1FYJA

Solution structure of multi-functional peptide motif-1 present in human glutamyl-prolyl trna synthetase (eprs).
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
DSLVLYNRVAVQGDVVRELKAKKAPKEDVDAAVKQLLSLKAEYKEKTGQEYKPGNPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of multifunctional peptide motifs in human bifunctional tRNA synthetase: identification of RNA-binding residues and functional implications for tandem repeats.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords MULTIFUNCTIONAL AMINOACYL-TRNA SYNTHETASE
total genus 20
structure length 57
sequence length 57
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2000-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1fyjA00
2UU9O 2UUAO 3J7AU 5BY1A 5FLXN 5A2QN 4DR5O 5BXZA 4DV7O 4B3RO 4AQYO 4JI6O 4X62O 4DUYO 4YY3O 4DV3O 2AGAA 4DR2O 2E5LO 4X64O 4LF8O 4LFCO 2UUBO 4DV4O 4NXMO 4A5UB 3J80N 4LFBO 1D2DA 4B3SO 5IWAO 4DV1O 2HHHO 1A32A 4DV0O 4X66O 1F7YA 4GKKO 4JI7O 2UUCO 3RT3C 1NS1A 1FKAO 4OX9O 5LL6Y 4KHPO 5IT9N 1X59A 2ZKOA 4YHHO 1G1XB 1N32O 3T1YO 4DV2O 5LMUO 1N36O 4OPHA 4GKJO 1I94O 1XNQO 2UXDO 1J5EO 4X65O 2Z0AA 4JYAO 3SDLA 4JI5O 4OPAA 3JAMN 1HNWO 4DR4O 4DUZO 1DK1A 4LF9O 1YZBA 1HR0O 4DR7O 4JI1O 1XNRO 5BR8O 2ZM6O 3T1HO 3OTOO 3O65A 1R6TA 2DJVA 4JV5O 1IBKO 4DR1O 2JRIA 4JI4O 1XMQO 4DR6O 2UXBO 5LMNO 4LF4O 4DV5O 3R66A 1IBLO 4B3TO 5H5NA 1AILA 4LF5O 4LF6O 1KUQA 3J81N 3F5TA 4JI3O 4JI8O 4JI0O 2VQEO 1HNXO 4JI2O 1FYJA 2DOSA 1R1BA 1XEQA 1HNZO 2N74A 2FKXA 3M8AA 2VQFO 4NXNO 4B3MO 4K0KO 1XMOO 1IBMO 2F4VO 4DV6O 1AB3A 1N34O 2UXCO 4DR3O 1FJGO 4LFAO 1N33O 2LW7A 4LF7O
chains in the Genus database with same CATH superfamily
2AXTZ 3J7AU 1Q8IA 3UCSC 2DW4A 4GLXA 3K04A 4N23A 2Q9LA 1OCZC 5EBMC 1YTFB 2BTQB 1OCRB 4DR2O 1VQLV 4B3TB 3B40A 1JR9A 4D6TH 3H1KH 4DO2A 5EYPB 2GV9A 3VQWA 5A9GA 4IYIA 4JYCA 1VF5B 1M93A 1AI7A 4J7KA 1R3LC 2WA4A 3QF7A 3GWKC 5LOVA 1N34B 3LUTB 4DV2O 2IJKA 3RBZA 3OAAG 1NU1H 2D3OW 2HEPA 3ZS8C 1XL6A 5JH7A 1I7FA 3CCQV 2LGQA 4OPAA 3JALB 3CEIA 4MT8A 5BZBA 2BTOA 4FPPA 1IZ3A 2DYRB 3A0HZ 1B04A 4MVOA 4NXMB 1BT8A 3MAQA 5LOVB 1SQGA 4FMTA 4YIOA 4GX0A 3PN1A 2ZINA 1SZTA 1XBLA 2P06A 1L0LH 4DRXB 4GYCB 1P49A 4G27B 3L72H 4DV5B 1Q3EA 4LF9B 2XOKG 5L3CA 3WU2Z 4UVAA 4I55A 1CEZA 1HW7A 2X0LA 5LP6C 2V1DA 2JJ2G 1ENVA 4UB6Z 1H2KA 4X8AA 3EFFK 3LSQA 1K9MW 4FIPC 4FK5C 2Y69B 3B2EE 4DR3O 2AW9A 4YJ3B 1AJNA 2LFRA 3B09A 1VQ9V 4I0XB 4TT3G 1VQPV 2GUZB 1NT2B 1XNRB 3T2MA 3FFQA 1PP9H 3CJHA 4X1IB 3SYCA 1J95A 3MDSA 5EZYB 2P5OA 2Q68A 2DYSB 2YXYA 4W4LA 5KA5A 4YHHB 4X20B 1VEWA 2DN9A 3ABMC 4FLUA 4YJ3A 3WB2A 4UVCA 3K79A 1S5JA 3CC2V 1Q86W 4YJ2B 4FLXA 4JI7O 3U10A 4KHPO 2XNDG 5BMVB 3ASOC 1PD3A 3UKMA 3JCZA 4LF7B 2JJ1G 3K9AA 4UUJC 2PYLA 1NJIW 2QSAA 2UUCB 4JI5O 2YIAA 4DV0B 5JVDA 4B7KA 4UXNA 4CS4A 3CP1A 3CMAV 5LMNB 5KX5A 2ZXWB 2CDYA 1IXBA 2WLIA 3UT5B 1YJNV 3CCSV 1SA0A 3SPHA 2OIEA 2ETNA 4ZOLB 3ZRWA 1KKCA 1B3QA 3CCLV 2X7RB 4DV6B 2Y0IA 4Q20A 1K4CC 5LHGA 1FFXB 1KECA 1OHHG 1V55B 2QTSA 2Q0AA 3HKCB 2JDIG 3QNEA 2UUAB 4LWSB 1W0KG 3FB7C 5E1AC 3HKDB 4RQEA 4I7ZB 2EIMC 3B8NA 2EINC 2PZSA 4O4HB 3FB5C 3QVNA 4CC6A 3SPGA 5B1NA 1FXVA 4DUYO 4H13B 4L8JA 4DR1B 1VQ6V 3HKCA 2CUGA 1MG1A 2H94A 2A79B 3JD4A 5KMGB 4NKGB 3OFNG 3BHPA 3FYIB 1PNKA 1FXKC 3PJSK 4RO2A 5LGNA 2OCCB 4X66O 2CTPA 3ZN1A 3C3SA 3NXSA 5IT9N 2F1MA 3BCCH 5DN6G 1I5XA 3RYCA 3N2KB 5J2TA 2ITDC 4CS2A 2CE4A 1ZAUA 5LMUO 2CTQA 1H38A 4EFEA 1U97A 2Z0AA 4QNHB 4J42A 3IC7A 4HNAB 1HNWO 1ZSPA 3TJTA 3UM7A 4B08A 1VQOV 4I4TA 5L3EA 3DGEA 3ETEA 2IU0A 1BZKA 1FPOA 4PI2A 4DV2B 3OGCC 3O65A 1K33A 2ZIMA 1I08A 4B3SB 3CD6V 4JV5O 3MHSC 4U3FH 2WLNA 2LP7A 1NTKH 2XUMA 5JJNB 4AILC 1H8EG 2QJ1A 1KC8W 1YCIA 2IJIA 3E86A 1M56B 1BMFG 2F4VB 4X88A 5EIBD 3LDDA 2QWNB 4JI8B 1ZX3A 1QLEC 1NZ6A 3SJAC 1Y76B 2DYSC 1M9NA 4EEQA 4FZ0A 5IY5C 2YI8A 4TV9A 3CCVV 3GB7C 1BHBA 1FXHA 1IDSA 1D5AA 4G2KA 4MVZA 3APOA 2CGOA 1COWG 3ZHRA 4K0KO 2WLMA 4R50A 1BS3A 2EULA 2F93B 3AG4B 1WB7A 4ZBMA 5GONA 3OM3B 1PL0A 2DMXA 2HJDA 2X6AA 2Z5UA 4WFGA 2DE0X 1L0NH 4G28B 1IBKB 4DK0A 5JCOC 2JVDA 4HAMA 4J7ZA 3MD0A 4X62O 1FXKB 2WPDG 2AGAA 5KHKA 3RVYA 3CWBH 3AG3B 2ZXWC 3OMIB 2KQXA 3BAAA 1QHTA 4K8ZA 1OZ0A 4FFKA 2KB1A 4PA4A 3I56V 2P90A 3G80A 4GKKO 1DGSA 4UCUA 1FXKA 4AHCA 2YI9A 1PV0A 1G1XB 1N32O 2WLIB 4XBFA 1G8MA 4X64B 5CN0A 3VQVA 1CP9A 2BSKA 3TGUH 4ZIBA 4IIJB 4ZHQB 3ABMB 4X66B 1IURA 3QO8A 4LF9O 2QTOA 3BABA 2YEVA 5L3FA 4KHPB 1RP3B 2NNUA 1N8RW 1FFXA 4N21A 5FPRA 1SERA 3JATB 1AJQA 3I5DA 3ETQA 4LWSA 3RYHB 3CMEV 1Y74B 1XMQO 2Q6AA 1K34A 4Z2WA 1HWYA 1IXMA 1KUQA 3J81N 4H44B 1Q43A 4NR1A 4UCRA 2E75B 4TSFG 4DW1A 3AG1B 1ZTEA 2AZ0A 5JQGA 3M8AA 5FNVB 4LF6B 3H1LH 3B8MA 2O57A 4JI6B 2EIJB 2EJ7A 4J9ZB 2IW5A 3T4ZA 1QVFU 4LH6A 4CS3A 1H2MA 3N27A 4C7UA 2UU9O 2UUAO 5BY1A 4DR5O 3P30A 2R72A 5HFMA 4FLTA 3TETA 5J2TB 4QPJA 3CS5A 4ZI7A 2A9HA 4GKKB 2V7QG 3ZMSA 1VQKV 2WA3A 2GTSA 4CC5A 3C3TA 1WNSA 1NTZH 3ZRSA 2DWDC 3E35A 1WP7A 1M56C 4MS2A 2Q4PA 3ZX6A 4X1YA 4YHHO 4LC1A 1NR7A 4QIWF 2LO1A 2M7WA 1OCCC 1PL4A 4IHJA 3OD4A 1ZL8B 3EHBB 1UJWB 2YUAA 4JTDB 4LCUC 5J9PC 1XDCA 3K57A 1TGOA 3A2FA 3JD0A 3T1HO 3ABUA 4O4JA 2YXHA 5J2UA 1UFIA 4BR6A 3AG2C 4D7SA 4KXRA 4TQFA 3U0ZA 4JI4O 4DR6O 2ZD9A 1WA8A 4FFBA 4DR7B 4HNAA 1ZL8A 4B3TO 3JD3A 3JD1A 2LGWA 4Q6GA 5LBQA 1GH6A 1QVGU 2QWPB 2IJHA 1PNMA 1MSDA 4F6RB 4XDLA 2FL4A 4LFAB 3CSXA 2ADQB 3KKYA 3UO3A 2BE3A 1YITV 2JEUA 3LDCA 3LSSA 3K5MA 3F7VC 2Q7HA 5FL7G 1K3EA 4YXWG 4U7NA 5BXZA 4DV7O 3P3PA 4FLYA 3OEHG 4I5SA 3AEIA 5GW7A 3CXCU 2HVJC 1K4DC 2QWRB 4DV4O 4NTXA 4NXMO 2KG7A 1K73W 4NVPA 2A06H 2IBZH 3CCMV 3RYFA 1URFA 1KP2A 4KP4A 3JASA 4LFCB 3K5LA 3OR7C 2ZKOA 3BA9A 1WN7A 1XREA 1JCHA 5AG2A 1S76D 1W0JG 2CH7B 1Y74A 2N04A 3RWRD 1LNQA 2Q69A 1DF5A 3UO2A 2EJRA 1ZLZA 4UB8Z 4UCOA 2QE7G 3G6EV 1N0NA 1XI1A 2VWKA 2Q7GA 1XMQB 2QEXV 3BEHA 1JPXA 2XHBA 4DR7O 2OCHA 2HJFC 3H01A 3SPJA 3SYQA 3H1JH 4X89A 2WLLB 1G6UA 3G6BA 4CH4A 4NYKA 3CCRV 3ZIAG 3BA8A 3VBBA 3ABKB 2JGDB 1XHZA 4JZ2A 4ZHQA 4X1KB 3BPZA 1AILA 2AHYA 2L6LA 2IJJA 4RQFA 4O4IA 3F5TA 2FMLA 2QWOB 1M4UA 3FB6C 4BAYA 1V9PA 3OTOB 2CK3G 3RW0A 3MHHC 2P7TC 1TUBA 5DEDA 3BVOA 1R6KA 2Q5ZA 4B3MO 1R3JC 1SA0B 1XMOO 3L73H 4QE7A 2GBOA 1N34O 3SR2C 1PM9A 5B1OA 4LF7O 4R7CA 3JAWA 3OMAB 4K0KB 3T1HB 1TAEA 3EXAA 4B3RO 3AG1C 1K7DA 1BCCH 4YY3O 4DV3O 3JSNA 3QO5A 4GCZA 5FNVA 3SJBC 4LF8O 4OX9B 4UCVA 1EZJA 2ITCC 2YDEA 1P84F 1S77D 5K1PA 5IJ9A 1WP8A 5L3GA 1AP5A 3SYAA 2ARHA 2QM7A 4ZI7B 2NN4A 4LF8B 1N32B 3E22A 3ASNC 4OPHA 5KUKA 4MTGA 2UU9B 5EYPA 5H6RA 1QU7A 1D5NA 2ZE7A 1S5HC 1WB8A 4DXWA 5KA6A 4TUYB 2CGNA 1N33B 1Y76A 1VQ8V 1AI5A 4FVMA 1W2BU 3ABLB 1THZA 4FM0A 3X2QB 3JSLA 4XDJA 3STLC 1W59A 2HP8A 4GKJB 3IJ4A 2ZQMA 3H9VA 4JAVA 1R73A 2RJZA 4HBNA 4LF4O 3ZJZA 4DV5O 2NR5A 2HLDG 2YS8A 1OV9A 1RPOA 4K3AA 1MSWD 1SRYA 5CA1B 1K92A 2DQ3A 5KHHA 4O2AA 1XNQB 5IWAB 2UXBB 2B5UA 3FB8C 3AG2B 3Q4HB 2ZR3A 1N36B 1YDXA 5KHJA 1UPGA 4JTAB 3DSQA 1KYOF 3RYFB 2PI4A 4TV9B 4JI6O 3ASOB 3SYOA 2ZIOA 2OCCC 2YICA 3Q4HA 5IJ0B 4JGSA 4PDLA 4GX5A 4J41A 4O4LA 5GONB 3OUFA 1QLNA 1Q6HA 4DV1B 2IM9A 3ZHTA 1VARA 2Y0PA 1AI4A 4XDKA 3ABKC 3RT3C 1NS1A 4ZKIA 1S72V 1GRJA 1GM7A 4LF5B 3VQYA 3IFXA 2W0FC 2YIDA 4GZRB 2FTKA 4LP8A 4PV1B 5FPOA 1XUQA 4H33A 3K9SA 2UXDO 2KG7B 1NBMG 1WPBA 2F66C 3JAMN 3E83A 5B1BB 1BGYH 2ADPA 3CYOA 1YI2V 4YJ2A 2WWWA 1KB9F 3W7SA 1OCOB 1Z2GA 1K97A 1O9HA 5JQGB 1IBKO 5LGUA 3JARA 3ZRVA 1RM1C 2XAHA 3R66A 1ORQC 2OWOA 3W7TA 4CH3A 4JAUA 1GN2A 2ZNJA 2H3OA 4E2LA 3AG4C 4JI2O 1M1KW 3JD2A 4MW3A 4JV5B 1Y67A 2E74B 2P67A 1JOYA 3M7MX 4PI0A 3SJQC 4X62B 4B7EA 2F4VO 4X1KA 2UXCO 3WG7B 4JYBA 4DR3B 1HR0B 2R9IA 2EIKB 2Q0OC 2BCCH 2X6BA 1NTMH 4CBCA 1RPRA 1EBOA 2E5LO 4UCTA 3G4SV 1EZVH 3ICXA 4JI3B 1KD1W 2ZNIA 2CTRA 2XAGA 1QBZA 3J80N 4IHJB 4Z1VA 1Z5WA 1SQBH 4B3SO 4LFBB 1SETA 5CA0A 1B06A 4DV0O 4TUYA 4RUEA 2OTJV 2M6YA 2P4VA 1TUEB 5J2UB 4BIUA 3OEEG 1I5YA 4JI1B 1R6NA 3CXHF 2JS3A 4FFBB 4JYAO 1HP8A 4GUNA 2QKSA 5IJ9B 4P9PA 2VWJA 3FKSG 4I55B 1RM1B 1Q82W 4O2AB 2EBOA 5LGTA 1US6A 3RYCB 5D5PA 1NQTA 5E79Z 5LHIA 1VMGA 2BOCC 3OMNB 2JRIA 3WB1A 3QO7A 5CB4B 1IVSA 2IH3C 1M57C 5B1AC 3SYPA 2GSMB 3ZMVA 1SESA 3HKEB 1FAFA 3ZHSA 3ABLC 4AQYB 5JJEB 3CRCA 4LF4B 5ITZB 4MVUA 1Q90D 4MSWC 1YEWA 5LXTB 4CZZA 2LW7A 5LA6A 1SQQH 4AI8A 4NXNB 5CBGA 3JASB 4R6ZA 4IGGA 2HKOA 4BIOA 4L87A 5JCOA 4WFEA 3ZN0A 1E1QG 1WAZA 2CH7A 2PUSA 5TISZ 3L74H 5LXTA 3ETGA 4J11A 1XOUA 1FFTB 1JJOA 4LFBO 4P30A 2HHHB 1DTOA 1GK9A 3CRAA 3RYIB 2VS0A 1VP7A 5H9CA 3RGBA 1B6QA 2UXNA 2QR4A 4WFHA 2B9ZA 4QJFB 3BY6A 3UT5A 2XASA 1AVMA 3DTUB 1DLBA 3T1CA 2JGDA 3K3WA 3SDLA 3K08A 1F4NA 1KU9A 3HKBB 1XNRO 4J7JA 1H2GA 2ZM6O 5BMVA 5IYCO 2Q73A 1TUBB 1Y6XA 3K5OA 1GM9A 2WLKA 1Q5OA 2IH1C 2R9RB 1AR5A 4FLVA 2YIBD 1SF9A 4O4HA 1CPYA 3HKBA 2OYQA 2QM4A 2UUBB 4JI8O 2QDOA 4JI0O 1HNXO 3W7XA 2WSSG 2CAZC 2PF4E 1H2SB 4TV8A 4ABMA 1HNZO 4BIZA 1OCRC 2W6IG 3OT7A 5CBHA 1FS0G 3JARB 1Q7YW 1BSMA 4DV6O 1ROPA 3O9OA 1S0VA 1N4CA 1JFFA 1OCOC 3E89A 3L75H 3ZRWB 3OE7G 4WBNB 2W6JG 3GWOA 4O4IB 3TXSA 2VQFB 5FLXN 5A2QN 2RNBA 1O9GA 3D36C 4Z1MG 1GTOA 3UQ8A 4WFBV 3K59A 5BR8B 3LSUA 3ABTA 4A5UB 3ZCCA 3JCUZ 2PYJA 4MVQA 4HZ3A 1AR4A 3AK2A 3SPIA 4LBEC 5JJJB 4U7OA 2PY5A 1YVWA 2LFSA 3D3QA 1I94O 2P4KA 1LUWA 3CE2A 2QGNA 4JPRA 2X6CA 4PHZA 2Q7EA 3LNNA 3K06A 5IYBO 3E8BA 3G71V 2EZOA 1HR0O 1Q6UA 1VF6A 5IYZB 5L3DA 1SS3A 4JI1O 3L71H 1H2LA 4WF9V 4DV4B 4JYYA 4OXSA 4HYOA 1IX9A 2EILC 1YXBA 2DJVA 3APQA 1SQPH 5B5EZ 1WPXA 3NR7A 3D3IA 1HNXB 2RQ6A 4DV7B 4I50A 1EM1A 1RFYA 2Y69C 1IBMB 1QNMA 3W7UA 1MZFA 4I9WA 1MABG 2CTWA 4UCSA 3CRQA 1NKDA 2D2CB 5LA6B 2GUZA 3E8FA 4WFFA 4FLZA 4O2BB 1NVPD 4DR6B 1TA8A 1H8HG 1WA8B 4MVMA 2QWQB 3LDEA 5CB4A 1XHXA 1M57B 2QKAA 1BQZA 3R65A 2YIBA 1P7GA 2FYUH 3CCEV 4PA9A 5KAIZ 3K58A 1K8AW 1BQ0A 4LH7A 1R3IC 4O2BA 4B3MB 1KBHA 2K1EA 3CC4V 2ZDIA 3I55V 3DXRB 1LUVA 1Q6IA 1U96A 5IYDO 1MOFA 3CCUV 3SJCC 5K1XA 4DK1A 4KUMA 2HHHO 1A32A 3ASNB 3CRMA 1MZEA 1RSOB 2GTAA 4R8CA 1V55C 1X59A 2JEXA 4FJCC 4YY3B 4DV3B 1XILA 3TK1A 3CJHB 4X1IA 2RDCA 1GMGA 1KP3A 5IJ0A 2Q67A 1P7BA 3DXRA 3ZMZA 4BW5A 3SGIA 3N2GB 4X20A 5B3SC 1ZWIC 4QE9A 3OUSA 2ZR2A 1HDJA 3K5NA 2AZ2A 2LJ2A 2XTAA 3FX7A 4LNUB 1YIJV 5LYJB 3OTOO 4JYAB 5KAFZ 3CCJV 4IL6Z 2KSDA 1Y4MA 1PPJH 2BSKB 4UFZA 5IY5B 4J9YB 5EBLC 2UXBO 4IIJA 4PA6A 1JFFB 1EN5A 1M90W 1GKFA 2ZE8A 3ZMUA 2XAFA 3IC9A 3ETDA 4ICGA 5KX5B 1FJGB 3KG2A 1AJPA 1AR1B 2VQFO 3HR0A 3BRCA 5B1AB 3F5WC 1E79G 3OW2U 1YJ9V 4JI0B 3ZHUA 3M99B 1NI8A 2LQTA 1N33O 3ML0A 1MMMA 2P6JA 1L1FA 2Y48A 5DM6V 5C93A 5IE9A 2LW1A 3E22B 1WLEA 3FD9A 2B1GA 3RN4A 5HFLA 2UUBO 3AG7A 3S3WA 5IDJA 4U3JA 1IBLB 4I4TB 4GX1A 5IYZA 1NR1A 5LL6Y 2JK5C 1QR8A 2F43G 2IU3A 2HFEC 4O4JB 2ZM6B 1YHQV 4YIPA 2ODMA 4E4EA 2EINB 1JJ2U 3KCYA 3H1IH 1J5EO 1AP6A 1CXZB 4F4LA 2XAQA 3A0BZ 5CA0B 5F2VO 3C90A 4W4KA 1QLEB 1VQ7V 2L35A 1H2NA 3ZBHA 4WFAV 1SQVH 4F6RA 2PI5A 4KFMA 1K5QA 1FD9A 4GX2A 2QKCA 1TVKA 4J10A 4ASUG 2MK3A 2GDSA 4BWAA 4JI2B 1HNWB 1Q81W 3ZRXA 1EN4A 1VF7A 2HVKC 1IBLO 5H5NA 4LF5O 1VIBA 4CH5A 3AG3C 3S3XA 3P32A 4KL1A 4K8XA 4LF6O 3K0GA 2E76B 4FM2A 2H8PC 4RAIA 1F51A 5CA3A 5L3BA 1R1BA 5H6QA 1XEQA 1SQFA 4IYHA 5B66Z 3OGIB 1QR9A 1JA8A 2FKXA 5D5QA 1QCEA 4NXNO 2RN9A 1KQSU 2DWEC 5JWPA 1AB3A 3IGAC 4MTOA 2EZPA 1NVPB 3RFRA 1JX9A 1I94B 5CA1A 2ZCEA 2UXDB 3HKEA 3RYIA 1P4RA 1GAXA 1E1RG 4AQYO 1I0HA 2JGUA 2RCVA 3QTCA 5H2FZ 2EIMB 1SZXA 3K0DA 1VQ4V 1GN4A 3W7WA 4MTFA 2YC0A 1SQXH 5IWAO 1NH2D 2XAJA 4DV1O 3P3NA 4RWUA 2YEVB 1JVMA 1EN6A 1XQ8A 4OGQB 2F95B 2QM8A 2WLHA 2YXLA 3OR6C 4DR4B 3IAYA 3T1YO 2PGGA 1LR1A 4MW8A 1GO3F 4GKJO 1XNQO 2A3QA 2DQ0A 2EIJC 4X65O 4QPKA 2HR3A 3WG7C 3D36A 3ZHQA 3HB3B 2R70A 3B4SA 4UV9A 4DR4O 4PDRA 3JAKA 1YZBA 3QG5A 2ATKC 3ZEDA 3E8GA 2GHYA 3JYCA 4X65B 4TOIA 4TV8B 3BFRA 4X9QA 4DR1O 1AI6A 2HG5C 2Q8VA 4PELA 1QQCA 5C8YA 4P9OA 4JI5B 1OCZB 3LNMB 3TXQA 2PTMA 2EILB 4DW0A 5KHGA 4WCEV 5JVDB 3X2QC 4WBNA 1KKDA 2ZT9B 2OT5A 3JAKB 4JI3O 3JAWB 4J80A 4DYLA 1K5SA 4LNUA 2DOSA 1YJWV 5LYJA 2BTQA 5B1BC 4PDVA 1WJZA 1MNGA 3RYHA 2ZE5A 4CH6A 4PA7A 4TWKA 5KMGA 1S5LZ 3E8HA 2JIZG 2ILMA 4U3JB 1YTFD 1SKVA 4FZ1A 3CB2A 4GT1A 1GM8A 1L8DA 2R9AA 1DF4A 1G4YB 2Y4UA 4JZGA 2DYRC 1F4MA 1JMKC 3OTFA 2G38A 3KZIZ 4F6EA 2F23A 1OCCB 4EFBA 1F23A 3SPCA 1D2DA 1J5EB 2EIKC 2BOBC 1V54B 4JI7B 1VQNV 1NH2B 1PKXA 2UUCO 3EVKA 4OX9O 3KCXA 3RVZA 1S3JA 1X4TA 4PJ0Z 4FM1A 2UXCB 4JAAA 5EC1C 4BW9A 3F7YC 3L70H 2AHZA 1GN6A 4DR5B 5CBFA 4RUFA 2B1IA 5GTIZ 1DK1A 5GTHZ 2ZDIC 2JS5A 2E3CA 3N2KA 5B3SB 4EKWA 4X1YB 1MA1A 4PA3A 5ITZA 3CX5F 3ZMTA 3FAVA 4K35A 5EC2C 4MVRA 1YSCA 3CPWU 5JH7B 4P2ZA 5DECA 2NLJC 3JALA 2Y4TA 4PD4F 3A0RA 4I0XA 4JF3A 1FYJA 4EB6B 5CMUA 5LMUB 3HPLC 1TVKB 3FAVB 5KHIA 1SC5B 1XMOB 5EZYA 3AK1A 4H37A 4DRXA 1GN3A 3TCUA 4DUYB 4I50B 3E2EA 4I9QA 2KKWA 3T1YB 3B77A 1FJGO 1ZUQA 1M5IA 2A7WA 1RSOA 3WFVA 2V4DA 5LP6B 4H0LB 4QGPA 2WLJA 2UXXA 4EB6A 2C2AA 4NTWA 3H1HH 4X64O 2XT9A 4LFCO 4MVSA 1VF6C 3WB0A 3U11A 1Y66A 2W0XA 2EX3A 3CC7V 1F7YA 4JASA 2E5LB 3CHXA 5LP6A 1FKAO 1HNZB 2ZE6A 2OTLV 3CRRA 3K03A 3GVMA 3JATA 3VQXA 3G67A 2WLLA 2FB5A 2N05A 3STZC 2P22C 1N36O 4LR3A 4IT5A 3A8TA 4JI4B 1JQ0A 5EK0A 1PNLA 4O4LB 3THOA 4B3RB 2MW2B 1KMIZ 1BE3H 4PDMA 4DUZO 2A0LA 1T5EA 1VQMV 2RMKB 5BR8O 1Z5VA 5KUMA 5LHHA 5EIBC 1R6TA 1R3KC 4DR2B 4DUZB 1VQ5V 1N0JA 4JTCB 4UVBA 3HKDA 5LMNO 3N2GA 3VOUA 1YF2A 4NTYA 2WAMA 3AK3A 2VRZA 4FLWA 2VQEO 1AROP 1BL8A 4UV8A 2K9PA 3T4DA 1V54C 2N74A 5EBWC 5KLVH 2OIGA 1OJHA 4NB5A 3FYEB 2YSUB 1XL4A 3DC5A 5C8YB 1IBMO 4MTXA 2VQEB 3L9DA 3DC6A 4ZOLA 2QA4V 2Z3YA 3ZHVA 1BHAA 4LFAO 1EFRG 3D8CA 4D7TA 4TQDA
chains in the Genus database with same CATH topology
2UU9O 2UUAO 3J7AU 5BY1A 5FLXN 5A2QN 4DR5O 5BXZA 4DV7O 4B3RO 4AQYO 4JI6O 4X62O 4DUYO 4YY3O 4DV3O 2AGAA 4DR2O 2E5LO 4X64O 4LF8O 4LFCO 2UUBO 4DV4O 4NXMO 4A5UB 3J80N 4LFBO 1D2DA 4B3SO 5IWAO 4DV1O 2HHHO 1A32A 4DV0O 4X66O 1F7YA 4GKKO 4JI7O 2UUCO 3RT3C 1NS1A 1FKAO 4OX9O 5LL6Y 4KHPO 5IT9N 1X59A 2ZKOA 4YHHO 1G1XB 1N32O 3T1YO 4DV2O 5LMUO 1N36O 4OPHA 4GKJO 1I94O 1XNQO 2UXDO 1J5EO 4X65O 2Z0AA 4JYAO 3SDLA 4JI5O 4OPAA 3JAMN 1HNWO 4DR4O 4DUZO 1DK1A 4LF9O 1YZBA 1HR0O 4DR7O 4JI1O 1XNRO 5BR8O 2ZM6O 3T1HO 3OTOO 3O65A 1R6TA 2DJVA 4JV5O 1IBKO 4DR1O 2JRIA 4JI4O 1XMQO 4DR6O 2UXBO 5LMNO 4LF4O 4DV5O 3R66A 1IBLO 4B3TO 5H5NA 1AILA 4LF5O 4LF6O 1KUQA 3J81N 3F5TA 4JI3O 4JI8O 4JI0O 2VQEO 1HNXO 4JI2O 1FYJA 2DOSA 1R1BA 1XEQA 1HNZO 2N74A 2FKXA 3M8AA 2VQFO 4NXNO 4B3MO 4K0KO 1XMOO 1IBMO 2F4VO 4DV6O 1AB3A 1N34O 2UXCO 4DR3O 1FJGO 4LFAO 1N33O 2LW7A 4LF7O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 O;  2UUA O;  3J7A U;  5BY1 A;  5FLX N;  5A2Q N;  4DR5 O;  5BXZ A;  4DV7 O;  4B3R O;  4AQY O;  4JI6 O;  4X62 O;  4DUY O;  4YY3 O;  4DV3 O;  2AGA A;  4DR2 O;  2E5L O;  4X64 O;  4LF8 O;  4LFC O;  2UUB O;  4DV4 O;  4NXM O;  4A5U B;  3J80 N;  4LFB O;  1D2D A;  4B3S O;  5IWA O;  4DV1 O;  2HHH O;  1A32 A;  4DV0 O;  4X66 O;  1F7Y A;  4GKK O;  4JI7 O;  2UUC O;  3RT3 C;  1NS1 A;  1FKA O;  4OX9 O;  5LL6 Y;  4KHP O;  5IT9 N;  1X59 A;  2ZKO A;  4YHH O;  1G1X B;  1N32 O;  3T1Y O;  4DV2 O;  5LMU O;  1N36 O;  4OPH A;  4GKJ O;  1I94 O;  1XNQ O;  2UXD O;  1J5E O;  4X65 O;  2Z0A A;  4JYA O;  3SDL A;  4JI5 O;  4OPA A;  3JAM N;  1HNW O;  4DR4 O;  4DUZ O;  1DK1 A;  4LF9 O;  1YZB A;  1HR0 O;  4DR7 O;  4JI1 O;  1XNR O;  5BR8 O;  2ZM6 O;  3T1H O;  3OTO O;  3O65 A;  1R6T A;  2DJV A;  4JV5 O;  1IBK O;  4DR1 O;  2JRI A;  4JI4 O;  1XMQ O;  4DR6 O;  2UXB O;  5LMN O;  4LF4 O;  4DV5 O;  3R66 A;  1IBL O;  4B3T O;  5H5N A;  1AIL A;  4LF5 O;  4LF6 O;  1KUQ A;  3J81 N;  3F5T A;  4JI3 O;  4JI8 O;  4JI0 O;  2VQE O;  1HNX O;  4JI2 O;  1FYJ A;  2DOS A;  1R1B A;  1XEQ A;  1HNZ O;  2N74 A;  2FKX A;  3M8A A;  2VQF O;  4NXN O;  4B3M O;  4K0K O;  1XMO O;  1IBM O;  2F4V O;  4DV6 O;  1AB3 A;  1N34 O;  2UXC O;  4DR3 O;  1FJG O;  4LFA O;  1N33 O;  2LW7 A;  4LF7 O; 
#chains in the Genus database with same CATH topology
 2AXT Z;  3J7A U;  1Q8I A;  3UCS C;  2DW4 A;  4GLX A;  3K04 A;  4N23 A;  2Q9L A;  1OCZ C;  5EBM C;  1YTF B;  2BTQ B;  1OCR B;  4DR2 O;  1VQL V;  4B3T B;  3B40 A;  1JR9 A;  4D6T H;  3H1K H;  4DO2 A;  5EYP B;  2GV9 A;  3VQW A;  5A9G A;  4IYI A;  4JYC A;  1VF5 B;  1M93 A;  1AI7 A;  4J7K A;  1R3L C;  2WA4 A;  3QF7 A;  3GWK C;  5LOV A;  1N34 B;  3LUT B;  4DV2 O;  2IJK A;  3RBZ A;  3OAA G;  1NU1 H;  2D3O W;  2HEP A;  3ZS8 C;  1XL6 A;  5JH7 A;  1I7F A;  3CCQ V;  2LGQ A;  4OPA A;  3JAL B;  3CEI A;  4MT8 A;  5BZB A;  2BTO A;  4FPP A;  1IZ3 A;  2DYR B;  3A0H Z;  1B04 A;  4MVO A;  4NXM B;  1BT8 A;  3MAQ A;  5LOV B;  1SQG A;  4FMT A;  4YIO A;  4GX0 A;  3PN1 A;  2ZIN A;  1SZT A;  1XBL A;  2P06 A;  1L0L H;  4DRX B;  4GYC B;  1P49 A;  4G27 B;  3L72 H;  4DV5 B;  1Q3E A;  4LF9 B;  2XOK G;  5L3C A;  3WU2 Z;  4UVA A;  4I55 A;  1CEZ A;  1HW7 A;  2X0L A;  5LP6 C;  2V1D A;  2JJ2 G;  1ENV A;  4UB6 Z;  1H2K A;  4X8A A;  3EFF K;  3LSQ A;  1K9M W;  4FIP C;  4FK5 C;  2Y69 B;  3B2E E;  4DR3 O;  2AW9 A;  4YJ3 B;  1AJN A;  2LFR A;  3B09 A;  1VQ9 V;  4I0X B;  4TT3 G;  1VQP V;  2GUZ B;  1NT2 B;  1XNR B;  3T2M A;  3FFQ A;  1PP9 H;  3CJH A;  4X1I B;  3SYC A;  1J95 A;  3MDS A;  5EZY B;  2P5O A;  2Q68 A;  2DYS B;  2YXY A;  4W4L A;  5KA5 A;  4YHH B;  4X20 B;  1VEW A;  2DN9 A;  3ABM C;  4FLU A;  4YJ3 A;  3WB2 A;  4UVC A;  3K79 A;  1S5J A;  3CC2 V;  1Q86 W;  4YJ2 B;  4FLX A;  4JI7 O;  3U10 A;  4KHP O;  2XND G;  5BMV B;  3ASO C;  1PD3 A;  3UKM A;  3JCZ A;  4LF7 B;  2JJ1 G;  3K9A A;  4UUJ C;  2PYL A;  1NJI W;  2QSA A;  2UUC B;  4JI5 O;  2YIA A;  4DV0 B;  5JVD A;  4B7K A;  4UXN A;  4CS4 A;  3CP1 A;  3CMA V;  5LMN B;  5KX5 A;  2ZXW B;  2CDY A;  1IXB A;  2WLI A;  3UT5 B;  1YJN V;  3CCS V;  1SA0 A;  3SPH A;  2OIE A;  2ETN A;  4ZOL B;  3ZRW A;  1KKC A;  1B3Q A;  3CCL V;  2X7R B;  4DV6 B;  2Y0I A;  4Q20 A;  1K4C C;  5LHG A;  1FFX B;  1KEC A;  1OHH G;  1V55 B;  2QTS A;  2Q0A A;  3HKC B;  2JDI G;  3QNE A;  2UUA B;  4LWS B;  1W0K G;  3FB7 C;  5E1A C;  3HKD B;  4RQE A;  4I7Z B;  2EIM C;  3B8N A;  2EIN C;  2PZS A;  4O4H B;  3FB5 C;  3QVN A;  4CC6 A;  3SPG A;  5B1N A;  1FXV A;  4DUY O;  4H13 B;  4L8J A;  4DR1 B;  1VQ6 V;  3HKC A;  2CUG A;  1MG1 A;  2H94 A;  2A79 B;  3JD4 A;  5KMG B;  4NKG B;  3OFN G;  3BHP A;  3FYI B;  1PNK A;  1FXK C;  3PJS K;  4RO2 A;  5LGN A;  2OCC B;  4X66 O;  2CTP A;  3ZN1 A;  3C3S A;  3NXS A;  5IT9 N;  2F1M A;  3BCC H;  5DN6 G;  1I5X A;  3RYC A;  3N2K B;  5J2T A;  2ITD C;  4CS2 A;  2CE4 A;  1ZAU A;  5LMU O;  2CTQ A;  1H38 A;  4EFE A;  1U97 A;  2Z0A A;  4QNH B;  4J42 A;  3IC7 A;  4HNA B;  1HNW O;  1ZSP A;  3TJT A;  3UM7 A;  4B08 A;  1VQO V;  4I4T A;  5L3E A;  3DGE A;  3ETE A;  2IU0 A;  1BZK A;  1FPO A;  4PI2 A;  4DV2 B;  3OGC C;  3O65 A;  1K33 A;  2ZIM A;  1I08 A;  4B3S B;  3CD6 V;  4JV5 O;  3MHS C;  4U3F H;  2WLN A;  2LP7 A;  1NTK H;  2XUM A;  5JJN B;  4AIL C;  1H8E G;  2QJ1 A;  1KC8 W;  1YCI A;  2IJI A;  3E86 A;  1M56 B;  1BMF G;  2F4V B;  4X88 A;  5EIB D;  3LDD A;  2QWN B;  4JI8 B;  1ZX3 A;  1QLE C;  1NZ6 A;  3SJA C;  1Y76 B;  2DYS C;  1M9N A;  4EEQ A;  4FZ0 A;  5IY5 C;  2YI8 A;  4TV9 A;  3CCV V;  3GB7 C;  1BHB A;  1FXH A;  1IDS A;  1D5A A;  4G2K A;  4MVZ A;  3APO A;  2CGO A;  1COW G;  3ZHR A;  4K0K O;  2WLM A;  4R50 A;  1BS3 A;  2EUL A;  2F93 B;  3AG4 B;  1WB7 A;  4ZBM A;  5GON A;  3OM3 B;  1PL0 A;  2DMX A;  2HJD A;  2X6A A;  2Z5U A;  4WFG A;  2DE0 X;  1L0N H;  4G28 B;  1IBK B;  4DK0 A;  5JCO C;  2JVD A;  4HAM A;  4J7Z A;  3MD0 A;  4X62 O;  1FXK B;  2WPD G;  2AGA A;  5KHK A;  3RVY A;  3CWB H;  3AG3 B;  2ZXW C;  3OMI B;  2KQX A;  3BAA A;  1QHT A;  4K8Z A;  1OZ0 A;  4FFK A;  2KB1 A;  4PA4 A;  3I56 V;  2P90 A;  3G80 A;  4GKK O;  1DGS A;  4UCU A;  1FXK A;  4AHC A;  2YI9 A;  1PV0 A;  1G1X B;  1N32 O;  2WLI B;  4XBF A;  1G8M A;  4X64 B;  5CN0 A;  3VQV A;  1CP9 A;  2BSK A;  3TGU H;  4ZIB A;  4IIJ B;  4ZHQ B;  3ABM B;  4X66 B;  1IUR A;  3QO8 A;  4LF9 O;  2QTO A;  3BAB A;  2YEV A;  5L3F A;  4KHP B;  1RP3 B;  2NNU A;  1N8R W;  1FFX A;  4N21 A;  5FPR A;  1SER A;  3JAT B;  1AJQ A;  3I5D A;  3ETQ A;  4LWS A;  3RYH B;  3CME V;  1Y74 B;  1XMQ O;  2Q6A A;  1K34 A;  4Z2W A;  1HWY A;  1IXM A;  1KUQ A;  3J81 N;  4H44 B;  1Q43 A;  4NR1 A;  4UCR A;  2E75 B;  4TSF G;  4DW1 A;  3AG1 B;  1ZTE A;  2AZ0 A;  5JQG A;  3M8A A;  5FNV B;  4LF6 B;  3H1L H;  3B8M A;  2O57 A;  4JI6 B;  2EIJ B;  2EJ7 A;  4J9Z B;  2IW5 A;  3T4Z A;  1QVF U;  4LH6 A;  4CS3 A;  1H2M A;  3N27 A;  4C7U A;  2UU9 O;  2UUA O;  5BY1 A;  4DR5 O;  3P30 A;  2R72 A;  5HFM A;  4FLT A;  3TET A;  5J2T B;  4QPJ A;  3CS5 A;  4ZI7 A;  2A9H A;  4GKK B;  2V7Q G;  3ZMS A;  1VQK V;  2WA3 A;  2GTS A;  4CC5 A;  3C3T A;  1WNS A;  1NTZ H;  3ZRS A;  2DWD C;  3E35 A;  1WP7 A;  1M56 C;  4MS2 A;  2Q4P A;  3ZX6 A;  4X1Y A;  4YHH O;  4LC1 A;  1NR7 A;  4QIW F;  2LO1 A;  2M7W A;  1OCC C;  1PL4 A;  4IHJ A;  3OD4 A;  1ZL8 B;  3EHB B;  1UJW B;  2YUA A;  4JTD B;  4LCU C;  5J9P C;  1XDC A;  3K57 A;  1TGO A;  3A2F A;  3JD0 A;  3T1H O;  3ABU A;  4O4J A;  2YXH A;  5J2U A;  1UFI A;  4BR6 A;  3AG2 C;  4D7S A;  4KXR A;  4TQF A;  3U0Z A;  4JI4 O;  4DR6 O;  2ZD9 A;  1WA8 A;  4FFB A;  4DR7 B;  4HNA A;  1ZL8 A;  4B3T O;  3JD3 A;  3JD1 A;  2LGW A;  4Q6G A;  5LBQ A;  1GH6 A;  1QVG U;  2QWP B;  2IJH A;  1PNM A;  1MSD A;  4F6R B;  4XDL A;  2FL4 A;  4LFA B;  3CSX A;  2ADQ B;  3KKY A;  3UO3 A;  2BE3 A;  1YIT V;  2JEU A;  3LDC A;  3LSS A;  3K5M A;  3F7V C;  2Q7H A;  5FL7 G;  1K3E A;  4YXW G;  4U7N A;  5BXZ A;  4DV7 O;  3P3P A;  4FLY A;  3OEH G;  4I5S A;  3AEI A;  5GW7 A;  3CXC U;  2HVJ C;  1K4D C;  2QWR B;  4DV4 O;  4NTX A;  4NXM O;  2KG7 A;  1K73 W;  4NVP A;  2A06 H;  2IBZ H;  3CCM V;  3RYF A;  1URF A;  1KP2 A;  4KP4 A;  3JAS A;  4LFC B;  3K5L A;  3OR7 C;  2ZKO A;  3BA9 A;  1WN7 A;  1XRE A;  1JCH A;  5AG2 A;  1S76 D;  1W0J G;  2CH7 B;  1Y74 A;  2N04 A;  3RWR D;  1LNQ A;  2Q69 A;  1DF5 A;  3UO2 A;  2EJR A;  1ZLZ A;  4UB8 Z;  4UCO A;  2QE7 G;  3G6E V;  1N0N A;  1XI1 A;  2VWK A;  2Q7G A;  1XMQ B;  2QEX V;  3BEH A;  1JPX A;  2XHB A;  4DR7 O;  2OCH A;  2HJF C;  3H01 A;  3SPJ A;  3SYQ A;  3H1J H;  4X89 A;  2WLL B;  1G6U A;  3G6B A;  4CH4 A;  4NYK A;  3CCR V;  3ZIA G;  3BA8 A;  3VBB A;  3ABK B;  2JGD B;  1XHZ A;  4JZ2 A;  4ZHQ A;  4X1K B;  3BPZ A;  1AIL A;  2AHY A;  2L6L A;  2IJJ A;  4RQF A;  4O4I A;  3F5T A;  2FML A;  2QWO B;  1M4U A;  3FB6 C;  4BAY A;  1V9P A;  3OTO B;  2CK3 G;  3RW0 A;  3MHH C;  2P7T C;  1TUB A;  5DED A;  3BVO A;  1R6K A;  2Q5Z A;  4B3M O;  1R3J C;  1SA0 B;  1XMO O;  3L73 H;  4QE7 A;  2GBO A;  1N34 O;  3SR2 C;  1PM9 A;  5B1O A;  4LF7 O;  4R7C A;  3JAW A;  3OMA B;  4K0K B;  3T1H B;  1TAE A;  3EXA A;  4B3R O;  3AG1 C;  1K7D A;  1BCC H;  4YY3 O;  4DV3 O;  3JSN A;  3QO5 A;  4GCZ A;  5FNV A;  3SJB C;  4LF8 O;  4OX9 B;  4UCV A;  1EZJ A;  2ITC C;  2YDE A;  1P84 F;  1S77 D;  5K1P A;  5IJ9 A;  1WP8 A;  5L3G A;  1AP5 A;  3SYA A;  2ARH A;  2QM7 A;  4ZI7 B;  2NN4 A;  4LF8 B;  1N32 B;  3E22 A;  3ASN C;  4OPH A;  5KUK A;  4MTG A;  2UU9 B;  5EYP A;  5H6R A;  1QU7 A;  1D5N A;  2ZE7 A;  1S5H C;  1WB8 A;  4DXW A;  5KA6 A;  4TUY B;  2CGN A;  1N33 B;  1Y76 A;  1VQ8 V;  1AI5 A;  4FVM A;  1W2B U;  3ABL B;  1THZ A;  4FM0 A;  3X2Q B;  3JSL A;  4XDJ A;  3STL C;  1W59 A;  2HP8 A;  4GKJ B;  3IJ4 A;  2ZQM A;  3H9V A;  4JAV A;  1R73 A;  2RJZ A;  4HBN A;  4LF4 O;  3ZJZ A;  4DV5 O;  2NR5 A;  2HLD G;  2YS8 A;  1OV9 A;  1RPO A;  4K3A A;  1MSW D;  1SRY A;  5CA1 B;  1K92 A;  2DQ3 A;  5KHH A;  4O2A A;  1XNQ B;  5IWA B;  2UXB B;  2B5U A;  3FB8 C;  3AG2 B;  3Q4H B;  2ZR3 A;  1N36 B;  1YDX A;  5KHJ A;  1UPG A;  4JTA B;  3DSQ A;  1KYO F;  3RYF B;  2PI4 A;  4TV9 B;  4JI6 O;  3ASO B;  3SYO A;  2ZIO A;  2OCC C;  2YIC A;  3Q4H A;  5IJ0 B;  4JGS A;  4PDL A;  4GX5 A;  4J41 A;  4O4L A;  5GON B;  3OUF A;  1QLN A;  1Q6H A;  4DV1 B;  2IM9 A;  3ZHT A;  1VAR A;  2Y0P A;  1AI4 A;  4XDK A;  3ABK C;  3RT3 C;  1NS1 A;  4ZKI A;  1S72 V;  1GRJ A;  1GM7 A;  4LF5 B;  3VQY A;  3IFX A;  2W0F C;  2YID A;  4GZR B;  2FTK A;  4LP8 A;  4PV1 B;  5FPO A;  1XUQ A;  4H33 A;  3K9S A;  2UXD O;  2KG7 B;  1NBM G;  1WPB A;  2F66 C;  3JAM N;  3E83 A;  5B1B B;  1BGY H;  2ADP A;  3CYO A;  1YI2 V;  4YJ2 A;  2WWW A;  1KB9 F;  3W7S A;  1OCO B;  1Z2G A;  1K97 A;  1O9H A;  5JQG B;  1IBK O;  5LGU A;  3JAR A;  3ZRV A;  1RM1 C;  2XAH A;  3R66 A;  1ORQ C;  2OWO A;  3W7T A;  4CH3 A;  4JAU A;  1GN2 A;  2ZNJ A;  2H3O A;  4E2L A;  3AG4 C;  4JI2 O;  1M1K W;  3JD2 A;  4MW3 A;  4JV5 B;  1Y67 A;  2E74 B;  2P67 A;  1JOY A;  3M7M X;  4PI0 A;  3SJQ C;  4X62 B;  4B7E A;  2F4V O;  4X1K A;  2UXC O;  3WG7 B;  4JYB A;  4DR3 B;  1HR0 B;  2R9I A;  2EIK B;  2Q0O C;  2BCC H;  2X6B A;  1NTM H;  4CBC A;  1RPR A;  1EBO A;  2E5L O;  4UCT A;  3G4S V;  1EZV H;  3ICX A;  4JI3 B;  1KD1 W;  2ZNI A;  2CTR A;  2XAG A;  1QBZ A;  3J80 N;  4IHJ B;  4Z1V A;  1Z5W A;  1SQB H;  4B3S O;  4LFB B;  1SET A;  5CA0 A;  1B06 A;  4DV0 O;  4TUY A;  4RUE A;  2OTJ V;  2M6Y A;  2P4V A;  1TUE B;  5J2U B;  4BIU A;  3OEE G;  1I5Y A;  4JI1 B;  1R6N A;  3CXH F;  2JS3 A;  4FFB B;  4JYA O;  1HP8 A;  4GUN A;  2QKS A;  5IJ9 B;  4P9P A;  2VWJ A;  3FKS G;  4I55 B;  1RM1 B;  1Q82 W;  4O2A B;  2EBO A;  5LGT A;  1US6 A;  3RYC B;  5D5P A;  1NQT A;  5E79 Z;  5LHI A;  1VMG A;  2BOC C;  3OMN B;  2JRI A;  3WB1 A;  3QO7 A;  5CB4 B;  1IVS A;  2IH3 C;  1M57 C;  5B1A C;  3SYP A;  2GSM B;  3ZMV A;  1SES A;  3HKE B;  1FAF A;  3ZHS A;  3ABL C;  4AQY B;  5JJE B;  3CRC A;  4LF4 B;  5ITZ B;  4MVU A;  1Q90 D;  4MSW C;  1YEW A;  5LXT B;  4CZZ A;  2LW7 A;  5LA6 A;  1SQQ H;  4AI8 A;  4NXN B;  5CBG A;  3JAS B;  4R6Z A;  4IGG A;  2HKO A;  4BIO A;  4L87 A;  5JCO A;  4WFE A;  3ZN0 A;  1E1Q G;  1WAZ A;  2CH7 A;  2PUS A;  5TIS Z;  3L74 H;  5LXT A;  3ETG A;  4J11 A;  1XOU A;  1FFT B;  1JJO A;  4LFB O;  4P30 A;  2HHH B;  1DTO A;  1GK9 A;  3CRA A;  3RYI B;  2VS0 A;  1VP7 A;  5H9C A;  3RGB A;  1B6Q A;  2UXN A;  2QR4 A;  4WFH A;  2B9Z A;  4QJF B;  3BY6 A;  3UT5 A;  2XAS A;  1AVM A;  3DTU B;  1DLB A;  3T1C A;  2JGD A;  3K3W A;  3SDL A;  3K08 A;  1F4N A;  1KU9 A;  3HKB B;  1XNR O;  4J7J A;  1H2G A;  2ZM6 O;  5BMV A;  5IYC O;  2Q73 A;  1TUB B;  1Y6X A;  3K5O A;  1GM9 A;  2WLK A;  1Q5O A;  2IH1 C;  2R9R B;  1AR5 A;  4FLV A;  2YIB D;  1SF9 A;  4O4H A;  1CPY A;  3HKB A;  2OYQ A;  2QM4 A;  2UUB B;  4JI8 O;  2QDO A;  4JI0 O;  1HNX O;  3W7X A;  2WSS G;  2CAZ C;  2PF4 E;  1H2S B;  4TV8 A;  4ABM A;  1HNZ O;  4BIZ A;  1OCR C;  2W6I G;  3OT7 A;  5CBH A;  1FS0 G;  3JAR B;  1Q7Y W;  1BSM A;  4DV6 O;  1ROP A;  3O9O A;  1S0V A;  1N4C A;  1JFF A;  1OCO C;  3E89 A;  3L75 H;  3ZRW B;  3OE7 G;  4WBN B;  2W6J G;  3GWO A;  4O4I B;  3TXS A;  2VQF B;  5FLX N;  5A2Q N;  2RNB A;  1O9G A;  3D36 C;  4Z1M G;  1GTO A;  3UQ8 A;  4WFB V;  3K59 A;  5BR8 B;  3LSU A;  3ABT A;  4A5U B;  3ZCC A;  3JCU Z;  2PYJ A;  4MVQ A;  4HZ3 A;  1AR4 A;  3AK2 A;  3SPI A;  4LBE C;  5JJJ B;  4U7O A;  2PY5 A;  1YVW A;  2LFS A;  3D3Q A;  1I94 O;  2P4K A;  1LUW A;  3CE2 A;  2QGN A;  4JPR A;  2X6C A;  4PHZ A;  2Q7E A;  3LNN A;  3K06 A;  5IYB O;  3E8B A;  3G71 V;  2EZO A;  1HR0 O;  1Q6U A;  1VF6 A;  5IYZ B;  5L3D A;  1SS3 A;  4JI1 O;  3L71 H;  1H2L A;  4WF9 V;  4DV4 B;  4JYY A;  4OXS A;  4HYO A;  1IX9 A;  2EIL C;  1YXB A;  2DJV A;  3APQ A;  1SQP H;  5B5E Z;  1WPX A;  3NR7 A;  3D3I A;  1HNX B;  2RQ6 A;  4DV7 B;  4I50 A;  1EM1 A;  1RFY A;  2Y69 C;  1IBM B;  1QNM A;  3W7U A;  1MZF A;  4I9W A;  1MAB G;  2CTW A;  4UCS A;  3CRQ A;  1NKD A;  2D2C B;  5LA6 B;  2GUZ A;  3E8F A;  4WFF A;  4FLZ A;  4O2B B;  1NVP D;  4DR6 B;  1TA8 A;  1H8H G;  1WA8 B;  4MVM A;  2QWQ B;  3LDE A;  5CB4 A;  1XHX A;  1M57 B;  2QKA A;  1BQZ A;  3R65 A;  2YIB A;  1P7G A;  2FYU H;  3CCE V;  4PA9 A;  5KAI Z;  3K58 A;  1K8A W;  1BQ0 A;  4LH7 A;  1R3I C;  4O2B A;  4B3M B;  1KBH A;  2K1E A;  3CC4 V;  2ZDI A;  3I55 V;  3DXR B;  1LUV A;  1Q6I A;  1U96 A;  5IYD O;  1MOF A;  3CCU V;  3SJC C;  5K1X A;  4DK1 A;  4KUM A;  2HHH O;  1A32 A;  3ASN B;  3CRM A;  1MZE A;  1RSO B;  2GTA A;  4R8C A;  1V55 C;  1X59 A;  2JEX A;  4FJC C;  4YY3 B;  4DV3 B;  1XIL A;  3TK1 A;  3CJH B;  4X1I A;  2RDC A;  1GMG A;  1KP3 A;  5IJ0 A;  2Q67 A;  1P7B A;  3DXR A;  3ZMZ A;  4BW5 A;  3SGI A;  3N2G B;  4X20 A;  5B3S C;  1ZWI C;  4QE9 A;  3OUS A;  2ZR2 A;  1HDJ A;  3K5N A;  2AZ2 A;  2LJ2 A;  2XTA A;  3FX7 A;  4LNU B;  1YIJ V;  5LYJ B;  3OTO O;  4JYA B;  5KAF Z;  3CCJ V;  4IL6 Z;  2KSD A;  1Y4M A;  1PPJ H;  2BSK B;  4UFZ A;  5IY5 B;  4J9Y B;  5EBL C;  2UXB O;  4IIJ A;  4PA6 A;  1JFF B;  1EN5 A;  1M90 W;  1GKF A;  2ZE8 A;  3ZMU A;  2XAF A;  3IC9 A;  3ETD A;  4ICG A;  5KX5 B;  1FJG B;  3KG2 A;  1AJP A;  1AR1 B;  2VQF O;  3HR0 A;  3BRC A;  5B1A B;  3F5W C;  1E79 G;  3OW2 U;  1YJ9 V;  4JI0 B;  3ZHU A;  3M99 B;  1NI8 A;  2LQT A;  1N33 O;  3ML0 A;  1MMM A;  2P6J A;  1L1F A;  2Y48 A;  5DM6 V;  5C93 A;  5IE9 A;  2LW1 A;  3E22 B;  1WLE A;  3FD9 A;  2B1G A;  3RN4 A;  5HFL A;  2UUB O;  3AG7 A;  3S3W A;  5IDJ A;  4U3J A;  1IBL B;  4I4T B;  4GX1 A;  5IYZ A;  1NR1 A;  5LL6 Y;  2JK5 C;  1QR8 A;  2F43 G;  2IU3 A;  2HFE C;  4O4J B;  2ZM6 B;  1YHQ V;  4YIP A;  2ODM A;  4E4E A;  2EIN B;  1JJ2 U;  3KCY A;  3H1I H;  1J5E O;  1AP6 A;  1CXZ B;  4F4L A;  2XAQ A;  3A0B Z;  5CA0 B;  5F2V O;  3C90 A;  4W4K A;  1QLE B;  1VQ7 V;  2L35 A;  1H2N A;  3ZBH A;  4WFA V;  1SQV H;  4F6R A;  2PI5 A;  4KFM A;  1K5Q A;  1FD9 A;  4GX2 A;  2QKC A;  1TVK A;  4J10 A;  4ASU G;  2MK3 A;  2GDS A;  4BWA A;  4JI2 B;  1HNW B;  1Q81 W;  3ZRX A;  1EN4 A;  1VF7 A;  2HVK C;  1IBL O;  5H5N A;  4LF5 O;  1VIB A;  4CH5 A;  3AG3 C;  3S3X A;  3P32 A;  4KL1 A;  4K8X A;  4LF6 O;  3K0G A;  2E76 B;  4FM2 A;  2H8P C;  4RAI A;  1F51 A;  5CA3 A;  5L3B A;  1R1B A;  5H6Q A;  1XEQ A;  1SQF A;  4IYH A;  5B66 Z;  3OGI B;  1QR9 A;  1JA8 A;  2FKX A;  5D5Q A;  1QCE A;  4NXN O;  2RN9 A;  1KQS U;  2DWE C;  5JWP A;  1AB3 A;  3IGA C;  4MTO A;  2EZP A;  1NVP B;  3RFR A;  1JX9 A;  1I94 B;  5CA1 A;  2ZCE A;  2UXD B;  3HKE A;  3RYI A;  1P4R A;  1GAX A;  1E1R G;  4AQY O;  1I0H A;  2JGU A;  2RCV A;  3QTC A;  5H2F Z;  2EIM B;  1SZX A;  3K0D A;  1VQ4 V;  1GN4 A;  3W7W A;  4MTF A;  2YC0 A;  1SQX H;  5IWA O;  1NH2 D;  2XAJ A;  4DV1 O;  3P3N A;  4RWU A;  2YEV B;  1JVM A;  1EN6 A;  1XQ8 A;  4OGQ B;  2F95 B;  2QM8 A;  2WLH A;  2YXL A;  3OR6 C;  4DR4 B;  3IAY A;  3T1Y O;  2PGG A;  1LR1 A;  4MW8 A;  1GO3 F;  4GKJ O;  1XNQ O;  2A3Q A;  2DQ0 A;  2EIJ C;  4X65 O;  4QPK A;  2HR3 A;  3WG7 C;  3D36 A;  3ZHQ A;  3HB3 B;  2R70 A;  3B4S A;  4UV9 A;  4DR4 O;  4PDR A;  3JAK A;  1YZB A;  3QG5 A;  2ATK C;  3ZED A;  3E8G A;  2GHY A;  3JYC A;  4X65 B;  4TOI A;  4TV8 B;  3BFR A;  4X9Q A;  4DR1 O;  1AI6 A;  2HG5 C;  2Q8V A;  4PEL A;  1QQC A;  5C8Y A;  4P9O A;  4JI5 B;  1OCZ B;  3LNM B;  3TXQ A;  2PTM A;  2EIL B;  4DW0 A;  5KHG A;  4WCE V;  5JVD B;  3X2Q C;  4WBN A;  1KKD A;  2ZT9 B;  2OT5 A;  3JAK B;  4JI3 O;  3JAW B;  4J80 A;  4DYL A;  1K5S A;  4LNU A;  2DOS A;  1YJW V;  5LYJ A;  2BTQ A;  5B1B C;  4PDV A;  1WJZ A;  1MNG A;  3RYH A;  2ZE5 A;  4CH6 A;  4PA7 A;  4TWK A;  5KMG A;  1S5L Z;  3E8H A;  2JIZ G;  2ILM A;  4U3J B;  1YTF D;  1SKV A;  4FZ1 A;  3CB2 A;  4GT1 A;  1GM8 A;  1L8D A;  2R9A A;  1DF4 A;  1G4Y B;  2Y4U A;  4JZG A;  2DYR C;  1F4M A;  1JMK C;  3OTF A;  2G38 A;  3KZI Z;  4F6E A;  2F23 A;  1OCC B;  4EFB A;  1F23 A;  3SPC A;  1D2D A;  1J5E B;  2EIK C;  2BOB C;  1V54 B;  4JI7 B;  1VQN V;  1NH2 B;  1PKX A;  2UUC O;  3EVK A;  4OX9 O;  3KCX A;  3RVZ A;  1S3J A;  1X4T A;  4PJ0 Z;  4FM1 A;  2UXC B;  4JAA A;  5EC1 C;  4BW9 A;  3F7Y C;  3L70 H;  2AHZ A;  1GN6 A;  4DR5 B;  5CBF A;  4RUF A;  2B1I A;  5GTI Z;  1DK1 A;  5GTH Z;  2ZDI C;  2JS5 A;  2E3C A;  3N2K A;  5B3S B;  4EKW A;  4X1Y B;  1MA1 A;  4PA3 A;  5ITZ A;  3CX5 F;  3ZMT A;  3FAV A;  4K35 A;  5EC2 C;  4MVR A;  1YSC A;  3CPW U;  5JH7 B;  4P2Z A;  5DEC A;  2NLJ C;  3JAL A;  2Y4T A;  4PD4 F;  3A0R A;  4I0X A;  4JF3 A;  1FYJ A;  4EB6 B;  5CMU A;  5LMU B;  3HPL C;  1TVK B;  3FAV B;  5KHI A;  1SC5 B;  1XMO B;  5EZY A;  3AK1 A;  4H37 A;  4DRX A;  1GN3 A;  3TCU A;  4DUY B;  4I50 B;  3E2E A;  4I9Q A;  2KKW A;  3T1Y B;  3B77 A;  1FJG O;  1ZUQ A;  1M5I A;  2A7W A;  1RSO A;  3WFV A;  2V4D A;  5LP6 B;  4H0L B;  4QGP A;  2WLJ A;  2UXX A;  4EB6 A;  2C2A A;  4NTW A;  3H1H H;  4X64 O;  2XT9 A;  4LFC O;  4MVS A;  1VF6 C;  3WB0 A;  3U11 A;  1Y66 A;  2W0X A;  2EX3 A;  3CC7 V;  1F7Y A;  4JAS A;  2E5L B;  3CHX A;  5LP6 A;  1FKA O;  1HNZ B;  2ZE6 A;  2OTL V;  3CRR A;  3K03 A;  3GVM A;  3JAT A;  3VQX A;  3G67 A;  2WLL A;  2FB5 A;  2N05 A;  3STZ C;  2P22 C;  1N36 O;  4LR3 A;  4IT5 A;  3A8T A;  4JI4 B;  1JQ0 A;  5EK0 A;  1PNL A;  4O4L B;  3THO A;  4B3R B;  2MW2 B;  1KMI Z;  1BE3 H;  4PDM A;  4DUZ O;  2A0L A;  1T5E A;  1VQM V;  2RMK B;  5BR8 O;  1Z5V A;  5KUM A;  5LHH A;  5EIB C;  1R6T A;  1R3K C;  4DR2 B;  4DUZ B;  1VQ5 V;  1N0J A;  4JTC B;  4UVB A;  3HKD A;  5LMN O;  3N2G A;  3VOU A;  1YF2 A;  4NTY A;  2WAM A;  3AK3 A;  2VRZ A;  4FLW A;  2VQE O;  1ARO P;  1BL8 A;  4UV8 A;  2K9P A;  3T4D A;  1V54 C;  2N74 A;  5EBW C;  5KLV H;  2OIG A;  1OJH A;  4NB5 A;  3FYE B;  2YSU B;  1XL4 A;  3DC5 A;  5C8Y B;  1IBM O;  4MTX A;  2VQE B;  3L9D A;  3DC6 A;  4ZOL A;  2QA4 V;  2Z3Y A;  3ZHV A;  1BHA A;  4LFA O;  1EFR G;  3D8C A;  4D7T A;  4TQD A; 
#chains in the Genus database with same CATH homology
 2UU9 O;  2UUA O;  3J7A U;  5BY1 A;  5FLX N;  5A2Q N;  4DR5 O;  5BXZ A;  4DV7 O;  4B3R O;  4AQY O;  4JI6 O;  4X62 O;  4DUY O;  4YY3 O;  4DV3 O;  2AGA A;  4DR2 O;  2E5L O;  4X64 O;  4LF8 O;  4LFC O;  2UUB O;  4DV4 O;  4NXM O;  4A5U B;  3J80 N;  4LFB O;  1D2D A;  4B3S O;  5IWA O;  4DV1 O;  2HHH O;  1A32 A;  4DV0 O;  4X66 O;  1F7Y A;  4GKK O;  4JI7 O;  2UUC O;  3RT3 C;  1NS1 A;  1FKA O;  4OX9 O;  5LL6 Y;  4KHP O;  5IT9 N;  1X59 A;  2ZKO A;  4YHH O;  1G1X B;  1N32 O;  3T1Y O;  4DV2 O;  5LMU O;  1N36 O;  4OPH A;  4GKJ O;  1I94 O;  1XNQ O;  2UXD O;  1J5E O;  4X65 O;  2Z0A A;  4JYA O;  3SDL A;  4JI5 O;  4OPA A;  3JAM N;  1HNW O;  4DR4 O;  4DUZ O;  1DK1 A;  4LF9 O;  1YZB A;  1HR0 O;  4DR7 O;  4JI1 O;  1XNR O;  5BR8 O;  2ZM6 O;  3T1H O;  3OTO O;  3O65 A;  1R6T A;  2DJV A;  4JV5 O;  1IBK O;  4DR1 O;  2JRI A;  4JI4 O;  1XMQ O;  4DR6 O;  2UXB O;  5LMN O;  4LF4 O;  4DV5 O;  3R66 A;  1IBL O;  4B3T O;  5H5N A;  1AIL A;  4LF5 O;  4LF6 O;  1KUQ A;  3J81 N;  3F5T A;  4JI3 O;  4JI8 O;  4JI0 O;  2VQE O;  1HNX O;  4JI2 O;  1FYJ A;  2DOS A;  1R1B A;  1XEQ A;  1HNZ O;  2N74 A;  2FKX A;  3M8A A;  2VQF O;  4NXN O;  4B3M O;  4K0K O;  1XMO O;  1IBM O;  2F4V O;  4DV6 O;  1AB3 A;  1N34 O;  2UXC O;  4DR3 O;  1FJG O;  4LFA O;  1N33 O;  2LW7 A;  4LF7 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...