5B1BB

Bovine heart cytochrome c oxidase in the fully reduced state at 1.6 angstrom resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title The Mg2+-containing Water Cluster of Mammalian Cytochrome c Oxidase Collects Four Pumping Proton Equivalents in Each Catalytic Cycle.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 68
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b1bB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1bB02
3IE9A 1ZDQA 3QJUB 1IKOP 4GXFA 3X1BA 5I6OA 1J5CA 5B3SB 1A3ZA 3FU8A 3NJKA 3U25A 9PCYA 4QLWA 1TEGA 1BQ5A 3UAEA 2QDVA 4DP9X 1WS8A 1BEXA 1MZYA 5B1AB 1EHKB 4E9YA 4AI7A 1JZFA 1ET8A 4E9QA 3FYEB 1SF3A 2EIJB 5B7MA 2FNWA 3ABKB 1SHXA 2VMJA 2YAHA 2BP0B 1E67A 3MX0B 1PNDA 1SF5A 1QHQA 3FU7B 1TEFA 1ZPUA 2PP9A 2YAQA 5I26A 4G70B 2MRYA 2XUWA 5I6NA 3NSCA 2J57A 3T71A 1BXVA 4HZ1A 1L9QA 3NJFA 2YAMA 3AG2B 4BWTA 1AQ8A 2GC7C 2HRHA 3QJQB 3CZUB 2IDTA 4L0PB 1SDDA 3WIAA 1QLEB 4YSRA 2FQFA 3WI9A 5B7FA 1IBZA 1MDAA 5I5IA 3L45A 7PAZA 1CYXA 3AG1B 3EH5B 3S3BB 1NPNA 1PNCA 1J9TA 3GXUB 1JZHA 2E86A 4YVNA 1NWPA 3T9WA 1NZRA 1J9RA 1PZAA 3MBWB 2GB2A 3PCYA 3ABMB 2NRDA 3TBCA 3FQYA 1KCWA 2BO0A 1JXDA 3CVBA 2ZWNA 2P80A 3CVCA 2XXGA 2N0MA 3NP3A 1GY2A 1T5KA 3NJLA 1L9OA 1XB3A 1JZEA 3EH3B 4AKQA 2UXTA 2OV0A 4HAKA 1YLBB 1TKWA 2GHZA 2EIKB 4YL4A 3WKQA 1V10A 4YSQA 4FAAB 2YEVB 3UABA 3X2QB 2ZXWB 1QNIA 3OD3A 5FC9A 1L9PA 4HHGA 4E9WA 2BWIA 2UX6A 2XX1A 3DTUB 3C75A 2FTAA 1XB6A 2YAEA 3IBOA 2EILB 2CAKA 1BQKA 4G7SB 1AS7A 2H3XC 1AR1B 4WKXA 2WO3B 2XV0A 5D4JA 4UF7C 5I6PA 2J5WA 2DY2A 4K9JA 3TA4D 2IWEA 4YSPA 6PAZA 1V54B 1ILSA 2JXMA 4QKTA 4NB7A 4PAZA 2GSMB 1L9TA 1GS7A 1AG0A 1ZIAA 1KGYE 1MG2C 2B08A 4HCFA 4A2FA 4A2EA 4P5SA 4CSZA 1OE2A 1BXUA 3NT0A 1OE3A 2TSBA 3NYKA 5F7AA 1ID2A 1SDDB 3ABGA 4YSDA 4BDVA 3TU6A 1VLXA 2BP8A 1NWOA 2GC4C 4HALA 5ANHA 3WKPA 2IDUA 1NTDA 3UAAA 1PLAA 2AZUA 3SBQA 1E5YA 2YAPA 4FA7B 1OCRB 1AZRA 2H47C 2UXVA 3OMIB 3H56A 3TASA 3H4HA 1JZGA 1OF0A 4N4YB 3X1NA 3KW8A 4M3HA 2LLNA 1TU2A 1CURA 3OMAB 5A7EA 1ZDSA 2QDWA 3BVDB 3FS9A 1J9QA 2XU9A 3GDCA 4MFHA 2I7OA 2BZCA 3QJRB 1CUOA 2Y1AA 3N55A 4WTQA 3FSVA 2XV3A 2IWFA 3NJGA 2JFCA 6PCYA 2TSAA 1NIAA 1NIDA 2CJ3A 2X87A 2I7SA 4TXVB 4A2DA 2GIMA 3N2JA 4RH4A 4YSUA 2BW5A 1J9SA 4KNUA 4GYBA 3UACA 3HEIB 5PCYA 1NICA 2FT8A 2Y69B 4G72B 2PPFA 4JHVA 1J5DA 2W8CA 3JT2A 3T6VA 1IBYA 2AANA 2VW6A 3IN0A 4HCIA 3OM3B 1ZIBA 1JXGA 1NIBA 2CUAA 2B3IA 4DPCX 1KYAA 2IDSA 2PLTA 1RZPA 2EINB 2YXVA 3BQVA 3PXLA 3S3CB 3TBBA 1NDTA 1XMEB 4KNTA 2IWKA 1GY1A 4F2FA 1ASQA 3EH4B 3QJTB 1X9RA 1JVLA 1L9SA 4Q8BA 1EZLA 2HX8A 1DYZA 1WS7A 3WNIA 4A2HA 3S8FB 1BQRA 1GW0A 2QPDB 4DP0X 1AZNA 1FA4A 5B1KA 2X88A 2YAOA 1AG6A 2HX7A 2IDFA 1URIA 4W9ZA 4DP6X 3FPYA 1ASPA 4M4RB 1OCZB 2JKWA 4BDVB 1BYOA 2BP8B 3PAVA 1ZV2A 1NPJA 1WAEA 1E5ZA 1E30A 4UANA 1IUZA 1N68A 2VN3A 2PP8A 2XVBA 2PCFA 1SHWA 1HFUA 1KDJA 3H4FA 2FWLB 2PP7A 2J55A 3NJIA 4UAHA 5F7BA 3SBPA 3X1GA 7PCYA 2YARA 4DPAX 1KBVA 2GI0A 4E9RA 2FJSA 2PPEA 5AFAA 5B1JC 1MG3C 1F56A 3RYMA 5B1JA 3PPSA 1AZCA 3PAZA 1CC3A 1M56B 4F7KA 1OV8A 1XB8A 1W6WA 3SQRA 5LDUA 3DIVA 1AOZA 2HX9A 3UADA 3KW7A 1R1CA 3QJSB 4GP8B 2DYSB 1A4CA 3QQXA 2VM3A 2AVFA 2Q9OA 1A65A 2EIMB 4BK5C 8PAZA 4BXVA 1WA0X 3AY2A 1JVOA 3V9CA 1UATA 3CVDA 3ASNB 4KOBA 2J56A 1ET5A 1OOWA 2XYBA 3PLYA 1L9RA 4YSAA 1N70A 2BZ7A 1KDIA 1AS8A 2HLEB 1SNRA 1BXAA 1M57B 1V55B 1IC0A 1SFHA 2FQDA 2FT7A 2HXAA 4G7QB 1GYCA 1ILUA 1RKRA 3G5WA 4G71B 2RACA 2CCWA 1B3IA 2VSKB 4JKNA 3X1EA 4PCYA 4YSEA 2CBPA 3CG8A 2H5UA 2HZHA 2PPCA 4JHUA 4F2EA 5I28A 2BW4A 2GBAA 1AS6A 3AW5A 3FQ1A 1PF3A 3ASOB 3V9EA 2WSDA 2PCYA 1NINA 5D4IA 2XWZA 3FT0A 1DZ0A 4ZK8A 5E9NA 2A3TA 4BXSV 1BAWA 3CDZA 4E9XA 2UXFA 4DPBX 1GS8A 5PAZA 3ZBMA 4BWUA 1ASOA 1SFDA 2FT6A 2MTAA 5B1BB 2XX0A 4YSOA 3NJHA 1GSKA 2VSMB 3EHBB 3FQ2A 3IEAA 1CYWA 1WA2X 4A66A 4KO6A 1RCYA 3PAUA 2IH9A 5I6KA 5I6LA 3NJMA 5EHFA 3NJNA 2QPEB 1FWXA 2R7EA 1A4BA 2AFNA 2FQGA 3AG4B 2VM4A 4E9TA 3OMNB 5I6MA 1WA1X 4DP4X 1OCOB 5IY5B 4Q89A 4A2GA 4N8UA 1JOIA 3SBRA 3S8GB 3T6ZA 4A67A 4GP5B 2YQBA 3QJVB 2HRGA 1ETJA 1W6LA 1E65A 2BWDA 3NSYA 1JERA 1AIZA 5AZUA 4KO5A 1AZBA 4YVUA 1FFTB 3GYRA 4DP5X 2QT6A 2IDQA 1OCCB 2YAFA 1SJMA 3D12B 4AKOA 4HIPA 1NIEA 2UXGA 4DP1X 4P5RA 3ZX1A 1MZZA 1W8EA 5TK4A 4EF3A 2UX7A 1X9UA 1GR7A 3T6WA 4YSTA 2OCCB 5I5MA 1ADWA 4DP7X 5AKRA 4KOCA 3FPXA 3AZUA 3FSWA 2PPAA 2BP0A 1HAWA 3QPKA 1PCSA 3WNJA 3OQRA 1AACA 4W1TA 3FU7A 3FYIB 4NAJA 3FSAA 4AX3A 2Q5BA 5D4HA 3ZDWA 3IN2A 4AZUA 2DV6A 3NP4A 1NIFA 5TK2A 2IAAC 5I5JA 1JZJA 2XLLA 3DKHA 3NSDA 2VW4A 1JZIA 2XV2A 3ERXA 4AKPA 1OE1A 3HB3B 1KV7A 4KO9A 4KO7A 4HHWA 4X4KA 2DYRB 3NSFA 4YSSA 1AAJA 2P80D 2FQEA 1I53A 5B7EA 1A8ZA 1PLBA 1PMYA 4G7RB 1ET7A 4GP4B 2BHFA 4DP2X 4YSCA 1AZUA 1PZBA 3CDZB 2AZAA 4DP8X 2ZOOA 1HAUA 3EF4A 2IH8A 2WO2B 3JTBA 3WG7B 2W88A 3T6XA 3ABLB 4GY4A 2PPDA 1PAZA 1KCBA 2OJ1A 1AANA 3FU9A 4A68A 1PLCA 4KNSA 2XXFA 3ZIYA 4ENZA 3FSZA 2DWTA 4NERA 4E9VA 3X1FA 1PZCA 1RZQA 2R7EB 3AG3B 3UGEA 4CSPA 2ZONA 2YXWA 4HCGA 1BYPA 2I85A 3S3DB 4BWWA 1A4AA 1M9WA 1PY0A 2DWSA 1GS6X 2VW7A 3NJJA 1JXFA 1KBWA 4E9SA 2CALA
chains in the Genus database with same CATH superfamily
1JHTB 2OMBA 4XPHH 2PXYB 3E0GA 2F5BH 4JQXA 3VXUB 2FEJA 3ZU8A 4Q9CA 2WKOA 4XI5D 3IXAB 3SJCC 1A7PH 4GW1B 4ZXBC 3DOSB 3F00A 3QULB 4H88H 4UTBL 3NGBB 2RMNA 2J21A 2HLFD 2NCEA 4K35A 4XXCC 2H2SC 3NZSA 1B4JH 1MFVA 1J5EO 1E3XA 2D03H 3CN0A 3GK8H 5KYXB 4WW1A 1KJVB 4N26A 1QSFA 2X7LA 3WLBB 3P77A 1BYNA 1CIUA 3CE2A 4ZAKC 4ZPTB 1QNMA 4U6HB 4MT8A 2EDRA 3LMJH 3ABUA 2XUWA 4AJVA 5IR1A 4XNYH 3PWUB 1MJ7H 2H2SD 1T5WB 3CRRA 1MH5B 1QEXA 3WS3A 4YXLL 1S3JA 3EFFA 1A14L 4WAFA 2Q7YA 5HDBE 5L0QC 1JZDC 2GJ6E 4CDHA 3KPOB 1DBBH 1YY8A 2F19L 2GC7C 4JZJA 5L8JB 4RX4D 5D2LE 1B0GB 3CRCA 3V5DA 4JZNA 3TF7C 3SGEI 2WGXA 4L05A 4AQEA 7PAZA 3A0RA 3U4EB 3D85B 4MA8L 1NEPA 4MVZA 2BIHA 4YHMH 4FXKB 3UIZA 1LEIB 1S2EA 2Q3XA 1GYWA 1KMIZ 5D1XB 5D7LA 1HXMB 4BKLB 3LV3A 4X1IA 2GBVA 4UFZA 5D96B 4JG0H 1JGVL 1W72L 2ZT9C 2AQPA 5A2IH 1M2OA 1NA8A 1IBDA 1NCDL 1J1XL 1RJCA 5F9OH 2ZWSA 4PYHA 3SD2A 4C4KT 4EI6A 4JNXA 3OKOA 1A3QA 3H7LA 1TQUA 2GB2A 2F95B 5B4MC 4RAIA 2YMXH 5D8JH 5INDB 4IGBC 1EEZB 4JUSA 4ACPA 5IB4A 2JJTC 2MIZA 2BVOB 5JDSA 2N0MA 4F33B 2WZ0A 3NVQA 1MCOL 2KUTA 1YEHL 1T5KA 4TSFG 2W0FC 4KKAD 1D2PA 3U0TA 2QGDA 2YN5A 4PBVC 3GBMH 3RWDB 5EOTA 4DV1O 3ZHNA 1GTOA 2UZPA 2QSCL 2E76C 4LOUC 2HFTA 5FO8A 1H15A 3LSQA 3B7TA 2OYQA 1XBDA 1D5BB 2BVQA 1T83C 4JJ5A 5IMOB 1QRKA 5IB2A 5L2KD 1UQSA 2O1AA 1V05A 4ZFOA 1M71B 3KG5A 1MNNA 2Y69C 2C9XA 4JFPA 3IDIB 4Z78B 4LWSA 4K9EC 1FZKB 2EH7H 2JIXB 3QI9A 4RLDA 1RUAH 4OKDA 1XB6A 2X9YA 4E0RB 3C5JB 3QFJA 3G5VA 3DSFH 5D7IF 4X9IA 2AAVA 2AF2A 2ZG2A 5JHAA 3S9DB 4TVPE 1L0NH 2B1AH 4PLOB 4LMQI 1ZLVH 2OMZA 5AYUL 1TMQA 4YHOH 4KROB 4CH6A 3DX0A 3UAFA 2CGRH 4UQAA 4AILC 4MJ2A 4URTB 3OF6D 3CFUA 1YIJV 1IAKA 5DM6V 4AVIA 2PWFA 2E59A 2X4PA 2X44D 4LMQE 2XAHA 5I6XB 2AK1H 3L3HA 1OE2A 1MAJA 2HFGH 4I50A 4P4KA 3T08A 3SO3B 1GSMA 1F4WH 2YPLE 4KKPA 3KCWA 1HP8A 2FLRT 4NC2B 4TV8B 5J12B 8FABA 3FTGA 4BDVA 2OYLA 2R70A 5KHJA 3T2OA 2XOTA 5D7IB 3TN0D 3V4VB 1MZEA 5EUOE 1F6FB 1VQ4V 1FE8H 1YCSA 1E5YA 5L2JB 3HW7A 4TOYL 3BAYA 2JK5A 4FTDA 4LLUA 1FVDB 4HIEA 4OCMC 1KGIA 2XTJC 1XZWA 4EBQH 4YFLI 3W5NA 2YGNA 1NAMB 5MENB 4LBEC 3TBSA 3KXFB 3VX1A 4P5TB 2X0WA 1TU2A 3P9WB 3HUJE 3NSJA 2XNAB 3BVNB 3X12B 5DJCA 4JFEE 3KH3A 3QFGA 1Z6JT 5ETUB 4IU3B 3LZNA 4P30A 2XAQA 1FVCB 2VDKH 3ARSA 4LDEB 5CF3A 1RH8A 3FUEA 5MHSE 2F7PA 3GSVA 1MZFA 4YDMA 3TFKD 3LNHA 1COBA 2OW6A 2AI0H 4OFPA 4G1EB 2AJ3B 3G6DL 4PHXA 3V0VB 3Q9QA 4ZI7A 5BV7H 3A4EA 4W68A 4WDIA 4UT6H 4HYOA 3OZKA 1BD2D 1RPOA 5D70H 4QPEA 3SBWA 1FXHA 5G55A 2H1XA 1RSYA 2GIMA 2IH3B 1VQNV 1P7KB 5CS7A 3EO1A 5D7SH 3L54A 4Y5VB 3VA2C 3X11B 3AROA 4DERA 1RP3B 1WTLA 5DJ8A 3I56V 2RIKA 1KTDA 4F8PA 2R69A 3DBXA 1NICA 1OO2A 3LKSB 4GBXD 5FCUL 3OC5A 1UPGA 3JT2A 5KZCD 3NBNA 1IBYA 2N05A 2YIBA 4LLVA 1THCA 1R46A 1E27A 5B1NA 1CE1L 2E3VA 3LQZB 4OJFL 3KYKL 4JM2C 3E3QE 1BLNA 3F7VB 4DO6A 4PJ7E 4WWKA 4ZNCD 4BQCA 4NTYA 3EH4B 4UIKH 1HKFA 5FUOH 3NZHL 4AHCA 1KIUB 4YXHH 1DYZA 3APOA 3JWNH 5JIPA 4N5ED 5EIIA 3NPZB 1W0JG 2QEXV 4X6CF 4F5CA 3P69A 3DVFA 5I8CB 1VFBB 1W91A 3UGUA 4GMSH 2IDFA 4WU7B 4DP6X 5K9OB 1QSEA 4HUNB 2YLKA 5IGXH 5J2TB 1EPFA 4OGAD 3PAVA 5GGVL 4BSVB 1UZ6E 3VXSB 4K9EL 1R4XA 4MRCA 4FJ6A 2X38A 3ZMTA 2RCSH 3IKCB 4UDTA 4F7EA 4Z7VF 5CLZA 2AXGB 5ITZB 1BGXH 3QNXA 4WV1A 3O4OC 3C08L 4E9RA 4XVUC 4K7FB 2HFEA 2GAZB 3KL0A 4J28A 3VXQA 1IXMA 3K58A 2NY1D 3OAYK 5GS1A 2VWEE 5T1LB 5DEJA 3OSVA 2HH0L 25C8H 4ZHQB 1OV8A 2G0LA 4PCKA 4TNVK 4H8QA 1B06A 3QNZB 4X6CB 2GTZA 1I5YA 4NN6C 5I15L 1NGWB 3HZMB 1HHKB 1I1AB 2QA4V 3JZYA 2YPVL 4PJ8C 1A5FL 1RU9H 4M6OH 5SWSD 1FS0G 3MSPA 2NY0D 1T04B 4JO3H 4YEFA 2XTLA 8PAZA 2AJZA 2YSSA 4JG0L 1KU9A 3GSNL 3KJ4B 3MREB 4BK5A 1CURA 4FI6A 5F9OL 5A6MA 3VFVA 2X1XR 4LFHD 4H8WH 4LKXB 3KLSA 4M62H 4S10A 3P9LA 4HIJA 1IBHA 1TYJA 5DC4B 1MDTA 5LHHA 4ERSL 3DVIA 4Y4HA 3H3PL 1KYUA 3FT4A 2F53E 1AROP 4NPKA 1Z9SA 1E40A 2K9PA 4L4VE 5AZ2H 2CM5A 5I8KL 1XGTB 3W0WA 3I02B 5I1LB 1T1ZB 1ACZA 3QPXH 1YN6B 5DURD 1F6AB 4TULL 3Q5OA 2PW1B 1SLVA 3P0VH 2Y25A 1UT2A 4D8PB 1UFUA 5KHHA 1EV2E 3L9RA 4PGEA 2CU9A 1K9TA 4ZSOB 1KCUL 4ZT1A 3ATBA 5F0JB 1TQWA 2H94A 3AW5A 4JY5H 5LBVA 2RB8A 3T1YB 1LK2B 4GO8A 1KJ2A 1SQPH 3AUWB 4QY8B 5L88L 2BOCB 1MWAH 1IVTA 3GBEA 4G7YL 4FTVD 2NY4B 2GT9A 4QD2E 2XBTA 2CWRA 3SDXF 2ITDC 1PKXA 1RUAL 1ZY9A 3N85L 4NXSA 4Y16B 1HOEA 4ZODA 4Z95H 1BIIB 4F3FA 1CD1B 3E83A 1ZD6A 2FJUB 3QBTB 5J06A 1B0WA 4BZ2H 3OPUA 3FCTB 2MTAA 1SHSA 4LCWD 4ODTH 2XQBH 1IM3D 1DJHA 1FG2A 4NRZA 4XOBA 5GRWA 5C0JB 4UTBA 1KLGB 4C4KO 3TS8A 2QBWA 5CHNB 3CC1A 3VQ2C 1F3DJ 1OSPH 3K59A 4KO6A 2ZXCA 3PAUA 4MAUH 1U96A 4W9HC 5I6LA 1IC7H 1PYWB 3MACL 4R3SA 2R7EA 1QRND 1MCSA 3P73B 5SWZA 3QUXA 3J81N 2COVD 1TAEA 3AQXA 1UJWB 5GGRY 5F9WB 1OZ0A 1LO3H 4EIZC 1SQBH 1OK8A 4G6JH 4XR8C 5D7KE 1EDYA 2R29L 4Q89A 4GT7A 3FRUA 1FSKB 3QVAA 1R19A 3SDXB 3WB2A 4FABH 2DI9A 2DTMH 1NGPH 2HRGA 3P1VA 2HTLC 4PJ9C 2A7BA 5HHVH 1AIZA 1O6SA 1TVBA 5JCOA 2BHUA 5JW4Q 4K3HA 4JKKA 2ZE5A 1NJ9A 2OR9H 4C7UA 3V0WH 1EDHA 4Z7OE 4XN5A 1N5AB 1DBML 4KX7A 4RNRB 4KK9D 4UB0L 1FIGL 1OLZA 5EZOH 2YWZA 4X5XA 2VXVL 4V33A 3RZCA 7FABL 1GKOA 1I9RH 4UT9H 5DRNA 2IXQB 1CYGA 3T0AA 4Q9QL 4JGMA 5IE9A 2ZUTA 4RIRB 1BMGA 1S3KL 2HTLD 3MGTB 4EDWL 4PJ9D 2WKLA 1PG7X 4F24A 3UJTH 1JTPA 3VFGL 1KYDA 1W72A 5D7JD 3A6BH 4N68A 1U41A 1H8SA 5CU5A 1DVXA 4MA3B 4H2CA 3WFCL 2PF4E 5EZJB 2H1PH 2WXOA 4EN3B 2VZTA 1FYTD 3D48R 4I3SH 4ODXB 3ABTA 5AOJA 1S7TB 4R7DA 4AZ8B 5H37G 3NK4A 4Q6YA 1XILA 3F6LA 3M07A 4QXUL 4X62B 3FCUB 43CAB 3QDGE 4UBDD 5GGSB 3TO2B 2CE4A 4M02A 5AD0A 5D2NA 4LNVA 3AG2C 1RK7A 4J7JA 3DKHA 3GHPA 1ZT7A 3IJSB 1C7TA 5HVGB 3ILEA 2P48B 3TWCL 4ZFQA 4OZIF 3ETBJ 3HS8A 1WHOA 3L8QA 1VFAA 4WI9A 1JHKH 3BUIA 5IW6B 5KYYB 1KXTA 1SVBA 4Q20A 1N33O 1MHEB 1RLBA 4K2UL 4O5LL 1F58H 4JLRA 3K2UH 4YWGH 2VE6B 5HGAA 4H1LB 4XNMB 1Q94B 2XIDA 2HWZL 4F8QA 1J8HD 3CX5F 4KMQA 4L37B 2LTQC 4HJIA 1H2KA 3CFJA 3NAAH 4L8CA 1CXLA 3DX8A 4NGHL 1KCBA 3ARZA 3DGEA 2OJ1A 4WFGD 2ICEC 3LN5A 2KB1A 4JKMA 1WPXA 5GW7A 3TV3L 3SQOL 1EHLH 4Y5XB 4JZOA 5K5YA 1FNSH 2OTUA 1IGJB 1FJGO 2HYMA 3H9HA 2V4LA 4ZW8A 2DQIH 1N6UA 4OZIB 2VDQB 3DX1A 2WVVA 3QSKB 3KBHE 3VFPA 4L48A 1KEML 4YHNA 4LSTL 4MCYB 3IDXL 4CBCA 2G3NA 3MJ8B 1RUQH 2HR3A 2WWKT 1VGKB 4ZI8A 2UZYB 1SOKA 4B3TB 3KPNB 3R19A 3SGJC 4KWUA 2P26A 3ARDC 3X2QC 1MY7A 3ECVA 3TETA 4PJ5D 2EE9A 4X7SH 5IUSA 3EOAB 4HS8H 3RGVD 4GXFA 4CC1A 3QUML 4V2CB 5BUGA 1CK0H 3CBJB 3O3DA 3Q1EA 1WB8A 4GEIA 1LMIA 3NJKA 2A9HA 3IFOA 5BPPA 1LP9E 2OTLV 4HSQA 1A9VA 4E9QA 1UWYA 3PHOA 3VFRB 5MP6H 4XXCA 4Q52A 4IBZA 3T1CA 1CFVL 2ZQMA 25C8L 1SHXA 4ISVA 4QRQA 3A4DA 1TJIL 1OAXH 1D5XB 2HPOA 5EU6B 3TBWA 2HT3D 1UWFA 5IT9N 1U8QB 3N42F 4RX4A 4Y2LA 3FU7B 1F7YA 1U8IA 4ZAKA 5I26A 1J1OH 3T1HO 3WFEH 4K55A 4NPYB 2NW3B 4YHLH 5IQ7L 2J57A 2WBJB 2AJSH 4A7GA 1QO3A 1E4HA 4V11A 1NGQH 3L48A 4N86A 4LKCA 2DQEH 4YE4L 2FK9A 3T4DA 1SM3H 1U95A 4E5XG 3N40P 2B5IC 4JB9L 3NRFA 4YSRA 3C2AL 3FU6A 2QTSA 4OM1L 5B7FA 3D69B 2XA8H 1OOAA 5E2WH 4I7ZB 2G3XA 3FFQA 5BO1H 5C0GB 4UINH 2FR4A 3QPXL 1RVFL 3IFNL 1U3HC 2PI4A 4W6YB 1WFOA 2WWMC 1I31A 3FKSG 3ZYOA 4ENED 4GX5A 1BQHA 5IJKC 3N42B 2WQAA 3S2CA 3UDWC 4P99A 1YEFH 2AV7A 2J20A 5JORB 3M7FB 3F5TA 5GGUB 3GXUB 1VQKV 1MQKL 4JGUA 1J9RA 5KAIZ 1BFVH 3BY6A 3FO0L 1JV2A 4MQ7A 4O00A 4P57B 1RXLA 3BVWA 4H37A 1AHKA 1AVAA 1P4UA 5JHLL 1TFPA 3KDMA 4IGBA 1CGTA 3TOPA 3PNWA 5DS8A 3U2SA 4X6BA 4BGDA 2JJTA 3LRKA 4Z95L 1LWHA 3OZ9L 5F7YC 4DCQA 3H85A 2ETNA 3EH3B 3AXIA 2CGNA 3ZS8C 2W0FA 3GSOB 4BZ2L 1X5JA 5E8PB 2CJUH 5I0VA 3J7AU 3AREB 2YZ8A 4MNHB 5LNDA 3CXHJ 1PL0A 3LPWA 3WELA 4MJ6B 2OMXB 1ED3A 3BD5A 3CZEA 4ODUB 3HZKB 1T83A 5T3XH 4CA4A 1AR2A 2YEVB 3L5WA 1TCRA 2K4WA 4LLWA 3HA0A 3O6MH 2JB6B 4I0CC 5DRWA 3D3VB 3DTUB 3PNRB 3QDJB 1XD0A 4KK6C 4NVPA 5E2TH 3IBOA 3TIDB 5AW9B 3JSLA 3QNFA 1BQKA 4G7SB 5DD6A 1JYNA 1BMFG 1IAOB 2A99A 1N64L 2R4SH 3F83A 4LPUA 4R8WH 3H6AA 2QFPA 1A3RL 1VP7A 1DLHA 4GG8B 4K9JA 1Z5YD 2BSCA 1YEJL 4IJ3B 4DV6O 5EUKA 3Q43A 4Z7QE 2YA1A 3EJUA 3KCXA 2CO1A 3FB6B 4KRPB 1UB5A 4OZGA 3GRGA 3Q44A 1FO0H 4ECNA 4AJ0A 5J7CC 2B08A 1P4BL 4HCFA 1DEEB 4KK6D 2ZUWA 3L7EB 1RJYB 4LXFA 2OFQA 2X2JA 1E9PA 5TE7H 1QLRB 4B9GA 4CSSA 1FL5A 4PCSA 4HK0A 2YPVA 4LF3B 1ZRUA 3F7QA 4E41B 3JAWB 1SDAB 4DO2A 2BP8A 5L9DH 3GSNA 5BXFB 1ZSHA 4C83A 1UXWB 1HZLA 2UVFA 4I3SL 2EKSA 1KC5H 1U8MA 3LX9A 4ABUA 1A0QL 3II1A 4U6VH 5ITFB 1QCEA 1D5MB 5HHMB 1WBZA 1LNUB 1OGAD 5HHNB 1A7QH 5F7UA 5C07D 2B0SL 4BFBD 4OUOA 3FB8C 4MVOA 2R8SH 3T65A 2BS9A 1J5EB 3GSWB 4U3HA 3KW8A 4F1ZA 2YRZA 4LBEA 2LLNA 3BMWA 3KWXA 3ISWA 4HISA 5JQHC 3MRDA 5FYKE 1Q9OB 3NABH 2KZKA 4B97A 1U9KA 5D55A 4YWGL 3MXVH 3MUGA 2ZCHH 5HD8D 2X4OA 5CNHA 1P2CA 4CRPA 3GDCA 4GXVH 2B2XH 1WGOA 2TRHA 2O4EA 4FQHB 2HFFA 3BDYH 4WTXA 1PPIA 1GM7A 3BKJH 3VFUA 4Z3EA 5IWLC 2V5RA 4XN7A 2ISDA 5J1AB 1N59A 4PRPE 4U1MA 3VYNA 4FQXB 3RI5F 1HNZO 5FWRA 1NM4A 2W07B 4QMEA 1RQ5A 3RB7A 3KPMA 1O0VA 1CICB 5C09E 4CADA 1MMMA 3TCUA 1HSBB 1R47A 3MODL 7TAAA 4YHIB 1LGVA 1HESA 2VL5B 2PO6D 3GIZL 4FEIA 1F6LL 4JCWA 4HV8B 5ENWA 5T3XD 3ZQXA 4MVMA 4AG4H 4F8TA 4ZD3H 2OMYA 2FDBP 2EIEA 4JHVA 5FUCC 3T6VA 2HKFH 1M05B 3HKZA 5IM7A 5I82A 2H3KA 5DD5H 1SBSH 1SXSA 4I18C 4LSVL 4Q0XH 1RUQL 3D25B 3CD6V 4PWFA 4XWGL 1XDTT 3KPLA 2PLTA 3GXPA 5DUBB 4TLSA 1GK9A 1NDTA 4JM2A 3W57A 1IC1A 2CTWA 1GY1A 3RQ3A 1J0YA 1ZA3A 2R29A 3FFCB 5E8OB 4X8CA 5DA0B 3HG1B 5F9JB 4N2LA 4NB5A 3AGWA 5E9DA 2WZPD 4MX7B 3AC0A 1PU0A 5TQ0L 4KTEH 2DQGH 2PWGA 3GSXB 5JPMC 1OGSA 2JSFA 1M7XA 2ALAA 1ASPA 2D4DA 4QOKD 3PS6A 2MCG1 4DAGL 3ARBD 5MEQB 4DV5B 4NM8H 3QUHA 5TQ2H 1MW0A 3K80A 4JYBA 3FN0H 3V8CA 1HFUA 3SE4C 2ZAHA 1FGVH 2BRRH 1RZJH 4GB9A 3HR5A 3VXRA 4B3EA 3WUWA 3SBPA 3WB0A 4PG9A 3H1JH 3QEGH 3AG4C 2NXYB 3SDDD 1NU1H 2EIDA 3RTQC 2AJSL 5E1AB 4OXSA 1CQKA 3A4AA 4D0CA 3EXLA 3N2GA 3EUDA 5A9GA 2ZNJA 2ZWLT 1OAUH 2DQEL 5F3HA 5SWSA 2F5AH 2ATAA 2J7LA 4GAGH 4LLAA 4MTMA 1U93B 3N27A 4NNYB 2X6CA 3MUHL 3D8CA 3LXUX 2XA8L 1YNKH 1M7DB 2WWKO 2OXHB 3DRTA 4JFXA 3UADA 3WNKA 1QBLH 2GK2A 2MNUA 2X6BA 4TUYA 3HS0C 1EMTL 4FCAA 5BO1L 2E7HA 2DQ3A 2BXZA 4Q97A 5J6GB 2Y07H 2G38A 5IB1B 2BOBB 5CA0B 2X3CA 1RHHA 4PJ8A 4QDGA 4DWHA 5DLMH 3EBHA 1ZLEA 3KAAA 1ZV5A 1JVOA 1BQLH 4MBOA 5F0PB 2WTPA 5ICXB 5JPNA 1IO4C 4KOBA 4NM4H 2ENJA 3SOBH 3UL4A 5LOVB 1BOGA 1GHFH 3T8MA 2PABA 1GOHA 1CXHA 1N70A 4XODA 2NX5D 3VGHA 3CCVV 4JRXD 2P06A 1BZ9B 1VGEL 5E7BA 2NY3C 3K0DA 1NGYB 2HJFB 1WVZA 3TBTB 1MHHB 2QWRB 3PREA 5LGTA 3QF7A 2QVTA 3QB7C 4FLXA 2DRUA 3CLFH 2Q67A 4P2RA 5FNVA 2CJUL 4ZUUB 5CA1A 3FRPB 4ZOEA 5LBSL 2H5UA 2Q20A 3G08A 3CFTA 3WFHA 1PLGH 1EDQA 4JG9A 2QEJA 2VS0A 4PTTA 3JD2A 1RJLB 1HKLL 5L4IA 5IVZB 1IM3A 4BV1A 5M94B 2UY7B 4IW4C 3ZR6A 2YEQA 1N7ML 2C4XA 3QP3A 1F90H 1K8DA 4Y1TA 5EO0B 2WNXA 4GSXA 3RYIA 2ITDA 4I5SA 1C9SA 1E8YA 3WXVH 1QRNA 1I3UA 2J6WA 4Y1SA 5BVPL 1S4IA 1ADQH 2UXFA 5HHQB 3QUMA 2AZ2A 5ADOH 1SOQA 4ONOA 2D3LA 4XCCL 1J8RA 4K7PH 3IDGA 2NNAA 1GC1C 3UZQA 3SCMC 1DSFL 2VDMH 3D2UD 2AXFB 2DN7A 4M5SA 2CPUA 1P7QA 5SX4I 5IHWA 3HNTH 2CLVA 4FFVC 4H0GA 2R1WA 1BA9A 3FTUA 1FO0L 4IQHA 2ERJC 3W1ZA 4URKA 4U1KB 1L7IH 3NOIA 3HG2A 1USZA 2P42B 3L9DA 4U1GB 1NBCA 3MXWL 2B4CC 4E9TA 4YHKH 1IE5A 2WXNA 1SQXH 4NQXA 4UM8A 4UCFA 3S3WA 2CRZA 5HJDA 4XGZB 4GQRA 5EU3B 2HVKC 1YPZE 2VO8A 3RYHB 1DSYA 5FAAA 3EGSA 2A1WH 2G9KA 4I5BA 4LE8A 4FFVD 1E65A 2PW2B 2W65A 5CILH 5AG2A 2BFVL 1PZ5B 5GRJL 2I07B 4PJ9A 1KN2L 1AMYA 1N8ZB 1KC5L 4G8AC 1VKXA 1SJMA 3WYRA 3OJ2C 3VI3F 4POZD 4NRXA 4DQOL 4QXWA 2WP3O 4IKIA 3WOVA 4D0BB 1XV8A 4PI2A 2XXCB 1ITCA 3L2NA 4OUUA 1X9UA 4YMPA 5JTWA 1IGML 1Q9LA 1XO8A 3OX8B 3MLSH 1DVFC 1S6NA 4JPRA 4AIEA 8CGTA 4MJID 3ZHQA 4GKKB 4JAVA 3QPKA 4GUCA 4OT1H 3WNJA 1INDH 4X8JA 5I9QC 2ED7A 4NAJA 4YBLB 1G7MA 3I55V 2X5PA 3BAEL 2E56A 3BN3B 3FONB 3D4GA 1FGNH 4JZGA 1DBKL 1VCAA 1JPGB 4XP4L 4H13B 4ZZFA 4NKOA 4QXTA 3LRMA 1DDHA 1A2YA 1IIIA 4V1DD 4DFIA 3FB7C 2XAJA 1N8OE 1ZSPA 2P5WD 3WFBH 3X3GL 1J8HA 5JHLA 3BIAX 3L5IA 4XCNA 4L3FA 4XPTL 3LRSB 2YRBA 4D8OA 5CJ5A 3VI3B 1NC4A 2OI9B 4YFEA 2UWEE 4YBHA 3L4WA 3ZHFA 3CHOA 5BZZA 1FLTX 5FK9B 5FECB 4PBDA 1UD6A 4D9LH 3WXWH 5FKAB 4RAHA 2PUQT 5I1JL 2C9PA 3RPBA 1F4MA 2KQNA 2E7LC 2FX7L 2ADPA 1P69B 2P43B 4JFYB 3BKCH 4S0HA 3JWDC 4QRSB 3BGAA 3WG7B 5E8DH 2KDGA 4XHQA 1N34B 4PJCF 4WI3A 3TPKA 5I2IB 4OF8A 4GKSB 3SY6A 1L6ZA 3A5VA 3CMOH 1JGEB 4LSPH 3CC7V 2ICEA 3K8LA 3ZCCA 2YPKB 1NCOA 3IMWA 4KK5C 2PMZA 4NERA 3IFPB 1S5HC 2AS5M 3PGCA 1IBGH 2FBOJ 1AHWC 4OCRL 5ITBL 2ZONA 3I85A 5HI5C 3QEHA 3OAUH 2QHLA 4KJYA 4X8AA 1AFVL 4MDJA 5I1HH 5F3FA 2VLRB 2R0LH 4HFWA 4KGLA 4ELKB 2P8PA 4CNIB 3VCLA 5DHMC 2KBGA 2P45B 4U1JA 3S36L 4XAKE 3SGJA 1CGYA 3ARDA 1R5VA 3ZW3A 5HHOA 1ROWA 3KLQA 1JFFA 4PJCB 3WL9B 3CDGA 4AMWA 2X9XA 3MRHA 4D3CH 5H4YA 4MS8D 4JO8A 3LDCA 1UC6A 3L3DA 4PJXF 4RAVB 1SA0A 1NGXA 2O5ZH 4BUGA 4H26B 2WTRA 1GC1L 1MCLA 5K59F 2W0PA 3CSFA 4L9LC 4P5KB 3T77A 1BZKA 4HDIA 3FYEB 1N6QL 2B16A 5DFWH 2CLZB 2ZUSA 3CRMA 3ESVF 4GUPB 4I1RA 2BP0B 2XY2A 1MREL 3MX0B 3PP3H 1VF6C 2QKIC 5D4QA 5E51A 3WIHL 5D6DC 5T5FH 4WJ5A 5DRXB 1D5IH 4W9KC 1JWMB 3OXSB 1U8PA 4G6ML 1MW3A 5E4EB 5D93C 2M26A 4ZUVB 3LRGA 5IOPB 1C8QA 3BEWB 3O9WB 5IIEA 2EO1A 4PBWD 3GMLA 4ZOBA 5FM4A 3V5KA 2ZE6A 2EUZA 3SDAD 2QR0B 4L0PB 3BQUD 1R5WB 4OKVA 1ZLUH 2JB5L 4K7PY 1FZJB 4PJXB 3SDYL 3VWJD 1XCQB 4U1HB 1JF1B 5F7NC 2UUCO 4N9OB 4YHPA 4X9FA 3LHAA 2NY2C 2AK4D 1PDKB 5CEYA 1UXMA 2AEWA 2IAND 1U3HA 3QWNA 3GRBA 5C0BB 2GTWA 1IM9D 2H45A 1L6PA 3FO2B 4P23B 5IJKA 1HYSD 1WUZA 1QBZA 4YVNA 2R51A 1OM3H 2IGLA 3UDWA 5KYUA 5H2FZ 3BPCB 3MBWB 5LA6A 1NLDL 2SEBA 3OKLA 4HAFA 2AQ2A 2YFNA 4N24A 5IJBC 3RYCB 4LF6O 5E6SB 3PXJA 5GTHZ 2NY2D 4X65O 2IW5A 3FOMB 4Y1AA 2P80A 5L8LB 1J88A 3UCSC 5A6IA 3CWBH 1GY2A 1QKZH 5IROC 3VVVA 1JZEA 2AJVH 1MRFH 3L2LA 5ADOL 4QHMB 5KX5A 2EDBA 5LCVH 4UTAL 3WN6A 4WHCA 3IAGC 5JQGB 3OKKB 1UKQA 1G4MA 4QTIL 2J6EH 3UABA 3APFA 2BNQD 4QRUA 5I75C 4FG6D 3V0IA 1B9ZA 3IDMA 4NLAA 4NUJB 5FO9A 3REVA 4Y19B 4KZDH 1K72A 3JWDL 2NY7L 2FTAA 3C75A 5I0XA 2A2QT 2XWBA 2YC1A 1OKEA 2ADJB 2EILB 4G5ZL 2Q76A 2X2UA 2XQYA 3DXAD 3EIFA 4RESB 1BD2E 3KPRB 1E2VA 4N9GB 2VB5A 1HC1A 4YDLB 1HZKA 4OGQB 3SPJA 1JGDA 3K08A 3BZ4B 2PYJA 2KI6A 5HBBA 2GUOA 4TSCH 4NB7A 5CSZB 4HKZA 4GRLD 3HLAB 3B56A 1G9MC 1AG0A 2F68X 1MG2C 3BE1L 4G9DA 3BFOA 1OHQA 5ISZB 1IGTA 1QYGH 2WQUA 3UO3A 4HIIA 4KAQH 1OHHG 3HAEA 3VTTA 5KW9L 1ZLWK 3BA8A 3SPVA 5K9QI 4B95C 3QDAA 3S5ZA 3BPNB 4O2CA 3UYOD 2X6VA 4X80H 5GONA 1AGBB 1JPST 1MELA 4O4JA 2FECI 3W7TA 2WAHA 1IEHA 1B3JA 3I6GB 1OGAA 2Q8BL 5T1MB 4RWYH 2V2WA 4GAAA 5B1OA 1XBLA 3BIKB 5F89A 3MRIA 3G04B 4LLQA 1UHVA 4XVJH 3VFWB 5JOFA 3CX5K 4RZCA 2OULB 3EJQA 3TCXA 2OP4H 2V7QG 4N2MA 2CDGB 4Z7NF 4BQBA 5KSAB 2QQLH 4PJEF 3WFBL 2UXXA 1CD9B 2ZKHL 3LPFA 5KTEH 2MQ0A 3WE6A 5EBMC 2IH1B 1ZVHA 1MNUL 4YZWA 4N4YB 1DQML 5KVEL 3FB8A 5CLTA 3CVHH 1XEQA 1Q43A 1M56C 3I6LE 3EBGA 2H0JA 5EOQH 3RILA 3ZPDA 1IL1A 1T4KA 1OIOA 5LBSA 4PRHB 3CXHF 2CE6A 4F7TA 3OPZL 4TYUA 4JI8O 3FT1A 3FU0A 2I7OA 2X41A 3NTCH 5DJZB 4KKCC 4C59B 2PO6A 1L1FA 1HSAB 5B38B 4OF7A 1XTMA 4JKLA 4KFZC 4LBAA 1VENA 2ILLA 2Q3ZA 3C3SA 3BSHA 3LOWA 4HIQA 3JV5A 5KOMC 5SWQB 4FF9A 4AYSA 1KTLA 5I1DA 3CMOL 3LNFA 1YAIA 4KJQD 3IMUA 4IRZH 1BVNP 1WGVA 1UACH 4Z7NB 1FXKB 4G6FB 1JRHH 4RH4A 3SE3C 4PJEB 1MI5B 2P5EB 4EZKA 4NTXA 1J9SA 3ULUD 3CXDH 1CLOL 3MRLB 4CUCA 2R9RB 3ETDA 1E3FA 3HE7C 3GMRA 4KKCD 3L70H 5DJ2B 3FULA 3RG1C 1A6AA 2VISA 2WZPA 1A6VH 4LCYB 4C4UA 1FO0A 1JXGA 4FLZA 1TO4A 1PVHA 2EC8A 5FKPB 1BZ7B 3VXOB 3VG9C 1NKGA 3NFPA 2W38A 1KYAA 2IDSA 2EE6A 2VJXA 3RU8H 3EYQD 3WCYA 5DZVA 1RPUA 4ESKA 2Q4PA 3C60C 4QOKA 5FM8A 1JZ3A 3ARBA 4F2FA 1NCWL 3MHSC 1H3UA 3OKDA 2O6DA 3VWKB 1G7HA 4MXVE 4YAQA 3C2SA 1C08B 5JO5B 1ZKAA 3BVOA 1OAZL 4JZ2A 4NENA 2J72A 4MAYC 4ES8A 4D3CL 5H2BB 2WTOA 3W82A 1N32O 1CLZH 4D94A 1XCTB 1E2WA 1AZNA 1QACA 3E9UA 2BTQA 1V7NL 1AJPA 4XO3A 1YDXA 1WRFA 4WO4D 2YO3A 4Z7UE 1AG6A 5JPMA 4KI5C 2ATPB 4LDCA 5KS9E 3I6SA 3K5NA 2J71A 3BVVA 3P9MB 4L4TA 4RWHA 4EI5C 2DKSA 2HUHA 1RZ7L 5DJAB 3LNGA 5IFAH 1NUNB 2JQAA 4X7TB 2PCFA 4N28A 4UTCA 4GJTB 4JFVA 5CCHE 4FTVE 4J6RH 4YDVA 3NJIA 1VQ7V 2X6UA 4UAHA 5FF6B 1WWAX 1A7NL 1HZHL 4OQTH 3WLWD 3VQ1C 4CS4A 5JH7A 1KBVA 1T1XB 4K3DL 3V79C 3TC9A 3JWNE 2A9BA 2B20A 3KLAA 4I1NB 3RTQA 1I7TA 3DI3B 4GUQA 5KHKA 2ZUVA 4IU2A 3MFGB 3A23A 1F56A 3TO4C 1WWCA 5IMLB 4ZW5A 1IBKB 2Y1YA 4LCWE 4DGYL 2VO5A 1G9ML 1I7RB 4FNSA 2A83A 3D08A 4LARL 3Q6GL 4TF4A 2DOSA 3U0WH 3OC8A 1AOZA 5E2VH 1ZHLB 3GJEB 4ZUSB 1GAXA 4ZJ9A 1R3JC 1JNNL 3JQOB 3BZEB 4M9PA 2VM3A 1CIDA 4JKPL 5F1NB 4KZEH 2GHYA 2ED6A 2XKNA 3QJHB 4AXWB 1LM8V 4BXVA 4NQED 5GZOC 3KPSD 4L3EB 2VN5A 1KXHA 4FZ1A 2NDGA 1VJSA 4HOXA 4QRRD 3ZQ9A 2GSGA 4O4HA 2AP2A 5BO0D 3CVDA 1TETL 4NZUH 2VDNB 4HEME 3BAAA 4H7VA 4JAMA 1QEWB 3WU2Z 5HFMA 3OL2A 3SKOB 1BL8A 3B8SA 2BZ7A 4G8EB 3EZJB 1PPJH 2QGCA 4BCYA 1G6RL 4F8OA 5ANMA 4ZIBA 1DN0A 1ODUA 3NDZE 3QO1A 1W16A 2HLEB 4PVMA 1V55B 4QYOB 1ZJAA 4FMTA 2VERN 2XG5B 3JCZA 5LUMA 3K71B 2HXAA 5IVXA 1RKRA 2RACA 1X7QB 2L6LA 1GGUA 2Z0UA 3ZT7A 3LUTB 4GIPD 1I3GL 3F7LA 3GMMA 1S9VB 2EULA 4U7OA 2HZHA 5GSRB 4OLWH 3CV5A 4MBRA 3KL5A 1RY7B 5FGCB 2XZCL 3H3BC 3ULUL 5A2FA 2HN7A 5HYJD 2X4TA 3DO4A 2AV1B 2WSDA 3U83A 2W92A 5C93A 1P5UC 2R2BA 2D0HA 1FYTE 2X1WL 3M1BB 4JFFA 4JFDA 5DQ9B 1YEWA 3KEHA 4P9HC 3LQAH 2DI8A 4Y2OB 5TE6L 3ET9F 4KX9A 4PRAB 3WSQH 1EZUA 3H9VA 1JSYA 2FB5A 1AXSB 3I50H 1FNGB 3JVFC 3QQ4A 4OVVA 4RETB 5AYQA 2DW5A 3GO1H 2YD7A 1XF3A 5HI3D 3JV4A 5KOVC 4HVBA 2FT6A 4IHJB 4TQ8A 1X5AA 3RKDC 2VSMB 3SCMA 3QFDB 4LHUG 1YEKH 4HWNA 1HI6A 5I1IH 3E2HC 3C5SB 3LKRA 2ITEA 4OLUH 5ABAA 4GFXA 4RDBA 4JTDB 1Q4NX 3NJMA 4KAQL 4LP4A 1MNGA 2LFRA 4LSQL 3CCLV 4HZAA 1A4BA 5TE4H 2CKBH 2VL4A 3INOA 4FKKA 3GXDA 4G11A 2EE3A 3BPLC 3WIHA 4MJHA 1M42A 4X80L 1TTBA 4BZ1H 1L9MA 4L3CA 3D9AL 3L3KB 4YK4B 4WFGE 4X99B 4DK5A 1SETA 3BKML 3GEWB 3QQ3B 1BHGA 3ATEA 4LCCC 1ETJA 2HVKA 4GI9A 2WPDG 4H25A 4DKFH 2Q7HA 3F01A 3TZVD 2ZE8A 1EVTC 2PXYC 2BMKB 2IDQA 2XKSA 1BWWA 4DKDC 1J7VR 4O02B 4HWBL 3TEWA 3D3IA 2BNRE 3K4DA 1DJGA 5ERWB 5HYQA 1YUHB 2X0VA 3NGBC 4M6NL 1LDPL 1LEKA 3RI5K 5CCJA 1IILE 1G1CA 4XXDA 1WP8A 5D1ZD 2AQQA 4PV9B 4AQAB 4LL4A 4F2MA 4V1DA 5JQ6H 1OPGH 4MQTB 4X1YB 4JYAB 2MSPA 3E8HA 2BIIA 1HK6A 3UZVB 4PJ5E 1AQDA 3SN6N 2C26A 4APQB 1UZ8B 1V3LA 2H8PB 3SSGA 3OGCB 4MD4B 3JATA 4N2EA 2ICWA 3AGVA 5EPMA 5D4HA 4K5MA 5DD1L 3U36B 4X6DF 4X5WB 2H3NA 1ZGLA 1M2VA 1OCOC 4RGOL 1OW0C 5I5JA 5KVFH 4XMPH 4XP9H 3C9NB 1P1ZA 5AVYB 4ZTOH 1L0QA 5CIPA 3B6SB 1T0NB 4IDJH 4IRZL 2L3BA 3B7UX 4XMLH 2ODMA 5DFVD 2FVNA 1KWGA 3MBED 2NR5A 1MVFA 1TJGL 1ZLDA 4G8IA 3CXDL 3MNWB 4UTAA 4WKZA 5F3BA 5DJYA 1WPBA 2AITA 4K15A 4FXKC 3GHEH 4NCDA 4PJFE 1XGQA 4OLZH 5D1XC 1C5CH 3IMVA 5D96C 1K2DB 3WDIA 3EF4A 4EZMA 1KP2A 4XMTA 2E7LA 4FM2A 5DK2B 2YK1L 3WNLA 3ZUCA 3ABLB 1SXAA 4GY4A 5T1KA 2EO7A 5CP3A 5DR5H 4FLTA 1T0OA 4X6DB 4CH3A 4G9FB 4RQFA 1Y74A 4LFAO 4JPQA 3FL7A 4IHOA 5E1GA 3RYFA 1HIML 4MQXC 4F7CB 2F54B 2VLJB 2N1TE 3B3IB 3WFZA 1S5HA 4LL9A 3ES6A 5KSVA 2JS5A 2IEPA 3KWVA 4M29A 4JPKH 5E70A 4C58B 1AHWA 4L8DA 4UWQB 1PKQB 2VLKD 2ARWA 3P11L 2E6QA 4X7EC 3EGDB 1VPOL 4PRDB 5AVZB 5J2UB 1E8XA 2GJPA 1EJ8A 4NAMA 1Q1JL 5FFGA 4GRWH 5I17B 4JFHE 1JMZA 2X4QB 3OT7A 1NH2B 5IFAL 4J3BA 2VQ4A 4W9GC 4P9HL 4K3AA 1OGPA 1NR1A 5CUSL 4JI2O 4GMTL 2V3FA 4W6WB 4OQTL 1NVPB 1ZHBB 2FLMA 3HOGA 5ES4B 4OCWL 3WB1A 1C1EL 3TIEB 3ZHVA 3I3DA 1TEGA 3E6HA 2N56A 4DUVA 1A8JH 1JXKA 4MHHG 2H6UA 2ZCEA 2QZ5A 3HKFA 3OG4B 2JLPA 3T0EB 4L9LA 3T2LA 1CTOA 4KROC 2NTSP 1FKAO 2R23B 5LAXA 1DO6A 5E8NB 2YGPA 1YQVL 3ZRFC 3UJJL 1QHQA 5T1DH 3DO7A 2JEXA 1E28A 2FIKB 1VF6A 2VWJA 2GK0B 4QE9A 4QRTB 5D6DA 3VXTA 3V0DA 4UQ3A 2X1OA 5I6XC 3J07A 5LGJA 1A6TA 5ACZB 1BXVA 4LASL 5LDSA 3FQTB 3SO3C 2WYIA 3ZSSA 3BEVA 1INQB 3OJMB 4JJHA 2J1YA 5J12C 2LLGA 3CZUB 1KNOB 4Z5RA 1ZVSB 1RM1B 1AGCA 1XSJA 4TQEH 4NZFA 5D9SB 4L1BA 2HT4D 5JIDA 1FDLH 5CZXC 4J3VA 1KJMA 5I1CH 2AEQH 5BMVA 3MRGB 2J4WH 4LSRL 3MLPA 3FQXA 4AYGA 4LFBO 3EH5B 3MCLL 2Z4QA 5JJJB 2PR4L 1EO8H 2YDEA 1FNAA 2CH7B 3CCEV 2PNDA 1NC2A 2XYCA 1UGKA 2XN0A 1QBMH 4P5TC 3UO8B 3UYPB 4HUVA 2BC4B 2VR7A 5C08A 5CLYA 1A6PA 1ZL8B 1F41A 5E6RB 4NZDA 1Z9PA 1YYML 3SPIA 1BVZA 4POYA 2ZTBA 4LF7B 3ZKND 1DBJL 1NFDF 5FHAL 1TUEB 1AGFA 2EYSB 1L7TH 3S5LB 1U92A 4MCNA 1ZT1A 3H7BB 3FHEA 3VXMD 4DR4O 4WUUD 3MA9H 2IPKA 3WSQL 4E36A 2BERA 2R1XB 4EUPA 3FBQA 4JR9H 3NJLA 1QBAA 1NMCB 1S7VA 5I18L 5IHUL 5IQ9A 4DUWA 5C07E 3KXFD 1QFUH 5IROA 4G8GA 4RRPG 4WZ9A 3VNYA 4BHUI 1CD8A 4J8RA 4NKDB 5CBGA 3ILPA 1SEQL 3DXAA 2IH3C 3GWOA 3ARPA 1MCRA 2ADFH 3TJPA 2ALWA 1DANU 1XR9A 2WMPB 3MOQA 4Y5VC 2ZJSL 1YEKL 3BKYH 5CLXA 1SJHB 1U3ZA 4U3XA 5BNXD 3HC3H 3N1FC 3OKMA 4UOZA 2R0ZL 5DD3H 3U6RB 5AZEH 3CBKB 4APXB 4E9WA 3ZMUA 4I0PD 4AM0A 3ARTA 3W39A 3WUZA 1NFDB 2Y7QA 3WS6C 4PLKD 2ESVE 1SC5B 3BO8A 3GLAA 4FULA 1BZOA 4TPRH 5IESL 4IRSB 3F7VC 3VU1A 3EGXA 2JXMA 5EU4A 5T3XE 1ZIAA 3C8KB 1J86A 1CXIA 5EC1A 4HH9B 2OQJA 1IARB 4LEXH 4N0UE 4JQIH 2RA1A 4HOWA 3QWRD 1IQDA 2EVJA 1R24B 4M03A 3JARB 1D5NA 3ZDXF 5K1XA 1UURA 2GDSA 3QZWA 5F7AA 1SDDB 2HG0A 4U6YB 5C7XL 3POHA 5CZRA 5I73B 4ZFZA 4GRMA 2LLLA 3CX2A 4HALA 1TZ8A 3MJGX 4LQFH 4DFHA 3SKMB 1F0LA 3F6IA 4L1HA 4I4WA 5JUEL 4QRBA 4RDQG 5KANG 1TTUA 5EFIA 4DV0O 1TENA 3HCVB 3C6SB 3MRNB 4GNKB 4KKLC 4UOJA 3ZTNH 4Z7AA 4JDTL 2H47C 1VHPA 3QA3B 4F9PC 2M6YA 2OK0L 2YIAA 1G6RA 2D0FA 4DKAA 1NEZB 5KSBE 2IMMA 3X14B 3BUYB 3MV8B 4QOKE 3UAJD 1SVCP 4B3SB 1YMMA 4A6YB 3QQ9C 4FLYA 4IDJL 4OV5B 5EBMA 2A0LC 2ZOKA 4CS3A 3MKGA 3RVZA 1L3WA 2EVHA 4HU8A 4ZKIA 4IHBA 1JTOA 2E75B 1ZV9A 1I1AC 3FS9A 3L3IB 3ZDXB 2H41A 2UXDB 1QW8A 2EXYC 4CKVX 4WEEA 4BAYA 3LY6A 2O6CA 5CGYD 1KGCD 2AMUA 4JGJA 1S9KC 3KJ4C 2DQUH 2X4NB 4YZFF 4AL8C 2EYRA 5T1LD 6PCYA 3E8GA 1NIAA 3HZYA 4NO5B 2X87A 3CSTA 1T21B 4IEFA 3V4VL 4NHCH 4WK0B 4A2DA 4JCMA 3MRKB 3MLZL 3APMA 4KDVA 5DHVB 1HDMB 2B8OT 2DL2A 3SE3A 2EXYD 5DVKA 5HY9A 5GZNC 3UACA 4TSBH 1NAML 3HE7A 2DYPB 5B1CA 2WXFA 3IN0A 2X3AA 4R97B 5IZ7A 4LSUH 1OP3H 1K5QA 3TPUB 3CAFA 4JO1H 2F6AA 5DK0A 3GI8H 5K9JH 4PD4J 5F88A 2EINB 4BK8A 3AWEA 3QQNA 3TBBA 1JFQH 3O3AA 2RH0A 4I9WE 1YEGH 2ZP0T 5BRZA 2NX5E 4HZ3A 5JHDD 2BOCC 3HMXH 5IJ0A 4JRXE 3C60A 4BFEA 5G5DB 4G3YH 1G94A 3RL1A 3DMMB 4Y16C 3VMPA 2EEBA 3WHXA 3FQRA 4MAYA 1EFXB 5I76A 1XF5B 2VLLB 3LXCA 2H6PA 4RSYA 4OGYH 1OCWH 4HWBA 4ES9A 1UADC 1UFIA 4YR6A 3S4SB 2XV6B 1A6WH 1E90A 3EDFA 3GDBA 1MSPA 3OKNB 4JX0A 1Z2KA 2NZ1A 1S9XA 3PWPE 3QIWB 1U8NB 1EM1A 4AGMA 1HNYA 3GMPA 2NY4D 4EI5A 5K9KB 4I3RH 4OZ4A 35C8H 3OFNG 3QHFH 4M1DL 4OF6A 4Y16D 5MERB 2OXGB 2VAAB 1WZMA 2GSIB 3IM1A 5AL8A 5I16A 3T3PE 2XHNA 5F9WC 1YN7A 2YI9A 3NFSL 1ECYA 1M1KW 3OLIA 4PUBL 1IBBA 4XCFL 1MG3C 1WD8A 2YA2A 1N3NA 4UCOA 1FSKC 1A9EA 1E4KC 1LUVA 1HEZB 3TO4A 3KPSA 5IFJB 1DJIA 4HUCA 4XN2A 1AO7B 4HNAB 3RN4A 1EJ6A 1NOAA 3B9DA 3MAWA 4QRRA 2ZR3A 5I1CL 1US6A 3P30H 4FQLH 5GRUL 4A39A 2C34A 4JO4L 1WT5C 3BGFC 1E6JH 3NCEB 4JFOB 3D50A 4IRZA 1MCPL 3RWEA 3BZFB 3P3YA 3DVNA 4QRPB 5LL6Y 5B66Z 1R3JA 3COOA 3WEMA 5I30L 1A65A 4LRNH 3ZYZA 3MYJB 3O2DL 1I9JH 2YJQA 4MNGB 1FLRL 4MDIB 4AE1A 3JXAA 5GZOA 3GZQA 3LKOB 4H0LB 1TUBA 1DR9A 1NCCH 3HBZA 4YH6A 3SE8H 4GG6A 4RUFA 2RJZA 15C8L 3HPJB 3I84A 3GLZA 1L0PA 3IPEA 5A2KH 2V0AA 1DL7L 3MLYL 5JW4R 3GHBH 1VFUA 4M93B 2VR9A 4DZBA 3AS0A 4EN3C 4WNJA 1CFQA 4Y2DD 3ZL2A 1BG9A 3K72B 1ZANH 3MLWH 3JWOH 1EJOL 5HYJA 2FQDA 2CMRL 1XIWB 3HFFA 4N0FB 4DVRH 1ILUA 3A3YB 4NQDB 1CGXA 5IMKB 1N18A 2A4EA 3I9GH 5E24E 1KCSL 1NGZB 1JN6B 1JGLL 1SPDA 4YUEH 3L16A 3TH2T 4FP8L 3U30B 5EZIL 1QNZH 1DFXA 1DQIA 3Q6FA 1SGKA 1IZKA 3BOVA 2HLAB 2ZYIA 1T5EA 4MJIE 4B7LA 3AAZB 1XAKA 5DEFA 3AADB 1XF4B 1X44A 1AI1L 4I88A 2QTVA 2PCPA 5D4IA 3TA3D 4EKXA 2R2HA 4LPYA 4JI8B 1P5UA 1MJJA 4J2XA 3E80A 3A22A 5HI4C 4BXSV 2P5WE 1UASA 4HYTB 3G5ZB 1SXNA 4LESA 5DU7A 2WXJA 5TFSL 1EZVX 2N0KA 1RMFL 3KL3A 5B1BB 1U58A 2XWTB 3CRQA 4FZ0A 3B2EE 2XX0A 2JKLA 4Y5XC 4Z0BH 1QR1B 1L0XA 3U2JA 1JGUL 1SQ2N 1MIEL 2DLFL 4GKOA 3GSUB 5I1EH 4ONHA 5I6KA 1FI8C 4BQ6A 4Z2WA 3R06A 3N04A 4XOCA 3TZVA 1QPKA 3ZL4H 1DJZA 1BZEA 3O41A 1NPUA 4FQQA 2VM4A 3OMNB 5I6MA 1FNEA 5KVGL 4WCEV 4YGVB 1TO5A 1BFOB 5AOKA 4Z77A 5IBLD 1VF7A 3K9SA 3EO9H 4P2QA 3QISA 5DO2D 3ZZLA 3CXHK 4PVNA 3RPIB 1OL0A 1GPOL 2ZWZA 1W6LA 3CRAA 4HU2A 4ZS7H 1VQLV 4LCCA 1T0MA 1TFHA 3BAIA 3NIGF 2BJML 2K9UA 1JHTA 5I1AB 2PXYA 1OY3B 3Q2NA 4XNZC 3VXUA 4A04A 4HIPA 3IXAA 4NWUH 1N32B 1X7TA 2EC9U 4IOSD 1H2NA 3G5XB 3AXLB 1Y0LB 2C1OB 3DOSA 3QULA 2ZOWA 3AUVA 4P5RA 3LSUA 5AW7B 4EF3A 2FJFB 2LGWA 3HKBB 5CCGE 3OR7B 1QP1A 3T6WA 1J05B 2WYZA 2CLRA 3G9VA 1SYVB 1NEZG 1OQOA 5KYXA 1ADWA 1XGYH 1KJVA 2WXHA 4BIZA 4OX9O 3GBLA 4YQXL 3WLBA 4NKMB 4W1TA 2CK0H 2P5PA 4ZQTA 4ZPTA 3ARVA 4BWAA 2EJ1A 4U6HA 4DUYO 4M7LT 2WBJC 3VAEA 3OHXB 4Y5YB 2OR8A 2A74B 2GJRA 3NACL 3PWUA 4CC4C 3FFDB 1WJZA 2YD3A 3RWJB 5KAQF 1T5WA 3D07A 1MH5A 3NIGB 5EIIG 4LCIL 2ZNIA 1OW0A 5EU6D 2VZ1A 3KPOA 1IIKA 5E08L 2Z31B 3KWUA 5CJBA 4YSSA 2V37A 3QH3B 1KY6A 1BP3B 3VDAA 4R90L 1HE7A 4I7ZC 3GUTB 1A8ZA 4LHQB 1QFWH 4NN5B 5EZLB 3U4EA 3LDBB 3RA7H 4GP4B 1KJ3L 2BHFA 4DP2X 3QYMA 2GEEA 4FXKA 1LEIA 1D7DA 1NAKH 3GJFB 4ZXBB 5CWSA 4DP8X 5D1XA 1FZOB 1HXMA 4BKLA 5ADPH 3NCJH 3S34L 5KJRL 3DGGB 1RD6A 4HXAL 4CVUA 3GKWH 2V1DA 4LLDB 1EVUA 4BA8A 1XBRA 2G30A 1Q7YW 4A68A 4KNSA 2HHHB 3CCJV 3HMXL 4FKEA 3RWHB 2O72A 2OL3H 1CCZA 3LKPB 4MA7H 5HJ3B 1UCBL 1T22B 4LF8B 1T7YA 1MCCA 5INDA 4E9VA 1EEZA 2DIEA 2AK4E 4PJBE 2YXFA 2BVOA 1NL0H 2AQ1A 3HMWH 4K3GA 2RJMA 3HE6D 4F33A 5I66B 2IANE 5FW8A 1IX2A 1GA2A 2W0LA 1OCWL 1MEXH 3AREC 2WIMA 2RNBA 2D7MA 4PJIF 4KQ4L 4QHKI 4ODBD 1UM6H 3O6FD 1D5BA 3NJJA 4DHLA 4JYCA 1H19A 1P0SE 3QIUB 5IMOA 3FUFA 3DWTA 1U3JA 2FEEL 2P8LB 3UTTD 2VDRH 3V4PB 3ECBB 1OTTC 4KY2A 5I23A 2WQXA 1M71A 3IDIA 2ZUYA 5FX3A 2WGNB 4GKLA 1FZKA 1ID5I 3CIAA 1DE4B 2JIXA 4B7KA 3B7RL 3U25A 4O2EB 1BOYA 4E0RA 1HINH 1ETZB 1A47A 2N7BA 4WEBL 5I8EB 4DV4B 1WD9A 1R0AL 3CTTA 2Z92B 2AXTZ 2VMJA 2X4SB 4IJ3C 3IXTB 3P2DA 1F00I 2VDQL 4KRPC 4J27A 3FB6C 3H1IH 1PTZA 2BNQE 2DTSA 1DANT 3QUZC 4LNRB 2FB4H 1OTTD 3DJSA 4KKZA 1TQVA 4S1SH 4PJIB 1J5OL 4UZGA 1N5YH 1NBZB 4GCZA 2DJVA 3I2CH 4PS7A 4HS3B 3O0RL 2XY1A 2HAZA 1A25A 5EEWA 3WTWA 2XVKA 2HSIA 1TA8A 3B8YA 5BJTB 2BFGA 3PHSA 2CGOA 1ROCA 4TV8A 5DVLA 3DJRA 3PAYA 2TAAA 2FQFA 2XN9B 3GHBL 4FL4B 1I1FB 4GS7C 4NRYB 1LTXA 1Z5HA 2CO7B 2APTA 5D7IA 3KVPA 5I74B 5F70A 1HHIB 3V4VA 1BPLB 2V3DA 3U1SL 5IQNA 5L2JA 4EVNB 5HYIA 1EN6A 2BSDA 2JKTM 2VR8A 1BZDA 4X0KB 1FVDA 1G7QB 1Y18B 2EXWC 3I9GL 3D39E 4S1DD 3RWDA 2K8MA 3TEUA 1QNZL 2Z7UA 1NAMA 5MENA 2E74B 1J9TA 3GBNL 2DQFB 2E86A 3KXFA 4P5TA 4I48B 5IBUB 4XC1H 2QV2A 3U1PA 2Z34A 4CH4A 4XC3L 3U4AA 2XNAA 3BVNA 3X12A 2NRDA 4X9HA 1A7OL 4QGYA 4QHUB 5H37A 2WCGA 5ETUA 2JCCE 3CVBA 4IU3A 5HHMD 3OGOE 1RSOA 1MCBA 3R66A 1FVCA 1RUKH 1UVQB 4XTRC 1LO5B 1UUSA 1L9OA 1XB3A 3E38A 3U1QA 5I0YA 1T3FB 2PWEA 3BAWA 3F12B 4G1EA 2AJ3A 3O4LD 2WXQA 4MYWB 4FQXC 2JELH 2VC2B 1FORL 1KENH 3F7KA 1CICC 2EICA 4U1NB 4W4OC 1YMHA 1EO5A 3A21A 4DIXA 2IH3A 1H0DB 1P7KA 2CXKA 2FBJL 3DJZA 4HPOL 3HVNA 4Y5VA 3X11A 1TSRA 4L8JA 4YS4A 2Q7AA 5FYJH 4PU2A 2IADB 4WENB 3W5MA 4J3WA 3LKSA 5GS0C 4DV3B 3ZHRA 2OLDA 3TEZA 4O9HH 1LEGB 4Y4KD 4FQXD 4X5PA 3WS6A 4DKEH 3MOAH 1PL4A 2NT1A 4JG1H 3GWKC 3LQZA 2Q7EA 4A7QA 1CICD 3RUGE 2DY2A 3DSNB 5CR8A 2K7PA 3F7VA 4HUKB 2W9EH 3M8AA 3ULUE 4GI6A 4N2HA 1SQQH 1KGYE 4HX1B 4K8RC 1QUNB 3P3RA 1CLVA 5AB0A 5IBTH 1KIUA 2HTKD 3ZDZE 1S9YB 4LRIA 4U6XA 4OIBA 3H1HH 1BXUA 1RHFA 1BJ1H 3PUCA 4NJ9L 1I7ZB 5I8CA 2XTAA 1VFBA 5K9OA 1LE9B 3MUZ1 3D5OF 4WU7A 2ATKB 1IRAY 5FHBH 4OZFB 5IREA 4UM9B 1P53A 3FFCD 3UAJA 4DK1A 5J2TA 3O2DA 1FH5H 3FT2B 1NWOA 3HG1D 4JL2A 4OIIL 5ANHA 3WEBA 3WKPA 4BSVA 4ZFGL 3VD2A 4FFWC 3VXSA 1MJUH 2CK0L 4JVPA 4X9BA 4Z3TA 3INUH 3BDBA 3UGXA 3UTSB 2DB8A 5DQJB 4KXBA 2NXYC 3IKCA 5E1AC 1QQDA 3C6LD 3X17A 4DGVH 2WXRA 1N36O 2AXGA 5ITZA 1ZT4B 3TASA 1WF5A 2GUYA 4ZDHB 4K7FA 2B1HL 2GAZA 4F9PA 1A4KB 5B22A 3ECQA 3QRGL 3ALPA 5T1LA 2N4IA 3RTLA 3BDXA 4YLBA 5IEKB 2A0LA 2CO2A 4FFWD 4ZHQA 2QDWA 1T6VN 4LK4A 4U0QB 3QNZA 3THML 4FQCH 4X6CA 4P2CG 4AMKL 4A38A 1RFDL 3QEUB 1J9QA 1NGWA 3HZMA 1RURH 1T7ZA 4M1GH 4LFCO 1I1AA 2X89D 3UCRA 1KQSU 1FH2A 1Q38A 1XMOO 2LABA 2BOBC 1CQYA 1K34A 4NO0D 2EP6A 1T04A 3NJGA 5D72L 1WNSA 4R5XA 3T2NL 1KELL 4WU5B 1QLEH 3DX6B 1PSKH 3HB3D 4E5XA 3HI1A 3MREA 5F6HI 1IEBB 5HJBA 4LKXA 3ARYA 5T3ZH 4Z7VA 4PS8A 3P4MB 3B43A 3GI9H 3W7UA 4KNUA 3G6JE 2C9RA 4GYBA 4O4YH 4QWWD 2G3MA 3AEIA 2HJFC 3RNQB 5I19L 2FT8A 2WQRA 3HRPA 4G72B 5J57B 1WEJH 5GZNA 3HMWL 1XGTA 5I1LA 2NLJB 3ARGB 1T1ZA 3I02A 4NQEE 1YN6A 3R7QA 3KPSE 1F6AA 1JRHI 2AANA 1ZTXH 2PW1A 4MD0B 3OM3B 1UWEL 1BE3H 5DHEA 4QRRE 3ZJAA 3SYOA 4G7VH 2H0FA 4IBQA 4D8PA 2N3JA 1NMAH 2YKLL 2IG2L 2O30A 4NQCD 4ZSOA 2ZOTA 1ULVA 4D7BA 4TL5A 2D7PA 3LXBA 4G5AA 4B9KC 5LNGA 4M5ZH 3DA0A 2Y7OA 3FH7A 5CEZD 1LK2A 2EDTA 2DQMA 1FVEB 2IIJA 1AJNA 4QY8A 3WBDA 2BOCA 5I8OL 3HKDB 1AE6H 2XZQH 4Q8BA 5E5MB 3TJEH 3RX7A 1AR4A 3PL6D 1TQTA 1GW0A 3FN3A 2BX5A 5DC2A 4Y16A 3D87B 4MVBD 4LU5H 2Y2WA 2WA3A 4TTDC 3SJVB 3CH8A 1JIBA 2FWSA 3NA4A 1BIIA 3V6FB 1CD1A 2XNDG 3FPYA 1BQHG 4FYRA 3UBFA 4A1RA 5HGHB 3FCTA 1JZ7A 2A9AA 1I9IL 3SEPA 4J12A 1UA6H 3ZE0E 3ULVF 3MNVB 4N6RB 1UOLA 5HYJE 1C5BH 5E1IA 3ZMRA 5C0JA 1KLGA 1N68A 1LO0L 1YQ2A 5CHNA 5GS0L 3SDCB 1U8KB 4HIHB 2DQDH 3LJ3A 4U1GC 4F1SA 7PCYA 5A2BA 1PYWA 1X4XA 4R4ND 2HJLB 2HEPA 3P73A 4J7ZA 4L8SB 2AGAA 5B1JC 4QJ5B 4FI8A 4YX2H 2X4UB 4GQZA 1E4KA 4K8RL 3HG4A 3K8KA 2V9UA 3L08A 3SDXA 1SY6L 2EE0A 4F91B 1F11B 1F97A 2C5DC 3W9DB 5E4IA 2TRYA 3LPOA 2J1ZA 1YO4A 4ZTPL 2KYIA 2QVIA 4TQFA 1WT5A 4DETA 2IAMD 1GGBH 4E4EA 1N5AA 2ENPA 4RNRA 1R3HB 2DDQL 2P49B 4DSYA 3QTCA 1KCRL 4F58L 2AJYL 3OUSA 3UBHA 2IQ9H 1F3DH 1M3JA 2IXQA 4PP1C 2AQSA 4PRIB 3TT1L 2O5NA 4RIRA 2E7CA 5D1ZI 4W4KA 5KHGA 1LWRA 3AY4C 1IDSA 3M8OH 3V9FA 5DJXB 4YBLC 5J11B 4WWID 4PD4F 4MLSA 4MA3A 4DV0B 2DOCA 1KBHA 5EZJA 1YTFB 4EN3A 5HDBF 4ODXA 4AZ8A 1U36A 1WFTA 2V7HB 4H13C 3K3WA 1S7TA 3U4KA 5JMRA 2PCXA 3PUUA 4PA9A 5D2LF 43CAA 5GGSA 2EC9T 3FQWB 3TO2A 1V5JA 3RY5A 3LHPL 4PPTA 3IJSA 2OI9C 2NOYA 1XEDA 3WMSA 4JRYD 4NC1E 1DLFL 5CR1A 3LB6D 4WI6A 3PP4L 5IW6A 4EOWL 5KYYA 5L8KB 1IBLB 1MHEA 5C97A 1NINA 2G75B 4E42B 4ZK8A 2VE6A 3A6CL 4H1LA 1QHPA 4PY8I 4ZMTA 2VKWA 3RIFF 3M6DA 1PFCA 1F2QA 3NESA 5EOCH 3HI5H 5BZWB 3WG7C 5CINH 4L37A 4JG1L 2Q8AL 4ETQB 5GJSH 3CSXA 4XMKH 2NNXA 2GUZA 5F6IB 3KLHC 4FX5A 5CEXB 2WQWA 1I5XA 4IYKA 5HDBB 2GJ6B 3ZKMC 5CEZL 2DD8L 2MOGA 1ZEAL 3KYNB 4Y5XA 3U7WH 1VF5B 1CYWA 1CTNA 5D2LB 1RV6X 4IBSA 1IGJA 5H4ZA 2ZSWB 1BMZA 3HR6A 2F08A 1VIWA 3HVDA 1NTKH 4PR5B 1OP5H 4OZIA 1NFKA 4QAWA 2CA3A 4GO6B 2DIAA 1SMAA 3L72H 3BPZA 3KLHD 4MCYA 4IOSA 2ADQB 2CCVA 3MJ8A 1J11A 1VGKA 2E7MA 2F1MA 2UZYA 3KPNA 3CJJA 5F93C 3IRZA 4ZO6A 1FYHB 5HVHB 4WHTB 2QTOA 1M53A 3GYRA 4JE0A 1T7WA 4UCSA 4XX5A 3EOAA 3F5WA 1IKFH 1G9NC 3GGWA 3GFUA 4AEIH 4DGVL 3BLPX 1XNRB 3M1CA 5J0BA 1R6KA 2VLKE 3OXRB 2VLRD 1ORSB 4HKXB 4HWEH 3BRFA 3VFRA 1E4JA 1F4NA 1XR8B 4KDTC 5GGTL 3CFIC 1Q5OA 4G6AD 3IDNB 1D5XA 3FPXA 5EU6A 3VJ6B 2AXJA 3LEVH 1SJEB 1U8QA 4HXBL 3W56A 1RURL 3GF8A 1CS6A 3FU7A 1B2YA 5ECJE 4FKHA 3H3KA 2EABA 1N12A 2XN1A 4JHWL 5TH2B 3QO5A 5ACMA 3U2IA 1AP2B 4NPYA 3RWGB 4XPFL 2IJKA 2Z6FA 1ZXQA 5E4EC 2WBJA 2Z3YA 3H53A 3NP4A 2ORBH 2IAAC 1CVSC 3O9WC 3BABA 3LH9A 4CC4A 2LOEA 1N19A 4GAYB 3RWIB 2I69A 1K85A 5EUOF 4XBEL 4DKTA 5IDJA 3QEQD 1MRDH 4MGXA 2WLMA 4A63A 1I1YB 4BKSC 3D69A 1TJHH 1S8DB 2CTRA 4MTXA 1IJNA 1WEJL 4HIXH 4YSCA 5C0GA 1AZUA 1G87A 3EJYC 3JASB 5BS0D 1ZTXL 2FWOB 3MLXH 2RMKB 2FJGB 4JAUA 3HUJF 3O9WD 4P23C 3MD0A 2W59A 3JTBA 2BY1A 2DQHL 4JANA 5KVFE 3RVWD 3QHZH 5JORA 4AUJA 1GTNA 4AQYO 5GGUA 1TTAA 1BBDL 2YPLB 5ILTL 2VZSA 1YJNV 1HXYB 1MHPL 3CBRA 2DWTA 4P57A 4F6RB 1AE6L 1BGYH 2IJJA 2R0WH 4UYQA 1UKSA 5LXTB 5EUOB 1CDBA 3UCQA 1RJZB 3GD1C 4P23D 1K3ZA 4JAAA 3D36C 1SZXA 1YC7A 2WWOA 3IT8D 4F27A 1Y66A 1AKJB 1OLLA 3ULSB 1NQBA 3GSOA 5E8PA 3TCLB 5LXGH 4ABMA 3AREA 4MNHA 1A4AA 1M9WA 3R8BB 1W0WB 1PY0A 3ROLB 3IF1B 1IAIH 1TZGH 2PF6A 4P2YA 1QSVA 3DPBB 4MJ6A 2OMXA 5JJNB 3D51A 2YBGA 4E9SA 2LAAA 4ODUA 3HZKA 3HUJB 1ZE3C 5ID0B 2BE3A 2VERA 2YEVA 5DDHB 2QQNH 2I9TB 1ZS2A 4JFEB 3VXME 3MRBB 4WUUE 2ZUQB 4QCIB 1C7SA 2JB6A 1MG1A 3D3VA 1EBPA 4ZQKB 2QZQA 4PBXA 4FADA 2EILC 3QDJA 4QLWA 4WJKB 2LE9A 4PJ7F 1YJDL 3TIDA 4YX2L 3QCVL 4YDLC 4OGQC 4P46B 1XGUB 1IAOA 4GRWE 4AQ1B 3LKQB 5CN0A 2N74A 2NPLX 4GG8A 4F7MA 5JXED 3EYOB 1A4JB 1NM9A 2A6KB 4JFQB 5EN3A 5E2UL 3FB6A 1SBBA 3BZ5A 3MPCA 1LK3H 4G70B 4PG2C 1MSDA 2DIJA 3NSCA 1G7JA 3BPNC 4L0YA 4J11A 2R56L 4AYDC 2Y0PA 1VQOV 1DEEA 3T1FB 1S9WB 3MLVL 2FD6H 4HZ1A 3L7EA 1RJYA 5T33L 4X1KB 1QLRA 4Y9GA 1VEWA 1UZ6F 5J1SC 1D7FA 4LF3A 4ZPVB 2NR6C 2Z8RA 4LEEA 5KBMA 3U7YL 3WIAA 4E41A 2EDDA 5I5IA 4PJ7B 3WJLC 1IB5A 1MFAH 5BXFA 4HUXB 1MPAH 1HCYA 1KD1W 4YBQD 1UXWA 2JLLA 3AG1B 1LLAA 5KSAC 1DDTA 1ZGLB 3HHSB 2GBOA 5ITFA 5DD0H 1D5MA 4WIQA 3FQNB 1LNUA 3NCXA 2IH1C 5J1TC 3J8F7 4ONGH 5HVFB 4ZOAA 1JI2A 3H42H 3HHMA 2VDOH 3GSWA 1OVZA 3ZMVA 3Q8FA 1S78C 3O4LA 1PZAA 3MBXL 3RVVC 3VACA 3KE0A 3TVMD 5C0RH 1Q9OA 4AGLA 4NAQA 1I1RA 4YDKH 1TITA 4ALAC 3DX9B 2Y7NA 3E8UH 2A9NH 4PJAE 3K5SA 1SLXA 4FQHA 1AYRA 5ESAB 3VRJB 5CINL 5JZ7D 2YEZB 1AQKL 5IHLB 5GJSL 1ZLZA 2H1LM 4UV9A 3N06B 4JQVC 5J1AA 4N5UA 1KBKA 2QQKH 1QPXA 2DKUA 4FQXA 2CG9X 1FXKC 2W07A 3CU7A 2XG4B 1NUFA 1R3LB 5DZOA 2ZNXA 3CZKA 1CICA 4W4OA 4CGTA 1HSBA 3GZOA 1Z2GA 3MA7B 1CDHA 1WBYB 4LL1A 3TXQA 4HHGA 4JBSA 4YHIA 3ZE2E 4EZJA 4HV8A 4WCYH 1KTKE 1KGCE 2RR3A 3L4VA 4OM0L 2FUQA 2VXQL 4LIQL 4KMLB 1M05A 2Y36L 3GJFK 1AS7A 5B3JE 4FXGB 2J1WA 2WO3B 2ZP8A 4LAQL 3D25A 1V3JA 4G6FD 3N1QC 2YA0A 1CBJA 5DUBA 2P5ED 4FN0A 1GZQB 2F7IA 3L4CA 4QKTA 3VWKC 1MVYA 2CJTA 2CK2A 2Y5EA 3GS4A 5E6ZA 5K1VA 5E8OA 3FFCA 4R7NB 1U8CB 2KT6A 1MCIA 3HG1A 3DPDA 5F9JA 1SOSA 2BK8A 2Z7YA 2F53B 4MCZB 5KZCB 1GZPB 2BSSB 2VXSL 1S72V 1GGIH 2YFOA 3GINA 3JUYA 1SY6A 4L4VB 4MX7A 4P5SA 5FV1L 3SE9L 5C70A 3IVKA 2ZKWA 4DZ8B 2MQ3A 3GSXA 2DLEA 3E7JA 4FZEL 4Z7VE 3WHE0 2E27H 3STZB 3STLB 3IDYB 1GCFA 3M88A 1MFNA 3QYCA 1I1CA 1PG7W 3F62A 4FXLA 1H3PH 2PR9A 5E6IB 3QW9A 3NZ8B 2KSDA 1N0JA 1SQGA 5JHDE 5HHXH 3UFIA 4KPHL 4NNXB 1Y76B 1RK1B 3Q06A 1KTCA 2QM4A 2N1KA 1O9GA 5CJXC 3VD7A 2DBLH 1AKPA 1NCHA 4XO4A 3EYUH 2CTQA 4XB7A 1KFAL 3QUKB 4K23L 5E1AA 3ZYJA 1OPOA 4WFEE 4LVNB 1N67A 3W37A 4I18B 4R4FL 4UQBA 2NZ9C 3HJ0A 3FX7A 3T5WA 1AJ7H 3O3UN 4ZMZA 1MRDL 4KP4A 4IYHA 4Z7OF 1U93A 1JPTL 4NNYA 3WDJA 4O2AB 1XSKA 3GIVB 1M7DA 4FM1A 2OXHA 4B08A 3ZK0A 5KYNA 3JD4A 2XU9A 3K2MC 3JAMN 4HIXL 4CC0A 1UG9A 2CR6A 4FJZA 1O7DC 5ICYB 2BZCA 4WTQA 3H1ZA 4NCC1 3H9SD 1FHGA 2XV3A 2IWFA 5IB1A 2JFCA 2BOBA 5CA0A 1B2WH 2EZ0C 1F23A 2TSAA 4FDWA 3VH8B 4BFFA 1DFBH 1NIDA 2NZ9D 4J3OH 4NJAH 5ICXA 1FAIH 2VR5A 4OZHB 4AYBA 2DN9A 4MW3A 1ETB1 1OT2A 2IGFH 2NY5L 1KCVH 2JDIG 1DQQB 1OAKL 4NQCA 3GC3A 3K6OA 4YIQB 3WENA 2D31B 1V55C 1QFOA 3VSQA 1BZ9A 5FYLH 4ZMPA 3UM7A 2HJFA 2W8CA 3TBTA 1MHHA 1Q0EA 4RBPH 4Z7OB 1YITV 1VERA 3A6OA 4HCIA 4M6MH 3ZGIA 1AD0B 4M3KB 1A6UH 3L5XH 4Q9RL 2FHFA 1PJWA 1B04A 4ZUUA 1MFBL 4NOFA 3VGDA 3FRPA 5JA8B 3IGKA 3QCTH 1PX3A 1CG9B 3CUPB 4NQVA 1RJLA 3GLEA 4P9ML 4ALAL 3K9AA 4X5QA 1H6FA 4NZ8A 5IVZA 3V7MA 2R4RH 2UY7A 3QUYB 2VR4A 4OB5H 4ANKA 3K04A 2NSXA 4UQDA 5EO0A 3QJFA 2K3TA 2ZWKA 3FBKA 5FGBC 2A38A 2FMLA 1OB0A 3FT9A 3FU3A 4UNTA 2C8NA 4YC2B 2HP4A 3QDGB 5HHQA 2BSRB 3LZPA 3DK0A 5AUMB 3SGIA 2V9RA 5C0ND 1XEUA 1KB5B 3FMGL 1BIHA 5KG9A 5C2BH 4G42B 3OR6A 2UZXB 1D6VH 3A0HZ 1KBGL 5JW4N 3QDMD 3W11C 4R2GD 3HPLB 2NY3B 4DPRA 4U1KA 1NH6A 2CRIA 5GGTA 5FLXN 5EU7C 5C0AD 5AAMC 2FD6L 4WY7L 1WYJA 4UOW0 4YK4C 2IAMA 5ALCL 2WN3A 5B1JA 3UQ8A 1AZCA 3PPSA 4XGZA 3DXRB 5AOZA 3WJMB 5IJVB 5LQBH 2DWYA 5EU3A 4AT6B 4QJ4B 3RYHA 2VDLB 4KXCA 4NZJA 4GQPH 1M5IA 3R4RA 1NR7A 5D5QA 1MFEL 2PW2A 3KW7A 3LN9A 4KXRA 1RUML 3LKNB 1PZ5A 2IU0A 2I07A 2DYSB 1N8ZA 5CJQH 5GISH 3TK1A 1LP9F 1WZ1H 3IDUA 4R7XA 1UWXK 2Q9OA 5CN2A 4JO2H 1Z66A 2RALA 3MRRB 3UC0L 3AVEA 4D0BA 1R3IH 4ONGL 4Q58C 3H42L 1YRKA 2XQYG 3OX8A 3PLYA 3QR0A 4NS0A 5HYEA 2VQTA 3KGRA 1OV9A 4APQC 2LW1A 1XH3A 2R9HD 2H8PC 2UVEA 4MNQD 2IC2A 4GW5B 3OGCC 4NEHB 2CM6A 2FL5A 2GW5A 3DRQB 5KAFZ 3AY4A 2A9NL 3ZZSA 1OT1A 1BT8A 1F8TH 3FONA 2F8XC 2OSWA 1N36B 1GMEA 4P3CL 2PYED 3HAEG 2R1YB 4XAWL 3CDCA 5HGGS 3TJHC 4PCYA 4EI6B 2WN2A 3KEDA 4B9PA