1FYJA

Solution structure of multi-functional peptide motif-1 present in human glutamyl-prolyl trna synthetase (eprs).
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
57
structure length
57
Chain Sequence
DSLVLYNRVAVQGDVVRELKAKKAPKEDVDAAVKQLLSLKAEYKEKTGQEYKPGNPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords MULTIFUNCTIONAL AMINOACYL-TRNA SYNTHETASE
publication title Structural analysis of multifunctional peptide motifs in human bifunctional tRNA synthetase: identification of RNA-binding residues and functional implications for tandem repeats.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 57
sequence length 57
ec nomenclature ec 6.1.1.15: Proline--tRNA ligase.
pdb deposition date 2000-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00458 WHEP-TRS WHEP-TRS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1fyjA00
2JRIA 2DJVA 2ZM6O 4B3RO 3RT3C 4JI0O 1DK1A 1KUQA 5FLXN 2UUBO 3J80N 4DV3O 1YZBA 4DV5O 4JI2O 2ZKOA 2UXBO 1F7YA 4GKJO 3R66A 4DUYO 3JAMN 4LF4O 3T1YO 4A5UB 2UUCO 3M8AA 1X59A 1IBLO 4DR6O 4OPHA 4X65O 3O65A 5LMUO 4AQYO 4DR1O 1IBMO 4JI8O 4LFBO 1FKAO 5BXZA 4JI1O 5IT9N 3SDLA 1XMQO 1FYJA 4DR2O 1AILA 4NXMO 2F4VO 2FKXA 4X64O 1N33O 1R1BA 4YY3O 2E5LO 2UXDO 2DOSA 1N34O 1A32A 2N74A 5IWAO 2UU9O 4LFCO 4X66O 4K0KO 3F5TA 4LF7O 1HNZO 4KHPO 1XEQA 4DR3O 4JI4O 4DR4O 5H5NA 4LF8O 1HNXO 3J81N 5A2QN 4DV6O 4JI7O 4JV5O 1HR0O 4DR5O 1G1XB 3J7AU 4DV0O 5LMNO 4DV7O 1J5EO 1N32O 3T1HO 1R6TA 4JI5O 4DV1O 4DV4O 4B3MO 4LF5O 2LW7A 1HNWO 4LF6O 4DV2O 2VQFO 1IBKO 3OTOO 1AB3A 4B3TO 1FJGO 4X62O 4B3SO 5LL6Y 4DUZO 2UUAO 2Z0AA 4JYAO 1XNQO 2UXCO 1XMOO 2HHHO 4DR7O 4GKKO 4JI6O 4OX9O 4JI3O 4LF9O 2AGAA 4YHHO 4LFAO 1D2DA 5BY1A 1N36O 5BR8O 4OPAA 2VQEO 4NXNO 1I94O 1NS1A 1XNRO
chains in the Genus database with same CATH superfamily
3EFFK 5J9PC 1AJQA 2F95B 3E8HA 3NR7A 4DV3O 3K06A 1NH2D 4IHJB 3JAMN 3A8TA 3C90A 1BQZA 4HNAA 3VQXA 2ZCEA 3G4SV 3P30A 2ZE8A 4K8ZA 3N2GB 3N27A 2W0XA 5IT9N 4PDMA 1FYJA 2X6CA 1MABG 1XNQB 3IJ4A 4DV7B 4CH5A 5J2TA 1SQQH 4RQEA 3OEHG 3GVMA 3ZEDA 1A32A 2RJZA 3OW2U 2LP7A 3STZC 3D36A 1VQ8V 2P7TC 2GUZA 1YITV 1NQTA 1EN6A 3WFVA 4B08A 2HJFC 1HWYA 3ABUA 1GK9A 1MNGA 1PPJH 1XDCA 2KG7A 1QR9A 2JDIG 4TV9B 2Q7HA 4P2ZA 3ZCCA 4JV5O 3BRCA 1IX9A 4KFMA 2FB5A 1XREA 3T1HO 4RQFA 4R50A 3K5LA 1R6TA 1W59A 4LWSB 4B3MO 1P7BA 4XDLA 2QWPB 3E83A 2YEVA 5JH7B 3JAKB 1EM1A 5EZYB 4CBCA 4J7ZA 5FNVA 2EULA 5GONB 2XAJA 3ICXA 2UUAO 3WB2A 2LGQA 3K0GA 1N0JA 1R6KA 4X66B 2OYQA 1YTFD 4L8JA 5LOVA 2AGAA 1CXZB 1O9HA 4FM0A 3K04A 1F4MA 2EJ7A 4X89A 4DR3B 1NTZH 2WSSG 3B2EE 5LP6B 2P22C 3J80N 1AJNA 2YIBD 2L6LA 3QO5A 1DF4A 1PL0A 4MT8A 4YIOA 4JI5B 4UCTA 1OCRC 2DYRB 4U3JA 1NJIW 3JATA 4EKWA 3AG7A 4G2KA 1BT8A 2QWNB 3P3PA 2OIEA 1M4UA 1VF5B 4X64O 1S77D 4P9OA 1AP5A 5TISZ 3K57A 2OCCB 1KMIZ 4DW0A 3CSXA 1RPOA 1FS0G 3FKSG 3WB1A 1Q8IA 3GWOA 1HNWB 2Q9LA 4IIJB 1H2SB 4DV2B 1IBKB 2JEXA 1IDSA 1H38A 1UPGA 3JASA 2ZE6A 4PDLA 4PJ0Z 2JK5C 1KYOF 3MHSC 2XAQA 5LBQA 3OTFA 5E79Z 2DE0X 1M9NA 2E74B 3OGIB 2ZXWB 4JTCB 3IC9A 4LNUA 4UCSA 3K5OA 3H1JH 4IHJA 2LFSA 1OV9A 2UUBB 4JI2B 2FL4A 1FJGO 3VBBA 1BMFG 3ZRWB 1LUVA 2GSMB 3D36C 3DC6A 1VQ7V 4KP4A 2YI8A 5D5QA 2HHHO 1M56C 2DWDC 5CA1B 4ASUG 1H8HG 1VF7A 2C2AA 3CCLV 4AQYB 1GMGA 1VQ9V 2JS5A 4H13B 5KA5A 2ZNJA 1EFRG 3RYIB 5L3FA 2JJ2G 4CH4A 1SQXH 1F7YA 4DRXA 1I7FA 1P84F 4ABMA 5JWPA 2ZE7A 3PN1A 3AK2A 1HDJA 3UKMA 1JMKC 3CCQV 4TV9A 4WBNA 4F4LA 3H1KH 4KL1A 5BMVB 4UVBA 1AP6A 1GH6A 3RYFB 4GLXA 2V1DA 4F6EA 2PI5A 4TSFG 2LW1A 2PI4A 5KA6A 1FXHA 1I0HA 3JAKA 1QCEA 2Q5ZA 4RWUA 2CE4A 5GONA 5L3EA 5EYPB 3OD4A 3JAWA 1DF5A 1J95A 1GN4A 5KMGA 1KP3A 3SJAC 1XOUA 4ZI7A 4DR4O 1IZ3A 2V7QG 3RYCB 2PYJA 1KKCA 4QPJA 4NTYA 4QE9A 2YICA 2F93B 2XUMA 1IXBA 4GZRB 3ABMB 1QQCA 4LF9B 1K4DC 4TV8B 1N32O 4X65B 1VQKV 4GX0A 4NXNB 1VP7A 4LF5O 3CEIA 3ABKB 3CJHA 3BPZA 1L0LH 1FXKC 3ASOC 3JD3A 3AG4C 4FLYA 2WPDG 1X4TA 2WLLB 5IJ9B 2RQ6A 2EIJB 2X6BA 1I5XA 2W6IG 3Q4HB 2WAMA 4GKKO 4UV8A 4DR7O 4FLZA 1GM7A 1T5EA 3AG3C 4K8XA 1SF9A 5F2VO 1V55B 3B77A 1YEWA 3ZMSA 3FB7C 5EBMC 1XHZA 3H1IH 4E4EA 4X1YB 4RAIA 5IYZA 1NS1A 1S0VA 2KQXA 2JRIA 1YJNV 4LF8B 5KHGA 3HB3B 4JI7B 4AHCA 2NR5A 1YZBA 4BR6A 2QWOB 3L9DA 2Y69B 3K03A 2HFEC 2DWEC 1IBLO 3T1CA 1VMGA 1ZWIC 5IDJA 1HNZB 3KZIZ 1E79G 4UV9A 4MVZA 3QG5A 3THOA 1UJWB 2YS8A 3ABTA 5BXZA 2BCCH 2K1EA 1GN2A 3B8NA 2O57A 3P32A 4U7OA 3ASNB 3SPJA 1ZUQA 1B04A 3U0ZA 3JD1A 1I94B 2QR4A 4H37A 3LSUA 4Q20A 1Q86W 2WLKA 2N04A 5LYJB 1Y76B 3M99B 2P4VA 4MVMA 3ABLB 2RMKB 2EINC 1XUQA 1CEZA 1PD3A 3CB2A 2ETNA 3CCJV 1FD9A 3VOUA 3ZHVA 4DV1O 4EFBA 1N4CA 4I7ZB 4LF6O 2H8PC 1K34A 4HNAB 4MS2A 4IYHA 1GO3F 3CMEV 4D7SA 2QM8A 4IT5A 3STLC 3AG2B 1K7DA 2VQEO 1JOYA 4LFBB 4P9PA 3ZRVA 4FMTA 5J2TB 1K9MW 2PGGA 2ZIMA 4UB8Z 5LGUA 4CZZA 1XMQB 1VQ4V 2RNBA 3FYIB 2F4VB 3G80A 3OE7G 3ZHUA 1N33B 1ZTEA 2GUZB 1I08A 3ZHSA 4W4KA 4L87A 1AJPA 5EYPA 5BZBA 3BVOA 5LGNA 2KG7B 2LO1A 2HVKC 3ZHTA 3RYCA 2DYRC 1SS3A 1Y4MA 1TUEB 2DQ0A 1R3KC 4I55A 4WFEA 1FFTB 3K3WA 2ILMA 2OWOA 4NXMO 2YSUB 3JD2A 1K97A 5B1NA 4JTDB 4WFBV 3OFNG 4OX9B 4O4LB 2E5LO 4F6RA 5JJEB 5FNVB 3KCYA 2HLDG 2UU9O 2FTKA 3ZMTA 1BHBA 2OCCC 3ZJZA 1YVWA 2AZ0A 2EIMB 3JD0A 1QLEB 5LOVB 5JCOA 5H5NA 2YXYA 3ZMUA 5A2QN 4JYAB 2UXCB 5B5EZ 2HVJC 3HR0A 3TGUH 3RN4A 1BE3H 2D3OW 3HKBA 1GTOA 3K79A 4JI0B 3K9SA 1RSOA 3BA8A 2VQFO 2YI9A 2ZXWC 4U3JB 1Q43A 4IL6Z 4ZBMA 3D3IA 4DUZO 3JATB 2EIKB 2UUCB 2JJ1G 1M90W 4BIOA 3SJQC 3P3NA 1AI6A 1SQBH 2Y48A 4FZ1A 4OPAA 3JARA 2Z3YA 5DN6G 1EN5A 3W7XA 2ZQMA 4DV5O 3CXCU 3CMAV 1H2GA 2ZKOA 1W0KG 2UXBO 1D5AA 1Q6UA 2P6JA 4MW8A 4XDKA 4FLUA 1AR1B 3T1YO 1PNLA 2OTJV 3M8AA 4XBFA 1X59A 4X1KB 3S3XA 3W7UA 1WB7A 4B3MB 2HJDA 3T4ZA 4J9YB 2LGWA 3UT5A 3CCVV 4G27B 4YJ3A 3KKYA 2JIZG 5E1AC 4BIUA 3ETGA 1BL8A 1G4YB 4LH7A 2A79B 4DR5B 4DK1A 4MVSA 4LNUB 3LSSA 3L71H 3TCUA 4MTOA 1YDXA 1YF2A 2IJIA 3RYHB 4K0KO 3RWRD 1R73A 3G6EV 3E8GA 4B3TB 2QKAA 3JALA 4X62B 4JI4O 3DXRA 3K08A 2Q8VA 5JQGB 3ZN0A 2OT5A 4LP8A 1NU1H 4DV0O 5FL7G 4I9WA 1J5EO 1TVKA 5EK0A 3ABMC 3L73H 1JX9A 3FB8C 3CCRV 4D7TA 4DRXB 1AI7A 4FFBA 3L70H 3ZRXA 1G8MA 3ABKC 5A9GA 1KU9A 1P7GA 4X64B 1KP2A 1JJOA 5KX5A 2EINB 4GX1A 1R6NA 5LHIA 4WBNB 2EIJC 1Z2GA 4RUFA 1NR7A 2M6YA 3IGAC 4DW1A 4FIPC 4YHHO 4EEQA 3SPCA 5LMUB 1QVGU 1N36O 4PV1B 4QGPA 1V55C 1FFXA 2IJHA 2Z5UA 2MK3A 5L3GA 1OCOB 2DJVA 3K58A 3G6BA 3AEIA 3RT3C 4O4LA 3D8CA 2AZ2A 1HW7A 3SPHA 2IU3A 1ENVA 2OIGA 2KSDA 3JYCA 4MVQA 3JAWB 2OCHA 2JGUA 5KMGB 4CH6A 2Y69C 4TWKA 2F1MA 4ZI7B 1R3LC 2WLIA 1NTKH 1FPOA 4PA7A 1JJ2U 3SYOA 1ZX3A 1K5SA 4G28B 2Q0AA 2XASA 3DC5A 1SQVH 4PA3A 1PL4A 3CXHF 5HFLA 3OMIB 4J80A 3CJHB 2IH3C 4YJ2A 5KHKA 1YJ9V 2DN9A 2Q4PA 3ASNC 4U3FH 3QVNA 4O4HA 4OGQB 1BZKA 1M5IA 2P67A 3AG1B 2H94A 1GN3A 3DSQA 2CH7A 2EILB 3ETDA 5B1BB 5IYZB 4GT1A 1WPXA 4JZGA 5H6QA 4TQDA 5LHGA 4OXSA 4FM2A 4NYKA 3SPIA 5C93A 4DV7O 4B7KA 4FLVA 3ABLC 4Z1MG 4QJFB 2FYUH 1TGOA 1NT2B 2VWKA 2B9ZA 1COWG 4B3RB 1VEWA 1Q81W 2QSAA 3OTOO 3RGBA 4X1KA 1GKFA 5J2UA 2IH1C 2QA4V 4DUYB 4LF4B 2Z0AA 4Q6GA 2EZPA 2XTAA 1L1FA 2CGNA 2ARHA 2PUSA 1L8DA 2A3QA 3OR6C 1D2DA 3UO2A 4QPKA 3AG2C 1GM9A 1ORQC 3E22B 3FX7A 3PJSK 4DR2B 1B3QA 3F5WC 2CTWA 3RYHA 4YY3B 4HBNA 2ITCC 1NBMG 3CS5A 3SJBC 1MOFA 1MG1A 3S3WA 2AHZA 3ZBHA 1DGSA 1THZA 1Q7YW 3A0BZ 3O9OA 3LDEA 1Q90D 3O65A 4TUYA 2QM4A 3B8MA 3FD9A 5JQGA 3U10A 2A7WA 5D5PA 1JCHA 3W7WA 2XAGA 1VQNV 2ZNIA 4GKKB 4DR7B 3OT7A 2YIDA 2R70A 4I5SA 2XOKG 2WWWA 2B1IA 2L35A 1RFYA 1QNMA 3CP1A 3BABA 1EBOA 3B09A 1KQSU 1K4CC 2R9AA 3H1LH 4KHPO 2ZINA 1VQPV 5DM6V 1WP7A 2AW9A 1Q5OA 3I5DA 2EIMC 4PELA 4EB6A 2VS0A 4B3SB 5DEDA 3LNMB 1QLEC 2BTQA 1E1RG 4FZ0A 3IFXA 4X1IA 5GW7A 3E8FA 2QEXV 4P30A 3APQA 5LMNO 4JI3B 3SJCC 1VQ5V 4E2LA 5L3BA 3L74H 4PA9A 1Y6XA 4MVOA 4LR3A 3MDSA 3L75H 2LW7A 1YHQV 1HNWO 3ZN1A 3H01A 3EVKA 4DV2O 1IBKO 2Q0OC 3OR7C 5KHIA 4I50A 1PKXA 3TK1A 2IJJA 2WA4A 4I55B 1XMOO 2EIKC 1K5QA 5IYBO 1FXVA 2Q7GA 3BFRA 1Z5WA 5BR8O 4RUEA 3CRCA 4JI8B 3F7VC 2XHBA 1SQPH 4JZ2A 4F6RB 4MVRA 3I55V 1EZJA 1RM1B 1KUQA 1XL4A 5KHHA 2UUBO 3LDDA 1WJZA 2RN9A 5LGTA 4I4TB 1V54C 4JI2O 1XQ8A 3CX5F 1XBLA 3SGIA 4LBEC 4JGSA 1JVMA 2YC0A 5JVDB 1F51A 5IWAB 1Y74A 3R65A 1WAZA 4LFCB 3CCUV 4TOIA 1JFFA 2V4DA 4AQYO 4PDRA 4DO2A 2QJ1A 3ZRSA 1WPBA 1HNXB 1Q6IA 4LH6A 4XDJA 3HKBB 4CS3A 1RSOB 4HYOA 1NVPB 2N74A 2VQEB 4FM1A 2QWQB 3D3QA 3K0DA 3FYEB 4UCVA 3FB5C 4WFHA 1RP3B 1VQ6V 2HKOA 2KB1A 1DTOA 1MZEA 2CAZC 4JAUA 1H2NA 3EHBB 4YIPA 4TT3G 4DV6O 3JARB 2XT9A 3ML0A 2GBOA 5KUKA 3E2EA 5LA6A 3E22A 2WLJA 1Q82W 4LFAB 1BHAA 1GN6A 2PYLA 5KHJA 4K3AA 3CRAA 3NXSA 1XNRB 2GDSA 2NNUA 3EXAA 1OCCB 1AB3A 1AI5A 3UT5B 4J7JA 2JS3A 2E5LB 4YJ3B 3CRQA 4DR6B 4MTXA 4LF9O 5EIBC 1QU7A 1Z5VA 1U96A 4MVUA 1U97A 4NXNO 3HKDA 1GRJA 1MA1A 3HPLC 1B6QA 1OCZB 4JI1B 4JYBA 4R6ZA 1S5LZ 3CCMV 2PZSA 1OCOC 1PP9H 2YIAA 2P5OA 2HP8A 1SESA 3DTUB 4JAAA 2DQ3A 5GTIZ 3JALB 3CC4V 3DXRB 4FJCC 3CRMA 3LNNA 4LF7B 2HR3A 3W7TA 3CD6V 1TVKB 5CA0B 1H8EG 4PI0A 3SDLA 1O9GA 4UUJC 1M1KW 1VF6A 4FFBB 1ZLZA 2ZIOA 2CUGA 2DYSB 4X88A 2RDCA 1N34O 3W7SA 1NR1A 1ZL8A 4DYLA 5KX5B 1RPRA 1SQFA 3SR2C 1HNZO 1FAFA 2CTQA 5EIBD 4WFAV 3E8BA 4LC1A 4RO2A 4DV5B 1LR1A 2UXBB 2W0FC 4UVAA 3AG1C 3ETQA 3BY6A 1FFXB 2EILC 1M93A 4J42A 3A0RA 5B1BC 1QR8A 1URFA 4NTWA 4PA4A 1M57B 2BTOA 1XILA 4DV4O 2WLHA 4CH3A 4I4TA 5DECA 2NLJC 1SERA 3GB7C 5JVDA 1V9PA 4DV3B 4CS4A 2CTPA 2WLIB 2GHYA 1NKDA 2YIBA 3CC2V 4W4LA 5K1XA 5C8YA 4MTFA 2Y4UA 3WG7B 4K0KB 2ADQB 2CDYA 2N05A 1SC5B 5HFMA 2YUAA 4YJ2B 3F7YC 5K1PA 1MMMA 2ZM6O 3H1HH 1S5JA 3ETEA 1PNKA 3M7MX 2LFRA 2P4KA 1XHXA 3JCZA 2QWRB 4O4HB 4CS2A 2PY5A 1AR5A 4GKJO 5KAFZ 5CN0A 1BS3A 1TAEA 2F66C 4JTAB 2QE7G 4IYIA 2Y0IA 2QTSA 2CH7B 2GTSA 3OMNB 1YJWV 4I0XA 3C3TA 1AR4A 3L72H 4DR1O 1IBMO 2Y4TA 2BSKA 4LFBO 4R7CA 2D2CB 3H9VA 5IY5B 4R8CA 4J11A 4FLTA 1V54B 4PI2A 1XMQO 3K5NA 1K92A 4JV5B 4HAMA 4WF9V 2F4VO 4FLXA 2HEPA 1YXBA 1N33O 4BW9A 2ODMA 1CPYA 2VRZA 4FLWA 1QVFU 5LHHA 3T1HB 1Y66A 5J2UB 2EJRA 4B7EA 3CWBH 3CRRA 4D6TH 2JGDA 4O2BA 2Q6AA 2HG5C 3J81N 4AILC 2UUAB 5EC1C 1ZAUA 1WN7A 4ZHQA 1HR0O 3J7AU 1SQGA 3K9AA 4IGGA 5GTHZ 3IC7A 3N2KA 3LUTB 1EN4A 3RW0A 1VF6C 1YSCA 4UCUA 3BA9A 3SYCA 1BCCH 4X20A 4WCEV 3MHHC 3APOA 4GCZA 4TUYB 2ZR3A 4JYAO 3BEHA 4PD4F 2UXCO 3JSLA 4JI6O 5AG2A 3TJTA 5CA0A 3HKEB 5B1AB 3SYQA 2QKCA 5B3SB 5IE9A 3K5MA 1KC8W 4JI0O 2EBOA 3TXSA 1K33A 1RM1C 3FAVA 3CCEV 2UUCO 4BWAA 4EB6B 3HKCA 2BTQB 5JCOC 2M7WA 4X1IB 2X6AA 4ZOLA 2KKWA 3OTOB 1VIBA 5FPOA 3UO3A 4O4IA 1W2BU 1KD1W 1UFIA 4JYCA 4DXWA 5EC2C 2FKXA 4YXWG 2H3OA 3GWKC 3WU2Z 5LXTA 5FPRA 2G38A 2UXDO 2BOCC 3CCSV 2DOSA 2ZD9A 2Q7EA 1AVMA 1ROPA 4I50B 4J7KA 1K3EA 1OJHA 5CB4B 1LNQA 1SZXA 2Q73A 1FJGB 3K59A 3OMAB 1P4RA 3G67A 3MD0A 4DR5O 2R72A 2HHHB 4O2AA 1D5NA 4NVPA 4I9QA 1SA0A 3FB6C 2RCVA 4JPRA 1PNMA 4MSWC 2LQTA 4QNHB 1Y67A 1ZSPA 5L3DA 4JF3A 4UXNA 2IJKA 1Y74B 2CTRA 4NKGB 4MTGA 4B3TO 4X62O 1IURA 1OCCC 1JFFB 4NB5A 5B66Z 1XNQO 1H2MA 2BOBC 4NR1A 2FMLA 2E76B 4AI8A 4KHPB 4UB6Z 5KLVH 3C3SA 1WLEA 5IJ0A 1NVPD 2WLNA 3UM7A 1SKVA 4LCUC 1TUBA 1MSWD 1OCZC 5FLXN 2WA3A 5ITZA 5LMNB 1FXKA 1OZ0A 4FFKA 4A5UB 1QBZA 2B5UA 1NI8A 2E75B 4GYCB 3ZS8C 4PA6A 3T4DA 2R9IA 3IAYA 3BHPA 1Q3EA 5LMUO 2ZT9B 3VQWA 5LA6B 4WFFA 5H9CA 1WA8B 4Z1VA 4DR4B 4J41A 1KBHA 1S5HC 1QLNA 1AILA 3UQ8A 2Q68A 2QDOA 1XMOB 1YIJV 4ICGA 1N32B 4UFZA 4J9ZB 5BR8B 4LF5B 2DYSC 3AK1A 4X66O 1I5YA 1BSMA 1NH2B 1JQ0A 3B4SA 4DR3O 2DMXA 4BAYA 3TXQA 2GTAA 5IYDO 4DK0A 3HKEA 1YCIA 3HKDB 1S72V 3KG2A 4O4JB 4FPPA 1G6UA 1R3IC 2ATKC 3N2GA 2X0LA 2R9RB 3T2MA 2IM9A 1MZFA 4JI5O 1M57C 2CK3G 3U11A 3QO7A 5KAIZ 1R3JC 1KECA 2NN4A 3E35A 2QM7A 2B1GA 5L3CA 3X2QB 3OAAG 2UXNA 2YXHA 1IBLB 5JJNB 4Z2WA 1WB8A 3CPWU 4X8AA 4QE7A 3WG7C 3E86A 1TA8A 3RVYA 4H44B 4TQFA 4B3RO 4N23A 2F23A 4DV6B 1ZL8B 2E3CA 4ZKIA 4LWSA 4X9QA 3R66A 3FFQA 4DUYO 4LF4O 4WFGA 5CB4A 2A06H 5H2FZ 5JH7A 5EBWC 1PM9A 5EZYA 4QIWF 4OPHA 3DGEA 4U7NA 1OHHG 1JA8A 1YTFB 1VQLV 4DR2O 5EBLC 5IY5C 1KKDA 1Q6HA 1E1QG 4YY3O 1F23A 3ZIAG 1NTMH 2W6JG 2AXTZ 5LP6A 4DV1B 1XL6A 4BW5A 4LF6B 5C8YB 3KCXA 2QKSA 4CC6A 4ZIBA 3ZHQA 4H0LB 4UVCA 2ADPA 4FK5C 1H2LA 2F43G 1S3JA 1QHTA 3QO8A 4GX5A 4K35A 1KB9F 4I0XB 1DLBA 4B3SO 1IXMA 3E89A 2BSKB 4IIJA 1JR9A 1N34B 3CE2A 1WP8A 2EX3A 2PF4E 5CMUA 1WA8A 4JI3O 3SPGA 5H6RA 3QNEA 2A9HA 5IYCO 1AROP 5B1AC 4MW3A 5B3SC 5JJJB 1VQOV 2VWJA 4NXMB 1B06A 2IW5A 1LUWA 3JCUZ 3VQYA 2Q67A 2A0LA 3VQVA 5CBGA 4GUNA 2JGDB 4O2BB 1OCRB 1W0JG 2ZR2A 2UU9B 1HP8A 4DV4B 3A2FA 2XAHA 1N0NA 2P06A 4X65O 3ZRWA 4ZHQB 4JYYA 2CGOA 4JI8O 4O4JA 1FKAO 5CA1A 4PDVA 3N2KB 3I56V 1SZTA 2K9PA 1NZ6A 4EFEA 1SETA 4JAVA 4UCRA 4UCOA 2P90A 4X20B 2OTLV 3LDCA 3RYIA 5IWAO 4PHZA 4LFCO 2ZDIA 2QGNA 4C7UA 3QF7A 2ZM6B 3F5TA 2VQFB 3OM3B 1XEQA 4KXRA 3CC7V 4GKJB 4LF8O 1HNXO 4DUZB 4JI7O 2IBZH 2Q69A 1G1XB 1VARA 1S76D 3ZX6A 3RBZA 5B1OA 3FAVB 4DR1B 1IBMB 5BMVA 2UXXA 1YI2V 4JASA 1IVSA 3B40A 3BAAA 3RYFA 1CP9A 2BE3A 2AHYA 1GM8A 3HKCB 3OUFA 5LP6C 4ZOLB 3T1YB 3UCSC 1M56B 2QTOA 2XAFA 1F4NA 4O4IB 1VQMV 4LFAO 2Y0PA 1SRYA 5BY1A 3JSNA 2IU0A 5LXTB 1I94O 1K73W 2XNDG 1XNRO 1DK1A 4TV8A 1HR0B 3CHXA 1BGYH 3G71V 2X7RB 3RFRA 2YEVB 3BCCH 3QTCA 3OUSA 4DR6O 2WLLA 5IJ9A 2PTMA 3Q4HA 4O2AB 3ZMVA 3MAQA 4JI4B 1WNSA 1SA0B 2GV9A 4JI1O 2YXLA 1BQ0A 1H2KA 5CBHA 3ZHRA 4DV0B 4X1YA 4JI6B 1R1BA 1XI1A 1J5EB 2DW4A 1US6A 5CBFA 1K8AW 4CC5A 4LF7O 3A0HZ 3ZMZA 2JVDA 3SYAA 1L0NH 2MW2B 1MSDA 3TETA 1GAXA 4KUMA 5IJ0B 1AI4A 4FVMA 1TUBB 4YHHB 4NTXA 1N36B 1EZVH 1PV0A 3CYOA 5KUMA 5ITZB 1N8RW 3RVZA 1FXKB 3ASOB 1P49A 3WB0A 3AG4B 2ITDC 2JEUA 2WLMA 2YDEA 4J10A 3AK3A 3JD4A 3SYPA 2ZE5A 2LJ2A 4BIZA 3LSQA 5LL6Y 4H33A 1JPXA 2ZDIC 2UXDB 3AG3B 4GX2A 5LYJA 3X2QC 1Y76A 4HZ3A 3JASB 3OGCC 4OX9O 3OEEG 5CA3A 2EZOA 4N21A
chains in the Genus database with same CATH topology
2JRIA 2DJVA 2ZM6O 4B3RO 3RT3C 4JI0O 1DK1A 1KUQA 5FLXN 2UUBO 3J80N 4DV3O 1YZBA 4DV5O 4JI2O 2ZKOA 2UXBO 1F7YA 4GKJO 3R66A 4DUYO 3JAMN 4LF4O 3T1YO 4A5UB 2UUCO 3M8AA 1X59A 1IBLO 4DR6O 4OPHA 4X65O 3O65A 5LMUO 4AQYO 4DR1O 1IBMO 4JI8O 4LFBO 1FKAO 5BXZA 4JI1O 5IT9N 3SDLA 1XMQO 1FYJA 4DR2O 1AILA 4NXMO 2F4VO 2FKXA 4X64O 1N33O 1R1BA 4YY3O 2E5LO 2UXDO 2DOSA 1N34O 1A32A 2N74A 5IWAO 2UU9O 4LFCO 4X66O 4K0KO 3F5TA 4LF7O 1HNZO 4KHPO 1XEQA 4DR3O 4JI4O 4DR4O 5H5NA 4LF8O 1HNXO 3J81N 5A2QN 4DV6O 4JI7O 4JV5O 1HR0O 4DR5O 1G1XB 3J7AU 4DV0O 5LMNO 4DV7O 1J5EO 1N32O 3T1HO 1R6TA 4JI5O 4DV1O 4DV4O 4B3MO 4LF5O 2LW7A 1HNWO 4LF6O 4DV2O 2VQFO 1IBKO 3OTOO 1AB3A 4B3TO 1FJGO 4X62O 4B3SO 5LL6Y 4DUZO 2UUAO 2Z0AA 4JYAO 1XNQO 2UXCO 1XMOO 2HHHO 4DR7O 4GKKO 4JI6O 4OX9O 4JI3O 4LF9O 2AGAA 4YHHO 4LFAO 1D2DA 5BY1A 1N36O 5BR8O 4OPAA 2VQEO 4NXNO 1I94O 1NS1A 1XNRO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRI A;  2DJV A;  2ZM6 O;  4B3R O;  3RT3 C;  4JI0 O;  1DK1 A;  1KUQ A;  5FLX N;  2UUB O;  3J80 N;  4DV3 O;  1YZB A;  4DV5 O;  4JI2 O;  2ZKO A;  2UXB O;  1F7Y A;  4GKJ O;  3R66 A;  4DUY O;  3JAM N;  4LF4 O;  3T1Y O;  4A5U B;  2UUC O;  3M8A A;  1X59 A;  1IBL O;  4DR6 O;  4OPH A;  4X65 O;  3O65 A;  5LMU O;  4AQY O;  4DR1 O;  1IBM O;  4JI8 O;  4LFB O;  1FKA O;  5BXZ A;  4JI1 O;  5IT9 N;  3SDL A;  1XMQ O;  1FYJ A;  4DR2 O;  1AIL A;  4NXM O;  2F4V O;  2FKX A;  4X64 O;  1N33 O;  1R1B A;  4YY3 O;  2E5L O;  2UXD O;  2DOS A;  1N34 O;  1A32 A;  2N74 A;  5IWA O;  2UU9 O;  4LFC O;  4X66 O;  4K0K O;  3F5T A;  4LF7 O;  1HNZ O;  4KHP O;  1XEQ A;  4DR3 O;  4JI4 O;  4DR4 O;  5H5N A;  4LF8 O;  1HNX O;  3J81 N;  5A2Q N;  4DV6 O;  4JI7 O;  4JV5 O;  1HR0 O;  4DR5 O;  1G1X B;  3J7A U;  4DV0 O;  5LMN O;  4DV7 O;  1J5E O;  1N32 O;  3T1H O;  1R6T A;  4JI5 O;  4DV1 O;  4DV4 O;  4B3M O;  4LF5 O;  2LW7 A;  1HNW O;  4LF6 O;  4DV2 O;  2VQF O;  1IBK O;  3OTO O;  1AB3 A;  4B3T O;  1FJG O;  4X62 O;  4B3S O;  5LL6 Y;  4DUZ O;  2UUA O;  2Z0A A;  4JYA O;  1XNQ O;  2UXC O;  1XMO O;  2HHH O;  4DR7 O;  4GKK O;  4JI6 O;  4OX9 O;  4JI3 O;  4LF9 O;  2AGA A;  4YHH O;  4LFA O;  1D2D A;  5BY1 A;  1N36 O;  5BR8 O;  4OPA A;  2VQE O;  4NXN O;  1I94 O;  1NS1 A;  1XNR O; 
#chains in the Genus database with same CATH topology
 3EFF K;  5J9P C;  1AJQ A;  2F95 B;  3E8H A;  3NR7 A;  4DV3 O;  3K06 A;  1NH2 D;  4IHJ B;  3JAM N;  3A8T A;  3C90 A;  1BQZ A;  4HNA A;  3VQX A;  2ZCE A;  3G4S V;  3P30 A;  2ZE8 A;  4K8Z A;  3N2G B;  3N27 A;  2W0X A;  5IT9 N;  4PDM A;  1FYJ A;  2X6C A;  1MAB G;  1XNQ B;  3IJ4 A;  4DV7 B;  4CH5 A;  5J2T A;  1SQQ H;  4RQE A;  3OEH G;  3GVM A;  3ZED A;  1A32 A;  2RJZ A;  3OW2 U;  2LP7 A;  3STZ C;  3D36 A;  1VQ8 V;  2P7T C;  2GUZ A;  1YIT V;  1NQT A;  1EN6 A;  3WFV A;  4B08 A;  2HJF C;  1HWY A;  3ABU A;  1GK9 A;  1MNG A;  1PPJ H;  1XDC A;  2KG7 A;  1QR9 A;  2JDI G;  4TV9 B;  2Q7H A;  4P2Z A;  3ZCC A;  4JV5 O;  3BRC A;  1IX9 A;  4KFM A;  2FB5 A;  1XRE A;  3T1H O;  4RQF A;  4R50 A;  3K5L A;  1R6T A;  1W59 A;  4LWS B;  4B3M O;  1P7B A;  4XDL A;  2QWP B;  3E83 A;  2YEV A;  5JH7 B;  3JAK B;  1EM1 A;  5EZY B;  4CBC A;  4J7Z A;  5FNV A;  2EUL A;  5GON B;  2XAJ A;  3ICX A;  2UUA O;  3WB2 A;  2LGQ A;  3K0G A;  1N0J A;  1R6K A;  4X66 B;  2OYQ A;  1YTF D;  4L8J A;  5LOV A;  2AGA A;  1CXZ B;  1O9H A;  4FM0 A;  3K04 A;  1F4M A;  2EJ7 A;  4X89 A;  4DR3 B;  1NTZ H;  2WSS G;  3B2E E;  5LP6 B;  2P22 C;  3J80 N;  1AJN A;  2YIB D;  2L6L A;  3QO5 A;  1DF4 A;  1PL0 A;  4MT8 A;  4YIO A;  4JI5 B;  4UCT A;  1OCR C;  2DYR B;  4U3J A;  1NJI W;  3JAT A;  4EKW A;  3AG7 A;  4G2K A;  1BT8 A;  2QWN B;  3P3P A;  2OIE A;  1M4U A;  1VF5 B;  4X64 O;  1S77 D;  4P9O A;  1AP5 A;  5TIS Z;  3K57 A;  2OCC B;  1KMI Z;  4DW0 A;  3CSX A;  1RPO A;  1FS0 G;  3FKS G;  3WB1 A;  1Q8I A;  3GWO A;  1HNW B;  2Q9L A;  4IIJ B;  1H2S B;  4DV2 B;  1IBK B;  2JEX A;  1IDS A;  1H38 A;  1UPG A;  3JAS A;  2ZE6 A;  4PDL A;  4PJ0 Z;  2JK5 C;  1KYO F;  3MHS C;  2XAQ A;  5LBQ A;  3OTF A;  5E79 Z;  2DE0 X;  1M9N A;  2E74 B;  3OGI B;  2ZXW B;  4JTC B;  3IC9 A;  4LNU A;  4UCS A;  3K5O A;  3H1J H;  4IHJ A;  2LFS A;  1OV9 A;  2UUB B;  4JI2 B;  2FL4 A;  1FJG O;  3VBB A;  1BMF G;  3ZRW B;  1LUV A;  2GSM B;  3D36 C;  3DC6 A;  1VQ7 V;  4KP4 A;  2YI8 A;  5D5Q A;  2HHH O;  1M56 C;  2DWD C;  5CA1 B;  4ASU G;  1H8H G;  1VF7 A;  2C2A A;  3CCL V;  4AQY B;  1GMG A;  1VQ9 V;  2JS5 A;  4H13 B;  5KA5 A;  2ZNJ A;  1EFR G;  3RYI B;  5L3F A;  2JJ2 G;  4CH4 A;  1SQX H;  1F7Y A;  4DRX A;  1I7F A;  1P84 F;  4ABM A;  5JWP A;  2ZE7 A;  3PN1 A;  3AK2 A;  1HDJ A;  3UKM A;  1JMK C;  3CCQ V;  4TV9 A;  4WBN A;  4F4L A;  3H1K H;  4KL1 A;  5BMV B;  4UVB A;  1AP6 A;  1GH6 A;  3RYF B;  4GLX A;  2V1D A;  4F6E A;  2PI5 A;  4TSF G;  2LW1 A;  2PI4 A;  5KA6 A;  1FXH A;  1I0H A;  3JAK A;  1QCE A;  2Q5Z A;  4RWU A;  2CE4 A;  5GON A;  5L3E A;  5EYP B;  3OD4 A;  3JAW A;  1DF5 A;  1J95 A;  1GN4 A;  5KMG A;  1KP3 A;  3SJA C;  1XOU A;  4ZI7 A;  4DR4 O;  1IZ3 A;  2V7Q G;  3RYC B;  2PYJ A;  1KKC A;  4QPJ A;  4NTY A;  4QE9 A;  2YIC A;  2F93 B;  2XUM A;  1IXB A;  4GZR B;  3ABM B;  1QQC A;  4LF9 B;  1K4D C;  4TV8 B;  1N32 O;  4X65 B;  1VQK V;  4GX0 A;  4NXN B;  1VP7 A;  4LF5 O;  3CEI A;  3ABK B;  3CJH A;  3BPZ A;  1L0L H;  1FXK C;  3ASO C;  3JD3 A;  3AG4 C;  4FLY A;  2WPD G;  1X4T A;  2WLL B;  5IJ9 B;  2RQ6 A;  2EIJ B;  2X6B A;  1I5X A;  2W6I G;  3Q4H B;  2WAM A;  4GKK O;  4UV8 A;  4DR7 O;  4FLZ A;  1GM7 A;  1T5E A;  3AG3 C;  4K8X A;  1SF9 A;  5F2V O;  1V55 B;  3B77 A;  1YEW A;  3ZMS A;  3FB7 C;  5EBM C;  1XHZ A;  3H1I H;  4E4E A;  4X1Y B;  4RAI A;  5IYZ A;  1NS1 A;  1S0V A;  2KQX A;  2JRI A;  1YJN V;  4LF8 B;  5KHG A;  3HB3 B;  4JI7 B;  4AHC A;  2NR5 A;  1YZB A;  4BR6 A;  2QWO B;  3L9D A;  2Y69 B;  3K03 A;  2HFE C;  2DWE C;  1IBL O;  3T1C A;  1VMG A;  1ZWI C;  5IDJ A;  1HNZ B;  3KZI Z;  1E79 G;  4UV9 A;  4MVZ A;  3QG5 A;  3THO A;  1UJW B;  2YS8 A;  3ABT A;  5BXZ A;  2BCC H;  2K1E A;  1GN2 A;  3B8N A;  2O57 A;  3P32 A;  4U7O A;  3ASN B;  3SPJ A;  1ZUQ A;  1B04 A;  3U0Z A;  3JD1 A;  1I94 B;  2QR4 A;  4H37 A;  3LSU A;  4Q20 A;  1Q86 W;  2WLK A;  2N04 A;  5LYJ B;  1Y76 B;  3M99 B;  2P4V A;  4MVM A;  3ABL B;  2RMK B;  2EIN C;  1XUQ A;  1CEZ A;  1PD3 A;  3CB2 A;  2ETN A;  3CCJ V;  1FD9 A;  3VOU A;  3ZHV A;  4DV1 O;  4EFB A;  1N4C A;  4I7Z B;  4LF6 O;  2H8P C;  1K34 A;  4HNA B;  4MS2 A;  4IYH A;  1GO3 F;  3CME V;  4D7S A;  2QM8 A;  4IT5 A;  3STL C;  3AG2 B;  1K7D A;  2VQE O;  1JOY A;  4LFB B;  4P9P A;  3ZRV A;  4FMT A;  5J2T B;  1K9M W;  2PGG A;  2ZIM A;  4UB8 Z;  5LGU A;  4CZZ A;  1XMQ B;  1VQ4 V;  2RNB A;  3FYI B;  2F4V B;  3G80 A;  3OE7 G;  3ZHU A;  1N33 B;  1ZTE A;  2GUZ B;  1I08 A;  3ZHS A;  4W4K A;  4L87 A;  1AJP A;  5EYP A;  5BZB A;  3BVO A;  5LGN A;  2KG7 B;  2LO1 A;  2HVK C;  3ZHT A;  3RYC A;  2DYR C;  1SS3 A;  1Y4M A;  1TUE B;  2DQ0 A;  1R3K C;  4I55 A;  4WFE A;  1FFT B;  3K3W A;  2ILM A;  2OWO A;  4NXM O;  2YSU B;  3JD2 A;  1K97 A;  5B1N A;  4JTD B;  4WFB V;  3OFN G;  4OX9 B;  4O4L B;  2E5L O;  4F6R A;  5JJE B;  5FNV B;  3KCY A;  2HLD G;  2UU9 O;  2FTK A;  3ZMT A;  1BHB A;  2OCC C;  3ZJZ A;  1YVW A;  2AZ0 A;  2EIM B;  3JD0 A;  1QLE B;  5LOV B;  5JCO A;  5H5N A;  2YXY A;  3ZMU A;  5A2Q N;  4JYA B;  2UXC B;  5B5E Z;  2HVJ C;  3HR0 A;  3TGU H;  3RN4 A;  1BE3 H;  2D3O W;  3HKB A;  1GTO A;  3K79 A;  4JI0 B;  3K9S A;  1RSO A;  3BA8 A;  2VQF O;  2YI9 A;  2ZXW C;  4U3J B;  1Q43 A;  4IL6 Z;  4ZBM A;  3D3I A;  4DUZ O;  3JAT B;  2EIK B;  2UUC B;  2JJ1 G;  1M90 W;  4BIO A;  3SJQ C;  3P3N A;  1AI6 A;  1SQB H;  2Y48 A;  4FZ1 A;  4OPA A;  3JAR A;  2Z3Y A;  5DN6 G;  1EN5 A;  3W7X A;  2ZQM A;  4DV5 O;  3CXC U;  3CMA V;  1H2G A;  2ZKO A;  1W0K G;  2UXB O;  1D5A A;  1Q6U A;  2P6J A;  4MW8 A;  4XDK A;  4FLU A;  1AR1 B;  3T1Y O;  1PNL A;  2OTJ V;  3M8A A;  4XBF A;  1X59 A;  4X1K B;  3S3X A;  3W7U A;  1WB7 A;  4B3M B;  2HJD A;  3T4Z A;  4J9Y B;  2LGW A;  3UT5 A;  3CCV V;  4G27 B;  4YJ3 A;  3KKY A;  2JIZ G;  5E1A C;  4BIU A;  3ETG A;  1BL8 A;  1G4Y B;  4LH7 A;  2A79 B;  4DR5 B;  4DK1 A;  4MVS A;  4LNU B;  3LSS A;  3L71 H;  3TCU A;  4MTO A;  1YDX A;  1YF2 A;  2IJI A;  3RYH B;  4K0K O;  3RWR D;  1R73 A;  3G6E V;  3E8G A;  4B3T B;  2QKA A;  3JAL A;  4X62 B;  4JI4 O;  3DXR A;  3K08 A;  2Q8V A;  5JQG B;  3ZN0 A;  2OT5 A;  4LP8 A;  1NU1 H;  4DV0 O;  5FL7 G;  4I9W A;  1J5E O;  1TVK A;  5EK0 A;  3ABM C;  3L73 H;  1JX9 A;  3FB8 C;  3CCR V;  4D7T A;  4DRX B;  1AI7 A;  4FFB A;  3L70 H;  3ZRX A;  1G8M A;  3ABK C;  5A9G A;  1KU9 A;  1P7G A;  4X64 B;  1KP2 A;  1JJO A;  5KX5 A;  2EIN B;  4GX1 A;  1R6N A;  5LHI A;  4WBN B;  2EIJ C;  1Z2G A;  4RUF A;  1NR7 A;  2M6Y A;  3IGA C;  4DW1 A;  4FIP C;  4YHH O;  4EEQ A;  3SPC A;  5LMU B;  1QVG U;  1N36 O;  4PV1 B;  4QGP A;  1V55 C;  1FFX A;  2IJH A;  2Z5U A;  2MK3 A;  5L3G A;  1OCO B;  2DJV A;  3K58 A;  3G6B A;  3AEI A;  3RT3 C;  4O4L A;  3D8C A;  2AZ2 A;  1HW7 A;  3SPH A;  2IU3 A;  1ENV A;  2OIG A;  2KSD A;  3JYC A;  4MVQ A;  3JAW B;  2OCH A;  2JGU A;  5KMG B;  4CH6 A;  2Y69 C;  4TWK A;  2F1M A;  4ZI7 B;  1R3L C;  2WLI A;  1NTK H;  1FPO A;  4PA7 A;  1JJ2 U;  3SYO A;  1ZX3 A;  1K5S A;  4G28 B;  2Q0A A;  2XAS A;  3DC5 A;  1SQV H;  4PA3 A;  1PL4 A;  3CXH F;  5HFL A;  3OMI B;  4J80 A;  3CJH B;  2IH3 C;  4YJ2 A;  5KHK A;  1YJ9 V;  2DN9 A;  2Q4P A;  3ASN C;  4U3F H;  3QVN A;  4O4H A;  4OGQ B;  1BZK A;  1M5I A;  2P67 A;  3AG1 B;  2H94 A;  1GN3 A;  3DSQ A;  2CH7 A;  2EIL B;  3ETD A;  5B1B B;  5IYZ B;  4GT1 A;  1WPX A;  4JZG A;  5H6Q A;  4TQD A;  5LHG A;  4OXS A;  4FM2 A;  4NYK A;  3SPI A;  5C93 A;  4DV7 O;  4B7K A;  4FLV A;  3ABL C;  4Z1M G;  4QJF B;  2FYU H;  1TGO A;  1NT2 B;  2VWK A;  2B9Z A;  1COW G;  4B3R B;  1VEW A;  1Q81 W;  2QSA A;  3OTO O;  3RGB A;  4X1K A;  1GKF A;  5J2U A;  2IH1 C;  2QA4 V;  4DUY B;  4LF4 B;  2Z0A A;  4Q6G A;  2EZP A;  2XTA A;  1L1F A;  2CGN A;  2ARH A;  2PUS A;  1L8D A;  2A3Q A;  3OR6 C;  1D2D A;  3UO2 A;  4QPK A;  3AG2 C;  1GM9 A;  1ORQ C;  3E22 B;  3FX7 A;  3PJS K;  4DR2 B;  1B3Q A;  3F5W C;  2CTW A;  3RYH A;  4YY3 B;  4HBN A;  2ITC C;  1NBM G;  3CS5 A;  3SJB C;  1MOF A;  1MG1 A;  3S3W A;  2AHZ A;  3ZBH A;  1DGS A;  1THZ A;  1Q7Y W;  3A0B Z;  3O9O A;  3LDE A;  1Q90 D;  3O65 A;  4TUY A;  2QM4 A;  3B8M A;  3FD9 A;  5JQG A;  3U10 A;  2A7W A;  5D5P A;  1JCH A;  3W7W A;  2XAG A;  1VQN V;  2ZNI A;  4GKK B;  4DR7 B;  3OT7 A;  2YID A;  2R70 A;  4I5S A;  2XOK G;  2WWW A;  2B1I A;  2L35 A;  1RFY A;  1QNM A;  3CP1 A;  3BAB A;  1EBO A;  3B09 A;  1KQS U;  1K4C C;  2R9A A;  3H1L H;  4KHP O;  2ZIN A;  1VQP V;  5DM6 V;  1WP7 A;  2AW9 A;  1Q5O A;  3I5D A;  2EIM C;  4PEL A;  4EB6 A;  2VS0 A;  4B3S B;  5DED A;  3LNM B;  1QLE C;  2BTQ A;  1E1R G;  4FZ0 A;  3IFX A;  4X1I A;  5GW7 A;  3E8F A;  2QEX V;  4P30 A;  3APQ A;  5LMN O;  4JI3 B;  3SJC C;  1VQ5 V;  4E2L A;  5L3B A;  3L74 H;  4PA9 A;  1Y6X A;  4MVO A;  4LR3 A;  3MDS A;  3L75 H;  2LW7 A;  1YHQ V;  1HNW O;  3ZN1 A;  3H01 A;  3EVK A;  4DV2 O;  1IBK O;  2Q0O C;  3OR7 C;  5KHI A;  4I50 A;  1PKX A;  3TK1 A;  2IJJ A;  2WA4 A;  4I55 B;  1XMO O;  2EIK C;  1K5Q A;  5IYB O;  1FXV A;  2Q7G A;  3BFR A;  1Z5W A;  5BR8 O;  4RUE A;  3CRC A;  4JI8 B;  3F7V C;  2XHB A;  1SQP H;  4JZ2 A;  4F6R B;  4MVR A;  3I55 V;  1EZJ A;  1RM1 B;  1KUQ A;  1XL4 A;  5KHH A;  2UUB O;  3LDD A;  1WJZ A;  2RN9 A;  5LGT A;  4I4T B;  1V54 C;  4JI2 O;  1XQ8 A;  3CX5 F;  1XBL A;  3SGI A;  4LBE C;  4JGS A;  1JVM A;  2YC0 A;  5JVD B;  1F51 A;  5IWA B;  1Y74 A;  3R65 A;  1WAZ A;  4LFC B;  3CCU V;  4TOI A;  1JFF A;  2V4D A;  4AQY O;  4PDR A;  4DO2 A;  2QJ1 A;  3ZRS A;  1WPB A;  1HNX B;  1Q6I A;  4LH6 A;  4XDJ A;  3HKB B;  4CS3 A;  1RSO B;  4HYO A;  1NVP B;  2N74 A;  2VQE B;  4FM1 A;  2QWQ B;  3D3Q A;  3K0D A;  3FYE B;  4UCV A;  3FB5 C;  4WFH A;  1RP3 B;  1VQ6 V;  2HKO A;  2KB1 A;  1DTO A;  1MZE A;  2CAZ C;  4JAU A;  1H2N A;  3EHB B;  4YIP A;  4TT3 G;  4DV6 O;  3JAR B;  2XT9 A;  3ML0 A;  2GBO A;  5KUK A;  3E2E A;  5LA6 A;  3E22 A;  2WLJ A;  1Q82 W;  4LFA B;  1BHA A;  1GN6 A;  2PYL A;  5KHJ A;  4K3A A;  3CRA A;  3NXS A;  1XNR B;  2GDS A;  2NNU A;  3EXA A;  1OCC B;  1AB3 A;  1AI5 A;  3UT5 B;  4J7J A;  2JS3 A;  2E5L B;  4YJ3 B;  3CRQ A;  4DR6 B;  4MTX A;  4LF9 O;  5EIB C;  1QU7 A;  1Z5V A;  1U96 A;  4MVU A;  1U97 A;  4NXN O;  3HKD A;  1GRJ A;  1MA1 A;  3HPL C;  1B6Q A;  1OCZ B;  4JI1 B;  4JYB A;  4R6Z A;  1S5L Z;  3CCM V;  2PZS A;  1OCO C;  1PP9 H;  2YIA A;  2P5O A;  2HP8 A;  1SES A;  3DTU B;  4JAA A;  2DQ3 A;  5GTI Z;  3JAL B;  3CC4 V;  3DXR B;  4FJC C;  3CRM A;  3LNN A;  4LF7 B;  2HR3 A;  3W7T A;  3CD6 V;  1TVK B;  5CA0 B;  1H8E G;  4PI0 A;  3SDL A;  1O9G A;  4UUJ C;  1M1K W;  1VF6 A;  4FFB B;  1ZLZ A;  2ZIO A;  2CUG A;  2DYS B;  4X88 A;  2RDC A;  1N34 O;  3W7S A;  1NR1 A;  1ZL8 A;  4DYL A;  5KX5 B;  1RPR A;  1SQF A;  3SR2 C;  1HNZ O;  1FAF A;  2CTQ A;  5EIB D;  4WFA V;  3E8B A;  4LC1 A;  4RO2 A;  4DV5 B;  1LR1 A;  2UXB B;  2W0F C;  4UVA A;  3AG1 C;  3ETQ A;  3BY6 A;  1FFX B;  2EIL C;  1M93 A;  4J42 A;  3A0R A;  5B1B C;  1QR8 A;  1URF A;  4NTW A;  4PA4 A;  1M57 B;  2BTO A;  1XIL A;  4DV4 O;  2WLH A;  4CH3 A;  4I4T A;  5DEC A;  2NLJ C;  1SER A;  3GB7 C;  5JVD A;  1V9P A;  4DV3 B;  4CS4 A;  2CTP A;  2WLI B;  2GHY A;  1NKD A;  2YIB A;  3CC2 V;  4W4L A;  5K1X A;  5C8Y A;  4MTF A;  2Y4U A;  3WG7 B;  4K0K B;  2ADQ B;  2CDY A;  2N05 A;  1SC5 B;  5HFM A;  2YUA A;  4YJ2 B;  3F7Y C;  5K1P A;  1MMM A;  2ZM6 O;  3H1H H;  1S5J A;  3ETE A;  1PNK A;  3M7M X;  2LFR A;  2P4K A;  1XHX A;  3JCZ A;  2QWR B;  4O4H B;  4CS2 A;  2PY5 A;  1AR5 A;  4GKJ O;  5KAF Z;  5CN0 A;  1BS3 A;  1TAE A;  2F66 C;  4JTA B;  2QE7 G;  4IYI A;  2Y0I A;  2QTS A;  2CH7 B;  2GTS A;  3OMN B;  1YJW V;  4I0X A;  3C3T A;  1AR4 A;  3L72 H;  4DR1 O;  1IBM O;  2Y4T A;  2BSK A;  4LFB O;  4R7C A;  2D2C B;  3H9V A;  5IY5 B;  4R8C A;  4J11 A;  4FLT A;  1V54 B;  4PI2 A;  1XMQ O;  3K5N A;  1K92 A;  4JV5 B;  4HAM A;  4WF9 V;  2F4V O;  4FLX A;  2HEP A;  1YXB A;  1N33 O;  4BW9 A;  2ODM A;  1CPY A;  2VRZ A;  4FLW A;  1QVF U;  5LHH A;  3T1H B;  1Y66 A;  5J2U B;  2EJR A;  4B7E A;  3CWB H;  3CRR A;  4D6T H;  2JGD A;  4O2B A;  2Q6A A;  2HG5 C;  3J81 N;  4AIL C;  2UUA B;  5EC1 C;  1ZAU A;  1WN7 A;  4ZHQ A;  1HR0 O;  3J7A U;  1SQG A;  3K9A A;  4IGG A;  5GTH Z;  3IC7 A;  3N2K A;  3LUT B;  1EN4 A;  3RW0 A;  1VF6 C;  1YSC A;  4UCU A;  3BA9 A;  3SYC A;  1BCC H;  4X20 A;  4WCE V;  3MHH C;  3APO A;  4GCZ A;  4TUY B;  2ZR3 A;  4JYA O;  3BEH A;  4PD4 F;  2UXC O;  3JSL A;  4JI6 O;  5AG2 A;  3TJT A;  5CA0 A;  3HKE B;  5B1A B;  3SYQ A;  2QKC A;  5B3S B;  5IE9 A;  3K5M A;  1KC8 W;  4JI0 O;  2EBO A;  3TXS A;  1K33 A;  1RM1 C;  3FAV A;  3CCE V;  2UUC O;  4BWA A;  4EB6 B;  3HKC A;  2BTQ B;  5JCO C;  2M7W A;  4X1I B;  2X6A A;  4ZOL A;  2KKW A;  3OTO B;  1VIB A;  5FPO A;  3UO3 A;  4O4I A;  1W2B U;  1KD1 W;  1UFI A;  4JYC A;  4DXW A;  5EC2 C;  2FKX A;  4YXW G;  2H3O A;  3GWK C;  3WU2 Z;  5LXT A;  5FPR A;  2G38 A;  2UXD O;  2BOC C;  3CCS V;  2DOS A;  2ZD9 A;  2Q7E A;  1AVM A;  1ROP A;  4I50 B;  4J7K A;  1K3E A;  1OJH A;  5CB4 B;  1LNQ A;  1SZX A;  2Q73 A;  1FJG B;  3K59 A;  3OMA B;  1P4R A;  3G67 A;  3MD0 A;  4DR5 O;  2R72 A;  2HHH B;  4O2A A;  1D5N A;  4NVP A;  4I9Q A;  1SA0 A;  3FB6 C;  2RCV A;  4JPR A;  1PNM A;  4MSW C;  2LQT A;  4QNH B;  1Y67 A;  1ZSP A;  5L3D A;  4JF3 A;  4UXN A;  2IJK A;  1Y74 B;  2CTR A;  4NKG B;  4MTG A;  4B3T O;  4X62 O;  1IUR A;  1OCC C;  1JFF B;  4NB5 A;  5B66 Z;  1XNQ O;  1H2M A;  2BOB C;  4NR1 A;  2FML A;  2E76 B;  4AI8 A;  4KHP B;  4UB6 Z;  5KLV H;  3C3S A;  1WLE A;  5IJ0 A;  1NVP D;  2WLN A;  3UM7 A;  1SKV A;  4LCU C;  1TUB A;  1MSW D;  1OCZ C;  5FLX N;  2WA3 A;  5ITZ A;  5LMN B;  1FXK A;  1OZ0 A;  4FFK A;  4A5U B;  1QBZ A;  2B5U A;  1NI8 A;  2E75 B;  4GYC B;  3ZS8 C;  4PA6 A;  3T4D A;  2R9I A;  3IAY A;  3BHP A;  1Q3E A;  5LMU O;  2ZT9 B;  3VQW A;  5LA6 B;  4WFF A;  5H9C A;  1WA8 B;  4Z1V A;  4DR4 B;  4J41 A;  1KBH A;  1S5H C;  1QLN A;  1AIL A;  3UQ8 A;  2Q68 A;  2QDO A;  1XMO B;  1YIJ V;  4ICG A;  1N32 B;  4UFZ A;  4J9Z B;  5BR8 B;  4LF5 B;  2DYS C;  3AK1 A;  4X66 O;  1I5Y A;  1BSM A;  1NH2 B;  1JQ0 A;  3B4S A;  4DR3 O;  2DMX A;  4BAY A;  3TXQ A;  2GTA A;  5IYD O;  4DK0 A;  3HKE A;  1YCI A;  3HKD B;  1S72 V;  3KG2 A;  4O4J B;  4FPP A;  1G6U A;  1R3I C;  2ATK C;  3N2G A;  2X0L A;  2R9R B;  3T2M A;  2IM9 A;  1MZF A;  4JI5 O;  1M57 C;  2CK3 G;  3U11 A;  3QO7 A;  5KAI Z;  1R3J C;  1KEC A;  2NN4 A;  3E35 A;  2QM7 A;  2B1G A;  5L3C A;  3X2Q B;  3OAA G;  2UXN A;  2YXH A;  1IBL B;  5JJN B;  4Z2W A;  1WB8 A;  3CPW U;  4X8A A;  4QE7 A;  3WG7 C;  3E86 A;  1TA8 A;  3RVY A;  4H44 B;  4TQF A;  4B3R O;  4N23 A;  2F23 A;  4DV6 B;  1ZL8 B;  2E3C A;  4ZKI A;  4LWS A;  4X9Q A;  3R66 A;  3FFQ A;  4DUY O;  4LF4 O;  4WFG A;  5CB4 A;  2A06 H;  5H2F Z;  5JH7 A;  5EBW C;  1PM9 A;  5EZY A;  4QIW F;  4OPH A;  3DGE A;  4U7N A;  1OHH G;  1JA8 A;  1YTF B;  1VQL V;  4DR2 O;  5EBL C;  5IY5 C;  1KKD A;  1Q6H A;  1E1Q G;  4YY3 O;  1F23 A;  3ZIA G;  1NTM H;  2W6J G;  2AXT Z;  5LP6 A;  4DV1 B;  1XL6 A;  4BW5 A;  4LF6 B;  5C8Y B;  3KCX A;  2QKS A;  4CC6 A;  4ZIB A;  3ZHQ A;  4H0L B;  4UVC A;  2ADP A;  4FK5 C;  1H2L A;  2F43 G;  1S3J A;  1QHT A;  3QO8 A;  4GX5 A;  4K35 A;  1KB9 F;  4I0X B;  1DLB A;  4B3S O;  1IXM A;  3E89 A;  2BSK B;  4IIJ A;  1JR9 A;  1N34 B;  3CE2 A;  1WP8 A;  2EX3 A;  2PF4 E;  5CMU A;  1WA8 A;  4JI3 O;  3SPG A;  5H6R A;  3QNE A;  2A9H A;  5IYC O;  1ARO P;  5B1A C;  4MW3 A;  5B3S C;  5JJJ B;  1VQO V;  2VWJ A;  4NXM B;  1B06 A;  2IW5 A;  1LUW A;  3JCU Z;  3VQY A;  2Q67 A;  2A0L A;  3VQV A;  5CBG A;  4GUN A;  2JGD B;  4O2B B;  1OCR B;  1W0J G;  2ZR2 A;  2UU9 B;  1HP8 A;  4DV4 B;  3A2F A;  2XAH A;  1N0N A;  2P06 A;  4X65 O;  3ZRW A;  4ZHQ B;  4JYY A;  2CGO A;  4JI8 O;  4O4J A;  1FKA O;  5CA1 A;  4PDV A;  3N2K B;  3I56 V;  1SZT A;  2K9P A;  1NZ6 A;  4EFE A;  1SET A;  4JAV A;  4UCR A;  4UCO A;  2P90 A;  4X20 B;  2OTL V;  3LDC A;  3RYI A;  5IWA O;  4PHZ A;  4LFC O;  2ZDI A;  2QGN A;  4C7U A;  3QF7 A;  2ZM6 B;  3F5T A;  2VQF B;  3OM3 B;  1XEQ A;  4KXR A;  3CC7 V;  4GKJ B;  4LF8 O;  1HNX O;  4DUZ B;  4JI7 O;  2IBZ H;  2Q69 A;  1G1X B;  1VAR A;  1S76 D;  3ZX6 A;  3RBZ A;  5B1O A;  3FAV B;  4DR1 B;  1IBM B;  5BMV A;  2UXX A;  1YI2 V;  4JAS A;  1IVS A;  3B40 A;  3BAA A;  3RYF A;  1CP9 A;  2BE3 A;  2AHY A;  1GM8 A;  3HKC B;  3OUF A;  5LP6 C;  4ZOL B;  3T1Y B;  3UCS C;  1M56 B;  2QTO A;  2XAF A;  1F4N A;  4O4I B;  1VQM V;  4LFA O;  2Y0P A;  1SRY A;  5BY1 A;  3JSN A;  2IU0 A;  5LXT B;  1I94 O;  1K73 W;  2XND G;  1XNR O;  1DK1 A;  4TV8 A;  1HR0 B;  3CHX A;  1BGY H;  3G71 V;  2X7R B;  3RFR A;  2YEV B;  3BCC H;  3QTC A;  3OUS A;  4DR6 O;  2WLL A;  5IJ9 A;  2PTM A;  3Q4H A;  4O2A B;  3ZMV A;  3MAQ A;  4JI4 B;  1WNS A;  1SA0 B;  2GV9 A;  4JI1 O;  2YXL A;  1BQ0 A;  1H2K A;  5CBH A;  3ZHR A;  4DV0 B;  4X1Y A;  4JI6 B;  1R1B A;  1XI1 A;  1J5E B;  2DW4 A;  1US6 A;  5CBF A;  1K8A W;  4CC5 A;  4LF7 O;  3A0H Z;  3ZMZ A;  2JVD A;  3SYA A;  1L0N H;  2MW2 B;  1MSD A;  3TET A;  1GAX A;  4KUM A;  5IJ0 B;  1AI4 A;  4FVM A;  1TUB B;  4YHH B;  4NTX A;  1N36 B;  1EZV H;  1PV0 A;  3CYO A;  5KUM A;  5ITZ B;  1N8R W;  3RVZ A;  1FXK B;  3ASO B;  1P49 A;  3WB0 A;  3AG4 B;  2ITD C;  2JEU A;  2WLM A;  2YDE A;  4J10 A;  3AK3 A;  3JD4 A;  3SYP A;  2ZE5 A;  2LJ2 A;  4BIZ A;  3LSQ A;  5LL6 Y;  4H33 A;  1JPX A;  2ZDI C;  2UXD B;  3AG3 B;  4GX2 A;  5LYJ A;  3X2Q C;  1Y76 A;  4HZ3 A;  3JAS B;  3OGC C;  4OX9 O;  3OEE G;  5CA3 A;  2EZO A;  4N21 A; 
#chains in the Genus database with same CATH homology
 2JRI A;  2DJV A;  2ZM6 O;  4B3R O;  3RT3 C;  4JI0 O;  1DK1 A;  1KUQ A;  5FLX N;  2UUB O;  3J80 N;  4DV3 O;  1YZB A;  4DV5 O;  4JI2 O;  2ZKO A;  2UXB O;  1F7Y A;  4GKJ O;  3R66 A;  4DUY O;  3JAM N;  4LF4 O;  3T1Y O;  4A5U B;  2UUC O;  3M8A A;  1X59 A;  1IBL O;  4DR6 O;  4OPH A;  4X65 O;  3O65 A;  5LMU O;  4AQY O;  4DR1 O;  1IBM O;  4JI8 O;  4LFB O;  1FKA O;  5BXZ A;  4JI1 O;  5IT9 N;  3SDL A;  1XMQ O;  1FYJ A;  4DR2 O;  1AIL A;  4NXM O;  2F4V O;  2FKX A;  4X64 O;  1N33 O;  1R1B A;  4YY3 O;  2E5L O;  2UXD O;  2DOS A;  1N34 O;  1A32 A;  2N74 A;  5IWA O;  2UU9 O;  4LFC O;  4X66 O;  4K0K O;  3F5T A;  4LF7 O;  1HNZ O;  4KHP O;  1XEQ A;  4DR3 O;  4JI4 O;  4DR4 O;  5H5N A;  4LF8 O;  1HNX O;  3J81 N;  5A2Q N;  4DV6 O;  4JI7 O;  4JV5 O;  1HR0 O;  4DR5 O;  1G1X B;  3J7A U;  4DV0 O;  5LMN O;  4DV7 O;  1J5E O;  1N32 O;  3T1H O;  1R6T A;  4JI5 O;  4DV1 O;  4DV4 O;  4B3M O;  4LF5 O;  2LW7 A;  1HNW O;  4LF6 O;  4DV2 O;  2VQF O;  1IBK O;  3OTO O;  1AB3 A;  4B3T O;  1FJG O;  4X62 O;  4B3S O;  5LL6 Y;  4DUZ O;  2UUA O;  2Z0A A;  4JYA O;  1XNQ O;  2UXC O;  1XMO O;  2HHH O;  4DR7 O;  4GKK O;  4JI6 O;  4OX9 O;  4JI3 O;  4LF9 O;  2AGA A;  4YHH O;  4LFA O;  1D2D A;  5BY1 A;  1N36 O;  5BR8 O;  4OPA A;  2VQE O;  4NXN O;  1I94 O;  1NS1 A;  1XNR O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...