2CTRA

Solution structure of j-domain from human dnaj subfamily b menber 9
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
GSSGSSGSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords DnaJ homolog subfamily B member 9
publication title Solution structure of J-domain from human DnaJ subfamily B menber 9
rcsb
source organism Homo sapiens
total genus 17
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ctrA00
2DN9A 2PF4E 2GUZA 3UO3A 3UO2A 2EJ7A 1HDJA 2QWRB 2QWPB 3AG7A 1XBLA 2DMXA 2CUGA 1WJZA 2CTQA 1FPOA 2CTRA 2QWNB 2QWOB 2CTWA 2OCHA 2QSAA 2L6LA 4J80A 3APOA 1IURA 2KQXA 3UCSC 3APQA 1BQZA 2LGWA 2M6YA 2CTPA 1N4CA 3BVOA 4J7ZA 1FAFA 2YUAA 2GUZB 1NZ6A 2LO1A 2N05A 2QWQB 2Y4TA 2Y4UA 1BQ0A 2YS8A 4IT5A 4RWUA 2N04A 1GH6A
chains in the Genus database with same CATH superfamily
1MZFA 4GX0A 2F95B 1EN5A 2B5UA 1KKDA 1OCRB 2XAHA 4PDVA 2OTLV 3ABMB 3L75H 4Z1MG 1NS1A 4JI6B 1YHQV 1I5XA 2HVKC 4XDKA 3H9VA 4Z1VA 2PYJA 2CAZC 3DTUB 1S0VA 3BFRA 3B8NA 5EC1C 5H9CA 5EC2C 2Y0IA 1K5SA 1GH6A 3CCJV 2BOCC 4JTAB 1BS3A 3CB2A 4J42A 4PELA 1XL4A 3Q4HB 4AI8A 5IJ0A 2OYQA 4JI4B 5EK0A 1W59A 4MVOA 4Q20A 1GK9A 3U0ZA 3ZRXA 1MSDA 3HKCB 1OCZC 1WB8A 5GONB 4E2LA 1EBOA 1BT8A 1V9PA 2EIKC 4MVUA 2W6JG 3ZMSA 2YXYA 5KHIA 5LMNB 4MS2A 2VWKA 4B3TB 3HKEB 1RFYA 4FM1A 5IWAB 2Y69C 3H1IH 3K5OA 4B3SB 2ZR3A 3DSQA 3CC7V 3SPGA 1QHTA 1HNWB 2XAFA 1H8HG 1KQSU 2Y4UA 4DUYO 3HKDA 4YHHB 2OCCB 1ZWIC 2X0LA 4JI8O 4DV2B 2UXDB 5EIBD 4J80A 3E22B 5L3CA 3RVZA 1Y6XA 5IJ9A 3BVOA 2ZCEA 1VQKV 3P30A 4TV9A 3A0HZ 4LF7B 2PF4E 4L87A 4IGGA 1AR4A 1XNRB 5BR8O 4I55B 4AHCA 3HB3B 4RQEA 5L3BA 3K3WA 5EZYA 4CS2A 2KQXA 2LQTA 1E1QG 4KFMA 3KKYA 2OWOA 4TV8B 1Y67A 3BA9A 2HG5C 2IW5A 4JI1O 2IBZH 1SA0B 2Z5UA 4O4LB 4TOIA 2PTMA 4B08A 2YXLA 4X1IB 2JEUA 4FLTA 3U11A 1OHHG 4X1KA 3LSSA 5FPOA 1R3JC 1H2SB 1M90W 3SYPA 3LUTB 4F6EA 3KCXA 5CBFA 1VQOV 3OMNB 4D6TH 2LGWA 2GTAA 4B3MO 4JPRA 3W7TA 4CH6A 2YIDA 5JQGA 4YXWG 2ZKOA 1XHXA 1YTFB 1F7YA 4W4LA 2Q0OC 2ZE8A 1XUQA 4KP4A 1EFRG 2ZQMA 1HWYA 2CTPA 3IC7A 5KHJA 3G71V 1I0HA 3QG5A 4X88A 3TGUH 1M1KW 1BCCH 2P90A 4U3FH 4JI3B 5JJNB 4OX9O 4YJ2B 3CJHA 3K04A 1CXZB 4BIUA 4ZBMA 4DR7O 2JIZG 4R7CA 4UCUA 5JVDA 4BIOA 5KA6A 4EB6A 4LFBO 4P2ZA 2F66C 1NT2B 2RQ6A 3K5LA 5CBHA 1RPRA 2MK3A 4IIJB 4DV1O 4ZI7B 3IC9A 5FL7G 1AVMA 3AG1B 1SQXH 3CCVV 3BEHA 3LSUA 2DMXA 3SJAC 1A32A 4O4HB 2JK5C 2LFRA 3M7MX 1G8MA 4MW8A 4JZGA 2GTSA 4N23A 2FMLA 1RSOB 2ZE6A 1IX9A 5B1BB 4EEQA 3CCUV 3JALB 1Q3EA 4WFAV 1AP5A 2ADPA 3CP1A 3CPWU 5JJEB 1K92A 2A3QA 1RM1C 5LA6B 4EFEA 3FD9A 1XMQB 3QO5A 3ABLB 3Q4HA 1SS3A 4LF5O 2ITDC 4MSWC 3G67A 1K9MW 2PY5A 1G6UA 1VMGA 3HKCA 1XOUA 3G6BA 3AG2C 2ZM6O 5B1AC 1VP7A 3E8BA 3GB7C 1TGOA 3CYOA 3VQYA 2Q0AA 1Y74A 2X6CA 1VF6C 5JCOC 3LNMB 5BZBA 3K58A 3HKEA 2K9PA 3JASB 3O9OA 2WWWA 5CMUA 1Q7YW 3CEIA 1GM8A 4X8AA 2AW9A 3A0RA 2JS3A 5B1NA 1R3IC 5KX5B 2NR5A 3WG7B 2ZINA 2ADQB 1BE3H 1JJ2U 3SYCA 2AXTZ 3CC4V 2MW2B 2QWRB 1PL0A 2CTQA 4JI2B 4F4LA 5IYCO 3I56V 4UVBA 5KMGA 5C8YA 1NH2B 2YEVA 4PA6A 4Q6GA 5LYJB 4DR2O 1R1BA 3GVMA 2ZXWB 1S77D 1N33O 1JX9A 2PUSA 2N05A 1VQ9V 1YCIA 3JATB 5LXTB 4OGQB 4UVCA 1Y66A 1QU7A 1HW7A 1QLEC 3ZN1A 2Q7EA 4LF6B 1QVFU 4I55A 2RN9A 2W6IG 1Y76A 4JTCB 4FPPA 1FXKC 3H01A 3EXAA 2BTQB 5IYZA 1U97A 2P7TC 3AG4C 3OGCC 4LF5B 1AILA 4X9QA 1GN2A 2QTOA 3SDLA 4JV5O 3CRRA 4X1IA 2ZM6B 2AZ2A 1Q5OA 1GN6A 2E5LO 2YUAA 4ZKIA 4LFAO 2R9RB 5LGNA 2JJ1G 3CMEV 4NXMO 3DC6A 1TA8A 2F4VO 4FJCC 3OAAG 1XNQB 2CUGA 3T4ZA 1BSMA 4NVPA 3T1CA 4PA4A 5L3EA 1GM9A 4H44B 1RP3B 2EJRA 1J5EO 3BHPA 3JAKB 2X6BA 4X20A 3R65A 2LO1A 4YY3O 1QCEA 4DR5B 4CC5A 4DV3O 2HJFC 4HYOA 1NJIW 4RO2A 3C3TA 3E89A 3M99B 4W4KA 1WLEA 4YJ2A 3MD0A 2F43G 1FD9A 1NTMH 3JARA 1WA8B 1N33B 1OCCC 1M5IA 3L70H 5DEDA 4G28B 5CA1A 4I50B 3G6EV 4PHZA 4J7ZA 1FAFA 4B3RO 3FB8C 4ZI7A 2UUBB 2HFEC 2ZIOA 3A2FA 5JWPA 1SERA 1EN4A 3AG3C 4DR1O 2YXHA 3RYFA 1BL8A 1FJGO 4R50A 2KG7B 4FFKA 2M7WA 3JSLA 3JSNA 3GWKC 4K3AA 4DV7B 1PNMA 3UT5A 3D3QA 5LP6B 3RYHB 1V55C 1OCOB 1K5QA 5EYPB 1ZL8B 2DWDC 4TQFA 3SJCC 1H38A 1HDJA 4FK5C 4JAVA 2F23A 5LOVB 2E76B 5J2TB 1OJHA 2QWOB 5IY5C 4TUYA 3WU2Z 1GTOA 2H8PC 5GW7A 4JI7B 4LFAB 2XASA 1K97A 4YIPA 1KKCA 4NXMB 2HJDA 4IYIA 2PZSA 2OIEA 4PI2A 2UXXA 1DLBA 5B3SB 2Q73A 3JAWA 3CRCA 5KAIZ 3SPJA 1ENVA 1J5EB 1SQQH 3PJSK 1EZVH 3ASNC 4JYAO 1YEWA 4QPKA 4WFHA 4ZIBA 1AI6A 1VQ4V 4GX2A 5H6QA 3RYCA 2DYSB 4WF9V 4FLYA 4DV3B 1P4RA 5EBMC 1X4TA 3FX7A 3RWRD 4LNUB 1VF7A 4YJ3B 2QE7G 4I4TA 4GX5A 5LMNO 1IBLB 2JS5A 3QVNA 1KYOF 1YSCA 2WLIB 1KBHA 4B3TO 2GSMB 1NH2D 4QJFB 5IWAO 4B3RB 2EINB 2LP7A 2JRIA 1OCRC 3TXSA 4B3SO 1AR5A 3CE2A 4NTYA 3L74H 1P7GA 2WAMA 3ABMC 4ZOLB 4TWKA 5LYJA 3ZRWA 1XEQA 5J2UA 3BCCH 3WB0A 5LHHA 5JCOA 1HNWO 1QQCA 4UCSA 1J95A 4FZ1A 4JTDB 3SPIA 3JATA 2CH7B 4YHHO 1FFXA 3N2GA 3EHBB 1S3JA 4GKKO 1V54B 1US6A 2ITCC 4CC6A 1WP8A 5IYDO 1NZ6A 3LDDA 1M56B 4I9QA 5F2VO 2D2CB 2HLDG 2HHHB 3KCYA 2BTQA 3S3WA 4RUFA 4NXNO 4DRXB 4LF7O 2AZ0A 1R3LC 5H2FZ 1YIJV 4LF4B 1SC5B 2A7WA 1VQ7V 1XNRO 4GT1A 4UUJC 2QTSA 4DW1A 3E8HA 3W7WA 1IXMA 3L73H 2KB1A 1JR9A 4ICGA 1IZ3A 4JYAB 5CA0A 4FFBB 2K1EA 2CTRA 3AK3A 1E79G 4PDLA 4LR3A 2JGDB 4BW5A 2ZT9B 4EFBA 2EBOA 1JVMA 2OCCC 1XDCA 4IHJB 2X6AA 3ZHTA 1FXKA 2YICA 2WLLA 1WPBA 1AJNA 4FLWA 1YI2V 4BAYA 1IBKB 1M4UA 4DV0B 1SETA 1ZSPA 1N8RW 3OEEG 1D2DA 1QR8A 2VS0A 3ZHSA 4F6RA 2Z0AA 4O4JB 4HBNA 1HNZB 3RT3C 2YIBA 1Z5WA 2ZE7A 1FXHA 1MSWD 4BR6A 3OFNG 2DWEC 1JFFA 4GKKB 3AG7A 4LWSA 4JI3O 1WP7A 1B04A 1UFIA 3CMAV 1VARA 1K34A 2PI4A 1WNSA 3ETGA 2ZNIA 3CXCU 4X64O 5D5PA 3F7YC 4O4IB 3ETDA 1TUBB 4NXNB 4ZHQA 3CX5F 3ZRVA 4I0XB 1ZL8A 1JA8A 1R73A 2RMKB 4UXNA 1HR0O 2DOSA 5ITZB 4FM0A 4FMTA 1G1XB 2A0LA 3BPZA 3DXRA 3C3SA 3OEHG 3I55V 1Q86W 2YI8A 2CK3G 3SGIA 1I94B 1I7FA 2P06A 2RDCA 1XMQO 3HPLC 3OUFA 1MOFA 4C7UA 2FKXA 4JZ2A 4GZRB 4RQFA 3D8CA 2QKAA 3FAVA 2ZD9A 1OZ0A 2DQ3A 1M93A 4LP8A 1TVKB 3ZMZA 1VIBA 4LNUA 1R6TA 2UXBB 5E1AC 1AI5A 2ILMA 2UUCB 2P22C 3NXSA 1N32B 2XT9A 3AG1C 1R3KC 4X1YB 1EM1A 3TK1A 1Q6IA 4XDLA 4FVMA 1Q6HA 3W7UA 1IBMO 1OV9A 2FTKA 2A9HA 5KAFZ 2JVDA 4AQYB 1DTOA 1N34B 1AR1B 2W0XA 2E3CA 5DECA 3K06A 3X2QB 3QO7A 4PA7A 5B1BC 3J7AU 2QM7A 1Y4MA 5BMVB 1LNQA 3WB2A 2BTOA 2UU9B 4WFBV 2VQEB 2QKCA 1DGSA 1D5AA 3SR2C 4X64B 3THOA 4JI2O 3UKMA 2BCCH 4NB5A 4K8XA 3OUSA 2HR3A 5CA3A 2V1DA 2BSKB 3ABLC 3N2KB 1L1FA 3CD6V 3RN4A 2EILB 3UO2A 1P49A 1SQVH 4UVAA 1HR0B 4DR3O 2VRZA 4TT3G 2XOKG 4JF3A 3FYIB 2XAQA 4PJ0Z 4TQDA 4UCOA 4LF6O 1GAXA 4D7TA 3CCEV 4DW0A 3CC2V 2Y0PA 4BIZA 1JOYA 5K1PA 3WG7C 2QSAA 5FNVB 1MNGA 4JYCA 1S72V 4P30A 4R8CA 4I7ZB 5GONA 1EZJA 1DF5A 4J10A 1Q90D 2LFSA 4QE7A 2QDOA 2ZXWC 2QWPB 1BZKA 3M8AA 4U3JB 3JD1A 3KG2A 5LMUO 1IBMB 3W7XA 1XNQO 3F5WC 1JJOA 2HEPA 2CDYA 2L35A 3ZMVA 3BAAA 3SYAA 2QR4A 3FB6C 2AHYA 1N0NA 2WA3A 4CH5A 2EJ7A 1U96A 4DR5O 1D5NA 1SF9A 3B40A 3OMAB 2UXCB 3LDEA 4X66O 4OPHA 2KKWA 2ZE5A 2F93B 3ZS8C 4X62B 4LF9B 3E22A 4H13B 2QWQB 4DR3B 3CCRV 4KXRA 1VQ5V 1NVPD 1XHZA 3OR7C 1ORQC 1K4CC 1K33A 4I0XA 2UUBO 3K5NA 5BXZA 4K0KO 5A2QN 1Z2GA 1AI4A 2BE3A 3A8TA 1BHAA 4UCTA 2B1IA 4QPJA 5HFMA 3B09A 1ZUQA 2GUZB 3CRQA 2DYRB 3T1YO 4MVMA 1N0JA 4DV7O 3T1HB 1P7BA 4TV8A 3OMIB 4RUEA 3B8MA 3MHSC 2EIJB 1SA0A 4O4LA 2ODMA 3DC5A 2AGAA 2CTWA 1QVGU 1GKFA 3FB5C 4JI0O 3E35A 2ZDIC 3IAYA 2Q5ZA 1PNKA 1R6KA 3CRMA 4GCZA 4NR1A 1AP6A 2N74A 2Q8VA 1BHBA 4JI7O 3ML0A 5H5NA 1SRYA 4UB6Z 5LMUB 2WPDG 5EBLC 4MTOA 3CCMV 2H3OA 2UXNA 4QE9A 2QWNB 3J81N 2EULA 3K08A 2UUAB 4LH6A 3UCSC 3MDSA 1AJQA 2EIMB 3HKBB 1PNLA 4NTXA 3K57A 5L3GA 4CS4A 4B7KA 1AROP 1ZLZA 5EIBC 4FM2A 3ASOB 4X66B 5HFLA 5LP6C 1OCOC 3SPCA 2F1MA 4GLXA 2Y48A 4HZ3A 1IBLO 1VF5B 4PA3A 2JJ2G 3TCUA 4Z2WA 1WN7A 1NKDA 5L3DA 1VQLV 2RCVA 1CPYA 3WFVA 2YS8A 3RYIB 4IIJA 4DR6O 3OE7G 5CN0A 3CHXA 2WLKA 2Q9LA 2BSKA 1XREA 3N2KA 3OTFA 3E8GA 4K0KB 5KUMA 2WSSG 1PP9H 1S5LZ 4PA9A 4GX1A 5B3SC 5L3FA 1FFTB 4G2KA 4O4HA 3HKDB 3T1YB 1BQZA 3ZBHA 4I5SA 2IU0A 1RSOA 4K8ZA 1BQ0A 2WA4A 3JALA 4U7NA 1B3QA 2DN9A 2DYSC 1ZAUA 1K73W 3CRAA 3ZMTA 4JI0B 2HHHO 3BY6A 5IJ9B 5LA6A 2V7QG 1KD1W 2QJ1A 1IXBA 3JD2A 1CEZA 4MTFA 4TV9B 4LF4O 1KU9A 3ABKB 1VQ8V 3E83A 1VEWA 1UPGA 1ZTEA 5B1OA 4UCRA 4MVZA 3ZIAG 2XNDG 2EINC 3UO3A 5EZYB 1B6QA 1GN3A 1PM9A 1Q81W 1LUVA 4KHPB 1M57B 3QO8A 2L6LA 4U3JA 3R66A 1S5HC 3JASA 3E86A 1SQFA 2P6JA 1V54C 3D3IA 3OTOB 5KX5A 4X1KB 5AG2A 3FYEB 2Z3YA 3P3NA 1K7DA 1IBKO 5LHGA 1S5JA 4FZ0A 3L72H 4DV0O 1M56C 1VQ6V 1I08A 3A0BZ 5KHKA 4QGPA 1KUQA 2RJZA 4DYLA 5JQGB 1S76D 4DR6B 1N36O 1QLNA 1HNZO 2CGNA 1F51A 2ZNJA 4DK0A 2Q69A 1AI7A 1WJZA 4GUNA 2A79B 4J11A 5LXTA 1IDSA 1L0LH 3GWOA 2YDEA 3CJHB 4O2AB 4J7KA 2LW1A 5JVDB 3AK2A 4EB6B 4LH7A 3ZHQA 1K4DC 3JD0A 3E2EA 1SZXA 1XBLA 2NNUA 3T2MA 1FPOA 2Q6AA 3LDCA 2ZR2A 2FYUH 1NU1H 3K03A 1Q43A 5JJJB 1FYJA 2IH1C 3W7SA 4CBCA 4WCEV 5C93A 3FKSG 1GO3F 3SYOA 1COWG 1LUWA 3RFRA 1FXVA 2IJKA 1AJPA 5CBGA 5B66Z 4LBEC 1H2GA 1WB7A 4TSFG 5GTHZ 1I94O 3F7VC 1HNXO 3KZIZ 5IE9A 1N4CA 4WBNB 3CCSV 1TUEB 2O57A 4MTGA 1XMOO 3HKBA 4WFFA 3JAKA 3L9DA 1SQBH 3QF7A 4MTXA 1O9HA 2GDSA 3JAMN 5JH7B 3BABA 2LJ2A 3OGIB 2UXBO 2ZDIA 4OPAA 3SJBC 4AILC 2KSDA 2UUCO 1N36B 1N32O 2HKOA 2AHZA 1AB3A 1ZX3A 3CCQV 5DM6V 1WA8A 1Y74B 4X89A 4GKJB 3UQ8A 3K0DA 3RVYA 4FLZA 4I50A 1YJNV 1JQ0A 3ETEA 4AQYO 4LF8B 1JCHA 2WLMA 1N34O 2R70A 1NTZH 4DXWA 5LGUA 2YIBD 1VQPV 3K0GA 3ICXA 3RYIA 3F5TA 1MZEA 3BA8A 3D36C 2VQFB 1XI1A 4CS3A 2UU9O 2FB5A 2VQEO 4PV1B 1PD3A 4KL1A 2KG7A 4DR4B 5KHHA 1MMMA 4QIWF 2P5OA 1OCZB 4LC1A 4CH4A 5LP6A 3RYHA 4DV6B 2EIKB 5EYPA 5C8YB 3OD4A 5KMGB 2YEVB 2Q68A 5CB4B 1R6NA 1YVWA 1MA1A 1DF4A 3L71H 1NVPB 5LOVA 5J2TA 1IVSA 1H2NA 3BRCA 2IJHA 1SESA 1F4NA 2Y69B 1SZTA 4BWAA 1GRJA 1T5EA 3G4SV 2LGQA 3ZHVA 1Y76B 3E8FA 1HNXB 4GYCB 1L0NH 4PD4F 3X2QC 4MT8A 4O2BB 4UB8Z 2B1GA 4IL6Z 1VQMV 5IYZB 5A9GA 1XMOB 3ZX6A 1Q82W 2Y4TA 1MG1A 2N04A 1P84F 5DN6G 1K8AW 4R6ZA 1W2BU 2JDIG 3ZRSA 2Q67A 2H94A 4YJ3A 1XQ8A 3IGAC 2HVJC 2WLIA 2EILC 2A06H 1W0KG 2ZIMA 5IT9N 3PN1A 3AEIA 2C2AA 4LCUC 4H0LB 2GHYA 3K9SA 4ZOLA 2ARHA 4QNHB 4FIPC 3STLC 1BMFG 2IU3A 4X20B 5TISZ 1VQNV 2CH7A 4RAIA 5K1XA 3APOA 1IURA 4DUYB 5EBWC 4J9YB 2UXCO 4HNAB 4JAUA 5BY1A 1H2KA 2GV9A 4X62O 3H1HH 3NR7A 4HAMA 4O2AA 4JI8B 1YZBA 4LF9O 3JARB 3P32A 2V4DA 3H1JH 1PKXA 4P9OA 2PGGA 2R9AA 2X7RB 3VQXA 5CA1B 2WLJA 3FB7C 4H37A 4WFEA 4FLUA 4DRXA 1XILA 3ZCCA 2LW7A 1F23A 1KP3A 3ZJZA 4A5UB 4ABMA 5BR8B 1GN4A 3RYFB 5J9PC 4UCVA 1HP8A 4ASUG 3STZC 2HP8A 3HR0A 3TXQA 1WPXA 3T1HO 2CGOA 3H1LH 3UT5B 2WLHA 3K59A 2Q7GA 3JYCA 3ZEDA 2XUMA 4FFBA 3APQA 2JGDA 4JI1B 4H33A 3P3PA 1CP9A 4IHJA 1B06A 4BW9A 4WBNA 1G4YB 1F4MA 5KLVH 1MABG 2DJVA 4TUYB 4MVSA 2QGNA 1KECA 1SKVA 4K35A 5IDJA 5JH7A 4B3MB 4UFZA 1SQGA 1RPOA 1QR9A 1PV0A 2JEXA 2IH3C 2P67A 3EFFK 1PL4A 3OT7A 3JAWB 4O4JA 1Q6UA 2UUAO 3ETQA 3B77A 4B7EA 3VQVA 3ABTA 4MVQA 2DYRC 3RYCB 4NYKA 2QM8A 1NQTA 2OT5A 2Q4PA 1PPJH 1BGYH 4DUZO 1RM1B 4DV5O 1Z5VA 4I4TB 4OX9B 2EIJC 3TJTA 2QM4A 4DR7B 3B4SA 4LFBB 1FKAO 3RW0A 4O4IA 4CZZA 1TUBA 3AG2B 4I9WA 5B1AB 1JPXA 4JI5O 2JGUA 4DK1A 4DV4O 4DV1B 3FFQA 2XAGA 3JD4A 1NTKH 5CB4A 3ZRWB 2G38A 4JAAA 1KC8W 5J2UB 2EZPA 4LFCO 2QA4V 5ITZA 5E79Z 3T4DA 3CCLV 1LR1A 2XTAA 1FFXB 2YC0A 3N2GB 1NBMG 4OXSA 1H2MA 3CSXA 2NN4A 2EIMC 3IJ4A 1QBZA 1H8EG 1URFA 3D36A 3ZMUA 1SQPH 5B5EZ 1GMGA 4O2BA 3ASOC 1FS0G 5LGTA 4MW3A 3IFXA 2OIGA 3ABUA 2YSUB 3OR6C 5H6RA 3TETA 1TVKA 2R72A 3MAQA 1K3EA 3AK1A 1YF2A 5LBQA 1XL6A 2Q7HA 4XBFA 2PYLA 4KHPO 3CS5A 3RGBA 1I5YA 4X1YA 1QLEB 2XAJA 5CA0B 4P9PA 5IJ0B 1YTFD 5LHIA 1GM7A 2OTJV 4DUZB 1M9NA 3OTOO 1FXKB 2WLLB 4DV5B 1E1RG 3C90A 5BMVA 4X65O 2QEXV 2EX3A 3SPHA 1KMIZ 3AG4B 3VOUA 3EVKA 2EZOA 3CXHF 3QTCA 2WLNA 2E74B 1ROPA 1YJ9V 1W0JG 4NTWA 1O9GA 4IT5A 4HNAA 3K79A 2DQ0A 3I5DA 4JI5B 4L8JA 1KP2A 2ATKC 4DV4B 4F6RB 3ABKC 1DK1A 4DR2B 1X59A 4JYYA 3OW2U 5D5QA 3JD3A 4LFCB 3S3XA 5GTIZ 2R9IA 2W0FC 2NLJC 4FLXA 3JCZA 1M57C 5KHGA 1JFFB 4LWSB 3QNEA 2P4KA 3OM3B 2B9ZA 4JASA 2P4VA 3N27A 2VWJA 4EKWA 1H2LA 1L8DA 1THZA 2BOBC 1YITV 4ZHQB 4WFGA 3RBZA 5FNVA 3ZHRA 3ZHUA 3U10A 4U7OA 1OCCB 5IYBO 4JV5B 1NR1A 2GBOA 2E5LB 1WAZA 4D7SA 3DXRB 4N21A 4FLVA 4JGSA 3VQWA 4JI6O 4UV9A 3AG3B 2F4VB 2E75B 2YI9A 5FPRA 3CWBH 5KA5A 4G27B 4NKGB 3LSQA 3MHHC 1JMKC 4X65B 5LL6Y 4PDMA 1V55B 2QKSA 5FLXN 2IJJA 4IYHA 3JCUZ 3FAVB 3O65A 2DW4A 4YY3B 4JI4O 2IJIA 3WB1A 4JYBA 2CE4A 2DE0X 3DGEA 3SJQC 1EN6A 3K9AA 1Q8IA 5IY5B 4J41A 4PI0A 4E4EA 4GKJO 3SYQA 3LNNA 2RNBA 4LF8O 3G80A 2ETNA 3K5MA 3H1KH 2XHBA 4CH3A 4UV8A 2M6YA 4YIOA 1QNMA 2IM9A 4KUMA 1NI8A 2VQFO 1VF6A 3B2EE 1YJWV 3ZN0A 3ASNB 4DR1B 3VBBA 3UM7A 2D3OW 1FJGB 2GUZA 1UJWB 1YXBA 4DR4O 4J9ZB 2FL4A 4DV6O 1KB9F 3J80N 4XDJA 5KUKA 2OCHA 4J7JA 2PI5A 2YIAA 1YDXA 4DV2O 2UXDO 4PDRA 1NR7A 4RWUA 1TAEA 4MVRA 4DO2A
chains in the Genus database with same CATH topology
2DN9A 2PF4E 2GUZA 3UO3A 3UO2A 2EJ7A 1HDJA 2QWRB 2QWPB 3AG7A 1XBLA 2DMXA 2CUGA 1WJZA 2CTQA 1FPOA 2CTRA 2QWNB 2QWOB 2CTWA 2OCHA 2QSAA 2L6LA 4J80A 3APOA 1IURA 2KQXA 3UCSC 3APQA 1BQZA 2LGWA 2M6YA 2CTPA 1N4CA 3BVOA 4J7ZA 1FAFA 2YUAA 2GUZB 1NZ6A 2LO1A 2N05A 2QWQB 2Y4TA 2Y4UA 1BQ0A 2YS8A 4IT5A 4RWUA 2N04A 1GH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DN9 A;  2PF4 E;  2GUZ A;  3UO3 A;  3UO2 A;  2EJ7 A;  1HDJ A;  2QWR B;  2QWP B;  3AG7 A;  1XBL A;  2DMX A;  2CUG A;  1WJZ A;  2CTQ A;  1FPO A;  2CTR A;  2QWN B;  2QWO B;  2CTW A;  2OCH A;  2QSA A;  2L6L A;  4J80 A;  3APO A;  1IUR A;  2KQX A;  3UCS C;  3APQ A;  1BQZ A;  2LGW A;  2M6Y A;  2CTP A;  1N4C A;  3BVO A;  4J7Z A;  1FAF A;  2YUA A;  2GUZ B;  1NZ6 A;  2LO1 A;  2N05 A;  2QWQ B;  2Y4T A;  2Y4U A;  1BQ0 A;  2YS8 A;  4IT5 A;  4RWU A;  2N04 A;  1GH6 A; 
#chains in the Genus database with same CATH topology
 1MZF A;  4GX0 A;  2F95 B;  1EN5 A;  2B5U A;  1KKD A;  1OCR B;  2XAH A;  4PDV A;  2OTL V;  3ABM B;  3L75 H;  4Z1M G;  1NS1 A;  4JI6 B;  1YHQ V;  1I5X A;  2HVK C;  4XDK A;  3H9V A;  4Z1V A;  2PYJ A;  2CAZ C;  3DTU B;  1S0V A;  3BFR A;  3B8N A;  5EC1 C;  5H9C A;  5EC2 C;  2Y0I A;  1K5S A;  1GH6 A;  3CCJ V;  2BOC C;  4JTA B;  1BS3 A;  3CB2 A;  4J42 A;  4PEL A;  1XL4 A;  3Q4H B;  4AI8 A;  5IJ0 A;  2OYQ A;  4JI4 B;  5EK0 A;  1W59 A;  4MVO A;  4Q20 A;  1GK9 A;  3U0Z A;  3ZRX A;  1MSD A;  3HKC B;  1OCZ C;  1WB8 A;  5GON B;  4E2L A;  1EBO A;  1BT8 A;  1V9P A;  2EIK C;  4MVU A;  2W6J G;  3ZMS A;  2YXY A;  5KHI A;  5LMN B;  4MS2 A;  2VWK A;  4B3T B;  3HKE B;  1RFY A;  4FM1 A;  5IWA B;  2Y69 C;  3H1I H;  3K5O A;  4B3S B;  2ZR3 A;  3DSQ A;  3CC7 V;  3SPG A;  1QHT A;  1HNW B;  2XAF A;  1H8H G;  1KQS U;  2Y4U A;  4DUY O;  3HKD A;  4YHH B;  2OCC B;  1ZWI C;  2X0L A;  4JI8 O;  4DV2 B;  2UXD B;  5EIB D;  4J80 A;  3E22 B;  5L3C A;  3RVZ A;  1Y6X A;  5IJ9 A;  3BVO A;  2ZCE A;  1VQK V;  3P30 A;  4TV9 A;  3A0H Z;  4LF7 B;  2PF4 E;  4L87 A;  4IGG A;  1AR4 A;  1XNR B;  5BR8 O;  4I55 B;  4AHC A;  3HB3 B;  4RQE A;  5L3B A;  3K3W A;  5EZY A;  4CS2 A;  2KQX A;  2LQT A;  1E1Q G;  4KFM A;  3KKY A;  2OWO A;  4TV8 B;  1Y67 A;  3BA9 A;  2HG5 C;  2IW5 A;  4JI1 O;  2IBZ H;  1SA0 B;  2Z5U A;  4O4L B;  4TOI A;  2PTM A;  4B08 A;  2YXL A;  4X1I B;  2JEU A;  4FLT A;  3U11 A;  1OHH G;  4X1K A;  3LSS A;  5FPO A;  1R3J C;  1H2S B;  1M90 W;  3SYP A;  3LUT B;  4F6E A;  3KCX A;  5CBF A;  1VQO V;  3OMN B;  4D6T H;  2LGW A;  2GTA A;  4B3M O;  4JPR A;  3W7T A;  4CH6 A;  2YID A;  5JQG A;  4YXW G;  2ZKO A;  1XHX A;  1YTF B;  1F7Y A;  4W4L A;  2Q0O C;  2ZE8 A;  1XUQ A;  4KP4 A;  1EFR G;  2ZQM A;  1HWY A;  2CTP A;  3IC7 A;  5KHJ A;  3G71 V;  1I0H A;  3QG5 A;  4X88 A;  3TGU H;  1M1K W;  1BCC H;  2P90 A;  4U3F H;  4JI3 B;  5JJN B;  4OX9 O;  4YJ2 B;  3CJH A;  3K04 A;  1CXZ B;  4BIU A;  4ZBM A;  4DR7 O;  2JIZ G;  4R7C A;  4UCU A;  5JVD A;  4BIO A;  5KA6 A;  4EB6 A;  4LFB O;  4P2Z A;  2F66 C;  1NT2 B;  2RQ6 A;  3K5L A;  5CBH A;  1RPR A;  2MK3 A;  4IIJ B;  4DV1 O;  4ZI7 B;  3IC9 A;  5FL7 G;  1AVM A;  3AG1 B;  1SQX H;  3CCV V;  3BEH A;  3LSU A;  2DMX A;  3SJA C;  1A32 A;  4O4H B;  2JK5 C;  2LFR A;  3M7M X;  1G8M A;  4MW8 A;  4JZG A;  2GTS A;  4N23 A;  2FML A;  1RSO B;  2ZE6 A;  1IX9 A;  5B1B B;  4EEQ A;  3CCU V;  3JAL B;  1Q3E A;  4WFA V;  1AP5 A;  2ADP A;  3CP1 A;  3CPW U;  5JJE B;  1K92 A;  2A3Q A;  1RM1 C;  5LA6 B;  4EFE A;  3FD9 A;  1XMQ B;  3QO5 A;  3ABL B;  3Q4H A;  1SS3 A;  4LF5 O;  2ITD C;  4MSW C;  3G67 A;  1K9M W;  2PY5 A;  1G6U A;  1VMG A;  3HKC A;  1XOU A;  3G6B A;  3AG2 C;  2ZM6 O;  5B1A C;  1VP7 A;  3E8B A;  3GB7 C;  1TGO A;  3CYO A;  3VQY A;  2Q0A A;  1Y74 A;  2X6C A;  1VF6 C;  5JCO C;  3LNM B;  5BZB A;  3K58 A;  3HKE A;  2K9P A;  3JAS B;  3O9O A;  2WWW A;  5CMU A;  1Q7Y W;  3CEI A;  1GM8 A;  4X8A A;  2AW9 A;  3A0R A;  2JS3 A;  5B1N A;  1R3I C;  5KX5 B;  2NR5 A;  3WG7 B;  2ZIN A;  2ADQ B;  1BE3 H;  1JJ2 U;  3SYC A;  2AXT Z;  3CC4 V;  2MW2 B;  2QWR B;  1PL0 A;  2CTQ A;  4JI2 B;  4F4L A;  5IYC O;  3I56 V;  4UVB A;  5KMG A;  5C8Y A;  1NH2 B;  2YEV A;  4PA6 A;  4Q6G A;  5LYJ B;  4DR2 O;  1R1B A;  3GVM A;  2ZXW B;  1S77 D;  1N33 O;  1JX9 A;  2PUS A;  2N05 A;  1VQ9 V;  1YCI A;  3JAT B;  5LXT B;  4OGQ B;  4UVC A;  1Y66 A;  1QU7 A;  1HW7 A;  1QLE C;  3ZN1 A;  2Q7E A;  4LF6 B;  1QVF U;  4I55 A;  2RN9 A;  2W6I G;  1Y76 A;  4JTC B;  4FPP A;  1FXK C;  3H01 A;  3EXA A;  2BTQ B;  5IYZ A;  1U97 A;  2P7T C;  3AG4 C;  3OGC C;  4LF5 B;  1AIL A;  4X9Q A;  1GN2 A;  2QTO A;  3SDL A;  4JV5 O;  3CRR A;  4X1I A;  2ZM6 B;  2AZ2 A;  1Q5O A;  1GN6 A;  2E5L O;  2YUA A;  4ZKI A;  4LFA O;  2R9R B;  5LGN A;  2JJ1 G;  3CME V;  4NXM O;  3DC6 A;  1TA8 A;  2F4V O;  4FJC C;  3OAA G;  1XNQ B;  2CUG A;  3T4Z A;  1BSM A;  4NVP A;  3T1C A;  4PA4 A;  5L3E A;  1GM9 A;  4H44 B;  1RP3 B;  2EJR A;  1J5E O;  3BHP A;  3JAK B;  2X6B A;  4X20 A;  3R65 A;  2LO1 A;  4YY3 O;  1QCE A;  4DR5 B;  4CC5 A;  4DV3 O;  2HJF C;  4HYO A;  1NJI W;  4RO2 A;  3C3T A;  3E89 A;  3M99 B;  4W4K A;  1WLE A;  4YJ2 A;  3MD0 A;  2F43 G;  1FD9 A;  1NTM H;  3JAR A;  1WA8 B;  1N33 B;  1OCC C;  1M5I A;  3L70 H;  5DED A;  4G28 B;  5CA1 A;  4I50 B;  3G6E V;  4PHZ A;  4J7Z A;  1FAF A;  4B3R O;  3FB8 C;  4ZI7 A;  2UUB B;  2HFE C;  2ZIO A;  3A2F A;  5JWP A;  1SER A;  1EN4 A;  3AG3 C;  4DR1 O;  2YXH A;  3RYF A;  1BL8 A;  1FJG O;  4R50 A;  2KG7 B;  4FFK A;  2M7W A;  3JSL A;  3JSN A;  3GWK C;  4K3A A;  4DV7 B;  1PNM A;  3UT5 A;  3D3Q A;  5LP6 B;  3RYH B;  1V55 C;  1OCO B;  1K5Q A;  5EYP B;  1ZL8 B;  2DWD C;  4TQF A;  3SJC C;  1H38 A;  1HDJ A;  4FK5 C;  4JAV A;  2F23 A;  5LOV B;  2E76 B;  5J2T B;  1OJH A;  2QWO B;  5IY5 C;  4TUY A;  3WU2 Z;  1GTO A;  2H8P C;  5GW7 A;  4JI7 B;  4LFA B;  2XAS A;  1K97 A;  4YIP A;  1KKC A;  4NXM B;  2HJD A;  4IYI A;  2PZS A;  2OIE A;  4PI2 A;  2UXX A;  1DLB A;  5B3S B;  2Q73 A;  3JAW A;  3CRC A;  5KAI Z;  3SPJ A;  1ENV A;  1J5E B;  1SQQ H;  3PJS K;  1EZV H;  3ASN C;  4JYA O;  1YEW A;  4QPK A;  4WFH A;  4ZIB A;  1AI6 A;  1VQ4 V;  4GX2 A;  5H6Q A;  3RYC A;  2DYS B;  4WF9 V;  4FLY A;  4DV3 B;  1P4R A;  5EBM C;  1X4T A;  3FX7 A;  3RWR D;  4LNU B;  1VF7 A;  4YJ3 B;  2QE7 G;  4I4T A;  4GX5 A;  5LMN O;  1IBL B;  2JS5 A;  3QVN A;  1KYO F;  1YSC A;  2WLI B;  1KBH A;  4B3T O;  2GSM B;  1NH2 D;  4QJF B;  5IWA O;  4B3R B;  2EIN B;  2LP7 A;  2JRI A;  1OCR C;  3TXS A;  4B3S O;  1AR5 A;  3CE2 A;  4NTY A;  3L74 H;  1P7G A;  2WAM A;  3ABM C;  4ZOL B;  4TWK A;  5LYJ A;  3ZRW A;  1XEQ A;  5J2U A;  3BCC H;  3WB0 A;  5LHH A;  5JCO A;  1HNW O;  1QQC A;  4UCS A;  1J95 A;  4FZ1 A;  4JTD B;  3SPI A;  3JAT A;  2CH7 B;  4YHH O;  1FFX A;  3N2G A;  3EHB B;  1S3J A;  4GKK O;  1V54 B;  1US6 A;  2ITC C;  4CC6 A;  1WP8 A;  5IYD O;  1NZ6 A;  3LDD A;  1M56 B;  4I9Q A;  5F2V O;  2D2C B;  2HLD G;  2HHH B;  3KCY A;  2BTQ A;  3S3W A;  4RUF A;  4NXN O;  4DRX B;  4LF7 O;  2AZ0 A;  1R3L C;  5H2F Z;  1YIJ V;  4LF4 B;  1SC5 B;  2A7W A;  1VQ7 V;  1XNR O;  4GT1 A;  4UUJ C;  2QTS A;  4DW1 A;  3E8H A;  3W7W A;  1IXM A;  3L73 H;  2KB1 A;  1JR9 A;  4ICG A;  1IZ3 A;  4JYA B;  5CA0 A;  4FFB B;  2K1E A;  2CTR A;  3AK3 A;  1E79 G;  4PDL A;  4LR3 A;  2JGD B;  4BW5 A;  2ZT9 B;  4EFB A;  2EBO A;  1JVM A;  2OCC C;  1XDC A;  4IHJ B;  2X6A A;  3ZHT A;  1FXK A;  2YIC A;  2WLL A;  1WPB A;  1AJN A;  4FLW A;  1YI2 V;  4BAY A;  1IBK B;  1M4U A;  4DV0 B;  1SET A;  1ZSP A;  1N8R W;  3OEE G;  1D2D A;  1QR8 A;  2VS0 A;  3ZHS A;  4F6R A;  2Z0A A;  4O4J B;  4HBN A;  1HNZ B;  3RT3 C;  2YIB A;  1Z5W A;  2ZE7 A;  1FXH A;  1MSW D;  4BR6 A;  3OFN G;  2DWE C;  1JFF A;  4GKK B;  3AG7 A;  4LWS A;  4JI3 O;  1WP7 A;  1B04 A;  1UFI A;  3CMA V;  1VAR A;  1K34 A;  2PI4 A;  1WNS A;  3ETG A;  2ZNI A;  3CXC U;  4X64 O;  5D5P A;  3F7Y C;  4O4I B;  3ETD A;  1TUB B;  4NXN B;  4ZHQ A;  3CX5 F;  3ZRV A;  4I0X B;  1ZL8 A;  1JA8 A;  1R73 A;  2RMK B;  4UXN A;  1HR0 O;  2DOS A;  5ITZ B;  4FM0 A;  4FMT A;  1G1X B;  2A0L A;  3BPZ A;  3DXR A;  3C3S A;  3OEH G;  3I55 V;  1Q86 W;  2YI8 A;  2CK3 G;  3SGI A;  1I94 B;  1I7F A;  2P06 A;  2RDC A;  1XMQ O;  3HPL C;  3OUF A;  1MOF A;  4C7U A;  2FKX A;  4JZ2 A;  4GZR B;  4RQF A;  3D8C A;  2QKA A;  3FAV A;  2ZD9 A;  1OZ0 A;  2DQ3 A;  1M93 A;  4LP8 A;  1TVK B;  3ZMZ A;  1VIB A;  4LNU A;  1R6T A;  2UXB B;  5E1A C;  1AI5 A;  2ILM A;  2UUC B;  2P22 C;  3NXS A;  1N32 B;  2XT9 A;  3AG1 C;  1R3K C;  4X1Y B;  1EM1 A;  3TK1 A;  1Q6I A;  4XDL A;  4FVM A;  1Q6H A;  3W7U A;  1IBM O;  1OV9 A;  2FTK A;  2A9H A;  5KAF Z;  2JVD A;  4AQY B;  1DTO A;  1N34 B;  1AR1 B;  2W0X A;  2E3C A;  5DEC A;  3K06 A;  3X2Q B;  3QO7 A;  4PA7 A;  5B1B C;  3J7A U;  2QM7 A;  1Y4M A;  5BMV B;  1LNQ A;  3WB2 A;  2BTO A;  2UU9 B;  4WFB V;  2VQE B;  2QKC A;  1DGS A;  1D5A A;  3SR2 C;  4X64 B;  3THO A;  4JI2 O;  3UKM A;  2BCC H;  4NB5 A;  4K8X A;  3OUS A;  2HR3 A;  5CA3 A;  2V1D A;  2BSK B;  3ABL C;  3N2K B;  1L1F A;  3CD6 V;  3RN4 A;  2EIL B;  3UO2 A;  1P49 A;  1SQV H;  4UVA A;  1HR0 B;  4DR3 O;  2VRZ A;  4TT3 G;  2XOK G;  4JF3 A;  3FYI B;  2XAQ A;  4PJ0 Z;  4TQD A;  4UCO A;  4LF6 O;  1GAX A;  4D7T A;  3CCE V;  4DW0 A;  3CC2 V;  2Y0P A;  4BIZ A;  1JOY A;  5K1P A;  3WG7 C;  2QSA A;  5FNV B;  1MNG A;  4JYC A;  1S72 V;  4P30 A;  4R8C A;  4I7Z B;  5GON A;  1EZJ A;  1DF5 A;  4J10 A;  1Q90 D;  2LFS A;  4QE7 A;  2QDO A;  2ZXW C;  2QWP B;  1BZK A;  3M8A A;  4U3J B;  3JD1 A;  3KG2 A;  5LMU O;  1IBM B;  3W7X A;  1XNQ O;  3F5W C;  1JJO A;  2HEP A;  2CDY A;  2L35 A;  3ZMV A;  3BAA A;  3SYA A;  2QR4 A;  3FB6 C;  2AHY A;  1N0N A;  2WA3 A;  4CH5 A;  2EJ7 A;  1U96 A;  4DR5 O;  1D5N A;  1SF9 A;  3B40 A;  3OMA B;  2UXC B;  3LDE A;  4X66 O;  4OPH A;  2KKW A;  2ZE5 A;  2F93 B;  3ZS8 C;  4X62 B;  4LF9 B;  3E22 A;  4H13 B;  2QWQ B;  4DR3 B;  3CCR V;  4KXR A;  1VQ5 V;  1NVP D;  1XHZ A;  3OR7 C;  1ORQ C;  1K4C C;  1K33 A;  4I0X A;  2UUB O;  3K5N A;  5BXZ A;  4K0K O;  5A2Q N;  1Z2G A;  1AI4 A;  2BE3 A;  3A8T A;  1BHA A;  4UCT A;  2B1I A;  4QPJ A;  5HFM A;  3B09 A;  1ZUQ A;  2GUZ B;  3CRQ A;  2DYR B;  3T1Y O;  4MVM A;  1N0J A;  4DV7 O;  3T1H B;  1P7B A;  4TV8 A;  3OMI B;  4RUE A;  3B8M A;  3MHS C;  2EIJ B;  1SA0 A;  4O4L A;  2ODM A;  3DC5 A;  2AGA A;  2CTW A;  1QVG U;  1GKF A;  3FB5 C;  4JI0 O;  3E35 A;  2ZDI C;  3IAY A;  2Q5Z A;  1PNK A;  1R6K A;  3CRM A;  4GCZ A;  4NR1 A;  1AP6 A;  2N74 A;  2Q8V A;  1BHB A;  4JI7 O;  3ML0 A;  5H5N A;  1SRY A;  4UB6 Z;  5LMU B;  2WPD G;  5EBL C;  4MTO A;  3CCM V;  2H3O A;  2UXN A;  4QE9 A;  2QWN B;  3J81 N;  2EUL A;  3K08 A;  2UUA B;  4LH6 A;  3UCS C;  3MDS A;  1AJQ A;  2EIM B;  3HKB B;  1PNL A;  4NTX A;  3K57 A;  5L3G A;  4CS4 A;  4B7K A;  1ARO P;  1ZLZ A;  5EIB C;  4FM2 A;  3ASO B;  4X66 B;  5HFL A;  5LP6 C;  1OCO C;  3SPC A;  2F1M A;  4GLX A;  2Y48 A;  4HZ3 A;  1IBL O;  1VF5 B;  4PA3 A;  2JJ2 G;  3TCU A;  4Z2W A;  1WN7 A;  1NKD A;  5L3D A;  1VQL V;  2RCV A;  1CPY A;  3WFV A;  2YS8 A;  3RYI B;  4IIJ A;  4DR6 O;  3OE7 G;  5CN0 A;  3CHX A;  2WLK A;  2Q9L A;  2BSK A;  1XRE A;  3N2K A;  3OTF A;  3E8G A;  4K0K B;  5KUM A;  2WSS G;  1PP9 H;  1S5L Z;  4PA9 A;  4GX1 A;  5B3S C;  5L3F A;  1FFT B;  4G2K A;  4O4H A;  3HKD B;  3T1Y B;  1BQZ A;  3ZBH A;  4I5S A;  2IU0 A;  1RSO A;  4K8Z A;  1BQ0 A;  2WA4 A;  3JAL A;  4U7N A;  1B3Q A;  2DN9 A;  2DYS C;  1ZAU A;  1K73 W;  3CRA A;  3ZMT A;  4JI0 B;  2HHH O;  3BY6 A;  5IJ9 B;  5LA6 A;  2V7Q G;  1KD1 W;  2QJ1 A;  1IXB A;  3JD2 A;  1CEZ A;  4MTF A;  4TV9 B;  4LF4 O;  1KU9 A;  3ABK B;  1VQ8 V;  3E83 A;  1VEW A;  1UPG A;  1ZTE A;  5B1O A;  4UCR A;  4MVZ A;  3ZIA G;  2XND G;  2EIN C;  3UO3 A;  5EZY B;  1B6Q A;  1GN3 A;  1PM9 A;  1Q81 W;  1LUV A;  4KHP B;  1M57 B;  3QO8 A;  2L6L A;  4U3J A;  3R66 A;  1S5H C;  3JAS A;  3E86 A;  1SQF A;  2P6J A;  1V54 C;  3D3I A;  3OTO B;  5KX5 A;  4X1K B;  5AG2 A;  3FYE B;  2Z3Y A;  3P3N A;  1K7D A;  1IBK O;  5LHG A;  1S5J A;  4FZ0 A;  3L72 H;  4DV0 O;  1M56 C;  1VQ6 V;  1I08 A;  3A0B Z;  5KHK A;  4QGP A;  1KUQ A;  2RJZ A;  4DYL A;  5JQG B;  1S76 D;  4DR6 B;  1N36 O;  1QLN A;  1HNZ O;  2CGN A;  1F51 A;  2ZNJ A;  4DK0 A;  2Q69 A;  1AI7 A;  1WJZ A;  4GUN A;  2A79 B;  4J11 A;  5LXT A;  1IDS A;  1L0L H;  3GWO A;  2YDE A;  3CJH B;  4O2A B;  4J7K A;  2LW1 A;  5JVD B;  3AK2 A;  4EB6 B;  4LH7 A;  3ZHQ A;  1K4D C;  3JD0 A;  3E2E A;  1SZX A;  1XBL A;  2NNU A;  3T2M A;  1FPO A;  2Q6A A;  3LDC A;  2ZR2 A;  2FYU H;  1NU1 H;  3K03 A;  1Q43 A;  5JJJ B;  1FYJ A;  2IH1 C;  3W7S A;  4CBC A;  4WCE V;  5C93 A;  3FKS G;  1GO3 F;  3SYO A;  1COW G;  1LUW A;  3RFR A;  1FXV A;  2IJK A;  1AJP A;  5CBG A;  5B66 Z;  4LBE C;  1H2G A;  1WB7 A;  4TSF G;  5GTH Z;  1I94 O;  3F7V C;  1HNX O;  3KZI Z;  5IE9 A;  1N4C A;  4WBN B;  3CCS V;  1TUE B;  2O57 A;  4MTG A;  1XMO O;  3HKB A;  4WFF A;  3JAK A;  3L9D A;  1SQB H;  3QF7 A;  4MTX A;  1O9H A;  2GDS A;  3JAM N;  5JH7 B;  3BAB A;  2LJ2 A;  3OGI B;  2UXB O;  2ZDI A;  4OPA A;  3SJB C;  4AIL C;  2KSD A;  2UUC O;  1N36 B;  1N32 O;  2HKO A;  2AHZ A;  1AB3 A;  1ZX3 A;  3CCQ V;  5DM6 V;  1WA8 A;  1Y74 B;  4X89 A;  4GKJ B;  3UQ8 A;  3K0D A;  3RVY A;  4FLZ A;  4I50 A;  1YJN V;  1JQ0 A;  3ETE A;  4AQY O;  4LF8 B;  1JCH A;  2WLM A;  1N34 O;  2R70 A;  1NTZ H;  4DXW A;  5LGU A;  2YIB D;  1VQP V;  3K0G A;  3ICX A;  3RYI A;  3F5T A;  1MZE A;  3BA8 A;  3D36 C;  2VQF B;  1XI1 A;  4CS3 A;  2UU9 O;  2FB5 A;  2VQE O;  4PV1 B;  1PD3 A;  4KL1 A;  2KG7 A;  4DR4 B;  5KHH A;  1MMM A;  4QIW F;  2P5O A;  1OCZ B;  4LC1 A;  4CH4 A;  5LP6 A;  3RYH A;  4DV6 B;  2EIK B;  5EYP A;  5C8Y B;  3OD4 A;  5KMG B;  2YEV B;  2Q68 A;  5CB4 B;  1R6N A;  1YVW A;  1MA1 A;  1DF4 A;  3L71 H;  1NVP B;  5LOV A;  5J2T A;  1IVS A;  1H2N A;  3BRC A;  2IJH A;  1SES A;  1F4N A;  2Y69 B;  1SZT A;  4BWA A;  1GRJ A;  1T5E A;  3G4S V;  2LGQ A;  3ZHV A;  1Y76 B;  3E8F A;  1HNX B;  4GYC B;  1L0N H;  4PD4 F;  3X2Q C;  4MT8 A;  4O2B B;  4UB8 Z;  2B1G A;  4IL6 Z;  1VQM V;  5IYZ B;  5A9G A;  1XMO B;  3ZX6 A;  1Q82 W;  2Y4T A;  1MG1 A;  2N04 A;  1P84 F;  5DN6 G;  1K8A W;  4R6Z A;  1W2B U;  2JDI G;  3ZRS A;  2Q67 A;  2H94 A;  4YJ3 A;  1XQ8 A;  3IGA C;  2HVJ C;  2WLI A;  2EIL C;  2A06 H;  1W0K G;  2ZIM A;  5IT9 N;  3PN1 A;  3AEI A;  2C2A A;  4LCU C;  4H0L B;  2GHY A;  3K9S A;  4ZOL A;  2ARH A;  4QNH B;  4FIP C;  3STL C;  1BMF G;  2IU3 A;  4X20 B;  5TIS Z;  1VQN V;  2CH7 A;  4RAI A;  5K1X A;  3APO A;  1IUR A;  4DUY B;  5EBW C;  4J9Y B;  2UXC O;  4HNA B;  4JAU A;  5BY1 A;  1H2K A;  2GV9 A;  4X62 O;  3H1H H;  3NR7 A;  4HAM A;  4O2A A;  4JI8 B;  1YZB A;  4LF9 O;  3JAR B;  3P32 A;  2V4D A;  3H1J H;  1PKX A;  4P9O A;  2PGG A;  2R9A A;  2X7R B;  3VQX A;  5CA1 B;  2WLJ A;  3FB7 C;  4H37 A;  4WFE A;  4FLU A;  4DRX A;  1XIL A;  3ZCC A;  2LW7 A;  1F23 A;  1KP3 A;  3ZJZ A;  4A5U B;  4ABM A;  5BR8 B;  1GN4 A;  3RYF B;  5J9P C;  4UCV A;  1HP8 A;  4ASU G;  3STZ C;  2HP8 A;  3HR0 A;  3TXQ A;  1WPX A;  3T1H O;  2CGO A;  3H1L H;  3UT5 B;  2WLH A;  3K59 A;  2Q7G A;  3JYC A;  3ZED A;  2XUM A;  4FFB A;  3APQ A;  2JGD A;  4JI1 B;  4H33 A;  3P3P A;  1CP9 A;  4IHJ A;  1B06 A;  4BW9 A;  4WBN A;  1G4Y B;  1F4M A;  5KLV H;  1MAB G;  2DJV A;  4TUY B;  4MVS A;  2QGN A;  1KEC A;  1SKV A;  4K35 A;  5IDJ A;  5JH7 A;  4B3M B;  4UFZ A;  1SQG A;  1RPO A;  1QR9 A;  1PV0 A;  2JEX A;  2IH3 C;  2P67 A;  3EFF K;  1PL4 A;  3OT7 A;  3JAW B;  4O4J A;  1Q6U A;  2UUA O;  3ETQ A;  3B77 A;  4B7E A;  3VQV A;  3ABT A;  4MVQ A;  2DYR C;  3RYC B;  4NYK A;  2QM8 A;  1NQT A;  2OT5 A;  2Q4P A;  1PPJ H;  1BGY H;  4DUZ O;  1RM1 B;  4DV5 O;  1Z5V A;  4I4T B;  4OX9 B;  2EIJ C;  3TJT A;  2QM4 A;  4DR7 B;  3B4S A;  4LFB B;  1FKA O;  3RW0 A;  4O4I A;  4CZZ A;  1TUB A;  3AG2 B;  4I9W A;  5B1A B;  1JPX A;  4JI5 O;  2JGU A;  4DK1 A;  4DV4 O;  4DV1 B;  3FFQ A;  2XAG A;  3JD4 A;  1NTK H;  5CB4 A;  3ZRW B;  2G38 A;  4JAA A;  1KC8 W;  5J2U B;  2EZP A;  4LFC O;  2QA4 V;  5ITZ A;  5E79 Z;  3T4D A;  3CCL V;  1LR1 A;  2XTA A;  1FFX B;  2YC0 A;  3N2G B;  1NBM G;  4OXS A;  1H2M A;  3CSX A;  2NN4 A;  2EIM C;  3IJ4 A;  1QBZ A;  1H8E G;  1URF A;  3D36 A;  3ZMU A;  1SQP H;  5B5E Z;  1GMG A;  4O2B A;  3ASO C;  1FS0 G;  5LGT A;  4MW3 A;  3IFX A;  2OIG A;  3ABU A;  2YSU B;  3OR6 C;  5H6R A;  3TET A;  1TVK A;  2R72 A;  3MAQ A;  1K3E A;  3AK1 A;  1YF2 A;  5LBQ A;  1XL6 A;  2Q7H A;  4XBF A;  2PYL A;  4KHP O;  3CS5 A;  3RGB A;  1I5Y A;  4X1Y A;  1QLE B;  2XAJ A;  5CA0 B;  4P9P A;  5IJ0 B;  1YTF D;  5LHI A;  1GM7 A;  2OTJ V;  4DUZ B;  1M9N A;  3OTO O;  1FXK B;  2WLL B;  4DV5 B;  1E1R G;  3C90 A;  5BMV A;  4X65 O;  2QEX V;  2EX3 A;  3SPH A;  1KMI Z;  3AG4 B;  3VOU A;  3EVK A;  2EZO A;  3CXH F;  3QTC A;  2WLN A;  2E74 B;  1ROP A;  1YJ9 V;  1W0J G;  4NTW A;  1O9G A;  4IT5 A;  4HNA A;  3K79 A;  2DQ0 A;  3I5D A;  4JI5 B;  4L8J A;  1KP2 A;  2ATK C;  4DV4 B;  4F6R B;  3ABK C;  1DK1 A;  4DR2 B;  1X59 A;  4JYY A;  3OW2 U;  5D5Q A;  3JD3 A;  4LFC B;  3S3X A;  5GTI Z;  2R9I A;  2W0F C;  2NLJ C;  4FLX A;  3JCZ A;  1M57 C;  5KHG A;  1JFF B;  4LWS B;  3QNE A;  2P4K A;  3OM3 B;  2B9Z A;  4JAS A;  2P4V A;  3N27 A;  2VWJ A;  4EKW A;  1H2L A;  1L8D A;  1THZ A;  2BOB C;  1YIT V;  4ZHQ B;  4WFG A;  3RBZ A;  5FNV A;  3ZHR A;  3ZHU A;  3U10 A;  4U7O A;  1OCC B;  5IYB O;  4JV5 B;  1NR1 A;  2GBO A;  2E5L B;  1WAZ A;  4D7S A;  3DXR B;  4N21 A;  4FLV A;  4JGS A;  3VQW A;  4JI6 O;  4UV9 A;  3AG3 B;  2F4V B;  2E75 B;  2YI9 A;  5FPR A;  3CWB H;  5KA5 A;  4G27 B;  4NKG B;  3LSQ A;  3MHH C;  1JMK C;  4X65 B;  5LL6 Y;  4PDM A;  1V55 B;  2QKS A;  5FLX N;  2IJJ A;  4IYH A;  3JCU Z;  3FAV B;  3O65 A;  2DW4 A;  4YY3 B;  4JI4 O;  2IJI A;  3WB1 A;  4JYB A;  2CE4 A;  2DE0 X;  3DGE A;  3SJQ C;  1EN6 A;  3K9A A;  1Q8I A;  5IY5 B;  4J41 A;  4PI0 A;  4E4E A;  4GKJ O;  3SYQ A;  3LNN A;  2RNB A;  4LF8 O;  3G80 A;  2ETN A;  3K5M A;  3H1K H;  2XHB A;  4CH3 A;  4UV8 A;  2M6Y A;  4YIO A;  1QNM A;  2IM9 A;  4KUM A;  1NI8 A;  2VQF O;  1VF6 A;  3B2E E;  1YJW V;  3ZN0 A;  3ASN B;  4DR1 B;  3VBB A;  3UM7 A;  2D3O W;  1FJG B;  2GUZ A;  1UJW B;  1YXB A;  4DR4 O;  4J9Z B;  2FL4 A;  4DV6 O;  1KB9 F;  3J80 N;  4XDJ A;  5KUK A;  2OCH A;  4J7J A;  2PI5 A;  2YIA A;  1YDX A;  4DV2 O;  2UXD O;  4PDR A;  1NR7 A;  4RWU A;  1TAE A;  4MVR A;  4DO2 A; 
#chains in the Genus database with same CATH homology
 2DN9 A;  2PF4 E;  2GUZ A;  3UO3 A;  3UO2 A;  2EJ7 A;  1HDJ A;  2QWR B;  2QWP B;  3AG7 A;  1XBL A;  2DMX A;  2CUG A;  1WJZ A;  2CTQ A;  1FPO A;  2CTR A;  2QWN B;  2QWO B;  2CTW A;  2OCH A;  2QSA A;  2L6L A;  4J80 A;  3APO A;  1IUR A;  2KQX A;  3UCS C;  3APQ A;  1BQZ A;  2LGW A;  2M6Y A;  2CTP A;  1N4C A;  3BVO A;  4J7Z A;  1FAF A;  2YUA A;  2GUZ B;  1NZ6 A;  2LO1 A;  2N05 A;  2QWQ B;  2Y4T A;  2Y4U A;  1BQ0 A;  2YS8 A;  4IT5 A;  4RWU A;  2N04 A;  1GH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...