2CTRA

Solution structure of j-domain from human dnaj subfamily b menber 9
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
GSSGSSGSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily B member 9
publication title Solution structure of J-domain from human DnaJ subfamily B menber 9
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 17
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ctrA00
2CTPA 2YUAA 2Y4UA 2QSAA 1BQ0A 2QWOB 2PF4E 1GH6A 1NZ6A 2CUGA 1HDJA 2LO1A 2QWRB 2L6LA 2Y4TA 4J80A 4J7ZA 2CTRA 2DN9A 2KQXA 3APQA 2QWPB 2CTQA 2QWQB 3BVOA 2DMXA 2N04A 1FPOA 2N05A 2QWNB 2M6YA 1WJZA 3AG7A 3UO3A 2LGWA 4IT5A 1FAFA 1XBLA 2EJ7A 3APOA 2OCHA 3UO2A 3UCSC 1BQZA 4RWUA 2GUZB 2CTWA 1IURA 2YS8A 1N4CA 2GUZA
chains in the Genus database with same CATH superfamily
4ZBMA 4I5SA 1L8DA 4IYHA 3P30A 3FD9A 3K5OA 4RUEA 2Q9LA 4JI0B 4JZ2A 1WA8B 2Z5UA 4DR3B 2EIKB 3QG5A 4DR4O 5IE9A 2UXBO 1B06A 5D5QA 3T1CA 1Y66A 2EIKC 5LGNA 2OTLV 1AR5A 1ZWIC 4F6RB 3ZEDA 2UUAB 4P9PA 1XQ8A 2Q4PA 2Y48A 3E8BA 1F51A 1Q5OA 3JSLA 3KCXA 4TV8A 5LBQA 1F23A 4F6EA 5LMNO 1R3IC 4B3TO 2PUSA 2HJFC 1N34O 4R8CA 4FLWA 2YIDA 4DV2O 5ITZB 3APOA 4JYCA 3ABLC 3K0GA 4QIWF 2GUZA 4XDJA 4JI7B 2HEPA 1ZLZA 1X59A 1H2GA 4QGPA 5GONB 3VBBA 4X8AA 1KP2A 2FMLA 5LP6B 2RQ6A 1SA0A 1K73W 4U7NA 3ZX6A 4FLXA 1GMGA 2EIMC 2W0XA 5LYJB 1YVWA 5LP6C 4TUYB 2WWWA 1XDCA 4JI1B 3CP1A 4CC6A 4B7KA 1XILA 1YF2A 5KA5A 4LFBB 1E79G 1H2SB 3GWOA 4O2AB 1S5LZ 4UB6Z 2VWKA 1VF6A 3HPLC 3CRRA 4H37A 1PKXA 1XUQA 3JAWB 2P4KA 5LGUA 4DR2O 4KP4A 1HNZO 2UXXA 3RYFA 4I0XB 2F66C 4GCZA 1HNXO 1DF4A 4D6TH 1YTFD 2BE3A 1IURA 3K9SA 3A0HZ 2QTSA 3K03A 2DE0X 4RQFA 1NQTA 2XUMA 3F5WC 2DMXA 5IDJA 3ZHRA 2QR4A 1KMIZ 5CA0B 1VEWA 1R1BA 1XREA 4YJ3A 3IC7A 3SYPA 2GBOA 1GN3A 1NZ6A 3W7SA 4FFBB 4YJ2A 3JARB 4FLUA 3A8TA 2IM9A 5GTIZ 3OTOO 3JALA 1SZXA 3G4SV 3AG4B 3T1HO 3K57A 2F93B 2E74B 3ICXA 4ZOLA 4KHPO 3AG4C 5BMVA 4JI3O 3D3IA 1DTOA 2F4VO 3UT5A 2JIZG 2PYLA 1HR0B 3C3SA 3SPGA 4LF9O 3LDEA 5L3FA 4WFAV 2FKXA 3W7UA 4ZHQB 2H3OA 3SPJA 2UUCO 1VARA 4FJCC 5CB4A 3BA8A 4UV9A 2HP8A 2EZPA 4X9QA 2Q5ZA 2A3QA 1CPYA 2Q68A 3MHHC 4LC1A 1B6QA 4O2BA 5EZYA 4ZI7B 4EFBA 2V1DA 2QTOA 5FPOA 3VOUA 1R6NA 1IBLB 3FB8C 5LMUO 4JYAB 1NU1H 4PA9A 3MD0A 2H8PC 4PELA 3TK1A 4LF5O 2R70A 4IIJB 2HG5C 4DV1O 2BSKB 3ETDA 2LFRA 4ZIBA 4X88A 2VQFB 5B1BC 2C2AA 2ZXWB 1Y76A 5FNVB 1SS3A 2JS3A 2YIBA 4B3MO 1AJPA 2ZXWC 2ADQB 4K0KB 2UXDO 4HYOA 4BIOA 4DV0B 2F23A 5C8YB 3UCSC 3ASNB 4DV3O 2GTSA 3K0DA 4OX9O 3FB5C 3RYHB 1IX9A 1Q7YW 4YHHO 3ASNC 4LH7A 3K79A 1GM8A 4O4LB 1BSMA 3B8NA 3DTUB 2NLJC 2WPDG 1KBHA 4P30A 3VQYA 4LFAB 1S72V 3AG2B 2EILB 1NBMG 1RP3B 1GO3F 3EFFK 1M93A 4X62B 2Y4TA 5A9GA 2EILC 1K92A 3BA9A 1P84F 1ZTEA 1ENVA 3M99B 1XL4A 2IU3A 2UU9B 5B5EZ 2N05A 3CS5A 1YJ9V 5B3SB 2RNBA 4FLZA 5IYDO 5JQGB 2XAFA 2BTQB 1JOYA 4FIPC 1YI2V 3TXSA 4LF8B 4NYKA 4JAUA 4DR1B 4YY3B 1PNKA 3STLC 2VWJA 2XOKG 4I4TB 4JI8O 4B7EA 1OCCC 1FXKB 1OCZC 2QDOA 4JI2O 1NKDA 5JCOC 1WA8A 2W6IG 1O9HA 1QCEA 1HWYA 1MSDA 1FXKC 3WB1A 2HVKC 1BMFG 1XHZA 4I50B 4MVUA 1OCRB 1AVMA 1RSOB 4QJFB 4OGQB 4KL1A 4YIPA 1W2BU 1Y74A 2PI4A 4F6RA 4PA7A 4CS2A 1OCRC 3K58A 2ZE8A 3ZRSA 4NR1A 1N0JA 3HKBB 1WAZA 5ITZA 1WP7A 5LHIA 1E1RG 2RJZA 4DR4B 3AK1A 1NVPD 3T1YO 2Y4UA 3E86A 4XDLA 4TT3G 1FFTB 3BABA 3FKSG 5DEDA 3QO5A 2DOSA 4QPKA 5GONA 3RN4A 1BS3A 4CH4A 4JYYA 1K34A 3OFNG 5LP6A 3ABKB 5JVDB 4MVRA 4GLXA 1RM1B 5E79Z 5LYJA 2EX3A 3JSNA 1P7BA 3SJAC 2HKOA 3OUFA 1V55B 1K9MW 4DV2B 1URFA 2GV9A 1QNMA 1K97A 5CBHA 4O4HB 4O2AA 3QO7A 4WF9V 4CS4A 5KUKA 4GYCB 4DV4B 3FYIB 3JAWA 1M56C 2R9IA 1PNLA 1THZA 4I0XA 1YJNV 3SJBC 1RFYA 3ABUA 4GT1A 2VRZA 1NJIW 2ZINA 1XMQO 4LF7B 1T5EA 4DV6B 1Y6XA 3JYCA 3CCQV 1TUBB 4CH3A 3C3TA 1NTZH 2HHHO 1GN2A 1Z2GA 1I0HA 3I56V 1AI6A 3BEHA 1M57B 1FPOA 2BCCH 3QVNA 3P3NA 3G71V 5EK0A 4CH5A 2JGDB 3B8MA 5CA0A 4GX0A 4TQFA 4NTXA 3CC4V 3J80N 4CH6A 5CBGA 1N33O 4DV7B 3H1JH 5IWAO 1JVMA 2LP7A 5H6RA 1PL4A 3TGUH 2YXHA 2B5UA 4RAIA 1V54B 5IYZB 2E75B 1SETA 3JARA 3STZC 4B08A 3CCUV 4I7ZB 3OMAB 1V54C 2JK5C 3HKDB 5KHGA 4UVBA 4BIUA 1NI8A 4DR5B 3DGEA 1RPRA 4LNUB 2WSSG 1IBMO 4DV5O 3JD3A 3RGBA 2YC0A 4PA3A 2K1EA 2G38A 3UO3A 3BHPA 4KUMA 4MTFA 3OTOB 4FM0A 4PA4A 3FB6C 4ZHQA 2DYSB 5K1XA 2YSUB 3R66A 4EFEA 4JAVA 1D2DA 2R9RB 3B40A 2DYSC 1Z5VA 3CPWU 3O65A 2ZE6A 4JI4O 4ZI7A 3SR2C 3MDSA 3HKEB 3ZN1A 1FAFA 1Q3EA 3QF7A 2XAHA 1AI7A 4LF9B 1K5QA 3ZBHA 2JEXA 4WFHA 3O9OA 2QKAA 4IIJA 1TGOA 4NVPA 1R3JC 2BSKA 1Y67A 4RUFA 5BR8O 3ZRWB 4DK0A 3CCVV 5FNVA 2ZKOA 1AR4A 3OT7A 4U3JB 4UUJC 2JJ2G 1TAEA 1WJZA 4X65O 3H01A 1SQBH 1XBLA 4J42A 3UO2A 5KA6A 2P4VA 2IJKA 5C8YA 2JS5A 4NXMO 5LMUB 2Z0AA 4H33A 2VQEB 3RYHA 5J2UB 4MVMA 4J41A 2ZDIA 4GX5A 1Y4MA 3DSQA 2GHYA 4NTYA 3CWBH 2ILMA 4O4LA 5B1OA 1XNRO 3CJHB 4X1KA 3CX5F 1JCHA 3CMAV 1ROPA 1YIJV 3W7TA 4MSWC 2P22C 1VP7A 5JJJB 1P49A 4Q6GA 2PF4E 5CA3A 5EC2C 4DO2A 3CC2V 2CGOA 4OX9B 4DR7O 4GX1A 1IVSA 1WB8A 3ZIAG 1SERA 4KFMA 1U96A 5JQGA 3E2EA 2BTQA 4AQYB 1YITV 2F95B 1R73A 3WU2Z 1GN4A 1F4NA 4LF6O 4J7ZA 3ZJZA 4WFEA 1K4DC 2DW4A 5JCOA 4I4TA 1PL0A 2A7WA 5H2FZ 1FXKA 1XHXA 4OPHA 2WLLB 4UVAA 2IW5A 1BZKA 4Z2WA 4P9OA 4X1YB 1PV0A 2Y0PA 5EBLC 2OIEA 4I50A 3JATB 2GTAA 1RSOA 4JAAA 2N74A 5EC1C 3SDLA 1LNQA 3RWRD 1AR1B 1IZ3A 2QE7G 3ZRVA 4P2ZA 1VQNV 3K9AA 4D7TA 1ZX3A 3HKBA 4DUYO 2RMKB 4JI5O 3F5TA 1BT8A 1KYOF 2YI9A 1PNMA 1CXZB 2Q0OC 2JGUA 2OWOA 4MVQA 4YIOA 2X6BA 3FAVB 1HNWO 5IJ9B 2AHYA 3RYCA 2FYUH 5CMUA 3JASB 5JVDA 4X64B 4CZZA 2IH1C 2UUBO 2RDCA 2RCVA 4O4JB 4GKJO 4MTXA 5D5PA 4JV5O 1O9GA 1NR7A 5EBMC 4J7KA 1ZL8B 3IC9A 1Q6IA 1HDJA 4PJ0Z 4D7SA 1E1QG 1Q90D 4LH6A 1QQCA 4O4HA 4G27B 3AK3A 4J11A 1WPBA 2YDEA 3A0BZ 4G2KA 5DECA 3ZHVA 5KMGB 1S5HC 2UXCO 4JI6B 2CGNA 3TCUA 5HFMA 4RWUA 4NXNO 3OGIB 2CTWA 4X1IB 1S5JA 3J81N 4W4LA 3ZCCA 3JD2A 3SPCA 1H2LA 3HR0A 2JEUA 2JDIG 4UCVA 1TUBA 1Q81W 1J5EO 1VQ7V 2CDYA 2QWQB 1IBKO 1PM9A 2ZQMA 3SPIA 3IAYA 2QM7A 3RVZA 5L3DA 4OXSA 2QM4A 2JGDA 1OZ0A 4B3SB 1R6TA 2Q73A 3VQWA 1KUQA 2YI8A 3F7YC 1JR9A 1K8AW 5IYZA 1QR9A 2AGAA 4YXWG 4BW9A 4JTAB 3E22B 1YJWV 2FL4A 1Z5WA 1N32O 3HKDA 1XNQO 1BHBA 3GVMA 4DXWA 1AB3A 3CCMV 4RO2A 1QLNA 4FZ1A 4LNUA 4FLTA 3OEEG 4PDRA 5IWAB 2HFEC 2KQXA 3K5NA 4BWAA 1FJGB 5DN6G 3H1LH 3AG1B 5KHHA 3BFRA 1MNGA 1FYJA 3AK2A 3JCZA 3L9DA 4HNAB 2P7TC 4TQDA 5KUMA 3B4SA 2V4DA 3KKYA 4LWSB 1H8HG 1W0KG 1MZEA 5LOVB 3W7WA 4DV5B 3U0ZA 3FX7A 1BHAA 4L8JA 4DUZO 3HKEA 1NH2D 2LGQA 1L1FA 1I5YA 3B2EE 4LF4B 2ZIOA 1K3EA 1Q6UA 1K7DA 3DXRB 3E8GA 1AROP 1SQQH 2LFSA 3ABTA 3ZRWA 3BVOA 2ZDIC 2X6CA 4U3JA 3W7XA 4J9ZB 2CAZC 1S77D 1QVFU 2AW9A 5L3EA 1WPXA 1Q86W 2EINB 3PJSK 4JI0O 4AILC 3ZMUA 2AZ0A 2QGNA 5J2UA 4B3RB 4FPPA 4HZ3A 3AG2C 5FPRA 1U97A 3FYEB 5J9PC 4J9YB 2DN9A 2EINC 4R7CA 3K3WA 2MW2B 5GW7A 2Y69B 2E3CA 4EB6B 2YIBD 4LR3A 3CJHA 2ZNJA 1XEQA 3ZN0A 2Y69C 2UUAO 1VQKV 2WLJA 2EJRA 1SQVH 2ITDC 2E5LB 5B3SC 2LW1A 1EZJA 2WLMA 2E76B 2BOBC 3ZHTA 3KG2A 2IH3C 1AILA 4BR6A 4JTDB 1NTMH 4U7OA 1TA8A 1HP8A 2AHZA 2D3OW 3CD6V 2OIGA 4MVOA 5CN0A 1X4TA 2RN9A 2CTPA 2AZ2A 1ZAUA 3OR6C 2YEVB 2WA3A 3LDCA 4MTGA 5B1NA 1GH6A 4AI8A 3H9VA 2XAQA 1FFXB 2CE4A 2LO1A 3E89A 2M7WA 3IJ4A 3T2MA 1NR1A 1OHHG 4DW1A 4LFBO 1KQSU 5DM6V 4K8XA 2WLLA 2ZE5A 4OPAA 1SRYA 2FTKA 1Q8IA 4MT8A 5LGTA 2UXBB 2OTJV 3NXSA 4X1YA 1JMKC 2X0LA 3D3QA 1JA8A 3JATA 2MK3A 3EVKA 5EIBC 1G6UA 1FXHA 4FM1A 3OR7C 5E1AC 1R3KC 1W0JG 1GRJA 3RBZA 4TUYA 3ABKC 1MZFA 1RM1C 5LMNB 4B3TB 4GZRB 3SYOA 1N34B 1PD3A 4PV1B 4DW0A 3E35A 1JFFB 1XMOO 1V55C 1D5AA 3M7MX 1SESA 3B09A 3FAVA 5IJ9A 1I5XA 3Q4HB 2Y0IA 3H1KH 3JASA 2WAMA 2QWNB 3ETGA 2ZD9A 4TV9B 3QNEA 5FLXN 4UCTA 4BIZA 4GKKO 4O4JA 1OCOB 3TXQA 2IJJA 4JTCB 4JI5B 2WLNA 3LNMB 3LUTB 1K33A 3C90A 3RYIB 1OCOC 1EN4A 3L70H 2OT5A 2Q7EA 1NS1A 3LDDA 1SQXH 2F43G 4ABMA 1QLEB 2LGWA 3CRMA 3KCYA 4MTOA 2ZR2A 4HBNA 4JZGA 3T4DA 3NR7A 5BXZA 1I94O 4TOIA 1M57C 2JRIA 1QLEC 3IFXA 4DR2B 1HR0O 1HNZB 4X1IA 2UUBB 5KHIA 3L75H 2CUGA 4GKJB 1HNXB 5TISZ 1K5SA 4FFBA 1HW7A 1SZTA 4UVCA 1WP8A 1MABG 5LHHA 3OM3B 3UQ8A 1EN6A 1VF5B 2X6AA 2EBOA 4MW8A 5AG2A 1VQ9V 1I7FA 2Q0AA 3AEIA 3OMIB 3UT5B 4N23A 4R6ZA 4JF3A 3CEIA 1QR8A 1COWG 2R9AA 3E83A 2UXCB 1S76D 2EZOA 1M5IA 1P7GA 1IBLO 4WBNB 4TSFG 4E2LA 3L74H 4JYAO 2O57A 2XNDG 4UCOA 3ZHQA 2DYRB 3E22A 3RT3C 1WNSA 1MOFA 2AXTZ 2ZIMA 3ETEA 1PP9H 1VQOV 4PDLA 3CCEV 2VQFO 3OMNB 1KECA 2DYRC 3EHBB 3T1HB 2B1IA 1SF9A 4KHPB 1ZUQA 4GUNA 4JASA 2L6LA 5LA6B 4JI3B 4K0KO 2ITCC 4MS2A 3HKCB 3G6EV 1Q82W 2F4VB 4PI0A 1Q43A 1WLEA 1UJWB 3I5DA 5K1PA 3IGAC 4PDVA 4LFCO 4MW3A 1N32B 4HNAA 2BTOA 2UUCB 4KXRA 5CA1B 3CYOA 4LWSA 3U10A 4FMTA 3H1HH 2CTRA 2CH7B 3ZS8C 1M9NA 4K8ZA 2DQ0A 2KSDA 5KX5B 5J2TB 1BCCH 5KHJA 3EXAA 3OTFA 5A2QN 2A79B 5JH7B 3G67A 1GTOA 3K04A 4O4IB 4PHZA 2UU9O 4LF5B 5BZBA 3DXRA 3FB7C 3JCUZ 4DV1B 2K9PA 4ZKIA 3CRCA 3GWKC 5IJ0B 3WG7B 2R72A 4XBFA 1BGYH 1WN7A 4LF8O 3BY6A 2V7QG 1FD9A 3ZMVA 3WG7C 4B3MB 4DR1O 4UCUA 5BY1A 2QJ1A 4DYLA 2UXDB 3KZIZ 3CE2A 1H38A 3DC6A 2Q67A 2QWRB 1G8MA 4UB8Z 4DV3B 2YXYA 4YHHB 1GAXA 4QNHB 3OW2U 1EBOA 3OD4A 2W6JG 2ZM6O 4EB6A 3THOA 3CXCU 2DWEC 4L87A 2ZCEA 3UM7A 3VQXA 5L3CA 3MHSC 2QEXV 2ZT9B 3BPZA 3UKMA 1RPOA 3SGIA 2A9HA 2CTQA 1VQLV 3SJCC 3CC7V 1KD1W 3TJTA 4I55B 4Q20A 4DR6O 4FVMA 2OCCB 2HR3A 3P32A 3CRAA 1AP6A 2QSAA 4NKGB 1PPJH 1Q6HA 2YEVA 1IXBA 1Y74B 2B1GA 1GM9A 2YICA 2OCCC 4J80A 1FFXA 3D36A 3WFVA 3RW0A 3N2KB 1AI5A 2EIJB 3ABLB 3I55V 3L73H 4JI8B 4LCUC 2EIJC 4IGGA 5B1AB 2UXNA 4JI2B 1KKDA 5LL6Y 3CB2A 2EIMB 5B1AC 2LQTA 5KLVH 4DV4O 5JJEB 1NTKH 4RQEA 1US6A 2L35A 2Q8VA 2QA4V 1EZVH 2PYJA 4WFBV 3CCLV 1H2MA 5JWPA 1YSCA 3AG7A 4IT5A 1JPXA 4LF7O 4DV6O 3LSQA 4IYIA 2PZSA 1IXMA 1OJHA 5IYCO 1J95A 2B9ZA 2KG7B 1JFFA 3LSUA 3N2GB 4WFFA 2NN4A 1TUEB 2QM8A 1YCIA 3T1YB 4CC5A 5EYPB 2ATKC 3Q4HA 3S3WA 1QHTA 4DV7O 3G80A 1DLBA 4TV9A 1FXVA 5L3BA 3J7AU 1LUWA 1YDXA 4C7UA 2YIAA 3A2FA 1KP3A 3RYIA 3JD4A 5IYBO 1XMOB 1L0NH 5EIBD 4W4KA 3E8FA 4DR5O 2VS0A 2ZR3A 2HLDG 1KKCA 3ZHUA 4Z1VA 1H2NA 1DGSA 4F4LA 3TETA 1M4UA 3K5MA 2YS8A 1A32A 3K08A 3A0RA 2XTAA 5H5NA 4G28B 1VQ4V 3JAKB 4GKKB 3T4ZA 2XASA 2XAGA 3X2QB 2A0LA 1XMQB 1QBZA 3K06A 5LXTB 3X2QC 2HHHB 3CCRV 1AI4A 3JD1A 3ZMZA 2NNUA 4QE7A 1D5NA 1ZSPA 1BQ0A 2ETNA 4PI2A 4LP8A 3HB3B 1I94B 1N33B 4XDKA 4WBNA 3AG3B 3ASOB 4FFKA 2HVJC 3M8AA 1W59A 3OEHG 2EJ7A 3AG3C 3ASOC 5B66Z 2IU0A 3AG1C 1ORQC 4X66O 1JQ0A 4QE9A 5LA6A 2WLIB 3CSXA 2XAJA 3L72H 3HKCA 2Q69A 4MVSA 1IBMB 1LUVA 3ZRXA 1N36O 3LNNA 4FK5C 2VQEO 4DRXB 2GDSA 3OUSA 4IHJB 1QU7A 2ADPA 5B1BB 1TVKB 4JYBA 5LHGA 2D2CB 3ETQA 2X7RB 5CA1A 4JGSA 1WB7A 1AJQA 2IBZH 2CH7A 1XI1A 1I08A 1VQ6V 1V9PA 2OCHA 4JI4B 4UCSA 5KX5A 5J2TA 4I9WA 1GN6A 2DJVA 4PA6A 5GTHZ 5JH7A 4LFCB 2JVDA 4O4IA 4DR3O 2HJDA 2LJ2A 2GSMB 2PTMA 3ABMB 1DF5A 3RVYA 2QWPB 4X1KB 4BAYA 4X20B 5IJ0A 5BR8B 5H6QA 3ABMC 5HFLA 4AQYO 1VQ5V 2P06A 3GB7C 2FB5A 1P4RA 4X65B 4HAMA 3JD0A 2Q6AA 2XT9A 4NTWA 4NXMB 5FL7G 3CHXA 5KAFZ 4DK1A 1IDSA 4UXNA 1SC5B 3BRCA 3ZMTA 4JI7O 2Z3YA 1EN5A 4WFGA 1F7YA 1XNRB 1YZBA 1KU9A 4UV8A 1OCCB 3PN1A 4J7JA 1OCZB 4NB5A 4AHCA 1CP9A 4TV8B 2OYQA 3QTCA 3MAQA 3ML0A 4Z1MG 4JI1O 1AP5A 1H2KA 1JX9A 1YTFB 4FLYA 3D36C 5IY5B 4ASUG 2XHBA 1GKFA 1G1XB 4I55A 4DR7B 2GUZB 2PGGA 5IY5C 2ZM6B 2P90A 1EM1A 3SJQC 1AJNA 3ZMSA 1SA0B 1UFIA 4X64O 2CK3G 1KC8W 2EULA 1VMGA 1BL8A 1MG1A 3CCJV 4UCRA 4PD4F 3N2KA 5JJNB 2P5OA 4LF6B 1KB9F 1QVGU 1OV9A 4LBEC 2ZNIA 3R65A 2ARHA 2DWDC 5KAIZ 2YXLA 2Q7GA 4DR6B 4A5UB 3RYCB 2KKWA 4E4EA 1YXBA 3H1IH 4ICGA 1EFRG 4JI6O 3P3PA 1DK1A 1VF6C 1N0NA 1XOUA 3CCSV 1UPGA 3RYFB 3SYQA 5C93A 5CBFA 4TWKA 2WA4A 4CS3A 1VQ8V 3SPHA 1CEZA 4CBCA 3FFQA 3WB0A 4DUYB 1R3LC 1JJOA 1ZL8A 2NR5A 2KG7A 4H0LB 1M1KW 3N2GA 2DQ3A 1M56B 3OAAG 4H44B 2N04A 1HNWB 1XL6A 5EYPA 1S0VA 4B3SO 3S3XA 4YJ3B 3CMEV 5KHKA 5KMGA 1K4CC 3N27A 2W0FC 2ZE7A 1VIBA 3VQVA 1H8EG 1R6KA 4YJ2B 1VQMV 3OGCC 3JALB 1NT2B 4JV5B 3SYAA 3APQA 4ZOLB 4J10A 1B04A 3L71H 4UFZA 5BMVB 1MA1A 3U11A 1FJGO 3G6BA 4NXNB 3JAKA 1NH2B 4H13B 3F7VC 4X89A 2Q7HA 2M6YA 3LSSA 5LXTA 1J5EB 5CB4B 5F2VO 1IBKB 1BQZA 2WLHA 3ZHSA 2WLKA 4O2BB 5EZYB 1S3JA 1YEWA 1B3QA 4FM2A 2JJ1G 1GM7A 4DV0O 2PI5A 4LF4O 4QPJA 1SQFA 1VF7A 1SKVA 1YHQV 1JJ2U 1LR1A 4EKWA 4K3AA 4I9QA 2QKCA 1N4CA 2YUAA 4R50A 1XNQB 1Y76B 1GK9A 3JAMN 4GX2A 4FLVA 3B77A 3OE7G 1MSWD 1MMMA 1F4MA 3WB2A 2WLIA 5EBWC 1SQGA 4LFAO 2KB1A 2IJIA 5LOVA 5IT9N 3E8HA 1L0LH 4DRXA 2BOCC 3SYCA 1VQPV 4X62O 3BCCH 4IHJA 4B3RO 1TVKA 5L3GA 3K5LA 2P6JA 4MVZA 2IJHA 4N21A 2P67A 4EEQA 3BAAA 4U3FH 1M90W 5H9CA 4IL6Z 4X66B 3DC5A 2E5LO 4K35A 2QKSA 4PDMA 4YY3O 1N36B 3RFRA 2F1MA 1FS0G 4WCEV 4DUZB 1FKAO 3D8CA 4FZ0A 2QWOB 3CRQA 1BE3H 2H94A 2A06H 3K59A 1N8RW 1G4YB 4BW5A 4JPRA 1SQPH 3CXHF 2PY5A 4X20A 2LW7A 2ODMA 1NVPB 3QO8A
chains in the Genus database with same CATH topology
2CTPA 2YUAA 2Y4UA 2QSAA 1BQ0A 2QWOB 2PF4E 1GH6A 1NZ6A 2CUGA 1HDJA 2LO1A 2QWRB 2L6LA 2Y4TA 4J80A 4J7ZA 2CTRA 2DN9A 2KQXA 3APQA 2QWPB 2CTQA 2QWQB 3BVOA 2DMXA 2N04A 1FPOA 2N05A 2QWNB 2M6YA 1WJZA 3AG7A 3UO3A 2LGWA 4IT5A 1FAFA 1XBLA 2EJ7A 3APOA 2OCHA 3UO2A 3UCSC 1BQZA 4RWUA 2GUZB 2CTWA 1IURA 2YS8A 1N4CA 2GUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTP A;  2YUA A;  2Y4U A;  2QSA A;  1BQ0 A;  2QWO B;  2PF4 E;  1GH6 A;  1NZ6 A;  2CUG A;  1HDJ A;  2LO1 A;  2QWR B;  2L6L A;  2Y4T A;  4J80 A;  4J7Z A;  2CTR A;  2DN9 A;  2KQX A;  3APQ A;  2QWP B;  2CTQ A;  2QWQ B;  3BVO A;  2DMX A;  2N04 A;  1FPO A;  2N05 A;  2QWN B;  2M6Y A;  1WJZ A;  3AG7 A;  3UO3 A;  2LGW A;  4IT5 A;  1FAF A;  1XBL A;  2EJ7 A;  3APO A;  2OCH A;  3UO2 A;  3UCS C;  1BQZ A;  4RWU A;  2GUZ B;  2CTW A;  1IUR A;  2YS8 A;  1N4C A;  2GUZ A; 
#chains in the Genus database with same CATH topology
 4ZBM A;  4I5S A;  1L8D A;  4IYH A;  3P30 A;  3FD9 A;  3K5O A;  4RUE A;  2Q9L A;  4JI0 B;  4JZ2 A;  1WA8 B;  2Z5U A;  4DR3 B;  2EIK B;  3QG5 A;  4DR4 O;  5IE9 A;  2UXB O;  1B06 A;  5D5Q A;  3T1C A;  1Y66 A;  2EIK C;  5LGN A;  2OTL V;  1AR5 A;  1ZWI C;  4F6R B;  3ZED A;  2UUA B;  4P9P A;  1XQ8 A;  2Q4P A;  2Y48 A;  3E8B A;  1F51 A;  1Q5O A;  3JSL A;  3KCX A;  4TV8 A;  5LBQ A;  1F23 A;  4F6E A;  5LMN O;  1R3I C;  4B3T O;  2PUS A;  2HJF C;  1N34 O;  4R8C A;  4FLW A;  2YID A;  4DV2 O;  5ITZ B;  3APO A;  4JYC A;  3ABL C;  3K0G A;  4QIW F;  2GUZ A;  4XDJ A;  4JI7 B;  2HEP A;  1ZLZ A;  1X59 A;  1H2G A;  4QGP A;  5GON B;  3VBB A;  4X8A A;  1KP2 A;  2FML A;  5LP6 B;  2RQ6 A;  1SA0 A;  1K73 W;  4U7N A;  3ZX6 A;  4FLX A;  1GMG A;  2EIM C;  2W0X A;  5LYJ B;  1YVW A;  5LP6 C;  4TUY B;  2WWW A;  1XDC A;  4JI1 B;  3CP1 A;  4CC6 A;  4B7K A;  1XIL A;  1YF2 A;  5KA5 A;  4LFB B;  1E79 G;  1H2S B;  3GWO A;  4O2A B;  1S5L Z;  4UB6 Z;  2VWK A;  1VF6 A;  3HPL C;  3CRR A;  4H37 A;  1PKX A;  1XUQ A;  3JAW B;  2P4K A;  5LGU A;  4DR2 O;  4KP4 A;  1HNZ O;  2UXX A;  3RYF A;  4I0X B;  2F66 C;  4GCZ A;  1HNX O;  1DF4 A;  4D6T H;  1YTF D;  2BE3 A;  1IUR A;  3K9S A;  3A0H Z;  2QTS A;  3K03 A;  2DE0 X;  4RQF A;  1NQT A;  2XUM A;  3F5W C;  2DMX A;  5IDJ A;  3ZHR A;  2QR4 A;  1KMI Z;  5CA0 B;  1VEW A;  1R1B A;  1XRE A;  4YJ3 A;  3IC7 A;  3SYP A;  2GBO A;  1GN3 A;  1NZ6 A;  3W7S A;  4FFB B;  4YJ2 A;  3JAR B;  4FLU A;  3A8T A;  2IM9 A;  5GTI Z;  3OTO O;  3JAL A;  1SZX A;  3G4S V;  3AG4 B;  3T1H O;  3K57 A;  2F93 B;  2E74 B;  3ICX A;  4ZOL A;  4KHP O;  3AG4 C;  5BMV A;  4JI3 O;  3D3I A;  1DTO A;  2F4V O;  3UT5 A;  2JIZ G;  2PYL A;  1HR0 B;  3C3S A;  3SPG A;  4LF9 O;  3LDE A;  5L3F A;  4WFA V;  2FKX A;  3W7U A;  4ZHQ B;  2H3O A;  3SPJ A;  2UUC O;  1VAR A;  4FJC C;  5CB4 A;  3BA8 A;  4UV9 A;  2HP8 A;  2EZP A;  4X9Q A;  2Q5Z A;  2A3Q A;  1CPY A;  2Q68 A;  3MHH C;  4LC1 A;  1B6Q A;  4O2B A;  5EZY A;  4ZI7 B;  4EFB A;  2V1D A;  2QTO A;  5FPO A;  3VOU A;  1R6N A;  1IBL B;  3FB8 C;  5LMU O;  4JYA B;  1NU1 H;  4PA9 A;  3MD0 A;  2H8P C;  4PEL A;  3TK1 A;  4LF5 O;  2R70 A;  4IIJ B;  2HG5 C;  4DV1 O;  2BSK B;  3ETD A;  2LFR A;  4ZIB A;  4X88 A;  2VQF B;  5B1B C;  2C2A A;  2ZXW B;  1Y76 A;  5FNV B;  1SS3 A;  2JS3 A;  2YIB A;  4B3M O;  1AJP A;  2ZXW C;  2ADQ B;  4K0K B;  2UXD O;  4HYO A;  4BIO A;  4DV0 B;  2F23 A;  5C8Y B;  3UCS C;  3ASN B;  4DV3 O;  2GTS A;  3K0D A;  4OX9 O;  3FB5 C;  3RYH B;  1IX9 A;  1Q7Y W;  4YHH O;  3ASN C;  4LH7 A;  3K79 A;  1GM8 A;  4O4L B;  1BSM A;  3B8N A;  3DTU B;  2NLJ C;  2WPD G;  1KBH A;  4P30 A;  3VQY A;  4LFA B;  1S72 V;  3AG2 B;  2EIL B;  1NBM G;  1RP3 B;  1GO3 F;  3EFF K;  1M93 A;  4X62 B;  2Y4T A;  5A9G A;  2EIL C;  1K92 A;  3BA9 A;  1P84 F;  1ZTE A;  1ENV A;  3M99 B;  1XL4 A;  2IU3 A;  2UU9 B;  5B5E Z;  2N05 A;  3CS5 A;  1YJ9 V;  5B3S B;  2RNB A;  4FLZ A;  5IYD O;  5JQG B;  2XAF A;  2BTQ B;  1JOY A;  4FIP C;  1YI2 V;  3TXS A;  4LF8 B;  4NYK A;  4JAU A;  4DR1 B;  4YY3 B;  1PNK A;  3STL C;  2VWJ A;  2XOK G;  4I4T B;  4JI8 O;  4B7E A;  1OCC C;  1FXK B;  1OCZ C;  2QDO A;  4JI2 O;  1NKD A;  5JCO C;  1WA8 A;  2W6I G;  1O9H A;  1QCE A;  1HWY A;  1MSD A;  1FXK C;  3WB1 A;  2HVK C;  1BMF G;  1XHZ A;  4I50 B;  4MVU A;  1OCR B;  1AVM A;  1RSO B;  4QJF B;  4OGQ B;  4KL1 A;  4YIP A;  1W2B U;  1Y74 A;  2PI4 A;  4F6R A;  4PA7 A;  4CS2 A;  1OCR C;  3K58 A;  2ZE8 A;  3ZRS A;  4NR1 A;  1N0J A;  3HKB B;  1WAZ A;  5ITZ A;  1WP7 A;  5LHI A;  1E1R G;  2RJZ A;  4DR4 B;  3AK1 A;  1NVP D;  3T1Y O;  2Y4U A;  3E86 A;  4XDL A;  4TT3 G;  1FFT B;  3BAB A;  3FKS G;  5DED A;  3QO5 A;  2DOS A;  4QPK A;  5GON A;  3RN4 A;  1BS3 A;  4CH4 A;  4JYY A;  1K34 A;  3OFN G;  5LP6 A;  3ABK B;  5JVD B;  4MVR A;  4GLX A;  1RM1 B;  5E79 Z;  5LYJ A;  2EX3 A;  3JSN A;  1P7B A;  3SJA C;  2HKO A;  3OUF A;  1V55 B;  1K9M W;  4DV2 B;  1URF A;  2GV9 A;  1QNM A;  1K97 A;  5CBH A;  4O4H B;  4O2A A;  3QO7 A;  4WF9 V;  4CS4 A;  5KUK A;  4GYC B;  4DV4 B;  3FYI B;  3JAW A;  1M56 C;  2R9I A;  1PNL A;  1THZ A;  4I0X A;  1YJN V;  3SJB C;  1RFY A;  3ABU A;  4GT1 A;  2VRZ A;  1NJI W;  2ZIN A;  1XMQ O;  4LF7 B;  1T5E A;  4DV6 B;  1Y6X A;  3JYC A;  3CCQ V;  1TUB B;  4CH3 A;  3C3T A;  1NTZ H;  2HHH O;  1GN2 A;  1Z2G A;  1I0H A;  3I56 V;  1AI6 A;  3BEH A;  1M57 B;  1FPO A;  2BCC H;  3QVN A;  3P3N A;  3G71 V;  5EK0 A;  4CH5 A;  2JGD B;  3B8M A;  5CA0 A;  4GX0 A;  4TQF A;  4NTX A;  3CC4 V;  3J80 N;  4CH6 A;  5CBG A;  1N33 O;  4DV7 B;  3H1J H;  5IWA O;  1JVM A;  2LP7 A;  5H6R A;  1PL4 A;  3TGU H;  2YXH A;  2B5U A;  4RAI A;  1V54 B;  5IYZ B;  2E75 B;  1SET A;  3JAR A;  3STZ C;  4B08 A;  3CCU V;  4I7Z B;  3OMA B;  1V54 C;  2JK5 C;  3HKD B;  5KHG A;  4UVB A;  4BIU A;  1NI8 A;  4DR5 B;  3DGE A;  1RPR A;  4LNU B;  2WSS G;  1IBM O;  4DV5 O;  3JD3 A;  3RGB A;  2YC0 A;  4PA3 A;  2K1E A;  2G38 A;  3UO3 A;  3BHP A;  4KUM A;  4MTF A;  3OTO B;  4FM0 A;  4PA4 A;  3FB6 C;  4ZHQ A;  2DYS B;  5K1X A;  2YSU B;  3R66 A;  4EFE A;  4JAV A;  1D2D A;  2R9R B;  3B40 A;  2DYS C;  1Z5V A;  3CPW U;  3O65 A;  2ZE6 A;  4JI4 O;  4ZI7 A;  3SR2 C;  3MDS A;  3HKE B;  3ZN1 A;  1FAF A;  1Q3E A;  3QF7 A;  2XAH A;  1AI7 A;  4LF9 B;  1K5Q A;  3ZBH A;  2JEX A;  4WFH A;  3O9O A;  2QKA A;  4IIJ A;  1TGO A;  4NVP A;  1R3J C;  2BSK A;  1Y67 A;  4RUF A;  5BR8 O;  3ZRW B;  4DK0 A;  3CCV V;  5FNV A;  2ZKO A;  1AR4 A;  3OT7 A;  4U3J B;  4UUJ C;  2JJ2 G;  1TAE A;  1WJZ A;  4X65 O;  3H01 A;  1SQB H;  1XBL A;  4J42 A;  3UO2 A;  5KA6 A;  2P4V A;  2IJK A;  5C8Y A;  2JS5 A;  4NXM O;  5LMU B;  2Z0A A;  4H33 A;  2VQE B;  3RYH A;  5J2U B;  4MVM A;  4J41 A;  2ZDI A;  4GX5 A;  1Y4M A;  3DSQ A;  2GHY A;  4NTY A;  3CWB H;  2ILM A;  4O4L A;  5B1O A;  1XNR O;  3CJH B;  4X1K A;  3CX5 F;  1JCH A;  3CMA V;  1ROP A;  1YIJ V;  3W7T A;  4MSW C;  2P22 C;  1VP7 A;  5JJJ B;  1P49 A;  4Q6G A;  2PF4 E;  5CA3 A;  5EC2 C;  4DO2 A;  3CC2 V;  2CGO A;  4OX9 B;  4DR7 O;  4GX1 A;  1IVS A;  1WB8 A;  3ZIA G;  1SER A;  4KFM A;  1U96 A;  5JQG A;  3E2E A;  2BTQ A;  4AQY B;  1YIT V;  2F95 B;  1R73 A;  3WU2 Z;  1GN4 A;  1F4N A;  4LF6 O;  4J7Z A;  3ZJZ A;  4WFE A;  1K4D C;  2DW4 A;  5JCO A;  4I4T A;  1PL0 A;  2A7W A;  5H2F Z;  1FXK A;  1XHX A;  4OPH A;  2WLL B;  4UVA A;  2IW5 A;  1BZK A;  4Z2W A;  4P9O A;  4X1Y B;  1PV0 A;  2Y0P A;  5EBL C;  2OIE A;  4I50 A;  3JAT B;  2GTA A;  1RSO A;  4JAA A;  2N74 A;  5EC1 C;  3SDL A;  1LNQ A;  3RWR D;  1AR1 B;  1IZ3 A;  2QE7 G;  3ZRV A;  4P2Z A;  1VQN V;  3K9A A;  4D7T A;  1ZX3 A;  3HKB A;  4DUY O;  2RMK B;  4JI5 O;  3F5T A;  1BT8 A;  1KYO F;  2YI9 A;  1PNM A;  1CXZ B;  2Q0O C;  2JGU A;  2OWO A;  4MVQ A;  4YIO A;  2X6B A;  3FAV B;  1HNW O;  5IJ9 B;  2AHY A;  3RYC A;  2FYU H;  5CMU A;  3JAS B;  5JVD A;  4X64 B;  4CZZ A;  2IH1 C;  2UUB O;  2RDC A;  2RCV A;  4O4J B;  4GKJ O;  4MTX A;  5D5P A;  4JV5 O;  1O9G A;  1NR7 A;  5EBM C;  4J7K A;  1ZL8 B;  3IC9 A;  1Q6I A;  1HDJ A;  4PJ0 Z;  4D7S A;  1E1Q G;  1Q90 D;  4LH6 A;  1QQC A;  4O4H A;  4G27 B;  3AK3 A;  4J11 A;  1WPB A;  2YDE A;  3A0B Z;  4G2K A;  5DEC A;  3ZHV A;  5KMG B;  1S5H C;  2UXC O;  4JI6 B;  2CGN A;  3TCU A;  5HFM A;  4RWU A;  4NXN O;  3OGI B;  2CTW A;  4X1I B;  1S5J A;  3J81 N;  4W4L A;  3ZCC A;  3JD2 A;  3SPC A;  1H2L A;  3HR0 A;  2JEU A;  2JDI G;  4UCV A;  1TUB A;  1Q81 W;  1J5E O;  1VQ7 V;  2CDY A;  2QWQ B;  1IBK O;  1PM9 A;  2ZQM A;  3SPI A;  3IAY A;  2QM7 A;  3RVZ A;  5L3D A;  4OXS A;  2QM4 A;  2JGD A;  1OZ0 A;  4B3S B;  1R6T A;  2Q73 A;  3VQW A;  1KUQ A;  2YI8 A;  3F7Y C;  1JR9 A;  1K8A W;  5IYZ A;  1QR9 A;  2AGA A;  4YXW G;  4BW9 A;  4JTA B;  3E22 B;  1YJW V;  2FL4 A;  1Z5W A;  1N32 O;  3HKD A;  1XNQ O;  1BHB A;  3GVM A;  4DXW A;  1AB3 A;  3CCM V;  4RO2 A;  1QLN A;  4FZ1 A;  4LNU A;  4FLT A;  3OEE G;  4PDR A;  5IWA B;  2HFE C;  2KQX A;  3K5N A;  4BWA A;  1FJG B;  5DN6 G;  3H1L H;  3AG1 B;  5KHH A;  3BFR A;  1MNG A;  1FYJ A;  3AK2 A;  3JCZ A;  3L9D A;  4HNA B;  2P7T C;  4TQD A;  5KUM A;  3B4S A;  2V4D A;  3KKY A;  4LWS B;  1H8H G;  1W0K G;  1MZE A;  5LOV B;  3W7W A;  4DV5 B;  3U0Z A;  3FX7 A;  1BHA A;  4L8J A;  4DUZ O;  3HKE A;  1NH2 D;  2LGQ A;  1L1F A;  1I5Y A;  3B2E E;  4LF4 B;  2ZIO A;  1K3E A;  1Q6U A;  1K7D A;  3DXR B;  3E8G A;  1ARO P;  1SQQ H;  2LFS A;  3ABT A;  3ZRW A;  3BVO A;  2ZDI C;  2X6C A;  4U3J A;  3W7X A;  4J9Z B;  2CAZ C;  1S77 D;  1QVF U;  2AW9 A;  5L3E A;  1WPX A;  1Q86 W;  2EIN B;  3PJS K;  4JI0 O;  4AIL C;  3ZMU A;  2AZ0 A;  2QGN A;  5J2U A;  4B3R B;  4FPP A;  4HZ3 A;  3AG2 C;  5FPR A;  1U97 A;  3FYE B;  5J9P C;  4J9Y B;  2DN9 A;  2EIN C;  4R7C A;  3K3W A;  2MW2 B;  5GW7 A;  2Y69 B;  2E3C A;  4EB6 B;  2YIB D;  4LR3 A;  3CJH A;  2ZNJ A;  1XEQ A;  3ZN0 A;  2Y69 C;  2UUA O;  1VQK V;  2WLJ A;  2EJR A;  1SQV H;  2ITD C;  2E5L B;  5B3S C;  2LW1 A;  1EZJ A;  2WLM A;  2E76 B;  2BOB C;  3ZHT A;  3KG2 A;  2IH3 C;  1AIL A;  4BR6 A;  4JTD B;  1NTM H;  4U7O A;  1TA8 A;  1HP8 A;  2AHZ A;  2D3O W;  3CD6 V;  2OIG A;  4MVO A;  5CN0 A;  1X4T A;  2RN9 A;  2CTP A;  2AZ2 A;  1ZAU A;  3OR6 C;  2YEV B;  2WA3 A;  3LDC A;  4MTG A;  5B1N A;  1GH6 A;  4AI8 A;  3H9V A;  2XAQ A;  1FFX B;  2CE4 A;  2LO1 A;  3E89 A;  2M7W A;  3IJ4 A;  3T2M A;  1NR1 A;  1OHH G;  4DW1 A;  4LFB O;  1KQS U;  5DM6 V;  4K8X A;  2WLL A;  2ZE5 A;  4OPA A;  1SRY A;  2FTK A;  1Q8I A;  4MT8 A;  5LGT A;  2UXB B;  2OTJ V;  3NXS A;  4X1Y A;  1JMK C;  2X0L A;  3D3Q A;  1JA8 A;  3JAT A;  2MK3 A;  3EVK A;  5EIB C;  1G6U A;  1FXH A;  4FM1 A;  3OR7 C;  5E1A C;  1R3K C;  1W0J G;  1GRJ A;  3RBZ A;  4TUY A;  3ABK C;  1MZF A;  1RM1 C;  5LMN B;  4B3T B;  4GZR B;  3SYO A;  1N34 B;  1PD3 A;  4PV1 B;  4DW0 A;  3E35 A;  1JFF B;  1XMO O;  1V55 C;  1D5A A;  3M7M X;  1SES A;  3B09 A;  3FAV A;  5IJ9 A;  1I5X A;  3Q4H B;  2Y0I A;  3H1K H;  3JAS A;  2WAM A;  2QWN B;  3ETG A;  2ZD9 A;  4TV9 B;  3QNE A;  5FLX N;  4UCT A;  4BIZ A;  4GKK O;  4O4J A;  1OCO B;  3TXQ A;  2IJJ A;  4JTC B;  4JI5 B;  2WLN A;  3LNM B;  3LUT B;  1K33 A;  3C90 A;  3RYI B;  1OCO C;  1EN4 A;  3L70 H;  2OT5 A;  2Q7E A;  1NS1 A;  3LDD A;  1SQX H;  2F43 G;  4ABM A;  1QLE B;  2LGW A;  3CRM A;  3KCY A;  4MTO A;  2ZR2 A;  4HBN A;  4JZG A;  3T4D A;  3NR7 A;  5BXZ A;  1I94 O;  4TOI A;  1M57 C;  2JRI A;  1QLE C;  3IFX A;  4DR2 B;  1HR0 O;  1HNZ B;  4X1I A;  2UUB B;  5KHI A;  3L75 H;  2CUG A;  4GKJ B;  1HNX B;  5TIS Z;  1K5S A;  4FFB A;  1HW7 A;  1SZT A;  4UVC A;  1WP8 A;  1MAB G;  5LHH A;  3OM3 B;  3UQ8 A;  1EN6 A;  1VF5 B;  2X6A A;  2EBO A;  4MW8 A;  5AG2 A;  1VQ9 V;  1I7F A;  2Q0A A;  3AEI A;  3OMI B;  3UT5 B;  4N23 A;  4R6Z A;  4JF3 A;  3CEI A;  1QR8 A;  1COW G;  2R9A A;  3E83 A;  2UXC B;  1S76 D;  2EZO A;  1M5I A;  1P7G A;  1IBL O;  4WBN B;  4TSF G;  4E2L A;  3L74 H;  4JYA O;  2O57 A;  2XND G;  4UCO A;  3ZHQ A;  2DYR B;  3E22 A;  3RT3 C;  1WNS A;  1MOF A;  2AXT Z;  2ZIM A;  3ETE A;  1PP9 H;  1VQO V;  4PDL A;  3CCE V;  2VQF O;  3OMN B;  1KEC A;  2DYR C;  3EHB B;  3T1H B;  2B1I A;  1SF9 A;  4KHP B;  1ZUQ A;  4GUN A;  4JAS A;  2L6L A;  5LA6 B;  4JI3 B;  4K0K O;  2ITC C;  4MS2 A;  3HKC B;  3G6E V;  1Q82 W;  2F4V B;  4PI0 A;  1Q43 A;  1WLE A;  1UJW B;  3I5D A;  5K1P A;  3IGA C;  4PDV A;  4LFC O;  4MW3 A;  1N32 B;  4HNA A;  2BTO A;  2UUC B;  4KXR A;  5CA1 B;  3CYO A;  4LWS A;  3U10 A;  4FMT A;  3H1H H;  2CTR A;  2CH7 B;  3ZS8 C;  1M9N A;  4K8Z A;  2DQ0 A;  2KSD A;  5KX5 B;  5J2T B;  1BCC H;  5KHJ A;  3EXA A;  3OTF A;  5A2Q N;  2A79 B;  5JH7 B;  3G67 A;  1GTO A;  3K04 A;  4O4I B;  4PHZ A;  2UU9 O;  4LF5 B;  5BZB A;  3DXR A;  3FB7 C;  3JCU Z;  4DV1 B;  2K9P A;  4ZKI A;  3CRC A;  3GWK C;  5IJ0 B;  3WG7 B;  2R72 A;  4XBF A;  1BGY H;  1WN7 A;  4LF8 O;  3BY6 A;  2V7Q G;  1FD9 A;  3ZMV A;  3WG7 C;  4B3M B;  4DR1 O;  4UCU A;  5BY1 A;  2QJ1 A;  4DYL A;  2UXD B;  3KZI Z;  3CE2 A;  1H38 A;  3DC6 A;  2Q67 A;  2QWR B;  1G8M A;  4UB8 Z;  4DV3 B;  2YXY A;  4YHH B;  1GAX A;  4QNH B;  3OW2 U;  1EBO A;  3OD4 A;  2W6J G;  2ZM6 O;  4EB6 A;  3THO A;  3CXC U;  2DWE C;  4L87 A;  2ZCE A;  3UM7 A;  3VQX A;  5L3C A;  3MHS C;  2QEX V;  2ZT9 B;  3BPZ A;  3UKM A;  1RPO A;  3SGI A;  2A9H A;  2CTQ A;  1VQL V;  3SJC C;  3CC7 V;  1KD1 W;  3TJT A;  4I55 B;  4Q20 A;  4DR6 O;  4FVM A;  2OCC B;  2HR3 A;  3P32 A;  3CRA A;  1AP6 A;  2QSA A;  4NKG B;  1PPJ H;  1Q6H A;  2YEV A;  1IXB A;  1Y74 B;  2B1G A;  1GM9 A;  2YIC A;  2OCC C;  4J80 A;  1FFX A;  3D36 A;  3WFV A;  3RW0 A;  3N2K B;  1AI5 A;  2EIJ B;  3ABL B;  3I55 V;  3L73 H;  4JI8 B;  4LCU C;  2EIJ C;  4IGG A;  5B1A B;  2UXN A;  4JI2 B;  1KKD A;  5LL6 Y;  3CB2 A;  2EIM B;  5B1A C;  2LQT A;  5KLV H;  4DV4 O;  5JJE B;  1NTK H;  4RQE A;  1US6 A;  2L35 A;  2Q8V A;  2QA4 V;  1EZV H;  2PYJ A;  4WFB V;  3CCL V;  1H2M A;  5JWP A;  1YSC A;  3AG7 A;  4IT5 A;  1JPX A;  4LF7 O;  4DV6 O;  3LSQ A;  4IYI A;  2PZS A;  1IXM A;  1OJH A;  5IYC O;  1J95 A;  2B9Z A;  2KG7 B;  1JFF A;  3LSU A;  3N2G B;  4WFF A;  2NN4 A;  1TUE B;  2QM8 A;  1YCI A;  3T1Y B;  4CC5 A;  5EYP B;  2ATK C;  3Q4H A;  3S3W A;  1QHT A;  4DV7 O;  3G80 A;  1DLB A;  4TV9 A;  1FXV A;  5L3B A;  3J7A U;  1LUW A;  1YDX A;  4C7U A;  2YIA A;  3A2F A;  1KP3 A;  3RYI A;  3JD4 A;  5IYB O;  1XMO B;  1L0N H;  5EIB D;  4W4K A;  3E8F A;  4DR5 O;  2VS0 A;  2ZR3 A;  2HLD G;  1KKC A;  3ZHU A;  4Z1V A;  1H2N A;  1DGS A;  4F4L A;  3TET A;  1M4U A;  3K5M A;  2YS8 A;  1A32 A;  3K08 A;  3A0R A;  2XTA A;  5H5N A;  4G28 B;  1VQ4 V;  3JAK B;  4GKK B;  3T4Z A;  2XAS A;  2XAG A;  3X2Q B;  2A0L A;  1XMQ B;  1QBZ A;  3K06 A;  5LXT B;  3X2Q C;  2HHH B;  3CCR V;  1AI4 A;  3JD1 A;  3ZMZ A;  2NNU A;  4QE7 A;  1D5N A;  1ZSP A;  1BQ0 A;  2ETN A;  4PI2 A;  4LP8 A;  3HB3 B;  1I94 B;  1N33 B;  4XDK A;  4WBN A;  3AG3 B;  3ASO B;  4FFK A;  2HVJ C;  3M8A A;  1W59 A;  3OEH G;  2EJ7 A;  3AG3 C;  3ASO C;  5B66 Z;  2IU0 A;  3AG1 C;  1ORQ C;  4X66 O;  1JQ0 A;  4QE9 A;  5LA6 A;  2WLI B;  3CSX A;  2XAJ A;  3L72 H;  3HKC A;  2Q69 A;  4MVS A;  1IBM B;  1LUV A;  3ZRX A;  1N36 O;  3LNN A;  4FK5 C;  2VQE O;  4DRX B;  2GDS A;  3OUS A;  4IHJ B;  1QU7 A;  2ADP A;  5B1B B;  1TVK B;  4JYB A;  5LHG A;  2D2C B;  3ETQ A;  2X7R B;  5CA1 A;  4JGS A;  1WB7 A;  1AJQ A;  2IBZ H;  2CH7 A;  1XI1 A;  1I08 A;  1VQ6 V;  1V9P A;  2OCH A;  4JI4 B;  4UCS A;  5KX5 A;  5J2T A;  4I9W A;  1GN6 A;  2DJV A;  4PA6 A;  5GTH Z;  5JH7 A;  4LFC B;  2JVD A;  4O4I A;  4DR3 O;  2HJD A;  2LJ2 A;  2GSM B;  2PTM A;  3ABM B;  1DF5 A;  3RVY A;  2QWP B;  4X1K B;  4BAY A;  4X20 B;  5IJ0 A;  5BR8 B;  5H6Q A;  3ABM C;  5HFL A;  4AQY O;  1VQ5 V;  2P06 A;  3GB7 C;  2FB5 A;  1P4R A;  4X65 B;  4HAM A;  3JD0 A;  2Q6A A;  2XT9 A;  4NTW A;  4NXM B;  5FL7 G;  3CHX A;  5KAF Z;  4DK1 A;  1IDS A;  4UXN A;  1SC5 B;  3BRC A;  3ZMT A;  4JI7 O;  2Z3Y A;  1EN5 A;  4WFG A;  1F7Y A;  1XNR B;  1YZB A;  1KU9 A;  4UV8 A;  1OCC B;  3PN1 A;  4J7J A;  1OCZ B;  4NB5 A;  4AHC A;  1CP9 A;  4TV8 B;  2OYQ A;  3QTC A;  3MAQ A;  3ML0 A;  4Z1M G;  4JI1 O;  1AP5 A;  1H2K A;  1JX9 A;  1YTF B;  4FLY A;  3D36 C;  5IY5 B;  4ASU G;  2XHB A;  1GKF A;  1G1X B;  4I55 A;  4DR7 B;  2GUZ B;  2PGG A;  5IY5 C;  2ZM6 B;  2P90 A;  1EM1 A;  3SJQ C;  1AJN A;  3ZMS A;  1SA0 B;  1UFI A;  4X64 O;  2CK3 G;  1KC8 W;  2EUL A;  1VMG A;  1BL8 A;  1MG1 A;  3CCJ V;  4UCR A;  4PD4 F;  3N2K A;  5JJN B;  2P5O A;  4LF6 B;  1KB9 F;  1QVG U;  1OV9 A;  4LBE C;  2ZNI A;  3R65 A;  2ARH A;  2DWD C;  5KAI Z;  2YXL A;  2Q7G A;  4DR6 B;  4A5U B;  3RYC B;  2KKW A;  4E4E A;  1YXB A;  3H1I H;  4ICG A;  1EFR G;  4JI6 O;  3P3P A;  1DK1 A;  1VF6 C;  1N0N A;  1XOU A;  3CCS V;  1UPG A;  3RYF B;  3SYQ A;  5C93 A;  5CBF A;  4TWK A;  2WA4 A;  4CS3 A;  1VQ8 V;  3SPH A;  1CEZ A;  4CBC A;  3FFQ A;  3WB0 A;  4DUY B;  1R3L C;  1JJO A;  1ZL8 A;  2NR5 A;  2KG7 A;  4H0L B;  1M1K W;  3N2G A;  2DQ3 A;  1M56 B;  3OAA G;  4H44 B;  2N04 A;  1HNW B;  1XL6 A;  5EYP A;  1S0V A;  4B3S O;  3S3X A;  4YJ3 B;  3CME V;  5KHK A;  5KMG A;  1K4C C;  3N27 A;  2W0F C;  2ZE7 A;  1VIB A;  3VQV A;  1H8E G;  1R6K A;  4YJ2 B;  1VQM V;  3OGC C;  3JAL B;  1NT2 B;  4JV5 B;  3SYA A;  3APQ A;  4ZOL B;  4J10 A;  1B04 A;  3L71 H;  4UFZ A;  5BMV B;  1MA1 A;  3U11 A;  1FJG O;  3G6B A;  4NXN B;  3JAK A;  1NH2 B;  4H13 B;  3F7V C;  4X89 A;  2Q7H A;  2M6Y A;  3LSS A;  5LXT A;  1J5E B;  5CB4 B;  5F2V O;  1IBK B;  1BQZ A;  2WLH A;  3ZHS A;  2WLK A;  4O2B B;  5EZY B;  1S3J A;  1YEW A;  1B3Q A;  4FM2 A;  2JJ1 G;  1GM7 A;  4DV0 O;  2PI5 A;  4LF4 O;  4QPJ A;  1SQF A;  1VF7 A;  1SKV A;  1YHQ V;  1JJ2 U;  1LR1 A;  4EKW A;  4K3A A;  4I9Q A;  2QKC A;  1N4C A;  2YUA A;  4R50 A;  1XNQ B;  1Y76 B;  1GK9 A;  3JAM N;  4GX2 A;  4FLV A;  3B77 A;  3OE7 G;  1MSW D;  1MMM A;  1F4M A;  3WB2 A;  2WLI A;  5EBW C;  1SQG A;  4LFA O;  2KB1 A;  2IJI A;  5LOV A;  5IT9 N;  3E8H A;  1L0L H;  4DRX A;  2BOC C;  3SYC A;  1VQP V;  4X62 O;  3BCC H;  4IHJ A;  4B3R O;  1TVK A;  5L3G A;  3K5L A;  2P6J A;  4MVZ A;  2IJH A;  4N21 A;  2P67 A;  4EEQ A;  3BAA A;  4U3F H;  1M90 W;  5H9C A;  4IL6 Z;  4X66 B;  3DC5 A;  2E5L O;  4K35 A;  2QKS A;  4PDM A;  4YY3 O;  1N36 B;  3RFR A;  2F1M A;  1FS0 G;  4WCE V;  4DUZ B;  1FKA O;  3D8C A;  4FZ0 A;  2QWO B;  3CRQ A;  1BE3 H;  2H94 A;  2A06 H;  3K59 A;  1N8R W;  1G4Y B;  4BW5 A;  4JPR A;  1SQP H;  3CXH F;  2PY5 A;  4X20 A;  2LW7 A;  2ODM A;  1NVP B;  3QO8 A; 
#chains in the Genus database with same CATH homology
 2CTP A;  2YUA A;  2Y4U A;  2QSA A;  1BQ0 A;  2QWO B;  2PF4 E;  1GH6 A;  1NZ6 A;  2CUG A;  1HDJ A;  2LO1 A;  2QWR B;  2L6L A;  2Y4T A;  4J80 A;  4J7Z A;  2CTR A;  2DN9 A;  2KQX A;  3APQ A;  2QWP B;  2CTQ A;  2QWQ B;  3BVO A;  2DMX A;  2N04 A;  1FPO A;  2N05 A;  2QWN B;  2M6Y A;  1WJZ A;  3AG7 A;  3UO3 A;  2LGW A;  4IT5 A;  1FAF A;  1XBL A;  2EJ7 A;  3APO A;  2OCH A;  3UO2 A;  3UCS C;  1BQZ A;  4RWU A;  2GUZ B;  2CTW A;  1IUR A;  2YS8 A;  1N4C A;  2GUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...