2CGNA

Factor inhibiting hif-1 alpha with succinate
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
347
structure length
338
Chain Sequence
b'ATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFNREEMKFHEFVEKLQDIQQREERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR
publication title Structural and Mechanistic Studies on the Inhibition of the Hypoxia-Inducible Transcription Factor Hydroxylases by Tricarboxylic Acid Cycle Intermediates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 107
structure length 338
sequence length 347
ec nomenclature ec 1.14.11.30: Hypoxia-inducible factor-asparagine dioxygenase.
pdb deposition date 2006-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1010 Mainly Alpha Orthogonal Bundle Helix Hairpins Clavaminate synthase-like 2cgnA02
2.60.120.1660 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2cgnA01
1H2NA 2CGOA 4AI8A 1IZ3A 3OD4A 4B7EA 2XUMA 4BIOA 3KCXA 4Z2WA 2W0XA 4JAAA 2ILMA 3P3NA 4B7KA 1MZEA 4Z1VA 4NR1A 2WA3A 2Y0IA 5JWPA 1MZFA 4QU2A 1H2KA 2YC0A 3P3PA 1YCIA 1H2LA 3D8CA 1H2MA 2CGNA 2WA4A 2YDEA 3KCYA
chains in the Genus database with same CATH superfamily
1N1VA 2DU0A 1NA1B 1OA2A 4YXWG 2RDRA 3AZVA 3GZEA 1HXS1 3M8LA 1N3PA 2Q30A 4COWA 3ZYIB 1VBE1 3M3QA 4DV3B 3WW2A 3HNYM 5F7UA 3ZR5A 2X10A 3UK9A 1H2MA 1GOHA 3OPTA 1XC6A 4W6YA 1REEA 4FMTA 3WQ7A 3BHPA 1S0DA 1RUH2 3IGAC 3AC0A 4C7UA 2BWCA 1RMU2 1XNCA 5C8CC 5DABA 1RUF2 1BBT1 1IXBA 4QQ2A 1QJFA 3HR0A 1R1A3 1W2TA 4CP9A 1NKDA 2E7AA 4MVZA 3QNEA 2ZIMA 2E75B 1ONAA 2BEOA 1GNZA 1IS6A 2VO5A 4J11A 1TNRA 4KP4A 4U36A 2CUGA 3D82A 2XBO3 1D4M3 3OSDA 4AAPA 2FDKA 4XW3A 1AYM2 1UW8A 3OAAG 2HBUA 1N36O 1ORQC 3ZHTA 3X2QC 4NPRA 1ZSPA 1V0AA 2P22C 4EJRA 4Q29A 3CP1A 1ZX5A 2NLRA 1QNYA 2NYYA 3UKMA 3AVRA 3RYRA 4Q0SA 3LSQA 3VD4A 2ID4A 4FCAA 2L6LA 4P9OA 4URTA 1RUE2 1JFFB 3CJIB 2UWBA 1FYUA 3WG3A 1KJRA 3JATB 4QT6A 5I8YA 4YVSA 2CHHA 2ZGKA 5DZFA 4UFJA 1XPWA 2VCCA 3BIWE 5FPVA 1G1XB 1JYNA 2AGAA 5GW7A 1CONA 3THCA 3FYEB 4X8AA 1PNKA 1W8WA 3PMEA 1WWYA 3CC2V 3SGIA 4E8DA 1C8M1 4B8EA 2R071 3NNMA 2OKXA 1QWRA 3QCWA 5FCCA 3ZPYA 4BXFA 3ABUA 3PU8A 1ZZCA 3OUFA 3MYXA 5FP9A 4WVMB 4IHJB 2V7QG 4S2GA 4BZ4A 1FFXA 4CDUB 5FZOA 1ZA4A 2HWC3 4OHZA 4UCSA 2AEYA 4ZXEA 2D6MA 1AL22 2O1QA 4JGZB 4QM9A 3VBSB 3CRAA 1GN2A 4XFCA 2QNKA 3ZMZA 1C1LA 1UO9A 3FHIB 2FKXA 1IQAA 1NT0A 4XDPA 4IDZA 1YJLA 5EBWC 5IYZB 2DCJA 5FYBA 3AVSA 1DF5A 3VQYA 4MTFA 1M4WA 2GTSA 2XJUA 1PK6C 2IWGB 2ADPA 1OOPA 5C71A 1MA1A 3QBQA 4AYUA 1ND3C 4DV4O 2JDAA 2PLV2 1BKZA 5FK8A 2VXJA 4KBZA 1NXMA 2VUCA 5FZFA 5LRRA 3ECQA 4HONA 4MHRA 2J1AA 2DU1A 4D6TH 1HNXO 3KMHA 4DINB 4H33A 4UBHA 5GZGA 3AXDA 5FZKA 1FXKB 2OZ6A 5FUNA 4UVCA 1PVC2 1WBFA 1NYWA 4FPEA 3OJBA 3ZN4A 4XFAA 3EVKA 1OLRA 5KA5A 1WMXA 5GLVA 3HKDB 4Y1YA 3ATGA 3K4DA 4QDRA 3BTYA 2WFF1 1ULGA 1RUF3 4CC5A 5BNPA 5FYUA 4Y33A 1EY2A 1RYYA 5FY4A 1W0NA 4AVTA 4GKKO 5FUIA 4P9GA 2D6KA 1KC8W 3K04A 3FHAA 1QLEC 4DR6O 4YSFA 4IE0A 1RUC3 3M7AA 5ABJC 4E9KA 1MEC2 4LIVA 3ZXKA 4P9WA 3CMAV 1F4MA 4J1WA 4O2AA 4JGSA 2QA4V 1EAH2 2FDFA 2DYRB 1LNQA 5TSWA 1GNHA 2VH9A 5JUVA 4A3ZA 3PURA 4B1MA 3BPSA 2DYCA 3IDAA 4MVSA 4KWKA 4M3CB 1O4ZA 2R041 4P5HA 4ZIBA 4PELA 1H4GA 3ACFA 2GP5A 3MPBA 5GONB 3NNFA 2PA7A 3JCIA 2PY5A 2JGDA 2DW4A 2JB4A 4WFHA 4O2BA 2ZHKA 3BY6A 4YJ3B 4UXNA 3BVCA 1I0HA 2GALA 1DGRA 4C90A 1THZA 2D7FA 4K0KO 3KM5A 3ZX7A 1VRH2 3LEGA 1N34B 4OYUA 4I3PA 2BOIA 1T6BX 1BL8A 2VVFA 1N1TA 1MS4A 4XXAA 4R8CA 2W3JA 3RWKX 2DYSC 3CB2A 2RCVA 3J8F1 3I2JA 4JZGA 4TYSA 4BE3A 4EYUA 4TTGA 4F7ZA 2XOKG 1HJFA 1VQ7V 4MG2A 3PDQA 1GMGA 4UW3A 1CXZB 4XACA 1RUG1 4XURA 2WZR1 3WP3A 2C26A 4KQ7A 1O3QA 2ZQMA 2OTLV 2RVAA 3SLIA 3VZKA 4WFBV 4INDA 3K58A 3I2HA 1VB2A 1UYYA 5BMVA 1WJZA 4UVAA 4E4DX 3K3OA 3UL2A 1GNYA 1ZL8B 3WNOA 2DE0X 5IVJA 3ABZA 5I0UA 3ETDA 4DRRA 5JH7A 1MS1A 3VD7A 4PDWB 4N23A 4JVAA 3WDTA 3OCPA 2Q68A 4D3WA 1OCZB 2W68A 4ASLA 1X82A 3RWNA 1JU3A 3ES1A 3UM7A 1JZ3A 4DYLA 3PIGA 1QXJA 4HOOA 3N4MA 2GC2A 2X6AA 2G4IA 4MVOA 5A1AA 1W6OA 3S57A 2VD7A 3HT2A 5C5UA 3AP7A 4PA7A 2ZGOA 1POV3 2YG0A 3ZFGB 4HAMA 1K5JA 4QM8A 4UCUA 5A6ZA 3NKGA 3MAQA 1DYOA 4BQ2A 2EIKB 1UIKA 3EFFK 3SPHA 1UX7A 1HW5A 3OTFA 2NLJC 2Y34A 4YVWB 1EZJA 3TXQA 3NRUA 3N9QA 4IQPA 5LCWL 1XL4A 4XXPA 5FZHA 1R091 3ACIA 3VUOA 1SMVA 4QMAA 5CG8A 3GYDA 3UETA 3UV9A 1BXHA 3JD71 2WT2A 3HN1A 3A21A 3LKJA 3T2MA 4YHHO 3B00A 5IJ0B 3SYOA 4YARA 1S0JA 4COYA 2P5BA 4LKEA 3OR6C 2LROA 2H6BA 1RB8G 4LO7A 2YFUA 3MUY1 3FLPA 4Y5TA 2A7WA 1XSRA 1L7QA 2Q67A 5IVVA 1DGRN 1H6XA 3ZRVA 2BFUS 1TMF1 1VQ5V 3LNNA 1D0HA 5BR8O 1BGYH 4IV3C 4QXCA 1ZWIC 3OGRA 4HT1T 2JG8B 5GM0A 1UYZA 5DUXA 4JQRA 3UT5B 3DUIA 3SJQC 1N33O 1CWPA 2EIEA 1VF6C 1A8MA 3VOUA 4Y1UA 3E35A 4XZUG 1ENXA 4QHOA 2LW8A 5IDJA 4YGDA 2DCTA 5EZYB 1HQWA 1QDOA 2WWUA 4FQZA 1EYBA 2BNMA 4O4IA 1FPN2 3U75A 3MHHC 4GD4A 5A7SA 3K57A 2QSAA 2DJVA 2GMPA 4NXMB 1IS5A 1W2NA 4I4TB 3W58A 5F2SA 1PHMA 4LF7B 1WNSA 4AVAA 1I7FA 3LA2A 2JDIG 2BVBA 2BVVA 1M56B 3WP4A 4Y22B 1L0LH 5CMUA 4UW4A 1F7YA 3SNMA 3W5MA 4FIPC 3AP5A 3SITA 4LF9O 5JAXA 4KNCA 4JX0A 4LO4B 4A7ZA 2R9AA 4JI6O 2YSUB 3QO7A 5IVEA 5BNOA 1IGOA 1LEMA 2UUBB 5HFMA 3PUIA 1WKYA 3T2PA 1VPHA 2B45X 1WW4A 4IIJA 1GN6A 2XONA 5FZ1A 1NUKA 4HKWA 1DLCA 4LHLA 4K6BA 2FDGA 1NE6A 2Q1FA 1GKBA 4ZS3A 1K5MB 3ZKUA 3ABKC 4JYAB 3AZXA 5KX5A 3HKCA 4HZFA 5D2AA 4BQ3A 5DDJ2 4DO0A 3AG1B 1GSLA 3HPLC 4JI8O 2WNEA 4ZI7A 5GALA 3RDIA 4EB6A 1SFYA 3D3IA 1X9TA 2X6BA 4LBNA 2ZX0A 1PO22 2BGCA 2DCKA 4CU9A 1IS3A 4PI0A 3GBFA 3TNPB 5A7OA 2RNBA 3ZYPA 4ZZ5A 3H7YA 2WSVA 4HKOA 2QQLA 1CAVA 2B9UA 3OBZA 5KAFZ 1LJ7A 2GDSA 1ULDA 2JDHA 3NL1A 3LSDA 4U3FH 3ROUA 3EMRA 2G1MA 1K5SA 4AXOA 1VMHA 1ZRCA 2YXHA 4WFGA 1BVP1 5FRAA 3WOGA 5CZKA 3WNXA 1OA3A 2ZHLA 4H7LA 3QF7A 2WAMA 2BE3A 3RMXA 1FJGB 2QEXV 5F3EA 1OCCC 1C4RA 1J3RA 2AH2A 2WNVB 3RNSA 1WW7A 4OVEA 2Y6JA 2CTWA 5IK5A 4AGRA 1Q8SA 3ZHQA 2GH2A 4UCRA 3M4FA 1LGBA 1KD7A 4AHWA 1H2SB 4JCKA 4MGYE 5AVPA 1FMD3 3X29B 2DV9A 5EZWA 2VUDA 1QNWA 3NXSA 4DV1B 1XNTA 3FE5A 2OIIA 5A6XA 2B1IA 5D21A 3B2EE 4J9YB 2WO7A 1YFUA 5LP6A 3LEKA 4HBNA 1TEIA 3U11A 5LA2A 4KL1A 4D6QA 4AK3A 1H8TA 3ZFEC 4XJ9A 4YY3B 3C2UA 2UUAO 2DDUA 5D8AA 4BLIA 1NE4A 5JQGB 4ASKA 4Q4V1 5FOBB 5JXGA 2W94A 3RJRA 1XL6A 3VV1A 5CB4A 3MW3A 3A0BZ 3ZRSA 1WPXA 2WT0A 3HVDA 3ASOC 1PIV3 1OJHA 1QJY2 3S0MA 4UYBA 4IEYA 1RHI3 5LA6B 3WDXA 1SQGA 3W7XA 5H9PA 2UXDB 2CE4A 1TGOA 3I2DA 5FREA 1WCUA 2QQMA 1W0PA 1R1ZA 1J84A 1RUD2 4YFWA 4JI7O 2E53A 1ZRFA 3GNEA 2DN9A 3URFA 1LHWA 1ZBE2 1DZQA 1GZWB 1DYKA 1VF6A 4CZZA 2UU8A 4L92A 5J9PC 2LALA 2BDRA 2YHJA 1QEXA 2CGNA 4J7JA 2EILC 1V6MA 1RSOA 2JJ6A 4D6RA 1OCOC 1W05A 1ULOA 2PYJA 1Q43A 2XL7A 2OUHA 2WLQA 5FFOC 4QX8A 5CBFA 1XEQA 5FJHA 2PFWA 3OBAA 1PP9H 4O4JA 1NVPB 5JPMB 3WF4A 4CCKA 2W91A 5EK0A 5E6HA 2WLKA 2XT9A 2SBAA 1POQA 2IJHA 1W2AX 3OW2U 3ACHA 3NJXA 5LW9A 3IWZA 1GBGA 1WGPA 1QLNA 2EA7A 1VBA1 3VBFC 2ZBJA 3I55V 1IBLO 4XUNA 3KHBA 4J1XA 4JI4O 3ZJZA 3NAPC 1S0CA 1JZ5A 1EV11 4YZ4A 2X53S 3ILRA 2ZE6A 1CAUA 3MEPA 3LPGA 1VR3A 1H1IA 4A3XA 3VBRA 4OQ8A 4N43C 4LF4O 2WJSA 4K1YA 4QGLA 3CJIC 5FZ3A 4FSJA 1GP6A 2W1SA 3N9MA 1LGCA 2DFCA 4I7ZB 5F3CA 1B04A 2VTXA 1O91A 1PMIA 1DFQA 4CEWC 1R3KC 1DLBA 1PNFA 1RUJ1 3FLRA 4IEZA 1LR1A 5HXMA 3K9AA 3ITQA 3K03A 2RDNA 4DR7O 4OHYA 5F3IA 3E8FA 2JE7A 2HJIA 4OHXA 2WNUC 3HWJA 3ZR6A 1GFF2 1UY0A 5GLZA 1HN0A 1NLRA 4KH9A 1UKRA 4I01A 3APQA 1KFXL 2ZGLA 4CDUC 2AZ2A 2OS2A 3V0BA 2FDJA 2C2AA 4LE3A 4ES8A 1LCLA 1B6QA 3MW4A 5LATA 2EIMC 3OF1A 2GZWA 1W9WA 5CB7A 5IAXA 2P7TC 5A3LA 3FD9A 3KS7A 5KMGB 1N36B 1AX1A 1ASJ1 5JR7B 1W6QA 4E4HA 4AEMA 1YDXA 1NH2D 1UNBA 1ODNA 1H0BA 3ENRA 3WFVA 3LA7A 3I2IA 1QJY3 3ILNA 1WB7A 5L3BA 4N90A 5K4LA 3FB5C 1RVF3 5JVDA 2WLHA 3SR2C 3ZIXA 3FL7A 1K34A 3MHZA 3NNGA 1QKQA 2RS51 4XJUA 4JI2O 1X36A 1RUD3 3M3IA 2Y26A 1FXKC 1W6MB 4WM7C 4NE9A 4YNIA 4I9WA 4DPNA 1ZNPA 2P3YA 4LUKA 5IYBO 2YXSA 2ZTNA 2QWNB 2ZA9A 3VBHA 1OI6A 4QX2A 3ZPOA 4AW7A 5C8YA 4H55A 5KWRA 5CA6A 3RG0A 3G4SV 4MSWC 4JV4A 1LOGA 5BY5A 1HDJA 1NCRC 3PVNA 3E89A 1YUDA 3BTZA 2E32A 1J3PA 1BQZA 2VR4A 5DEDA 2O0OA 1A32A 4H37A 1XYNA 1NA1A 4HLTA 2XAHA 1DG6A 5I0DA 2G19A 5FMOL 2NPIA 1BEV2 4R7CA 3JYCA 3BRCA 1N32O 2ERFA 3E8GA 2XVLA 2DYRC 4CPBA 1ZBA2 4LHKA 3T30A 5LMUO 3OGSA 2BOCC 3N9NA 3JAKB 5AG2A 4QPIC 1SA0B 1EUTA 4DV4B 3RBZA 3M1HA 4L97A 1W03A 3C7HA 4PJYA 2HWD1 5CFCC 2W2IA 2YDEA 2ZZJA 2XUEA 3CCRV 1XNQO 3WX5A 3C8XA 3O1PA 1BS3A 2R9IA 4PIYA 1DF0A 3B8NA 4QJFB 2FBEA 1M06G 2VG9A 4CA9A 2HWF3 2ENRA 3ACLA 2E63A 2WIIB 5LMNO 3W21A 1UPIA 1LGNA 1SC5B 1XE0A 5T5LA 2EIBA 4OI2A 2IC1A 3S5AA 3PLQA 2XJQA 4J7ZA 3OGJA 2DF7A 4DR3O 2UURA 5JSPA 4GKKB 2QZ3A 1BBT2 4UVBA 4OPHA 1JFFA 3CJIA 2N04A 3JATA 3KZ4C 4DR6B 4XBQA 4FFHA 1HN1A 3VDCA 3WDUA 4DNYA 5JLVA 3DPRB 5C5TA 4FZ1A 5A1FA 3OMNB 3LOIA 5FK7A 3QG5A 1BLZA 1Y9GA 3KHCA 1AR71 2O8OA 4MH0E 1W28A 4DV6O 1DQ0A 1K8AW 3JARB 5CG9A 3JD3A 2CK3G 1JVMA 5CKQA 2ITCC 2HH9A 4TV8B 5EWSA 2PN5A 3MLKA 4ABMA 2ARXA 2HEWF 1YWKA 3PTYA 4CDXC 2PHXA 3SEPA 4WVMA 4IHJA 3QH7A 2ZCEA 4CDUA 1Q6IA 2E74B 2LQTA 1XOUA 3VBSA 4JGZA 1PM9A 4GMP0 4YW2A 1G9DA 2VOXA 1W8UA 3N35A 3CDZB 3B93A 1QJU3 4PF1A 2YFZA 3CWBH 4K0KB 5IYZA 4M3CE 1GLHA 4IEUA 2Z42A 1JZ6A 3RI8A 3MF6A 4GB33 1ENSA 3S6PA 1VBB3 4YVWC 1UPGA 4D7YA 2JEMA 1B35C 1HRV3 4A4AA 4HANA 5HCHA 1A34A 4NRMA 4G2KA 4OLLA 3OGCC 5FYHA 4XF4A 1N3OA 2E76B 4GULA 2OUJA 5KXDA 4BMEA 5FZDA 3VHRA 2Z79A 2R1BA 1O4TA 1OZ0A 1MZ6A 2B39A 2NM1A 4I55B 3ZEDA 4PBOA 2GTAA 2WS93 1G8MA 1FXKA 2XWBB 2R1DA 4H0LB 1COV2 2QKSA 1A78A 3ZMSA 4Q0PA 4XJZA 4OHWA 1PZ9A 4E2QA 3B7MA 3CC7V 3KG2A 1FOD3 3N7LA 2NP0A 1QQP1 1US2A 2NQYA 2X09A 3HKDA 2QQWA 3LIGA 1SLCA 3B9IA 2QUOA 4Q2FA 4L0PA 2P5OA 2V73A 3JAWB 1XNDA 1W04A 1Z5VA 2ZX1A 4HZ3A 4Q4X3 2OCCB 4KHPO 2WO1A 5ACA1 5KXEA 3ZN6B 4BYYA 1O9GA 1M5IA 2QWRB 3B40A 1WA4A 4YWAA 1F31A 4PD4F 1JH5A 3AYCA 5JJJB 1LECA 2LUWA 1G9AA 4MTXA 4XABA 1JX9A 4UCOA 1HXS3 1YLLA 4K35A 1VBE3 2RS11 1RTVA 1XMQO 1TVKB 1TNFA 4HETA 2OX0A 1KECA 2FYUH 3HMYA 4FPOB 4BU2A 1M56C 4PI2A 3ACGA 4Z92B 5A7PA 1YI9A 1UU6A 4YHHB 2W6IG 1GV9A 1YI2V 5GONA 5CFCA 4RQEA 5L3FA 2LP7A 1QXRA 3MIFA 1NBMG 3NNLA 5FYTA 4YJ3A 4XIOA 4ZONA 3Q8AA 2Q5TA 3CRRA 3CMEV 1W8TA 5F5IA 3WG7B 4U7NA 3GCXA 4FZ0A 4R9CA 3C7OA 5FYVA 3EO6A 4OI0A 3IKWA 2WLPA 2LGWA 3ZYJB 2Y4TA 2Q0OC 4BHPA 2P06A 4DY3A 4Z1VA 5F3GA 4KGQA 1DYPA 5K0UC 1F23A 2A6YA 5BR8B 5A7NA 2Y60A 3IIAA 3OR7C 2ARBA 4FBFA 3WG2A 3WSOA 2P2KA 5JOXA 2AENA 2KA3A 2Q1MA 3GM8A 1N33B 3FAVB 1MOFA 3W9AA 1KS5A 4LKDA 3W59A 4UAPA 3IJ4A 2C1FA 4EQVA 3WW4A 2C24A 4XBFA 4FM0A 3DEMA 4BW9A 5LBBA 4XEZA 2CYFA 3DXRB 1QOSA 2O8QA 1ZL8A 4DY5A 2UUCB 5EC1C 3JD0A 4PLNA 5FPUA 3VDDB 2RJ2A 4RR3C 1GZCA 3J81N 1SQFA 1NR1A 4Z82A 4PDWA 4LJHA 4I30A 4V1PA 3EB7A 5E1AC 1C8M3 4XFGA 2I07B 2R073 4CH6A 4P5YA 4MHUA 2VS0A 2DOSA 5GLTA 4AFBA 1DQ4A 3H1HH 4LF9B 3I59B 2UXNA 1N1SA 2JD4A 4EROA 3CS5A 2W92A 1UOFA 5A9GA 3ZFGA 4PHZA 2HWE2 3WXPA 4DXRA 5J2TB 5FZCA 5FMBA 2ZIOA 4YW5A 1SHWB 4XHBA 4YVWA 2VOKA 5GKAC 4O65A 3GALA 2ZDIA 1L3JA 1PMJX 5LK5A 4HPKA 1XOYA 1MZFA 3HNBM 3FLTA 2EXJA 1WLWA 2WYFA 4NXNO 2DUPA 2R49A 2P67A 4JI8B 1K92A 4O61A 5LHIA 4OX9B 3JCZA 1Q8QA 1HP8A 2MEV3 5IJ0A 5B1AC 2VW0A 5FZ6A 4PIXA 4H13B 4YM1A 5KBFA 1RXFA 4IE4A 1KYOF 3I49A 4IL6Z 2Y6LA 3H8UA 3SJBC 4NIGA 3T4DA 3EBRA 3G67A 1BMV2 1HV0A 4RYDA 1H1AA 5A32B 2E51A 1V9U2 2LRPA 4XJAA 2Q1ZB 2WWWA 1Z2GA 4WFEA 3GGLA 3JQXA 2RM22 1OKQA 1VBC1 3ZXJA 3UT5A 4BW5A 3SH5A 2ZXWB 2N7GA 2WFF3 4WM8C 5CBLA 1S1AA 4DV3O 4LA2A 5FTTC 3VBBA 4PDLA 2RMU2 1AVMA 1W39A 3LWCA 2ZGQA 3WHUA 3VBUB 2PGGA 2QR4A 1W59A 4A6OA 5EZYA 1U5XA 4XFBA 1LUVA 1AR61 5ISLA 2J1EA 3BAAA 4FP3A 3D8CA 4TUYA 4HK9A 4IGQA 2RR12 4UB8Z 4I4TA 1RL3A 1OFNA 5F5QA 5J37A 5FY9A 2HYXA 4A7YA 1TMF2 4Y22A 4CCLA 4QPGC 4D8MA 4UBGA 3H1IH 3LDBA 3IDCB 4A7KA 4ZS2A 2P4VA 3K4AA 2ZKLA 5DUWA 5H5NA 3I3EA 2CNAA 1K97A 2R043 1V55B 4TLGA 5CA1B 2VRZA 1JHNA 2R061 3UT0A 3AK2A 1ENQA 2D3PA 2WWSA 4FOVA 4FTSA 5L3DA 4CP0A 2QJVA 3IB3A 5I0SA 4XDJA 4CXYA 1FFTB 4FVMA 4LBQD 3MW2A 1GN3A 3GHMA 5IY5C 1J1LA 1K5MA 1C3HA 2BQPA 1OLME 2F93B 3MGUA 4GZ9A 2QTOA 3PUHA 4CP1A 4F4LA 4FLUA 1RM1C 4YZ2A 1HJGA 1G9FA 1ZRRA 3J8F3 4RL7A 2VECA 3ZDVA 1QJX2 1WCSA 4JPRA 3OUJA 3T08A 3OEAA 2WLMA 2IM9A 3UKTA 4CC6A 1KP3A 1RUG3 1OCRB 5C8CB 2WZR3 3LDCA 4PA9A 4JRAA 1D0GA 4B3NA 3AFKA 5FPXA 4XBLA 2MHFA 3JD2A 1DQ6A 2R7EB 3ZN0A 5GZEA 1I08A 2Q4SA 3CRQA 1FD9A 2IUWA 2A06H 4CCOA 2IJKA 4CUCA 4K40A 4LK7A 4FPHA 4UWDA 1HB3A 4DR2B 5IFPA 3P1IA 2ZJCA 4DQAA 2JICA 1ZZBA 1P4RA 4FFGA 3FX7A 4ZY9A 1IBLB 3D6EA 2WNVA 1DQ5A 2BOJA 2HFEC 4HFSA 4JYYA 4GQ7A 4JASA 3TRSB 3HQUA 3CCLV 2WNOA 4CCNA 1ZAUA 1BHAA 2ZE7A 4MUVA 5FZ4A 3OD0A 2ZACA 1F8VA 3LEMA 3NW4A 4Y3OA 4D7SA 1VIWB 3AYAA 1HRI1 2EICA 3NJVA 4DUWA 3HOBA 1ULFA 4GX1A 3FUQA 2ORZA 2WLLB 1PX4A 5T52A 2K2SA 2W46A 1W8NA 2A3WA 3JD4A 2JKXA 1R093 4B3TO 1JXNA 3WNPA 3TEXA 3GWOA 2DBNA 1Z0HA 1VRBA 2IJIA 3E1F1 3JD73 5JQGA 2DBIA 4CDWC 2GSYA 1IKPA 1BYHA 1DF4A 1OLMA 2WZEA 3N9PA 1YCIA 4GWNA 4YGEA 1S72V 2JDKA 2A6WA 2OIGA 2PHTA 3VHPA 1VBD2 5FL7G 5IVFA 4IE5A 1FNYA 2QQJA 3I3QA 2VULA 3MIGA 1JYVA 3DYOA 1Q6HA 1I3HA 3OGGA 1D4VB 3WVJA 4RFT0 3GZAA 3HR9A 1H2GA 1D2QA 3POGA 1V6IA 1DIWA 4YIPA 4H3WA 1GZWA 5G05L 1NZIA 2VXRA 3P3NA 2VQAA 1M93A 3TN92 1F5JA 4U3JB 3GWKC 3HT1A 1PK6B 4R9DA 2F4PA 1ZA7A 1TME1 1ENVA 4AQ2A 5KHKA 4Q4V2 3ZSMA 2K9ZA 1ND3B 4KWLA 3SYAA 3OEHG 3U78A 1REDA 4JDNA 5DXDA 2QTSA 5FMOS 1XMOO 3WP5A 2XAFA 2WR9A 2VCMA 1CIWA 1D5AA 4M4PA 2DUQA 5I0TA 2TUNA 5JCTA 1GO3F 2VQEO 4CYDA 4FFKA 3B94A 4LFBO 4SLIA 2EAAA 1CN1A 3C7FA 2Q8DA 1OD3A 4LF5O 3ZYFA 4MTOA 4AQSA 1LOFA 4GJYA 5AC91 3NQHA 1AI7A 1CX4A 1F15A 4LNVA 5FNVB 4IV1B 5A2QN 1EN5A 1WD4A 5JSOA 3UJOA 3H3LA 1YJKA 3TBDA 3LZZA 4XDQA 1RUI2 2JENA 1QLEB 5BV6A 4BIOA 3RZGA 4IL7A 5ABJB 3A0RA 1G8WA 2RJLA 5DECA 5FZBA 5GTHZ 3TGUH 5IWFA 3ZO0B 4LFCB 1V54C 2V4VA 2B1GA 2YI9A 2AC1A 1V70A 1KRIA 5JOWA 2WBKA 2LTNA 4MADA 1STMA 4WF9V 1N32B 2VAUA 4DB5A 3JBG1 1W06A 1OBNA 4YW1A 3MO4A 5BNNC 3OOXA 3ELNA 1VAMA 5LMUB 4ASUG 3R66A 1GP4A 2GNMA 1JW6A 1WMEA 1EPZA 5EC2C 1WW6A 3AL5A 3CHXA 2KSDA 2ZMLA 2E7TA 1F4NA 4DV7O 3O7OA 4NRPA 4EE2A 1GMMA 5HCFA 4A6SA 2Q6AA 4A44A 1XNQB 3CEIA 4FAHA 5F39A 2EZPA 3S3XA 1S2KA 2CGOA 3NV1A 2HKOA 3CIHA 3BCWA 4JTNA 1YQ6A 5KMGA 2G9FA 2RS32 5LMNB 3ZHUA 3A8TA 3MIDA 2DYSB 4H44B 2YBKA 3A22A 3MICA 2LM3A 2VOVA 4TZDA 1XUQA 1QMJA 1XYPA 2AUYA 3FBMA 4GH4C 1S3JA 2DQ0A 2WLJA 4AAXA 2VZRA 4DR3B 1AR92 2DMXA 1JYTA 3FUOA 1G7YA 3K2OA 1VARA 4ONUA 4KI5M 4YJ2B 4ZHQB 1IBKB 5EYYA 4F3JA 4I2OA 4TOIA 1ZM1A 3ETEA 2Y0PA 1M4UA 4LQRA 4ASMB 4Q4W3 2CDPA 5EPAA 1W6MA 4XJWA 2VWJA 1XBLA 2CAZC 5FLJA 1DBNA 4H14A 3IPVB 1JQ0A 1HX6A 1OVSA 2I45A 4DUZO 2H6CA 4GKXA 3TCUA 2VMCA 4DV6B 2VQ0A 4QDQA 4G27B 4OI1A 2CGPA 2LFSA 3PJYA 1ZTEA 2W6JG 4EFEA 1E79G 1Q5OA 1JU4A 3FJSA 3J80N 1FXZA 2XVGA 2BGOA 3CF6E 5FZ7A 2OCCC 1AXZA 2P4EA 1UZ0A 1W6PB 1B06A 1Z7S2 3LPFA 4XQWA 2RS52 4MGSA 1JUHA 4NB5A 4NYKA 3T1MA 1X4TA 3RRDA 3PVEA 4MTGA 3TB0A 1AYN1 5DN6G 3C3SA 3WQ1A 3JAKA 1SA0A 4ZOLB 2DTYA 5HV4A 4W65A 2WAOA 2VOTA 4YFZA 1O5UA 3BUCA 4B3RO 4IE7A 1I94O 4A2UA 1QJZA 4CS2A 3L9JT 1SDDB 1RIRA 5FYIA 3THPA 2PUSA 2ZGMA 3KQ4B 3WG7C 3VHOA 3RZLA 4JC1A 4NRQA 5F32A 3S7EA 4P9PA 1VBA3 3O9OA 3B69A 2PHFA 1YHFA 5CA0B 1XB9A 4IV3B 1W2UA 1M9NA 4MX3A 1EV13 3APOA 1SBDA 1AVBA 1Y66A 2C6SA 1SQ4A 1GTOA 4J25A 1FXVA 2XLGA 3LOBA 1GZTA 1ZZ9A 1KJLA 4D94A 1OSGA 2OT7A 4V2VA 3DPRA 5A1LA 2VZVA 4ISQA 3HQRA 3Q8BA 5LGNA 2WO2A 1HW7A 1DZTA 1NQTA 1W3VA 4GMP1 5L3CA 1Y76B 5DZEA 2P6JA 1Z5WA 1M1KW 3JARA 3MLLA 4S2DA 2YY1A 1RUJ3 1ZZ6A 2CDOA 4TV8A 2UY8A 3VDDC 4I0XA 1DQ1A 3NKTA 2KD7A 2EZOA 1IPJA 1U5YA 2P90A 5B4NA 1WW5A 1LKNA 3WW3A 1KU9A 1FJGO 4YZ3A 1P8JA 4I50B 1A6CA 4NPMA 5IFTA 2K46A 5LOVB 3PVOA 1PGL2 3ZYBA 4DK1A 4LC1A 1YI7A 2QM7A 4X65O 4FXGB 3ZHSA 1AR81 4L11A 1SBEA 3AKPA 2WQ8A 1AP6A 1TVGA 3ES4A 1IPSA 3HPNA 1V6OA 3SYPA 5J36A 1OQDA 1QJEA 4P9IA 1ACCA 3WZ1A 3ABKB 1Y67A 4XTPA 1RPOA 1ASJ3 4N7UA 2Q7HA 2ITDC 2XBO2 5LY1A 2OYQA 2VWKA 5FYSA 3S7IA 1RJ8A 1SERA 1AILA 4XFHA 2YICA 4I0BA 3E6BA 4PDRA 3LA3A 2VZQA 1DCSA 2BSKB 2ZKNA 1XI1A 5LWBA 2ZT9B 5GLWA 3ZS8C 2ZMKA 4UT5A 4NWVA 1JOBA 4NTYA 3GJBA 1P7BA 3BU7A 1TG7A 1W99A 2B4KA 4XYXA 1RUH1 4O9EA 4FLXA 1RMU1 1S76D 1AX0A 1GP5A 2UXDO 4X64O 3CO2A 3I2GA 3K0GA 1R3LC 4MVQA 1J59A 4NHKA 5FJKA 4GB31 3UQ8A 2YPDA 4NIIA 3JAWA 4Y4RA 2MW2B 2ADEA 1OCCB 4ISRA 4R9BA 3CZUA 2ZXWC 2GNTA 2B5HA 2JDYA 4LLFA 2UU9O 3ZN6A 1S0GA 1UAIA 4TV9B 3VBUC 4R4XA 1LUWA 1AYM1 4MGTA 1YIFA 3N2KB 5FLHA 3SPGA 1ZZ8A 3GZTB 4CS4A 3RYKA 2HWC2 1N3QA 1FAYA 2YUEA 1Q86W 3BODA 4BQ1A 3U4SA 3OPZA 3KT1A 4DIQA 4CE8A 4EN0A 1TVKA 5JVDB 1S2BA 5LASA 4M01A 3A0KA 4NXNB 4LTAA 3SPIA 2W5FA 3H0OA 3KT7A 1RUE1 1J3QA 1PKXA 2QCSB 3ZFEB 1QXPA 1EBOA 2DURA 1GM7A 3AG2C 5JCOC 3AZZA 5AFBA 1DGSA 2OT5A 5IYCO 2D6LX 3PUAA 1GICA 2DUOA 4B7KA 1V55C 2RJKA 1UYPA 1XRUA 1DGLA 1O5LA 2HWD3 4LBMA 3ASOB 4RGAA 2YGLA 1NAEA 1CPNA 3SKJE 3THOA 4LT5A 4B7EA 4L2NA 4EWDA 1JMKC 2LS6A 3NNJA 4Q1RA 2ZE5A 1KEXA 4LP8A 2EVXA 1CAWB 1YQ2A 4HXCA 3OY8B 3F7VC 1H2LA 1VP6A 1IVSA 5JXHA 3M99B 1S5HC 5FPRA 4PDMA 2ETEA 3KCXA 1AL21 3NJYA 4PCRA 4JAAA 3FAVA 4RN5A 2WA3A 3SISA 2EILB 4DEQA 3IMNA 1OCOB 3INAA 2YZ4A 4PA6A 3T1HO 4QPJA 1OCRC 1BVVA 2A6ZA 4MVRA 4AG4A 1C5IA 3P6BA 1PX3A 3IDEA 3DXRA 4BIZA 4AILC 2JB8A 2XDVA 4UFHA 4HVOA 1VQMV 4ZPIA 4GCZA 3VDDA 2HKXA 3DKWA 1RUC2 3IAYA 1AR73 3N9OA 3I2FA 2BJSA 3R4DB 2WSUA 3MFAA 2ZKOA 2ARAA 3G6EV 3JXSA 4K8RB 3VBFB 2KB1A 1O8SA 3WU2Z 4QQHA 1O6UA 3I59A 5KUMA 1UCXA 1CZSA 1ND2B 1RUNA 3NAPB 1PVC1 4W8JA 5J2TA 3AMHA 3ZBHA 4Q4Y3 4NJ4A 3U0ZA 2YC4A 2CWSA 3O1TA 2VVEA 5EV7A 3FC0A 4FFFA 3ZXFA 2LJ2A 5L7OC 1OH4A 5L73A 1XQ8A 4N43B 1UY4A 2AR6A 4KBBA 4WVVA 5FPAA 3BU0A 4IETA 3QH6A 3WF1A 4QXBA 2IFRA 2B9ZA 5CAZA 1OUXA 5H6QA 4D7TA 4YLZA 3RZMA 3L2HA 2QKCA 4CEWB 2PF4E 2FCUA 3A0NA 2VMDA 2DWRA 3VKOA 4FPLA 3BCCH 1MEC1 4B08A 3SCFA 4AZZA 1VMFA 2XJPA 2D40A 2RG4A 4ATFA 1WCKA 2Q0AA 2D5FA 2WNUB 4XUQA 1JCHA 3M3EA 1EAH1 4CUGA 5FYMA 5A32A 4AQYO 2F95B 3AXEA 4FLTA 2DCZA 3CXHF 4UF0B 1MS3A 5BXZA 3VKNA 1QQP3 1W9FA 5CEHA 2EIMB 3B8MA 4LIUA 2EIJC 1K33A 2CU5A 5CKMA 2RHPA 1E5SA 2D44A 2ZHNA 3WB2A 4LUMA 4N8MA 3AK3A 3ZCCA 3W7SA 1TA8A 3Q4HB 1BJQA 3VBUA 4B4QA 2VNGA 2GV9A 2GC3A 2PXJA 1VRH1 2Q8OA 3L72H 3D3AA 1A8DA 1C5HA 5ACA3 2MEV1 1RJ7A 1AZDA 3B5LB 5D5PA 1U97A 5A6QA 5GZFA 3OG2A 2ETNA 2JGUA 4D6SA 4GKJO 3DV8A 1KQRA 1Y4MA 1KXGA 4P9JA 1UD1A 2E7QA 5CVRA 4JQTA 2M6YA 4BPZA 2R9RB 4Y24A 4RQPC 1OVPA 2EJ7A 4B3TB 1PM4A 1JYWA 2Y6FA 1WBLA 4WM7B 2RS13 4B1LA 4WCEV 3OB8A 1B09A 5LL6Y 3OE7G 1VBC2 5CA1A 2QJ1A 3DTUB 3WR0A 4O4LB 2FHRA 1M57C 5JIUA 4IV1C 1NCRB 1J5EO 4QX0A 4JV5B 1MZ5A 1AXKA 4QD2A 2WL1A 1OUSA 1FT9A 4IE6A 2AHYA 5IJ9B 1REFA 3QO5A 2XLAA 5A70A 3E6DA 5K7PA 3AM2A 1S0IA 2VZ3A 1AJOA 4JDMA 4PV1B 1E5HA 2WYSA 2D5HA 2GC1A 1U5ZA 3EHKA 1DGWA 3KQRA 1JYXA 4MGZE 5B4XA 2GH8A 3AKTA 2VMFA 1ZLZA 5L3GA 3T4ZA 4TSFG 3AMNA 3SH4A 3I54A 5T3NA 5A3NA 2GUZB 2XB6C 1DK1A 1QBZA 5EIBD 5IK8A 4FP2A 3SXWA 4MLOA 5C8CA 1W9TA 4DW0A 1L7LA 2KG7B 1AI5A 2VQTA 4LULA 4QPIB 4JI1O 1W8ZA 2YU1A 2EJRA 4QB2A 1BHGA 2RMKB 3VD9A 2C5DA 4CSWA 2R72A 4Y5Z0 3AG4B 1XMOB 5CFCB 1W2BU 2XR4A 3RZKA 3VKLA 2XQXA 2J22A 3GB7C 2YC2A 4JGYC 2YS8A 4OGQB 3AL6A 3A2FA 2VQEB 2JJ2G 1NT2B 1LU2A 3J7LA 4MVTA 1JJ2U 4LFBB 5E89A 4MGKE 3LQCA 3HIFA 1GRJA 4LF5B 1VAKA 5C3SA 1K4CC 4FPFA 1SLTA 3K59A 3ZYGA 4TT3G 2KQXA 1HB2A 3WNLA 1ULEA 5C6CA 2ZE8A 1YHQV 1QHDA 2P3JA 4CCMA 3MIEA 3USUB 3F5WC 4A5UB 4NWWA 3SPJA 4Z07A 3S30A 3MIHA 1QQCA 2W39A 5HPOA 1OV9A 2WLLA 4JYBA 3CCUV 1SLBA 3ST7A 2QTWB 5H9CA 5FPOA 3D4KA 2VUJA 5EBLC 4LR4A 2WO3A 4KU7A 5EHDA 4IEXA 4H2AA 1TUEB 3RSJA 1IG0A 3L75H 2JJ1G 3IC9A 1FPN1 4OPAA 2JDUA 2QDRA 3B01A 4CDXB 1ZUQA 4L8QA 2LW1A 4O9GA 2Y69C 2RV9A 5FMDA 5C9AC 2QKDA 3N36A 4M4RA 5KXCA 3U14A 4DV7B 4CCDA 1HDKA 3UO3A 1AJQA 2GSMB 4DUXA 1UL9A 2P1BA 3CJXA 1NS1A 1YZBA 4DRXB 4BQXA 3GZUC 3B02A 5EQUA 1EZVH 1JPXA 3G80A 2ZZQA 4XCBA 2BERA 4FK5C 1PGW2 4H7MA 4U3JA 4JKKA 1PK6A 2OPWA 2ZEYA 1VBC3 1B35B 1DP0A 1MMMA 2AZ5A 1XE7A 4HPKB 4OUSA 1ND3A 1OH3A 3U10A 3BOPA 1IS4A 1YQCA 5JSRA 3RYFB 1MQTB 5CFDC 1KB9F 1AR63 3POIA 1OF3A 2C9AA 5DDJ1 3HQXA 3SCHA 4LO5B 3C3TA 4QX5A 1UXZA 3FWEA 1GANA 1PO21 1E57A 2XUMA 3J9SA 3U07A 3N2GB 5A80A 5I8SA 1FMD2 3D3QA 1ODMA 2YB7A 5DUUA 5KR7A 4DUZB 2A71A 1PZ7A 5FNVA 4IV1A 2YUAA 2J1TA 3KV5A 2Y33A 3PTRB 2P3IA 3BKZA 4QIWF 2LGQA 2TEPA 5F8PA 2R063 3M7MX 4OHVA 3DGEA 2YEVB 3FFQA 4JI0O 4FLZA 1OFSA 1VQ8V 4XUTA 1CIYA 5ABJA 4LK6A 5EIYB 3STZC 3L70H 5BY1A 1WPBA 2D98A 4WBBA 1V00A 3MI8A 1QF3A 3VB9A 4HVRA 2QVSB 5JI9A 2BPA2 5A3PA 1PIV2 1YQ8A 2WN2A 5EYXA 1UF2C 3POSA 1Q81W 4OFGA 1VQLV 1GZ9A 1RHI2 1T2XA 5FOJB 3CJHB 4TUYB 2QWOB 1O3RA 3K48A 4MXWB 4J80A 2UUCO 5DAXA 2GNBA 1YXBA 2BTQB 1W3XA 2ZX2A 4W4LA 1O9HA 2X05A 2XPJA 3ABLB 2W52A 4B3RB 1PNMA 1YIPA 2D2CB 2VGDA 1RC6A 1WLDA 1I94B 2OVUA 4WFFA 1PNLA 3RYCB 4XMIA 3ASNC 3I97A 2EULA 2OIEA 3SEEA 3ZMTA 1RGSA 1IXMA 2GDFA 5JIAA 2BTVC 1QH6A 1QY4A 4AVSA 4RS5C 3HB3B 1E5RA 5FYYA 4ATEA 3R4SA 1NCQC 1NXD1 3WP6A 3K06A 3WNKA 4BOWA 2X5IC 5K0UB 3ZMUA 5LA1A 1QNMA 4I5SA 1YYNA 1XNBA 1KKDA 3WF0A 3ZX6A 1OLQA 3BTAA 1YTFD 2QE7G 2XJVA 2MK3A 2UYBA 3LSEA 5A3TA 4K7JA 5EXOA 1QOOA 3VKMA 1VMGA 4OX9O 4YJ2A 4ZHQA 4HG6B 4ZKTB 2CH7B 3AMQA 5GJ6A 2FCVA 1HRI3 4BWAA 1N0JA 1D2DA 2WZPP 1ZBE1 5C3OA 4FFBB 3K77A 4AGVA 4RWUA 2AZ0A 1YRZA 1MR5A 4C1XA 4XF0A 4CXXA 1X59A 1KDMA 3IPVA 4IYHA 2EF6A 2PHLA 4OMCA 5IVCA 3H8OA 1ZREA 1EFRG 5IVYA 5H2FZ 4RR3B 4XBNA 3E5UA 4QKBA 5L19A 5J3UA 1SFPA 2KKWA 3F5TA 2G9GA 4Q0QA 4W4ZA 5AVAA 1LULA 1BE3H 5KHIA 5C7GA 3DYPA 5CN0A 3GF6A 3WCSA 4UFIA 2XG3A 4X65B 4CPBD 2GN3A 4XIKA 1W6PA 2B8MA 2EBOA 1JUIA 2JVDA 1I5XA 1U0AA 4N21A 1N4CA 5BXXA 2VMEA 1XNAA 2YIBA 1GQGA 3B77A 3N9LA 2PAEA 2BUKA 2A3YA 4S2FA 2PMWB 5C70A 2FDHA 4MZUA 5H6RA 4GALA 2N05A 4Q4W1 1HNWO 1AF9A 2W1UA 3CYOA 1F2NA 4ZOLA 1KS4A 2R16A 3WF2A 2XJRA 1TME3 4KG0A 3DXTA 1CVNA 4DXSA 5HBAA 4NMIA 1F4HA 1H9PA 2VZ1A 5B1AB 4XFFA 1VE0A 4CTEA 2IH1C 2QWQB 1Q8PA 1QVGU 3CRMA 4LF6O 4MW3A 1CQ9A 3BPZA 2BP6A 1SLLA 3LAGA 1FAFA 3RPQA 1Q90D 1E1RG 1AROP 3CD6V 5KC6A 3H1LH 1WA8B 3C3VA 3I3DA 2QWPB 3THDA 2IZWA 3BIEA 3FBYA 1RVF2 4X64B 2YC0A 2NMOA 4FM1A 5JXIA 5CA0A 5FYCA 3O1SA 4IV3A 1XSQA 4MGQA 5AC93 4F6RB 2R70A 4OMDA 3J7MA 1H8VA 3AP4A 2TBVA 3DL3A 1VIBA 4WM8B 4X1IB 3M3OA 4LBOA 4AR2A 2HP8A 2VTFA 2A9HA 2UU9B 4RAIA 3VDBA 1N0NA 1F9KA 3HN3A 5A7WB 4OCTA 1JI6A 5IK7A 1I9RA 4X1KB 3O65A 1RFYA 1K3IA 2BNOA 2KM2A 3N7KA 3AX4A 3Q8CA 5KHHA 1Y76A 5CYYA 2FMYA 1GK9A 2ZXQA 1PPJH 5BNQA 1V6NA 3EJKA 5JI7A 4NAMA 3JALB 3RYPA 3OBRA 4B4RA 3JBG3 1GKFA 2O14A 4QPGB 5T54A 4DRVA 3NSTA 4DR2O 4MT8A 1H4HA 4E2GA 3ZYHA 2VVDA 1K45A 4I50A 1QR8A 5B1NA 5LOVA 4IYIA 4PDVA 2ATFA 2X29A 4HN0A 4LO8A 1CESA 1ND2C 1NLSA 4E27A 4CCCA 1KMIZ 1VQNV 1X8MA 4E4SA 1K3EA 4IEOA 3RVYA 4J41A 2ZHMA 5JOZA 4D69A 3FN9A 5B3SC 2ZMNA 4NHLA 1MS5A 3WY6A 5BZBA 1EPWA 5A3UA 4QGNA 1HR0B 5IY5B 3VL9A 3DSQA 3JU9A 2E9QA 4BQYA 1OOPC 3ZHRA 1RM1B 2QM4A 5CA3A 3JCUZ 2H8PC 3AMPA 1WA6X 2HWF2 3POBA 4M3CF 5HFLA 4L8JA 3BN6A 3RN4A 2BSKA 3LEIA 3BFRA 1MPXA 4I0AA 2XTAA 2BCCH 4FI9A 3T1HB 3PU3A 4A42A 1CAXB 5J7MA 2YIDA 3CU7A 2QDOA 4CU8A 4ZU4A 5IT6A 2ET1A 2K0GA 3VZMA 5HV0A 1AJNA 1JYIA 1CZTA 4YG0A 1SETA 1LU1A 5IATA 2JX9A 4OUEA 1HV1A 3PIJA 4LPLA 4Z2WA 2Y64A 4JI5O 1YF2A 5BNPC 4RUEA 2QBXA 1SQVH 2XLFA 4JZRA 3MUZ1 3Q8FA 2ZGUA 1R3JC 2ZNJA 4E4ZA 3E22B 1XBFA 5A3WA 5FZ8A 4TV9A 1ZVFA 4JI3O 5FKBA 3N2KA 2I2SA 3BOWA 3ZXEA 3H50A 5E88A 5CISA 5ANNA 1J1TA 1Y6XA 2V09A 5DPNA 1G86A 1W90A 3RMYA 2HHHO 5EP9A 5GLUA 2WUHA 2J1RA 2C0ZA 4W50A 5JJNB 3HBKA 3K9SA 3QD6A 4IGOA 3ZFEA 1QJU2 1AYN3 1FS0G 4Q26A 5F37A 4WFAV 4HK8A 4GB32 1PGSA 4CDWB 1VBB2 3JASB 1E5IA 4WZFA 4LOSA 1QR9A 2XAJA 2J42A 3KLSA 4LF8O 1HRV2 4PT6A 4AI1A 4URAA 4DMIA 4XAEA 3ZSEA 1P84F 5FZGA 2WN3A 4NUBA 4AQYB 4LR3A 4HMZA 1HIXA 1OHFA 4AGGA 1OPOA 2ZABA 1BK1A 1NLQA 4Z8BA 4LCUC 3HEIA 4X89A 1CAWA 1VQPV 3N27A 3OY8A 3GXUA 1XHZA 4Q27A 2VTXJ 3ZXAC 2WS92 1XXNA 3APBA 2W87A 5ERLA 2WFPA 3N7MA 1L7RA 4LFCO 1PO13 1V6KA 2CY6A 3L71H 4XUOA 1YITV 3CLPA 1TE1B 1FOD2 2P17A 4BJ0A 4MO3M 2BNNA 4G28B 1IBMO 2H0BA 3JQWA 3VL8A 3BB6A 1NY71 3I2OA 4RGGA 1D2SA 5DG1A 4GKJB 2QQKA 3AEIA 2AHZA 4AOCA 3MPPG 4Q4X2 1UU5A 1BT8A 3AG4C 2JG9C 4GMP3 1SEFA 2G9ZA 4FOYA 1EP0A 3JD1A 1HNZB 4QX3A 3OGVA 3VBFA 1SPPB 1LHNA 2WT1A 2IVJA 1URFA 5SV5A 2L35A 1ND2A 1HXS2 3NAPA 1G6UA 1COV1 5FLXN 2Y8KA 1VBE2 2D6OX 3OYWB 4M0NA 4UFZA 4BK5A 1VB4A 1J5EB 4P30A 5LGTA 1UN1A 4XE9A 1AR83 1UY1A 4OZXA 3RYHB 4N43A 4R6ZA 2PELA 5KA6A 3NV2A 4O4HB 1LTEA 1IURA 1MVQA 2R30A 1GR3A 3W20A 1IBKO 5C3RA 2IBZH 4UUJC 5EJ3A 4GYCB 3OBTA 4LBJA 1YFWA 3MDSA 4QKDA 4CEWA 3RVHA 3I7DA 2HBTA 1V54B 3MBWA 4YG6A 1XNKA 3OUSA 3NV3A 4Q8KA 4FPGA 2ZAAA 1KDKA 1R083 4MS2A 4AFCA 1BCXA 4C8DA 2OQ6A 1UXXX 2ZGPA 3FB6C 3TWIA 5BNNB 1S4CA 4Y1ZA 3POWA 3ZMNA 2WNUA 3H9VA 4DXZA 4JI1B 1VMJA 3ZOIA 4I0XB 1WP7A 1US3A 3WD5A 4HSJA 1DGWX 2SLIA 3ON7A 1Q7YW 4CCEA 4UF0A 2CTQA 4Q4Y1 3AJZA 4NHXA 2PAKA 3MFCA 1GN4A 1RUH3 4GXLA 1RMU3 1NU1H 2F4LA 4OQ9A 2RE9A 1IKQA 2UXXA 3WDWA 4IXLA 1NZ6A 1ULCA 2UWAA 5CKNA 4YYOA 1Z78A 2E5LB 3Q4HA 4BAYA 2VZOA 5BUVA 4YM3A 1X8EA 4YM0A 4PQ9A 4XZPA 4QB6A 4DUYO 1O3SA 4GH4B 3O0XA 4AI9A 4Y5SA 1NI8A 3H9AA 4AEJA 1C8M2 2R072 3K3WA 1AYM3 3W7TA 1W9YA 2VUAA 1KP2A 2H94A 2NNUA 1MQTC 2D43A 1IPKA 3ZKYA 3L2YA 3HAGA 4RFRB 1NH2B 1G6NA 3CSXA 3T1CA 1XREA 1FX5A 5FQ0B 3IDBB 4WM7A 3PL0A 5M0TA 3POJA 2KXLA 4JHTA 2JECA 4W6XA 2R32A 3KVAA 3K79A 1RUE3 3UCSC 4COZA 3ABMC 4LWSB 4DR1O 4YZ5A 3TOJA 4O4LA 4J6GA 4IGPA 3O1OA 4CH5A 3WNNA 3SJCC 1NX9A 4FQ4A 5C8WA 5F5CA 1NCRA 2X7RB 4G9SB 4FJCC 2VJXA 4UOJA 1UPSA 5BNOC 5IJ9A 4EWAA 4QPKA 2CAVA 1SKVA 2MEV2 4XETA 4YW7A 2V4AA 1W9SA 3AJYA 2B9VA 4Q20A 3D0JA 4COUA 3K5NA 3TYJA 4K8XA 1XJAA 2EXHA 4GKYA 1GQPA 4CCJA 3T2QA 3C90A 4PA4A 1UMIA 2GUZA 4R9AA 1E1QG 2HWE1 2W47A 4XPVA 4FPKA 1AL23 4XILA 3AG3B 2HR3A 1JR9A 2KG7A 3B4SA 3SJAC 4QPIA 2XXZA 1DDLA 3UGGA 5D1IA 2PZSA 4DK0A 4XUPA 4JHZA 1OHHG 2VNVA 2WFF2 3ABLC 4CH4A 2JG9A 3IN9A 2BU9A 5EIBC 3CBNA 1H2KA 5IE9A 1QCEA 3HKBB 3KWVA 3T0DA 5J2UB 2WDBA 2PLV3 5ITZB 3UKVA 2XL9A 3LDEA 3ZHVA 3M2MA 1MG1A 3K75B 1GQHA 5IWAB 5JZGB 3WINE 2HG5C 2UXCO 1BMV1 4WBNB 5SV8A 2GMEA 1UOGA 3USUA 3STLC 5FZEA 1PVC3 5DAVA 3KV6A 1K5QA 4UB6Z 1V9U1 3O0WA 1WMDA 1JZ7A 2AYHA 4JI0B 3ASIA 2BV4A 1LRHA 4G4FA 2R042 4ZKIA 1TQ5A 2RM21 4TWKA 1Q8OA 5LP6C 1OD5A 1W8FA 4PQQA 4YGCA 2RMU1 3MD0A 2YGMA 1H8TC 4BQ5A 4K1ZA 5LEKA 4CUAA 1J58A 5D8AC 2ZNIA 1U96A 1MSWD 1MEC3 4D0QA 3O0VA 4CDXA 3CMGA 4FFIA 2OYZA 3WV6A 4X1YB 2R6QA 4LNUB 2RR11 2IJJA 1AI6A 3J8F2 4FTEA 5A7QA 5B66Z 1EAH3 1SQPH 5KAIZ 2GNDA 1OA4A 2QKAA 2PHWA 3AYDA 2VMIA 4LORA 3NV4A 4DRXA 2A3XA 2HYKA 1VQ9V 3I8TA 3T3YA 2IH3C 1RUG2 2YI8A 2WZR2 3ZDSA 1MABG 2A7AA 2RDSA 4OXSA 3KV4A 3UO2A 4PBPA 4FAGA 1ENRA 4JYCA 1NVPD 4JKMA 4FLWA 3OD4A 3OUHA 1B35A 3J4UH 3IIIA 5J1XA 1YEWA 3G71V 1WCQA 1POV0 2R0FA 3LFMA 5LBEA 4XC9A 1QH7A 4CU7A 5ANQA 5FO7B 3S3WA 2JEXA 4KFMA 4X8NA 1VF7A 3Q8EA 3V0AB 3RYFA 1MQTA 1VRH3 2ODMA 3ZIAG 2VBDA 4NVPA 4UFLA 3ZXLA 1NJIW 2IVIB 1KFUL 3J7HA 2A73B 2Z3YA 5B5EZ 2A1XA 1C1FA 2IFWA 1MS9A 1JJOA 2VW2A 4NN0A 2BW8A 5CADA 3ETPA 1QJX1 3SC7X 5JPNB 4NIHA 3N2GA 1WP8A 4WV8A 2DFBA 1VQOV 5FY5A 2AREA 4CP2A 3DF0A 5GZDA 3RZJA 4EN9B 5K1PA 3C7EA 2JKBA 2YIAA 2JS3A 2EINC 2IU0A 1PZ8A 1R092 1JOYA 5APAA 4XF9A 1C8NA 2YEVA 3UGFA 4QGMA 3JD72 3ZFFB 3VBRC 5HXVA 4I3GA 5IK4A 4C0BA 3D0SA 2HEYF 3NJZA 3U1XA 1QU7A 4RHV1 1RPRA 1YNAA 5AFEA 4KG8A 3BI3A 2DWEC 4QHBA 4IUGA 1P7GA 5FP3A 5LK7B 2YXLA 1S0FA 3WUDA 3KD4A 3EQEA 3CJHA 4UCVA 1R64A 4QGPA 3IAQA 4MXWA 1GUIA 1JTZX 1UOJA 3ZRWB 4OZOA 4RO2A 2PI5A 5FV3A 3ZVXA 2E31A 2BTQA 2OTJV 1HNWB 4DEVA 4Y20B 3V56A 4DR5O 4Q6GA 5IYYA 2LFRA 4L99A 5E8AA 4ZXKA 2A70A 5JVVA 3AG2B 4X8PA 3J7NA 5DQ0A 3RYCA 1VQ4V 2FD8A 3AK1A 4LF6B 3ZSKA 1W2OA 4LH6A 1DU3D 1W6NB 4NKGB 4L9BA 2AACA 1LNSA 1HB4A 2CSGA 1QVFU 1SDWA 4P00B 2Z4FA 3CXCU 4CDQB 4JDOA 3JUUA 2QZ2A 3QLQA 5K0UA 3T0BA 1CPMA 1BK0A 3I3BA 3HKEB 4ZBMA 2EIGA 1UU4A 4NTWA 1VBD1 4K21A 1YO8A 2VNOA 3BEHA 4AHCA 1SQBH 4ARXA 1XNRO 3UNPA 2W1QA 2VL4A 3SH3A 3CCEV 3O12A 5LBFA 2M7WA 3K0DA 4KUMA 4QXKA 2CH7A 2JIGA 4YW3A 4N53B 4CVUA 2WRAA 4PLMA 5KC5A 2AGSA 1TAEA 4JAVA 4FFBA 3USSA 1DZRA 3TN91 3J26N 1IZ3A 4NIAA 5FIXA 3IFXA 3CQOA 1QGLA 4X66B 3R4UA 2PHRA 3IZOA 4RR3A 4PJ0Z 3VBHC 3LF7A 3T09A 4RSUA 5LBCA 4ARYA 1R6NA 2QDNA 4Q8LA 1XILA 3K4ZA 1FPN3 4ES9A 1GOGA 1DQ2A 2AW9A 5EJZB 4X62O 4F8AA 1WMFA 4LHNA 5GZCA 1YC61 4DR4O 1FI2A 5T5PA 2A6VA 4ITCA 4GZRB 4I09A 4NOTA 3UYJA 1NA1C 3EHBB 1K12A 1S55A 1UOBA 5DAWA 5L7OB 3ZYRA 2GAUA 2XQRA 5FO8B 5F6LB 4QHZA 1RINA 1YFXA 4Z1MG 4O7XA 1RUI1 4A41A 5CBHA 4GA9A 4FM2A 4CU6A 2ZM6O 4BIUA 2OWOA 5LYJB 1IG3A 4DV5B 5FZ9A 4W6WA 3RYIA 4BQ4A 4FPJA 2VY0A 3WF3A 4IW3A 3FB7C 2D93A 3UGHA 5DDJ3 3H1YA 5BYNA 4LLOA 1WA8A 2JXAA 1OMIA 5GTIZ 4JV5O 4QKFA 1PO23 1G4YB 2BTOA 4NAOA 1NTMH 5FY7A 1MSDA 5LA0A 4PF5A 1ALYA 3P30A 2F4VO 4XMAA 3THTA 1SQXH 3QTCA 4F6RA 3LNMB 2EIJB 1QU0A 1ZZ7A 4Q4W2 4BA6A 2WLIB 4JI5B 2FMLA 4WM8A 3OEBA 4X1IA 5KXBA 5FBZA 3M3CA 1V9PA 2LW7A 1HB1A 3DC6A 1Y74B 2DCYA 3MZHA 5A7WA 2BOBC 3FMGA 2X6CA 2YROA 4N9IA 4JI3B 4X1KA 2HWB1 4JZ2A 4CBCA 2VZPA 4K3AA 1C28A 1SZBA 2NR5A 3TK1A 1KUQA 4XJ8A 2RS31 3B09A 3GDBA 1HLCA 2V5YA 1ZYBA 2XOMA 1LHOA 5FDBA 1L1FA 3H1WA 2JS5A 2HHHB 5CNAA 3JALA 2F6BA 3EYPA 2JEUA 4B3SO 4RQPB 1AR91 3LIHA 1NR7A 4QPGA 3WQ0A 2FZ1A 1EN4A 3AZWA 4RA0A 4MVMA 3RZZA 2OZJA 1I6XA 3VBOB 4LF8B 2B7YA 3VBSC 4JGZC 2P34A 5DN2A 5FXWA 2BYVE 2J1SA 3ZSLA 1M57B 1UMHA 5T50A 1U12A 3EXUA 2QFEA 4GX0A 1QOTA 4BQWA 5H9QA 4DV0O 1SFNA 2VCBA 4XF1A 4BM8A 2PI4A 4NO4A 3OT7A 4AF9A 2XHNA 1XE8A 3LDDA 3LUTB 2CDYA 1GWMA 2ZGNA 4TXWA 3SPCA 4Y1VA 5LY2A 2HEPA 4P02B 4GUNA 2UXBO 5FZIA 4GLXA 1R1BA 1RXGA 1Y43B 3FKSG 4C0HA 4IGGA 1LODA 1R3IC 3WDYA 3KZIZ 5FPZA 3E5QA 4LBQB 2FZ2A 1VBA2 1T6GC 1Z7S1 5E1RA 3ICXA 4QWNA 1IBMB 1OXCA 1IDSA 1CAXA 5DAPA 5B1BB 5E79Z 3R0RA 3H01A 1LOBA 2V4DA 2Q7GA 1BMFG 2MNGA 1EV12 1VJ2A 1ZBE3 3DCQA 4DZGA 2ZGRA 4J42A 4U2AA 1S0EA 2PAMA 1TZOA 4DXTA 1COWG 3ZN1A 5FAXA 4JGYB 3I4IA 1VQKV 1CP9A 4P2ZA 4QQPA 4FPYA 5CBGA 2F17A 3OM3B 2GN7A 4EEQA 3O1RA 1BZWA 3VGIA 1K4DC 4KGGA 3IT8A 4QE7A 3E22A 1CJDA 4AI2A 3HBZA 2YU2A 1MVEA 3VD5A 1RUJ2 2XGXA 4Y4YA 3ILFA 3A4UA 5C4WB 1H1MA 4META 2VQFO 1Q8IA 2IU3A 1TUBB 1AR5A 5I91A 1V6LA 4S2HA 2F1MA 5J48A 4X6QB 1ROPA 2IXHA 4HN1A 1S0VA 2EX3A 3DXUA 4QKNA 2JDZA 4E2LA 4LBKA 4EZ4A 2Y48A 1JOPA 4I0WB 3OTOO 4LKFA 1GOFA 3PJSK 4P14A 1BZKA 2QQNA 4JKLA 3SCGA 4CDWA 3ZXGA 3JASA 4L87A 2EALA 4ORFA 3LE0A 3LSUA 2XKPA 1BHBA 1HNXB 4AE2A 3OMAB 4DV2O 3AFGA 3UJQA 1AJKA 1R6KA 2D6NA 4ZU5A 1ASJ2 3U37A 3R6SA 2Y69B 5C9AB 3SKVA 3PN1A 2VBPA 2RDCA 3LD8A 2UYAA 3O5SA 5FLIA 2E26A 4HKLA 4XCAA 3GJAA 4HVQA 4YG3A 2CV6A 1BQ0A 2WSSG 1WLCA 3BABA 3VD3A 4BISA 2RJZA 4JTOA 5A6YA 3VQVA 1YXWA 4FO9A 4AHXA 5I0RA 2D3OW 3R65A 1US6A 3KSCA 1PGL1 5BPXA 4TLFA 3NMBA 3PHMA 1AJPA 5JMCA 3O14A 1L0NH 4CRQA 4UV8A 3RW0A 1UZZA 1SS3A 4AFAA 4XFIA 3PJQA 3ME2A 3VLBB 2HVJC 1R1A1 4DUYB 3AG3C 1AR1B 2P4KA 2L9LA 1JZ8A 1I5ZA 3JB4C 1U5IA 3AK0A 3T2TA 5L9BA 2A0LA 5CFDB 1GWLA 3A7QA 1GM8A 2BZDA 2XWJB 4CUBA 2ZX3A 1UJWB 4K9SA 2XBO1 1D4M1 5LXTB 2ZR2A 4JTAB 2VM9A 2IXCA 3HD8B 5T5OA 1SCRA 4PDWC 3CC4V 2E33A 5EFUA 1AX2A 2A6XA 1VALA 3H42B 1SPPA 1OT5A 3M70A 1OCZC 4JAUA 1RUOA 1O4YA 1CPYA 2YMZA 3CNAA 3Q9OA 1F5FA 4DR1B 3AKQA 3V65A 3LFIA 4UCTA 3KF5A 4J9ZB 5JZGC 3H3UA 3OYWA 3H1JH 1O8PA 4ZZ8A 3ZFGC 3VZLA 1PO11 4XQ4A 3I5DA 5EJ1B 1X9PA 2IXLA 2V1DA 2EIKC 3RYHA 2WAAA 4ICGA 2ZOEB 3RT3C 1NY72 4AQTA 4O4HA 3WEZA 3CCQV 3ALQA 2ZDIC 1GYKA 4AFMA 4JTCB 2W9XA 4AEDB 4AHZA 2HWD2 2DQ3A 5FBJA 4XDLA 3RJ2X 1YIJV 4NTXA 3IC7A 3P5BA 1YJWV 4HNAB 5A3MA 2OW4A 3TAYA 4R52A 4E4EA 2FMDA 5BNNA 4EFBA 3ZN5A 1CZVA 1QDCA 3CX5F 3D36C 1VEWA 1LOEA 4FVVA 1I1EA 4WVZA 3I2KA 2HWC1 5CU1A 2XHBA 4IEPA 3BVOA 4K3UA 2QQVA 1BEV3 3L9DA 1G9CA 3KGZA 5A33B 3PNAA 1R6TA 3ASNB 3ORJA 3BYWA 4XDKA 1ZBA3 1CD3G 3OMIB 3WNMA 4W4KA 2JD9A 3G6BA 1CX1A 3F2ZA 4B29A 5JWPA 4YGBA 4DXWA 5KUKA 3WQBA 1PVXA 4RS5B 2Q73A 4OULA 1EUUA 2VPVA 4BB3A 1NCQB 1FV2A 2JG8C 4YIOA 4B3MO 1ZRIA 4AHYA 2X5IB 5IT9N 1GU3A 1SZXA 1OKOA 5FY1A 1BCCH 5FXVA 3L73H 4OUMA 2UXCB 1SLAA 1AR72 4GH4A 4QPYA 2JDNA 3HNMA 3VZNA 1R081 1H2NA 3WB1A 2F23A 2YBSA 1GWKA 3KKYA 1EN6A 3B9CA 2BRTA 4XF3A 4Q4Y2 5FQ0A 2X0LA 1VF5B 5IYDO 4MOAA 2Q7EA 2F66C 4M3CA 5DAQA 3ETGA 2GC0A 2A3QA 2F43G 2PTMA 1BBT3 1Y9MA 1CR7A 4LWSA 1AP5A 4NR1A 3W7UA 5EYPB 2CAUA 2ZGTA 4CXWA 1M90W 1RUF1 3LSSA 3TEYA 5FY8A 4X20B 2ES3A 4I02A 2XH6A 4SBVA 4CEYB 1SF9A 5LRSA 1PM7A 1RUC1 2EXKA 2ZCWA 4CZSA 1Y9QA 3MV01 3ZFFC 2CL2A 3T1YO 2XNDG 1K5MC 4M0HA 3WG1A 1UX6A 3AG1C 1UY3A 4JF3A 2J1UA 1LOCA 4MXVA 1Y3TA 2XJTA 4GT1A 2PHUA 1JA8A 4HSLA 2Y0OA 1X7NA 5C3PA 3WCRA 4EKWA 1QQP2 3ZXDA 3AKSA 3VZJA 2DVAA 3GBWA 5FY0A 3G7DA 1YVWA 2ORXA 3FB8C 4CP9B 2XJSA 2HVKC 4NROA 3T2OA 1G9BA 2R0HA 3GBGA 1XQNA 3FZ3A 1LB2A 1AI4A 3TEZA 4BWOA 4LA3A 1MZEA 2ZEWA 3HKBA 3BTXA 2JWPA 2VQUA 5IVBA 4I9QA 5J2UA 5ACA2 1LHVA 5ITZA 2WA4A 2VMHA 1JZ2A 4F83A 1WLEA 4JRLA 4EN7B 5IHRA 4AWDA 4CDQC 5JZGA 2QE3A 4COVA 1IOAA 2WNVC 4WBNA 1HR0O 3KV9A 2EXIA 5J96B 4ZHNA 4JI6B 1GAXA 2VNRA 5FP7A 3HJRA 3V64A 1IQDC 1COV3 5LB6A 1WB8A 5JOYA 3O1VA 3NWKA 2RS12 4RQFA 1MS0A 2D3RA 2XAGA 3LDRA 4BIFA 1ZX3A 3DN7A 3JB8A 2CTVA 3VKFC 4AQ6A 3MV11 5F6KA 4N53C 4TSVA 1GM9A 3VQXA 4YVSB 1O7FA 2CWMA 4EN6B 1CEZA 5FZMA 5JDBA 3UKNA 2ZD9A 1AL0G 5FWEA 4LFAO 5TISZ 1L8DA 3D36A 4TWTA 5H9SA 3POEA 4YRDA 5FZAA 3PUSA 1H8EG 1AXYA 4DR5B 4X1YA 2PLV1 4LNUA 3J7AU 4XDOA 3CL1A 3JAMN 3GHNA 3G6JB 5FUPA 1WLTA 1NZCA 1FFXB 1POV1 3RWRD 1RITA 5FZOB 2IXJA 2D97A 4LEJA 4EWEA 5A3OA 3MIBA 3TNQA 2D6PA 1MS8A 2JG8A 2YBPA 3KB5A 2EIDA 2PQQA 5B3SB 2ADQB 5FXXA 4NHMA 2PQSA 5J09A 5KHGA 4QX7A 3LDKA 4LBLA 4AL9A 3CE2A 1ST8A 4DS0A 1J83A 2WINB 4NHYA 5IJRA 2VW1A 3SMHA 3DGTA 1BSMA 3K5MA 1OOPB 1FKAO 4IEQA 1XNRB 3ABTA 2BBVA 3FYIB 3V0AA 3K51A 1LOAA 2HJDA 4ZU7A 3JZVA 2IW5A 1Q56A 2D3SA 1SRYA 2CTRA 1JS9A 2GMMA 1XU1A 2GBOA 4P08A 3EXAA 1UKGA 3K5LA 2ZPXA 3GVMA 2JE8A 4QXHA 5FXZA 1W0KG 3K08A 2PYTA 2Y4UA 5H9RA 1PNGA 4YW4A 3VZOA 4E2SA 1XU2A 2UUAB 1JBCA 3I56V 3VHNA 1LOFC 4UI9L 4LBEC 4YPJA 1KBHA 2Y38A 3B3QE 4RUFA 4Q0VA 4FOWA 2UWCA 4DUVA 1HQLA 4GWIA 5EBMC 2FTKA 2FB5A 5BNPB 3QOPA 3ZFFA 2TNFA 1QIQA 1Q6UA 4WVWA 1V6JA 2JDPA 4DW1A 1H30A 4M00A 1CJPA 4X62B 4QE9A 1SBFA 4BK4A 4DR4B 2IXKA 4Q1PA 4BCUA 4FPCA 1URXA 4JI7B 1UIJA 2VOWA 4YW6A 1JYCA 1JZ4A 3A23A 1D7PM 4O2AB 1OC1A 4K20A 3ZRWA 2Y6KA 1H6YA 1LESA 3CEWA 4GWMA 4AFDA 1I5YA 3TETA 2WQ4A 2DVGA 4Y20A 1PD3A 3WB0A 2HWE3 2P6HA 3W5NA 3E97A 2Q5ZA 2GU9A 2RN9A 1HNZO 3H1KH 4IESA 1W8OA 2ZGSA 1UMZA 5DG2A 5JCOA 2A5ZA 2ZM6B 2VZTA 2YYOA 3H3ZA 1SQQH 2Z5WA 2XAQA 2KR2A 3GCWA 1WUVA 1K9MW 2JGDB 2Q69A 4O2BB 5E16A 3VBOC 2NMNA 1OPMA 2XVKA 1W6NA 1S0BA 2OQ7A 3I3MA 4QX1A 1S2EA 4RHV2 4JTDB 5DUVA 4CDQA 3MF9A 4LKSA 2YXYA 2Q9LA 1B3QA 3X2QB 4JI4B 1AR62 3HKEA 1FPOA 2WZ8A 3SHRA 2F4VB 1AUYA 5D5QA 3SYCA 1VQ6V 3DKQA 4RD7A 2ZR3A 2GP3A 2RDQA 2XKOA 3SYQA 1F35A 1BQPA 2DTWA 4NPLA 5CIRA 3N7JA 1VLNA 1C57A 2AXTZ 4N53A 4LF4B 4LE4A 1V9U3 5FP4A 2QGNA 1H38A 3JSNA 4ET7A 5KHJA 5FZ0A 1PGW1 4LITA 4IT5A 5B1BC 2RM23 4K8ZA 1W8HA 1ZRDA 5BMVB 1H8HG 2ZS6B 1DLLA 2R062 4R4ZA 1PMHX 1HQNA 2PYLA 4QAWA 1SESA 3PVBB 2RMU3 1XHXA 4X9QA 4DR7B 2Z5UA 2JG9B 1DHKB 4GX2A 1N8RW 4TQFA 4IEVA 5FPBA 3U4XA 1I5PA 2YV8A 4MSVA 4B3SB 3K5OA 4AVCA 5JH7B 5HCAA 4AI8A 3ZM8A 5G04L 5LA6A 4QQLA 2YIBD 4J10A 2RR13 5FZLA 2Q8CA 2E5LO 2WWJA 3E6CC 4KMQA 1YJNV 2PHDA 4FLYA 1W6OB 3QVNA 3VQWA 3H7JA 1LENA 5B1OA 1NKGA 1TMF3 5IW0A 1FMD1 3WG4A 5B2GB 5L7OA 5C4WC 5HI0A 4HYOA 4A45A 1K73W 3T1LA 1CGPA 5K9YA 4DV0B 3PUQA 4GJZA 3E8HA 3CRCA 2W0FC 4MGIE 2ADDA 2QQIA 2JE9A 1FNZA 3OEEG 5LHGA 2UXBB 3KVBA 3AZYA 4N7IA 5LYJA 1QHTA 1D5NA 1AHSA 1KQSU 4AEKA 4OI4A 1PIV1 3ETQA 4C1WA 4JI2B 1RHI1 1H9WA 2GHYA 1XYOA 2Y0IA 4BR6A 2ARHA 5J98B 1UY2A 2FL4A 3LGRA 1N34O 1QJX3 2QM8A 1WAZA 1S77D 5FWJA 4LXLA 1VP7A 2B5UA 1HRI2 1NOVA 1UYXA 4KXRA 4FXKB 2K9PA 1YQ5A 3OPWA 3RVZA 3IM0A 4TN7A 2WLIA 5IAVA 4BXSV 3H8RA 3KCYA 4NIDA 4AVBA 4DOUA 3OFNG 3ZRXA 1X33A 1UZWA 1Y74A 4B4PA 3AKRA 2Q8EA 4QB1A 5C33A 3RS6A 3AG7A 3W7WA 4MYEA 5FR3A 2H0VA 4PIZA 3S5QA 2VQFB 3NO8A 3DPRC 4RHV3 5C93A 2C9KA 1WD3A 1FXHA 3CCJV 5DZGA 2DWDC 2RQ6A 1Q8VA 5JXJA 4O4IB 3ZMVA 5JR2A 5F5AA 1IHMA 2VCAA 1UQXA 4MW8A 3TJTA 3VN4A 3LCPA 2JK5C 4K8FA 4RQPA 3KGLA 3OTOB 3WW1A 3CPWU 1Y4WA 4YM2A 1NG0A 3TXSA 4Z2AA 4IERA 3ABMB 5IWAO 3RI9A 3VBOA 2WABA 4R50A 3BGAA 5LGUA 4DV2B 2A75A 5F1RA 1TME2 2E6VA 3ZMOA 1PL0A 5BNOB 5FKCA 4WZCA 2ILMA 2HWB2 5DM6V 2ARCA 5FP8A 5DMYA 2VMGA 3BALA 1SLIA 3IAPA 5JJEB 3T4VA 3KF3A 4EN8B 4IIJB 4C91A 2HJFC 5LEJA 4XTMA 2C4XA 1JODA 3RQ0A 2WQZC 3SDLA 4E8CA 2OXBA 3WUCA 5I93A 4AEDC 3DECA 1YSCA 1Y7BA 5KX5B 3HKCB 1VBD3 4BLJA 4FOQA 2QQOA 4ZI7B 3CCSV 4EB6B 2FDIA 4LBQA 5L9VA 3H8XA 4UFMA 2XMLA 2NN8A 3SQOA 2BGPA 2W1WA 5AC92 5FMCA 1O3TA 1CAVB 3P3PA 4MV2A 5T55A 1APNA 3M8AA 4X6RB 4Q0UA 3TN93 3DYMA 2HEVF 1S5LZ 4JGYA 3E83A 2DVFA 3AP6A 5FO9B 4Q4V3 4LOTA 4FLVA 3F7YC 3C7GA 4EV0A 4XQDA 1FATA 1JOJA 3L74H 2B46X 4P9YA 2JIZG 4Y26A 1KKCA 4CS3A 1QJY1 5C4WA 4GIQA 3CZJA 4F6EA 5JMOA 3N3HA 3JSLA 3JBG2 2YPJA 2ZEXA 1TUBA 1PL4A 1UZYA 1RVF1 5C3QA 1SG3A 1LEDA 2OCHA 4P9LA 2HLDG 2XASA 4YZ1A 1P49A 3H1MA 3P32A 2G38A 4NXMO 4QU2A 1JN2P 3IBMA 1RUD1 4LF7O 1O59A 3UESA 1SZTA 3CCMV 3T4HB 5LP6B 1F51A 2V5DA 1KGYA 1KITA 4LHSA 1RUI3 3PMSA 1H8TB 1WCDJ 2BFUL 2B42B 3RGBA 5D8AB 2P3KA 3FHQA 1UWWA 4P9XA 1LHUA 3O1UA 3BA8A 4LH7A 3MDPA 3CCVV 5FYZA 4EZHA 5CB4B 4XOGA 5C9AA 2UUBO 2VBBA 5F9TA 2JRIA 3POFA 4CEYC 5K8SA 4R8HA 1UZVA 2QQPA 3FFZA 2WKKA 1R73A 1A3KA 1X50A 1MNGA 1WZXA 3FX3A 4UFKA 5LBQA 1XDCA 4RGKA 4JYAO 1W0OA 4QNHB 1DTOA 4B3MB 1K7DA 3BA9A 2Y6HA 4KHPB 5L9RA 2A79B 1N47A 1UFIA 1OF4A 1RSOB 4UW5A 1NTKH 2WPDG 3ZSJA 5CFDA 2HWB3 1AB3A 1JMUB 5F2VO 3WHTA 4O4JB 3KCCA 2ZINA 2RS33 1YJ9V 3RYIB 5LXTA 4LO6B 1XMQB 1IX9A 1HKDA 5IUQA 5LHHA 2NZ9A 5LA9A 2UY9A 2HWF1 4FTBA 3E5XA 2VE1A 4DFSA 4KWUA 1AR93 2JDMA 1Q82W 2W0XA 4TQDA 3NR7A 5L36A 1HWYA 2VZUA 4Y1XA 1LAJA 2EINB 5I8TA 2FCTA 2ATKC 3ML0A 3WDVA 1NQDA 5HCBA 4V2WA 1AYN2 4G3YC 3TEWA 2IXIA 1PV0A 3AB0A 1R1A2 4XAAA 2JIJA 1CAUB 4FT8A 2VU9A 4J7KA 1ULPA 2W08A 3VBRB 2WC2A 3NVCA 2X8KA 1SACA 4DV1O 4AEDA 2OPKA 4CH3A 3KT4A 4BDVB 3T1YB 2MPFA 1KD1W 3WT3A 4HL0A 4AVVA 5FPLA 1D4M2 2P37A 4YVSC 3OGIB 3DC5A 3ZLIA 4PLOA 4HNAA 4YY3O 3F95A 4PA3A 2XHKA 1T5EA 4FPPA 5L3EA 4X66O 2Q8VA 4I55A 1EM1A 4QDSA 3OUIA 3R05A 4U7OA 3LB9A 2I74A 3D5OA 1YFYA 2N74A 5LZ6A 3A0HZ 4IEWA 1Z7S3 1S5JA 4UW6A 2NN4A 1JHJA 4AI0A 2RS53 4GX5A 4GWJA 3K3NA 1PO12 5A33A 3WLUA 1FV3A 2AEZA 2FQPA 1QJU1 4AI3A 4GAZA 3CKHA 1AR4A 3ZIWA 3V0BB 2K1EA 2Z2SB 4RS5A 2J1VA 2Q4PA 4BH9A 1NCQA 2VC9A 2CTPA 1VBB1 3AYEA 4MVUA 2H3OA 2Z0AA 2X5IA 1HRV1 4BMBA 2O57A 1LR5A 4Q5OA 1W6QB 2QQUA 3K46A 2DVDA 3T0AA 2V72A 3VDAA 5F2WA 3E86A 1W0JG 4UV9A 5K1XA 1VAVA 2BWAA 2LO1A 1GH6A 4X88A 2J7MA 3POYA 4DV5O 2ZAHA 2ZEZA 2WS91 1SCSA 2EAKA 2ET7A 1MACA 1RP3B 3MLJA 1YTFB 4UXAA 1WN7A 3E8BA 2Z69A 3RFRA 1OQEA 1BEV1 1OURA 2P6CA 2Y6GA 1FOD1 4XVHA 3MHSC 2BBAA 1FYJA 4QU1A 1AR82 2W95A 2OA2A 1ZBA1 4LFAB 5T5JA 4KU8A 1OQ1A 5EYPA 3VBHB 1F4AA 3QACA 4X20A 5C8YB 4QPWA 5KLVH 1NQJA 3AMMA 3RZHA 4N9HA 2HLEA 1N1YA 1Q3EA 4XHXA 2DVBA 4CEYA 2VZSA 2ZX4A 4Q4X1 4QQOA 3O1MA 2E3CA 2WLNA 1R082 3E2EA 3AP9A 4KWJA 3IMMA 1K42A 4DO2A 3QO8A 1J95A 4LMFA 1NTZH
chains in the Genus database with same CATH topology
5GLTA 4C0HA 4AFBA 1LODA 1N1VA 1DQ4A 2DU0A 3I59B 3WDYA 1NA1B 1N1SA 1OA2A 2JD4A 4QX5A 5FPZA 3E5QA 3FWEA 1GANA 3AZVA 1PO21 1E57A 4LBQB 2XUMA 4EROA 2FZ2A 1HXS1 1VBA2 1T6GC 1Z7S1 5E1RA 3M8LA 1N3PA 2Q30A 3J9SA 3U07A 3ZFGA 4COWA 3ZYIB 1VBE1 3M3QA 5I8SA 1CAXA 1FMD2 2HWE2 3WXPA 3WW2A 5DUUA 3R0RA 1LOBA 2WBPA 2A71A 3UK9A 1H2MA 4W6YA 1PZ7A 2MNGA 4YW5A 1EV12 1REEA 1VJ2A 4XHBA 1ZBE3 3WQ7A 1DRTA 4DZGA 1S0DA 2ZGRA 4U2AA 4YVWA 1S0EA 2VOKA 2PAMA 1RUH2 4IV1A 5GKAC 2BWCA 3GALA 1RMU2 1XNCA 1L3JA 2P3IA 5C8CC 1RUF2 1BBT1 5FAXA 2TEPA 4HPKA 4JGYB 4QQ2A 5LK5A 1R1A3 1MZFA 2R063 3I4IA 2E7AA 3FLTA 4OHVA 4QQPA 2EXJA 4FPYA 1WLWA 1ONAA 2DUPA 3FFQA 1OFSA 2GN7A 2BEOA 1GNZA 2R49A 5ABJA 1IS6A 1BZWA 3VGIA 4KGGA 2D98A 3IT8A 1Q8QA 4WBBA 1V00A 1TNRA 2MEV3 3MI8A 2VW0A 1QF3A 4U36A 3D82A 2XBO3 1CJDA 1D4M3 2QVSB 4HVRA 4BGMA 3HBZA 4PIXA 4AI2A 5JI9A 2BPA2 1MVEA 1PIV2 4YM1A 5KBFA 5EYXA 1RUJ2 1UF2C 2XGXA 3POSA 4OFGA 4XW3A 1AYM2 1GZ9A 1RHI2 1UW8A 4Y4YA 3ILFA 5FOJB 3A4UA 3H8UA 5C4WB 1H1MA 1O3RA 3K48A 4META 4MXWB 3EBRA 4NPRA 2GNBA 1BMV2 1HV0A 5I91A 1V6LA 4EJRA 1H1AA 4Q29A 4S2HA 1ZX5A 2NLRA 5J48A 4X6QB 2IXHA 1QNYA 5A32B 4HN1A 2NYYA 2ZX2A 5HSXA 3RYRA 4Q0SA 2E51A 2XPJA 2JDZA 1V9U2 4FCAA 4LBKA 2W52A 4XJAA 2Q1ZB 1YIPA 2VGDA 1RC6A 1WLDA 4I0WB 4URTA 2OVUA 1RUE2 3JQXA 1GQWA 3CJIB 2RM22 1FYUA 2UWBA 1OKQA 1KJRA 4P14A 3WG3A 4XMIA 4QT6A 1VBC1 3SCGA 3ZXJA 5I8YA 3SH5A 4CDWA 2WFF3 2N7GA 1RGSA 4WM8C 4YVSA 5CBLA 3ZXGA 1S1AA 2EALA 2ZGKA 2GDFA 4LA2A 2BTVC 1QH6A 4ORFA 5FTTC 5DZFA 5JIAA 2RMU2 1QY4A 4AVSA 4RS5C 1W39A 3LWCA 2XKPA 2ZGQA 1NX4A 3BIWE 4AE2A 3WHUA 4ATEA 3VBUB 3R4SA 1NCQC 1NXD1 3WP6A 3AFGA 3UJQA 1AJKA 2D6NA 4ZU5A 4BOWA 1ASJ2 1CONA 2X5IC 1U5XA 4XFBA 3R6SA 5K0UB 1YYNA 5C9AB 1AR61 1XNBA 3PMEA 2UYAA 4FP3A 3D8CA 3O5SA 5FLIA 4HK9A 1C8M1 4HKLA 4B8EA 2R071 1OLQA 3BTAA 2RR12 2XJVA 1QWRA 3QCWA 5FCCA 2UYBA 3V17A 4HVQA 3ZPYA 4YG3A 1RL3A 3LSEA 2CV6A 1ZZCA 1OFNA 5F5QA 3MYXA 5J37A 4WVMB 4K7JA 1WLCA 5EXOA 4S2GA 1QOOA 3VKMA 4BZ4A 4JTOA 4A7YA 4CDUB 1YXWA 4ZKTB 1ZA4A 2HWC3 1TMF2 4Y22A 4OHZA 4FO9A 3AMQA 4AHXA 5I0RA 2D6MA 1AL22 2O1QA 4JGZB 4QM9A 4QPGC 3VBSB 5GJ6A 1HRI3 4UBGA 3KSCA 4XFCA 1PGL1 2QNKA 3IDCB 4A7KA 5BPXA 1C1LA 2WZPP 4TLFA 1ZBE1 3FHIB 3PHMA 2ZKLA 4AGVA 5DUWA 3O14A 5JMCA 1IQAA 4CRQA 2CNAA 2R043 1YRZA 1MR5A 1YJLA 4XF0A 4C1XA 1UZZA 1KDMA 2DCJA 4AFAA 3IPVA 4XFIA 3PJQA 3ME2A 3VLBB