A 3S57A 1O3TA 5APAA 4BR6A 1TVKB 3CMGA 2N05A 4W50A 4LHNA 1O91A 4JTCB 4DXZA 2B46X 3AG1C 2Y64A 5FPBA 3GBWA 2JDKA 3MEPA 4ET7A 3I97A 3PDQA 2YS8A 2IXIA 1SESA 3O1TA 5JOWA 2V4DA 4X66B 3W7WA 5IFTA 2DE0X 5LYJA 2AZ0A 1SACA 3MPPG 1OCOC 4IE5A 4X6QB 3B8MA 4BXFA 1L1FA 2WT1A 2D93A 2PHUA 5C9AC 5F3CA 4ZOLB 5KX5A 5LA1A 2ZHMA 4AW7A 3IAPA 2W52A 3WW3A 4LF9O 2K1EA 5LOVA 1XRUA 5ACA1 3NNJA 5CBGA 5FXVA 2FYUH 5JWPA 1XNRB 5C33A 5C3RA 4CPBD 4DR1B 1WW5A 3B09A 1NZIA 2XONA 3ZN5A 1WP8A 4NHLA 4MGIE 3CRAA 4DV5O 4B3RO 1RJ7A 4O4HB 2JECA 5LP6B 1ULCA 5KXEA 1I94O 3E22B 5GJ6A 3KV5A 4FPJA 5CKNA 4QPIC 3WNLA 3H1IH 1GQPA 2WFPA 3V0AB 4K8ZA 4AK3A 4WV8A 2HWB3 2C26A 2VTFA 2XJUA 4QM9A 2EZPA 2QQIA 3AEIA 1OA2A 5D8AA 5DAVA 3CCVV 1HRV2 2A6VA 3B9CA 3VL9A 1DGWA 2MPFA 1K5MA 4RR3B 2E26A 3CKHA 2Q8OA 4BYYA 1B35A 4Q0PA 2YFUA 4JZGA 5J1XA 1TME3 1LTEA 1RC6A 4I09A 3D8CA 3U4XA 3IMMA 2QCSB 2XXZA 4IE4A 5DUVA 3UETA 4EN7B 4DW0A 1GANA 1SQGA 4E4HA 2UXNA 1W2OA 5FYYA 5CFCA 2A6WA 1RUF1 3NV4A 5JSOA 4QDSA 1VMFA 2OIIA 3TNPB 3DCQA 3RYIB 2XHKA 1EN4A 1UX6A 1R1A2 3DN7A 4RUEA 2XHNA 4GX0A 5EFUA 1W39A 2Q6AA 4FFGA 2BJSA 5IHRA 5IVVA 4WFBV 1WMDA 4YVWC 3UESA 2ZGPA 4I01A 5FP4A 3RYPA 5F3EA 2Y33A 3ZM8A 4BE3A 2A7AA 3DL3A 4GYCB 2B39A 1XL6A 4TV8B 4QQLA 4MTGA 3R05A 2D2CB 2QBXA 1OOPA 5J96B 4LQRA 5A7WB 1BEV2 2WWJA 4QMAA 1R091 4Y20A 2MNGA 1VRBA 4I0WB 4U36A 1R6TA 4XAAA 3RW0A 2XG3A 1M57C 2JRIA 2WFF3 3FMGA 3UKTA 2A6YA 4PCRA 1UZZA 2DYSB 4RSUA 4OHYA 4P5YA 2HYXA 1MQTB 4XE9A 1ZBE3 1HQWA 2JG9A 2PMWB 3AKPA 2AH2A 4ZY9A 2C4XA 4QQHA 4XJ8A 4MSWC 3NAPB 4RFRB 4HPKB 4RGGA 1LGBA 3FC0A 2RMU1 1WA8A 4KFMA 1PV0A 1UX7A 3LKJA 4JI3B 4JI6O 1UIKA 5LA6B 5DM6V 1WLTA 1OF4A 1VBE2 3W58A 3A8TA 1WPXA 2JDNA 2VQFB 2J22A 1GRJA 2OTLV 3MDSA 3LB9A 3WD5A 4FFBB 2Q1MA 4FFHA 5J2UA 4DMIA 5JIUA 4P9LA 4V2VA 3IT8A 4XFIA 1G86A 3C3VA 4FP3A 4KP4A 4LITA 3S5AA 3HBZA 1COV1 3ZRVA 2DVBA 1OCZB 4YM2A 3FAVB 2WA4A 2YUAA 4NPRA 3O1UA 2XAHA 2CV6A 4XHBA 5JSPA 3MHHC 2BV4A 1RUH3 2TEPA 2DWEC 1Y7BA 1JQ0A 1UZWA 1JS9A 2GSMB 5B1BB 1LOFA 1BQPA 4FM1A 4YG0A 4TLGA 4BHPA 2YUEA 5SV8A 4JHZA 2WLQA 4CDXC 2XLGA 5CN0A 5BNNC 2AR6A 3K4AA 4ARXA 1N33O 4ZKTB 1ZA7A 4E2LA 1MZFA 2WDBA 2VNGA 2Q4PA 1VBB3 4AI1A 1VMGA 1BVP1 1CIYA 4QM8A 5DAQA 1N3QA 3JBG2 2JIJA 3SH4A 2CAUA 3LSQA 3BFRA 2VBPA 1ZX5A 4EN8B 1WCDJ 3BHPA 1GWLA 2FTKA 5FPOA 1EBOA 2JWPA 1C8NA 5FNVB 1FFXB 1R73A 3NNGA 1HRI2 3MF9A 2AHZA 4KWKA 5CMUA 5AFEA 4D7TA 2R043 3ILNA 2N04A 3JASB 1Y74B 4O2AB 4YW3A 4QPKA 2EILC 2WNUA 2JS5A 4XFAA 5C3OA 5CADA 4YHHB 5DUWA 3Q8BA 4Z82A 4DV1B 4QX3A 5J37A 4OUEA 4H33A 3MAQA 1PNFA 1X4TA 3PVNA 1PO12 1ZTEA 1K8AW 5IUQA 5JH7A 3QG5A 1TUBA 4PQQA 3JD73 3OE7G 5FFOC 2BTQA 4YLZA 2YC0A 1H2KA 1UXZA 3E6DA 3CPWU 4L87A 3A21A 1E57A 1WA4A 3T0DA 2RS32 3QO8A 4LF4O 4X62O 5GKAC 1AX0A 2GTSA 4LORA 4INDA 4ZBMA 2W47A 1RM1C 4G3YC 2XJTA 3ZXGA 1DYPA 4FVMA 1RSOB 1D4VB 3FHIB 5FZFA 4QWNA 2OQ6A 2WO3A 4DV4O 4P08A 2K9PA 1UYPA 4RO2A 1LODA 1DP0A 3DV8A 1GM8A 3B94A 3JARB 1W6QB 2GZWA 2VCBA 1PP9H 4HONA 1OBNA 1AF9A 4GJZA 3OEHG 4NHKA 1NE4A 5CA1A 5K0UC 3K03A 4UI9L 3AC0A 3LNNA 5ABJC 2Q9LA 3BA9A 1UKGA 1JOPA 1LJ7A 1M93A 2Q8DA 4KWJA 5A1LA 1QJEA 1E5IA 2VZOA 4IUGA 3CJIA 1GMMA 1EPWA 2JG8B 3WHUA 4J7KA 1ULFA 1G8WA 5T5OA 3FUOA 1U12A 1JYTA 1S55A 2JG8A 1DZRA 2XTAA 3ACGA 3VDAA 1T6BX 1XSQA 5F5AA 1V54C 3LZZA 4Q2FA 2DCYA 4LKSA 4AXOA 1Q7YW 3MIDA 1Y4MA 3CNAA 4HOOA 4D6SA 2YEVB 4M3CA 4LLOA 4DR1O 2D3OW 4S2HA 1BGYH 3SJBC 4UCSA 5D5PA 1SDWA 1Q3EA 2HLDG 3LSSA 5TSWA 3VDCA 4OQ8A 2J1UA 4LJHA 1KJRA 5FYTA 5A7QA 3T2TA 1HNZO 2CWSA 4NPMA 1HW7A 4IEXA 5K8SA 2EALA 5CIRA 1VBA1 5JUVA 1FS0G 3LF7A 3OUJA 2X53S 2RS53 3OGIB 4LF6O 4MVOA 3P3PA 1N1YA 4F83A 3S5QA 2Q4SA 4JV5O 4MXWA 1IQDC 4UW5A 3F5WC 1GZ9A 3H9VA 2QFEA 3K2OA 3QLQA 1EAH2 4DRVA 3WU2Z 4KQ7A 3OTOO 5BY5A 3BIEA 5A3OA 4X20A 3VD5A 4QB2A 1MA1A 4YM3A 1YIJV 1R082 4LBNA 4Y5SA 3SITA 4O2BA 3HNBM 3SCFA 1D5NA 2VMFA 2ZEXA 1XQNA 1AXKA 3Q8CA 4LF8O 4TSFG 2D6NA 2XWBB 4LUMA 5FMBA 2XPJA 2UY9A 4YM0A 2ZGRA 4PT6A 1OLME 2QZ3A 3ZLIA 5CBFA 3QBQA 4RQPB 2G1MA 2DQ0A 2XLAA 4YGDA 3AG2B 3ATGA 1US3A 2UU9B 3TN93 1RGSA 1YWKA 2BNMA 4FFFA 2QM4A 2W87A 3GNEA 3KQRA 4Q20A 1D0HA 1Q8QA 1SMVA 5IWAB 3RYFA 3SYQA 3OMIB 5JSRA 2YXLA 3ZPYA 2E33A 2YBKA 1RUJ1 1H2MA 4DQAA 1KU9A 1PVC3 5HCHA 2WLHA 4IEOA 2CAVA 1EZJA 1OPOA 3FYIB 4DRXB 2XASA 1P49A 2MEV2 3X2QC 3J4UH 3OB8A 3OUSA 2IFRA 3ELNA 4R4XA 1JA8A 4Y3OA 1KC8W 1PIV2 3JQXA 4DW1A 5FUNA 4F4LA 4COYA 4NN0A 5KHGA 2HJIA 4HVQA 5JR2A 2VD7A 4AAPA 2W68A 3G7DA 4TV9B 5G05L 2DWRA 2R30A 2BVVA 1REDA 2YU1A 4CUCA 2P22C 1W05A 3RSJA 1RMU3 3VZMA 4X9QA 2OS2A 4M3CE 3U37A 1ZZ7A 2RHPA 1RUG3 4HNAB 5IVCA 4CDWC 3O1SA 3ZFEC 1X7NA 2XKPA 5A33B 2J7MA 3DYMA 1Y9GA 3C2UA 3JUUA 1XMQB 4NRPA 1WLWA 2E53A 1SHWB 2EJRA 1GH6A 1OLQA 1LHOA 3NRUA 4MADA 4NRMA 1UCXA 1YJ9V 3I59B 3RWNA 1S0CA 3LEGA 5J98B 3HQXA 5HV4A 2W08A 1H4GA 4BIFA 4I0XB 4PDWB 5KAIZ 5D2AA 3UO3A 4FVVA 2DVAA 4Q4V1 4JTOA 4LWSB 1W9SA 2DCJA 3GZEA 1H1MA 3FB5C 1YFYA 1WMFA 3KGLA 3VDDB 3AZWA 5LZ6A 3DGEA 4I4TA 2DYSC 2W91A 4UFHA 1X82A 5EJZB 5F2WA 4YJ3B 4H44B 2WNVC 3LCPA 1F4MA 1UO9A 5A2QN 5B66Z 1IS4A 2E7AA 3UNPA 2CL2A 1IVSA 5FWJA 3AK1A 4NWWA 5IK7A 1R3LC 3GVMA 4LXLA 3VBUC 1AYN3 1FXKA 5FZ6A 5D1IA 1HNXO 5DN2A 4P9PA 3WG7B 3OMAB 1GMGA 1HRV1 3OOXA 2EINB 1NTMH 4FPOB 4EYUA 4CEWA 2Q7HA 4HG6B 4RL7A 3T2PA 1GK9A 5ISLA 1W2NA 3KWVA 2Y48A 4Y1ZA 2IC1A 1ASJ3 2DFBA 4NJ4A 5JXGA 3ZIWA 1AR91 3I5DA 1N32B 3H1HH 1F7YA 3ZRXA 5JI9A 3TYJA 1H8TC 2VCAA 4IERA 5BV6A 4AQYB 2ZX3A 1WGPA 4XIKA 5FZHA 2ZTNA 2QGNA 1Z7S2 5FL7G 4LBJA 4BAYA 5GONA 2QKCA 3CIHA 3UV9A 2QJVA 1MEC2 1W0PA 2ZDIA 5B1BC 1RUI3 2BOIA 1BL8A 2JKBA 2LP7A 3H1MA 5FDBA 3PJQA 4NIIA 3VBSB 5DUUA 5FZMA 5FYIA 4JGYA 1S0DA 3QD6A 4DUXA 2EXKA 4MW8A 2IJIA 3Q8AA 3B2EE 3ZFGB 4XBFA 1RUC3 2BWAA 1MPXA 5B3SB 1C57A 3K59A 4AZZA 4QGPA 3STLC 1OHFA 1GSLA 3IM0A 4E27A 1CAWB 3HN1A 4BIOA 5IYCO 1PO21 4TYSA 1AL22 4PI0A 2W94A 4ISQA 5FQ0A 3HB3B 2JDUA 3WR0A 2PAMA 4NIAA 2WSVA 4KHPB 1P8JA 2G9ZA 1QQP3 3E1F1 4DR3O 1G7YA 2GC1A 2ATKC 3ZYHA 3RPQA 3LNMB 1W8OA 2HR3A 5LY1A 2EBOA 1JZ3A 1LOCA 1WD4A 3HBKA 1ULGA 2VZSA 4QU1A 2H0BA 3MYXA 1VBE1 4LO5B 3VBFB 3SYPA 1S4CA 1UIJA 3VKLA 3FFQA 5CB7A 1RPRA 4FAGA 1YEWA 1UFIA 4Y5TA 4CUAA 2DYRB 4ITCA 1R093 3RYCB 4AG4A 1AVBA 3PIGA 4TWKA 4R7CA 4FOVA 4UFJA 1W0KG 1Y76A 4F7ZA 3ZN4A 2RM22 3ACFA 5C3QA 4EN9B 1JOYA 2VMGA 4JTDB 1BSMA 1CP9A 3VD4A 3R4UA 2WWWA 3F95A 4RUFA 2ZHKA 4P9OA 4PA3A 1MZ5A 4MVQA 5JCTA 4NHMA 3CCUV 5HXMA 3K75B 2V5YA 1C28A 3OJBA 3A0HZ 3CL1A 1W6PA 5GM0A 1KDKA 2JDPA 5I8YA 5L7OB 2WL1A 2ADQB 4ZXKA 3TXQA 4GXLA 5L3BA 1O5UA 1FD9A 2OA2A 2TUNA 5L7OA 1QOOA 2ZXWB 4W8JA 5LHIA 5JDBA 1HR0B 4QKBA 1NCQB 1Q6IA 4GB32 1AL0G 5JOZA 3PN1A 3N9PA 2ZZJA 2ZM6B 1NZCA 4MVZA 3JBG1 4P9WA 3PTRB 4JI5B 5J2TA 1XJAA 4C1XA 1M56C 1F4AA 4OUSA 1Q86W 3WF4A 2HVJC 1O8PA 2R062 4BK5A 3WB0A 2P6JA 2RS12 5FYMA 5CB4B 2WLLA 2A3YA 3MV11 1SLAA 3CRMA 1FT9A 4N21A 5B1OA 1CAXB 4N7IA 4QPGC 3IAYA 4CEYA 1VBD1 1VRH1 3AJZA 5IWAO 1US6A 5JOXA 4N43A 1W2BU 3U14A 3RBZA 3OGJA 2FZ2A 1PO11 2OIEA 3ZN6A 1DLBA 2Q30A 4FMTA 2E63A 4PHZA 1XL4A 1S0EA 1QXJA 3ZXEA 3S0MA 2VMCA 2KQXA 3HKCA 1OD5A 1AR72 3AYEA 4YW6A 1J1TA 3RQ0A 1U5YA 2EULA 2WO7A 1PMHX 1Q6HA 1J59A 5DDJ3 5EK0A 1REEA 2IVIB 2YICA 1N1SA 2JGDA 5HCBA 4GMP1 1OD3A 3ZS8C 4WVMA 5IYDO 3AKRA 4FPEA 1LCLA 3T2MA 4IL7A 2XB6C 3QOPA 4HN1A 2VGDA 4HL0A 3ZXDA 2LGQA 1C1LA 2CYFA 4M4RA 4AEMA 2VCCA 4NHYA 5HCAA 3ZIXA 2V09A 2DUOA 3AG2C 5H9QA 4NMIA 2ZE8A 1Q56A 5BNQA 1JUHA 3NSTA 2QWOB 2R072 1QDOA 5LCWL 1JYVA 1AUYA 3B02A 1W9YA 4R52A 2ZE5A 4CP0A 3M3CA 1JU3A 2YPJA 3M8LA 1DG6A 1ODMA 5KMGA 5DXDA 1GTOA 5F6LB 3OR7C 1PZ8A 3OSDA 4UF0B 4LBEC 4X1YB 5GW7A 1QU7A 1F4NA 1LNQA 4HKLA 2VZ3A 1OLRA 5EV7A 2LQTA 1SCRA 1RUD3 4FQ4A 2I2SA 4ARYA 1SLTA 4IV1B 5EPAA 1F2NA 2XOMA 2UXBB 4QKDA 3H1YA 3BIWE 4WM7A 1PL4A 2YXYA 4JX0A 3L9JT 4DV3O 4AL9A 3HT2A 4QXCA 2B4KA 2J1RA 3RRDA 5HFMA 2VZVA 4Z2AA 4EN0A 1Q90D 3KZ4C 4YVSB 1ND3A 5C8WA 3UKNA 2IW5A 2BU9A 4DV6O 1O5LA 3FBMA 1L3JA 1UOFA 4G28B 1V55C 2AUYA 3I3BA 4AAXA 3K5MA 1WWYA 3PMSA 1BBT1 4OZOA 4JGZA 3H0OA 1L8DA 4L8JA 1XOYA 2W1WA 1EV13 2ZPXA 5KHKA 3MDPA 5D21A 1PNMA 1JX9A 4DUYB 5DG2A 5ITZA 4HXCA 5KHIA 1V9U2 1MABG 2UUAB 4GWJA 3BU0A 5CFDA 2Q1FA 2WZR3 1QOTA 3WB2A 5LXTB 2JDMA 1VMHA 4NTYA 1W6NB 3T1MA 2UXCO 1RYYA 1Y66A 4AQYO 4LR4A 3NL1A 1F5FA 4IGGA 4CCKA 3SJQC 1CPNA 2CGOA 2FDKA 1GZWB 2B45X 2O57A 2D6OX 3SHRA 1ZX3A 2HEVF 2D6KA 1ZBA2 1JYCA 4B4QA 2WN2A 4QB6A 1CR7A 3VHPA 1GQHA 3K0DA 5A6XA 3LSUA 4B3TB 4XF9A 3E83A 5E16A 4FLUA 1VF5B 2HWE2 1YJLA 3K79A 3RVZA 3AG4C 3HNYM 3DSQA 3KQ4B 4WM8A 2BFUS 3CC7V 3PJSK 1FAYA 2FMYA 1QMJA 4P9JA 3LQCA 1GOHA 4DV7B 2FZ1A 1W9WA 5IY5B 3J8F3 1TE1B 1IBKB 1SQXH 1Y6XA 2P4EA 1BCXA 1NXMA 3P30A 1Q5OA 2MEV1 5FTTC 3BA8A 3ZXFA 3ENRA 4E2GA 2DURA 4LA3A 1M4UA 2RJKA 3JAKA 1PIV1 4CCMA 1QF3A 2EIMB 1YTFD 4E8DA 5FZDA 2DU0A 4KHPO 2WA3A 2WAMA 5A3TA 2Z79A 2ADEA 4Q4X1 1NCRA 2VR4A 5B4NA 1YXWA 3RYHA 3USUB 1ZL8B 4GH4C 4CE8A 2ZACA 2BUKA 4XF0A 4IEUA 4AFAA 4QE9A 3IN9A 4NXMO 1JMKC 3E2EA 4OHWA 5JVDB 5BYNA 4UXNA 5BY1A 1EPZA 4ZI7B 1H1IA 1XILA 2OXBA 5FK8A 4META 4EZHA 2ZEZA 4BQ5A 1LOEA 4B08A 4YFWA 1C5IA 4NTWA 3PU3A 4QHZA 2JEUA 4AI2A 4PQ9A 3HD8B 3C90A 2PHDA 1BMV2 3J7LA 4A3ZA 3NV3A 3GBGA 3T0AA 2YDEA 2CWMA 3ZX6A 3LFMA 2WT2A 4XJAA 3HKDA 2OWOA 1FV3A 3WB1A 1AYM2 2OT7A 2HEYF 4GULA 4AF9A 3SYOA 3FFZA 4X64B 5DEDA 3ECQA 5FZ9A 3WHTA 1W59A 3RS6A 5I0TA 1PGL2 5FXZA 3ZCCA 1RHI3 3NKGA 1D4M2 2VG9A 5I0RA 5T5JA 3NR7A 1Z78A 1GN6A 2IXHA 3LA2A 4E2QA 2D98A 1K97A 1O59A 1GKFA 1NU1H 4LBQD 2QZ2A 3VBOA 2VW1A 1APNA 3U1XA 4AEDA 1YSCA 4XABA 4B3SO 1F51A 2BOJA 4LBMA 2BNNA 1RUE1 2A6ZA 3VBFC 4ZKIA 5JJNB 2P4VA 1IPJA 2NN8A 2HKOA 1HB1A 5FV3A 1LOAA 2X6CA 3FKSG 5H6RA 3ZRWB 2FCVA 3SDLA 2VNRA 5EYYA 2PXJA 1K42A 1FMD3 5CA6A 1FJGB 2UU8A 1WN7A 1AP5A 4N9HA 2QUOA 1UF2C 1HV1A 2IJKA 4O4IA 4D7YA 2HWD3 4OFGA 4RQEA 1SFYA 3P32A 2WLMA 1O9HA 1GOFA 3ZRSA 2JK5C 5LBQA 3H8UA 3A0NA 3DGTA 2QWNB 1MZ6A 1JZ6A 1NLRA 3MF6A 3G67A 3APQA 2YIDA 1CESA 1ZRDA 1XEQA 5BNPA 2KKWA 4FTBA 2TNFA 1IS5A 1PHMA 2ERFA 4YZ2A 2D43A 2RDQA 1WB8A 1H6YA 4YM1A 2NNUA 4ABMA 3HQUA 5FUPA 4CH5A 2Y69C 1NCQC 3AL5A 2HWF3 5D8AC 3JD0A 1T2XA 1JFFB 4F6RB 2ZINA 2WQZC 4J42A 3K5LA 5FAXA 1RJ8A 4FLYA 5K1PA 4HYOA 2XHBA 3AP6A 3VQVA 3T4ZA 4KH9A 1K5MC 1GOGA 1PX3A 4IHJB 4SBVA 5BR8B 5JIAA 1B35C 4K7JA 2RDSA 3AP9A 4Q27A 1DYOA 1LENA 3HR9A 4ZS2A 1D5AA 4JV4A 2ZBJA 4XURA 3CD6V 3SMHA 3T30A 3LUTB 5EZYB 3OD4A 3KKYA 2WLPA 5CFCC 2RCVA 4IGQA 3VD9A 1K73W 2IBZH 3ZXLA 1ZAUA 1NZ6A 4IL6Z 3E5QA 4CCCA 1R1A3 4NR1A 1SPPA 4Q8LA 5FPVA 2HEWF 5LATA 3VZNA 3ZFFA 4KWUA 5IT9N 1QJX3 1NA1A 1DF0A 1YTFB 3K0GA 4AR2A 1UN1A 4UW6A 2UXBO 5CA3A 4XFFA 1K5SA 4H7MA 5EBMC 3IPVB 3KV9A 1UAIA 2JE9A 2GDSA 1BEV3 4W6XA 1AILA 4AEJA 5FY8A 1KRIA 3OUHA 3B01A 1WZXA 1SKVA 1OFNA 3Q4HB 2ET1A 4GX5A 5FPLA 2X6AA 4Y4YA 2OYQA 1KUQA 3IAQA 1KGYA 3HEIA 3IGAC 4J25A 3H8RA 4CCNA 3I55V 1M06G 4NRQA 3L9DA 3IIAA 1IBLO 4JF3A 3PTYA 3V64A 4UAPA 4IE7A 3AKQA 2JG9C 5LMNO 4K0KO 5EYXA 2F4LA 5FLXN 4Q4W3 1WW6A 2C9KA 3HPLC 4J11A 1CAVA 4GX2A 4JTAB 4A7ZA 5FIXA 1RVF3 1KB9F 3VUOA 1DGRN 2EX3A 1IPSA 2GP5A 2K9ZA 1DGLA 4FSJA 3JALA 5LEJA 3AL6A 2UUCB 4JI1O 1GR3A 2Q5TA 2BP6A 1GN3A 4DB5A 4U3JA 2HBTA 4D3WA 3D3QA 3HKBB 2OX0A 5FOJB 2R32A 2CTQA 4Q4Y3 4CDQB 4LR3A 5AG2A 4ATFA 4L9BA 4LBQB 1QJY3 4XMIA 4LKEA 4FPPA 5EBWC 3I3EA 2NYYA 1YCIA 3LSDA 4JZ2A 3D82A 1UD1A 1C4RA 2EXJA 5IT6A 5FO7B 4MLOA 4B4RA 3ASOB 2WLIA 2BCCH 2PYJA 4NROA 3CF6E 1XSRA 1QWRA 4CXYA 1VQMV 4MTOA 2GN7A 1LOFC 4HFSA 4JCKA 4DV7O 1KDMA 2Q0OC 1V70A 5JXHA 1IBKO 4WBNA 2KD7A 3LGRA 4XQWA 2XBO2 1W99A 2BE3A 2X6BA 1AR71 1C8M2 3G6EV 3ABLB 3DXTA 1YVWA 2VW2A 1HDKA 1JR9A 4B7KA 2JDIG 3ZYGA 4YSFA 3CP1A 4JI8B 5KHJA 2W3JA 3NNFA 3M8AA 4YW4A 1HNWB 1DGSA 3I3DA 4ES8A 4UBGA 4M0HA 5IATA 3A2FA 1WCSA 2HLEA 4YW5A 1HRI3 2FL4A 5F2VO 5CISA 1XNQB 2WS91 1OH4A 2DTYA 4QPJA 1STMA 4XW3A 1FAFA 1SA0B 1DQ4A 4LF7B 3J81N 4A5UB 2KG7A 1BQ0A 3O7OA 3ASIA 5T52A 3K9AA 3BB6A 3VBRA 1BK0A 2L35A 4X1KB 5IY5C 2Q8EA 4CRQA 1VE0A 5IJ0A 3MO4A 4MHRA 3VV1A 2X5IB 4DV2B 3JSNA 2VXJA 3KHCA 1F15A 5IFPA 5A9GA 2GU9A 3B40A 5DECA 4I55B 3CE2A 1A34A 4U7NA 2XUMA 2RS33 3J7MA 3IC9A 5CU1A 5KUMA 4HANA 3WQ1A 2ZGNA 2ZIMA 4KI5M 5F1RA 1GV9A 2A0LA 2VMDA 3DYOA 4X64O 1SBFA 3K4ZA 4N9IA 4BJ0A 5C9AB 2ARAA 2VCMA 1BS3A 1I5XA 3EJKA 3DYPA 3R66A 4M01A 4FO9A 4O9GA 3RYKA 1OCCC 2AXTZ 3N7JA 2Q67A 3SH3A 4BDVB 5A32A 3VQXA 4DR4B 1S0JA 4CH3A 4CA9A 2F43G 3TETA 2BW8A 3ZDVA 5K4LA 2ETNA 2RMU2 3T0BA 1H30A 2BTOA 2CH7A 4QPIB 4PIZA 4CDUB 4LOTA 4YNIA 3JSLA 2VZQA 4XC9A 4UVBA 5FPXA 3THOA 5LA2A 4M00A 1S2KA 4XDJA 1YQ6A 1J58A 4Q1PA 2X09A 2VQUA 1K9MW 1V6IA 2WO2A 2AC1A 5KXBA 1JTZX 4XQ4A 1KQSU 4RS5A 2GUZB 5HCFA 4NIDA 4YFZA 5EYPB 1S1AA 3BUCA 4E4SA 4NYKA 3KV6A 4LF9B 1YI7A 4AVAA 3N7LA 3E6CC 2Z5UA 1BMFG 1QHTA 2R1DA 3ZYFA 1WP7A 2DWDC 2HWE1 2CTPA 2A06H 1XU1A 2YB7A 1TME2 3L72H 5FO9B 3THDA 1X9PA 2UURA 4QX0A 3JB8A 4B3RB 3EMRA 1M90W 3ROUA 1R3JC 1YJWV 4HKWA 1G6UA 5T5PA 1I94B 2JIGA 2VU9A 1EAH3 5C8YA 3OGSA 1GICA 3JZVA 4EROA 4Z8BA 5A3NA 1BHBA 3MW4A 2A3WA 1IKPA 4FP2A 4OX9B 2Y6KA 4FLTA 1DYKA 5IWFA 2YZ4A 1R083 5BR8O 1WLCA 2RVAA 1MS9A 3L2YA 3WF3A 1WB7A 1JJOA 4Q0VA 3JD1A 2OW4A 4IXLA 3GBFA 4YVWA 2JXAA 5IJRA 1VBC2 4LFBO 1AR83 2HJFC 5F3IA 1MVEA 4YZ4A 2AHYA 4D94A 1OA4A 1HQNA 5CA0B 2D5HA 1MSWD 1M57B 4FZ1A 4LMFA 1MS1A 2GNMA 1ND2A 3FLTA 3IZOA 1DQ5A 3FLRA 2UYAA 2P4KA 4TSVA 3CCLV 1W9TA 3I56V 2CSGA 2VUJA 1AROP 2XAGA 4ASMB 2ZD9A 2ZKOA 3CMEV 3HPNA 3GYDA 3CRQA 4YGBA 1R3KC 5LMUB 3ASNC 3BTAA 4YWAA 5HFLA 2PHWA 4RN5A 4FI9A 1BMV1 4MGZE 4LE3A 3RZJA 2JICA 4XMAA 4OLLA 4P9XA 3LAGA 5FPZA 1SBDA 4SLIA 1AYM1 2Q73A 5DAXA 4AQ2A 1Q81W 5FZ7A 4IIJB 5FZCA 1H2LA 1AXZA 5JZGA 1PNLA 3WG4A 1YYNA 2B9ZA 5BNOA 2R0HA 3UGGA 3T09A 1FXZA 2Y0IA 1QJU1 3FB6C 3M3EA 3B69A 4CU6A 1WA6X 4MHUA 2GN3A 1DF5A 3ETDA 1Q8SA 1WD3A 3HVDA 2F6BA 3ABMB 2AREA 4I50B 5FLIA 3AYAA 3WP6A 4CH6A 4DXWA 3N27A 1WJZA 2P5BA 3C7OA 3WCSA 5D5QA 1FFTB 2O0OA 4XPVA 5JOYA 4XDKA 1X9TA 1JBCA 4CDXB 1Y67A 1TMF1 2GDFA 4Y22B 5BNNB 4CP9B 2D6PA 3WOGA 2VPVA 4BWOA 5GLUA 1FV2A 4GKXA 1YF2A 3FZ3A 3UT5A 3PIJA 3A0KA 2J1SA 4BQ3A 2PHXA 2R70A 4XBNA 4XZUG 3LIHA 5GLVA 3MLLA 2LGWA 3WF0A 2ZJCA 5B4XA 4XXPA 1CWPA 5IYYA 4P9GA 2VMHA 2ZGLA 4QAWA 4PF5A 3HKEA 1XYOA 4FM0A 4DFSA 4MVRA 1UU6A 3JAWB 1ENRA 2WSSG 2EJ7A 1M4WA 2W0XA 2DV9A 2ZR3A 3WVJA 3T1CA 1VBA2 2BERA 2J42A 4RHV1 5L3DA 2OPWA 5AFBA 2JDAA 4M0NA 4CUGA 1GP4A 2OTJV 3ILFA 5CBHA 5JQGB 1FXKC 2EILB 2VECA 3DXRA 3VD3A 4MS2A 2GMEA 3D3AA 3EB7A 5IJ9A 5C4WA 4CC6A 4IQPA 4WVZA 3E8FA 2NLRA 4CEWC 4LP8A 1FPOA 1DTOA 3R4DB 3I2JA 2ZGTA 1FATA 1NI8A 1PMJX 1L7QA 4K40A 4Q6GA 1N33B 1CN1A 3ABZA 1WUVA 2WLKA 3VHRA 2CK3G 4GCZA 3BOWA 2WAAA 3QNEA 4KG0A 1Z7S3 5KC5A 4BA6A 3SNMA 3JD72 3ZN1A 1CZSA 1XNQO 5FBZA 1SLIA 1MEC3 4OXSA 4AHZA 3QF7A 1RM1B 5FMDA 4GKKB 4LF7O 3NXSA 3FE5A 3FLPA 3VDBA 2CDYA 2JDHA 4DY5A 5C5TA 3UL2A 2D7FA 1UY4A 1JCHA 4XVHA 4PELA 3T4VA 4JQRA 3PNAA 2P3KA 4WVVA 3ZKUA 1SZBA 5C8CA 2KM2A 1PK6A 4JGYC 3POWA 3ZHSA 1CEZA 4YW2A 3TWIA 4FJCC 4W4ZA 3L71H 1XBFA 1ONAA 4IEZA 4LNVA 1YQ5A 2BYVE 4Y1UA 2ATFA 2DOSA 5ABJB 3N36A 3T1YO 1ZZ9A 4CVUA 1B06A 4HBNA 4RWUA 5K0UA 3ITQA 4CSWA 3ZR5A 2F4PA 1AL23 5BMVA 2MHFA 3LDEA 3CS5A 1AZDA 4JVAA 5CKQA 1SQPH 3ES4A 3OY8B 1W8ZA 3OTFA 4UCOA 1V6JA 2YIAA 5JPMB 4LF4B 3T1HO 2HWC3 4X62B 3A7QA 1DQ0A 4XJ9A 4HZ3A 4DR5O 3UT0A 1JHJA 2ZGMA 4CC5A 1QJFA 2YIBA 1JU4A 1V54B 1B6QA 1EM1A 1QHDA 1I0HA 2IH1C 4JGSA 1N34O 4ZU4A 1ENQA 2YPDA 3TGUH 3OGRA 4DV4B 4N7UA 4A6OA 5EJ1B 4MH0E 4XETA 1XE8A 3W59A 1XU2A 1VB4A 2WLNA 2O8OA 3FX7A 1CAUA 4HVRA 1RTVA 4F6EA 3CJHA 4CZSA 1MS4A 1AR61 3JAMN 4DO2A 4GZ9A 2VZ1A 2K0GA 1TVKA 1S0GA 3SEEA 5FPUA 5EQUA 1E79G 5JCOA 1ZRIA 1BHAA 4D6QA 2RR13 2ZEWA 5E1RA 2RM23 2FMLA 2RS52 5FZOB 2XWJB 1Y43B 4H7LA 3POYA 2Q69A 3ZDSA 4Q4V2 4ZOLA 4LH7A 1XNDA 5DZGA 3E8HA 5AC93 4TZDA 4J10A 5A3MA 4J9ZB 1MSDA 2VL4A 3H9AA 2XDVA 2BVBA 4Z92B 4N53B 2QJ1A 4EB6B 1EUTA 4JDNA 2QTSA 5HBAA 5FXXA 4PLOA 1DZTA 3OUFA 1N0JA 2J1TA 1JPXA 4FZ0A 4CDUC 1HNZB 1XPWA 2YSUB 2O8QA 4AHXA 4O4HA 3LWCA 5LP6A 2FCUA 4LBLA 2A7WA 4GB33 2XBO1 3D5OA 3E22A 4OX9O 1T6GC 4LF6B 2V73A 3V0AA 4BW9A 1C8M1 1PZ9A 1F5JA 3GXUA 2E31A 4AGGA 4JV5B 1E1QG 4X8AA 4JI0O 1BYHA 3TN92 5JJJB 2EICA 4MVSA 1Q82W 3OTOB 2ZNIA 3X2QB 2IXJA 2R063 1AR92 1UMIA 2RS13 1UPGA 4RR3A 1TG7A 4JASA 1PVC2 2A6XA 4LT5A 2HJDA 5LK7B 4COUA 1NG0A 3BCCH 5LBCA 4LF8B 1SC5B 3OBRA 1Y9MA 4PV1B 2WIIB 1IOAA 3HOBA 4CEYC 4UCVA 4JAVA 3WUCA 4ICGA 1IGOA 1FI2A 4OGQB 2HP8A 3MLJA 4UCUA 3WP4A 1WKYA 2ZABA 1NKDA 5FY7A 3AZZA 5FYHA 2UY8A 2W1QA 1CZVA 2ZGUA 2GH8A 4L0PA 5E88A 1W2AX 1OQDA 4CDWB 5LMUO 3RYIA 3ML0A 5FZ3A 3ZFEB 1QKQA 4UFMA 3R65A 1ZZBA 4Y4RA 5A7SA 3KCCA 2VTXJ 1UWWA 3TEYA 4A3XA 4UOJA 1Q43A 2OKXA 3N3HA 1PO22 4Q5OA 2CTRA 2ZX2A 2BWCA 4DS0A 4TV8A 1TGOA 4KWLA 1CD3G 4IV3B 4K1YA 1W06A 5A7WA 1RL3A 3F5TA 2L9LA 2R073 3I4IA 2PYLA 3LA7A 1LHVA 4D69A 2D5FA 1SLBA 2ZAAA 3BAAA 1UKRA 2EIKC 2C24A 1ZUQA 2P5OA 1QLEC 3VBHB 2E75B 4I9WA 1ST8A 1RP3B 2WUHA 4JZRA 2WNVB 4DEVA 3KG2A 1MQTA 1C1FA 2QM8A 3HNMA 4IT5A 4P00B 2WNVA 2EA7A 4A2UA 3H3UA 3EXUA 3NAPA 4HPKA 4JRAA 4BZ4A 3ETPA 4IETA 2WAOA 3VBUB 1GP5A 2YGLA 5FP9A 5IVYA 4QDRA 2IJJA 2XJPA 3O5SA 3KMHA 1GKBA 3GWOA 4I0BA 5FZ1A 2ORZA 1POV0 5IW0A 5LA6A 1QJZA 2E7TA 5IVBA 4R9CA 3HAGA 5B1NA 1AYN2 4GA9A 1W90A 4AEKA 2V5DA 5LA9A 2HWB1 2UXDO 2OQ7A 1B09A 4I9QA 4FFBA 4CBCA 4XDQA 2G4IA 5GZCA 4LULA 2R9IA 1H8TB 1MOFA 1ND3C 2IZWA 1ASJ2 1NR1A 2E5LO 2W92A 1KMIZ 2DUQA 2R1BA 2FDHA 2V1DA 4FTEA 3FAVA 5DZFA 1W6OB 3ABMC 4M4PA 4LNUB 2EIJC 2VULA 3AMQA 1TME1 3VLBB 1JYNA 1ZRRA 5I0SA 1SQ4A 1S0BA 1W6OA 1DU3D 4JGZC 5FYZA 1AI4A 3TRSB 3OGCC 2QR4A 1OC1A 4I3GA 2ZE6A 1KXGA 4BISA 4C90A 1G4YB 2OUJA 4GWIA 4DUWA 1V9U3 5A3PA 4YYOA 2JJ1G 4QQOA 1ENXA 3R4SA 1AI5A 3G6BA 4S2GA 3ZMTA 1HNXB 5CFDC 1FKAO 3H50A 4K6BA 2F66C 5FZBA 4EQVA 2WWSA 3VB9A 3S7IA 2GC2A 2O1QA 4XUNA 4H0LB 2QTWB 2RJZA 1ZBA3 4FLWA 3CC4V 4CPBA 4A41A 1VBC1 1VR3A 4LIUA 1JZ2A 4EFBA 4QGLA 3H42B 4GKKO 3OYWB 5ANNA 1RUC2 3SPJA 1S0FA 3USSA 1F8VA 1E1RG 2CDOA 5JR7B 3EYPA 5H6QA 4QD2A 1XYPA 2W46A 4E4DX 5FR3A 3N7MA 2LM3A 4TUYB 1K92A 2P90A 4WM8C 2PY5A 2VTXA 5FNVA 4ZHQB 5GZFA 1F9KA 3IDCB 1FFXA 1TNRA 1VBD2 1VRH2 2LFRA 2W6IG 3VZKA 3WP3A 5E8AA 3N9MA 4FBFA 4J80A 3PLQA 1NS1A 3SGIA 3I3MA 3JASA 1Y74A 4O2AA 1PM7A 2W9XA 2WFF1 4ISRA 2P17A 2TBVA 2JD9A 1U96A 1N4CA 4AFCA 1MR5A 2QE3A 3ZVXA 1ZBE1 5B5EZ 2BSKB 4UW3A 2RDNA 3GZAA 5FZAA 3N2GB 1A78A 2PAEA 3SJAC 1VEWA 4CU8A 1X8MA 4UFKA 1ZSPA 3WUDA 3CLPA 4AFBA 3PVOA 4LK7A 1NCRC 1ORQC 4NE9A 3AM2A 3VOUA 5C3SA 3SPIA 1DF4A 1W03A 1ACCA 1VQNV 1RSOA 2DU1A 2K2SA 5LWBA 3P6BA 3POSA 1J3QA 2QQMA 1LNSA 5K9YA 1PL0A 3HN3A 1XMOO 4DR3B 3R6SA 4R50A 4QX5A 2R9RB 3FL7A 5F8PA 5T50A 5GZGA 4EWDA 2X29A 3ACLA 1FYUA 2QQUA 1C5HA 3JARA 1W6QA 2IXCA 3OW2U 2JKXA 1AI6A 1YI2V 3CO2A 3SCHA 5JVVA 3MD0A 2XJRA 1H2GA 2QE7G 5KA5A 1W8HA 1YNAA 1RUH1 3K04A 4CZZA 1BZWA 5FYBA 5H9RA 3MIHA 3QACA 5J7MA 3NWKA 5F6KA 1NQDA 2ZEYA 1AR1B 2P3JA 4YGCA 4FIPC 4B1MA 1FXVA 4DR2B 1QNYA 1MG1A 1ZA4A 2D44A 4LHSA 5HI0A 5J48A 1BVVA 1HXS3 1YIFA 3WEZA 2RNBA 3KCYA 3LDCA 4YXWG 3U4SA 5L73A 2IXKA 1FNYA 2VAUA 1D4M3 4OI2A 1M56B 2B8MA 4P14A 2F93B 3K3OA 1VBB1 1OVSA 1O6UA 4KMQA 1YUDA 2PZSA 3WSOA 4Z1VA 5H9CA 2JEMA 1KECA 1Z2GA 2YEVA 2I74A 4XFCA 1W3VA 3ST7A 1L0LH 4TTGA 2CHHA 3MFAA 2GMMA 4AEDC 4Y1XA 1BBT2 4NB5A 2XVLA 1H8VA 4EEQA 2WNOA 4QPGB 3L75H 1IKQA 1ULPA 3K3NA 4H2AA 4OHXA 4Z07A 1POV3 1OCRC 1TNFA 1YHQV 4D6TH 3AK0A 4AQ6A 1EUUA 1ZRFA 1UJWB 1EFRG 5F32A 4K1ZA 4QQ2A 4JI4O 2DCZA 1RUOA 3RFRA 2R041 5FLJA 1B3QA 4KU7A 1DFQA 3L2HA 2GNDA 5FYUA 4LE4A 2NM1A 1V9PA 2ZT9B 1MZEA 2VOKA 4X65O 1G9FA 5FP7A 1ENSA 5KAFZ 3BEHA 3JD71 2IJHA 2ZMKA 1S76D 3EVKA 2I07B 3F7YC 1SG3A 3T4DA 2OVUA 2Y6LA 2ADPA 3LPGA 2IH3C 4N53C 3RG0A 4TQFA 1ULDA 4O65A 3G80A 5DDJ2 2J1EA 4UFLA 5A80A 2N7GA 1K5JA 3ZSKA 4XUPA 2WZ8A 4XDLA 4RQPA 4Y26A 5EP9A 1W6MB 1W0JG 1AB3A 2Y6FA 4J1XA 5CYYA 2V7QG 1R1ZA 5HXVA 3MLKA 2XT9A 3DC5A 3D36C 4COZA 3J7HA 2PQSA 2DVFA 3SR2C 5GTIZ 3MIFA 2QKDA 3J80N 1DGWX 1J5EO 4WFEA 2WYFA 4W6YA 2XH6A 4DRXA 1QOSA 4AFDA 3LOIA 5J09A 1QXRA 5LBBA 1Q8PA 1RUD2 3LOBA 5KLVH 3MV01 4ZIBA 4UUJC 3W9AA 2WABA 4Q4X2 2EIGA 2AZ2A 2VWJA 4L8QA 1XYNA 5C70A 4K20A 4X8NA 5FP8A 4YZ5A 3VZOA 3MFCA 4HETA 1VQ6V 1YI9A 4TV9A 2VOVA 2C1FA 4ORFA 1V55B 3ABKC 1G1XB 3E97A 4HNAA 1FOD2 1HQLA 3ZSLA 4COVA 3FBYA 1S2EA 4O4JB 3N9LA 1FPN3 2D40A 5A33A 4XEZA 1N47A 4J7ZA 3OPWA 1WW4A 3DPRB 2YXHA 4DR6B 4D0QA 3B7MA 4EKWA 3J26N 5IYZB 2RS51 3I59A 2M6YA 2MK3A 3DEMA 4IV3C 4DV3B 4QX2A 3KB5A 4I0XA 3JD4A 4PDWA 3B8NA 1IQAA 3VKOA 3R0RA 4XCBA 4LWSA 3VHNA 2D6MA 3VBHC 2QQJA 3VDDA 1OV9A 2GALA 4CYDA 3E89A 5LHHA 1JH5A 5GZEA 4PDRA 4YJ3A 3PU8A 5DAWA 5FPAA 4DV6B 4N90A 3H1WA 3AG4B 2YI8A 1UYYA 3BRCA 3FB8C 1KBHA 3MUY1 3POGA 5KR7A 1K3IA 1RUE2 5CBLA 4S2FA 4XJZA 1NH2D 2RJLA 4NXNO 3HJRA 2ETEA 1RIRA 4O9EA 1NTZH 3TN91 3SJCC 4X88A 1LULA 2Z4FA 1V00A 1PNKA 5KC6A 3RI9A 3ACIA 4HLTA 4P9IA 5ACA3 3VKFC 3N2KB 2B5UA 2ID4A 2UXCB 5LL6Y 3IDBB 2C5DA 4AQTA 2XUEA 1PVC1 4C7UA 3AKSA 2AW9A 1QBZA 3T2QA 2GP3A 2YROA 4EE2A 3RZMA 2JE7A 4DXRA 2JB4A 4O4LB 5G04L 1JZ4A 2CDPA 5C71A 4X1IB 4CCOA 2JDZA 3GALA 4LO6B 4HN0A 3WCRA 2ZX0A 3ALQA 4GH4B 3JATB 3OG2A 1O9GA 4Q29A 4LTAA 4ZONA 5EWSA 5FWEA 4X8PA 4XQDA 5EZWA 1JHNA 3TBDA 1UPSA 4JC1A 4XXAA 3VBSA 1QDCA 5FKBA 4NOTA 1UY1A 2A79B 2P2KA 1RMU1 5EC1C 4JDMA 2R7EB 1ZREA 1RUG1 3MW2A 1BCCH 5DABA 3ZFGA 3ZO0B 4PLMA 3I2HA 3OUIA 1H2NA 4HSJA 3K06A 3NJVA 1PGW1 3EHBB 3KCXA 2Y6HA 2KR2A 1DGRA 2ZQMA 1CAWA 3AJYA 3V0BB 1O3SA 1QY4A 1MS0A 2F4VO 1RUF3 5GLTA 4YJ2B 1PX4A 1QLNA 3I7DA 2A5ZA 1AVMA 1YFWA 2Y6GA 5L3FA 2PI4A 5JAXA 1YXBA 2ZR2A 1UYXA 2LUWA 4NXMB 3K77A 1HN1A 1D0GA 3NVCA 1Y4WA 5CG8A 2Y4TA 4W4LA 2LRPA 1Q8IA 3E8BA 1RXGA 3K4DA 4AI8A 3VGIA 3APBA 1WCUA 3I2DA 3LPFA 4MGTA 1NLQA 4KGQA 4J41A 3VHOA 4DR2O 3JCUZ 4DO0A 4B3MO 2P1BA 3CHXA 5IK8A 1QU0A 4Q26A 5LYJB 3VBFA 4IYIA 1YJNV 3V65A 5LGTA 5HV0A 1JMUB 4JI7O 1AYN1 5K1XA 4FPYA 2JIZG 5KX5B 3O1VA 3RYCA 3WT3A 5I8SA 2BTVC 5A3UA 3HMYA 3A0BZ 3PMEA 5LOVB 2Y60A 3O0WA 4ZZ8A 4FFIA 1NX9A 1ASJ1 3CXCU 2WPDG 2XQRA 1FMD2 3UM7A 1BT8A 5BXXA 1UU4A 2MW2B 2ZGOA 1LEDA 2BBVA 1BXHA 2FDJA 1VIBA 4FCAA 2W5FA 2HWD2 2DCKA 3LSEA 2RMU3 1PZ7A 4GT1A 3IIIA 4DV0O 4DK0A 4IE6A 1CX1A 2IFWA 1XHZA 2OCCC 1OURA 3PUQA 1LGNA 4YZ3A 3AZXA 4K3AA 3BPSA 1S0VA 3ZYPA 2Q1ZB 4Q0SA 1KD1W 2YC2A 1SLLA 2DYCA 3G4SV 4B3SB 2P34A 1YQ2A 1D2SA 3GCWA 3FD9A 2Y69B 3OM3B 1RUI1 5D8AB 1NUKA 4E2SA 4P9YA 4YW7A 5LBEA 3EHKA 2VZTA 1X59A 2IXLA 1NCQA 4PIXA 3TEZA 3AP5A 1LECA 1COV3 1K5MB 4RS5C 1MVQA 1VALA 1HB2A 2HWF2 1XDCA 1B35B 2XNDG 2R0FA 1AJPA 1V6NA 2QSAA 1RUC1 3ES1A 5FZ8A 3O12A 3JQWA 3P1IA 1H6XA 2XVKA 1GM7A 2Y4UA 3KF3A 5FKCA 2PLV2 1N8RW 1NH2B 2RDRA 3NQHA 5CB4A 4RGAA 5K7PA 5CFCB 1XNTA 2G9GA 3QO7A 1XHXA 5LASA 2AYHA 3WXPA 1CAXA 3RWRD 4DK1A 1W9FA 4Y1VA 4ATEA 3WF2A 2QQVA 1QQP1 4IEPA 3ZMOA 2PELA 5JMOA 5DG1A 5H9SA 1UMHA 5T5LA 3PUAA 1A3KA 2RJ2A 5A70A 1GWKA 5FZ0A 5FJHA 1W28A 2YMZA 1VBC3 2W39A 2FHRA 2FKXA 3KLSA 1WCQA 4MT8A 5L3GA 1QJX2 1P7GA 5FZIA 5J9PC 1TEIA 1R64A 2ET7A 1OOPB 1WBLA 5E6HA 1G8MA 5FMOS 4RAIA 3PUIA 1GUIA 4Y20B 1JOJA 1LRHA 2WS92 4PA7A 3ZJZA 5AVAA 1ND2C 4A7YA 5B2GB 3OF1A 4I3PA 2PHTA 3IJ4A 3BTYA 4IESA 1N36B 2JG9B 3ZBHA 3MGUA 4OHVA 1QR8A 4JYYA 2ZS6B 5GLWA 4GKJB 1AXYA 4GIQA 1WA8B 5FLHA 1DZQA 4DNYA 1OFSA 2D97A 2ZMLA 3O65A 2ZKLA 1JZ5A 3NV1A 2JD4A 4UF0A 3VKMA 4DR6O 2Q68A 4X1YA 4Q4W2 4IYHA 4XJUA 4Q1RA 1RVF2 1O3QA 1UW8A 1VQ8V 4IV1A 1AJKA 5J2UB 1M9NA 1XNCA 3M3IA 2WR9A 5B1AC 5L9RA 5IVEA 4XFHA 3I2IA 1A6CA 1YHFA 4J9YB 4MOAA 5L3EA 5JZGC 3A23A 1YIPA 2YG0A 4PJ0Z 1VQ9V 5BNOC 2Q7EA 3GJBA 4CS3A 2BOBC 3WF1A 2G38A 3BN6A 5HPOA 5A6YA 4OQ9A 4Q4Y2 4GLXA 4AGVA 4JYAB 4EJRA 3AG3C 4BW5A 4YVSA 2KXLA 5LW9A 3M2MA 3I2KA 1QJY2 1IBLB 4KNCA 1BJQA 4IE0A 5LMNB 5A7OA 4K0KB 5EBLC 1S77D 1J83A 3SXWA 1SFPA 1XI1A 1AJQA 1P4RA 1X50A 1YDXA 3H01A 4MVMA 3NO8A 1VQOV 3EO6A 3DPRC 4TN7A 1KKDA 5GTHZ 4WZCA 2PN5A 4PBPA 4JI1B 4JKMA 3IWZA 5E1AC 2V72A 1KQRA 5LXTA 3SPGA 1GNYA 1W6NA 4ZU5A 5FMOL 3J9SA 2EXHA 1UXXX 1QEXA 4XIOA 3CDZB 3TEXA 4HVOA 1GZWA 1MS5A 3OBZA 4Y1YA 3NMBA 4LFAO 3VZJA 1CXZB 2W1SA 1ZVFA 3MHZA 2FDGA 5DDJ1 1JVMA 2LW8A 3SYAA 3UQ8A 1PGSA 1VBA3 3IBMA 3B00A 3TEWA 3WX5A 2Y0PA 4LA2A 2VVEA 3MBWA 2HHHO 4DXTA 4YIOA 3CC2V 1J1LA 2WNUB 3SPCA 5A1FA 2VJXA 1WAZA 1J3PA 4D6RA 1CPMA 3I8TA 3E5XA 3S3XA 5C4WC 5KBFA 1WMEA 2DMXA 1V6OA 3WLUA 5JH7B 4B1LA 5L9VA 4MVUA 1TUBB 3VQWA 3IC7A 5KWRA 3VQYA 2BTQB 1ZZ6A 2ZHLA 2BZDA 1ZM1A 1VQ5V 4NKGB 3ZXJA 1N1TA 4WZFA 4RFT0 3VKNA 4LF5B 2G19A 1W2UA 2DFCA 3CX5F 4ONUA 1JOBA 4DRRA 2HVKC 1JYXA 1RUD1 5L3CA 2NR5A 1QGLA 5T54A 2CGPA 4XDPA 2FMDA 2XL9A 4XAEA 1K45A 3OEEG 1OLMA 2ZX1A 4WVWA 5TISZ 3H1JH 3M4FA 1OCCB 2X0LA 3RZZA 1I3HA 4AQSA 3USUA 2ODMA 4AFMA 1ZL8A 2ZE7A 3EXAA 4DZGA 4YARA 3TCUA 2YC4A 1EYBA 5C8CC 3N4MA 1PK6C 4JTNA 4AVCA 3LEMA 1W2TA 1RUJ3 5JVDA 1M5IA 5CA1B 2PFWA 1THZA 1KP3A 1FOD1 1VAMA 4ZI7A 3RI8A 1V6LA 4WBBA 5AVPA 3LFIA 1QNMA 1NKGA 2B42B 1GAXA 4B4PA 3CZJA 3PHMA 5L9BA 4FLVA 1COWG 4PA9A 1E5HA 2QDNA 4X66O 4EWAA 3THTA 3CJIB 3ZSJA 5KUKA 4C1WA 1KD7A 1KP2A 1EV11 2WQ4A 4HAMA 3WQ0A 2EAAA 4A45A 2FCTA 3ZHUA 2ZGSA 3T1LA 4MTFA 4B3NA 3CXHF 2PUSA 2WO1A 3CMAV 2WZR1 3BOPA 1ROPA 4M3CB 1PM4A 2BOCC 1XNRO 4CU7A 5KXDA 1QJU2 3VD7A 2Q5ZA 3OR6C 1S3JA 3C3TA 2H6CA 1G9AA 3H8OA 3DTUB 3STZC 3WG2A 2B5HA 1HWYA 4N8MA 1WMXA 2LROA 5LGNA 1LOBA 1LEMA 4NIGA 4OPHA 3AK2A 3GZUC 2XR4A 3NKTA 4DINB 2PGGA 2BPA2 3B77A 3LE0A 3G6JB 1GFF2 3ZR6A 2OYZA 1TMF2 5JCOC 1XC6A 4MXWB 2DTWA 3FX3A 1KFXL 4JHTA 2BBAA 2XL7A 1UY2A 1ZWIC 1PPJH 1W8NA 4Q4V3 4QJFB 3ZRWA 3KS7A 4X20B 3K5NA 4FK5C 4Z2WA 3J8F1 4XBQA 1I1EA 1G9CA 4IEWA 1YC61 4O2BB 1AI7A 3UKMA 4R8CA 1J3RA 4AVSA 5DUXA 2ORXA 3N9OA 4FOYA 5E79Z 1A32A 1WLDA 1V0AA 2ZKNA 2LALA 2WWUA 4MGYE 4E4EA 2FDFA 2A75A 3DECA 4BH9A 5IE9A 1F23A 1AR82 1CJPA 1DQ1A 1Y9QA 2PA7A 3W7SA 1IS3A 4QT6A 4LLFA 4XTPA 3O1PA 3RMYA 4G4FA 4RHV2 1AJOA 2QQKA 3RT3C 1UU5A 1QVFU 3OT7A 5LP6C 2VQEB 1HRV3 3Q8EA 4QDQA 3ACHA 2O14A 4UB6Z 4EZ4A 1HV0A 3RYFB 2Z42A 1KITA 2E6VA 1JUIA 2C6SA 2HKXA 4IW3A 2OUHA 1CJDA 1JFFA 4F6RA 1AR93 4YW1A 2A9HA 4FOWA 4LO4B 1O8SA 3TB0A 3ASNB 4TQDA 3OCPA 2JB8A 4HT1T 4ASUG 3ZYBA 4RR3C 3LA3A 1V6KA 4IHJA 4AOCA 4GMP0 4QGMA 3CCEV 3AFGA 1K33A 3ZOIA 1JYIA 4LFBB 1VQLV 1J84A 1NXD1 1R1BA 5T3NA 2VOWA 4QXKA 2XAQA 5L36A 3ZX7A 1O7FA 2D3RA 2ARXA 3O0XA 5EZYA 3CCMV 3OFNG 2DVGA 1N36O 3GHMA 3PURA 2RDCA 4GKJO 2VQTA 4AILC 4GZRB 4G2KA 3TJTA 5L19A 2A71A 4U7OA 3RVYA 5JLVA 1RHI1 1FNZA 5KXCA 2Y8KA 4JI3O 2WJSA 3O1RA 4I02A 3B4SA 1OQEA 2RQ6A 2E7QA 1TZOA 4XF4A 1PO23 4FXGB 2YBPA 2ES3A 2VUAA 2VQFO 1OOPC 4UBHA 5FY0A 4L92A 3EBRA 3IPVA 2RE9A 5IK4A 2E9QA 1SBEA 4CS4A 4CTEA 3Q4HA 4CCDA 4PDMA 2P3YA 4ZPIA 3WNMA 2ADDA 4JYAO 2A1XA 1FMD1 5F9TA 3POEA 4I4TB 3GGLA 3ZEDA 3FN9A 3ICXA 5A6ZA 4YG3A 2HWD1 3WQBA 2XGXA 4GQ7A 3OEAA 4GJYA 4IDZA 1MQTC 1JODA 4OI4A 4YRDA 2ITDC 5CKMA 5H2FZ 1VBE3 2VZUA 3NAPC 3K58A 1AR62 3AP7A 5EIYB 2ZZQA 4UYBA 1CQ9A 2YYOA 4Q8KA 1FXKB 4K9SA 2QM7A 1GO3F 3KZIZ 2ZX4A 4MV2A 2NMOA 3WDXA 2Y6JA 3UCSC 1I5YA 1YQ8A 4CEWB 3RWKX 4I7ZB 4Z1MG 5A3WA 4DUVA 4HK9A 1K5QA 4QQPA 5T55A 3POIA 4XF1A 2HWF1 3TXSA 4UCRA 3OPTA 3HKBA 1IDSA 4CDQA 1IXBA 3C7GA 4QHBA 3INAA 4LBQA 4B8EA 2IU0A 3RVHA 2JEXA 1R6NA 1OCZC 2PLV1 4CUBA 2GC0A 5GONB 1F4HA 3E86A 4ZS3A 4QX8A 2YFZA 1IXMA 2E76B 1SQFA 4XUQA 3JCZA 4DXSA 1GU3A 2B7YA 4MX3A 1VF6A 1I08A 5CG9A 3KT4A 2EVXA 5IVFA 4YHHO 4DV1O 4JGYB 1CX4A 3A4UA 3HR0A 1RUNA 4QXBA 2WN3A 3JBG3 1R1A1 2C2AA 4RA0A 4LF5O 3CEWA 2D3SA 1URXA 1ULEA 4R4ZA 4MUVA 1QJX1 2X8KA 2JE8A 2DBIA 2UXXA 1K7DA 3RYRA 2N74A 3W7XA 1S0IA 2VUCA 3BABA 4UVAA 1SEFA 2QQLA 2P3IA 5FQ0B 3D0SA 1IURA 2QKAA 3ZXAC 5ERLA 4P02B 3FHQA 5H9PA 4JKKA 1BEV1 4GKYA 2ITCC 4R6ZA 5IDJA 1VBD3 1VRH3 3M70A 2PI5A 4PI2A 3WFVA 3MIGA 3M99B 3AXDA 1LUVA 2XOKG 3U11A 4PA6A 1SA0A 3THCA 2HWC2 2WNUC 1LUWA 3B5LB 1PO13 2W6JG 1URFA 3WZ1A 4LO7A 2H0VA 4FM2A 1AR4A 3SH5A 3AK3A 4KUMA 1OXCA 4X1KA 2HFEC 3AG7A 4MVTA 4MO3M 3WDVA 2XJVA 5C5UA 3RZLA 2X5IA 2DW4A 1VF7A 4UV8A 1UY0A 3NNMA 4Q4W1 3K9SA 4I55A 1I5ZA 1RVF1 3I49A 3T1YB 5FY9A 3J7AU 4GMP3 3H7YA 4Y24A 2Z69A 1YO8A 1DLCA 1OQ1A 4P2ZA 1OSGA 1U97A 5A6QA 1Y76B 3UJQA 1QCEA 3FB7C 1ZYBA 4XBLA 3G71V 3P3NA 3T1HB 5C9AA 2KA3A 2RR12 4DR5B 1HB4A 2CUGA 5FZEA 4P5HA 1HJGA 1GBGA 2JS3A 4Q4Y1 1SRYA 1VP7A 4FPCA 1N34B 1UZ0A 5EIBD 1QJY1 3I54A 1MS8A 2VVDA 3UGHA 5AC92 1W6PB 3AYCA 1K3EA 3BPZA 3IDEA 4YZ1A 1KS5A 1GZCA 3OGGA 1NQTA 2WC2A 3KT7A 1BLZA 2JDYA 3P5BA 2PTMA 3GB7C 1ZZ8A 3NNLA 1KFUL 3FJSA 4WF9V 3CJIC 2CY6A 1QH7A 4QPIA 2I45A 4CDUA 1LB2A 3WW1A 4LC1A 1SQQH 4BOWA 4BMEA 2NLJC 1KYOF 1R6KA 2JG8C 3HWJA 1UY3A 3RZKA 2GV9A 1B04A 2PYTA 1U5XA 4Q0UA 2HWB2 1W0NA 5J2TB 1BE3H 1H9PA 1OJHA 4TWTA 4EV0A 1J95A 3ZYRA 3H8XA 4AVBA 3GHNA 2GUZA 1UPIA 4PBOA 4OPAA 4UCTA 5EYPA 2SBAA 4H55A 2WLLB 3J7NA 3RZGA 1BBT3 4AHWA 1D2DA 3OD0A 3K46A 2Z5WA 2BGPA 3APOA 2VQEO 1S5JA 5FMCA 5FUIA 4CEYB 4UB8Z 2DQ3A 1HRI1 4GWNA 2JGUA 2YI9A 2UU9O 3WNNA 2QA4V 3F7VC 2VNVA 3KSCA 2VBDA 3RMXA 4N43B 4BLIA 3WW2A 3WW4A 3CRRA 3ZN6B 4GALA 3RNSA 5FYSA 5LGUA 5SV5A 3AVRA 3HKCB 1HB3A 1VB2A 4GUNA 3VN4A 3MW3A 2P06A 4JI0B 1UZVA 5F37A 2QDRA 4BQYA 1JJ2U 4K21A 3UJOA 1UNBA 5F39A 2JGDB 1GWMA 3LDBA 2E3CA 2F95B 2V4VA 5LEKA 4QX7A 4WVMB 2RS31 3BU7A 4LOSA 3IMNA 1BQZA 2Z2SB 1P7BA 4JYBA 1OA3A 4PLNA 2PHRA 4WCEV 4CXWA 2LW1A 1G9BA 2M7WA 2A73B 4PF1A 3VL8A 4OHZA 4FOQA 2VVFA 5CZKA 2IVJA 4RQPC 2EIKB 5F5QA 5CA0A 1QLEB 4R9AA 4LBOA 2VM9A 4XZPA 3O1OA 3CZUA 3S3WA 2VMEA 3U10A 2Y38A 4CCEA 2WBKA 1VPHA 5KMGB 2WFF2 1NBMG 3MIBA 2QDOA 1XQ8A 4HKOA 2MEV3 3SLIA 4DUZB 1NYWA 3AFKA 4HK8A 2EAKA 1VMJA 1ZBE2 1NJIW 1XMQO 1IPKA 3BTZA 3WDYA 1GP6A 3M7MX 4EN6B 3SPHA 5EJ3A 1PIV3 1M1KW 1JI6A 3H3ZA 3GZTB 3CRCA 3N35A 4Q4X3 4WM7B 3U0ZA 3U07A 5I93A 4I30A 3DKQA 3KVBA 5FYCA 1U0AA 1OUSA 1LKNA 1NTKH 2ZCWA 4L97A 3E8GA 3EFFK 2ENRA 5H5NA 1R3IC 4I2OA 4QIWF 3RJRA 4W6WA 4IIJA 1N1VA 1ND3B 2QVSB 1MS3A 2WQ8A 4BIZA 3CJXA 3SC7X 4LO8A 1EZVH 5C93A 3CB2A 1FOD3 1NE6A 2WZEA 2EIJB 3L70H 1UL9A 1OF3A 2DCTA 5FBJA 5LBFA 4LKFA 4TT3G 4U3FH 2AACA 3WNKA 4JGZB 4I50A 3DXUA 2QQNA 3AKTA 4Y33A 2FB5A 1RUH2 3GF6A 3LIGA 4A44A 3JD3A 4KL1A 5ITZB 4LEJA 5FJKA 4CDXA 2NPIA 4Y22A 5DN6G 5BNNA 4CP9A 3RJ2X 5CFDB 2VW0A 3L74H 2L6LA 3VZLA 3D4KA 2XAFA 1EAH1 2AZ5A 4C91A 4FLXA 4BXSV 4PDWC 3ZN0A 1N32O 1W3XA 2NQYA 2UXDB 2HBUA 1IBMB 4MYEA 3TOJA 2CAZC 1R081 3AMNA 4NAMA 4HMZA 1VBB2 3ZMVA 5F7UA 2BRTA 3F2ZA 3VDDC 2GAUA 5IK5A 3OMNB 3UYJA 3W7UA 2E5LB 4F3JA 1GN2A 1TA8A 3AZVA 4RD7A 4QPYA 1AR81 3E5UA 4MGKE 3D0JA 1X36A 4MSVA 4NAOA 4ZU7A 1RUE3 1FX5A 2VNOA 1H4HA 4WM8B 3JAWA 1D2QA 4XFBA 2ZHNA 2Z3YA 1AR5A 4QB1A 1RFYA 4O7XA 1E5RA 2BNOA 5DPNA 4O61A 4DR7B 2VS0A 5JQGA 3JU9A 2R042 2WNEA 5FREA 1IX9A 2K46A 1H8EG 4URTA 3WG7C 3WNPA 3ZKYA 2EINC 1K4CC 1NAEA 4D7SA 2PAKA 4NO4A 4TXWA 1LHNA 1DCSA 4AYUA 2F17A 1JZ7A 2VC9A 1L7LA 3PL0A 4LPLA 4L11A 2E32A 3JCIA 1I9RA 3JAKB 1US2A 2XMLA 3Q8FA 1W04A 3BTXA 1SF9A 1KJLA 1YFXA 5DZEA 3FWEA 4G9SB 1NCRB 4KG8A 2QKSA 2YV8A 2ZDIC 1ZNPA 1GNHA 2R16A 5KA6A 2AGSA 3RYHB 4Q0QA 4LUKA 1LHUA 4BIUA 1HJFA 4QGNA 3N9NA 5A7NA 3IB3A 4QPWA 1SFNA 4JDOA 2R9AA 4BMBA 3KD4A 2NP0A 2YXSA 4TOIA 4E8CA 2D3PA 1LGCA 5JI7A 4URAA 4V1PA 3BCWA 3VBSC 2LJ2A 4FPHA 4NIHA 2P7TC 2ZGKA 3CSXA 2QTOA 3S6PA 4J6GA 1IHMA 1X8EA 1BZKA 2PHLA 2Q7GA 3ZFGC 4QNHB 5B3SC 4BB3A 5ABJA 4B7EA 1YRZA 1N3PA 1IZ3A 2SLIA 2GC3A 4QKNA 3SCGA 5F5IA 1XNAA 3E35A 4N23A 3HKDB 2B1IA 3AZYA 3OY8A 4L2NA 4V2WA 3ETEA 3KF5A 2Y34A 1UZYA 3C7FA 1LU2A 1GNZA 4EWEA 3QO5A 3NJZA 1NY72 1EP0A 3OEBA 1HXS2 1IG0A 1QIQA 4UFIA 4OI1A 1NR7A 1I6XA 1VARA 1XMOB 5JPNB 1WW7A 3EQEA 4A42A 4Y5Z0 2WRAA 4H3WA 3VBOB 4AEDB 4AI0A 2BFUL 3IFXA 4AI3A 3H1LH 4DPNA 1TVGA 4FQZA 2BEOA 1H9WA 3ZMZA 2QWPB 1S72V 1OCRB 1HR0O 1FXHA 2QWRB 5M0TA 3WNOA 3OPZA 3SYCA 1G9DA 1ZLZA 3LEIA 3PUHA 1SQBH 4GD4A 2ZM6O 2DYRC 3WINE 1Q8OA 3W21A 4WFGA 5FY1A 4O4IB 3KVAA 4JI5O 1H8HG 1IS6A 4KU8A 3PJYA 4WFFA 5FZOA 2UWAA 1YQCA 2HYKA 3OAAG 1HP8A 1DK1A 3WY6A 2QQPA 3T08A 3Q9OA 1LU1A 1LR5A 3AMMA 1AP6A 2XKOA 4KBBA 1NQJA 1Z7S1 2VXRA 5CNAA 3CWBH 5BNPB 5FOBB 4N53A 1BHGA 4EB6A 4XF3A 1JYWA 1MEC1 1W8WA 2G9FA 3FUQA 1WPBA 1QNWA 1L7RA 3WNXA 3DC6A 4UXAA 5L7OC 4A6SA 4AWDA 4C8DA 4ZXEA 1HDJA 1N3OA 3ZHQA 3A0RA 2CTWA 3FHAA 2ZXWC 2EXIA 2J1VA 2GNTA 4TLFA 4XUOA 3U78A 1VAVA 3CCQV 4JI4B 3ZYJB 2H94A 2JJ2G 3ZPOA 3AMHA 3ZIAG 2LO1A 3N7KA 3TK1A 3D36A 4BM8A 5DMYA 1QQCA 3K08A 2IWGB 2X05A 3UO2A 5IVJA 3MIEA 4X65B 4MGQA 4PJYA 2PLV3 1AX1A 1YZBA 4CCJA 4MTXA 2OZ6A 1GQGA 2OCHA 4XYXA 2XQXA 4W65A 1AL21 1FYJA 5IAXA 4YGEA 1SETA 4DY3A 4S2DA 1TUEB 4LKDA 3CU7A 4UWDA 2VZPA 2HWC1 4MZUA 3BI3A 3DF0A 1Z5WA 4XHXA 1VQ4V 4WFAV 3THPA 2LFSA 1JN2P 3LD8A 3NW4A 3ABUA 4N43C 4NUBA 1POQA 1SPPB 4LCUC 5FY4A 4DUZO 1AR73 3ZFFB 1F31A 2UUBB 5F3GA 4BQ4A 2AENA 2C9AA 4RYDA 3ABKB 2EF6A 1NA1B 3QH7A 1LESA 4OMCA 1RMU2 4CDWA 1X33A 2EIEA 3ZFEA 1RUG2 1WNSA 2WLJA 1UOBA 5LRRA 4OUMA 1EN6A 2Y0OA 2ZGQA 4KXRA 2P6CA 2WYSA 2FD8A 2VE1A 1Q6UA 1VLNA 1J5EB 1PGW2 1FPN2 2WS93 2JVDA 4DIQA 1H0BA 4AHCA 1ZRCA 2ZAHA 3O1MA 1I7FA 2DVDA 4F8AA 1XUQA 2RR11 1SZXA 3I2GA 1AX2A 3C8XA 3KHBA 1XNKA 2RM21 2E74B 1Y3TA 4IV3A 4DYLA 5DAPA 2B9VA 1HN0A 1O4YA 1MMMA 3BKZA 2AGAA 4FAHA 2DUPA 5ANQA 1GLHA 3JB4C 4UV9A 1D7PM 5CAZA 1HX6A 5AC91 3BVCA 4XDOA 3VBHA 3I3QA 1CAVB 3D6EA 5LB6A 3L73H 1TAEA 3W5NA 2B9UA 2YU2A 4CS2A 4A4AA 5FCCA 3JALB 4FPFA 3WDUA 4YY3B 1DBNA 4CCLA 1ZZCA 4BQXA 3VBUA 3URFA 4DUYO 2PF4E 1DDLA 3H3LA 2VQ0A 4AVVA 5CEHA 3ZHVA 4WM7C 4U3JB 1SLCA 4NTXA 2UUAO 1LHWA 5LA0A 4IV1C 1IG3A 3T2OA 2GTAA 1G6NA 1P84F 3MICA 3GDBA 2QQWA 4YIPA 4GB31 1IBMO 5FY5A 4PDVA 1SQVH 2GBOA 3M3QA 2UYBA 5FZ4A 1DHKB 4MG2A 1QXPA 4XOGA 5C7GA 1ULOA 4AVTA 1H8TA 4YVSC 5ACA2 5FK7A 3B9IA 3GJAA 4WFHA 3POFA 1WBFA 2QQOA 2R061 2RG4A 2WLIB 4B3TO 2RS11 4ES9A 1MNGA 3M1HA 4AI9A 3T3YA 4BU2A 2P6HA 3LDRA 2QNKA 3T4HB 1SCSA 3BODA 4X6RB 2ZXQA 4LNUA 1OH3A 5C6CA 4JAUA 5F5CA 1XE0A 4BLJA 2JX9A 1XE7A 4DR7O 4WBNB 2XJSA 5BUVA 2XVGA 2DDUA 2XJQA 2OZJA 3ZMNA 1RUI2 5C3PA 4BQ1A 2DF7A 3O14A 4NXNB 3ME2A 5EIBC 1DIWA 4YG6A 1AHSA 1V6MA 1S2BA 3RGBA 3WQ7A 1A8DA 3ORJA 2HH9A 3N9QA 4PDLA 3B3QE 2EIDA 4BWAA 2YBSA 3BVOA 3GM8A 3S7EA 1CGPA 2A70A 3K5OA 2VUDA 3KV4A 3K51A 2HWE3 2LS6A 2VOTA 1RINA 1H38A 3OYWA 1ALYA 4JAAA 2WSUA 2GMPA 3QH6A 5LRSA 4XILA 1SERA 2KG7B 4D8MA 4FPLA 4TUYA 4E4ZA 3RZHA 2IM9A 3JYCA 3CEIA 4P30A 4MGSA 3VBRB 2R071 3GWKC 4ZHQA 2WKKA 1RUF2 4ASKA 3CCRV 4JKLA 1W8FA 2JENA 5IJ0B 3BGAA 4QE7A 1QQP2 3DKWA 3X29B 1OI6A 1DLLA 1VQ7V 1XB9A 2ARHA 1DQ6A 4HZFA 3HT1A 2VWKA 1ODNA 3ZMUA 4JI2B 2BGCA 3OGVA 4L99A 1YJKA 3AB0A 1I5PA 2GNBA 4AE2A 2BSKA 3AG1B 1U5IA 4K3UA 3N2GA 2ILMA 4CU9A 3WV6A 1O4ZA 1PM9A 1UOGA 1DQ2A 3ZMSA 5FZGA 3PVEA 2EIMC 1OCOB 1EN5A 1VAKA 2RN9A 4PD4F 1OUXA 2ZNJA 1LOGA 1QH6A 1R092 2F4VB 2IUWA 3CBNA
chains in the Genus database with same CATH topology
4ZU4A 2QDNA 1VBE1 4LO5B 1ENQA 3VBFB 5A32B 4EWAA 1OIJB 1UIJA 5JMCA 4N7UA 3THTA 3CJIB 3VKLA 5CVRA 3FFQA 3ZSJA 5A3LA 1UMZA 4MH0E 5CB7A 4FAGA 4C1WA 4XETA 1XE8A 1KD7A 4AHYA 1EV11 2WQ4A 3W59A 4ITCA 3WQ0A 1XU2A 1VB4A 1R093 4AG4A 1AVBA 2EAAA 4FOVA 2O8OA 1CAUA 4HVRA 5BPXA 2ZGSA 3WDWA 3T1LA 4F7ZA 1RTVA 3ZN4A 4B3NA 4CZSA 1MS4A 1AR61 2RM22 3SISA 3B93A 2K0GA 2WZR1 3BOPA 1S0GA 4PIYA 4EN9B 4M3CB 2VMGA 2ZA9A 3PVJA 5KXDA 1QJU2 1AYM3 1EY2A 1H1AA 4LHKA 2RR13 1W0OA 3R4UA 2H6CA 1WCKA 1YFUA 2ZHKA 1G9AA 1V9U1 1MZ5A 5JCTA 5E1RA 4NHMA 2RM23 3WG2A 2B5HA 2C0ZA 2GSYA 2RS52 3HIFA 2V5YA 1C28A 4RS5B 3OJBA 2XWJB 1Y43B 1RB8G 3CL1A 2BQPA 1W6PA 4H7LA 3POYA 3ZDSA 1LOBA 5GM0A 1KDKA 1QJU3 1LEMA 4Q4V2 5I8YA 5L7OB 4DINB 3GZUC 3NKTA 2WL1A 4ZXKA 1XNDA 5DZGA 2BPA2 3G6JB 5AC93 1GFF2 4TZDA 4GXLA 2OYZA 1O5UA 1TMF2 5A3MA 2OG7A 2OA2A 2TUNA 4MXWB 4R9DA 5L7OA 1QOOA 1COV2 2DTWA 3V56A 3H9AA 5KEUA 1ZBA1 3FX3A 1KFXL 5JDBA 2BVBA 2XL7A 4Z92B 4N53B 1NCQB 2Q4AA 1OIIA 3VBOC 4GB32 4Q4V3 1AL0G 3KS7A 5JOZA 2VH9A 5GLZA 4JDNA 2ZMNA 4Z2WA 5HBAA 3J8F1 4NWVA 2NZ9A 2ZZJA 4PLOA 4XBQA 1DZTA 1I1EA 1G9CA 4IEWA 1NZCA 1TMF3 1OMIA 3JBG1 4P9WA 4BCUA 4CDUC 4QPGA 1J3RA 4AVSA 2O8QA 4AHXA 4C1XA 3LWCA 5DUXA 1NLSA 2WT0A 4LBLA 4OUSA 4GB33 2XBO1 3D5OA 4FOYA 2R062 3H7JA 1T6GC 1WLDA 2ZKNA 4BHGA 3ZSMA 2LALA 2RS12 2V73A 3V0AA 2GH2A 4MGYE 1C8M1 1PZ9A 2A3YA 1F5JA 3AXEA 2FQPA 4AGGA 2A75A 1SLAA 1NOVA 4BH9A 1BYHA 3TN92 1AR82 1CJPA 1DQ1A 1Y9QA 1FT9A 2PA7A 5I8TA 2XLFA 1IS3A 4C0HA 4QT6A 4LLFA 4XTPA 1CAXB 3RMYA 1A8MA 1CVNA 2CTVA 1CIWA 4N7IA 4G4FA 1YLLA 4QPGC 4RHV2 4YVWB 4CEYA 1AJOA 2IXJA 2R063 1AR92 1U5ZA 2R49A 4I0AA 1UU5A 1VBD1 1VRH1 1PMIA 2RS13 3AJZA 1HRV3 4XFGA 2WINB 4RR3A 5JOXA 1PVC2 1HKDA 1HV0A 4N43A 2A6XA 2Z42A 1KITA 3OGJA 4LT5A 2FZ2A 5LK7B 1PO11 2E6VA 1JUIA 4COUA 1NG0A 3ZN6A 2Q30A 4AGRA 2E63A 5BNPC 1VP6A 2HKXA 2Q0AA 2OUHA 4OVEA 1S0EA 3PVBB 4RHV3 1CJDA 1QXJA 3ZXEA 3OBRA 1AR93 3S0MA 4YW1A 1OD5A 1HLCA 3ZSEA 1AR72 4FOWA 3AYEA 4LO4B 3TB0A 1J1TA 1IOAA 2WIIB 5J3UA 3RQ0A 1ND2B 3OCPA 1OKQA 4CEYC 1U5YA 4HT1T 3WUCA 1IGOA 1HW5A 1FI2A 3MLJA 3WP4A 1J59A 4RR3C 2ZABA 3LA3A 2UWBA 1V6KA 3AZZA 5DDJ3 1REEA 2UY8A 4GMP0 1W6MA 4QGMA 3AFGA 1N1SA 2ZGUA 4OULA 2GH8A 1XXNA 4JRLA 5E88A 1JYIA 5HCBA 4GMP1 1NXD1 1OQDA 4WVMA 4CDWB 3MI8A 3AKRA 5T3NA 4ASLA 4FPEA 2VOWA 1LCLA 4QXKA 4IL7A 3ZFEB 2XB6C 3QOPA 5L36A 3ZX7A 1O7FA 4HN1A