5B1BB

Bovine heart cytochrome c oxidase in the fully reduced state at 1.6 angstrom resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title The Mg2+-containing Water Cluster of Mammalian Cytochrome c Oxidase Collects Four Pumping Proton Equivalents in Each Catalytic Cycle.
pubmed doi rcsb
total genus 68
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5b1bB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5b1bB02
4HHWA 2OCCB 1MG2C 2JFCA 1J9SA 4GP4B 4RH4A 4DP7X 5I6PA 2YQBA 2VM4A 2B08A 2PPAA 4DP0X 1L9OA 2FNWA 2EIJB 3N2JA 3NSDA 4HALA 1GY2A 1CC3A 3H4HA 5AKRA 2YARA 1A8ZA 2IWFA 4YVNA 4A67A 6PAZA 4BDVA 1AG0A 1J5DA 1HAWA 3CDZB 4L0PB 1T5KA 3FYIB 1KBWA 2HRHA 2YAEA 3IE9A 1AG6A 3NJNA 3ERXA 2XX1A 1DZ0A 4GP8B 4W1TA 2H3XC 3NJFA 3IBOA 1PAZA 2FQGA 2H47C 3FPYA 2IH8A 1V54B 4WTQA 2PP7A 1ASPA 1BXUA 1NIEA 2AZUA 1L9QA 1GSKA 1SDDB 2VW4A 3SBQA 1J9TA 1SF5A 4BXSV 1W6LA 1PZBA 4GY4A 3S3CB 3PAZA 1AS7A 3UGEA 4KOBA 1ET7A 1W6WA 2ZXWB 1GS8A 1F56A 3SBPA 3CVDA 2VSKB 3X2QB 4P5SA 8PAZA 3T6ZA 4ENZA 1L9TA 1TU2A 4GYBA 3CG8A 3CVBA 1E5YA 1ET5A 1J5CA 2GHZA 4E9TA 3DTUB 1RCYA 2IDUA 1JZGA 2PP8A 4FAAB 3FQ2A 1FWXA 1BQ5A 1CYWA 3QPKA 3KW8A 2DWSA 3BQVA 3L45A 3UAAA 1KCBA 4G70B 3AG2B 2A3TA 2XUWA 2HXAA 3S3DB 3NJMA 2VSMB 1IBYA 1J9RA 5PAZA 3FQ1A 3UADA 1NIBA 3NJHA 1E67A 2MRYA 3AG4B 2QDVA 1L9SA 1AZCA 3ZIYA 5I5JA 1NINA 1TEGA 3IN0A 1RKRA 2CBPA 2BP0A 4UAHA 1GR7A 3PCYA 1URIA 2DV6A 4YSTA 1N70A 2FQFA 5B1AB 4AKPA 3QJVB 2W88A 2PCFA 3FPXA 5B1JA 4A2HA 2J57A 3ABLB 2YAPA 4BXVA 3ABMB 1R1CA 4M3HA 1EHKB 3ABKB 1DYZA 1SF3A 2AFNA 1KV7A 3OMIB 1J9QA 2ZWNA 2RACA 1SNRA 1JXGA 2IDSA 4E9YA 4KOCA 3EF4A 3NJIA 4KO5A 2QDWA 2GI0A 4Q8BA 4DPAX 3GDCA 4NB7A 1ZDSA 2FT7A 2E86A 3QJQB 4MFHA 2VW6A 3U25A 1L9PA 5TK2A 9PCYA 1JZIA 2P80A 1V10A 1WS8A 1N68A 3KW7A 5IY5B 2VW7A 1MDAA 4DP5X 4E9XA 3FT0A 1BQRA 1NDTA 1KYAA 4YVUA 3WNJA 1QNIA 2JXMA 4UANA 2X88A 4BWTA 1JXDA 4DP9X 2HX7A 3ABGA 1E30A 2AVFA 4YSAA 5D4HA 1E65A 3CZUB 5I6NA 3BVDB 2BW5A 3T6VA 7PCYA 3EHBB 1BYPA 4BDVB 4A68A 3WG7B 4G7SB 3OMAB 2HZHA 3C75A 3ASNB 4EF3A 1NPNA 4CSZA 1ZDQA 2CCWA 1KDJA 3FS9A 4KO6A 4DPCX 2X87A 2UXGA 2FJSA 4G71B 3X1NA 4E9QA 5D4JA 1BYOA 2UX6A 2J5WA 5I28A 2GB2A 4AKQA 1XB6A 2Q5BA 4BWWA 3V9CA 4PAZA 4A66A 2FQEA 1AZUA 2MTAA 1V55B 1RZQA 1B3IA 5D4IA 2EILB 4E9SA 2IWKA 5FC9A 1GW0A 3CVCA 1OE1A 3FSWA 4GXFA 1M56B 3UAEA 2VMJA 5I6KA 1ID2A 4DP6X 1IC0A 1ASQA 1XMEB 1RZPA 1AR1B 1NIAA 4KO9A 4YL4A 2PCYA 2TSBA 4DPBX 1AQ8A 4A2GA 4YSRA 2XLLA 1M57B 2P80D 3FQYA 1MG3C 3N55A 2XV2A 3V9EA 4YSEA 4F7KA 1XB3A 1WAEA 3X1BA 4P5RA 5AZUA 1KBVA 5F7AA 1BXAA 2XV3A 1SHWA 5PCYA 3JTBA 1GY1A 5ANHA 3NSCA 1PZCA 2XXFA 4PCYA 1HAUA 3T71A 4N4YB 2CUAA 1SFHA 1ZIBA 1QLEB 1PCSA 2BP0B 1PF3A 2I85A 2R7EA 2PPEA 2UXTA 1JERA 1ETJA 3FSZA 1JZHA 1MZZA 1OCZB 2I7OA 2XVBA 5AFAA 2FT6A 2WO3B 1MZYA 1HFUA 3RYMA 4G72B 1WS7A 3SQRA 2Y1AA 1PLAA 5B7FA 2Y69B 3PXLA 2XXGA 1NWPA 2Q9OA 1AAJA 1OCCB 5I26A 4AI7A 2UX7A 2PLTA 2NRDA 1W8EA 1TKWA 1ILSA 2BZ7A 2GIMA 4HIPA 4KNSA 1NICA 1A4BA 5B3SB 4K9JA 1WA0X 2YEVB 3HEIB 3NJGA 2GSMB 3FSAA 3NSYA 2AZAA 2QT6A 1KGYE 1AZNA 4YSPA 2YAOA 1XB8A 3OD3A 4AKOA 1NIFA 3NYKA 2BP8A 3ZBMA 1ILUA 1X9RA 3FU7A 3OMNB 1ZIAA 4UF7C 1L9RA 3X1EA 2H5UA 3FU9A 3PLYA 2BWDA 3T6XA 1JZEA 4E9WA 3FSVA 3EH4B 3PAVA 2CALA 2PP9A 4G7QB 2UXVA 2I7SA 4YSQA 3H4FA 1PMYA 2J56A 1NTDA 4CSPA 3WKPA 1AZRA 2BZCA 2TSAA 3G5WA 3QJUB 1AIZA 5I5MA 1FA4A 2BWIA 2CJ3A 1JVOA 1PNCA 2HX8A 3NJKA 1WA1X 1A65A 2JKWA 4ZK8A 3S8GB 2DYSB 1BQKA 3NJJA 1AANA 4F2FA 1I53A 2VN3A 2IDFA 4NAJA 1GS6X 2GC7C 4HCGA 2CAKA 3QJTB 1JVLA 1TEFA 3MX0B 3TBBA 2HX9A 4E9VA 1AS6A 4N8UA 3EH3B 1ASOA 2DWTA 2FTAA 3MBWB 4KNTA 4X4KA 4YSSA 4BWUA 4YSUA 4HAKA 1M9WA 1UATA 3GYRA 4E9RA 1VLXA 3AW5A 3UABA 2EINB 2EIKB 2XV0A 5LDUA 2UXFA 1CUOA 4HZ1A 1OV8A 2IWEA 2WSDA 3WNIA 3T6WA 4KO7A 1ET8A 4YSDA 3SBRA 3NSFA 3NP4A 1CURA 2QPEB 1AACA 1A3ZA 5F7BA 1AOZA 2B3IA 1ZPUA 1NZRA 3AZUA 3NP3A 5B7EA 1AZBA 1JZFA 4KNUA 3D12B 2YXWA 1PLBA 2OJ1A 1OOWA 4GP5B 3AG3B 5B1JC 1JZJA 2HRGA 4F2EA 1ADWA 3CDZA 2BO0A 6PCYA 1PZAA 2PPDA 2R7EB 3QJSB 1GYCA 3TU6A 3UACA 3JT2A 2YAFA 3H56A 3IN2A 1IUZA 2EIMB 3FYEB 2FQDA 5EHFA 3TA4D 4A2FA 1X9UA 1BAWA 2BHFA 2QPDB 5B1BB 3FU8A 4G7RB 4JKNA 2FWLB 1SDDA 3NT0A 2DY2A 4BK5C 5I6MA 1KDIA 4QKTA 2IDQA 3S3BB 3OQRA 3WKQA 1CYXA 3DIVA 1OCRB 1KCWA 4M4RB 2IH9A 1OF0A 2YAHA 4YSCA 4AX3A 3NJLA 2HLEB 1SHXA 3ZX1A 2VM3A 4DP4X 2BW4A 4JHVA 1OCOB 1GS7A 4DP2X 1OE3A 3ASOB 1QHQA 4HCIA 2XYBA 4JHUA 3IEAA 3TBCA 2ZONA 4HHGA 7PAZA 2IAAC 1WA2X 1NIDA 1PNDA 2ZOOA 2BP8B 3FU7B 4A2DA 1EZLA 3QJRB 2GBAA 2N0MA 1PY0A 3AG1B 5B1KA 1ZV2A 3HB3B 4YSOA 1FFTB 3QQXA 4A2EA 2XX0A 4WKXA 1E5ZA 4HCFA 3X1GA 3TASA 5I6OA 2XU9A 1SFDA 2IDTA 2LLNA 2PPFA 2W8CA 4NERA 3GXUB 4FA7B 3PAUA 3ZDWA 1SJMA 1PLCA 1BEXA 1JXFA 3OM3B 1IBZA 5A7EA 1YLBB 2XWZA 2YAMA 3WI9A 3DKHA 1OE2A 4DP8X 1NPJA 5B7MA 4DP1X 3T9WA 3X1FA 1AS8A 2AANA 5E9NA 4TXVB 1JOIA 3AY2A 3WIAA 2DYRB 5TK4A 4QLWA 4AZUA 5I5IA 5I6LA 2OV0A 1A4AA 2YAQA 4Q89A 2FT8A 3EH5B 3S8FB 4W9ZA 1IKOP 3PPSA 2PPCA 2GC4C 2J55A 2WO2B 1NWOA 2YXVA 1A4CA 1BXVA
chains in the Genus database with same CATH superfamily
2FB5A 1B6UA 2YWYA 4TUYA 4F7TA 3HBQA 1XNQO 5F2VO 4HA1A 3ZU8A 4DP7X 2RNBA 4YX2H 3S4SB 3ZL4L 1EXUA 4IHOA 4GBXD 3OKLA 1IC7H 1AO7B 3X3FL 3M8OL 1NGQL 3REVB 5F0MB 3CFTA 3ZRVA 5AOLA 5A9GA 1N10A 3DGDA 1D5NA 3LH8A 3NSDA 2A79B 4DV7B 2KDYA 1BZEA 1N0XH 3SOBH 2UWEE 1A9EA 2P45B 2VLME 3T4YB 5GRWA 2A0LC 1JI2A 3RFZC 1IKNC 1F2XK 2XV6B 3VXTA 3LPWA 5KOVC 1BCCH 1FHNA 2EH7H 2X12A 3QFDA 4DV7O 5JDSB 4L8CA 4BR6A 5EC2B 2FTKA 1AG6A 1E3XA 1IAKA 2GQHA 3FOLB 4DZ8A 2NY6D 3D2TA 4UV7H 4IBTA 2X0VA 1SN0A 1URFA 4LCYA 1H2SB 4RQFA 3AG7A 2FQGA 3F58H 5EBLB 2CDGA 3CLWA 4QPEA 2YUZA 5DMIL 5IWLC 2VIRA 4XH2A 5IMMB 1YJ9V 1S3KL 2VW4A 3HN5A 4WY7H 1F0LA 4HCRA 4BXSV 4KBPA 2VYRE 4ESKA 1WWBX 2IOOA 3HI1B 1BE3H 3MV7A 1XT5A 4NRZA 1KJ2H 2DQCL 1HQRB 2AEPH 2FZ3B 2A6KB 4HS6A 2X28A 3SBPA 4BA8A 1AP5A 3QXWA 2BVQA 2FWOA 2J72A 5K59F 4ENZA 2BSSA 5DK3A 5DHXB 4GYBA 4W4KA 5EZIH 1GH6A 1UJ3C 1CBVH 3PP4H 4P9HH 1ET5A 1S8DA 4M7LL 3T1FA 1GO3F 2A74A 1MVYA 3LS4L 1INEH 5D7SH 3F5WA 1IJ9A 3AWFA 3SYAA 4Y7MA 1BQ5A 1X5LA 2DWSA 1KV3A 4JI6O 5TDNB 4TL5A 4G7YH 4F7EB 2WVUA 5CLZA 2Q8AL 3P32A 1VFMA 3H9HA 5KYNA 3WHE0 5JIQA 3C60C 1RM1C 1NBZA 1PZUB 1E27B 4MAYB 3MLRL 4X7CC 4C54A 2ZYHA 2IQ9H 5FXCH 3SYCA 5DRXA 4FXKB 4UDUB 3B3IB 3GSOB 3LVEA 4KH2A 1NZ6A 2R59A 4IKNA 3UQ8A 4JRXA 1SGKA 1MFDH 1TTUA 4EEEA 4HJTA 1N36B 3LPFA 4ZX3A 2I24N 1IM9A 5LBSH 3QRBA 1KBPA 2AKRA 3BVTA 3IPFA 3QPXL 4MB3A 5DSCA 1URIA 4KKLC 4J3OC 5E9DD 4IBUA 3EHBD 3CFQA 1J1PH 5LP6C 4MD0B 5I2IA 1N5YL 1G9NL 1GN6A 3J80N 4AV5A 1PZ5B 3KYAA 1BZKA 2L7UA 5IYBO 3VI4E 1VF6C 1WP7A 3ABMB 1IBLB 1CVRA 1OQOA 3O2WH 4W9CC 1MJ7H 5T3ZL 2DD8H 4G6ML 5E5MB 4DVBB 2KQMA 5C08E 4XP6H 2HKOA 4HWBL 3GJFH 3O8XB 1TCRA 4ZO6A 4G11A 3RPKA 4WSJA 3MZGB 3KPSB 1IBLO 1YY8B 2F7RA 3FUJA 2FJUB 2QHRH 2NXYD 1ZA3B 3D25B 1G6UA 2IG2L 4JFQA 4MAUL 2V17H 1T0PB 3QJQB 4YEEA 4OLUL 3V4LA 3V10A 1XF4A 1V05A 3PV6A 3RB5A 4PJBE 2C1OA 4K7FB 1KJVA 4H25A 4ODXA 1JHLL 1NGYA 2EAEA 1HL9A 3C6LA 1MJUH 1CGYA 2IU3A 1HH6A 2QKAA 3CSFA 4IM8A 5EWIL 1E5UI 4FQQB 4MKTA 1LQBC 3I6KA 4DOHB 4E9XA 1HEZB 4V1DB 5JW3H 4TTGA 3VB8A 3CZSA 3BH4A 1RPOA 1UD5A 4PUBH 3QI9A 4AYEC 4Q6GA 5G5DB 2CIKA 2HX7A 1JNHA 1HX0A 4WW2F 2DOSA 2DLTA 2RA1A 3R8QA 2E27L 4K9EL 2HKFH 3LJ3A 5D4HA 3W7UA 2B77A 3RFRA 1GZHA 1QLFA 1JGLL 1BDYA 4OLYL 3ULVF 1NGWB 5CBEA 3B7TA 4LRIA 5KVDE 5DVLA 2QGBA 3CPWU 1B0WA 3FUHA 1UGNA 5L6YL 1FNFA 4G8GD 5DUMH 3TJHD 1NLBH 5HI3D 4YZFF 4QI3A 5H35B 4XPBH 2O4EA 1F90H 2AEWA 4Y16D 4B7KA 3DETD 1CE6B 3AQZA 4WWKC 2X05A 1FFXA 5F6HJ 4ZPTB 2AK4D 3RJOA 1JPFB 2D3OW 3QHFH 3QXDB 3VU1A 3JD2A 2CAZC 3S35L 1MIMH 1S9YA 4D94A 2ITDC 3V9CA 4LFCB 3R1GL 3K6SB 4JLRA 4O4HB 1RSYA 1T5XB 4IRSD 4ZZFA 3K06A 3A67L 3MRHB 3T8VA 1ECZA 1OGAA 4U1JB 3UCQA 4IKKA 4L1SA 4DRXA 1OAYH 5D9SA 4LFCO 4MNGB 5EMYA 5DVPA 4MVOA 2D4DA 1L1FA 2G2RB 5E1HB 4W4OC 3FZUD 5LQBL 4PMFA 2A77L 4V33A 1ZHNA 1G8MA 3LZOA 2ITEA 2YPVL 4UB0L 2XLLA 4GQRA 3L2NA 1FN4A 4D0BB 3CC7V 5DJ0B 1ZRUA 1H2NA 4RRPG 4ZQTA 4NQTA 1M2OA 1KPUB 4GBXB 4PJCF 1IQWL 2Q3AA 5BPPA 1WP8A 1FIGL 3BZ4B 2D7PA 4XCNB 4YDKL 4RFEB 2MHAA 5IQMA 3JTBA 1R73A 4Y9GA 5GGTA 2IFFL 3NSCA 4NGHH 5I9QB 5EF0A 4XPFL 5CN3A 4CMHB 2C9QA 1AYRA 3DX8B 4XMKH 4MA8H 2ZKYA 3U36A 2QADC 3PDOA 3TL5A 1T1XB 2ADIA 1CBJA 3FRPB 1MZZA 4ADJA 2W1NA 1GCYA 4YX2L 3FB5B 3T65B 1KYOJ 1I7UA 2JLPA 2Q7HA 2IJ0C 5EDXA 5HBBA 4MS2A 35C8H 4NWTH 1FAIL 2LU4A 3R65A 4FJZA 2CK0H 3STZC 2IOIA 5CUSH 3VQLA 5I26A 1D9KD 5CS7A 1AGBB 3BUBA 2ZP0T 5GS3A 3NESA 3EZJB 2NOYA 4P0DA 3TT1H 2ZP8A 5DHDA 1MCCA 4F58L 3CD6V 3M17A 4GS7B 3ARVA 3E2HC 4GUOA 1P4UA 2VLMD 1BD2E 1WBXB 1FXHA 4TUOB 5C3TA 2ZXBA 1NOFA 4NO3B 3AK1A 4ZAKD 3REWB 5AD0A 4GAAA 4HCRL 4IEFA 5CMUA 3FUIA 3LH2H 3RT3C 2OFQA 2X4PB 4G8EA 4P2QE 1U8JB 1T20B 1XTLA 3IAGC 2IGLA 4OPAA 2DIBA 3F58L 4FFBA 1S72V 2YA1A 3IS0X 3IAPA 4F80A 3JSNA 3L2LA 3ARUA 2QTOA 1BQUA 4NUPA 1RFDH 5DLLA 4WY7L 1MQKH 2I25N 3STLC 4IOIB 1EEYA 5CILL 2RJZA 2P46B 5AEAA 2ATAA 2WLIB 1EZVX 5GTHZ 4OSUH 4UUJB 1E6OH 4WU5A 1MSWD 2X1PA 3MNZB 4YE4H 4CS4A 4XBPB 5AAWA 4GQ9L 4ZBMA 2FUTA 1BZ9B 2W92A 5DQDL 1K6QL 1CBVL 1FLTX 4ODUA 3BVWA 1LR1A 5CA0A 1KECA 3FTYA 5DVOA 1XH3A 1HHJB 2BNQA 1AY1H 4PTTB 5D7SL 3TLRA 1AGCB 1INEL 4PRAA 1AD9B 3WS6C 1CXLA 5E9DB 4LVOC 1A8JH 1F1AA 4HAMA 4CU7A 4G7YL 4X9HA 5I8EB 4LFBO 4ZK8A 4OCMC 1VEWA 5IHWA 5D7LB 1FDLH 4A2MA 4EZMA 4XBGB 2ZOLA 2HT4C 5FX3A 2NZ9C 4R97B 4IMLB 4HUUA 4YHHB 3QSKB 2XT1B 2BSBA 1TEFA 3VXRB 3K57A 1TA8A 4ZOLA 1IAIH 2D0GA 1HEHC 4OFKA 1AHWA 4D9LH 3H1JH 2VQ4A 4PBDA 4G8IB 1MFDL 1OHZA 1M57C 1U4EA 4KGJA 5F9DC 3ZE0B 4U6HB 3TIDB 3JVGA 5LBSL 3KWUA 4YHHO 3KPPA 2MKLC 1FH2A 2SEBA 3P9MA 5F70A 1OANA 4E9RA 3VJ6A 3CMOL 3VGHA 2WKOA 4LPVA 1FVCB 1OV8A 1GM8A 3GK8L 1NDMB 5IQLA 1KBGH 3O2WL 3SE3A 1NLDH 2DD8L 3B9KD 4JM2D 4NS0A 4WHYH 4Q74A 5HHNA 2H0FA 4L4TE 4KKQA 4MHHG 1J0HA 5HXMA 3K3QA 2QV4A 1HR0B 1OXYA 4TV8A 1G0DA 1KTLB 3EO9H 5C08D 4JGSA 3T3PF 3VCLB 3QJFB 3BDXA 3JAWB 4F4LA 4IRJA 5KAFZ 3HAEH 4FP8H 3AG3B 4E2LA 3F7VA 5JYMA 1MWAB 2QHRL 1CD9B 2VR7A 3DK2A 3QK0A 4QIRA 4ACPA 4DKEH 1URZA 3RVTD 4C4KT 1HR0O 6PCYA 1YEFL 2YWZA 1L0YA 5JQGB 2PPDA 3ARWA 1QRNA 5DK0A 3TA3A 3DVGB 3LYRA 1ND0B 1XR8B 1EO7A 5E0QA 4A38A 5KW9L 4RA3A 3TA4D 3WLBB 1MJUL 2X1OA 3QZMA 4X20A 1MFAL 2IMNA 5KYUB 1SUHA 4LNRB 1KTDB 2O5YH 1XSJA 2XASA 2VLKE 4Y16B 4XMXA 1NA8A 2F5AL 3QTCA 4PUBL 3WE6A 1LO3H 2Z64C 3CFEA 1FXKC 4M5TA 2RCVA 2FHFA 2MSPA 1RMFH 1BBJA 1HHIA 5AOJA 4N2GA 5BXFA 3WNLA 1JYWA 5DHYA 4GIPD 4QLRA 1Y67A 1JDDA 1IEHA 1CDCA 5JJJB 2QKSA 4AL8C 1G4MA 3E7JA 2ADQB 1VIBA 1FRGH 5GRVK 4XBFA 5A3ID 3BLBA 3W38A 2QKIC 4Z7QF 1MLBB 2FEDC 4LCUA 3CVHH 2IV9A 2XKNB 1Y6KR 5DUML 3TEXA 3VD5A 4DP2X 2GCYA 4P99A 2WSSG 4E2OA 1QHQA 4JN1L 2XPGB 4I9XA 4Y4FD 2ZONA 2BY0A 4PCSA 4O4IA 1F90L 1MY7A 1N4CA 4NP9A 4RGNC 4BUGA 1TVHA 4QRQB 2EP6A 3OSVA 2GTZA 2ZOOA 5DYFA 5EBMC 4O2AA 3D39E 3MLZH 3QHFL 3KAAA 1DQQB 4U1SB 2XG4B 4OY9A 4NWUH 5ESVA 4B60A 4ZFOA 4CGTA 1SA0B 5DECA 4H26A 1A64A 2HWZL 4HKZB 1EZLA 1Q4NX 4NJAH 5JPNA 2EYSA 1JNLH 1PY0A 4ZTOL 4LRNL 1MHEA 2FX9H 3EXLA 3LNMB 5CR1A 5HJGA 4ZODA 3TP4A 3PWPE 4J8RA 1FBIH 1OAYL 3JD3A 4EZLA 4IDJL 4CVZB 5J06A 2R83A 2P5EA 2XA8H 4L8BA 3BPNB 3TASA 4HIJB 3CRAA 3FH8A 3PL6A 3Q6GH 1BW8A 2MPAL 5DWPA 3RI5F 4HLEA 1CGWA 2XN9E 3HKEB 2O72A 4YGAB 2MOGA 5TDOA 3QQDA 1K9TA 2D2CC 1F6LL 1I1FA 4MS8D 5H8DA 4AGOA 5I0YA 3CZGA 3JATA 1QATA 3DRQA 4BIZA 3LRMA 5D96B 1TUBA 3OWEA 3TO4C 2X9WA 3LIUA 3O81A 2X42A 5D6CA 1UA7A 3O2VL 5DURD 3R8BB 4NKOA 2BERA 3WXWH 1G43A 3T1HB 4QDGA 5DD3H 1JRHL 4JRLA 1AR2A 3WL9A 3X14A 5GZNC 1OP9A 2BFVH 3GTNA 4XNUL 3EH5B 4N9OB 4HJEA 2P4AB 1C7SA 1XEDA 4XMKL 4LLDB 1NEZB 2B4CH 3ULAB 1DEEA 2ATKB 1XF2B 3TZVB 2J55A 3T1HO 1U8LA 4EI5A 4QCIB 3D85B 2Z31C 2X2UA 3D07A 4PJHE 4UCOA 2DM2A 1UB5B 5BW7A 5FUCE 1MG2C 4GP4B 3B40A 1J9SA 4LDLB 4RH4A 4JG9A 1Y0LA 4NO0B 4NCDA 5L8JB 3ZR6A 3RWFB 4BSJA 3MRGA 4AENB 1YPZE 1SBSH 5DS2A 1RZ8B 3TCLA 4DP0X 35C8L 2K78A 4NWTL 1J1XL 3V6ZA 4ZHQB 1DQJA 4JB9H 3F65A 2CK0L 5CUSL 3WN5B 1B4JH 3P0YH 4R0LC 4AMWA 1CTOA 2VWEE 5K33A 4WJ5B 5F7MC 2CLVA 1RJLB 2VZTA 2ZF8A 4H2CA 5B1BC 1T5KA 3SPJA 3ARDB 4ELME 3CSTA 1QACA 4QF1A 3ERXA 1AKJA 3LKQA 4ZS6C 4O2BB 1I7TA 3US1A 3LH2L 3H7BB 4DGYH 4I9QA 5EO0A 1WD8A 4DXWA 1BD2D 2FLMA 1K8IA 4WTQA 3PDDA 4N0FA 3KPOA 4P2QD 5KANG 4JRFA 3U46A 4B3EA 2YSUB 4MD4B 1RFDL 3IFOA 2VXSH 4DUZO 1MFMA 2EDLA 5DHEA 2PXYA 5DWUH 4ZSOB 4JFFB 3RWJA 1JZ8A 3GXIA 1QLNA 2B1GA 2A6IB 3BRCA 5HD8C 3VG9C 5I0WA 4P9OA 4OSUL 1P0SE 4KQ0A 1E6OL 4E9LA 3CFDB 5IB1B 3ZN0A 3V5HA 1Q1JL 4YE4L 1DL7H 5EC1A 3ZTJH 1L9TA 1CD1B 2AXJA 2MTPA 2YIDA 4P05A 3EYQC 3W7WA 3ARGD 1R3LA 4OZ4A 4PJXE 3RYIB 2GHZA 5I17A 3Q4HB 3UPRB 2CK3G 1H8LA 1FE8H 2Y3NA 3EJTA 1PV0A 5E6ID 2WANA 1AY1L 1QBLL 3NN8B 1NBYA 2CR3A 4N2OA 1TNNA 5CWSA 2E7LA 5LXGH 1KGCE 5JNYA 5DT1H 3NIGE 1RD6A 3QIBD 3WTWA 2A3TA 1S3RA 3S3DB 4JREC 1FDLL 4RNRB 2VSMB 2HCZX 1CEZA 5PAZA 1HCFX 4ZI7A 4FTVE 2XWBB 4HIIA 4EAEA 1I1RA 1INDH 3SY6A 3NJHA 4CC4C 4D9LL 1WLEA 4TTDD 3U1SH 3ECUA 3ZCCA 4QRPB 4L23A 3QUYC 3SOTA 5BOJA 2LAAA 1DJGA 4IJ3C 4QD2E 3E1ZA 3ZY7A 4NIKB 3RUGE 2VJ8A 4IBQA 4MDRA 3H53A 3F7QA 2AXFB 1T1WA 3TCTA 2QTVA 5FCUL 3FTWA 1ZLUK 4NQCB 2HKHL 4OUOA 2VRZA 3ABLB 3E8BA 4WFEA 4I0PC 4YJ3A 1QFPA 1G1KA 1TYRA 3CN0A 1KPVB 1KTKE 1KBGL 5T1KA 1F6FB 4JM4L 3BIAX 1NLDL 4Y1AB 3VGDA 3VXPA 5FEBA 1KV7A 4PJBB 3OMIB 1J9QA 4IRZA 1YXBA 4KK6C 4OZGA 5J57B 4N1EA 5D7EA 1EHAA 4IBZA 3FK3A 1JZ4A 4OZHF 1Z6JT 4Y4KD 1WBZB 3JWOC 1NC2B 5IKCA 4ENED 3GSNB 4L4TD 2N4IA 3A5VA 5FO8B 2CTWA 1JPST 2EXYC 3VVWA 3Q13A 4U3SA 4J3OH 4FP8L 4BSVB 2I07B 4Z1PA 2LW3A 4GRLA 4AV4A 4BINA 3OJVC 4PD4F 4DKEL 2Q76A 4NKIL 3QWOA 2VW6A 3MLXH 4LASH 3QP3A 4YDIH 2ESVA 1YEKH 1HHKB 3L4VA 2ZX5A 2X6VA 1WTLA 5E0FA 3S96A 4CW1A 1PLGH 2QR0B 4L8SA 4WRLA 3AGWA 2G5BA 1O7VA 3FT0A 5FYKU 2VJXA 3SDDA 1M2VB 5CZXD 4XVOA 4Y4FB 3ZKXB 5C6WH 1ZAGA 2O5YL 5J3HC 1OP5K 2B0SL 1P5VA 1CD8A 2C9RA 1IGCH 4X98B 3BJLA 1RMFL 2VLKD 4HIHA 5DJ2A 2RDCA 4OM0H 3OR6A 1IBBA 2QLYA 3FTXA 3T09A 2H8PB 3B2UC 1G6VK 1HH9A 4GKZB 5J9PC 4DR6B 1OAXH 3RURA 5B38B 4M02A 1V55C 4XI5D 3JBG7 2ZOKB 5DJ8A 2JB5L 3OMAB 4X6BB 1FRGL 2P8LA 4W4NA 1J0YA 3RVVD 1ZLZA 2DOCA 3O4OC 5E6ZA 4XCFL 2FR4A 1E7UA 3THOA 4ZFOL 4DR6O 1YAZA 2X87A 1ZANL 1ZHBA 2R2CA 4DVRL 1X5KA 4E9QA 1W72B 2XVLA 5ITZA 3QH3A 1NI8A 1BYOA 4CADA 5TH2B 5GGSY 2P8MA 2P5OA 2B9BA 3I55V 3X11A 2X53A 2RHEA 1M1XB 2ZCEA 4NJAL 3D39D 4F37F 4G1MB 3WS3A 4KRNA 4Y19A 2FX9L 2Y4UA 3QCVH 3QUKA 3FRUB 5GSRB 3CVCA 1OE1A 4PWIA 2LABA 4QR7A 1Z2GA 5GZOC 1FBIL 1S9WA 3R0MA 1G7QB 5DQ9B 3E22B 3UZVB 1IC0A 3PWPD 3QIWD 4APQB 1KC8W 3Q6GL 2PCXA 1QNMA 1ZSHA 4KY1H 3Q5OA 1VEOA 3GT6A 3MA7B 4KK5C 5GQBA 4MD5B 4BSWA 2WNKA 4YIPA 5FKAB 2XN9D 5AVVB 3T77B 5IFAH 1MG3C 1PVHA 2EE0A 4TSCL 2CLZA 1Q9KB 4LPCA 4U3XA 3ZTNH 3NFSH 1XV8A 1U8CA 4KXDA 2A99A 1K8AW 2BWQA 1W8NA 1WP6A 4LSQL 3BZEA 1C5CL 1W15A 4FQXC 5PCYA 4FYTA 5DD3L 2GTAA 4HEPG 2XXFA 3L9BA 2BFVL 3VYNA 3QZBA 1SFHA 2J5LB 3SJVE 4DGUA 4PGEA 5HSFA 3BH8A 3D4CA 5BUGA 4YK4C 2GHWB 2B4CL 2F7QA 4W9IC 4MXVF 5DHMC 1UFIA 3VXSE 1DUZA 4Y5YC 1BPLB 2F93B 2PCFB 3U0TA 5F7YC 2NW2A 3O3EA 2CUHA 4GZRB 4BK8A 4URKA 3S5LA 3U82B 1QVGU 4X7TA 4XP5H 4Y5VA 5MI0B 5ADOH 1XNRB 3APQA 3HRZC 2Y1AA 3QW9A 5B7FA 4JN2B 4N2AA 5AB2A 3MGTA 3QUZB 4V11A 3NZSA 5BV7B 4JB9L 1B0IA 4IS6A 4JASA 1TKWA 2Z93A 5LNEA 2VLLA 5ISZB 1P1ZA 1BMFG 1XNRO 2IANA 4HOZA 4KNSA 2BDNH 1NICA 1DGSA 1Z5VA 3B7SA 4Y2NA 1GYVA 2AI0L 1E4XH 1GVIA 3OAUL 4ZOBA 4X64B 4U7SA 5F2FA 3IJHB 4AC2A 2PO6B 3ARGB 4RX4D 4X6DF 5E6UB 2ILLA 2CH8A 4DGYL 5C0JB 3FSAA 1BT8A 2B5IB 2DE0X 3NSYA 4Z7NE 1EAPB 1SDYA 4X64O 2ROYA 5GRVL 4KAQH 1DJSA 4AKOA 1JV5A 4AG4H 2ZCZA 5DWUL 2WWKO 4I85A 4LSUL 1MAJA 4WKZA 1GGUA 3VI3B 2FBJL 3H7LA 1KMIZ 4LL1A 2VJ0A 5LVEA 5DN6G 4FLSA 3B8NA 4A6YA 4N0YH 1ZLSH 4EI6A 2PABA 3W9DB 4DN3H 2DWEB 3U4AA 2BVPB 1XGQB 4ZUVA 3FFCB 5AALA 1FE8L 4GT7A 4XDLA 4EDWH 4NXMB 3FQTA 3TX4A 1M4KA 5LXGL 2L7QA 4JY4B 4JDEB 1G4YB 3GNML 5JOFA 2Z0UA 3NJJA 4PJEB 3VWKB 1KGCD 3VXNB 4TQEH 5ENWA 3ZMZA 1I53A 3W0WA 4E68A 1K8DB 4NXMO 5HGBA 3TWCH 2E7BA 3W39B 1AE6H 3J27A 3O2DH 1FC1A 2CHZA 4R4FH 1E79G 2A74C 1H3PH 3CHSA 5GRJH 2O5ZH 4PRPE 3ARFA 3KXFA 2C5DC 2Y07H 3TWYA 1I82A 1OK8A 1PAMA 4FTVD 4KXZI 1BIIB 4I9WA 4L4TB 4JFOA 4HLZG 1IE5A 3LSSA 3QG6A 1BPVA 4FLRA 4ONHB 1UATA 2D2OA 2EC9U 3IWUA 2X4SB 2VH5H 3A6CH 4N90E 1CDGA 3PQYE 4P06A 2IGTA 4PBVC 5EA0H 5FYLE 3HR6A 3VFVA 4HK0B 2DMGA 2WAHA 4YIQB 1O6TA 3QBTB 3MLVH 3DSFL 3RYFB 4OKDA 4XRCB 5AVTB 1SY6H 2F18A 2PTVA 1P1VA 3T04D 5AAMA 1UASA 3N2GA 4KNUA 3D12B 5FA4A 1MABG 2R2HA 4FTDA 4HFUH 1SVCP 4F5CE 5J1TC 1OOWA 2HP8A 2NX5B 4U0RC 5I1KL 1G1OA 4K5PA 3QEQB 2LLLA 2QM4A 2DQFB 3QYNA 3OR7B 5I0ZA 2WLLB 3MLXL 1PZAA 4LASL 1FQ9C 2QFPA 1YEKL 1F42A 4TNEA 1JR9A 1K4DA 1KLFA 3NH7H 4ZZKA 4U0QB 3ICXA 1R3JB 4KX9A 1JF5A 1PLGL 4UQDA 5AW7B 1QR4A 5C8JB 3IPEA 1ZT4B 1A7NH 2DY2A 2HVJB 1Z2KA 4XNQB 4AIOA 5D1ZB 2P43B 3WFEH 1IGCL 3HE7B 3L7FA 4I5BB 2AQNA 2XWTA 4ISVA 1VB9A 3D1MC 4N5UA 1F6AB 1NGXA 3VWJC 4X4MA 3C6LC 3D9AH 1PU0A 1KMGA 1SZNA 2JIXD 4LLWA 1ZLWH 3UYOD 3ZX1A 3OFNG 4X1IB 3IJ7A 3HKCB 5F9WC 3ILDA 2HG5B 5IMKB 4RIRB 1SN5A 4GAJH 3L3OA 5EIBD 3QAZC 3ZMRA 4QHUA 3MCKB 1UZ6F 4BQCA 5CEZL 1H3UA 7PAZA 1AVMA 1I9EA 4XB8A 4BFFA 3LCYA 4N5ED 3CCJV 1GZHC 1HXYA 3IDJB 2R0KH 5IYZB 4NB5A 1Q0YH 2Z4QB 1F11B 3E80A 3P4NA 4LAJH 5LOVA 1OF2A 1NU1H 1M7IB 1R6TA 3NDZE 1UZ8B 1NFDA 4XAKE 4I55B 1LMIA 5EBWA 2D7NA 2DIEA 4N2BA 1Y76A 1CFQA 1JF1A 2X4RB 3NIDB 1F58H 4YDJA 3QCVL 4PB0H 3KBPA 1BJMA 3TO2A 5AOZA 2DYPA 4OUUB 3PWJB 2H6PA 4PRBB 5D7HA 4KZDL 2UY7A 3BVNB 4PRDB 5I6OA 2F68X 3G6JB 5DJDB 3L5WA 3RKDD 1FO0H 3BT2L 3A8TA 3T6QC 1PLCA 1BQHG 2DDQH 3O3DA 4P23B 5JXED 1WWCA 1RUML 3FB6C 1OAZH 2E9GA 2VXVH 4FNUA 1IBZA 4YXLH 2CE4A 4KRMB 5IR1A 1SPDA 1IBGL 2JK5B 3WJMA 3ZTNL 1FO0A 1OARH 2AXTZ 3NFSL 3FN0L 2V6HA 4PA4A 2WGNB 5BCAA 1H3GA 3OXSA 4UQ2A 4RGOL 5C0DA 1NCUA 5FUOH 5E24E 3H1ZA 4XZUA 4XMWA 4PSRA 5AAPA 5DJ6A 3HNSH 3II1A 4J2XA 4EIZC 3QNZB 3QO0B 2G0KA 2PF6A 2WO2B 4EKWA 4Z3EA 4FNRA 1S5HB 5DXWA 3SJVD 5FHAH 3IF1B 5JIPA 5A2QN 4V2CB 4WF7A 1BFSA 2F6AA 3HZMA 2WMPA 4OH2A 4YDVA 3VXSD 5JHLH 1S78C 5ADOL 5SV4A 1U36A 2EZPA 4HS3A 2Y48A 3QWRA 2HTKC 1BSIA 2PTTA 3BEWB 5C8YB 4IMKA 1A8ZA 4RA0C 4AHCA 3QORD 2BDNL 4NTYA 3DDGA 5D2NE 4HUVA 3AITA 5D1XA 2CGRH 4RAUB 1EDHA 2UWEF 5H6QA 4XWGH 1P7QD 5AW6B 5IV2B 5LGJA 3FYIB 2RH0A 2IBZX 3P40A 2YAEA 3IE9A 4KI5E 1YIJV 3F01A 3Q8EA 4GP8B 2FAUA 3MO1A 4K3JH 1BJ1H 2Y4SA 1SMOA 1TO4A 5E1IA 1NFKA 4MJJA 1NGPH 2CHXA 3F7LA 1TCMA 5IB2B 1OZ0A 5I73B 3AABA 2P5WA 4PJXB 5EBGA 5I16A 1KYOK 2HJFC 4PU2A 4KAQL 2D0HA 4UTBH 1LE5A 1P4RA 4WO4B 4A6YL 2FH8A 3K71A 1Z3RA 4N0UA 1QI3A 4AH2A 5K93A 3O9WA 2R70A 3CVDA 4FNLL 4H1LB 4IOFC 2N59A 3CG8A 3L3HB 1SKVA 4PJ5A 2VDLB 4N0YL 1ZLSL 1KY6A 1J5CA 3QEHA 1NAMB 1OSZA 3AUVA 2NY6C 2ZZUT 4PA6A 1CZ8H 3ZR5A 1MHCB 4EDWL 4TVPH 4O4JA 3KW8A 3JALA 4N25A 4CJ1A 4PRHB 1SZXA 1WZAA 4AVIA 4HZLA 3DYMA 1Q82W 5E5LA 2DQGH 5TPWH 1TT6A 5AAWC 2HXAA 2O61A 2P42B 4EN3D 4O9HL 2MCMA 3TWCL 2VDNB 2UXDB 5CU9A 1AE6L 2YBRA 3KWWB 3O2DL 2PCPB 1C12B 3C3TA 4R4FL 4JNXA 1H3PL 1EEZB 2VR5A 5GRJL 2O5ZL 4BH8A 3FHEA 2F8IA 2DKMA 2OZ4A 3L73H 3OB8A 5I5JA 1TEGA 4B3VA 4N8VG 5J6HA 2VC2H 1H15B 1TZ8A 4IBLT 4PRPD 2YN3A 5FNVA 4NX0A 2JJ2G 4QHPA 4YSTA 1A2YB 4OZGF 5EA0L 3A6CL 1G7HB 2F08A 32C2A 3FPXA 5IJVA 3QDME 4GKOA 3ZDXE 4N90D 2YAPA 4BXVA 2EJ7A 3PQYD 1ZVSA 5FYLD 1NJIW 5IY5C 1SF3A 3DWTA 4ZJ9A 2XTJE 1L6XA 1AHWC 5C7XH 1D7CA 3MLTA 5F88B 4N9GA 3UYPB 3V0IA 1I7RA 3E38A 3KGUA 2LU5A 3L9RB 4M6AA 3JWNH 4ABWA 2OQJB 4IBSA 4DAGH 4DNLA 3WEAA 1AFVH 4KOCA 1H2KA 3JAMN 4R6ZA 3TBTA 3CLEH 3IJEA 4NQEB 4AEHH 4ZFZA 3D18A 4LSDA 1FNEA 4KTEL 1K97A 4S0SD 4PHZA 3IJYB 5E8PB 3IKCA 4X65B 4NB7A 2FLBT 5KVFE 4Z3JA 4NO5A 1MFNA 4AGLA 1C9SA 1QWHA 3SE3C 9PCYA 3EHBC 1FIEA 1T3FB 1ZTXE 4JFZH 2EIJC 1LP9E 5AOKA 4H8VA 5EN2A 4X65O 1DR9A 4P2RA 3HZ3A 1TTFA 2LFRA 4D7SA 5IBTH 4Y5XA 2F66C 5AENA 1JPTH 3LKRB 1KCSH 1MCJA 2BRRL 1BLIA 3TNMA 3VXUA 3BGAA 4CDHA 4TQFA 3RVUC 1SQFA 3WFEL 1SQPH 5GXBB 2IVFC 5GGUB 3VFSB 3BEVB 1RURH 1UM4H 2BW5A 1CFNB 2NUTB 3D9AL 3KR3H 3BVUA 5KMGB 4FFWD 4ODHL 1K2DA 3FO2A 3A0BZ 1JWSA 3N41F 5D7JD 1BMWA 3ESVF 2CDEB 5IYDO 1YYLL 3E35A 4H33A 2F53A 3DSNB 3H42H 2KT6A 3BISA 3OG6B 4HBNA 1FSKB 4AQOA 4O02A 1NBCA 3TF4A 5BO1L 3H1IH 5I28A 3OB0H 1U8KB 1A32A 1QSEE 3GS0A 1BGYH 2R0KL 3LS5L 4HUXA 1Q0YL 4O51A 2K3TA 3SGJA 4HPHA 3OEEG 3T4ZA 3ETSA 3PWLB 4M7ZC 2QQKH 2QE7G 4FIPC 4LCUC 1Q0EA 3LKSA 1U8IA 1J0ZA 4M93C 1INQB 1QHOA 2O6EA 4RDQF 4HWZB 4PVLA 3FSWA 3D3VE 4PB0L 2CSPA 4XAKD 5BUAA 4DP6X 1IC4L 5DUJA 5HVGB 3WAJA 1JNNH 5KX5A 1L7IH 1J95A 2FSEA 2RD0A 5CIPH 5LAXA 4JZJA 2DWDA 4L9LA 3L81A 1H8HG 5HI3C 3L75H 1QX1A 3DIDA 1FYTE 1FO0L 2GG1A 4JUSA 5HJ3A 1MPAL 3B1TA 5KN5B 3DETC 2DL2A 5JPNC 1YN6A 1NKGA 2VXVL 2JKIS 1VACB 4D0DA 2XV2A 2WOBA 2WWWA 1X9QA 4J10A 1ZOXA 2FCBA 3OGIB 2IM9A 5AZUA 4PJ7E 4XCYB 5A2AA 1OARL 3EGSB 3K79A 1AI1L 4LNVA 4CSSA 5F9AC 4IRSC 1W0KG 1M05B 2QFRA 4M8RA 1SHWA 2KUTA 4PJFB 4ZDHA 3P1VA 2ZWZA 4NHUA 2RMNA 5CA1B 2EIEA 4JJ5A 1QLEB 4LEEA 1F97A 1SXCA 1DJYA 3HNSL 3QORB 1XBRA 2BJMH 5HGAA 1R0AH 3FZUC 1FFOA 1HQ4B 2WXKA 2Z0BA 3MA9H 5DMKA 4DK0A 5EEVA 4P48A 1UOKA 2PF4E 4RRPM 4X1KB 1GKOA 2XNAB 4M3KB 4U1MB 4BFEA 5KG9B 3HZVA 3SQRA 4FFZH 4UM9A 3F5TA 4JPIA 4LAQH 3CRMA 1IGMH 3EFOB 1WZKA 4XNXH 1BFTA 1VKXA 3UAJA 4Y9CA 3U2SA 4X1YB 4JQIA 4X9BA 4EI5C 4XB3A 2Q20A 4FFZA 3MRCB 2ICEB 3IAYA 3BABA 5B3SB 2CGRL 4RAVB 5TF1H 3T3MB 1AHMA 4MMYA 3I50H 3G5YB 4KK9D 3ESNA 3S48A 4YHPA 3D09A 4LO9A 4LDOB 3NACL 1CF8H 2EE6A 4HF5H 4K3JL 2H32B 4KI5D 4K94H 4I1PA 2H3KA 3GM0A 2ETNA 3GMMB 4HLJA 1W0JG 1MVUB 2QTEA 2FL4A 3I6GB 4JVWA 5IK3A 3UT5A 3Q9PA 2BSKB 4RMUA 3NYKA 4GX1A 3RILA 4QJ5B 3VD3A 4UCSA 1D9KC 3MREA 4EB6A 1L9RA 4NQVB 3HMWH 5I30L 5CCGE 2NY0B 4L0YA 3M1BA 1HINH 4IOSA 3SYOA 3DTXA 3GTVA 1QZ1A 1XAKA 4NUQA 1E8XA 1KBBA 3K2KA 3OZKA 4PJ8B 2GPZA 3DUSA 1JFHA 3G4SV 1U3NA 5E5RB 1Y18A 2XPYA 3KDMB 4ZAKC 4AILC 2DM4A 2YMOA 1OP3K 4AQEA 1X5AA 1G84A 4Y4HC 1AMXA 3L8QA 3L3IA 3MRMB 1MAKA 3EDFA 3ASWA 3W9EA 1E6JL 1JGVH 5HDOA 4HZ3A 1U30A 1IEBA 3JT0A 4YR6B 4YBLC 3EYOB 1P6FA 1VPOH 5EC1C 1CG9B 2OZ4L 3EUUA 5GS2H 3QE5A 1GS6X 1W8OA 4RWYH 3SKOA 3STBA 4KQ3H 1K4CB 1DEDA 3S8WA 3HPLC 1RU9H 1LEKB 2O30A 1XVSA 2ZR3A 2B9ZA 4KNTA 3BPLB 3L1EA 1TSHA 2J8UA 1RK1A 2J88H 4GSRA 4TULL 1XGUA 5C6PB 4ZRGA 4Q2ZA 2BSTA 5DEGB 3L5IA 1R6KA 3CDGB 3DIFA 4OD3H 1ZK9A 5E1AB 5HJDA 4YHML 1HHHB 3NG5A 2VO5A 3S4SA 4PH8A 4X8CA 1LWRA 3WLWD 4D7TA 1AO7A 1HJBC 4BWAA 2DKUA 5E99H 3G5XB 2AJYL 1W91A 2JJWA 1ACCA 3QDMD 3REVA 3UTTE 5C7XL 4NI3A 1A3ZA 1I4FB 4JZGA 1M5IA 2ZOWA 2EKSB 1ZPUA 1NZRA 3CSPA 1FGNH 3U79A 3WSQL 4DAGL 4G9FE 4M62H 2XTJD 2YXWA 1PLBA 1BFVH 2R9IA 3MJGX 1FUNA 4HXAL 1P4IL 3T4YA 3CLEL 1AHKA 4GP5B 4M61B 4AEHL 5KSAB 4KJPC 4RMRA 1XXFC 1ZKAA 2N1KA 2V7HB 3AXLB 5JDSA 3B9VA 5EC2A 3MGOB 3JUZA 3V4UL 4WUKH 2CJSA 3FOLA 4WHCA 4Z7AA 2X0WA 4WFFE 5C0AB 5EBLA 2PYEE 4FQHB 2L7JA 3FNKA 3L9EA 4IYHA 4HBCH 4JFZL 5D1QB 5E8NB 4AQZA 3IGFA 4G7RB 3EBGA 2QJDA 1ZX3A 5IBTL 1BF5A 3ABUA 1EVUA 4QKTA 4B7IA 4F57L 1JPTL 3NIFE 1KCSL 1U6AH 3I9GH 5DDHB 3HI1A 1OCRB 5HHOE 4X2UA 1TXKA 2FZ3A 1HQRA 1EGJH 2L6LA 1OTUD 2A6KA 3GI8H 4WI6A 4FQLH 4C4KO 3BUIA 4JCLA 1PKOA 2WWMC 4HWUA 5EOCH 1L0LH 2PTUA 5KYWB 1UM4L 2GSIB 3SKJL 3JXAA 3O4LE 1QBMH 3SDDC 5HYSB 1EGJA 1OCOB 3QVAA 4KKCC 1YVWA 2F1EA 1JCHA 4GRWH 2WN2A 5TDNA 1EIBA 2WHVA 4F7EA 1JFFA 1DQLL 2GJRA 2GY5A 4RCAA 1QW8A 2CRMA 3QYCA 3OR6C 3AJ7A 4R4ND 1FFNB 2WYIA 4JFVA 3FUKA 1BAFL 4UDTB 3K2MC 4LOUC 3GIVB 1E27A 4MAYA 3S2CA 3MRRB 3KMDA 2HEPA 1IO4C 4FXKA 2QQKL 1X5JA 3B3IA 1YRKA 1QSED 2IH1B 4UDUA 4CU8A 4LCCB 4AZ8B 1J8RA 5B1KA 5IOKA 3NCJH 2AS5M 4KJQC 3DOIA 5L4JA 2YD9A 4XX1G 3EADA 5A3IC 5K9JH 3T4DA 1L6ZA 1E9OB 1SJXA 1L7IL 3D3VD 4MD0A 2LLNA 1HNZO 1KN4H 3FB7B 4R4BB 5JDJA 3D06A 3MLPA 4WWID 5L9DH 1PZ5A 2ZAGA 4WI7A 4ASUG 3SO3B 3RL1B 2BOCB 4RSVA 1JS4A 1RK0B 1H5BC 1A1OB 5E5MA 4WUUE 3C9NB 4DVBA 3SKMB 1FYTD 1DZBA 4WGVB 4MQSB 1EJ6A 3AT8A 2QQNL 3D30A 2LFGA 4NC0B 4OF6A 3UO1H 3O8XA 2FVNA 3FB8B 1AS8A 2JCCB 5ACLA 2FECL 4AYFB 3KPSA 4QTFA 1PY9A 1YY8A 5TK4A 5ID1B 4QT5B 5FL7G 5CJOH 4N2EA 2G3XA 3LXAA 2EINC 1UWYA 1ZA3A 4Q89A 3RP1A 3D25A 1RK7A 3CNKA 3P0VH 5IVXF 5J2UB 1XILA 4XC1H 5EULV 1EHNA 4LT7A 5HVHB 2MIZA 1K9MW 1X3DA 2QVIA 5C2UB 3LNIA 2C26A 4K7FA 2R72A 4LSTL 4MGXA 5L3DA 3MA9L 2V2TA 1HSAB 2J6EH 2JFCA 5I8KL 1R47A 5I6PA 4FQQA 2I9LB 1HEZA 4V1DA 5E1QA 3LDDA 4HHAB 3EJPA 5AW9B 3EJCA 4XN4A 4FFZL 1TVDA 2E7DA 5KVGE 3EBHA 4JHAH 4JKWA 1IGML 4FLTA 1L9OA 5G5DA 5KEZA 4XNXL 1DSFL 2L0DA 2I5YH 4P59L 4I0KA 4QAWA 4B27A 2OL3B 3ARRA 3H4HA 4OIBA 2EDHA 2F1MA 1DBAH 2DLHA 4NN7B 1NGWA 5L3GA 2VTFA 2VZ1A 1P5UC 4AI8A 1QSVA 1KLUB 3C09B 3S0PA 3ILPB 1RIUH 4Y5VC 1R17A 4DR7O 2H3NB 5CJQH 2YC0A 5E70A 4ELMF 3K9SA 3TETA 2K1MA 2UYLB 1OZUA 5H35A 1CF8L 1Q94B 2ITCB 3G6DH 4K94L 1FFPB 1TTGA 2WBWB 4DPRA 1CE6A 3GZPA 1D5XB 2BSCA 3K0DA 2HP4A 4B53A 3NVQA 4KV5F 4ZPTA 1JPFA 3QXDA 2Y1ZA 2BIHA 2F54E 2C4FU 3ULUH 3K6SA 2XQYK 1EX0A 4O4HA 1AJNA 1T5XA 2V5MA 3DXAB 4A2LA 3MRHA 4U1JA 1C5BH 1LXMA 1HINL 2W60B 4PJ6A 4NN5C 4GKKB 2V9UA 5HDLA 4MNGA 4TLUA 2VDOH 5AUMB 3F7PC 2J2ZB 5TQ2H 5CD5D 4E9TA 2G2RA 1X4ZA 2ZUQC 3L17A 3ESUF 3MHZA 4Z7UE 4JFHE 5GHWH 3ECWA 3KKYA 4MTMA 1FWXA 2EC8A 4MBOA 4GKSB 4GKKO 4D0BA 4KQ4H 4BUQA 1JGVL 5DJ0A 5ABZA 4ZNEA 4YXHL 3CPUA 4OTXL 4MLIA 1KPUA 1QYGH 2A4CA 2FBOJ 3H2QA 1IT9L 2I60L 3BZ4A 3KLDA 3OG4B 1BAGA 3Q5YA 4XCNA 4RFEA 4A39A 5I15H 2B3RA 4UZGA 5KOMC 5L3CA 3ZDYE 1TUEB 1A0QL 1RU9L 3BRGC 2C3VB 2XTJB 2QMJA 1N8OE 2XWEA 3DX8A 3F83A 3ARED 4ZD3H 4MA7H 5AB0A 2F15A 3T1YB 2A2QT 4JDVB 4FCAA 4KI1A 1T1XA 1YJDH 3FRPA 3KPRE 5E6IC 3ZGHA 1UHVA 1HDMB 5DMGD 4XMVA 1JP5A 3FB5A 5LMNB 3T65A 4U6TA 2QWQB 3QIBC 4FG2A 4H88L 3CFUA 3T1YO 5F6IB 3HFFA 5IFHH 3MOQA 1QFOA 1IVSA 4Q4EA 2BY2A 3ARFC 4B5ZA 3ISYA 1S7RB 3ZHLA 4GX0A 2CO1A 1EXHA 5SWZE 5LMNO 1AGBA 1FGNL 5BR8B 1YA5A 3ECQA 3NFNB 4M6NL 4XNBA 2DLFH 3UTTD 3DGGB 5KS9E 1BFVL 3LQZB 1KU9A 2X6UA 4NHCH 3UTSE 4FQCH 4G9FD 4TTDC 5C09B 2O57A 2ZE6A 4BK4A 5LJYH 2FT7A 4TUOA 5BR8O 1N6VA 1WBXA 3DUHA 3JVFC 5JJEB 4NO3A 3REWA 1NANI 3FQ4A 5TQ0L 5L3FA 2X4PA 1OT2A 4HDIB 1U8JA 3WV0A 2KKQA 1A9VA 3BZDA 5AAMC 3CH1B 5CNHA 2NXZC 1F02I 4WFFD 3C5JB 3Q8FA 3E3QE 2PYED 2F74B 5IUCA 4G6FD 5CZKA 4IOIA 3FU6A 2W0XA 1RZGB 4P2OB 3SPCA 1KELH 1U6AL 2WXPA 3I9GL 2WLIA 3N44B 3QWNA 4UUJA 3SE4C 3VA2C 4ENEC 4DUVA 3MNZA 1EGJL 4JYCA 3DX9B 3GI8L 5FDYA 4FQLL 4XBPA 1RUKH 5HHOD 1K4DC 4ECNA 4I8DA 5EOCL 4IU2B 1KYOF 1BZ9A 3KZ8A 2AQRA 5IMLB 1HHJA 4PTTA 3WJLA 2BINA 1M56C 5LHIA 1AGCA 4CSZA 5I71B 1AD9A 5DO8A 4KO6A 3UJJL 5BS0E 4X9FA 5E9DA 1IZKA 3N43F 5ABDE 4G71B 2R9RB 3O4LD 1AR1C 5I8EA 1N0NA 4D8OA 5CZXC 4J3UA 5EUOE 1PNKA 4WWNA 5D7LA 1CGUA 2XQYA 4GAGH 1J9CT 4R2GC 4BYHA 4XBGA 3KPMB 2Q5BA 4BWWA 4A66A 3LQMA 4OXSA 3Q8AA 4IMLA 1FYTB 4XOBA 5DUBB 2WQAA 5IE9A 3VXRA 1JYNA 5D4IA 2Q6AA 3M07A 2WUCH 5AW4B 2Z8SA 3NCJL 4IIJB 3ZXAC 4G8IA 1E5BA 1ID2A 4U6HA 2OMNA 4YC2B 2YZ1A 5B22A 3TIDA 3V6OE 5K9JL 2AQSA 2QVMA 2QV2A 3GB7C 3RGVB 4N0RA 1H8NA 4NNYB 3VFTB 2QTSA 4AUJA 1KN4L 3K6OA 4AW7A 2JKJA 3OAWA 4C56E 1YY9C 2WCSA 2WXGA 4XPHL 5L9DL 4KRPB 1FVCA 2J4WH 2FO4B 2W0KA 3E0GA 4NUJB 4EN2A 4QPJA 4OJCA 4P5TD 1KCVL 1NDMA 4LARL 4F3FB 3GPSA 1J0JA 2QQQA 3L13A 4HJJH 5JA9A 1CO1A 5L4MA 4JRYB 3UO1L 1KBVA 1KB5B 2JJTC 4WUUD 4LXFA 1KTLA 5F1SA 3VCLA 3QJFA 3JAWA 3SJCC 5TISZ 1R6VA 2GIXA 4UT9H 5CJOL 4H13C 1MWAA 5L0QB 3P0VL 3DMMB 3NCFB 4P2YA 1XMOO 4TRPL 4XC1L 5SX5H 2BP0B 1FL5B 4GO8A 5JQGA 3SDXB 1VAHA 3BVXA 3ZE1E 3DVGA 1ND0A 2XT9A 1NBVH 4H4NA 1I3UA 1GOFA 1XR8A 3VW3H 2CKBB 4O2EB 3WLBA 4MJIE 3CCSV 1F4AA 3GXFA 5ICZB 3BDYH 1I9RH 3L2MA 3OZ9H 5KYUA 4POYA 4F8LA 1GIGH 4LNRA 1QR1B 1Y74B 1KTDA 1G4RA 3BP4B 4Y16A 2XZCL 1CTMA 3QFJB 1OM3L 4YEFA 2J8OA 5H37H 4GKLA 4FQJH 1OCCB 3B1UA 3AU0A 2I5YL 3K91A 2GIMA 4K73A 3HUJB 4DSYA 3CQPA 2F95B 3HMXA 3VD1A 1DBAL 4OIIL 1KEMH 4U3JB 1JD7A 1MLBA 1XHXA 3OPUA 5IEKB 4F7MB 2XKNA 4N68A 3ECBB 3BGMB 5AG9A 1R6NA 5CJQL 2WIIB 4KXZH 4GW1B 4F8OA 3GZKA 2XPGA 5E94B 4R90H 3QEUB 3G6DL 2F5BH 4QRQA 4YGVB 3O6KL 2EIZB 5FUCC 4QOKB 4GRMB 4CN4A 2DF3A 2LJ2A 2N04A 1X5GA 3OSKA 4U1SA 5SV3A 2E8ZA 1DQQA 3QYMA 1E28B 2XG4A 1SA0A 2JJSA 3JSSA 4RQQB 4F91B 3CSGA 3MUY1 3ULUL 4HKZA 4UTAH 2HA1A 4IK7A 2CUMA 3GMPA 3VGAB 5FYKE 1ZVNA 1CT8B 1NCBH 1CLCA 1TZHB 2F54D 2N01B 1RH8A 1ZHLB 3EH4B 3PAVA 2CALA 2M7WA 1QLRB 4EUPB 3QG7L 1OGTB 4PREB 3TCUA 4CVZA 4Z3TA 3ETEA 1YJNV 4B3TB 2E74B 3B34A 3QQ3B 1X7SA 4HIJA 3SCMD 3FT2B 5FW8A 3WKPA 1WIPA 5TQ2L 3ELQA 4LLMB 1Q72L 3HKEA 4Z7OF 1X5HA 5B3NA 2R15A 2DLIA 4ETYA 3DTDA 3E6HB 2LVCA 3CCLV 3GRWH 2GTWB 4KQ4L 4JFHD 3RIFK 3O9WC 2J3SA 3P11H 4PIBA 5SWSE 1QVOB 3UG3A 3DGCR 1CICB 2XHNA 1IU1A 1QYGL 2QSQA 1VCBC 2J8UF 1Z9PA 3CIAA 3FJTA 2FJHB 5HYJB 2EE2A 1Z5HA 3APCA 5T5NF 5IF0B 2DWTA 2FTAA 4ZD3L 3BFQG 4LLDA 3Q1EA 1NEZA 1H2GA 2ATKA 1XF2A 2I27N 4J12A 2WA3A 2AJSH 3TZVA 4EFBA 4JYYA 4QCIA 3D85A 1YJDL 2A3QA 3H54A 3GRGA 1UB5A 4UQCA 4L4VE 4FI7A 4E5XB 5GIRB 1VQ7V 2JNZA 3RWRD 4Q58C 2OCJA 3KPRD 4NO0A 4LDEB 3RWFA 1G5AA 4NR1A 1SERA 3MRQB 3BGFB 5FK9B 4AENA 1RZ8A 5IFHL 4DV2B 3KLHD 2YKKA 1KC5H 4QRSB 4ZHQA 3MBED 1I1AB 1LILA 5I74C 3WN5A 1JCVA 1JZFA 2AAVA 2DLFL 4ZXBD 2VB5A 1V7NH 1KP3A 4DV2O 1J8HB 2E9JA 4NHCL 4WJ5A 5SWZD 1SBBA 3SB3A 3NIFB 5KA6A 4FQCL 4H0LC 1RJLA 2JKNA 3ARDA 2BO0A 3BUPA 3UTSD 1T0NB 1WFUA 2HVKC 4B3RO 1AP2B 4O2BA 3UACA 2CH7B 2DJUA 3H7BA 2D9CA 4B9KC 4UIMB 3NCMA 1YO4A 4FG4A 3JCZA 3X12B 1SQGA 1MCWM 1XGZA 3JUYA 4MD4A 2RQ6A 1A25A 1CI5A 1KDIA 2OW7A 4R5VA 3UPCA 1G9MC 2E6QA 4NQSB 4ZSOA 4JFFA 3JV6B 4Z7WB 5CSGA 2A6IA 3HNTL 3P4LA 1J12A 3PFQA 4KY2A 4WFGE 3TURA 3CV5A 3CFDA 5IB1A 4ZUUB 4YSCA 2BS8A 1CFBA 1L5GB 1YEIL 4X4YB 1CD1A 1RUKL 2CKNA 1DDHB 4JHWL 4CGUB 5B4MD 1XMQB 2HLEB 5EPMB 1F4WH 1SHXA 2WQSA 1DQML 4XXCA 4L3CB 3RYIA 3Q4HA 3W56A 3IKKA 3DJSA 3DX3A 3HTLX 4Y5XC 4L48A 3NN8A 4AIZB 5DEDA 1KB3A 4TLTA 4MASA 3OTTA 1VQKV 2VNCA 3TBCA 3HBPA 2QJ1A 3ZHQA 3QHZL 4GT0A 5BS0D 1R4XA 1PNDA 3VUAA 4F15B 4I3RH 2WIMA 4I13B 2JQAA 1NMAH 1LDPH 4GAGL 4N8CL 4RNRA 2BP8B 1VQPV 3KVQA 3OHXB 5IW1B 2CPUA 1D7FA 4JI2B 2XWBA 3AROA 2J71A 2H0JA 1NFAA 2VERA 3MAWA 4L8DB 4LEOB 5ICYB 4N3TA 1Q43A 2WUCL 1ZV2A 5HHXH 1KCLA 4G1EB 5CCKH 2FYUH 4NCC1 4QRPA 4OCSH 4XMPH 1BZOA 3PF2A 4A2EA 1EN6A 2MQGA 4QRRA 3L3KB 4OCYH 4JI2O 3CZFB 5CINL 5LGHH 1MFEL 1UGKA 3IJ4A 1BV8A 1ZT7B 3DVIA 4WV1C 5F3FA 2AXFA 3SGJC 4NQCA 2J4WL 5A7BA 1B0RB 3S5ZA 3GMRA 5E2VH 4C56D 3WFCH 1KPVA 4N5EC 4OLXH 2YAMA 3Q05A 4Y1AA 1T6VN 1GTOA 4M48H 4QJ3B 4PJBA 4ANUA 4DP8X 2LT9A 2JQZA 3ZN1A 4KVPA 2D31B 3UH8A 2OR9L 2CPCA 4UT6A 1WBZA 2OKMA 1NC2A 1JOIA 5F1OB 5J6GB 2FJFB 3VRIB 4BCXA 1TZOA 3GSNA 2BK8A 5FO8A 4JZJC 2R9AA 5GRUH 4FABH 5KVDH 4BSVA 2I07A 4GOSA 5DZAA 3VX0A 4KROD 3BSGA 3B2MA 2GAZB 4MCZB 2NY1D 2PR9A 1HXMB 1HHKA 1UPGA 4HWNA 2ZNIA 4JY5L 3D2UD 3NRFA 4MQXD 4IGBB 1NBVL 3RKDC 1ZGLB 2BSEA 2QR0A 5T1JA 2A9CA 1KIUB 2YQBA 2ZKMX 3O6FD 3Q1SL 1DJZA 1A02N 3BDYL 4FQ2H 3C5ZB 3OZ9L 2OSWA 1M2VA 3DX0A 2EADA 1GIGL 1MZFA 2V0AA 3D33A 4MJID 3HMXL 3B6SB 3OTFA 1M7XA 4JFDB 4X98A 4YDLC 2YGVA 2PR4H 1BFOB 3HS8A 2H8PA 1CIUA 3A3YB 4GKZA 1PGRB 2P52A 3UJTL 5B38A 2BHYA 3RY4A 3CBRA 4RGMC 2ZOKA 1W72H 1J5DA 1MIEH 2DI9A 3JTTB 4HKXB 4X6BA 1WIUA 1S7XB 4HP5A 1Q3EA 4GQPH 5B8CB 3SGEI 1OV9A 4K3GA 5I1IL 3LQAC 4XHJC 3KG2A 4KHTH 4JI8B 1W72A 4LEXL 1VIWA 3BP7B 2FGWL 2DW4A 2ITFA 4GSDH 5TH2A 1N59B 4KTYA 1J9TA 1JCKA 1T7YA 1M1XA 2K45A 3DV6B 3EJZC 4UTAL 5JW4M 4G1MA 1KJ2B 1GXEA 4U7KA 2CGYA 2XBTA 4B9CA 4MB5A 5GSRA 1ZAUA 3FRUA 1H6EA 3VRLE 2ADJB 1U2CA 2WNWA 4A63A 2YRBA 3OF6A 3N3EA 1G7QA 1KFGA 5DQ9A 4MQ7B 4Y2DD 3E22A 5FYKD 5C07E 3V0HA 1KJMB 3UZVA 4HIXH 1Q6IA 4APQA 2DAVA 2VXTH 3G5VB 4MBRA 4FAAB 1JZGA 1A7PH 3FO0L 4YZWA 1CQYA 2P7TB 3MA7A 3TN0D 4MD5A 5FKAA 3GRWL 3T0BA 5DM6V 3T77A 5B1AC 4MXWL 4RDQG 2LW7A 1Q9KA 3TV3L 4ZUTB 4AJYV 4WU7B 1I9JL 1TPXC 4FKEA 1FF5A 5JHDE 1NAKH 5AKSA 4JE4B 5SWSD 3G04B 3FQ1A 2OWOA 5AZEH 4U3FH 4N0CD 2FGZA 2XN1A 3UC2A 4JO2H 3AG4B 1ZCRA 3MTRA 5EU5B 2OYKA 1AZCA 3WGUB 3ETBJ 1YZZA 4B0MM 4EXPX 2C7UB 4WFAV 3DVFA 4UAHA 1ZA6B 4AEIH 3BI9X 4RFNC 1FZOB 2EX3A 3F6IA 3QFGA 1A4KB 4CVXB 5KS9B 4J4PD 2OIEA 5E2UH 2PCFA 1D6EB 5B3JF 2VMEA 3C5XA 1Y4MA 1KBKA 4K7PX 4QXTB 4OFPA 4L4VD 4O00A 1DYZA 4JN2A 4WFHA 3ZDXF 5ES4B 2O5NA 3QUZA 1H8OA 5HHPB 3ZW3A 4EN3C 3S5LG 3GJFB 1EAJA 1I7ZB 2J44A 2YRLA 3CN4A 1IGIL 5LAPA 1XIWD 4GSQA 5ISZA 1S9VB 5LWYL 5J5EA 3MJWA 1MRCH 3IDMB 4PGBB 1MREL 1V7NL 2GI0A 3DC5A 1B9ZA 3CUPB 4L87A 1JXKA 4X6CF 4F6EA 1A3RH 1KCRH 1XQ4A 1HZKA 1HZHH 3IJHA 1OTTC 4FHBD 2PO6A 3WY3A 3ZTDC 3ARGA 1YHPA 3CCQV 5KHKA 1MCRA 2WQWA 4M43H 2YK1L 5C0JA 3MYZA 2YFNA 3BLPX 3L4CA 4EDXB 3HG1B 3R7QA 1EAPA 4TNFA 3BE1H 5KJ7E 4JPRA 2FD6L 2ZXDA 5D5MB 4FC3E 1RPKA 4L8JA 1WICA 4F93B 3ZKND 2B14A 4MMZB 4YDNA 2EZOA 5EC2C 2NDGA 5I18H 1XEUA 3TFBA 4ZG1A 1LUWA 1GOHA 1TQBC 2B7DT 3VI3A 4JL1A 4FKHA 2AQPA 2F19L 4MJ6B 3K6FA 3L16A 3MYJB 3PS6A 4WFGD 3ZDZE 5EBLC 2HT2D 3W9DA 2DWEA 5MENE 5FYJL 2BVPA 1XGQA 1NKRA 1VJSA 1DJXA 2D3LA 3FFCA 1KDJA 3L1OH 3TH2T 3E8UH 1C8PA 1YEDB 2IAMD 2WCGA 2PW2B 2QWRB 4LH6A 4JY4A 4JDEA 1U3YA 4JG0H 2WTOA 5D4JA 4AQ1C 1QFWL 3VWKA 5H9CA 2UX6A 4PJEA 3S98A 3VXNA 1F3JB 1K8DA 4GO6B 3ZE0F 1YI2V 5HHQB 4TQDA 4ZNEE 3W39A 4P4KB 3SDAB 5CFHA 1USQA 5EIQA 2Q8VA 3RJDA 2X10A 2JIZG 4DKDC 5HHVL 2QVTA 1NC4D 4KZCA 4N20A 3B8MA 1BIIA 4L4TA 4XMPL 4FFWC 4ZIBA 5GGVY 4JVUA 1HC1A 4NXKA 5I0VA 3BWAB 3JZYA 4OCYL 3QZLA 3UFIA 1XMEB 4ONHA 1ZS2A 5IMMA 1NIAA 2X4SA 5TDPA 3RPIA 5LGHL 3H01A 3C8HA 1MQ8A 5BZXA 4HK0A 4MAYC 1E2ZA 4GO9A 3K1DA 4MSWB 4UT6L 1E4JA 4YIQA 4U4BA 4FXKC 5F89B 4NCC2 3I6SA 3GSNL 4JFEE 3T2OA 4R7DB 3RYFA 4NFBA 4XRCA 1YUHB 3ECVA 4OLXL 3TFKC 3RIAK 4GAYB 1WAEA 4OFQA 4NTXA 5AKVA 4H8WC 2YHGA 3HNVH 4FLYA 2Y69C 4NTWA 1SYVB 4P2AA 3U7WH 3KJ6H 1KYFA 2NX5A 4ALAC 5JZ7D 3QEQA 2EQDA 3B43A 3LB6D 4NQDE 5KVDL 3VRJB 1IFGA 4YJ2B 2DQFA 5KZCB 3OR7A 1PF3A 4BFBD 2WLLA 4EIGB 2HKAA 2X4TB 1AOHA 3ATBA 5AFAA 3O8XC 1R3JA 3G71V 3HIZA 5C8JA 2CIIB 3HA0A 5C0BE 4UOZA 1ZT4A 3MV8B 1W16A 1BZ7B 4FQ2L 1CXZB 1R5WB 2HVJA 4JYBA 1MKFA 4XNQA 5T1LD 4PDMA 3V5DB 4ZMXA 1SEQL 5D1ZA 2MW2B 1JBJA 3HE7A 3L9DA 4K2UH 1W8EA 4I5BA 1GZQB 3MSPA 1F6AA 2ZUVA 1X59A 3APNA 2LO1A 5LGUA 4QGYA 1A6AB 1UWXH 4X1IA 1GHFL 1W72L 3HKCA 3LRKA 2IH3B 1PSKH 3MROB 3BPCB 2EE3A 4JTDB 2HG5A 5IMKA 4RIRA 4Y2DB 4F1SA 1MG1A 2ENJA 4BGDA 4BQBA 3ROLB 4RBPK 2DBLH 4KHTL 2Y6SD 2AZAA 5MEPB 4FXLA 4TN9A 3TN0B 3O3UN 5IYZA 2Z4QA 4Q6IB 1F11A 4ZOEA 1B6QA 1M7IA 4XVUD 2JB6B 5FPOA 3V0VB 1UZ8A 4J2QA 1BHBA 3HHSB 4I55A 4I2XB 3VGEA 3OKMB 3GMOB 5D7IE 2X4RA 3FCUB 1HWWA 3RU8L 5LXTB 4EVNB 4OUUA 3PWJA 4PRBA 4BA0A 3BVNA 4PRDA 1AXTH 2A6JB 5D2NC 3BAEL 3G6JA 3LMJH 1AZRA 4OPHA 4HIXL 4MLSA 5DJDA 4G83A 1AIZA 1UJTA 1IKFH 1RJZB 2IFGA 5C07D 4L3EE 4XP9H 2OTPA 4P23A 3NJKA 1IGFH 3APMA 5DYOB 1E0OB 5DD6B 1SQMA 4QEGA 4PLNC 1HYRC 2K9FB 4EEQA 2A0LD 3RGHA 4A7GA 4BIUA 1AANA 2Q68A 2LV4A 5D6DA 3BWUF 4XBEL 2JK5A 4OFYD 3DUUB 3HE6B 4AE1A 3MU3A 4ZS7L 3ZVVA 3P69A 1B9KA 5EF3A 1J18A 1FAKT 5CAYB 5JHDD 1OAUH 4UT7H 3QULA 4JO2L 3OXRB 4N8UA 3AWGA 3CFJB 4S0TD 4QRUB 4UZSA 1F4HA 3RDTB 4X4KA 3QNZA 4AJWA 5LUMA 4AEIL 2ZNJA 1BVZA 3QO0A 1G0XA 5IJ9B 3FCGA 3GSUB 4FFVC 1S5HA 3UABA 3IF1A 1OWRM 2YICA 5E2UL 2EIKB 2EE9A 3JV0A 2FE0A 5SX4I 5BV7L 1IJNA 3WIHA 5HDBB 2V2XB 4JG5A 3ZMNA 2HYMA 2L35A 3DJZA 4YSDA 1I8AA 1TJGL 5I9QC 1PCXA 2YD6A 2HJKB 1OOAA 3ARBB 3AZUA 3T08A 3BEWA 4PJ9D 2OTUB 4D0CB 5C8YA 3RTQB 1VP7A 2WXHA 2XIBA 2CDFB 3HAEB 3NTCH 2YS4A 3BPOC 3GO1H 3PIQB 4PR5B 1MRCL 4RAUA 4AGMA 5I1DB 3T2MA 5AYUH 5IV2A 5FGBA 8FABB 3KGRA 4UCUA 1E40A 2M1KA 5L88H 1KCRL 3H9ZA 4LLUB 1HZHL 2VLRE 3TU6A 3C60D 3H56A 3ZJAA 3OTOB 4M43L 5K59E 3BESR 2DH3A 1BAWA 5IB2A 2BCCH 1PG7X 3RA7H 3D08A 4PJXA 1OPGH 1DQDH 3BWSA 2FWLB 2YQ2A 2DM3A 2P8PB 1I3RB 1OSPH 2Z7UA 3TK1A 3OTOO 1XX9C 3F04A 4WO4A 4FA6A 4J28A 1Z5LB 2BOBB 4QXGH 2YAHA 4KKLD 3DK0A 5I18L 1PNLA 4H1LA 4AX3A 1VMGA 3L3HA 4RMSA 2ZP9A 1KJ3H 1P7KA 2G60H 2ZWYA 1ANUA 1MXDA 3OAZH 1NAMA 1NC4B 3QRLA 3UG4A 1CFTB 4V2BA 2ENSA 3CVHB 4XE5B 3U9PH 3AMLA 1IVLA 1MHCA 4X8XA 1TMCB 4AIXA 5MEND 3GS7A 5FS5A 1XAUA 3B7RL 3E8UL 4FL4B 4PRHA 1BG9A 1USZA 1BQLH 2WP3T 4DFIA 4Z8FH 1FI8C 1F8TH 1JMXA 5T1MB 3VXQB 1HZLA 4LCWB 2E5LB 1EQWA 4JPWH 2DQTH 3L70H 4HUNB 3QJRB 3KWWA 1OTUC 1SVZA 2JMRA 2PCPA 1C12A 3WJLC 2OIGA 1EEZA 4X99B 1FFTB 2AJVH 3QQXA 3RIFF 4LLYB 1PKQB 3QZNA 2VRAA 4DO6A 2E5LO 1T2JA 5KYXB 4FQ1L 1I8KB 1H15A 4OI8A 3DI3B 2HJLB 2PW1B 1DVXA 1THAA 1GC1C 2X1WL 1A2YA 4AQ8A 4UV9A 4WI0B 3GWKC 1G7HA 3F85A 2YXHA 4PJIB 5EF1A 5D8JH 2W94A 3QXUA 4HOXA 1YLBB 3QIUB 4C59B 4WTXA 1LMKA 5F88A 4DIXA 3P02A 3UYPA 3L9RA 2ZKWA 2ICWB 4JFED 4NQUA 2OQJA 4YQXL 2AANA 4LBEC 1QKZH 3L5XH 4MVQA 3B2VH 3HNVL 5T1LB 2G3MA 2F4VB 2CR6A 2VLJE 2PNDA 4JFYB 4NQEA 4RGNE 3W11C 3KJ6L 5E8PA 2A1WL 3AAZB 1Q8MA 2O6PA 3IJYA 4L5FE 4WWKD 4TNWF 2GIYA 3L5JA 5BMFH 4FDWA 2F4VO 4NQDD 1D2PA 4OJDH 1GMGA 1T3FA 2WWOA 2F1BA 2X44D 4DEPC 2ZKXA 4EKXA 5JHMA 2CCVA 3ULVE 3GXTA 3G6AB 4OZFH 4UQIM 4MTOA 2K4AA 2J12B 3LKRA 1RZIB 1MVFA 3AG3C 4CC0A 4LF6B 1U3HD 3IFLH 5INCB 5C0BD 4BD4A 4BFIB 1WGVA 3K4AA 4HC1A 4YZFE 3NMEA 2AQTA 1ZLVH 2ZE0A 4UB6Z 2VKWA 4JANB 2FO8A 5GGUA 3VFSA 4C8XA 3KCXA 3BEVA 1OL0A 2B39A 2Z1KA 1CFNA 4JFUA 2NUTA 4K8ZA 4FMFA 5KMGA 3BKCL 2QHLA 3DARA 4GG6B 3CCRV 1KBWA 2CDEA 1M7UA 3I3EA 1DZ0A 1JGDB 1G7MB 1B4RA 1NTKH 3IBOA 3DSNA 1CQKA 1JOYA 2XACC 4QYAA 3FTSA 1GRJA 5E9AA 1J5IA 3BEHA 2DBLL 5C07B 4BFOA 3MRDB 1BVKB 4I3SH 1NCAH 2AXWA 2PETA 1U8KA 5JXEA 2EDEA 1W6LA 1PZBA 4JY6B 1LO2H 1H2MA 3PWLA 3V7AG 2R0LL 1US6A 3RFZB 2QADD 5IYCO 5DRZB 2KHAA 3ETQA 2O5XH 4KJWD 1INQA 2Q86B 4HWZA 4CC5A 3KGSA 4UWQB 5C0FB 3E9UA 3PXHA 1R1BA 1AXTL 3LQAH 4G27B 4HAFA 5IIEB 3ZRSA 3IDYB 4J8QA 2P4VA 3P30H 1OWWA 3QA3B 1IKFL 3ARXA 3FX7A 1QSFE 5KN5A 4XP9L 1H38A 1IGFL 1NANH 1IM3D 1VACA 4DGIH 2UUBB 4GMTH 4L3ED 1N2RB 3P9LB 1HIMH 2OMZB 5DJAB 2A83B 4XCYA 1LE9B 1J9RA 3EGSA 3BPNC 1XSIA 4PDRA 1M05A 4KMLB 1KIQB 2VDMH 4PJFA 3VXME 1IAMA 1MSDA 4UT7L 4R96B 3A2FA 3MRBB 5CA1A 2EUXA 3WIHL 3QORA 2UVFA 5CD5C 2LE9A 1KWGA 1HQ4A 2NY4B 3OBAA 2W88A 1A7QH 1H6FA 3NRPA 4X1KA 2XNAA 5HFMA 4U1MA 4A2HA 4FHJA 2YD5A 5KG9A 2F1AA 1A6PA 1UH3A 4NZDA 3MXVH 1E2VA 3JYBA 3UL4A 1PKXA 4N86A 1J10A 2LTQC 3CSXA 2M26A 2AFNA 4UYQA 3EFOA 3WUWB 2Q6WB 4PFEA 3G3LA 2BCKB 1JXGA 3IMTA 4HGKC 2JVUA 4E41B 2ZUXA 4EE2A 5CA3A 4E9YA 4X1YA 2DQ0A 3N40P 4UCTA 4BK5A 1T2XA 1DO5A 3NTCL 3MRCA 1WA8B 2ICEA 1Q6HA 3GO1L 4N2DA 4Q8BA 2Q0OC 4BHUI 4B3SB 4RAVA 1N6UA 1TJIH 3G5YA 5AYUL 2E86A 3U25A 5JXAH 1JZIA 2P80A 3KVPA 4ZFFB 2HT4D 3MXWH 3LIZA 3RVXC 5IROD 5JH7B 2H32A 4MNQB 5IVZB 1UA6H 2NZ9D 3TJTA 3A4AA 5E4IA 4B3SO 2R69H 1MVUA 1GYWA 2VLRD 3GMMA 1AQDB 3GBMH 3I6GA 4PY7B 3VI3F 4ORGB 1CXFA 1KYAA 5MENB 2BSKA 3S35X 3BVOA 1DQDL 1SEBB 3D50A 2E46A 3NCEB 1J88A 3KBFA 1OSPL 5I1JH 2WXMA 4F6RB 3D36C 1CLYL 2VDLL 4NQVA 4QXGL 4GH7B 1S7VB 3HZYB 1UVQB 3WDJA 3RX9A 2EJRA 1OGPA 5I6NA 4FZ1A 4WQOA 5CU5A 1URLA 3T6VA 1PBYA 4PJ8A 1BLNB 1U8MB 5F7DB 4KZEL 1KJ3L 4X50A 3EFFB 3ASNB 3KDMA 3AB0C 4PJEF 2EEFA 1M6OB 1XCXA 1YEHH 3U9PL 4S1QL 5MP6H 4ABVA 5FYLH 2JWYA 2VDKH 4XMLH 3MRMA 1ZVYA 2UXGA 3ATDA 5L2KB 3MNWB 3KJ4C 1BQLL 1KD1W 4YR6A 5FOBB 5JIMA 3SPHA 3EYOA 1F8TL 1ZEAH 1CG9A 2ARWA 4NT6B 2Y1YA 3V0AC 1GW6A 4AUYA 1MI5B 1K4CA 7FABL 4N2KA 1WTGT 2L7EA 2BIQA 1LEKA 3EG9B 5LN4A 1ZSDB 1L0NH 2AJVL 3GINA 3L9YA 2EEXA 1TU2B 1NM9A 4LHJB 4JAVA 4Z7VB 5CJ8A 3DJTA 5JLZB 2AW2A 1GOGA 3TPUB 5DEGA 3MODH 4KO9A 2IADB 3CDGA 2PCYA 2TSBA 5E1AA 1D7BA 1HHHA 4XBMA 2Z65C 4P5MB 1HCVA 1D5RA 2QSTA 1PQZB 2W0PA 5CGTA 2XY2A 4DZBB 2AEIT 2ITDB 3G5XA 5T5NG 5A2KH 1J5EB 4XE0A 4F7KA 1VZIA 1I4FA 3X1BA 3S4SG 2XYCA 2EKSA 2I26N 2FEDD 3CBJB 3MUGB 4PRIE 1SXNA 2KERA 1DO6A 2NW3B 4XOCA 1QKZL 5LB1A 3MCLH 3PDGA 3L5XL 3VE0B 5C0BB 3B2VL 3QDGB 2V4DA 1WSST 4DEWA 3IMBA 1Q7YW 4WLCA 4M61A 3HCVB 1J5EO 4LSSH 5KSAA 4HSAC 2E0PA 5FGRA 2V7HA 3N85H 2NYKA 1BQSA 1PDKB 2VLJD 2YDEA 1K72A 3AXLA 3MGOA 4RGND 5EU6B 5MERB 3WELA 2D3VA 1LK2B 5BMFL 1WVZA 4UXNA 5C0AA 1CMOA 4HJ0C 3P3UA 1JQ0A 4HUCA 2X2JA 4FQHA 5D1QA 1RFYA 9CGTA 3K8MA 3QARA 2APFA 4HC1L 4P5TC 5K39B 1TMQA 1X5XA 2JVDA 2WK2A 4ZKIA 1V3LA 4IYIA 5ELIA 4Z7QE 4H8WH 3ULVD 1MN4A 1NPUA 1CDUA 3IFLL 3H9SE 1W0WB 5DDHA 5DD1H 1T5EA 2UX7A 1RHFA 3QZWB 3TIEB 3C2AH 5F7WC 4J9YB 2N7SA 4OQTH 4GMSH 3MJ7B 3TJEH 5FM5O 1J5OL 1MRDH 2IBGA 5KYWA 5I5RA 2GSIA 3BSHA 4B9JA 2CNYA 1B90A 2R4RH 2EH8L 1I5YA 1JPXA 2H9GB 5HYSA 3WNMA 3EXJA 4LPXA 3NJGA 4PP1D 2GSMB 2M2DA 3QCTH 1OCWH 4Q14A 3KLSA 4OD2B 1F5WA 1FXVA 4H0GA 1G7LB 1E4KA 3WJJA 3N1GC 1FFNA 2H8PC 3NIDF 3KPLB 5E8DH 4UDTA 5GZND 4AE0A 4I3SL 4I0XB 3FUMA 2JXMB 4NPJA 2YUWA 3GIVA 3ZBMA 1ILUA 5TDPB 3MRRA 3IDGB 4M56A 4PTUB 3OMNB 2DYSC 2IH1A 2RTTA 3G6JF 1SQ2N 4LCCA 4AZ8A 2O5XL 2VN5A 2Z31D 5FDWB 1G1XB 1UA3A 5JOPE 1FPOA 4IYKA 4G7QB 4OJFH 2DPKA 2JKLA 4ABMA 5I0DA 2OJZH 1T83C 2J56A 4FQPA 2X70B 1E9OA 2OULB 4G5ZH 2K8MA 2IIJA 3FB7A 4R4BA 2VL4A 3OE7G 2X89A 4YFLI 4JAUA 3RL1A 2BOCA 2W9DH 1YQVL 5C70A 1RK0A 2X2IA 2FUQA 4L1HA 5BQDA 1A1OA 3ZL2A 1JJ2U 5BVPH 3C9NA 1Z9SB 2FWSA 3SKMA 4DGIL 1QSFD 5CBAB 4GMTL 1VQ6V 2CHWA 2VISB 2VN3A 1DTOA 3FB8A 3RWGB 1VADB 1EFXD 2JCCA 3W3BA 4AYFA 3APFA 3CU7A 4ZS6D 4QT5A 2MPVA 3TYFB 5ID1A 2WXFA