5B1BB

Bovine heart cytochrome c oxidase in the fully reduced state at 1.6 angstrom resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mg2+-containing Water Cluster of Mammalian Cytochrome c Oxidase Collects Four Pumping Proton Equivalents in Each Catalytic Cycle.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 68
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b1bB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1bB02
1MZYA 1AZCA 1GW0A 2A3TA 2OJ1A 1KCBA 2GB2A 3FQYA 3OQRA 1L9PA 1XB8A 5F7BA 3S8FB 1RZQA 3SBQA 4KO6A 4UAHA 3BQVA 1GY1A 4E9RA 1SNRA 5E9NA 3EF4A 4AI7A 5I28A 1JOIA 1SDDA 2J56A 1OE2A 2PPFA 4DPBX 5F7AA 2UX6A 3EH3B 3S3BB 2FNWA 1SDDB 5I6PA 5AZUA 4AKQA 1KBVA 2PPAA 4YL4A 3X2QB 1MZZA 2P80A 3G5WA 3IE9A 3FPYA 3FSWA 1TKWA 4BWWA 4BK5C 1SHXA 3N55A 2PPEA 2OV0A 2CCWA 3ASNB 1FWXA 1M56B 2FT6A 2R7EA 3QJQB 1TEGA 2GI0A 1A3ZA 1B3IA 2XX0A 3UADA 1BXVA 3FSZA 3FSVA 4YSPA 2YAHA 1NWOA 1ILSA 1ZIAA 4HCFA 3IN2A 1JZIA 1E5ZA 1CC3A 2QT6A 4DPCX 2P80D 3FQ2A 3GYRA 4KO5A 4HHWA 3QJSB 1JZEA 2CAKA 2HRGA 2PCFA 2PP7A 2XYBA 5TK4A 1TU2A 1SFDA 2NRDA 3PAZA 4AKPA 2VN3A 1GS7A 5I6OA 1IBYA 1ZPUA 3T9WA 1OE3A 2VSKB 1BQKA 1JZGA 2XV0A 4W9ZA 1PCSA 2XLLA 1NINA 1A65A 3CVDA 2Y1AA 4YSQA 1CYWA 4E9QA 2HX9A 2R7EB 3OMAB 3OM3B 1AANA 3T71A 3NJKA 1PF3A 4WKXA 3SBRA 4YSSA 2PLTA 5D4JA 2TSBA 5B7EA 3CDZA 2IDQA 2VW7A 4GP5B 2CJ3A 4E9YA 2AANA 4A2GA 4G7SB 1BQRA 3FYEB 1X9RA 3S3DB 2ZWNA 2Q5BA 1QLEB 1AG0A 1QNIA 2ZONA 1GR7A 4A68A 1XB3A 3CVBA 1A8ZA 1A4AA 1WA1X 1IUZA 3H56A 2XV2A 1ZIBA 4YVUA 2YEVB 5D4HA 1PLBA 5I5IA 3FT0A 1WS7A 4F7KA 5B1KA 1E67A 4YSEA 4KOBA 1NIAA 3PPSA 3NYKA 2WO3B 1BQ5A 4A2EA 3FS9A 1W8EA 2J55A 1UATA 1IBZA 1SHWA 3ERXA 5PCYA 3FYIB 2YAEA 1PNCA 3WNJA 4NB7A 3QJVB 4BDVB 1BAWA 9PCYA 2AZAA 3FU8A 2BWDA 2I85A 2H3XC 3NJGA 1ET7A 2N0MA 3ABGA 4K9JA 4ZK8A 1JZHA 2AVFA 4CSZA 4QLWA 3NJHA 1KCWA 2XU9A 1KYAA 2JFCA 1J5DA 4JHUA 2QPEB 2YAQA 5IY5B 4M4RB 1AOZA 3AW5A 1VLXA 2YAOA 2B3IA 3ABKB 1AS7A 3S8GB 4DP5X 1YLBB 1SFHA 1NWPA 4KNUA 3AG1B 3NSYA 4P5RA 1DZ0A 4PCYA 1OE1A 2IWEA 3DTUB 1URIA 1V54B 1AS8A 2JKWA 3X1BA 4JHVA 4E9TA 6PAZA 1ADWA 1JXGA 1E5YA 2EINB 1MG3C 2FT8A 4A67A 2IH8A 2CBPA 1J9TA 1KDIA 3TASA 1V55B 1CURA 2X88A 1PMYA 1FFTB 1A4CA 3DIVA 3ZX1A 1PZBA 4DP1X 1L9OA 1RCYA 4BXSV 2B08A 4HALA 1NIDA 3MBWB 1ET5A 3WKQA 4G7RB 2YAFA 3QQXA 4A2HA 1ZDSA 4KOCA 3QJTB 1HFUA 3KW8A 2PP9A 1N70A 1RKRA 1L9RA 3C75A 4E9WA 4YSRA 3UGEA 3JTBA 1AZUA 3NP4A 1AS6A 2HX8A 4YSOA 3WG7B 4DP2X 1JXFA 4BXVA 3PXLA 4AZUA 1NTDA 5B1JA 3UABA 2GBAA 4A2FA 3FU7B 3FU7A 4L0PB 3UAAA 5AFAA 1FA4A 1JVOA 1JERA 3ASOB 4G72B 4JKNA 1OCOB 3EH5B 2GC4C 4DP7X 2XWZA 3NSDA 2IDUA 3TBCA 3AG3B 5I6NA 3TU6A 3PAVA 2UXVA 1JZFA 4EF3A 2EIJB 4GYBA 4F2FA 3AZUA 3HB3B 3HEIB 1X9UA 2FJSA 2IAAC 1BXUA 3NSFA 4HAKA 2VM4A 4A66A 2IDSA 2UXFA 1OV8A 1NPNA 4E9VA 3PAUA 2BP8A 5I6LA 2WO2B 2BP8B 4BWTA 4G70B 1N68A 3D12B 4NAJA 1W6LA 3X1FA 3NJJA 1KGYE 2FTAA 2YAPA 1NICA 1CUOA 3CDZB 1PZCA 2CUAA 4E9SA 4BDVA 8PAZA 2BHFA 3ABMB 3QJRB 1ET8A 1KDJA 2DYRB 5TK2A 1T5KA 1TEFA 4AKOA 2XVBA 3FU9A 5B1JC 2XV3A 3NJNA 4N8UA 3OMIB 5B1BB 1J9QA 1ASPA 5PAZA 2UXGA 4AX3A 1JVLA 4YSDA 4CSPA 2BW4A 3UAEA 3RYMA 2J57A 2DYSB 1AZNA 4DP8X 2WSDA 1DYZA 1MG2C 2X87A 2TSAA 1IKOP 2QPDB 3T6VA 4DP4X 1GS6X 2FQEA 2RACA 2FT7A 1L9TA 1BYPA 1RZPA 3NJMA 2IH9A 2VW4A 2GHZA 5FC9A 4YSTA 4DPAX 3EH4B 6PCYA 2YQBA 2ZOOA 2UXTA 3ZBMA 4YSCA 1GS8A 4KO7A 1SF3A 2W88A 4NERA 1OCRB 3PCYA 1OCCB 3BVDB 1J9RA 4HIPA 4A2DA 5I6KA 1WA2X 2ZXWB 3IEAA 2PPDA 2VMJA 2DWTA 3NJLA 3AY2A 5ANHA 2XX1A 4M3HA 1PLCA 3FQ1A 4GY4A 2IDTA 4BWUA 3KW7A 3NJIA 1J9SA 3AG2B 2BP0B 3FPXA 4HCIA 4HZ1A 1AACA 2VM3A 2PP8A 1NPJA 3NP3A 2J5WA 4DP0X 2VSMB 3DKHA 4ENZA 5LDUA 4G7QB 4GXFA 1GSKA 3T6XA 1AIZA 2PCYA 4UANA 3QJUB 3TBBA 4N4YB 1OCZB 3PLYA 4X4KA 2GIMA 5B7FA 3X1EA 5I5MA 3NT0A 4G71B 1L9QA 1WS8A 3S3CB 2H5UA 2XXGA 3T6WA 4DP6X 4FA7B 2FQGA 4YSAA 3X1NA 2I7SA 3WIAA 2Y69B 2EIKB 2IWFA 1SF5A 4TXVB 5D4IA 2XUWA 1IC0A 1OOWA 2H47C 1M9WA 1JZJA 5I26A 1EHKB 2BZ7A 3NJFA 5I6MA 1CYXA 3WNIA 1AZBA 1JXDA 2QDWA 1XMEB 3SQRA 3ZDWA 3CVCA 3N2JA 2CALA 3TA4D 1WA0X 1F56A 2HLEB 2GSMB 2MTAA 5EHFA 1NIFA 2BWIA 2PPCA 3JT2A 1OF0A 4FAAB 3WI9A 1ETJA 1PZAA 1PAZA 5B3SB 1AG6A 2DY2A 2YXWA 2HX7A 3OMNB 4GP8B 3MX0B 1GY2A 1AQ8A 5AKRA 2BZCA 3U25A 2HZHA 1PLAA 1HAUA 3OD3A 3QPKA 1ASQA 1GYCA 4DP9X 1ASOA 1E30A 2JXMA 2YAMA 1E65A 1KV7A 2DWSA 2LLNA 3NSCA 3GXUB 5B7MA 4QKTA 3EHBB 4Q89A 2IDFA 5I5JA 4WTQA 3CZUB 2YXVA 1ZDQA 3H4HA 1PNDA 4UF7C 1M57B 4HCGA 4PAZA 2DV6A 2FWLB 3SBPA 4E9XA 3AG4B 4P5SA 2QDVA 1BYOA 1EZLA 5B1AB 2Q9OA 1BEXA 2IWKA 2EIMB 3V9EA 2BW5A 2I7OA 4KNSA 1L9SA 3T6ZA 1A4BA 3UACA 3V9CA 2VW6A 1ZV2A 1MDAA 2FQDA 4YVNA 4HHGA 2BO0A 1BXAA 1WAEA 3IN0A 2EILB 1R1CA 3GDCA 7PCYA 5A7EA 4MFHA 1V10A 2FQFA 2HXAA 4Q8BA 1AAJA 1NIBA 3X1GA 1QHQA 7PAZA 2MRYA 3L45A 3ABLB 1XB6A 3FSAA 1HAWA 4RH4A 2AFNA 3WKPA 1ILUA 2XXFA 4W1TA 3ZIYA 1KBWA 1PY0A 1SJMA 4KO9A 1AR1B 2OCCB 4KNTA 2YARA 4F2EA 3H4FA 1J5CA 3CG8A 2AZUA 2BP0A 1W6WA 2UX7A 1NIEA 2W8CA 4GP4B 1NDTA 3IBOA 4YSUA 2E86A 1ID2A 1NZRA 2HRHA 1AZRA 1I53A 2GC7C
chains in the Genus database with same CATH superfamily
1AKJD 1T0OA 2UYLB 2BTQA 3NCJH 5TDPA 2J1KA 2JH2A 5GJTH 2VDNB 4PV9A 4NGHL 1HQRA 4PG9A 1YN6B 1XXDC 3DV6A 5C0FA 2E9BA 3TYFA 1XH2A 3IDUA 4P3CL 4ZMWA 1W16A 4FFVC 1FL6B 1SNRA 3FB6A 3REVA 5IMKA 4XMZA 1QWHA 3BRFA 1NKGA 4Y5VC 4XVUC 1XCTB 4B9PA 2A6KB 3V6ZA 3VGDA 4Z7VE 3LEXA 3HRPA 4JTAB 4JI7B 4FM0A 3ROOA 1AQDB 2OR8A 4EEQA 3HCVA 3LV3B 4PGEA 4MVMA 3UBXG 3HNTH 3FTYA 4JF3A 1E9OB 3BE1H 4AOFA 5IWLC 4JFUA 1P5UC 5CXPA 3BGFB 4Y7MA 4CN6A 2NR6C 4MAYA 2FT6A 1QR4A 3EYOB 1KN2L 3FB7C 4A7UA 2OQJB 4UCUA 3QXWA 4M8QA 4DOHB 1RZGB 3VXSD 3UDWA 1L7IH 1MW3A 2VJ0A 4ZOLB 4WW2A 3L1OL 4Z0BH 5HPMA 1KIRB 1EHAA 4JHZA 4WFHE 1OGPA 2J44A 3CPLB 1NFDF 3H3PH 1JPGB 2AV1B 3LQAH 4O9HL 3FRPB 5HVGB 4GSUA 4I5SA 2JQZA 3RI5F 4ZPTB 2NYZA 3BFRA 2VMFA 4WNQA 2Q0AA 1LNQA 1BPVA 2WN3A 5E0FA 3MRNA 5IKCA 4FFBB 2V33A 1AZVA 3QIBB 4AJ0A 2APTA 3SIKA 2EE6A 1SDYA 3PWPB 1AI5A 4OCRH 5T3ZE 2LGWA 1QSFD 1JV5A 2G0LA 3VXQA 1NMAL 1WFOA 4N2LA 2VQ1A 1EIBA 4I18B 4R5TA 4F2MB 2OCHA 1EFXD 1TMCB 1G6RL 1RJLA 1T4KA 1SBSL 2H26B 2MCG1 1N36B 1K9MW 2MWCA 2FWOB 2OWOA 4XXWA 4PRHE 4KZEH 2GKIA 4XBGB 1YAIA 3GXFA 1CDBA 4QRUB 2CDFB 3ZHNA 4CJ0A 5A3IC 3OMAB 1UFUA 3DBSA 4Z1VA 3KHOA 2C4FU 2NYYC 4LIQL 4WK2B 2DTML 1MFCH 2E5EA 4P5TD 1HN1A 2BCKA 5GRUH 5KSVB 1MJ8L 2BINA 4HEME 2IDQA 1SMOA 3ET9F 4XPGL 5CGBA 2IU0A 1IQWL 5E8OA 4OBSA 3WN5C 5EBLA 2WWKO 1QVOA 3CVHA 3TIDA 5EH1A 2GITB 2NCMA 4KTYA 4PA3A 3AUWB 4F9PC 1OT2A 2OMWA 3I02A 3NFSH 3QJZA 3V5KA 2XV6B 5AB2A 4GAJH 1RUKH 4NWTH 3WIFA 3A0HZ 1EK3A 1NMBL 1AFVH 2WVVA 3EKCA 3Q8BA 5EWIH 2FR4B 5MHSE 4BZ2L 1LR1A 2P06A 4XMXA 2G5UA 1JUFA 4HYTB 1W15A 3T3MF 5ANMB 1OAQL 1CFBA 1ZK5A 3L75H 1FAIL 4BHUI 1Q9KA 5DMGC 2GIYA 3KPRD 3OC8A 3UZEA 1D6VH 1U92A 3WXWL 2DBLL 1W8EA 4UYPA 4ZMPA 4JG1L 4MVSA 4ZTOH 3FW6A 5ABAA 4G2AA 4X6FA 3L2LA 4FFVD 2PYFB 1BWMA 3LXUX 4MZIA 3VX0A 4L3EA 5ADOL 3SJCC 4L2LA 5KBNC 4JGSA 3C2AH 4NQCD 4AZ8A 3D34A 1Y67A 3RYHB 1RZKC 1VFAB 2IBGA 2N0MA 1M1SA 4FMVA 5EPMB 1I94B 5J3HD 1G9MH 3CH1B 3L5IA 5FLVA 3FCBA 1AGEA 3VXUA 4AG4L 3CP1A 3PL6D 4YOKA 2UXNA 4NPYA 3CRMA 3BP4B 4W9JC 3KVQA 4MX7B 3QWRD 2VRQA 4W9DC 3NJXA 4HGKC 4M61A 4TRPL 1DUZB 1VLXA 4B95C 1LXMA 1V7ML 5DMKB 1HEZB 4GG6E 1HH9B 1XF4A 5FFOA 1PQZB 1RLBA 4XNZB 3ZT7A 1INDH 2NQCA 2GFBB 5FGBC 1T1ZB 3LZFH 4YDLC 4GKZA 2MCPL 2BSKB 4MAZA 2QJ1A 3FT3A 1T0MA 3HB3C 4KI1A 2BOCB 4GXUN 4MCMA 1DBAH 4OUUB 3MV8B 1X7SA 3O6ML 2DWEA 4KQ4H 2B1HH 2XJLA 3K4AA 1DANU 2ITFA 1MCNA 3QWRA 3Q8FA 4XPBH 4ZDHA 1IZJA 2E75C 2Y22A 4DFIA 2XXCB 2VISA 4Z2WA 4QY8A 1QBML 2ITCA 3IRPX 3ZN1A 2WXGA 3GMRB 4K3JL 3Q9QA 4MA3B 1R0AL 1IM3A 3GHBH 1RCYA 2B1IA 5F0JB 4M43L 3G04B 2NQDA 2Z65C 4Z78B 2I24N 4LF3B 3MCKB 4WDIB 3ATFA 4G7RB 3OKEB 3QQXA 5GZND 3RY5A 1ZHNA 4FJYA 3HC3H 5BUPA 1FYJA 4KJQC 4YPGA 4EXPX 1CBVL 1HKLH 5JIQA 5TE7H 1YYML 4JR9L 3WIIH 1JNLL 4YHPB 3VRIA 4HG4J 4U3XA 1EXUA 3GMPA 5BV7C 1TVHA 3G5ZA 4JYCA 3HE7D 3QIUB 1AS6A 3W0WE 1E8XA 1E8ZA 1GIGH 3IFOA 4L48A 4AZUA 4BXVA 4Z8FH 5B1JA 3FQ4A 4RMUA 2Z8SA 4JFDD 3L1FA 4XCEA 1L6ZA 1KN4H 3LKQA 3RIKA 2BS8A 3DMMD 3WS3A 1SKVA 4XB7A 2W0FA 1NCBL 5KX5B 2X6BA 3HRZC 2RQ6A 3QHZH 1ZHNB 3V6OC 2R56L 3NXSA 3QUYC 1YUHA 4HDIA 3ULVE 2YR3A 5C0BE 4FCHA 5C6WH 4I55B 1XD1A 2DI7A 4XN5A 1H3WM 1UQSA 3CK0H 4FA8A 3ZE2F 2ZG3A 5DUPH 3UYPA 3MSPA 4Z7WE 2WO2B 5AW4B 5K33A 3BQUC 5JW3H 1EMTH 1Q1JH 1BQLH 1H5BC 5LCVA 1AQKH 3PWLA 3IF1A 3W11C 2X3AA 2FTAA 3QCUH 1NICA 4ODWA 4HC1A 5E51A 1OTTC 1J1XH 2IH3B 3KPSB 5C0CD 1Z5VA 4JFYB 1DEEB 1QWUA 5G4OA 3LZLA 1GZQA 4DV3B 1UWFA 2Q6WA 3T3ME 1QYGL 3WXVH 3FU9A 4JPIB 4JRLA 2NNAA 2VDQB 3NJNA 5GRXG 1ZGLM 1PFOA 4AX3A 2UXGA 3V79C 5JW4M 1NCJA 3GEWB 5INCA 4Y5VA 3VI4E 1M3IA 3V4VL 1CWVA 1RULH 3OKMA 4H8WL 4URKA 4P9HH 4PG2A 1H2GA 2EZ0C 4BKSC 5F88B 3T6VA 1CFVH 4AMKL 3OPUA 2PR4L 4QJFB 2RACA 2AJSH 2R8SL 3S9DB 1L9TA 1RZPA 4O2CB 2ZUQC 3LSSA 3EJCA 2IH9A 5GGVH 4QRPA 4M48H 1OAXL 4NYKA 3BPNB 2APSA 3LHPH 5H8DA 5CBAA 4W68A 1ULVA 1BF2A 2AI0H 3OTOB 2MQCA 4DPAX 2BCCH 1FSKC 3O6FD 5ESAB 1KXTB 2QGEA 5GZOA 2G0KA 4YSCA 5AVQB 4TV9B 1NVPB 4ZMLA 2HWZL 4GSDH 4NERA 2PYFA 3ZYOA 1W0YT 1RIHL 1SJXA 4UQ3A 3DXRB 3CTTA 3NCYP 1X5MA 1MRFH 4YQXL 1PJ9A 1XMOB 3B40A 2EIDA 2C9SA 4R7NA 1TJIH 1AI4A 2IG2L 1DBJL 4J3XA 4XO5A 2XX1A 1XEUA 1JGLH 1N3NB 2BNRE 2AMGA 3FCTA 1FZJA 5EZOH 3T4YB 1VQ7V 3IGLA 2N56A 3AG4C 2ATKB 4ETYA 1HXMB 2E5LO 4XCFL 5KJ4A 4MQSB 4OLWL 3QZOA 1PG7W 4ONHA 3WIFB 2Y2TA 3PDOB 1XF1A 3KKYA 3PXHA 4YHNA 5L88H 3G4SV 3ECUA 5KOMC 3RIAF 5JIPA 2AHZA 2D3NA 2JJVA 3CGTA 2X4SA 3G5YB 1ZLDA 1YJWV 1WCBA 4JKPL 5CHNB 3VFWB 3VUAA 4PJIB 3KL0A 4LCIH 4CSSA 5B8CB 2OMVB 4FOMA 4OB5H 3OF6D 3S6CA 1VERA 1PTZA 5HGDA 4QNPF 5DA0B 1USQA 1CP9A 1R5VA 4MVBC 3QZMA 4UTBH 4WJ5B 3A0RA 1IARB 1FFNA 3QDAA 4JE4B 4OT1H 4EDWL 3Q2VA 2QMJA 3GGWB 3U7YH 1NTMH 3AG1C 4AQYB 1EBPA 1QTYT 3RBSA 4HWNA 5TQ0L 1BDYA 3CEIA 1SXAA 3QTCA 4IRJC 4XP9L 3VB9A 4J3OG 1HKFA 4YHHB 3DROB 5DD6B 5EV7A 3RU8L 3CD6V 2O5NA 3G5XA 3GSWB 4U1KA 2QGDA 3ARFA 3B9KA 3QNXB 3T2MA 5CA1B 4X50A 3OFNG 5CZRA 5D9SA 4G6FB 4Q74A 1IV8A 5HJDA 1JJOA 2VS0A 4NAMA 4K55A 1ZSDB 4OJDH 4CADB 3IMTA 5LAXA 3DRQB 3BT2L 4X6BB 2YXWA 4OF6A 1PEWA 1RZGA 1KBGH 4Q6YA 1T1YB 3Q4HB 2VL5B 3EDJA 1RZJC 3D50A 3RVWD 1X3DA 5EBWB 2GCYB 4XCEB 2OYPA 1G9NH 2I9LA 2Y1ZA 4OZIB 5BZWB 5LG1A 1I7RB 1N34B 2Z31C 2JB6A 2R1XA 3ZUNC 2DM2A 1C5BL 1PZSA 5AYUH 2ZYHA 1UJWB 1MVUB 3LQZA 4YE4H 4R3SA 3ZLQC 3HZKB 4MMXC 4AGLA 3NACH 3QUYB 3O41B 1IC7L 5FKAB 1OHZA 4DR2O 1ZSHA 3ARGB 4G6KH 2EVIA 2JK5A 2BDNL 1YEFH 3UTTA 4B7KA 5LVEA 2FZ3B 5DR5H 4WDIA 4L8SB 2WAMA 3QS2A 4LLWA 5HYSB 2E5LB 2PUSA 2XN9A 1J18A 2VR7A 3EJZD 1RZ8A 5AB9A 4YXHL 3V6OA 1Y07A 1R6KA 3CE1A 3ZO0A 1IM3B 4JRXE 4KH9A 4L9LA 1G9NC 4LCYB 4LVEA 4WVRA 5GS0L 5D55A 2AV7A 1H0DA 2VDNH 4OJCA 1ZT7A 3TJHD 1QSED 4HSCX 3UACA 3ARXA 1E3FA 2ORBH 4WGVB 3KEHA 2DTSA 2I69A 5C09E 3T04D 4D0BA 2BO0A 1J10A 1WAEA 2W9DH 3KXFD 3CLEH 3THML 3VYNA 3MRLA 3D4ZA 4QHNA 5DMYA 3S35X 2X7LB 3IRCA 2ICWI 2C8NA 2VWEE 4HOZA 3E6HB 2OMZB 3LXAA 4M6OH 3I2CH 1PG7L 1T3FB 4GSQA 1L3WA 1XGPA 2WO4A 5ESQA 1LE5B 1HH9A 3QAQA 2NSMA 3PNWA 1ODUA 1ILUA 2NZ9D 4LLAA 4L1HA 3QFJE 5IEHA 1SJMA 3IDXH 1JTTA 1J5CA 3L6FB 4XB3A 4TNWK 1MNUL 1ZD6A 3SJBC 2EADA 3CFJA 4Y19B 5HGAB 3RYHA 1VFAA 1MG1A 3OBAA 1GGIH 3GK8H 2UX7A 4I1RA 1BPLB 5E8EA 1EEYB 5ERWB 2WOYA 1JD9A 4ZMYA 5I17B 3RP1A 3BEVA 3KYNA 1SA0A 1ID2A 5G4NA 3Q48A 1FZOB 3BAIA 4JI5B 1RUQH 2X53A 2IAMC 3D87B 2OJ1A 5FV2A 5DVOA 1MREH 4H88L 4PW9A 1U92B 2NXYD 2QKIB 1XB8A 3O3DB 5GSVB 3AQXA 4KROD 2HFEA 1YJDL 1RFDH 3N0AA 4UAHA 1HHHB 4XPHL 2W1NA 1THAA 2DWDA 5E6SB 4WFFE 4KKZA 4GBXC 4JHWL 1GL4B 1JVKA 3C8KB 4AI7A 4FFTA 4EVNB 3C6LA 3BX7C 3GRWL 1NGQH 1YC7A 4YLCA 2A73A 1KT2A 3U10A 3GM0A 3M1CA 2QE7G 1UACH 2EIKC 1IGTB 1TA8A 1G4RA 1NC2D 5F7FA 2DJ4A 3V5KB 4L23A 1MCEA 4FKEA 2XZAH 2IGTA 3FU5A 4NDMA 5C07E 3O6FA 4K7FB 5A2CA 4IW4C 4PRPB 1JXJA 4NM4L 5C0BD 1SHXA 3CFDA 2A7WA 1IAIM 2GUOB 4K3EH 5JQ6L 4DR1O 3VAEA 3OGOE 3QGVA 3ZOAA 3APMA 1ZTMA 3P3RA 3RGBA 3K57A 4JI8O 1PNMA 1XR8A 1EA9C 2QA4V 3K2IA 1DQDL 4X9QA 4TNVK 4FABH 4GMSH 1JV2A 4ZUTA 5AAMA 4TTDD 4PRPA 3I6GB 4UM8B 2QQNL 2QVTA 4FNRA 1ILSA 4F2MA 3HPLA 4M6AA 4JDEB 2HR3A 2G30A 1MZFA 3FQ2A 3EBAA 3UTQA 1CLZH 1VESA 4DCQB 4MDRA 4LFAB 3ZHTA 4Z76A 2V7HA 3IAYA 1NLDH 2XYBA 3GBML 3RWRD 2XDHA 1DQQB 4MJIA 4KDWA 1DVXA 4B9YA 2YHGA 5I6OA 4K5MA 2P6JA 2JLPA 2KI6A 3NPZB 4TVPE 5IVXE 3WUZA 3P3UA 2E46A 4HX1B 4AHCA 2XASA 4LF6O 5E6IB 3GRWA 3L9DA 5ECGA 4E9QA 3AG2C 4NJ9H 4ZTEA 1A0QL 2E7MA 1PZDA 2YUWA 5B38B 4QCIA 5ESVA 4UQCA 3VU1A 5C0IB 5I71B 4AK2A 2AGJL 3ISYA 3AK2A 1RP3B 1EZSA 1N0LB 3AMKA 1SESA 5EBMC 3C87A 5DHXB 5DRWB 4CA4A 1BJ8A 5I1LA 2VLMD 4OLUH 4P3DB 1P69B 3DPBB 5D1XC 1G6RB 3WE6A 5L6YH 2F4VO 3ZYJA 2FWSA 2RCSH 3TETA 2YWYA 4L8SC 4UOW0 2VSDA 1HHGB 4JFDA 5D1ZD 1XB3A 4OLZH 2N1TE 2HAZA 3FMGH 4QJ3B 5LOVA 1WFMA 5CF3A 4YE0A 3FB6B 4YVUA 4TQDA 4KKCC 1EN4A 2YZ8A 5IVZA 1WS7A 4WEBL 4NLAA 3ZE1B 5F7KC 3ETSA 1CFNA 3VX1A 2OMZA 1Q0EA 1V27A 4E9LA 2GAZA 1YEIH 2ZOLA 3MLZL 5F1OB 3PGDB 2XWBB 3B4NA 4HK0B 3KCPB 3T5WA 3VMNA 5I30L 4WWKA 1D6EA 1UOLA 1K4DB 2K9UA 2YAEA 5EOCJ 1YY9C 5BRZD 1SYSA 3RL1A 3N27A 5F9OL 3RQ3A 2UUBB 1ZT7B 2W92A 1RAMA 3U36B 2H3XC 2LFGA 2DIEA 1TZ8A 1D6EB 4ZFGH 3NJHA 5L3DA 5KOVC 3N42B 5BJTA 4FLOA 2A06H 4RUEA 3KGSA 4G6JH 4BFNA 2VDMH 1Q3EA 2YAQA 4PJ5B 2X09A 4MB1A 2JK5B 4K5LA 4FQXB 4HW6A 2FYYB 1EEZA 3MLSH 4IRZL 4PJGF 4ZHQA 2OZ4H 1CQYA 4WO4B 4I3GA 3EO0B 5HDLA 4Q9BA 3VA2C 5I1JH 2J8OA 4HWEL 4AYSA 4G7VH 2KQNA 4DSYA 1CCZA 2EDMA 3RFZC 2QVFB 4GG6A 1DVZA 2X2HA 3LY6A 5E00B 5JVDA 2F5BL 5CSGA 4AW7A 1QA9B 4PJBB 3X3FL 4KKAD 5HDOA 2FJHA 4E9TA 3Q1EA 1JHTA 2Y6TE 1FFPB 1AR1D 1SQVH 4DV2O 1E8YA 1H3UA 3HC0B 3PRZA 4KGJA 4QCIB 5ESVB 5DDHB 3G71V 4UT7L 3O6FB 4PJFA 1WP6A 2G3ZA 4XMVA 1T89A 3BH4A 1JOYA 5TE4H 2CCLA 4RGMC 1KGIA 4IBQA 3UMTA 2EE2A 4KNQA 1GRWA 4HALA 4MMYB 3QG7H 4XPTH 1T89C 4B41A 1YQVH 2QKSA 2ESVA 4XT1C 5E1GA 5GGRB 5E99L 1MJUL 5FB8A 3J7HA 4MGXA 3B2VH 3ESVF 4ZD3H 1C1EH 1MAML 4G7YH 4WWPA 2WB1A 1IGFL 2XTJD 3SE4A 4A2HA 3WLWC 1U8PA 2BP5M 5AYQA 3VW3L 5DD6A 4ZQKB 4X6EA 4KDTC 5LGUA 2UUAB 4DR3O 4YWGH 4IEFA 3WKMH 1QSFB 1A32A 3HPLB 5GW7A 2X0VA 1U6AH 3MUGA 3V0HA 5ICZB 3AK1A 5IQ9B 1JXFA 3OKYA 2PO6A 4J4PD 4KTGA 3WENA 2IIJA 5AVYB 4A2FA 2Q7EA 3GWKC 4DGYH 3BUQA 5BV7L 1PL4A 4JFED 4Y16D 2DEYX 3O3BB 3ZHSA 2Z4QB 4WNJA 5TH2B 2WXKA 4Y8AA 5IVXF 3ENEA 2EDJA 3MAQA 1JYXA 4Q0XL 1AJQA 1HX0A 1X7TA 2G5RA 5EO9A 3UBXI 2ZCLH 3MV9A 2XRAH 4F7CB 4MD0A 2EIJB 3B8NA 4GYBA 2YFOA 4IDLA 3LZQA 1B4RA 2OL3H 1B4TA 2FJSA 1T7YA 4HKXA 5AVSB 4O2BA 3FQUA 3RGVC 3BGFC 2VXTL 5AL8A 3D0LA 4LKXA 4DQOL 4U1NB 1UJ3A 3BVUA 2BSED 4GMTL 1KELH 4TQIA 4G6FD 3SSGA 3HAEH 3RX5A 1CGWA 3UAFA 2GTZA 2VN4A 4G70B 4HIEB 3S7GA 3ATEA 2LT9A 4GRLD 1KCRL 4U3JB 3IGAA 1XSJA 1FIGL 4JM2C 2IAMB 1A64A 1N3NA 3FCTB 3QQ4B 1CPYA 2YAPA 3VTAA 1E5CA 3A6CH 5D8JL 3K7UA 4Q6GA 1HVXA 4MA7H 5GISH 1Q8IA 1B88A 5C9JB 4NBZB 8PAZA 4ODUA 2QADB 2NUTA 1T83A 2R72A 2RQ8A 4XBEL 3HR0A 2R59A 2FHBA 4OZGF 1F86A 1SEQH 3OJ2C 1I9RH 1CIUA 3B7SA 5LCVH 5CD5D 5IWLA 2LLGA 4IOIA 5A2LH 5EULV 1OT4A 3UJTL 3B7YA 5IQ7H 1AZNA 4ODHL 1WHPA 5FCSH 3HKBA 5EF0A 4GKSA 1VFOA 5KVDL 4ZFOB 3GBNH 2H45A 5JLZB 3ULUC 3FT9A 3IS0X 5B39B 1J12A 1I9EA 2Y5EA 2VLME 3UTZB 1RI8A 3GB7B 2Q6AA 1ZSPA 3FCUB 4LSVH 5GGSY 3AUVA 4R3SB 3HNSH 4MYPA 3IC7A 1E4HA 1P2CA 4JVPA 2W0PA 5F3HA 4XP1H 4ORGA 2EDKA 2LGNA 1PP9H 2W88A 3AACA 4M8UA 3D85A 3QDMA 2CA3A 2Q6WB 3MACL 1TFPA 2GK0A 5I8EA 2Y25A 1VACA 5LBVA 3VWJA 4A2DA 4XI5D 4ODSL 2PPDA 2YJQA 3AY2A 1IC4L 2B16A 3BJLA 3P11L 3VH8A 5GRYA 1L0NH 1EPFA 5DEGB 5I74C 4FG6D 1QX1A 4L4TB 4ODVH 3FQXB 1EBAA 2FIRT 4JQXA 5EOQL 4J9ZB 3HG1D 2CO3A 2CTWA 1G7LB 4EI0A 4IYKA 1CT8B 3CXHJ 4ABWA 1IBMB 3AWEA 3HKZA 1H8SA 3P9LB 4PS4L 1ITCA 5KAQG 5HI3C 2CBMA 5C7ZA 3LCYA 4GXFA 4AQ1A 2CKBB 2WP3T 5IYZB 1LO3H 1NUNB 3MLTB 4GLRH 2HPTA 1X7QB 4QGYA 5DS1A 3I50L 2EYRB 4POUB 4TUKL 2XN0A 3FUFA 2VCOA 3D3VE 4P46B 4OGYH 1CE1L 4ADIA 3G6EV 1BREA 3IS1X 3S3CB 4FPPA 1FLTX 3CNKA 4P23A 1MVUA 2YSSA 3KPQA 3LQZB 3OAZH 4RNRB 1VA9A 4IHJA 1XWVA 4H5SA 2FJGB 3MJ8A 1JYVA 5DMIL 2IBZH 3KCXA 1CTNA 1IC0A 5JPNB 2FO4B 1I7TA 2H47C 1TQBC 1VQKV 3ASNC 2VAAA 2J6EH 1BYNA 1Q82W 2MPAL 3K72A 2BOBC 2HN7B 1G7PA 3RT3C 5FOBA 2BNRD 1U91A 2YD3A 4ZFOA 3GSNL 1H15A 2BOBA 4QRRE 4IU2A 3VMPA 1E4KC 1NIFA 3ZRXA 3QRFM 5CA1A 4MS8D 4X7SL 4FAAB 1H2LA 4J42A 3QEQA 2VDLH 2CH8A 1WZ1L 4A1RA 4HS3A 2AK4B 4OCYH 1U8HA 3L3HA 1PLGH 3OMNB 3NGBB 4LSDA 5E2VL 3U6XA 3B8YA 3ILPA 2M7WA 5CMUA 3FONA 3ATBA 3LNFA 4BIKA 4RQEA 5KYXA 2CH7A 3MRDB 3E8UH 3WFBH 4UQ3B 1UA6L 3ZXAC 1HXYA 2FEDC 3OD3A 4LARL 4JG0H 1OP9A 4PS3A 3BXNB 1FYTB 1ZLVH 2F8IA 1Q5OA 1E30A 4U6YB 2XT1B 3L4TA 1UOVA 3M07A 3PN1A 3MJ8B 2WBJB 5F71A 4E5XA 4BQ9A 5DD1L 4FHBD 4DW2H 4PJIE 5JPNC 4JFVA 2FAUA 1GSMA 3WOVA 5EC2A 5EU6B 3LH9A 5J2TB 3TCLB 3ZL1A 1URLA 4UQAA 3N0PB 2EQDA 4MD0B 2XQBH 3PV6B 2VUOA 4QOKB 4WKZA 1SYVB 1S3JA 3PDOA 4LBEA 3CFMA 3DGGB 1P49A 1MWAH 2WBXA 4E5XB 3T2NL 1TJGL 1QVGU 3T3PB 2LR4A 4C7UA 1NKOA 4TOYH 1ZLSH 3T6ZA 3V4VB 3D9AH 3OSVA 3T3PE 1NJ9A 1AGCB 2P5EA 4Z6AT 5EOCH 4U6XA 1ZTXH 2G60L 2DMHA 1QEWB 5JOFB 4R7NB 4MS8C 3TT3L 4XNUL 7PCYA 3ML8A 2IANE 1IE4A 1OANA 3VCLA 1FPTH 4NUJB 4RQQA 3V0JA 1OW0C 5KBKA 1TJHL 5KWYC 4HZLB 3LKNB 4N2GA 1Q9KB 1ZHKB 4Z95L 4J3OD 1HTYA 4DV2B 3MBEC 2GK0B 5D1XE 1G87A 3GT6A 3BFWA 4N6RA 3L3JA 4RMTA 2DQDL 2XQYK 3JXAA 2BJMH 4B3RO 4HDIB 4IBUA 1C12B 3SDLA 4IDJL 4MVRA 2HRPH 1U3HC 2PO6C 2VNCA 2Z5UA 4NZ8A 4TSCL 5D93B 3TWCH 2OSLB 3B43A 4KNTA 4QT5B 3O3AB 4NKIH 2ZD9A 1M57C 2W9LA 1X5YA 1U3HA 1QVOB 3CVHB 2WUBL 3V2AR 3VTTA 5BUAA 5KYYA 8FABA 1PY4A 4XZUB 1R3HB 2Z93A 3OAWA 3GXMA 3BSZL 1MRDH 4TYUA 3OD4A 3CC4V 4J9YB 2ITCC 3NTCL 2ZIMA 3OZ9H 3WB1A 3HZMA 1N2RB 4H5SB 3OVUB 5GTHZ 5TF1L 1YY8B 4Z3IA 5JHDB 5BCAA 5K9OB 4X1IB 1D2DA 3PY9A 1DEEA 1MOFA 5CLTA 5L2JB 3KPMA 1EM1A 3KZIZ 2P4VA 4HHAA 4KKPA 4P46A 3SDDA 5EUOB 1EFXA 1ROPA 4NZTH 4GW5B 1NM9A 3JATB 1QFUL 3NDZE 4KO6A 1HWGB 2RDCA 2H8PB 2VJ8A 4QR7A 3BQVA 1GY1A 4YDZA 3S37H 1YY9D 2CKBA 4MQ7A 2AAVA 2JDIG 3AU0A 1MLBB 4N2KA 4OM1H 4TSBH 2CR0A 5I15L 5C71A 4N26A 2UX6A 1ZL8A 3DX0A 1I85A 3OGCC 2FLMA 2AF2A 5K9QI 3IJHA 1KSRA 1KKDA 1WEJH 4KHXH 4N90D 3HG1E 1GOGA 2VISB 3N42F 2X4NB 3FPYA 2LTQC 3M86A 3QE5A 4K94H 5EU6D 2G2NA 3L1GA 2UU9O 1SYSB 5FW8A 3B6SA 2HEPA 1EVTC 1E4XL 3DX6B 3VYOA 4MJ2A 2D3LA 1QP1A 5I16B 3UDWC 2XZCH 1BM3L 2ZXAA 4S2SA 4L4VD 3D69B 1GH7A 1NANI 3VQLA 1GA2A 1FC1A 3OGIB 1CDYA 3L4CA 5KTEH 3HKEB 1TEGA 2H6UA 1EQWA 3LRLA 2OMUB 4R0LB 1A1NA 3QIUC 3ULUD 1WT5A 1KFAL 4S0TD 4ORGB 4PJEB 3B9DA 3NCCB 4NWUL 4NJAL 1NWOA 2LU4A 4PBVC 1ZIAA 2QPSA 4PRNA 2WQSA 4U6HB 5IJ9A 4XH2A 3R0NA 4JRYB 4WENB 2YSUB 4X8JB 1JNHB 4F7PA 3FO2B 2HJLB 4HPYH 3RJQB 2HTLC 2P80D 5ICZA 2WGNB 4GRWF 3UZVB 2HUEA 2RD0A 1F90H 2PCFA 2L04A 4P4RB 5DURD 4N1EA 1EXGA 3VXMA 5J0BA 3VXUB 2LE9A 3II3A 5HHVH 1F2QA 4AY0A 3E8HA 2CR6A 2H32A 4ESKA 1XF5A 2V5YA 1BJ1J 1HSAB 1PCSA 4G5ZH 3A0OA 4MXVF 1ZVSB 4MMZA 2BNRB 2C9QA 2VIRA 2Y1AA 5GS2H 1H6EA 4BCZA 2J3SA 2BIOA 1ND0A 3HZYA 1LK3L 2IGFL 5GTIZ 1NBZA 1KLUA 3SBRA 1RURH 2DQEL 2PLTA 1OP3H 4CH3A 3ZIAG 4I2XE 4UINH 1KIUA 4BCYA 1AGDB 1KB5L 2WBJC 4HEPG 2AJYL 2AEWA 1ERNA 4JI1B 3O3UN 1V55C 1IXMA 3A21A 4FQ1H 4NBXB 5J1AB 2P67A 1YHPA 1BQRA 2ZKWA 4JFFA 5JDJA 4WI0B 3R8QA 4LF8O 3DTDA 1TVBA 3MMEA 2XV2A 4P23C 4RMVA 4M7LT 3TIDB 3DETD 4OU3A 2OYLA 3GTVA 4M7LL 4NUMA 5EO9B 1KV3A 3ZQXA 3JYBA 2WO3B 1RUMH 5JJEB 4K8RC 3V95A 4NENA 4KHTH 2X6UA 5D2NE 2CDGA 3FYIB 3KXFA 2Z4QA 1OAKL 1PNCA 3EGXB 4F5CA 1NDMA 5DQ9B 2Q8AL 3WNJA 3G6JF 4X6CB 3MXVL 3S3WA 2MMXA 5DJXA 3WLWD 3D06A 2CBQA 2AAAA 1YSOA 3NJGA 1OXYA 4JLRB 4LNUA 2E6QA 1DSFL 4TOIA 3Q0HA 2GBTA 3TXQA 1II4E 3S3SA 1KYAA 4TLTA 2VN7A 4YX2H 3RZWA 3F58L 4GAGL 4E41D 1H5BB 2ETNA 4P2RD 4PJ9A 1KD1W 2FEEI 2RH0A 4XTRC 5DUMH 2I25N 1C5DB 2ENYA 1F4HA 2WLMA 2GAZB 4UNIA 1WQVT 2LV4A 4ZUUB 2F53E 2WZ5A 1A4JB 1P9MA 4N8VG 5F7WC 2J8UE 3AB0C 5FYKE 2F58L 1L0XA 1AE6H 4S1SH 4NCDA 1CTMA 3O2VH 3R18A 4QTHB 5EZIL 5GS3A 4Y4HC 5FKPB 3DPBA 3A6OA 1S7XA 4U1SA 1JXGA 4WO0A 4Y9CA 1H3TA 4L9LC 2QHRL 3BRCA 3MNZA 3LV3A 3PYCA 1KDIA 2WLYA 3A6BH 4I85A 1F41A 4FL4B 5C0IA 1OARH 4NKDB 2Y0IA 3G6BA 1PZBA 5E5LA 4GG8B 3RNKB 5I24A 4OQTL 2H26A 3CN1A 3IETA 1TGOA 2WZ0A 1J7VR 1XGUA 3QIBC 3C12A 2EH8H 2X12A 4QTIL 2H0EA 4NN5C 3UZQB 3W39B 4Z7AA 3BI9X 3BC9A 4KMTL 2BP3A 1A47A 3QIBA 1R75A 3Q7JA 1U8IA 2OTWB 3QCVL 3K6NA 5IB2B 2H7WA 5BJTB 1CLCA 1IC5L 3HUJB 2AQTA 4J3UA 3E3QC 5FECA 1LM8V 1AROP 4QHLB 2XQ0A 1E79G 2HLDG 4YSOA 3UPCA 3U36A 3WMQA 1ADQA 3EFDH 5L2KD 3FFDA 4BZ1H 1QSEE 4PLNC 2Q20A 3TS8A 1D5XA 4YEEA 4PJHA 2AITA 5JIMA 1W72L 4FFZH 4TLSA 1INEL 4M5ZL 2KLRA 2DKUA 2Z31B 4YBQD 3WFEL 4DV5O 5FECB 3NSDA 4MA8L 1TQCB 3BZFB 1MW0A 3ZQ9A 2YUAA 2JEUA 3H85A 1Z3GL 5BVJA 1JZFA 4PJCB 1P7BA 5JR1H 3ABZA 1AQDA 3AS2A 4TL4A 4ILDA 1BFOB 4JY4A 1NLBL 3F83A 2FX8H 1ZS2A 3HI1A 5K9QG 4LDOB 3LB6D 1BX2A 1MHPH 2QGNA 2FO8A 2P43B 4X8CA 3RNKA 3ULVC 5JHLA 3ZRSA 5FUCE 5CCHE 1KT2B 1RIVH 3F6JA 1QO3B 2WYHA 1NJIW 1AILA 4XBMA 4LSQL 1OD7A 5GXBB 3K03A 3KXFE 1HQRB 1HHHA 2WTPA 4W6WB 3SDDC 1ORSB 2DQHL 1XBRA 2F8OA 1ROWA 5HYJE 1QBBA 4DV6O 1NAKL 1SEBB 5CM1A 3X14B 1BD2B 2DJVA 5TK2A 4F15C 4X1KB 1KP3A 1ADQL 1QATA 4QAWA 4JQXC 3QZWA 1XHZA 4V2BA 4NQEB 3FH7A 3F5WA 3DRQA 2RGSA 1JVLA 4JFZL 5D7IA 3ISRA 3ZKQD 2EABA 2EXSA 3BKMH 2YN5A 3VJ6A 4DP8X 1GM8A 5CGYC 5F7HA 1IKOP 4NQVB 1M71A 4U1KB 2YPKB 1WWCA 4B3EA 1ZT1B 5I8KL 4FQ2H 1BZEA 3J8F7 3ULUE 3JTTA 4MJ6A 3RGHA 3V8OA 3GUTB 4N9GB 1U2YA 3Q13A 2V1DA 4JM4H 3I9AA 4DERA 4LCUC 3EH4B 5AD0A 1NSNL 2YQBA 4UT9L 3GPEA 2Z35A 5D2LA 3CC7V 5I76A 4FERA 4WWID 1YSCA 1NM4A 2IC2A 5CIPH 5DZAA 1TR7A 2Y7MA 1WJZA 3DVGB 5A1AA 4Y16A 1GTFA 4HXBH 2ZP0T 3E80A 1VPOH 1FORL 4V1DD 3QA3B 4QNHB 1P1ZB 1F4WH 4O4LA 2K1MA 4XVJH 3L7FB 3BAEH 3CFDB 3TO2A 3BVTA 4OCSL 2Y4SA 1Y66A 4PWGA 4JQIL 3U48A 3BEHA 1GJIA 2IDTA 4YIPA 2YD7A 4PJFE 1DL7L 3TF7C 1VDGA 3FPXA 4PJHE 3P4LA 2HKHL 5BVPL 4P0DA 2NDGA 5I6XB 2MK3A 4XPFL 3FN9A 3QO0A 5LDUA 3FU6A 1KBHA 3D5OF 3L7EA 2LU5A 1T4WA 3IDMB 3RG1C 5KJRH 4XN9A 3IXTB 3U1SL 3WFVA 2OYMA 3X1EA 3QRGH 4F7TA 3IKKA 3DOSA 2VQFO 4PGCB 4RFNB 2OIGA 1E5AA 4FQXC 4LF6B 2IPTL 1M1XB 2CIKB 1Y6MR 3EFOA 5FUOL 5LWYH 1FL5A 1OM9A 4TV8A 4G9DB 5G5DA 2NY2B 5T1MA 4AL8C 2EIKB 1U8NB 2K9FB 1P5VB 3DSFH 5DHVA 4DEPB 2E9GA 5I1IH 4EO5A 3US0A 4E42B 5GRWA 2AW2A 1T7XA 3BPOC 4L37A 4Y4HA 1ZA6B 1Z5WA 1DCEA 3GI8H 3N1MC 4JGUA 3KLSA 1PPIA 4PJEF 5C0AE 4NQXB 2PCFB 2AQ1A 4P4RA 3ZDWA 4RMRA 1F58H 4YN3A 5C0EB 5DJYA 1N0XH 3DIFB 4JPWH 3AM8A 2AEQH 1E2WA 3OSKA 4AILC 2JELH 2R2EA 3P77B 3VG9C 5LAXB 4L0YA 1YNTF 4JY5H 1LEKB 1BFVL 5DYFA 3S98A 5BXFA 1RP8A 4PV8A 2OMUA 4G9FA 1JDCA 4TNGA 1NCAH 5E1AC 3ZHDA 4BM7A 5E2UL 4GP8B 4R7CA 4Y89A 2AQSA 2XPGB 2IH3A 3PP4L 4PRIE 2BVEA 2NT0A 3OR6C 1BVNT 5KA5A 1HAUA 2X4TB 3TFBA 2CTQA 1K4CB 2RTTA 4S1RL 5C09D 1UWXH 4HQQL 4PJ9C 4XHJD 4YY3O 2JXMA 3I9PA 4PVMA 3BUBA 1IAOA 4ZW3A 5J6HA 3JARA 1EJOH 3I6LE 4U1LB 4OLVH 4JY6A 4WF9V 2I60L 4Q58C 2PCXA 3KR3L 1MLBA 5K1VA 1NCDH 4DTGL 5BV7B 1J0YA 4ZD3L 1IGMH 2YXLA 3I84A 4PAZA 1UADC 5CUSH 4CNIA 5E6IC 1HZHL 1YEDB 2PTTB 4IGBA 3O41A 4OI9A 2OULB 1U2CA 3HBPA 4HMDA 3MR9A 2BW5A 2WCSA 5E23A 4ERSH 2Y0SA 4X62B 1ACYL 1Y76B 3LRGA 4OLYH 2XWRA 5BXZA 1C08A 3CFNA 3ZR5A 3VVVA 5TQ2H 4L3ED 5IB1B 4Q2ZB 2ZDIA 4BRJA 3L5XH 5T1DH 2VW6A 1JZ3A 2AXJA 3QIWA 1TLMA 3CFCL 2LLLA 2ZCEA 1AHWB 2ZR3A 1UWGL 1LQBC 2GUYA 1BHAA 3KVPA 1CXHA 4NTYA 1FZJB 3IMVA 4O4YH 3SJVE 1XNRB 3VRIB 4JO2H 3PQYB 5DYOA 3ESMA 5DFVC 3N04A 3G80A 3DOIA 3ES6B 2Q1EA 4D8PA 1OV9A 1A7QH 3GSXB 3KDMB 1B4JL 3Q1SL 2A9NL 1INQB 1T5XA 3BN9D 3I3DA 3M8OL 1OAJA 1IEAB 4JO4H 5EC1C 4YBLC 4AITA 4XMTA 3GB7C 5FOJA 3EHBD 3A3YB 1NEPA 3M88A 4MMXB 4PQXA 4QHUB 3CHSA 1IFHH 1SUHA 5F7YC 4YY3B 4QRRD 1M4UA 2BCMA 1BAGA 4BINA 1PY0A 5FHBH 2V3FA 2CM5A 3S5LA 3AG7A 2WNWA 4HZLA 3EDFA 4YDVA 2XWTA 2WLKA 1G9HA 4Y4FA 4HJEA 5KHGA 1VCBC 3QEGH 5EF2A 2K3TA 4MNHB 5IB5A 2F19H 2F5AL 5F3FA 4UUJC 1W6WA 3W1ZA 4AQYO 4X4ZA 3GI9H 4HKBB 3P4MA 4OLXL 1ZJBA 4GP4B 4H1LA 2ZUQB 1E43A 1HHJA 2CR3A 3BVWA 2QLVB 4XCCL 2JIXD 2WMPA 2P9RA 43C9A 3BJ91 4C47A 4QRQB 1BWWA 2GC7C 4UTCA 3ETBF 1AZCA 5JWPA 3CDCA 4JAMB 4WLCA 5B8CA 4RAVA 5SWSB 4ZMVA 3R7RA 4EIZC 2Y3NA 2DJUA 2OMYA 1HHJB 1G8MA 2ZE5A 4XNDA 2R9AA 5LGKA 4Z7OF 1GRJA 3BWUC 2QSQA 5FW7A 1OSYA 2VITA 3AABA 3MNVA 4FXKB 3NH7L 4TNWF 5IQOA 4ZOEA 5IVOA 3MUY1 3Q5OA 3RDJA 3ZE0B 2MNWA 3P30L 1R24A 1ZHLB 3EO9L 3QNYB 4UZGA 1AD9A 3QEQE 5CILL 4OZFB 5C8YB 2VZOA 5E8DH 1I1CA 5DJAA 5T1MB 1WWWX 3D2UD 4XP4L 2OZNA 1E9PB 2Y6SC 3LNEA 1FVDB 2WLNA 3CVHH 1JK9B 3WU1A 2VLJB 2VLJA 3MLXH 4G8GB 4C58B 2W0FB 5TTRA 1D3CA 4Z1PA 4PIRF 3Q44A 4JO5A 1TETL 2NUPA 5LHHA 2BVQA 2UWEE 3RWGB 2LO1A 1B3IA 1ZGLB 4G3YL 1P53A 1MQKL 1T03H 5C7XL 4X80L 1P6AB 4JL2A 4N22A 2AJXH 3ZR6A 3VGGA 2NPLX 1V7NL 3B37A 1SM3H 3MZTA 4WEUD 1NFIA 1WZKA 1MVYA 1XV8A 2YICA 2D0HA 2J8HA 4RWYH 3VRLF 2QT6A 4XN8A 1D9KA 3EYUL 2VR9A 1JCKA 3PWNA 4LVNC 5DEDA 3FQRB 3I02B 1JZEA 3REWA 3JT0A 3KPRB 2WN2A 5L2KA 4OX9O 4MAUH 1LO4L 3J07A 1VENA 5LA6B 2NQ3A 3QP3A 1ZPUA 4V33A 4GKOA 1OGTB 2DD8L 5GS0C 2OSWA 5LDSA 1E7UA 1REIA 5DVPA 2ZKYA 5IMMB 2ATPB 3U0TB 4OF7A 2YGOA 2NNAB 2X9XA 4XMKL 2HX9A 4N2AA 4KMQA 2Y4TA 2X89A 3QRBA 4JFQA 4CMMA 2R69H 4R4NC 4GLXA 1CGUA 1RVFH 4Y1SA 4ALAL 5FYJE 1UM4L 4OKDA 3MQIA 4GT1A 4JHAH 2QM7A 4ABMA 3TA3A 3K9SA 5E5RB 1JYWA 4AIEA 2KMWA 3RWIA 4E9YA 2AANA 1NGZB 2ZIOA 1T1WB 3I6SA 5IV2A 4OI8A 2F7QA 1CXFA 4A2GA 1J8SA 3WB0A 3KYMA 1FF5A 1OCRC 4FFBA 2AK1L 2XN9D 1K4CC 2XXMB 3MRNB 3ARDC 4NTXA 1HDJA 3ARBA 5IBTL 3UTTD 1MIEL 5AENA 4AGNA 5ICUA 1FO0L 1P9MC 5J11B 1JAEA 1NGPL 4MNQA 1UFGA 2N7BA 1VHPA 4QXGL 4H13B 2VN6A 5ACMA 3GTTA 4ZMAT 4TQEH 3C90A 2G3XA 2G2RB 3KH3A 1BVLA 3VWKC 1QLEL 5FYJH 1TPXB 4PWIA 1YG9A 4X0NA 3DO7B 4CVZB 2WZ6A 3CQPA 2Z3FA 4JCWA 4LHUA 5J1SC 1AI1H 2MCMA 3V6FB 4IGBC 4KX9A 1DGSA 4UB8Z 4UV9A 1FG2B 3QQDB 5EF1A 4PI2A 4JFTA 1OPGL 1U9KA 3TZVA 3WHE0 2F4VB 2VDKH 4JI0O 1AXTH 1MAKA 2CK0H 3HI5L 5F89B 3VD7A 1WFUA 3AREB 3GSVA 3MCLL 3L4WA 5EEYA 1DP0A 2YUVA 3ETEA 1W0VA 4B97A 1U42A 1LNUB 1KCWA 4IU3A 4N2DA 5F9DC 4I4TA 2CRYA 2JFCA 3HI1B 4Z23A 2E27L 4JPRA 1ONQA 2B2XH 4JHUA 4LAQH 4FQQA 3GJFB 4OJAA 1YQ2A 3HE6D 1JGUL 1NAML 4Z78A 1ZLVK 3KS0J 5E8PA 2ZE8A 3TONA 3VI4F 4PV9B 5CCGE 3VXSE 1Z1WA 2FX7L 1ZAUA 4GIOA 3ZKMD 5GS1B 1SXZA 5JORA 4X88A 4ZS6C 3ZMRA 2IH1B 1RMFL 5ELIA 4PI0A 2C1PA 4Z7OB 1AXSB 2X6AA 4LOEA 5EORL 2XNDG 1S9XA 3VNZA 3F01A 2JGDB 1SQQH 1IU1A 4HJTA 2JS5A 3HE6C 4IYHA 3SOBL 2J73A 4LVOB 4ACPA 3ABUA 5CJQH 5DD5H 2IH8A 1L4IA 4FEIA 4Q9RL 3DO3A 2BSKA 5HI3D 1IGJB 4MJ5A 4EI5D 3DYMA 1MAJA 1MCOH 2A6IA 2DMGA 4YMPA 1J0ZA 4K9EC 2C3GA 3MRMA 4BXSV 2EYSA 2V5SA 1JPXA 1DFXA 3DVGA 1N19A 3GLDA 4I0KA 1OAYH 4EDXB 5IWAB 3WU2Z 1E1RG 3IAPA 5CBFA 5D2LB 1CFQB 3ZDYB 3QO7A 1HWHB 1OSPH 1KWGA 1BVOA 2Y0PA 4NPYB 5C0EA 5HI5D 5CEZL 1QU7A 1XR9B 1JNNH 4YGAB 2HT3C 4DV7O 5F44A 1NL0H 2V8LA 3BKYL 4WFEE 4CVXB 2ZKOA 2A5UA 3CZFA 4XAWL 5JUEL 1S7XB 4WFAV 4U7KA 5ENWA 2ZJSH 3BP6B 1KJMA 3WUWB 2RBLA 3LPPA 2KG7A 5B5EZ 1FAKT 2V8MA 2LU7A 4OF5A 2O1AA 3ZU8A 3IDJB 3KNBB 1KB5A 5G4MA 2XJKA 3QFJA 1YC8A 3L17A 4N2OA 1TUEB 1A8JH 4PTTA 4FA6A 1BLIA 4LBEC 4KVNH 4L4VB 4GS7B 3KCYA 4RZKA 5A7BA 5LKNA 2VR6A 2GBVA 2ZNWA 5BZDA 1K73W 1KCUL 4KUZH 1DJYA 1P4BH 3TGXA 3H7BA 2V5MA 4JLRA 1XTLA 1HL9A 1MHHB 3JAKA 1LQSR 3CIAA 4F7EB 3RDTA 4FLVA 5I2IA 2BCKB 2Q2EB 3TF4A 1ECYA 4RO2A 5I1HH 1Z6JT 4UDUA 1IB5A 1FV1B 4M1CC 3IJYB 1T5KA 3SYCA 1JYNA 4Q9QL 3UG3A 1OTSC 4DGIH 1G6VK 3A2FA 3LKRB 3SDXB 2CLZB 4X20B 3MA7B 3OHXA 3UJJH 1Q43A 4AEHL 4NUGL 4YSDA 1NKRA 3U4EB 2BNUA 3T8XB 4CSPA 3MRRB 3QORB 1D5XB 1JV5B 3DHJA 2P8MB 3O8XD 1EO8H 4LF9B 2Y7NA 3T0EA 3O81A 4G80A 4ZXBA 3K81A 2WXRA 1J1OH 2FATH 2O30A 2I27N 3IJSA 2X6MA 3I55V 4DV4O 4ZAKD 5HPMB 3QDGD 5T33L 5D5PA 2OCCC 1XGUB 4ZIBA 5B3JF 2CO6B 4G1EA 1BD2A 4DZ8A 4M62L 1MFDH 1LILA 4PJGE 1A02N 3P0GB 4J3WA 3ZT6A 5HDWA 3A23A 1L7TH 3WTTA 4CC0A 1JRHL 2Q9LA 1A25A 2ZWSA 2E8ZA 15C8H 4EBQH 3VWJD 1PLCA 5DUJA 5CMAB 1E90A 5E5MA 3BT0A 2DLHA 3TO4A 1BS3A 2NXYC 1B6UA 1YEHH 5AZEL 3EYQD 5D6DA 4AQ1C 3GD1C 4Z3HA 3EYFA 1AACA 3C5ZC 3OC5A 2PP8A 2UY6B 2UY6A 1NPJA 3VFGL 1XBLA 3NP3A 5CA0A 2KT6A 3MVSA 4OFPA 3B34A 2EJ7A 2AJUL 1AJNA 1BFOA 4JZNB 3ZT5A 2DM7A 3GEFA 3RBZA 1KLFB 1JFHA 3BWUF 5CMAA 1HT6A 5D2NB 3GBDA 5B7FA 2PTVA 4L4VE 5L4IA 5I5MA 1ZLUH 3JD1A 1A6UL 1JPST 2Y7QA 3MBXH 2AEPL 5A6LA 2MNUA 4FA7B 4UQ9A 4ZW6A 1CLYH 4PBWD 3P9MB 1QKZH 3SPVA 4Z5RB 4ZMZA 2E9IA 4HJUA 4DR2B 1I8IA 3IDJA 4XWOC 2XUWA 5BUGA 3UZEC 1VKXA 2XWCA 4PD4K 2HVBA 4OF8A 2XG4B 5IUCA 1ZHBA 3EF7A 2YA0A 1A7NL 4M5TA 1BG1A 1K5NB 3MBED 4U7NA 4AVJA 4UCRA 2CSPA 2V7HB 3GMQA 4PWKA 4B50A 2BNQD 5DVMA 5B22A 1N34O 3N2JA 3K79A 2IFGA 4S1QL 4GRLA 1I9IH 1IBLO 2D03L 4I2XB 3ABTA 2PPCA 4JYAO 4PGBA 2IOIA 4GQRA 5C07A 4GRLC 5B3SB 1AG6A 2IO5A 3VI3E 4JASA 4TUOA 3TCXA 2HYMA 4KAQH 3BUPA 1OB0A 3QYNA 4R83A 1GZHC 4M1GL 4WI4A 5JXEA 2HT2D 4GKLA 4Z7WB 1NFDB 2K7PA 3JWNG 1JCHA 1Y7VA 2LOEA 4B3TB 5FL7G 1KIPB 4HETA 2J5LC 4JI7O 2P24B 4MVOA 3QXUA 2HH0L 3G6JA 4LPVA 2UUAO 3P3TA 2F1MA 1N64L 4QE7A 1MHHA 5DC9B 1U8CA 1ITBB 5JYMA 4OGZA 3W7XA 1Q9WB 1P7KB 4W9KC 4N68A 1BZ7B 2C1PB 5EZLB 4NHCL 4HJ0C 3LS5L 4BWAA 1WZMA 4UOZA 4TULL 4Q89A 5C93A 1MCLA 3UEZA 1IBBA 3ME0B 4OZ4A 5D1XD 2NDFA 4UF7C 5LXGL 3WFDL 2CHWA 5I23A 4PDMA 1FE8H 2XCMC 2NY1D 3V5HA 1PIFA 2QDVA 1I7UA 5DVKA 3SY0A 2XQYG 4KZDH 2R0LL 4WSJA 2IWKA 5JIDA 4ELKB 3MJ7B 4AEIL 2VXUH 1Z3RA 1WFTA 2P22C 3PGCB 4H8UA 1E7VA 1RY7B 3QJHA 4D9LL 4KHPB 2X6CA 1BEYH 1BZ9B 1D5ZB 3RVTD 3NZHL 4PD4F 2CBOA 1O6SA 3VXME 2DMBA 1M7XA 1OW0A 2CZNA 4Y5XB 1K8DA 4U1MB 3PHAA 3DUSA 4YHKH 2QWNB 4JZGA 2MOVA 3MI6A 4X6DA 4YLQT 1AKPA 5IFAH 1LJMA 4X89A 3S3PA 4L8CA 1NGXA 1B04A 3C5SA 1HR0O 1GKOA 4P9MH 3LAFA 5AAWC 3TVMC 4NT6B 1FJ1B 4O2AB 1CFSA 1VF5C 4YEFA 4JE0A 1SMDA 1ROCA 7FABL 1YF2A 3QCTH 2GJ6D 1HAWA 1KYOK 3VFNA 3DO7A 1DBBH 1QRNE 2FSEB 4B9FA 2AFNA 3D2TA 5AALA 4FZ8H 2X28A 1S7QA 4H2AA 4UCSA 3DX8B 3FH5A 1UZ6E 4I50A 5D71L 2OR9L 4F58L 4KO9A 2EO9A 1FUNA 4LVOC 2JK5C 3LDCA 3SE9H 3WSQL 3U4BL 1NC4A 2JWYA 3OKDB 4LVHB 4ZXBB 3SD5A 4KK9D 1RZ7H 1BVKB 1BZQK 3SPIA 3JZYA 4Z1MG 3SDXF 5AVVB 1A5FL 2F08A 3TA3B 5JORB 2GTWB 5JH7A 1R3LB 2OA9A 1O6VA 4XAKD 3UEQA 1MDTA 2BERA 1G4MA 1ZVSA 4MMZB 2X0UA 3STLB 2XA8L 2G5BA 2BSTA 4F57H 4JZJB 1YPZB 4C56B 3BQUB 1J5EB 4KRPD 4JDTH 4XNXL 4FLWA 1OP3K 1KTDA 2XIDA 4FG6C 3H8NA 3ARUA 5L7XH 2V2XA 4HZAA 3THOA 3X3GL 2HRLA 3D3IA 2H1PL 3H2QA 2N7SA 3ALXA 5BZZA 5C3IA 1PV0A 1OGAE 4OZIF 1JNHA 1H6FA 4JDZB 2VAAB 1U4FA 2PPAA 4FX5A 5KVGE 1XAUA 5IHUH 2H2PD 4FZEL 5I18H 5LGHL 4EIBA 2C1OA 2X1OA 4O02L 5CU9A 4EOWL 5BO1L 1KXVC 1TFHA 5B38G 2UY7B 3ZUCA 2VXVH 3IPFA 3D69A 3R4DA 2EYTA 4IHOB 1GN4A 1XVSA 2DLFH 4UUJA 4QOKE 4O2FB 3P30A 3V0AC 1CK0H 4CVZA 2FO1A 2OXHA 4I9QA 5F6HJ 3SQOL 3NA9L 3GUFA 1GGCH 1N5AB 1NC4D 1ESOA 4N20A 5IYZA 1KG0A 2VM9A 2KG7B 1T0PB 4JAUA 2P48B 3KM1A 4AC4A 1EHXA 1JZIA 4O4HA 2H41A 2WYZA 2X9WA 1TYJA 1UC6A 4GUOA 3V4VA 3ASOC 1AR5A 3CZFB 1S76D 4RFOH 4DN4L 2OI9B 4LCCC 1DFBL 1QPPA 2IV8A 3DGGA 2Y23A 4AKPA 3EYSL 4D7BA 5CAYB 1A1MB 3LPGA 1ZK9A 1HHIB 3APQA 2CPUA 4LEXL 3CDGA 2XSKA 3FT2B 3GMMA 3VFRA 3HS9A 2Q68A 3M17B 4XMLL 3GGWA 3UYRL 1A6WL 4HLJA 3TCLA 1RXLA 4AYDC 3CFKB 4RRPG 2D9QB 1PZ5B 2EJ1A 1LO5B 1CDIA 2X9YA 3MCYA 4OUOA 4M93B 2HG5C 5ACZA 3FFCA 43C9B 4FYQA 3IVKA 4PRDA 5E1HB 3V7AE 1DDTA 1WCBB 3CSYA 2IFFH 3H3BC 4ZXBD 3AAZA 1HXYB 3TEUA 3LH2L 4N2EA 2XOKG 3VQYA 3F6LA 3NIDB 1QABA 5CINL 3VFSB 1HC1A 1R6VA 4JKWA 4J3BA 3TK1A 1W9XA 4HS8H 2Q5ZA 4DK1A 3PWNB 2UXBB 4KU1A 1T80A 4NO3B 4D2NA 5I0WA 4HT1L 1N4XH 2AMUA 3SCMB 1RK1B 1TJMA 1WA1X 4A2MA 3HKBB 2DBJA 4GT7A 2FBJH 3GSNB 3UBXA 3WLBB 3TJTA 4Y16C 3BGAA 4FG2A 4NS0A 5KVGL 4IRJA 2D7PA 4HJSA 4U6VH 3F7LA 4K23L 1I8LA 1Z2GA 3AS3A 1EAPA 4L4TE 2CK2A 3F65A 2NUPB 4DGVH 5HVHC 5MP6H 2VMEA 1ACXA 4BFFA 1DQLH 3MOBL 4P8QA 2VXSH 2K6ZA 2ZUTA 4Y2DD 4IU3B 3KPOB 3V0GA 5GGTL 3MJGX 2ZXDA 4X5QA 4R7XA 5KYUB 3AAZB 4RRPM 2CA4A 4L29A 1WZAA 4RIRA 2R29H 4EN3C 2I85A 2YKLL 3D4YA 3CXDH 3QG5A 4QIWF 2WYTA 4QYAA 3STZB 2I32A 4EI5C 4CSZA 1P84J 4XPAH 3E22A 4X4YA 2QSCH 1TU2B 3J80N 4BSVA 2NNFA 2HFFA 1RU9H 3WO4B 1ZLWK 1WAPA 3BH8B 2H3KA 3PE9A 4GQ9L 6FABL 1ZWIB 2ADFH 3ULVF 1CG9A 3KEDA 3HFFA 4ODXA 4AV5A 1N10A 1TMQA 4H26B 5D70H 1AI6A 3RUGB 4LL9A 1MFEL 4L5FH 4CH5A 3N1FC 4HISA 2PWHA 4WY7L 4JFEE 1W0JG 3CCMV 2Y07L 4OLEA 5CLYA 4XNYL 1OHHG 2DKSA 3O8XB 4RMQA 3MRPB 1RIUH 1AS8A 1FYTE 4K7PL 3OQ3B 1KYDA 3QHTC 5DJDA 2QZ5A 3UQ8A 2IPKA 2OP4L 4NYLA 5T3XL 4UZUA 3RUGE 2UWEB 3BKJH 3CD4A 4IM8A 4BSJA 5J06A 2JI3A 1HHKB 4O58H 5E8NB 3PWLB 4A67A 2CBPA 5D7JD 5AW6B 3VGAB 1Y6NR 3T8MA 1FXKC 5D1QC 2NY4D 3MFFA 1AJ7H 5D2NC 4N5EC 2FUTA 3ZRFC 2VLRD 2GIXA 3UYPB 25C8L 4IRSD 4JO8A 4YO0A 4AUYA 4DP1X 5DK2B 3K08A 3QEQB 3INOA 5KBPA 4QHPA 2E76C 2ESVB 3AS0A 1BBJB 1S7RB 3CFTA 4A6YL 4LRNL 3OE7G 2VR4A 2DDQL 3NEOA 4R90H 1BZOA 1HE8A 4UCTA 3Q6FA 4YJ2B 2AXFA 2PP9A 3K2UL 1CR9H 1QZNA 3JWDH 5GSRB 2NXYB 3ZTNL 2ZKHH 1AHMA 3FAVB 3I85A 5DMGD 3U83A 3MU3A 2HX8A 1IAII 1T66C 1JHTB 2BLFA 2QADD 3LNGA 4BFBD 5B3JE 1NTDA 1WA8A 2QQKL 4RLDA 4PJDF 2XKSA 3DETC 3LQMA 3IE4A 1ZPLA 4MTFA 1H3PL 3IDGB 3CC2V 4G72B 1I1RA 4DR4O 3AQYA 3MX0A 2XWZA 4K9EL 5E4EC 4LF8B 3NZSA 5FO9B 5DK3A 2X6VA 4XRCB 2E7LC 4IBSA 1QUNB 5LXTA 5ITFB 4MD5B 4LOVA 5F93C 3ZDXF 4CDGC 4UTAL 5I6NA 5E08L 1L9NA 4MTXA 3PQYE 2OYKA 2WXHA 3OKEA 4NM8L 1YHQV 4JANA 1BXUA 2VDOL 4YUEL 5I19H 4HAKA 1P7QB 3KCWA 3OAZK 2WKGA 4FQJL 1HL8A 1TTCA 3IFNH 1KGXA 3IDMA 3JVGC 5FA4A 4PB0L 3U2JA 1DQIA 5EU7C 2G38A 1MF2H 4HJGA 4QF1A 3V55A 1BHGA 5DO8A 2QR0A 1QI3A 3CSPA 4OFIA 4X4XB 1OTTD 3FUEA 1CUOA 3N41B 3BCCH 3DLQR 3CDZB 2KZ1B 2EDTA 5LGTA 1GCYA 5AG8A 5K9KA 3RHWK 1WFNA 1HNYA 4RAVB 3D85D 4UOJA 4L5FE 3DTXA 4QJ5B 4KJWC 3KWVA 2OMXA 4LRIC 3WTSA 4BIZA 3ARBD 3LZRA 1H8EG 2XPZA 2X87A 3OF6A 3WFHB 3RI5K 3OR7B 5FIEA 1Q90A 1P6FA 4JO1H 2C9RA 1HEJC 2YQ2A 1G7JA 2NOYA 3JUYA 1T04B 4JVUA 5B39A 2O5XH 2JJSC 5KYNA 3DMMC 4NSKB 1OSEA 2FD6L 1OHQA 4MJ6B 4FZ0A 1XGZA 1HNFA 4N24A 1UB5A 2F53D 3D30A 5H2BA 4LQFL 4PDVA 2J43A 2KPWA 1TUBB 1JPSL 1HINH 1MJ7L 1RZKH 4MA1B 1C5CL 3SCMC 1SLXA 5I1GH 1S9WA 4XO8A 3MRGA 1IT9H 3SPCA 2Y72A 4L3EB 1EAOA 35C8H 3C5JB 1LEGB 1T7ZA 1JJ2U 2HT4D 3O6KL 4CW1A 5IW6A 1BVZA 1GYWA 2IJHA 2LP7A 2APFA 5GRJL 5FUCC 1J9RA 3DI2B 3L5HA 5GHWL 1N7MH 5KVFE 5HHOB 5I1KH 4HC1H 5KSAB 4TF4A 2VMJA 5IREA 3QR0A 1W72A 4TWKA 4XO3A 3BAAA 4WFHA 4KK5C 1DBKH 4NQDA 1IBGH 2HVJB 2P5WB 3FOLB 3V0WL 1U8OA 2YN3A 1F6AB 4NIYE 3UO1H 3KW7A 1K3ZA 1B0WA 2KQXA 3OT7A 3VRJA 4GI6A 4DH2A 3HAEG 3ZE1E 1QFWM 4NQCE 3QG6A 4MLSA 4AJYV 4PJAF 1QLNA 1G1YA 1GSKA 1DQVA 5DHYA 4CBPA 5BRZE 2ZICA 3WIHL 4N2FA 2ZXEB 3QJUB 2A0LD 1MCWW 2FVNA 5DHEA 1OCZB 1JMKC 4NKOA 4OFVA 2GIMA 3T0EC 3RFZB 1MCBA 5AWNH 4QKXB 3MV7A 2JEXA 2FB4H 1Q90D 3MUZ1 3DSQA 3LRSB 1HNXB 4J8RA 2XXGA 3HE6B 3E2HC 1E4WH 4OJFH 4DP6X 3WS6A 4KKNA 5CEXA 4PV1C 2Y69B 1KTLB 3QDGE 4KVCL 5EU3A 2WAQA 2AJVH 3EHBC 1OOWA 1RJLB 4I88A 3FQNA 5T3ZH 5FYJU 4TMPA 3DGEA 3CLFH 4UTBA 1Q72H 2YRBA 3FFDB 3VACA 3RL2B 2CO7B 1ZEAL 5F7NC 5KSBE 3OR7C 3SQRA 4Y1AE 1HDMB 4F6RA 1U8PB 1PYWA 2YIAA 1X4YA 4K3GA 4HUXB 2C5DC 5F1KC 3MLUH 1DO5A 4LXFA 2MTAA 4H40A 5HYJA 1K8IA 1LEKA 2JTDA 1PZAA 5K1JA 1T6WA 3AXLB 5CA0B 4ZUVB 1OALA 2ZNIA 4DAGL 3QEQD 5MHSD 4PJFB 1LGVA 5CGTA 3ARPA 4HAGA 3K71B 3CV5A 3BISA 3NN8A 3SOTA 2IQ9L 5T1LB 2WLJA 4Y4FD 5F1IA 4WTWA 1DDHA 3F85A 4KK8C 4KXZH 3DX7B 3RWHA 3QR2A 1FNAA 5KSBB 2EXTA 4ZQTA 4X98A 2QQLH 1RM1B 1NQBA 5IT2H 1NCWL 1BX2B 4P2CG 3EHBB 4QRFA 2YK1H 5I9QB 2HLAB 4JREB 1XH0A 1FFXB 4XN2A 1ANUA 1G84A 4KDVA 2X5PA 5D7KD 3ZL4L 2R0WH 1CF8H 2VXQA 3CVIL 1YN6A 3DV6B 4E9XA 2PW2A 1CDJA 2QDOA 2F6AA 4XNMB 3A67H 4OGAD 4MDJB 1NFDE 4KNSA 2P8LA 2HT2C 2MCAA 1TSRA 2X4PB 3F7VB 1E6JH 1QWNA 1T2JA 4LU5L 5D1QA 3VO0A 5IESH 4IRSA 3VFUA 1H8NA 5CSZB 5KSUB 4LSTL 4P4KA 4XWGH 4D94A 1X5GA 3POHA 4JFPB 4P05A 5FS5A 5DK0B 4EKWA 3FU0A 4AK1A 4E5XG 2KZBA 3I6GA 4KV5E 4F93B 5EU3B 1DLFH 4WWKB 1IL1A 3IU4L 1MABG 3MYJB 5DQ9A 1A9EB 1Q38A 1ZA3A 1R4XA 4FLRA 3MZGB 3FC8A 4IIJA 1XZ0A 1VQPV 2QVIA 1OM3H 2WVSA 2MIZA 1KU9A 2M8XA 4G8IB 3ZCCA 4H8WC 4K3DH 4MQXD 3UTTB 4AL8H 2AKRB 3TN0B 4K7FA 4MVQA 3EIFA 2YC1A 1RSOB 4WI8A 5D1ZB 2ZT9B 1MCWM 3TV3H 1YZBA 3O4LE 5I76B 3VH8G 5EF3A 3B1UA 4HS6A 2WPGA 2YDEA 2HJFB 2QTVA 3SQBB 3ZKMC 2ADQB 3A22A 3ZSTA 1B2YA 3MV7E 4F2EA 3GLAA 1GH6A 4P3DA 2PYED 3CMOH 4MA1C 5EUOF 4RMSA 1LDSA 2W0XA 2R1XB 4LSUH 4MZ2A 4JFFB 3VRJB 1JNJA 1JGIA 3DVNA 4QYOA 4ANXA 3EJPA 3HTLX 3P0YL 1HH6A 4QRPD 2Y5TB 5KYWA 4X62O 4L3AA 5DURB 5HHPA 3QEUB 4Y2NA 3ATAA 3FB8A 4HULB 2VRZA 2VXQL 3GSQA 4ANUA 3JASB 1FBIH 5IMOA 2V9UA 3FQYA 3T0BA 3ESUF 4HD9A 4GI8A 4NAQA 5F7BA 4KI5C 3BP6A 2YIBD 4JPKH 3Q2NA 1HEHC 2OW6A 4MJIB 5D72H 1ZLZA 4QXUH 3LEVH 5F7EH 4AMWA 3TVMA 5AAWA 4LPWA 1H5BA 5LUMA 2GSGA 5D7EA 2W60B 1A6ZA 2GUZA 1QHTA 4X8AA 1JOIA 4H20L 3S96B 2CPCA 4TQHA 3EO1B 3V5DA 1DQML 1AY1H 2WKOA 1SDDB 2Q3XA 5HYQA 1KJ2L 2D7TL 4A6YB 4QGPA 1DN0B 1TQSA 1FGVL 4H44B 4WU5A 5DS8B 5D1ZA 2CGRH 3NJVA 3WFHA 3FHQA 1FFNB 1ED3A 3ROLA 1KTLA 1HNZO 5T5NF 4U7OA 1IAIL 2OTPA 4NNYA 5IG7A 3KLAB 3UBGA 1RZJH 3D09A 5T1KD 3WGVB 1I1AD 1N8ZA 5DZJA 1MNNA 2BC4B 5TDOB 3BDYH 4DKFL 2Q67A 3D25B 1XCWA 4LWSA 2JJSA 1Z9LA 4LEOA 2EIZB 2ZYRA 4NXKA 3QXDB 2APWA 5CJOH 3X11A 3M1BA 4CN1A 1JPTH 4MQXC 1PX3A 3B7TA 2XN9E 3IGAC 2WNKA 2J20A 4N5UA 5MEPB 4JM0A 1I8LC 5L0QC 5B4MC 4NR1A 2PR9A 2LQTA 2NRDA 3H6AA 5I1EL 4Z3JA 2JCWA 5BQDA 2BHYA 3GO1H 3T4YA 4ELDA 3BP7B 2OJZL 1AGDA 5GONB 4XC3H 1AXIB 3GJFA 4GIPD 1OP5K 3C08H 4H0LC 3W5NA 5LXTB 5ITFA 1EFXB 1FDLL 3K59A 5SX4I 4Z7IA 1BF5A 3T71A 3D8CA 4WKXA 2AERT 2Z91B 1UM6L 4CRPA 1HSBB 3ARED 4PUBL 3LH8A 1OCWL 3IAGC 1RZFH 1VP7A 3QUYD 1DDHB 2B1AL 3L6FA 2XWJA 1DLHB 2VH5H 4JX0A 2DQUL 1WE5A 4HJ1A 5L9DH 3Q4HA 5FPOA 3CVBA 3QFJD 3TEWA 4OCLC 2XBTA 3FN0H 1E28A 1NC2A 2ZX8A 3TEXA 2JIXB 2G2RA 4ZTPL 3IFPB 2NLJB 4ETQA 5KVFL 1SBBA 4J4PC 3MAWA 2J6EA 3DXAA 3Q43A 1K8IB 2F7PA 4FHJA 1SHMA 1S7RA 3UP6A 4KOBA 4LCCA 5IBLD 2W65A 5IGXH 5I66B 1KC5H 4PH8A 3RIFF 2J55A 1VF7A 1IBZA 2XTJB 2IJ0C 4RISH 3W2DH 3FQWA 5DJ0A 1COWG 3KPSA 4E41E 3X13B 1TF4A 3ZN6A 4NUJA 4RQQB 1GGUA 5C0RL 3ZDYE 5I8OL 1A6VL 1EVUA 1ACCA 3BZ4A 3Q8EA 4GQQA 3QISA 3PL6A 4DRXA 3GKWH 3K4ZA 3MA9L 4JO3L 4PR5A 4ZSOE 5B1CA 4M7KH 4ATTA 2QR0B 5ALBH 3MO1A 2NZ1A 5JCOC 3WTWA 5HJ3B 4N5ED 2W95A 3FOMA 5HGDB 5DRXA 1SN2A 1RZ8B 2WANA 4UXNA 2VLKE 1YEKL 3VDAA 4AXWA 4UI2A 4EE2A 4KZCA 5ILTH 1NCCH 3K8LA 2KKQA 5LB1A 5C1MB 1FNLA 2E74C 1K5WA 4PW3A 2IMMA 1ZWIA 2O26U 3T8VA 1X4XA 4H0GA 3KGUA 4ANKA 1MCQA 1JF6A 5AZ2L 5AOLA 3KPRA 1LLAA 4W93A 1QR9A 3FT1A 3PREA 4YHNB 3HZKA 2BIQA 2EVJA 5JO5B 3PGFL 3H7LA 3SHSA 1DZ0A 4FQXD 2IWEA 1MFBH 3DTUB 3AS1A 3CH8A 1WZLA 3QWQB 1MUJB 3ETBJ 5C3LD 1XBDA 2IEPA 4OCXH 1BG9A 2A9DA 1KCVH 2PW1A 3B5TA 3IJ8A 3V10A 4AYEC 4FQIL 5EIQA 3ILQC 4DUWA 2A0LC 4RFNC 3ZVVA 2ATKC 3BH9B 2VL5A 1JGDB 4C54A 2OSLA 2VOTA 2FEJA 1BAFL 1FVDA 2MFNA 5JHLH 4PSPA 4B0MB 2CNZA 3MCKA 4M93C 4X7CC 2UVEA 1IKNA 4KKRA 1M05B 1FNFA 3Q5TA 4HFUH 5D2LF 5LBSH 4CC4C 12E8H 1AD9B 2UWEF 4LNRB 1S7UA 3B77A 3FRUA 1RL1A 5IVXA 5LQBL 4TPRH 2DB8A 4KRPB 3MFFB 4K8RD 2CJUH 2HTKD 3SE4C 3S35H 2YPVH 3MLWL 4OGQC 1UCBL 3WG7B 1J8RA 4HKZB 4DP2X 2WNXA 1WAAF 1QEWA 1U93B 5EUKA 3N2GA 5EIBC 1NCHA 4KPHL 4F8OA 5FDWA 3TFKD 3K5SA 2FMLA 4OBRA 4FDWA 2IW5A 3BIKA 3FFCB 3KH4A 2VL4A 1F4YH 4PJEA 3MOQA 5DVNA 3IVKB 4DV1B 5A16A 2AJZB 4UT6H 3HBGA 1S7TA 4ALAC 4HKJB 1PY9A 1GZQB 1IJ9A 4P2RA 4PJ9D 4E41A 3UTPE 3DX9B 3PHSA 4R26L 2BVYA 5EUKB 3RNQA 3CBJB 5ITZB 2XFXA 5KUKA 1MWAB 1AGBB 2CRZA 2VZTA 2ZKMX 1WB7A 2QKAA 4RCAA 5DD0L 2PUQT 1DVUA 4TUYA 2WD0A 3E1ZA 2UXFA 1MPAL 1NPNA 2A9BA 2VDQL 1PZ2A 3FO9A 5C0BA 4DO2A 3RY6A 1HXMA 2W9EL 3TNMB 2EUWA 4F37F 2DQCL 1CT8A 4NAJA 1JL8A 1HZKA 1VGEH 4HGWA 2XIBA 3NJJA 1TSHA 1W0WA 2CMRH 2K70A 3KPOA 5BNXD 3H1KH 1H9DA 1SUJA 1Z9MA 4FIPC 5K9JL 5IM7A 5LN8A 2O72A 3GNML 2CGOA 3IJ9A 3RKPA 3QAZB 5FO9A 4IIQB 1XDCA 3VWJB 4P30A 1OY3B 3JTSA 1HYRC 3KGRA 4LDCA 4JZJC 2CHDA 2X1PA 2YPVA 4LGSB 1IDSA 4U1GB 5E70A 1CLOH 4JCLA 1FNGB 1KXTA 1MIMH 2WSDA 1DYZA 1GC1H 5DECA 2Z7WA 4KY1H 3RKDD 1H15B 2BOBB 3L4XA 4B3MB 5KA6A 2NLJA 4ETQB 4KXCA 1X6LA 4XC1H 5BMFL 3NJMA 1WNSA 5LBSA 3TN0C 1JFQH 2RFXB 1S3KH 3RPKA 1W59A 3ILDA 3PP3K 2NLJC 3BEWA 1B2WL 3C8HA 2YXYA 4YJ2A 2AXFB 2NY0D 4DN3L 5DRNA 2GW5A 1GPOL 4P59L 2CGYA 3JVGA 4QI3A 2C9XA 3ARDB 5KMGA 4PTUB 5I0VA 4H0HB 4JFEA 5CEZD 5CR1A 5IROD 4LSSH 1UXWB 4XNAA 5K93A 2NX5B 1NU1H 5SWZE 1KXQA 2BRRH 5FYLH 1JHLH 5D2LE 3US1A 4OW6A 1CEZA 2UU9B 3BW9B 1TZHB 4DR7O 5DC2A 4GBXD 4QGTA 4BUGA 1K2DB 3P3YA 4TSAH 1G1KA 2FGWH 2NY4B 3L5WA 1NAMA 1SN0A 3MV8A 2QL1A 1ECZA 1BJMA 4FK5C 4FFYL 4HZ1A 1NTZH 1FJGB 1G7LA 1I9JH 3UTOA 3MLRH 1T1ZA 1MFMA 5DS2A 4Z7UB 2JIXA 5I5RA 2J2ZA 2YEVA 3EGDA 4HUUA 1NEZB 2E0PA 4N4YB 1I1YA 5DJ6A 1DUZA 2BK8A 1OP4A 5F9WC 1EEQA 4PJXA 5KJ7E 3DMMA 4M02A 4FGMA 3F05A 5JIIA 2YD0A 2ICEB 1MCIA 4ZMXA 3F62A 5LN4A 3T4ZA 4EB6B 3CMGA 2CAZC 1TEYA 2VDKB 1NFAA 5D1XA 4NZRH 2D2OA 3RKDC 1G0YR 1V05A 2A1WH 4HJJH 4PP2B 3GF8A 1W91A 4A7GF 1D5BA 3CJHB 4PRHB 4E42A 1WK0A 3K6SA 1EHKB 1EXUB 4I0XA 1D5ZA 1H2KA 1UWEH 2EH7L 3GMPB 3OXSA 2EO7A 4MYWB 1RHFA 3G6DH 5TISZ 4S1DD 3TVMD 3E86A 1P4IL 1NKDA 4AQEB 4HIXL 3PABA 3CVCA 1SRDA 1ORQC 4ZFZB 2V5RA 3VQWA 5DFVD 5SX5K 3U7W<