5B1BB

Bovine heart cytochrome c oxidase in the fully reduced state at 1.6 angstrom resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title The Mg2+-containing Water Cluster of Mammalian Cytochrome c Oxidase Collects Four Pumping Proton Equivalents in Each Catalytic Cycle.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 68
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b1bB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1bB02
3WG7B 3ABKB 4WTQA 1KBVA 2GIMA 2PLTA 1PNCA 8PAZA 1FWXA 1MG3C 1J5DA 2BP8A 3KW8A 3PAVA 1WS8A 2WSDA 5B1AB 5D4HA 1SF3A 3FQ2A 3SBPA 2XU9A 1BYOA 1E5YA 1XB6A 1SHWA 3AG3B 2IDQA 3UAAA 2GSMB 3N55A 3S3CB 5B7MA 5LDUA 4YSAA 2AZUA 2EIMB 4EF3A 2ZWNA 3X1EA 1NIEA 4AX3A 4KO7A 1M56B 2HX7A 3HEIB 3BVDB 1TKWA 5I26A 1BYPA 1XMEB 3T9WA 3QQXA 4L0PB 1BQKA 3CDZA 2H3XC 3FQYA 3NJMA 1ASOA 1DZ0A 4KNTA 4AKQA 3DTUB 7PAZA 3UAEA 2IH9A 2MRYA 1QHQA 4YSPA 3V9CA 1HAUA 4DP2X 1MG2C 2OJ1A 4PCYA 5D4JA 1L9OA 1JZJA 4NB7A 2QDWA 2IWFA 5I5IA 3T6VA 3NJIA 3WKQA 2QDVA 4NAJA 2IDFA 1XB3A 2AZAA 3WKPA 3ZX1A 2FQFA 4F2FA 2QT6A 1OV8A 4G70B 2VN3A 2UX6A 2AANA 2FNWA 1OF0A 3WNJA 4YL4A 3OM3B 2VW6A 4KOBA 4FA7B 3T6ZA 9PCYA 3FU7B 3T6XA 1AS8A 3NJLA 3CG8A 2HXAA 2R7EB 2X87A 1AACA 2XWZA 4G72B 4YSCA 6PCYA 3NJKA 1SFDA 1ZV2A 1L9PA 3X1GA 3GYRA 2TSAA 3C75A 2HZHA 1PZAA 2UX7A 3G5WA 4E9WA 1KV7A 1PLCA 2AVFA 2CJ3A 3NSDA 4PAZA 4Q8BA 2CALA 4KNUA 3PPSA 2BP0A 1AQ8A 5F7BA 6PAZA 1N70A 3SQRA 2BO0A 1IBZA 1OE3A 1A8ZA 1NPNA 3PLYA 5AZUA 1CUOA 1PLAA 1OCCB 1SHXA 1SJMA 1WA0X 4HCIA 1V55B 1L9RA 4DP6X 1W6LA 4UAHA 4GP5B 2IWKA 4KNSA 1NIFA 1AAJA 1ZIAA 4E9RA 3D12B 5E9NA 2BZCA 1RKRA 3UADA 3CVDA 1IKOP 1CC3A 4MFHA 3FQ1A 2HRGA 2J56A 2XV2A 1A4CA 2YQBA 2J55A 2IWEA 2PP7A 2VW4A 5B1JC 3FSAA 4BWTA 2DY2A 1BXUA 1BQRA 2PPEA 3IEAA 1CYWA 3AZUA 3EH4B 7PCYA 4HZ1A 3X1NA 2UXFA 2XV0A 3MBWB 1ILSA 1AG6A 1AIZA 4YSRA 1BAWA 1NWOA 1PZCA 3IE9A 3NT0A 4HHWA 4W9ZA 3X2QB 2NRDA 4YVUA 5TK4A 3KW7A 2GB2A 1OCRB 1AANA 2YAEA 2E86A 1PMYA 3NJNA 1L9TA 2IDUA 2YXVA 4GYBA 3UGEA 4AKPA 5I5MA 1JXFA 4YVNA 4BK5C 2YEVB 3FYEB 1EZLA 1F56A 1UATA 3RYMA 2CCWA 1ZPUA 1T5KA 1KCWA 2YAFA 1L9QA 2MTAA 1NTDA 2XYBA 1N68A 5I6MA 3ZDWA 1SDDA 1EHKB 2OV0A 2BZ7A 2FJSA 1GYCA 1NICA 4A68A 2GHZA 2XLLA 3FSZA 1CYXA 3PCYA 3JT2A 2J57A 3CDZB 1M57B 2JKWA 2W8CA 4JKNA 3S3DB 2AFNA 1JZHA 1A4BA 3SBQA 2FTAA 3TASA 4DPCX 4A2GA 3GDCA 2PPDA 1ET7A 1BXAA 5PCYA 5B1BB 1PZBA 3OQRA 4E9YA 4YSEA 4ZK8A 2FQEA 2XX0A 1KGYE 1SNRA 4ENZA 5PAZA 3FU8A 2YXWA 3NP4A 4BXVA 1JZIA 3DIVA 3EF4A 1GW0A 5ANHA 2W88A 1V10A 2PCYA 4K9JA 3AG1B 5F7AA 4BDVA 4AKOA 4DP4X 2EIJB 4N8UA 4X4KA 2WO3B 3TU6A 2I85A 2PPCA 2PPFA 3S3BB 2FT6A 3QJRB 2XX1A 3IN0A 1GS6X 4F2EA 1BXVA 3EH3B 2P80D 5A7EA 2BP0B 3ABLB 3NJHA 4YSUA 4A67A 4DP7X 1NIAA 3AY2A 4HHGA 3TBBA 2P80A 2PP9A 4N4YB 1R1CA 2BWDA 1RZPA 2RACA 1ASPA 4G71B 4QKTA 2BW5A 2DWTA 1KYAA 2VM4A 4KO5A 3NJGA 4HAKA 4NERA 3SBRA 4GY4A 3MX0B 4M4RB 1W6WA 2BW4A 4A66A 4E9SA 2BHFA 2BWIA 1KBWA 3EH5B 1FA4A 1OOWA 5IY5B 4BWWA 2JFCA 4A2DA 3UACA 3AG2B 2CAKA 1GS8A 1ZDQA 3CVBA 1NINA 3FPYA 1JZGA 3FS9A 4A2HA 1NZRA 2XVBA 3N2JA 1NIDA 2XV3A 2LLNA 1PAZA 3QJUB 1FFTB 1AZRA 3PXLA 3X1FA 4YSOA 4UF7C 4AI7A 5B7FA 2DYRB 2N0MA 1NIBA 1E67A 1A65A 1RZQA 2TSBA 1CURA 3FT0A 2IDSA 3DKHA 1A3ZA 1AS7A 3PAZA 3IN2A 2CUAA 5B7EA 4DP5X 3QJSB 5TK2A 2UXTA 1IBYA 1ET5A 4KO9A 3T71A 1ZDSA 4YSTA 3EHBB 1E65A 2Q9OA 1L9SA 2I7SA 1MZZA 3NSFA 1XB8A 3H4HA 2BP8B 3T6WA 4WKXA 1ZIBA 2VSKB 4M3HA 2YAMA 1URIA 2FT7A 4DP8X 1ILUA 4P5SA 3ABGA 5I6KA 3FPXA 3ASOB 3OMAB 1J9SA 5I6OA 2VSMB 3UABA 2PP8A 2YARA 4KO6A 1JOIA 3FYIB 1PLBA 2UXGA 2B3IA 2B08A 3QJTB 2H47C 1IUZA 5D4IA 1JVLA 4AZUA 2I7OA 1ADWA 1I53A 5B1KA 3IBOA 1OCOB 3FSWA 1HAWA 3U25A 3NSCA 1PCSA 1TEGA 3GXUB 4BDVB 1B3IA 2Y69B 1AZBA 1NDTA 1WA2X 1W8EA 1AOZA 2GC4C 1MDAA 5I5JA 1GY1A 1IC0A 1PNDA 1VLXA 1KDJA 3BQVA 3NP3A 2EILB 4JHVA 2HLEB 2CBPA 1MZYA 4GXFA 1JXDA 1OCZB 3ASNB 2UXVA 1WAEA 2PPAA 3S8FB 3ERXA 1QNIA 4Q89A 1A4AA 3FSVA 4HCGA 1SF5A 3X1BA 1ASQA 5I28A 1HFUA 4TXVB 3V9EA 2YAHA 3OD3A 3QPKA 5B1JA 1RCYA 4RH4A 4GP8B 2JXMA 2GI0A 4G7QB 4DP1X 4YSDA 4HCFA 1OE1A 2DWSA 4KOCA 1J9QA 4W1TA 1JXGA 3H4FA 1GY2A 2GBAA 3CVCA 3L45A 2IH8A 5EHFA 5I6PA 2VM3A 3ABMB 3QJQB 1YLBB 2IAAC 1JVOA 1JERA 2J5WA 2ZXWB 3NYKA 2WO2B 2FWLB 1SFHA 1TU2A 4HALA 1DYZA 4BXSV 1J9RA 4CSZA 2X88A 2HX8A 4G7RB 1X9RA 2FT8A 3TBCA 2HX9A 1WA1X 1GS7A 4YSSA 2EIKB 2YAQA 5B3SB 1E30A 4A2EA 4F7KA 3S8GB 3NJFA 4FAAB 1ETJA 2DV6A 4DP9X 3WI9A 1TEFA 1AG0A 2XXFA 3AW5A 2XXGA 4YSQA 2DYSB 1PF3A 2IDTA 2FQGA 3OMNB 4BWUA 3FU7A 1V54B 1OE2A 1WS7A 5AFAA 4GP4B 4P5RA 2ZOOA 2R7EA 5I6LA 2VW7A 3FU9A 1J9TA 3NJJA 3WIAA 3ZIYA 3CZUB 3PAUA 3HB3B 3WNIA 1NPJA 2XUWA 1KDIA 1AS6A 1SDDB 3AG4B 5FC9A 4A2FA 4UANA 1GSKA 4DP0X 2FQDA 4QLWA 1AZUA 4JHUA 1JZEA 2GC7C 4E9VA 2EINB 3TA4D 2QPEB 1ID2A 1AZNA 2OCCB 2YAOA 3NSYA 5AKRA 4E9TA 4E9QA 3H56A 1E5ZA 1BQ5A 1ET8A 1QLEB 2HRHA 1PY0A 2A3TA 1BEXA 3QJVB 2ZONA 4E9XA 1J5CA 1X9UA 1JZFA 1KCBA 3OMIB 3JTBA 4CSPA 1AR1B 2QPDB 1M9WA 4G7SB 1GR7A 2H5UA 1AZCA 2VMJA 4DPBX 2Y1AA 1NWPA 5I6NA 3ZBMA 2Q5BA 2YAPA 4HIPA 4DPAX 2PCFA
chains in the Genus database with same CATH superfamily
2GAZB 1G7LB 5CJOL 1JPSH 3RDJA 4EI6B 2GIMA 1FN4A 4ZW5A 3IMRA 3LDEA 5E9DE 2B1GA 3ABMC 4C4UA 4G80B 4ISVB 1E5BA 5E2UH 3WJMA 2D7NA 1EAPA 4XAWH 3FT2A 5JHAA 1E3ZA 5IMLB 1FC1A 2YGNA 1E9QB 3F8UB 1YQVL 3OKLB 5E08L 4NQSA 1Q5OA 4LBEA 3ARBB 3P4OB 3S98A 2R1YA 2WSSG 4MMXB 2Q9LA 5GTIZ 2HN7B 2XZQL 1KB5B 1JNJA 2OXGA 2OIEA 2DQFA 3DX6A 3OL2A 4Y2DB 5DLMH 5LAPA 1RI8A 3F7YB 3MV01 1LNUA 4JJHA 3H9SA 4YH6A 3GUFA 2XQBH 1PNLA 5EDSA 5ITZB 3BVNA 3BWSA 4LCWD 4EI5D 1KMIZ 2FYUH 2ZXCA 1X5GA 1N0JA 4IMKC 2FL4A 1UD8A 5TGBA 3VFWB 2UUAO 3ZHSA 2EDEA 5J13B 4NWUH 4QXTA 1RZ7L 2OSXA 1VJSA 1T1XA 4QOKA 3WY3A 1GGCH 1TJXA 4ANUA 4NQQA 1HL8A 1L9OA 4XZUA 4UAOB 2GEEA 4RFNB 1ZLWH 1EZSA 4FQXA 4M9PA 2OTPA 4U3SA 3DVIA 1DQDL 5C9JA 1VQLV 3MJ8A 2X1XR 1YDXA 1FHGA 2OWOA 3ZX1A 1F51A 5DDHA 4FE9A 3K5OA 4CGUB 2EXWC 4TNEA 5EIIA 1X7SA 1WCQA 3T6XA 5HYSA 3I55V 2FWSA 4N1CA 2IOMA 2ZXGA 3C8KB 3EYSL 3NEEA 2B14A 3F6IA 2FJHB 4JHWH 4B53A 4BK8A 1GC1H 1VGKB 4N2EA 4DAGL 3IF1A 4L9LA 2XNDG 1HNFA 2SODB 4NNXB 1IT9L 1JNLH 4ZUTA 3KPLA 1N19A 4DV5O 1KV7A 5C09D 3ZRWB 5CEYA 3LXCA 3FD9A 3BHBA 4PAZA 4ZMQA 3ROOB 4TQFA 3BIAX 3QK0A 1FG2B 3RTQC 3GSNB 5F89B 3SIKA 1RIUL 3QVNA 2RB8A 4YOKA 1C16A 2QLYA 1SOQA 1GMIA 3K04A 4OLXL 2WO4A 3UL4A 3DSQA 1NBVH 5IF0A 3EZ8A 2E9IA 4MWFB 3C6LC 3MI6A 4TVUA 4E2LA 5KN5B 1H3UA 5DK3A 4RVBA 2XHBA 3L8QA 3DXAE 5DYOA 1KTDA 3GJFK 4OVUA 3WELA 2BDNL 7FABH 1MLBA 1SVZA 4QXUH 3CDGA 3TIDA 4MMZA 2WWMC 3T1WA 4NENA 4YO0B 4NXMO 2X4TA 3P40A 4MNGB 4X9GA 3SZ6A 3T1FB 5FO8B 2XXCB 3FQTA 1N18A 5KHGA 4TSFG 3OAYH 4MA7H 1N8RW 1KJVB 4Q20A 3FQ4A 1SXSA 2J55A 1KZQA 3FUNA 4IQHA 1D5RA 3UIYA 3V5KA 3J80N 1Z6JT 2CGRH 1WBYB 3MRIA 3HN5A 3ZUCA 2IH1A 1HL9A 1SEBB 1Q43A 4JKPH 5LN4A 4K3EH 4OM1H 3KLHD 1MVFA 1UM5H 3CC4V 1ZT4B 2NMSA 2WWKT 4WI7A 2GBTA 4KZEL 2DDQL 3MJ7A 4HZAA 4QRRB 1OP5K 3NFSH 2EUWA 2NRDA 2A0LA 4GAYA 3VD2A 3PGDA 3MTRA 1OCRB 2JJTA 2B9ZA 3CD6V 1RPQA 4GEIA 1FLRH 3OAZK 4GSQA 5C0BD 1TMQA 5B38G 3QDJA 4FQHA 4RX4A 4UIKH 2XZAH 5CLXA 2JJ2G 2WYZA 4XPFL 4P9PA 2NZIA 3TETA 2NW2A 1ZY9A 4IMLB 2BOBC 4X8AA 1K4DB 3SDYH 3Q8BA 2UYLA 4ICXA 4JTCB 1DJZA 3U46B 1MXDA 5E23A 3PUCA 4HT1L 4X1IA 1B0RA 3QNYB 5D7IE 1OKEA 5AZEH 3JT2A 2OMVA 2HTLD 3QUYB 2X41A 1J1PL 5FM5O 5AW0B 5I0XA 5L7XH 3ZT5A 4TUOA 2A74C 3A4AA 5E6IA 1ODAA 3GXNA 3U6RA 4JANA 3UC2A 3W37A 2EO1A 4OCXH 3L3OC 1R4XA 4UTBL 5INDA 3HRZA 2BVTA 4ZK8A 1JRHL 4GKJO 3QCTH 4XPAL 3BH9A 5T5NF 4WTZA 1HEHC 4NQVB 3RB5A 1XDCA 1NQTA 5GGRY 3VXPA 2UZXB 1P5UB 1JA8A 1HIML 1MHHB 1XEQA 3EF4A 4UV4H 4MJHA 1ESOA 1E6OL 1W9XA 3L16A 4N22A 3ZQ9A 4L4VB 1A4JB 2D7MA 3EXAA 5CD3B 1O5DT 4MHHI 4UIMB 4F37K 5AZ2L 1UD3A 4IIJB 1UQSB 2YGOA 1G7PA 2PPCA 1S3RA 1UA3A 1WH0A 3S3BB 2UXDO 2IPKB 3MV11 1MCFA 2DQDL 2C7UB 3O4OC 2WIIB 4R7VA 4PD4J 3L2MA 2P5WE 3NJHA 3P2TA 4PLOB 4GAGH 5BRZA 1KN2L 3CFJA 4DP7X 5CZVL 4E2OA 5I1IH 3GK8L 2GDSA 3AMKA 2P80A 5T1DH 4OZHF 4BKLB 4JFHD 3FCTB 4KXDA 3MFFA 3RYIA 5I1DA 4OF3A 1ZL8A 4DIXA 3UC0H 2EEAA 5DD6B 4QRPB 3QH3B 4NO2A 3MUJA 1KYAA 4OJDH 5D72H 4ONGH 2YQ2A 2RCSH 3JALB 4DERA 4DCQB 4P46D 4G2KA 2ZSVB 4JRYA 4Z0XB 3NMEA 3QDGA 4CGTA 3U0WL 3EH5B 3QI9C 4FL4B 4F8OA 2FEJA 3A5VA 1MIEL 1TVDA 5I19L 1LMIA 1QO3B 4ESKA 2O5XH 3O9WB 4GRLB 2DQHL 4JTAB 1VEWA 3VD5A 1JHTA 4O02A 3HS0C 4QYAA 1AJQA 5G4MA 3RU8L 5EZJA 4D8PB 5DO2D 1JVKA 2OTWA 2XICA 2MEJB 4LF5B 3NABH 2P42B 3QJUB 5CWSA 4PJ7B 1KIRA 3G08A 2A06H 3W39B 4N28A 3HUJA 3VXNB 3MXWH 3ZE2B 1QACA 3H53A 1NC4B 2CDEB 4B27A 3ESOA 4S0TD 4R50A 2Q8BL 1ES0B 4JI5O 3QHTC 4P4KB 3O4LD 4ZS6C 3HRZC 4OCWL 5EUOF 2CMRH 4UUJB 5BOPA 3V0HA 1RY7B 2YGPA 4GNKB 3K71B 3BGMB 5LGUA 1TJIL 5HHVL 3HE6B 3D52A 3T5WA 4G8GA 1QBLH 3ARYA 3BVXA 3RWJA 3P54A 2X42A 1MZFA 4NR1A 4PB0H 3WU2Z 1QFWL 3QFJA 3OR6A 3T4DA 1J5EO 2NY7H 4KRPB 5EC1B 2H45A 3MRJB 4KRMB 4L23A 4J4PA 1ZIBA 3CXHJ 4WFHA 4JKWA 1IM9D 1JFFA 4JFQB 3OKOA 3JARB 4A2LA 2WQSA 5SX4I 4RWYL 4U1SB 3CSFA 4I85A 4Z3GA 3EJPA 3OMAB 5L3FA 3CRRA 1QR4A 5EORH 5JW4M 5TQ2L 2GSIB 4OIIL 1OPGL 4B3RB 1E7VA 2BWQA 2YKLL 1THCA 3GEFA 3DHMA 4F80A 2QEJA 3UABA 2PP8A 4M1CC 3D8MA 4FFVD 2UXGA 1ZLWK 5LQBH 1P2CB 3MRRB 2DD8H 2B3IA 1LK3L 3FK3A 3GKWL 4WI4A 3RB7A 1I3VA 4HU8A 4MXVF 2XWTB 4XX5A 5EK0A 3F05A 3EUDA 3V95A 2EE0A 4ALAH 5E70A 1QI4A 3REWA 4EAEA 1YUHB 3GJEA 1GZHC 1J9CT 2OFQA 4HV8A 1H5BB 1WLEA 3QG7L 4LFCO 2Q0OC 1DQMH 2IMNA 4BW9A 2MCPH 1L6XA 3DRTB 1H2LA 3BWAA 4YEFA 1UUSA 5DK2B 1J05A 3HPLA 4NO5A 4HUVB 3QQ9D 1REIA 1N6VA 5FB8B 5LGKA 1FFOA 4JFOB 4LPVA 4R4ND 4FN0A 4ERSH 1BBJA 4QHNA 4V1DE 2V5YA 4MAUH 5JXAL 2V5TA 2ZQKA 4TSBH 5CP3H 2Z4QA 2Q0ZX 2QQQA 2Z7ZA 1TZIB 2BNQE 3MRQB 3VFPA 3ZE0F 1CLVA 5KVEH 1MFMA 3CUPB 3KXFB 1MLCB 3VXMA 4MB4A 2VDOL 2BMKA 3F83A 4UU9A 5FW8A 2ZM6B 2VR6A 1TVKA 2IU0A 1UA6L 2YRBA 3KLLA 1ITCA 1NH2D 3VX0A 4OIBA 3ULVE 1CIDA 4FNPA 1IFHH 4XCNA 3TXAA 4S11A 5E1HB 5EBLB 1ND0A 3I50L 1S77D 2I9TA 2J6WA 3F58L 1U8PB 2W0FB 3S37X 1MABG 2ZP9A 3AU0A 3R06A 5CFHA 3DC6A 3OAYK 1DFBH 1FNEA 2FX9H 3PABA 1OALA 3C2AH 1YTFD 1WEJL 3PQYB 4I0PA 4PJGA 1PZ5B 1WJ3A 4ZMVA 2LVCA 1RU9L 4PJCF 4TNVK 2KLRA 1N2RB 3DSNA 1SF9A 5AB0A 5E5UB 5IMKB 1CF8L 1EZUA 5E8PA 3B1UA 5LXGH 1JERA 4FQQA 2C3XA 4NQED 1NCDH 2VDMB 5GXBB 1GZPA 4QNHB 3SGJC 1GA2A 3ARED 3DPBA 3VI3A 5C0GB 3L73H 1I8UA 4XPGH 4QPKA 3IGFA 4E41A 3O2DH 4JPKL 2AJXH 4OM0L 4UV9A 3ETTA 4RLDA 2QEXV 2JKIS 5I2IA 1ACXA 4M8QA 1CMOA 2NNUA 2DTML 2YHGA 2J2ZB 4KKQA 4HG4J 2CIIA 3KNBB 4E9LA 3GT6A 2VABA 4X1KB 1XSKA 3VQYA 5D1QA 3ASOC 2NOYA 2VDKL 5AAWA 4IBWA 4NC1E 3BUPA 1HXMA 2F7RA 4U1NA 1D7FA 4MJ4A 3LHPL 2H1PH 2FJFA 1U3HD 1XD1A 4MJ5A 4DO2A 4PRPA 2CNYA 2DLTA 1U42A 3OZKA 4BWUA 5BR8B 1ORQB 2QKCA 4TWKA 2XRAL 4P5RA 5E2WL 1K92A 4IDLA 4X5QA 5L8JB 1R3KC 4Z6AT 2I25N 1J9TA 4U3JA 3L4XA 4XNUL 3SEPA 1PKQB 3CCEV 2X2HA 4LSSH 3PHQB 1KPUB 4B08A 4ZKIA 2XJLA 4NZTH 3T2QA 4ZBJA 3U7YL 1M7UA 3OHXA 1IZ3A 3D3VA 4LSUL 4P9HL 4Y4HA 5C0CE 4LHQB 3UTQB 3EFFK 3EOAB 4GSDH 3Q6GL 3OGIB 1NUGA 3MRKB 2WVUA 3QIUB 1NCOA 1IIIA 4XC3L 1LTXA 1JZEA 3DROB 2CLVB 1FPTH 1HTYA 3B9KB 1E4XI 3QG6A 3MV9A 1RPRA 1ETZB 1TXKA 2RIKA 1JV2B 4OIAA 1GGYA 4MAYA 4E9TA 3FRUB 2AXGA 3A24A 4HS8L 4CVWA 1SDAB 2XG4A 3IS1X 4H26A 3E7JA 4Z7AA 1IXMA 2JJUA 4XNZB 4O5LH 1J1OH 5LGJA 2J6EH 3P11H 3AC0A 1FL5B 4NP9A 4O2BA 3H9HA 4LBAA 1OZTG 5BQ7B 4NNPL 3T1HB 4X89A 3MODL 1CLCA 2ATPA 1GXEA 1QSFA 5SWSD 1SMOA 5HI3C 3N2GB 5KYUB 3EYFA 5F1NA 2WBJA 1J18A 2VMJA 1GC1C 4JM2B 3QXVA 5HYJB 3PWPB 2Z92A 4HFWA 2HFFA 4TPRH 2Y4UA 4HFUH 4Z7WE 3INOA 3JV5A 3FUDA 5E5RB 4DVBB 1NCHA 4GBXC 3P3PA 1MJJB 1KCSH 2YBRA 4TTDC 4LSTL 2E7LA 1KF9B 2QPUA 3QUZA 4ZOAA 4ZHQB 3B8YA 3KEDA 4ZOCA 1ZHNA 1JNNL 4K7FB 2CGYA 5D4HA 3MLSL 3FQ2A 3DTXA 4E5XB 3WO4C 1E5YA 2SEBA 3GXDA 5LG1A 5AAWC 4XXCC 3EFFA 4Y8AA 2WQRA 1J5HA 3R8QA 5HHOE 3WN5C 2IQ9L 4KKBC 3LPOA 1B6DA 5SX5H 2KMWA 5AOLA 3BKMH 1AXTH 5GTHZ 3HR6A 2B4CL 5GHWH 1CD8A 1BD2E 3X1EA 4K3AA 5C08B 3S5LG 2YXHA 1NIEA 1B88A 5GZNA 1ZA6B 3TN0A 3GWOA 3NSXA 4AX3A 2ZAGA 4L8BA 5T3ZH 5KANI 3QDMA 1BYPA 4F91B 2XIBA 2FR4A 2VLJD 4IRZL 4L0PB 5FW7A 3V6ZA 1V5JA 1ZXKA 2VLKE 4OD1L 5BW7A 3TPKA 3SCMB 3C6EA 5I8OH 2OJ1A 4UM9B 2Z8SA 4ODSL 4FFBB 3MYJB 1H38A 3UYPB 1C5DB 1XMQB 3QR1A 3QUKB 1XF2A 1VFBA 4HJUA 2IFFL 2IDFA 3IJ9A 1JK9A 1E9PB 4MAYC 4R4BA 3VX1A 1PZ3A 2YRZA 1IAOB 2F4VO 2C9AA 5DVNA 4AZ8A 4R96B 3QC5X 5TF1L 3FB7A 4G3YL 2N4IA 5EIBD 2AK4E 5CBAB 3NJVA 2GUOA 2DOSA 4LP5A 5CA1B 3MA7B 3UG5A 1QPPA 2XWZA 2PF4E 5DFWH 4OF7A 4Z9KB 4F27A 3KJ4C 3UTPD 5IQLA 5EPMA 5EOCJ 4YJ3A 1I7UB 2DTSA 5I1KL 4LKXA 5LMUO 2WBJC 1E0OB 2X0VA 3MLVL 1W72H 5J0BA 1PLCA 2CHZA 2IJ0C 5F7DA 3X12B 3NSDA 2CALA 2CSPA 4MXQD 5D70L 3GUTB 4P2QD 3ZN1A 1ZLZA 1TZHA 2VLME 4LC1A 1OE3A 2BIHA 2ZIMA 1T66D 2E7LC 3QUZC 1A8ZA 2K3HA 4Z7QB 3KYOA 3V0VA 1F45A 2HJKA 3H9ZA 3KBHE 3FQUA 3MRLB 5J5EA 5KSBA 3LQAC 4L29B 4OV5B 2XUMA 1XILA 5IJKA 1QHPA 3WFEL 1KTLB 2KZ1B 2IWKA 5LGNA 3QXAA 3X3GH 1NIFA 1ZIAA 4I3SH 3SE8L 3KM1A 1CJYA 3DHUA 1NAMB 5D1ZI 1T5WA 3LS5H 5J4MA 3K81A 3E22B 4XN9A 4H25A 4OZIE 4M03A 4PGBB 3T0EB 1P4LB 1GHFH 4BWTA 1QWNA 3D0VB 4ZQTA 4QLRA 1DLFH 3VI4A 1I8LC 2VZUA 3KYKH 4AIOA 3BH8A 3P77A 4MD0A 7PCYA 1ICTA 2WLLB 2EE9A 1SYVB 1ZGLB 1VQ5V 5I66A 4R3SA 4GMTL 1NBZB 4XNYL 4HC1L 2L8AA 4FFZA 1T80A 4JDVB 2B1HL 3HKFA 2BSDA 2IAND 3RBGA 3LSOA 1WZ1H 4RGNC 3ARBC 2NY4C 2XG5B 1NDGA 4JG5A 4Y2DC 1AHWA 4NHUA 4YHZH 4GYBA 3UGEA 4PJIA 4GW5B 4UINL 4W9DC 1MJ7L 5GQBA 5AVSB 3V0WH 4MA1B 1KCUH 1XIWB 2ZE6A 5H2BB 4F2ME 2R23B 3POHA 4HJGB 3FB7C 4XVSL 5AW9B 5ISZD 5JMOC 2XKSA 4JO2L 5J13C 3T4ZA 1HHJB 1TCRB 2NUPB 1DGSA 1H3TA 1Y6NR 1CDGA 2EIJC 4B3MO 2C3VA 3TA3D 3CVHH 4L5FE 4UAOC 1TTGA 5CCJA 2D0HA 4WRLA 1CWVA 1ACYL 4NKIL 3GI9H 3OLGA 3M1BB 1XHXA 3VGGA 4DKAA 1YF2A 3HAEH 3GQFA 3RTQD 4KU1A 4PY8I 3L5WA 4UYPA 4YDVB 5AW6B 4A7TA 1GPOH 3KPSA 5KAQG 1K2DB 2ENQA 5IJCC 4O2EA 2EDQA 2OP4L 3OXSB 3PP4L 4A7QA 5SWZE 4RUFA 4X6DB 5BS0B 5CP3A 4ZAKD 1XZ0A 3DO3A 4LCVA 5DJ8B 2IGTA 5C0AB 1S78C 4UDTB 2M7WA 1QW9A 2WWMD 2ITDA 2XX0A 4ZW6A 1WCBA 2FD6H 4M5ZL 1JGDA 3VG0H 3BYYA 2EIEA 4XBEL 3TNNB 1O7DC 1F23A 4QHMA 4KK5D 3JCZA 1H6TA 1S7VA 1JPFB 4MRCA 4D7TA 5TF0A 4FQIH 4MQ7B 2Q7HA 2FO4A 4K9JA 5F7AA 5I71B 4FC3E 4S1RH 4TNGA 3CBKB 1JR9A 1CFMA 3G6BA 2WLHA 1MH5B 2HVKC 3BKYL 4ODXB 1PLGL 1GKFA 3FX7A 2O72A 3E1F1 5F2VO 1E4WL 4BZ2L 3U1SL 3RN4A 2ZCHL 3CIQA 5CZKA 5EZPA 2PTTA 5JIMA 1O9WA 5L9DH 4XRCB 1ZUQA 4PWKA 3B9AA 4Z7NE 3EO0A 3F84A 1DHKA 3TBWB 4HWZB 3QJZA 3RE0A 3EOBB 1H8NA 1XBRA 1LE9B 2WNKA 3HJ0A 5TQ0H 1L7IL 2FH6A 4Q2ZB 4X5PA 4XCYA 2IGFH 2VDRL 2EULA 3O2DA 1NVPD 5LAXB 4HUCA 3STZA 4MSWB 1CFTA 3VB8A 2QWNB 2BHFA 1H2MA 3EHBC 3QZPA 4ALAC 2NDGA 5IQ9A 1I9IH 3ESNA 3T8VA 4YDIH 2B3RA 5IBLC 1OCRC 3AG2B 5F9WB 2ZCEA 3QNEA 1EJOH 3CC5A 1AQMA 3EFOA 3N41F 3TH3T 3ULVF 3QEQD 5HXMA 2EUXA 2GJ6B 1PAZA 5I6XC 5EIVA 2ICWI 3EDDA 3MLWH 1K4DC 2DYRB 1X6LA 2BRRL 3MLTA 4WU7A 3RWDA 2NY5C 3OR7B 2F19L 4TLSA 4RDQG 4DV0B 3KPRA 1PW3A 3ILQC 4FXGA 4GAJL 4F58H 1MCJA 4A1RA 4F8PA 1JPTH 1B4JH 4EIZC 2HJFB 4NPYA 1JDCA 3QUYC 1MFBH 1SXNA 3RFRA 2A1WL 3CNKA 5DK0B 2G0KA 3L9EA 4JRXB 2Z7UA 5SX5K 2DJMA 4CSTA 2JB5H 5TDNA 1WN7A 4N2NA 1FN4B 1FYHB 3CZNA 3K0WA 1I4FA 5ICZB 1CFQB 3BD3A 1PD6A 3B2PA 4XMKL 3TJHD 1T03H 3FB6A 1EAPB 1URIA 3QISA 3ATEA 2LFEA 2W9LA 1IAKA 2WOYA 2A79B 2BIPA 5EU6A 2J6EA 3U83A 5I8KH 1QPXA 1P5UC 4PW3A 3ASNC 1ZLVK 2ZT9C 1SQGA 4NQSB 4PQXA 1FFRA 1SBSH 4N5ED 5DZVA 5KVGL 3FTVA 1TQSA 4KDVA 4KMTH 3EBGA 4O2AB 4NUGL 5A9GA 1D7BA 4YL9A 3ILPA 5BXFA 3QDHA 4Y4KD 5LHGA 3FQXB 5D2LA 4NZRH 3W9DB 4G8IA 4LEXH 3BVNB 3ZS8C 5BCAA 3VFTA 4DQAA 1TUBA 3F7QA 4PJXA 5TGBB 4X66B 4K15A 3QI9D 4AQ8A 5L8LB 1XAKA 3HBQA 3RWEA 1JHKL 4QOKB 1OJHA 1G1CA 4AXWA 3LH2H 4HPYL 4OD3L 4ODUA 4O4LA 2IBZY 3H9VA 4WEUD 4WLCA 2EDKA 3F01A 3MYZA 4PJDE 3CZJA 2JMRA 3OJMB 3MJ8B 4HXAH 4KXZH 3BRGC 2XBDA 4OBSA 1RFYA 1GCFA 2HUEA 1BEYH 5EIIB 2E76B 3LVTA 4LNUA 4ZBMA 4FL4C 2PNDA 1PBYA 3ILDA 1O6SB 4DK0A 1QNIA 2WWOA 3SSGA 2DM2A 3AITA 3MUY1 3QPXL 4Q89A 2MCG1 3IF1B 1OAKL 3ZY7A 5KVDL 2WXKA 4X62O 2PCPB 3H42H 3MREA 4FXGC 3GBMH 1P7QD 4LPTA 4ZUTB 5CEYB 5HVHB 5HGAB 3BHBB 3KCPA 2AVGA 2R69H 3U79A 3CX2A 3IFLH 4FFWC 1C16B 5DQDH 4ZNEE 2X89A 1OF2A 2VCOA 4PBVC 4AYMC 2F54D 4GKLA 5GRJH 2ZOLA 1PV0A 1T20B 4LEEA 1U21A 1MPAH 1U8OA 1RK0B 5EHFA 1D5IL 5H2FZ 1SN0A 4NZUH 2B20A 2NXZD 4Z7WF 5T5FL 5JW4N 1DE4B 1I8MA 2GEQA 3F62A 3D39D 1MLBB 3BO8A 3TIDB 4UUJC 3ATFA 4MMZB 2AZ2A 3P3NA 2WN2A 5IHWA 2Q2EB 1NCCH 2X4TB 3VNZA 3G6JF 2K8MA 3M7OA 4XP1L 1OZUA 1TNNA 3K6SB 3HE6C 2ETWA 3FQTB 1CFVL 4BQ9A 5I0VA 4RIRA 1SQXH 5E4AA 4BIUA 3MAQA 3L4ZA 3KWXA 4ZI7A 1W72A 2WZPD 4GAAA 3V5KB 5TE6L 1TJMA 3GBLA 4UMSA 3WHE0 2FT8A 4ZOLA 2P44B 2J8HA 3TURA 2GTAA 1Z5LB 2H0FA 4WO4B 2YAQA 1MF2L 2XTJB 4IBYA 3S34L 3VWKC 4DGVH 1PYWB 4L8SB 5AOZA 3MJ7B 1RUKL 4IKIA 2L6LA 4N6RB 1KMGA 4DTGL 4MQTB 1F58L 4DK3A 4GKOA 3OMNB 1YEEL 3QQDA 4U0RB 3IDJA 4BHUA 3CJHA 3RZCD 1LD9B 4LEBA 2V7NA 1JFQL 3FTSA 4JM4L 4X6CA 4Y7OC 4WHCA 5JVDB 5E56A 1T5XB 4HXBL 3TO4B 3AJ7A 4F7EA 2BH0A 2F5AH 1AS6A 4J7RA 1OQOA 4B9IA 3FBKA 1A7OL 4CMMA 4KJYA 2FUQA 4IKJA 4XCFL 2ENPA 1NFDF 1B0RB 4GAFB 1SN2A 5GRUL 1B0WA 3RVZA 3HNTL 1DBAH 3O11A 2OMVB 3I9IA 4BA8A 4ABMA 1KEML 3DUHA 4O4HA 4XODA 2P49B 3MGTB 1US6A 2O93L 3DJRA 4TUOB 4CN4A 4GRWH 2B5UA 1BZ7A 1ET8A 1J8HD 2VM9A 2QWOB 3LKOA 4LGPB 4WFED 5E6IB 5T1LA 4U7NA 1JGLL 4JANB 2HRHA 4CBZA 4PI0A 4XMLL 2UWEA 3U7AA 1VEPA 1NSNL 2E6PA 4Q4IA 2YSTA 3CN2A 5INDB 2CGNA 1HXYA 2ZKHL 5C6PB 1DBML 2VE6B 1U33A 4OUUB 4U49A 4O4IB 3VBBA 3BH9B 3KDMA 3TP4A 4G7SB 5K69A 2QQNH 4K7PH 3VXPB 1SJEA 2H5UA 3KS0H 2APWA 4DPBX 3CVHA 4X1YA 2I60H 3DURB 2QMJA 1MJ8L 4IHBA 5AWNH 3D85B 1KJMA 2BSSA 2PCFA 5EEVA 5EV7A 4B60A 1GGIL 35C8H 3SE3A 2FB4L 5IKCA 1UM4L 3HAEA 1AR5A 3HN3A 3KPQA 4MYWB 1AGBB 4ZFGL 2Q7EA 1TUEB 5HHMD 3QQ3B 5JHDE 3WHXA 2E75B 4MA3B 5KANG 4OZIF 1IBKO 2W0KA 4XHJD 4G43B 2X44D 5DUML 5KYWA 3MGOA 5BRZB 1E1RG 1NEUA 2A5UA 1W15A 1YDPA 2KG7A 3GRWL 3GSUB 1S46A 3RYIB 3MFFB 4DW1A 1GAXA 4Z1PA 5I1DB 2J44A 1M4KA 3ZRFC 4NO2B 4EF3A 2C34A 4L48A 2JDIG 4U1IA 3ZRSA 4KJPD 5JYLA 3O6LL 4MVBC 5DZOA 3EJJX 1AE6H 4JFDE 1TKWA 2WWKO 2IH3A 2QSTA 1Q90A 2HYMA 3QQXA 2XOTA 4QE7A 2HUHA 5EYPB 3NJMA 1NLDL 4P2OA 2CRMA 4LLVA 12E8L 4LARL 3TPUA 4UOW0 2ZX5A 4WW2A 3ARDD 4KK9C 5EOTB 3PWUB 1HAUA 4DP2X 2AKRB 4LQFH 4PSRA 1H0DB 4W9IC 3D08A 3RNQB 3LZOA 2F1MA 4NQDB 4O02B 1INEH 4DYLA 4JGJA 1N3NA 1VF6A 1N33B 4PJHA 3NJIA 1MCWW 2BS71 4RWUA 1KPVA 3MACL 4NAJA 3QZWA 3VGHA 2OTWB 3QARA 1XNRO 5CWSB 4BCZA 3T77B 1OV8A 1KTRL 3IB4A 4N0CC 3HUJB 4K23L 4LLYB 1A3RL 5T33L 3BA9A 1C8QA 4I9XA 4ODVL 3VG9C 4BZ1L 2BOCC 4DV2O 3PL6A 3FO2B 4UQEA 3LEXA 1VQPV 1T0MA 1UM6H 1IAIL 1EHNA 2V0AA 4KY2A 1ZLEA 3GRGA 4OVVA 3G7TA 5HI3D 4PRID 4FA6A 4BFIA 5FR3A 3WGVB 2AVFA 4ELMB 3RWJB 4XBPA 1X4YA 5BRPA 1IQDA 3HMWL 3QFJB 4XNZC 3SE3C 3BP6A 5D7LB 5AW8B 5JOFB 1H15A 1ZTXH 4JI7O 4ZZKA 2PO6A 4J28A 2DWXA 3UTTB 3MR9B 1JFFB 1CUOA 3BW9A 3LDBB 3L08A 5EBWC 4BK4A 3OKOB 2Y24A 1C5BL 1CL7H 4J11A 3RLSA 4M3KB 5TDPA 4FNLH 5F96L 4QNPE 3BSGA 3DK0A 4NM4L 2ZP0T 5D1XA 1SMDA 1LP9B 2IXQA 1KCLA 2Y0PA 1OGAD 4X4XA 3DV4A 3T3PE 5FPIA 5JLZA 1XWVA 2NY3D 3IFOA 4LCCA 5IQ7L 3BMVA 4W4KA 4JG9A 2DYPA 4W4LA 3LEVH 2DQTL 5LGHH 2Z0AA 1JGIA 1XGQB 3SGIA 4JI8B 3GSRA 3X13B 3WD5L 5F8RC 1H8HG 4NWTH 1JZ6A 2GW5A 3GJEB 2OR9L 1MCOH 2G3NA 2BM3A 3PU7A 4I55A 1JHLL 4HEPG 4HV8B 1TZGH 3HC4L 3JWNH 3DJ9A 1F4XH 1A6AB 4I5BA 4I9WA 4LPYA 4XTRD 3D69A 4OI9A 4UV7L 4FYSA 5DLLA 4EN3C 2A77L 4JPQA 2LLGA 5DA4A 3BWAB 2BFGA 1EEUA 3HPLB 2FJGA 3LNGA 1UWEH 1XFPA 2C5DC 4YVUA 4RRPG 3ZQXA 2VJ0A 5G4NA 3HW7A 3AS2A 4CH3A 1I3RA 1L9TA 4JY5L 1ZHBA 3O6FA 1G6RL 4LAJH 4QGYA 1QR1A 5IWAO 5E4IA 3TEXA 1G6UA 4YVNA 4XPTH 5LLIC 4HNAA 3RYMA 3D3QA 2CCWA 3C90A 4W9HC 2DLFH 3GO1H 1VFUA 4UU9B 2YD6A 1GJIA 1F4WH 3P2BA 4D8OA 1GJWA 5I17A 1FDLL 3E38A 3HG1A 3PL6C 4PJ8A 5CINL 4LAQL 1R5VB 1UASA 3J27A 4XCNB 3GZPA 2YOCA 1IAII 2TAAA 3CVIH 4ZO9A 1ND0B 5K1PA 2G3MA 1UD5A 2I9TB 1V3JA 2ZX6A 4AQ1B 3R06B 1N5AA 2HG5C 1EHLL 4WFAV 1NGWB 1Y7VA 3E3QC 3O2WL 3OV6A 3PABB 1OSZA 2X7LA 3QHZH 4Y16B 5EBMB 1U6AH 4X20B 2AFNA 4I0PB 4XI5C 1FFNB 2YRLA 4AITA 4QCIA 5HDBF 3DSNB 4FADA 3F2LA 2J1KA 3T1CA 2BSBA 2CO6A 2R4SL 4KC3B 4Z18A 3EBHA 4FQQB 4KROD 3T4YA 1PQZA 4HGWA 3OQRA 1XSIA 4CADB 2DQJL 4N0UA 1UB5B 3TL5A 3ZVVA 4JV5O 5DZPA 3ESVF 5FF6A 3VI3B 5IHZA 2XYCA 4MTFA 2JELL 3FU8A 2EKSA 3K72B 5DSCA 2IFGA 4FYTA 4X2UA 1A25A 3SKMA 8CGTA 1T4KA 4B9FA 4PPTA 5DD1L 2Z31D 3TYGL 4HQQL 3MD0A 2UUCO 2R69A 5F0JB 5KOVC 4UOJA 1WAAF 2X1WL 4YN3A 3SDXF 2HRPL 2XKNA 2AAAA 5HJBA 1FIGL 2CIIB 3TV8A 4HKXA 2VABB 3DYOA 4M7JH 1VKXA 3NFNA 5IJ0A 4JM0A 3QWQB 1Y1DA 4LSRH 1BXVA 4U1NB 3FCBA 4POUB 3QCVL 4FQCL 1C7SA 3N44F 3VO0A 3L1GA 4Z23A 4U3XA 3Q0HA 5DS8B 3DYPA 1OV9A 1TJHL 3ZHFA 3UAJC 3ARBD 1Q0YH 1OP9A 1JOYA 5EO0A 3CFTA 4EB6B 1RZPA 1CLOL 2B1OA 5MI0B 5KHIA 3BVWA 4L4TA 5AW3B 4U3JB 2Y1VA 1YECL 2BVPB 1I1AA 4ZDHA 4QR7A 5E99L 1MRDL 4BFBD 1UH4A 1EX0A 1EBPA 1TDQA 2BIIA 3MX0B 4FXKB 4ZUWA 3D87B 1NZ6A 3D3VB 4IIZA 3U30B 4Y4HB 4PJDF 3RL2A 3UPCA 3T2LA 5KS9E 1JJUA 3V4UH 5KUKA 1TTAA 1QW8A 2V5RA 4G82A 4PJ8C 1FA4A 1MCKA 2P1YA 3E80A 1RULH 3B2XA 3MRHA 2YI9A 3QG6B 1ZV9A 4FP8L 3OKKA 4XPHH 4DPRA 3FPYA 5AENA 1NGQL 2APXA 3FS9A 4RFEB 1NZRA 3CRQA 2XVBA 1QFPA 3T2MA 3MCLH 4IL6Z 1WBZB 3GBDA 4MA1C 1Q3EA 4H26B 5AYQA 3NZ8A 3W11C 1MREH 1VHPA 3EFDH 4JFFA 1T0NA 3CFNA 2GK0B 1DQJA 1NDMB 3H9HB 5HY9A 5DZLA 1JN6B 2N74A 2OXHA 4LL1A 1YNTF 1S78D 2ATPB 4JO3L 1QSFB 2GPZA 1KB5L 2XETA 5A2JH 4UCTA 3DX0A 5F1NB 5B7EA 4F33B 1RPOA 4PG9A 4U6VH 4WW1A 2WN3A 1B04A 5MP6L 2WB7A 1KXQA 5D5PA 4WQOA 4YSTA 2FLBT 1IBDA 1RPUA 2VQFO 2PXYA 3V0GA 2EYSB 3DRQA 4DV7O 3H4HA 2LW3A 1BVKA 1ZHNB 1GAFH 3KGUA 1IEBB 1SKVA 3DTXB 5ECJE 2SEBB 3C08H 4DP8X 1MQKH 3OW2U 3UYRH 3FPXA 2VC2H 1FYJA 3B2UC 3HLKA 4PTTB 4YFLI 2KB1A 4FLTA 2IEPA 3MJGX 3QNZA 3CZFA 3EADA 1H2SB 3WMSA 2A9NL 4XH2A 3O2VL 1FGNL 4AW4A 4EQ2A 2YZ1A 2QMKA 3TN0B 3QJTB 4N24A 1BIIB 5D7KE 5IFJB 1S8DA 3QDMB 1HNWO 2FR4B 2NT0A 1CZ8L 3V6ZB 3WTYA 1IAMA 2E74B 1VFAA 5J6HA 1LVEA 4QRRD 1XREA 5CCKH 4BFFA 1XH0A 4AMKH 5L4MA 1F4AA 1TEGA 3GSNL 3V6FA 4WFFE 2E8ZA 3I02B 5IBLD 1SGKA 5AVZB 3WFCH 1CQYA 4PBWD 1S7UA 1U0QA 1XF2B 1VAHA 1B4LA 3K9SA 4R2GB 5HGBB 3TJTA 3BPZA 4IEFA 2OCFD 3RWCA 3VYOA 1JK9B 4R4BB 1CDBA 4RAUA 2RFXB 4XVUC 1O6TA 4UBDD 3B3BA 3QYCA 1E4JA 1TJGH 2NLJA 2OTLV 3GMPA 1I3GL 3X1BA 2WTRB 3ILQD 4FNQA 3E8GA 5EPMB 5D2NA 1CN4A 5JDSA 4YHML 1RCYA 1XCXA 4N2FA 3QUYD 1YEJL 4AUYA 5F7DB 3SE9H 2AW2A 1S7TB 1FBIH 3L7EA 3TWCL 4YR6A 5KX5A 3OAWA 3K8MA 2B0SH 5I73B 1P4BL 3S9DB 4KPHL 1ZE3H 2UXCB 4IIQB 1HSAA 2YO3A 5GRVL 1LO3L 3UJIH 3IDXH 4F6RA 2CLRB 3KYOB 5HP5A 2BNRA 4OZHA 3OR7C 5LA6A 2DBLL 3TCLA 1OXYA 2IH8A 2BS8A 2DMGA 3QWRA 3O3AB 5CA3A 3SDAA 5D6DA 3RUGB 4D9LL 1ZHKA 1WNSA 2FWLB 3QHFL 3VFNA 1TITA 3BFQG 4X6FA 3VXQA 4J23A 3WNNA 4BK5A 4WI9A 3CQFA 3I6KA 1DVYA 1G5AA 1XF5B 2GKIA 3QQ4B 4L4VD 4ZFFA 2YUXA 4H25B 4RDBA 1TVBB 2IMMA 3QRLA 5CEZD 3L54A 4ELKB 2J88H 1FV1B 2ZCKL 4LOEA 1MFAH 3G4SV 1FAKT 3P9MA 4UQAA 4PUBH 3VXSB 4DGUA 4DO6A 4YXHH 4Q74A 2QGNA 4ZMXA 4MD0B 3MBXL 4J27A 3B43A 3PJSK 5J7CC 1Z9SA 2L3BA 5B3SB 4DGYL 4M61B 2JGDA 5I66B 4R3SB 2FX8L 3UO1L 2Q73A 1WBXB 3AU1A 3RIAK 2LV4A 3IJEA 4JBSA 3WFDL 4YSQA 4YX2L 5D6CA 4YUEL 3H0TB 2X4OB 4M8RA 4XP9H 5CXPA 2HTKC 4L3EA 5HVGB 4G6AD 5JPMC 2N7SA 4RZKA 1T7VA 2BK8A 4F93B 1AHWB 4NHUB 5BOJA 3O41B 2YPLB 2DWEB 4PJIB 4XOAA 5CZRA 3RA7L 1QEXA 4D2NA 1IFRA 4JVPA 4TUYB 2PYLA 1KYUA 5IMMA 1CF1A 5FOBA 4ACPA 5IB2A 1A4KA 1ZOXA 5F7EH 1HQ4B 2PWHA 2VQ4A 1DJHA 3P69A 3VU1A 4TTGA 4K0OA 1MCHA 3LJ3A 2C3VB 3BIKA 2VQ1A 3ZIAG 1RVFL 3LIZH 3O9WD 4GRLD 3C5JB 4KX8A 2X05A 1UWGH 1WGVA 3BH4A 4EBQH 5TH2A 5CEZL 5BV7H 4FNTA 5JJJB 3MLRL 3KZ8A 2EX3A 1JWMA 5E6ZA 5TD4A 1AO7A 3STBA 1P1ZA 2FBJH 2X4QA 5EO9B 1AP6A 2W65B 2NPLX 3KPSB 4NTXA 4H1LG 4NJ9H 4JPVH 1DLBA 4GX2A 1NC4D 1NT2B 2DRUA 3QJVB 3EGSB 4P4KD 2D03L 3I5DA 4XP6L 1BMFG 3T0DA 2NCEA 3PJSA 5C8YA 4C57C 1PL4A 5J2TA 4X6EA 5J1AA 5C07E 5C71A 5D6DC 5DHYB 3S37H 3TVMB 2DPKA 1MCQA 4ETQB 3VXRA 3D05A 2FO8A 3MBEB 3NBNA 2WSKA 3HE6D 3U36A 2DQCL 4QHMB 3B7YA 3P9WB 1Q0EA 4TQEH 3RFZA 1M7IB 5JNYA 3WFBH 3MGAA 2RAMA 4AYID 1SA0B 4QNPF 3DA0A 4N2KA 5E00B 3SDDD 1JD7A 4KRPD 1Q38A 1YEFH 3T3PF 4LHUA 3WLBA 3COOA 3IDMB 1MI5B 2KQMA 1QSEA 4Q97A 2BCKA 3FRPA 4MNQA 4UCFA 4Y88A 1H3PL 4PGEB 3T08A 3Q48A 1KB9J 3HLAB 1YMMB 3RGHA 4DWHA 2BY0A 3QUXB 1DLHA 1RJCA 2WXIA 4WUKL 5FWQA 3EO0B 4AGLA 2FWOA 5JZ7C 1MHCB 4QWWC 5EEUA 5E1GA 3N55A 3D4YA 4HSQA 5K1JA 3VFUB 3TESA 2CKBH 2GABA 3UDWC 2QTOA 3Q3GA 3STZB 4WWKC 1BBDH 2DWDB 2PMZA 2KBGA 3PWVA 1K9MW 3FQWB 3MUGA 1Q72L 4JG0H 2HFTA 4WSJA 2ZG1A 2Y5TB 7PAZA 1BJ8A 4U0RC 3BIBX 4P9MH 1Y18B 2O5ZH 4FKHA 4LDCA 2HP8A 1FORH 1AGCA 2ZUWA 3N40P 1RH8A 3QFDA 5E8OB 2YFNA 3F12A 4OZFG 4P5MB 3VGDA 5FDWA 4G1EA 2AZAA 4BH8B 4IBSA 4NVPA 2IAMA 2KS0A 3KXFD 4JFSA 4G70B 5E9DA 3MA9H 2MPAL 4NPKA 2AANA 4ZMYA 4OX9O 2R9HD 3BX7C 3MLTB 1EA9C 3Q13A 2X4RA 3WNJA 4EN2A 2JLPA 3FT3A 3T6ZA 4GS7B 1LUWA 2GY7B 4E36A 2CXKA 4OZGF 3B9EA 4G5ZH 2X2YA 1ZWIA 2Y2YA 1IGML 4HBQA 2VXQH 2QTVA 4Z7VB 1XR9A 1Z5YD 2UX7A 4R8WH 5TDNB 2QVKA 3VH8A 1AC6A 4FRWA 3W1ZA 3QIWA 4JB9H 3MJ9L 3PQYD 1C9SA 5LMNO 6PAZA 1I4FB 2HHHB 4FZ0A 2JB6B 5J06A 1IM3A 5IUCA 2DLGA 2LTQB 5IYZB 3FB6B 3X2QC 2CA3A 5ALCH 2VUYA 5IB3A 2WC7A 4OF0A 2P5EE 4LF3B 4AT6B 2EACA 3RX7A 4DOHE 4WI6A 1D5AA 4BYHA 5GZOA 1DVUA 3G9VA 1CGSH 2JRIA 5GPRA 1D9KA 3DK2A 4HKBA 4M5YH 4P5KA 4Z78A 3B1TA 2YUAA 1IC5L 3GLZA 1G9MC 4MNHB 5EZIL 5MEOA 1XMWA 4LLMA 3QG5A 4Z7IA 4JDZA 4OF5A 4G8IB 4EVNA 2E75C 2P47B 1HCVA 2WNGA 3QO5A 5E8DL 1TUBB 3MLPA 4XX1E 1UD2A 3CPUA 4NCDA 2R8SH 5KVFE 3BPNC 1XAUA 2C3WA 2G38A 1MCSA 2O6PA 3FTZA 3HZVA 1J0YA 1DANT 4ELDA 1RUPL 5B8CB 1A6VH 3WEXA 5ID1A 3BAEH 4CN6A 5HYQA 4NI3A 5B3JF 1JJOA 1WF5A 4KHPB 5KS9F 5GS1B 1IDSA 5I1AA 1I1FB 5D7HA 4MJ6B 2Y23A 3IMSA 4IKKA 5J12C 4AKPA 5BNXD 2VDML 3T0WA 3RYCB 2P8LA 2IAMC 1HOCA 4LNUB 1AI4A 1RMFH 4NT6B 1E5UI 2YD9A 4TSAH 5KSAA 4ZQKA 3DXAA 4OB5H 2QHRL 4IJ3C 2M83A 3OX8A 3QIUD 4AL8C 3NK4A 2YICA 4S0SD 4CVZB 3L9RB 4BUQA 5ANME 4KBPA 1JYVA 1SZNA 2BE3A 3B9KD 4PRHE 3JUYA 3DWTA 2VL5B 1P5VA 2XPZA 1TYRA 4A68A 4DF9A 1MRCH 3OTFA 4JO1H 2NY2B 1KTKE 2VAAA 1ED3A 1HE8A 2J57A 3CFDB 4M7ZB 1M57B 5JR1L 3UTSE 1QTSA 5DWUL 1U8KA 4MS2A 3CRAA 4G9FA 1HZHH 2X12A 2FTAA 2VH5H 2R51A 5C0DA 1GYVA 3BRFA 5L3EA 1ET7A 2BP3A 3BO8B 2KPWA 3UBXG 3WNKA 2ODIA 5B1BB 4X9HA 3MLXH 4E9YA 4YSEA 3M17A 3D25B 4DN3H 4HZ3A 1MDTA 4JM2D 5HYJD 2KH2B 3PWPD 4P04A 3RVYA 2H3NA 4RIRB 4WY7H 2B7DT 2OYKA 2XN9B 1MEXH 1F3DH 1DTOA 1JZIA 4TQIA 3DO7A 5LP6A 1W72B 4NCC1 3Q8FA 1PZSA 4UT9H 1HCYA 3U7WL 5KYXA 3D4ZA 3GGWA 4JCMA 5D71L 5EU5A 1T1YA 4H8WH 2NTSP 3LDBC 3A6CL 4WCYL 3ZUNC 3LB6D 1NKOA 4WJG3 1OAJA 3CBRA 1YY8A 2ADQB 1FH2A 4P2ZA 5BY1A 4S1SH 4I0KA 1JSYA 3DC5A 2HKHL 2X1QA 3WUWG 3ZHDA 2WXNA 2PYFA 2KZBA 3O8XA 5D7IA 3QQDB 5DUJA 1DDHA 4MB1A 3CJHB 4DV5B 4P4RA 5FFLA 5C08D 4GLRH 1BVOA 1QZ1A 2R2HA 4NFBA 4X6CB 4GJTB 2C3GA 4YIOA 5D5MF 2Q7YB 3DHPA 1NGXB 3HZKA 4C83A 4JJOA 1T83C 2CLZB 3O0RH 1Z9MA 3H55A 3SCMD 4KJYB 1G9NH 4CMMB 5F9OL 1HZKA 4PVBA 4LF9O 2QPFA 4UM9D 4FNUA 5E8NA 5IFAH 1AXSA 3JVGC 4Q6KA 3GB7C 4WUUA 3O11B 3T4AB 5K9KA 1ZDQA 2UY7A 4Z76A 1XV8A 4Q6YA 1WB7A 2WOBA 2EDDA 3KVQA 2LT9A 4UQ2B 4RA3A 5T1LB 4XI5D 4CAGA 4XO8A 4B9KC 1F41A 3S88H 4N0RA 2UWEB 4OTXH 3CLFH 1D5ZB 3RI5K 2VR9A 1XCWA 4R7DA 5TE7H 3BSZL 4WHTA 1A65A 4IM8A 5HDRA 2CK3G 1LM8V 3TTSA 2P5WA 7CGTA 2W9DL 3PAZA 2VSDA 1SJEB 1Y6KR 3IDUA 3C60A 4AQ1C 4B3SB 3K0YA 4X1YB 3LIZA 3BKCL 1G1KA 4FG6C 3U9UA 4KKAD 3VTAA 5EBMC 2CBOA 4Y16C 4A2MA 1KJMB 3E8BA 1H6EA 2BSSB 1N8ZA 3BPLC 1XR8A 2V1DA 1ZVSB 5LP6C 3W7WA 2YLHA 2I7SA 4KAQL 3ZDYB 1G0XA 1R33A 3NQIA 4H0LC 5I1JH 3HVDA 1KEGL 1NC2D 4AMWA 5DD5H 1N4XH 1DJXA 3EO1B 4HKZB 1EEQA 2A83B 2G5BA 4DFHA 1U4EA 5AD0B 1VA9A 4TSCL 1A14H 3WLWC 3MGOB 2VXVH 5DFVC 4N86A 3X14A 5JOEA 5IROC 4XBMA 3RVXD 2ZKXA 4A63A 4FYRA 5E7BA 4GI6A 1J9SA 2KZKA 4X99A 4Y5VA 1NGYA 4IU3A 4H8PA 3UAJD 1DL7H 1AI1H 2NY0B 4FTVB 32C2A 4KJWC 3T0ED 4A7GF 4Z5RB 3BEHA 4L1HA 4BKSC 3LD8B 1PLBA 3H9SE 3L1EA 4FLUA 2XSKA 4DKFH 1P7BA 5KMGA 1NCNA 2GJPA 2IADA 3S4SA 2ZAHA 4KRNA 4M62L 4UDUA 4J3OF 1IUZA 2ZKWA 4WEBL 3Q4HA 1KLUB 2AQSA 2AC0A 1F02I 2R0WH 1A1NA 1EXGA 1S7WA 2XZCL 3B3IA 4F8LA 4P2OB 3LOWA 1R3JA 3FSWA 2PWDA 4NO0A 4NM8H 1CLZH 3NDZE 3ZYOA 3D4GA 2CO7A 3N43F 5IB5A 3GXUB 1O5PA 1TPXC 4LCUA 1OY3B 1QFUH 3IRCA 3P1VA 1ZPLA 4KTGA 1RZFH 5ENWA 5FL7G 4ZTOH 2WYTA 2E9WA 3OLDA 5MI0C 2BTOA 4HLZG 4D7SA 3ARGA 5EF3A 1XIWD 2Q7NA 2Y9RT 3K4ZA 4DVRH 1S5HA 5FGBA 2GG1A 3R1GH 2CKBA 4DV3B 3I2CH 5H94B 5CEXA 5K59F 3V4VB 2OZ4L 4MKTA 5IBTH 1WITA 3AM8A 3BWZA 5IBUG 1NAML 2XFGB 1TO5A 3S8FB 1MHPH 2YLKA 1VPOH 1HDJA 3S2AA 5ITBL 1W0KG 4B9YA 3GXTA 1SLXA 3QUMB 3SY0B 2V9TA 2Y4SA 5D7JA 4WJ5B 3FN9A 3O45A 3C60C 3CWGA 5B1JA 3V5DA 1JTOA 1N5YH 2EIKC 4AGNA 5KBLA 1KELL 1Q94A 2F53E 3HE7A 3U0TA 1EO7A 4MASA 5F6HI 1PSKL 3ME0B 1OE1A 3LN5A 5GONB 2H1LM 3QAZC 1DVQA 3ECBB 5BS0D 5T1MA 4IOIA 5BMVA 1R17A 3JXAA 4UTAA 2D0GA 1GOFA 5BZWB 3BW9B 3HNSL 4FJ6A 3UQ8A 1GY2A 3ALXA 3CZLA 1FJ1B 4I2XB 2VM3A 3E6HA 5C0AD 1NBQA 1K73W 5DFAA 3GSXA 1Q8MA 2Y5QA 2EAEA 3QJQB 3ZYJA 2J5WA 4LLUB 4WWPA 5E1AC 4RAHA 2A99A 5K9JL 4HALA 1M7XA 3AAZB 4PLJC 1S7QA 2A4CA 2MMXA 1SLVA 3IFOB 1G7MB 2VXQA 2IW5A 4WNSA 4V1DA 4QI3A 2B1AL 2QVTA 3GSRB 2EVJA 2YKKA 2AV1B 4HVBA 3QYMA 3HR0A 2VUOA 3DIDA 4TQDA 3UAFA 4I55B 3WBDA 1MCDA 1L9MA 2ARJQ 4I5BB 1E30A 3CPWU 2XN0A 3D69B 4PS8A 4DUWA 4M00A 4DP9X 3SKOB 4I0CC 5CBEB 5DRWA 5HYEA 4PG2C 2FJGB 4JFPA 1DSWA 1XXFC 3QIBC 3F5WB 3VFMB 2V7HA 2ALWA 1QUNB 5AFAA 2CK0H 1F0LA 3MLYH 1ZHBB 4APXA 1QR1B 4KFZC 3U11A 1AR1C 4MVZA 4HNAB 3FU5A 1S5HC 1QVOB 5FHBL 5I23A 2XAJA 4JZ2A 2B2XH 2BJML 4TNWK 4CC1A 4K5NA 1EEZB 2E74C 3W81A 1XO8A 3BA8A 3AM8C 4H20H 4HDIA 4A6YH 2LJ2A 1FG9C 1HWHB 2X6UA 2VN7A 1JF1A 4LOUC 3QEHB 1MW0A 2ED8A 1UT2A 1VFOA 1PEZA 5H35B 1BM3H 2EEBA 3H3KA 4N9GB 2DQGH 1DQQB 2V2XB 2X9XA 4BUGA 2RMNA 2X7LB 3DI2B 2GJ6D 3HE7C 4KKLD 1OTSC 4PD4K 5AKRA 4UCOA 4NZFA 5FKPA 1BQ5A 2BSED 2EC8A 4HAMA 3FN3A 4QCIB 4O2FB 5KSVA 4Y9GA 2R9IA 2DH2A 5FKAA 2X1OA 2HWZL 3ZKXC 4E9XA 1IE4A 3T4YB 1KCBA 3OMIB 4N2AA 4LFCB 1R75A 5FF6B 3TTYA 3A8TA 2A9BA 2CDFA 3UH8A 5CD5D 2ZIOA 2EKSB 4JRXD 1GR7A 5DSCB 2G2RA 3HNVH 4B9PA 4RNRA 3ARRA 4YQXL 4DKEH 3CIAA 1BIHA 3HI6H 5I73C 4NRXA 2OL3A 4U6TA 1T2JA 3JV6A 3E2HC 4IIQC 5BQDA 2GK2A 4ZO6A 4AC4A 4WTQA 2G75A 4ZSOE 3UX9B 1VKXB 5I0YA 1J5DA 4JQVC 5IJ0B 1PY9A 5AVRB 3CFQA 4PRAA 1S7XA 1X3DA 1FXHA 4B3RO 1JWSB 1SQBH 2J5LB 3GHEH 5IHBA 1BA9A 1UB6A 5IJVA 1ZANL 5FYLD 5IEHB 1DEDA 1G94A 4CW1A 3S36L 3BQUC 1E8ZA 4P07A 4XC1L 4PJBF 3D36C 3H1ZA 3S96A 3L3JA 4OLZH 3LRKA 5I0ZA 2ZYHA 5IKCB 4P06A 3MRFB 5CSZB 1QRNB 1NAKH 4JQIL 5TISZ 3P9LB 2OX5A 3QPQC 2EIMB 2C4FT 3GI8H 3TONA 1KUMA 3SOBH 2OSLB 3MLZH 4K8ZA 5IIEB 3FHEA 3QDGE 2J8UE 3RGVA 1CI3M 4UT9A 4D3CL 1BV8A 1M56B 3AS1A 5B3SC 3CCSV 2FX7H 3QULB 4ZPVA 3WAKA 4ZUWB 5I26A 1PKOA 5A2AA 3ABZA 1WSST 4AV0A 5CGTA 4GO6B 4QOKD 1P4IL 3FB8B 4KNTA 4QJFB 3MRHB 4BIKA 4KI5D 1CP9A 3SKJL 1NFIB 4NKDA 3AK2A 3QJXA 1ZLDA 4HD9A 3CXHK 1HEZB 5F2FA 4G9DB 1OCWL 4L8DA 2HH0L 1R3IH 2JJSC 3VD9A 2NY1B 4LRNH 3R7QA 4JEGB 3DUSB 1R6NA 1MNUL 4PV9B 4R0LB 1UCBH 1WA8A 2C1PA 2UVFA 1BW8A 4P57A 2CDGB 1DQJB 5FYLL 5HY9B 3SPCA 4DQOH 2VAJA 1H8SA 2OXHB 3UM7A 4NUMA 3AQDA 2JE8A 3BE1L 2R7EB 2UY6B 4JPIB 3A2FA 2WY3B 5HHOA 1I85A 3TT1H 4PG9B 4K2UL 3MRGB 4WFEE 1AKJA 4Y2LA 2EH7L 3FH5A 4CJ0A 1DANU 5KBMA 4PS4L 2JGUA 3CE1A 5F88A 1HKLL 2PXYB 1AOHA 4AK2A 3DRQB 4HOZA 4QGPA 3BKJL 4FXTA 3ML0A 5GGSB 1I94O 2CE4A 2CCVA 3SQRA 2BO0A 2EDBA 1TZOA 3A6OA 4WZ9A 8FABB 3CFBB 3B83A 3BJ91 5ID0B 2XAHA 5EC2B 3QNXA 3TT3L 3KMDA 1KJ3L 3TVMC 4IK6A 4WNJA 2VLKA 4BCXA 4TVPE 4RMSA 3MBEC 4FQ1L 1W6LA 4AIZA 4NQXA 1EK3A 4IGBA 4E9RA 5JZ7D 3CZFB 2Y7OA 3VQVA 5AVYB 1JJ2U 2JS3A 5DEGB 2Q2LA 3CVDA 3H3PL 4J2QA 5L88L 4BQ8A 3L9YA 4PEEA 1MAKA 4MFHA 3T3ME 1NM4A 3P4MA 3M45A 1U8JA 2XV2A 4Z77B 2ZUQC 3NAAH 4WO4D 3TO2B 1EGJH 5AVQB 1BG9A 1QR8A 3N50A 2XTJD 5FM4A 1MCLA 2AK4A 4UT7H 5IUSA 2NNXA 5E2TL 2MNUA 3QUXC 1CGXA 1G7IA 5BR8O 1KGJA 5EA0H 1BQLH 3ML9A 3VRIA 2VLRA 4PW9A 1ILSA 2R0ZL 4HP5A 3D6GA 2YPVL 4CNIB 3ZMVA 4PJ5A 1NMAH 1Q82W 4ICGA 3OSVA 4LLAA 3US9A 1B06A 3P3YA 3OPZL 5FYKE 5TK4A 3RWCB 2YAEA 4JQXA 4IOFC 1KLGA 4RX4D 2OKMA 3B8MA 2E7HA 3ZZSA 5C0JA 1HESA 3WNMA 2DWDC 1GCYA 4BAYA 3VXME 4GKKO 4H88L 3TO4D 4K71B 2YR3A 3GMMA 4FQJL 1VADA 1XNQO 1EZLA 5B1NA 2WZ0A 4OLWL 3MUUA 2YAFA 2NLJB 2ESVA 2RQEA 1KIPA 3GMPB 4FABH 5FUZL 2WQWA 5JDSB 5D2NB 3REVB 2OV0A 1RZKH 4KUCD 5ES4B 1Z5VA 4UNVA 3CK0H 1KC5L 5AOJA 3SKUD 4HG4K 1CR9H 3PNWA 3L7EB 2HFGL 1I9JL 3FO0L 4G6KH 1O6VA 4PJGE 5E6ID 1ZEAH 4DGIH 3BUTA 2ZYRA 3BZEB 1YJ9V 4OJEH 1X4ZA 4JKNA 1HSBA 4F6RB 4KI1A 3ORJA 1Y07A 5J1TC 3T1HO 2BNRB 4OZHB 2EADA 5F1OB 5GGQL 2I9LA 4GS7C 3TCLB 5A3IC 5LXTA 4WFGD 4ZFOA 1OARL 5CLTA 3ZL4H 1HR0O 2DW5A 3O3BA 3SDAB 3NCYS 1D3CA 3SZKC 4IRJA 2JKNA 1N64H 1H8OA 4N2BA 4XN7A 1EUTA 2WGNB 2QKIA 1ZSDB 2WXQA 3JT0A 5C0IA 5I15L 4X6FB 5K1XA 4F15B 2HLFC 3ESMA 4HIEA 4IGBC 4KXCA 1QBZA 4J9ZB 3D85D 1F6AB 1V7NH 2D7TH 1GMGA 3BCFA 2K4AA 2Y2TA 3QJHA 1GTOA 3P0VH 4I3RL 5BMFH 4ATTA 3P9MB 5JPNA 4FK5C 1I3UA 2LTQC 2XN1A 2EEXA 3DNKA 4N1EA 4BDVA 2F4VB 2K3TA 5GGVH 4TV3A 1Z9SB 5JMRA 3VSUA 5IGXH 4JHAH 1FFQA 4X9IA 4WK2B 3VGAB 5BRZD 3GBNH 2DIEA 4RAVB 4TV9A 3BC9A 3IJEB 3ULUD 2P80D 5D6CB 1TZ8A 3PP3K 3R4RA 5DRZB 3CSXA 1B4TA 4Y1AE 1A7RH 4HHGA 3GIZH 3NTCH 4JHZA 5LMUB 1A2YA 1VQKV 2AEQL 2CHDA 2A6IB 1BAFH 1E8YA 3P0GB 4G8FA 2DQUH 4KI5F 1V3MA 5EUOB 3LMJH 3HKBB 1B9KA 1HVXA 5DQJA 2K6WA 3ILEA 1I8AA 1HNXB 5FDYA 5SWZA 1X9LA 2OMWA 2VDPH 3E1ZA 1A4KB 2XV6B 1YCSA 5FOBB 2VXUH 25C8H 1INDL 4HWEH 1X5MA 1KULA 1CL7I 2PYEB 4R5TA 4PGDA 3LKQA 3MV9E 3VQ1C 1L1FA 5IY5B 2A9AA 1OHHG 5TH2B 1E9OB 4NQUA 1USQA 1E6JH 1MJUL 2RH0A 3IDIA 2KL6A 3V6BR 1P1ZB 2X4QB 3HN8A 5K39B 3APMA 1OT1A 2EQDA 3QZLA 2HJDA 5DD0L 5IOPA 2QGEA 2QTEA 2YGQA 2EXYD 3IT8D 3OD4A 3ULUL 4FZ1A 4JRFA 4F7PB 1EZVY 4LSDA 4J6RL 1N0LB 5IT2H 2EVGA 2HVJA 1HI6B 1FYTA 2LLLA 2YQGA 5C8YB 1DSYA 1TMCB 3EJSA 3OZ9H 5D7EA 1K6QL 2JKXA 3FT0A 4O58H 1HU8A 1AS7A 1Q0XL 3KHQA 3VXRB 4OCYL 3IU4H 4A6YA 2NY2C 1IGJB 3U36B 4DP5X 1IGYB 5JNYB 4M7ZC 1ZDSA 2MKLC 3VRJA 1Y6MR 3IDYB 3QFJD 4XVTL 2Q9OA 4CKQA 5D7LD 4GB9A 3FFOA 4N90E 5J3HC 3VFVB 3S35L 4X8JA 5JPNC 3UTTD 5CIPH 5IMOA 3WLBB 1AHMA 2K70A 4B9CA 3KPOA 4U7MA 1QSEB 4WKXA 1YPZA 2BCKB 1AQDA 4BFNA 4O02L 1UYWL 1L0YA 1HW7A 1WT5A 1L5GB 2FSEB 3L17A 2K9UA 4P8QA 1PTZA 3TJPA 1DBBL 1YQVH 2N3JA 5DVLA 4B3MB 3ZE0B 5E08H 1H8EG 2XY1A 4YDZA 2XZQH 1EANA 3FN0L 1D5BB 4ZMPA 3MV7A 2A4ZA 3OB0H 2E56A 3Q3GB 3HZMA 1Z66A 4M6AA 4HHAA 3NN8A 2KERA 4KMLB 2Z91B 2OA9A 1MN4A 2Z0UA 2IG2L 4E5XG 1YZBA 5T3XD 3E6FB 3LRLA 1RZ7H 3HOGA 4UMGA 1DQLL 2YN3A 4ONHA 1OCOB 4BH7A 3MUGB 4L1SA 4RGNE 4GYCB 3BLPX 3DVGB 4DR3O 1NCBH 5IJ9A 1XEUA 5GGUA 4Z95L 2O57A 5HGHB 1W8EA 5EF1A 4PJCB 1AOZA 4F5CE 1AGCB 5CR8A 3EGXB 3APDA 5HTSA 5JIHA 1FH5H 4K3DL 2F1BA 3P4LA 4Q56A 1IC0A 43CAB 4KFMA 3RVUC 2VL4A 5F72S 3VD7A 2PW1B 4AYFA 4PJ9B 3MVSA 3RNKB 2CBPA 1MZYA 3C5SA 5E9DB 2DBJA 5KWYC 1OCZB 2NTFB 1HWGB 1W0VA 4AY0A 3G5XA 3EYSH 4L3CB 5EFIA 1HNZO 1WAEA 2LU7A 4BSVA 4DAGH 1R6KA 1IX9A 3HRPA 4H2CA 5IK3A 2P7TA 4YC2C 1IT9H 1I7TA 2YA2A 3T4AC 2JKRM 1JGUH 2B9AA 2J73A 2VLLA 2H26B 3Q06A 2QSAA 3GMRB 4U6XA 1RIUH 4FG6D 5BVPL 3K1KC 4W4NA 4Y16D 4JR9H 2OCJA 2H8PC 4I0PD 5T3XL 4B50A 2BSTA 2ITCC 4HCFA 5HHXL 3THML 2QGDA 1IM3B 2YD1A 1L3NA 2Q68A 3IAQA 3RTLA 3LRHA 1D2OA 2BDNH 2K6ZA 5F93C 3QEGL 4W9KC 3KKYA 1LK2B 4P59L 1KNOB 3ABUA 5DFTA 3A4DA 1D9KB 3L95A 4KXBA 5J11C 1O7DE 4Z78B 4YXLL 1DDTA 5GS3A 1A3QA 5HI5D 3BVOA 4TQPA 5DEFA 2AQQA 3ASWA 5MEOB 1DYZA 5EF0A 1J5OH 3ULUF 2KQNA 4PJDA 4FEIA 4PP1D 2EDYA 4PSPA 1KPRA 3I6GA 4GXVL 4M8VA 1HHHB 3KYMA 1ULVA 2VR3A 4MTGA 1LUVA 1MG1A 3TBVB 5CA0A 1OP3H 4EVNB 3QNFA 4Y19A 2VWKA 1DEEA 5D1QD 4NWUL 4W9JC 5FX3A 2AMGA 5FO9A 4YSSA 1ZD6A 5MERA 4KZEH 3AB0C 2DDQH 1WB8A 3HZVB 3F65A 5SV3A 2DV6A 4NTYA 4PRPD 3U48A 4CRPA 4HCRL 3MV8B 2J8UF 5ID1B 5HJ3A 3ZGIA 5HYQB 1IX2A 1MCIA 2VC2B 4N87A 4W81A 5GRWA 4M02A 4QHUB 3OKDA 5JO5A 2D73A 5K9OA 3N1MC 1A21A 4HU2A 4XPFH 3US1A 4F9PC 2V5SA 4ZNEA 3AS3A 1A9BB 2VW7A 3FU9A 3NJJA 1TEYA 2B5IB 5F7LB 1HOCB 2WAQA 3AXIA 1A6WL 1K8DA 3D07A 3FAWA 3D3VD 5KSAB 4Y4HD 3DXAB 2R2EA 4DR6O 3OX8B 1EGJA 4GQ9L 4LLDA 3FOLA 4HT1H 4AQEB 3H85A 1CICC 1GSKA 3ML8A 1P5VB 2CHWA 4DP0X 3WSQL 1CXEA 4JI2O 1AZUA 1J1PH 3AVEA 5F7HA 4FLWA 2CHXA 4IRSA 2VAAB 3TA4D 1ED3B 3VXOA 4OU3A 2DL9A 3L3GA 3NH7H 5D7SL 4K35A 3G6AA 2YAOA 4M1GH 3B4NA 4MD5A 5DEDA 5KTEL 4CS2A 4ZOBA 1QLEB 1F6LL 1M6UA 2Q76A 4Q9RL 2C4FU 3R0MA 1BZEA 1Q1JL 4HIJB 1JZFA 4XPAH 1CE1L 1QSFD 3A22A 3M17B 4PIBA 2CQVA 2C9UA 2L7JA 3H7LA 1HIMH 4RUEA 4NLAA 2DL2A 1F3JA 4J3TA 1E6OH 4TUJA 2ARWA 4K8RH 1GKEA 1K3IA 1PD1A 1RZ8A 4J39A 4JFZL 2CGRL 2YA1A 4J8RA 3DO7B 3ZTDC 1SVCP 5KYXB 4DW2L 1NWPA 5AZ2H 4YLCA 1R19A 3BAWA 4P2CG 3GGWB 3VDAA 3G5ZA 1MKFA 1T1YB 1T89C 1NGZA 2FL5A 2L04A 3OHMB 4JKPL 2WINA 2DQDH 4NO3B 4U6HA 5SX4H 1AQHA 2ENSA 3KPPA 1RUQL 3DMMB 2IJIA 4Z3JA 1ETB1 3T3MF 4TN9A 3ZLQC 2DI9A 1KN2H 5CZVH 3NJXA 3GK8H 4PA4A 1XH3B 2E6QA 3B7SA 1R5IA 2PYFB 4DZ8A 3PGFH 3CX5F 4MTOA 4U3FH 4UVCA 4P4RB 3BT0A 5GZND 1QVGU 2R2HB 1HQRA 3TN0D 4POZD 1T21A 1UHVA 2EEDA 3QDMD 1A9VA 4MXWL 1EO8H 3QXDA 4EXPX 5JXEA 3PV6A 4OD2A 5I19H 5EUKA 4FLVA 1MHEA 2XASA 1RUML 5E4EC 5DF0A 1H3GA 1FVDB 4WBNB 4C7UA 4HPOL 4LOUD 4ODWB 4QRPE 2WLMA 5E8NB 3F5WC 3G67A 3E8VA 2WLKA 2PWEA 2MRYA 2ZXBA 3CD4A 5K9KB 3IGUA 4Z76B 1TUPA 4R2GD 3VM7A 5FAAA 2CR6A 4P3WA 3U9PH 1MWAA 1OCCC 4H0GA 3GLEA 1U95A 3BFWA 1OTSD 1FGVL 1P6FA 5BVJB 2Q3AA 2V4LA 5DUBB 3JASB 2Q8BH 1ZA3B 2OMZB 4J7KA 3KPRE 1WISA 2FNWA 5JHDA 1KECA 4OCWH 4YL4A 3BUIA 1WLHA 2FLRT 3L1OL 4PJGF 3WB2A 4FA7B 3TGUH 4TOYL 4UB0L 4XNQB 2CAZC 2OT5A 4JVUA 1TJIH 4Y0GA 3FKUS 5HHVH 1YEGH 1SFDA 2XWDA 2EE3A 5E51A 5K1NA 2OI9B 3I3DA 4K94C 4PJ7E 1UKTA 4AJWA 2XTAA 2AMUA 2HZHA 1LJMA 3UBFA 3STLA 3CHQA 4I4TB 1XR8B 1DK1A 3A21A 5E0FA 1RSOB 4HS6B 2F5BL 4BZYA 4F8NA 1P7GA 1VP7A 2ODHA 4W9CC 3V5HB 1FXKA 4TOIA 2G5BB 5CHNA 5EU6E 4RWYH 3RDTB 5I1IL 5H6QA 4D6TH 1U8LA 2BY2A 4IOSD 3U1PA 1LO5A 1PLAA 2AJ3A 1N59B 2X4UA 4NYLA 4W4OC 4OIIH 3MOBL 1OPGH 2YKLH 3TEWA 4Y5VB 2LU4A 5CN2A 4AOFA 1NGYB 3GMLB 3IWUA 3MKKA 4IU3B 2WXGA 3D12B 3QRGH 2ZD9A 4OW6A 4PIRF 2JCCE 1LK3H 3ZHVA 3GKWH 4ONGL 3DIFA 4HAGA 5D2LE 4ZYKB 3JVFC 5KMGB 3VXSD 3IBEA 4C56E 2FK9A 5F9JA 4IHOA 4CDHA 1TCMA 4PJXE 1L0LH 3CSPA 2M26A 4B7IA 3QG7H 3SJVE 3B3IB 4LVOC 4MQXC 3ROLB 1SJHB 5CIPA 1QBML 5SWSB 4A37A 3ZZLA 4HJEA 2CO7B 3ALPA 2XT9A 2EDNA 3DJTA 4TNVF 4LCUB 3WFZA 1SUHA 2NX5E 3CXFA 1J0HA 2F6AA 4HHWA 2ZWKA 5DU7A 4LE8A 2EO9A 5LCVL 4AV5A 4NQCE 3C8DA 3NABL 2YPLD 5JXAH 2EIMC 1ACZA 1M71A 3D9AL 1SPDA 3SBWA 4N2LA 3ZDZF 3ARGB 3F7PC 3TFBA 1WICA 1K8IA 1NKDA 1JXFA 1KXTB 1PL0A 3PGCB 1XHZA 1BZ9A 1L0XA 1BZOA 3B34A 2AJYL 3C5ZB 5KAIZ 4KQ3L 4GIAA 1S3JA 3FB8C 1G7JB 2OJZH 3BXNA 3GIVA 1IBKB 3WL9A 1EDYA 4GSXA 4PBXA 5ICYA 3SO3C 2HEPA 3I50H 5EU4A 4CVXA 1XGRA 3AG1C 3F58H 2XFXA 5AW4B 3DJZA 4G8EB 3BD5A 3L3IA 3VE0A 1YNLL 1J10A 1QYGH 2ADJA 1S5IL 3K2UH 4GIPD 3RIKA 3U0TB 4LF6B 5F3BB 4LWSA 3CN1A 2NY1C 3KPSD 5HHNA 1WEJH 3FU0A 2PTMA 2AW9A 5EIIG 4YHLL 4R0LC 5KHHA 3NIGE 2XPGB 4IGGA 1RU9H 3S3DB 4FFZL 1YYCA 3K5SA 1NM9A 1CF8H 1YJDL 3JV0A 4FS0A 3VQMA 3SBQA 1XCQB 4GQZA 3O3DB 1FXKC 4BR6A 3FZUC 3EZJB 4QY8A 3TZVC 4LVEA 1DUZA 3OG4B 3TVMD 4OCRH 1OTTD 4XB3A 5FOJA 3EOYG 5KOMC 3J81N 5JW3L 3L5XL 1I1YA 5FK9A 3RHWK 3MBED 3RVVC 4EXKA 3MRDA 4TQ8A 4ZNCD 1P1VA 3L9DA 2EJRA 2DD8L 3VYNA 4AJVA 4U05A 1S7QB 3LAFA 5AB9A 3VXTB 4JPKH 1QU7A 5AVXB 4MS8D 4BA0A 4BXVA 1WIOA 1S9VA 4V1DB 3OLEA 1E4KC 3RWGB 4PRNA 3QF7A 5JH7A 1ZVYA 2IGLA 4U1GC 3VQ2C 4ZMLA 1V10A 2FIKB 2BNQB 3IMBA 4W70A 4XMUA 4URKA 3IDNA 1MI5D 4AKOA 4BD4A 4DP4X 5E6RB 2EXSA 4N8UA 3CPLA 4NKMB 2VDKH 5EC2C 4ACTA 1BFTA 1Y4MA 3GMQA 3N41B 4G7VL 3FTGB 3LHPH 3MU3A 1A7NL 3QUXD 2G4GA 2DE0X 4DV2B 1AYRA 4O51A 5DRWB 2UVEA 4B3EA 4AEEA 1P7KB 2XRAH 4KP4A 4R7CA 4CU8A 4A67A 4JY6B 4C47A 3TBYB 3LZFL 4XNUH 3E9UA 4RQQB 3WS3A 2K6YA 2ICES 4WI0A 4APXB 4Q9QL 3MNVB 1NEPA 3U7YH 4GH7B 1BREA 3CN0A 4LSUH 1J8SA 1ETA1 3LS4L 4GY4A 4P9HH 4JI7B 5CGYC 3U2IA 1F4YL 1K5QA 3Q6GH 2Z34A 1IFHL 5CILH 4XC3H 1TSHA 1W91A 2BWIA 4HK3N 2AJVL 4HWUA 5E1IA 5C09A 3WIHH 1Q9LA 4MB3A 4BFKA 3ARSA 3ARWA 2Q1EA 4YDMA 3T8XB 3UACA 1FNHA 2VITA 5IHLB 1I7ZB 2X7RB 4HS8H 3WTSA 1JZGA 5JCOA 1SXBA 4X4YB 1UGNA 4M48H 5HSFA 3S7GA 3N1GC 2ZF9A 4TUKL 2FIRT 4G42A 5LXGL 5FKAB 1FFTB 1AZRA 1NCDL 3HC0A 4V2BA 1SYSA 4YSOA 4NNPH 2ATKC 2KI6A 4JKKA 3WTVA 3MODH 4XWGL 4RSVA 5M94B 1OHQA 5KSBF 1SESA 5FNVB 3ELAT 3GBEA 3WFHB 1T7XA 4H0IA 1CDIA 2GUZB 1ECZA 2HLFD 1B2WL 1AJ7L 3LH8A 3WNOA 1QASA 2OL3B 3WENA 4LSTH 3FQRB 1ROPA 1S7SA 1TVHB 1UXSA 4GSRA 4HUNB 5EMYA 4EI5C 3U4AA 3JAWA 1JNNH 3AG7A 3MLSH 3VJ6B 2EDTA 2ZCLL 2QE7G 2KKWA 1ORSA 2NQCA 2VWJA 1G4MA 4PRAB 5KYYA 1QNZL 1V8HA 3EJCA 5C0CB 3VI4F 3I9PA 4Y4FB 3SGEH 5KS9A 1A6ZA 1DJWA 4PYHA 3K5MA 4I77L 1UB6B 1JD9A 2IQ9H 3PWNA 4YK4B 5LHDA 1NKGA 1S7RA 1U8HA 3GXPA 5C0BA 4BFGA 2B4CH 1YO4A 2J12B 3S96B 3B2EE 5DRNA 1W0WB 5E9AA 2D0FA 4B3VA 5C8JA 3KEHA 4R5XA 1JNHA 2OX5B 3M88A 4MLIA 4FDWA 1WZAA 1SQMA 1F7YA 1CLYL 3RGVB 2QR0B 4ZPVB 1UACH 4IRZH 5GGRA 4QTIL 4GSDL 3LXAA 4YXKH 4D94A 4OD1H 5B1KA