3STZC

Kcsa potassium channel mutant y82c with nitroxide spin label
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
102
structure length
102
Chain Sequence
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
total genus 44
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3stzC00
1JVMA 2K1EA 3HPLC 4HYOA 4G27B 2WLNA 4MTOA 4PDRA 2WLLA 2X6BA 4MW3A 4XDJA 1R3LC 4BW5A 3F7VC 4MVOA 4P30A 4MVUA 4J9YB 1R3KC 2QTOA 4J9ZB 3RVZA 1J95A 3KG2A 2EIJC 3F5WC 1K4CC 4PA9A 3SYCA 4PDVA 2EILC 2IH3C 4EKWA 3SPIA 4RO2A 3SPJA 3T4DA 3LDDA 4PA7A 4CBCA 3R65A 2EIKC 4HZ3A 4PA3A 3RBZA 3E8BA 1M56C 4R8CA 5EBWC 4QNHB 3E89A 2AHYA 4P9PA 3LUTB 3TCUA 3GB7C 2HFEC 2BOBC 3FB7C 3JYCA 4X89A 2WLIA 4MW8A 4XDLA 2W0FC 2AHZA 5EK0A 3RW0A 4JTCB 3SYQA 5J9PC 3WG7C 4KFMA 1QLEC 2EINC 2X6CA 5B3SC 5KUKA 2Y69C 2A9HA 3OR6C 3OUFA 4LCUC 3SPGA 4UUJC 4MTFA 4MTGA 4JTDB 3RVYA 3AG4C 2ITDC 5CBFA 5B1AC 3IFXA 3AG3C 3T1CA 3FB5C 4WFGA 3STLC 3UM7A 4PA4A 2DYSC 4F4LA 1OCRC 4ZBMA 4OXSA 3E86A 2WLLB 3K0DA 4P9OA 1V54C 4R7CA 4GX1A 2HVJC 3SYOA 2DWDC 2ZXWC 3K04A 3ABMC 4QE9A 1OCOC 2EIMC 2WLIB 3K06A 1R3JC 5E1AC 2A0LA 4MVMA 4LP8A 4R6ZA 5EC1C 3SPHA 3STZC 3SJQC 5BZBA 4GX5A 3BEHA 2Q69A 4MVQA 4QE7A 4H37A 1XL6A 1K4DC 2HVKC 2WLKA 3K03A 3AG2C 4GX0A 4PDMA 4RUEA 4WFEA 4XDKA 2WLMA 4G28B 2Q6AA 5EBLC 3ZRSA 3TETA 2Q67A 2OCCC 2YEVA 3OGCC 3SPCA 1BL8A 5EC2C 2P7TC 3E8GA 3PJSK 3OUSA 3ZJZA 5CBGA 2QKSA 2ITCC 3OR7C 3SYAA 2A79B 4LBEC 2IH1C 4WFHA 1S5HC 1M57C 1OCZC 3UKMA 1ZWIC 2Q68A 3AG1C 4MVSA 2KB1A 3ASNC 4TWKA 3SYPA 3T4ZA 5KUMA 3X2QC 3E8FA 1P7BA 2DYRC 4H33A 5IY5C 4MSWC 5EBMC 1ORQC 2H8PC 4JTAB 2WLJA 4X88A 1OCCC 3E8HA 3F7YC 3ABLC 4MS2A 3ASOC 3ABKC 4GX2A 4R50A 2BOCC 3K08A 4WFFA 1R3IC 2JK5C 2WLHA 3E83A 4X8AA 1V55C 2DWEC 2HG5C 3EFFK 3IGAC 1XL4A 4MVZA 2R9RB 1LNQA 4PDLA 2NLJC 5B1BC 4I9WA 5CBHA 1G4YB 2X6AA 2HJFC 3FB6C 3LNMB 4MVRA 2ATKC 4PA6A 3FB8C 4RAIA 4DXWA 3LDCA 4RUFA 3T2MA 4P2ZA 1KKDA 3LDEA 3VOUA 3K0GA 2ZD9A
chains in the Genus database with same CATH superfamily
4YIOA 5JH7B 2OCCB 2YXYA 5LMUB 4I4TA 1P84F 1XEQA 2XAJA 1Y67A 1R6TA 1IXMA 3SYCA 3DC6A 1JJ2U 4ZIBA 4NR1A 2EIKC 5B66Z 2ZE7A 2DN9A 1L8DA 4XDLA 2WLIA 3HKDB 3DXRA 1PNLA 2YIAA 3WG7C 1S0VA 5LOVB 1BHBA 3MAQA 2CGOA 4DUZO 3RVYA 5B1BB 1AI5A 1YHQV 2OYQA 3RN4A 1YSCA 3I55V 5CA0B 2PZSA 4X64B 4ZBMA 1HW7A 1H2LA 2DWDC 1YJWV 5LXTB 4LP8A 2QGNA 3UQ8A 2ZIOA 2H3OA 1Q90D 3BEHA 1FFXB 4QE7A 3D36C 3HKEA 4LR3A 2XAQA 4YXWG 1AB3A 2CTRA 2UUBO 1EZVH 3CX5F 2NNUA 4O2BA 3SPCA 4JGSA 1BL8A 2P7TC 3E8GA 3TXSA 3B8MA 5CBGA 5LYJA 1U96A 2ILMA 1S5HC 5JJNB 3UKMA 1K3EA 3RYIB 3ASNC 3X2QC 1TAEA 1IXBA 5K1PA 4WBNB 5KX5B 2XHBA 3E8HA 2X0LA 3APQA 3L74H 4AI8A 1KMIZ 2DYSB 4YJ2B 2DW4A 2BOCC 4WFFA 2D3OW 5IWAO 4O4IB 3K79A 4X1IB 4BWAA 4X64O 2YI9A 1GN4A 4DR5B 5KMGB 1NS1A 2YXLA 3LDCA 4X62B 5H6QA 2BCCH 4G27B 1WPXA 4UB8Z 3ABKB 1HNWB 4MVOA 1HNXB 3H1KH 3RVZA 1K8AW 3G67A 3OE7G 3QO5A 1OJHA 3OTOB 3EXAA 1VQ7V 1ROPA 2ZKOA 3AG4B 1FXKB 3E2EA 2Q0OC 1I7FA 4X89A 3J80N 2AHZA 4TOIA 2LGQA 3ETEA 2AZ2A 1QHTA 2ADPA 5JVDA 3K5MA 2F66C 3A2FA 1I94O 5EZYA 4K0KB 2ZINA 3IFXA 3WU2Z 2JGUA 3IAYA 1YDXA 3JATA 2XOKG 1FAFA 5KA5A 1JFFB 1Q6HA 1V54C 1IURA 5IJ9A 3SYOA 2DE0X 2DQ0A 1R3JC 4MVQA 3RW0A 3WB1A 1H2GA 3CCRV 2OCCC 5LP6B 4D7TA 1Y4MA 4GLXA 3O65A 2UUBB 3K3WA 4HNAA 1TUBA 4LFAB 5J2UA 2IH1C 1SS3A 4FM0A 1AI6A 2VWKA 4DR1B 1HNXO 2OIEA 4K35A 2P4KA 2YS8A 1L1FA 1WA8A 1P7BA 3A0RA 3G71V 4LF4O 4DRXA 4UVBA 1P7GA 4LWSA 4GUNA 4JI4B 4U3FH 3ABKC 5KAFZ 1R3IC 3GWKC 3KKYA 1GN2A 5B1BC 1SA0A 1G4YB 1VEWA 1Q3EA 1MZEA 2EZPA 1VQPV 4JYAO 1XILA 3L70H 3VOUA 4JI5B 3A8TA 3K5OA 5C93A 4UCSA 4LH6A 4MVUA 4FLUA 3F5WC 1YTFB 2VQFO 1Y76A 5LA6B 4PDVA 1SF9A 3RYCA 3CHXA 4O4LB 1XHXA 1BGYH 4TSFG 3TCUA 1GM8A 4MW8A 1V54B 1NH2D 2LP7A 1YF2A 1GO3F 4MTGA 4JI1O 3ZRVA 1ZLZA 4JTDB 4JAVA 2A7WA 1SERA 4UB6Z 3HKCB 4JI5O 3UM7A 5LP6C 3CCQV 1US6A 2XAGA 3ETGA 3I56V 3TXQA 4GCZA 2EIMC 2YDEA 4E2LA 3SPHA 1M9NA 4NXNB 4K8XA 2VS0A 1JR9A 2XUMA 2UUAO 4PDMA 4G28B 4JI4O 3VBBA 1J5EO 1I0HA 3J81N 1CP9A 1HNZB 1AR5A 4QJFB 2QWQB 3OMIB 3G6EV 4GZRB 3T1HO 1S5JA 2QR4A 1M5IA 2Q68A 1SA0B 4I7ZB 4QPJA 4YHHB 1YJNV 4JTAB 3S3WA 5CN0A 4NTXA 5EIBD 4YJ3B 3JAWA 2LFSA 1XNQB 3TGUH 2VQFB 3OGIB 1OCZB 3SJBC 2JEUA 1AJNA 3H1JH 3AG3B 4BW9A 4OX9B 4CS2A 2HR3A 2QWPB 4EB6B 2P06A 3HPLC 1TUBB 1NQTA 2IJKA 4DR4O 4DUYO 4MW3A 1PV0A 1H8EG 3KG2A 3E22A 1AR1B 1SQGA 1QLNA 3ZRXA 1FXVA 3RYIA 1HR0B 3E8BA 4R8CA 5EBWC 2UXDO 1A32A 1JFFA 1K92A 3MHSC 3RYFB 1EZJA 4FMTA 3ASOB 4PD4F 1HP8A 2GV9A 1VARA 2EILB 2L35A 3QTCA 5CA1B 1IBMO 1OCCB 4AQYB 1HDJA 3STLC 2UUCO 1VF6A 1L0NH 2A06H 5ITZB 2V4DA 1G8MA 3H1IH 2ZE6A 5EIBC 4GX5A 3CE2A 3BVOA 2VQEO 5B1AB 1K4DC 3CCVV 3D36A 3JALB 3X2QB 3AEIA 3HR0A 3JD2A 1IBLO 3CXHF 3BY6A 4UVAA 4H0LB 2LO1A 3G6BA 2ZIMA 2W0XA 1NKDA 4KXRA 2EJRA 3FAVA 4ZI7B 1YXBA 4FIPC 2VRZA 3CXCU 3SYPA 1RSOB 2NN4A 2F95B 2YIBD 3DGEA 4D7SA 4FZ1A 1XNRO 1SETA 4DR6B 3RT3C 3N27A 2JK5C 3RFRA 1JX9A 4OGQB 3IGAC 5IJ0A 4I9WA 1LUVA 2HJFC 1F7YA 2CUGA 3U11A 4PHZA 1UFIA 1Q86W 4DV7O 2PF4E 4J41A 1J5EB 2WA3A 1YVWA 4JI2O 1IZ3A 1XI1A 2EIMB 3JSLA 1NU1H 2M7WA 1PPJH 4O2BB 2FB5A 5A2QN 5HFLA 1IX9A 4UVCA 1COWG 4DV0B 1H2SB 4RO2A 5GW7A 3R65A 1EBOA 3LSUA 1H2NA 2QKAA 2V7QG 2PI4A 5B3SC 4G2KA 1THZA 1GMGA 3P3NA 3SPGA 2A3QA 4B7KA 4LF8B 1JCHA 1MA1A 3CYOA 4TV8A 1QVGU 3VQWA 2BTOA 1E79G 3FB5C 1Z2GA 3DTUB 4J10A 1E1QG 4CH5A 3HKBB 1KKCA 2LJ2A 5B1OA 1NT2B 3IJ4A 4QIWF 3SJQC 3HKCA 2CH7B 4J7JA 3I5DA 3EHBB 3K9AA 3B40A 1S76D 1LR1A 4JF3A 3JD1A 1N36O 3WB2A 3ZJZA 2HLDG 2ITCC 5AG2A 3H1HH 4LNUB 1W59A 5DECA 1QVFU 1CEZA 5IY5C 1VQ4V 1DF4A 1KC8W 1M4UA 2WPDG 2UXCB 2CE4A 1NVPB 4O4IA 2IU3A 3N2KA 4ICGA 4NXMB 4X8AA 5LL6Y 1M57B 2QM8A 3ABMB 2Z5UA 1K5QA 1KB9F 1WLEA 3OEHG 5L3FA 4GYCB 2LQTA 4RAIA 4DXWA 4DR2O 4F6RA 4PI2A 4Z1MG 4LF6O 3SR2C 3K0GA 2CDYA 5IJ9B 3O9OA 4UCUA 3L72H 3U0ZA 5LHHA 2BTQB 4JAUA 1K33A 2VWJA 4CC5A 1FS0G 4HZ3A 3ASNB 1WN7A 3CP1A 1D5NA 5LHGA 5J9PC 4DV1B 4KFMA 3T1YO 2EINC 5ITZA 5H9CA 2ZCEA 4L8JA 1PNKA 3K9SA 1SQQH 4UFZA 1VF7A 4BIUA 2R70A 2C2AA 3P32A 2P4VA 1YZBA 1S77D 1DTOA 3K0DA 4P9OA 4O2AA 2QEXV 2UUAB 1OCOC 2LW1A 3JARB 4TQFA 1GN6A 5KHIA 1AJPA 4WFEA 2EULA 2EZOA 4ZOLB 4FLVA 2Q6AA 1ENVA 5EZYB 3CD6V 2WAMA 3OGCC 3ZHQA 5H6RA 3TK1A 4DR2B 5CA3A 1N8RW 4KL1A 3JCZA 1DK1A 3CRCA 4KP4A 1M57C 2YUAA 1P49A 1Y6XA 3SJCC 3T4ZA 4DK1A 3MHHC 3ZMUA 2QM7A 2N04A 2E3CA 3BFRA 3CSXA 3W7XA 4RQEA 1QQCA 1FD9A 3ZIAG 4IYHA 1WA8B 3W7WA 1GKFA 1Y74A 2HHHB 3BCCH 4PA6A 1TVKB 3WFVA 3ZCCA 4J7KA 1MSWD 3OEEG 2MW2B 4P30A 1H2MA 1Q6IA 3ABTA 5IE9A 1QLEB 3FYIB 1J95A 5LGNA 2HHHO 5IT9N 5KX5A 4I50A 4DW1A 3JAMN 1SZTA 2Q4PA 1XMQO 4X20B 4DR5O 3RYFA 2LW7A 1NTZH 1Q7YW 3K59A 1QNMA 5LYJB 5JWPA 4LF8O 4NXMO 2W6JG 3OR6C 4MTFA 1B6QA 3AG4C 3TJTA 5B1AC 3E22B 4ZHQB 2XTAA 3OW2U 1ZL8B 2Y48A 2QJ1A 1ZAUA 1MMMA 2UU9B 1IVSA 3ABMC 3D3IA 3OMAB 5EC1C 4FFBB 2PTMA 4JI7O 1AI4A 5EBLC 2O57A 4NYKA 1QU7A 3K58A 4X1KB 4I0XA 4X65B 3H9VA 3JAWB 4U7NA 3SYAA 3CCMV 1K97A 4J11A 1EN5A 2P90A 1AI7A 2Q0AA 5L3BA 2RQ6A 2DJVA 5BMVA 2B1GA 2ZDIA 3OMNB 4MS2A 4DUZB 4AILC 4IHJA 4R50A 3CJHB 4IHJB 2M6YA 3K5NA 2OTJV 2R9RB 1LNQA 3FB6C 5EYPB 4JYYA 4B3SB 1IDSA 4FPPA 4CC6A 3IC7A 2Z0AA 3T2MA 1SESA 4JPRA 3LNNA 2K1EA 1F23A 5KHHA 4CS4A 2WLNA 4BW5A 4DV0O 3JAKA 1BQ0A 1N33O 1R3KC 2OIGA 3CRAA 4J9ZB 4YY3O 5HFMA 3HKEB 4AHCA 1R73A 2HJDA 4X1YA 3QO8A 4OPHA 3ZHUA 4DV2B 4NTWA 2GBOA 1XMQB 4QNHB 4O2AB 3ZHRA 1KUQA 3JYCA 3SYQA 2Y4UA 4OX9O 3ABUA 1G6UA 2QE7G 4NKGB 3RYCB 1XNRB 1OV9A 4ZHQA 2Q9LA 3AG3C 2UXDB 3FX7A 5GTHZ 3HKDA 4AQYO 3L71H 1NH2B 3E86A 4FLZA 4RWUA 3IC9A 2HEPA 2FYUH 4TQDA 1VF6C 3QO7A 1PM9A 1DLBA 2UXXA 2JS3A 1VF5B 1JQ0A 3AG2C 3ZRSA 4RUEA 1JMKC 2XT9A 2YEVA 2EX3A 3P30A 2YI8A 3ETQA 4B08A 5LGUA 3HB3B 2FL4A 3RWRD 1YCIA 3ZN1A 4JI0B 1X4TA 4E4EA 5IYDO 4JI6O 3F5TA 1RPRA 4MVSA 5DEDA 2OCHA 3MDSA 2Y0PA 1QR8A 1D5AA 1VQ8V 2WLJA 2KKWA 4HNAB 2ZQMA 1VQ6V 3OFNG 4Z1VA 4MVZA 1XUQA 2Q7GA 1HNWO 5L3DA 2X6AA 3C90A 1XNQO 4C7UA 1D2DA 2RCVA 1JOYA 4JI8B 2PI5A 4MT8A 2XNDG 3LDEA 4TUYB 1VIBA 4XDJA 4I55A 2F23A 3CJHA 4YHHO 1VQOV 5IYZA 2QSAA 3CCSV 2YEVB 1ZL8A 2EINB 1SC5B 1KP2A 3SJAC 1MNGA 2IJJA 4DUYB 3ZX6A 3Q4HA 2F43G 3SPJA 3T4DA 1VQMV 3ZS8C 1WB8A 3RBZA 2KG7B 1QBZA 1W2BU 1MOFA 3LUTB 3GB7C 2ZR3A 3CMEV 5LMNB 2UXBO 1Q81W 3ZHVA 1U97A 3CMAV 5BXZA 5D5QA 3OD4A 3OAAG 1K9MW 1SKVA 4OXSA 1Q82W 2WLLB 5LOVA 3N2GA 1B04A 1BSMA 5IDJA 1XOUA 1N0NA 2WLIB 1TUEB 4MVMA 2MK3A 2KG7A 2JJ1G 3AG1B 1H2KA 1XL6A 3K5LA 1JPXA 4O4JA 1F4MA 1R6NA 4IIJA 1GK9A 5JCOA 4DV6O 4B3TO 5LGTA 2BTQA 5JQGB 1RM1C 1SQPH 2A79B 2F1MA 4LBEC 4WFHA 1TA8A 2UU9O 1R1BA 2NR5A 1ZWIC 1S5LZ 4NTYA 4I50B 2H94A 4U3JB 5FNVB 1NJIW 4J42A 1SQVH 3KCXA 4JI1B 2YIDA 3AK1A 4LFCB 5LHIA 4IIJB 5H5NA 4EB6A 4O4JB 5CBHA 4LFBO 4MTXA 1KU9A 2ZNIA 3CB2A 3N2GB 4Q20A 3B8NA 4YIPA 4FLYA 5K1XA 4B7EA 3WG7B 4B3MB 1CPYA 5CMUA 1YEWA 1W0KG 4XBFA 3A0HZ 1XREA 1WJZA 3CRMA 1GH6A 3J7AU 2QA4V 3E89A 1GTOA 5EK0A 1O9GA 3THOA 3QNEA 2Y69C 2BSKA 2A9HA 1WAZA 1PP9H 4UUJC 5CBFA 2ZR2A 1AILA 1O9HA 1KBHA 2UXCO 4PA4A 5IYZB 4UCRA 4W4LA 4X20A 4TUYA 3ZMTA 3JASA 4LF5O 1N4CA 1OHHG 4CS3A 3FD9A 4X66O 1YJ9V 2WLMA 2CGNA 5KA6A 1YTFD 1OZ0A 1H38A 3ZMSA 2E75B 2EIJB 2ZDIC 4FLTA 4A5UB 2IW5A 1Q5OA 3UT5A 1N32O 4FZ0A 4GKJB 1KECA 2QWOB 3ABLC 2GTAA 1EN6A 1NR7A 1Q43A 2ZM6O 4JZGA 3LNMB 4BR6A 2CH7A 3ZEDA 2RNBA 2XAFA 2Y4TA 2HKOA 1K73W 4LF7B 2JGDB 2B9ZA 3OTFA 4B3SO 1R3LC 3N2KB 3F7VC 4I0XB 3B2EE 2ARHA 1RP3B 4CZZA 3NXSA 2Q7HA 4JYCA 4CBCA 1T5EA 4DV6B 4B3TB 2DYRB 2GDSA 4P9PA 2BOBC 4EEQA 3QF7A 3GWOA 1B06A 2RJZA 5KUKA 2Q73A 4NVPA 5IWAB 3UO2A 2Y0IA 4F6EA 3H01A 5L3CA 4DR6O 2ADQB 1BZKA 4K8ZA 4WFGA 4EFBA 4R7CA 3QVNA 4GX1A 4QE9A 3HKBA 4QPKA 2UXBB 4RQFA 1MZFA 1BS3A 4WFAV 1H8HG 2CAZC 2Q67A 1AROP 3SDLA 1S72V 1OCRB 4JYBA 4W4KA 1YITV 5IYBO 1ZUQA 4EFEA 3S3XA 4CH6A 1I94B 1TGOA 1RSOA 1PNMA 1BMFG 2GSMB 5KUMA 4H33A 3FAVB 1ORQC 1B3QA 4X88A 4GKKO 1Y74B 4JI8O 1PKXA 2OT5A 4FLXA 3CC4V 1SZXA 3BABA 2HG5C 2QM4A 2GUZB 1XL4A 3D3QA 2E5LB 2F93B 3BA8A 2HP8A 2EIKB 4U7OA 2ZD9A 1VMGA 2JRIA 4MTOA 2X6BA 2AZ0A 2KQXA 1V55B 3PN1A 5C8YA 5TISZ 1HWYA 1PL4A 2IH3C 4UV9A 4ZOLA 1GM9A 4JI2B 3U10A 3SGIA 3JARA 1IBMB 1BHAA 3RYHA 3KZIZ 2IU0A 1QLEC 3ZHSA 4WF9V 3B4SA 1K5SA 4TV8B 4TV9A 4B3MO 3AK3A 2AGAA 3L75H 5FLXN 1NBMG 4JYAB 4CH3A 3CRQA 3VQYA 1PD3A 2UUCB 3BHPA 4FFKA 1FJGO 4X62O 2R72A 2DOSA 4JI0O 1NZ6A 5BR8O 1FXKA 5JCOC 4J7ZA 1XHZA 1QCEA 1PL0A 4N21A 1FKAO 4LF5B 3CEIA 4DV5B 4H37A 4PV1B 2B5UA 2E74B 4IL6Z 4GX0A 3TETA 3CPWU 1VQLV 1G1XB 1I5XA 2D2CB 1DGSA 4B3RO 4KHPB 4UCVA 4JI7B 2P67A 4YY3B 5DM6V 1OCZC 1WP7A 3OT7A 3C3SA 2DYRC 5EBMC 1N36B 2FTKA 4DW0A 1I08A 1Z5WA 5KHJA 4FVMA 2E76B 1FYJA 3B77A 3JSNA 3VQVA 5JH7A 2CK3G 4HAMA 1OCOB 2YICA 4Q6GA 3NR7A 1VQ9V 4ZI7A 2YIBA 2B1IA 1AP6A 5FPRA 3AG2B 2GUZA 5KHKA 2GHYA 3CCLV 4ZKIA 3T1HB 3JALA 4FM2A 4H13B 3MD0A 2RDCA 1SRYA 4DK0A 1VP7A 3G4SV 2EILC 5LMNO 5FL7G 2ETNA 1HNZO 2JVDA 4DYLA 3JD0A 1M56C 1UPGA 2AHYA 3FKSG 4DV4O 4DR7O 1DF5A 2Q5ZA 2AXTZ 3BPZA 1VQ5V 5DN6G 3M7MX 4LCUC 1WP8A 4JI6B 4LC1A 2FKXA 2IJHA 5LBQA 5JJEB 1KYOF 5KLVH 2DYSC 5CB4A 3RYHB 4LF4B 4FK5C 4GKJO 1W0JG 2ZXWC 3K04A 2JGDA 2YXHA 2VQEB 4O4HA 3STZC 2Q69A 2OWOA 5BR8B 1K7DA 2QKCA 5C8YB 1SQBH 2DQ3A 2PYLA 2CTWA 4DV3O 1GAXA 4D6TH 3JD3A 2R9IA 3ZRWB 4FLWA 3UT5B 4BIZA 4BIOA 1E1RG 4WFBV 2KB1A 3QG5A 5KMGA 1VQNV 3E8FA 2ZT9B 4LNUA 3M8AA 1BQZA 1WNSA 2AW9A 4IYIA 3ASOC 1Y66A 4GX2A 1R6KA 2QWRB 3BA9A 5E79Z 3C3TA 3E83A 3KCYA 5J2TB 1KP3A 3EFFK 4PDLA 3ZHTA 2NLJC 1M90W 4MVRA 1ZTEA 4WBNA 5LMUO 4DR3B 4UCTA 1AR4A 4O4HB 4FJCC 4Z2WA 5FPOA 3BRCA 1M56B 4TT3G 1YI2V 4PDRA 4L87A 3B09A 4I9QA 1EFRG 5CB4B 1P4RA 4DO2A 3JATB 4BAYA 1VQKV 2N05A 5B3SB 4UCOA 3L73H 2N74A 3BAAA 3DSQA 4PA9A 1BCCH 2XAHA 5BY1A 1XQ8A 4JI3B 3A0BZ 2JJ2G 4PA7A 4PA3A 1FFXA 2F4VB 3FB7C 1BT8A 1I5YA 5KHGA 2X6CA 4X1KA 3LSSA 2WWWA 1EN4A 2ITDC 1XMOO 5A9GA 4DR4B 3ABLB 5IYCO 5CA1A 2QWNB 1IBLB 4TV9B 1M93A 1OCRC 3JASB 3CC7V 1XMOB 3AK2A 2HVJC 1MSDA 2E5LO 2RMKB 2ZE8A 4LFAO 4X1YB 4ABMA 3T1YB 3APOA 1WB7A 4DV1O 1N0JA 4X1IA 1LUWA 1URFA 1V9PA 2BSKB 5EC2C 4FM1A 3CCJV 2QKSA 5B5EZ 2UXNA 1BE3H 3AG1C 4TWKA 3RGBA 4JASA 4DV2O 1FXHA 2JS5A 1X59A 1SQFA 5JQGA 4K0KO 2Z3YA 1UJWB 2IBZH 4LF9O 1AP5A 2WLHA 3M99B 1V55C 2DWEC 4YJ3A 4GT1A 1N33B 4IT5A 4LFCO 5LXTA 4RUFA 1AJQA 1Q8IA 2XASA 3ICXA 4P2ZA 4JI3O 2WLLA 5D5PA 5KAIZ 5LP6A 3W7TA 4J9YB 2QTOA 4OPAA 2EIJC 1K4CC 3E35A 2ZNJA 3SPIA 3CRRA 3CWBH 3LDDA 1GRJA 4JV5O 4I5SA 1HR0O 2DMXA 3R66A 5B1NA 2HFEC 2W0FC 4JTCB 3DC5A 3CS5A 4NB5A 4DR1O 1GM7A 2LFRA 5IY5B 4X9QA 3ETDA 4DV4B 1QR9A 4DR7B 2V1DA 1SQXH 4F4LA 2L6LA 2WA4A 5L3EA 3JD4A 1NTKH 1XBLA 4NXNO 2Y69B 2K9PA 1ZSPA 3OM3B 1IBKB 5E1AC 2P22C 4R6ZA 3ZBHA 4LF9B 4DV3B 4K3AA 3EVKA 2GTSA 2WLKA 4GKKB 4B3RB 4KHPO 4O4LA 3FFQA 3FYEB 1Y76B 5LA6A 2PGGA 4DV7B 3PJSK 2PUSA 1N32B 1WPBA 3OR7C 3D8CA 3DXRB 2P5OA 1MABG 5L3GA 1NTMH 1S3JA 2YC0A 4PJ0Z 1KD1W 4X65O 1AVMA 4ASUG 2P6JA 1NR1A 3JCUZ 1FFTB 4MSWC 3CCUV 3F7YC 4IGGA 2F4VO 5F2VO 3H1LH 4JV5B 4X66B 4I4TB 3ML0A 1IBKO 1Q6UA 3OTOO 3W7UA 3ZN0A 5JJJB 4F6RB 1NI8A 5BMVB 2ATKC 2Q8VA 3FB8C 3P3PA 4LF7O 1JVMA 2OTLV 4HYOA 5J2TA 2ZE5A 3AG7A 5H2FZ 4UV8A 3K57A 3VQXA 1ZX3A 1RM1B 4DR3O 2PYJA 1GN3A 2YSUB 2ZM6B 4EKWA 2QTSA 1KQSU 4J80A 3ZRWA 1JJOA 3ZMZA 5CA0A 1Z5VA 1N34B 2IM9A 4DV5O 2ZXWB 1RPOA 3UO3A 3G80A 2ODMA 2R9AA 3OUFA 4QGPA 2EBOA 2JIZG 4N23A 2PY5A 4JAAA 1XDCA 4HBNA 4KUMA 2X7RB 2BE3A 3T1CA 4H44B 2CTQA 4CH4A 5JVDB 4LFBB 3CCEV 2QDOA 4WCEV 4LH7A 1NVPD 2KSDA 1L0LH 2CTPA 3K06A 2A0LA 3Q4HB 1MG1A 2Q7EA 5BZBA 2WSSG 2HVKC 3K03A 4PELA 4XDKA 3UCSC 1EM1A 1F51A 1CXZB 1FXKC 2IJIA 4I55B 1M1KW 3OUSA 4LWSB 2G38A 2LGWA 4DRXB 1RFYA 4UXNA 3W7SA 1YIJV 5GONA 1FJGB 1TVKA 2H8PC 4JZ2A 1K34A 1OCCC 3ZMVA 2W6IG 5J2UB 3CC2V 3L9DA 1JA8A 3GVMA 3JAKB 3K08A 4YJ2A 1FPOA 2JEXA 3WB0A 1F4NA 1N34O 4PI0A 5GONB 5GTIZ 4U3JA 5FNVA 4FFBA 2RN9A 2FMLA 2EJ7A 5EYPA 3LSQA 4LF6B 5IJ0B 2JDIG 1KKDA
chains in the Genus database with same CATH topology
2OCCB 2GHYA 3CCLV 4XDJA 2EIMB 1VQOV 2M7WA 3CCSV 2XAJA 2YEVB 4ZKIA 5HFLA 2EINB 4UVCA 1KP2A 1COWG 1IXMA 2IJJA 1SRYA 3MD0A 3SYCA 3G4SV 2EILC 5FL7G 1JJ2U 4RO2A 2F43G 3SPJA 3T4DA 5GW7A 1VQMV 3R65A 2EIKC 3RBZA 1EBOA 3JD0A 1QBZA 1M56C 1W2BU 1MOFA 2AHYA 3FKSG 3LUTB 3GB7C 1DF5A 4XDLA 1VQ5V 2WLIA 2ZR3A 1PNLA 3CMEV 2V7QG 3WG7C 5DN6G 1S0VA 2PI4A 5B3SC 1Q81W 4G2KA 1THZA 4LCUC 1GMGA 3SPGA 1BHBA 4LC1A 1JCHA 2IJHA 5LBQA 3CMAV 3RVYA 3CYOA 1QVGU 5B1BB 1AI5A 1YHQV 1YSCA 1E79G 3FB5C 3I55V 3DTUB 2DYSC 1E1QG 3OAAG 1K9MW 4ZBMA 4FK5C 4OXSA 1W0JG 2WLLB 1Q82W 5B1OA 2DWDC 2ZXWC 3K04A 5IDJA 1YJWV 2WLIB 4QIWF 1TUEB 4LP8A 4MVMA 2MK3A 3STZC 3SJQC 3BEHA 2Q69A 4QE7A 2JJ1G 3AG1B 3EHBB 3K9AA 1XL6A 2XAQA 4YXWG 1JPXA 1K7DA 1F4MA 1R6NA 1S76D 2DQ3A 2NNUA 1GK9A 4JGSA 3SPCA 1BL8A 4JF3A 5LGTA 3JD1A 2P7TC 3E8GA 3B8MA 3ZJZA 1RM1C 5CBGA 2HLDG 2ITCC 2A79B 3JD3A 4LBEC 2R9IA 4WFHA 3ZRWB 1S5HC 4BIZA 3UKMA 1ZWIC 1E1RG 1K3EA 4WFBV 2KB1A 3ASNC 3X2QC 1QVFU 1VQNV 3E8FA 1CEZA 5IY5C 1VQ4V 1DF4A 1KC8W 2H94A 3E8HA 2X0LA 1NJIW 2WPDG 1NVPB 3ASOC 5LHIA 2DYSB 2IU3A 1Y66A 4GX2A 2DW4A 1R6KA 2BOCC 4WFFA 3E83A 4X8AA 2D3OW 1KP3A 1M57B 3K79A 3EFFK 2QM8A 3ABMB 2Z5UA 4PDLA 2NLJC 1M90W 5CBHA 1K5QA 1WLEA 3OEHG 4MVRA 5L3FA 4RAIA 4MTXA 4DXWA 3LDCA 5H6QA 4FJCC 4Z1MG 3K0GA 1M56B 4G27B 4TT3G 1YI2V 4PDRA 4Q20A 1WPXA 3ABKB 3B8NA 4L87A 1EFRG 4MVOA 1P4RA 3WG7B 4DO2A 4BAYA 1VQKV 1CPYA 5CMUA 1W0KG 5B3SB 3RVZA 4XBFA 1K8AW 5LHHA 4JAUA 1K33A 3OE7G 4PA9A 3QO5A 2XAHA 1VQ7V 1ROPA 3AG4B 2JJ2G 4PA7A 1FS0G 1FXKB 4HZ3A 3ASNB 3E2EA 4PA3A 2QA4V 3E89A 3CP1A 1GTOA 3FB7C 4X89A 5LHGA 5EK0A 2AHZA 5J9PC 1I5YA 4KFMA 2EINC 2X6CA 3QNEA 5H9CA 3ETEA 2Y69C 2A9HA 3LSSA 1PNKA 4UUJC 2WWWA 5CBFA 4BIUA 2ITDC 2ZR2A 3IFXA 2C2AA 3ABLB 3P32A 5IYCO 2XOKG 4PA4A 5KA5A 1OCRC 1S77D 1DTOA 3K0DA 4P9OA 3CC7V 1V54C 2QEXV 2HVJC 3SYOA 1OCOC 2DQ0A 3ZMTA 1R3JC 1OHHG 4MVQA 1AJPA 3RW0A 4WFEA 1YJ9V 2EZOA 2WLMA 2Q6AA 5KA6A 1ENVA 1H2GA 3CD6V 3CCRV 2OCCC 2WAMA 3OGCC 5H6RA 3TK1A 1YTFD 1OZ0A 1H38A 1Y4MA 5EC2C 3ZMSA 5CA3A 3CCJV 1N8RW 3K3WA 2QKSA 3JCZA 2EIJB 2ZDIC 2IH1C 1AI6A 2UXNA 4KP4A 1M57C 3AG1C 2IW5A 4TWKA 3T4ZA 1L1FA 3A0RA 1P7BA 3G71V 1KECA 4JASA 3MHHC 1FXHA 3ZMUA 2QM7A 3ABLC 4UVBA 2Z3YA 3ABKC 3W7XA 4RQEA 1UJWB 1NR7A 3ZIAG 1R3IC 2WLHA 3M99B 1V55C 2DWEC 3W7WA 1GKFA 4GT1A 5B1BC 1G4YB 3LNMB 4PA6A 2XAFA 2EZPA 3WFVA 3ZCCA 2HKOA 4RUFA 1AJQA 2XASA 4P2ZA 1VQPV 1K73W 3VOUA 5C93A 1MSWD 2WLLA 1R3LC 3OEEG 3F7VC 3W7TA 4P30A 4MVUA 4J9YB 2QTOA 3ABTA 1QLEB 3FYIB 1J95A 2EIJC 3F5WC 5LGNA 1YTFB 1K4CC 3E35A 4PDVA 3SPIA 1SZTA 4CZZA 3LDDA 3NXSA 4CBCA 4JYCA 4I5SA 5B1NA 4TSFG 2DYRB 4P9PA 3TCUA 2HFEC 2BOBC 1GM8A 1Q7YW 4MW8A 3GWOA 2W0FC 4JTCB 1V54B 1NH2D 2LP7A 5KUKA 2W6JG 3OR6C 1GO3F 4MTFA 1GM7A 4MTGA 3H01A 2LFRA 3ZRVA 5IY5B 4JTDB 1B6QA 3AG4C 5L3CA 5B1AC 3ETDA 4JAVA 1QR9A 1SERA 2V1DA 3OW2U 4WFGA 3UM7A 4F4LA 2Y48A 3CCQV 5L3EA 3JD4A 2XAGA 3ETGA 4R7CA 3I56V 4GX1A 4QE9A 3ABMC 4GCZA 2Y69B 2EIMC 3OM3B 4QPKA 4E2LA 5E1AC 4R6ZA 3SPHA 1M9NA 3D3IA 3OMAB 5EC1C 4RQFA 2WLKA 4WFAV 1AI4A 4PDMA 1H8HG 5EBLC 4G28B 3VBBA 2Q67A 1AROP 3FYEB 1S72V 1OCRB 4JYBA 3PJSK 1CP9A 4U7NA 1YITV 3OR7C 3SYAA 5IYBO 4QJFB 3CCMV 1K97A 3OMIB 1MABG 5L3GA 3G6EV 1S3JA 1KD1W 1PNMA 2P90A 1AI7A 2Q68A 4ASUG 4QPJA 1BMFG 5L3BA 2GSMB 5KUMA 1YJNV 2P6JA 1NR1A 4H33A 1FFTB 4MSWC 1ORQC 4JTAB 3CCUV 2B1GA 4X88A 5CN0A 3F7YC 2ZDIA 3OMNB 4MS2A 1PKXA 2LFSA 2OT5A 4R50A 3ML0A 3CC4V 1OCZB 2HG5C 3W7UA 2OTJV 1XL4A 3ZN0A 2R9RB 1LNQA 2JEUA 1AJNA 3AG3B 3FB6C 2ATKC 4FPPA 3FB8C 2HR3A 3IC7A 3T2MA 1SESA 2EIKB 4JPRA 4U7OA 2ZD9A 1JVMA 2K1EA 3HPLC 1F23A 4HYOA 1NQTA 2OTLV 2WLNA 2IJKA 4MTOA 2X6BA 4MW3A 4BW5A 4UV8A 1R3KC 1RM1B 1V55B 1H8EG 4J9ZB 3KG2A 1HWYA 1AR1B 2YSUB 5HFMA 1R73A 2IH3C 1QLNA 4EKWA 4UV9A 3ZRXA 1FXVA 3QO8A 1GM9A 3E8BA 4QNHB 4R8CA 5EBWC 1KQSU 3ZRWA 3JYCA 1BHAA 3SYQA 1K92A 3MHSC 1EZJA 4FMTA 3ZMZA 1QLEC 3ASOB 3ABUA 2ZXWB 1RPOA 2IU0A 4WF9V 1K5SA 2QE7G 3OUFA 2EILB 3CCVV 2EBOA 2JIZG 4N23A 1OCCB 4KUMA 2X7RB 3AG3C 1NBMG 3T1CA 3STLC 1PD3A 1NH2B 3E86A 3CCEV 1G8MA 4WCEV 1NVPD 3K06A 1FXKA 3QO7A 1QCEA 1PL0A 2A0LA 4N21A 1MG1A 1DLBA 5BZBA 4GX5A 2UXXA 2WSSG 4H37A 5B1AB 2B5UA 1JQ0A 1K4DC 2HVKC 3K03A 4GX0A 3AG2C 4PELA 4RUEA 3D36A 4XDKA 3X2QB 3ZRSA 3AEIA 3TETA 3CPWU 1F51A 2YEVA 3JD2A 1VQLV 1I5XA 1FXKC 2IJIA 3BY6A 1M1KW 4UVAA 3P30A 3OUSA 5LGUA 3HB3B 2P67A 1NKDA 2EJRA 4UXNA 3W7SA 3ZN1A 4FIPC 1OCZC 5DM6V 5IYDO 1RPRA 4MVSA 1YIJV 3CXCU 3SYPA 1QR8A 2DYRC 3DGEA 5EBMC 1VQ8V 2H8PC 2WLJA 2FTKA 1K34A 1OCCC 3ZMVA 2W6IG 3CC2V 2ZQMA 1SETA 1VQ6V 3OFNG 3B77A 3K08A 2JEXA 2JK5C 2CK3G 4HAMA 1JX9A 1F4NA 3IGAC 4MVZA 1OCOB 4I9WA 5L3DA 2X6AA 2HJFC 1VQ9V 2B1IA 1Q86W 1JOYA 2PI5A 3LSQA 4MT8A 2XNDG 3AG2B 2JDIG 1KKDA 3LDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVM A;  2K1E A;  3HPL C;  4HYO A;  4G27 B;  2WLN A;  4MTO A;  4PDR A;  2WLL A;  2X6B A;  4MW3 A;  4XDJ A;  1R3L C;  4BW5 A;  3F7V C;  4MVO A;  4P30 A;  4MVU A;  4J9Y B;  1R3K C;  2QTO A;  4J9Z B;  3RVZ A;  1J95 A;  3KG2 A;  2EIJ C;  3F5W C;  1K4C C;  4PA9 A;  3SYC A;  4PDV A;  2EIL C;  2IH3 C;  4EKW A;  3SPI A;  4RO2 A;  3SPJ A;  3T4D A;  3LDD A;  4PA7 A;  4CBC A;  3R65 A;  2EIK C;  4HZ3 A;  4PA3 A;  3RBZ A;  3E8B A;  1M56 C;  4R8C A;  5EBW C;  4QNH B;  3E89 A;  2AHY A;  4P9P A;  3LUT B;  3TCU A;  3GB7 C;  2HFE C;  2BOB C;  3FB7 C;  3JYC A;  4X89 A;  2WLI A;  4MW8 A;  4XDL A;  2W0F C;  2AHZ A;  5EK0 A;  3RW0 A;  4JTC B;  3SYQ A;  5J9P C;  3WG7 C;  4KFM A;  1QLE C;  2EIN C;  2X6C A;  5B3S C;  5KUK A;  2Y69 C;  2A9H A;  3OR6 C;  3OUF A;  4LCU C;  3SPG A;  4UUJ C;  4MTF A;  4MTG A;  4JTD B;  3RVY A;  3AG4 C;  2ITD C;  5CBF A;  5B1A C;  3IFX A;  3AG3 C;  3T1C A;  3FB5 C;  4WFG A;  3STL C;  3UM7 A;  4PA4 A;  2DYS C;  4F4L A;  1OCR C;  4ZBM A;  4OXS A;  3E86 A;  2WLL B;  3K0D A;  4P9O A;  1V54 C;  4R7C A;  4GX1 A;  2HVJ C;  3SYO A;  2DWD C;  2ZXW C;  3K04 A;  3ABM C;  4QE9 A;  1OCO C;  2EIM C;  2WLI B;  3K06 A;  1R3J C;  5E1A C;  2A0L A;  4MVM A;  4LP8 A;  4R6Z A;  5EC1 C;  3SPH A;  3STZ C;  3SJQ C;  5BZB A;  4GX5 A;  3BEH A;  2Q69 A;  4MVQ A;  4QE7 A;  4H37 A;  1XL6 A;  1K4D C;  2HVK C;  2WLK A;  3K03 A;  3AG2 C;  4GX0 A;  4PDM A;  4RUE A;  4WFE A;  4XDK A;  2WLM A;  4G28 B;  2Q6A A;  5EBL C;  3ZRS A;  3TET A;  2Q67 A;  2OCC C;  2YEV A;  3OGC C;  3SPC A;  1BL8 A;  5EC2 C;  2P7T C;  3E8G A;  3PJS K;  3OUS A;  3ZJZ A;  5CBG A;  2QKS A;  2ITC C;  3OR7 C;  3SYA A;  2A79 B;  4LBE C;  2IH1 C;  4WFH A;  1S5H C;  1M57 C;  1OCZ C;  3UKM A;  1ZWI C;  2Q68 A;  3AG1 C;  4MVS A;  2KB1 A;  3ASN C;  4TWK A;  3SYP A;  3T4Z A;  5KUM A;  3X2Q C;  3E8F A;  1P7B A;  2DYR C;  4H33 A;  5IY5 C;  4MSW C;  5EBM C;  1ORQ C;  2H8P C;  4JTA B;  2WLJ A;  4X88 A;  1OCC C;  3E8H A;  3F7Y C;  3ABL C;  4MS2 A;  3ASO C;  3ABK C;  4GX2 A;  4R50 A;  2BOC C;  3K08 A;  4WFF A;  1R3I C;  2JK5 C;  2WLH A;  3E83 A;  4X8A A;  1V55 C;  2DWE C;  2HG5 C;  3EFF K;  3IGA C;  1XL4 A;  4MVZ A;  2R9R B;  1LNQ A;  4PDL A;  2NLJ C;  5B1B C;  4I9W A;  5CBH A;  1G4Y B;  2X6A A;  2HJF C;  3FB6 C;  3LNM B;  4MVR A;  2ATK C;  4PA6 A;  3FB8 C;  4RAI A;  4DXW A;  3LDC A;  4RUF A;  3T2M A;  4P2Z A;  1KKD A;  3LDE A;  3VOU A;  3K0G A;  2ZD9 A; 
#chains in the Genus database with same CATH topology
 4YIO A;  5JH7 B;  2OCC B;  2YXY A;  5LMU B;  4I4T A;  1P84 F;  1XEQ A;  2XAJ A;  1Y67 A;  1R6T A;  1IXM A;  3SYC A;  3DC6 A;  1JJ2 U;  4ZIB A;  4NR1 A;  2EIK C;  5B66 Z;  2ZE7 A;  2DN9 A;  1L8D A;  4XDL A;  2WLI A;  3HKD B;  3DXR A;  1PNL A;  2YIA A;  3WG7 C;  1S0V A;  5LOV B;  1BHB A;  3MAQ A;  2CGO A;  4DUZ O;  3RVY A;  5B1B B;  1AI5 A;  1YHQ V;  2OYQ A;  3RN4 A;  1YSC A;  3I55 V;  5CA0 B;  2PZS A;  4X64 B;  4ZBM A;  1HW7 A;  1H2L A;  2DWD C;  1YJW V;  5LXT B;  4LP8 A;  2QGN A;  3UQ8 A;  2ZIO A;  2H3O A;  1Q90 D;  3BEH A;  1FFX B;  4QE7 A;  3D36 C;  3HKE A;  4LR3 A;  2XAQ A;  4YXW G;  1AB3 A;  2CTR A;  2UUB O;  1EZV H;  3CX5 F;  2NNU A;  4O2B A;  3SPC A;  4JGS A;  1BL8 A;  2P7T C;  3E8G A;  3TXS A;  3B8M A;  5CBG A;  5LYJ A;  1U96 A;  2ILM A;  1S5H C;  5JJN B;  3UKM A;  1K3E A;  3RYI B;  3ASN C;  3X2Q C;  1TAE A;  1IXB A;  5K1P A;  4WBN B;  5KX5 B;  2XHB A;  3E8H A;  2X0L A;  3APQ A;  3L74 H;  4AI8 A;  1KMI Z;  2DYS B;  4YJ2 B;  2DW4 A;  2BOC C;  4WFF A;  2D3O W;  5IWA O;  4O4I B;  3K79 A;  4X1I B;  4BWA A;  4X64 O;  2YI9 A;  1GN4 A;  4DR5 B;  5KMG B;  1NS1 A;  2YXL A;  3LDC A;  4X62 B;  5H6Q A;  2BCC H;  4G27 B;  1WPX A;  4UB8 Z;  3ABK B;  1HNW B;  4MVO A;  1HNX B;  3H1K H;  3RVZ A;  1K8A W;  3G67 A;  3OE7 G;  3QO5 A;  1OJH A;  3OTO B;  3EXA A;  1VQ7 V;  1ROP A;  2ZKO A;  3AG4 B;  1FXK B;  3E2E A;  2Q0O C;  1I7F A;  4X89 A;  3J80 N;  2AHZ A;  4TOI A;  2LGQ A;  3ETE A;  2AZ2 A;  1QHT A;  2ADP A;  5JVD A;  3K5M A;  2F66 C;  3A2F A;  1I94 O;  5EZY A;  4K0K B;  2ZIN A;  3IFX A;  3WU2 Z;  2JGU A;  3IAY A;  1YDX A;  3JAT A;  2XOK G;  1FAF A;  5KA5 A;  1JFF B;  1Q6H A;  1V54 C;  1IUR A;  5IJ9 A;  3SYO A;  2DE0 X;  2DQ0 A;  1R3J C;  4MVQ A;  3RW0 A;  3WB1 A;  1H2G A;  3CCR V;  2OCC C;  5LP6 B;  4D7T A;  1Y4M A;  4GLX A;  3O65 A;  2UUB B;  3K3W A;  4HNA A;  1TUB A;  4LFA B;  5J2U A;  2IH1 C;  1SS3 A;  4FM0 A;  1AI6 A;  2VWK A;  4DR1 B;  1HNX O;  2OIE A;  4K35 A;  2P4K A;  2YS8 A;  1L1F A;  1WA8 A;  1P7B A;  3A0R A;  3G71 V;  4LF4 O;  4DRX A;  4UVB A;  1P7G A;  4LWS A;  4GUN A;  4JI4 B;  4U3F H;  3ABK C;  5KAF Z;  1R3I C;  3GWK C;  3KKY A;  1GN2 A;  5B1B C;  1SA0 A;  1G4Y B;  1VEW A;  1Q3E A;  1MZE A;  2EZP A;  1VQP V;  4JYA O;  1XIL A;  3L70 H;  3VOU A;  4JI5 B;  3A8T A;  3K5O A;  5C93 A;  4UCS A;  4LH6 A;  4MVU A;  4FLU A;  3F5W C;  1YTF B;  2VQF O;  1Y76 A;  5LA6 B;  4PDV A;  1SF9 A;  3RYC A;  3CHX A;  4O4L B;  1XHX A;  1BGY H;  4TSF G;  3TCU A;  1GM8 A;  4MW8 A;  1V54 B;  1NH2 D;  2LP7 A;  1YF2 A;  1GO3 F;  4MTG A;  4JI1 O;  3ZRV A;  1ZLZ A;  4JTD B;  4JAV A;  2A7W A;  1SER A;  4UB6 Z;  3HKC B;  4JI5 O;  3UM7 A;  5LP6 C;  3CCQ V;  1US6 A;  2XAG A;  3ETG A;  3I56 V;  3TXQ A;  4GCZ A;  2EIM C;  2YDE A;  4E2L A;  3SPH A;  1M9N A;  4NXN B;  4K8X A;  2VS0 A;  1JR9 A;  2XUM A;  2UUA O;  4PDM A;  4G28 B;  4JI4 O;  3VBB A;  1J5E O;  1I0H A;  3J81 N;  1CP9 A;  1HNZ B;  1AR5 A;  4QJF B;  2QWQ B;  3OMI B;  3G6E V;  4GZR B;  3T1H O;  1S5J A;  2QR4 A;  1M5I A;  2Q68 A;  1SA0 B;  4I7Z B;  4QPJ A;  4YHH B;  1YJN V;  4JTA B;  3S3W A;  5CN0 A;  4NTX A;  5EIB D;  4YJ3 B;  3JAW A;  2LFS A;  1XNQ B;  3TGU H;  2VQF B;  3OGI B;  1OCZ B;  3SJB C;  2JEU A;  1AJN A;  3H1J H;  3AG3 B;  4BW9 A;  4OX9 B;  4CS2 A;  2HR3 A;  2QWP B;  4EB6 B;  2P06 A;  3HPL C;  1TUB B;  1NQT A;  2IJK A;  4DR4 O;  4DUY O;  4MW3 A;  1PV0 A;  1H8E G;  3KG2 A;  3E22 A;  1AR1 B;  1SQG A;  1QLN A;  3ZRX A;  1FXV A;  3RYI A;  1HR0 B;  3E8B A;  4R8C A;  5EBW C;  2UXD O;  1A32 A;  1JFF A;  1K92 A;  3MHS C;  3RYF B;  1EZJ A;  4FMT A;  3ASO B;  4PD4 F;  1HP8 A;  2GV9 A;  1VAR A;  2EIL B;  2L35 A;  3QTC A;  5CA1 B;  1IBM O;  1OCC B;  4AQY B;  1HDJ A;  3STL C;  2UUC O;  1VF6 A;  1L0N H;  2A06 H;  5ITZ B;  2V4D A;  1G8M A;  3H1I H;  2ZE6 A;  5EIB C;  4GX5 A;  3CE2 A;  3BVO A;  2VQE O;  5B1A B;  1K4D C;  3CCV V;  3D36 A;  3JAL B;  3X2Q B;  3AEI A;  3HR0 A;  3JD2 A;  1IBL O;  3CXH F;  3BY6 A;  4UVA A;  4H0L B;  2LO1 A;  3G6B A;  2ZIM A;  2W0X A;  1NKD A;  4KXR A;  2EJR A;  3FAV A;  4ZI7 B;  1YXB A;  4FIP C;  2VRZ A;  3CXC U;  3SYP A;  1RSO B;  2NN4 A;  2F95 B;  2YIB D;  3DGE A;  4D7S A;  4FZ1 A;  1XNR O;  1SET A;  4DR6 B;  3RT3 C;  3N27 A;  2JK5 C;  3RFR A;  1JX9 A;  4OGQ B;  3IGA C;  5IJ0 A;  4I9W A;  1LUV A;  2HJF C;  1F7Y A;  2CUG A;  3U11 A;  4PHZ A;  1UFI A;  1Q86 W;  4DV7 O;  2PF4 E;  4J41 A;  1J5E B;  2WA3 A;  1YVW A;  4JI2 O;  1IZ3 A;  1XI1 A;  2EIM B;  3JSL A;  1NU1 H;  2M7W A;  1PPJ H;  4O2B B;  2FB5 A;  5A2Q N;  5HFL A;  1IX9 A;  4UVC A;  1COW G;  4DV0 B;  1H2S B;  4RO2 A;  5GW7 A;  3R65 A;  1EBO A;  3LSU A;  1H2N A;  2QKA A;  2V7Q G;  2PI4 A;  5B3S C;  4G2K A;  1THZ A;  1GMG A;  3P3N A;  3SPG A;  2A3Q A;  4B7K A;  4LF8 B;  1JCH A;  1MA1 A;  3CYO A;  4TV8 A;  1QVG U;  3VQW A;  2BTO A;  1E79 G;  3FB5 C;  1Z2G A;  3DTU B;  4J10 A;  1E1Q G;  4CH5 A;  3HKB B;  1KKC A;  2LJ2 A;  5B1O A;  1NT2 B;  3IJ4 A;  4QIW F;  3SJQ C;  3HKC A;  2CH7 B;  4J7J A;  3I5D A;  3EHB B;  3K9A A;  3B40 A;  1S76 D;  1LR1 A;  4JF3 A;  3JD1 A;  1N36 O;  3WB2 A;  3ZJZ A;  2HLD G;  2ITC C;  5AG2 A;  3H1H H;  4LNU B;  1W59 A;  5DEC A;  1QVF U;  1CEZ A;  5IY5 C;  1VQ4 V;  1DF4 A;  1KC8 W;  1M4U A;  2WPD G;  2UXC B;  2CE4 A;  1NVP B;  4O4I A;  2IU3 A;  3N2K A;  4ICG A;  4NXM B;  4X8A A;  5LL6 Y;  1M57 B;  2QM8 A;  3ABM B;  2Z5U A;  1K5Q A;  1KB9 F;  1WLE A;  3OEH G;  5L3F A;  4GYC B;  2LQT A;  4RAI A;  4DXW A;  4DR2 O;  4F6R A;  4PI2 A;  4Z1M G;  4LF6 O;  3SR2 C;  3K0G A;  2CDY A;  5IJ9 B;  3O9O A;  4UCU A;  3L72 H;  3U0Z A;  5LHH A;  2BTQ B;  4JAU A;  1K33 A;  2VWJ A;  4CC5 A;  1FS0 G;  4HZ3 A;  3ASN B;  1WN7 A;  3CP1 A;  1D5N A;  5LHG A;  5J9P C;  4DV1 B;  4KFM A;  3T1Y O;  2EIN C;  5ITZ A;  5H9C A;  2ZCE A;  4L8J A;  1PNK A;  3K9S A;  1SQQ H;  4UFZ A;  1VF7 A;  4BIU A;  2R70 A;  2C2A A;  3P32 A;  2P4V A;  1YZB A;  1S77 D;  1DTO A;  3K0D A;  4P9O A;  4O2A A;  2QEX V;  2UUA B;  1OCO C;  2LW1 A;  3JAR B;  4TQF A;  1GN6 A;  5KHI A;  1AJP A;  4WFE A;  2EUL A;  2EZO A;  4ZOL B;  4FLV A;  2Q6A A;  1ENV A;  5EZY B;  3CD6 V;  2WAM A;  3OGC C;  3ZHQ A;  5H6R A;  3TK1 A;  4DR2 B;  5CA3 A;  1N8R W;  4KL1 A;  3JCZ A;  1DK1 A;  3CRC A;  4KP4 A;  1M57 C;  2YUA A;  1P49 A;  1Y6X A;  3SJC C;  3T4Z A;  4DK1 A;  3MHH C;  3ZMU A;  2QM7 A;  2N04 A;  2E3C A;  3BFR A;  3CSX A;  3W7X A;  4RQE A;  1QQC A;  1FD9 A;  3ZIA G;  4IYH A;  1WA8 B;  3W7W A;  1GKF A;  1Y74 A;  2HHH B;  3BCC H;  4PA6 A;  1TVK B;  3WFV A;  3ZCC A;  4J7K A;  1MSW D;  3OEE G;  2MW2 B;  4P30 A;  1H2M A;  1Q6I A;  3ABT A;  5IE9 A;  1QLE B;  3FYI B;  1J95 A;  5LGN A;  2HHH O;  5IT9 N;  5KX5 A;  4I50 A;  4DW1 A;  3JAM N;  1SZT A;  2Q4P A;  1XMQ O;  4X20 B;  4DR5 O;  3RYF A;  2LW7 A;  1NTZ H;  1Q7Y W;  3K59 A;  1QNM A;  5LYJ B;  5JWP A;  4LF8 O;  4NXM O;  2W6J G;  3OR6 C;  4MTF A;  1B6Q A;  3AG4 C;  3TJT A;  5B1A C;  3E22 B;  4ZHQ B;  2XTA A;  3OW2 U;  1ZL8 B;  2Y48 A;  2QJ1 A;  1ZAU A;  1MMM A;  2UU9 B;  1IVS A;  3ABM C;  3D3I A;  3OMA B;  5EC1 C;  4FFB B;  2PTM A;  4JI7 O;  1AI4 A;  5EBL C;  2O57 A;  4NYK A;  1QU7 A;  3K58 A;  4X1K B;  4I0X A;  4X65 B;  3H9V A;  3JAW B;  4U7N A;  3SYA A;  3CCM V;  1K97 A;  4J11 A;  1EN5 A;  2P90 A;  1AI7 A;  2Q0A A;  5L3B A;  2RQ6 A;  2DJV A;  5BMV A;  2B1G A;  2ZDI A;  3OMN B;  4MS2 A;  4DUZ B;  4AIL C;  4IHJ A;  4R50 A;  3CJH B;  4IHJ B;  2M6Y A;  3K5N A;  2OTJ V;  2R9R B;  1LNQ A;  3FB6 C;  5EYP B;  4JYY A;  4B3S B;  1IDS A;  4FPP A;  4CC6 A;  3IC7 A;  2Z0A A;  3T2M A;  1SES A;  4JPR A;  3LNN A;  2K1E A;  1F23 A;  5KHH A;  4CS4 A;  2WLN A;  4BW5 A;  4DV0 O;  3JAK A;  1BQ0 A;  1N33 O;  1R3K C;  2OIG A;  3CRA A;  4J9Z B;  4YY3 O;  5HFM A;  3HKE B;  4AHC A;  1R73 A;  2HJD A;  4X1Y A;  3QO8 A;  4OPH A;  3ZHU A;  4DV2 B;  4NTW A;  2GBO A;  1XMQ B;  4QNH B;  4O2A B;  3ZHR A;  1KUQ A;  3JYC A;  3SYQ A;  2Y4U A;  4OX9 O;  3ABU A;  1G6U A;  2QE7 G;  4NKG B;  3RYC B;  1XNR B;  1OV9 A;  4ZHQ A;  2Q9L A;  3AG3 C;  2UXD B;  3FX7 A;  5GTH Z;  3HKD A;  4AQY O;  3L71 H;  1NH2 B;  3E86 A;  4FLZ A;  4RWU A;  3IC9 A;  2HEP A;  2FYU H;  4TQD A;  1VF6 C;  3QO7 A;  1PM9 A;  1DLB A;  2UXX A;  2JS3 A;  1VF5 B;  1JQ0 A;  3AG2 C;  3ZRS A;  4RUE A;  1JMK C;  2XT9 A;  2YEV A;  2EX3 A;  3P30 A;  2YI8 A;  3ETQ A;  4B08 A;  5LGU A;  3HB3 B;  2FL4 A;  3RWR D;  1YCI A;  3ZN1 A;  4JI0 B;  1X4T A;  4E4E A;  5IYD O;  4JI6 O;  3F5T A;  1RPR A;  4MVS A;  5DED A;  2OCH A;  3MDS A;  2Y0P A;  1QR8 A;  1D5A A;  1VQ8 V;  2WLJ A;  2KKW A;  4HNA B;  2ZQM A;  1VQ6 V;  3OFN G;  4Z1V A;  4MVZ A;  1XUQ A;  2Q7G A;  1HNW O;  5L3D A;  2X6A A;  3C90 A;  1XNQ O;  4C7U A;  1D2D A;  2RCV A;  1JOY A;  4JI8 B;  2PI5 A;  4MT8 A;  2XND G;  3LDE A;  4TUY B;  1VIB A;  4XDJ A;  4I55 A;  2F23 A;  3CJH A;  4YHH O;  1VQO V;  5IYZ A;  2QSA A;  3CCS V;  2YEV B;  1ZL8 A;  2EIN B;  1SC5 B;  1KP2 A;  3SJA C;  1MNG A;  2IJJ A;  4DUY B;  3ZX6 A;  3Q4H A;  2F43 G;  3SPJ A;  3T4D A;  1VQM V;  3ZS8 C;  1WB8 A;  3RBZ A;  2KG7 B;  1QBZ A;  1W2B U;  1MOF A;  3LUT B;  3GB7 C;  2ZR3 A;  3CME V;  5LMN B;  2UXB O;  1Q81 W;  3ZHV A;  1U97 A;  3CMA V;  5BXZ A;  5D5Q A;  3OD4 A;  3OAA G;  1K9M W;  1SKV A;  4OXS A;  1Q82 W;  2WLL B;  5LOV A;  3N2G A;  1B04 A;  1BSM A;  5IDJ A;  1XOU A;  1N0N A;  2WLI B;  1TUE B;  4MVM A;  2MK3 A;  2KG7 A;  2JJ1 G;  3AG1 B;  1H2K A;  1XL6 A;  3K5L A;  1JPX A;  4O4J A;  1F4M A;  1R6N A;  4IIJ A;  1GK9 A;  5JCO A;  4DV6 O;  4B3T O;  5LGT A;  2BTQ A;  5JQG B;  1RM1 C;  1SQP H;  2A79 B;  2F1M A;  4LBE C;  4WFH A;  1TA8 A;  2UU9 O;  1R1B A;  2NR5 A;  1ZWI C;  1S5L Z;  4NTY A;  4I50 B;  2H94 A;  4U3J B;  5FNV B;  1NJI W;  4J42 A;  1SQV H;  3KCX A;  4JI1 B;  2YID A;  3AK1 A;  4LFC B;  5LHI A;  4IIJ B;  5H5N A;  4EB6 A;  4O4J B;  5CBH A;  4LFB O;  4MTX A;  1KU9 A;  2ZNI A;  3CB2 A;  3N2G B;  4Q20 A;  3B8N A;  4YIP A;  4FLY A;  5K1X A;  4B7E A;  3WG7 B;  4B3M B;  1CPY A;  5CMU A;  1YEW A;  1W0K G;  4XBF A;  3A0H Z;  1XRE A;  1WJZ A;  3CRM A;  1GH6 A;  3J7A U;  2QA4 V;  3E89 A;  1GTO A;  5EK0 A;  1O9G A;  3THO A;  3QNE A;  2Y69 C;  2BSK A;  2A9H A;  1WAZ A;  1PP9 H;  4UUJ C;  5CBF A;  2ZR2 A;  1AIL A;  1O9H A;  1KBH A;  2UXC O;  4PA4 A;  5IYZ B;  4UCR A;  4W4L A;  4X20 A;  4TUY A;  3ZMT A;  3JAS A;  4LF5 O;  1N4C A;  1OHH G;  4CS3 A;  3FD9 A;  4X66 O;  1YJ9 V;  2WLM A;  2CGN A;  5KA6 A;  1YTF D;  1OZ0 A;  1H38 A;  3ZMS A;  2E75 B;  2EIJ B;  2ZDI C;  4FLT A;  4A5U B;  2IW5 A;  1Q5O A;  3UT5 A;  1N32 O;  4FZ0 A;  4GKJ B;  1KEC A;  2QWO B;  3ABL C;  2GTA A;  1EN6 A;  1NR7 A;  1Q43 A;  2ZM6 O;  4JZG A;  3LNM B;  4BR6 A;  2CH7 A;  3ZED A;  2RNB A;  2XAF A;  2Y4T A;  2HKO A;  1K73 W;  4LF7 B;  2JGD B;  2B9Z A;  3OTF A;  4B3S O;  1R3L C;  3N2K B;  3F7V C;  4I0X B;  3B2E E;  2ARH A;  1RP3 B;  4CZZ A;  3NXS A;  2Q7H A;  4JYC A;  4CBC A;  1T5E A;  4DV6 B;  4B3T B;  2DYR B;  2GDS A;  4P9P A;  2BOB C;  4EEQ A;  3QF7 A;  3GWO A;  1B06 A;  2RJZ A;  5KUK A;  2Q73 A;  4NVP A;  5IWA B;  3UO2 A;  2Y0I A;  4F6E A;  3H01 A;  5L3C A;  4DR6 O;  2ADQ B;  1BZK A;  4K8Z A;  4WFG A;  4EFB A;  4R7C A;  3QVN A;  4GX1 A;  4QE9 A;  3HKB A;  4QPK A;  2UXB B;  4RQF A;  1MZF A;  1BS3 A;  4WFA V;  1H8H G;  2CAZ C;  2Q67 A;  1ARO P;  3SDL A;  1S72 V;  1OCR B;  4JYB A;  4W4K A;  1YIT V;  5IYB O;  1ZUQ A;  4EFE A;  3S3X A;  4CH6 A;  1I94 B;  1TGO A;  1RSO A;  1PNM A;  1BMF G;  2GSM B;  5KUM A;  4H33 A;  3FAV B;  1ORQ C;  1B3Q A;  4X88 A;  4GKK O;  1Y74 B;  4JI8 O;  1PKX A;  2OT5 A;  4FLX A;  3CC4 V;  1SZX A;  3BAB A;  2HG5 C;  2QM4 A;  2GUZ B;  1XL4 A;  3D3Q A;  2E5L B;  2F93 B;  3BA8 A;  2HP8 A;  2EIK B;  4U7O A;  2ZD9 A;  1VMG A;  2JRI A;  4MTO A;  2X6B A;  2AZ0 A;  2KQX A;  1V55 B;  3PN1 A;  5C8Y A;  5TIS Z;  1HWY A;  1PL4 A;  2IH3 C;  4UV9 A;  4ZOL A;  1GM9 A;  4JI2 B;  3U10 A;  3SGI A;  3JAR A;  1IBM B;  1BHA A;  3RYH A;  3KZI Z;  2IU0 A;  1QLE C;  3ZHS A;  4WF9 V;  3B4S A;  1K5S A;  4TV8 B;  4TV9 A;  4B3M O;  3AK3 A;  2AGA A;  3L75 H;  5FLX N;  1NBM G;  4JYA B;  4CH3 A;  3CRQ A;  3VQY A;  1PD3 A;  2UUC B;  3BHP A;  4FFK A;  1FJG O;  4X62 O;  2R72 A;  2DOS A;  4JI0 O;  1NZ6 A;  5BR8 O;  1FXK A;  5JCO C;  4J7Z A;  1XHZ A;  1QCE A;  1PL0 A;  4N21 A;  1FKA O;  4LF5 B;  3CEI A;  4DV5 B;  4H37 A;  4PV1 B;  2B5U A;  2E74 B;  4IL6 Z;  4GX0 A;  3TET A;  3CPW U;  1VQL V;  1G1X B;  1I5X A;  2D2C B;  1DGS A;  4B3R O;  4KHP B;  4UCV A;  4JI7 B;  2P67 A;  4YY3 B;  5DM6 V;  1OCZ C;  1WP7 A;  3OT7 A;  3C3S A;  2DYR C;  5EBM C;  1N36 B;  2FTK A;  4DW0 A;  1I08 A;  1Z5W A;  5KHJ A;  4FVM A;  2E76 B;  1FYJ A;  3B77 A;  3JSN A;  3VQV A;  5JH7 A;  2CK3 G;  4HAM A;  1OCO B;  2YIC A;  4Q6G A;  3NR7 A;  1VQ9 V;  4ZI7 A;  2YIB A;  2B1I A;  1AP6 A;  5FPR A;  3AG2 B;  2GUZ A;  5KHK A;  2GHY A;  3CCL V;  4ZKI A;  3T1H B;  3JAL A;  4FM2 A;  4H13 B;  3MD0 A;  2RDC A;  1SRY A;  4DK0 A;  1VP7 A;  3G4S V;  2EIL C;  5LMN O;  5FL7 G;  2ETN A;  1HNZ O;  2JVD A;  4DYL A;  3JD0 A;  1M56 C;  1UPG A;  2AHY A;  3FKS G;  4DV4 O;  4DR7 O;  1DF5 A;  2Q5Z A;  2AXT Z;  3BPZ A;  1VQ5 V;  5DN6 G;  3M7M X;  4LCU C;  1WP8 A;  4JI6 B;  4LC1 A;  2FKX A;  2IJH A;  5LBQ A;  5JJE B;  1KYO F;  5KLV H;  2DYS C;  5CB4 A;  3RYH B;  4LF4 B;  4FK5 C;  4GKJ O;  1W0J G;  2ZXW C;  3K04 A;  2JGD A;  2YXH A;  2VQE B;  4O4H A;  3STZ C;  2Q69 A;  2OWO A;  5BR8 B;  1K7D A;  2QKC A;  5C8Y B;  1SQB H;  2DQ3 A;  2PYL A;  2CTW A;  4DV3 O;  1GAX A;  4D6T H;  3JD3 A;  2R9I A;  3ZRW B;  4FLW A;  3UT5 B;  4BIZ A;  4BIO A;  1E1R G;  4WFB V;  2KB1 A;  3QG5 A;  5KMG A;  1VQN V;  3E8F A;  2ZT9 B;  4LNU A;  3M8A A;  1BQZ A;  1WNS A;  2AW9 A;  4IYI A;  3ASO C;  1Y66 A;  4GX2 A;  1R6K A;  2QWR B;  3BA9 A;  5E79 Z;  3C3T A;  3E83 A;  3KCY A;  5J2T B;  1KP3 A;  3EFF K;  4PDL A;  3ZHT A;  2NLJ C;  1M90 W;  4MVR A;  1ZTE A;  4WBN A;  5LMU O;  4DR3 B;  4UCT A;  1AR4 A;  4O4H B;  4FJC C;  4Z2W A;  5FPO A;  3BRC A;  1M56 B;  4TT3 G;  1YI2 V;  4PDR A;  4L87 A;  3B09 A;  4I9Q A;  1EFR G;  5CB4 B;  1P4R A;  4DO2 A;  3JAT B;  4BAY A;  1VQK V;  2N05 A;  5B3S B;  4UCO A;  3L73 H;  2N74 A;  3BAA A;  3DSQ A;  4PA9 A;  1BCC H;  2XAH A;  5BY1 A;  1XQ8 A;  4JI3 B;  3A0B Z;  2JJ2 G;  4PA7 A;  4PA3 A;  1FFX A;  2F4V B;  3FB7 C;  1BT8 A;  1I5Y A;  5KHG A;  2X6C A;  4X1K A;  3LSS A;  2WWW A;  1EN4 A;  2ITD C;  1XMO O;  5A9G A;  4DR4 B;  3ABL B;  5IYC O;  5CA1 A;  2QWN B;  1IBL B;  4TV9 B;  1M93 A;  1OCR C;  3JAS B;  3CC7 V;  1XMO B;  3AK2 A;  2HVJ C;  1MSD A;  2E5L O;  2RMK B;  2ZE8 A;  4LFA O;  4X1Y B;  4ABM A;  3T1Y B;  3APO A;  1WB7 A;  4DV1 O;  1N0J A;  4X1I A;  1LUW A;  1URF A;  1V9P A;  2BSK B;  5EC2 C;  4FM1 A;  3CCJ V;  2QKS A;  5B5E Z;  2UXN A;  1BE3 H;  3AG1 C;  4TWK A;  3RGB A;  4JAS A;  4DV2 O;  1FXH A;  2JS5 A;  1X59 A;  1SQF A;  5JQG A;  4K0K O;  2Z3Y A;  1UJW B;  2IBZ H;  4LF9 O;  1AP5 A;  2WLH A;  3M99 B;  1V55 C;  2DWE C;  4YJ3 A;  4GT1 A;  1N33 B;  4IT5 A;  4LFC O;  5LXT A;  4RUF A;  1AJQ A;  1Q8I A;  2XAS A;  3ICX A;  4P2Z A;  4JI3 O;  2WLL A;  5D5P A;  5KAI Z;  5LP6 A;  3W7T A;  4J9Y B;  2QTO A;  4OPA A;  2EIJ C;  1K4C C;  3E35 A;  2ZNJ A;  3SPI A;  3CRR A;  3CWB H;  3LDD A;  1GRJ A;  4JV5 O;  4I5S A;  1HR0 O;  2DMX A;  3R66 A;  5B1N A;  2HFE C;  2W0F C;  4JTC B;  3DC5 A;  3CS5 A;  4NB5 A;  4DR1 O;  1GM7 A;  2LFR A;  5IY5 B;  4X9Q A;  3ETD A;  4DV4 B;  1QR9 A;  4DR7 B;  2V1D A;  1SQX H;  4F4L A;  2L6L A;  2WA4 A;  5L3E A;  3JD4 A;  1NTK H;  1XBL A;  4NXN O;  2Y69 B;  2K9P A;  1ZSP A;  3OM3 B;  1IBK B;  5E1A C;  2P22 C;  4R6Z A;  3ZBH A;  4LF9 B;  4DV3 B;  4K3A A;  3EVK A;  2GTS A;  2WLK A;  4GKK B;  4B3R B;  4KHP O;  4O4L A;  3FFQ A;  3FYE B;  1Y76 B;  5LA6 A;  2PGG A;  4DV7 B;  3PJS K;  2PUS A;  1N32 B;  1WPB A;  3OR7 C;  3D8C A;  3DXR B;  2P5O A;  1MAB G;  5L3G A;  1NTM H;  1S3J A;  2YC0 A;  4PJ0 Z;  1KD1 W;  4X65 O;  1AVM A;  4ASU G;  2P6J A;  1NR1 A;  3JCU Z;  1FFT B;  4MSW C;  3CCU V;  3F7Y C;  4IGG A;  2F4V O;  5F2V O;  3H1L H;  4JV5 B;  4X66 B;  4I4T B;  3ML0 A;  1IBK O;  1Q6U A;  3OTO O;  3W7U A;  3ZN0 A;  5JJJ B;  4F6R B;  1NI8 A;  5BMV B;  2ATK C;  2Q8V A;  3FB8 C;  3P3P A;  4LF7 O;  1JVM A;  2OTL V;  4HYO A;  5J2T A;  2ZE5 A;  3AG7 A;  5H2F Z;  4UV8 A;  3K57 A;  3VQX A;  1ZX3 A;  1RM1 B;  4DR3 O;  2PYJ A;  1GN3 A;  2YSU B;  2ZM6 B;  4EKW A;  2QTS A;  1KQS U;  4J80 A;  3ZRW A;  1JJO A;  3ZMZ A;  5CA0 A;  1Z5V A;  1N34 B;  2IM9 A;  4DV5 O;  2ZXW B;  1RPO A;  3UO3 A;  3G80 A;  2ODM A;  2R9A A;  3OUF A;  4QGP A;  2EBO A;  2JIZ G;  4N23 A;  2PY5 A;  4JAA A;  1XDC A;  4HBN A;  4KUM A;  2X7R B;  2BE3 A;  3T1C A;  4H44 B;  2CTQ A;  4CH4 A;  5JVD B;  4LFB B;  3CCE V;  2QDO A;  4WCE V;  4LH7 A;  1NVP D;  2KSD A;  1L0L H;  2CTP A;  3K06 A;  2A0L A;  3Q4H B;  1MG1 A;  2Q7E A;  5BZB A;  2WSS G;  2HVK C;  3K03 A;  4PEL A;  4XDK A;  3UCS C;  1EM1 A;  1F51 A;  1CXZ B;  1FXK C;  2IJI A;  4I55 B;  1M1K W;  3OUS A;  4LWS B;  2G38 A;  2LGW A;  4DRX B;  1RFY A;  4UXN A;  3W7S A;  1YIJ V;  5GON A;  1FJG B;  1TVK A;  2H8P C;  4JZ2 A;  1K34 A;  1OCC C;  3ZMV A;  2W6I G;  5J2U B;  3CC2 V;  3L9D A;  1JA8 A;  3GVM A;  3JAK B;  3K08 A;  4YJ2 A;  1FPO A;  2JEX A;  3WB0 A;  1F4N A;  1N34 O;  4PI0 A;  5GON B;  5GTI Z;  4U3J A;  5FNV A;  4FFB A;  2RN9 A;  2FML A;  2EJ7 A;  5EYP A;  3LSQ A;  4LF6 B;  5IJ0 B;  2JDI G;  1KKD A; 
#chains in the Genus database with same CATH homology
 2OCC B;  2GHY A;  3CCL V;  4XDJ A;  2EIM B;  1VQO V;  2M7W A;  3CCS V;  2XAJ A;  2YEV B;  4ZKI A;  5HFL A;  2EIN B;  4UVC A;  1KP2 A;  1COW G;  1IXM A;  2IJJ A;  1SRY A;  3MD0 A;  3SYC A;  3G4S V;  2EIL C;  5FL7 G;  1JJ2 U;  4RO2 A;  2F43 G;  3SPJ A;  3T4D A;  5GW7 A;  1VQM V;  3R65 A;  2EIK C;  3RBZ A;  1EBO A;  3JD0 A;  1QBZ A;  1M56 C;  1W2B U;  1MOF A;  2AHY A;  3FKS G;  3LUT B;  3GB7 C;  1DF5 A;  4XDL A;  1VQ5 V;  2WLI A;  2ZR3 A;  1PNL A;  3CME V;  2V7Q G;  3WG7 C;  5DN6 G;  1S0V A;  2PI4 A;  5B3S C;  1Q81 W;  4G2K A;  1THZ A;  4LCU C;  1GMG A;  3SPG A;  1BHB A;  4LC1 A;  1JCH A;  2IJH A;  5LBQ A;  3CMA V;  3RVY A;  3CYO A;  1QVG U;  5B1B B;  1AI5 A;  1YHQ V;  1YSC A;  1E79 G;  3FB5 C;  3I55 V;  3DTU B;  2DYS C;  1E1Q G;  3OAA G;  1K9M W;  4ZBM A;  4FK5 C;  4OXS A;  1W0J G;  2WLL B;  1Q82 W;  5B1O A;  2DWD C;  2ZXW C;  3K04 A;  5IDJ A;  1YJW V;  2WLI B;  4QIW F;  1TUE B;  4LP8 A;  4MVM A;  2MK3 A;  3STZ C;  3SJQ C;  3BEH A;  2Q69 A;  4QE7 A;  2JJ1 G;  3AG1 B;  3EHB B;  3K9A A;  1XL6 A;  2XAQ A;  4YXW G;  1JPX A;  1K7D A;  1F4M A;  1R6N A;  1S76 D;  2DQ3 A;  2NNU A;  1GK9 A;  4JGS A;  3SPC A;  1BL8 A;  4JF3 A;  5LGT A;  3JD1 A;  2P7T C;  3E8G A;  3B8M A;  3ZJZ A;  1RM1 C;  5CBG A;  2HLD G;  2ITC C;  2A79 B;  3JD3 A;  4LBE C;  2R9I A;  4WFH A;  3ZRW B;  1S5H C;  4BIZ A;  3UKM A;  1ZWI C;  1E1R G;  1K3E A;  4WFB V;  2KB1 A;  3ASN C;  3X2Q C;  1QVF U;  1VQN V;  3E8F A;  1CEZ A;  5IY5 C;  1VQ4 V;  1DF4 A;  1KC8 W;  2H94 A;  3E8H A;  2X0L A;  1NJI W;  2WPD G;  1NVP B;  3ASO C;  5LHI A;  2DYS B;  2IU3 A;  1Y66 A;  4GX2 A;  2DW4 A;  1R6K A;  2BOC C;  4WFF A;  3E83 A;  4X8A A;  2D3O W;  1KP3 A;  1M57 B;  3K79 A;  3EFF K;  2QM8 A;  3ABM B;  2Z5U A;  4PDL A;  2NLJ C;  1M90 W;  5CBH A;  1K5Q A;  1WLE A;  3OEH G;  4MVR A;  5L3F A;  4RAI A;  4MTX A;  4DXW A;  3LDC A;  5H6Q A;  4FJC C;  4Z1M G;  3K0G A;  1M56 B;  4G27 B;  4TT3 G;  1YI2 V;  4PDR A;  4Q20 A;  1WPX A;  3ABK B;  3B8N A;  4L87 A;  1EFR G;  4MVO A;  1P4R A;  3WG7 B;  4DO2 A;  4BAY A;  1VQK V;  1CPY A;  5CMU A;  1W0K G;  5B3S B;  3RVZ A;  4XBF A;  1K8A W;  5LHH A;  4JAU A;  1K33 A;  3OE7 G;  4PA9 A;  3QO5 A;  2XAH A;  1VQ7 V;  1ROP A;  3AG4 B;  2JJ2 G;  4PA7 A;  1FS0 G;  1FXK B;  4HZ3 A;  3ASN B;  3E2E A;  4PA3 A;  2QA4 V;  3E89 A;  3CP1 A;  1GTO A;  3FB7 C;  4X89 A;  5LHG A;  5EK0 A;  2AHZ A;  5J9P C;  1I5Y A;  4KFM A;  2EIN C;  2X6C A;  3QNE A;  5H9C A;  3ETE A;  2Y69 C;  2A9H A;  3LSS A;  1PNK A;  4UUJ C;  2WWW A;  5CBF A;  4BIU A;  2ITD C;  2ZR2 A;  3IFX A;  2C2A A;  3ABL B;  3P32 A;  5IYC O;  2XOK G;  4PA4 A;  5KA5 A;  1OCR C;  1S77 D;  1DTO A;  3K0D A;  4P9O A;  3CC7 V;  1V54 C;  2QEX V;  2HVJ C;  3SYO A;  1OCO C;  2DQ0 A;  3ZMT A;  1R3J C;  1OHH G;  4MVQ A;  1AJP A;  3RW0 A;  4WFE A;  1YJ9 V;  2EZO A;  2WLM A;  2Q6A A;  5KA6 A;  1ENV A;  1H2G A;  3CD6 V;  3CCR V;  2OCC C;  2WAM A;  3OGC C;  5H6R A;  3TK1 A;  1YTF D;  1OZ0 A;  1H38 A;  1Y4M A;  5EC2 C;  3ZMS A;  5CA3 A;  3CCJ V;  1N8R W;  3K3W A;  2QKS A;  3JCZ A;  2EIJ B;  2ZDI C;  2IH1 C;  1AI6 A;  2UXN A;  4KP4 A;  1M57 C;  3AG1 C;  2IW5 A;  4TWK A;  3T4Z A;  1L1F A;  3A0R A;  1P7B A;  3G71 V;  1KEC A;  4JAS A;  3MHH C;  1FXH A;  3ZMU A;  2QM7 A;  3ABL C;  4UVB A;  2Z3Y A;  3ABK C;  3W7X A;  4RQE A;  1UJW B;  1NR7 A;  3ZIA G;  1R3I C;  2WLH A;  3M99 B;  1V55 C;  2DWE C;  3W7W A;  1GKF A;  4GT1 A;  5B1B C;  1G4Y B;  3LNM B;  4PA6 A;  2XAF A;  2EZP A;  3WFV A;  3ZCC A;  2HKO A;  4RUF A;  1AJQ A;  2XAS A;  4P2Z A;  1VQP V;  1K73 W;  3VOU A;  5C93 A;  1MSW D;  2WLL A;  1R3L C;  3OEE G;  3F7V C;  3W7T A;  4P30 A;  4MVU A;  4J9Y B;  2QTO A;  3ABT A;  1QLE B;  3FYI B;  1J95 A;  2EIJ C;  3F5W C;  5LGN A;  1YTF B;  1K4C C;  3E35 A;  4PDV A;  3SPI A;  1SZT A;  4CZZ A;  3LDD A;  3NXS A;  4CBC A;  4JYC A;  4I5S A;  5B1N A;  4TSF G;  2DYR B;  4P9P A;  3TCU A;  2HFE C;  2BOB C;  1GM8 A;  1Q7Y W;  4MW8 A;  3GWO A;  2W0F C;  4JTC B;  1V54 B;  1NH2 D;  2LP7 A;  5KUK A;  2W6J G;  3OR6 C;  1GO3 F;  4MTF A;  1GM7 A;  4MTG A;  3H01 A;  2LFR A;  3ZRV A;  5IY5 B;  4JTD B;  1B6Q A;  3AG4 C;  5L3C A;  5B1A C;  3ETD A;  4JAV A;  1QR9 A;  1SER A;  2V1D A;  3OW2 U;  4WFG A;  3UM7 A;  4F4L A;  2Y48 A;  3CCQ V;  5L3E A;  3JD4 A;  2XAG A;  3ETG A;  4R7C A;  3I56 V;  4GX1 A;  4QE9 A;  3ABM C;  4GCZ A;  2Y69 B;  2EIM C;  3OM3 B;  4QPK A;  4E2L A;  5E1A C;  4R6Z A;  3SPH A;  1M9N A;  3D3I A;  3OMA B;  5EC1 C;  4RQF A;  2WLK A;  4WFA V;  1AI4 A;  4PDM A;  1H8H G;  5EBL C;  4G28 B;  3VBB A;  2Q67 A;  1ARO P;  3FYE B;  1S72 V;  1OCR B;  4JYB A;  3PJS K;  1CP9 A;  4U7N A;  1YIT V;  3OR7 C;  3SYA A;  5IYB O;  4QJF B;  3CCM V;  1K97 A;  3OMI B;  1MAB G;  5L3G A;  3G6E V;  1S3J A;  1KD1 W;  1PNM A;  2P90 A;  1AI7 A;  2Q68 A;  4ASU G;  4QPJ A;  1BMF G;  5L3B A;  2GSM B;  5KUM A;  1YJN V;  2P6J A;  1NR1 A;  4H33 A;  1FFT B;  4MSW C;  1ORQ C;  4JTA B;  3CCU V;  2B1G A;  4X88 A;  5CN0 A;  3F7Y C;  2ZDI A;  3OMN B;  4MS2 A;  1PKX A;  2LFS A;  2OT5 A;  4R50 A;  3ML0 A;  3CC4 V;  1OCZ B;  2HG5 C;  3W7U A;  2OTJ V;  1XL4 A;  3ZN0 A;  2R9R B;  1LNQ A;  2JEU A;  1AJN A;  3AG3 B;  3FB6 C;  2ATK C;  4FPP A;  3FB8 C;  2HR3 A;  3IC7 A;  3T2M A;  1SES A;  2EIK B;  4JPR A;  4U7O A;  2ZD9 A;  1JVM A;  2K1E A;  3HPL C;  1F23 A;  4HYO A;  1NQT A;  2OTL V;  2WLN A;  2IJK A;  4MTO A;  2X6B A;  4MW3 A;  4BW5 A;  4UV8 A;  1R3K C;  1RM1 B;  1V55 B;  1H8E G;  4J9Z B;  3KG2 A;  1HWY A;  1AR1 B;  2YSU B;  5HFM A;  1R73 A;  2IH3 C;  1QLN A;  4EKW A;  4UV9 A;  3ZRX A;  1FXV A;  3QO8 A;  1GM9 A;  3E8B A;  4QNH B;  4R8C A;  5EBW C;  1KQS U;  3ZRW A;  3JYC A;  1BHA A;  3SYQ A;  1K92 A;  3MHS C;  1EZJ A;  4FMT A;  3ZMZ A;  1QLE C;  3ASO B;  3ABU A;  2ZXW B;  1RPO A;  2IU0 A;  4WF9 V;  1K5S A;  2QE7 G;  3OUF A;  2EIL B;  3CCV V;  2EBO A;  2JIZ G;  4N23 A;  1OCC B;  4KUM A;  2X7R B;  3AG3 C;  1NBM G;  3T1C A;  3STL C;  1PD3 A;  1NH2 B;  3E86 A;  3CCE V;  1G8M A;  4WCE V;  1NVP D;  3K06 A;  1FXK A;  3QO7 A;  1QCE A;  1PL0 A;  2A0L A;  4N21 A;  1MG1 A;  1DLB A;  5BZB A;  4GX5 A;  2UXX A;  2WSS G;  4H37 A;  5B1A B;  2B5U A;  1JQ0 A;  1K4D C;  2HVK C;  3K03 A;  4GX0 A;  3AG2 C;  4PEL A;  4RUE A;  3D36 A;  4XDK A;  3X2Q B;  3ZRS A;  3AEI A;  3TET A;  3CPW U;  1F51 A;  2YEV A;  3JD2 A;  1VQL V;  1I5X A;  1FXK C;  2IJI A;  3BY6 A;  1M1K W;  4UVA A;  3P30 A;  3OUS A;  5LGU A;  3HB3 B;  2P67 A;  1NKD A;  2EJR A;  4UXN A;  3W7S A;  3ZN1 A;  4FIP C;  1OCZ C;  5DM6 V;  5IYD O;  1RPR A;  4MVS A;  1YIJ V;  3CXC U;  3SYP A;  1QR8 A;  2DYR C;  3DGE A;  5EBM C;  1VQ8 V;  2H8P C;  2WLJ A;  2FTK A;  1K34 A;  1OCC C;  3ZMV A;  2W6I G;  3CC2 V;  2ZQM A;  1SET A;  1VQ6 V;  3OFN G;  3B77 A;  3K08 A;  2JEX A;  2JK5 C;  2CK3 G;  4HAM A;  1JX9 A;  1F4N A;  3IGA C;  4MVZ A;  1OCO B;  4I9W A;  5L3D A;  2X6A A;  2HJF C;  1VQ9 V;  2B1I A;  1Q86 W;  1JOY A;  2PI5 A;  3LSQ A;  4MT8 A;  2XND G;  3AG2 B;  2JDI G;  1KKD A;  3LDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...