1FYJA

Solution structure of multi-functional peptide motif-1 present in human glutamyl-prolyl trna synthetase (eprs).
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
DSLVLYNRVAVQGDVVRELKAKKAPKEDVDAAVKQLLSLKAEYKEKTGQEYKPGNPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MULTIFUNCTIONAL AMINOACYL-TRNA SYNTHETASE
publication title Structural analysis of multifunctional peptide motifs in human bifunctional tRNA synthetase: identification of RNA-binding residues and functional implications for tandem repeats.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 20
structure length 57
sequence length 57
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2000-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1fyjA00
4JI4O 2LW7A 4LFAO 3J80N 5LMNO 2ZM6O 2UUBO 1N32O 1AB3A 4OPAA 4DR7O 4JI3O 2UXBO 4K0KO 2VQFO 2E5LO 5LL6Y 2UUAO 1XMQO 2DJVA 5BXZA 4JV5O 4DR5O 4LFBO 4DV4O 4X62O 1FJGO 1N33O 4NXMO 1R1BA 1IBMO 1DK1A 1XEQA 3J7AU 4X64O 1YZBA 1IBKO 4LFCO 4JI5O 3F5TA 3T1YO 2UUCO 3SDLA 4DV7O 1KUQA 4JI0O 2Z0AA 2DOSA 4DR1O 3R66A 4DR6O 5FLXN 2JRIA 1FKAO 1J5EO 4LF4O 4LF9O 4DV6O 5IWAO 4JI7O 4DUZO 4B3SO 1AILA 4LF6O 4KHPO 1D2DA 4OX9O 1HNZO 4DR3O 5H5NA 4AQYO 4YHHO 3J81N 4DR4O 4DV3O 1R6TA 2AGAA 2FKXA 5LMUO 4JI2O 4DV1O 5BR8O 3M8AA 1N36O 4JI1O 4LF7O 1HNXO 2UU9O 4X65O 4JI6O 1FYJA 1XMOO 3JAMN 4DUYO 4OPHA 1HR0O 1HNWO 4DV0O 4NXNO 2HHHO 1XNQO 2UXDO 4GKKO 4X66O 5IT9N 4LF5O 1XNRO 1IBLO 2UXCO 5BY1A 4DV2O 4DV5O 4JYAO 1G1XB 4A5UB 4DR2O 4LF8O 1X59A 4B3TO 4GKJO 4JI8O 2VQEO 2N74A 1N34O 4B3RO 1NS1A 3OTOO 1F7YA 4YY3O 4B3MO 2ZKOA 3T1HO 3O65A 1A32A 3RT3C 5A2QN 1I94O 2F4VO
chains in the Genus database with same CATH superfamily
1K4CC 1RSOA 1EZVH 4TV9A 1AP5A 2PZSA 5A9GA 1PKXA 1JA8A 4PJ0Z 1IURA 3JD3A 1IXBA 1Q81W 1R1BA 2OIGA 2HLDG 1SC5B 1NJIW 1DK1A 1ROPA 3JCUZ 5LHIA 1IBKO 1VQ9V 1SA0B 3A0BZ 4PA7A 2QDOA 4RO2A 4EB6A 1S77D 4IYIA 1VQPV 3T1CA 5LP6B 2DWDC 3QG5A 3K5NA 4DR6O 3E22B 2DMXA 3BCCH 3QVNA 3K79A 2AXTZ 3L9DA 3CEIA 4G28B 1MABG 1M93A 4J9ZB 5GONA 1URFA 2LJ2A 3PJSK 4MTOA 1TVKB 2RJZA 4JI6B 5LMUO 4XDLA 2IJKA 3CHXA 3M8AA 3S3XA 3OFNG 1HNXO 4ICGA 4X65O 1JFFA 4JZ2A 1IBLB 1HR0O 1XQ8A 4DV0O 3AG2C 1XNQO 3KZIZ 4WF9V 4LF5O 2B1IA 4GKJB 3JARB 2Q0AA 4U7NA 5DEDA 4O4JA 3ZRXA 4G2KA 3RWRD 1XL4A 1YITV 4A5UB 2QSAA 2QM8A 3H1IH 1U97A 1MOFA 3EFFK 5CMUA 4YJ3A 4LFAB 1VQ7V 1PL0A 3ZHVA 1YJWV 2CGNA 3JSNA 1H2KA 3ETDA 4TV8B 1WA8B 3LDDA 4AHCA 1KP3A 2JIZG 1DTOA 1ZX3A 1XILA 3KCXA 3JYCA 4XDKA 4K0KO 4DV4B 4X62B 1YSCA 2YSUB 3DXRB 1AJNA 2FL4A 2CTQA 2KG7A 4ABMA 1EN6A 1VMGA 4O2BB 3DTUB 4IIJB 4ZI7B 1BE3H 1G8MA 3T1YB 2EIMC 5BMVB 2GDSA 4LCUC 2XAGA 1Z2GA 1OCRB 3IC9A 1QVGU 1OV9A 4HNAB 1KC8W 3RYIB 1Y74B 4PI0A 3BA8A 1Y76A 4MS2A 1K3EA 3FB5C 2RQ6A 2HVJC 4LP8A 3JATA 2WWWA 2Z3YA 4X1YB 3N2GA 2P22C 2P4KA 2UXDB 4I55B 1V55B 2BCCH 1DGSA 2XAJA 4J80A 2JDIG 3W7XA 4GKKO 3UT5A 1NBMG 3T2MA 3JAKB 1BZKA 4CH6A 3I5DA 1FXHA 1O9GA 2YIDA 3L71H 4O4HB 5KHGA 4LH6A 1KD1W 2OWOA 4TSFG 3AG4B 2YXYA 2CGOA 1F7YA 1ZWIC 4TQFA 1NVPB 1B6QA 3T4ZA 1GM8A 1KKCA 1FFXB 2PI5A 4I9QA 1BCCH 1MZFA 4J7ZA 1QCEA 3E86A 2F4VO 4NR1A 3G4SV 2LW7A 1VQ4V 2A06H 4XBFA 2L35A 2K1EA 4MW3A 3ABKB 2G38A 2HVKC 2QWRB 1S0VA 4LH7A 4PDMA 5CBHA 4DW0A 1SKVA 3ETGA 1W2BU 1NTMH 2NLJC 1KYOF 2QJ1A 1EFRG 3BFRA 3CCSV 1XUQA 4RQFA 1NH2D 3C3TA 1SQGA 4QIWF 3ZN0A 4DV7B 1PD3A 1Q6IA 1E1QG 2DYRC 4AI8A 2Q5ZA 4QPJA 3QF7A 4J7KA 4LF4B 4FM1A 1GRJA 1BQZA 1GAXA 1WB8A 4IHJB 4DUZB 1JJ2U 4WFGA 5CA0A 5JQGA 2OCHA 3CC7V 1SQQH 3ASNC 2A9HA 2WLKA 4UFZA 4YHHO 4DV3O 3QTCA 1K8AW 1KBHA 3ZHTA 4JF3A 3FB8C 4CH3A 2Y69B 1OCOB 5EBWC 4R50A 3CCQV 5LXTA 3QO7A 4TOIA 3STLC 5KUMA 1XNRO 3TXSA 3N2KB 3K59A 3OMNB 2DWEC 2BTQA 1EN4A 4IGGA 3ABLB 5L3FA 5B1BC 4B3TO 1V54B 4YXWG 3TK1A 1VQLV 4NB5A 3ZMZA 2ZKOA 4MVSA 1IXMA 4CS2A 1GN3A 2DQ3A 4YIPA 5B3SB 2F1MA 1GN4A 1I5YA 4FLUA 1AJPA 1P7BA 3RN4A 1AB3A 3ZHRA 4WFEA 5ITZA 1FJGB 1KMIZ 4KHPB 3BA9A 3WB2A 4NXMB 5H2FZ 4LFBO 4I50A 1Z5VA 4FFBA 3G80A 1FPOA 1Q90D 1I5XA 2VRZA 2OT5A 1ZTEA 2WA3A 1MSWD 1YZBA 5B1AC 2JJ1G 4H13B 4X20B 4D6TH 3FB6C 5CB4B 4KFMA 1VF6C 4JI0O 1BQ0A 2IU3A 4B3SB 3R66A 2F43G 1J5EO 3CP1A 1YF2A 3B09A 3LUTB 3S3WA 4WFHA 4UV9A 1YJ9V 2NNUA 5LOVA 5JCOC 2P67A 5CA1B 2WLIB 3OMAB 2Q67A 2AHZA 1TUBA 4H37A 3LDEA 3AK1A 2FKXA 1R3LC 2UU9B 1M5IA 4CZZA 3F5WC 4PA6A 2LQTA 4MT8A 2KB1A 4GT1A 1NTKH 2Q7GA 1YJNV 3ABUA 3H9VA 2BSKB 5JJNB 4X66O 5IY5B 3MD0A 1T5EA 3O9OA 2Y4TA 4B3RB 4JYAO 4UVAA 1VIBA 4FLZA 1PM9A 3CJHA 4CC6A 5IE9A 1B04A 4WFAV 2LFSA 1HDJA 4JYBA 1ZL8A 1PV0A 2XASA 4JI4O 1F51A 3JD0A 2ZCEA 3M99B 5LMNO 3JAWA 5CN0A 2ZXWC 1O9HA 4OPAA 2DE0X 2ZIOA 4TUYB 2YIBD 3ZS8C 4GUNA 2M7WA 5CBGA 1M9NA 4K8ZA 1IBKB 1LNQA 5KHIA 4BIOA 2GUZA 1I08A 5DN6G 3CMEV 3L73H 2ARHA 3DGEA 2IJJA 4N23A 4UCSA 5J2UB 3CC2V 5K1XA 2ZE7A 4JI5O 2F23A 4DR6B 1W0JG 2EIJC 1SZXA 2FTKA 4RUFA 1VQ6V 4B08A 3CWBH 2WA4A 2P7TC 3H1HH 2JRIA 2R9AA 2VWJA 3ZHQA 3CS5A 2OIEA 1KQSU 2Q73A 3SPGA 4KHPO 1NT2B 5LMUB 3HR0A 2ODMA 1WP7A 2AGAA 3H1LH 4CS3A 1HNXB 4X65B 1R73A 4MSWC 1H2GA 4PV1B 3G6EV 4DW1A 4O4IA 1HR0B 1LUWA 4DV0B 1F4MA 4N21A 1SQFA 4JI1O 4LF5B 4O4LA 5J2TB 1Y6XA 2Y48A 1YEWA 4DUYO 3Q4HA 4U3JB 3CXCU 2DYSB 4PI2A 1S5JA 3HKCB 5EZYB 1K92A 3GWKC 5LYJB 3WG7B 2HR3A 2PYJA 3QNEA 1VQMV 1CP9A 1H2LA 3X2QC 2WLHA 3D36A 1N34O 4W4LA 4JGSA 3RYHA 2YC0A 4IYHA 3T1HO 1WAZA 3L72H 4W4KA 1XI1A 4FZ1A 3G6BA 2F95B 4K0KB 2GHYA 2XOKG 3W7SA 2ZINA 3NR7A 1GMGA 2ZNIA 2ZDIC 1NR7A 2JGUA 2CE4A 1QU7A 3QO8A 2PGGA 4I7ZB 4NKGB 1S72V 1MSDA 5IDJA 4J10A 3IJ4A 1SQXH 3HB3B 2EIKB 2E3CA 3ZJZA 4GX2A 4D7SA 1Q6HA 1GK9A 1ZAUA 3RYFB 4CC5A 4MW8A 1XOUA 1IBMO 2VWKA 4EFEA 4X64O 4O2AB 4I0XB 3ETEA 1GN2A 5JVDB 1P4RA 2AW9A 1AI7A 1RP3B 1BS3A 4I9WA 2OCCB 2W6JG 2IU0A 1NQTA 3HKDB 3SGIA 5IWAO 1YXBA 1AILA 3RVYA 3OUFA 4LF6O 2WLJA 1SA0A 2QTOA 2LFRA 5C93A 4OX9O 2ZQMA 3HPLC 5LP6A 2EJRA 1M4UA 5KHHA 1RM1C 3E22A 4GKKB 1PPJH 4LNUB 4OGQB 4NTXA 1FYJA 2GBOA 3TGUH 3SPIA 5EK0A 3E8HA 5IJ9B 1YIJV 1AR4A 3OM3B 2FB5A 2JEUA 3AG7A 2EILC 2JEXA 4X1IB 2OTLV 4Q6GA 2F4VB 2ZDIA 1Q3EA 2HKOA 2NN4A 2R72A 3O65A 3JARA 1TUEB 3ZRWB 4UVBA 2X0LA 1V55C 3UO2A 1HP8A 3VQWA 1RPRA 1I0HA 4BWAA 3E2EA 4YJ2B 3SR2C 5DM6V 4BIZA 3K5OA 4EKWA 3GVMA 3K3WA 4GZRB 2EINC 2P4VA 1B06A 5IYDO 3JD2A 3P3NA 1HWYA 4TV8A 1US6A 1WA8A 3EXAA 3OEEG 3E35A 4J9YB 5GW7A 4X88A 3OUSA 2AHYA 1PNKA 1VEWA 3DXRA 3VQXA 3A8TA 3JALB 2XUMA 3L70H 1SESA 4O2BA 3CXHF 4IIJA 3ZHUA 3ZRVA 3K08A 4ZI7A 2RDCA 5FPOA 4BAYA 3LDCA 5BMVA 4YHHB 5D5QA 4DV3B 4DXWA 2FMLA 3FX7A 4DRXB 2JGDB 4HNAA 3K0DA 1E1RG 3CD6V 3HKEB 5EIBD 3RYIA 1Y74A 2BTOA 4UCTA 2ZR3A 3WFVA 1V9PA 4QE9A 1I7FA 1NR1A 1OCZC 2Q9LA 4QPKA 1XNRB 4FZ0A 4U3FH 2Q8VA 5KMGB 2RNBA 2W0XA 4JAVA 4UVCA 4UXNA 1Q86W 4B3TB 4QGPA 4X1YA 1XMQB 1XHZA 5BY1A 4DV2O 4DV5O 2UXXA 2P5OA 2Z5UA 2F93B 4DR5B 3AG1C 4I55A 4LC1A 3CSXA 1VQOV 2EULA 3MHHC 3C90A 2CAZC 3BAAA 3ZMSA 3LSUA 3FYEB 3ZCCA 4ZIBA 4ZOLB 2ADQB 3JAKA 1UFIA 1NVPD 1IVSA 3UQ8A 2UUBO 1NKDA 2N04A 1YTFB 3OE7G 2X6CA 4O4HA 4UCUA 5L3CA 4JI3O 4LFBB 4KL1A 5EYPB 3AG2B 1FFXA 1WPBA 1Q6UA 3BABA 5LGTA 1TAEA 1EM1A 2ITDC 4FPPA 2A0LA 4JI0B 2E74B 3NXSA 2Y4UA 2PUSA 4H33A 3F5TA 2R9RB 1J5EB 3ETQA 4RUEA 1ORQC 4QNHB 5IYZB 2XAFA 4UCVA 2XT9A 4JI7O 1CPYA 3BHPA 4FMTA 1SZTA 2VQEB 3FAVB 1P49A 4MTXA 3B2EE 5LGUA 4IHJA 4J42A 1Q82W 2HJFC 1BT8A 4P9PA 5CA3A 4K3AA 2X6AA 4X66B 2V1DA 2EIMB 2IH3C 3ASOC 5EC2C 1KECA 2QM7A 3RW0A 3SPCA 3IGAC 4JYAB 5IJ0B 4JTCB 4NVPA 4ZHQB 3DC5A 2PYLA 1M1KW 1G1XB 1G4YB 2CDYA 4WCEV 4WFFA 1NI8A 4B7KA 3P32A 1AI4A 1J95A 2ZE8A 1AP6A 3IC7A 3ABTA 1L0LH 4YY3O 4JI4B 1UPGA 4F6RB 1H8HG 2IBZH 3ZN1A 5LMNB 4B3MO 2HJDA 2QGNA 1E79G 2GTAA 1NZ6A 3W7TA 3ZHSA 1M57C 1PNMA 5KAFZ 5IY5C 4DO2A 5LL6Y 1IDSA 1XMQO 1SRYA 3P30A 5BXZA 4QE7A 4DR5O 3E8GA 1MNGA 4FLTA 3D3QA 1N33O 1S5LZ 4JI5B 1YDXA 2IM9A 1ENVA 2BOBC 3RBZA 3L75H 3CRMA 4GX0A 2UUCO 1H2MA 3LSQA 1M56C 4FM2A 4MVQA 4PA4A 2H3OA 2DQ0A 5C8YB 1D5AA 2LGQA 2YXHA 2B1GA 4IL6Z 5JH7B 1SS3A 4X9QA 4J41A 1GM9A 4LF8B 4X20A 5GTHZ 3RYCB 5L3BA 1PP9H 3HKBB 3FD9A 1PL4A 4JI1B 2JK5C 1JMKC 1SETA 4DUYB 2ZE6A 4JI2O 5BZBA 4BIUA 5HFMA 2ZM6B 1VF7A 1RPOA 3E83A 5CA1A 3ML0A 1HNWO 2DYRB 3GB7C 3CCEV 1NU1H 2WLIA 2HHHO 1B3QA 4FFBB 2EZPA 3FB7C 4P9OA 3UKMA 1FXVA 2QA4V 3OTFA 1FD9A 2UUAB 1QR9A 1N34B 2DW4A 5LA6B 3H1KH 3ABMB 2DN9A 1H38A 1R3KC 2VQEO 3T1HB 2N74A 4JYCA 3ASNB 3OT7A 2BSKA 1GTOA 3RT3C 3SPJA 1Y4MA 2RMKB 2JS3A 2QKAA 2CTWA 2QWPB 4CH5A 2DYSC 1EN5A 3AG3C 5KUKA 3CRCA 4DR7O 3OD4A 1TUBB 3FYIB 4I4TA 1HW7A 4ASUG 2L6LA 4JASA 1JQ0A 3ICXA 5LHHA 1SQBH 1IBMB 4CH4A 1Z5WA 4X64B 3FKSG 4BW5A 3JASA 5B1BB 4J7JA 2P90A 2MK3A 3SYQA 1U96A 2XHBA 5DECA 1XEQA 3D36C 3CPWU 2GSMB 4TUYA 4LFCO 1FXKB 3GWOA 3SJCC 4PA9A 3OAAG 2QEXV 5IWAB 3ZMVA 4DR1O 3VOUA 4LF6B 1W59A 1QQCA 3UM7A 4OX9B 4LF9O 4FK5C 2HG5C 2AZ0A 1BHBA 1WJZA 5EBMC 2IJHA 3FFQA 2YICA 2R70A 5J2UA 2YIBA 2X6BA 4PHZA 1K5SA 3WB1A 4H0LB 2QTSA 1VQNV 4R7CA 3DC6A 3RGBA 2QKCA 5L3DA 4WBNB 1N0JA 3W7WA 4MTGA 1H2SB 3AEIA 1I94B 2QWNB 3CB2A 3C3SA 3K9AA 2ZT9B 4ZBMA 4MTFA 1YHQV 2F66C 3H01A 5GTIZ 1XMOO 5B1AB 5B5EZ 1EBOA 1XL6A 1AJQA 3AK3A 2PF4E 2UXCO 3LNNA 1AROP 1X4TA 1XHXA 1JX9A 4DR2O 4LF8O 4UB8Z 2HP8A 5KA6A 5J2TA 2EBOA 4U3JA 2A79B 2CTPA 2MW2B 2ZR2A 3HKCA 4X1KB 2M6YA 5LP6C 5LYJA 3B40A 3SYAA 3T4DA 2YS8A 3DSQA 2ZM6O 4LWSB 1JJOA 5E79Z 3BVOA 3TXQA 5CBFA 1IZ3A 3CCVV 1GO3F 5KX5B 3G67A 3IAYA 2UUAO 2YEVB 4LBEC 4JV5O 1K97A 4BR6A 3SPHA 2XAHA 3SYOA 2KQXA 3CX5F 3K58A 3Q4HB 1PNLA 3TJTA 5H6QA 2CH7B 2LO1A 2WLLA 2ITCC 1JCHA 3A0HZ 4CBCA 1D5NA 2QR4A 5FNVA 1EZJA 3G71V 2QM4A 3RYFA 1Q7YW 4DV6O 2ZXWB 3RYHB 3APQA 4O2AA 3N27A 4I0XA 4E2LA 4TT3G 3P3PA 4DR3O 1M90W 3B8MA 4AQYO 1SQPH 2CK3G 3J81N 4DR4O 3KKYA 2LP7A 3TETA 5B66Z 3F7YC 1VQKV 4H44B 4Z1MG 4DV1O 4MVRA 3HKDA 3D3IA 1N36O 4JYYA 1AI6A 1WN7A 1K34A 2W0FC 4DV2B 4DV5B 4NXNO 2EIJB 2E5LB 1AVMA 2FYUH 1WB7A 2ZNJA 2IH1C 1K7DA 4P30A 3CCJV 3OR6C 1S3JA 1RSOB 4LNUA 5KLVH 4JAUA 4TV9B 3SYPA 1N0NA 1OCRC 1AR1B 4R6ZA 2UUBB 1A32A 5A2QN 5IJ9A 1I94O 1JOYA 3B8NA 1VQ5V 1KP2A 4JI3B 4P2ZA 1TVKA 1W0KG 4X1IA 1MZEA 5EC1C 2UXBO 5EIBC 5KHKA 2VQFO 1OCCB 4EB6B 2DJVA 3OR7C 3ZRWA 2YI9A 1H2NA 4R8CA 1K5QA 1BL8A 1XDCA 2QKSA 4IT5A 4NTWA 4OXSA 2OTJV 3X2QB 4YJ2A 1ZSPA 1Q5OA 3MDSA 3QO5A 4LF7B 1JR9A 1QLEB 2B5UA 3WU2Z 1BGYH 4UUJC 1N8RW 4JI7B 5GONB 3OGIB 2RN9A 3M7MX 5H9CA 1YI2V 3EHBB 3AG4C 1JFFB 2LW1A 5H6RA 5D5PA 4FLXA 2ATKC 1HNZO 2GTSA 4PDRA 3JALA 5H5NA 3ZMTA 2HEPA 2PTMA 2D3OW 4O4JB 3CRAA 3SJQC 3TCUA 4X8AA 2E76B 3BY6A 5L3GA 5LHGA 5LGNA 3JAMN 3ABKC 3KG2A 4YJ3B 1KU9A 4DRXA 2WLMA 2HFEC 2JGDA 3HKEA 1AR5A 1YVWA 3JD4A 1SQVH 4YY3B 4JI8O 4B3MB 1QLNA 1DF5A 3CRQA 5KMGA 3OTOO 4PA3A 2JS5A 1R6NA 2N05A 2KG7B 2Q6AA 1QHTA 1R3IC 1MA1A 4TQDA 2JJ2G 1RM1B 1GH6A 3J80N 4Q20A 2O57A 4FLWA 3THOA 2E5LO 3E8BA 1YTFD 1N33B 3VQVA 4ZOLA 2R9IA 1R3JC 4GCZA 2V7QG 1K9MW 4L87A 1COWG 2EILB 1UJWB 2Y69C 1OCOC 3OGCC 5TISZ 1Y76B 4LR3A 2UUCB 1WPXA 5EYPA 3ZX6A 2NR5A 3JATB 5HFLA 4FLYA 5JWPA 2ZD9A 4PDLA 2QWQB 3SJBC 3K57A 4X89A 1VARA 3ABLC 4UCOA 3N2GB 2Q68A 1V54C 1Q8IA 3H1JH 1D2DA 3ZMUA 1XBLA 3CCUV 4K35A 2EINB 3CCLV 4JI2B 1L0NH 1OHHG 3CCMV 2KSDA 3UT5B 5IYZA 3OMIB 1JPXA 3KCYA 3ZBHA 2UXNA 5B3SC 1HNWB 1ZUQA 4HAMA 4HBNA 1VQ8V 2HHHB 3ZIAG 4LF7O 3K0GA 4JI6O 4FVMA 2QE7G 3FAVA 2Q7HA 1MMMA 3WB0A 2WSSG 4JTAB 1MG1A 1DLBA 4D7TA 3K06A 4PD4F 1IBLO 2YXLA 1KKDA 2VS0A 2XNDG 3SJAC 3AK2A 4UV8A 1X59A 4AILC 4GKJO 3R65A 2WLNA 4DK0A 4U7OA 4JAAA 1S5HC 1LUVA 4EFBA 3L74H 3JCZA 2H8PC 5IJ0A 4YIOA 3K5MA 4I5SA 3U10A 3I56V 4ZHQA 5J9PC 1NTZH 5B1OA 4DR7B 4LFAO 3B4SA 2CUGA 1OCZB 3EVKA 1BHAA 3W7UA 3A0RA 1XREA 4F6RA 1NH2B 1QVFU 2K9PA 2D2CB 5E1AC 3ABMC 5JJEB 3CC4V 4DV4O 4X62O 3N2KA 2E75B 4Z2WA 4LFCB 3BRCA 5CA0B 1Q43A 2H94A 5JQGB 3I55V 3AG1B 3UO3A 2ILMA 4DR1B 1CEZA 2B9ZA 2A3QA 3T1YO 2Y0PA 3APOA 4LF9B 3K04A 2RCVA 1L1FA 2EZOA 2PY5A 1P7GA 2IJIA 4UB6Z 3U11A 2Q4PA 4GX5A 5LXTB 1IX9A 1AI5A 1R6KA 3MHSC 4B7EA 2LGWA 3B77A 1R6TA 2BTQB 1XMOB 4JPRA 5C8YA 4MVUA 1OZ0A 1FXKC 4GX1A 5JH7A 3CRRA 4BW9A 4OPHA 1KB9F 2UXCB 3RYCA 1N32B 1F23A 2UXDO 4KUMA 4DYLA 4PDVA 3HKBA 4DR2B 4PELA 4C7UA 5CB4A 3OEHG 2Q7EA 1FS0G 4J11A 3OW2U 3A2FA 1FFTB 1OJHA 5KHJA 2Y0IA 1GN6A 5FPRA 3MAQA 5ITZB 3E8FA 1BSMA 1K73W 4QJFB 1GM7A 4TWKA 1FAFA 1Y67A 4I50B 5LA6A 5JJJB 1ZLZA 3BPZA 3ASOB 4JV5B 1L8DA 1WLEA 5FL7G 2ETNA 1VP7A 3CCRV 2GV9A 1QR8A 2CTRA 4CS4A 4JTDB 2BE3A 2YUAA 3RVZA 4HYOA 4FIPC 5LOVB 5BR8B 2ADPA 1WP8A 2YI8A 3CE2A 3SDLA 4DV7O 1Y66A 4DV6B 4K8XA 1N4CA 4FLVA 3WG7C 1DF4A 1FKAO 4LF4O 4DK1A 4DR3B 4RAIA 4DUZO 4AQYB 1M57B 5LBQA 4DR4B 1QBZA 1FXKA 2QWOB 2Q69A 3D8CA 4DV1B 1JVMA 1N36B 3U0ZA 4JZGA 2Q0OC 4I4TB 4NXNB 3IFXA 4MVMA 4XDJA 3CJHB 2A7WA 4HZ3A 4ZKIA 1S76D 4MVZA 4RWUA 2BOCC 4RQEA 5IT9N 3STZC 4WBNA 1ZL8B 1M56B 3JASB 3ZEDA 1TA8A 1YCIA 2EIKC 2XTAA 4GLXA 2EX3A 1P84F 5IYCO 3JAWB 4EEQA 1GKFA 5K1PA 2JVDA 3ZRSA 1WNSA 1K4DC 2WAMA 1VF6A 4FJCC 2OCCC 2P6JA 1BMFG 2UXBB 2WPDG 2VQFB 2GUZB 1QNMA 3BEHA 2YDEA 1N32O 2XAQA 2ZE5A 3UCSC 5JCOA 1K33A 5F2VO 2V4DA 2KKWA 5KAIZ 2OYQA 5IYBO 3PN1A 4X1KA 1FJGO 4E4EA 3CYOA 4LWSA 4Z1VA 5EZYA 4KP4A 4WFBV 4NXMO 3CMAV 3J7AU 1THZA 1H8EG 4L8JA 3SYCA 2AZ2A 4G27B 5KX5A 4GYCB 5AG2A 2YEVA 3LNMB 1KUQA 3K5LA 2ZIMA 3VQYA 5L3EA 2Z0AA 2DOSA 1XNQB 4F6EA 5FLXN 2X7RB 4MVOA 1HNZB 4O4IB 2P06A 2C2AA 1OCCC 4B3SO 3AG3B 4O4LB 4F4LA 2CH7A 1CXZB 5B1NA 3E89A 4FM0A 2IW5A 3K03A 3K9SA 2YIAA 4NYKA 3VBBA 5KA5A 5BR8O 2UU9O 2EJ7A 1QLEC 4KXRA 1G6UA 3LSSA 1SF9A 1VF5B 4UCRA 4JI8B 5JVDA 3OTOB 5EBLC 1SERA 3RFRA 3F7VC 2W6IG 3JSLA 2WLLB 1LR1A 4B3RO 1F4NA 1NS1A 4FFKA 1TGOA 1RFYA 4NTYA 2PI4A 3JD1A 5FNVB
chains in the Genus database with same CATH topology
4JI4O 2LW7A 4LFAO 3J80N 5LMNO 2ZM6O 2UUBO 1N32O 1AB3A 4OPAA 4DR7O 4JI3O 2UXBO 4K0KO 2VQFO 2E5LO 5LL6Y 2UUAO 1XMQO 2DJVA 5BXZA 4JV5O 4DR5O 4LFBO 4DV4O 4X62O 1FJGO 1N33O 4NXMO 1R1BA 1IBMO 1DK1A 1XEQA 3J7AU 4X64O 1YZBA 1IBKO 4LFCO 4JI5O 3F5TA 3T1YO 2UUCO 3SDLA 4DV7O 1KUQA 4JI0O 2Z0AA 2DOSA 4DR1O 3R66A 4DR6O 5FLXN 2JRIA 1FKAO 1J5EO 4LF4O 4LF9O 4DV6O 5IWAO 4JI7O 4DUZO 4B3SO 1AILA 4LF6O 4KHPO 1D2DA 4OX9O 1HNZO 4DR3O 5H5NA 4AQYO 4YHHO 3J81N 4DR4O 4DV3O 1R6TA 2AGAA 2FKXA 5LMUO 4JI2O 4DV1O 5BR8O 3M8AA 1N36O 4JI1O 4LF7O 1HNXO 2UU9O 4X65O 4JI6O 1FYJA 1XMOO 3JAMN 4DUYO 4OPHA 1HR0O 1HNWO 4DV0O 4NXNO 2HHHO 1XNQO 2UXDO 4GKKO 4X66O 5IT9N 4LF5O 1XNRO 1IBLO 2UXCO 5BY1A 4DV2O 4DV5O 4JYAO 1G1XB 4A5UB 4DR2O 4LF8O 1X59A 4B3TO 4GKJO 4JI8O 2VQEO 2N74A 1N34O 4B3RO 1NS1A 3OTOO 1F7YA 4YY3O 4B3MO 2ZKOA 3T1HO 3O65A 1A32A 3RT3C 5A2QN 1I94O 2F4VO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 O;  2LW7 A;  4LFA O;  3J80 N;  5LMN O;  2ZM6 O;  2UUB O;  1N32 O;  1AB3 A;  4OPA A;  4DR7 O;  4JI3 O;  2UXB O;  4K0K O;  2VQF O;  2E5L O;  5LL6 Y;  2UUA O;  1XMQ O;  2DJV A;  5BXZ A;  4JV5 O;  4DR5 O;  4LFB O;  4DV4 O;  4X62 O;  1FJG O;  1N33 O;  4NXM O;  1R1B A;  1IBM O;  1DK1 A;  1XEQ A;  3J7A U;  4X64 O;  1YZB A;  1IBK O;  4LFC O;  4JI5 O;  3F5T A;  3T1Y O;  2UUC O;  3SDL A;  4DV7 O;  1KUQ A;  4JI0 O;  2Z0A A;  2DOS A;  4DR1 O;  3R66 A;  4DR6 O;  5FLX N;  2JRI A;  1FKA O;  1J5E O;  4LF4 O;  4LF9 O;  4DV6 O;  5IWA O;  4JI7 O;  4DUZ O;  4B3S O;  1AIL A;  4LF6 O;  4KHP O;  1D2D A;  4OX9 O;  1HNZ O;  4DR3 O;  5H5N A;  4AQY O;  4YHH O;  3J81 N;  4DR4 O;  4DV3 O;  1R6T A;  2AGA A;  2FKX A;  5LMU O;  4JI2 O;  4DV1 O;  5BR8 O;  3M8A A;  1N36 O;  4JI1 O;  4LF7 O;  1HNX O;  2UU9 O;  4X65 O;  4JI6 O;  1FYJ A;  1XMO O;  3JAM N;  4DUY O;  4OPH A;  1HR0 O;  1HNW O;  4DV0 O;  4NXN O;  2HHH O;  1XNQ O;  2UXD O;  4GKK O;  4X66 O;  5IT9 N;  4LF5 O;  1XNR O;  1IBL O;  2UXC O;  5BY1 A;  4DV2 O;  4DV5 O;  4JYA O;  1G1X B;  4A5U B;  4DR2 O;  4LF8 O;  1X59 A;  4B3T O;  4GKJ O;  4JI8 O;  2VQE O;  2N74 A;  1N34 O;  4B3R O;  1NS1 A;  3OTO O;  1F7Y A;  4YY3 O;  4B3M O;  2ZKO A;  3T1H O;  3O65 A;  1A32 A;  3RT3 C;  5A2Q N;  1I94 O;  2F4V O; 
#chains in the Genus database with same CATH topology
 1K4C C;  1RSO A;  1EZV H;  4TV9 A;  1AP5 A;  2PZS A;  5A9G A;  1PKX A;  1JA8 A;  4PJ0 Z;  1IUR A;  3JD3 A;  1IXB A;  1Q81 W;  1R1B A;  2OIG A;  2HLD G;  1SC5 B;  1NJI W;  1DK1 A;  1ROP A;  3JCU Z;  5LHI A;  1IBK O;  1VQ9 V;  1SA0 B;  3A0B Z;  4PA7 A;  2QDO A;  4RO2 A;  4EB6 A;  1S77 D;  4IYI A;  1VQP V;  3T1C A;  5LP6 B;  2DWD C;  3QG5 A;  3K5N A;  4DR6 O;  3E22 B;  2DMX A;  3BCC H;  3QVN A;  3K79 A;  2AXT Z;  3L9D A;  3CEI A;  4G28 B;  1MAB G;  1M93 A;  4J9Z B;  5GON A;  1URF A;  2LJ2 A;  3PJS K;  4MTO A;  1TVK B;  2RJZ A;  4JI6 B;  5LMU O;  4XDL A;  2IJK A;  3CHX A;  3M8A A;  3S3X A;  3OFN G;  1HNX O;  4ICG A;  4X65 O;  1JFF A;  4JZ2 A;  1IBL B;  1HR0 O;  1XQ8 A;  4DV0 O;  3AG2 C;  1XNQ O;  3KZI Z;  4WF9 V;  4LF5 O;  2B1I A;  4GKJ B;  3JAR B;  2Q0A A;  4U7N A;  5DED A;  4O4J A;  3ZRX A;  4G2K A;  3RWR D;  1XL4 A;  1YIT V;  4A5U B;  2QSA A;  2QM8 A;  3H1I H;  1U97 A;  1MOF A;  3EFF K;  5CMU A;  4YJ3 A;  4LFA B;  1VQ7 V;  1PL0 A;  3ZHV A;  1YJW V;  2CGN A;  3JSN A;  1H2K A;  3ETD A;  4TV8 B;  1WA8 B;  3LDD A;  4AHC A;  1KP3 A;  2JIZ G;  1DTO A;  1ZX3 A;  1XIL A;  3KCX A;  3JYC A;  4XDK A;  4K0K O;  4DV4 B;  4X62 B;  1YSC A;  2YSU B;  3DXR B;  1AJN A;  2FL4 A;  2CTQ A;  2KG7 A;  4ABM A;  1EN6 A;  1VMG A;  4O2B B;  3DTU B;  4IIJ B;  4ZI7 B;  1BE3 H;  1G8M A;  3T1Y B;  2EIM C;  5BMV B;  2GDS A;  4LCU C;  2XAG A;  1Z2G A;  1OCR B;  3IC9 A;  1QVG U;  1OV9 A;  4HNA B;  1KC8 W;  3RYI B;  1Y74 B;  4PI0 A;  3BA8 A;  1Y76 A;  4MS2 A;  1K3E A;  3FB5 C;  2RQ6 A;  2HVJ C;  4LP8 A;  3JAT A;  2WWW A;  2Z3Y A;  4X1Y B;  3N2G A;  2P22 C;  2P4K A;  2UXD B;  4I55 B;  1V55 B;  2BCC H;  1DGS A;  2XAJ A;  4J80 A;  2JDI G;  3W7X A;  4GKK O;  3UT5 A;  1NBM G;  3T2M A;  3JAK B;  1BZK A;  4CH6 A;  3I5D A;  1FXH A;  1O9G A;  2YID A;  3L71 H;  4O4H B;  5KHG A;  4LH6 A;  1KD1 W;  2OWO A;  4TSF G;  3AG4 B;  2YXY A;  2CGO A;  1F7Y A;  1ZWI C;  4TQF A;  1NVP B;  1B6Q A;  3T4Z A;  1GM8 A;  1KKC A;  1FFX B;  2PI5 A;  4I9Q A;  1BCC H;  1MZF A;  4J7Z A;  1QCE A;  3E86 A;  2F4V O;  4NR1 A;  3G4S V;  2LW7 A;  1VQ4 V;  2A06 H;  4XBF A;  2L35 A;  2K1E A;  4MW3 A;  3ABK B;  2G38 A;  2HVK C;  2QWR B;  1S0V A;  4LH7 A;  4PDM A;  5CBH A;  4DW0 A;  1SKV A;  3ETG A;  1W2B U;  1NTM H;  2NLJ C;  1KYO F;  2QJ1 A;  1EFR G;  3BFR A;  3CCS V;  1XUQ A;  4RQF A;  1NH2 D;  3C3T A;  1SQG A;  4QIW F;  3ZN0 A;  4DV7 B;  1PD3 A;  1Q6I A;  1E1Q G;  2DYR C;  4AI8 A;  2Q5Z A;  4QPJ A;  3QF7 A;  4J7K A;  4LF4 B;  4FM1 A;  1GRJ A;  1BQZ A;  1GAX A;  1WB8 A;  4IHJ B;  4DUZ B;  1JJ2 U;  4WFG A;  5CA0 A;  5JQG A;  2OCH A;  3CC7 V;  1SQQ H;  3ASN C;  2A9H A;  2WLK A;  4UFZ A;  4YHH O;  4DV3 O;  3QTC A;  1K8A W;  1KBH A;  3ZHT A;  4JF3 A;  3FB8 C;  4CH3 A;  2Y69 B;  1OCO B;  5EBW C;  4R50 A;  3CCQ V;  5LXT A;  3QO7 A;  4TOI A;  3STL C;  5KUM A;  1XNR O;  3TXS A;  3N2K B;  3K59 A;  3OMN B;  2DWE C;  2BTQ A;  1EN4 A;  4IGG A;  3ABL B;  5L3F A;  5B1B C;  4B3T O;  1V54 B;  4YXW G;  3TK1 A;  1VQL V;  4NB5 A;  3ZMZ A;  2ZKO A;  4MVS A;  1IXM A;  4CS2 A;  1GN3 A;  2DQ3 A;  4YIP A;  5B3S B;  2F1M A;  1GN4 A;  1I5Y A;  4FLU A;  1AJP A;  1P7B A;  3RN4 A;  1AB3 A;  3ZHR A;  4WFE A;  5ITZ A;  1FJG B;  1KMI Z;  4KHP B;  3BA9 A;  3WB2 A;  4NXM B;  5H2F Z;  4LFB O;  4I50 A;  1Z5V A;  4FFB A;  3G80 A;  1FPO A;  1Q90 D;  1I5X A;  2VRZ A;  2OT5 A;  1ZTE A;  2WA3 A;  1MSW D;  1YZB A;  5B1A C;  2JJ1 G;  4H13 B;  4X20 B;  4D6T H;  3FB6 C;  5CB4 B;  4KFM A;  1VF6 C;  4JI0 O;  1BQ0 A;  2IU3 A;  4B3S B;  3R66 A;  2F43 G;  1J5E O;  3CP1 A;  1YF2 A;  3B09 A;  3LUT B;  3S3W A;  4WFH A;  4UV9 A;  1YJ9 V;  2NNU A;  5LOV A;  5JCO C;  2P67 A;  5CA1 B;  2WLI B;  3OMA B;  2Q67 A;  2AHZ A;  1TUB A;  4H37 A;  3LDE A;  3AK1 A;  2FKX A;  1R3L C;  2UU9 B;  1M5I A;  4CZZ A;  3F5W C;  4PA6 A;  2LQT A;  4MT8 A;  2KB1 A;  4GT1 A;  1NTK H;  2Q7G A;  1YJN V;  3ABU A;  3H9V A;  2BSK B;  5JJN B;  4X66 O;  5IY5 B;  3MD0 A;  1T5E A;  3O9O A;  2Y4T A;  4B3R B;  4JYA O;  4UVA A;  1VIB A;  4FLZ A;  1PM9 A;  3CJH A;  4CC6 A;  5IE9 A;  1B04 A;  4WFA V;  2LFS A;  1HDJ A;  4JYB A;  1ZL8 A;  1PV0 A;  2XAS A;  4JI4 O;  1F51 A;  3JD0 A;  2ZCE A;  3M99 B;  5LMN O;  3JAW A;  5CN0 A;  2ZXW C;  1O9H A;  4OPA A;  2DE0 X;  2ZIO A;  4TUY B;  2YIB D;  3ZS8 C;  4GUN A;  2M7W A;  5CBG A;  1M9N A;  4K8Z A;  1IBK B;  1LNQ A;  5KHI A;  4BIO A;  2GUZ A;  1I08 A;  5DN6 G;  3CME V;  3L73 H;  2ARH A;  3DGE A;  2IJJ A;  4N23 A;  4UCS A;  5J2U B;  3CC2 V;  5K1X A;  2ZE7 A;  4JI5 O;  2F23 A;  4DR6 B;  1W0J G;  2EIJ C;  1SZX A;  2FTK A;  4RUF A;  1VQ6 V;  4B08 A;  3CWB H;  2WA4 A;  2P7T C;  3H1H H;  2JRI A;  2R9A A;  2VWJ A;  3ZHQ A;  3CS5 A;  2OIE A;  1KQS U;  2Q73 A;  3SPG A;  4KHP O;  1NT2 B;  5LMU B;  3HR0 A;  2ODM A;  1WP7 A;  2AGA A;  3H1L H;  4CS3 A;  1HNX B;  4X65 B;  1R73 A;  4MSW C;  1H2G A;  4PV1 B;  3G6E V;  4DW1 A;  4O4I A;  1HR0 B;  1LUW A;  4DV0 B;  1F4M A;  4N21 A;  1SQF A;  4JI1 O;  4LF5 B;  4O4L A;  5J2T B;  1Y6X A;  2Y48 A;  1YEW A;  4DUY O;  3Q4H A;  4U3J B;  3CXC U;  2DYS B;  4PI2 A;  1S5J A;  3HKC B;  5EZY B;  1K92 A;  3GWK C;  5LYJ B;  3WG7 B;  2HR3 A;  2PYJ A;  3QNE A;  1VQM V;  1CP9 A;  1H2L A;  3X2Q C;  2WLH A;  3D36 A;  1N34 O;  4W4L A;  4JGS A;  3RYH A;  2YC0 A;  4IYH A;  3T1H O;  1WAZ A;  3L72 H;  4W4K A;  1XI1 A;  4FZ1 A;  3G6B A;  2F95 B;  4K0K B;  2GHY A;  2XOK G;  3W7S A;  2ZIN A;  3NR7 A;  1GMG A;  2ZNI A;  2ZDI C;  1NR7 A;  2JGU A;  2CE4 A;  1QU7 A;  3QO8 A;  2PGG A;  4I7Z B;  4NKG B;  1S72 V;  1MSD A;  5IDJ A;  4J10 A;  3IJ4 A;  1SQX H;  3HB3 B;  2EIK B;  2E3C A;  3ZJZ A;  4GX2 A;  4D7S A;  1Q6H A;  1GK9 A;  1ZAU A;  3RYF B;  4CC5 A;  4MW8 A;  1XOU A;  1IBM O;  2VWK A;  4EFE A;  4X64 O;  4O2A B;  4I0X B;  3ETE A;  1GN2 A;  5JVD B;  1P4R A;  2AW9 A;  1AI7 A;  1RP3 B;  1BS3 A;  4I9W A;  2OCC B;  2W6J G;  2IU0 A;  1NQT A;  3HKD B;  3SGI A;  5IWA O;  1YXB A;  1AIL A;  3RVY A;  3OUF A;  4LF6 O;  2WLJ A;  1SA0 A;  2QTO A;  2LFR A;  5C93 A;  4OX9 O;  2ZQM A;  3HPL C;  5LP6 A;  2EJR A;  1M4U A;  5KHH A;  1RM1 C;  3E22 A;  4GKK B;  1PPJ H;  4LNU B;  4OGQ B;  4NTX A;  1FYJ A;  2GBO A;  3TGU H;  3SPI A;  5EK0 A;  3E8H A;  5IJ9 B;  1YIJ V;  1AR4 A;  3OM3 B;  2FB5 A;  2JEU A;  3AG7 A;  2EIL C;  2JEX A;  4X1I B;  2OTL V;  4Q6G A;  2F4V B;  2ZDI A;  1Q3E A;  2HKO A;  2NN4 A;  2R72 A;  3O65 A;  3JAR A;  1TUE B;  3ZRW B;  4UVB A;  2X0L A;  1V55 C;  3UO2 A;  1HP8 A;  3VQW A;  1RPR A;  1I0H A;  4BWA A;  3E2E A;  4YJ2 B;  3SR2 C;  5DM6 V;  4BIZ A;  3K5O A;  4EKW A;  3GVM A;  3K3W A;  4GZR B;  2EIN C;  2P4V A;  1B06 A;  5IYD O;  3JD2 A;  3P3N A;  1HWY A;  4TV8 A;  1US6 A;  1WA8 A;  3EXA A;  3OEE G;  3E35 A;  4J9Y B;  5GW7 A;  4X88 A;  3OUS A;  2AHY A;  1PNK A;  1VEW A;  3DXR A;  3VQX A;  3A8T A;  3JAL B;  2XUM A;  3L70 H;  1SES A;  4O2B A;  3CXH F;  4IIJ A;  3ZHU A;  3ZRV A;  3K08 A;  4ZI7 A;  2RDC A;  5FPO A;  4BAY A;  3LDC A;  5BMV A;  4YHH B;  5D5Q A;  4DV3 B;  4DXW A;  2FML A;  3FX7 A;  4DRX B;  2JGD B;  4HNA A;  3K0D A;  1E1R G;  3CD6 V;  3HKE B;  5EIB D;  3RYI A;  1Y74 A;  2BTO A;  4UCT A;  2ZR3 A;  3WFV A;  1V9P A;  4QE9 A;  1I7F A;  1NR1 A;  1OCZ C;  2Q9L A;  4QPK A;  1XNR B;  4FZ0 A;  4U3F H;  2Q8V A;  5KMG B;  2RNB A;  2W0X A;  4JAV A;  4UVC A;  4UXN A;  1Q86 W;  4B3T B;  4QGP A;  4X1Y A;  1XMQ B;  1XHZ A;  5BY1 A;  4DV2 O;  4DV5 O;  2UXX A;  2P5O A;  2Z5U A;  2F93 B;  4DR5 B;  3AG1 C;  4I55 A;  4LC1 A;  3CSX A;  1VQO V;  2EUL A;  3MHH C;  3C90 A;  2CAZ C;  3BAA A;  3ZMS A;  3LSU A;  3FYE B;  3ZCC A;  4ZIB A;  4ZOL B;  2ADQ B;  3JAK A;  1UFI A;  1NVP D;  1IVS A;  3UQ8 A;  2UUB O;  1NKD A;  2N04 A;  1YTF B;  3OE7 G;  2X6C A;  4O4H A;  4UCU A;  5L3C A;  4JI3 O;  4LFB B;  4KL1 A;  5EYP B;  3AG2 B;  1FFX A;  1WPB A;  1Q6U A;  3BAB A;  5LGT A;  1TAE A;  1EM1 A;  2ITD C;  4FPP A;  2A0L A;  4JI0 B;  2E74 B;  3NXS A;  2Y4U A;  2PUS A;  4H33 A;  3F5T A;  2R9R B;  1J5E B;  3ETQ A;  4RUE A;  1ORQ C;  4QNH B;  5IYZ B;  2XAF A;  4UCV A;  2XT9 A;  4JI7 O;  1CPY A;  3BHP A;  4FMT A;  1SZT A;  2VQE B;  3FAV B;  1P49 A;  4MTX A;  3B2E E;  5LGU A;  4IHJ A;  4J42 A;  1Q82 W;  2HJF C;  1BT8 A;  4P9P A;  5CA3 A;  4K3A A;  2X6A A;  4X66 B;  2V1D A;  2EIM B;  2IH3 C;  3ASO C;  5EC2 C;  1KEC A;  2QM7 A;  3RW0 A;  3SPC A;  3IGA C;  4JYA B;  5IJ0 B;  4JTC B;  4NVP A;  4ZHQ B;  3DC5 A;  2PYL A;  1M1K W;  1G1X B;  1G4Y B;  2CDY A;  4WCE V;  4WFF A;  1NI8 A;  4B7K A;  3P32 A;  1AI4 A;  1J95 A;  2ZE8 A;  1AP6 A;  3IC7 A;  3ABT A;  1L0L H;  4YY3 O;  4JI4 B;  1UPG A;  4F6R B;  1H8H G;  2IBZ H;  3ZN1 A;  5LMN B;  4B3M O;  2HJD A;  2QGN A;  1E79 G;  2GTA A;  1NZ6 A;  3W7T A;  3ZHS A;  1M57 C;  1PNM A;  5KAF Z;  5IY5 C;  4DO2 A;  5LL6 Y;  1IDS A;  1XMQ O;  1SRY A;  3P30 A;  5BXZ A;  4QE7 A;  4DR5 O;  3E8G A;  1MNG A;  4FLT A;  3D3Q A;  1N33 O;  1S5L Z;  4JI5 B;  1YDX A;  2IM9 A;  1ENV A;  2BOB C;  3RBZ A;  3L75 H;  3CRM A;  4GX0 A;  2UUC O;  1H2M A;  3LSQ A;  1M56 C;  4FM2 A;  4MVQ A;  4PA4 A;  2H3O A;  2DQ0 A;  5C8Y B;  1D5A A;  2LGQ A;  2YXH A;  2B1G A;  4IL6 Z;  5JH7 B;  1SS3 A;  4X9Q A;  4J41 A;  1GM9 A;  4LF8 B;  4X20 A;  5GTH Z;  3RYC B;  5L3B A;  1PP9 H;  3HKB B;  3FD9 A;  1PL4 A;  4JI1 B;  2JK5 C;  1JMK C;  1SET A;  4DUY B;  2ZE6 A;  4JI2 O;  5BZB A;  4BIU A;  5HFM A;  2ZM6 B;  1VF7 A;  1RPO A;  3E83 A;  5CA1 A;  3ML0 A;  1HNW O;  2DYR B;  3GB7 C;  3CCE V;  1NU1 H;  2WLI A;  2HHH O;  1B3Q A;  4FFB B;  2EZP A;  3FB7 C;  4P9O A;  3UKM A;  1FXV A;  2QA4 V;  3OTF A;  1FD9 A;  2UUA B;  1QR9 A;  1N34 B;  2DW4 A;  5LA6 B;  3H1K H;  3ABM B;  2DN9 A;  1H38 A;  1R3K C;  2VQE O;  3T1H B;  2N74 A;  4JYC A;  3ASN B;  3OT7 A;  2BSK A;  1GTO A;  3RT3 C;  3SPJ A;  1Y4M A;  2RMK B;  2JS3 A;  2QKA A;  2CTW A;  2QWP B;  4CH5 A;  2DYS C;  1EN5 A;  3AG3 C;  5KUK A;  3CRC A;  4DR7 O;  3OD4 A;  1TUB B;  3FYI B;  4I4T A;  1HW7 A;  4ASU G;  2L6L A;  4JAS A;  1JQ0 A;  3ICX A;  5LHH A;  1SQB H;  1IBM B;  4CH4 A;  1Z5W A;  4X64 B;  3FKS G;  4BW5 A;  3JAS A;  5B1B B;  4J7J A;  2P90 A;  2MK3 A;  3SYQ A;  1U96 A;  2XHB A;  5DEC A;  1XEQ A;  3D36 C;  3CPW U;  2GSM B;  4TUY A;  4LFC O;  1FXK B;  3GWO A;  3SJC C;  4PA9 A;  3OAA G;  2QEX V;  5IWA B;  3ZMV A;  4DR1 O;  3VOU A;  4LF6 B;  1W59 A;  1QQC A;  3UM7 A;  4OX9 B;  4LF9 O;  4FK5 C;  2HG5 C;  2AZ0 A;  1BHB A;  1WJZ A;  5EBM C;  2IJH A;  3FFQ A;  2YIC A;  2R70 A;  5J2U A;  2YIB A;  2X6B A;  4PHZ A;  1K5S A;  3WB1 A;  4H0L B;  2QTS A;  1VQN V;  4R7C A;  3DC6 A;  3RGB A;  2QKC A;  5L3D A;  4WBN B;  1N0J A;  3W7W A;  4MTG A;  1H2S B;  3AEI A;  1I94 B;  2QWN B;  3CB2 A;  3C3S A;  3K9A A;  2ZT9 B;  4ZBM A;  4MTF A;  1YHQ V;  2F66 C;  3H01 A;  5GTI Z;  1XMO O;  5B1A B;  5B5E Z;  1EBO A;  1XL6 A;  1AJQ A;  3AK3 A;  2PF4 E;  2UXC O;  3LNN A;  1ARO P;  1X4T A;  1XHX A;  1JX9 A;  4DR2 O;  4LF8 O;  4UB8 Z;  2HP8 A;  5KA6 A;  5J2T A;  2EBO A;  4U3J A;  2A79 B;  2CTP A;  2MW2 B;  2ZR2 A;  3HKC A;  4X1K B;  2M6Y A;  5LP6 C;  5LYJ A;  3B40 A;  3SYA A;  3T4D A;  2YS8 A;  3DSQ A;  2ZM6 O;  4LWS B;  1JJO A;  5E79 Z;  3BVO A;  3TXQ A;  5CBF A;  1IZ3 A;  3CCV V;  1GO3 F;  5KX5 B;  3G67 A;  3IAY A;  2UUA O;  2YEV B;  4LBE C;  4JV5 O;  1K97 A;  4BR6 A;  3SPH A;  2XAH A;  3SYO A;  2KQX A;  3CX5 F;  3K58 A;  3Q4H B;  1PNL A;  3TJT A;  5H6Q A;  2CH7 B;  2LO1 A;  2WLL A;  2ITC C;  1JCH A;  3A0H Z;  4CBC A;  1D5N A;  2QR4 A;  5FNV A;  1EZJ A;  3G71 V;  2QM4 A;  3RYF A;  1Q7Y W;  4DV6 O;  2ZXW B;  3RYH B;  3APQ A;  4O2A A;  3N27 A;  4I0X A;  4E2L A;  4TT3 G;  3P3P A;  4DR3 O;  1M90 W;  3B8M A;  4AQY O;  1SQP H;  2CK3 G;  3J81 N;  4DR4 O;  3KKY A;  2LP7 A;  3TET A;  5B66 Z;  3F7Y C;  1VQK V;  4H44 B;  4Z1M G;  4DV1 O;  4MVR A;  3HKD A;  3D3I A;  1N36 O;  4JYY A;  1AI6 A;  1WN7 A;  1K34 A;  2W0F C;  4DV2 B;  4DV5 B;  4NXN O;  2EIJ B;  2E5L B;  1AVM A;  2FYU H;  1WB7 A;  2ZNJ A;  2IH1 C;  1K7D A;  4P30 A;  3CCJ V;  3OR6 C;  1S3J A;  1RSO B;  4LNU A;  5KLV H;  4JAU A;  4TV9 B;  3SYP A;  1N0N A;  1OCR C;  1AR1 B;  4R6Z A;  2UUB B;  1A32 A;  5A2Q N;  5IJ9 A;  1I94 O;  1JOY A;  3B8N A;  1VQ5 V;  1KP2 A;  4JI3 B;  4P2Z A;  1TVK A;  1W0K G;  4X1I A;  1MZE A;  5EC1 C;  2UXB O;  5EIB C;  5KHK A;  2VQF O;  1OCC B;  4EB6 B;  2DJV A;  3OR7 C;  3ZRW A;  2YI9 A;  1H2N A;  4R8C A;  1K5Q A;  1BL8 A;  1XDC A;  2QKS A;  4IT5 A;  4NTW A;  4OXS A;  2OTJ V;  3X2Q B;  4YJ2 A;  1ZSP A;  1Q5O A;  3MDS A;  3QO5 A;  4LF7 B;  1JR9 A;  1QLE B;  2B5U A;  3WU2 Z;  1BGY H;  4UUJ C;  1N8R W;  4JI7 B;  5GON B;  3OGI B;  2RN9 A;  3M7M X;  5H9C A;  1YI2 V;  3EHB B;  3AG4 C;  1JFF B;  2LW1 A;  5H6R A;  5D5P A;  4FLX A;  2ATK C;  1HNZ O;  2GTS A;  4PDR A;  3JAL A;  5H5N A;  3ZMT A;  2HEP A;  2PTM A;  2D3O W;  4O4J B;  3CRA A;  3SJQ C;  3TCU A;  4X8A A;  2E76 B;  3BY6 A;  5L3G A;  5LHG A;  5LGN A;  3JAM N;  3ABK C;  3KG2 A;  4YJ3 B;  1KU9 A;  4DRX A;  2WLM A;  2HFE C;  2JGD A;  3HKE A;  1AR5 A;  1YVW A;  3JD4 A;  1SQV H;  4YY3 B;  4JI8 O;  4B3M B;  1QLN A;  1DF5 A;  3CRQ A;  5KMG A;  3OTO O;  4PA3 A;  2JS5 A;  1R6N A;  2N05 A;  2KG7 B;  2Q6A A;  1QHT A;  1R3I C;  1MA1 A;  4TQD A;  2JJ2 G;  1RM1 B;  1GH6 A;  3J80 N;  4Q20 A;  2O57 A;  4FLW A;  3THO A;  2E5L O;  3E8B A;  1YTF D;  1N33 B;  3VQV A;  4ZOL A;  2R9I A;  1R3J C;  4GCZ A;  2V7Q G;  1K9M W;  4L87 A;  1COW G;  2EIL B;  1UJW B;  2Y69 C;  1OCO C;  3OGC C;  5TIS Z;  1Y76 B;  4LR3 A;  2UUC B;  1WPX A;  5EYP A;  3ZX6 A;  2NR5 A;  3JAT B;  5HFL A;  4FLY A;  5JWP A;  2ZD9 A;  4PDL A;  2QWQ B;  3SJB C;  3K57 A;  4X89 A;  1VAR A;  3ABL C;  4UCO A;  3N2G B;  2Q68 A;  1V54 C;  1Q8I A;  3H1J H;  1D2D A;  3ZMU A;  1XBL A;  3CCU V;  4K35 A;  2EIN B;  3CCL V;  4JI2 B;  1L0N H;  1OHH G;  3CCM V;  2KSD A;  3UT5 B;  5IYZ A;  3OMI B;  1JPX A;  3KCY A;  3ZBH A;  2UXN A;  5B3S C;  1HNW B;  1ZUQ A;  4HAM A;  4HBN A;  1VQ8 V;  2HHH B;  3ZIA G;  4LF7 O;  3K0G A;  4JI6 O;  4FVM A;  2QE7 G;  3FAV A;  2Q7H A;  1MMM A;  3WB0 A;  2WSS G;  4JTA B;  1MG1 A;  1DLB A;  4D7T A;  3K06 A;  4PD4 F;  1IBL O;  2YXL A;  1KKD A;  2VS0 A;  2XND G;  3SJA C;  3AK2 A;  4UV8 A;  1X59 A;  4AIL C;  4GKJ O;  3R65 A;  2WLN A;  4DK0 A;  4U7O A;  4JAA A;  1S5H C;  1LUV A;  4EFB A;  3L74 H;  3JCZ A;  2H8P C;  5IJ0 A;  4YIO A;  3K5M A;  4I5S A;  3U10 A;  3I56 V;  4ZHQ A;  5J9P C;  1NTZ H;  5B1O A;  4DR7 B;  4LFA O;  3B4S A;  2CUG A;  1OCZ B;  3EVK A;  1BHA A;  3W7U A;  3A0R A;  1XRE A;  4F6R A;  1NH2 B;  1QVF U;  2K9P A;  2D2C B;  5E1A C;  3ABM C;  5JJE B;  3CC4 V;  4DV4 O;  4X62 O;  3N2K A;  2E75 B;  4Z2W A;  4LFC B;  3BRC A;  5CA0 B;  1Q43 A;  2H94 A;  5JQG B;  3I55 V;  3AG1 B;  3UO3 A;  2ILM A;  4DR1 B;  1CEZ A;  2B9Z A;  2A3Q A;  3T1Y O;  2Y0P A;  3APO A;  4LF9 B;  3K04 A;  2RCV A;  1L1F A;  2EZO A;  2PY5 A;  1P7G A;  2IJI A;  4UB6 Z;  3U11 A;  2Q4P A;  4GX5 A;  5LXT B;  1IX9 A;  1AI5 A;  1R6K A;  3MHS C;  4B7E A;  2LGW A;  3B77 A;  1R6T A;  2BTQ B;  1XMO B;  4JPR A;  5C8Y A;  4MVU A;  1OZ0 A;  1FXK C;  4GX1 A;  5JH7 A;  3CRR A;  4BW9 A;  4OPH A;  1KB9 F;  2UXC B;  3RYC A;  1N32 B;  1F23 A;  2UXD O;  4KUM A;  4DYL A;  4PDV A;  3HKB A;  4DR2 B;  4PEL A;  4C7U A;  5CB4 A;  3OEH G;  2Q7E A;  1FS0 G;  4J11 A;  3OW2 U;  3A2F A;  1FFT B;  1OJH A;  5KHJ A;  2Y0I A;  1GN6 A;  5FPR A;  3MAQ A;  5ITZ B;  3E8F A;  1BSM A;  1K73 W;  4QJF B;  1GM7 A;  4TWK A;  1FAF A;  1Y67 A;  4I50 B;  5LA6 A;  5JJJ B;  1ZLZ A;  3BPZ A;  3ASO B;  4JV5 B;  1L8D A;  1WLE A;  5FL7 G;  2ETN A;  1VP7 A;  3CCR V;  2GV9 A;  1QR8 A;  2CTR A;  4CS4 A;  4JTD B;  2BE3 A;  2YUA A;  3RVZ A;  4HYO A;  4FIP C;  5LOV B;  5BR8 B;  2ADP A;  1WP8 A;  2YI8 A;  3CE2 A;  3SDL A;  4DV7 O;  1Y66 A;  4DV6 B;  4K8X A;  1N4C A;  4FLV A;  3WG7 C;  1DF4 A;  1FKA O;  4LF4 O;  4DK1 A;  4DR3 B;  4RAI A;  4DUZ O;  4AQY B;  1M57 B;  5LBQ A;  4DR4 B;  1QBZ A;  1FXK A;  2QWO B;  2Q69 A;  3D8C A;  4DV1 B;  1JVM A;  1N36 B;  3U0Z A;  4JZG A;  2Q0O C;  4I4T B;  4NXN B;  3IFX A;  4MVM A;  4XDJ A;  3CJH B;  2A7W A;  4HZ3 A;  4ZKI A;  1S76 D;  4MVZ A;  4RWU A;  2BOC C;  4RQE A;  5IT9 N;  3STZ C;  4WBN A;  1ZL8 B;  1M56 B;  3JAS B;  3ZED A;  1TA8 A;  1YCI A;  2EIK C;  2XTA A;  4GLX A;  2EX3 A;  1P84 F;  5IYC O;  3JAW B;  4EEQ A;  1GKF A;  5K1P A;  2JVD A;  3ZRS A;  1WNS A;  1K4D C;  2WAM A;  1VF6 A;  4FJC C;  2OCC C;  2P6J A;  1BMF G;  2UXB B;  2WPD G;  2VQF B;  2GUZ B;  1QNM A;  3BEH A;  2YDE A;  1N32 O;  2XAQ A;  2ZE5 A;  3UCS C;  5JCO A;  1K33 A;  5F2V O;  2V4D A;  2KKW A;  5KAI Z;  2OYQ A;  5IYB O;  3PN1 A;  4X1K A;  1FJG O;  4E4E A;  3CYO A;  4LWS A;  4Z1V A;  5EZY A;  4KP4 A;  4WFB V;  4NXM O;  3CMA V;  3J7A U;  1THZ A;  1H8E G;  4L8J A;  3SYC A;  2AZ2 A;  4G27 B;  5KX5 A;  4GYC B;  5AG2 A;  2YEV A;  3LNM B;  1KUQ A;  3K5L A;  2ZIM A;  3VQY A;  5L3E A;  2Z0A A;  2DOS A;  1XNQ B;  4F6E A;  5FLX N;  2X7R B;  4MVO A;  1HNZ B;  4O4I B;  2P06 A;  2C2A A;  1OCC C;  4B3S O;  3AG3 B;  4O4L B;  4F4L A;  2CH7 A;  1CXZ B;  5B1N A;  3E89 A;  4FM0 A;  2IW5 A;  3K03 A;  3K9S A;  2YIA A;  4NYK A;  3VBB A;  5KA5 A;  5BR8 O;  2UU9 O;  2EJ7 A;  1QLE C;  4KXR A;  1G6U A;  3LSS A;  1SF9 A;  1VF5 B;  4UCR A;  4JI8 B;  5JVD A;  3OTO B;  5EBL C;  1SER A;  3RFR A;  3F7V C;  2W6I G;  3JSL A;  2WLL B;  1LR1 A;  4B3R O;  1F4N A;  1NS1 A;  4FFK A;  1TGO A;  1RFY A;  4NTY A;  2PI4 A;  3JD1 A;  5FNV B; 
#chains in the Genus database with same CATH homology
 4JI4 O;  2LW7 A;  4LFA O;  3J80 N;  5LMN O;  2ZM6 O;  2UUB O;  1N32 O;  1AB3 A;  4OPA A;  4DR7 O;  4JI3 O;  2UXB O;  4K0K O;  2VQF O;  2E5L O;  5LL6 Y;  2UUA O;  1XMQ O;  2DJV A;  5BXZ A;  4JV5 O;  4DR5 O;  4LFB O;  4DV4 O;  4X62 O;  1FJG O;  1N33 O;  4NXM O;  1R1B A;  1IBM O;  1DK1 A;  1XEQ A;  3J7A U;  4X64 O;  1YZB A;  1IBK O;  4LFC O;  4JI5 O;  3F5T A;  3T1Y O;  2UUC O;  3SDL A;  4DV7 O;  1KUQ A;  4JI0 O;  2Z0A A;  2DOS A;  4DR1 O;  3R66 A;  4DR6 O;  5FLX N;  2JRI A;  1FKA O;  1J5E O;  4LF4 O;  4LF9 O;  4DV6 O;  5IWA O;  4JI7 O;  4DUZ O;  4B3S O;  1AIL A;  4LF6 O;  4KHP O;  1D2D A;  4OX9 O;  1HNZ O;  4DR3 O;  5H5N A;  4AQY O;  4YHH O;  3J81 N;  4DR4 O;  4DV3 O;  1R6T A;  2AGA A;  2FKX A;  5LMU O;  4JI2 O;  4DV1 O;  5BR8 O;  3M8A A;  1N36 O;  4JI1 O;  4LF7 O;  1HNX O;  2UU9 O;  4X65 O;  4JI6 O;  1FYJ A;  1XMO O;  3JAM N;  4DUY O;  4OPH A;  1HR0 O;  1HNW O;  4DV0 O;  4NXN O;  2HHH O;  1XNQ O;  2UXD O;  4GKK O;  4X66 O;  5IT9 N;  4LF5 O;  1XNR O;  1IBL O;  2UXC O;  5BY1 A;  4DV2 O;  4DV5 O;  4JYA O;  1G1X B;  4A5U B;  4DR2 O;  4LF8 O;  1X59 A;  4B3T O;  4GKJ O;  4JI8 O;  2VQE O;  2N74 A;  1N34 O;  4B3R O;  1NS1 A;  3OTO O;  1F7Y A;  4YY3 O;  4B3M O;  2ZKO A;  3T1H O;  3O65 A;  1A32 A;  3RT3 C;  5A2Q N;  1I94 O;  2F4V O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...