2CTRA

Solution structure of j-domain from human dnaj subfamily b menber 9
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
b'GSSGSSGSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily B member 9
publication title Solution structure of J-domain from human DnaJ subfamily B menber 9
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 17
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ctrA00
2QWPB 2GUZB 4J7ZA 4RWUA 2QSAA 2CTPA 2QWOB 1FPOA 3UO3A 1WJZA 1NZ6A 2OCHA 2Y4UA 3BVOA 1IURA 4IT5A 1BQZA 1BQ0A 2LO1A 2LGWA 2KQXA 1N4CA 2CTQA 2Y4TA 1GH6A 2CUGA 2M6YA 4J80A 2QWQB 1HDJA 3APOA 2N05A 2QWRB 2L6LA 2YUAA 2QWNB 3APQA 2PF4E 2CTWA 2DN9A 2DMXA 3UCSC 3AG7A 1FAFA 2N04A 1XBLA 2CTRA 2YS8A 3UO2A 2GUZA 2EJ7A
chains in the Genus database with same CATH superfamily
4JPRA 4NKGB 3SDLA 1ORQC 1NZ6A 3RGBA 3AG4C 3RYFA 1JX9A 4DV1O 5IDJA 3M99B 5LHHA 4O2AA 4DR3B 4WBNB 1VQMV 4CH6A 3WB0A 2E5LO 1AR4A 1ZTEA 3WB2A 1W59A 2VWJA 4NTXA 2Q6AA 4KL1A 1JFFA 3A0BZ 3IFXA 1F23A 1SQPH 3BEHA 4PD4F 5B1NA 2QEXV 4LFBO 3AK2A 2CTQA 3G67A 2F66C 1ZLZA 3R66A 4GCZA 1WB7A 4FLVA 3LSQA 2HLDG 4YIOA 1FXKC 2A3QA 3ZCCA 5JVDA 3HKDA 2PYLA 2BTQB 5FNVA 2ADPA 3SYQA 2Q8VA 1AP6A 4WF9V 2CTPA 4GKKO 3ETGA 3ETDA 3E22B 3ABUA 1Q6IA 3JATB 5KHKA 4FLXA 1F4NA 1N33B 4DV4O 2QWQB 2QTSA 4TWKA 1XHZA 4ZKIA 1FJGB 4O4IA 3GWKC 1GM7A 4DR1B 3D36C 1S76D 5IJ0A 2EILC 4IHJA 2OTJV 2ODMA 4DR6O 2ZDIA 1KECA 2QKCA 3ZRWA 1XI1A 2HHHO 4JYAO 2NR5A 1K34A 5DM6V 1FFTB 4PA7A 4J80A 3CSXA 3CC4V 4H33A 4WFGA 1IBLO 5KX5B 4N21A 3JD3A 3OUSA 2ZR3A 4LFAB 4RQFA 3G4SV 1HNZB 3E86A 2Q0AA 2YS8A 4I7ZB 3CRMA 1V54C 3AG4B 2H8PC 4FLWA 4BIOA 1SETA 5KHIA 2EINC 4K8XA 4D6TH 4N23A 1OCZC 5CBHA 1JVMA 4MVQA 3ZRVA 1GM9A 1NT2B 4TUYB 3G6BA 4JI4B 3ASNB 2YXLA 5IYDO 1OCOC 4X8AA 3VQVA 1AP5A 3OMAB 1DK1A 2W6IG 5LOVA 2UU9O 4I50A 1IBMB 1VQ8V 2VWKA 2EZOA 3JAWB 2UUCO 4DR4B 3RVYA 4TV9B 4HAMA 3UM7A 4X65B 1AR1B 1W0JG 2BSKA 3CRQA 2EBOA 1Y74A 3CMEV 5LGTA 4F4LA 3A0RA 1BCCH 4JZGA 1YSCA 1NJIW 2CGOA 5IYBO 4B7KA 3OEEG 2IU3A 4CS3A 3F7VC 4DR7O 4LH6A 3KCXA 1NVPB 4DV2B 4YXWG 5C8YB 2Y69C 2LFRA 3CXHF 2XASA 1PV0A 2DYSC 2RN9A 1IBKB 4O4JA 4J41A 3KKYA 1KD1W 2CK3G 2KKWA 2XTAA 3HKBB 4PA9A 5K1XA 1QR9A 1SQVH 2Q73A 2GDSA 4LH7A 2B1IA 1S72V 2ZXWC 2ZR2A 4ICGA 5HFLA 2EIKB 2YI8A 1K3EA 4UCUA 1MSWD 1FYJA 3UO3A 3GB7C 3ETEA 2PYJA 3E8GA 3KCYA 2V1DA 2IJIA 2EIMC 4MTOA 4JI5O 4DK0A 2QA4V 2BTOA 1R6KA 3F7YC 3CCUV 2UXCO 1YIJV 4GKJO 3CCLV 1ZL8B 4K8ZA 1K4DC 1QR8A 2YICA 1OJHA 2OCCB 1L1FA 3SPHA 2H94A 3FYIB 1N32O 2Y4UA 4EB6B 1IURA 1O9GA 1U97A 5EBMC 1YEWA 4P30A 4FM0A 3CRCA 4U3JA 5KAFZ 2Y48A 2ZQMA 4QIWF 5BR8O 3ZJZA 1LUWA 4LF4B 3C90A 4BAYA 4JI8B 3BFRA 2X0LA 5IYZB 3MAQA 1K5SA 2R9RB 4JYYA 4EFBA 4TV8B 1SERA 5LMUB 1TVKA 2CE4A 3Q4HA 1NTZH 1I0HA 1B3QA 3J7AU 2VQFB 1P7BA 1S0VA 2HR3A 3UO2A 1COWG 2OIGA 5DECA 4FZ0A 2IBZH 4HYOA 1JR9A 3E2EA 3CS5A 5BY1A 3U0ZA 2F23A 4X1KB 4JAUA 4MSWC 5KUMA 4LNUB 4E2LA 1NVPD 4UVBA 3SGIA 2CH7B 4J10A 4XDLA 2UXXA 4D7TA 2DQ3A 4CS4A 4F6RB 1GTOA 3OGCC 4LF8B 3H1HH 1GM8A 1BS3A 2E74B 4LF5B 3TCUA 3E8HA 4XBFA 5IY5B 1BZKA 1GKFA 1S5HC 4PHZA 3ABLC 2VQEB 5CBFA 3BPZA 1H38A 3B4SA 4JASA 2PY5A 4AQYB 3ZHQA 1KP3A 1BT8A 3L73H 3OFNG 3RT3C 5CA1B 3RVZA 3K5LA 1ENVA 1OV9A 5BXZA 1B04A 4HNAB 1WP7A 4H0LB 1TA8A 2HG5C 2KG7B 2RMKB 1BHAA 1ZWIC 5LP6C 2UXDO 3WFVA 1P84F 5H2FZ 1CPYA 3E8FA 5CBGA 1GN6A 4KXRA 1VIBA 3T1CA 2QDOA 1EN6A 1VF6A 1HNWO 4O4HB 4PA3A 4EFEA 3KZIZ 3LSSA 1R3JC 4Z2WA 1SRYA 2DE0X 3K0DA 4DRXA 2Q67A 4AILC 2FKXA 3H1IH 5D5PA 3K9AA 4TV8A 4LF9B 3RYIB 4LR3A 1I5XA 4B3MO 1W0KG 1OCCC 1CEZA 3AK3A 4P9PA 3B2EE 3THOA 4FZ1A 1Q6HA 5J2TB 4OXSA 4X64B 3CCSV 5KMGA 4NTWA 1AI7A 5H6QA 4K0KB 1BL8A 1AR5A 2W0FC 5LHIA 5LXTB 3TXSA 4CBCA 4IIJB 2YEVB 3DTUB 4O4LA 4DW1A 5ITZA 1XNQB 3HKEB 4IYHA 1B6QA 4I9QA 5K1PA 5KLVH 4MVZA 1LR1A 3BA8A 3CJHB 3ZHUA 1XUQA 1R1BA 1K5QA 1SA0B 2A06H 1DF5A 3TETA 2GUZB 1K33A 4EEQA 2JVDA 4YY3O 2P06A 1VQPV 4TQFA 1H2SB 4JI7B 4MTFA 2V7QG 1AI5A 2ZIMA 5EIBD 4LF7B 2Q0OC 4DR2B 3AG3C 3A8TA 4ZI7B 1HP8A 2Q9LA 4JYCA 2QKSA 2WLMA 5BMVA 3SJAC 2DYRC 3N27A 2P90A 4DV7O 2UUBO 3SPIA 4JAAA 3X2QB 5JJEB 4CC6A 2FYUH 1LNQA 4HNAA 3B40A 5HFMA 3RYFB 1WA8A 2KG7A 2P4VA 3ZMZA 3CPWU 3L71H 1XNRB 3U11A 4O2AB 4I4TA 3ZN0A 2XNDG 4FLZA 2DOSA 2JEUA 3AG2B 1GH6A 4B3SB 3OTFA 2QTOA 1JFFB 1OCCB 4PELA 4RUEA 1OHHG 5IJ9A 2YIAA 3ZRSA 4FM1A 4UUJC 3RW0A 5KUKA 4QPKA 1QVGU 1QU7A 4JI3B 3G80A 1TUEB 1Y67A 5GW7A 1VQ9V 4E4EA 4RQEA 4NXNB 5JVDB 4JTCB 5FNVB 3ZBHA 2XHBA 1Q82W 1NKDA 1X4TA 4X9QA 4G28B 5IWAB 5GONA 3K0GA 3M8AA 4PDRA 1M93A 4MVUA 1FS0G 2RCVA 4IT5A 2DQ0A 4JYBA 1SQQH 3ASOB 4JV5O 1K8AW 1VF7A 3OEHG 4JGSA 4DV6B 4CC5A 1IXMA 4TSFG 3LDCA 4O4IB 4I9WA 1BHBA 5IJ0B 4DYLA 4IHJB 3OE7G 2A7WA 5L3DA 1S77D 4ABMA 5JJJB 3ZRWB 1Z5WA 4JI4O 2JJ2G 5CB4B 2JK5C 3U10A 3S3XA 2YIBA 4HBNA 1P49A 1HR0O 3IAYA 1PP9H 5FPRA 3N2GA 4RWUA 3T2MA 1AVMA 5CMUA 2YIBD 1ZSPA 2ARHA 5FL7G 3F5WC 2UXBO 3BVOA 3ABMC 2KQXA 1RSOA 3B09A 1B06A 1QNMA 2WLLB 1DTOA 4DUZO 3UKMA 1Q90D 4X66B 2ZCEA 3OTOB 3D3IA 1KKDA 4D7SA 1YJ9V 2AW9A 1I5YA 3ZMVA 2E3CA 3ASNC 2F4VB 5LOVB 1PNLA 3K9SA 3CC7V 3B8NA 4J9ZB 4I50B 1E79G 4DR5O 1YITV 3P30A 1WPXA 5LBQA 1RM1B 2Q7GA 2EZPA 4G27B 2WWWA 1YXBA 3CYOA 3DXRA 2ZE6A 4OPHA 1EZVH 2BSKB 3OD4A 1Y74B 2D2CB 1GN4A 3H1LH 3PN1A 3OW2U 5A9GA 4RAIA 3T1YO 2WLKA 5EYPB 3K06A 3SYPA 2HEPA 4B3RB 2ZM6B 2YUAA 1HW7A 2W0XA 1VMGA 4I0XA 4B3TB 1XBLA 3HPLC 3AEIA 3NXSA 2WLNA 3GVMA 2HVKC 3LNNA 1MSDA 5H9CA 1K92A 1JQ0A 4O4JB 4JI2B 3SPJA 1H8HG 3ZN1A 1I94O 4W4KA 1NU1H 5CB4A 3L9DA 4C7UA 1U96A 1N36O 1SC5B 2LFSA 5JCOA 2UUAB 1VQNV 3BABA 3CP1A 3FB5C 5C93A 4JI6O 3ABMB 4NXMO 1WPBA 4XDJA 2DJVA 3UT5A 4FFBA 1JCHA 1N8RW 1AROP 1SKVA 2EIKC 1F4MA 3JALA 2WLLA 1W2BU 5LGUA 2MK3A 4LFCB 2DWDC 3JARA 4YJ2A 1WP8A 4UCSA 2QKAA 4I5SA 3ZX6A 4GLXA 3I5DA 1VQ5V 4OX9B 1XMOO 5H6RA 3ZMTA 1P4RA 2OCCC 2WLJA 3DC6A 1FXVA 3G71V 5IT9N 1XL6A 4FPPA 5JQGA 1EFRG 2Y0IA 4U3JB 1AI6A 1V55C 5FPOA 3P32A 2KB1A 3DSQA 4GX5A 2ADQB 3R65A 1Q86W 1PKXA 3SYAA 2F95B 1TVKB 1SQGA 1H2LA 3Q4HB 5EYPA 4PDMA 3ZMUA 5GTIZ 4DV1B 3CCJV 3ETQA 2VRZA 4LWSA 1KBHA 3HB3B 4U7OA 2EJ7A 2ZE5A 2E5LB 2VQEO 4AHCA 4F6EA 1H2MA 4Q6GA 3W7WA 2P7TC 4AQYO 4MVRA 3C3TA 4LFBB 2IH1C 4J7JA 1NTKH 2HJDA 1PPJH 3W7XA 1ZX3A 3VQYA 4Z1VA 2Q68A 1R6NA 2ETNA 1HWYA 1WN7A 4DUYO 3VQXA 2LGWA 1N0JA 5EIBC 5B3SB 4L87A 2WA3A 5IY5C 2PI4A 4KFMA 3H1KH 1VEWA 2JGDA 3RYHA 4DV4B 2Z3YA 5J2UA 4QE7A 1VQOV 4X1YA 1QBZA 2Q4PA 3E35A 1JJOA 1D2DA 3WU2Z 2XAFA 5J9PC 1HNXB 2AGAA 1GO3F 2WSSG 4UCTA 1XQ8A 4G2KA 4DR6B 4PI0A 1PNMA 2GBOA 2AZ0A 1V55B 4UVCA 1MZFA 4J7KA 2JS5A 2HHHB 4JYAB 2AZ2A 1IBLB 4P2ZA 3ABKB 2ZT9B 1OCRB 3OMNB 3I55V 3SPGA 2JS3A 2H3OA 3J81N 4DRXB 2EJRA 2FB5A 2GV9A 2IM9A 4LF6O 4UXNA 2ZKOA 1T5EA 3K08A 3FB8C 1FXHA 2ZE8A 2R72A 1VQ4V 5KMGB 3B8MA 3UQ8A 4LCUC 1YI2V 4YHHB 3BCCH 1AI4A 3L72H 4O4LB 5ITZB 3ZHTA 3K58A 4TQDA 3D36A 3MDSA 3OAAG 1YZBA 1GN2A 2UU9B 4KP4A 4R50A 4L8JA 1XOUA 4OGQB 2YDEA 3EFFK 1NR7A 1UJWB 5IE9A 1XNRO 1SF9A 1YDXA 2F1MA 1JMKC 1N4CA 1DF4A 1EM1A 4U7NA 1PL4A 2EIJB 1X59A 2ZNIA 4A5UB 3ML0A 4MVOA 1G1XB 5BMVB 3SJBC 1XMQO 1M56B 1MNGA 1N34O 3SJCC 4DR7B 2JIZG 4JI0B 4BW5A 3QO8A 1F7YA 4X62O 3SYCA 3X2QC 5JH7A 3HKCA 4TT3G 1XHXA 1WA8B 3CHXA 4I55B 3TK1A 4I4TB 4KHPO 4MVSA 3TJTA 3SR2C 4JI1B 4O2BA 2PGGA 4IYIA 4ASUG 3MHSC 3AG2C 1YTFD 3IC7A 5IJ9B 3CCRV 4K3AA 4PV1B 4GX1A 4H37A 3H01A 1I08A 1FFXB 1AJPA 3CX5F 3O9OA 4ZIBA 3VQWA 2KSDA 4JI5B 4WCEV 1JA8A 3WB1A 2UXCB 1TUBB 2GSMB 3L70H 1M1KW 1PM9A 4XDKA 5GONB 5EC2C 1KP2A 4GX0A 5LA6A 4X20A 3T1HB 1WLEA 1AB3A 5CA3A 2LW7A 3OUFA 3C3SA 1IDSA 1XL4A 4AI8A 4DV0O 2A79B 2RJZA 1N32B 4UCVA 1SS3A 1XEQA 3ASOC 2QGNA 2YIDA 2M7WA 3OR7C 1JOYA 2F93B 5BR8B 4MTXA 5LMNB 1Y76A 3OMIB 1MG1A 3KG2A 4DR3O 5LYJA 1BSMA 2ZDIC 3MD0A 1Q8IA 4NR1A 2JDIG 2Z0AA 3UCSC 2PTMA 2R70A 2YI9A 3N2GB 5B1BB 4QE9A 5LHGA 3H9VA 3FB7C 1G4YB 3S3WA 5GTHZ 3RYCA 4FLUA 2OCHA 3E89A 3EVKA 3SPCA 1KC8W 4JZ2A 1RSOB 3JCUZ 4I55A 4LP8A 2ZE7A 2D3OW 2DN9A 3H1JH 3JSNA 3JD1A 2LGQA 3TXQA 4Q20A 4QJFB 4NYKA 2B5UA 1SQXH 2QJ1A 3EHBB 4FLYA 1N33O 2ZINA 4BIZA 1J5EB 4B3RO 1M4UA 1FJGO 4DR1O 2PZSA 1K4CC 2IW5A 1FFXA 3T4DA 3QTCA 3ZMSA 4X88A 2BOCC 1US6A 4FJCC 2EULA 5CA0B 3DXRB 1RM1C 1TUBA 4BIUA 4JI2O 3CWBH 3K03A 3PJSK 5KAIZ 4WFAV 1M9NA 2XAJA 2XAGA 3ABTA 4PDLA 2P22C 3N2KA 4ZHQA 4LFAO 5EZYA 2E76B 1HNZO 3WG7B 2LP7A 3K04A 4OPAA 2OYQA 3QO7A 3IC9A 4I0XB 2UXNA 1YJNV 2OT5A 4FIPC 3JASA 5B5EZ 1Z5VA 1SZXA 1G6UA 3I56V 2BCCH 1HNWB 4LFCO 1IVSA 3JAKA 2YC0A 4NB5A 2GTAA 3LDDA 3APOA 1HDJA 1M5IA 3IJ4A 4Z1MG 4BR6A 2JRIA 4UVAA 4B3MB 4R8CA 3A0HZ 4FVMA 4J42A 4X1IA 2RQ6A 1NH2D 4YJ3B 1IBMO 3LSUA 4GYCB 3CD6V 3QNEA 1S5LZ 3UT5B 4GZRB 5B1AB 4DK1A 4IL6Z 5B66Z 4FFBB 4QGPA 4DR4O 3JALB 4IGGA 1R3LC 4UCRA 1QVFU 4X65O 1J95A 2IH3C 2AHZA 2A0LA 4FFKA 2JJ1G 3JARB 4YJ2B 4DV3B 1Q81W 2BE3A 1BGYH 2R9IA 3RFRA 2IJKA 1DLBA 1YF2A 2QWOB 4JTDB 1Y6XA 5LP6A 1Q6UA 1BQZA 5KHHA 2F43G 4YY3B 2N05A 4DV2O 1EBOA 5JQGB 3APQA 3SJQC 5CA0A 1MZEA 1IBKO 3LNMB 5L3GA 2PUSA 1H2GA 3LDEA 1AJQA 1EN4A 5B1OA 4WFEA 4DV7B 1BQ0A 1Y66A 2UUBB 5L3CA 1F51A 4EKWA 4MVMA 4CH3A 3RWRD 2QM4A 2HJFC 1JPXA 2QM7A 3OT7A 3QVNA 4CS2A 4LWSB 2IU0A 4J9YB 4ZBMA 3JSLA 3LUTB 3FAVA 1VF5B 1GMGA 3K79A 3FD9A 1QLEB 2DW4A 2QWRB 1BMFG 1XDCA 1HNXO 5IYCO 1FAFA 4YJ3A 4JAVA 3BHPA 4LC1A 4WFHA 2C2AA 1Y4MA 2LJ2A 5E1AC 1YVWA 3A2FA 3GWOA 3E83A 1M57B 2LO1A 2FTKA 1EZJA 3FX7A 2CUGA 2CDYA 1H2KA 4LF4O 3DC5A 4JI8O 4DV5B 5B3SC 2X7RB 1KB9F 2ZD9A 5JWPA 4JV5B 2JGDB 3RYHB 2P67A 5J2UB 4X1YB 5LMUO 1O9HA 5TISZ 3ICXA 2X6CA 1SZTA 1KU9A 2VQFO 5LL6Y 4WBNA 1P7GA 2RNBA 2XAQA 3D3QA 3EXAA 4J11A 4W4LA 1VQKV 3MHHC 1URFA 4YHHO 1Q3EA 3VBBA 2HP8A 3K5OA 1HR0B 1KQSU 1CXZB 1MABG 1RPRA 4DW0A 1ROPA 1L8DA 3ABKC 1OCRC 1VF6C 4PI2A 1FXKB 4LF8O 2YSUB 1JJ2U 1IX9A 2UXBB 4LF5O 3K57A 1KKCA 2BTQA 2N74A 4DUZB 3AG1C 2EX3A 1UPGA 3STLC 1D5NA 1Z2GA 4UFZA 3E22A 1H8EG 2YXHA 4H13B 3JYCA 1GRJA 3JATA 1AILA 1IZ3A 2EILB 3JD0A 3SYOA 1QLNA 4B08A 4DR5B 4ZOLB 1GAXA 4JI0O 1S5JA 5L3BA 2WPDG 3CCEV 2CTRA 4K35A 1CP9A 1DGSA 1ZUQA 1ZAUA 1Q5OA 4GT1A 4CH5A 4PA6A 2GHYA 2XAHA 3W7UA 5KHJA 3E8BA 3QG5A 4JI1O 4GUNA 1RPOA 5KX5A 4GKKB 4TOIA 1V54B 4JTAB 4YIPA 2NNUA 5EK0A 3T1YB 2WLIB 1XREA 3AG7A 1TAEA 2EIJC 2EINB 1L0LH 2QWPB 1TGOA 4LF9O 1OCZB 1SQFA 1LUVA 1M56C 3JCZA 2HKOA 5H5NA 4X64O 5JH7B 3HKCB 4CZZA 1OCOB 4K0KO 2ATKC 4TUYA 4LBEC 5D5QA 2ILMA 5A2QN 1YTFB 1D5AA 1I94B 3ZHSA 3T1HO 2N04A 1XNQO 4O2BB 3D8CA 1N36B 2PI5A 4MS2A 3DGEA 3T4ZA 2JEXA 1PL0A 3ZHVA 1WJZA 4X89A 4JI6B 3CB2A 4NXMB 1FXKA 4UV8A 2WAMA 4UCOA 1S3JA 4MW8A 3W7TA 3JAWA 3AG1B 1QQCA 1KYOF 2L35A 2OWOA 4FLTA 5LMNO 2CTWA 2GTSA 3VOUA 4TV9A 1QCEA 1E1QG 3ZHRA 3QO5A 4JI7O 3JD2A 5CN0A 2Q7EA 3RBZA 3CRRA 4LF7O 3BA9A 4X20B 5LA6B 3CXCU 4DR2O 1PD3A 1K7DA 5KA5A 4PDVA 2WA4A 1XMOB 1OZ0A 2Q7HA 4PJ0Z 1A32A 1XILA 3NR7A 2Y69B 3K5MA 1AJNA 4ZOLA 2YXYA 3CCQV 2DYSB 2HFEC 1G8MA 5C8YA 1IXBA 3FB6C 1THZA 1L0NH 2QSAA 2UUCB 1Y76B 2O57A 1FKAO 4R7CA 1RFYA 5LYJB 1WAZA 3HKBA 2ITCC 2ZXWB 4B3SO 2P6JA 2NN4A 3F5TA 3OM3B 2LW1A 2WLIA 1J5EO 2XOKG 2W6JG 2B1GA 1R73A 3RN4A 4U3FH 2V4DA 5KA6A 4JI3O 1WB8A 2EIMB 1R3KC 4RUFA 2XUMA 1H2NA 3CCMV 3RYCB 5B1BC 1EN5A 4PA4A 4NXNO 5KHGA 2RDCA 3BAAA 1GN3A 1ZL8A 3M7MX 5IWAO 4UV9A 4B7EA 3STZC 1VARA 1K73W 3J80N 3CE2A 2ZNJA 1FPOA 2DWEC 5JJNB 4EB6A 2QE7G 3K3WA 4DV6O 2BOBC 3QF7A 2G38A 4DUYB 2JGUA 2Z5UA 3O65A 2P5OA 3CC2V 3ZS8C 5IYZA 5FLXN 2HVJC 4GKJB 1R6TA 1R3IC 3K5NA 3N2KB 1NI8A 1QHTA 2E75B 4ZHQB 5EZYB 3IGAC 2XT9A 2Y0PA 3CRAA 3BY6A 3AK1A 3L75H 3P3PA 1SESA 4MTGA 2X6AA 3WG7C 1UFIA 4MW3A 4BWAA 3JASB 4J7ZA 1PNKA 1VQ7V 2CAZC 4X1KA 4QNHB 3CCVV 5DN6G 4H44B 3FKSG 4LNUA 1NH2B 4X66O 4DV3O 3OTOO 1NS1A 3JAKB 5BZBA 2CH7A 3B77A 2X6BA 2AHYA 2IJHA 4F6RA 2AXTZ 2F4VO 4X1IB 4LF6B 5AG2A 4DXWA 4MT8A 1FD9A 1K97A 3ABLB 1MA1A 1BE3H 4QPJA 5JCOC 2OTLV 4GX2A 5EBWC 4FMTA 4WFFA 5B1AC 2WLHA 5L3EA 2K9PA 3BRCA 4NTYA 3CEIA 2P4KA 1I7FA 5CA1A 5E79Z 4RO2A 2A9HA 3L74H 4JF3A 3K59A 5LP6B 1M90W 1YCIA 2ZM6O 2Y4TA 1KMIZ 2M6YA 4B3TO 1KUQA 4CH4A 2ITDC 2QWNB 1SQBH 2LQTA 4O4HA 5L3FA 1YJWV 1K9MW 1XMQB 3RYIA 1V9PA 1N34B 5EC1C 2MW2B 2UUAO 4NVPA 4FM2A 1YHQV 4X62B 5J2TA 2L6LA 4UB8Z 3W7SA 1NR1A 2FMLA 2PF4E 5LGNA 3HKDB 1VQLV 2NLJC 1N0NA 2B9ZA 5F2VO 1VP7A 3ZEDA 5LXTA 1NTMH 2UXDB 4IIJA 2YEVA 4KHPB 2CGNA 2OIEA 2QM8A 4KUMA 3P3NA 2FL4A 1NQTA 4DV5O 3HKEA 4DO2A 1GK9A 1MOFA 3FYEB 3FAVB 4P9OA 5DEDA 4R6ZA 1RP3B 1NBMG 3JAMN 2Q69A 3CJHA 2R9AA 2QR4A 2VS0A 4OX9O 3ZRXA 4HZ3A 3FFQA 1SA0A 4BW9A 3OGIB 1QLEC 3G6EV 2GUZA 5EBLC 1WNSA 3CMAV 4UB6Z 1MMMA 2ZIOA 3HR0A 3TGUH 2K1EA 3AG3B 4FK5C 2DYRB 3ZIAG 3JD4A 1M57C 1Q43A 4ZI7A 2IJJA 4WFBV 1VQ6V 2DMXA 1E1RG 4DV0B 1Q7YW 3OR6C 2Q5ZA
chains in the Genus database with same CATH topology
2QWPB 2GUZB 4J7ZA 4RWUA 2QSAA 2CTPA 2QWOB 1FPOA 3UO3A 1WJZA 1NZ6A 2OCHA 2Y4UA 3BVOA 1IURA 4IT5A 1BQZA 1BQ0A 2LO1A 2LGWA 2KQXA 1N4CA 2CTQA 2Y4TA 1GH6A 2CUGA 2M6YA 4J80A 2QWQB 1HDJA 3APOA 2N05A 2QWRB 2L6LA 2YUAA 2QWNB 3APQA 2PF4E 2CTWA 2DN9A 2DMXA 3UCSC 3AG7A 1FAFA 2N04A 1XBLA 2CTRA 2YS8A 3UO2A 2GUZA 2EJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWP B;  2GUZ B;  4J7Z A;  4RWU A;  2QSA A;  2CTP A;  2QWO B;  1FPO A;  3UO3 A;  1WJZ A;  1NZ6 A;  2OCH A;  2Y4U A;  3BVO A;  1IUR A;  4IT5 A;  1BQZ A;  1BQ0 A;  2LO1 A;  2LGW A;  2KQX A;  1N4C A;  2CTQ A;  2Y4T A;  1GH6 A;  2CUG A;  2M6Y A;  4J80 A;  2QWQ B;  1HDJ A;  3APO A;  2N05 A;  2QWR B;  2L6L A;  2YUA A;  2QWN B;  3APQ A;  2PF4 E;  2CTW A;  2DN9 A;  2DMX A;  3UCS C;  3AG7 A;  1FAF A;  2N04 A;  1XBL A;  2CTR A;  2YS8 A;  3UO2 A;  2GUZ A;  2EJ7 A; 
#chains in the Genus database with same CATH topology
 4JPR A;  4NKG B;  3SDL A;  1ORQ C;  1NZ6 A;  3RGB A;  3AG4 C;  3RYF A;  1JX9 A;  4DV1 O;  5IDJ A;  3M99 B;  5LHH A;  4O2A A;  4DR3 B;  4WBN B;  1VQM V;  4CH6 A;  3WB0 A;  2E5L O;  1AR4 A;  1ZTE A;  3WB2 A;  1W59 A;  2VWJ A;  4NTX A;  2Q6A A;  4KL1 A;  1JFF A;  3A0B Z;  3IFX A;  1F23 A;  1SQP H;  3BEH A;  4PD4 F;  5B1N A;  2QEX V;  4LFB O;  3AK2 A;  2CTQ A;  3G67 A;  2F66 C;  1ZLZ A;  3R66 A;  4GCZ A;  1WB7 A;  4FLV A;  3LSQ A;  2HLD G;  4YIO A;  1FXK C;  2A3Q A;  3ZCC A;  5JVD A;  3HKD A;  2PYL A;  2BTQ B;  5FNV A;  2ADP A;  3SYQ A;  2Q8V A;  1AP6 A;  4WF9 V;  2CTP A;  4GKK O;  3ETG A;  3ETD A;  3E22 B;  3ABU A;  1Q6I A;  3JAT B;  5KHK A;  4FLX A;  1F4N A;  1N33 B;  4DV4 O;  2QWQ B;  2QTS A;  4TWK A;  1XHZ A;  4ZKI A;  1FJG B;  4O4I A;  3GWK C;  1GM7 A;  4DR1 B;  3D36 C;  1S76 D;  5IJ0 A;  2EIL C;  4IHJ A;  2OTJ V;  2ODM A;  4DR6 O;  2ZDI A;  1KEC A;  2QKC A;  3ZRW A;  1XI1 A;  2HHH O;  4JYA O;  2NR5 A;  1K34 A;  5DM6 V;  1FFT B;  4PA7 A;  4J80 A;  3CSX A;  3CC4 V;  4H33 A;  4WFG A;  1IBL O;  5KX5 B;  4N21 A;  3JD3 A;  3OUS A;  2ZR3 A;  4LFA B;  4RQF A;  3G4S V;  1HNZ B;  3E86 A;  2Q0A A;  2YS8 A;  4I7Z B;  3CRM A;  1V54 C;  3AG4 B;  2H8P C;  4FLW A;  4BIO A;  1SET A;  5KHI A;  2EIN C;  4K8X A;  4D6T H;  4N23 A;  1OCZ C;  5CBH A;  1JVM A;  4MVQ A;  3ZRV A;  1GM9 A;  1NT2 B;  4TUY B;  3G6B A;  4JI4 B;  3ASN B;  2YXL A;  5IYD O;  1OCO C;  4X8A A;  3VQV A;  1AP5 A;  3OMA B;  1DK1 A;  2W6I G;  5LOV A;  2UU9 O;  4I50 A;  1IBM B;  1VQ8 V;  2VWK A;  2EZO A;  3JAW B;  2UUC O;  4DR4 B;  3RVY A;  4TV9 B;  4HAM A;  3UM7 A;  4X65 B;  1AR1 B;  1W0J G;  2BSK A;  3CRQ A;  2EBO A;  1Y74 A;  3CME V;  5LGT A;  4F4L A;  3A0R A;  1BCC H;  4JZG A;  1YSC A;  1NJI W;  2CGO A;  5IYB O;  4B7K A;  3OEE G;  2IU3 A;  4CS3 A;  3F7V C;  4DR7 O;  4LH6 A;  3KCX A;  1NVP B;  4DV2 B;  4YXW G;  5C8Y B;  2Y69 C;  2LFR A;  3CXH F;  2XAS A;  1PV0 A;  2DYS C;  2RN9 A;  1IBK B;  4O4J A;  4J41 A;  3KKY A;  1KD1 W;  2CK3 G;  2KKW A;  2XTA A;  3HKB B;  4PA9 A;  5K1X A;  1QR9 A;  1SQV H;  2Q73 A;  2GDS A;  4LH7 A;  2B1I A;  1S72 V;  2ZXW C;  2ZR2 A;  4ICG A;  5HFL A;  2EIK B;  2YI8 A;  1K3E A;  4UCU A;  1MSW D;  1FYJ A;  3UO3 A;  3GB7 C;  3ETE A;  2PYJ A;  3E8G A;  3KCY A;  2V1D A;  2IJI A;  2EIM C;  4MTO A;  4JI5 O;  4DK0 A;  2QA4 V;  2BTO A;  1R6K A;  3F7Y C;  3CCU V;  2UXC O;  1YIJ V;  4GKJ O;  3CCL V;  1ZL8 B;  4K8Z A;  1K4D C;  1QR8 A;  2YIC A;  1OJH A;  2OCC B;  1L1F A;  3SPH A;  2H94 A;  3FYI B;  1N32 O;  2Y4U A;  4EB6 B;  1IUR A;  1O9G A;  1U97 A;  5EBM C;  1YEW A;  4P30 A;  4FM0 A;  3CRC A;  4U3J A;  5KAF Z;  2Y48 A;  2ZQM A;  4QIW F;  5BR8 O;  3ZJZ A;  1LUW A;  4LF4 B;  3C90 A;  4BAY A;  4JI8 B;  3BFR A;  2X0L A;  5IYZ B;  3MAQ A;  1K5S A;  2R9R B;  4JYY A;  4EFB A;  4TV8 B;  1SER A;  5LMU B;  1TVK A;  2CE4 A;  3Q4H A;  1NTZ H;  1I0H A;  1B3Q A;  3J7A U;  2VQF B;  1P7B A;  1S0V A;  2HR3 A;  3UO2 A;  1COW G;  2OIG A;  5DEC A;  4FZ0 A;  2IBZ H;  4HYO A;  1JR9 A;  3E2E A;  3CS5 A;  5BY1 A;  3U0Z A;  2F23 A;  4X1K B;  4JAU A;  4MSW C;  5KUM A;  4LNU B;  4E2L A;  1NVP D;  4UVB A;  3SGI A;  2CH7 B;  4J10 A;  4XDL A;  2UXX A;  4D7T A;  2DQ3 A;  4CS4 A;  4F6R B;  1GTO A;  3OGC C;  4LF8 B;  3H1H H;  1GM8 A;  1BS3 A;  2E74 B;  4LF5 B;  3TCU A;  3E8H A;  4XBF A;  5IY5 B;  1BZK A;  1GKF A;  1S5H C;  4PHZ A;  3ABL C;  2VQE B;  5CBF A;  3BPZ A;  1H38 A;  3B4S A;  4JAS A;  2PY5 A;  4AQY B;  3ZHQ A;  1KP3 A;  1BT8 A;  3L73 H;  3OFN G;  3RT3 C;  5CA1 B;  3RVZ A;  3K5L A;  1ENV A;  1OV9 A;  5BXZ A;  1B04 A;  4HNA B;  1WP7 A;  4H0L B;  1TA8 A;  2HG5 C;  2KG7 B;  2RMK B;  1BHA A;  1ZWI C;  5LP6 C;  2UXD O;  3WFV A;  1P84 F;  5H2F Z;  1CPY A;  3E8F A;  5CBG A;  1GN6 A;  4KXR A;  1VIB A;  3T1C A;  2QDO A;  1EN6 A;  1VF6 A;  1HNW O;  4O4H B;  4PA3 A;  4EFE A;  3KZI Z;  3LSS A;  1R3J C;  4Z2W A;  1SRY A;  2DE0 X;  3K0D A;  4DRX A;  2Q67 A;  4AIL C;  2FKX A;  3H1I H;  5D5P A;  3K9A A;  4TV8 A;  4LF9 B;  3RYI B;  4LR3 A;  1I5X A;  4B3M O;  1W0K G;  1OCC C;  1CEZ A;  3AK3 A;  4P9P A;  3B2E E;  3THO A;  4FZ1 A;  1Q6H A;  5J2T B;  4OXS A;  4X64 B;  3CCS V;  5KMG A;  4NTW A;  1AI7 A;  5H6Q A;  4K0K B;  1BL8 A;  1AR5 A;  2W0F C;  5LHI A;  5LXT B;  3TXS A;  4CBC A;  4IIJ B;  2YEV B;  3DTU B;  4O4L A;  4DW1 A;  5ITZ A;  1XNQ B;  3HKE B;  4IYH A;  1B6Q A;  4I9Q A;  5K1P A;  5KLV H;  4MVZ A;  1LR1 A;  3BA8 A;  3CJH B;  3ZHU A;  1XUQ A;  1R1B A;  1K5Q A;  1SA0 B;  2A06 H;  1DF5 A;  3TET A;  2GUZ B;  1K33 A;  4EEQ A;  2JVD A;  4YY3 O;  2P06 A;  1VQP V;  4TQF A;  1H2S B;  4JI7 B;  4MTF A;  2V7Q G;  1AI5 A;  2ZIM A;  5EIB D;  4LF7 B;  2Q0O C;  4DR2 B;  3AG3 C;  3A8T A;  4ZI7 B;  1HP8 A;  2Q9L A;  4JYC A;  2QKS A;  2WLM A;  5BMV A;  3SJA C;  2DYR C;  3N27 A;  2P90 A;  4DV7 O;  2UUB O;  3SPI A;  4JAA A;  3X2Q B;  5JJE B;  4CC6 A;  2FYU H;  1LNQ A;  4HNA A;  3B40 A;  5HFM A;  3RYF B;  1WA8 A;  2KG7 A;  2P4V A;  3ZMZ A;  3CPW U;  3L71 H;  1XNR B;  3U11 A;  4O2A B;  4I4T A;  3ZN0 A;  2XND G;  4FLZ A;  2DOS A;  2JEU A;  3AG2 B;  1GH6 A;  4B3S B;  3OTF A;  2QTO A;  1JFF B;  1OCC B;  4PEL A;  4RUE A;  1OHH G;  5IJ9 A;  2YIA A;  3ZRS A;  4FM1 A;  4UUJ C;  3RW0 A;  5KUK A;  4QPK A;  1QVG U;  1QU7 A;  4JI3 B;  3G80 A;  1TUE B;  1Y67 A;  5GW7 A;  1VQ9 V;  4E4E A;  4RQE A;  4NXN B;  5JVD B;  4JTC B;  5FNV B;  3ZBH A;  2XHB A;  1Q82 W;  1NKD A;  1X4T A;  4X9Q A;  4G28 B;  5IWA B;  5GON A;  3K0G A;  3M8A A;  4PDR A;  1M93 A;  4MVU A;  1FS0 G;  2RCV A;  4IT5 A;  2DQ0 A;  4JYB A;  1SQQ H;  3ASO B;  4JV5 O;  1K8A W;  1VF7 A;  3OEH G;  4JGS A;  4DV6 B;  4CC5 A;  1IXM A;  4TSF G;  3LDC A;  4O4I B;  4I9W A;  1BHB A;  5IJ0 B;  4DYL A;  4IHJ B;  3OE7 G;  2A7W A;  5L3D A;  1S77 D;  4ABM A;  5JJJ B;  3ZRW B;  1Z5W A;  4JI4 O;  2JJ2 G;  5CB4 B;  2JK5 C;  3U10 A;  3S3X A;  2YIB A;  4HBN A;  1P49 A;  1HR0 O;  3IAY A;  1PP9 H;  5FPR A;  3N2G A;  4RWU A;  3T2M A;  1AVM A;  5CMU A;  2YIB D;  1ZSP A;  2ARH A;  5FL7 G;  3F5W C;  2UXB O;  3BVO A;  3ABM C;  2KQX A;  1RSO A;  3B09 A;  1B06 A;  1QNM A;  2WLL B;  1DTO A;  4DUZ O;  3UKM A;  1Q90 D;  4X66 B;  2ZCE A;  3OTO B;  3D3I A;  1KKD A;  4D7S A;  1YJ9 V;  2AW9 A;  1I5Y A;  3ZMV A;  2E3C A;  3ASN C;  2F4V B;  5LOV B;  1PNL A;  3K9S A;  3CC7 V;  3B8N A;  4J9Z B;  4I50 B;  1E79 G;  4DR5 O;  1YIT V;  3P30 A;  1WPX A;  5LBQ A;  1RM1 B;  2Q7G A;  2EZP A;  4G27 B;  2WWW A;  1YXB A;  3CYO A;  3DXR A;  2ZE6 A;  4OPH A;  1EZV H;  2BSK B;  3OD4 A;  1Y74 B;  2D2C B;  1GN4 A;  3H1L H;  3PN1 A;  3OW2 U;  5A9G A;  4RAI A;  3T1Y O;  2WLK A;  5EYP B;  3K06 A;  3SYP A;  2HEP A;  4B3R B;  2ZM6 B;  2YUA A;  1HW7 A;  2W0X A;  1VMG A;  4I0X A;  4B3T B;  1XBL A;  3HPL C;  3AEI A;  3NXS A;  2WLN A;  3GVM A;  2HVK C;  3LNN A;  1MSD A;  5H9C A;  1K92 A;  1JQ0 A;  4O4J B;  4JI2 B;  3SPJ A;  1H8H G;  3ZN1 A;  1I94 O;  4W4K A;  1NU1 H;  5CB4 A;  3L9D A;  4C7U A;  1U96 A;  1N36 O;  1SC5 B;  2LFS A;  5JCO A;  2UUA B;  1VQN V;  3BAB A;  3CP1 A;  3FB5 C;  5C93 A;  4JI6 O;  3ABM B;  4NXM O;  1WPB A;  4XDJ A;  2DJV A;  3UT5 A;  4FFB A;  1JCH A;  1N8R W;  1ARO P;  1SKV A;  2EIK C;  1F4M A;  3JAL A;  2WLL A;  1W2B U;  5LGU A;  2MK3 A;  4LFC B;  2DWD C;  3JAR A;  4YJ2 A;  1WP8 A;  4UCS A;  2QKA A;  4I5S A;  3ZX6 A;  4GLX A;  3I5D A;  1VQ5 V;  4OX9 B;  1XMO O;  5H6R A;  3ZMT A;  1P4R A;  2OCC C;  2WLJ A;  3DC6 A;  1FXV A;  3G71 V;  5IT9 N;  1XL6 A;  4FPP A;  5JQG A;  1EFR G;  2Y0I A;  4U3J B;  1AI6 A;  1V55 C;  5FPO A;  3P32 A;  2KB1 A;  3DSQ A;  4GX5 A;  2ADQ B;  3R65 A;  1Q86 W;  1PKX A;  3SYA A;  2F95 B;  1TVK B;  1SQG A;  1H2L A;  3Q4H B;  5EYP A;  4PDM A;  3ZMU A;  5GTI Z;  4DV1 B;  3CCJ V;  3ETQ A;  2VRZ A;  4LWS A;  1KBH A;  3HB3 B;  4U7O A;  2EJ7 A;  2ZE5 A;  2E5L B;  2VQE O;  4AHC A;  4F6E A;  1H2M A;  4Q6G A;  3W7W A;  2P7T C;  4AQY O;  4MVR A;  3C3T A;  4LFB B;  2IH1 C;  4J7J A;  1NTK H;  2HJD A;  1PPJ H;  3W7X A;  1ZX3 A;  3VQY A;  4Z1V A;  2Q68 A;  1R6N A;  2ETN A;  1HWY A;  1WN7 A;  4DUY O;  3VQX A;  2LGW A;  1N0J A;  5EIB C;  5B3S B;  4L87 A;  2WA3 A;  5IY5 C;  2PI4 A;  4KFM A;  3H1K H;  1VEW A;  2JGD A;  3RYH A;  4DV4 B;  2Z3Y A;  5J2U A;  4QE7 A;  1VQO V;  4X1Y A;  1QBZ A;  2Q4P A;  3E35 A;  1JJO A;  1D2D A;  3WU2 Z;  2XAF A;  5J9P C;  1HNX B;  2AGA A;  1GO3 F;  2WSS G;  4UCT A;  1XQ8 A;  4G2K A;  4DR6 B;  4PI0 A;  1PNM A;  2GBO A;  2AZ0 A;  1V55 B;  4UVC A;  1MZF A;  4J7K A;  2JS5 A;  2HHH B;  4JYA B;  2AZ2 A;  1IBL B;  4P2Z A;  3ABK B;  2ZT9 B;  1OCR B;  3OMN B;  3I55 V;  3SPG A;  2JS3 A;  2H3O A;  3J81 N;  4DRX B;  2EJR A;  2FB5 A;  2GV9 A;  2IM9 A;  4LF6 O;  4UXN A;  2ZKO A;  1T5E A;  3K08 A;  3FB8 C;  1FXH A;  2ZE8 A;  2R72 A;  1VQ4 V;  5KMG B;  3B8M A;  3UQ8 A;  4LCU C;  1YI2 V;  4YHH B;  3BCC H;  1AI4 A;  3L72 H;  4O4L B;  5ITZ B;  3ZHT A;  3K58 A;  4TQD A;  3D36 A;  3MDS A;  3OAA G;  1YZB A;  1GN2 A;  2UU9 B;  4KP4 A;  4R50 A;  4L8J A;  1XOU A;  4OGQ B;  2YDE A;  3EFF K;  1NR7 A;  1UJW B;  5IE9 A;  1XNR O;  1SF9 A;  1YDX A;  2F1M A;  1JMK C;  1N4C A;  1DF4 A;  1EM1 A;  4U7N A;  1PL4 A;  2EIJ B;  1X59 A;  2ZNI A;  4A5U B;  3ML0 A;  4MVO A;  1G1X B;  5BMV B;  3SJB C;  1XMQ O;  1M56 B;  1MNG A;  1N34 O;  3SJC C;  4DR7 B;  2JIZ G;  4JI0 B;  4BW5 A;  3QO8 A;  1F7Y A;  4X62 O;  3SYC A;  3X2Q C;  5JH7 A;  3HKC A;  4TT3 G;  1XHX A;  1WA8 B;  3CHX A;  4I55 B;  3TK1 A;  4I4T B;  4KHP O;  4MVS A;  3TJT A;  3SR2 C;  4JI1 B;  4O2B A;  2PGG A;  4IYI A;  4ASU G;  3MHS C;  3AG2 C;  1YTF D;  3IC7 A;  5IJ9 B;  3CCR V;  4K3A A;  4PV1 B;  4GX1 A;  4H37 A;  3H01 A;  1I08 A;  1FFX B;  1AJP A;  3CX5 F;  3O9O A;  4ZIB A;  3VQW A;  2KSD A;  4JI5 B;  4WCE V;  1JA8 A;  3WB1 A;  2UXC B;  1TUB B;  2GSM B;  3L70 H;  1M1K W;  1PM9 A;  4XDK A;  5GON B;  5EC2 C;  1KP2 A;  4GX0 A;  5LA6 A;  4X20 A;  3T1H B;  1WLE A;  1AB3 A;  5CA3 A;  2LW7 A;  3OUF A;  3C3S A;  1IDS A;  1XL4 A;  4AI8 A;  4DV0 O;  2A79 B;  2RJZ A;  1N32 B;  4UCV A;  1SS3 A;  1XEQ A;  3ASO C;  2QGN A;  2YID A;  2M7W A;  3OR7 C;  1JOY A;  2F93 B;  5BR8 B;  4MTX A;  5LMN B;  1Y76 A;  3OMI B;  1MG1 A;  3KG2 A;  4DR3 O;  5LYJ A;  1BSM A;  2ZDI C;  3MD0 A;  1Q8I A;  4NR1 A;  2JDI G;  2Z0A A;  3UCS C;  2PTM A;  2R70 A;  2YI9 A;  3N2G B;  5B1B B;  4QE9 A;  5LHG A;  3H9V A;  3FB7 C;  1G4Y B;  3S3W A;  5GTH Z;  3RYC A;  4FLU A;  2OCH A;  3E89 A;  3EVK A;  3SPC A;  1KC8 W;  4JZ2 A;  1RSO B;  3JCU Z;  4I55 A;  4LP8 A;  2ZE7 A;  2D3O W;  2DN9 A;  3H1J H;  3JSN A;  3JD1 A;  2LGQ A;  3TXQ A;  4Q20 A;  4QJF B;  4NYK A;  2B5U A;  1SQX H;  2QJ1 A;  3EHB B;  4FLY A;  1N33 O;  2ZIN A;  4BIZ A;  1J5E B;  4B3R O;  1M4U A;  1FJG O;  4DR1 O;  2PZS A;  1K4C C;  2IW5 A;  1FFX A;  3T4D A;  3QTC A;  3ZMS A;  4X88 A;  2BOC C;  1US6 A;  4FJC C;  2EUL A;  5CA0 B;  3DXR B;  1RM1 C;  1TUB A;  4BIU A;  4JI2 O;  3CWB H;  3K03 A;  3PJS K;  5KAI Z;  4WFA V;  1M9N A;  2XAJ A;  2XAG A;  3ABT A;  4PDL A;  2P22 C;  3N2K A;  4ZHQ A;  4LFA O;  5EZY A;  2E76 B;  1HNZ O;  3WG7 B;  2LP7 A;  3K04 A;  4OPA A;  2OYQ A;  3QO7 A;  3IC9 A;  4I0X B;  2UXN A;  1YJN V;  2OT5 A;  4FIP C;  3JAS A;  5B5E Z;  1Z5V A;  1SZX A;  1G6U A;  3I56 V;  2BCC H;  1HNW B;  4LFC O;  1IVS A;  3JAK A;  2YC0 A;  4NB5 A;  2GTA A;  3LDD A;  3APO A;  1HDJ A;  1M5I A;  3IJ4 A;  4Z1M G;  4BR6 A;  2JRI A;  4UVA A;  4B3M B;  4R8C A;  3A0H Z;  4FVM A;  4J42 A;  4X1I A;  2RQ6 A;  1NH2 D;  4YJ3 B;  1IBM O;  3LSU A;  4GYC B;  3CD6 V;  3QNE A;  1S5L Z;  3UT5 B;  4GZR B;  5B1A B;  4DK1 A;  4IL6 Z;  5B66 Z;  4FFB B;  4QGP A;  4DR4 O;  3JAL B;  4IGG A;  1R3L C;  4UCR A;  1QVF U;  4X65 O;  1J95 A;  2IH3 C;  2AHZ A;  2A0L A;  4FFK A;  2JJ1 G;  3JAR B;  4YJ2 B;  4DV3 B;  1Q81 W;  2BE3 A;  1BGY H;  2R9I A;  3RFR A;  2IJK A;  1DLB A;  1YF2 A;  2QWO B;  4JTD B;  1Y6X A;  5LP6 A;  1Q6U A;  1BQZ A;  5KHH A;  2F43 G;  4YY3 B;  2N05 A;  4DV2 O;  1EBO A;  5JQG B;  3APQ A;  3SJQ C;  5CA0 A;  1MZE A;  1IBK O;  3LNM B;  5L3G A;  2PUS A;  1H2G A;  3LDE A;  1AJQ A;  1EN4 A;  5B1O A;  4WFE A;  4DV7 B;  1BQ0 A;  1Y66 A;  2UUB B;  5L3C A;  1F51 A;  4EKW A;  4MVM A;  4CH3 A;  3RWR D;  2QM4 A;  2HJF C;  1JPX A;  2QM7 A;  3OT7 A;  3QVN A;  4CS2 A;  4LWS B;  2IU0 A;  4J9Y B;  4ZBM A;  3JSL A;  3LUT B;  3FAV A;  1VF5 B;  1GMG A;  3K79 A;  3FD9 A;  1QLE B;  2DW4 A;  2QWR B;  1BMF G;  1XDC A;  1HNX O;  5IYC O;  1FAF A;  4YJ3 A;  4JAV A;  3BHP A;  4LC1 A;  4WFH A;  2C2A A;  1Y4M A;  2LJ2 A;  5E1A C;  1YVW A;  3A2F A;  3GWO A;  3E83 A;  1M57 B;  2LO1 A;  2FTK A;  1EZJ A;  3FX7 A;  2CUG A;  2CDY A;  1H2K A;  4LF4 O;  3DC5 A;  4JI8 O;  4DV5 B;  5B3S C;  2X7R B;  1KB9 F;  2ZD9 A;  5JWP A;  4JV5 B;  2JGD B;  3RYH B;  2P67 A;  5J2U B;  4X1Y B;  5LMU O;  1O9H A;  5TIS Z;  3ICX A;  2X6C A;  1SZT A;  1KU9 A;  2VQF O;  5LL6 Y;  4WBN A;  1P7G A;  2RNB A;  2XAQ A;  3D3Q A;  3EXA A;  4J11 A;  4W4L A;  1VQK V;  3MHH C;  1URF A;  4YHH O;  1Q3E A;  3VBB A;  2HP8 A;  3K5O A;  1HR0 B;  1KQS U;  1CXZ B;  1MAB G;  1RPR A;  4DW0 A;  1ROP A;  1L8D A;  3ABK C;  1OCR C;  1VF6 C;  4PI2 A;  1FXK B;  4LF8 O;  2YSU B;  1JJ2 U;  1IX9 A;  2UXB B;  4LF5 O;  3K57 A;  1KKC A;  2BTQ A;  2N74 A;  4DUZ B;  3AG1 C;  2EX3 A;  1UPG A;  3STL C;  1D5N A;  1Z2G A;  4UFZ A;  3E22 A;  1H8E G;  2YXH A;  4H13 B;  3JYC A;  1GRJ A;  3JAT A;  1AIL A;  1IZ3 A;  2EIL B;  3JD0 A;  3SYO A;  1QLN A;  4B08 A;  4DR5 B;  4ZOL B;  1GAX A;  4JI0 O;  1S5J A;  5L3B A;  2WPD G;  3CCE V;  2CTR A;  4K35 A;  1CP9 A;  1DGS A;  1ZUQ A;  1ZAU A;  1Q5O A;  4GT1 A;  4CH5 A;  4PA6 A;  2GHY A;  2XAH A;  3W7U A;  5KHJ A;  3E8B A;  3QG5 A;  4JI1 O;  4GUN A;  1RPO A;  5KX5 A;  4GKK B;  4TOI A;  1V54 B;  4JTA B;  4YIP A;  2NNU A;  5EK0 A;  3T1Y B;  2WLI B;  1XRE A;  3AG7 A;  1TAE A;  2EIJ C;  2EIN B;  1L0L H;  2QWP B;  1TGO A;  4LF9 O;  1OCZ B;  1SQF A;  1LUV A;  1M56 C;  3JCZ A;  2HKO A;  5H5N A;  4X64 O;  5JH7 B;  3HKC B;  4CZZ A;  1OCO B;  4K0K O;  2ATK C;  4TUY A;  4LBE C;  5D5Q A;  2ILM A;  5A2Q N;  1YTF B;  1D5A A;  1I94 B;  3ZHS A;  3T1H O;  2N04 A;  1XNQ O;  4O2B B;  3D8C A;  1N36 B;  2PI5 A;  4MS2 A;  3DGE A;  3T4Z A;  2JEX A;  1PL0 A;  3ZHV A;  1WJZ A;  4X89 A;  4JI6 B;  3CB2 A;  4NXM B;  1FXK A;  4UV8 A;  2WAM A;  4UCO A;  1S3J A;  4MW8 A;  3W7T A;  3JAW A;  3AG1 B;  1QQC A;  1KYO F;  2L35 A;  2OWO A;  4FLT A;  5LMN O;  2CTW A;  2GTS A;  3VOU A;  4TV9 A;  1QCE A;  1E1Q G;  3ZHR A;  3QO5 A;  4JI7 O;  3JD2 A;  5CN0 A;  2Q7E A;  3RBZ A;  3CRR A;  4LF7 O;  3BA9 A;  4X20 B;  5LA6 B;  3CXC U;  4DR2 O;  1PD3 A;  1K7D A;  5KA5 A;  4PDV A;  2WA4 A;  1XMO B;  1OZ0 A;  2Q7H A;  4PJ0 Z;  1A32 A;  1XIL A;  3NR7 A;  2Y69 B;  3K5M A;  1AJN A;  4ZOL A;  2YXY A;  3CCQ V;  2DYS B;  2HFE C;  1G8M A;  5C8Y A;  1IXB A;  3FB6 C;  1THZ A;  1L0N H;  2QSA A;  2UUC B;  1Y76 B;  2O57 A;  1FKA O;  4R7C A;  1RFY A;  5LYJ B;  1WAZ A;  3HKB A;  2ITC C;  2ZXW B;  4B3S O;  2P6J A;  2NN4 A;  3F5T A;  3OM3 B;  2LW1 A;  2WLI A;  1J5E O;  2XOK G;  2W6J G;  2B1G A;  1R73 A;  3RN4 A;  4U3F H;  2V4D A;  5KA6 A;  4JI3 O;  1WB8 A;  2EIM B;  1R3K C;  4RUF A;  2XUM A;  1H2N A;  3CCM V;  3RYC B;  5B1B C;  1EN5 A;  4PA4 A;  4NXN O;  5KHG A;  2RDC A;  3BAA A;  1GN3 A;  1ZL8 A;  3M7M X;  5IWA O;  4UV9 A;  4B7E A;  3STZ C;  1VAR A;  1K73 W;  3J80 N;  3CE2 A;  2ZNJ A;  1FPO A;  2DWE C;  5JJN B;  4EB6 A;  2QE7 G;  3K3W A;  4DV6 O;  2BOB C;  3QF7 A;  2G38 A;  4DUY B;  2JGU A;  2Z5U A;  3O65 A;  2P5O A;  3CC2 V;  3ZS8 C;  5IYZ A;  5FLX N;  2HVJ C;  4GKJ B;  1R6T A;  1R3I C;  3K5N A;  3N2K B;  1NI8 A;  1QHT A;  2E75 B;  4ZHQ B;  5EZY B;  3IGA C;  2XT9 A;  2Y0P A;  3CRA A;  3BY6 A;  3AK1 A;  3L75 H;  3P3P A;  1SES A;  4MTG A;  2X6A A;  3WG7 C;  1UFI A;  4MW3 A;  4BWA A;  3JAS B;  4J7Z A;  1PNK A;  1VQ7 V;  2CAZ C;  4X1K A;  4QNH B;  3CCV V;  5DN6 G;  4H44 B;  3FKS G;  4LNU A;  1NH2 B;  4X66 O;  4DV3 O;  3OTO O;  1NS1 A;  3JAK B;  5BZB A;  2CH7 A;  3B77 A;  2X6B A;  2AHY A;  2IJH A;  4F6R A;  2AXT Z;  2F4V O;  4X1I B;  4LF6 B;  5AG2 A;  4DXW A;  4MT8 A;  1FD9 A;  1K97 A;  3ABL B;  1MA1 A;  1BE3 H;  4QPJ A;  5JCO C;  2OTL V;  4GX2 A;  5EBW C;  4FMT A;  4WFF A;  5B1A C;  2WLH A;  5L3E A;  2K9P A;  3BRC A;  4NTY A;  3CEI A;  2P4K A;  1I7F A;  5CA1 A;  5E79 Z;  4RO2 A;  2A9H A;  3L74 H;  4JF3 A;  3K59 A;  5LP6 B;  1M90 W;  1YCI A;  2ZM6 O;  2Y4T A;  1KMI Z;  2M6Y A;  4B3T O;  1KUQ A;  4CH4 A;  2ITD C;  2QWN B;  1SQB H;  2LQT A;  4O4H A;  5L3F A;  1YJW V;  1K9M W;  1XMQ B;  3RYI A;  1V9P A;  1N34 B;  5EC1 C;  2MW2 B;  2UUA O;  4NVP A;  4FM2 A;  1YHQ V;  4X62 B;  5J2T A;  2L6L A;  4UB8 Z;  3W7S A;  1NR1 A;  2FML A;  2PF4 E;  5LGN A;  3HKD B;  1VQL V;  2NLJ C;  1N0N A;  2B9Z A;  5F2V O;  1VP7 A;  3ZED A;  5LXT A;  1NTM H;  2UXD B;  4IIJ A;  2YEV A;  4KHP B;  2CGN A;  2OIE A;  2QM8 A;  4KUM A;  3P3N A;  2FL4 A;  1NQT A;  4DV5 O;  3HKE A;  4DO2 A;  1GK9 A;  1MOF A;  3FYE B;  3FAV B;  4P9O A;  5DED A;  4R6Z A;  1RP3 B;  1NBM G;  3JAM N;  2Q69 A;  3CJH A;  2R9A A;  2QR4 A;  2VS0 A;  4OX9 O;  3ZRX A;  4HZ3 A;  3FFQ A;  1SA0 A;  4BW9 A;  3OGI B;  1QLE C;  3G6E V;  2GUZ A;  5EBL C;  1WNS A;  3CMA V;  4UB6 Z;  1MMM A;  2ZIO A;  3HR0 A;  3TGU H;  2K1E A;  3AG3 B;  4FK5 C;  2DYR B;  3ZIA G;  3JD4 A;  1M57 C;  1Q43 A;  4ZI7 A;  2IJJ A;  4WFB V;  1VQ6 V;  2DMX A;  1E1R G;  4DV0 B;  1Q7Y W;  3OR6 C;  2Q5Z A; 
#chains in the Genus database with same CATH homology
 2QWP B;  2GUZ B;  4J7Z A;  4RWU A;  2QSA A;  2CTP A;  2QWO B;  1FPO A;  3UO3 A;  1WJZ A;  1NZ6 A;  2OCH A;  2Y4U A;  3BVO A;  1IUR A;  4IT5 A;  1BQZ A;  1BQ0 A;  2LO1 A;  2LGW A;  2KQX A;  1N4C A;  2CTQ A;  2Y4T A;  1GH6 A;  2CUG A;  2M6Y A;  4J80 A;  2QWQ B;  1HDJ A;  3APO A;  2N05 A;  2QWR B;  2L6L A;  2YUA A;  2QWN B;  3APQ A;  2PF4 E;  2CTW A;  2DN9 A;  2DMX A;  3UCS C;  3AG7 A;  1FAF A;  2N04 A;  1XBL A;  2CTR A;  2YS8 A;  3UO2 A;  2GUZ A;  2EJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...