1FYJA

Solution structure of multi-functional peptide motif-1 present in human glutamyl-prolyl trna synthetase (eprs).
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
DSLVLYNRVAVQGDVVRELKAKKAPKEDVDAAVKQLLSLKAEYKEKTGQEYKPGNPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of multifunctional peptide motifs in human bifunctional tRNA synthetase: identification of RNA-binding residues and functional implications for tandem repeats.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords MULTIFUNCTIONAL AMINOACYL-TRNA SYNTHETASE
total genus 20
structure length 57
sequence length 57
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2000-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1fyjA00
4LF6O 4LFBO 1I94O 4LF7O 2E5LO 1A32A 2FKXA 4DV7O 4JI4O 4JI1O 4X62O 1FJGO 5BXZA 3J80N 2JRIA 2VQEO 2HHHO 1NS1A 4JI2O 1IBKO 4DV2O 2VQFO 4JYAO 1HR0O 4JI3O 4NXNO 5A2QN 4GKJO 1FKAO 4DR3O 1DK1A 4OPHA 1FYJA 2UUCO 2UXBO 1XNQO 1F7YA 4K0KO 1J5EO 1N34O 4DV1O 2UU9O 4YY3O 4LF5O 4DV3O 4NXMO 4DUYO 2UUBO 3J81N 4DV4O 3M8AA 3J7AU 4JI8O 4LF8O 1YZBA 4KHPO 5LMNO 1R1BA 5IT9N 4DR4O 4DR1O 2DOSA 4JI7O 3OTOO 1G1XB 4DV5O 3R66A 4DR5O 3T1YO 4LFAO 4DV6O 4JI5O 2UUAO 4DUZO 5IWAO 1AB3A 1N36O 4YHHO 4DV0O 1XNRO 4OX9O 3SDLA 3T1HO 4LF9O 1N33O 4X65O 5BR8O 1XEQA 4X66O 1XMOO 4JV5O 4DR2O 1D2DA 3F5TA 1IBMO 2UXDO 4DR7O 4A5UB 2F4VO 5H5NA 1AILA 1KUQA 2DJVA 1HNXO 4LFCO 4AQYO 5FLXN 3JAMN 2ZKOA 2N74A 4JI0O 1HNZO 1N32O 5BY1A 3RT3C 4GKKO 1X59A 4LF4O 1R6TA 2ZM6O 4B3MO 3O65A 4DR6O 1XMQO 4X64O 5LL6Y 1HNWO 2AGAA 1IBLO 4OPAA 5LMUO 4JI6O 2Z0AA 4B3TO 4B3RO 4B3SO 2UXCO 2LW7A
chains in the Genus database with same CATH superfamily
3VOUA 2JVDA 2JK5C 5JVDA 3JD2A 2VQEO 3T1HB 5DEDA 3UQ8A 1O9HA 1IXBA 3ZRSA 2QWOB 4RAIA 4DV5B 1HR0B 2VS0A 1NQTA 2W6JG 1ZLZA 1L0LH 3K57A 5KHHA 3CPWU 2DYSB 2B9ZA 3H1KH 1Y74B 1F7YA 1N34O 1WLEA 4WF9V 3AG1C 4NB5A 4FLWA 1THZA 5KA5A 1COWG 3FB6C 4UVBA 1NH2B 2DE0X 4EB6B 3CEIA 4YIPA 1AR1B 4KHPO 4LH6A 2Q0AA 2GTAA 5IT9N 4H0LB 1PL4A 1TGOA 2LO1A 2C2AA 3EVKA 4O4LB 1PNKA 2VQEB 2YIAA 4WCEV 1RSOB 4DV2B 1BQZA 4TV8B 5IYCO 2V7QG 1Q81W 4GX2A 1KYOF 2RCVA 3SDLA 3P30A 3SPJA 1HNZB 3CCRV 4DR2O 5B1NA 1M90W 3TGUH 1N0NA 2IU0A 3TETA 4AQYO 5FLXN 3RFRA 3E8GA 4FFBB 2AXTZ 4I4TB 4N23A 1WPBA 2QM8A 2HR3A 1MMMA 3CMEV 1NZ6A 3T1CA 1IBLO 2JS5A 1KD1W 1VIBA 5LP6C 5A9GA 1PP9H 1E79G 4IL6Z 1GM7A 2AW9A 1IURA 3B4SA 1AP5A 2EZOA 3RGBA 4FLUA 4LF7O 3D8CA 4O4HB 1FJGO 1PNMA 2WLNA 3CE2A 5BMVA 3DGEA 1QLNA 1EFRG 4JASA 3OR7C 4WFEA 4GKJO 1FKAO 4JYAB 5DECA 2AZ0A 4JAVA 1BQ0A 1Q43A 1M9NA 4MSWC 1VQMV 5C93A 1NTMH 4DV1B 2UUBO 5KHIA 3H1LH 3K03A 5JJEB 4FLXA 5LBQA 5LXTB 3RYFB 1YHQV 2GUZB 4HNAB 1OCOC 4H44B 3RVYA 3H1JH 1S3JA 2WLJA 5LHGA 4DV0O 3HB3B 4OX9B 4D6TH 4UXNA 3HKBA 2F1MA 4HAMA 4U7OA 4GX0A 3K9AA 3MHSC 1I08A 3OEEG 2QA4V 2X7RB 1MSDA 4K8ZA 1FD9A 2OTJV 1GN2A 1ROPA 3KZIZ 2PTMA 1S0VA 4UFZA 2KKWA 4GT1A 2QE7G 1OCOB 3CP1A 4AILC 4IHJA 3B09A 3T4ZA 3TXQA 2HVJC 3CRRA 2RJZA 2CTRA 3QO5A 2P90A 2W0FC 2F66C 1U96A 4OPAA 5KX5B 4J9YB 1OZ0A 2GDSA 2UXNA 1Q6HA 4JYCA 4AI8A 3ZHUA 3ABLC 1I94O 5B66Z 3Q4HA 4X62O 3OGIB 4DR2B 3L71H 1WN7A 1NS1A 2ZNIA 1WAZA 4G27B 2VQFO 1R3IC 2E75B 5LHHA 5HFMA 1N8RW 2GTSA 2XASA 1K4DC 4QNHB 1R3LC 3G6BA 2ZR3A 3OW2U 5JQGB 4CS4A 1HNWB 2UUAB 3P3PA 3CSXA 3HR0A 4X20A 2Q9LA 4DR4B 4NTYA 3K9SA 3NXSA 5H6RA 1M5IA 4PD4F 4DR1O 4UUJC 5F2VO 1SA0A 1GM8A 4IHJB 2HKOA 1RM1B 2R9AA 5EIBD 1Q5OA 2EX3A 4LNUB 4ZBMA 3ZS8C 2PUSA 1YDXA 3FAVB 5H2FZ 4GCZA 3ZRXA 1JJ2U 3BHPA 3KKYA 1Q6UA 1Y76A 2KG7A 3IAYA 4JI0B 2ZT9B 3ETEA 4L8JA 2WAMA 4LWSA 3LDEA 1K4CC 2ZXWC 4QE7A 3ICXA 1Q8IA 2QTOA 3TJTA 2LGWA 3W7XA 5GONA 3MDSA 1BHAA 4PJ0Z 4LFCO 1QVFU 3WU2Z 3EHBB 3FX7A 4DR1B 1TAEA 2N74A 1R3KC 3OM3B 3RT3C 3IFXA 1OCZB 4I9WA 1R6TA 5LYJA 5BR8B 2F23A 4CH3A 1AR4A 4LF5B 1SQBH 1AI5A 2Z0AA 4QGPA 4B3SO 2LFSA 1W59A 1CP9A 3A2FA 3H1HH 1VQ9V 4I55A 1ZAUA 3HKDA 4F6RB 4DV7O 1IXMA 3SPCA 5BXZA 2JS3A 4NXNB 1Y6XA 5EBWC 3IC9A 4GLXA 4PELA 4FLZA 3W7UA 3JALA 1IZ3A 4JAUA 4FM0A 4W4KA 1HP8A 4LFAB 4J7ZA 3BA9A 5CBHA 2ILMA 5ITZA 2Q68A 1YTFD 2P22C 1XNRB 3H1IH 1VMGA 3OTOO 1B06A 4FK5C 1EN5A 2ZE5A 1ZSPA 4O4JB 3T1YO 4DK0A 4JI5O 3ML0A 2BTQB 4J9ZB 3OUFA 5IJ0B 4FJCC 4H33A 1R6KA 2ZNJA 1PV0A 5CA3A 2AZ2A 4FZ0A 3CCEV 3HKDB 4F6RA 1QLEB 2NNUA 1N33O 3SPIA 2L6LA 3F5TA 1VARA 3K3WA 1VF6C 1M4UA 3DXRB 5C8YB 4UCOA 1KUQA 5H5NA 2JGDA 1FPOA 4JTAB 3I5DA 2Z3YA 3ZEDA 1MNGA 1W0KG 2ZM6B 3GWKC 4LF4O 2P67A 2F95B 2M6YA 4BIZA 1QR9A 3CCSV 3ETGA 1EZJA 4KFMA 4DR3B 1WNSA 5IDJA 3HPLC 5JJJB 4NVPA 1QU7A 4TV9A 3N2KB 3THOA 2ARHA 3SGIA 2ZINA 1R3JC 5LA6B 3WFVA 2EILC 1VQKV 2X0LA 4R7CA 1Q3EA 3ASOB 4JI1O 1GN6A 4HZ3A 5IY5B 1VEWA 2CUGA 4MVZA 2EJRA 2CH7B 5E79Z 2Y69C 3LSQA 5K1XA 3LNNA 4ZOLA 2CK3G 3M7MX 4MT8A 1L1FA 1PPJH 3LUTB 3OE7G 1DK1A 4TQDA 1MA1A 1CXZB 3L70H 1D5AA 1EN6A 1OHHG 2Z5UA 2IM9A 5IYBO 1TVKB 3OEHG 1XUQA 1Q6IA 3WB0A 2YEVA 2UUBB 3FFQA 4IYHA 4DV3B 4JI8O 1QBZA 3GB7C 2EINB 3SYOA 1JFFA 4UV8A 4ZI7A 3BY6A 2XAJA 3G67A 5HFLA 2OCCB 3FKSG 3L9DA 4MTGA 2PI4A 3RYCB 4I5SA 2UUAO 2N05A 4DV0B 5IWAO 3RYHA 5LMUB 1GAXA 4U3FH 5KLVH 1XDCA 3AK2A 3N2GB 1WP7A 4X65O 2YS8A 3VQYA 3SYAA 1PL0A 1M1KW 3UO3A 1AROP 1HDJA 4A5UB 2UXCB 4BIOA 4B08A 4MTFA 4E4EA 1VQ5V 4DYLA 2UUCB 4LP8A 4WFAV 2NN4A 3A8TA 1UFIA 1TVKA 5L3FA 4I9QA 1ZL8B 4B3MO 4X1YA 1LNQA 2R9RB 4LC1A 4MTOA 1IVSA 4ZKIA 1FXVA 1YF2A 5KHJA 5LOVA 2X6CA 1H2SB 3CD6V 4FLTA 3ABKC 1EBOA 1OCRB 3IC7A 2YXLA 2UU9B 3K06A 4JZGA 3JASB 5IYZB 1IBKO 4CH4A 4JYAO 4BR6A 1HR0O 3E89A 1DF5A 2UXBO 4NTXA 3SJBC 2DYRB 3LDDA 2YXHA 3JAWB 1AP6A 4HYOA 3AG3B 4LF4B 3ZHQA 1SQGA 3CX5F 4UCUA 3AG4B 3MHHC 3CMAV 3ETQA 4J41A 3BEHA 2WLIA 5DN6G 2P7TC 1VQOV 3L73H 4I50A 4LBEC 3OR6C 1SETA 1R6NA 4FFBA 3BCCH 4IGGA 3R66A 3TXSA 1UPGA 4DV6B 4LFAO 4XDKA 2F4VB 1US6A 4EB6A 3N27A 1AB3A 1GK9A 1FFXB 1K5QA 2DYRC 3ZCCA 4O4HA 3UO2A 4IT5A 3ZRWA 4DR6B 1RPRA 1NJIW 1SZXA 1FXKA 2EIKC 4X64B 4OGQB 5CBGA 3ASNB 1H38A 1YIJV 4QE9A 2F93B 3JAMN 3OFNG 4UCVA 1FJGB 4O4IA 1ORQC 2YI8A 1WA8A 1ZTEA 1BCCH 3EFFK 4X88A 3RVZA 1SQVH 2R72A 5EC2C 4PDMA 3ABLB 4W4LA 3RYIB 5LXTA 4MVQA 4QPKA 1JVMA 1FFTB 4LFBO 2VWJA 2LGQA 3CCVV 4G28B 5JH7A 4UVAA 1S5LZ 2EULA 2XOKG 3C3SA 3CRQA 2HHHO 1VQ7V 2Q0OC 3ASOC 4JYBA 3ZJZA 5GTIZ 2Q73A 3DSQA 3HKEA 3FYEB 4DR3O 4B3SB 2ZE8A 3ZHVA 4FPPA 4R50A 1OJHA 2PYLA 1P49A 2ZIMA 3OGCC 4R6ZA 2MK3A 4NXMO 2EZPA 2QDOA 1FXKB 3EXAA 1PNLA 2H94A 2JGUA 1JCHA 2OTLV 4ABMA 5LMNO 4DR4O 3K04A 4FM1A 3B8MA 4PDLA 1NVPD 2HFEC 3ABMB 1Q86W 2HHHB 3ZMZA 2LQTA 3K0GA 1S5JA 5FNVB 4UB8Z 3RYIA 2XAQA 2DWEC 2Q7EA 3WB2A 1I5XA 5L3CA 1QVGU 4J7JA 1JA8A 2ZXWB 1IX9A 1D2DA 4X9QA 3W7SA 1F23A 2DQ0A 4CS3A 2E3CA 3ZMUA 3D36A 5CA0A 4LF7B 1AR5A 4KUMA 2WLLB 4O2BB 1N32O 1H2KA 4EEQA 1HWYA 5B1BC 4K8XA 1YITV 2H8PC 4P2ZA 1VF5B 1D5NA 2F43G 2IH1C 3K5MA 3JD3A 2Y4TA 3B8NA 1Y74A 4P30A 1F51A 2E5LO 3BAAA 2PYJA 4WFBV 4Z1MG 2JRIA 4KL1A 2ZD9A 2BOCC 4JI2O 4DV2O 5K1PA 1KQSU 5KX5A 2HLDG 4NXNO 3SJAC 4XBFA 2DWDC 2WLKA 4MVMA 3ABUA 2EINC 1XBLA 4DUZB 1XNQO 2NR5A 4AHCA 2DMXA 1Y76B 1SQFA 3UT5B 1Y66A 3CRAA 2OCCC 2Q69A 1RFYA 4LWSB 2HEPA 4YJ2B 5KHGA 4LF8O 3AG4C 3E86A 3CCQV 2DYSC 3FB5C 4TT3G 4PI2A 3DTUB 4OXSA 4CC5A 3JYCA 4RWUA 1XL6A 4K35A 4YXWG 2JJ1G 5LYJB 5GTHZ 4DR5B 4UB6Z 5KAFZ 1F4MA 5CA1B 3SYQA 3H01A 3I56V 1E1RG 5J2UB 1GMGA 1SA0B 2LJ2A 3T1HO 1H8EG 4LH7A 2OIGA 4JZ2A 2CAZC 2RMKB 3WG7B 5J2TA 3CRMA 1EN4A 4KXRA 1K34A 4PHZA 2XT9A 1LUVA 1H2LA 2BCCH 1OCCC 5EZYA 4D7TA 1QR8A 3I55V 5EK0A 2LFRA 3UT5A 4B3MB 5B1AB 5BMVB 4BAYA 4X65B 4DR6O 3JCUZ 2PI5A 2AGAA 2MW2B 2B1IA 4YJ2A 4GX1A 2UXCO 1BE3H 2ZDIA 4LF6B 2LW7A 5GONB 3E83A 2QWQB 4JI4O 4I0XB 3WB1A 3UKMA 4O4JA 5LP6B 2WSSG 5CB4B 2CE4A 2BTQA 1XQ8A 4UV9A 2GV9A 4UVCA 5EYPB 2RDCA 5CA1A 4MS2A 5IJ0A 2H3OA 2XTAA 3RYFA 2E5LB 1P84F 2QKCA 5J2UA 3FB7C 3E22B 4TQFA 5B1AC 1L8DA 4WFHA 5KUKA 3L75H 2YIDA 2QWNB 4RUFA 4K0KB 3OUSA 1S76D 4DV3O 5KUMA 3T1YB 2Q8VA 4JI5B 1DGSA 1Q82W 1Y4MA 2BE3A 3DXRA 1YJWV 5JCOC 1BMFG 4MVRA 1VF7A 5CN0A 3CYOA 1W2BU 1GTOA 3ZN0A 1K3EA 1SF9A 2YDEA 2Y4UA 4JI7O 3S3WA 1SQXH 1SQPH 5IJ9B 3ZX6A 1M57C 4NTWA 1QCEA 4NR1A 1GRJA 2OT5A 2EIKB 1J5EB 3X2QC 5LA6A 1I94B 3JCZA 4D7SA 1G6UA 4I0XA 2E76B 4GYCB 4DK1A 1N4CA 1XEQA 4JI4B 3QTCA 2XAFA 1BS3A 3OTFA 2VQFB 2DJVA 1VQ6V 1VQ8V 1B3QA 2CGOA 3ZRVA 2ATKC 1DF4A 1NI8A 2A3QA 2AHYA 3F7YC 2E74B 1NKDA 4P9PA 3P32A 3E22A 3ZMVA 1NH2D 1AJNA 2QM4A 1RM1C 3U0ZA 2ZM6O 1M57B 1NT2B 1HNWO 3FYIB 1QLEC 4CS2A 2V4DA 4B3RO 1S5HC 3ZMSA 2IJIA 4DO2A 4O2AA 3VQVA 2OCHA 3CJHA 5L3EA 4B7EA 3KG2A 4PDVA 5JQGA 5LGUA 2R9IA 1WP8A 1YTFB 3AG1B 3RYCA 3K59A 2N04A 1M56C 3G6EV 1IBKB 4NKGB 4JYYA 2W6IG 5EBMC 3BPZA 3AG3C 1MOFA 4CH5A 4QPJA 5KMGA 1J5EO 4WFFA 5JVDB 5IYDO 3STLC 2ITCC 3JD4A 2CH7A 2Y48A 4FFKA 3J81N 4DV4O 3SJCC 2A79B 1SRYA 4MVSA 3APOA 2CDYA 2EIMC 5LMNB 3RN4A 2ZE7A 1XHZA 2KG7B 3S3XA 1G1XB 3GVMA 4X66B 1XMOB 1ZL8A 4RQFA 2XUMA 2HJFC 1JX9A 1KP2A 3AG2B 3CCLV 5JJNB 2PF4E 4GKJB 1IBLB 2P5OA 4BW9A 4FM2A 3CJHB 4MW8A 2A06H 1H2MA 4JV5O 2ZE6A 2ADQB 2VRZA 5IYZA 4CC6A 2UXDO 3U11A 1I0HA 1OCRC 2WWWA 4TV8A 2ZR2A 4IYIA 3TK1A 5TISZ 4BW5A 4I55B 4JI1B 3T4DA 1HNZO 3JAWA 3OMNB 3HKCB 1K33A 5H9CA 1KB9F 2IBZH 4BIUA 5L3DA 1MZEA 1KMIZ 1YI2V 4LFBB 4I50B 1QQCA 1V55C 1S77D 3QO7A 1A32A 2FKXA 3JD0A 3OTOB 4RUEA 1P7GA 4Z2WA 2OWOA 3BRCA 2K1EA 4NYKA 5AG2A 2WA4A 3ZIAG 2FYUH 2QSAA 1I5YA 4F6EA 2QJ1A 5ITZB 1RP3B 3CS5A 5H6QA 1BHBA 3CCUV 3LDCA 4EKWA 3CCMV 4HBNA 4LF5O 3ZRWB 4MVOA 2A0LA 5JCOA 2D3OW 1LR1A 2IJJA 2OIEA 4DR7B 3ABKB 1XREA 1GH6A 4DXWA 3KCYA 4JAAA 1VQ4V 2DN9A 1SESA 3OAAG 5EIBC 3OT7A 4B3RB 1CEZA 2ODMA 1K92A 3U10A 4FIPC 1VQNV 1BSMA 3RW0A 5IY5C 5LGNA 1MSWD 1JOYA 4GZRB 2BSKB 4DR5O 1Q90D 1LUWA 2LP7A 2RN9A 3E8FA 4DV6O 3B77A 4TSFG 4YHHB 1B04A 3W7WA 2WLIB 1M93A 3E8BA 2W0XA 2WLMA 2FTKA 2GUZA 1W0JG 1BL8A 3CB2A 3C3TA 1H2NA 2QR4A 4X1KB 4DR7O 2CTQA 2VWKA 1K5SA 5KAIZ 3HKEB 3N2KA 4Q20A 1Z5WA 1NU1H 3D3QA 1XHXA 1WJZA 1Z2GA 1R73A 3F7VC 4DW0A 5JWPA 2ZCEA 2P6JA 4JI6O 2HP8A 1JMKC 4WFGA 4B3TO 4UCSA 1GO3F 4J10A 3ABTA 1V54B 3PJSK 1WA8B 4GX5A 1AJPA 1PKXA 1X4TA 4X89A 2CTPA 2Q5ZA 2JEUA 4BWAA 1ENVA 4ZHQB 1MZFA 3AK1A 3SYPA 3Q4HB 2DW4A 3G80A 1AI7A 4IIJB 2XHBA 2P06A 4DUYO 1YVWA 4RO2A 5KA6A 4XDJA 4PV1B 3K08A 5B3SC 3F5WC 1V54C 5LHIA 3AEIA 3ZHSA 2KSDA 2V1DA 2ITDC 1NTKH 5L3BA 1IBMB 2G38A 4X20B 3AG2C 4R8CA 2IU3A 4Q6GA 3ZMTA 4DW1A 4FLYA 3OMAB 4I4TA 4JI7B 1PD3A 2JEXA 4JI8B 3CCJV 2Q6AA 4PA4A 1SKVA 3D3IA 2BTOA 2JJ2G 1G8MA 1QNMA 1HNXO 4ZHQA 5FNVA 1P7BA 3K5LA 1SERA 4JI0O 4H13B 4I7ZB 5FPRA 4J7KA 4O4LA 3VBBA 3L72H 1S72V 3PN1A 3UCSC 1RSOA 5LMUO 1YEWA 2CGNA 1RPOA 2O57A 2P4KA 1B6QA 3K58A 5CA0B 5B1OA 5FL7G 4K3AA 4TOIA 3E8HA 2RQ6A 2R70A 1KP3A 3QVNA 4QJFB 2HJDA 1V9PA 3ASNC 4PA9A 3DC6A 5A2QN 1EZVH 2WPDG 3UM7A 2M7WA 1KU9A 4OPHA 4LFCB 1WPXA 4HNAA 1IDSA 4K0KO 1FS0G 2YC0A 4DV1O 1XMQB 1N0JA 2JIZG 2GSMB 1XI1A 3APQA 4EFEA 1U97A 4JPRA 3SPHA 5J9PC 4B3TB 4LF8B 1Y67A 1BZKA 5DM6V 1UJWB 3K5NA 4P9OA 5EZYB 1KKDA 2QM7A 5D5PA 1L0NH 3JALB 3FD9A 3VQWA 3W7TA 2QKAA 4TUYB 2QWRB 4U3JB 5GW7A 3T2MA 2GHYA 4LR3A 1K97A 1AI4A 3X2QB 2ZIOA 1AI6A 3D36C 1XNRO 3B2EE 3K5OA 3DC5A 2A9HA 2WLHA 1QHTA 1URFA 5FPOA 1JQ0A 4X66O 1XMOO 1IBMO 1BGYH 1YSCA 2NLJC 2QTSA 3L74H 1AILA 3MAQA 4L87A 3LSSA 2HG5C 2UXBB 1FAFA 2IW5A 4PA7A 1NBMG 2KQXA 3G71V 4GKKO 1ZWIC 1PM9A 3QG5A 4MTXA 1GM9A 4J42A 1XMQO 3CWBH 3R65A 1XOUA 2FL4A 4JTCB 1JPXA 5C8YA 1DTOA 1XILA 1NR7A 5J2TB 1NVPB 3FB8C 2PZSA 1H2GA 3HKBB 3LNMB 4LF6O 3CRCA 2B1GA 3IJ4A 4B7KA 3WG7C 2PY5A 2A7WA 1SS3A 3J80N 2YUAA 1N33B 1JJOA 1M56B 4TUYA 4U3JA 5IJ9A 1Q7YW 4E2LA 1KC8W 4X8AA 3MD0A 4JTDB 1K8AW 3TCUA 3VQXA 5B5EZ 1F4NA 1N34B 1AVMA 2IJHA 4G2KA 5LP6A 3JD1A 1G4YB 4ZIBA 2GBOA 1ZX3A 3FAVA 3QO8A 2EIJC 5EYPA 2QKSA 3QF7A 3JATB 2L35A 1N36B 2DOSA 3IGAC 1Z5VA 1P4RA 2QGNA 4J80A 1NTZH 3CC2V 3JSNA 2YIBA 5LGTA 4LCUC 4WBNA 2B5UA 4O2AB 4C7UA 2WLLA 3P3NA 2LW1A 4O2BA 4ZI7B 1K9MW 2FB5A 2WA3A 4OX9O 4TWKA 3E35A 4LF9O 3ZN1A 3H9VA 3CHXA 4RQEA 4XDLA 2YICA 1YJNV 4YIOA 3AG7A 1ZUQA 3G4SV 5KMGB 1DLBA 2ZKOA 1XNQB 2YIBD 4AQYB 3ZBHA 4CBCA 2YXYA 2UXXA 5EC1C 3B40A 3N2GA 4JI6B 4FMTA 3BA8A 3JAKB 5LL6Y 4JF3A 4LNUA 2CTWA 1V55B 1MABG 3A0BZ 3ETDA 3CC7V 3O9OA 4ICGA 4JI3B 3O65A 3KCXA 5CMUA 3JATA 1HNXB 1NR1A 4GKKB 1YJ9V 2EJ7A 1TUEB 1KKCA 3ZHTA 4FZ1A 1WB8A 4X1YB 1WB7A 2ETNA 2IH3C 3OD4A 1E1QG 4WBNB 1FYJA 2UUCO 2YSUB 2OYQA 3RWRD 3LSUA 2JDIG 4UCRA 2UU9O 5B3SB 4YY3O 1YCIA 2HVKC 1XL4A 5KHKA 4DUYB 4GUNA 4F4LA 1GN4A 3JARB 3K79A 2ZDIC 1KBHA 1R1BA 2PGGA 4CH6A 3JSLA 1MG1A 1SQQH 2Q4PA 3JAKA 2QEXV 2IJKA 1YXBA 2ZQMA 2RNBA 2XAHA 3K0DA 4X1IB 4DUZO 4PI0A 2KB1A 1N36O 4U7NA 3SR2C 1HW7A 3BVOA 5EBLC 2Q67A 2EIMB 4DRXA 4MVUA 4JGSA 2P4VA 2Y0IA 2EBOA 3A0RA 4TV9B 3GWOA 5IWAB 4FVMA 2Q7GA 2Y69B 1VQPV 1FFXA 2DQ3A 3BFRA 1X59A 3NR7A 4MW3A 4YY3B 4ZOLB 3AK3A 4X64O 2XAGA 5CB4A 1CPYA 1OCZC 4NXMB 3JARA 1OCCB 2ADPA 4DV7B 1GN3A 4O4IB 4LF9B 3CXHF 3STZC 3HKCA 1BT8A 2D2CB 2BSKA 1GKFA 3ZHRA 1FXHA 2QWPB 3SPGA 3A0HZ 4JI3O 4YJ3A 4X1IA 2JGDB 1JFFB 2BOBC 4ASUG 4J11A 4UCTA 2FMLA 2X6AA 4DRXB 5JH7B 1VQLV 4EFBA 4FLVA 3ABMC 2AHZA 2EILB 3M8AA 3J7AU 3RBZA 1SC5B 3QNEA 1YZBA 3RYHB 1TUBB 1O9GA 4PA3A 2EIJB 1K7DA 1EM1A 4JV5B 1KECA 4DV5O 1N32B 1AJQA 2UXDB 3SYCA 4CZZA 1I7FA 2Q7HA 1TA8A 3E2EA 1H8HG 3SJQC 4YHHO 3M99B 3CXCU 3CC4V 4H37A 1T5EA 5BR8O 5L3GA 2YEVB 5B1BB 3BABA 2Y0PA 2YI9A 2K9PA 5IE9A 1OV9A 1J95A 1SZTA 3C90A 5D5QA 5LOVB 2F4VO 4YJ3B 5E1AC 4JI2B 1VF6A 5BZBA 1K73W 4PDRA 3OMIB 4X62B 5BY1A 1JR9A 2X6BA 4IIJA 1VP7A 3JASA 4QIWF 4DV4B 1FXKC 4PA6A 4X1KA 4Z1VA 4KHPB 4N21A 1TUBA 2XNDG 5CBFA 4KP4A
chains in the Genus database with same CATH topology
4LF6O 4LFBO 1I94O 4LF7O 2E5LO 1A32A 2FKXA 4DV7O 4JI4O 4JI1O 4X62O 1FJGO 5BXZA 3J80N 2JRIA 2VQEO 2HHHO 1NS1A 4JI2O 1IBKO 4DV2O 2VQFO 4JYAO 1HR0O 4JI3O 4NXNO 5A2QN 4GKJO 1FKAO 4DR3O 1DK1A 4OPHA 1FYJA 2UUCO 2UXBO 1XNQO 1F7YA 4K0KO 1J5EO 1N34O 4DV1O 2UU9O 4YY3O 4LF5O 4DV3O 4NXMO 4DUYO 2UUBO 3J81N 4DV4O 3M8AA 3J7AU 4JI8O 4LF8O 1YZBA 4KHPO 5LMNO 1R1BA 5IT9N 4DR4O 4DR1O 2DOSA 4JI7O 3OTOO 1G1XB 4DV5O 3R66A 4DR5O 3T1YO 4LFAO 4DV6O 4JI5O 2UUAO 4DUZO 5IWAO 1AB3A 1N36O 4YHHO 4DV0O 1XNRO 4OX9O 3SDLA 3T1HO 4LF9O 1N33O 4X65O 5BR8O 1XEQA 4X66O 1XMOO 4JV5O 4DR2O 1D2DA 3F5TA 1IBMO 2UXDO 4DR7O 4A5UB 2F4VO 5H5NA 1AILA 1KUQA 2DJVA 1HNXO 4LFCO 4AQYO 5FLXN 3JAMN 2ZKOA 2N74A 4JI0O 1HNZO 1N32O 5BY1A 3RT3C 4GKKO 1X59A 4LF4O 1R6TA 2ZM6O 4B3MO 3O65A 4DR6O 1XMQO 4X64O 5LL6Y 1HNWO 2AGAA 1IBLO 4OPAA 5LMUO 4JI6O 2Z0AA 4B3TO 4B3RO 4B3SO 2UXCO 2LW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 O;  4LFB O;  1I94 O;  4LF7 O;  2E5L O;  1A32 A;  2FKX A;  4DV7 O;  4JI4 O;  4JI1 O;  4X62 O;  1FJG O;  5BXZ A;  3J80 N;  2JRI A;  2VQE O;  2HHH O;  1NS1 A;  4JI2 O;  1IBK O;  4DV2 O;  2VQF O;  4JYA O;  1HR0 O;  4JI3 O;  4NXN O;  5A2Q N;  4GKJ O;  1FKA O;  4DR3 O;  1DK1 A;  4OPH A;  1FYJ A;  2UUC O;  2UXB O;  1XNQ O;  1F7Y A;  4K0K O;  1J5E O;  1N34 O;  4DV1 O;  2UU9 O;  4YY3 O;  4LF5 O;  4DV3 O;  4NXM O;  4DUY O;  2UUB O;  3J81 N;  4DV4 O;  3M8A A;  3J7A U;  4JI8 O;  4LF8 O;  1YZB A;  4KHP O;  5LMN O;  1R1B A;  5IT9 N;  4DR4 O;  4DR1 O;  2DOS A;  4JI7 O;  3OTO O;  1G1X B;  4DV5 O;  3R66 A;  4DR5 O;  3T1Y O;  4LFA O;  4DV6 O;  4JI5 O;  2UUA O;  4DUZ O;  5IWA O;  1AB3 A;  1N36 O;  4YHH O;  4DV0 O;  1XNR O;  4OX9 O;  3SDL A;  3T1H O;  4LF9 O;  1N33 O;  4X65 O;  5BR8 O;  1XEQ A;  4X66 O;  1XMO O;  4JV5 O;  4DR2 O;  1D2D A;  3F5T A;  1IBM O;  2UXD O;  4DR7 O;  4A5U B;  2F4V O;  5H5N A;  1AIL A;  1KUQ A;  2DJV A;  1HNX O;  4LFC O;  4AQY O;  5FLX N;  3JAM N;  2ZKO A;  2N74 A;  4JI0 O;  1HNZ O;  1N32 O;  5BY1 A;  3RT3 C;  4GKK O;  1X59 A;  4LF4 O;  1R6T A;  2ZM6 O;  4B3M O;  3O65 A;  4DR6 O;  1XMQ O;  4X64 O;  5LL6 Y;  1HNW O;  2AGA A;  1IBL O;  4OPA A;  5LMU O;  4JI6 O;  2Z0A A;  4B3T O;  4B3R O;  4B3S O;  2UXC O;  2LW7 A; 
#chains in the Genus database with same CATH topology
 3VOU A;  2JVD A;  2JK5 C;  5JVD A;  3JD2 A;  2VQE O;  3T1H B;  5DED A;  3UQ8 A;  1O9H A;  1IXB A;  3ZRS A;  2QWO B;  4RAI A;  4DV5 B;  1HR0 B;  2VS0 A;  1NQT A;  2W6J G;  1ZLZ A;  1L0L H;  3K57 A;  5KHH A;  3CPW U;  2DYS B;  2B9Z A;  3H1K H;  1Y74 B;  1F7Y A;  1N34 O;  1WLE A;  4WF9 V;  3AG1 C;  4NB5 A;  4FLW A;  1THZ A;  5KA5 A;  1COW G;  3FB6 C;  4UVB A;  1NH2 B;  2DE0 X;  4EB6 B;  3CEI A;  4YIP A;  1AR1 B;  4KHP O;  4LH6 A;  2Q0A A;  2GTA A;  5IT9 N;  4H0L B;  1PL4 A;  1TGO A;  2LO1 A;  2C2A A;  3EVK A;  4O4L B;  1PNK A;  2VQE B;  2YIA A;  4WCE V;  1RSO B;  4DV2 B;  1BQZ A;  4TV8 B;  5IYC O;  2V7Q G;  1Q81 W;  4GX2 A;  1KYO F;  2RCV A;  3SDL A;  3P30 A;  3SPJ A;  1HNZ B;  3CCR V;  4DR2 O;  5B1N A;  1M90 W;  3TGU H;  1N0N A;  2IU0 A;  3TET A;  4AQY O;  5FLX N;  3RFR A;  3E8G A;  4FFB B;  2AXT Z;  4I4T B;  4N23 A;  1WPB A;  2QM8 A;  2HR3 A;  1MMM A;  3CME V;  1NZ6 A;  3T1C A;  1IBL O;  2JS5 A;  1KD1 W;  1VIB A;  5LP6 C;  5A9G A;  1PP9 H;  1E79 G;  4IL6 Z;  1GM7 A;  2AW9 A;  1IUR A;  3B4S A;  1AP5 A;  2EZO A;  3RGB A;  4FLU A;  4LF7 O;  3D8C A;  4O4H B;  1FJG O;  1PNM A;  2WLN A;  3CE2 A;  5BMV A;  3DGE A;  1QLN A;  1EFR G;  4JAS A;  3OR7 C;  4WFE A;  4GKJ O;  1FKA O;  4JYA B;  5DEC A;  2AZ0 A;  4JAV A;  1BQ0 A;  1Q43 A;  1M9N A;  4MSW C;  1VQM V;  5C93 A;  1NTM H;  4DV1 B;  2UUB O;  5KHI A;  3H1L H;  3K03 A;  5JJE B;  4FLX A;  5LBQ A;  5LXT B;  3RYF B;  1YHQ V;  2GUZ B;  4HNA B;  1OCO C;  4H44 B;  3RVY A;  3H1J H;  1S3J A;  2WLJ A;  5LHG A;  4DV0 O;  3HB3 B;  4OX9 B;  4D6T H;  4UXN A;  3HKB A;  2F1M A;  4HAM A;  4U7O A;  4GX0 A;  3K9A A;  3MHS C;  1I08 A;  3OEE G;  2QA4 V;  2X7R B;  1MSD A;  4K8Z A;  1FD9 A;  2OTJ V;  1GN2 A;  1ROP A;  3KZI Z;  2PTM A;  1S0V A;  4UFZ A;  2KKW A;  4GT1 A;  2QE7 G;  1OCO B;  3CP1 A;  4AIL C;  4IHJ A;  3B09 A;  3T4Z A;  3TXQ A;  2HVJ C;  3CRR A;  2RJZ A;  2CTR A;  3QO5 A;  2P90 A;  2W0F C;  2F66 C;  1U96 A;  4OPA A;  5KX5 B;  4J9Y B;  1OZ0 A;  2GDS A;  2UXN A;  1Q6H A;  4JYC A;  4AI8 A;  3ZHU A;  3ABL C;  1I94 O;  5B66 Z;  3Q4H A;  4X62 O;  3OGI B;  4DR2 B;  3L71 H;  1WN7 A;  1NS1 A;  2ZNI A;  1WAZ A;  4G27 B;  2VQF O;  1R3I C;  2E75 B;  5LHH A;  5HFM A;  1N8R W;  2GTS A;  2XAS A;  1K4D C;  4QNH B;  1R3L C;  3G6B A;  2ZR3 A;  3OW2 U;  5JQG B;  4CS4 A;  1HNW B;  2UUA B;  3P3P A;  3CSX A;  3HR0 A;  4X20 A;  2Q9L A;  4DR4 B;  4NTY A;  3K9S A;  3NXS A;  5H6R A;  1M5I A;  4PD4 F;  4DR1 O;  4UUJ C;  5F2V O;  1SA0 A;  1GM8 A;  4IHJ B;  2HKO A;  1RM1 B;  2R9A A;  5EIB D;  1Q5O A;  2EX3 A;  4LNU B;  4ZBM A;  3ZS8 C;  2PUS A;  1YDX A;  3FAV B;  5H2F Z;  4GCZ A;  3ZRX A;  1JJ2 U;  3BHP A;  3KKY A;  1Q6U A;  1Y76 A;  2KG7 A;  3IAY A;  4JI0 B;  2ZT9 B;  3ETE A;  4L8J A;  2WAM A;  4LWS A;  3LDE A;  1K4C C;  2ZXW C;  4QE7 A;  3ICX A;  1Q8I A;  2QTO A;  3TJT A;  2LGW A;  3W7X A;  5GON A;  3MDS A;  1BHA A;  4PJ0 Z;  4LFC O;  1QVF U;  3WU2 Z;  3EHB B;  3FX7 A;  4DR1 B;  1TAE A;  2N74 A;  1R3K C;  3OM3 B;  3RT3 C;  3IFX A;  1OCZ B;  4I9W A;  1R6T A;  5LYJ A;  5BR8 B;  2F23 A;  4CH3 A;  1AR4 A;  4LF5 B;  1SQB H;  1AI5 A;  2Z0A A;  4QGP A;  4B3S O;  2LFS A;  1W59 A;  1CP9 A;  3A2F A;  3H1H H;  1VQ9 V;  4I55 A;  1ZAU A;  3HKD A;  4F6R B;  4DV7 O;  1IXM A;  3SPC A;  5BXZ A;  2JS3 A;  4NXN B;  1Y6X A;  5EBW C;  3IC9 A;  4GLX A;  4PEL A;  4FLZ A;  3W7U A;  3JAL A;  1IZ3 A;  4JAU A;  4FM0 A;  4W4K A;  1HP8 A;  4LFA B;  4J7Z A;  3BA9 A;  5CBH A;  2ILM A;  5ITZ A;  2Q68 A;  1YTF D;  2P22 C;  1XNR B;  3H1I H;  1VMG A;  3OTO O;  1B06 A;  4FK5 C;  1EN5 A;  2ZE5 A;  1ZSP A;  4O4J B;  3T1Y O;  4DK0 A;  4JI5 O;  3ML0 A;  2BTQ B;  4J9Z B;  3OUF A;  5IJ0 B;  4FJC C;  4H33 A;  1R6K A;  2ZNJ A;  1PV0 A;  5CA3 A;  2AZ2 A;  4FZ0 A;  3CCE V;  3HKD B;  4F6R A;  1QLE B;  2NNU A;  1N33 O;  3SPI A;  2L6L A;  3F5T A;  1VAR A;  3K3W A;  1VF6 C;  1M4U A;  3DXR B;  5C8Y B;  4UCO A;  1KUQ A;  5H5N A;  2JGD A;  1FPO A;  4JTA B;  3I5D A;  2Z3Y A;  3ZED A;  1MNG A;  1W0K G;  2ZM6 B;  3GWK C;  4LF4 O;  2P67 A;  2F95 B;  2M6Y A;  4BIZ A;  1QR9 A;  3CCS V;  3ETG A;  1EZJ A;  4KFM A;  4DR3 B;  1WNS A;  5IDJ A;  3HPL C;  5JJJ B;  4NVP A;  1QU7 A;  4TV9 A;  3N2K B;  3THO A;  2ARH A;  3SGI A;  2ZIN A;  1R3J C;  5LA6 B;  3WFV A;  2EIL C;  1VQK V;  2X0L A;  4R7C A;  1Q3E A;  3ASO B;  4JI1 O;  1GN6 A;  4HZ3 A;  5IY5 B;  1VEW A;  2CUG A;  4MVZ A;  2EJR A;  2CH7 B;  5E79 Z;  2Y69 C;  3LSQ A;  5K1X A;  3LNN A;  4ZOL A;  2CK3 G;  3M7M X;  4MT8 A;  1L1F A;  1PPJ H;  3LUT B;  3OE7 G;  1DK1 A;  4TQD A;  1MA1 A;  1CXZ B;  3L70 H;  1D5A A;  1EN6 A;  1OHH G;  2Z5U A;  2IM9 A;  5IYB O;  1TVK B;  3OEH G;  1XUQ A;  1Q6I A;  3WB0 A;  2YEV A;  2UUB B;  3FFQ A;  4IYH A;  4DV3 B;  4JI8 O;  1QBZ A;  3GB7 C;  2EIN B;  3SYO A;  1JFF A;  4UV8 A;  4ZI7 A;  3BY6 A;  2XAJ A;  3G67 A;  5HFL A;  2OCC B;  3FKS G;  3L9D A;  4MTG A;  2PI4 A;  3RYC B;  4I5S A;  2UUA O;  2N05 A;  4DV0 B;  5IWA O;  3RYH A;  5LMU B;  1GAX A;  4U3F H;  5KLV H;  1XDC A;  3AK2 A;  3N2G B;  1WP7 A;  4X65 O;  2YS8 A;  3VQY A;  3SYA A;  1PL0 A;  1M1K W;  3UO3 A;  1ARO P;  1HDJ A;  4A5U B;  2UXC B;  4BIO A;  4B08 A;  4MTF A;  4E4E A;  1VQ5 V;  4DYL A;  2UUC B;  4LP8 A;  4WFA V;  2NN4 A;  3A8T A;  1UFI A;  1TVK A;  5L3F A;  4I9Q A;  1ZL8 B;  4B3M O;  4X1Y A;  1LNQ A;  2R9R B;  4LC1 A;  4MTO A;  1IVS A;  4ZKI A;  1FXV A;  1YF2 A;  5KHJ A;  5LOV A;  2X6C A;  1H2S B;  3CD6 V;  4FLT A;  3ABK C;  1EBO A;  1OCR B;  3IC7 A;  2YXL A;  2UU9 B;  3K06 A;  4JZG A;  3JAS B;  5IYZ B;  1IBK O;  4CH4 A;  4JYA O;  4BR6 A;  1HR0 O;  3E89 A;  1DF5 A;  2UXB O;  4NTX A;  3SJB C;  2DYR B;  3LDD A;  2YXH A;  3JAW B;  1AP6 A;  4HYO A;  3AG3 B;  4LF4 B;  3ZHQ A;  1SQG A;  3CX5 F;  4UCU A;  3AG4 B;  3MHH C;  3CMA V;  3ETQ A;  4J41 A;  3BEH A;  2WLI A;  5DN6 G;  2P7T C;  1VQO V;  3L73 H;  4I50 A;  4LBE C;  3OR6 C;  1SET A;  1R6N A;  4FFB A;  3BCC H;  4IGG A;  3R66 A;  3TXS A;  1UPG A;  4DV6 B;  4LFA O;  4XDK A;  2F4V B;  1US6 A;  4EB6 A;  3N27 A;  1AB3 A;  1GK9 A;  1FFX B;  1K5Q A;  2DYR C;  3ZCC A;  4O4H A;  3UO2 A;  4IT5 A;  3ZRW A;  4DR6 B;  1RPR A;  1NJI W;  1SZX A;  1FXK A;  2EIK C;  4X64 B;  4OGQ B;  5CBG A;  3ASN B;  1H38 A;  1YIJ V;  4QE9 A;  2F93 B;  3JAM N;  3OFN G;  4UCV A;  1FJG B;  4O4I A;  1ORQ C;  2YI8 A;  1WA8 A;  1ZTE A;  1BCC H;  3EFF K;  4X88 A;  3RVZ A;  1SQV H;  2R72 A;  5EC2 C;  4PDM A;  3ABL B;  4W4L A;  3RYI B;  5LXT A;  4MVQ A;  4QPK A;  1JVM A;  1FFT B;  4LFB O;  2VWJ A;  2LGQ A;  3CCV V;  4G28 B;  5JH7 A;  4UVA A;  1S5L Z;  2EUL A;  2XOK G;  3C3S A;  3CRQ A;  2HHH O;  1VQ7 V;  2Q0O C;  3ASO C;  4JYB A;  3ZJZ A;  5GTI Z;  2Q73 A;  3DSQ A;  3HKE A;  3FYE B;  4DR3 O;  4B3S B;  2ZE8 A;  3ZHV A;  4FPP A;  4R50 A;  1OJH A;  2PYL A;  1P49 A;  2ZIM A;  3OGC C;  4R6Z A;  2MK3 A;  4NXM O;  2EZP A;  2QDO A;  1FXK B;  3EXA A;  1PNL A;  2H94 A;  2JGU A;  1JCH A;  2OTL V;  4ABM A;  5LMN O;  4DR4 O;  3K04 A;  4FM1 A;  3B8M A;  4PDL A;  1NVP D;  2HFE C;  3ABM B;  1Q86 W;  2HHH B;  3ZMZ A;  2LQT A;  3K0G A;  1S5J A;  5FNV B;  4UB8 Z;  3RYI A;  2XAQ A;  2DWE C;  2Q7E A;  3WB2 A;  1I5X A;  5L3C A;  1QVG U;  4J7J A;  1JA8 A;  2ZXW B;  1IX9 A;  1D2D A;  4X9Q A;  3W7S A;  1F23 A;  2DQ0 A;  4CS3 A;  2E3C A;  3ZMU A;  3D36 A;  5CA0 A;  4LF7 B;  1AR5 A;  4KUM A;  2WLL B;  4O2B B;  1N32 O;  1H2K A;  4EEQ A;  1HWY A;  5B1B C;  4K8X A;  1YIT V;  2H8P C;  4P2Z A;  1VF5 B;  1D5N A;  2F43 G;  2IH1 C;  3K5M A;  3JD3 A;  2Y4T A;  3B8N A;  1Y74 A;  4P30 A;  1F51 A;  2E5L O;  3BAA A;  2PYJ A;  4WFB V;  4Z1M G;  2JRI A;  4KL1 A;  2ZD9 A;  2BOC C;  4JI2 O;  4DV2 O;  5K1P A;  1KQS U;  5KX5 A;  2HLD G;  4NXN O;  3SJA C;  4XBF A;  2DWD C;  2WLK A;  4MVM A;  3ABU A;  2EIN C;  1XBL A;  4DUZ B;  1XNQ O;  2NR5 A;  4AHC A;  2DMX A;  1Y76 B;  1SQF A;  3UT5 B;  1Y66 A;  3CRA A;  2OCC C;  2Q69 A;  1RFY A;  4LWS B;  2HEP A;  4YJ2 B;  5KHG A;  4LF8 O;  3AG4 C;  3E86 A;  3CCQ V;  2DYS C;  3FB5 C;  4TT3 G;  4PI2 A;  3DTU B;  4OXS A;  4CC5 A;  3JYC A;  4RWU A;  1XL6 A;  4K35 A;  4YXW G;  2JJ1 G;  5LYJ B;  5GTH Z;  4DR5 B;  4UB6 Z;  5KAF Z;  1F4M A;  5CA1 B;  3SYQ A;  3H01 A;  3I56 V;  1E1R G;  5J2U B;  1GMG A;  1SA0 B;  2LJ2 A;  3T1H O;  1H8E G;  4LH7 A;  2OIG A;  4JZ2 A;  2CAZ C;  2RMK B;  3WG7 B;  5J2T A;  3CRM A;  1EN4 A;  4KXR A;  1K34 A;  4PHZ A;  2XT9 A;  1LUV A;  1H2L A;  2BCC H;  1OCC C;  5EZY A;  4D7T A;  1QR8 A;  3I55 V;  5EK0 A;  2LFR A;  3UT5 A;  4B3M B;  5B1A B;  5BMV B;  4BAY A;  4X65 B;  4DR6 O;  3JCU Z;  2PI5 A;  2AGA A;  2MW2 B;  2B1I A;  4YJ2 A;  4GX1 A;  2UXC O;  1BE3 H;  2ZDI A;  4LF6 B;  2LW7 A;  5GON B;  3E83 A;  2QWQ B;  4JI4 O;  4I0X B;  3WB1 A;  3UKM A;  4O4J A;  5LP6 B;  2WSS G;  5CB4 B;  2CE4 A;  2BTQ A;  1XQ8 A;  4UV9 A;  2GV9 A;  4UVC A;  5EYP B;  2RDC A;  5CA1 A;  4MS2 A;  5IJ0 A;  2H3O A;  2XTA A;  3RYF A;  2E5L B;  1P84 F;  2QKC A;  5J2U A;  3FB7 C;  3E22 B;  4TQF A;  5B1A C;  1L8D A;  4WFH A;  5KUK A;  3L75 H;  2YID A;  2QWN B;  4RUF A;  4K0K B;  3OUS A;  1S76 D;  4DV3 O;  5KUM A;  3T1Y B;  2Q8V A;  4JI5 B;  1DGS A;  1Q82 W;  1Y4M A;  2BE3 A;  3DXR A;  1YJW V;  5JCO C;  1BMF G;  4MVR A;  1VF7 A;  5CN0 A;  3CYO A;  1W2B U;  1GTO A;  3ZN0 A;  1K3E A;  1SF9 A;  2YDE A;  2Y4U A;  4JI7 O;  3S3W A;  1SQX H;  1SQP H;  5IJ9 B;  3ZX6 A;  1M57 C;  4NTW A;  1QCE A;  4NR1 A;  1GRJ A;  2OT5 A;  2EIK B;  1J5E B;  3X2Q C;  5LA6 A;  1I94 B;  3JCZ A;  4D7S A;  1G6U A;  4I0X A;  2E76 B;  4GYC B;  4DK1 A;  1N4C A;  1XEQ A;  4JI4 B;  3QTC A;  2XAF A;  1BS3 A;  3OTF A;  2VQF B;  2DJV A;  1VQ6 V;  1VQ8 V;  1B3Q A;  2CGO A;  3ZRV A;  2ATK C;  1DF4 A;  1NI8 A;  2A3Q A;  2AHY A;  3F7Y C;  2E74 B;  1NKD A;  4P9P A;  3P32 A;  3E22 A;  3ZMV A;  1NH2 D;  1AJN A;  2QM4 A;  1RM1 C;  3U0Z A;  2ZM6 O;  1M57 B;  1NT2 B;  1HNW O;  3FYI B;  1QLE C;  4CS2 A;  2V4D A;  4B3R O;  1S5H C;  3ZMS A;  2IJI A;  4DO2 A;  4O2A A;  3VQV A;  2OCH A;  3CJH A;  5L3E A;  4B7E A;  3KG2 A;  4PDV A;  5JQG A;  5LGU A;  2R9I A;  1WP8 A;  1YTF B;  3AG1 B;  3RYC A;  3K59 A;  2N04 A;  1M56 C;  3G6E V;  1IBK B;  4NKG B;  4JYY A;  2W6I G;  5EBM C;  3BPZ A;  3AG3 C;  1MOF A;  4CH5 A;  4QPJ A;  5KMG A;  1J5E O;  4WFF A;  5JVD B;  5IYD O;  3STL C;  2ITC C;  3JD4 A;  2CH7 A;  2Y48 A;  4FFK A;  3J81 N;  4DV4 O;  3SJC C;  2A79 B;  1SRY A;  4MVS A;  3APO A;  2CDY A;  2EIM C;  5LMN B;  3RN4 A;  2ZE7 A;  1XHZ A;  2KG7 B;  3S3X A;  1G1X B;  3GVM A;  4X66 B;  1XMO B;  1ZL8 A;  4RQF A;  2XUM A;  2HJF C;  1JX9 A;  1KP2 A;  3AG2 B;  3CCL V;  5JJN B;  2PF4 E;  4GKJ B;  1IBL B;  2P5O A;  4BW9 A;  4FM2 A;  3CJH B;  4MW8 A;  2A06 H;  1H2M A;  4JV5 O;  2ZE6 A;  2ADQ B;  2VRZ A;  5IYZ A;  4CC6 A;  2UXD O;  3U11 A;  1I0H A;  1OCR C;  2WWW A;  4TV8 A;  2ZR2 A;  4IYI A;  3TK1 A;  5TIS Z;  4BW5 A;  4I55 B;  4JI1 B;  3T4D A;  1HNZ O;  3JAW A;  3OMN B;  3HKC B;  1K33 A;  5H9C A;  1KB9 F;  2IBZ H;  4BIU A;  5L3D A;  1MZE A;  1KMI Z;  1YI2 V;  4LFB B;  4I50 B;  1QQC A;  1V55 C;  1S77 D;  3QO7 A;  1A32 A;  2FKX A;  3JD0 A;  3OTO B;  4RUE A;  1P7G A;  4Z2W A;  2OWO A;  3BRC A;  2K1E A;  4NYK A;  5AG2 A;  2WA4 A;  3ZIA G;  2FYU H;  2QSA A;  1I5Y A;  4F6E A;  2QJ1 A;  5ITZ B;  1RP3 B;  3CS5 A;  5H6Q A;  1BHB A;  3CCU V;  3LDC A;  4EKW A;  3CCM V;  4HBN A;  4LF5 O;  3ZRW B;  4MVO A;  2A0L A;  5JCO A;  2D3O W;  1LR1 A;  2IJJ A;  2OIE A;  4DR7 B;  3ABK B;  1XRE A;  1GH6 A;  4DXW A;  3KCY A;  4JAA A;  1VQ4 V;  2DN9 A;  1SES A;  3OAA G;  5EIB C;  3OT7 A;  4B3R B;  1CEZ A;  2ODM A;  1K92 A;  3U10 A;  4FIP C;  1VQN V;  1BSM A;  3RW0 A;  5IY5 C;  5LGN A;  1MSW D;  1JOY A;  4GZR B;  2BSK B;  4DR5 O;  1Q90 D;  1LUW A;  2LP7 A;  2RN9 A;  3E8F A;  4DV6 O;  3B77 A;  4TSF G;  4YHH B;  1B04 A;  3W7W A;  2WLI B;  1M93 A;  3E8B A;  2W0X A;  2WLM A;  2FTK A;  2GUZ A;  1W0J G;  1BL8 A;  3CB2 A;  3C3T A;  1H2N A;  2QR4 A;  4X1K B;  4DR7 O;  2CTQ A;  2VWK A;  1K5S A;  5KAI Z;  3HKE B;  3N2K A;  4Q20 A;  1Z5W A;  1NU1 H;  3D3Q A;  1XHX A;  1WJZ A;  1Z2G A;  1R73 A;  3F7V C;  4DW0 A;  5JWP A;  2ZCE A;  2P6J A;  4JI6 O;  2HP8 A;  1JMK C;  4WFG A;  4B3T O;  4UCS A;  1GO3 F;  4J10 A;  3ABT A;  1V54 B;  3PJS K;  1WA8 B;  4GX5 A;  1AJP A;  1PKX A;  1X4T A;  4X89 A;  2CTP A;  2Q5Z A;  2JEU A;  4BWA A;  1ENV A;  4ZHQ B;  1MZF A;  3AK1 A;  3SYP A;  3Q4H B;  2DW4 A;  3G80 A;  1AI7 A;  4IIJ B;  2XHB A;  2P06 A;  4DUY O;  1YVW A;  4RO2 A;  5KA6 A;  4XDJ A;  4PV1 B;  3K08 A;  5B3S C;  3F5W C;  1V54 C;  5LHI A;  3AEI A;  3ZHS A;  2KSD A;  2V1D A;  2ITD C;  1NTK H;  5L3B A;  1IBM B;  2G38 A;  4X20 B;  3AG2 C;  4R8C A;  2IU3 A;  4Q6G A;  3ZMT A;  4DW1 A;  4FLY A;  3OMA B;  4I4T A;  4JI7 B;  1PD3 A;  2JEX A;  4JI8 B;  3CCJ V;  2Q6A A;  4PA4 A;  1SKV A;  3D3I A;  2BTO A;  2JJ2 G;  1G8M A;  1QNM A;  1HNX O;  4ZHQ A;  5FNV A;  1P7B A;  3K5L A;  1SER A;  4JI0 O;  4H13 B;  4I7Z B;  5FPR A;  4J7K A;  4O4L A;  3VBB A;  3L72 H;  1S72 V;  3PN1 A;  3UCS C;  1RSO A;  5LMU O;  1YEW A;  2CGN A;  1RPO A;  2O57 A;  2P4K A;  1B6Q A;  3K58 A;  5CA0 B;  5B1O A;  5FL7 G;  4K3A A;  4TOI A;  3E8H A;  2RQ6 A;  2R70 A;  1KP3 A;  3QVN A;  4QJF B;  2HJD A;  1V9P A;  3ASN C;  4PA9 A;  3DC6 A;  5A2Q N;  1EZV H;  2WPD G;  3UM7 A;  2M7W A;  1KU9 A;  4OPH A;  4LFC B;  1WPX A;  4HNA A;  1IDS A;  4K0K O;  1FS0 G;  2YC0 A;  4DV1 O;  1XMQ B;  1N0J A;  2JIZ G;  2GSM B;  1XI1 A;  3APQ A;  4EFE A;  1U97 A;  4JPR A;  3SPH A;  5J9P C;  4B3T B;  4LF8 B;  1Y67 A;  1BZK A;  5DM6 V;  1UJW B;  3K5N A;  4P9O A;  5EZY B;  1KKD A;  2QM7 A;  5D5P A;  1L0N H;  3JAL B;  3FD9 A;  3VQW A;  3W7T A;  2QKA A;  4TUY B;  2QWR B;  4U3J B;  5GW7 A;  3T2M A;  2GHY A;  4LR3 A;  1K97 A;  1AI4 A;  3X2Q B;  2ZIO A;  1AI6 A;  3D36 C;  1XNR O;  3B2E E;  3K5O A;  3DC5 A;  2A9H A;  2WLH A;  1QHT A;  1URF A;  5FPO A;  1JQ0 A;  4X66 O;  1XMO O;  1IBM O;  1BGY H;  1YSC A;  2NLJ C;  2QTS A;  3L74 H;  1AIL A;  3MAQ A;  4L87 A;  3LSS A;  2HG5 C;  2UXB B;  1FAF A;  2IW5 A;  4PA7 A;  1NBM G;  2KQX A;  3G71 V;  4GKK O;  1ZWI C;  1PM9 A;  3QG5 A;  4MTX A;  1GM9 A;  4J42 A;  1XMQ O;  3CWB H;  3R65 A;  1XOU A;  2FL4 A;  4JTC B;  1JPX A;  5C8Y A;  1DTO A;  1XIL A;  1NR7 A;  5J2T B;  1NVP B;  3FB8 C;  2PZS A;  1H2G A;  3HKB B;  3LNM B;  4LF6 O;  3CRC A;  2B1G A;  3IJ4 A;  4B7K A;  3WG7 C;  2PY5 A;  2A7W A;  1SS3 A;  3J80 N;  2YUA A;  1N33 B;  1JJO A;  1M56 B;  4TUY A;  4U3J A;  5IJ9 A;  1Q7Y W;  4E2L A;  1KC8 W;  4X8A A;  3MD0 A;  4JTD B;  1K8A W;  3TCU A;  3VQX A;  5B5E Z;  1F4N A;  1N34 B;  1AVM A;  2IJH A;  4G2K A;  5LP6 A;  3JD1 A;  1G4Y B;  4ZIB A;  2GBO A;  1ZX3 A;  3FAV A;  3QO8 A;  2EIJ C;  5EYP A;  2QKS A;  3QF7 A;  3JAT B;  2L35 A;  1N36 B;  2DOS A;  3IGA C;  1Z5V A;  1P4R A;  2QGN A;  4J80 A;  1NTZ H;  3CC2 V;  3JSN A;  2YIB A;  5LGT A;  4LCU C;  4WBN A;  2B5U A;  4O2A B;  4C7U A;  2WLL A;  3P3N A;  2LW1 A;  4O2B A;  4ZI7 B;  1K9M W;  2FB5 A;  2WA3 A;  4OX9 O;  4TWK A;  3E35 A;  4LF9 O;  3ZN1 A;  3H9V A;  3CHX A;  4RQE A;  4XDL A;  2YIC A;  1YJN V;  4YIO A;  3AG7 A;  1ZUQ A;  3G4S V;  5KMG B;  1DLB A;  2ZKO A;  1XNQ B;  2YIB D;  4AQY B;  3ZBH A;  4CBC A;  2YXY A;  2UXX A;  5EC1 C;  3B40 A;  3N2G A;  4JI6 B;  4FMT A;  3BA8 A;  3JAK B;  5LL6 Y;  4JF3 A;  4LNU A;  2CTW A;  1V55 B;  1MAB G;  3A0B Z;  3ETD A;  3CC7 V;  3O9O A;  4ICG A;  4JI3 B;  3O65 A;  3KCX A;  5CMU A;  3JAT A;  1HNX B;  1NR1 A;  4GKK B;  1YJ9 V;  2EJ7 A;  1TUE B;  1KKC A;  3ZHT A;  4FZ1 A;  1WB8 A;  4X1Y B;  1WB7 A;  2ETN A;  2IH3 C;  3OD4 A;  1E1Q G;  4WBN B;  1FYJ A;  2UUC O;  2YSU B;  2OYQ A;  3RWR D;  3LSU A;  2JDI G;  4UCR A;  2UU9 O;  5B3S B;  4YY3 O;  1YCI A;  2HVK C;  1XL4 A;  5KHK A;  4DUY B;  4GUN A;  4F4L A;  1GN4 A;  3JAR B;  3K79 A;  2ZDI C;  1KBH A;  1R1B A;  2PGG A;  4CH6 A;  3JSL A;  1MG1 A;  1SQQ H;  2Q4P A;  3JAK A;  2QEX V;  2IJK A;  1YXB A;  2ZQM A;  2RNB A;  2XAH A;  3K0D A;  4X1I B;  4DUZ O;  4PI0 A;  2KB1 A;  1N36 O;  4U7N A;  3SR2 C;  1HW7 A;  3BVO A;  5EBL C;  2Q67 A;  2EIM B;  4DRX A;  4MVU A;  4JGS A;  2P4V A;  2Y0I A;  2EBO A;  3A0R A;  4TV9 B;  3GWO A;  5IWA B;  4FVM A;  2Q7G A;  2Y69 B;  1VQP V;  1FFX A;  2DQ3 A;  3BFR A;  1X59 A;  3NR7 A;  4MW3 A;  4YY3 B;  4ZOL B;  3AK3 A;  4X64 O;  2XAG A;  5CB4 A;  1CPY A;  1OCZ C;  4NXM B;  3JAR A;  1OCC B;  2ADP A;  4DV7 B;  1GN3 A;  4O4I B;  4LF9 B;  3CXH F;  3STZ C;  3HKC A;  1BT8 A;  2D2C B;  2BSK A;  1GKF A;  3ZHR A;  1FXH A;  2QWP B;  3SPG A;  3A0H Z;  4JI3 O;  4YJ3 A;  4X1I A;  2JGD B;  1JFF B;  2BOB C;  4ASU G;  4J11 A;  4UCT A;  2FML A;  2X6A A;  4DRX B;  5JH7 B;  1VQL V;  4EFB A;  4FLV A;  3ABM C;  2AHZ A;  2EIL B;  3M8A A;  3J7A U;  3RBZ A;  1SC5 B;  3QNE A;  1YZB A;  3RYH B;  1TUB B;  1O9G A;  4PA3 A;  2EIJ B;  1K7D A;  1EM1 A;  4JV5 B;  1KEC A;  4DV5 O;  1N32 B;  1AJQ A;  2UXD B;  3SYC A;  4CZZ A;  1I7F A;  2Q7H A;  1TA8 A;  3E2E A;  1H8H G;  3SJQ C;  4YHH O;  3M99 B;  3CXC U;  3CC4 V;  4H37 A;  1T5E A;  5BR8 O;  5L3G A;  2YEV B;  5B1B B;  3BAB A;  2Y0P A;  2YI9 A;  2K9P A;  5IE9 A;  1OV9 A;  1J95 A;  1SZT A;  3C90 A;  5D5Q A;  5LOV B;  2F4V O;  4YJ3 B;  5E1A C;  4JI2 B;  1VF6 A;  5BZB A;  1K73 W;  4PDR A;  3OMI B;  4X62 B;  5BY1 A;  1JR9 A;  2X6B A;  4IIJ A;  1VP7 A;  3JAS A;  4QIW F;  4DV4 B;  1FXK C;  4PA6 A;  4X1K A;  4Z1V A;  4KHP B;  4N21 A;  1TUB A;  2XND G;  5CBF A;  4KP4 A; 
#chains in the Genus database with same CATH homology
 4LF6 O;  4LFB O;  1I94 O;  4LF7 O;  2E5L O;  1A32 A;  2FKX A;  4DV7 O;  4JI4 O;  4JI1 O;  4X62 O;  1FJG O;  5BXZ A;  3J80 N;  2JRI A;  2VQE O;  2HHH O;  1NS1 A;  4JI2 O;  1IBK O;  4DV2 O;  2VQF O;  4JYA O;  1HR0 O;  4JI3 O;  4NXN O;  5A2Q N;  4GKJ O;  1FKA O;  4DR3 O;  1DK1 A;  4OPH A;  1FYJ A;  2UUC O;  2UXB O;  1XNQ O;  1F7Y A;  4K0K O;  1J5E O;  1N34 O;  4DV1 O;  2UU9 O;  4YY3 O;  4LF5 O;  4DV3 O;  4NXM O;  4DUY O;  2UUB O;  3J81 N;  4DV4 O;  3M8A A;  3J7A U;  4JI8 O;  4LF8 O;  1YZB A;  4KHP O;  5LMN O;  1R1B A;  5IT9 N;  4DR4 O;  4DR1 O;  2DOS A;  4JI7 O;  3OTO O;  1G1X B;  4DV5 O;  3R66 A;  4DR5 O;  3T1Y O;  4LFA O;  4DV6 O;  4JI5 O;  2UUA O;  4DUZ O;  5IWA O;  1AB3 A;  1N36 O;  4YHH O;  4DV0 O;  1XNR O;  4OX9 O;  3SDL A;  3T1H O;  4LF9 O;  1N33 O;  4X65 O;  5BR8 O;  1XEQ A;  4X66 O;  1XMO O;  4JV5 O;  4DR2 O;  1D2D A;  3F5T A;  1IBM O;  2UXD O;  4DR7 O;  4A5U B;  2F4V O;  5H5N A;  1AIL A;  1KUQ A;  2DJV A;  1HNX O;  4LFC O;  4AQY O;  5FLX N;  3JAM N;  2ZKO A;  2N74 A;  4JI0 O;  1HNZ O;  1N32 O;  5BY1 A;  3RT3 C;  4GKK O;  1X59 A;  4LF4 O;  1R6T A;  2ZM6 O;  4B3M O;  3O65 A;  4DR6 O;  1XMQ O;  4X64 O;  5LL6 Y;  1HNW O;  2AGA A;  1IBL O;  4OPA A;  5LMU O;  4JI6 O;  2Z0A A;  4B3T O;  4B3R O;  4B3S O;  2UXC O;  2LW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...