3STZC

Kcsa potassium channel mutant y82c with nitroxide spin label
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
102
structure length
102
Chain Sequence
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
total genus 44
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3stzC00
4P9PA 4WFHA 1BL8A 5B3SC 3SYOA 1OCCC 1K4DC 1ZWIC 5KUKA 4F4LA 3AG1C 3LDCA 2A9HA 2QKSA 5J9PC 3RW0A 4R7CA 1XL4A 5IY5C 4MW3A 4PA3A 4XDKA 2BOCC 1ORQC 4WFGA 1R3IC 4R8CA 2WLLA 3TETA 3PJSK 5EBLC 3IGAC 2X6CA 4JTDB 4X89A 3ZRSA 5EBWC 2NLJC 1V54C 2HVJC 4GX1A 3RBZA 3E89A 5CBFA 3R65A 4CBCA 3FB6C 3K06A 1OCOC 3K08A 5KUMA 3AG4C 3OUSA 3X2QC 2WLLB 3SPIA 2P7TC 2DWEC 2WLNA 3SJQC 3TCUA 2Y69C 3ASNC 3GB7C 1P7BA 4MVZA 3SYQA 1LNQA 2HJFC 4MVOA 2ITDC 4HYOA 3E83A 4LP8A 4PDVA 4QE7A 3OR7C 3HPLC 2YEVA 2DYRC 2BOBC 4MSWC 2AHZA 4J9YB 5E1AC 3EFFK 2JK5C 3K04A 2DWDC 1R3KC 4MW8A 4RO2A 3RVZA 4GX2A 5EBMC 4DXWA 1G4YB 3UKMA 4MTGA 4X8AA 4MVQA 2IH1C 2IH3C 3OR6C 4MTFA 4OXSA 4KFMA 2WLJA 4G28B 3SPHA 2WLIA 3ASOC 3FB8C 4JTCB 3F7YC 4R6ZA 3LDEA 5BZBA 4G27B 4J9ZB 1KKDA 1OCRC 4QE9A 1JVMA 2X6AA 3F5WC 2WLIB 2A0LA 3T4ZA 2EIJC 3K03A 1R3JC 2EILC 3E8FA 3T1CA 4ZBMA 4MVRA 5EK0A 3KG2A 3FB5C 4XDLA 2WLKA 4MS2A 3SPCA 3STLC 4GX0A 4P2ZA 3OUFA 4PA4A 2EIMC 3E8BA 2QTOA 2Q69A 3IFXA 3OGCC 3ABLC 4H37A 3SYCA 4QNHB 2ZXWC 5CBHA 2KB1A 1S5HC 3AG3C 4JTAB 3LUTB 3E86A 3E8GA 4MTOA 4LCUC 2HG5C 4PA7A 4MVUA 5B1AC 3SYPA 2EIKC 2Q68A 4UUJC 3E8HA 3F7VC 2EINC 4LBEC 3T4DA 4PA6A 3BEHA 3STZC 3WG7C 3AG2C 2Q6AA 2WLHA 2ZD9A 4RAIA 4RUEA 4PDRA 3K0DA 2WLMA 4P9OA 3RVYA 3T2MA 4EKWA 3UM7A 2DYSC 1V55C 4RUFA 4X88A 3SPJA 1QLEC 2OCCC 4I9WA 2ATKC 1R3LC 2K1EA 3SYAA 4R50A 1K4CC 4HZ3A 4WFFA 2HVKC 2AHYA 3LNMB 2W0FC 4WFEA 4H33A 5EC2C 5B1BC 2HFEC 1M56C 5CBGA 4GX5A 3SPGA 3LDDA 2X6BA 1M57C 4PDMA 5EC1C 3ZJZA 1J95A 2H8PC 3ABKC 1XL6A 3K0GA 4PDLA 4MVMA 3VOUA 2Q67A 3JYCA 4XDJA 2R9RB 1OCZC 4PA9A 3ABMC 4TWKA 4MVSA 4P30A 3FB7C 2ITCC 2A79B 4BW5A
chains in the Genus database with same CATH superfamily
1QCEA 5B3SC 2UXBB 3SYOA 4DV6O 4PV1B 1IZ3A 2A9HA 2Q9LA 3IC7A 4FFBA 3NR7A 4U7NA 3VBBA 2AZ2A 1R6TA 3OM3B 2JGDB 5EBWC 2GV9A 1M4UA 5CBFA 1QVGU 1T5EA 3FB6C 1N4CA 1WLEA 2W6JG 4BR6A 1FS0G 3CC7V 5DEDA 4DV5O 4O4HA 4PD4F 4RO2A 5IJ9B 4ABMA 1XUQA 5C93A 3G6EV 4JTCB 1O9GA 2BSKA 2D2CB 4FK5C 1BHBA 1CP9A 3OW2U 1HDJA 4MVRA 2GUZA 1WB7A 1XEQA 1YXBA 4TQDA 4QNHB 4I4TA 4J41A 4J7KA 1XBLA 3E8GA 3M99B 1QHTA 3HKCB 5B3SB 3E8HA 2EINC 1Y66A 2MW2B 4X66B 2OIEA 1FD9A 3S3WA 3CCMV 2CK3G 4DV3O 1W0JG 1VQKV 3LDDA 4JI3B 2ZIOA 3DSQA 4PDLA 2VQFB 4U3JA 3VOUA 5CA3A 2UXCO 4K35A 3H1IH 4CS3A 4LFCB 4B7EA 3SGIA 3FB7C 5B1NA 4N23A 4CH5A 1XNRB 4B3TO 1ZAUA 3JD0A 4NVPA 1OHHG 1M1KW 4J80A 4CZZA 4CC6A 2GTSA 4R7CA 1RP3B 5LXTB 1S5JA 2WLLA 3ZX6A 1YVWA 2X6CA 4DV4B 1SA0B 1N32B 1V54C 2HVJC 2Q5ZA 1WN7A 1HNXB 3DC6A 4FLWA 3TXSA 4LF9O 1SRYA 2DWEC 1L0LH 5IYZA 5L3EA 4JYBA 4H0LB 4L8JA 2RJZA 4F6RB 1IXBA 5E1AC 4DK0A 1R3KC 2OT5A 5EBMC 2LFSA 5LHGA 1Q82W 2P06A 2WWWA 3JARA 3FB8C 1FXKA 2YDEA 3ZEDA 4QPKA 1KQSU 1HR0O 4I50B 4Z1MG 1E1RG 2BSKB 5LL6Y 2W0XA 4P2ZA 3OUFA 3CMAV 5LGUA 4QJFB 2IU3A 5LOVB 5A9GA 1IURA 1NH2D 2HHHO 1GM8A 1VF7A 4X1KA 3ETQA 4JI8O 3STZC 3JAKA 3ICXA 3OEHG 1ZSPA 2K1EA 4DUZO 1K4CC 5DM6V 3ABKB 2HVKC 1VQ5V 4BW9A 2GSMB 4DW0A 3L70H 3CRRA 1AI4A 5K1PA 3H1HH 3HKBA 3SPGA 1LR1A 4JV5B 3CXCU 5LA6B 1WPBA 3CP1A 3CMEV 4FFKA 1AP6A 3IAYA 3ABMC 1Q5OA 4DR6B 1FXKB 1P4RA 4KHPB 4W4LA 5H6RA 5HFMA 4YHHO 4DR2O 2ITCC 1YDXA 4WFHA 3JALB 3ZRXA 2Y0IA 3JD2A 1NI8A 5IT9N 1NR7A 3BA8A 4MW3A 4PI0A 5LBQA 4AQYB 4L87A 5FPOA 2WAMA 3CWBH 1JPXA 2UXDO 4X66O 2G38A 3X2QC 3APOA 5BMVB 3KZIZ 1SA0A 2AW9A 4MT8A 2VQEB 4QE7A 1SQBH 3A8TA 3T1HO 2YEVA 1KYOF 3SDLA 2RN9A 4MSWC 3EFFK 4CS2A 2DWDC 5LXTA 1G6UA 5GTIZ 2GTAA 1YJNV 3TJTA 2E74B 2WLIA 1XDCA 2N05A 1KKDA 1B06A 1XQ8A 1YHQV 4FLTA 3HKBB 3K79A 4DRXA 2RQ6A 3E8BA 3ABMB 1BCCH 1S5HC 1D5AA 3SR2C 3RYFB 1HNZO 3CCQV 2PYLA 4LBEC 4LF6O 3AG2C 5B66Z 2XASA 2ZR3A 5ITZA 4I0XA 2LO1A 2A06H 4J11A 3ZRWA 2BTQB 4PHZA 1ZX3A 3AG2B 2ARHA 4WFEA 5H9CA 1XNQO 5C8YA 3JAKB 3AG4B 3J7AU 3G6BA 2H8PC 1XMOB 2JRIA 2L35A 1NS1A 2XTAA 2YIBA 2BCCH 5LMNB 4DUYB 4OPHA 2PF4E 1RM1B 1GH6A 4FFBB 4JI4O 4NR1A 2ZE5A 3ZMUA 1S3JA 2VWJA 2BTQA 3CX5F 4IYIA 5IYZB 5JWPA 3CC2V 3ZHRA 4W4KA 3ZRSA 4X64B 4GYCB 2QA4V 1VQ8V 2WLLB 3NXSA 3BCCH 3ZMVA 3TCUA 3APQA 3ASNC 4D7SA 2EJ7A 4JI4B 1WNSA 3CCUV 1XHXA 4HYOA 3UQ8A 1TVKB 2P5OA 1EN4A 1S0VA 4AILC 2XHBA 2YICA 3UT5A 1OCRB 4MW8A 1GN4A 4AQYO 1BGYH 3UO2A 1ZTEA 4IT5A 4H44B 1AI7A 4O2AB 4FLUA 3T4ZA 3CCRV 3E8FA 4DR4B 1NT2B 2X0LA 1GTOA 4C7UA 1EN5A 4PA4A 1IBLB 2PI4A 2A3QA 5EIBC 4O4JB 1B6QA 4DV7B 4CC5A 1L0NH 4LF8O 4D6TH 1QNMA 4EKWA 1JX9A 3UM7A 1TAEA 3SPJA 2OCCC 4I9WA 3D36C 2YXYA 3CRCA 1AJNA 1DF5A 4TT3G 2W0FC 3A2FA 4NXMB 2JGUA 1SF9A 1VQMV 1XL6A 4Z1VA 1HNXO 3RYCB 2YSUB 3JYCA 1FYJA 3MHSC 5EYPA 2PYJA 5JVDB 1NTMH 2DW4A 1RFYA 1FFXB 3H9VA 2QTSA 5L3CA 1GN3A 2YXLA 2ZT9B 5EZYB 1AILA 3D3QA 1IDSA 3CEIA 4JI3O 2BE3A 2NLJC 4GX1A 2XAGA 4UFZA 5KLVH 1EZVH 3ZHTA 3CCEV 2P7TC 3ZIAG 2UU9O 3ZRWB 3LSSA 2RMKB 1JR9A 3CJHA 4LWSB 4FLYA 4K8XA 1OV9A 3AK1A 3DGEA 3QNEA 1VQLV 2JK5C 2Y4TA 4I50A 4GZRB 4MTGA 2F95B 2VQFO 1JJ2U 1FJGB 1NTKH 4B3RB 4J10A 2JGDA 4WCEV 5KAIZ 1GO3F 3RYHA 1QR9A 3O65A 1Y74A 2X6AA 1S77D 2PGGA 3T1CA 1I7FA 4DR1B 3FB5C 1YF2A 2QSAA 2ZNJA 2HLDG 1N33B 1XHZA 5L3BA 3KCYA 1CEZA 2QWPB 1QU7A 1Z5VA 2QE7G 3LUTB 3E86A 1K34A 2HG5C 1I5XA 2QWOB 3K0DA 2DMXA 1V55C 4B3MB 2P4VA 2DE0X 2DQ3A 3MAQA 1M57B 1H38A 5H2FZ 4Q6GA 4BIOA 4A5UB 4GKKO 3A0HZ 5BR8B 3JASB 3P30A 4EFBA 1M57C 2LFRA 2NN4A 5JH7A 1Y76B 1SZTA 2V1DA 5LP6B 3E2EA 5LMNO 1PKXA 2Q4PA 4Q20A 3EXAA 3MD0A 4X1YB 4XDKA 2A79B 5KMGB 2L6LA 5IYDO 4UB8Z 4B08A 1N0JA 5IY5C 1SQXH 2YUAA 2JEXA 4X89A 3L73H 5LYJB 1BQ0A 3THOA 3R65A 3HKDB 4QPJA 2UUCB 4JI6B 4JI2B 1AVMA 2FKXA 4DR3O 1LNQA 3G71V 1GM7A 4I4TB 3Q4HA 4J9YB 1N0NA 1RM1C 5EZYA 4UB6Z 1R1BA 3BRCA 2IH1C 2IH3C 1VQPV 4GKJO 1VF5B 3SPHA 1B04A 1GM9A 4UXNA 4QE9A 4ZI7A 1M56B 3ZMSA 3EHBB 1AR4A 5JJNB 5IJ0B 4QIWF 1IXMA 4XDLA 4CH6A 2P22C 1R73A 3SJBC 2EIJB 4O2BB 1K5QA 1MSWD 4DV4O 4X1IB 1N32O 2YC0A 1IVSA 3F7VC 4FZ1A 3B09A 1Q90D 2OTLV 1NH2B 4RUEA 2DJVA 1BE3H 1YZBA 3C3SA 4X65B 4CS4A 1PV0A 2QR4A 4ZOLB 4EB6B 4U7OA 1S76D 3RWRD 1AJPA 3W7WA 1Z5WA 3LNMB 3BY6A 3ETEA 3D3IA 1N33O 4GX5A 3WB0A 4PDMA 5J2UA 1TUBB 3BA9A 2Z3YA 1VQNV 3I56V 3P32A 4JI1B 4YY3O 3AEIA 1VMGA 1UFIA 2ZE6A 2XAQA 4PI2A 2JS3A 1ZL8A 2XAFA 1KP3A 3JALA 2A7WA 4KUMA 4DO2A 4P30A 2E75B 5LGNA 3GVMA 1KP2A 2UXBO 5KHKA 1QLEB 4DR7O 1ORQC 1VEWA 3ZMTA 3A0RA 4NXMO 2FTKA 4D7TA 3RBZA 1SS3A 1TVKA 4B7KA 1K9MW 1SC5B 1NR1A 4LF8B 3DTUB 2P90A 3SPIA 2WLNA 4O4LB 1VQ9V 2UUAO 1F23A 4YJ3A 4FJCC 2YIAA 4O2BA 2XUMA 3N2GB 1S5LZ 1G4YB 1DF4A 2XAHA 3S3XA 1RSOA 4FPPA 5JVDA 5L3GA 1OCRC 1SQFA 5CB4B 1XOUA 1YTFB 5GONA 2RNBA 1U96A 1M93A 1MOFA 2K9PA 2WLKA 4UCUA 1AJQA 3JARB 3IFXA 3OGCC 3K9SA 3HKEA 3VQVA 4JI7B 4MTOA 3AK2A 1FPOA 2ZE7A 3FAVA 3RYIA 3T4DA 3WG7C 4WFAV 2CTQA 4DR5B 4P9OA 2WLMA 3RYIB 1NBMG 1KB9F 2CH7B 5FNVB 4K0KB 1QLEC 5F2VO 5KAFZ 1YI2V 4JYAB 4NTWA 1P7GA 2IJIA 5B1BC 1IBLO 1N36B 1OCZB 1Q7YW 3CHXA 1V9PA 4K3AA 5KMGA 2UUBB 5TISZ 1FFXA 3K59A 4TV9A 3ABLB 1K97A 4KHPO 1F4NA 2OIGA 4BAYA 1S72V 4UUJC 3UO3A 4BW5A 4P9PA 3D8CA 1AR1B 5LP6A 2LGWA 4PJ0Z 1Y76A 1QQCA 1ROPA 2QWNB 2PZSA 2V4DA 2ODMA 2JDIG 2CDYA 3U11A 4JTDB 3CPWU 2FYUH 1H2NA 3N27A 1KECA 2YIBD 3FKSG 4FLZA 4IHJA 2R70A 1E1QG 4IIJA 1J5EB 2QM8A 3JAWB 4PDVA 3HPLC 4DK1A 3CB2A 3G80A 4MTXA 2N04A 1QBZA 4PELA 1F7YA 2EZOA 2X7RB 4X62B 1JOYA 1H8HG 4U3JB 1BSMA 2KQXA 4KFMA 4G28B 3J81N 4LF6B 4JI5B 2AXTZ 4DV1O 3LDEA 4B3SB 4H13B 3JSLA 5K1XA 5B1BB 4E4EA 3BPZA 3ZN0A 3T1YB 4LF5B 5J2UB 3SPCA 2EIMC 1XNQB 1NU1H 2Q69A 4IL6Z 4BIZA 3T1HB 3CJHB 1GK9A 4OGQB 1PL4A 4KXRA 1H2KA 4AHCA 4MVUA 4O4HB 2Y0PA 3SYPA 2UXCB 2EIKC 3ZN1A 2E76B 4YHHB 3K58A 4DR2B 4WFBV 1L1FA 3ETDA 2CTRA 4F6EA 4DR4O 1PNKA 4X65O 2YI9A 1KU9A 4UCOA 4WFFA 4X1KB 3CC4V 3QF7A 4LFBB 1FKAO 1XMQO 3X2QB 5IYBO 4BWAA 3RFRA 3OTOB 1L8DA 2JJ2G 1VQ7V 4MVMA 1XILA 4DV2B 2KKWA 4DW1A 4RQEA 4UCVA 1BS3A 3CXHF 2ZDIA 3RYCA 3JATA 1KBHA 3LDCA 3BABA 1WP7A 5FL7G 3BVOA 5JJJB 2BOCC 4JAAA 2EBOA 3PJSK 3IGAC 3E89A 3BAAA 4NTXA 2XNDG 3W7SA 1Q8IA 1MG1A 1XREA 3N2GA 2YIDA 4I0XB 3SJQC 4DR1O 5KX5A 2HJFC 3QG5A 1IBKO 4JZGA 1M5IA 4JI0O 1I5YA 3L75H 4NXNB 2LP7A 1JFFA 1HW7A 2AGAA 2NNUA 1VARA 1Q6HA 2EILB 4X8AA 1WAZA 1CPYA 3F5WC 4TQFA 1MZEA 2EJRA 4IGGA 1G1XB 1R3JC 2EILC 3ZHQA 1HR0B 2CE4A 2F4VB 4ZKIA 3JASA 3ZHSA 4LFBO 2KSDA 2DOSA 2EINB 2ZXWC 2YXHA 3AG3C 5LGTA 1FFTB 1URFA 1WB8A 4DV2O 1OCCB 3OFNG 4U3FH 4LF4B 3VQYA 5BMVA 3LSQA 4X1IA 4RUFA 2ATKC 2ZE8A 1FXHA 4FLXA 1QR8A 4NB5A 2IJJA 3H1LH 1JMKC 4H33A 3A0BZ 3W7XA 1TA8A 2CGNA 2ZKOA 4ZIBA 3K5MA 2GBOA 2ZR2A 3ASNB 4DV1B 2V7QG 2F23A 4TV8B 1PL0A 3FX7A 1N34B 2DYRB 3WB2A 2QWRB 3OMIB 2CAZC 3MHHC 1Y4MA 1K8AW 4TV8A 2R9AA 5LMUO 1HWYA 3OTFA 5IJ9A 1NJIW 4JF3A 4NXNO 3ZS8C 1AP5A 1EFRG 1DK1A 2LW1A 1GAXA 3N2KA 4YXWG 2QKAA 3OUSA 1NZ6A 3H1JH 3E83A 1SQPH 3OR7C 1VF6C 1B3QA 5GW7A 1Q81W 2JVDA 3ZBHA 1I94B 2Z5UA 3OR6C 1JJOA 1MA1A 1BZKA 3ASOC 4G27B 1R6NA 4J9ZB 2A0LA 3ML0A 1JFFB 4HAMA 1BHAA 5JCOA 3ASOB 3LNNA 4JASA 3R66A 1TUBA 4JYCA 1QLNA 4O4LA 4JV5O 3E35A 1IX9A 1MNGA 4F6RA 3W7TA 4LNUA 4ZOLA 4EB6A 2Q6AA 4NYKA 3I55V 2EZPA 4OX9O 4LNUB 4X88A 4QGPA 1R3LC 1O9HA 4GKKB 3AK3A 3H01A 3ZHVA 4DV5B 2UUAB 3G67A 3FD9A 5LP6C 2R9IA 5B1OA 2CGOA 4FM2A 1GMGA 3L74H 4TV9B 3RN4A 3K0GA 3ZCCA 1K3EA 1ZL8B 2O57A 1OCZC 2ZM6O 3RGBA 4B3SO 1ZLZA 3JD4A 2QM4A 1Q43A 4DYLA 5IY5B 5IJ0A 4LWSA 5H6QA 4DV6B 2CH7A 5LHHA 1XL4A 4K8ZA 1NVPD 2E3CA 1DGSA 4R8CA 3CYOA 4JI5O 4DV7O 4YY3B 4E2LA 1OCOC 4OX9B 5KUMA 1F4MA 1PNLA 4N21A 3B2EE 1P7BA 2HR3A 2VRZA 2XT9A 1BMFG 3JATB 4J7JA 2IU0A 1OCOB 2Q0AA 1LUWA 4HNAA 2EULA 1GN6A 2Y4UA 1JCHA 5KHGA 2ETNA 3RVZA 3HB3B 4DXWA 1KC8W 2WA4A 2XOKG 1K7DA 5L3DA 1KKCA 3F7YC 5J2TB 2R72A 5GONB 3OT7A 2PTMA 2M7WA 2EIJC 1KD1W 1Q6IA 2QGNA 1GKFA 1VF6A 2OCHA 1R6KA 1ZUQA 2DQ0A 5CB4A 4DV3B 2C2AA 5JH7B 5CA0B 3G4SV 1H2MA 4FVMA 2KB1A 1N8RW 2ZIMA 2ZINA 1UPGA 1BT8A 1WA8B 4EFEA 2UXXA 1PD3A 1FAFA 2Q68A 2M6YA 4WF9V 1H8EG 1Q3EA 3WU2Z 4GKJB 3OE7G 5FPRA 2DYSC 2UU9B 2Z0AA 1K33A 2DYSB 1X4TA 1XI1A 3CS5A 3LSUA 2Y69B 3UCSC 1JA8A 2LW7A 5LHIA 4LC1A 1AR5A 2KG7A 1D5NA 4O4JA 3JCUZ 5HFLA 4DR5O 2HJDA 4LF4O 4IYHA 2QWQB 5B1AB 1N34O 1Y6XA 1OCCC 1SESA 2F43G 3AG1C 4F4LA 3RW0A 1XMQB 5KX5B 2HHHB 1HP8A 3WB1A 5H5NA 5CA1A 3D36A 3BHPA 2RCVA 4JI2O 1GRJA 2IM9A 1HNWB 3E22B 3VQXA 5IDJA 3GWKC 3M8AA 2DYRC 4ZI7B 3N2KB 5KA5A 4MTFA 1YITV 3RYHB 2GUZB 3MDSA 2YI8A 2CUGA 4ASUG 2IJKA 1VQOV 5J2TA 1V54B 5EK0A 4O4IA 2P4KA 3TGUH 3STLC 4GX0A 2OTJV 3JSNA 4JPRA 3B4SA 4JI0B 1WP8A 5B1AC 4PA6A 1VQ4V 2EX3A 4CH4A 4NKGB 4CH3A 4LF9B 1SETA 4B3TB 2LJ2A 4UVAA 1G8MA 4UV9A 4DRXB 3CCVV 5EIBD 4YIPA 1SZXA 4HBNA 3CCJV 3OMNB 1XMOO 1WPXA 2ADPA 5EYPB 1H2GA 2VS0A 2QJ1A 2ZDIC 4TWKA 1Q6UA 2IW5A 4MVSA 4LF7B 4I9QA 4LFCO 1W0KG 4YJ3B 1MMMA 5KHHA 4DV0B 2IJHA 3L71H 1D2DA 2XAJA 4X20A 1R3IC 1RPRA 2B5UA 3CCSV 2Q7GA 1SQQH 3BFRA 4IIJB 4B3RO 5BXZA 4GT1A 2Q7HA 3U10A 2UUCO 2F93B 4MVOA 4TUYA 1DTOA 3QTCA 4GCZA 2JEUA 1UJWB 2B9ZA 1YTFD 3JCZA 4O2AA 1EZJA 2YS8A 1NKDA 3OMAB 3FAVB 1YJ9V 4FIPC 4R6ZA 3TK1A 5BZBA 3K3WA 3HKEB 4LH6A 4TOIA 3K03A 2RDCA 1YIJV 2JIZG 4JYYA 3ABLC 4LH7A 5CBHA 4WBNB 4G2KA 3Q4HB 4PA7A 1K73W 3KKYA 5C8YB 5IWAO 2WLHA 5JJEB 3T2MA 3CSXA 3E22A 1EM1A 2F4VO 1IBKB 4O4IB 3CE2A 3CRMA 1Z2GA 5EC2C 5ITZB 5CA1B 5KA6A 1M56C 1V55B 2WA3A 2Y48A 1N36O 3B77A 4FM1A 5D5QA 5DECA 1J95A 2LGQA 3ABKC 3DC5A 4JI7O 1I94O 1THZA 4X1YA 2Q67A 5CN0A 2AZ0A 5JCOC 4JI8B 2R9RB 1KMIZ 5LOVA 3K57A 2ADQB 5L3FA 3L9DA 1MSDA 1K4DC 1OJHA 5KUKA 4UV8A 2QKSA 2ZQMA 4XBFA 3OGIB 3GWOA 4UCSA 3SJAC 3RT3C 1COWG 3FYEB 4WFGA 3HKDA 5EBLC 4ZHQB 2QM7A 1FJGO 3QO7A 4CBCA 3K06A 3K08A 3K5NA 3AG4C 1NVPB 3ABTA 1SQVH 4OPAA 4RWUA 2Y69C 3GB7C 1TUEB 3O9OA 5KHJA 2W6IG 3ABUA 1OZ0A 2EIKB 1AI6A 4JAUA 4KP4A 5BY1A 2BOBC 1K92A 2AHZA 4FLVA 1M90W 2PI5A 1WA8A 3K04A 4IHJB 3K5LA 2E5LB 4GX2A 3OTOO 3UKMA 4MVQA 3OEEG 4X62O 5CA0A 5CMUA 4X64O 2Q7EA 1H2LA 2P6JA 1AB3A 2UXNA 1JVMA 5JQGB 3CCLV 4J42A 1YJWV 4UCRA 4ZBMA 2JJ1G 1J5EO 3PN1A 2ZCEA 4AI8A 1EBOA 3OD4A 1M9NA 2QTOA 1W2BU 3L72H 5FNVA 4JTAB 3UT5B 3JAMN 5IYCO 1SQGA 1GN2A 3AG7A 2ZD9A 4PDRA 2OYQA 1E79G 3HR0A 4FMTA 2VQEO 4ZHQA 2AHYA 1SKVA 4GUNA 5FLXN 2X6BA 1NQTA 2Q8VA 5EC1C 1KUQA 3ZJZA 2QDOA 4EEQA 2B1IA 3QO8A 1RSOB 2WSSG 1YSCA 1HNZB 2WPDG 2UXDB 5LA6A 4BIUA 3K9AA 4HNAB 3TXQA 1ENVA 1ZWIC 5J9PC 2PUSA 4PA3A 2E5LO 4DV0O 2OCCB 3ETGA 4LFAO 5BR8O 4JGSA 4UVBA 1LUVA 3KCXA 3I5DA 4J7ZA 3IC9A 4UVCA 5AG2A 1TGOA 3U0ZA 2Q0OC 3JAWA 4DR3B 3P3PA 4K0KO 4KL1A 5LYJA 2PY5A 4MVZA 3VQWA 1VQ6V 3SYQA 5IE9A 2ITDC 5KHIA 1F51A 1US6A 1AROP 1Y67A 3B8MA 4LFAB 4FZ0A 2QKCA 4OXSA 4Z2WA 2WLJA 4LR3A 4DR6O 1AI5A 4I7ZB 1HNWO 1JQ0A 2F1MA 2GDSA 1U97A 1MABG 4YJ2A 2NR5A 5LMUB 4MS2A 1PPJH 4I55B 3W7UA 2H94A 4LF5O 3FYIB 2HP8A 4YJ2B 3SYCA 2H3OA 3WG7B 3C3TA 3CD6V 1IBMO 1PM9A 1CXZB 2VWKA 1EN6A 3ZHUA 2HKOA 4I5SA 4ICGA 3CRAA 4JI6O 4RAIA 1H2SB 2F66C 4DUYO 2IBZH 1FXVA 3IJ4A 4JAVA 4B3MO 3HKCA 1DLBA 1PP9H 4X20B 5CBGA 3QVNA 1PNMA 4FM0A 2HEPA 5E79Z 1RPOA 2CTWA 3FFQA 4NTYA 4PA9A 1Y74B 2ILMA 3QO5A 1VP7A 4GLXA 5IWAB 2FB5A 5A2QN 1BL8A 4RQFA 5GTHZ 1A32A 3SJCC 1XNRO 2N74A 3J80N 2B1GA 3TETA 4YIOA 1IBMB 2UUBO 2OWOA 1WJZA 3T1YO 2ZNIA 4LP8A 1MZFA 3RYFA 4WBNA 3P3NA 1P49A 3B40A 2JS5A 4JI1O 4DR7B 3EVKA 1QVFU 2MK3A 3F5TA 3H1KH 4X9QA 1W59A 2BTOA 2WLIB 3OAAG 2KG7B 1X59A 4LF7O 4TSFG 4JYAO 3KG2A 2P67A 5D5PA 1P84F 1YEWA 4H37A 4UCTA 1FXKC 4TUYB 4JZ2A 3M7MX 4LCUC 2EIMB 2Q73A 1I08A 1K5SA 3BEHA 2QEXV 1NTZH 3RVYA 1BQZA 2LQTA 2GHYA 2DN9A 2FMLA 2FL4A 3CRQA 3B8NA 3SYAA 4R50A 4HZ3A 3C90A 3JD3A 4DUZB 2CTPA 4I55A 3WFVA 2HFEC 5DN6G 3JD1A 3ZRVA 1SERA 3DXRB 1Q86W 1VIBA 1YCIA 2D3OW 3ZMZA 3K5OA 4XDJA 5JQGA 3AG1B 2ZXWB 3DXRA 2ZM6B 3AG3B 5B5EZ 2YEVB 1I0HA
chains in the Genus database with same CATH topology
2DW4A 1QCEA 5B3SC 3SYOA 3LDCA 2A9HA 3IC7A 5L3CA 5FL7G 4U7NA 3VBBA 2IJHA 2BOCC 2XAJA 3OM3B 1R3IC 1RPRA 2EBOA 2B5UA 3PJSK 3IGAC 3CCSV 5EBWC 2NLJC 4GX1A 2XAGA 3E89A 5CBFA 1QVGU 3FB6C 2XNDG 4GT1A 1WLEA 3W7SA 1MG1A 2W6JG 3CCEV 2P7TC 3ZIAG 3SJQC 1FS0G 3ZRWB 2HJFC 4MVOA 1DTOA 3LSSA 3CC7V 4GCZA 2JEUA 1UJWB 3QNEA 3DGEA 1YTFD 1I5YA 3JCZA 1VQLV 2JK5C 4RO2A 1EZJA 2LP7A 1NKDA 4MTGA 4X8AA 3OMAB 2NNUA 2EILB 1YJ9V 5C93A 3G6EV 1JJ2U 4JTCB 1CPYA 4FIPC 4R6ZA 3TK1A 5BZBA 3K3WA 1GO3F 4WCEV 1QR9A 1S77D 3F5WC 2X6AA 2EJRA 4FK5C 1BHBA 1CP9A 3K03A 3OW2U 1R3JC 2EILC 3T1CA 4MVRA 3FB5C 4ZKIA 1YIJV 2JIZG 2HLDG 2EINB 4QNHB 3ABLC 5L3BA 2ZXWC 5CBHA 1CEZA 4G2KA 2QE7G 3AG3C 3LUTB 3E86A 3E8GA 1FFTB 4PA7A 1K34A 2HG5C 5LGTA 3M99B 1K73W 5B3SB 3E8HA 1OCCB 1I5XA 2EINC 3OFNG 1Y66A 2WLHA 3LSQA 3K0DA 3T2MA 1V55C 4RUFA 2DQ3A 1M57B 2ATKC 3CCMV 1H38A 1FXHA 1QR8A 2CK3G 2IJJA 5EC2C 4H33A 5KA6A 1M56C 3W7XA 1V55B 2Y48A 1W0JG 1VQKV 3P30A 3LDDA 1M57C 2LFRA 3B77A 1J95A 3ABKC 2V1DA 1SZTA 2ZR2A 4PDLA 3ASNB 1THZA 3E2EA 3VOUA 2Q67A 5CN0A 2R9RB 1PKXA 2V7QG 5CA3A 1PL0A 4Q20A 3MD0A 2DYRB 5L3FA 3FB7C 3OMIB 4XDKA 2A79B 4N23A 5B1NA 3MHHC 1Y4MA 5IYDO 1K8AW 1K4DC 5KUKA 4UV8A 2QKSA 2ZQMA 3JD0A 1HWYA 1OHHG 3GWOA 4XBFA 4CZZA 1M1KW 1COWG 3FYEB 4R7CA 1NJIW 5IY5C 4JF3A 4WFGA 2JEXA 2WLLA 5EBLC 2X6CA 4X89A 1V54C 1EFRG 2HVJC 2QM7A 3QO7A 3R65A 4CBCA 3K06A 3K08A 4QPJA 3AG4C 4YXWG 3OUSA 1SRYA 1NVPB 3ABTA 2DWEC 5L3EA 2Y69C 3GB7C 1TUEB 4JYBA 1LNQA 3E83A 2W6IG 3G71V 3OR7C 1GM7A 3ABUA 1OZ0A 2EIKB 1AI6A 4JAUA 4KP4A 5GW7A 2BOBC 1Q81W 1K92A 2AHZA 4J9YB 5E1AC 1M90W 1RM1C 2PI5A 3K04A 1R3KC 2OT5A 4GX2A 5EBMC 3UKMA 2LFSA 5LHGA 4MVQA 2IH1C 2IH3C 2Z5UA 3OEEG 3OR6C 1VQPV 1Q82W 3SPHA 2WWWA 3ASOC 3FB8C 5CMUA 1FXKA 2P6JA 1GM9A 4G27B 1R6NA 4J9ZB 4UXNA 2UXNA 4QE9A 1JVMA 4QPKA 3CCLV 1KQSU 2A0LA 1M56B 1YJWV 3ZMSA 3ML0A 3EHBB 4Z1MG 4QIWF 4ZBMA 1E1RG 1IXMA 4HAMA 4XDLA 1BHAA 2JJ1G 3ASOB 4P2ZA 3OUFA 1EBOA 4JASA 1M9NA 1R73A 2QTOA 4JYCA 3CMAV 1QLNA 1W2BU 2EIJB 5LGUA 4QJFB 2IU3A 3E35A 1K5QA 1MSWD 4JTAB 1NH2D 1GM8A 3W7TA 3F7VC 5IYCO 3STZC 2Q6AA 1NH2B 2OTLV 2ZD9A 4RUEA 3I55V 2EZPA 4PDRA 3OEHG 4X88A 1R3LC 2K1EA 4U7OA 1K4CC 1E79G 1S76D 5DM6V 3ABKB 1AJPA 2HVKC 3H01A 4FMTA 3W7WA 2AHYA 3LNMB 1VQ5V 2R9IA 2GSMB 3BY6A 5B1OA 3ETEA 3D3IA 1AI4A 4GX5A 3SPGA 2X6BA 1NQTA 4PDMA 1GMGA 5EC1C 3CXCU 2Z3YA 1VQNV 3ZJZA 3I56V 2B1IA 3CP1A 3P32A 3K0GA 3QO8A 3ZCCA 1K3EA 3CMEV 2WSSG 3AEIA 1YSCA 1OCZC 2XAQA 3ABMC 2XAFA 2WPDG 1FXKB 1KP3A 1P4RA 4KUMA 4DO2A 4P30A 5H6RA 3JD4A 4BIUA 3K9AA 5HFMA 5IY5B 2ITCC 5LGNA 4WFHA 1ENVA 1ZWIC 3ZRXA 3JD2A 1KP2A 5H6QA 5J9PC 5LHHA 1XL4A 1NR7A 4MW3A 4PA3A 1QLEB 5LBQA 1NVPD 1ORQC 2OCCB 3ETGA 4R8CA 4L87A 3ZMTA 4JGSA 3A0RA 4UVBA 3CYOA 2FTKA 3RBZA 2WAMA 4E2LA 1K9MW 1NR1A 4UVCA 1OCOC 3DTUB 2P90A 5KUMA 1JPXA 1F4MA 3X2QC 1PNLA 3SPIA 4N21A 2WLNA 4MT8A 1P7BA 4MVZA 2HR3A 1VQ6V 3SYQA 1VQ9V 1F23A 1BMFG 2ITDC 4QE7A 1OCOB 4FJCC 2IU0A 1F51A 2YEVA 4MSWC 1AROP 3EFFK 1JCHA 2DWDC 3B8MA 3RVZA 3HB3B 4DXWA 1G4YB 1KC8W 1DF4A 2XOKG 2XAHA 1K7DA 1YJNV 4OXSA 5L3DA 2WLJA 2WLIA 3F7YC 4FPPA 1AI5A 1KKDA 5L3GA 1OCRC 2M7WA 1YHQV 2EIJC 1KD1W 1JQ0A 1YTFB 1MABG 3K79A 1GKFA 1MOFA 1R6KA 2DQ0A 2WLKA 4MS2A 3W7UA 2H94A 2C2AA 1AJQA 3FYIB 3E8BA 3IFXA 3OGCC 3SYCA 3G4SV 3WG7B 3ABMB 2KB1A 1N8RW 1S5HC 3CD6V 4MTOA 2UXXA 1PD3A 2Q68A 3CCQV 4WF9V 1H8EG 4LBEC 3T4DA 3WG7C 2HKOA 3AG2C 4I5SA 4WFAV 2XASA 3OE7G 2ZR3A 4RAIA 1FXVA 2WLMA 4P9OA 1NBMG 2DYSC 4JAVA 1QLEC 3ZRWA 1YI2V 1DLBA 3AG2B 1K33A 4WFEA 2IJIA 5H9CA 5B1BC 2DYSB 1OCZB 5CBGA 1Q7YW 1PNMA 3AG4B 2H8PC 2Y69B 1RPOA 3ABLB 1K97A 4PA9A 5LHIA 4LC1A 1F4NA 4BAYA 3QO5A 5HFLA 1S72V 4UUJC 1RM1B 4BW5A 5B1AB 4P9PA 1BL8A 4RQFA 1AR1B 1OCCC 1SESA 2F43G 3AG1C 4F4LA 3ZMUA 1S3JA 1ROPA 3RW0A 2JDIG 2B1GA 3TETA 3CC2V 3CPWU 4JTDB 3ZRSA 3D36A 2QA4V 1KECA 1VQ8V 3FKSG 2WLLB 3NXSA 1E1QG 3ZMVA 3TCUA 3ASNC 5IDJA 2QM8A 3CCUV 4HYOA 4PDVA 4LP8A 3HPLC 1S0VA 2DYRC 4MTXA 1QBZA 4PELA 2EZOA 1OCRB 4MW8A 2X7RB 1JOYA 1H8HG 5KA5A 4MTFA 1YITV 1QVFU 2MK3A 4KFMA 4G28B 3LDEA 4ASUG 1AI7A 2IJKA 5B1BB 2WLIB 3OAAG 3T4ZA 1VQOV 4TSFG 3CCRV 3ZN0A 1V54B 3E8FA 5EK0A 3KG2A 2X0LA 1GTOA 2P67A 3SPCA 3STLC 4GX0A 2OTJV 4PA4A 2EIMC 4JPRA 2Q69A 4H37A 2PI4A 4BIZA 1FXKC 1GK9A 1B6QA 4LCUC 4MVUA 5B1AC 3SYPA 2EIMB 2EIKC 3ZN1A 4PA6A 1K5SA 3BEHA 1VQ4V 2QEXV 3RVYA 4WFBV 1L1FA 1JX9A 4EKWA 3UM7A 3ETDA 2GHYA 1SETA 3SPJA 2OCCC 4I9WA 4UVAA 3B8NA 1PNKA 3SYAA 1G8MA 4R50A 4HZ3A 1AJNA 1DF5A 4WFFA 3CC4V 3JD3A 4TT3G 4UV9A 2W0FC 3CCVV 3WFVA 2HFEC 5DN6G 3JD1A 3CCJV 3OMNB 3ZRVA 1SERA 3X2QB 5IYBO 1WPXA 1VQMV 1Q86W 2D3OW 1XL6A 2JJ2G 3ZMZA 1H2GA 1VQ7V 4MVMA 2YSUB 3JYCA 4XDJA 3AG1B 2ZXWB 4RQEA 3MHSC 2ZDIC 4TWKA 4MVSA 2IW5A 2ZDIA 3AG3B 2YEVB 1W0KG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P9P A;  4WFH A;  1BL8 A;  5B3S C;  3SYO A;  1OCC C;  1K4D C;  1ZWI C;  5KUK A;  4F4L A;  3AG1 C;  3LDC A;  2A9H A;  2QKS A;  5J9P C;  3RW0 A;  4R7C A;  1XL4 A;  5IY5 C;  4MW3 A;  4PA3 A;  4XDK A;  2BOC C;  1ORQ C;  4WFG A;  1R3I C;  4R8C A;  2WLL A;  3TET A;  3PJS K;  5EBL C;  3IGA C;  2X6C A;  4JTD B;  4X89 A;  3ZRS A;  5EBW C;  2NLJ C;  1V54 C;  2HVJ C;  4GX1 A;  3RBZ A;  3E89 A;  5CBF A;  3R65 A;  4CBC A;  3FB6 C;  3K06 A;  1OCO C;  3K08 A;  5KUM A;  3AG4 C;  3OUS A;  3X2Q C;  2WLL B;  3SPI A;  2P7T C;  2DWE C;  2WLN A;  3SJQ C;  3TCU A;  2Y69 C;  3ASN C;  3GB7 C;  1P7B A;  4MVZ A;  3SYQ A;  1LNQ A;  2HJF C;  4MVO A;  2ITD C;  4HYO A;  3E83 A;  4LP8 A;  4PDV A;  4QE7 A;  3OR7 C;  3HPL C;  2YEV A;  2DYR C;  2BOB C;  4MSW C;  2AHZ A;  4J9Y B;  5E1A C;  3EFF K;  2JK5 C;  3K04 A;  2DWD C;  1R3K C;  4MW8 A;  4RO2 A;  3RVZ A;  4GX2 A;  5EBM C;  4DXW A;  1G4Y B;  3UKM A;  4MTG A;  4X8A A;  4MVQ A;  2IH1 C;  2IH3 C;  3OR6 C;  4MTF A;  4OXS A;  4KFM A;  2WLJ A;  4G28 B;  3SPH A;  2WLI A;  3ASO C;  3FB8 C;  4JTC B;  3F7Y C;  4R6Z A;  3LDE A;  5BZB A;  4G27 B;  4J9Z B;  1KKD A;  1OCR C;  4QE9 A;  1JVM A;  2X6A A;  3F5W C;  2WLI B;  2A0L A;  3T4Z A;  2EIJ C;  3K03 A;  1R3J C;  2EIL C;  3E8F A;  3T1C A;  4ZBM A;  4MVR A;  5EK0 A;  3KG2 A;  3FB5 C;  4XDL A;  2WLK A;  4MS2 A;  3SPC A;  3STL C;  4GX0 A;  4P2Z A;  3OUF A;  4PA4 A;  2EIM C;  3E8B A;  2QTO A;  2Q69 A;  3IFX A;  3OGC C;  3ABL C;  4H37 A;  3SYC A;  4QNH B;  2ZXW C;  5CBH A;  2KB1 A;  1S5H C;  3AG3 C;  4JTA B;  3LUT B;  3E86 A;  3E8G A;  4MTO A;  4LCU C;  2HG5 C;  4PA7 A;  4MVU A;  5B1A C;  3SYP A;  2EIK C;  2Q68 A;  4UUJ C;  3E8H A;  3F7V C;  2EIN C;  4LBE C;  3T4D A;  4PA6 A;  3BEH A;  3STZ C;  3WG7 C;  3AG2 C;  2Q6A A;  2WLH A;  2ZD9 A;  4RAI A;  4RUE A;  4PDR A;  3K0D A;  2WLM A;  4P9O A;  3RVY A;  3T2M A;  4EKW A;  3UM7 A;  2DYS C;  1V55 C;  4RUF A;  4X88 A;  3SPJ A;  1QLE C;  2OCC C;  4I9W A;  2ATK C;  1R3L C;  2K1E A;  3SYA A;  4R50 A;  1K4C C;  4HZ3 A;  4WFF A;  2HVK C;  2AHY A;  3LNM B;  2W0F C;  4WFE A;  4H33 A;  5EC2 C;  5B1B C;  2HFE C;  1M56 C;  5CBG A;  4GX5 A;  3SPG A;  3LDD A;  2X6B A;  1M57 C;  4PDM A;  5EC1 C;  3ZJZ A;  1J95 A;  2H8P C;  3ABK C;  1XL6 A;  3K0G A;  4PDL A;  4MVM A;  3VOU A;  2Q67 A;  3JYC A;  4XDJ A;  2R9R B;  1OCZ C;  4PA9 A;  3ABM C;  4TWK A;  4MVS A;  4P30 A;  3FB7 C;  2ITC C;  2A79 B;  4BW5 A; 
#chains in the Genus database with same CATH topology
 1QCE A;  5B3S C;  2UXB B;  3SYO A;  4DV6 O;  4PV1 B;  1IZ3 A;  2A9H A;  2Q9L A;  3IC7 A;  4FFB A;  3NR7 A;  4U7N A;  3VBB A;  2AZ2 A;  1R6T A;  3OM3 B;  2JGD B;  5EBW C;  2GV9 A;  1M4U A;  5CBF A;  1QVG U;  1T5E A;  3FB6 C;  1N4C A;  1WLE A;  2W6J G;  4BR6 A;  1FS0 G;  3CC7 V;  5DED A;  4DV5 O;  4O4H A;  4PD4 F;  4RO2 A;  5IJ9 B;  4ABM A;  1XUQ A;  5C93 A;  3G6E V;  4JTC B;  1O9G A;  2BSK A;  2D2C B;  4FK5 C;  1BHB A;  1CP9 A;  3OW2 U;  1HDJ A;  4MVR A;  2GUZ A;  1WB7 A;  1XEQ A;  1YXB A;  4TQD A;  4QNH B;  4I4T A;  4J41 A;  4J7K A;  1XBL A;  3E8G A;  3M99 B;  1QHT A;  3HKC B;  5B3S B;  3E8H A;  2EIN C;  1Y66 A;  2MW2 B;  4X66 B;  2OIE A;  1FD9 A;  3S3W A;  3CCM V;  2CK3 G;  4DV3 O;  1W0J G;  1VQK V;  3LDD A;  4JI3 B;  2ZIO A;  3DSQ A;  4PDL A;  2VQF B;  4U3J A;  3VOU A;  5CA3 A;  2UXC O;  4K35 A;  3H1I H;  4CS3 A;  4LFC B;  4B7E A;  3SGI A;  3FB7 C;  5B1N A;  4N23 A;  4CH5 A;  1XNR B;  4B3T O;  1ZAU A;  3JD0 A;  4NVP A;  1OHH G;  1M1K W;  4J80 A;  4CZZ A;  4CC6 A;  2GTS A;  4R7C A;  1RP3 B;  5LXT B;  1S5J A;  2WLL A;  3ZX6 A;  1YVW A;  2X6C A;  4DV4 B;  1SA0 B;  1N32 B;  1V54 C;  2HVJ C;  2Q5Z A;  1WN7 A;  1HNX B;  3DC6 A;  4FLW A;  3TXS A;  4LF9 O;  1SRY A;  2DWE C;  1L0L H;  5IYZ A;  5L3E A;  4JYB A;  4H0L B;  4L8J A;  2RJZ A;  4F6R B;  1IXB A;  5E1A C;  4DK0 A;  1R3K C;  2OT5 A;  5EBM C;  2LFS A;  5LHG A;  1Q82 W;  2P06 A;  2WWW A;  3JAR A;  3FB8 C;  1FXK A;  2YDE A;  3ZED A;  4QPK A;  1KQS U;  1HR0 O;  4I50 B;  4Z1M G;  1E1R G;  2BSK B;  5LL6 Y;  2W0X A;  4P2Z A;  3OUF A;  3CMA V;  5LGU A;  4QJF B;  2IU3 A;  5LOV B;  5A9G A;  1IUR A;  1NH2 D;  2HHH O;  1GM8 A;  1VF7 A;  4X1K A;  3ETQ A;  4JI8 O;  3STZ C;  3JAK A;  3ICX A;  3OEH G;  1ZSP A;  2K1E A;  4DUZ O;  1K4C C;  5DM6 V;  3ABK B;  2HVK C;  1VQ5 V;  4BW9 A;  2GSM B;  4DW0 A;  3L70 H;  3CRR A;  1AI4 A;  5K1P A;  3H1H H;  3HKB A;  3SPG A;  1LR1 A;  4JV5 B;  3CXC U;  5LA6 B;  1WPB A;  3CP1 A;  3CME V;  4FFK A;  1AP6 A;  3IAY A;  3ABM C;  1Q5O A;  4DR6 B;  1FXK B;  1P4R A;  4KHP B;  4W4L A;  5H6R A;  5HFM A;  4YHH O;  4DR2 O;  2ITC C;  1YDX A;  4WFH A;  3JAL B;  3ZRX A;  2Y0I A;  3JD2 A;  1NI8 A;  5IT9 N;  1NR7 A;  3BA8 A;  4MW3 A;  4PI0 A;  5LBQ A;  4AQY B;  4L87 A;  5FPO A;  2WAM A;  3CWB H;  1JPX A;  2UXD O;  4X66 O;  2G38 A;  3X2Q C;  3APO A;  5BMV B;  3KZI Z;  1SA0 A;  2AW9 A;  4MT8 A;  2VQE B;  4QE7 A;  1SQB H;  3A8T A;  3T1H O;  2YEV A;  1KYO F;  3SDL A;  2RN9 A;  4MSW C;  3EFF K;  4CS2 A;  2DWD C;  5LXT A;  1G6U A;  5GTI Z;  2GTA A;  1YJN V;  3TJT A;  2E74 B;  2WLI A;  1XDC A;  2N05 A;  1KKD A;  1B06 A;  1XQ8 A;  1YHQ V;  4FLT A;  3HKB B;  3K79 A;  4DRX A;  2RQ6 A;  3E8B A;  3ABM B;  1BCC H;  1S5H C;  1D5A A;  3SR2 C;  3RYF B;  1HNZ O;  3CCQ V;  2PYL A;  4LBE C;  4LF6 O;  3AG2 C;  5B66 Z;  2XAS A;  2ZR3 A;  5ITZ A;  4I0X A;  2LO1 A;  2A06 H;  4J11 A;  3ZRW A;  2BTQ B;  4PHZ A;  1ZX3 A;  3AG2 B;  2ARH A;  4WFE A;  5H9C A;  1XNQ O;  5C8Y A;  3JAK B;  3AG4 B;  3J7A U;  3G6B A;  2H8P C;  1XMO B;  2JRI A;  2L35 A;  1NS1 A;  2XTA A;  2YIB A;  2BCC H;  5LMN B;  4DUY B;  4OPH A;  2PF4 E;  1RM1 B;  1GH6 A;  4FFB B;  4JI4 O;  4NR1 A;  2ZE5 A;  3ZMU A;  1S3J A;  2VWJ A;  2BTQ A;  3CX5 F;  4IYI A;  5IYZ B;  5JWP A;  3CC2 V;  3ZHR A;  4W4K A;  3ZRS A;  4X64 B;  4GYC B;  2QA4 V;  1VQ8 V;  2WLL B;  3NXS A;  3BCC H;  3ZMV A;  3TCU A;  3APQ A;  3ASN C;  4D7S A;  2EJ7 A;  4JI4 B;  1WNS A;  3CCU V;  1XHX A;  4HYO A;  3UQ8 A;  1TVK B;  2P5O A;  1EN4 A;  1S0V A;  4AIL C;  2XHB A;  2YIC A;  3UT5 A;  1OCR B;  4MW8 A;  1GN4 A;  4AQY O;  1BGY H;  3UO2 A;  1ZTE A;  4IT5 A;  4H44 B;  1AI7 A;  4O2A B;  4FLU A;  3T4Z A;  3CCR V;  3E8F A;  4DR4 B;  1NT2 B;  2X0L A;  1GTO A;  4C7U A;  1EN5 A;  4PA4 A;  1IBL B;  2PI4 A;  2A3Q A;  5EIB C;  4O4J B;  1B6Q A;  4DV7 B;  4CC5 A;  1L0N H;  4LF8 O;  4D6T H;  1QNM A;  4EKW A;  1JX9 A;  3UM7 A;  1TAE A;  3SPJ A;  2OCC C;  4I9W A;  3D36 C;  2YXY A;  3CRC A;  1AJN A;  1DF5 A;  4TT3 G;  2W0F C;  3A2F A;  4NXM B;  2JGU A;  1SF9 A;  1VQM V;  1XL6 A;  4Z1V A;  1HNX O;  3RYC B;  2YSU B;  3JYC A;  1FYJ A;  3MHS C;  5EYP A;  2PYJ A;  5JVD B;  1NTM H;  2DW4 A;  1RFY A;  1FFX B;  3H9V A;  2QTS A;  5L3C A;  1GN3 A;  2YXL A;  2ZT9 B;  5EZY B;  1AIL A;  3D3Q A;  1IDS A;  3CEI A;  4JI3 O;  2BE3 A;  2NLJ C;  4GX1 A;  2XAG A;  4UFZ A;  5KLV H;  1EZV H;  3ZHT A;  3CCE V;  2P7T C;  3ZIA G;  2UU9 O;  3ZRW B;  3LSS A;  2RMK B;  1JR9 A;  3CJH A;  4LWS B;  4FLY A;  4K8X A;  1OV9 A;  3AK1 A;  3DGE A;  3QNE A;  1VQL V;  2JK5 C;  2Y4T A;  4I50 A;  4GZR B;  4MTG A;  2F95 B;  2VQF O;  1JJ2 U;  1FJG B;  1NTK H;  4B3R B;  4J10 A;  2JGD A;  4WCE V;  5KAI Z;  1GO3 F;  3RYH A;  1QR9 A;  3O65 A;  1Y74 A;  2X6A A;  1S77 D;  2PGG A;  3T1C A;  1I7F A;  4DR1 B;  3FB5 C;  1YF2 A;  2QSA A;  2ZNJ A;  2HLD G;  1N33 B;  1XHZ A;  5L3B A;  3KCY A;  1CEZ A;  2QWP B;  1QU7 A;  1Z5V A;  2QE7 G;  3LUT B;  3E86 A;  1K34 A;  2HG5 C;  1I5X A;  2QWO B;  3K0D A;  2DMX A;  1V55 C;  4B3M B;  2P4V A;  2DE0 X;  2DQ3 A;  3MAQ A;  1M57 B;  1H38 A;  5H2F Z;  4Q6G A;  4BIO A;  4A5U B;  4GKK O;  3A0H Z;  5BR8 B;  3JAS B;  3P30 A;  4EFB A;  1M57 C;  2LFR A;  2NN4 A;  5JH7 A;  1Y76 B;  1SZT A;  2V1D A;  5LP6 B;  3E2E A;  5LMN O;  1PKX A;  2Q4P A;  4Q20 A;  3EXA A;  3MD0 A;  4X1Y B;  4XDK A;  2A79 B;  5KMG B;  2L6L A;  5IYD O;  4UB8 Z;  4B08 A;  1N0J A;  5IY5 C;  1SQX H;  2YUA A;  2JEX A;  4X89 A;  3L73 H;  5LYJ B;  1BQ0 A;  3THO A;  3R65 A;  3HKD B;  4QPJ A;  2UUC B;  4JI6 B;  4JI2 B;  1AVM A;  2FKX A;  4DR3 O;  1LNQ A;  3G71 V;  1GM7 A;  4I4T B;  3Q4H A;  4J9Y B;  1N0N A;  1RM1 C;  5EZY A;  4UB6 Z;  1R1B A;  3BRC A;  2IH1 C;  2IH3 C;  1VQP V;  4GKJ O;  1VF5 B;  3SPH A;  1B04 A;  1GM9 A;  4UXN A;  4QE9 A;  4ZI7 A;  1M56 B;  3ZMS A;  3EHB B;  1AR4 A;  5JJN B;  5IJ0 B;  4QIW F;  1IXM A;  4XDL A;  4CH6 A;  2P22 C;  1R73 A;  3SJB C;  2EIJ B;  4O2B B;  1K5Q A;  1MSW D;  4DV4 O;  4X1I B;  1N32 O;  2YC0 A;  1IVS A;  3F7V C;  4FZ1 A;  3B09 A;  1Q90 D;  2OTL V;  1NH2 B;  4RUE A;  2DJV A;  1BE3 H;  1YZB A;  3C3S A;  4X65 B;  4CS4 A;  1PV0 A;  2QR4 A;  4ZOL B;  4EB6 B;  4U7O A;  1S76 D;  3RWR D;  1AJP A;  3W7W A;  1Z5W A;  3LNM B;  3BY6 A;  3ETE A;  3D3I A;  1N33 O;  4GX5 A;  3WB0 A;  4PDM A;  5J2U A;  1TUB B;  3BA9 A;  2Z3Y A;  1VQN V;  3I56 V;  3P32 A;  4JI1 B;  4YY3 O;  3AEI A;  1VMG A;  1UFI A;  2ZE6 A;  2XAQ A;  4PI2 A;  2JS3 A;  1ZL8 A;  2XAF A;  1KP3 A;  3JAL A;  2A7W A;  4KUM A;  4DO2 A;  4P30 A;  2E75 B;  5LGN A;  3GVM A;  1KP2 A;  2UXB O;  5KHK A;  1QLE B;  4DR7 O;  1ORQ C;  1VEW A;  3ZMT A;  3A0R A;  4NXM O;  2FTK A;  4D7T A;  3RBZ A;  1SS3 A;  1TVK A;  4B7K A;  1K9M W;  1SC5 B;  1NR1 A;  4LF8 B;  3DTU B;  2P90 A;  3SPI A;  2WLN A;  4O4L B;  1VQ9 V;  2UUA O;  1F23 A;  4YJ3 A;  4FJC C;  2YIA A;  4O2B A;  2XUM A;  3N2G B;  1S5L Z;  1G4Y B;  1DF4 A;  2XAH A;  3S3X A;  1RSO A;  4FPP A;  5JVD A;  5L3G A;  1OCR C;  1SQF A;  5CB4 B;  1XOU A;  1YTF B;  5GON A;  2RNB A;  1U96 A;  1M93 A;  1MOF A;  2K9P A;  2WLK A;  4UCU A;  1AJQ A;  3JAR B;  3IFX A;  3OGC C;  3K9S A;  3HKE A;  3VQV A;  4JI7 B;  4MTO A;  3AK2 A;  1FPO A;  2ZE7 A;  3FAV A;  3RYI A;  3T4D A;  3WG7 C;  4WFA V;  2CTQ A;  4DR5 B;  4P9O A;  2WLM A;  3RYI B;  1NBM G;  1KB9 F;  2CH7 B;  5FNV B;  4K0K B;  1QLE C;  5F2V O;  5KAF Z;  1YI2 V;  4JYA B;  4NTW A;  1P7G A;  2IJI A;  5B1B C;  1IBL O;  1N36 B;  1OCZ B;  1Q7Y W;  3CHX A;  1V9P A;  4K3A A;  5KMG A;  2UUB B;  5TIS Z;  1FFX A;  3K59 A;  4TV9 A;  3ABL B;  1K97 A;  4KHP O;  1F4N A;  2OIG A;  4BAY A;  1S72 V;  4UUJ C;  3UO3 A;  4BW5 A;  4P9P A;  3D8C A;  1AR1 B;  5LP6 A;  2LGW A;  4PJ0 Z;  1Y76 A;  1QQC A;  1ROP A;  2QWN B;  2PZS A;  2V4D A;  2ODM A;  2JDI G;  2CDY A;  3U11 A;  4JTD B;  3CPW U;  2FYU H;  1H2N A;  3N27 A;  1KEC A;  2YIB D;  3FKS G;  4FLZ A;  4IHJ A;  2R70 A;  1E1Q G;  4IIJ A;  1J5E B;  2QM8 A;  3JAW B;  4PDV A;  3HPL C;  4DK1 A;  3CB2 A;  3G80 A;  4MTX A;  2N04 A;  1QBZ A;  4PEL A;  1F7Y A;  2EZO A;  2X7R B;  4X62 B;  1JOY A;  1H8H G;  4U3J B;  1BSM A;  2KQX A;  4KFM A;  4G28 B;  3J81 N;  4LF6 B;  4JI5 B;  2AXT Z;  4DV1 O;  3LDE A;  4B3S B;  4H13 B;  3JSL A;  5K1X A;  5B1B B;  4E4E A;  3BPZ A;  3ZN0 A;  3T1Y B;  4LF5 B;  5J2U B;  3SPC A;  2EIM C;  1XNQ B;  1NU1 H;  2Q69 A;  4IL6 Z;  4BIZ A;  3T1H B;  3CJH B;  1GK9 A;  4OGQ B;  1PL4 A;  4KXR A;  1H2K A;  4AHC A;  4MVU A;  4O4H B;  2Y0P A;  3SYP A;  2UXC B;  2EIK C;  3ZN1 A;  2E76 B;  4YHH B;  3K58 A;  4DR2 B;  4WFB V;  1L1F A;  3ETD A;  2CTR A;  4F6E A;  4DR4 O;  1PNK A;  4X65 O;  2YI9 A;  1KU9 A;  4UCO A;  4WFF A;  4X1K B;  3CC4 V;  3QF7 A;  4LFB B;  1FKA O;  1XMQ O;  3X2Q B;  5IYB O;  4BWA A;  3RFR A;  3OTO B;  1L8D A;  2JJ2 G;  1VQ7 V;  4MVM A;  1XIL A;  4DV2 B;  2KKW A;  4DW1 A;  4RQE A;  4UCV A;  1BS3 A;  3CXH F;  2ZDI A;  3RYC A;  3JAT A;  1KBH A;  3LDC A;  3BAB A;  1WP7 A;  5FL7 G;  3BVO A;  5JJJ B;  2BOC C;  4JAA A;  2EBO A;  3PJS K;  3IGA C;  3E89 A;  3BAA A;  4NTX A;  2XND G;  3W7S A;  1Q8I A;  1MG1 A;  1XRE A;  3N2G A;  2YID A;  4I0X B;  3SJQ C;  4DR1 O;  5KX5 A;  2HJF C;  3QG5 A;  1IBK O;  4JZG A;  1M5I A;  4JI0 O;  1I5Y A;  3L75 H;  4NXN B;  2LP7 A;  1JFF A;  1HW7 A;  2AGA A;  2NNU A;  1VAR A;  1Q6H A;  2EIL B;  4X8A A;  1WAZ A;  1CPY A;  3F5W C;  4TQF A;  1MZE A;  2EJR A;  4IGG A;  1G1X B;  1R3J C;  2EIL C;  3ZHQ A;  1HR0 B;  2CE4 A;  2F4V B;  4ZKI A;  3JAS A;  3ZHS A;  4LFB O;  2KSD A;  2DOS A;  2EIN B;  2ZXW C;  2YXH A;  3AG3 C;  5LGT A;  1FFT B;  1URF A;  1WB8 A;  4DV2 O;  1OCC B;  3OFN G;  4U3F H;  4LF4 B;  3VQY A;  5BMV A;  3LSQ A;  4X1I A;  4RUF A;  2ATK C;  2ZE8 A;  1FXH A;  4FLX A;  1QR8 A;  4NB5 A;  2IJJ A;  3H1L H;  1JMK C;  4H33 A;  3A0B Z;  3W7X A;  1TA8 A;  2CGN A;  2ZKO A;  4ZIB A;  3K5M A;  2GBO A;  2ZR2 A;  3ASN B;  4DV1 B;  2V7Q G;  2F23 A;  4TV8 B;  1PL0 A;  3FX7 A;  1N34 B;  2DYR B;  3WB2 A;  2QWR B;  3OMI B;  2CAZ C;  3MHH C;  1Y4M A;  1K8A W;  4TV8 A;  2R9A A;  5LMU O;  1HWY A;  3OTF A;  5IJ9 A;  1NJI W;  4JF3 A;  4NXN O;  3ZS8 C;  1AP5 A;  1EFR G;  1DK1 A;  2LW1 A;  1GAX A;  3N2K A;  4YXW G;  2QKA A;  3OUS A;  1NZ6 A;  3H1J H;  3E83 A;  1SQP H;  3OR7 C;  1VF6 C;  1B3Q A;  5GW7 A;  1Q81 W;  2JVD A;  3ZBH A;  1I94 B;  2Z5U A;  3OR6 C;  1JJO A;  1MA1 A;  1BZK A;  3ASO C;  4G27 B;  1R6N A;  4J9Z B;  2A0L A;  3ML0 A;  1JFF B;  4HAM A;  1BHA A;  5JCO A;  3ASO B;  3LNN A;  4JAS A;  3R66 A;  1TUB A;  4JYC A;  1QLN A;  4O4L A;  4JV5 O;  3E35 A;  1IX9 A;  1MNG A;  4F6R A;  3W7T A;  4LNU A;  4ZOL A;  4EB6 A;  2Q6A A;  4NYK A;  3I55 V;  2EZP A;  4OX9 O;  4LNU B;  4X88 A;  4QGP A;  1R3L C;  1O9H A;  4GKK B;  3AK3 A;  3H01 A;  3ZHV A;  4DV5 B;  2UUA B;  3G67 A;  3FD9 A;  5LP6 C;  2R9I A;  5B1O A;  2CGO A;  4FM2 A;  1GMG A;  3L74 H;  4TV9 B;  3RN4 A;  3K0G A;  3ZCC A;  1K3E A;  1ZL8 B;  2O57 A;  1OCZ C;  2ZM6 O;  3RGB A;  4B3S O;  1ZLZ A;  3JD4 A;  2QM4 A;  1Q43 A;  4DYL A;  5IY5 B;  5IJ0 A;  4LWS A;  5H6Q A;  4DV6 B;  2CH7 A;  5LHH A;  1XL4 A;  4K8Z A;  1NVP D;  2E3C A;  1DGS A;  4R8C A;  3CYO A;  4JI5 O;  4DV7 O;  4YY3 B;  4E2L A;  1OCO C;  4OX9 B;  5KUM A;  1F4M A;  1PNL A;  4N21 A;  3B2E E;  1P7B A;  2HR3 A;  2VRZ A;  2XT9 A;  1BMF G;  3JAT B;  4J7J A;  2IU0 A;  1OCO B;  2Q0A A;  1LUW A;  4HNA A;  2EUL A;  1GN6 A;  2Y4U A;  1JCH A;  5KHG A;  2ETN A;  3RVZ A;  3HB3 B;  4DXW A;  1KC8 W;  2WA4 A;  2XOK G;  1K7D A;  5L3D A;  1KKC A;  3F7Y C;  5J2T B;  2R72 A;  5GON B;  3OT7 A;  2PTM A;  2M7W A;  2EIJ C;  1KD1 W;  1Q6I A;  2QGN A;  1GKF A;  1VF6 A;  2OCH A;  1R6K A;  1ZUQ A;  2DQ0 A;  5CB4 A;  4DV3 B;  2C2A A;  5JH7 B;  5CA0 B;  3G4S V;  1H2M A;  4FVM A;  2KB1 A;  1N8R W;  2ZIM A;  2ZIN A;  1UPG A;  1BT8 A;  1WA8 B;  4EFE A;  2UXX A;  1PD3 A;  1FAF A;  2Q68 A;  2M6Y A;  4WF9 V;  1H8E G;  1Q3E A;  3WU2 Z;  4GKJ B;  3OE7 G;  5FPR A;  2DYS C;  2UU9 B;  2Z0A A;  1K33 A;  2DYS B;  1X4T A;  1XI1 A;  3CS5 A;  3LSU A;  2Y69 B;  3UCS C;  1JA8 A;  2LW7 A;  5LHI A;  4LC1 A;  1AR5 A;  2KG7 A;  1D5N A;  4O4J A;  3JCU Z;  5HFL A;  4DR5 O;  2HJD A;  4LF4 O;  4IYH A;  2QWQ B;  5B1A B;  1N34 O;  1Y6X A;  1OCC C;  1SES A;  2F43 G;  3AG1 C;  4F4L A;  3RW0 A;  1XMQ B;  5KX5 B;  2HHH B;  1HP8 A;  3WB1 A;  5H5N A;  5CA1 A;  3D36 A;  3BHP A;  2RCV A;  4JI2 O;  1GRJ A;  2IM9 A;  1HNW B;  3E22 B;  3VQX A;  5IDJ A;  3GWK C;  3M8A A;  2DYR C;  4ZI7 B;  3N2K B;  5KA5 A;  4MTF A;  1YIT V;  3RYH B;  2GUZ B;  3MDS A;  2YI8 A;  2CUG A;  4ASU G;  2IJK A;  1VQO V;  5J2T A;  1V54 B;  5EK0 A;  4O4I A;  2P4K A;  3TGU H;  3STL C;  4GX0 A;  2OTJ V;  3JSN A;  4JPR A;  3B4S A;  4JI0 B;  1WP8 A;  5B1A C;  4PA6 A;  1VQ4 V;  2EX3 A;  4CH4 A;  4NKG B;  4CH3 A;  4LF9 B;  1SET A;  4B3T B;  2LJ2 A;  4UVA A;  1G8M A;  4UV9 A;  4DRX B;  3CCV V;  5EIB D;  4YIP A;  1SZX A;  4HBN A;  3CCJ V;  3OMN B;  1XMO O;  1WPX A;  2ADP A;  5EYP B;  1H2G A;  2VS0 A;  2QJ1 A;  2ZDI C;  4TWK A;  1Q6U A;  2IW5 A;  4MVS A;  4LF7 B;  4I9Q A;  4LFC O;  1W0K G;  4YJ3 B;  1MMM A;  5KHH A;  4DV0 B;  2IJH A;  3L71 H;  1D2D A;  2XAJ A;  4X20 A;  1R3I C;  1RPR A;  2B5U A;  3CCS V;  2Q7G A;  1SQQ H;  3BFR A;  4IIJ B;  4B3R O;  5BXZ A;  4GT1 A;  2Q7H A;  3U10 A;  2UUC O;  2F93 B;  4MVO A;  4TUY A;  1DTO A;  3QTC A;  4GCZ A;  2JEU A;  1UJW B;  2B9Z A;  1YTF D;  3JCZ A;  4O2A A;  1EZJ A;  2YS8 A;  1NKD A;  3OMA B;  3FAV B;  1YJ9 V;  4FIP C;  4R6Z A;  3TK1 A;  5BZB A;  3K3W A;  3HKE B;  4LH6 A;  4TOI A;  3K03 A;  2RDC A;  1YIJ V;  2JIZ G;  4JYY A;  3ABL C;  4LH7 A;  5CBH A;  4WBN B;  4G2K A;  3Q4H B;  4PA7 A;  1K73 W;  3KKY A;  5C8Y B;  5IWA O;  2WLH A;  5JJE B;  3T2M A;  3CSX A;  3E22 A;  1EM1 A;  2F4V O;  1IBK B;  4O4I B;  3CE2 A;  3CRM A;  1Z2G A;  5EC2 C;  5ITZ B;  5CA1 B;  5KA6 A;  1M56 C;  1V55 B;  2WA3 A;  2Y48 A;  1N36 O;  3B77 A;  4FM1 A;  5D5Q A;  5DEC A;  1J95 A;  2LGQ A;  3ABK C;  3DC5 A;  4JI7 O;  1I94 O;  1THZ A;  4X1Y A;  2Q67 A;  5CN0 A;  2AZ0 A;  5JCO C;  4JI8 B;  2R9R B;  1KMI Z;  5LOV A;  3K57 A;  2ADQ B;  5L3F A;  3L9D A;  1MSD A;  1K4D C;  1OJH A;  5KUK A;  4UV8 A;  2QKS A;  2ZQM A;  4XBF A;  3OGI B;  3GWO A;  4UCS A;  3SJA C;  3RT3 C;  1COW G;  3FYE B;  4WFG A;  3HKD A;  5EBL C;  4ZHQ B;  2QM7 A;  1FJG O;  3QO7 A;  4CBC A;  3K06 A;  3K08 A;  3K5N A;  3AG4 C;  1NVP B;  3ABT A;  1SQV H;  4OPA A;  4RWU A;  2Y69 C;  3GB7 C;  1TUE B;  3O9O A;  5KHJ A;  2W6I G;  3ABU A;  1OZ0 A;  2EIK B;  1AI6 A;  4JAU A;  4KP4 A;  5BY1 A;  2BOB C;  1K92 A;  2AHZ A;  4FLV A;  1M90 W;  2PI5 A;  1WA8 A;  3K04 A;  4IHJ B;  3K5L A;  2E5L B;  4GX2 A;  3OTO O;  3UKM A;  4MVQ A;  3OEE G;  4X62 O;  5CA0 A;  5CMU A;  4X64 O;  2Q7E A;  1H2L A;  2P6J A;  1AB3 A;  2UXN A;  1JVM A;  5JQG B;  3CCL V;  4J42 A;  1YJW V;  4UCR A;  4ZBM A;  2JJ1 G;  1J5E O;  3PN1 A;  2ZCE A;  4AI8 A;  1EBO A;  3OD4 A;  1M9N A;  2QTO A;  1W2B U;  3L72 H;  5FNV A;  4JTA B;  3UT5 B;  3JAM N;  5IYC O;  1SQG A;  1GN2 A;  3AG7 A;  2ZD9 A;  4PDR A;  2OYQ A;  1E79 G;  3HR0 A;  4FMT A;  2VQE O;  4ZHQ A;  2AHY A;  1SKV A;  4GUN A;  5FLX N;  2X6B A;  1NQT A;  2Q8V A;  5EC1 C;  1KUQ A;  3ZJZ A;  2QDO A;  4EEQ A;  2B1I A;  3QO8 A;  1RSO B;  2WSS G;  1YSC A;  1HNZ B;  2WPD G;  2UXD B;  5LA6 A;  4BIU A;  3K9A A;  4HNA B;  3TXQ A;  1ENV A;  1ZWI C;  5J9P C;  2PUS A;  4PA3 A;  2E5L O;  4DV0 O;  2OCC B;  3ETG A;  4LFA O;  5BR8 O;  4JGS A;  4UVB A;  1LUV A;  3KCX A;  3I5D A;  4J7Z A;  3IC9 A;  4UVC A;  5AG2 A;  1TGO A;  3U0Z A;  2Q0O C;  3JAW A;  4DR3 B;  3P3P A;  4K0K O;  4KL1 A;  5LYJ A;  2PY5 A;  4MVZ A;  3VQW A;  1VQ6 V;  3SYQ A;  5IE9 A;  2ITD C;  5KHI A;  1F51 A;  1US6 A;  1ARO P;  1Y67 A;  3B8M A;  4LFA B;  4FZ0 A;  2QKC A;  4OXS A;  4Z2W A;  2WLJ A;  4LR3 A;  4DR6 O;  1AI5 A;  4I7Z B;  1HNW O;  1JQ0 A;  2F1M A;  2GDS A;  1U97 A;  1MAB G;  4YJ2 A;  2NR5 A;  5LMU B;  4MS2 A;  1PPJ H;  4I55 B;  3W7U A;  2H94 A;  4LF5 O;  3FYI B;  2HP8 A;  4YJ2 B;  3SYC A;  2H3O A;  3WG7 B;  3C3T A;  3CD6 V;  1IBM O;  1PM9 A;  1CXZ B;  2VWK A;  1EN6 A;  3ZHU A;  2HKO A;  4I5S A;  4ICG A;  3CRA A;  4JI6 O;  4RAI A;  1H2S B;  2F66 C;  4DUY O;  2IBZ H;  1FXV A;  3IJ4 A;  4JAV A;  4B3M O;  3HKC A;  1DLB A;  1PP9 H;  4X20 B;  5CBG A;  3QVN A;  1PNM A;  4FM0 A;  2HEP A;  5E79 Z;  1RPO A;  2CTW A;  3FFQ A;  4NTY A;  4PA9 A;  1Y74 B;  2ILM A;  3QO5 A;  1VP7 A;  4GLX A;  5IWA B;  2FB5 A;  5A2Q N;  1BL8 A;  4RQF A;  5GTH Z;  1A32 A;  3SJC C;  1XNR O;  2N74 A;  3J80 N;  2B1G A;  3TET A;  4YIO A;  1IBM B;  2UUB O;  2OWO A;  1WJZ A;  3T1Y O;  2ZNI A;  4LP8 A;  1MZF A;  3RYF A;  4WBN A;  3P3N A;  1P49 A;  3B40 A;  2JS5 A;  4JI1 O;  4DR7 B;  3EVK A;  1QVF U;  2MK3 A;  3F5T A;  3H1K H;  4X9Q A;  1W59 A;  2BTO A;  2WLI B;  3OAA G;  2KG7 B;  1X59 A;  4LF7 O;  4TSF G;  4JYA O;  3KG2 A;  2P67 A;  5D5P A;  1P84 F;  1YEW A;  4H37 A;  4UCT A;  1FXK C;  4TUY B;  4JZ2 A;  3M7M X;  4LCU C;  2EIM B;  2Q73 A;  1I08 A;  1K5S A;  3BEH A;  2QEX V;  1NTZ H;  3RVY A;  1BQZ A;  2LQT A;  2GHY A;  2DN9 A;  2FML A;  2FL4 A;  3CRQ A;  3B8N A;  3SYA A;  4R50 A;  4HZ3 A;  3C90 A;  3JD3 A;  4DUZ B;  2CTP A;  4I55 A;  3WFV A;  2HFE C;  5DN6 G;  3JD1 A;  3ZRV A;  1SER A;  3DXR B;  1Q86 W;  1VIB A;  1YCI A;  2D3O W;  3ZMZ A;  3K5O A;  4XDJ A;  5JQG A;  3AG1 B;  2ZXW B;  3DXR A;  2ZM6 B;  3AG3 B;  5B5E Z;  2YEV B;  1I0H A; 
#chains in the Genus database with same CATH homology
 2DW4 A;  1QCE A;  5B3S C;  3SYO A;  3LDC A;  2A9H A;  3IC7 A;  5L3C A;  5FL7 G;  4U7N A;  3VBB A;  2IJH A;  2BOC C;  2XAJ A;  3OM3 B;  1R3I C;  1RPR A;  2EBO A;  2B5U A;  3PJS K;  3IGA C;  3CCS V;  5EBW C;  2NLJ C;  4GX1 A;  2XAG A;  3E89 A;  5CBF A;  1QVG U;  3FB6 C;  2XND G;  4GT1 A;  1WLE A;  3W7S A;  1MG1 A;  2W6J G;  3CCE V;  2P7T C;  3ZIA G;  3SJQ C;  1FS0 G;  3ZRW B;  2HJF C;  4MVO A;  1DTO A;  3LSS A;  3CC7 V;  4GCZ A;  2JEU A;  1UJW B;  3QNE A;  3DGE A;  1YTF D;  1I5Y A;  3JCZ A;  1VQL V;  2JK5 C;  4RO2 A;  1EZJ A;  2LP7 A;  1NKD A;  4MTG A;  4X8A A;  3OMA B;  2NNU A;  2EIL B;  1YJ9 V;  5C93 A;  3G6E V;  1JJ2 U;  4JTC B;  1CPY A;  4FIP C;  4R6Z A;  3TK1 A;  5BZB A;  3K3W A;  1GO3 F;  4WCE V;  1QR9 A;  1S77 D;  3F5W C;  2X6A A;  2EJR A;  4FK5 C;  1BHB A;  1CP9 A;  3K03 A;  3OW2 U;  1R3J C;  2EIL C;  3T1C A;  4MVR A;  3FB5 C;  4ZKI A;  1YIJ V;  2JIZ G;  2HLD G;  2EIN B;  4QNH B;  3ABL C;  5L3B A;  2ZXW C;  5CBH A;  1CEZ A;  4G2K A;  2QE7 G;  3AG3 C;  3LUT B;  3E86 A;  3E8G A;  1FFT B;  4PA7 A;  1K34 A;  2HG5 C;  5LGT A;  3M99 B;  1K73 W;  5B3S B;  3E8H A;  1OCC B;  1I5X A;  2EIN C;  3OFN G;  1Y66 A;  2WLH A;  3LSQ A;  3K0D A;  3T2M A;  1V55 C;  4RUF A;  2DQ3 A;  1M57 B;  2ATK C;  3CCM V;  1H38 A;  1FXH A;  1QR8 A;  2CK3 G;  2IJJ A;  5EC2 C;  4H33 A;  5KA6 A;  1M56 C;  3W7X A;  1V55 B;  2Y48 A;  1W0J G;  1VQK V;  3P30 A;  3LDD A;  1M57 C;  2LFR A;  3B77 A;  1J95 A;  3ABK C;  2V1D A;  1SZT A;  2ZR2 A;  4PDL A;  3ASN B;  1THZ A;  3E2E A;  3VOU A;  2Q67 A;  5CN0 A;  2R9R B;  1PKX A;  2V7Q G;  5CA3 A;  1PL0 A;  4Q20 A;  3MD0 A;  2DYR B;  5L3F A;  3FB7 C;  3OMI B;  4XDK A;  2A79 B;  4N23 A;  5B1N A;  3MHH C;  1Y4M A;  5IYD O;  1K8A W;  1K4D C;  5KUK A;  4UV8 A;  2QKS A;  2ZQM A;  3JD0 A;  1HWY A;  1OHH G;  3GWO A;  4XBF A;  4CZZ A;  1M1K W;  1COW G;  3FYE B;  4R7C A;  1NJI W;  5IY5 C;  4JF3 A;  4WFG A;  2JEX A;  2WLL A;  5EBL C;  2X6C A;  4X89 A;  1V54 C;  1EFR G;  2HVJ C;  2QM7 A;  3QO7 A;  3R65 A;  4CBC A;  3K06 A;  3K08 A;  4QPJ A;  3AG4 C;  4YXW G;  3OUS A;  1SRY A;  1NVP B;  3ABT A;  2DWE C;  5L3E A;  2Y69 C;  3GB7 C;  1TUE B;  4JYB A;  1LNQ A;  3E83 A;  2W6I G;  3G71 V;  3OR7 C;  1GM7 A;  3ABU A;  1OZ0 A;  2EIK B;  1AI6 A;  4JAU A;  4KP4 A;  5GW7 A;  2BOB C;  1Q81 W;  1K92 A;  2AHZ A;  4J9Y B;  5E1A C;  1M90 W;  1RM1 C;  2PI5 A;  3K04 A;  1R3K C;  2OT5 A;  4GX2 A;  5EBM C;  3UKM A;  2LFS A;  5LHG A;  4MVQ A;  2IH1 C;  2IH3 C;  2Z5U A;  3OEE G;  3OR6 C;  1VQP V;  1Q82 W;  3SPH A;  2WWW A;  3ASO C;  3FB8 C;  5CMU A;  1FXK A;  2P6J A;  1GM9 A;  4G27 B;  1R6N A;  4J9Z B;  4UXN A;  2UXN A;  4QE9 A;  1JVM A;  4QPK A;  3CCL V;  1KQS U;  2A0L A;  1M56 B;  1YJW V;  3ZMS A;  3ML0 A;  3EHB B;  4Z1M G;  4QIW F;  4ZBM A;  1E1R G;  1IXM A;  4HAM A;  4XDL A;  1BHA A;  2JJ1 G;  3ASO B;  4P2Z A;  3OUF A;  1EBO A;  4JAS A;  1M9N A;  1R73 A;  2QTO A;  4JYC A;  3CMA V;  1QLN A;  1W2B U;  2EIJ B;  5LGU A;  4QJF B;  2IU3 A;  3E35 A;  1K5Q A;  1MSW D;  4JTA B;  1NH2 D;  1GM8 A;  3W7T A;  3F7V C;  5IYC O;  3STZ C;  2Q6A A;  1NH2 B;  2OTL V;  2ZD9 A;  4RUE A;  3I55 V;  2EZP A;  4PDR A;  3OEH G;  4X88 A;  1R3L C;  2K1E A;  4U7O A;  1K4C C;  1E79 G;  1S76 D;  5DM6 V;  3ABK B;  1AJP A;  2HVK C;  3H01 A;  4FMT A;  3W7W A;  2AHY A;  3LNM B;  1VQ5 V;  2R9I A;  2GSM B;  3BY6 A;  5B1O A;  3ETE A;  3D3I A;  1AI4 A;  4GX5 A;  3SPG A;  2X6B A;  1NQT A;  4PDM A;  1GMG A;  5EC1 C;  3CXC U;  2Z3Y A;  1VQN V;  3ZJZ A;  3I56 V;  2B1I A;  3CP1 A;  3P32 A;  3K0G A;  3QO8 A;  3ZCC A;  1K3E A;  3CME V;  2WSS G;  3AEI A;  1YSC A;  1OCZ C;  2XAQ A;  3ABM C;  2XAF A;  2WPD G;  1FXK B;  1KP3 A;  1P4R A;  4KUM A;  4DO2 A;  4P30 A;  5H6R A;  3JD4 A;  4BIU A;  3K9A A;  5HFM A;  5IY5 B;  2ITC C;  5LGN A;  4WFH A;  1ENV A;  1ZWI C;  3ZRX A;  3JD2 A;  1KP2 A;  5H6Q A;  5J9P C;  5LHH A;  1XL4 A;  1NR7 A;  4MW3 A;  4PA3 A;  1QLE B;  5LBQ A;  1NVP D;  1ORQ C;  2OCC B;  3ETG A;  4R8C A;  4L87 A;  3ZMT A;  4JGS A;  3A0R A;  4UVB A;  3CYO A;  2FTK A;  3RBZ A;  2WAM A;  4E2L A;  1K9M W;  1NR1 A;  4UVC A;  1OCO C;  3DTU B;  2P90 A;  5KUM A;  1JPX A;  1F4M A;  3X2Q C;  1PNL A;  3SPI A;  4N21 A;  2WLN A;  4MT8 A;  1P7B A;  4MVZ A;  2HR3 A;  1VQ6 V;  3SYQ A;  1VQ9 V;  1F23 A;  1BMF G;  2ITD C;  4QE7 A;  1OCO B;  4FJC C;  2IU0 A;  1F51 A;  2YEV A;  4MSW C;  1ARO P;  3EFF K;  1JCH A;  2DWD C;  3B8M A;  3RVZ A;  3HB3 B;  4DXW A;  1G4Y B;  1KC8 W;  1DF4 A;  2XOK G;  2XAH A;  1K7D A;  1YJN V;  4OXS A;  5L3D A;  2WLJ A;  2WLI A;  3F7Y C;  4FPP A;  1AI5 A;  1KKD A;  5L3G A;  1OCR C;  2M7W A;  1YHQ V;  2EIJ C;  1KD1 W;  1JQ0 A;  1YTF B;  1MAB G;  3K79 A;  1GKF A;  1MOF A;  1R6K A;  2DQ0 A;  2WLK A;  4MS2 A;  3W7U A;  2H94 A;  2C2A A;  1AJQ A;  3FYI B;  3E8B A;  3IFX A;  3OGC C;  3SYC A;  3G4S V;  3WG7 B;  3ABM B;  2KB1 A;  1N8R W;  1S5H C;  3CD6 V;  4MTO A;  2UXX A;  1PD3 A;  2Q68 A;  3CCQ V;  4WF9 V;  1H8E G;  4LBE C;  3T4D A;  3WG7 C;  2HKO A;  3AG2 C;  4I5S A;  4WFA V;  2XAS A;  3OE7 G;  2ZR3 A;  4RAI A;  1FXV A;  2WLM A;  4P9O A;  1NBM G;  2DYS C;  4JAV A;  1QLE C;  3ZRW A;  1YI2 V;  1DLB A;  3AG2 B;  1K33 A;  4WFE A;  2IJI A;  5H9C A;  5B1B C;  2DYS B;  1OCZ B;  5CBG A;  1Q7Y W;  1PNM A;  3AG4 B;  2H8P C;  2Y69 B;  1RPO A;  3ABL B;  1K97 A;  4PA9 A;  5LHI A;  4LC1 A;  1F4N A;  4BAY A;  3QO5 A;  5HFL A;  1S72 V;  4UUJ C;  1RM1 B;  4BW5 A;  5B1A B;  4P9P A;  1BL8 A;  4RQF A;  1AR1 B;  1OCC C;  1SES A;  2F43 G;  3AG1 C;  4F4L A;  3ZMU A;  1S3J A;  1ROP A;  3RW0 A;  2JDI G;  2B1G A;  3TET A;  3CC2 V;  3CPW U;  4JTD B;  3ZRS A;  3D36 A;  2QA4 V;  1KEC A;  1VQ8 V;  3FKS G;  2WLL B;  3NXS A;  1E1Q G;  3ZMV A;  3TCU A;  3ASN C;  5IDJ A;  2QM8 A;  3CCU V;  4HYO A;  4PDV A;  4LP8 A;  3HPL C;  1S0V A;  2DYR C;  4MTX A;  1QBZ A;  4PEL A;  2EZO A;  1OCR B;  4MW8 A;  2X7R B;  1JOY A;  1H8H G;  5KA5 A;  4MTF A;  1YIT V;  1QVF U;  2MK3 A;  4KFM A;  4G28 B;  3LDE A;  4ASU G;  1AI7 A;  2IJK A;  5B1B B;  2WLI B;  3OAA G;  3T4Z A;  1VQO V;  4TSF G;  3CCR V;  3ZN0 A;  1V54 B;  3E8F A;  5EK0 A;  3KG2 A;  2X0L A;  1GTO A;  2P67 A;  3SPC A;  3STL C;  4GX0 A;  2OTJ V;  4PA4 A;  2EIM C;  4JPR A;  2Q69 A;  4H37 A;  2PI4 A;  4BIZ A;  1FXK C;  1GK9 A;  1B6Q A;  4LCU C;  4MVU A;  5B1A C;  3SYP A;  2EIM B;  2EIK C;  3ZN1 A;  4PA6 A;  1K5S A;  3BEH A;  1VQ4 V;  2QEX V;  3RVY A;  4WFB V;  1L1F A;  1JX9 A;  4EKW A;  3UM7 A;  3ETD A;  2GHY A;  1SET A;  3SPJ A;  2OCC C;  4I9W A;  4UVA A;  3B8N A;  1PNK A;  3SYA A;  1G8M A;  4R50 A;  4HZ3 A;  1AJN A;  1DF5 A;  4WFF A;  3CC4 V;  3JD3 A;  4TT3 G;  4UV9 A;  2W0F C;  3CCV V;  3WFV A;  2HFE C;  5DN6 G;  3JD1 A;  3CCJ V;  3OMN B;  3ZRV A;  1SER A;  3X2Q B;  5IYB O;  1WPX A;  1VQM V;  1Q86 W;  2D3O W;  1XL6 A;  2JJ2 G;  3ZMZ A;  1H2G A;  1VQ7 V;  4MVM A;  2YSU B;  3JYC A;  4XDJ A;  3AG1 B;  2ZXW B;  4RQE A;  3MHS C;  2ZDI C;  4TWK A;  4MVS A;  2IW5 A;  2ZDI A;  3AG3 B;  2YEV B;  1W0K G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...