5B1BB

Bovine heart cytochrome c oxidase in the fully reduced state at 1.6 angstrom resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title The Mg2+-containing Water Cluster of Mammalian Cytochrome c Oxidase Collects Four Pumping Proton Equivalents in Each Catalytic Cycle.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 68
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b1bB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1bB02
1WS8A 2CJ3A 2UXVA 4PCYA 1BXUA 1WS7A 2OV0A 2J5WA 4A67A 2FT6A 1J5DA 2DYSB 3EF4A 3QJQB 3TU6A 4E9TA 1NICA 3SBRA 3T6ZA 3ABGA 4BWUA 1QHQA 2XXGA 3PAUA 2VSMB 1JZHA 3T6VA 1E30A 1JVOA 4F2FA 3JT2A 5EHFA 4YVUA 3D12B 3GYRA 2GHZA 1MG2C 1PAZA 2YXVA 5I28A 6PAZA 2BZ7A 3QJTB 2BP0A 2PPFA 1XB3A 8PAZA 4M4RB 5I6MA 2VN3A 1NWPA 1F56A 3ERXA 1AS8A 1PNCA 1R1CA 2YQBA 2ZONA 2HRGA 3OMIB 5FC9A 4Q89A 3TA4D 2CBPA 2IH9A 3IN2A 3NSFA 4W9ZA 1NPNA 1MZYA 2EIKB 1J9TA 2BWDA 4YSTA 1CYWA 1IBYA 2JXMA 1WA0X 1AS7A 4HZ1A 2IWEA 4P5RA 6PCYA 1E67A 3ABMB 2QPEB 4GP5B 3ZBMA 2UXTA 2W88A 3CVBA 1JZGA 1NWOA 2J56A 1W6WA 2J57A 4PAZA 1ET7A 1OOWA 2FT8A 2XU9A 3N55A 3OMAB 3FU7A 2DWTA 4YSDA 4GY4A 3NJNA 1CC3A 1QNIA 3ASOB 2MTAA 4JKNA 4N4YB 3PCYA 1GS6X 3H4HA 4KOCA 2UX7A 4CSPA 2GBAA 4FAAB 5AFAA 2CAKA 1KCBA 2QDVA 3X1NA 3HB3B 4HCGA 5AKRA 2IAAC 1SDDA 2XLLA 1ILSA 4QKTA 4MFHA 1A4CA 2A3TA 2BW5A 3G5WA 3AG3B 1JVLA 3FU8A 4A68A 4P5SA 3N2JA 1BEXA 2BP0B 2FT7A 4GXFA 4BDVB 1KYAA 3BVDB 2GB2A 3S8FB 1EZLA 5LDUA 4AZUA 4A66A 1W6LA 3T71A 1ET5A 3S3CB 4G72B 1X9RA 1SFHA 2DY2A 1KBWA 3FQ1A 2GI0A 2VM3A 4WTQA 4DP7X 2DV6A 7PAZA 1NIAA 4G7SB 4E9XA 2IWFA 3PLYA 2Y1AA 2PP9A 2AFNA 1TEFA 1BXAA 4KNTA 3CVDA 2YARA 5B1KA 7PCYA 3SQRA 3FQ2A 4HALA 2VW7A 4DP6X 1V54B 1SHXA 4N8UA 4DPBX 2P80D 3PAVA 3AG2B 3FU7B 2X88A 2PP7A 4A2DA 1KBVA 5B1JC 2GIMA 3FSAA 2XV0A 2NRDA 3IEAA 3NJLA 1OV8A 4AKOA 1KCWA 1AS6A 1J5CA 4EF3A 1AOZA 3AY2A 1ID2A 2XYBA 1X9UA 3WKPA 4AX3A 4E9VA 3UABA 3X1GA 2YAEA 5F7AA 4YSSA 4GYBA 2CALA 2VM4A 4TXVB 4WKXA 2PPAA 1KDJA 1MDAA 1AACA 4HHWA 2LLNA 4HAKA 1CURA 2JFCA 3T6WA 2FNWA 2IDUA 2I7SA 3ABLB 2FTAA 1IUZA 5I6PA 4A2EA 1AG0A 2YAFA 3FYEB 1GS8A 1AR1B 1AQ8A 1ILUA 2FQDA 3DIVA 2ZXWB 1PNDA 2FWLB 1M9WA 2ZOOA 3EH3B 1AZNA 1DZ0A 5D4JA 4BDVA 4YSCA 3KW8A 1E5YA 4E9QA 4K9JA 3X1BA 5I5JA 2QDWA 1BAWA 2YAPA 1YLBB 2EILB 4GP8B 4KNUA 2BP8A 1J9SA 1ZIBA 2BZCA 3FU9A 1XB8A 3NJIA 4G7RB 2WSDA 4YL4A 5B3SB 4QLWA 2ZWNA 2BO0A 2XV2A 4DP5X 5E9NA 2QT6A 4UF7C 3EHBB 5A7EA 1M57B 3SBPA 1SF5A 2JKWA 1ZDSA 2X87A 4KNSA 1WA1X 1UATA 3WNJA 1A8ZA 2PPCA 5B7MA 2HRHA 1AG6A 3SBQA 1SHWA 2AZUA 1PZCA 1T5KA 3AZUA 2DWSA 2EINB 3CVCA 1AZBA 4BXVA 1RZPA 4HCIA 5PAZA 3C75A 2BHFA 5B1BB 1CUOA 1WA2X 2XX1A 1OCRB 1NTDA 1BYPA 3X1FA 1J9QA 1NDTA 3OMNB 1ZPUA 4YSOA 2YXWA 2XUWA 4X4KA 1PLCA 1GYCA 5D4IA 2PP8A 2XVBA 2OJ1A 4YSRA 2DYRB 3DKHA 3U25A 2OCCB 1RZQA 4A2FA 1GW0A 1V10A 1N68A 2UXFA 1BQ5A 3FS9A 5D4HA 2BP8B 1E5ZA 2AANA 1JERA 3IBOA 4HHGA 3BQVA 4KO7A 1JOIA 1EHKB 3GDCA 2FQGA 3MX0B 3QJUB 4HIPA 5B1JA 2HX9A 2TSAA 2IDTA 1KV7A 2E86A 1SFDA 1OCZB 3EH4B 1GR7A 4BWTA 2QPDB 1TU2A 2HX7A 3QJRB 3H4FA 1A4BA 1AZRA 2GC4C 4KOBA 4BXSV 1JZFA 1FWXA 2W8CA 3FPYA 3HEIB 1GS7A 2XWZA 3DTUB 1ASQA 1HAWA 1SJMA 1HFUA 1RCYA 2VW4A 2GC7C 2WO3B 1W8EA 3CDZA 5B7EA 3WI9A 4G71B 4DP4X 4E9YA 3CG8A 5TK4A 2B08A 3L45A 4UANA 1BQKA 4KO6A 1NIDA 4NAJA 2Q9OA 3KW7A 2PPDA 1ASPA 2YAHA 3QJVB 5I5IA 2N0MA 4ENZA 4ZK8A 4CSZA 4A2GA 3QQXA 3QPKA 3NP4A 4A2HA 1OF0A 2YEVB 1L9PA 4YSAA 2J55A 5I5MA 3RYMA 3ASNB 2VW6A 2MRYA 1TKWA 5ANHA 1JZIA 1QLEB 3WIAA 1KDIA 9PCYA 3NSYA 2P80A 4DPCX 1J9RA 2IDFA 2VSKB 3JTBA 3FSZA 2PCYA 3IN0A 1PMYA 1PCSA 1M56B 2WO2B 4DP9X 1JXDA 3AG1B 3UGEA 4BWWA 3GXUB 1E65A 3WNIA 2IDQA 4YSEA 4E9WA 4DP1X 2Q5BA 1JXFA 1DYZA 1ET8A 3NJMA 3NJJA 3S8GB 3OD3A 3WKQA 3NP3A 1JZEA 1L9OA 3NSDA 2UX6A 4JHVA 1A4AA 2IWKA 3FQYA 4AKPA 1L9RA 3FYIB 3CDZB 2IH8A 2XX0A 1L9SA 3S3DB 5F7BA 3UAAA 3ZIYA 2XV3A 1KGYE 5TK2A 3PPSA 2PPEA 1BYOA 4F7KA 2I85A 4NB7A 3CZUB 4UAHA 4M3HA 1PF3A 1TEGA 3TBCA 2AZAA 2CUAA 1JZJA 2I7OA 4YSPA 2IDSA 5IY5B 1ZIAA 2HZHA 3X2QB 3PXLA 1NIBA 4E9RA 2VMJA 4HCFA 1GSKA 3UACA 2EIMB 3V9CA 2RACA 1OCOB 4F2EA 3T6XA 1A3ZA 1OE3A 3FPXA 1FA4A 5PCYA 3NYKA 1BQRA 5I6KA 1ZDQA 2PLTA 4DP8X 4YSUA 5B7FA 2H3XC 1L9QA 1V55B 4FA7B 3UADA 2GSMB 1WAEA 3V9EA 4L0PB 1A65A 3ABKB 2CCWA 1NPJA 3S3BB 3T9WA 2R7EA 1NIFA 1GY2A 1SF3A 1XB6A 4BK5C 3OM3B 5I26A 1BXVA 4RH4A 2H47C 3ZX1A 2FJSA 1ADWA 2UXGA 1VLXA 2H5UA 3AW5A 4KO9A 4GP4B 1FFTB 1MG3C 5I6OA 3MBWB 4Q8BA 3QJSB 2FQEA 1NINA 3NJFA 4G70B 1GY1A 4AKQA 3NSCA 1PZAA 3H56A 2YAMA 4DP0X 1RKRA 2YAQA 1IKOP 1PY0A 2FQFA 3FT0A 2EIJB 1PLBA 1XMEB 1OE1A 1AZCA 3IE9A 1NZRA 3OQRA 1AANA 1AIZA 4W1TA 1JXGA 2TSBA 1L9TA 2HXAA 3UAEA 5I6NA 4DP2X 3TASA 5B1AB 4AI7A 1IBZA 2YAOA 2AVFA 4YVNA 3TBBA 5AZUA 2BW4A 4DPAX 3EH5B 2HLEB 1MZZA 1ZV2A 1URIA 3NJKA 1HAUA 3WG7B 4YSQA 4JHUA 1ETJA 3FSWA 1SNRA 2B3IA 1AZUA 1B3IA 2BWIA 3FSVA 5I6LA 2R7EB 4NERA 3AG4B 4G7QB 1NIEA 1PZBA 1ASOA 3NJGA 1SDDB 2PCFA 1PLAA 2HX8A 2XXFA 4KO5A 1CYXA 1OCCB 3ZDWA 2Y69B 3X1EA 3PAZA 1N70A 1OE2A 1IC0A 3NJHA 1I53A 3NT0A 4E9SA 1AAJA
chains in the Genus database with same CATH superfamily
4AQ1B 4PCYA 5FB8B 4NTWA 4NCDA 5HD8D 3D39B 2Q86B 4Q9RL 2Q7AA 3QXWA 1J0ZA 2EYTB 3RVYA 3E3QE 4R96A 2C4XA 3I50L 3DGEA 3CHXA 3ZRFC 4PJ8B 4BWUA 4PJBF 1L6ZA 4Z3EA 1CTOA 5I18H 1TUPA 3ZIMA 1MSDA 4X6CA 2A6KB 4JQIH 1AO7A 2WWOA 1KJ3L 5AAMC 1DDHB 4QXVA 1KCKA 3ETBJ 1UGKA 6PAZA 3W0WA 1KYDA 5KSVA 1KXHA 1BW8A 3K1KC 5L3GA 3A3YB 3DO7A 1OCRC 4A7QA 3T4YA 4YHOH 4YMPA 3T0EA 3ARSA 5DJ2A 1G9MC 4GUQA 2R0ZH 1O5DT 4J7RA 1FFRA 2XWBB 2YHGA 4HFUH 3KKYA 5KAQF 4XVUD 3BAJA 3MFFB 5FECA 1UD2A 2KDYA 4M62L 4OQTL 5K59E 1YQ2A 4FLVA 4MAZA 4C47A 4S1QH 2QV2A 4BH8B 2ADQB 4XPFH 3DROA 1SBSL 5EEZA 3E22A 4ZMOA 3Q8CA 4IYHA 5G4NA 2ICWI 2BHYA 2F08A 2FWSA 1X5ZA 2LABA 2UXTA 2VERN 2JJSA 2YWYA 1IAKA 2J57A 5F7KC 1BX2A 2AQ3A 3BRGC 1MSPA 3ZDZF 2D0GA 1Y76A 5LP6C 3THMH 4FLWA 2XWRA 4P2AA 4JB9H 5GSVB 4F1ZA 2ESVE 1PD0A 1HHJB 2J12B 4XMPH 3O45A 4ELKB 3TCLB 1YZZA 1PGRB 2KUTA 3E35A 2O61A 1S8DA 4N9GA 4IRZH 4NQDB 1KCBA 3LRLA 1A9BB 4JO4H 4WENB 4AEEA 1F8TL 4LF8O 3U11A 3PGDA 1OW0A 5CN2A 2VLLB 1FC1A 1CQKA 3HPJA 2IQAB 3GSNB 4NUPA 4MZRA 1NS1A 4X8GA 3T1FB 2V2XB 3KGTA 4F3FA 4Z77A 1Q1PA 5DFTA 4ADGA 5T3XL 2R9IA 2O5YH 3WLBA 3MUGA 5I1LA 1VQ9V 4DV6B 2AXJA 2DQUH 2IBZY 3LDBB 4OFKA 3F7YA 3NCYP 1ZSHA 3QAZC 3A67L 2CR0A 2C9RA 4ZAKD 3EJSA 1MCBA 4ZOLB 2H32B 2VDQH 1FN4A 3I3EA 1FH5L 4E9XA 1OXYA 3REWA 2WLZA 1N3NB 5DQDH 1RULL 3ISWA 4G80B 1XF1A 5M94B 2X0WA 3OKNB 4OZ4B 4YWGH 2N1TE 1JYWA 2ARJB 1LE9B 2AVGA 5IJ0A 1ZEAL 3CVHA 2VDKB 1WB7A 1QPKA 3MRQA 2P28B 3KWVA 6TAAA 3SJQC 4Z7UF 5E2TL 3PAVA 3IJEA 3QRLA 1WIOA 1J8HA 4FZEH 5D7LE 1I3RB 3ZT6A 3C6LC 3QXTA 2ZX7A 1EANA 3C6SA 3KPQB 3LQZB 1IL1B 4O51B 3TBWA 2P7TC 4P23B 3SZ6A 1PQZA 4ALAC 1IQDB 1BIHA 3SD5A 4CW1B 4U1HB 5HYQB 2CTRA 4EF3A 3TFBA 1GIGL 1HHHA 5JCOC 1YTFD 4MDJB 2ERJB 2YICA 4JFDD 3AACA 5FM5M 4WUKL 3AK3A 4K7FA 2NNAB 4YX2H 5J2UB 3SE8H 3US9A 5DR5H 3GBEA 5F7AA 3PJLA 1PU0A 4ZFOB 1AGEB 3SO5A 4FI8A 1DTUA 1JFHA 4NZRH 1GGCL 5AAMA 4Y5VB 5KVMC 4JFFA 1D6VL 4GG6B 1CTMA 1UWEH 3NQIA 2H0JA 2HLAA 3LN5A 3OKYA 5DHYB 1QHPA 1HNWB 2GY5A 2IDUA 2B1HH 4I88A 4QRRE 5DF0A 4AM0B 5MI0C 1MAMH 4U6VH 2FEEL 2YAFA 1CE1H 4G6MH 1VQ8V 2BY3A 3P1VA 4LLVB 1N6QH 3VFTA 3SDXF 1QZNA 2NDFA 3DUUB 2OZ4L 1NI8A 4C56E 2IJHA 3MHSC 1BZ9A 2VXVH 2R9HD 4XC1L 4Z3HA 1A7OL 1H2GA 1E4XH 4WSKA 1J05B 5E7BA 1DR9A 5FGCE 4KY1L 4Y1AD 1VA9A 4CC0A 3M46A 3SQOH 1A9VA 1T5XB 1BAWA 5DCCA 1MHHA 4K94H 2WXQA 3OSVA 4GP8B 4XMLH 1ZIBA 3FO9B 4KAQL 2X12A 4HZLB 1XEUA 4OZFH 2JELL 3IF1B 3DPBA 5AOZA 1JPTH 5EEXA 4KKPA 5LP6A 2EZ0D 5BY1A 5IUSA 4KXZH 1M57B 35C8L 1GYUA 4X7FC 3TWCL 4KXRA 3QA3B 5DJ6B 4CU6A 5BUPA 1J1XH 2WV3A 3F6LA 3MZTA 3QUGA 5KSBA 3QPXL 3IKKA 3FB6C 5CJQH 3EDDA 4PRPA 2ZM6B 4DV3O 2ZOTA 4XMUA 1ONQA 5LHDA 1F97A 3P0YH 1X59A 3RJQB 4PY8J 2Q8BH 3OKOA 4FQIH 4AENA 4O5LL 3IFPA 2FJFA 4OZIB 4JGMA 3CCEV 1FS0G 1EEUA 3AQDA 4WW2B 3VB8A 4FNQA 2Z91B 3QS3A 1F11A 1YJDC 1CUOA 5D96B 1U3HB 1NTDA 2H4EA 5JOPE 5E8DL 4DEWA 1YVLA 4N0RA 1EFXB 1W80A 1R17A 2Z8VC 3VQ2C 4JBSA 3P32A 3HAEH 1UXWA 3JWDC 4ZIBA 2UUDK 1GYCA 3H9YA 3WMSA 4G11A 1MFMA 1PEWA 1I7ZB 4J4PC 4KKNA 4PJAE 3FFQA 3ZL4H 5E1GA 1S7WA 3H0TA 5T33L 1KY7A 4JTDB 1RJLB 4PWKA 1OLZA 2Y1VA 3ZHNA 1YA5A 2HTKD 4FQXD 1TZHA 3DX9B 4CVWA 1D5ZB 2J20A 5BO1L 3L3DB 4JHWH 2FH8A 3B5TA 2NX5B 4HT1L 4Y2NA 5A6LA 2AP2A 4G1MA 3ZKSD 1G7HB 1HSBA 1KQSU 1QLRA 3IBOA 3CFTA 1ESOA 5H8DA 1H3XA 1UKTA 3M17B 4WJ5A 4CAGA 1DBKH 4JGJA 5ICZA 4Z0BH 3LD8B 4NN6B 3GK8L 2WQVA 5BMVA 2I07B 4AVJA 2C9QA 3C6LA 4TOYL 4U1JA 3ZDYF 3MNVA 4JDEA 1GAXA 1FI8C 4MQXC 2VC2B 4UQCA 3WFDH 1GKOA 1AOHA 5C92A 1KPUA 2G5RA 1NL0H 4J9ZB 3LEXB 3JD2A 5CCJA 5JCOA 2CRZA 3VFNB 2XAQA 1A4BA 1PD3A 4DK5A 5FHBH 5D70H 1BE3H 3HFFA 7FABH 5EYPA 2WUCH 3BN9C 2YBRB 2VR6A 4OCRH 3UX9B 1F6FB 3NACL 1ASQA 2W60B 2VW4A 2HJKA 3LSOA 2C4FT 4L5FH 2ICWA 2PXYD 2ZD9A 1ADQL 4F9LC 1KJ2H 1MW0A 4TUOA 4QT5B 4TQPA 5B1CA 4HWEH 3HRPA 1KWKA 4DESA 2BH0A 2YI8A 2XNAB 1GJUA 4NWUL 3HLAA 3GSUB 3AEIA 5K33A 1UPGA 3VI3A 5EBWB 5BXFB 1NLDL 1COWG 4P5TC 4HPYH 4JY5H 4ENZA 2ED9A 5HPMB 1EDQA 5EOQL 2OA9A 1MI5D 5C8JA 3M1BB 2R29A 3IT8D 4Y2DD 1URFA 1P49A 1H6UA 2KLSA 2GBUA 4XPTH 5BUGA 2N3JA 4Z7QF 4FQ1L 4DZ8A 5LWYL 2BVQA 4HIHA 2VABA 1EDYA 1GGIL 2WD0A 2B0SL 5C08D 4TLUA 3MRNA 1TKWA 4KHXH 4N68A 3LKNA 5D1QD 3V8CA 4A6YB 3CRCA 4LF6O 1QLEB 3U4EA 3MV9D 4RAUA 3RA7L 1XHHA 1XGQB 4KROD 1T2QL 3L17A 4OI7A 3HMWL 2VXQA 2XACC 1M71B 2BCMA 2ODHA 3MRKA 5DEFB 3GXPA 5C6TH 1AP6A 1U92A 3ARGA 3BZEB 3KLAB 4JJOA 1E40A 3K71B 4JI5B 3GXUB 4G8FB 4P9PA 1DSFL 2G75A 3FB6A 3UG5A 1KELH 2QZ5A 4ZXBD 1WV7T 4PRHB 3TJHC 3ZQWA 5EUOE 4NUQA 1VADA 4QNHB 1FIEA 3SE9L 3NCJL 5CJXC 2V1DA 4KK8D 5CZXD 4LVNC 4ZTPH 2EDHA 2XX0A 5EZLA 3NPSC 3FKSG 4HW6A 5DRNA 5KYYA 5BZWB 5IK3A 3WL9A 3IJHA 1ZCRA 4BQ8A 1E1QG 1HJCA 2HFFB 4PJ5D 1F4AA 2WLHA 4PRBB 4BK4A 4M7JH 3D34A 4LL4A 1ORQC 1SA0A 1GSMA 2O6FA 4UTBL 4XMKH 5ISZA 3C8KA 4RFEA 4J4PA 3F58H 3RI5K 4WFHA 3ZTEA 3H42L 4G8IB 5DS2A 4J8RB 5DLLA 1LEIA 2IC2A 2E7BA 2NYYC 3QJHB 2EDFA 4JFDE 4LVEA 2WNXA 3ZKMD 5FIEA 1K5SA 1BQRA 2WP3T 2X4RB 3HVDA 1UG9A 5T5FA 5IHLB 2OYMA 5EIIG 5AAPA 5KWYC 1BMFG 3C60C 5ACLA 1OB1A 5HHXL 2PWDA 1O7SA 4OTXL 2UUBB 4L0YA 5AW9B 5I1JL 4LC1A 3VXSA 5J57B 3LNIA 4JZJC 3ZSSA 2IQ9L 1SVBA 1RUKL 3MLTA 2N7AA 3ARUA 2XRAL 3MV7A 4RMWA 1ZAUA 1UC6A 1TETL 5JIDA 3V4VA 3MCLH 3RB5A 4JO2H 4ELME 4GAAA 5I6OA 4DPRA 1WPXA 2OMZA 5LGYA 3T1YO 3VD0A 2E74C 4Y1AE 4LRNL 1U4EA 1RKRA 3R1GH 3K3WA 4GJTB 2EE3A 2QJ1A 5IB2A 1WK0A 4GUNA 4G42B 4Q2ZA 4XAKD 5L2JB 1ZT7B 1MFCH 5F3HA 5JHDB 2F93B 2ZYRA 3MLXH 3QK0A 1XREA 2DWDB 3WU2Z 2OW6A 3SKMA 1DO5A 4F9LA 5CBAA 4GKZA 4MCZB 3HC4L 2D7QA 1S7XB 1WJ3A 2P8MA 5D2LE 4NN5C 3T3MB 3T2QA 2PO6C 4HX1B 3IJ4A 1MQKL 4NVPA 1AGBB 5AZ2L 3ZE0E 5JW4N 5JW4M 1MFNA 4FCAA 4KVCH 1JMXA 2G3XA 3ZYOA 2BFVL 5EU3A 4P5TA 5D2NB 4L8JA 2GAZB 3MCKB 3HKBA 4EQ2A 3MYJA 4CVZB 1MRCH 4HUUB 1WLHA 2Y0SA 3CC1A 2BOCC 1GA2A 3IC9A 3OC5A 3RVWC 5GXBB 5HHQA 1S7SA 4M7LT 3D5OF 2K70A 4YSQA 4HKBA 3K91A 3CFNA 1N33O 3B5GA 4KFMA 2ADFH 3NFSH 4E42A 5IDJA 2XQYG 1NIEA 4MKTA 5FYJE 5I8CA 2KYIA 4MJIA 4B3SB 3CZFB 4UT9H 3IM1A 2VH5H 4WCYL 2VL4A 2WYTA 3UYRL 1H5BC 1XI1A 2HA1A 3ROOA 1F4WH 5F9AC 4IEFA 3QZOA 5L2KA 4TOIA 2FUTA 4E41B 1QASA 4E0RA 4MSWB 1RMFL 2I24N 1IM9D 5EPMB 4TV8A 4K2UH 2WVSA 5FX3A 5CJXA 1BXUA 3S34L 2WLYA 2QSCH 1WS7A 5DT1H 4AQAB 4IS6B 1NCCH 3COOA 2GJ6B 3SBRA 1BT8A 4RQFA 1LK2A 3OKEA 1Q9LB 2AJ3A 5JMRA 3I6LE 4G9FA 5BOJA 4JI0B 3ZOAA 1IM3A 1SXBA 2CK2A 2KC0A 2WNKA 3FB7B 3JWOC 3Q8EA 5FCUH 2HTLC 3C3SA 1MZFA 2YZ8A 1HZHL 1I3UA 1QPPA 1E6JH 2R1XB 3BWSA 4HH8A 4QAMB 4YVUA 3TESA 2X2YA 3BIKA 2BERA 1IT9H 1ORQA 1P84F 1YJ9V 4PJFF 5GGRA 1BBDL 8PAZA 3FCUB 2F1MA 2ILLA 4P46C 4X6DE 2VN3A 1HSAA 4R9HA 2NSMA 3GJFA 2ADJB 3Q4HB 3NCBB 2F5AL 2EYRA 5EN2A 2F61A 5H2FZ 2X4SA 3TA4D 1V3JA 1AD9B 3UTZB 3IN2A 4FL4C 2JKTM 2KZKA 4B0MM 4F37K 1I8AA 3HMXH 2XTLA 5FFOA 1SQXH 3P11H 1RZJH 4O02L 4D8OA 1AILA 4XN4A 4GIPD 4JKPH 1MFBH 2OSYA 4FXLA 4HGMA 2WLLB 2NXZB 2P5ED 4JZJA 4GP5B 5EC2B 3FO0L 4MHHG 4K5LA 2R27A 5EEWA 3GC3A 4FTDA 1AR1D 1VARA 2J56A 3BLKA 4H20L 1NMAH 1UJWB 2AKRB 3STZC 3QR1A 4PRAB 5LAXB 2ZYSA 2BVYA 3GZQA 1NBZB 2VWJA 3S35X 2DMBA 4R3SB 4YXKH 4HPOH 2EXWD 2YPVA 2K1MA 4DRXB 4NRYA 1MI5E 3Q6GL 4YK4B 3UTPD 1ZHLB 2EP6A 3AS1A 3PWNA 1JI2A 2HH0H 3T0XA 4HCGA 5C08E 4N28A 2CSPA 3VUAA 2XHBA 5D1QE 4XCNB 2QR4A 1XGTA 5E00B 2YXFA 3Q44A 5E8PB 2WSKA 5E8EA 1GPOH 1NCTA 5I76A 1B2WL 2BW5A 1LO4H 4E5XA 2CH7A 3HOGA 2FWOB 2QQNL 4PCTA 2PO6A 4Z7NF 5EIBD 2ADYA 4KQ3L 2BY0A 4I1PA 5GHWH 5LMUO 2Z7WA 4ZTPL 4P9ML 1I1AB 1TZIA 2PCPB 1BLNB 1QFHA 3ILPB 4N2FA 4O2BA 5TJWK 1BVKA 4Z95L 1AGFB 3PP3K 1X9RA 2GI0A 2VM3A 2BOCA 2JXMB 5AB9A 1PY4A 2K0RA 1NIAA 2CLRA 3ZKQD 4FLXA 1EGJL 3JAMN 5LHIA 3IGUA 3O3AA 1B9ZA 4H5SB 4JPIA 3IJSA 3ZZLA 5TDPB 1G9NL 5I0DA 5K9QI 1U58B 3JV4B 4ZS7L 1OAZL 4OFYA 2DH2A 3NMEA 2LAAA 5F1KC 5E1AC 2NY0C 4PJ5E 4OGAD 2IXQA 2JJ2G 1XSOA 2Z1PA 1TMQA 5HI5C 2HWZL 3QDGD 1H5BA 4JFUA 5F7EL 5CN3A 3T4AB 5ETUB 4FM2A 1AXIB 4DKEH 15C8H 2O5NA 2ZUSA 4HJTA 3HG3A 4MDIA 2EICA 3V5DB 5KA5A 4Q6IB 4D9RD 1C5BL 5KN5B 3L2MA 3V6OC 1M56C 2DRUA 1Y6XA 2QA4V 1VQ6V 1AS6A 2XDHA 3BKCL 5E5LA 3SY0A 5GTHZ 1PPJH 1EZSA 4BZ1L 1K2DB 4DR4B 2IMMA 4X6FB 2XYBA 2F15A 2WBJB 3AWFA 3DX2A 5EU6B 1I7UA 3A6BH 4I1RA 3AB0B 5ADPL 2WZPA 4K0OA 4YN3A 2Y7MA 3Q9PA 2HG5C 5KW9L 3BESR 2Y07H 5EU7E 4X1IB 1U9KA 5CBEB 1HEZB 3CCHA 4WEUD 2VDOB 2NUPA 5F7YC 1IBDA 1G94A 2JFCA 5C9JB 1E0OB 2H9GB 1IUZA 4O4JB 1H3GA 1XH1A 2AK4D 2AJYH 2A77L 4P46A 4BJLA 4CU7A 4MWFB 1YYML 4Z7AA 5IM7A 3MV8E 3ZU8A 5HGBA 2Q4PA 3ESUF 4G8GB 4I9WD 2CH8A 1N34B 1BS3A 2CJTA 2FQDA 3E3QC 4M29A 5K9OB 4WFAV 1WFNA 2XTJB 5GONA 3NCMA 2BSCA 5D7IE 2RCSH 2XAJA 4D7SA 1MMMA 4XAKE 5F0LB 4KVCL 1OM3L 2VISA 4NO0B 3ME0A 1LEGA 4HJ1A 3VFPB 1AVAA 2DD8L 2O1AA 2VWEE 4WUUD 4XNYL 3T1HO 4U6XA 4BZ2L 2A1WL 1UD4A 1SYVB 2WW8A 2AQSA 4JFZL 2CIIA 2EYSB 2LW3A 32C2A 3NJIA 3SKOA 4JN2B 3QUXB 7TAAA 4QLWA 2D8KA 3STZA 2GJZA 1FXVA 3VE0A 2AJXL 4C4BA 2EQDA 3BSZA 4DKDC 2FX8H 4NXNO 5EIIB 4AYGA 3SGJC 3ULUD 4N0UB 2N7SA 3F7LA 3A8TA 2HUHA 1FFPB 4KZDH 4XCCH 1S4IA 3Q5OA 4M6OH 5IMOB 4BWAA 2W0PA 3QXAA 1LWHA 1NANI 2HSIA 5E2WL 3UMNA 3VXQA 4PGBB 3FCTA 2VDRL 1A8JH 5CXPA 3EYFB 3CVCA 3NGBB 3JZYA 1IKFL 1IGIH 4Z9KB 3ZRVA 3ULVC 2WXGA 2OTUB 3NN8B 3D3VD 1NLBL 1BZKA 1XMQB 1MJ7L 2BHFA 2JF1A 2Y36H 3C2AH 3O4LA 4H1LA 4HIEB 3UG4A 3ZMZA 1CYGA 3AC0A 5T1KB 2D3VA 2OMUA 4OBSA 3NESA 5DUMH 4XDJA 1Z5VA 1CR9H 1XO8A 1IGYA 1M7DB 5F71A 3IJ9A 5KYWB 1I8KB 2FO4A 1SJEB 3GRWA 3KJ4C 4X64B 5HHVH 1XF2A 5DJZB 2AV1A 3KYMB 1G1OA 1YUHA 4FMKA 3K0WA 4ZOAA 5DGQA 5F7DA 3MI6A 1KB5L 1AIFA 2P22C 1N6VA 1N0XH 2XY1A 1AJQA 5IEHA 3MXVH 4KRPC 1AY1L 2BRRL 5F3FA 5FO9A 1Z6JT 1IGCL 4K8RL 3T0BA 1R3JC 4K7PL 2AXFA 3W9EB 1JHTA 3SDDC 1RHHB 3HZMB 4IYKA 1I8IA 1QRND 1KECA 1EQWA 4JNXA 2ATKB 1IGML 3Q01A 1XGRB 3K1DA 5D72L 2XAGA 2BSDA 4NIYE 3NA4A 3CZNA 5IQOA 2UXCB 1J0IA 2PI4A 4CBPA 2HX9A 5C9KA 1QATA 2B4CL 3MNWB 5BOZG 3H7LA 4MMZB 4JE4B 1FYTD 2YA1A 1JV5B 3V6OA 4N6QA 3WO3B 4J3XA 4G6AC 1H2MA 2L7UA 3AQZA 3H3PL 1KB9K 2ICEC 2OW7A 2CHZA 4W9GC 3KBFA 4XN9A 3AREC 3G5VA 1UWGH 1N32O 3R06A 3TV3H 1EEZB 5KVDE 2UVFA 1ENVA 1YEKL 4NQDD 5CUSL 1DLHA 1X9LA 3DTUB 1G7JA 1SJMA 2HG5A 1TZGH 5JIQA 2GC7C 5AALA 5KS9B 1Y74A 2MK3A 3AJ7A 1CU4L 1IC4L 3HNSL 5C0CD 3WAKA 1B4RA 4J6IA 4KKBD 3QIUC 3ARPA 4AGMA 5F88A 5AW7B 4UOW1 4MB5A 1L7IH 3PU7A 4Q56A 3FTGB 5E6IB 3UTPE 2VRQA 1GKFA 3EJUA 5I73B 3QRBA 2K6WA 1EVUA 2X4UA 2JTYA 3O81A 1YMMB 3I75B 3LMJL 4UQ2A 2DQGH 3WENA 2VYRE 3ESMA 4P57A 1KGXA 4FIPC 2JEUA 4J6RL 1ZX3A 4B9FA 3DC5A 3RYCA 1YPZF 2CUGA 3CFCL 4PDRA 3EO9L 3LVEA 2WCGA 4GG8B 1DTOA 3QEGH 4GRLD 3CVHH 4XB7A 3O9WD 3ECQA 4NNPL 4Y16B 5CEYB 4BH7B 4HK0B 1HOEA 1OCOC 3IN0A 1ZHNA 3L6FB 1FNSL 2R59A 2X4NB 5HGDB 5HGAB 5JQGB 1Q1JL 2DI8A 2NNRA 3L5WA 3L7FB 2QADC 4M1CC 4UDUB 3SGJA 3T77A 2LO1A 4PJIE 5CMAB 2AQ2A 4OIFA 3RZCC 4PGCA 4NC1E 1U8KA 4R26L 3NJJA 1IILE 2F68X 3MRJB 4P23D 5TGBA 2ITDC 1S5LZ 3EG9A 3GHEL 2B16A 3PNWA 3G71V 2YD9A 2IH8A 1JMZA 2GKIA 5DRXA 3UAAA 2CKBA 4XTRD 3M6DA 2QGNA 1RZFL 1U8IB 3KYKH 4YL9A 3LV3A 5HI3C 3UTOA 1N2RB 4BFRA 3OAYK 1UZ8A 2ESVA 1B3QA 5EO0B 3HZKB 5DEZA 4PLKD 5DJAB 4XVSH 3VRIB 1A6WH 1TZ8A 4UTAL 4D9RE 3TBTB 1TUBA 4XVOA 2VTFA 4LNRA 5GGQL 5EH1A 3D85A 4I3SH 5CBGA 1Y0LB 4H13C 4Z3GA 4WKZA 2JWYA 4HIXL 2WB1A 1DK1A 3BDYL 4JFQB 1R3JA 1FA4A 2QTOA 5AYUL 1CF8L 4CNIB 1SQVH 1CI3M 3SDDA 2JE8A 1QI3A 4P06A 2RN9A 1H3TA 2NNUA 1U2CA 2MQ0A 2WINA 1V55B 3GFUA 4X7CC 5F96H 3VRLF 4G6KL 4H88L 4W9FC 4UZSA 3ARFB 1HS6A 5JA8B 3BAXA 3MTRA 3VSTA 5KVFE 1CK0H 3D06A 4RUEA 3EYOA 3HRZB 1EAPA 2X40A 3WU1A 2JVDA 2A0LC 2AK4E 4NKDA 2ZNWA 5HGHA 4KTEH 4ZW6A 1TCRB 2OCFD 2UXBB 4JJ5A 2Z6FA 5CGYD 4I9WE 5I1CH 5I23A 5D5MA 3EOBA 1VZIA 3CFJB 1YNKH 2FZ3B 1TVKA 3FQTB 2ICEA 3II1A 4QYAA 1OGPA 3ML0A 4XOEA 2Z8RA 3BPLB 2BHZA 4LVHB 3JYCA 1X5FA 4YZFF 3BFOA 1JTTA 3AREA 4WHYG 5I17B 5C0RL 2HB0A 3QQ3B 4JO1L 4NQCA 1EV2E 3X3GL 1N5YH 2IJJA 4OFQA 5D7LA 2FNBA 3LRHA 2BSEA 1SQFA 3ABZA 3G5XA 3DA0A 5CLXA 5G4MA 5CA0B 4XPGH 1G6RA 3UPRA 2BTQA 4JZNB 2HXAA 1PP9H 4XVUC 3QIUA 4Z18A 3JCZA 1K34A 3KGRA 5EU4A 1I0HA 3C5ZC 4EI5A 4WI4A 1QLNA 1U3HD 4QXUL 4XNMA 1HNFA 1K4DC 3N5AA 5EC1B 3ULUE 3O8XB 1EFXD 5HPOA 2Y1ZA 2VIRB 5DEDA 4IRJD 3CQFA 1NKRA 3JWNG 3FCBA 3EH5B 4LEOB 1JZ2A 2Y0IA 1URIA 4QXGH 4D0DA 1UB5B 2F7PA 1YITV 1FCCA 2DYPA 3VYNA 1UADC 4JHUA 2GUZB 4FPPA 1TQSA 4PV8A 3RUGE 3D3VE 2BWIA 4QRRA 3EZJB 1JD7A 3AG4B 4G7QB 4X8AA 1PZDA 3BN3B 3UTSB 1XCWA 2D9QB 3KBHE 1ZE3C 5AVWB 1HHGB 3LZNA 3RWHB 3QQ9D 1FNFA 1SDAB 2YEZA 3N42F 3V4PA 2FJGA 4C56A 2R4SH 4X20B 2KG7A 2VITA 5FYKE 1MVUB 2EIKC 1E3XA 1W0VB 4XNUH 5SV3A 4ALAH 1DQJB 2A9HA 4HIQA 4XP4L 3L75H 5IB5A 2OL3L 3RZCA 1DQDL 3NJHA 3IJYB 3S97C 4E9SA 4Z5RB 4PTTA 4UQEA 2ITDA 3GI9H 4OCLC 2TRYA 3P3TA 1QRNE 4XXCC 5KOMC 3UBXI 4AIOA 2CGYA 2WVTA 1VFAA 4JM2D 4HLZG 4OLYL 4P2RB 3RDTC 3OLDA 4XBMA 1KIQA 4NQED 3UO3A 4GRWB 2EIZA 1ZGLA 1GM9A 4OJFH 3LH8A 3LRMA 1CBJA 1N4XL 5DWUH 4F7TB 5AUMA 4UMGA 1P1ZA 3QJTB 4I7ZC 2QBWA 4PV9A 2BP0A 1BEYL 1FYTE 2HVKB 4LASH 2FLBT 4OCWL 3GXDA 5JR1H 3QFDA 1F18A 1XIWB 3CFUA 4NRXB 4TL5A 5HVHC 2V7QG 4QD2E 5DTFB 2DQEH 5TQ2H 1AHWB 1JTPA 1FFNB 2Z65C 3C6EA 5BS0D 4DV6O 5CEXB 2HMID 5FW8A 4HV8B 2BSBA 4NQDE 4S1SL 1WA0X 4OFVA 4F20A 2MQCA 2UYLA 4DO6A 4ONGL 1PX8A 5MERA 4I55A 1NC2B 5DD6B 3MR9B 1TJHH 1MFDH 4YPJA 5C0CE 4I18A 4X1YB 4S2SA 3CUPA 4GLRI 2A0LA 5HHOD 3KPPB 3PWJB 4GW5B 4LSVL 4PJAA 4DN3L 4YHNB 4PJBA 3G04A 1X5HA 4HGKC 1M6OB 5HDQL 3HI5H 1B3JA 2JKLA 1A9EA 4PJXE 1EPFA 1MFAH 3F12A 3ASOB 4ZO6A 4D9LH 1UM6L 3AK2A 3HUJB 1IGFH 2WXIA 4WW1B 4HSQA 2GBAA 3WLWD 3ZL2A 3WTXA 1FH2A 3FT2B 3EYVB 3LIZA 4L1LA 3SJAC 4LLMB 5ABDE 5CP3A 3MNMA 1JJOA 4LLWA 1MLCA 4UNUA 3VYOA 1K85A 4H8VA 2AEOA 3V52L 3I02A 4APQB 1MOFA 1OP4A 2QGCA 4PWFA 1IAOA 1UM5H 4ODHL 4BCYA 3UAFA 5KG9B 5FLVA 2YMTA 4LF3A 2EDNA 3ZXAC 1KGCD 1HI6B 3GMRB 1HNYA 3C5ZA 1SS3A 1O9VA 4P2ZA 1ZTXE 2EEXA 4NJAL 4Q4EA 2K6YA 1WD9A 4FLRA 3KS0H 1K4DA 1XHZA 2YGQA 4F6RA 2G2NA 5CU5A 4UILL 2CPUA 1F02I 2DQMA 3QH3A 1EBPA 2D0FA 4MRBA 4YDJA 2DY2A 1KBWA 4CILA 4TQEL 2FL5B 3SPVA 3CFMA 2HAZA 1W72A 4PJEA 4OJCA 5E5MB 4ZUTA 1VEPA 5T5FH 3TIEA 3T4DA 4I77H 4QJ3B 4AGQA 3L95B 3RYHA 1D5MB 1G9ML 2AFNA 4OGYH 3P30L 4Y8AA 3LX9A 2CE4A 4KNTA 2IANA 2Q6AA 2J5LC 5B1KA 1RV6X 3BW9A 2CO6A 3FQ2A 4HALA 4ES9A 3DPDA 1EIBA 5GIRA 4XI5C 2GTWB 3ZHSA 3RTQB 4HYOA 4M93C 5E03A 3CCRV 2AK1L 1JQ0A 4N2KA 3UIYA 4AIZB 3VA2C 4WFGA 1S5JA 4FFBB 1KN4H 3JAWB 5EBMB 3V4VH 3H6AA 4JO8A 4YDIH 3ZE1F 1H3PL 2EE2A 2P8LA 5JLZB 1JJUA 1SYSB 1AGDA 4XXCA 3A2FA 4MW8A 3MRDA 1IDSA 4TUYA 4I0PB 2FR4A 4LHJB 1S9VB 1HK6A 1CXHA 3PWLA 1HR0O 4X98A 3RDTA 5EBLC 4WI0A 2HYMA 4YJ3A 2XVKA 4N5UA 3Q3GB 4QHMB 2GSGB 4FTVB 5AW8B 4IMLB 4E68A 1FE8H 3ZO0A 1LK3L 4NHCL 2GHYA 4GYBA 1J1PH 1XL4A 1BFOB 5DC0A 4QXTB 5A6MA 2C9SA 3D36C 5C07D 3NZ8A 3V2AR 3LKQB 3GMOA 4RSYA 2ARJQ 1QFOA 4OH2A 2EKSA 4OLXH 3BIAX 4PM1A 2D0HA 3K5NA 4N2OA 5MEND 2XZCH 3MJ8A 5CD5D 1FZKA 4ERSH 1YQVL 5HI4D 3BA9A 1Z0MA 2MH4A 1JFQH 1HIMH 1M1XB 3K58A 1RPKA 2ZOOA 1IIIA 3SE3A 4BBWA 2R1WB 2K8MA 3D51A 3GBLA 2V5SA 3G9AB 4FXTA 3GHPA 4IBQA 4JVPA 5I8OH 4ONFH 4B9CA 2OMTB 4IOFD 3UYPB 4PP2A 2X5PA 3O0RL 2VQ1A 3QCUH 2Q8AH 3V55A 1NJIW 4ADIA 1LLAA 2VGLM 3FOLA 4RIRB 2CHNA 1VP7A 3PF2A 2VAJA 1GGBL 1NSNL 3FH8A 3CFEB 1BD2D 4MA7L 1YEIH 1MIMH 2Y6SC 3MRMA 4QRSA 4O9HL 4DP5X 1EJOL 2O4EA 2RCVA 4AK1A 5IWAB 4DEUA 5DJXB 4PJCB 1KCLA 1T1WB 4KUCF 2RD0A 1OGTA 4RMTA 1JWMA 1ZANL 3LXUX 4X5XA 3EO1B 4NKMB 5JA9A 5IW6B 3WGVB 4DV7B 3UEQA 1MAJA 4I48A 2PXYC 5I6XC 1GZQB 5B3JF 4RMQA 2P1YA 3OUSA 5HDRA 3V6BR 4PS7A 1NFIB 4AM0Q 3DURA 2QR0A 4DV2B 4BXVA 2JQMA 4RO2A 2LW7A 1KIRB 4ELMA 5J06A 2GJ6D 4EVNB 1X5LA 3SDCA 1T4WA 3G08A 4K5NA 5J1TC 4Y2DC 3MLSL 3TVMD 4GH7B 4YIQA 3V0WH 5LG6A 3GBNH 1X5YA 4U3HA 3VU1A 4FZ8H 4P2OD 3CFBA 4HJSA 1C1EH 1D6EB 1QKZL 3GJFH 4HNAA 1ZVHA 4JKWA 3FAVB 2YWZA 3BEWB 3FCSB 3QHZH 3KBEA 4XE5B 2X1PA 4XCYA 5HGGS 5GS2H 1HTYA 3VD7A 4KROC 3NIDE 5BR8O 4Y8DC 1KYOJ 4NQEE 5D2LA 1MREH 1YNTF 1SPDA 3HC0B 2MOGA 1FLTX 4JZOA 2QHRL 1MJUH 2GSIA 1I9EA 4AV0A 1AH1A 4FMFA 1ZMYA 3DGGA 4OCYH 5H2BA 5I66B 2R29L 3L3OA 4L4TD 3GO1L 5C0EA 5IJ9B 4PVNA 4ZXBC 4HWZB 4HGWB 1IC1A 1D7CA 1KLFA 2B8OT 2IDTA 1X6LA 1I4FB 1Z5LB 3HC3L 3QDJE 4W9LC 4FNTA 5E99H 5DQ9A 5CZXC 1RJYB 3VQVA 1Q9OB 5DK3A 2YPVH 5ERWB 2E0PA 5BS0E 2JCWA 1P7KB 1HE7A 1LO2L 3QG6B 4L3CA 2VXQL 3UC0L 4HQQH 1D2OA 3QE5A 1EHLH 5FYJU 3RB7A 4LCUB 3UZEC 3UKMA 5EBLA 4J3OG 2G3MA 1JZFA 4JI5O 4F7PA 5IGXL 2IO5A 2CMRL 3IMVA 5F1IB 5IVXB 2P5OA 1W8EA 3KPLB 5B7EA 3V4UH 5HHOE 3BVUA 3T09A 2Y7SA 1HXYB 3D36A 3F7PC 4JR9L 1TVHB 4GO9A 4F4LA 2BRQA 3ZKMC 3DV4A 5JNYA 2X2JA 5IJVB 2C9XA 1GYVA 4YDLC 4ODWB 1YJDL 1NDMA 1F2XK 1HNXO 4DW2H 2YO3A 4WK2B 1I1AD 4QJ4B 4UCOA 2BZDA 5KHGA 1LUWA 1F4XL 4H8WC 4KGJA 2PZSA 3JWDL 4MMXB 3HHSA 1MCPH 3DX0A 3KLLA 4YSAA 2E9GA 1R6KA 3HFMH 5EU7C 1R3LC 3X3FH 3OGCB 4GKSA 3S3XA 1K97A 5HHNB 5ANHA 3MNZA 3WY4A 4O2AB 3ZS8C 3HR6A 4HJGB 4WWID 1KGCE 1EN6A 4X6DA 1U8MB 3ZDXF 1MRFL 5JW5B 4V33A 2VDRB 1QSFB 2BE3A 4JI7B 1ACYH 3APQA 3LN4B 4KKLD 5MEPA 4LNUB 2UUBO 4XX1G 1NCDL 3RU8H 2ZCLL 4BCZA 2VR5A 5DJ8A 1MHEA 4UVAA 2ARWA 4LFBB 4L29B 5C1MB 2VRAA 3MREB 2VWKA 1YY8B 1CD1A 3RWGB 1W91A 4MBOA 2Y25A 3KPNB 2UWEF 1HN1A 3ABKC 4R4ND 2WCPA 4NUGH 2DB8A 4UBDD 4OD2B 5I74B 1AD0A 3RG1C 2IH3C 2BC4B 2ADIB 2GT9A 4ZI7A 2GI7A 2P9RA 2PR4H 4LKXA 5AYQA 3VXTA 1KB5B 5DHVA 1IAMA 1W9XA 3JWOH 1OOAA 3NRQA 3GZPA 3GPEA 4R5XA 1H9VA 4PRNA 1KEGH 4Y2DA 4FKHA 5ENWA 2ROYA 1JZJA 2ZKHH 3MLRH 1BWWA 1BLIA 1WBXB 2ZWKA 3BPCA 4N2LA 4F58L 3U0PA 1CPUA 2HZHA 5KUMA 3MO1A 2FYYA 4FYSA 4PRID 4RDBA 5GS0C 3BP5B 3ECWA 5C0DB 4KBPA 3TONA 1KXTB 4PY7B 3RL2A 4PB0L 4HIJA 1U2HA 1T66D 1IFRA 2FIKB 5HP5A 5IFHH 5C09B 3EH2A 4L2LA 1BZOA 3CIQA 5EF0A 1CMOA 4FFYH 1TQCB 1VPOH 1Q7YW 1KC8W 4HP5A 5C07E 5HVWA 4J2QA 5F9WC 4ZXBA 1JHLH 2K8QA 3I9PA 1CFSA 4L8SC 1AROP 3V4LA 2Q7HA 3OM3B 3NXSA 1JPFB 2F6AA 5MENE 3DVGA 2PI5A 3QUXD 3C3TA 3BFWA 4TVPH 4MCYA 3L1OH 4FLTA 4B3SO 1UZ6E 3CV5A 4HXBH 2V9UA 4QPJA 1A6AA 1IGJB 1OD7A 2Q69A 1PLGH 3UTQB 1IFHL 4K3GA 2IV9A 3FZUD 3UZEA 5D5PA 1KSRA 5BVJA 3VXNB 2H1PH 4Q9QH 1GGUA 2YXHA 1NFDF 3M07A 2J1YA 3BT2L 3L08A 4PJGB 5KANG 1PSKL 3QSKB 5DUBB 4YPGB 1AGCA 1UWYA 3B9KB 3CLEH 4NP9A 3UROR 2W59A 3ZL1A 3OQRA 4G7VH 4W1TA 1BD2E 1WP6A 2V5YA 2DI9A 4KVNL 1IGTB 4NGHL 1HL9A 3BWAA 1I3GL 4GW4B 4NNXB 5EIQA 4X9HA 3V5KB 4FADA 4N8CH 3GRWH 1FO0A 2JJTC 4HLJA 3IDJB 4MAYB 1T80A 4QNPE 1YYLH 4AT6A 4QY8A 4OD1L 5DK2A 5T1DL 3RVTC 5TDOA 2XUMA 2K4AA 1BM3L 4MXVF 1ES0A 5EIVA 2X4PA 3H2QA 1X5JA 3U2SB 3TCTA 2BCKA 3H9SB 1COBA 1AR1C 4GSUA 1REIA 1R3LA 5EZPA 3KCPA 3DMMB 1C1EL 1YEFL 2E9JA 5FO7B 4JDTH 4XH2A 4QRUB 4LPVA 5DZ9A 5CM1A 3MV8A 1JFFA 2CGOA 2Q73A 5DMKA 5LOVA 5I9QB 4QYOA 5LXGL 3NJGA 5JUEL 3B7SA 2YUAA 3E9UA 1DEEB 2P52A 2EDBA 3WIFB 1J95A 1QSEB 1RURL 1MSWD 4FULA 4YHPB 3TBVB 5D7IA 5D1XB 1CLVA 4LOEA 4X0NA 2OI9C 5IOPA 4ISVB 3CIAA 4PWEA 4RAVB 5KVGL 5HY9A 3CDYA 4LDCA 2UU9B 1NTKH 3I6KB 4ZO7A 3BKJL 3EYQD 4GAGL 2I9LA 2EBOA 1VFUA 5GRJL 1EXUA 5CJ8A 5I19H 1B4LA 3BKYL 2XZQL 4YC2C 5CS7A 5F7WC 5JHAA 2IH3A 2P67A 3G6AB 2AJZA 1H8HG 5BRZB 3QZLA 1D5XA 3STLC 3CSFA 3F6JA 4JPVH 3G6JE 2BIQA 3KXFD 5IG7B 3Q2LA 4L4TE 1S5HC 3R66A 2E5LO 2AABL 5FXCH 4HLEA 4L3ED 3VQYA 1H0DB 1MG2C 2YXVA 5ITFA 2BZ7A 1ZHKA 4U49A 3UZQB 2WPGA 3F8UB 5E0QA 4ETQB 4JQXA 3HR0A 4NC1C 1BG9A 4M4RB 3N85L 1W15A 3G6DH 3MJ7B 4TLTA 1CIDA 3IMWA 3VI4B 3VRJA 4QIWF 1I7TB 1P5VB 1CL7I 1OT1A 2HHHB 1SQBH 3T3PB 3JTSA 3T2LA 1HNZO 1B0RA 2KQMA 3BVNA 3FT3B 5CP7A 2OMYA 2BWDA 4FFWD 3CXCU 2G60H 3OL2A 1CYWA 4O4IB 3C5SB 5IR1B 4LCVA 2OIEA 1MY7A 3QRGH 2ZT9B 4ICGA 1X4TA 1MJJB 1GM8A 6PCYA 4PW3A 1KNOA 1QWUA 1KIUA 3PL6D 3JUZA 3L73H 1CG9B 1ACZA 2EUVA 3HR5A 4L8SA 1TJGH 1IM9A 3WKMH 2R0WH 2X3CA 1KENH 3L3JB 5DK0B 4BQ6A 4B9YA 2VLRE 2E46A 2FH6A 1C8PA 2FD6H 4JASA 1OTSC 5FL7G 2BJML 2FO1A 4H44C 4PJFA 3IE4A 2WXOA 1NBYA 3HZYA 1OCZC 2BTOA 2MCG1 1F1DA 3OV6A 1K3ZA 4AQEA 5D93B 4NENA 4R7XA 5DA4A 3VD2A 3DX7A 4QHUA 4X6CB 2IIJA 3ULVH 2BSKA 4AMKH 1AO7B 1VQMV 5BNXD 4MFHA 4NP4L 1A4CA 3O2VL 1BPLB 3N06B 4M8VA 2WXLA 4L1DA 4Z2WA 5KSVB 4TTGA 4Y0GA 3DO7B 3T0EB 3UDWC 3HTLX 1XWVA 2WVUA 4DCQA 1RK1A 2JJTA 3DI2B 5EOTA 1NQTA 2FHCA 2TRHA 1R19A 2ZZUT 3LJ3A 1A3LL 3PQYD 4K3JH 4ODBD 5FECB 4PGDB 5CCHE 2LGWA 4WTQA 1VZHA 5ILTH 1OAQH 5D1ZC 4BKLA 4RQEA 1KKCA 2DLGA 3DROB 3E22B 2VLJD 4LP4A 4WWPA 3UJIL 4JAUA 2EO9A 1BXAA 5FM4A 5H37A 2VZSA 1NGPH 5BQ7A 1V7MH 2VLKE 1IIKA 5C7XH 2P90A 7PCYA 4OZGF 3LH2H 4NUJB 3SKUD 1VFMA 1BX2B 1IBGL 3A4FA 3CNKA 4ENED 1Y76B 2P42B 1QSZA 3N43F 5KJ4A 4DPBX 1OPGH 4CUCA 4N24A 3K0GA 1CLCA 4PRIE 2PY5A 2GY7B 3QIBC 3T2NL 3NTCL 1A7RH 5BV7B 2O61B 2XPYA 3TT1H 1S8DB 4N9GB 4RDQF 4ZSOA 1KEML 1OV8A 1E4WH 1OWWA 1D5IH 2QWPB 3CCLV 2OJZL 3DXRA 4HCRA 3RJDA 2UUAO 1P4BL 1ID2A 3MOBH 3PGDB 4HFWA 2D7OA 4H26A 1YAZA 3QQ4A 4EZJA 1J5IA 3HPJB 3BSZL 4P99A 3NA9H 4F3FB 3FULA 5C0IA 4Z77B 3STLA 4F8QA 1BFVL 4ONOA 1B4JH 1RZ7H 4X8CA 1S5HA 3WLBB 2ICCA 4MDRA 4JM4H 4ODTL 4X4YA 4A7GF 1BVOA 3MUGB 2PPAA 1KDJA 2CHXA 3BD4A 5I1LB 2ZR3A 3BDXA 3MGOA 4PJIA 1KN2H 3F7YB 3B1UA 3BKMH 1K92A 1S5IL 1IXBA 3C5JA 5J6HA 3IDYB 1A0QL 1DQMH 4X89A 1P1VA 1ETZB 1SQPH 5DD0L 2XASA 4DAGL 4U3FH 1TTCA 3D05A 2VOTA 3AMLA 1N12A 4RGOH 2A99A 1E43A 2V37A 1PD6A 3GXMA 1R3IC 3EH3B 3W56A 4N0UE 4MKMA 4HWBA 1NANH 3L4ZA 1NCAL 5GGVY 3W81A 5IJ0B 4F2ME 3ZMUA 2V4DA 5L4MA 3MRQB 1G7LB 5SWSB 3TH3T 4E2LA 4J7ZA 3FOMB 2R0KH 1HEJC 3IJEB 4NBXB 1IVSA 3D3IA 1J8HB 5L8JB 1OZTG 5K1NA 1RD6A 4XP1H 4XO8A 4KQ0A 4ONHA 4Z23A 2HRPH 3V4PH 1PQZB 2JLLA 4RRPG 5JHBA 1URZA 3WB2A 1HHHB 2Q10A 5C7ZA 3VACA 5DFVD 3X14A 4JVWA 4UQBA 3O2DA 4K7FB 3SBQA 1AQHA 1RJZA 1HC1A 5AOKA 4Z7VE 5DMIH 3HI1B 3BGFC 1JHKL 4JI3B 1TJIH 1MNUH 2QGBA 2AK4A 2WQRA 3K4AA 4I1NB 4KKBC 4GEIA 1I9RH 2EDEA 3AY4C 3KEDA 4KMTL 2QTSA 4JFFB 1KG0A 4L4VD 4I9WA 3LN5B 4DUVA 1K8DB 2XVLA 4HKZA 4M6NH 5BRQA 1OCRB 3JD3A 1AI1H 4RX4D 3UDWA 5AG8A 1XTLA 5C6WH 3LOWA 3G67A 3BE1H 2XQBL 3ARQA 1SZTA 4LFCB 3VFTB 4DR6B 3EFFA 3JSNA 3H85A 4JPVL 4U1GC 4X4KA 4XZUA 4KK5D 1BZ9B 4YXHL 2F7OA 4GRLC 4AGOA 2OJ1A 3O9WC 2DW4A 4BFEA 1Q6IA 2DE0X 3RYFB 3MA9H 5D1ZA 4TNWF 1KJVA 2DLHA 4FQHA 1B6QA 3T2MA 1RY7B 2CAZC 1MHHB 2VR3A 2YRLA 3KXFE 1BAFH 2L3BA 1E5ZA 4GUPA 2WXHA 3B2DC 4O4LB 1HCVA 2FSDA 3DPBB 4J3SA 3J7AU 1WHOA 3NUKA 2AW2A 4HHGA 4DGIL 4OW6A 1D5NA 4L3EE 4OUUA 4X9GA 1EHKB 5E4AA 3CCUV 1A4JA 4CVXA 5B8CC 1J5OH 4L9DA 3L2LA 2JSFA 3QIBA 3D2UD 2G4EA 2G2PA 3EW3B 1V7NL 3P2DA 1I9IH 1NT2B 1GN2A 2DQCH 4AEIL 4W4LA 4DTGL 4XTRC 5CZVL 1DQQA 3GGWA 3RUGA 4BWTA 4LLQB 5HHMB 3OF6D 3D3VA 4OBRA 3OKOB 4AENB 1YMHB 2Y69C 1D5BB 4OLZL 3IFPB 3H2PA 3LIZH 4OJAA 5DHMC 3BQUD 3U4BL 4Z7OE 2W8CA 1EEYA 2PTTA 1F11B 2X44D 2XZAL 4JKMA 4X50A 3SO3C 4KQ4L 2C7FA 4C55A 4ORGA 3CDZA 4O4YL 3OAZH 5DJYA 1GN6A 2CZNA 3AT8A 3BUYA 4KKQA 3VO0A 3QAZB 3CG8A 4LF5O 3VD3A 4UT7L 1UXWB 4APQD 1XXFC 1XF4A 3HS0C 5BO0D 2CKBL 2K9FB 3H0TB 3FU0A 4HXAH 1N18A 2GTAA 3MAWA 4CH5A 4FJ6A 5FUCE 4ZFGH 2VDLH 3MZGB 2A79B 4RZCB 4ZK8A 3WYRA 2BPBA 2N04A 1TZHB 5CR8A 4A2GA 4YAQA 3MYZA 1Q0YH 3QPKA 1NBVH 2YEVB 3CFIC 5EZYA 3WFHB 2EDOA 3U7YL 1ZT4B 1K5NB 5CZRA 1R0AL 4MLSA 4JFED 4WJ5B 3RWIA 5ICZB 1RUAL 1FYTA 2XWXA 1CPYA 4WU7A 5BMVB 1A7NH 5CEZH 3S5LA 3C6LB 5HVGB 4MD4B 1ZXKA 3MNVB 4JDEB 4DGYL 2ZXDA 2W9EL 2P7TB 4PG2A 2H3OA 1EHAA 4E5XG 2XN2A 2NTFA 1T22A 4Z7WE 3S88L 1KPUB 2I60H 2OTLV 5EFIB 1ERNA 5I1DA 4B9PA 3S5ZA 2C5DC 3N04A 3PQYE 4EBQL 5A7BA 5DXWA 4GAYB 3RFZC 1NC4A 3RQ3A 1FP5A 5BZBA 3SYPA 1KMIZ 4JV5O 3CP1A 3C08L 3IS0X 1FZJA 4XN7A 2DKMA 4MTXA 5EYPB 1QFPA 1V27A 2VLJE 1JUFA 4K4KA 2UXBO 4M6AA 5C3LD 3S8GB 2GUYA 5C0CA 5IMMA 3CK0L 4AKPA 5B1OA 2P4KA 2HJKB 3FYIB 3LSOB 1CE6A 3VM7A 1SM3H 2VT0A 2DI7A 1T7XA 3AY4A 4PGEA 3CX5J 1BCCH 4TUOB 3RVVC 2PPEA 4XCEB 3RDJA 4UCFA 4WI6A 3EZ8A 2DLTA 3O2WH 1YPZA 5MI0B 4NKIH 4IRJC 3V9FA 4G3YH 3HLAB 1Q0XH 3N41B 1BECA 1O6TA 5FUZL 3GINA 3NA9L 2I7OA 2Z31C 2VQUA 4KZ0A 3VI3B 1IAIL 3JD4A 5L3FA 3TURA 3NDZE 4R0LA 2AGJH 4WBNA 2APSA 4GRLA 3WY1A 3OTTA 4DZ8B 5IQ7H 4XAWL 1G6RL 1L6XA 1RSFA 2BVQB 2Q6WB 5JMOC 5FHAL 5C0ND 3D07A 2LAGB 4LSPH 1TZOA 1TQTA 1SXZA 1ZDQA 4R5TA 3MRNB 1TKWB 2R23A 3IJ7A 3LKNB 3QQ9C 4M6ML 4WY7H 4ZJ9A 1XGPA 3U4EB 4RAUB 1QQCA 2E4TA 2R2HA 4J23A 2E7DA 5SWZD 5CJBA 4XBGA 4L0PB 2CR6A 3F5WC 4UB0L 5B8CA 1HCZA 3TP4A 4JCWA 4K8XA 5F8QC 1HKLL 1U92B 1A22B 2APFA 3FMGH 1JCHA 2X28A 1RHFA 4TTDC 5F6HI 1NH6A 1XB6A 3AT0A 4BK5C 1PZ3A 2F53D 1VGKA 3JXAA 3BVVA 2IG2H 3P73A 4JM2C 4PVMA 5FWQA 2G75B 3FB6B 2WIIA 2JJ1G 1JCVA 4N2EA 2Y2YA 4JZGA 3KR3H 2JIZG 1J10A 5E4EC 4YHZL 5EO9A 3B2VL 5EZLB 2ZKWA 4JPQA 2CUIA 3H56A 2X2HA 4DP0X 2YK1H 4P4RA 5DRNB 1HW7A 5KYYB 5IK3B 3D2TA 3FRPA 5F72S 3U1SH 4NFDA 3IJHB 4ICWA 1VQKV 5A2BA 1BSIA 5LCVL 2DQHL 4RWYL 5CLTA 5B21A 1MNGA 5DM6V 2AAVA 2GTSA 4KRNA 1GC1C 1SA0B 3W2DL 1L9TA 1RFDH 2HMIC 4RFEB 1MCCA 43C9A 1LEIB 1U3NA 3OSKA 1R33A 4YVNA 2YKLH 3MRPA 3UJJH 2IAMC 4BINA 3QWNA 1S6NA 1XV8A 3AAZB 1JAEA 1LP9E 4R5VA 1OB1B 3FUIA 1RUML 4NJ9H 4H2AA 4TV9A 4NZUL 1CXKA 5F7MC 3RBZA 1GZHC 4JF3A 4L9LB 4L4VE 4MJ5B 5G4OA 3VXSB 1CQYA 2Q7EA 5GRVL 1XCXA 2C4FU 2ZPKL 4IHOA 1N8OE 1QHOA 4YHHO 2MNUA 1X7SA 1SETA 1TQVA 3GXTA 2FB5A 3FD9A 5CBHA 3Q7JA 8FABA 2JCCB 3WLWC 4HISA 4B3VA 4H1LG 2Y7QA 4WGWB 5CKAA 4GRMA 3K7UA 4R6UA 1NBMG 4G28B 3EADA 3RFZA 1FDLH 4V2BA 4TRPL 4AHCA 4PWHA 4R7VA 1EHNA 4DT2A 2OMNA 4KNQA 4YIOA 4IU3A 2AEWA 1CGWA 3UTTA 1AVMA 2UXVA 4RMUA 2KLRA 2AEQH 2B7DT 5FYJH 2KH2B 2OV0A 4A67A 2Q2LA 3SKMB 4ZMXA 3CH8A 4GKZB 1VQ4V 2P8MB 1MWAA 4Q52A 1XTMA 2VXUL 4W81A 1DBJL 1E30A 4LHUG 5J0BA 4GLRH 3B77A 4N2NA 4F2FA 3KJ6L 1GHFH 1FPTL 1ZGLP 1W8NA 3VGGA 5CCKL 2Z31A 1NJ9A 5JDJA 5EU3B 5I0YA 4U7MA 4NDMA 1D3CA 2P6JA 3MYJB 5I6MA 3B2EE 2R2BA 4KKZA 5HHQB 2YQBA 1VEWA 2J1WA 3CU1A 4NTYA 4PJHF 4R7DA 2V2WA 5ECJE 3TIDA 3VJ6A 3X12B 1NPNA 2K9UA 4FERA 5D8JL 4KK9D 3OAUL 1JN6A 4JRXB 3QDHA 1ETA1 1UA6L 3IDXH 3FNKA 5EZIL 3WGUB 1VEOA 5C0AA 1HVXA 3TEUA 3V6ZA 5TE4H 5I8CB 4C4UA 4XN5A 3F5WA 4DR3B 2CHDA 3CLFL 3F5TA 1W72L 4FHJA 1UH2A 1UURA 1JZGA 3ROOB 1RVFH 4CH3A 4XBEH 3VGDA 4OJDH 3SODB 4IEFB 2J4WH 1MFEL 1ET7A 5L2KB 1N0JA 4E0RB 1WPBA 2R9RB 4LSRL 2W0FC 2NY4C 1DANT 1E6OH 3J27A 1QG3A 1QSFD 2OMWA 1AKPA 1BQLL 2B9AA 4TV8B 2PW2A 2R1YA 4RWUA 4FCHA 3TZVC 5F7HA 4LVNB 2PYED 4L48A 3BSGA 4XPAH 3MACL 4FAAB 2BY2A 2QDVA 1OD9A 4HS8L 1VB9A 1LK2B 3OKEB 5JPNA 4JFEE 4QRFA 4KKAD 3TPUA 3ZUNC 1SDDA 3AG2C 1HP8A 1OTTC 3OVUB 1RZKC 3QDJA 5DHVH 1K3EA 3VFSA 1T6VN 4KV5E 2NY3D 4MQTB 1KTDB 3KPMA 3BIKB 5FW7A 4QO1A 5GRJH 4JI6B 4WO0A 1CGXA 5HI4C 1HSAB 1EZLA 3GJFB 7CGTA 4M5YH 3QUMH 2EYRB 3BAYA 4NWTH 2X4SB 5EN2B 1JPSL 2IAMA 1IQWL 3HG1B 5LGKA 2PYLA 3OLIA 4NKIL 1RSOA 3FQ1A 4R4BA 2WUBL 4HEPA 4OGXL 5E24E 4FXKA 2ZCHH 3C60B 3RRQA 1F4YL 5LGHH 1QR1A 2NY1C 4FLOA 5MP6L 2F54A 3L4XA 1GZHA 2WZ5A 2D2OA 3BUTA 3OXRB 2L6LA 3QHFL 4N0CC 4JZJB 3S36H 1U42A 3LS4H 4X80H 1T89C 2IWGA 3ZHUA 4JG1H 4L5FE 4X7TA 4CADA 1DBMH 1TJMA 2C1PA 2XA8L 2FYVA 1U8CB 1J48A 2CO7A 2XJKA 4TWKA 3TEWA 3PWUA 1G5AA 1OAKL 4Q7DA 5CILL 4Q74A 3ZHRA 3QO0A 4NRYB 2BINA 2VZOA 3FSAA 1PZ2A 5DA0B 1SVZA 1CXEA 1ZXQA 2E74B 3U10A 2B20A 2J6EA 3S8WA 1JWSA 2V3DA 1CLZL 2PNDA 2BS71 1K8AW 3KLHC 1FVCA 4M8QA 3BJ91 2FSEA 5IWAO 2X1QA 3NIGE 5AKTA 3JZ7A 5E8EB 4Y9BA 1ZLUK 4WI2A 5SWZE 5I76B 4DFHA 2B9BA 4E5XB 2CH7B 2Q7GA 4U6TA 2YAEA 4M48H 3TVMC 2V0AA 5L8LB 1BZ7B 4NN5B 4P2OC 2WA4A 4NXSA 3CX5K 4ORZC 3RIFF 4PLNC 2NCEA 2F53E 3NABH 3NZHH 5DC2A 5SWQA 1AE6L 2BOCB 3FU6A 4DUWA 2DAVA 1AI7A 3LEYL 4ZO9A 2CLRB 4O2FA 4R97C 1DE4B 3AUVA 4A39A 5AL8A 4N9OB 4DXWA 3A21A 3O3AB 2ZXWB 2QEXV 2FGWH 3TETA 2B5IC 2XN0A 3BH9A 3HG4A 3B2UC 1GMGA 2R69A 4JPIB 1DZ0A 3OXSA 4N2CA 1XGUA 1E5YA 3I2CL 4MMYA 1H6TA 5TE6H 2E6QA 2ZWLT 3BHBB 3RFRA 4O00A 3VOUA 1H5BB 1T0NA 1S3KH 3L5XL 4BRJA 3DMMD 3FU9A 1XB8A 3B7UX 3TV8A 4YL4A 3H1HH 1YRKA 2H8PC 5JIMA 4DWHA 5FYLH 3S35L 4OJYA 4R7NA 2W0FA 1ZT1B 4JGSA 1IJNA 4KP4A 2J8HA 2VQEO 5DS8A 3FUHA 4EDXA 3TZVA 1SHSA 1AYRA 1U8OA 4GG6F 2B5UA 1R3KC 3GTTA 4FQCH 4ODXA 1KWGA 5FA3A 3PFUA 3NK3A 4YHIA 2EDXA 1S7QA 4DR2O 2FB4H 1DL7H 4DR5B 2EH8H 3GRGA 4XO9A 2E6JA 1FZMA 5M95B 4FJZA 1XZ0A 2VQTA 3MLZL 1WDAA 5F97E 2VLMD 3CCHB 3WSQH 5MENA 4AI8A 2NUPB 3APOA 1L9NA 2AF2A 3HG0A 2EIJC 4P46B 1HHIA 3MAQA 3C9NA 1J9QA 2FECL 3IS1X 2V2TA 5HGBB 1E28A 5GS0H 1F2QA 3GSQA 1JCKA 2XT1B 4FL4B 2Q0OC 2UUCO 4LARH 4YDMA 1TG8A 3BRFA 3J8F7 1H2KA 1WLEA 1UASA 2VISB 2GJJA 3HS8A 1BXXA 3ME0B 1LEGB 3QCVL 1BD2A 1RZQA 5KA6A 3R8BB 2LLGA 2L0DA 4U6XB 5FO8A 1UFIA 4ZUUB 2QQLH 4NQVB 1T89A 4DUXA 1NAMA 2CIIB 2KBGA 4OZHE 3MA7A 32C2B 4ZYKA 1VCBC 3STZB 3GI8H 3BQVA 1M6UA 1M7UA 3MLWH 3KCXA 2GJZB 5EBGA 3VE0B 1TT6A 5IBTH 2FQGA 3HBGA 4UFZA 4IDJL 4JFHD 4KTYA 4IKNA 2M7WA 3TNMA 4CJ1A 4WI5A 1M4UA 2Z93A 3P4MA 4OZIF 1WC7A 4WW2F 4YXLL 1BJ8A 1CFQA 2YMOA 1SFDA 4LO9A 3EDJA 3ATDA 1SJHA 5F7LB 5AW2B 4GKKO 2CGRL 1F3DH 3QXAB 4Y4FA 3VXQB 1G5GA 4FYRA 4JI7O 4NZJA 2CRMA 2L04A 2B1IA 2XWJA 3GM0A 4ZBMA 1SEQH 2VAAA 2IH1C 2BY1A 2GC4C 4KKCD 4UV4H 1FVEA 1FWXA 4GXUM 1NEPA 1VF7A 3TVMA 4LFBO 1GS7A 3CMAV 4GW1A 1FGVH 3O4LB 4H1LB 2IJIA 3L54A 2JNZA 4P2OA 5GRUL 1RZIA 2OMUB 3FONA 3LNEA 2O5XH 1DVFC 3BPZA 3NAAH 1IGYB 4G71B 2WYHA 4LCCB 4PB9L 2FO4B 2C7UA 1T66C 3X11A 2AV1B 1K9MW 1WZ1H 2Z35A 1YUHB 3W0WD 4FRWA 5FNVB 1QSFE 3KW7A 4L3AA 2BNQA 5F7DB 1AIFB 3QQDA 4HBCH 3CC7V 2E47A 2YAHA 5IEHB 3VQWA 4X83A 2PYEE 5FO9B 1JXJA 1N36B 4K8ZA 4FG6D 3CDGB 1WTGT 2AXFB 3FFCE 1JHTB 1FZOA 3GLZA 3G6JA 2QWNB 3QQXA 1DJSA 2E6PA 1YEHL 2WY3B 2MCMA 4LHUB 1NGXB 3PIQA 5GGUA 1GAFL 4L1BA 4KJPD 1T1ZA 3GEWB 2NY0B 3ATEA 3HC2A 4YEEA 1HL8A 5E1AB 3I6GA 3VGAC 5H37H 1T6WA 3U46A 2KQNA 3VFGH 1WAPA 3JYBA 3FO2A 2QWRB 3WIAA 4U3SA 4PJ7B 2RA1A 1UEYA 2A6IB 1OF2A 4G9DA 4Z7IA 2EIMC 1NUNB 2H8PA 4AYFB 5JXAL 3MLPA 1FL6A 5CHNA 3CS5A 2NZ9C 3IVKA 1RXLA 5FUOH 1M56B 3HZVA 3Q6FB 1MHCA 2VZVA 2OYQA 3CSBA 4ZMAT 3UGEA 2X4QB 5IFAH 2VS0A 4AYBA 1DYZA 3NQKA 1R3KA 1NKOA 3R06B 1NMBH 4BZYA 5KHKA 1DLHB 2UX6A 1G7JB 3QWOA 4AIXA 3QC5X 1TTGA 3DTXA 1Y74B 3CRRA 1P2CA 5F7BA 3CPLA 1KGYE 3BUBA 3ML8A 5HDBB 2VLRA 3HB3C 4WQOA 3I84A 3SE6A 1QU7A 1F13A 5EORL 4NKGB 5F88B 1NTMH 5KSAA 4Y2OA 3EUUA 2R56H 2EVFA 3DYOA 1ETB1 3PGFL 3QG7H 3FN3A 4M48L 4CDGC 4X65B 2X4UB 2HKFL 4OT1H 5D71H 2VMJA 3P9LA 2RMNA 2G30A 3V8OA 1N19A 1M42A 2J88H 2KS0A 4G5ZH 4UINH 3T6XA 3RYCB 1A3ZA 1RUQL 4X1KB 2BVTA 3NYKA 5KZCD 1MCOL 5ACZA 1MZEA 5E6SB 3K2UL 5ID0B 4RFOH 4FABH 1FO0L 3EIFA 2Y7OA 4D94A 4MA3A 3EJRA 2UWEA 3BEHA 3VFMA 3POCA 5AB2A 2DJSA 4H8WL 4N5ED 4X7SL 1A14H 4U4IA 1NPJA 3S3BB 3PPEA 5E08H 1AJ7H 3STBA 4DKFH 1ECZA 1XT5A 4J3UA 1Q72L 3T77B 2V5RA 1J8HD 1X5MA 1UACH 1BXVA 3WUZA 1U8NA 1FFTB 1AZVA 1U8KB 1ZD6A 3BP7A 5TGBB 3U9PH 1O6SA 5DRWB 3EG9B 1SKVA 2VLKA 3QIWD 3PNWB 2IH1A 5IYDO 3F6IA 4MRCA 3DX1A 3ZTNH 2W9DH 4OD3H 5AWNH 1K8IA 2CKBB 5GZNC 1JK8A 2D9CA 1C5DA 4IIQC 4FZ0A 2AJVH 3IKCB 3INUL 3LV3B 4XB8A 5E1IA 1QFWH 4EXKA 2ESVB 3VQ1C 1BFSA 2YGVA 2V33A 1NCJA 3E8HA 3MMEB 3MV01 1DVFA 1M53A 1F6AA 4JFWA 3KJ4B 4HOMA 2NT1A 2IPUG 3H9HA 2PMZA 3DARA 4LNRB 4P9OA 4JN1H 2OSWA 3D85B 1PZSA 3ZYJA 4DP2X 4MVMA 3OBAA 4NLHA 1G6VK 4JG9A 5I71C 2OK0H 2O26U 4WKZB 3ZK0A 2GFBA 3NCYS 4KRPB 2IEPA 2YOCA 1T21A 2ZYIA 4HDIA 3ABLC 4BUHA 5B38A 2JS3A 4QIRA 3SJCC 2WINB 1DDTA 1ZV2A 1BGXH 2X6AA 4I4WA 3DRQA 2ZXQA 1DUYB 1S9WA 2WWMC 2RQ8A 5E2VH 4AJWA 3FSWA 1RZGA 4HK3J 1NDGA 5IB1B 4JDZA 4XVJL 3EYOB 2FDBP 5J9PC 1WJZA 1EAPB 4CRPA 2ED7A 1NFDA 3FT4A 1F4MA 1T5WA 3A6CL 3CMOH 4JL1A 4NKDB 5HJBA 1ZLUH 4Y2LA 5HGHB 2DM7A 4JJ5B 5FUCC 4JI8O 1VIBA 1YNLH 5EZJA 5KHIA 4IDLA 3L9YA 3EOBB 3DX8A 4LKCA 4TSAH 1TVKB 5DVPA 2ICEB 3O3UN 4N23A 3X1EA 4Y4KB 2COQA 4F2MA 1CL7H 1OE2A 1IC0A 2W5PA 3T3MF 2Z0BA 1I53A 4MX7A 5IBTL 4NQCB 1XL6A 3I9AA 1CWVA 4JO3H 5DD5L 5JYMA 3T3PE 3T8VA 4PRPD 1YEGL 1QW8A 1ZJBA 4HMEA 5D7LB 5DFWH 2V3EA 5HHMD 2J5WA 5GGVL 1J5DA 4YLBA 3QJQB 4EDWL 2VDMH 5JWPA 1G6RB 1QHQA 3EYSL 5FYKH 3UPRB 1E4JA 3K9SA 4JFHE 4R4FL 5EU4B 1T0MA 4Q6GA 2WMPA 2C2AA 4LCIL 3IGFA 2GHZA 4XNMB 1PAZA 4I4TB 5IF0A 2ITCB 3JASA 3WJMB 2Y2WA 5HDLA 2D03L 4Z7VA 1IBKB 4ZFZA 1A7PH 4D0DB 1BJ1J 3W7SA 3VVWA 5LMNB 1CF1A 1KD1W 1AR2A 2Q9LA 2DYPB 2NW3A 4E4EA 1SQGA 1R4XA 4PV8B 3OB0K 3WXWH 4ENEC 3IXAA 1Q90A 4JVUA 4Q6KA 4QRRB 4BEIA 3QG5A 4HZ1A 5KVDL 3RX5A 2OCCC 1QNZH 4X6CE 1HDMB 4B5ZA 4EUPA 3ROLA 1SUHA 4GKNA 4I5BA 2YEZB 3V4PB 1JVKA 4C56B 3PDOA 2CK0H 1AFVH 2J43A 2KG7B 2VITB 2LOEA 3W0WE 3ENEA 3ETDA 2ALAA 5IQNA 4GI8A 1NAKH 3C6LD 5FGCB 4YHLL 1JYXA 5IB5B 1A1NA 2D2CC 4HUCA 3N50A 3NJNA 5JJJB 4U33A 4RISL 1K72A 3RIAF 2GJPA 2ORBH 2FATH 1P4LA 1VFAB 3OKDA 4FXGC 2XIBA 3DOIA 5GZNA 4EOWH 1KIQB 2HFGL 3MRLA 3OLGA 2EIZB 1ZGLB 3K79A 4Y4HC 2QV4A 2WLMA 5LDSA 2D3LA 4CH4A 4GKJO 1UD5A 1C8QA 4L8CA 1UJ3A 1YJWV 3TJPA 1A6ZB 2FX9L 2Q67A 5BRPA 4TPRL 2MCPH 4UM8B 2A3TA 4HCRL 5AUMB 1M05B 3EXAA 1P1ZB 4IRSC 1BBJA 1T04A 2BP0B 5DD1H 3LPPA 2EXYD 3PY9A 4H13B 2GB2A 3QFDB 2Y7NA 5KLVH 2I5YH 1DQKA 1W0YT 2QQKH 3GMNA 1B06A 3O6LL 3T71A 1ANUA 1UHVA 3REVB 3FQRA 2Y4TA 3V0FA 3K6IA 4P5MA 3LQAC 4R90L 4GBXD 3U1QA 4D3CH 2IWFA 2GHWB 2UYLB 5IHUL 4QJFB 3LZFL 3WD5H 5MERB 4I55B 4OLWL 4X5WA 3BAEL 1CFNA 3CC2V 5ESAA 5FKPA 3BYYA 5J9PA 4GMSL 3CUPB 4S2SB 5TQ0H 1CGSH 4PJAB 1A2YB 4FLSA 4QHLB 4LP8A 3EOAB 3G04B 4N8UA 3FN0L 1JE6A 4HWBL 1NOFA 2HKHL 4FABL 3ZHQA 4LF9B 1A9EB 1LGVA 3IPBA 4NM8L 2B9ZA 5GS1C 2FTKA 1NCNA 2EDMA 3CZSA 3ARGD 5H94A 1SESA 1PJWA 1S7UA 2C9AA 3WFCL 1VQ5V 4LL9A 3UO8B 3OR6C 4FNLL 4PREA 5C2UB 1Z9PA 3F00A 2DQTH 4N26A 4PSPA 4LLWB 1MLCB 3WEXB 1H15A 3QO1A 2VR7A 2RFXA 2GEEA 3CCQV 1X9UA 5KVEH 3I02B 4AX3A 3HKEA 5I1IL 1OQXA 2AEIT 1VGEL 4LESA 1IAOB 1F51A 3I56V 4Z7WA 3VWJD 2D7MA 1KBGH 1ZRUA 3L48A 4DN4H 4KK5C 3O2DL 3C5ZB 3PQYA 1DJXA 2QM4A 2XOTA 1JZ3A 5IYBO 5KVFL 1K4DB 2Z92B 2IDCA 4HAKA 2JIXD 4F6RB 1CURA 4ODSH 3EDFA 2VDLB 1BOYA 2X4OB 3ZDZB 3VAEA 4OIBA 5ALBH 2HP4A 3BZ5A 1W72B 4GAFB 4PJEB 5HJDA 2CRYA 5KBNC 5MEQB 4ABMA 1NM9A 4ZUTB 5ISZD 1MVFA 4WFHD 5A2KH 3Q9QA 1I31A 1S72V 4K94C 4XP5L 1YF2A 3RYHB 4MJJA 5LB1A 1NR1A 5D4JA 4BDVA 2IANB 3BW9B 2CO6B 2Y1YA 2OK0L 3QT2A 4XOAA 1I3VA 3X1BA 3RP1A 3WIIL 5GIRB 3WJLC 2ZUVA 3K0DA 1UB6A 3NCCB 3BRCA 3PUCA 3UXFA 1ZLZA 3TYGL 4TLKA 2IALB 5L7XH 1MEXL 1Z0NA 3BLBA 5D4QA 2UY6A 5HXMA 1ACXA 4DVRH 3MV7D 2XV2A 5E2VL 3BQUC 1HEHC 3EJZD 3MOAL 4MQXD 4QOKA 5A7EA 3MQIA 1OSZA 2P8LB 3EOYG 1AGDB 1RUPH 2FR4B 3SPCA 1MW1A 1WA1X 3ULUL 3HE6C 4FXGA 3Q06A 3PWLB 4X98B 4DYLA 5B7MA 2D7TL 4WFFD 4YJ3B 4WI0B 4E36A 3TXQA 3SDAC 3E8UL 5MHSD 4QF1A 4Y4HA 1YN6B 3N27A 2NOYA 1IXMA 1DBAL 4ZAKB 3VG0L 1YEDA 1BREA 3BN9D 3MV11 3UJTH 3CXDH 5D6DC 3W9DA 2ISDA 4AJVA 3WS6C 2O5ZL 4GSDL 1MWAH 3BLPX 5H35A 4I7ZB 4FJCC 2DMCA 4IRSA 3GMOB 3U7WH 5B1BB 3WIHA 2WTOA 5IQMA 4J3VA 3AU1B 5EUOB 3AFLA 4Z76B 5HVHB 4ACPA 1B0IA 3CSPA 4M00A 1GKEA 4FQQB 1QZ1A 1QR9A 1BQ0A 2BVOA 4J1UB 4IBUA 2Z0UA 1J7VR 5ADOH 1Q81W 3OPZL 4HD9A 4P5TD 5KSBE 4IGGA 2P48B 2B2XH 4ZPVA 5J8OA 1Y67A 5EOCJ 4PRPE 5B1AC 4DR1B 4MS2A 1VIWA 4CA4A 4ZTOL 4B9GA 1S3RA 5HHME 4MQ7A 1XSIA 2UXDB 1E7VA 3K46A 1ROWA 5D7SH 5HVFB 1GW0A 4OGZA 4OQ1A 4PP2B 3WN5C 3ZSTA 2VQ1B 2UXFA 1FGNH 4DJMA 4MA1B 2DBLH 3FOLB 1QBZA 3Q2VA 4PVLA 5LBGA 2G9KA 2ZXCA 3C12A 4JK0D 5IV2B 4IBLT 4BSVA 1R3IL 3MRMB 1JOIA 3SJVA 1KCSL 4JFDB 2EDYA 4MJID 1DVTA 3THOA 5J11C 1GTFA 3QJZA 1BVLA 1FQ9C 5B22A 5GS1A 4PHZA 1LP9A 1JWMB 5AG2A 4UV7L 2M83A 4X5XB 1A32A 1PYWA 5DD3L 5FDYA 5HTSA 2LU3A 3OR6A 4I48B 1F1GA 3JQOB 4JAVA 5L2KD 1OLLA 1JK9B 3WFEL 3DBXA 1UCBL 3K5OA 3N0AA 4M9PA 3TJHD 2KKWA 4DGUA 3DURB 3S6CA 4HWUA 5JXEC 3SE4C 1X7TA 5GRWA 1UOKA 3VA6A 1UXSA 2XWZA 4ELMB 1HU8A 1GGYA 2X4TA 4HH9A 1TF4A 1UYWL 3WI9A 3N3EA 4P2CG 4G9FD 4JPWL 1BF8A 3WBDA 1K9TA 1IM3D 3QR0A 1JRHL 1PEZA 3ZQ9A 1CLOL 2RDCA 2B08A 4Y1AB 3U1PA 4U1LB 2FBJL 4XPBH 5FA4B 1BOGB 1BGYH 3MBXH 5LNEA 4U3JA 1QI4A 2AQNA 2W1NA 2AV7B 5GISH 4XCYB 1EZVH 4YH6A 1OZ0A 1X4ZA 5D2LB 3NP4A 4JZOB 1BQUA 2DQJH 1NFAA 4OZFA 4X8JA 3ZE0B 4HUVA 3L3IA 4PBDA 4K0KB 2GSIB 3PJSA 1WWBX 4KH9A 2YFNA 2NY6D 1SDYA 5H2BB 4M93B 3TO2A 4B9JA 5C0EB 3ZHVA 1LQBC 3OJVC 3K06A 4OGQC 1PW3A 4PFEA 3TF7C 1H2LA 3OF6A 4GMTL 1KLFB 1NGYA 3SKJH 4AEHL 4ANVA 25C8H 3BQUA 3ZN0A 3ABMC 1PCSA 4R8WL 1ZWIC 1QO3A 4MVSA 1ZTXL 3AG1B 1J9CT 5KS9F 4L3CB 3MXWL 3MUHL 2CQVA 2J6EH 4IU2A 3HE6A 4P9HC 4DP1X 4PR5A 2A83B 3GQFA 4DV1O <