3STZC

Kcsa potassium channel mutant y82c with nitroxide spin label
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
102
structure length
102
Chain Sequence
b'ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 44
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3stzC00
3FB7C 3R65A 3E8FA 4RO2A 3UM7A 1G4YB 3ABKC 2QTOA 1ORQC 2WLIA 2ZXWC 3FB6C 3LUTB 2JK5C 5E1AC 2WLIB 4BW5A 2DYRC 1P7BA 3ABLC 3SPGA 4MVZA 1OCOC 3KG2A 4UUJC 2AHYA 3K0GA 1V55C 1OCZC 2ZD9A 4KFMA 4MVUA 4X89A 4QNHB 2A9HA 5KUMA 1R3JC 1V54C 3BEHA 3X2QC 2X6BA 4F4LA 3STLC 4XDJA 3F7VC 3RBZA 1QLEC 4CBCA 3SYOA 4MVOA 2BOBC 3VOUA 4G28B 4RUEA 4P9PA 5CBGA 4WFGA 3SPHA 4WFEA 3E8HA 3ZJZA 4MW3A 4MW8A 2EINC 3AG1C 4MTFA 4X8AA 3RW0A 3SJQC 2EIJC 5IY5C 2X6AA 4XDLA 3SYAA 5EBWC 4QE7A 3IGAC 4R50A 4RUFA 5EBLC 4MVSA 2KB1A 4MVMA 3SYCA 4P2ZA 4J9ZB 4TWKA 3WG7C 4GX2A 4H33A 4MVQA 5B1BC 3PJSK 3T1CA 3AG2C 5CBFA 4OXSA 3E8GA 3ZRSA 3K0DA 4RAIA 1S5HC 3FB5C 4GX0A 2HVJC 4MS2A 3OUFA 3T4ZA 3K06A 2HVKC 4JTAB 4QE9A 5BZBA 5KUKA 4H37A 4EKWA 3OUSA 1R3LC 2P7TC 2ATKC 4PA4A 4ZBMA 4LP8A 5B1AC 2Q67A 4PDLA 2OCCC 2Y69C 3F7YC 1M57C 4LBEC 2HG5C 2R9RB 1LNQA 2A79B 2IH3C 3F5WC 4GX1A 1ZWIC 2K1EA 3E8BA 3K03A 4HZ3A 3ASOC 3RVZA 3STZC 2AHZA 3K04A 2BOCC 4WFHA 3LDCA 3JYCA 1OCCC 2HJFC 4PDMA 1JVMA 2YEVA 3SYPA 2EIMC 3TETA 3OR7C 4MTOA 4PA9A 4R7CA 4JTCB 4PA7A 3FB8C 4WFFA 4I9WA 2EIKC 2ITCC 2DYSC 3IFXA 4X88A 5J9PC 3UKMA 1R3KC 1K4DC 2EILC 1K4CC 1OCRC 2QKSA 2DWEC 2WLJA 2WLHA 2X6CA 2WLLA 3E86A 4G27B 4P9OA 4PDVA 4DXWA 3RVYA 2A0LA 2Q69A 1R3IC 2WLLB 3T2MA 1BL8A 4MTGA 3SPJA 3SPCA 2ITDC 3ASNC 5CBHA 2HFEC 3LDEA 5EK0A 2NLJC 4PA3A 3OR6C 4R6ZA 2Q68A 2Q6AA 3OGCC 4JTDB 3LDDA 1KKDA 5EBMC 3SPIA 3K08A 2WLNA 4PDRA 3T4DA 1M56C 2IH1C 3LNMB 4MVRA 3ABMC 3AG4C 4MSWC 1XL6A 4GX5A 4P30A 3E83A 3GB7C 3E89A 3EFFK 2DWDC 4PA6A 2WLMA 4LCUC 4HYOA 3SYQA 2W0FC 4XDKA 1XL4A 4R8CA 3TCUA 3AG3C 5EC1C 1J95A 2H8PC 2WLKA 5EC2C 4J9YB 5B3SC 3HPLC
chains in the Genus database with same CATH superfamily
4LF6B 4TV8A 2WWWA 3ABKC 4UXNA 4Z2WA 4JI4O 1IBKB 4NTWA 2GDSA 4NXMB 3SPGA 3O9OA 1P49A 2IJJA 1BT8A 2ZD9A 3X2QC 4IGGA 3TK1A 2H94A 4FFBA 2QGNA 2EIKB 4UVCA 1SQFA 3SPHA 1GMGA 1VQ7V 4B3TO 4DV5O 1K3EA 1YJNV 5EBLC 4X20A 3SYCA 4YXWG 3JARB 1VF5B 4XBFA 4X62B 4OXSA 3I56V 2DJVA 4O4LB 5FLXN 3VQYA 3G71V 4K0KB 3D36C 4JI5B 4JI8B 4PELA 2QTSA 2CTQA 2LW7A 5E79Z 5B1NA 4U7NA 2VWKA 3HKBB 2HHHB 3TETA 4CH3A 2LGWA 1GTOA 3H1IH 3VQVA 4AHCA 4WBNA 3K9AA 3UCSC 1FXKB 1ZX3A 2WLLB 4DR1B 3ASNC 5EK0A 4PA3A 2Q7GA 2Q6AA 3NR7A 2OCHA 4JTDB 4KL1A 1S3JA 2LGQA 4UCSA 4UCTA 4GKKB 1XL6A 3P30A 1YHQV 3IJ4A 2JVDA 1N8RW 1WLEA 2UXNA 3M7MX 2B9ZA 3R66A 4NB5A 4RQEA 1K97A 1VMGA 2H8PC 1IZ3A 3CMAV 5KHGA 3KCYA 4I9QA 5BR8O 5LHGA 3ETEA 1NJIW 2KSDA 2ZDIC 1M57B 2ZKOA 4TOIA 2ZR3A 1SRYA 3JATA 4LR3A 3DC6A 1KUQA 1EZVH 1YSCA 2A9HA 3BEHA 4FJCC 3I55V 4B08A 5J2TB 1Y66A 3F7VC 3RT3C 4RWUA 4ZHQB 3BAAA 3HKEA 1XDCA 5CA0B 1FPOA 2X6AA 5DN6G 3DGEA 4TV8B 4UB6Z 4MVMA 2YSUB 1FD9A 2XASA 1Y76A 1M9NA 1SQGA 3RYCA 2ZQMA 4LF8O 5CB4B 5LMUB 3RYFB 1QCEA 5CA3A 1OCCB 3OW2U 4QE9A 4EKWA 4AILC 2HG5C 2A79B 4J11A 5JQGA 1OCRB 3KCXA 3K03A 5D5PA 1F23A 1SA0B 4IIJA 2Q7EA 5IJ0A 2HJDA 3E22A 1PNKA 4A5UB 2PF4E 2QKCA 2UXCB 4FIPC 1PL0A 4DR6B 1AI5A 4X64O 2YI8A 2R9IA 1YIJV 1UFIA 1BSMA 3A0RA 1UPGA 4O2BB 5DM6V 4FZ0A 1H2NA 1PV0A 2IW5A 3JCZA 4DR4B 5LGNA 3ZMZA 2VQEO 4JYBA 3WG7B 3ZRWA 5B1BB 3TJTA 4DUZB 4JI6O 2W0FC 3CRQA 4JI0O 3JAWA 2VQFO 3UT5A 4FLYA 5B3SC 4Z1MG 2AXTZ 2ZIOA 4LF6O 1ORQC 5B1AB 4Q20A 2X7RB 2DYRC 3ABLC 1IBKO 1ZSPA 1N0NA 1XUQA 3CCUV 1R3JC 3L70H 4DYLA 1XREA 2EBOA 3SYOA 2AZ2A 4G28B 2CAZC 3GVMA 4DRXA 5KLVH 1U97A 3Q4HA 2EIJC 5IY5C 2QEXV 2JS3A 3H1JH 3CMEV 1N36O 4HAMA 4ZOLA 4B3RO 3CCLV 5CBFA 5KMGA 3JATB 2QR4A 4PI0A 2GTSA 4X62O 4WFBV 4I0XB 2W0XA 3OFNG 3HKCB 4K0KO 1G1XB 3F7YC 4JI5O 2R9RB 4JI8O 4HZ3A 2ZINA 2YEVA 2Y4UA 4LF9B 2ETNA 3FD9A 4CZZA 1Y4MA 1OHHG 4CS2A 4B3SO 2CTPA 3UKMA 1NR1A 1K4DC 2NNUA 4DV0O 1XNRB 1XHZA 1Q6HA 4TT3G 2ZE7A 3ZMSA 5LXTA 2X6CA 5IDJA 1N34O 1HNWB 4DR3O 4YIOA 1HNXO 4NTYA 4X65B 4O2AA 1AB3A 2XT9A 2Q68A 1YVWA 3QG5A 1P84F 4E4EA 3E22B 1J5EB 4O4JA 5LHIA 1AILA 3SJAC 4GKKO 3WB1A 4DUYB 4JAVA 2XAGA 2LQTA 1VIBA 2YUAA 3AG3C 2BTQA 3PN1A 4OPHA 4EB6A 1IX9A 1JMKC 3AK1A 3EXAA 1QLEB 4GYCB 4DV2B 4BIUA 3QNEA 5E1AC 3RYIA 2GUZA 4EFBA 5H6RA 2PI5A 4UUJC 2Y48A 3ZRWB 4YJ2A 2C2AA 1JX9A 4U3JA 1M1KW 3BHPA 3AG1C 3QF7A 1NZ6A 4TV9B 3SYAA 5EBWC 2FYUH 2E74B 1JPXA 1PP9H 2PY5A 1WPBA 5IYCO 1R1BA 3PJSK 5C8YA 3K3WA 1TUEB 5FNVB 1Y74A 5LMUO 1VQ6V 4LF7O 2RJZA 2ZR2A 5EYPB 2P5OA 4ZBMA 5LOVA 4PDLA 1COWG 2EJRA 4J7ZA 3BFRA 4PDMA 1I0HA 2R70A 1I94O 3OD4A 1SZTA 1SKVA 4JZ2A 1PNLA 1H2GA 2QM7A 2UXCO 2GBOA 1QNMA 2Z0AA 2Q9LA 3E86A 1OCZB 4JYAB 3UQ8A 2LJ2A 3OGCC 2P06A 1FJGO 2EX3A 3BRCA 1VF6C 4LF4B 3WFVA 2MW2B 1G6UA 3CHXA 4D7TA 4DR4O 3AK2A 1VF7A 5EIBC 1XBLA 1Q8IA 1XEQA 4B3MO 1CEZA 4I5SA 1ZTEA 2ADPA 4DW0A 1MG1A 2QTOA 4LFAO 5B5EZ 3W7XA 4FM2A 2WLIB 2E5LB 2RNBA 2XAHA 3L74H 1NS1A 4D7SA 2L35A 2CTRA 4O4JB 3RBZA 4CBCA 2KKWA 3VOUA 1CPYA 2QJ1A 3E8HA 3HB3B 1Q81W 1YITV 2P4KA 1I7FA 2KG7B 3JARA 2QWQB 3ZRXA 3CRCA 4TQFA 4JF3A 1PPJH 3RYIB 2Z5UA 3E8GA 4D6TH 4X66B 4O4LA 1X59A 4RAIA 1XMOB 4GLXA 2GSMB 2HVJC 4WCEV 4JYYA 2F1MA 1YTFB 2ATKC 1WB8A 4LBEC 3B4SA 2DMXA 3HKBA 1IBMB 3LDCA 4N23A 1NTZH 1DK1A 1JR9A 5EZYB 2JEXA 4LF9O 4PJ0Z 2PYLA 2QKSA 2PYJA 1Y74B 2WLLA 3OMIB 2A0LA 2UUCB 1DGSA 2Q0OC 5C93A 4TQDA 2CGNA 3GWKC 2AGAA 1Q86W 1VQ8V 1SQPH 1V9PA 5JVDA 1R6NA 1VEWA 3E83A 4FMTA 1J5EO 2DWDC 4K8XA 4JV5B 5LGTA 2A3QA 1XL4A 2M6YA 1OCOB 1RPRA 1BE3H 2JS5A 4ICGA 3CCJV 1SQBH 1IXBA 2LO1A 1KBHA 1SZXA 2YIDA 3FB6C 2ZT9B 4DV2O 3SGIA 3A0HZ 3OEEG 2CTWA 5J2TA 4JI7B 2BOBC 4BW9A 5FPOA 4ZHQA 1S76D 1US6A 4K8ZA 4KHPB 3IC7A 3LSSA 1TAEA 4P2ZA 4MVQA 3ABTA 5CB4A 3JD3A 3RYFA 1Q3EA 1AVMA 1ENVA 4GX0A 3OUFA 1W0JG 2FTKA 1QQCA 1HWYA 3OUSA 4I55A 2Q67A 3G6BA 2DW4A 4MVOA 4BWAA 1SA0A 3K57A 4GX1A 4EEQA 1N33O 3THOA 1SQVH 1OCCC 3CE2A 1QHTA 2P90A 2ITCC 2DYSC 4B7EA 4K3AA 4KXRA 1OCRC 3CCQV 3CP1A 3BY6A 1V54B 4L8JA 1R3IC 2N74A 2JDIG 4J42A 4O2BA 5GW7A 5K1XA 2HFEC 3BCCH 1MNGA 5LBQA 2EZOA 3WB2A 4ZIBA 2YDEA 2WLNA 3OT7A 2CE4A 3TXSA 4LF5O 1P4RA 4RQFA 4KUMA 1GH6A 1XHXA 1TVKA 3OEHG 4F6EA 5GTIZ 1J95A 2DQ0A 4H13B 2ADQB 1PM9A 1H8HG 3H1KH 3L75H 1HNZB 3SDLA 1R73A 3T1YB 3AEIA 1KKCA 2E5LO 1V55C 2FMLA 3D3QA 3CPWU 2D3OW 5JVDB 2ODMA 4ABMA 2WAMA 1NR7A 3AG2B 1GKFA 3P32A 1RM1B 1K92A 2VRZA 4JAUA 1D5AA 5IYZA 1VQ5V 1OV9A 1QVFU 1XILA 1BS3A 2E3CA 4GT1A 4MTFA 4UVAA 2EULA 4DV3O 4NYKA 4QPKA 1XNQO 4MVSA 4JI2B 1Q6UA 2IJHA 1SETA 1MABG 1YF2A 4I0XA 1YTFD 3K5MA 4JI3O 1D5NA 5KUKA 1XMOO 1KP2A 5LMNB 3HKCA 2JJ2G 5JCOA 4YIPA 4O4IB 1I5YA 4LP8A 1FKAO 3F5WC 3E8BA 2WPDG 3ASOC 3K04A 4DK0A 5CMUA 4FLUA 3SYPA 1IBMO 5H2FZ 3ABKB 1JJOA 2QA4V 2JJ1G 2YICA 3QO5A 4DR5B 3L71H 1O9GA 2WLHA 3H9VA 1WAZA 3N2GB 1I5XA 3X2QB 4I55B 4E2LA 2UUCO 3CSXA 4GCZA 3CX5F 1M56C 3DXRA 4DR7B 4UV8A 4DW1A 1CXZB 2ZNIA 3FYEB 2HEPA 4JV5O 2IJIA 1RFYA 4NR1A 3FFQA 3J81N 3M99B 3ZHTA 3JAMN 2XUMA 3CXHF 2UU9O 2E75B 3CYOA 1SESA 4LNUB 2EINB 1NBMG 4IHJA 3JSNA 2DE0X 4FM1A 3B8MA 3JD2A 2QM8A 2CH7B 4H44B 1K73W 1QLEC 5H6QA 2W6JG 3L9DA 1PD3A 1TVKB 4JI7O 1K5SA 5CBGA 5IT9N 4G2KA 4TV9A 1GM8A 1MSWD 3P3PA 4GUNA 3SJQC 3G67A 5L3CA 3BPZA 4GX2A 4I4TB 2Y69B 1AI6A 1DLBA 4O4HB 1A32A 5L3BA 5FNVA 3KZIZ 4UFZA 3IC9A 1S5HC 4QJFB 3RYHA 4NXMO 5EYPA 4MS2A 1GN6A 3K06A 1K33A 1R3LC 5JJNB 2E76B 2OCCC 5LP6A 1BHBA 3JD4A 5IYZB 3G4SV 1RSOA 3B8NA 2UUBB 4L87A 4WFAV 1JVMA 2YXLA 2YI9A 2EIMC 1XI1A 3OR7C 4IT5A 1GRJA 5LA6A 4WFFA 2W6IG 3OE7G 3IFXA 1YI2V 2ZE8A 2CGOA 4B7KA 1Q90D 2EILC 5KHIA 2RQ6A 1KP3A 5L3FA 4DXWA 3CRMA 4G27B 2ZE6A 4CS4A 3OGIB 1OZ0A 1EBOA 3ZHRA 3GWOA 4LH6A 4X1YB 3AG4C 4DR2B 4FVMA 2HHHO 2A06H 1B6QA 3BABA 2PI4A 1BQZA 1ZAUA 4XDKA 3TCUA 2AW9A 2YC0A 2D2CB 4X1KB 1D2DA 2HR3A 2PZSA 4RO2A 4X1IA 4DR1O 2WLIA 1HP8A 2PGGA 2QM4A 2Y0IA 3CRRA 1E1QG 3G80A 4YHHB 1VQKV 1WP7A 1L0NH 2IJKA 1HNZO 2YXHA 2ZM6B 3DXRB 4KFMA 2P22C 3DTUB 5B66Z 5IE9A 5LYJA 3APOA 4WFGA 3U0ZA 3CCRV 2FB5A 2MK3A 1SERA 5AG2A 2KG7A 2XTAA 1RP3B 4FFKA 4BIOA 4CH4A 1MZFA 3C90A 3N2KB 2IBZH 1WB7A 4FLXA 3K0DA 4IHJB 3TGUH 1K7DA 5LL6Y 2OWOA 1NTMH 1O9HA 5IJ9B 1JOYA 2HP8A 4JYCA 5LMNO 2YIAA 2NN4A 1S0VA 1KMIZ 5B3SB 1N32B 4MTOA 1ZLZA 5EZYA 4AQYB 4X88A 1K4CC 3ABMB 3RYHB 1KD1W 2CDYA 5BY1A 3RVYA 3VQXA 2ITDC 2NLJC 5KA6A 4W4KA 5LP6B 4J7JA 1WP8A 1RSOB 3K08A 4PDRA 2ZCEA 4J41A 5IY5B 1EN6A 4DR7O 5LA6B 1WNSA 4DV7B 1JCHA 4LWSA 3CCSV 4DR6O 1N4CA 1SS3A 1L8DA 3U10A 1OJHA 2RDCA 3E8FA 2VS0A 1KC8W 3CEIA 3MHSC 2ZXWC 3LUTB 3CS5A 5L3GA 1EN4A 1OCOC 4MVZA 2O57A 2GTAA 5HFMA 2ILMA 3SJBC 3FYIB 3UO2A 4P9PA 4DUZO 2DOSA 4CC6A 4UCRA 5IWAB 2CUGA 4XDLA 1JJ2U 4I50B 4QE7A 4NTXA 4X1IB 3ICXA 5L3EA 4TWKA 4H33A 2QKAA 1G8MA 1LUWA 3T1CA 3ZEDA 3E2EA 4HNAB 1XMQB 1AR1B 2P67A 3JD0A 3AG7A 3OTOB 1S77D 2V7QG 3W7UA 4TUYA 5LYJB 2F23A 1IURA 2IH3C 3AG3B 3CC4V 3STZC 2AHZA 4GKJB 2BE3A 3JYCA 5GTHZ 1AR5A 5CA1B 3FB8C 1BCCH 2Q73A 2EIKC 5JH7B 4J7KA 2PUSA 4P9OA 1THZA 5BR8B 4JASA 5KHJA 2GV9A 3D8CA 1MSDA 3OR6C 1HDJA 1KKDA 2P6JA 3SPIA 1M4UA 3AG1B 3S3XA 2DN9A 4JI1B 3UO3A 4HYOA 1EZJA 3NXSA 3SR2C 1M90W 4FLVA 5KAFZ 3K5NA 5EC2C 1XNRO 3FAVB 3FB7C 1L1FA 3CC2V 1F7YA 1HNWO 5HFLA 3K5LA 3ZMUA 4X65O 1Q82W 1BGYH 2P4VA 1NTKH 3E35A 4N21A 3W7WA 5DECA 1FXKC 5KUMA 2ZM6O 2JGDA 1FFXB 3CCEV 3U11A 4AI8A 4LWSB 2N05A 4DUYO 3QVNA 3B77A 1URFA 3RW0A 4DV1B 4DV4B 1K9MW 2KB1A 1U96A 4J9ZB 2UXBB 4TSFG 3C3TA 4U7OA 2WA4A 3AG2C 4X64B 2F4VB 3B09A 5KX5B 5IYBO 3ZX6A 4JTAB 2NR5A 1NI8A 3JAKA 4O4IA 2L6LA 2QWOB 1SQXH 1M57C 1FAFA 3A0BZ 1ZWIC 1NQTA 5B1OA 3ZHUA 1MOFA 4BIZA 4J10A 2VWJA 1KB9F 1FFTB 2VQEB 1YCIA 4PV1B 4JTCB 4JI6B 2BSKB 3F5TA 2VQFB 1HW7A 2OIEA 3N2GA 1AI7A 2DWEC 1Q5OA 4X9QA 1BZKA 3CJHA 5TISZ 3LDEA 1AR4A 4TUYB 1DF4A 2B5UA 3LDDA 1S72V 1AI4A 4J80A 2UXDB 1XOUA 2WA3A 4MTXA 4OX9B 3EFFK 1YDXA 1KQSU 5GONB 1F4NA 4F6RA 4DV7O 1S5JA 5EC1C 4UCVA 4J9YB 2ZE5A 3H1HH 2YIBD 1N36B 3D36A 4JYAO 2F93B 4OGQB 4B3RB 1ZL8A 4LNUA 4UCOA 2K9PA 4PI2A 1L0LH 4BW5A 4NKGB 1YEWA 2CH7A 2AHYA 3K0GA 4MVUA 4LF4O 4QNHB 1JFFA 2QWNB 4XDJA 1P7GA 2EJ7A 5KHKA 5L3DA 3I5DA 3ETGA 4YJ3B 5KHHA 2EINC 4X8AA 3CXCU 3N27A 1EFRG 5IWAO 5F2VO 4I4TA 3RWRD 1AJQA 2OYQA 3K5OA 4O4HA 3WG7C 3OTFA 5B1BC 1MA1A 4B3SB 3CWBH 1H2KA 4DV6B 4UCUA 1W59A 4DV0B 1NKDA 5A2QN 2V4DA 4JGSA 4Q6GA 3T4ZA 1N34B 2HVKC 5BZBA 4DR3B 1HNXB 1H2MA 3ZMVA 1ROPA 3WB0A 2JGDB 4PA4A 1XMQO 5B1AC 1TUBA 4FZ1A 4FLZA 1Y6XA 2Y69C 3JALB 4FM0A 3OTOO 2K1EA 3HR0A 2JIZG 4ASUG 4GKJO 4PA7A 3ZHQA 2ZDIA 2RCVA 1VQOV 1GM7A 4FPPA 2LFRA 2QDOA 1WN7A 1PKXA 4KP4A 4X66O 2LP7A 4PDVA 1AROP 4U3FH 2QWPB 1QR9A 4I7ZB 4NXNB 3JAKB 3P3NA 2HKOA 3ZHSA 1AJPA 1H2LA 4X1YA 5H5NA 2ARHA 2YXYA 4UVBA 2EZPA 1ZUQA 2Q7HA 4PA6A 4JI1O 2JGUA 5JCOC 2Q4PA 4IYHA 4X1KA 5H9CA 1TA8A 2YS8A 3ZCCA 3CC7V 3CJHB 3R65A 4CC5A 4ZI7A 2F43G 1DTOA 5LHHA 4BAYA 2XAQA 5IYDO 2CK3G 4LF7B 3G6EV 1AJNA 4BR6A 2B1GA 3CRAA 5FPRA 4LFCB 3M8AA 4FFBB 5KA5A 4RUEA 2DYSB 4F6RB 3VQWA 1B06A 4MW3A 4IL6Z 4DV1O 4DV4O 3OAAG 3N2KA 4K35A 1I94B 5JJJB 1S5LZ 1ZL8B 4X20B 2UXBO 1KECA 2N04A 4LC1A 3S3WA 5EIBD 3ZS8C 2F4VO 1Y67A 5IJ9A 1NVPD 1WPXA 2R72A 1JFFB 1W0KG 3A2FA 1YJWV 2P7TC 3RFRA 1H8EG 2V1DA 3QO7A 3L72H 1FJGB 3APQA 3SYQA 1R6TA 4YY3B 3RVZA 1E79G 4W4LA 4KHPO 3VBBA 3ASNB 2Z3YA 4B3MB 4CH5A 1YXBA 3QO8A 2OT5A 4UB8Z 5KAIZ 3T1HB 2BCCH 2GHYA 2IU0A 1V55B 3ZRVA 1SQQH 4WBNB 3T2MA 2AZ0A 4LFAB 1BL8A 1VQPV 1VQ4V 1Z5VA 3EVKA 1TUBB 3LSUA 1H38A 2Q5ZA 2H3OA 3LNMB 3ZHVA 3ABMC 1N0JA 4MSWC 5FL7G 3W7SA 4GX5A 2BTOA 4P30A 5K1PA 3E89A 2UXDO 2WLMA 2JEUA 4H0LB 4OX9O 3HKDA 5LP6C 2OTJV 4QGPA 4LFBB 5BMVA 1VP7A 3K79A 1FXVA 1K8AW 2YIBA 2JRIA 3H01A 3KKYA 2M7WA 1GN4A 1PNMA 5CN0A 4QPJA 4PD4F 3ASOB 2IU3A 3KG2A 1OCZC 4C7UA 1Z5WA 1W2BU 3WU2Z 3C3SA 3J7AU 5ITZA 4IYIA 4I50A 3HKEB 3ZIAG 4HBNA 3OMAB 4Z1VA 1E1RG 4ZI7B 2XAJA 2XHBA 1M93A 1Y76B 3FKSG 3ZRSA 3RYCB 4DV6O 4HNAA 3T1YO 1QBZA 1M56B 2RN9A 3MDSA 1IXMA 1T5EA 4ZKIA 3CCVV 4R8CA 5JQGB 3ZMTA 3CCMV 1GAXA 4IIJB 5IJ0B 2BOCC 4WFHA 2HJFC 3OMNB 4MT8A 3ZN0A 5CA1A 3MHHC 4R7CA 2WSSG 4JI2O 5JH7A 1R3KC 3LSQA 1KYOF 1VQNV 1AP6A 2IM9A 3FX7A 2HLDG 1Q43A 5CBHA 4NXNO 1IDSA 1CP9A 2A7WA 2IH1C 1HR0B 4CS3A 1NT2B 1YZBA 1WA8A 1IBLB 2PTMA 1SC5B 4LCUC 3AK3A 3BVOA 2B1IA 2UUAB 2DYRB 2OTLV 1QU7A 3ABLB 4DR5O 3FAVA 1LR1A 2F66C 3JAWB 2XOKG 3UT5B 4LH7A 3UM7A 1G4YB 1M5IA 4JI4B 1B3QA 1NH2B 2XNDG 3J80N 5LGUA 5J2UA 2R9AA 1FXHA 2JK5C 2OCCB 2DQ3A 3JD1A 2EIJB 1P7BA 4X89A 3JSLA 1FFXA 2EIMB 1KU9A 3ETQA 4F4LA 3STLC 1BMFG 2F95B 3DSQA 1SF9A 2FL4A 3LNNA 3BA9A 1N33B 1QLNA 2G38A 4LFCO 3HKDB 4B3TB 2EILB 4MW8A 4DRXB 4DV5B 1I08A 3Q4HB 4UV9A 5BMVB 3IGAC 4RUFA 2X0LA 1JA8A 3H1LH 4ZOLB 1GN3A 5KX5A 1MZEA 1VF6A 5DEDA 3FB5C 5KMGB 3AG4B 2QWRB 1AP5A 1K5QA 4QIWF 4WF9V 1VQMV 1GO3F 1R6KA 3EHBB 2Y4TA 1GK9A 2XAFA 1LNQA 5ITZB 4OPAA 3JASA 1FS0G 4LF5B 4YY3O 4GZRB 1IVSA 1H2SB 2Q8VA 2YEVB 2BSKA 3ML0A 3W7TA 4I9WA 1BQ0A 4CH6A 4DK1A 5JJEB 1Q7YW 1PL4A 2WLJA 1YJ9V 3A8TA 4FK5C 3T1HO 2QSAA 5LXTB 2Q69A 3ZN1A 3OM3B 4O2AB 1QR8A 3ETDA 2ZNJA 1EN5A 4JPRA 3RGBA 4MVRA 2UUBO 1NU1H 1FYJA 3GB7C 5GONA 3B40A 2WLKA 4DV3B 2BTQB 3B2EE 1XNQB 1XQ8A 4EB6B 2UXXA 5JWPA 4FLTA 4LFBO 2ZIMA 1MMMA 4FLWA 1VQ9V 4PHZA 4JI3B 2GUZB 3K59A 3ZBHA 1V54C 1WA8B 2X6BA 1VQLV 4DR2O 1LUVA 3SJCC 4DO2A 5A9GA 1TGOA 4YJ3A 1Z2GA 4YJ2B 4WFEA 3ZJZA 4U3JB 1GN2A 2LW1A 4R50A 1QVGU 4JAAA 1DF5A 4LF8B 1F4MA 5J2UB 4YHHO 5D5QA 1K34A 3MAQA 2QE7G 5C8YB 3MD0A 1UJWB 4JZGA 2OIGA 4EFEA 1FXKA 2Q0AA 3O65A 4H37A 3CB2A 3CD6V 3JALA 5BXZA 3JCUZ 5LOVB 3L73H 3BA8A 1GM9A 2RMKB 3RN4A 4PA9A 1X4TA 4NVPA 2ZXWB 1RM1C 3IAYA 5J9PC 1VARA 1BHAA 1EM1A 3K58A 2KQXA 4MTGA 1F51A 3SPJA 3SPCA 1WJZA 1NVPB 2UU9B 2Y0PA 2LFSA 4R6ZA 1B04A 5EBMC 3QTCA 3T4DA 2FKXA 3DC5A 3JASB 3ABUA 1N32O 3TXQA 3K9SA 1JQ0A 1HR0O 4AQYO 3D3IA 1IBLO 4JI0B 1Q6IA 2UUAO 1NH2D 5CA0A 1RPOA 3HPLC
chains in the Genus database with same CATH topology
2HR3A 2WWWA 3R65A 4RO2A 1MG1A 3ABKC 2F43G 2QTOA 1DTOA 5LHHA 2WLIA 4UXNA 3W7XA 1E1QG 1VQKV 2WLIB 2XAQA 4BAYA 2XAHA 5IYDO 2IJKA 3SPGA 2CK3G 2IJJA 4KFMA 2ZD9A 3G6EV 1AJNA 3DTUB 3X2QC 2B1GA 3TK1A 2H94A 3RBZA 4CBCA 3VOUA 1CPYA 5KA5A 4RUEA 2EIKB 2DYSB 4UVCA 4WFGA 3SPHA 1GMGA 3CCRV 3E8HA 4MW3A 1VQ7V 2MK3A 3HB3B 1Q81W 1YITV 1SERA 3OAAG 1YJNV 1K3EA 5EBLC 3SYCA 3ZRXA 4YXWG 4JF3A 4XBFA 4OXSA 1KECA 2Z5UA 3E8GA 3I56V 3K0DA 4RAIA 4LC1A 1K7DA 2GSMB 2HVJC 4WCEV 3G71V 1NVPD 1WPXA 1W0KG 1YTFB 1JOYA 1YJWV 2P7TC 2ATKC 4JYCA 1H8EG 2V1DA 3QO7A 4LBEC 3SYQA 4PELA 3RVZA 5B1NA 4U7NA 1E79G 1S0VA 5B3SB 3LDCA 3VBBA 4N23A 3TETA 3ASNB 4MTOA 2Z3YA 2JEXA 4X88A 3QO8A 1K4CC 2OT5A 2QKSA 3ABMB 1GTOA 2GHYA 2IU0A 1V55B 2WLLA 3K9AA 1KD1W 3ZRVA 1FXKB 3OMIB 2A0LA 3RVYA 2WLLB 3T2MA 1BL8A 1VQPV 2ITDC 3ASNC 1VQ4V 5EK0A 2NLJC 4PA3A 5KA6A 2Q6AA 4JTDB 5C93A 1H38A 3K08A 1Q86W 4PDRA 1VQ8V 1S3JA 3LNMB 5IY5B 3ABMC 4MSWC 1R6NA 1XL6A 4GX5A 5FL7G 4P30A 3W7SA 3E83A 4FMTA 3P30A 1YHQV 3E89A 2DWDC 2WLMA 2JEUA 1JCHA 5LGTA 1WLEA 3CCSV 1XL4A 2UXNA 4RQEA 1N8RW 1K97A 1OCOB 1RPRA 2H8PC 2OTJV 3CMAV 3K79A 3CCJV 3E8FA 1FXVA 1KC8W 1K8AW 5LHGA 3ETEA 2ZXWC 3FB6C 3H01A 3LUTB 2M7WA 3MHSC 5CN0A 1PNMA 2ZDIC 1M57B 4QPJA 5L3GA 1NJIW 2ZR3A 1SRYA 3OEEG 3ASOB 4MVZA 1OCOC 2IU3A 3KG2A 5HFMA 1OCZC 1YSCA 2A9HA 3BEHA 4FJCC 3I55V 1W2BU 1Y66A 3F7VC 3FYIB 2BOBC 4P9PA 1S76D 2X6AA 4XDLA 1JJ2U 3IC7A 3LSSA 5DN6G 3DGEA 4QE7A 3ZIAG 3OMAB 1E1RG 5L3EA 4MVMA 2YSUB 4P2ZA 2XAJA 4TWKA 4MVQA 4H33A 2XASA 3ABTA 1M9NA 1G8MA 3T1CA 3JD3A 2ZQMA 3FKSG 3ZRSA 1QCEA 5CA3A 1ENVA 1QBZA 1M56B 3E2EA 1OCCB 4GX0A 3OW2U 3OUFA 1W0JG 4QE9A 2FTKA 1IXMA 1AR1B 2P67A 4EKWA 3JD0A 1HWYA 3OUSA 1S77D 2V7QG 4ZKIA 2Q67A 3W7UA 3CCVV 4R8CA 2DW4A 4MVOA 2HG5C 2A79B 4GX1A 2IH3C 1OCRB 3AG3B 3K03A 1F23A 3CC4V 3STZC 3ZMTA 3CCMV 2AHZA 2BOCC 4WFHA 3JYCA 1OCCC 2HJFC 3OMNB 4MT8A 1PNKA 3ZN0A 3MHHC 4R7CA 3FB8C 2WSSG 4FIPC 2P90A 2EIKC 2ITCC 1PL0A 2DYSC 1AI5A 1R3KC 3LSQA 1OCRC 1VQNV 3CCQV 3CP1A 3BY6A 4P9OA 1V54B 2R9IA 1R3IC 1THZA 2JDIG 1YIJV 4JASA 2HLDG 5GW7A 5CBHA 2HFEC 3A0RA 3OR6C 5DM6V 1CP9A 5LBQA 2EZOA 1KKDA 2P6JA 3SPIA 2WLNA 3AG1B 2IH1C 2IW5A 3JCZA 5LGNA 1P4RA 3ZMZA 4RQFA 4KUMA 4JYBA 3WG7B 3ZRWA 5B1BB 4LCUC 4HYOA 2B1IA 2W0FC 3OEHG 2DYRB 1EZJA 3NXSA 2OTLV 3ABLB 1M90W 1J95A 2DQ0A 5EC2C 2XOKG 5B3SC 4Z1MG 3FB7C 1L1FA 3CC2V 3UM7A 1G4YB 5HFLA 1H8HG 2XNDG 1NH2B 3ZMUA 5LGUA 1Q82W 1ORQC 5B1AB 1FXHA 2JK5C 2OCCB 2DQ3A 4Q20A 2X7RB 1R73A 2DYRC 3JD1A 3AEIA 2EIJB 1P7BA 3ABLC 3E35A 4N21A 4X89A 1V55C 3W7WA 3CPWU 2D3OW 1FXKC 1R3JC 5KUMA 3CCUV 2EIMB 4F4LA 2EBOA 2WAMA 1NR7A 3STLC 3CCEV 1BMFG 3SYOA 3AG2B 1GKFA 3P32A 4G28B 1RM1B 1QLNA 1K92A 4JAUA 1QVFU 1VQ5V 2EILB 3B77A 3RW0A 4GT1A 4MW8A 4MTFA 4UVAA 2EIJC 5IY5C 1K9MW 2QEXV 4UV9A 4QPKA 3IGAC 4RUFA 3CMEV 2X0LA 4HAMA 2KB1A 4MVSA 4J9ZB 4TSFG 3CCLV 4U7OA 3AG2C 2IJHA 1SETA 5CBFA 1MABG 1YTFD 3FB5C 5IYBO 4WFBV 4JTAB 3AG4B 5KUKA 1K5QA 1KP2A 4QIWF 4WF9V 2JJ2G 3OFNG 1VQMV 1I5YA 4LP8A 1GO3F 1R6KA 3EHBB 3F7YC 1GK9A 1M57C 2R9RB 1LNQA 2XAFA 3F5WC 1ZWIC 1NQTA 3E8BA 4HZ3A 2WPDG 3ASOC 5B1OA 1FS0G 3K04A 1MOFA 4BIZA 5CMUA 2YEVA 3SYPA 1FFTB 3ABKB 2YEVB 4JTCB 4CZZA 1Y4MA 1OHHG 3ML0A 3W7TA 4I9WA 2QA4V 2JJ1G 3QO5A 3UKMA 1Q7YW 1NR1A 1K4DC 2NNUA 1AI7A 4TT3G 2DWEC 2WLJA 1YJ9V 3ZMSA 2WLHA 2X6CA 4FK5C 1I5XA 5IDJA 3X2QB 2Q69A 3ZN1A 3LDEA 4E2LA 3OM3B 1DF4A 2Q68A 1QR8A 2B5UA 3LDDA 4GCZA 1S72V 1AI4A 3ETDA 1M56C 4JPRA 4MVRA 4UV8A 5LHIA 3GB7C 4MTXA 3EFFK 4JAVA 2XAGA 1KQSU 3FYEB 1F4NA 3AG3C 5EC1C 2WLKA 4J9YB 2IJIA 3D36A 2UXXA 1QLEB 3M99B 4BIUA 3QNEA 5E1AC 3CYOA 1SESA 2EINB 4BW5A 1NBMG 1VQ9V 5H6RA 2PI5A 4UUJC 2AHYA 3K0GA 3B8MA 4MVUA 3JD2A 2QM8A 4QNHB 1V54C 2X6BA 2Y48A 1VQLV 4XDJA 4DO2A 1K73W 1QLEC 3ZRWB 5H6QA 2C2AA 2W6JG 1PD3A 5L3DA 1JX9A 3ETGA 1K5SA 5CBGA 4G2KA 1MSWD 1GM8A 4WFEA 1M1KW 3ZJZA 2EINC 3AG1C 4X8AA 3SJQC 5L3CA 3CXCU 3SYAA 5EBWC 1EFRG 4R50A 1QVGU 1JPXA 1AJQA 1DF5A 3WG7C 4GX2A 5B1BC 2Y69B 5IYCO 3PJSK 1AI6A 1DLBA 1F4MA 5L3BA 3K3WA 1TUEB 1K34A 1NKDA 2QE7G 1S5HC 4QJFB 4JGSA 3MD0A 1UJWB 4MS2A 1VQ6V 3T4ZA 3K06A 2HVKC 5BZBA 1FXKA 2ZR2A 4H37A 3ZMVA 1ROPA 1K33A 1R3LC 4PA4A 3CD6V 4ZBMA 5B1AC 4PDLA 2OCCC 2Y69C 1BHBA 3JD4A 1COWG 3G4SV 2K1EA 2EJRA 3B8NA 4L87A 2JIZG 1GM9A 4ASUG 4WFAV 4PDMA 1JVMA 2EIMC 3OR7C 4PA9A 4PA7A 1SZTA 1PNLA 2ZDIA 4WFFA 1H2GA 1VQOV 2W6IG 2ZXWB 3OE7G 1RM1C 1GM7A 3IFXA 1YI2V 4FPPA 2LFRA 2QM7A 5J9PC 1PKXA 4KP4A 2EILC 1BHAA 2LP7A 1KP3A 3E86A 1OCZB 4PDVA 4G27B 4DXWA 1AROP 5L3FA 1QR9A 4MTGA 1F51A 3SPJA 3SPCA 1NVPB 2HKOA 2LFSA 4R6ZA 3OGCC 1OZ0A 1AJPA 1EBOA 5EBMC 3T4DA 3GWOA 3ABUA 3WFVA 3AG4C 4UVBA 2EZPA 1JQ0A 1B6QA 2PI4A 4PA6A 3D3IA 4XDKA 1CEZA 3TCUA 4I5SA 5H9CA 1NH2D 3ZCCA 3CC7V 1RPOA 3HPLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FB7 C;  3R65 A;  3E8F A;  4RO2 A;  3UM7 A;  1G4Y B;  3ABK C;  2QTO A;  1ORQ C;  2WLI A;  2ZXW C;  3FB6 C;  3LUT B;  2JK5 C;  5E1A C;  2WLI B;  4BW5 A;  2DYR C;  1P7B A;  3ABL C;  3SPG A;  4MVZ A;  1OCO C;  3KG2 A;  4UUJ C;  2AHY A;  3K0G A;  1V55 C;  1OCZ C;  2ZD9 A;  4KFM A;  4MVU A;  4X89 A;  4QNH B;  2A9H A;  5KUM A;  1R3J C;  1V54 C;  3BEH A;  3X2Q C;  2X6B A;  4F4L A;  3STL C;  4XDJ A;  3F7V C;  3RBZ A;  1QLE C;  4CBC A;  3SYO A;  4MVO A;  2BOB C;  3VOU A;  4G28 B;  4RUE A;  4P9P A;  5CBG A;  4WFG A;  3SPH A;  4WFE A;  3E8H A;  3ZJZ A;  4MW3 A;  4MW8 A;  2EIN C;  3AG1 C;  4MTF A;  4X8A A;  3RW0 A;  3SJQ C;  2EIJ C;  5IY5 C;  2X6A A;  4XDL A;  3SYA A;  5EBW C;  4QE7 A;  3IGA C;  4R50 A;  4RUF A;  5EBL C;  4MVS A;  2KB1 A;  4MVM A;  3SYC A;  4P2Z A;  4J9Z B;  4TWK A;  3WG7 C;  4GX2 A;  4H33 A;  4MVQ A;  5B1B C;  3PJS K;  3T1C A;  3AG2 C;  5CBF A;  4OXS A;  3E8G A;  3ZRS A;  3K0D A;  4RAI A;  1S5H C;  3FB5 C;  4GX0 A;  2HVJ C;  4MS2 A;  3OUF A;  3T4Z A;  3K06 A;  2HVK C;  4JTA B;  4QE9 A;  5BZB A;  5KUK A;  4H37 A;  4EKW A;  3OUS A;  1R3L C;  2P7T C;  2ATK C;  4PA4 A;  4ZBM A;  4LP8 A;  5B1A C;  2Q67 A;  4PDL A;  2OCC C;  2Y69 C;  3F7Y C;  1M57 C;  4LBE C;  2HG5 C;  2R9R B;  1LNQ A;  2A79 B;  2IH3 C;  3F5W C;  4GX1 A;  1ZWI C;  2K1E A;  3E8B A;  3K03 A;  4HZ3 A;  3ASO C;  3RVZ A;  3STZ C;  2AHZ A;  3K04 A;  2BOC C;  4WFH A;  3LDC A;  3JYC A;  1OCC C;  2HJF C;  4PDM A;  1JVM A;  2YEV A;  3SYP A;  2EIM C;  3TET A;  3OR7 C;  4MTO A;  4PA9 A;  4R7C A;  4JTC B;  4PA7 A;  3FB8 C;  4WFF A;  4I9W A;  2EIK C;  2ITC C;  2DYS C;  3IFX A;  4X88 A;  5J9P C;  3UKM A;  1R3K C;  1K4D C;  2EIL C;  1K4C C;  1OCR C;  2QKS A;  2DWE C;  2WLJ A;  2WLH A;  2X6C A;  2WLL A;  3E86 A;  4G27 B;  4P9O A;  4PDV A;  4DXW A;  3RVY A;  2A0L A;  2Q69 A;  1R3I C;  2WLL B;  3T2M A;  1BL8 A;  4MTG A;  3SPJ A;  3SPC A;  2ITD C;  3ASN C;  5CBH A;  2HFE C;  3LDE A;  5EK0 A;  2NLJ C;  4PA3 A;  3OR6 C;  4R6Z A;  2Q68 A;  2Q6A A;  3OGC C;  4JTD B;  3LDD A;  1KKD A;  5EBM C;  3SPI A;  3K08 A;  2WLN A;  4PDR A;  3T4D A;  1M56 C;  2IH1 C;  3LNM B;  4MVR A;  3ABM C;  3AG4 C;  4MSW C;  1XL6 A;  4GX5 A;  4P30 A;  3E83 A;  3GB7 C;  3E89 A;  3EFF K;  2DWD C;  4PA6 A;  2WLM A;  4LCU C;  4HYO A;  3SYQ A;  2W0F C;  4XDK A;  1XL4 A;  4R8C A;  3TCU A;  3AG3 C;  5EC1 C;  1J95 A;  2H8P C;  2WLK A;  5EC2 C;  4J9Y B;  5B3S C;  3HPL C; 
#chains in the Genus database with same CATH topology
 4LF6 B;  4TV8 A;  2WWW A;  3ABK C;  4UXN A;  4Z2W A;  4JI4 O;  1IBK B;  4NTW A;  2GDS A;  4NXM B;  3SPG A;  3O9O A;  1P49 A;  2IJJ A;  1BT8 A;  2ZD9 A;  3X2Q C;  4IGG A;  3TK1 A;  2H94 A;  4FFB A;  2QGN A;  2EIK B;  4UVC A;  1SQF A;  3SPH A;  1GMG A;  1VQ7 V;  4B3T O;  4DV5 O;  1K3E A;  1YJN V;  5EBL C;  4X20 A;  3SYC A;  4YXW G;  3JAR B;  1VF5 B;  4XBF A;  4X62 B;  4OXS A;  3I56 V;  2DJV A;  4O4L B;  5FLX N;  3VQY A;  3G71 V;  4K0K B;  3D36 C;  4JI5 B;  4JI8 B;  4PEL A;  2QTS A;  2CTQ A;  2LW7 A;  5E79 Z;  5B1N A;  4U7N A;  2VWK A;  3HKB B;  2HHH B;  3TET A;  4CH3 A;  2LGW A;  1GTO A;  3H1I H;  3VQV A;  4AHC A;  4WBN A;  3K9A A;  3UCS C;  1FXK B;  1ZX3 A;  2WLL B;  4DR1 B;  3ASN C;  5EK0 A;  4PA3 A;  2Q7G A;  2Q6A A;  3NR7 A;  2OCH A;  4JTD B;  4KL1 A;  1S3J A;  2LGQ A;  4UCS A;  4UCT A;  4GKK B;  1XL6 A;  3P30 A;  1YHQ V;  3IJ4 A;  2JVD A;  1N8R W;  1WLE A;  2UXN A;  3M7M X;  2B9Z A;  3R66 A;  4NB5 A;  4RQE A;  1K97 A;  1VMG A;  2H8P C;  1IZ3 A;  3CMA V;  5KHG A;  3KCY A;  4I9Q A;  5BR8 O;  5LHG A;  3ETE A;  1NJI W;  2KSD A;  2ZDI C;  1M57 B;  2ZKO A;  4TOI A;  2ZR3 A;  1SRY A;  3JAT A;  4LR3 A;  3DC6 A;  1KUQ A;  1EZV H;  1YSC A;  2A9H A;  3BEH A;  4FJC C;  3I55 V;  4B08 A;  5J2T B;  1Y66 A;  3F7V C;  3RT3 C;  4RWU A;  4ZHQ B;  3BAA A;  3HKE A;  1XDC A;  5CA0 B;  1FPO A;  2X6A A;  5DN6 G;  3DGE A;  4TV8 B;  4UB6 Z;  4MVM A;  2YSU B;  1FD9 A;  2XAS A;  1Y76 A;  1M9N A;  1SQG A;  3RYC A;  2ZQM A;  4LF8 O;  5CB4 B;  5LMU B;  3RYF B;  1QCE A;  5CA3 A;  1OCC B;  3OW2 U;  4QE9 A;  4EKW A;  4AIL C;  2HG5 C;  2A79 B;  4J11 A;  5JQG A;  1OCR B;  3KCX A;  3K03 A;  5D5P A;  1F23 A;  1SA0 B;  4IIJ A;  2Q7E A;  5IJ0 A;  2HJD A;  3E22 A;  1PNK A;  4A5U B;  2PF4 E;  2QKC A;  2UXC B;  4FIP C;  1PL0 A;  4DR6 B;  1AI5 A;  4X64 O;  2YI8 A;  2R9I A;  1YIJ V;  1UFI A;  1BSM A;  3A0R A;  1UPG A;  4O2B B;  5DM6 V;  4FZ0 A;  1H2N A;  1PV0 A;  2IW5 A;  3JCZ A;  4DR4 B;  5LGN A;  3ZMZ A;  2VQE O;  4JYB A;  3WG7 B;  3ZRW A;  5B1B B;  3TJT A;  4DUZ B;  4JI6 O;  2W0F C;  3CRQ A;  4JI0 O;  3JAW A;  2VQF O;  3UT5 A;  4FLY A;  5B3S C;  4Z1M G;  2AXT Z;  2ZIO A;  4LF6 O;  1ORQ C;  5B1A B;  4Q20 A;  2X7R B;  2DYR C;  3ABL C;  1IBK O;  1ZSP A;  1N0N A;  1XUQ A;  3CCU V;  1R3J C;  3L70 H;  4DYL A;  1XRE A;  2EBO A;  3SYO A;  2AZ2 A;  4G28 B;  2CAZ C;  3GVM A;  4DRX A;  5KLV H;  1U97 A;  3Q4H A;  2EIJ C;  5IY5 C;  2QEX V;  2JS3 A;  3H1J H;  3CME V;  1N36 O;  4HAM A;  4ZOL A;  4B3R O;  3CCL V;  5CBF A;  5KMG A;  3JAT B;  2QR4 A;  4PI0 A;  2GTS A;  4X62 O;  4WFB V;  4I0X B;  2W0X A;  3OFN G;  3HKC B;  4K0K O;  1G1X B;  3F7Y C;  4JI5 O;  2R9R B;  4JI8 O;  4HZ3 A;  2ZIN A;  2YEV A;  2Y4U A;  4LF9 B;  2ETN A;  3FD9 A;  4CZZ A;  1Y4M A;  1OHH G;  4CS2 A;  4B3S O;  2CTP A;  3UKM A;  1NR1 A;  1K4D C;  2NNU A;  4DV0 O;  1XNR B;  1XHZ A;  1Q6H A;  4TT3 G;  2ZE7 A;  3ZMS A;  5LXT A;  2X6C A;  5IDJ A;  1N34 O;  1HNW B;  4DR3 O;  4YIO A;  1HNX O;  4NTY A;  4X65 B;  4O2A A;  1AB3 A;  2XT9 A;  2Q68 A;  1YVW A;  3QG5 A;  1P84 F;  4E4E A;  3E22 B;  1J5E B;  4O4J A;  5LHI A;  1AIL A;  3SJA C;  4GKK O;  3WB1 A;  4DUY B;  4JAV A;  2XAG A;  2LQT A;  1VIB A;  2YUA A;  3AG3 C;  2BTQ A;  3PN1 A;  4OPH A;  4EB6 A;  1IX9 A;  1JMK C;  3AK1 A;  3EXA A;  1QLE B;  4GYC B;  4DV2 B;  4BIU A;  3QNE A;  5E1A C;  3RYI A;  2GUZ A;  4EFB A;  5H6R A;  2PI5 A;  4UUJ C;  2Y48 A;  3ZRW B;  4YJ2 A;  2C2A A;  1JX9 A;  4U3J A;  1M1K W;  3BHP A;  3AG1 C;  3QF7 A;  1NZ6 A;  4TV9 B;  3SYA A;  5EBW C;  2FYU H;  2E74 B;  1JPX A;  1PP9 H;  2PY5 A;  1WPB A;  5IYC O;  1R1B A;  3PJS K;  5C8Y A;  3K3W A;  1TUE B;  5FNV B;  1Y74 A;  5LMU O;  1VQ6 V;  4LF7 O;  2RJZ A;  2ZR2 A;  5EYP B;  2P5O A;  4ZBM A;  5LOV A;  4PDL A;  1COW G;  2EJR A;  4J7Z A;  3BFR A;  4PDM A;  1I0H A;  2R70 A;  1I94 O;  3OD4 A;  1SZT A;  1SKV A;  4JZ2 A;  1PNL A;  1H2G A;  2QM7 A;  2UXC O;  2GBO A;  1QNM A;  2Z0A A;  2Q9L A;  3E86 A;  1OCZ B;  4JYA B;  3UQ8 A;  2LJ2 A;  3OGC C;  2P06 A;  1FJG O;  2EX3 A;  3BRC A;  1VF6 C;  4LF4 B;  3WFV A;  2MW2 B;  1G6U A;  3CHX A;  4D7T A;  4DR4 O;  3AK2 A;  1VF7 A;  5EIB C;  1XBL A;  1Q8I A;  1XEQ A;  4B3M O;  1CEZ A;  4I5S A;  1ZTE A;  2ADP A;  4DW0 A;  1MG1 A;  2QTO A;  4LFA O;  5B5E Z;  3W7X A;  4FM2 A;  2WLI B;  2E5L B;  2RNB A;  2XAH A;  3L74 H;  1NS1 A;  4D7S A;  2L35 A;  2CTR A;  4O4J B;  3RBZ A;  4CBC A;  2KKW A;  3VOU A;  1CPY A;  2QJ1 A;  3E8H A;  3HB3 B;  1Q81 W;  1YIT V;  2P4K A;  1I7F A;  2KG7 B;  3JAR A;  2QWQ B;  3ZRX A;  3CRC A;  4TQF A;  4JF3 A;  1PPJ H;  3RYI B;  2Z5U A;  3E8G A;  4D6T H;  4X66 B;  4O4L A;  1X59 A;  4RAI A;  1XMO B;  4GLX A;  2GSM B;  2HVJ C;  4WCE V;  4JYY A;  2F1M A;  1YTF B;  2ATK C;  1WB8 A;  4LBE C;  3B4S A;  2DMX A;  3HKB A;  1IBM B;  3LDC A;  4N23 A;  1NTZ H;  1DK1 A;  1JR9 A;  5EZY B;  2JEX A;  4LF9 O;  4PJ0 Z;  2PYL A;  2QKS A;  2PYJ A;  1Y74 B;  2WLL A;  3OMI B;  2A0L A;  2UUC B;  1DGS A;  2Q0O C;  5C93 A;  4TQD A;  2CGN A;  3GWK C;  2AGA A;  1Q86 W;  1VQ8 V;  1SQP H;  1V9P A;  5JVD A;  1R6N A;  1VEW A;  3E83 A;  4FMT A;  1J5E O;  2DWD C;  4K8X A;  4JV5 B;  5LGT A;  2A3Q A;  1XL4 A;  2M6Y A;  1OCO B;  1RPR A;  1BE3 H;  2JS5 A;  4ICG A;  3CCJ V;  1SQB H;  1IXB A;  2LO1 A;  1KBH A;  1SZX A;  2YID A;  3FB6 C;  2ZT9 B;  4DV2 O;  3SGI A;  3A0H Z;  3OEE G;  2CTW A;  5J2T A;  4JI7 B;  2BOB C;  4BW9 A;  5FPO A;  4ZHQ A;  1S76 D;  1US6 A;  4K8Z A;  4KHP B;  3IC7 A;  3LSS A;  1TAE A;  4P2Z A;  4MVQ A;  3ABT A;  5CB4 A;  3JD3 A;  3RYF A;  1Q3E A;  1AVM A;  1ENV A;  4GX0 A;  3OUF A;  1W0J G;  2FTK A;  1QQC A;  1HWY A;  3OUS A;  4I55 A;  2Q67 A;  3G6B A;  2DW4 A;  4MVO A;  4BWA A;  1SA0 A;  3K57 A;  4GX1 A;  4EEQ A;  1N33 O;  3THO A;  1SQV H;  1OCC C;  3CE2 A;  1QHT A;  2P90 A;  2ITC C;  2DYS C;  4B7E A;  4K3A A;  4KXR A;  1OCR C;  3CCQ V;  3CP1 A;  3BY6 A;  1V54 B;  4L8J A;  1R3I C;  2N74 A;  2JDI G;  4J42 A;  4O2B A;  5GW7 A;  5K1X A;  2HFE C;  3BCC H;  1MNG A;  5LBQ A;  2EZO A;  3WB2 A;  4ZIB A;  2YDE A;  2WLN A;  3OT7 A;  2CE4 A;  3TXS A;  4LF5 O;  1P4R A;  4RQF A;  4KUM A;  1GH6 A;  1XHX A;  1TVK A;  3OEH G;  4F6E A;  5GTI Z;  1J95 A;  2DQ0 A;  4H13 B;  2ADQ B;  1PM9 A;  1H8H G;  3H1K H;  3L75 H;  1HNZ B;  3SDL A;  1R73 A;  3T1Y B;  3AEI A;  1KKC A;  2E5L O;  1V55 C;  2FML A;  3D3Q A;  3CPW U;  2D3O W;  5JVD B;  2ODM A;  4ABM A;  2WAM A;  1NR7 A;  3AG2 B;  1GKF A;  3P32 A;  1RM1 B;  1K92 A;  2VRZ A;  4JAU A;  1D5A A;  5IYZ A;  1VQ5 V;  1OV9 A;  1QVF U;  1XIL A;  1BS3 A;  2E3C A;  4GT1 A;  4MTF A;  4UVA A;  2EUL A;  4DV3 O;  4NYK A;  4QPK A;  1XNQ O;  4MVS A;  4JI2 B;  1Q6U A;  2IJH A;  1SET A;  1MAB G;  1YF2 A;  4I0X A;  1YTF D;  3K5M A;  4JI3 O;  1D5N A;  5KUK A;  1XMO O;  1KP2 A;  5LMN B;  3HKC A;  2JJ2 G;  5JCO A;  4YIP A;  4O4I B;  1I5Y A;  4LP8 A;  1FKA O;  3F5W C;  3E8B A;  2WPD G;  3ASO C;  3K04 A;  4DK0 A;  5CMU A;  4FLU A;  3SYP A;  1IBM O;  5H2F Z;  3ABK B;  1JJO A;  2QA4 V;  2JJ1 G;  2YIC A;  3QO5 A;  4DR5 B;  3L71 H;  1O9G A;  2WLH A;  3H9V A;  1WAZ A;  3N2G B;  1I5X A;  3X2Q B;  4I55 B;  4E2L A;  2UUC O;  3CSX A;  4GCZ A;  3CX5 F;  1M56 C;  3DXR A;  4DR7 B;  4UV8 A;  4DW1 A;  1CXZ B;  2ZNI A;  3FYE B;  2HEP A;  4JV5 O;  2IJI A;  1RFY A;  4NR1 A;  3FFQ A;  3J81 N;  3M99 B;  3ZHT A;  3JAM N;  2XUM A;  3CXH F;  2UU9 O;  2E75 B;  3CYO A;  1SES A;  4LNU B;  2EIN B;  1NBM G;  4IHJ A;  3JSN A;  2DE0 X;  4FM1 A;  3B8M A;  3JD2 A;  2QM8 A;  2CH7 B;  4H44 B;  1K73 W;  1QLE C;  5H6Q A;  2W6J G;  3L9D A;  1PD3 A;  1TVK B;  4JI7 O;  1K5S A;  5CBG A;  5IT9 N;  4G2K A;  4TV9 A;  1GM8 A;  1MSW D;  3P3P A;  4GUN A;  3SJQ C;  3G67 A;  5L3C A;  3BPZ A;  4GX2 A;  4I4T B;  2Y69 B;  1AI6 A;  1DLB A;  4O4H B;  1A32 A;  5L3B A;  5FNV A;  3KZI Z;  4UFZ A;  3IC9 A;  1S5H C;  4QJF B;  3RYH A;  4NXM O;  5EYP A;  4MS2 A;  1GN6 A;  3K06 A;  1K33 A;  1R3L C;  5JJN B;  2E76 B;  2OCC C;  5LP6 A;  1BHB A;  3JD4 A;  5IYZ B;  3G4S V;  1RSO A;  3B8N A;  2UUB B;  4L87 A;  4WFA V;  1JVM A;  2YXL A;  2YI9 A;  2EIM C;  1XI1 A;  3OR7 C;  4IT5 A;  1GRJ A;  5LA6 A;  4WFF A;  2W6I G;  3OE7 G;  3IFX A;  1YI2 V;  2ZE8 A;  2CGO A;  4B7K A;  1Q90 D;  2EIL C;  5KHI A;  2RQ6 A;  1KP3 A;  5L3F A;  4DXW A;  3CRM A;  4G27 B;  2ZE6 A;  4CS4 A;  3OGI B;  1OZ0 A;  1EBO A;  3ZHR A;  3GWO A;  4LH6 A;  4X1Y B;  3AG4 C;  4DR2 B;  4FVM A;  2HHH O;  2A06 H;  1B6Q A;  3BAB A;  2PI4 A;  1BQZ A;  1ZAU A;  4XDK A;  3TCU A;  2AW9 A;  2YC0 A;  2D2C B;  4X1K B;  1D2D A;  2HR3 A;  2PZS A;  4RO2 A;  4X1I A;  4DR1 O;  2WLI A;  1HP8 A;  2PGG A;  2QM4 A;  2Y0I A;  3CRR A;  1E1Q G;  3G80 A;  4YHH B;  1VQK V;  1WP7 A;  1L0N H;  2IJK A;  1HNZ O;  2YXH A;  2ZM6 B;  3DXR B;  4KFM A;  2P22 C;  3DTU B;  5B66 Z;  5IE9 A;  5LYJ A;  3APO A;  4WFG A;  3U0Z A;  3CCR V;  2FB5 A;  2MK3 A;  1SER A;  5AG2 A;  2KG7 A;  2XTA A;  1RP3 B;  4FFK A;  4BIO A;  4CH4 A;  1MZF A;  3C90 A;  3N2K B;  2IBZ H;  1WB7 A;  4FLX A;  3K0D A;  4IHJ B;  3TGU H;  1K7D A;  5LL6 Y;  2OWO A;  1NTM H;  1O9H A;  5IJ9 B;  1JOY A;  2HP8 A;  4JYC A;  5LMN O;  2YIA A;  2NN4 A;  1S0V A;  1KMI Z;  5B3S B;  1N32 B;  4MTO A;  1ZLZ A;  5EZY A;  4AQY B;  4X88 A;  1K4C C;  3ABM B;  3RYH B;  1KD1 W;  2CDY A;  5BY1 A;  3RVY A;  3VQX A;  2ITD C;  2NLJ C;  5KA6 A;  4W4K A;  5LP6 B;  4J7J A;  1WP8 A;  1RSO B;  3K08 A;  4PDR A;  2ZCE A;  4J41 A;  5IY5 B;  1EN6 A;  4DR7 O;  5LA6 B;  1WNS A;  4DV7 B;  1JCH A;  4LWS A;  3CCS V;  4DR6 O;  1N4C A;  1SS3 A;  1L8D A;  3U10 A;  1OJH A;  2RDC A;  3E8F A;  2VS0 A;  1KC8 W;  3CEI A;  3MHS C;  2ZXW C;  3LUT B;  3CS5 A;  5L3G A;  1EN4 A;  1OCO C;  4MVZ A;  2O57 A;  2GTA A;  5HFM A;  2ILM A;  3SJB C;  3FYI B;  3UO2 A;  4P9P A;  4DUZ O;  2DOS A;  4CC6 A;  4UCR A;  5IWA B;  2CUG A;  4XDL A;  1JJ2 U;  4I50 B;  4QE7 A;  4NTX A;  4X1I B;  3ICX A;  5L3E A;  4TWK A;  4H33 A;  2QKA A;  1G8M A;  1LUW A;  3T1C A;  3ZED A;  3E2E A;  4HNA B;  1XMQ B;  1AR1 B;  2P67 A;  3JD0 A;  3AG7 A;  3OTO B;  1S77 D;  2V7Q G;  3W7U A;  4TUY A;  5LYJ B;  2F23 A;  1IUR A;  2IH3 C;  3AG3 B;  3CC4 V;  3STZ C;  2AHZ A;  4GKJ B;  2BE3 A;  3JYC A;  5GTH Z;  1AR5 A;  5CA1 B;  3FB8 C;  1BCC H;  2Q73 A;  2EIK C;  5JH7 B;  4J7K A;  2PUS A;  4P9O A;  1THZ A;  5BR8 B;  4JAS A;  5KHJ A;  2GV9 A;  3D8C A;  1MSD A;  3OR6 C;  1HDJ A;  1KKD A;  2P6J A;  3SPI A;  1M4U A;  3AG1 B;  3S3X A;  2DN9 A;  4JI1 B;  3UO3 A;  4HYO A;  1EZJ A;  3NXS A;  3SR2 C;  1M90 W;  4FLV A;  5KAF Z;  3K5N A;  5EC2 C;  1XNR O;  3FAV B;  3FB7 C;  1L1F A;  3CC2 V;  1F7Y A;  1HNW O;  5HFL A;  3K5L A;  3ZMU A;  4X65 O;  1Q82 W;  1BGY H;  2P4V A;  1NTK H;  3E35 A;  4N21 A;  3W7W A;  5DEC A;  1FXK C;  5KUM A;  2ZM6 O;  2JGD A;  1FFX B;  3CCE V;  3U11 A;  4AI8 A;  4LWS B;  2N05 A;  4DUY O;  3QVN A;  3B77 A;  1URF A;  3RW0 A;  4DV1 B;  4DV4 B;  1K9M W;  2KB1 A;  1U96 A;  4J9Z B;  2UXB B;  4TSF G;  3C3T A;  4U7O A;  2WA4 A;  3AG2 C;  4X64 B;  2F4V B;  3B09 A;  5KX5 B;  5IYB O;  3ZX6 A;  4JTA B;  2NR5 A;  1NI8 A;  3JAK A;  4O4I A;  2L6L A;  2QWO B;  1SQX H;  1M57 C;  1FAF A;  3A0B Z;  1ZWI C;  1NQT A;  5B1O A;  3ZHU A;  1MOF A;  4BIZ A;  4J10 A;  2VWJ A;  1KB9 F;  1FFT B;  2VQE B;  1YCI A;  4PV1 B;  4JTC B;  4JI6 B;  2BSK B;  3F5T A;  2VQF B;  1HW7 A;  2OIE A;  3N2G A;  1AI7 A;  2DWE C;  1Q5O A;  4X9Q A;  1BZK A;  3CJH A;  5TIS Z;  3LDE A;  1AR4 A;  4TUY B;  1DF4 A;  2B5U A;  3LDD A;  1S72 V;  1AI4 A;  4J80 A;  2UXD B;  1XOU A;  2WA3 A;  4MTX A;  4OX9 B;  3EFF K;  1YDX A;  1KQS U;  5GON B;  1F4N A;  4F6R A;  4DV7 O;  1S5J A;  5EC1 C;  4UCV A;  4J9Y B;  2ZE5 A;  3H1H H;  2YIB D;  1N36 B;  3D36 A;  4JYA O;  2F93 B;  4OGQ B;  4B3R B;  1ZL8 A;  4LNU A;  4UCO A;  2K9P A;  4PI2 A;  1L0L H;  4BW5 A;  4NKG B;  1YEW A;  2CH7 A;  2AHY A;  3K0G A;  4MVU A;  4LF4 O;  4QNH B;  1JFF A;  2QWN B;  4XDJ A;  1P7G A;  2EJ7 A;  5KHK A;  5L3D A;  3I5D A;  3ETG A;  4YJ3 B;  5KHH A;  2EIN C;  4X8A A;  3CXC U;  3N27 A;  1EFR G;  5IWA O;  5F2V O;  4I4T A;  3RWR D;  1AJQ A;  2OYQ A;  3K5O A;  4O4H A;  3WG7 C;  3OTF A;  5B1B C;  1MA1 A;  4B3S B;  3CWB H;  1H2K A;  4DV6 B;  4UCU A;  1W59 A;  4DV0 B;  1NKD A;  5A2Q N;  2V4D A;  4JGS A;  4Q6G A;  3T4Z A;  1N34 B;  2HVK C;  5BZB A;  4DR3 B;  1HNX B;  1H2M A;  3ZMV A;  1ROP A;  3WB0 A;  2JGD B;  4PA4 A;  1XMQ O;  5B1A C;  1TUB A;  4FZ1 A;  4FLZ A;  1Y6X A;  2Y69 C;  3JAL B;  4FM0 A;  3OTO O;  2K1E A;  3HR0 A;  2JIZ G;  4ASU G;  4GKJ O;  4PA7 A;  3ZHQ A;  2ZDI A;  2RCV A;  1VQO V;  1GM7 A;  4FPP A;  2LFR A;  2QDO A;  1WN7 A;  1PKX A;  4KP4 A;  4X66 O;  2LP7 A;  4PDV A;  1ARO P;  4U3F H;  2QWP B;  1QR9 A;  4I7Z B;  4NXN B;  3JAK B;  3P3N A;  2HKO A;  3ZHS A;  1AJP A;  1H2L A;  4X1Y A;  5H5N A;  2ARH A;  2YXY A;  4UVB A;  2EZP A;  1ZUQ A;  2Q7H A;  4PA6 A;  4JI1 O;  2JGU A;  5JCO C;  2Q4P A;  4IYH A;  4X1K A;  5H9C A;  1TA8 A;  2YS8 A;  3ZCC A;  3CC7 V;  3CJH B;  3R65 A;  4CC5 A;  4ZI7 A;  2F43 G;  1DTO A;  5LHH A;  4BAY A;  2XAQ A;  5IYD O;  2CK3 G;  4LF7 B;  3G6E V;  1AJN A;  4BR6 A;  2B1G A;  3CRA A;  5FPR A;  4LFC B;  3M8A A;  4FFB B;  5KA5 A;  4RUE A;  2DYS B;  4F6R B;  3VQW A;  1B06 A;  4MW3 A;  4IL6 Z;  4DV1 O;  4DV4 O;  3OAA G;  3N2K A;  4K35 A;  1I94 B;  5JJJ B;  1S5L Z;  1ZL8 B;  4X20 B;  2UXB O;  1KEC A;  2N04 A;  4LC1 A;  3S3W A;  5EIB D;  3ZS8 C;  2F4V O;  1Y67 A;  5IJ9 A;  1NVP D;  1WPX A;  2R72 A;  1JFF B;  1W0K G;  3A2F A;  1YJW V;  2P7T C;  3RFR A;  1H8E G;  2V1D A;  3QO7 A;  3L72 H;  1FJG B;  3APQ A;  3SYQ A;  1R6T A;  4YY3 B;  3RVZ A;  1E79 G;  4W4L A;  4KHP O;  3VBB A;  3ASN B;  2Z3Y A;  4B3M B;  4CH5 A;  1YXB A;  3QO8 A;  2OT5 A;  4UB8 Z;  5KAI Z;  3T1H B;  2BCC H;  2GHY A;  2IU0 A;  1V55 B;  3ZRV A;  1SQQ H;  4WBN B;  3T2M A;  2AZ0 A;  4LFA B;  1BL8 A;  1VQP V;  1VQ4 V;  1Z5V A;  3EVK A;  1TUB B;  3LSU A;  1H38 A;  2Q5Z A;  2H3O A;  3LNM B;  3ZHV A;  3ABM C;  1N0J A;  4MSW C;  5FL7 G;  3W7S A;  4GX5 A;  2BTO A;  4P30 A;  5K1P A;  3E89 A;  2UXD O;  2WLM A;  2JEU A;  4H0L B;  4OX9 O;  3HKD A;  5LP6 C;  2OTJ V;  4QGP A;  4LFB B;  5BMV A;  1VP7 A;  3K79 A;  1FXV A;  1K8A W;  2YIB A;  2JRI A;  3H01 A;  3KKY A;  2M7W A;  1GN4 A;  1PNM A;  5CN0 A;  4QPJ A;  4PD4 F;  3ASO B;  2IU3 A;  3KG2 A;  1OCZ C;  4C7U A;  1Z5W A;  1W2B U;  3WU2 Z;  3C3S A;  3J7A U;  5ITZ A;  4IYI A;  4I50 A;  3HKE B;  3ZIA G;  4HBN A;  3OMA B;  4Z1V A;  1E1R G;  4ZI7 B;  2XAJ A;  2XHB A;  1M93 A;  1Y76 B;  3FKS G;  3ZRS A;  3RYC B;  4DV6 O;  4HNA A;  3T1Y O;  1QBZ A;  1M56 B;  2RN9 A;  3MDS A;  1IXM A;  1T5E A;  4ZKI A;  3CCV V;  4R8C A;  5JQG B;  3ZMT A;  3CCM V;  1GAX A;  4IIJ B;  5IJ0 B;  2BOC C;  4WFH A;  2HJF C;  3OMN B;  4MT8 A;  3ZN0 A;  5CA1 A;  3MHH C;  4R7C A;  2WSS G;  4JI2 O;  5JH7 A;  1R3K C;  3LSQ A;  1KYO F;  1VQN V;  1AP6 A;  2IM9 A;  3FX7 A;  2HLD G;  1Q43 A;  5CBH A;  4NXN O;  1IDS A;  1CP9 A;  2A7W A;  2IH1 C;  1HR0 B;  4CS3 A;  1NT2 B;  1YZB A;  1WA8 A;  1IBL B;  2PTM A;  1SC5 B;  4LCU C;  3AK3 A;  3BVO A;  2B1I A;  2UUA B;  2DYR B;  2OTL V;  1QU7 A;  3ABL B;  4DR5 O;  3FAV A;  1LR1 A;  2F66 C;  3JAW B;  2XOK G;  3UT5 B;  4LH7 A;  3UM7 A;  1G4Y B;  1M5I A;  4JI4 B;  1B3Q A;  1NH2 B;  2XND G;  3J80 N;  5LGU A;  5J2U A;  2R9A A;  1FXH A;  2JK5 C;  2OCC B;  2DQ3 A;  3JD1 A;  2EIJ B;  1P7B A;  4X89 A;  3JSL A;  1FFX A;  2EIM B;  1KU9 A;  3ETQ A;  4F4L A;  3STL C;  1BMF G;  2F95 B;  3DSQ A;  1SF9 A;  2FL4 A;  3LNN A;  3BA9 A;  1N33 B;  1QLN A;  2G38 A;  4LFC O;  3HKD B;  4B3T B;  2EIL B;  4MW8 A;  4DRX B;  4DV5 B;  1I08 A;  3Q4H B;  4UV9 A;  5BMV B;  3IGA C;  4RUF A;  2X0L A;  1JA8 A;  3H1L H;  4ZOL B;  1GN3 A;  5KX5 A;  1MZE A;  1VF6 A;  5DED A;  3FB5 C;  5KMG B;  3AG4 B;  2QWR B;  1AP5 A;  1K5Q A;  4QIW F;  4WF9 V;  1VQM V;  1GO3 F;  1R6K A;  3EHB B;  2Y4T A;  1GK9 A;  2XAF A;  1LNQ A;  5ITZ B;  4OPA A;  3JAS A;  1FS0 G;  4LF5 B;  4YY3 O;  4GZR B;  1IVS A;  1H2S B;  2Q8V A;  2YEV B;  2BSK A;  3ML0 A;  3W7T A;  4I9W A;  1BQ0 A;  4CH6 A;  4DK1 A;  5JJE B;  1Q7Y W;  1PL4 A;  2WLJ A;  1YJ9 V;  3A8T A;  4FK5 C;  3T1H O;  2QSA A;  5LXT B;  2Q69 A;  3ZN1 A;  3OM3 B;  4O2A B;  1QR8 A;  3ETD A;  2ZNJ A;  1EN5 A;  4JPR A;  3RGB A;  4MVR A;  2UUB O;  1NU1 H;  1FYJ A;  3GB7 C;  5GON A;  3B40 A;  2WLK A;  4DV3 B;  2BTQ B;  3B2E E;  1XNQ B;  1XQ8 A;  4EB6 B;  2UXX A;  5JWP A;  4FLT A;  4LFB O;  2ZIM A;  1MMM A;  4FLW A;  1VQ9 V;  4PHZ A;  4JI3 B;  2GUZ B;  3K59 A;  3ZBH A;  1V54 C;  1WA8 B;  2X6B A;  1VQL V;  4DR2 O;  1LUV A;  3SJC C;  4DO2 A;  5A9G A;  1TGO A;  4YJ3 A;  1Z2G A;  4YJ2 B;  4WFE A;  3ZJZ A;  4U3J B;  1GN2 A;  2LW1 A;  4R50 A;  1QVG U;  4JAA A;  1DF5 A;  4LF8 B;  1F4M A;  5J2U B;  4YHH O;  5D5Q A;  1K34 A;  3MAQ A;  2QE7 G;  5C8Y B;  3MD0 A;  1UJW B;  4JZG A;  2OIG A;  4EFE A;  1FXK A;  2Q0A A;  3O65 A;  4H37 A;  3CB2 A;  3CD6 V;  3JAL A;  5BXZ A;  3JCU Z;  5LOV B;  3L73 H;  3BA8 A;  1GM9 A;  2RMK B;  3RN4 A;  4PA9 A;  1X4T A;  4NVP A;  2ZXW B;  1RM1 C;  3IAY A;  5J9P C;  1VAR A;  1BHA A;  1EM1 A;  3K58 A;  2KQX A;  4MTG A;  1F51 A;  3SPJ A;  3SPC A;  1WJZ A;  1NVP B;  2UU9 B;  2Y0P A;  2LFS A;  4R6Z A;  1B04 A;  5EBM C;  3QTC A;  3T4D A;  2FKX A;  3DC5 A;  3JAS B;  3ABU A;  1N32 O;  3TXQ A;  3K9S A;  1JQ0 A;  1HR0 O;  4AQY O;  3D3I A;  1IBL O;  4JI0 B;  1Q6I A;  2UUA O;  1NH2 D;  5CA0 A;  1RPO A;  3HPL C; 
#chains in the Genus database with same CATH homology
 2HR3 A;  2WWW A;  3R65 A;  4RO2 A;  1MG1 A;  3ABK C;  2F43 G;  2QTO A;  1DTO A;  5LHH A;  2WLI A;  4UXN A;  3W7X A;  1E1Q G;  1VQK V;  2WLI B;  2XAQ A;  4BAY A;  2XAH A;  5IYD O;  2IJK A;  3SPG A;  2CK3 G;  2IJJ A;  4KFM A;  2ZD9 A;  3G6E V;  1AJN A;  3DTU B;  3X2Q C;  2B1G A;  3TK1 A;  2H94 A;  3RBZ A;  4CBC A;  3VOU A;  1CPY A;  5KA5 A;  4RUE A;  2EIK B;  2DYS B;  4UVC A;  4WFG A;  3SPH A;  1GMG A;  3CCR V;  3E8H A;  4MW3 A;  1VQ7 V;  2MK3 A;  3HB3 B;  1Q81 W;  1YIT V;  1SER A;  3OAA G;  1YJN V;  1K3E A;  5EBL C;  3SYC A;  3ZRX A;  4YXW G;  4JF3 A;  4XBF A;  4OXS A;  1KEC A;  2Z5U A;  3E8G A;  3I56 V;  3K0D A;  4RAI A;  4LC1 A;  1K7D A;  2GSM B;  2HVJ C;  4WCE V;  3G71 V;  1NVP D;  1WPX A;  1W0K G;  1YTF B;  1JOY A;  1YJW V;  2P7T C;  2ATK C;  4JYC A;  1H8E G;  2V1D A;  3QO7 A;  4LBE C;  3SYQ A;  4PEL A;  3RVZ A;  5B1N A;  4U7N A;  1E79 G;  1S0V A;  5B3S B;  3LDC A;  3VBB A;  4N23 A;  3TET A;  3ASN B;  4MTO A;  2Z3Y A;  2JEX A;  4X88 A;  3QO8 A;  1K4C C;  2OT5 A;  2QKS A;  3ABM B;  1GTO A;  2GHY A;  2IU0 A;  1V55 B;  2WLL A;  3K9A A;  1KD1 W;  3ZRV A;  1FXK B;  3OMI B;  2A0L A;  3RVY A;  2WLL B;  3T2M A;  1BL8 A;  1VQP V;  2ITD C;  3ASN C;  1VQ4 V;  5EK0 A;  2NLJ C;  4PA3 A;  5KA6 A;  2Q6A A;  4JTD B;  5C93 A;  1H38 A;  3K08 A;  1Q86 W;  4PDR A;  1VQ8 V;  1S3J A;  3LNM B;  5IY5 B;  3ABM C;  4MSW C;  1R6N A;  1XL6 A;  4GX5 A;  5FL7 G;  4P30 A;  3W7S A;  3E83 A;  4FMT A;  3P30 A;  1YHQ V;  3E89 A;  2DWD C;  2WLM A;  2JEU A;  1JCH A;  5LGT A;  1WLE A;  3CCS V;  1XL4 A;  2UXN A;  4RQE A;  1N8R W;  1K97 A;  1OCO B;  1RPR A;  2H8P C;  2OTJ V;  3CMA V;  3K79 A;  3CCJ V;  3E8F A;  1FXV A;  1KC8 W;  1K8A W;  5LHG A;  3ETE A;  2ZXW C;  3FB6 C;  3H01 A;  3LUT B;  2M7W A;  3MHS C;  5CN0 A;  1PNM A;  2ZDI C;  1M57 B;  4QPJ A;  5L3G A;  1NJI W;  2ZR3 A;  1SRY A;  3OEE G;  3ASO B;  4MVZ A;  1OCO C;  2IU3 A;  3KG2 A;  5HFM A;  1OCZ C;  1YSC A;  2A9H A;  3BEH A;  4FJC C;  3I55 V;  1W2B U;  1Y66 A;  3F7V C;  3FYI B;  2BOB C;  4P9P A;  1S76 D;  2X6A A;  4XDL A;  1JJ2 U;  3IC7 A;  3LSS A;  5DN6 G;  3DGE A;  4QE7 A;  3ZIA G;  3OMA B;  1E1R G;  5L3E A;  4MVM A;  2YSU B;  4P2Z A;  2XAJ A;  4TWK A;  4MVQ A;  4H33 A;  2XAS A;  3ABT A;  1M9N A;  1G8M A;  3T1C A;  3JD3 A;  2ZQM A;  3FKS G;  3ZRS A;  1QCE A;  5CA3 A;  1ENV A;  1QBZ A;  1M56 B;  3E2E A;  1OCC B;  4GX0 A;  3OW2 U;  3OUF A;  1W0J G;  4QE9 A;  2FTK A;  1IXM A;  1AR1 B;  2P67 A;  4EKW A;  3JD0 A;  1HWY A;  3OUS A;  1S77 D;  2V7Q G;  4ZKI A;  2Q67 A;  3W7U A;  3CCV V;  4R8C A;  2DW4 A;  4MVO A;  2HG5 C;  2A79 B;  4GX1 A;  2IH3 C;  1OCR B;  3AG3 B;  3K03 A;  1F23 A;  3CC4 V;  3STZ C;  3ZMT A;  3CCM V;  2AHZ A;  2BOC C;  4WFH A;  3JYC A;  1OCC C;  2HJF C;  3OMN B;  4MT8 A;  1PNK A;  3ZN0 A;  3MHH C;  4R7C A;  3FB8 C;  2WSS G;  4FIP C;  2P90 A;  2EIK C;  2ITC C;  1PL0 A;  2DYS C;  1AI5 A;  1R3K C;  3LSQ A;  1OCR C;  1VQN V;  3CCQ V;  3CP1 A;  3BY6 A;  4P9O A;  1V54 B;  2R9I A;  1R3I C;  1THZ A;  2JDI G;  1YIJ V;  4JAS A;  2HLD G;  5GW7 A;  5CBH A;  2HFE C;  3A0R A;  3OR6 C;  5DM6 V;  1CP9 A;  5LBQ A;  2EZO A;  1KKD A;  2P6J A;  3SPI A;  2WLN A;  3AG1 B;  2IH1 C;  2IW5 A;  3JCZ A;  5LGN A;  1P4R A;  3ZMZ A;  4RQF A;  4KUM A;  4JYB A;  3WG7 B;  3ZRW A;  5B1B B;  4LCU C;  4HYO A;  2B1I A;  2W0F C;  3OEH G;  2DYR B;  1EZJ A;  3NXS A;  2OTL V;  3ABL B;  1M90 W;  1J95 A;  2DQ0 A;  5EC2 C;  2XOK G;  5B3S C;  4Z1M G;  3FB7 C;  1L1F A;  3CC2 V;  3UM7 A;  1G4Y B;  5HFL A;  1H8H G;  2XND G;  1NH2 B;  3ZMU A;  5LGU A;  1Q82 W;  1ORQ C;  5B1A B;  1FXH A;  2JK5 C;  2OCC B;  2DQ3 A;  4Q20 A;  2X7R B;  1R73 A;  2DYR C;  3JD1 A;  3AEI A;  2EIJ B;  1P7B A;  3ABL C;  3E35 A;  4N21 A;  4X89 A;  1V55 C;  3W7W A;  3CPW U;  2D3O W;  1FXK C;  1R3J C;  5KUM A;  3CCU V;  2EIM B;  4F4L A;  2EBO A;  2WAM A;  1NR7 A;  3STL C;  3CCE V;  1BMF G;  3SYO A;  3AG2 B;  1GKF A;  3P32 A;  4G28 B;  1RM1 B;  1QLN A;  1K92 A;  4JAU A;  1QVF U;  1VQ5 V;  2EIL B;  3B77 A;  3RW0 A;  4GT1 A;  4MW8 A;  4MTF A;  4UVA A;  2EIJ C;  5IY5 C;  1K9M W;  2QEX V;  4UV9 A;  4QPK A;  3IGA C;  4RUF A;  3CME V;  2X0L A;  4HAM A;  2KB1 A;  4MVS A;  4J9Z B;  4TSF G;  3CCL V;  4U7O A;  3AG2 C;  2IJH A;  1SET A;  5CBF A;  1MAB G;  1YTF D;  3FB5 C;  5IYB O;  4WFB V;  4JTA B;  3AG4 B;  5KUK A;  1K5Q A;  1KP2 A;  4QIW F;  4WF9 V;  2JJ2 G;  3OFN G;  1VQM V;  1I5Y A;  4LP8 A;  1GO3 F;  1R6K A;  3EHB B;  3F7Y C;  1GK9 A;  1M57 C;  2R9R B;  1LNQ A;  2XAF A;  3F5W C;  1ZWI C;  1NQT A;  3E8B A;  4HZ3 A;  2WPD G;  3ASO C;  5B1O A;  1FS0 G;  3K04 A;  1MOF A;  4BIZ A;  5CMU A;  2YEV A;  3SYP A;  1FFT B;  3ABK B;  2YEV B;  4JTC B;  4CZZ A;  1Y4M A;  1OHH G;  3ML0 A;  3W7T A;  4I9W A;  2QA4 V;  2JJ1 G;  3QO5 A;  3UKM A;  1Q7Y W;  1NR1 A;  1K4D C;  2NNU A;  1AI7 A;  4TT3 G;  2DWE C;  2WLJ A;  1YJ9 V;  3ZMS A;  2WLH A;  2X6C A;  4FK5 C;  1I5X A;  5IDJ A;  3X2Q B;  2Q69 A;  3ZN1 A;  3LDE A;  4E2L A;  3OM3 B;  1DF4 A;  2Q68 A;  1QR8 A;  2B5U A;  3LDD A;  4GCZ A;  1S72 V;  1AI4 A;  3ETD A;  1M56 C;  4JPR A;  4MVR A;  4UV8 A;  5LHI A;  3GB7 C;  4MTX A;  3EFF K;  4JAV A;  2XAG A;  1KQS U;  3FYE B;  1F4N A;  3AG3 C;  5EC1 C;  2WLK A;  4J9Y B;  2IJI A;  3D36 A;  2UXX A;  1QLE B;  3M99 B;  4BIU A;  3QNE A;  5E1A C;  3CYO A;  1SES A;  2EIN B;  4BW5 A;  1NBM G;  1VQ9 V;  5H6R A;  2PI5 A;  4UUJ C;  2AHY A;  3K0G A;  3B8M A;  4MVU A;  3JD2 A;  2QM8 A;  4QNH B;  1V54 C;  2X6B A;  2Y48 A;  1VQL V;  4XDJ A;  4DO2 A;  1K73 W;  1QLE C;  3ZRW B;  5H6Q A;  2C2A A;  2W6J G;  1PD3 A;  5L3D A;  1JX9 A;  3ETG A;  1K5S A;  5CBG A;  4G2K A;  1MSW D;  1GM8 A;  4WFE A;  1M1K W;  3ZJZ A;  2EIN C;  3AG1 C;  4X8A A;  3SJQ C;  5L3C A;  3CXC U;  3SYA A;  5EBW C;  1EFR G;  4R50 A;  1QVG U;  1JPX A;  1AJQ A;  1DF5 A;  3WG7 C;  4GX2 A;  5B1B C;  2Y69 B;  5IYC O;  3PJS K;  1AI6 A;  1DLB A;  1F4M A;  5L3B A;  3K3W A;  1TUE B;  1K34 A;  1NKD A;  2QE7 G;  1S5H C;  4QJF B;  4JGS A;  3MD0 A;  1UJW B;  4MS2 A;  1VQ6 V;  3T4Z A;  3K06 A;  2HVK C;  5BZB A;  1FXK A;  2ZR2 A;  4H37 A;  3ZMV A;  1ROP A;  1K33 A;  1R3L C;  4PA4 A;  3CD6 V;  4ZBM A;  5B1A C;  4PDL A;  2OCC C;  2Y69 C;  1BHB A;  3JD4 A;  1COW G;  3G4S V;  2K1E A;  2EJR A;  3B8N A;  4L87 A;  2JIZ G;  1GM9 A;  4ASU G;  4WFA V;  4PDM A;  1JVM A;  2EIM C;  3OR7 C;  4PA9 A;  4PA7 A;  1SZT A;  1PNL A;  2ZDI A;  4WFF A;  1H2G A;  1VQO V;  2W6I G;  2ZXW B;  3OE7 G;  1RM1 C;  1GM7 A;  3IFX A;  1YI2 V;  4FPP A;  2LFR A;  2QM7 A;  5J9P C;  1PKX A;  4KP4 A;  2EIL C;  1BHA A;  2LP7 A;  1KP3 A;  3E86 A;  1OCZ B;  4PDV A;  4G27 B;  4DXW A;  1ARO P;  5L3F A;  1QR9 A;  4MTG A;  1F51 A;  3SPJ A;  3SPC A;  1NVP B;  2HKO A;  2LFS A;  4R6Z A;  3OGC C;  1OZ0 A;  1AJP A;  1EBO A;  5EBM C;  3T4D A;  3GWO A;  3ABU A;  3WFV A;  3AG4 C;  4UVB A;  2EZP A;  1JQ0 A;  1B6Q A;  2PI4 A;  4PA6 A;  3D3I A;  4XDK A;  1CEZ A;  3TCU A;  4I5S A;  5H9C A;  1NH2 D;  3ZCC A;  3CC7 V;  1RPO A;  3HPL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...