3STZC

Kcsa potassium channel mutant y82c with nitroxide spin label
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
102
structure length
102
Chain Sequence
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 44
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3stzC00
2YEVA 3ZRSA 3E8BA 3OR6C 2EILC 3K04A 4H37A 5EC2C 3F7YC 3E83A 4I9WA 2Y69C 4WFGA 2BOCC 5EBMC 3KG2A 1M56C 5EBWC 1OCRC 2DWEC 3R65A 3TCUA 4HYOA 2KB1A 5EBLC 1XL4A 3STZC 3UKMA 4WFHA 5B3SC 3SYPA 3X2QC 3E89A 3PJSK 3OUFA 3LNMB 2IH3C 2JK5C 1V55C 2ZXWC 3SPGA 4ZBMA 2ZD9A 2DYRC 4JTCB 1K4DC 2QTOA 4LP8A 4GX1A 4R8CA 3RW0A 3ASOC 2WLMA 2ATKC 3FB8C 2HG5C 2Q69A 4MVUA 2K1EA 2WLHA 1LNQA 3FB5C 2W0FC 1S5HC 2EINC 1R3IC 2DWDC 3AG4C 1M57C 4P9OA 2EIMC 5KUMA 4QNHB 3STLC 5CBFA 3K03A 2DYSC 2ITCC 3K0DA 4WFEA 4DXWA 3E86A 4MTGA 5J9PC 2X6CA 3F5WC 4MTFA 4XDKA 5E1AC 1J95A 3EFFK 1BL8A 4X89A 4P30A 4QE7A 2X6BA 4H33A 4J9YB 4LCUC 2HVKC 4X8AA 4J9ZB 1KKDA 3LDCA 4PA4A 2WLLA 3SJQC 4G28B 4MVRA 4XDLA 2IH1C 2NLJC 4R50A 4X88A 4PA7A 4QE9A 2WLJA 4PDLA 2HJFC 2HFEC 4MVOA 4WFFA 4MW8A 3SYCA 3K0GA 1ZWIC 3ABKC 1OCCC 4P2ZA 3SPHA 3SYQA 3JYCA 3BEHA 3E8GA 3LUTB 4GX0A 2WLNA 5EK0A 2EIJC 2A0LA 3ABLC 4GX2A 4LBEC 5IY5C 4P9PA 3T4DA 3RVYA 1K4CC 4MVMA 5EC1C 4HZ3A 4MVQA 2R9RB 4G27B 4MS2A 3UM7A 5CBHA 3RBZA 2HVJC 3SYOA 5CBGA 1V54C 1OCZC 3K06A 4JTDB 4UUJC 4MVSA 5B1BC 1XL6A 3OR7C 4EKWA 3K08A 3E8FA 3VOUA 3TETA 4PA6A 4PDRA 2Q6AA 5BZBA 3ABMC 4BW5A 4F4LA 4OXSA 4PDMA 4KFMA 3T1CA 3ASNC 4CBCA 3F7VC 3ZJZA 4PA9A 3SPIA 2H8PC 2P7TC 5B1AC 1JVMA 4PDVA 3SYAA 2WLIB 4MW3A 3FB6C 2ITDC 2Q67A 3IFXA 2BOBC 2A79B 2QKSA 4XDJA 4JTAB 3RVZA 3SPJA 4MTOA 1G4YB 2A9HA 3IGAC 3E8HA 2X6AA 3HPLC 2AHYA 3OGCC 4PA3A 2OCCC 1R3KC 3T2MA 3GB7C 3LDDA 3LDEA 4RUEA 3AG1C 2WLKA 4MVZA 2Q68A 1QLEC 4TWKA 1OCOC 3T4ZA 5KUKA 4MSWC 4RAIA 1R3JC 4RUFA 3WG7C 3AG3C 3SPCA 2AHZA 3FB7C 2EIKC 4GX5A 1ORQC 4RO2A 1R3LC 3AG2C 2WLLB 4R7CA 4R6ZA 3OUSA 1P7BA 2WLIA
chains in the Genus database with same CATH superfamily
1BZKA 4O4LB 5LHHA 2QWQB 4ZOLA 4Z1VA 4RQEA 3FAVA 1XNRB 1KYOF 4PJ0Z 3SGIA 1VF7A 2BSKB 1MSDA 5JVDB 2OT5A 1GM7A 4IHJB 5JJNB 5L3EA 4E2LA 4GKKO 1AR4A 2D2CB 4H0LB 4DV1O 2Z3YA 4FM0A 1TVKB 2EINC 1YF2A 5CBFA 4MT8A 3K0DA 4KP4A 4DXWA 2ZE5A 3JALB 2IM9A 2VWKA 4FLWA 3DXRB 1U96A 3ETQA 4J9ZB 1KKDA 5LGUA 1SF9A 3HKBA 3ICXA 5CA0A 3ASOB 2Q73A 3K0GA 4DO2A 1W2BU 5K1XA 3ZMSA 4DV0B 3CC4V 4O2AA 5EC1C 2HVJC 3W7SA 5FPOA 4JTDB 2QJ1A 1YI2V 1PKXA 2JS5A 4NKGB 4FLYA 1VF6A 3T1CA 2ADPA 3OGIB 1EBOA 2CUGA 5B1AC 4J7ZA 1VP7A 2QR4A 1YJ9V 2P4KA 3CJHA 2Q4PA 3OGCC 2K9PA 2X6AA 2QWNB 4LF5B 3LDDA 1TGOA 1VEWA 4X62B 4DV7B 1XMOB 1R3JC 1IXBA 2MK3A 3IC9A 1Q6IA 2NR5A 3CC7V 2UUCB 4GYCB 3E83A 5EBMC 1TAEA 1KD1W 5EBLC 3H1IH 5LA6A 3SYPA 4J7JA 1BQZA 1EN5A 4JTCB 2FL4A 4LC1A 2LQTA 2P4VA 4LP8A 1RP3B 1Y74A 1QLEB 1YZBA 1HNWB 1GTOA 2DMXA 5JWPA 3HKBB 2F93B 3ABMB 3EHBB 5CA0B 4L8JA 3JD0A 4X64O 3L74H 2GTAA 1VQ7V 4LF8O 4DV5O 2X6BA 3FX7A 1JFFB 1H38A 1F4MA 3N2GA 4LWSB 4O2AB 4O4IA 4XDLA 1UPGA 1JA8A 1SKVA 2Y4TA 4UCOA 5IJ9A 2UXBB 1RSOA 1ZWIC 1OHHG 3KCXA 2Q0AA 1PL4A 4UCTA 2CTPA 1M90W 2UUBB 2C2AA 5GW7A 4IYIA 3T4DA 1HWYA 3W7TA 2XAFA 1W0JG 3CJHB 5CA1A 4CH5A 1BCCH 4PA6A 4PDRA 1M4UA 1R73A 4JI8O 4PDMA 3L73H 1M1KW 2OCHA 1DGSA 3IJ4A 5TISZ 3DC6A 1JVMA 3SYAA 1F23A 2CE4A 1YTFB 3IFXA 3G67A 2KKWA 4JI3B 3HKDB 4LF4O 2KG7B 4JI1B 5IY5B 2WLKA 3SR2C 4ICGA 3JD3A 4DR3O 3T4ZA 5KUKA 1KKCA 3FB7C 1SQGA 3OTOO 3MHHC 5L3BA 4F6RA 1IBKB 2L35A 2UUAB 4YIPA 2WLLB 4YJ3A 1PM9A 1AP5A 2YEVA 3B77A 1Y74B 1Q7YW 3AG7A 4K35A 1XUQA 4FFBA 1MZFA 1NZ6A 2E5LB 1RPOA 3CE2A 3CRAA 5HFMA 3HB3B 2JS3A 4K8ZA 1XHXA 2DYRC 1COWG 1SQPH 2QTOA 4B3SB 4DR1O 3N2GB 1I94B 4OPAA 3FB5C 4O4IB 5J2TA 1S5HC 5LMNO 2DQ3A 1IDSA 4ASUG 1RSOB 4XDKA 1AJQA 1D2DA 2HR3A 4P30A 1N0NA 4H33A 3ZHQA 3X2QB 1HR0B 5LHGA 3JASA 1W0KG 5LXTA 3CCQV 1N33O 4RQFA 5IWAB 3BEHA 3LUTB 4D7SA 5LBQA 3CCVV 4UFZA 5DECA 4FZ1A 3CP1A 2DW4A 3ETDA 3JCUZ 1SQBH 1JJOA 1JQ0A 2VWJA 3P3PA 4NVPA 1MZEA 2R9IA 1PL0A 3CRQA 2JEXA 3SPIA 3DC5A 2XAHA 4YJ3B 2ZR3A 2YEVB 3D36C 2QKSA 2IJIA 2Z0AA 4B3MB 1Q6UA 1VQ8V 2QM8A 2ZNJA 1M9NA 4TT3G 4DR5B 1K97A 3CS5A 5D5PA 1WP8A 5BXZA 3JD1A 4DV4O 3A2FA 1N4CA 5GONA 5KAFZ 1YJNV 2LGQA 3J7AU 3HKEA 3SJCC 5EC2C 3RWRD 1ZTEA 4DV2O 2M7WA 1Y66A 2PY5A 4DR4B 2XUMA 3UKMA 4UVAA 3QO8A 3E89A 4JI6B 3H1JH 4L87A 3UT5B 1IBMB 4R8CA 2PI4A 2YXLA 2BTQB 3THOA 2WAMA 1AR5A 1ZL8B 5KUMA 3ZHVA 2DYSC 5J9PC 3ZMZA 4TQFA 5IDJA 1CPYA 2E3CA 1P4RA 1W59A 2VQFO 1FD9A 2CDYA 3ZHSA 1YHQV 4DW0A 3KCYA 1NTKH 4J42A 3LSQA 1WJZA 2RMKB 3B40A 3SYCA 1GH6A 3K59A 1XMQB 4KXRA 4B3TO 1EN4A 2PZSA 2DN9A 2P5OA 1NI8A 4NTYA 1GN2A 5DN6G 5C8YA 1FS0G 1M5IA 1XL6A 2UU9O 2OYQA 2ZM6B 2ZCEA 5JQGB 4OPHA 3VQVA 3ABMC 4YHHB 5IT9N 1AI5A 4JZ2A 4N21A 1SQFA 1S72V 3CRCA 1K3EA 1YSCA 4K0KO 3CRMA 5GONB 4X62O 4X1YA 4JI7B 4GKJB 1H2LA 3JATA 5CB4A 3OTFA 2HHHB 3RN4A 2EIJB 1AB3A 2ZINA 4MSWC 2VQEB 2AHZA 4N23A 4NXMB 1VF6C 3NR7A 1OJHA 3E8BA 1XNQB 4LFBO 1B06A 2CH7B 5GTIZ 4X65O 4UCRA 3M99B 4QJFB 3H01A 1GAXA 1KP2A 4IYHA 3OW2U 4IGGA 3CPWU 1ZX3A 5EIBD 2HP8A 3AG1B 4EEQA 1H2SB 2ATKC 1KQSU 2XAQA 1UFIA 1YJWV 3K58A 5KHHA 1U97A 5B5EZ 4FIPC 1YTFD 2Y69B 3G4SV 1Q8IA 4CH6A 3RYCA 3QF7A 2ZQMA 3LDCA 3DTUB 3SJQC 2GUZB 5C8YB 3HR0A 2QA4V 1GN3A 1FXHA 2F1MA 3K5MA 2PYJA 3C3SA 1AI7A 3AG2B 3SYQA 4LF6O 1FPOA 2WLNA 2P67A 1S5LZ 2BSKA 1RFYA 2A0LA 4FFKA 5L3CA 1ZAUA 3CSXA 4IT5A 1E1QG 4BAYA 1Q5OA 1VQOV 1K34A 3BY6A 5J2UB 5BZBA 2HKOA 4CBCA 1DF4A 1CEZA 1LUVA 1IVSA 4JF3A 2VRZA 1XILA 3DXRA 4MTOA 2AHYA 1H2GA 1IBKO 1VQ4V 5FLXN 2HEPA 1ZLZA 3BFRA 3S3WA 4TOIA 1OV9A 1QCEA 2JDIG 5ITZA 1EFRG 2QWRB 2ZT9B 1Q43A 4UCSA 5F2VO 3H1KH 3F7YC 1Q81W 3TCUA 1RPRA 4B3RO 3APQA 4TSFG 3ZMUA 3SPGA 3ABLB 2IJJA 2ZD9A 4WCEV 4LFAB 3D3IA 4UVCA 4GX1A 4JI5O 2ODMA 4YIOA 1HNZO 3B8NA 1TUBA 3DGEA 2QDOA 4U3JA 2DWDC 3AG4C 4P9OA 3K03A 2RJZA 2BE3A 4CC5A 4JYCA 2VS0A 4JAUA 1SA0B 3SJAC 3MD0A 1H8HG 2OCCB 1NT2B 3K3WA 4GUNA 2IH1C 1F7YA 2ZDIA 1K5SA 4WFFA 4PV1B 1NVPB 2YICA 1GM8A 5L3DA 2W6JG 4DUYB 2QKAA 2CTRA 4JI0B 2EILB 3FFQA 4UCUA 2GSMB 5IYBO 4ABMA 4BIZA 3CRRA 1N34O 5CBHA 1HP8A 4LF7B 1QBZA 4UUJC 4FLVA 4AHCA 4JAAA 4AILC 2QWOB 4OX9O 4DR2B 5ITZB 4DRXA 4B7KA 4PDVA 2IW5A 4FLXA 4MW3A 3FB6C 2ITDC 4XDJA 1OCCB 3MAQA 1FXKC 4WFAV 1JFFA 3E35A 4LWSA 3OMIB 3T1HB 2RNBA 5KHIA 2A7WA 2LFSA 4GX5A 1WB8A 3ZN0A 1MMMA 4DV6B 4AQYO 2UXDB 4GT1A 4NXNB 1MOFA 1HNXB 1KU9A 2N04A 2DQ0A 4CC6A 5LMUB 3KG2A 1XHZA 5DM6V 1TUBB 4U7NA 2F4VB 4U3JB 3ABKB 2UXXA 2V7QG 4NTWA 3OE7G 1WPXA 3APOA 1YVWA 3ETGA 3OFNG 2EZOA 1V54B 2AXTZ 2K1EA 1RM1B 5CA3A 1EN6A 2XAJA 2LJ2A 3H1HH 5IYZA 3HKDA 3ASNB 5LP6B 2KG7A 4MTGA 3EFFK 1OCRB 4H44B 4X89A 1Y6XA 1QNMA 3JAKA 4J9YB 4X8AA 3TK1A 3CB2A 2WLLA 4QE9A 2WLJA 2F23A 1UJWB 1Y4MA 1N32B 1B6QA 5LL6Y 3VQXA 2HLDG 4BIUA 3Q4HA 2YSUB 4P9PA 4HBNA 1X59A 4DRXB 2ZM6O 2N74A 4G27B 4TUYA 4JYAO 2IBZH 3G71V 2H94A 1AVMA 3K08A 1V55B 3TETA 3ZHTA 5IYDO 5IE9A 1SZXA 1YIJV 2PGGA 3TXQA 3I55V 2A9HA 3TGUH 4IIJB 2YC0A 1TUEB 3ZRWB 2JVDA 4O2BA 1VQLV 1L8DA 3OD4A 4PHZA 3CCEV 1N36B 3AG2C 3OUSA 2WLIA 3SJBC 2RDCA 2DE0X 2FB5A 1FAFA 2KQXA 3K57A 2BOCC 1M56C 4WF9V 3RGBA 4HYOA 1AJPA 5L3FA 3CMEV 4X20A 5IYZB 4YY3O 3ZHUA 1WPBA 5IYCO 4ZHQB 4DUZB 1V9PA 3JAKB 3FB8C 3RW0A 4Z1MG 4JV5O 1FKAO 3WG7B 4MVUA 3JD2A 1R3IC 5FPRA 2EIKB 1G6UA 5LHIA 1J95A 2AGAA 3DSQA 4QE7A 3Q4HB 3CXCU 1Y76A 1MNGA 3BA8A 1QVGU 1FFXA 1MA1A 4TUYB 1J5EO 1IBLB 3K5NA 1VQ5V 4I55A 2XAGA 4I7ZB 4PELA 3SPHA 3ABLC 2EIMB 4JAVA 4X66O 1O9HA 1N8RW 3UM7A 3UT5A 1M93A 2YUAA 1G8MA 2BTQA 1XI1A 3GWKC 3VOUA 1I5YA 1ZL8A 3ZIAG 4O2BB 3OAAG 1BS3A 4MTXA 3E2EA 4K3AA 2ZE7A 3BPZA 1WAZA 2WLIB 2L6LA 1NS1A 5KHGA 2OCCC 1P84F 5L3GA 5LYJB 2H3OA 4BWAA 2CAZC 4X20B 2PI5A 1WB7A 1PPJH 4RO2A 1JMKC 1P7BA 2O57A 4LF9O 1KUQA 1ZUQA 2EILC 3CEIA 1SETA 1NVPD 2YIBD 4DV1B 5DEDA 4DR6O 2GHYA 2KB1A 5JQGA 1SRYA 2GDSA 3ASOC 4UB6Z 2X0LA 2JGDA 4UV8A 1XNRO 1Y76B 1FFTB 4H13B 1FFXB 3MHSC 3JSLA 4J80A 2IJHA 2ITCC 3FYEB 4I55B 1VQ9V 3F5WC 1VARA 3JAWB 4LCUC 3K5LA 2ARHA 2NN4A 2R70A 2P6JA 2CGNA 2ZE6A 2CH7A 2Z5UA 3ABKC 3P30A 1WA8A 2EINB 2Q7HA 1NR1A 3RYIA 2JJ2G 4MVMA 4QPJA 1ZSPA 3SYOA 1T5EA 1V54C 4MVSA 1RM1C 1SESA 1KB9F 1BHAA 3OMAB 4KL1A 2BCCH 2ZDIC 1F51A 4KFMA 2QE7G 1SQQH 3ASNC 3OEEG 3ZJZA 4EFBA 2GBOA 4RWUA 4DV0O 4FK5C 2X7RB 1YEWA 5BR8B 3CC2V 4CS3A 3N27A 1Y67A 2GUZA 3JD4A 1QLEC 3IC7A 5HFLA 4J7KA 1QLNA 3CYOA 1GK9A 4FVMA 1R3LC 2OTLV 4X1IA 4PI2A 4CS4A 5JH7A 1VF5B 3K04A 1VQNV 4LF5O 2XT9A 2JGDB 3JARA 4E4EA 3UO3A 2Y4UA 4DV7O 5B1AB 1XMOO 4GLXA 3KKYA 1V55C 4X64B 3LSSA 5J2UA 1AILA 5LOVA 2GTSA 4LF8B 1WP7A 1XBLA 2QM7A 4DV5B 2UUCO 1VQ6V 3RFRA 1OCZB 4I5SA 4EFEA 4I9QA 1BE3H 2FKXA 3E86A 4CS2A 2D3OW 5EIBC 1WA8B 1OZ0A 3B4SA 2EBOA 1US6A 2KSDA 3RYIB 3RT3C 1HNWO 2CTQA 2BTOA 4HNAA 3AK2A 1OCOB 2F43G 4MW8A 4J10A 1H2NA 2P90A 2YXYA 4JI8B 3KZIZ 1BT8A 2XTAA 4DYLA 2N05A 2F66C 5IY5C 1K4CC 1KC8W 4HZ3A 4MVQA 1E1RG 2JGUA 3C3TA 3A0BZ 1MSWD 3O65A 4HAMA 2UXBO 4LF4B 1XDCA 2XHBA 4FM2A 3ABUA 4BW5A 4DR3B 3A0RA 2UUBO 3F7VC 5B1OA 3OTOB 4DV3B 1S5JA 4PA9A 4C7UA 2ZKOA 2ZR2A 4J41A 4X1IB 2P7TC 4JASA 5JH7B 3OT7A 2A79B 3CX5F 4JTAB 1SA0A 4OGQB 1M57B 3E8HA 1EZVH 1K73W 1XOUA 3JARB 1JOYA 1Z5VA 3L72H 2OIGA 4FJCC 1R1BA 1AJNA 2LP7A 4G2KA 1NQTA 4F6EA 2YIBA 1VQPV 1SQXH 3RYFA 5LOVB 2E76B 3QO5A 5KA6A 4D6TH 4DR1B 2B9ZA 4JI3O 2RCVA 2DWEC 2CK3G 3AK1A 4JI1O 1IX9A 2ZNIA 3CWBH 5LMNB 3X2QC 3CXHF 3W7UA 2YIAA 2AZ0A 1L0NH 3PN1A 1X4TA 2LO1A 2UUAO 2PF4E 3CCUV 2WLMA 3M7MX 2AW9A 1HW7A 4JI2B 2R9AA 2W0FC 2E5LO 4HNAB 3BA9A 2JRIA 1GKFA 4BIOA 3AEIA 2OTJV 2ZE8A 4WFEA 1YCIA 1N33B 3VQWA 3NXSA 4B3SO 3FKSG 1IBLO 4Q6GA 1A32A 4UVBA 3ZEDA 3M8AA 4WBNB 1I94O 1NTMH 2DYRB 3P3NA 1PNMA 3QG5A 1Z2GA 1LUWA 5FNVB 4JZGA 4FLUA 3J81N 4LH6A 2JIZG 1PV0A 3E8GA 2YXHA 2UXCB 3D8CA 2M6YA 1HR0O 2WPDG 3WB2A 3RVYA 4XBFA 1VQKV 1XQ8A 1CP9A 1VQMV 4CH3A 5IWAO 2ZIOA 4OXSA 2Q8VA 4KHPB 5LP6A 1GO3F 4FPPA 4LFCB 2ILMA 4DV4B 3RYFB 3QVNA 5H9CA 4DV2B 2YS8A 1R3KC 3BVOA 1ENVA 4RUEA 2QGNA 2V4DA 4ZKIA 1NH2B 4GCZA 1BSMA 1BHBA 4RUFA 3U0ZA 4B3MO 1AR1B 2P06A 4DR5O 1BMFG 3STZC 3LSUA 2E75B 3VBBA 1GN6A 4FLTA 3L75H 4O4HA 1GN4A 3EVKA 1WNSA 4U3FH 4DK1A 3UQ8A 4O4JB 3ZS8C 3C90A 2FYUH 4ZIBA 5EYPA 4DR4O 4I50A 3D3QA 2VQFB 4NB5A 1KP3A 3O9OA 2CGOA 5A9GA 3STLC 1FYJA 4IIJA 4JI6O 1DLBA 1IZ3A 5H6RA 3ZRWA 4W4LA 3VQYA 4B3TB 2PYLA 4IL6Z 1IBMO 1H2MA 2HVKC 1NR7A 1QQCA 2ADQB 4CZZA 3UCSC 4G28B 1JX9A 4I0XB 3W7WA 3BABA 4WFBV 4JGSA 1G1XB 2HFEC 1BGYH 4MVOA 1AI6A 2UU9B 1NBMG 2FTKA 3ML0A 3B8MA 2AZ2A 1P7GA 2EIJC 1YDXA 4GX2A 4ZOLB 5IJ0A 2DYSB 3FAVB 4ZHQA 2R9RB 4K0KB 2XASA 5KHJA 3CD6V 4YXWG 3CCMV 5B3SB 1OCZC 1S76D 5H6QA 2ZXWB 4LNUA 2ETNA 1H8EG 1QR9A 5BR8O 1Q82W 4F4LA 5CMUA 1XMQO 4JI4B 5JCOA 1SZTA 1JPXA 1MABG 1G4YB 4LFBB 3HPLC 3QO7A 3U10A 1EM1A 4X65B 4JPRA 1TA8A 1E79G 3AG1C 4YHHO 1OCOC 4O4HB 1R6NA 5C93A 3SPCA 4J11A 5AG2A 4R6ZA 3UO2A 4NR1A 3ZRSA 4JI7O 3OR6C 4GKJO 1WLEA 3CCRV 5EYPB 2Y69C 2HHHO 4I50B 5CN0A 5A2QN 3ZMVA 4EB6A 2YDEA 2VQEO 3OUFA 2QSAA 3I56V 1L0LH 3K9SA 3ZHRA 4NXMO 3HKCA 3WB0A 1XNQO 1AP6A 5B1BB 3ZRXA 1LNQA 1SC5B 1XREA 2DJVA 2V1DA 1M57C 1FJGB 1SQVH 5LYJA 3I5DA 4NTXA 4LF6B 3ZRVA 5IJ0B 3CCLV 3JAMN 3OMNB 2Y0IA 3T1YB 1JR9A 4X88A 4PA7A 4TQDA 2HJFC 3AG3B 4Q20A 2GV9A 4LNUB 1THZA 1K33A 4X1KA 4GX0A 3TJTA 1B3QA 2EJ7A 3WU2Z 4PD4F 5B66Z 2A06H 4MS2A 2P22C 3RBZA 5LA6B 4Z2WA 4FZ0A 3K5OA 3WB1A 4B7EA 4FM1A 4DV3O 3E8FA 1KMIZ 2PTMA 5E79Z 2WA4A 2QEXV 3JAWA 3B2EE 3SDLA 3SPJA 4JYYA 3RVZA 2F95B 4PA3A 3GB7C 3A0HZ 2XOKG 4EB6B 4B3RB 4RAIA 3ABTA 2XNDG 2W6IG 2YIDA 3HKCB 3H9VA 4D7TA 4DR7B 2B5UA 4JI5B 4UXNA 4H37A 4I9WA 4WFGA 5IJ9B 5GTHZ 5EBWC 1HNZB 1DK1A 1XL4A 1NJIW 4WFHA 5FL7G 1D5AA 2DOSA 4ZBMA 2FMLA 4JI2O 2Q7GA 1AI4A 2UXNA 2HJDA 1GM9A 1NU1H 2JEUA 3OEHG 2LW7A 2Q69A 5CA1B 4GKKB 4KUMA 2R72A 3CHXA 4DW1A 2NNUA 4UCVA 1FXKA 3ZX6A 2X6CA 3OM3B 5E1AC 4LFAO 4X1KB 1BL8A 4QIWF 1IXMA 2QM4A 4CH4A 1K9MW 3F5TA 1GMGA 1YXBA 1NH2D 1O9GA 1N34B 2WSSG 2NLJC 3AK3A 4B08A 5B1NA 2RN9A 1L1FA 3R66A 4NYKA 2UXCO 1URFA 3BRCA 4F6RB 5LGTA 2LFRA 5H5NA 3L71H 1OCCC 3G80A 1N0JA 3QNEA 4ZI7A 3CMAV 3JYCA 4OX9B 3AG4B 4LBEC 4BR6A 4FFBB 3MDSA 5CBGA 1PNKA 3G6EV 4KHPO 3OR7C 2Q5ZA 4LFCO 2Q6AA 4DUYO 4JI0O 2B1GA 5BMVA 3IAYA 4AQYB 1MG1A 5J2TB 1I0HA 1Q86W 2Q67A 2BOBC 4LF7O 1LR1A 3T2MA 1R6KA 5KA5A 1NKDA 1K5QA 4TWKA 3ZN1A 1PP9H 1D5NA 4DR2O 1EZJA 3N2KA 1BQ0A 5EZYA 1K92A 4R7CA 3K9AA 3JASB 3L9DA 3ZMTA 3P32A 2G38A 5LP6C 2QTSA 3ZCCA 5LXTB 1OCRC 1QR8A 4A5UB 3R65A 1IURA 3T1HO 3H1LH 5BY1A 1Z5WA 3LNNA 5B3SC 2IH3C 2JK5C 2ZXWC 1KBHA 1FXKB 4DV6O 1K4DC 2UXDO 4NXNO 3U11A 1HNXO 1S77D 2ZIMA 2HG5C 5LMUO 3BHPA 1DTOA 5KX5A 2F4VO 3RYHA 1JJ2U 2EJRA 3JSNA 2B1IA 2LGWA 1FXVA 4ZI7B 5KLVH 1F4NA 1XEQA 4BW9A 1P49A 4I4TA 2QKCA 1K7DA 2EX3A 1R6TA 4YJ2A 2YI9A 4R50A 2OWOA 4JYAB 1K8AW 3EXAA 3HKEB 5BMVB 4UB8Z 1QHTA 3BAAA 2RQ6A 1CXZB 2QWPB 4QPKA 1NTZH 4JI4O 4TV8A 1ROPA 5B1BC 1SERA 4PI0A 3W7XA 2LW1A 1N32O 1KECA 1QVFU 2CTWA 3FD9A 3N2KB 5EZYB 2A3QA 5KHKA 4TV9A 2H8PC 1DF5A 1PNLA 3B09A 4FMTA 3CCSV 3IGAC 2Y0PA 3G6BA 2EZPA 5KAIZ 1I08A 4WBNA 3LDEA 4UV9A 1YITV 4MVZA 2Q68A 1WN7A 5FNVA 4YY3B 1JCHA 3AG3C 3WG7C 5KMGA 1GRJA 1I7FA 1I5XA 3JCZA 3J80N 2EIKC 4AI8A 3TXSA 5JCOC 5JJJB 1HDJA 4JV5B 4JYBA 2W0XA 5KX5B 2IJKA 3RYHB 3GWOA 2Q0OC 3PJSK 3E22A 3LNMB 2Y48A 2MW2B 1Q90D 1N36O 4O4LA 1FJGO 3BCCH 4LR3A 4I4TB 2Q9LA 2WLHA 4DK0A 1H2KA 1VIBA 2IU3A 4LH7A 4YJ2B 4X9QA 1S3JA 2WWWA 2EIMC 4QNHB 1J5EB 5JVDA 4IHJA 3K79A 4MTFA 3QTCA 1M56B 1SS3A 4U7OA 3T1YO 4DUZO 4W4KA 4X1YB 5K1PA 2WA3A 3ETEA 3JATB 5CB4B 2JJ1G 1QU7A 3ZBHA 4PA4A 4X66B 4MVRA 2E74B 1TVKA 4TV8B 4PDLA 1VMGA 5D5QA 5LGNA 3JALA 4P2ZA 3L70H 3D36A 5EK0A 1PD3A 3CCJV 1B04A 4TV9B 4O4JA 2OIEA 5H2FZ 4K8XA 3K06A 4QGPA 4EKWA 5JJEB 3FYIB 1Q3EA 3GVMA 2EULA 5KMGB 3S3XA 2Q7EA 2YI8A 4LF9B 1Q6HA 4FLZA 4DR6B 1AROP 1S0VA 4I0XA 3RYCB 4GZRB 4DR7O 3WFVA 3E22B 1ORQC 2PUSA 3A8TA 2IU0A
chains in the Genus database with same CATH topology
3ZRSA 3E8BA 3OR6C 2EILC 1WLEA 5LHHA 3CCRV 1SETA 1NVPD 2Y69C 4RQEA 5CN0A 3M99B 3ZMVA 2GHYA 2KB1A 4QJFB 3H01A 1KP2A 3OUFA 3I56V 3OW2U 2OT5A 1GM7A 3CPWU 5L3EA 4E2LA 1SRYA 3AG1B 3ASOC 2ATKC 2X0LA 1KQSU 5B1BB 3ZRXA 2Z3YA 2XAQA 4UV8A 1LNQA 1FFTB 2EINC 1YJWV 2V1DA 3MHSC 1M57C 5CBFA 2IJHA 4MT8A 2ITCC 3FYEB 3K0DA 4KP4A 4FIPC 4DXWA 1VQ9V 1YTFD 2Y69B 3F5WC 3G4SV 3ZRVA 4LCUC 2ZQMA 4J9ZB 3CCLV 1KKDA 3LDCA 3DTUB 5LGUA 3SJQC 3OMNB 2QA4V 4X88A 4PA7A 2P6JA 2HJFC 3AG3B 4Q20A 1FXHA 3ASOB 1THZA 2Z5UA 3K0GA 4DO2A 1AI7A 3ABKC 3AG2B 3P30A 3SYQA 1W2BU 1K33A 4GX0A 2EINB 2WLNA 2P67A 2A0LA 3ZMSA 5L3CA 3CC4V 1NR1A 2JJ2G 4MVMA 1E1QG 5EC1C 4BAYA 4MS2A 3RBZA 2HVJC 4QPJA 3SYOA 3W7SA 1V54C 4JTDB 1VQOV 4MVSA 1YI2V 1PKXA 1RM1C 1SESA 1K34A 1BHAA 3E8FA 3BY6A 3OMAB 5BZBA 2HKOA 2ZDIC 1F51A 4KFMA 2QE7G 3T1CA 3ASNC 3OEEG 4CBCA 3ZJZA 1EBOA 2QEXV 4FK5C 2X7RB 1DF4A 1CEZA 5B1AC 4JF3A 1YJ9V 3SPJA 3RVZA 4MTOA 3CC2V 3OGCC 2X6AA 2AHYA 4PA3A 1H2GA 3GB7C 3LDDA 2XOKG 1VQ4V 3JD4A 1QLEC 3IC7A 4RAIA 1R3JC 3ABTA 5HFLA 1QLNA 3CYOA 1GK9A 1R3LC 1QCEA 2MK3A 2XNDG 2W6IG 2OTLV 2JDIG 1EFRG 2B5UA 3CC7V 3K04A 4UXNA 1VQNV 4H37A 3F7YC 3E83A 4I9WA 4WFGA 5EBMC 5EBWC 1KD1W 1Q81W 3TCUA 5EBLC 1RPRA 1XL4A 1NJIW 4WFHA 4TSFG 5B1AB 3SYPA 3ZMUA 5FL7G 1V55C 3SPGA 3LSSA 3ABLB 4ZBMA 2IJJA 2ZD9A 4JTCB 4WCEV 4LC1A 3D3IA 4UVCA 1AI4A 2UXNA 4LP8A 4GX1A 1GM9A 2QM7A 1VQ6V 1QLEB 2JEUA 1OCZB 4I5SA 3OEHG 2Q69A 3B8NA 3DGEA 1GTOA 4KUMA 2DWDC 3AG4C 3ABMB 3EHBB 4P9OA 3JD0A 3K03A 2NNUA 3E86A 1FXKA 2X6CA 3OM3B 5E1AC 4JYCA 2D3OW 1VQ7V 1BL8A 4JAUA 1IXMA 4QIWF 1OZ0A 2X6BA 2EBOA 1K9MW 1GMGA 3MD0A 1H8HG 1F4MA 1H38A 2OCCB 1NH2D 3K3WA 4XDLA 2IH1C 2WSSG 2NLJC 5B1NA 1OCOB 2ZDIA 1L1FA 2F43G 1K5SA 4WFFA 4MW8A 5LGTA 2LFRA 1ZWIC 1NVPB 1GM8A 1OCCC 1OHHG 2P90A 3QNEA 2W6JG 5L3DA 3CMAV 3JYCA 1M90W 2C2AA 3AG4B 4LBEC 2EILB 5GW7A 5IY5C 2GSMB 3T4DA 5IYBO 1HWYA 1K4CC 4BIZA 1KC8W 3W7TA 4HZ3A 2XAFA 4MVQA 5CBHA 1E1RG 1W0JG 5CBGA 1QBZA 4UUJC 1MSWD 1PNKA 4HAMA 3G6EV 3OR7C 4PA6A 4PDRA 2Q6AA 3ABUA 1R73A 4BW5A 4PDMA 1M1KW 3A0RA 3F7VC 5B1OA 2B1GA 4PA9A 2ZR2A 2P7TC 1JVMA 4PDVA 1MG1A 2IW5A 4JASA 3SYAA 4MW3A 1F23A 3FB6C 2ITDC 2Q67A 3IFXA 2BOBC 2A79B 4XDJA 1OCCB 4JTAB 1YTFB 1FXKC 1M57B 3E8HA 4WFAV 1K73W 3E35A 3T2MA 1JOYA 5IY5B 3OMIB 4FJCC 1R6KA 5KA5A 2WLKA 1NKDA 1K5QA 3JD3A 4TWKA 3ZN1A 1AJNA 3T4ZA 5KUKA 2LP7A 4G2KA 1EZJA 2LFSA 3FB7C 1NQTA 3MHHC 4GX5A 3ZN0A 5L3BA 2WLLB 1K92A 4R7CA 1VQPV 3K9AA 3B77A 2YEVA 4GT1A 1MOFA 3ZMTA 3P32A 3QO5A 5KA6A 2DQ0A 3ZCCA 1Q7YW 3KG2A 1OCRC 1QR8A 2DWEC 5DM6V 2CK3G 3R65A 4U7NA 3ABKB 1RPOA 2UXXA 5B3SC 5HFMA 3X2QC 3W7UA 2V7QG 3OE7G 2IH3C 2JK5C 2ZXWC 3HB3B 1FXKB 1WPXA 2DYRC 1COWG 1K4DC 2QTOA 3ETGA 3OFNG 3CCUV 2EZOA 2WLMA 1S77D 1V54B 2HG5C 2K1EA 1RM1B 1DTOA 5CA3A 3FB5C 2XAJA 2W0FC 1S5HC 1JJ2U 1GKFA 3AEIA 2EJRA 2DQ3A 2B1IA 2OTJV 3ASNB 4ASUG 4WFEA 4MTGA 1FXVA 4XDKA 3EFFK 1OCRB 1AJQA 1F4NA 2HR3A 4X89A 4P30A 4H33A 4J9YB 3NXSA 4X8AA 3FKSG 3X2QB 3TK1A 4UVBA 2WLLA 1K7DA 5LHGA 2DYRB 1PNMA 1W0KG 4R50A 4QE9A 2WLJA 1UJWB 1Y4MA 3CCQV 4RQFA 1K8AW 1B6QA 2JIZG 3BEHA 3E8GA 3LUTB 2HLDG 4BIUA 2YSUB 5LBQA 4P9PA 2WPDG 3CCVV 3RVYA 4XBFA 1VQKV 4G27B 4QPKA 1ROPA 5B1BC 3G71V 1SERA 1CP9A 2H94A 3CP1A 1VQMV 3K08A 1V55B 3TETA 2DW4A 3ETDA 3W7XA 5IYDO 1JQ0A 1KECA 4OXSA 1YIJV 1QVFU 2R9IA 1PL0A 1GO3F 2JEXA 4FPPA 3SPIA 2XAHA 2H8PC 1DF5A 2ZR3A 1PNLA 2YEVB 4FMTA 2QKSA 2IJIA 3I55V 3CCSV 2A9HA 3IGAC 2QM8A 5H9CA 1VQ8V 1M9NA 2EZPA 1R3KC 4TT3G 1K97A 1ENVA 1TUEB 4RUEA 3LDEA 4UV9A 3ZRWB 1YITV 4ZKIA 4MVZA 2Q68A 1NH2B 4GCZA 1VQLV 1BHBA 4RUFA 1JCHA 3AG3C 3WG7C 3CCEV 3JD1A 1I5XA 3AG2C 3JCZA 3OUSA 2WLIA 2EIKC 1YJNV 5EC2C 4JYBA 1Q86W 2M7WA 1Y66A 2BOCC 1AR1B 1M56C 4WF9V 1BMFG 2IJKA 4HYOA 3STZC 3VBBA 1AJPA 5L3FA 3UKMA 3CMEV 3GWOA 4UVAA 3QO8A 3E89A 3PJSK 3LNMB 2Y48A 4L87A 5IYCO 4R8CA 3RW0A 3FB8C 4Z1MG 2PI4A 3WG7B 4MVUA 2WLHA 3JD2A 2WAMA 2IU3A 1KP3A 1R3IC 1S3JA 2WWWA 2EIMC 2EIKB 5KUMA 3STLC 4QNHB 2DYSC 1DLBA 5J9PC 5H6RA 3K79A 3ZRWA 4MTFA 3ZMZA 5LHIA 1J95A 1M56B 4U7OA 5IDJA 1CPYA 4QE7A 1P4RA 2HVKC 3ETEA 1NR7A 2JJ1G 3CXCU 4CZZA 4PA4A 4G28B 4MVRA 1JX9A 1QVGU 3W7WA 1YHQV 4WFBV 4JGSA 4PDLA 2HFEC 3LSQA 1VQ5V 4MVOA 2XAGA 1AI6A 3SYCA 1NBMG 4PELA 5LGNA 4P2ZA 3SPHA 2FTKA 3ML0A 3B8MA 3D36A 5EK0A 2EIJC 3ABLC 4GX2A 2EIMB 4JAVA 1PD3A 3CCJV 2DYSB 1N8RW 5DN6G 2R9RB 2XASA 3UM7A 3CD6V 4YXWG 1FS0G 3CCMV 5B3SB 1OCZC 3K06A 1S76D 1G8MA 5H6QA 1XL6A 4EKWA 2ZXWB 3VOUA 1I5YA 3FYIB 1H8EG 1QR9A 3ABMC 3ZIAG 4F4LA 5CMUA 1AI5A 1Q82W 3OAAG 4N21A 4MTXA 3E2EA 1S72V 1SZTA 1JPXA 2WLIB 1K3EA 1MABG 1YSCA 1G4YB 3HPLC 3QO7A 2OCCC 4JPRA 2EIJB 5L3GA 1AROP 1E79G 3AG1C 1S0VA 1OCOC 1R6NA 4MSWC 3WFVA 5C93A 2PI5A 3SPCA 2AHZA 4N23A 1ORQC 4RO2A 4R6ZA 2IU0A 1P7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEV A;  3ZRS A;  3E8B A;  3OR6 C;  2EIL C;  3K04 A;  4H37 A;  5EC2 C;  3F7Y C;  3E83 A;  4I9W A;  2Y69 C;  4WFG A;  2BOC C;  5EBM C;  3KG2 A;  1M56 C;  5EBW C;  1OCR C;  2DWE C;  3R65 A;  3TCU A;  4HYO A;  2KB1 A;  5EBL C;  1XL4 A;  3STZ C;  3UKM A;  4WFH A;  5B3S C;  3SYP A;  3X2Q C;  3E89 A;  3PJS K;  3OUF A;  3LNM B;  2IH3 C;  2JK5 C;  1V55 C;  2ZXW C;  3SPG A;  4ZBM A;  2ZD9 A;  2DYR C;  4JTC B;  1K4D C;  2QTO A;  4LP8 A;  4GX1 A;  4R8C A;  3RW0 A;  3ASO C;  2WLM A;  2ATK C;  3FB8 C;  2HG5 C;  2Q69 A;  4MVU A;  2K1E A;  2WLH A;  1LNQ A;  3FB5 C;  2W0F C;  1S5H C;  2EIN C;  1R3I C;  2DWD C;  3AG4 C;  1M57 C;  4P9O A;  2EIM C;  5KUM A;  4QNH B;  3STL C;  5CBF A;  3K03 A;  2DYS C;  2ITC C;  3K0D A;  4WFE A;  4DXW A;  3E86 A;  4MTG A;  5J9P C;  2X6C A;  3F5W C;  4MTF A;  4XDK A;  5E1A C;  1J95 A;  3EFF K;  1BL8 A;  4X89 A;  4P30 A;  4QE7 A;  2X6B A;  4H33 A;  4J9Y B;  4LCU C;  2HVK C;  4X8A A;  4J9Z B;  1KKD A;  3LDC A;  4PA4 A;  2WLL A;  3SJQ C;  4G28 B;  4MVR A;  4XDL A;  2IH1 C;  2NLJ C;  4R50 A;  4X88 A;  4PA7 A;  4QE9 A;  2WLJ A;  4PDL A;  2HJF C;  2HFE C;  4MVO A;  4WFF A;  4MW8 A;  3SYC A;  3K0G A;  1ZWI C;  3ABK C;  1OCC C;  4P2Z A;  3SPH A;  3SYQ A;  3JYC A;  3BEH A;  3E8G A;  3LUT B;  4GX0 A;  2WLN A;  5EK0 A;  2EIJ C;  2A0L A;  3ABL C;  4GX2 A;  4LBE C;  5IY5 C;  4P9P A;  3T4D A;  3RVY A;  1K4C C;  4MVM A;  5EC1 C;  4HZ3 A;  4MVQ A;  2R9R B;  4G27 B;  4MS2 A;  3UM7 A;  5CBH A;  3RBZ A;  2HVJ C;  3SYO A;  5CBG A;  1V54 C;  1OCZ C;  3K06 A;  4JTD B;  4UUJ C;  4MVS A;  5B1B C;  1XL6 A;  3OR7 C;  4EKW A;  3K08 A;  3E8F A;  3VOU A;  3TET A;  4PA6 A;  4PDR A;  2Q6A A;  5BZB A;  3ABM C;  4BW5 A;  4F4L A;  4OXS A;  4PDM A;  4KFM A;  3T1C A;  3ASN C;  4CBC A;  3F7V C;  3ZJZ A;  4PA9 A;  3SPI A;  2H8P C;  2P7T C;  5B1A C;  1JVM A;  4PDV A;  3SYA A;  2WLI B;  4MW3 A;  3FB6 C;  2ITD C;  2Q67 A;  3IFX A;  2BOB C;  2A79 B;  2QKS A;  4XDJ A;  4JTA B;  3RVZ A;  3SPJ A;  4MTO A;  1G4Y B;  2A9H A;  3IGA C;  3E8H A;  2X6A A;  3HPL C;  2AHY A;  3OGC C;  4PA3 A;  2OCC C;  1R3K C;  3T2M A;  3GB7 C;  3LDD A;  3LDE A;  4RUE A;  3AG1 C;  2WLK A;  4MVZ A;  2Q68 A;  1QLE C;  4TWK A;  1OCO C;  3T4Z A;  5KUK A;  4MSW C;  4RAI A;  1R3J C;  4RUF A;  3WG7 C;  3AG3 C;  3SPC A;  2AHZ A;  3FB7 C;  2EIK C;  4GX5 A;  1ORQ C;  4RO2 A;  1R3L C;  3AG2 C;  2WLL B;  4R7C A;  4R6Z A;  3OUS A;  1P7B A;  2WLI A; 
#chains in the Genus database with same CATH topology
 1BZK A;  4O4L B;  5LHH A;  2QWQ B;  4ZOL A;  4Z1V A;  4RQE A;  3FAV A;  1XNR B;  1KYO F;  4PJ0 Z;  3SGI A;  1VF7 A;  2BSK B;  1MSD A;  5JVD B;  2OT5 A;  1GM7 A;  4IHJ B;  5JJN B;  5L3E A;  4E2L A;  4GKK O;  1AR4 A;  2D2C B;  4H0L B;  4DV1 O;  2Z3Y A;  4FM0 A;  1TVK B;  2EIN C;  1YF2 A;  5CBF A;  4MT8 A;  3K0D A;  4KP4 A;  4DXW A;  2ZE5 A;  3JAL B;  2IM9 A;  2VWK A;  4FLW A;  3DXR B;  1U96 A;  3ETQ A;  4J9Z B;  1KKD A;  5LGU A;  1SF9 A;  3HKB A;  3ICX A;  5CA0 A;  3ASO B;  2Q73 A;  3K0G A;  4DO2 A;  1W2B U;  5K1X A;  3ZMS A;  4DV0 B;  3CC4 V;  4O2A A;  5EC1 C;  2HVJ C;  3W7S A;  5FPO A;  4JTD B;  2QJ1 A;  1YI2 V;  1PKX A;  2JS5 A;  4NKG B;  4FLY A;  1VF6 A;  3T1C A;  2ADP A;  3OGI B;  1EBO A;  2CUG A;  5B1A C;  4J7Z A;  1VP7 A;  2QR4 A;  1YJ9 V;  2P4K A;  3CJH A;  2Q4P A;  3OGC C;  2K9P A;  2X6A A;  2QWN B;  4LF5 B;  3LDD A;  1TGO A;  1VEW A;  4X62 B;  4DV7 B;  1XMO B;  1R3J C;  1IXB A;  2MK3 A;  3IC9 A;  1Q6I A;  2NR5 A;  3CC7 V;  2UUC B;  4GYC B;  3E83 A;  5EBM C;  1TAE A;  1KD1 W;  5EBL C;  3H1I H;  5LA6 A;  3SYP A;  4J7J A;  1BQZ A;  1EN5 A;  4JTC B;  2FL4 A;  4LC1 A;  2LQT A;  2P4V A;  4LP8 A;  1RP3 B;  1Y74 A;  1QLE B;  1YZB A;  1HNW B;  1GTO A;  2DMX A;  5JWP A;  3HKB B;  2F93 B;  3ABM B;  3EHB B;  5CA0 B;  4L8J A;  3JD0 A;  4X64 O;  3L74 H;  2GTA A;  1VQ7 V;  4LF8 O;  4DV5 O;  2X6B A;  3FX7 A;  1JFF B;  1H38 A;  1F4M A;  3N2G A;  4LWS B;  4O2A B;  4O4I A;  4XDL A;  1UPG A;  1JA8 A;  1SKV A;  2Y4T A;  4UCO A;  5IJ9 A;  2UXB B;  1RSO A;  1ZWI C;  1OHH G;  3KCX A;  2Q0A A;  1PL4 A;  4UCT A;  2CTP A;  1M90 W;  2UUB B;  2C2A A;  5GW7 A;  4IYI A;  3T4D A;  1HWY A;  3W7T A;  2XAF A;  1W0J G;  3CJH B;  5CA1 A;  4CH5 A;  1BCC H;  4PA6 A;  4PDR A;  1M4U A;  1R73 A;  4JI8 O;  4PDM A;  3L73 H;  1M1K W;  2OCH A;  1DGS A;  3IJ4 A;  5TIS Z;  3DC6 A;  1JVM A;  3SYA A;  1F23 A;  2CE4 A;  1YTF B;  3IFX A;  3G67 A;  2KKW A;  4JI3 B;  3HKD B;  4LF4 O;  2KG7 B;  4JI1 B;  5IY5 B;  2WLK A;  3SR2 C;  4ICG A;  3JD3 A;  4DR3 O;  3T4Z A;  5KUK A;  1KKC A;  3FB7 C;  1SQG A;  3OTO O;  3MHH C;  5L3B A;  4F6R A;  1IBK B;  2L35 A;  2UUA B;  4YIP A;  2WLL B;  4YJ3 A;  1PM9 A;  1AP5 A;  2YEV A;  3B77 A;  1Y74 B;  1Q7Y W;  3AG7 A;  4K35 A;  1XUQ A;  4FFB A;  1MZF A;  1NZ6 A;  2E5L B;  1RPO A;  3CE2 A;  3CRA A;  5HFM A;  3HB3 B;  2JS3 A;  4K8Z A;  1XHX A;  2DYR C;  1COW G;  1SQP H;  2QTO A;  4B3S B;  4DR1 O;  3N2G B;  1I94 B;  4OPA A;  3FB5 C;  4O4I B;  5J2T A;  1S5H C;  5LMN O;  2DQ3 A;  1IDS A;  4ASU G;  1RSO B;  4XDK A;  1AJQ A;  1D2D A;  2HR3 A;  4P30 A;  1N0N A;  4H33 A;  3ZHQ A;  3X2Q B;  1HR0 B;  5LHG A;  3JAS A;  1W0K G;  5LXT A;  3CCQ V;  1N33 O;  4RQF A;  5IWA B;  3BEH A;  3LUT B;  4D7S A;  5LBQ A;  3CCV V;  4UFZ A;  5DEC A;  4FZ1 A;  3CP1 A;  2DW4 A;  3ETD A;  3JCU Z;  1SQB H;  1JJO A;  1JQ0 A;  2VWJ A;  3P3P A;  4NVP A;  1MZE A;  2R9I A;  1PL0 A;  3CRQ A;  2JEX A;  3SPI A;  3DC5 A;  2XAH A;  4YJ3 B;  2ZR3 A;  2YEV B;  3D36 C;  2QKS A;  2IJI A;  2Z0A A;  4B3M B;  1Q6U A;  1VQ8 V;  2QM8 A;  2ZNJ A;  1M9N A;  4TT3 G;  4DR5 B;  1K97 A;  3CS5 A;  5D5P A;  1WP8 A;  5BXZ A;  3JD1 A;  4DV4 O;  3A2F A;  1N4C A;  5GON A;  5KAF Z;  1YJN V;  2LGQ A;  3J7A U;  3HKE A;  3SJC C;  5EC2 C;  3RWR D;  1ZTE A;  4DV2 O;  2M7W A;  1Y66 A;  2PY5 A;  4DR4 B;  2XUM A;  3UKM A;  4UVA A;  3QO8 A;  3E89 A;  4JI6 B;  3H1J H;  4L87 A;  3UT5 B;  1IBM B;  4R8C A;  2PI4 A;  2YXL A;  2BTQ B;  3THO A;  2WAM A;  1AR5 A;  1ZL8 B;  5KUM A;  3ZHV A;  2DYS C;  5J9P C;  3ZMZ A;  4TQF A;  5IDJ A;  1CPY A;  2E3C A;  1P4R A;  1W59 A;  2VQF O;  1FD9 A;  2CDY A;  3ZHS A;  1YHQ V;  4DW0 A;  3KCY A;  1NTK H;  4J42 A;  3LSQ A;  1WJZ A;  2RMK B;  3B40 A;  3SYC A;  1GH6 A;  3K59 A;  1XMQ B;  4KXR A;  4B3T O;  1EN4 A;  2PZS A;  2DN9 A;  2P5O A;  1NI8 A;  4NTY A;  1GN2 A;  5DN6 G;  5C8Y A;  1FS0 G;  1M5I A;  1XL6 A;  2UU9 O;  2OYQ A;  2ZM6 B;  2ZCE A;  5JQG B;  4OPH A;  3VQV A;  3ABM C;  4YHH B;  5IT9 N;  1AI5 A;  4JZ2 A;  4N21 A;  1SQF A;  1S72 V;  3CRC A;  1K3E A;  1YSC A;  4K0K O;  3CRM A;  5GON B;  4X62 O;  4X1Y A;  4JI7 B;  4GKJ B;  1H2L A;  3JAT A;  5CB4 A;  3OTF A;  2HHH B;  3RN4 A;  2EIJ B;  1AB3 A;  2ZIN A;  4MSW C;  2VQE B;  2AHZ A;  4N23 A;  4NXM B;  1VF6 C;  3NR7 A;  1OJH A;  3E8B A;  1XNQ B;  4LFB O;  1B06 A;  2CH7 B;  5GTI Z;  4X65 O;  4UCR A;  3M99 B;  4QJF B;  3H01 A;  1GAX A;  1KP2 A;  4IYH A;  3OW2 U;  4IGG A;  3CPW U;  1ZX3 A;  5EIB D;  2HP8 A;  3AG1 B;  4EEQ A;  1H2S B;  2ATK C;  1KQS U;  2XAQ A;  1UFI A;  1YJW V;  3K58 A;  5KHH A;  1U97 A;  5B5E Z;  4FIP C;  1YTF D;  2Y69 B;  3G4S V;  1Q8I A;  4CH6 A;  3RYC A;  3QF7 A;  2ZQM A;  3LDC A;  3DTU B;  3SJQ C;  2GUZ B;  5C8Y B;  3HR0 A;  2QA4 V;  1GN3 A;  1FXH A;  2F1M A;  3K5M A;  2PYJ A;  3C3S A;  1AI7 A;  3AG2 B;  3SYQ A;  4LF6 O;  1FPO A;  2WLN A;  2P67 A;  1S5L Z;  2BSK A;  1RFY A;  2A0L A;  4FFK A;  5L3C A;  1ZAU A;  3CSX A;  4IT5 A;  1E1Q G;  4BAY A;  1Q5O A;  1VQO V;  1K34 A;  3BY6 A;  5J2U B;  5BZB A;  2HKO A;  4CBC A;  1DF4 A;  1CEZ A;  1LUV A;  1IVS A;  4JF3 A;  2VRZ A;  1XIL A;  3DXR A;  4MTO A;  2AHY A;  1H2G A;  1IBK O;  1VQ4 V;  5FLX N;  2HEP A;  1ZLZ A;  3BFR A;  3S3W A;  4TOI A;  1OV9 A;  1QCE A;  2JDI G;  5ITZ A;  1EFR G;  2QWR B;  2ZT9 B;  1Q43 A;  4UCS A;  5F2V O;  3H1K H;  3F7Y C;  1Q81 W;  3TCU A;  1RPR A;  4B3R O;  3APQ A;  4TSF G;  3ZMU A;  3SPG A;  3ABL B;  2IJJ A;  2ZD9 A;  4WCE V;  4LFA B;  3D3I A;  4UVC A;  4GX1 A;  4JI5 O;  2ODM A;  4YIO A;  1HNZ O;  3B8N A;  1TUB A;  3DGE A;  2QDO A;  4U3J A;  2DWD C;  3AG4 C;  4P9O A;  3K03 A;  2RJZ A;  2BE3 A;  4CC5 A;  4JYC A;  2VS0 A;  4JAU A;  1SA0 B;  3SJA C;  3MD0 A;  1H8H G;  2OCC B;  1NT2 B;  3K3W A;  4GUN A;  2IH1 C;  1F7Y A;  2ZDI A;  1K5S A;  4WFF A;  4PV1 B;  1NVP B;  2YIC A;  1GM8 A;  5L3D A;  2W6J G;  4DUY B;  2QKA A;  2CTR A;  4JI0 B;  2EIL B;  3FFQ A;  4UCU A;  2GSM B;  5IYB O;  4ABM A;  4BIZ A;  3CRR A;  1N34 O;  5CBH A;  1HP8 A;  4LF7 B;  1QBZ A;  4UUJ C;  4FLV A;  4AHC A;  4JAA A;  4AIL C;  2QWO B;  4OX9 O;  4DR2 B;  5ITZ B;  4DRX A;  4B7K A;  4PDV A;  2IW5 A;  4FLX A;  4MW3 A;  3FB6 C;  2ITD C;  4XDJ A;  1OCC B;  3MAQ A;  1FXK C;  4WFA V;  1JFF A;  3E35 A;  4LWS A;  3OMI B;  3T1H B;  2RNB A;  5KHI A;  2A7W A;  2LFS A;  4GX5 A;  1WB8 A;  3ZN0 A;  1MMM A;  4DV6 B;  4AQY O;  2UXD B;  4GT1 A;  4NXN B;  1MOF A;  1HNX B;  1KU9 A;  2N04 A;  2DQ0 A;  4CC6 A;  5LMU B;  3KG2 A;  1XHZ A;  5DM6 V;  1TUB B;  4U7N A;  2F4V B;  4U3J B;  3ABK B;  2UXX A;  2V7Q G;  4NTW A;  3OE7 G;  1WPX A;  3APO A;  1YVW A;  3ETG A;  3OFN G;  2EZO A;  1V54 B;  2AXT Z;  2K1E A;  1RM1 B;  5CA3 A;  1EN6 A;  2XAJ A;  2LJ2 A;  3H1H H;  5IYZ A;  3HKD A;  3ASN B;  5LP6 B;  2KG7 A;  4MTG A;  3EFF K;  1OCR B;  4H44 B;  4X89 A;  1Y6X A;  1QNM A;  3JAK A;  4J9Y B;  4X8A A;  3TK1 A;  3CB2 A;  2WLL A;  4QE9 A;  2WLJ A;  2F23 A;  1UJW B;  1Y4M A;  1N32 B;  1B6Q A;  5LL6 Y;  3VQX A;  2HLD G;  4BIU A;  3Q4H A;  2YSU B;  4P9P A;  4HBN A;  1X59 A;  4DRX B;  2ZM6 O;  2N74 A;  4G27 B;  4TUY A;  4JYA O;  2IBZ H;  3G71 V;  2H94 A;  1AVM A;  3K08 A;  1V55 B;  3TET A;  3ZHT A;  5IYD O;  5IE9 A;  1SZX A;  1YIJ V;  2PGG A;  3TXQ A;  3I55 V;  2A9H A;  3TGU H;  4IIJ B;  2YC0 A;  1TUE B;  3ZRW B;  2JVD A;  4O2B A;  1VQL V;  1L8D A;  3OD4 A;  4PHZ A;  3CCE V;  1N36 B;  3AG2 C;  3OUS A;  2WLI A;  3SJB C;  2RDC A;  2DE0 X;  2FB5 A;  1FAF A;  2KQX A;  3K57 A;  2BOC C;  1M56 C;  4WF9 V;  3RGB A;  4HYO A;  1AJP A;  5L3F A;  3CME V;  4X20 A;  5IYZ B;  4YY3 O;  3ZHU A;  1WPB A;  5IYC O;  4ZHQ B;  4DUZ B;  1V9P A;  3JAK B;  3FB8 C;  3RW0 A;  4Z1M G;  4JV5 O;  1FKA O;  3WG7 B;  4MVU A;  3JD2 A;  1R3I C;  5FPR A;  2EIK B;  1G6U A;  5LHI A;  1J95 A;  2AGA A;  3DSQ A;  4QE7 A;  3Q4H B;  3CXC U;  1Y76 A;  1MNG A;  3BA8 A;  1QVG U;  1FFX A;  1MA1 A;  4TUY B;  1J5E O;  1IBL B;  3K5N A;  1VQ5 V;  4I55 A;  2XAG A;  4I7Z B;  4PEL A;  3SPH A;  3ABL C;  2EIM B;  4JAV A;  4X66 O;  1O9H A;  1N8R W;  3UM7 A;  3UT5 A;  1M93 A;  2YUA A;  1G8M A;  2BTQ A;  1XI1 A;  3GWK C;  3VOU A;  1I5Y A;  1ZL8 A;  3ZIA G;  4O2B B;  3OAA G;  1BS3 A;  4MTX A;  3E2E A;  4K3A A;  2ZE7 A;  3BPZ A;  1WAZ A;  2WLI B;  2L6L A;  1NS1 A;  5KHG A;  2OCC C;  1P84 F;  5L3G A;  5LYJ B;  2H3O A;  4BWA A;  2CAZ C;  4X20 B;  2PI5 A;  1WB7 A;  1PPJ H;  4RO2 A;  1JMK C;  1P7B A;  2O57 A;  4LF9 O;  1KUQ A;  1ZUQ A;  2EIL C;  3CEI A;  1SET A;  1NVP D;  2YIB D;  4DV1 B;  5DED A;  4DR6 O;  2GHY A;  2KB1 A;  5JQG A;  1SRY A;  2GDS A;  3ASO C;  4UB6 Z;  2X0L A;  2JGD A;  4UV8 A;  1XNR O;  1Y76 B;  1FFT B;  4H13 B;  1FFX B;  3MHS C;  3JSL A;  4J80 A;  2IJH A;  2ITC C;  3FYE B;  4I55 B;  1VQ9 V;  3F5W C;  1VAR A;  3JAW B;  4LCU C;  3K5L A;  2ARH A;  2NN4 A;  2R70 A;  2P6J A;  2CGN A;  2ZE6 A;  2CH7 A;  2Z5U A;  3ABK C;  3P30 A;  1WA8 A;  2EIN B;  2Q7H A;  1NR1 A;  3RYI A;  2JJ2 G;  4MVM A;  4QPJ A;  1ZSP A;  3SYO A;  1T5E A;  1V54 C;  4MVS A;  1RM1 C;  1SES A;  1KB9 F;  1BHA A;  3OMA B;  4KL1 A;  2BCC H;  2ZDI C;  1F51 A;  4KFM A;  2QE7 G;  1SQQ H;  3ASN C;  3OEE G;  3ZJZ A;  4EFB A;  2GBO A;  4RWU A;  4DV0 O;  4FK5 C;  2X7R B;  1YEW A;  5BR8 B;  3CC2 V;  4CS3 A;  3N27 A;  1Y67 A;  2GUZ A;  3JD4 A;  1QLE C;  3IC7 A;  5HFL A;  4J7K A;  1QLN A;  3CYO A;  1GK9 A;  4FVM A;  1R3L C;  2OTL V;  4X1I A;  4PI2 A;  4CS4 A;  5JH7 A;  1VF5 B;  3K04 A;  1VQN V;  4LF5 O;  2XT9 A;  2JGD B;  3JAR A;  4E4E A;  3UO3 A;  2Y4U A;  4DV7 O;  5B1A B;  1XMO O;  4GLX A;  3KKY A;  1V55 C;  4X64 B;  3LSS A;  5J2U A;  1AIL A;  5LOV A;  2GTS A;  4LF8 B;  1WP7 A;  1XBL A;  2QM7 A;  4DV5 B;  2UUC O;  1VQ6 V;  3RFR A;  1OCZ B;  4I5S A;  4EFE A;  4I9Q A;  1BE3 H;  2FKX A;  3E86 A;  4CS2 A;  2D3O W;  5EIB C;  1WA8 B;  1OZ0 A;  3B4S A;  2EBO A;  1US6 A;  2KSD A;  3RYI B;  3RT3 C;  1HNW O;  2CTQ A;  2BTO A;  4HNA A;  3AK2 A;  1OCO B;  2F43 G;  4MW8 A;  4J10 A;  1H2N A;  2P90 A;  2YXY A;  4JI8 B;  3KZI Z;  1BT8 A;  2XTA A;  4DYL A;  2N05 A;  2F66 C;  5IY5 C;  1K4C C;  1KC8 W;  4HZ3 A;  4MVQ A;  1E1R G;  2JGU A;  3C3T A;  3A0B Z;  1MSW D;  3O65 A;  4HAM A;  2UXB O;  4LF4 B;  1XDC A;  2XHB A;  4FM2 A;  3ABU A;  4BW5 A;  4DR3 B;  3A0R A;  2UUB O;  3F7V C;  5B1O A;  3OTO B;  4DV3 B;  1S5J A;  4PA9 A;  4C7U A;  2ZKO A;  2ZR2 A;  4J41 A;  4X1I B;  2P7T C;  4JAS A;  5JH7 B;  3OT7 A;  2A79 B;  3CX5 F;  4JTA B;  1SA0 A;  4OGQ B;  1M57 B;  3E8H A;  1EZV H;  1K73 W;  1XOU A;  3JAR B;  1JOY A;  1Z5V A;  3L72 H;  2OIG A;  4FJC C;  1R1B A;  1AJN A;  2LP7 A;  4G2K A;  1NQT A;  4F6E A;  2YIB A;  1VQP V;  1SQX H;  3RYF A;  5LOV B;  2E76 B;  3QO5 A;  5KA6 A;  4D6T H;  4DR1 B;  2B9Z A;  4JI3 O;  2RCV A;  2DWE C;  2CK3 G;  3AK1 A;  4JI1 O;  1IX9 A;  2ZNI A;  3CWB H;  5LMN B;  3X2Q C;  3CXH F;  3W7U A;  2YIA A;  2AZ0 A;  1L0N H;  3PN1 A;  1X4T A;  2LO1 A;  2UUA O;  2PF4 E;  3CCU V;  2WLM A;  3M7M X;  2AW9 A;  1HW7 A;  4JI2 B;  2R9A A;  2W0F C;  2E5L O;  4HNA B;  3BA9 A;  2JRI A;  1GKF A;  4BIO A;  3AEI A;  2OTJ V;  2ZE8 A;  4WFE A;  1YCI A;  1N33 B;  3VQW A;  3NXS A;  4B3S O;  3FKS G;  1IBL O;  4Q6G A;  1A32 A;  4UVB A;  3ZED A;  3M8A A;  4WBN B;  1I94 O;  1NTM H;  2DYR B;  3P3N A;  1PNM A;  3QG5 A;  1Z2G A;  1LUW A;  5FNV B;  4JZG A;  4FLU A;  3J81 N;  4LH6 A;  2JIZ G;  1PV0 A;  3E8G A;  2YXH A;  2UXC B;  3D8C A;  2M6Y A;  1HR0 O;  2WPD G;  3WB2 A;  3RVY A;  4XBF A;  1VQK V;  1XQ8 A;  1CP9 A;  1VQM V;  4CH3 A;  5IWA O;  2ZIO A;  4OXS A;  2Q8V A;  4KHP B;  5LP6 A;  1GO3 F;  4FPP A;  4LFC B;  2ILM A;  4DV4 B;  3RYF B;  3QVN A;  5H9C A;  4DV2 B;  2YS8 A;  1R3K C;  3BVO A;  1ENV A;  4RUE A;  2QGN A;  2V4D A;  4ZKI A;  1NH2 B;  4GCZ A;  1BSM A;  1BHB A;  4RUF A;  3U0Z A;  4B3M O;  1AR1 B;  2P06 A;  4DR5 O;  1BMF G;  3STZ C;  3LSU A;  2E75 B;  3VBB A;  1GN6 A;  4FLT A;  3L75 H;  4O4H A;  1GN4 A;  3EVK A;  1WNS A;  4U3F H;  4DK1 A;  3UQ8 A;  4O4J B;  3ZS8 C;  3C90 A;  2FYU H;  4ZIB A;  5EYP A;  4DR4 O;  4I50 A;  3D3Q A;  2VQF B;  4NB5 A;  1KP3 A;  3O9O A;  2CGO A;  5A9G A;  3STL C;  1FYJ A;  4IIJ A;  4JI6 O;  1DLB A;  1IZ3 A;  5H6R A;  3ZRW A;  4W4L A;  3VQY A;  4B3T B;  2PYL A;  4IL6 Z;  1IBM O;  1H2M A;  2HVK C;  1NR7 A;  1QQC A;  2ADQ B;  4CZZ A;  3UCS C;  4G28 B;  1JX9 A;  4I0X B;  3W7W A;  3BAB A;  4WFB V;  4JGS A;  1G1X B;  2HFE C;  1BGY H;  4MVO A;  1AI6 A;  2UU9 B;  1NBM G;  2FTK A;  3ML0 A;  3B8M A;  2AZ2 A;  1P7G A;  2EIJ C;  1YDX A;  4GX2 A;  4ZOL B;  5IJ0 A;  2DYS B;  3FAV B;  4ZHQ A;  2R9R B;  4K0K B;  2XAS A;  5KHJ A;  3CD6 V;  4YXW G;  3CCM V;  5B3S B;  1OCZ C;  1S76 D;  5H6Q A;  2ZXW B;  4LNU A;  2ETN A;  1H8E G;  1QR9 A;  5BR8 O;  1Q82 W;  4F4L A;  5CMU A;  1XMQ O;  4JI4 B;  5JCO A;  1SZT A;  1JPX A;  1MAB G;  1G4Y B;  4LFB B;  3HPL C;  3QO7 A;  3U10 A;  1EM1 A;  4X65 B;  4JPR A;  1TA8 A;  1E79 G;  3AG1 C;  4YHH O;  1OCO C;  4O4H B;  1R6N A;  5C93 A;  3SPC A;  4J11 A;  5AG2 A;  4R6Z A;  3UO2 A;  4NR1 A;  3ZRS A;  4JI7 O;  3OR6 C;  4GKJ O;  1WLE A;  3CCR V;  5EYP B;  2Y69 C;  2HHH O;  4I50 B;  5CN0 A;  5A2Q N;  3ZMV A;  4EB6 A;  2YDE A;  2VQE O;  3OUF A;  2QSA A;  3I56 V;  1L0L H;  3K9S A;  3ZHR A;  4NXM O;  3HKC A;  3WB0 A;  1XNQ O;  1AP6 A;  5B1B B;  3ZRX A;  1LNQ A;  1SC5 B;  1XRE A;  2DJV A;  2V1D A;  1M57 C;  1FJG B;  1SQV H;  5LYJ A;  3I5D A;  4NTX A;  4LF6 B;  3ZRV A;  5IJ0 B;  3CCL V;  3JAM N;  3OMN B;  2Y0I A;  3T1Y B;  1JR9 A;  4X88 A;  4PA7 A;  4TQD A;  2HJF C;  3AG3 B;  4Q20 A;  2GV9 A;  4LNU B;  1THZ A;  1K33 A;  4X1K A;  4GX0 A;  3TJT A;  1B3Q A;  2EJ7 A;  3WU2 Z;  4PD4 F;  5B66 Z;  2A06 H;  4MS2 A;  2P22 C;  3RBZ A;  5LA6 B;  4Z2W A;  4FZ0 A;  3K5O A;  3WB1 A;  4B7E A;  4FM1 A;  4DV3 O;  3E8F A;  1KMI Z;  2PTM A;  5E79 Z;  2WA4 A;  2QEX V;  3JAW A;  3B2E E;  3SDL A;  3SPJ A;  4JYY A;  3RVZ A;  2F95 B;  4PA3 A;  3GB7 C;  3A0H Z;  2XOK G;  4EB6 B;  4B3R B;  4RAI A;  3ABT A;  2XND G;  2W6I G;  2YID A;  3HKC B;  3H9V A;  4D7T A;  4DR7 B;  2B5U A;  4JI5 B;  4UXN A;  4H37 A;  4I9W A;  4WFG A;  5IJ9 B;  5GTH Z;  5EBW C;  1HNZ B;  1DK1 A;  1XL4 A;  1NJI W;  4WFH A;  5FL7 G;  1D5A A;  2DOS A;  4ZBM A;  2FML A;  4JI2 O;  2Q7G A;  1AI4 A;  2UXN A;  2HJD A;  1GM9 A;  1NU1 H;  2JEU A;  3OEH G;  2LW7 A;  2Q69 A;  5CA1 B;  4GKK B;  4KUM A;  2R72 A;  3CHX A;  4DW1 A;  2NNU A;  4UCV A;  1FXK A;  3ZX6 A;  2X6C A;  3OM3 B;  5E1A C;  4LFA O;  4X1K B;  1BL8 A;  4QIW F;  1IXM A;  2QM4 A;  4CH4 A;  1K9M W;  3F5T A;  1GMG A;  1YXB A;  1NH2 D;  1O9G A;  1N34 B;  2WSS G;  2NLJ C;  3AK3 A;  4B08 A;  5B1N A;  2RN9 A;  1L1F A;  3R66 A;  4NYK A;  2UXC O;  1URF A;  3BRC A;  4F6R B;  5LGT A;  2LFR A;  5H5N A;  3L71 H;  1OCC C;  3G80 A;  1N0J A;  3QNE A;  4ZI7 A;  3CMA V;  3JYC A;  4OX9 B;  3AG4 B;  4LBE C;  4BR6 A;  4FFB B;  3MDS A;  5CBG A;  1PNK A;  3G6E V;  4KHP O;  3OR7 C;  2Q5Z A;  4LFC O;  2Q6A A;  4DUY O;  4JI0 O;  2B1G A;  5BMV A;  3IAY A;  4AQY B;  1MG1 A;  5J2T B;  1I0H A;  1Q86 W;  2Q67 A;  2BOB C;  4LF7 O;  1LR1 A;  3T2M A;  1R6K A;  5KA5 A;  1NKD A;  1K5Q A;  4TWK A;  3ZN1 A;  1PP9 H;  1D5N A;  4DR2 O;  1EZJ A;  3N2K A;  1BQ0 A;  5EZY A;  1K92 A;  4R7C A;  3K9A A;  3JAS B;  3L9D A;  3ZMT A;  3P32 A;  2G38 A;  5LP6 C;  2QTS A;  3ZCC A;  5LXT B;  1OCR C;  1QR8 A;  4A5U B;  3R65 A;  1IUR A;  3T1H O;  3H1L H;  5BY1 A;  1Z5W A;  3LNN A;  5B3S C;  2IH3 C;  2JK5 C;  2ZXW C;  1KBH A;  1FXK B;  4DV6 O;  1K4D C;  2UXD O;  4NXN O;  3U11 A;  1HNX O;  1S77 D;  2ZIM A;  2HG5 C;  5LMU O;  3BHP A;  1DTO A;  5KX5 A;  2F4V O;  3RYH A;  1JJ2 U;  2EJR A;  3JSN A;  2B1I A;  2LGW A;  1FXV A;  4ZI7 B;  5KLV H;  1F4N A;  1XEQ A;  4BW9 A;  1P49 A;  4I4T A;  2QKC A;  1K7D A;  2EX3 A;  1R6T A;  4YJ2 A;  2YI9 A;  4R50 A;  2OWO A;  4JYA B;  1K8A W;  3EXA A;  3HKE B;  5BMV B;  4UB8 Z;  1QHT A;  3BAA A;  2RQ6 A;  1CXZ B;  2QWP B;  4QPK A;  1NTZ H;  4JI4 O;  4TV8 A;  1ROP A;  5B1B C;  1SER A;  4PI0 A;  3W7X A;  2LW1 A;  1N32 O;  1KEC A;  1QVF U;  2CTW A;  3FD9 A;  3N2K B;  5EZY B;  2A3Q A;  5KHK A;  4TV9 A;  2H8P C;  1DF5 A;  1PNL A;  3B09 A;  4FMT A;  3CCS V;  3IGA C;  2Y0P A;  3G6B A;  2EZP A;  5KAI Z;  1I08 A;  4WBN A;  3LDE A;  4UV9 A;  1YIT V;  4MVZ A;  2Q68 A;  1WN7 A;  5FNV A;  4YY3 B;  1JCH A;  3AG3 C;  3WG7 C;  5KMG A;  1GRJ A;  1I7F A;  1I5X A;  3JCZ A;  3J80 N;  2EIK C;  4AI8 A;  3TXS A;  5JCO C;  5JJJ B;  1HDJ A;  4JV5 B;  4JYB A;  2W0X A;  5KX5 B;  2IJK A;  3RYH B;  3GWO A;  2Q0O C;  3PJS K;  3E22 A;  3LNM B;  2Y48 A;  2MW2 B;  1Q90 D;  1N36 O;  4O4L A;  1FJG O;  3BCC H;  4LR3 A;  4I4T B;  2Q9L A;  2WLH A;  4DK0 A;  1H2K A;  1VIB A;  2IU3 A;  4LH7 A;  4YJ2 B;  4X9Q A;  1S3J A;  2WWW A;  2EIM C;  4QNH B;  1J5E B;  5JVD A;  4IHJ A;  3K79 A;  4MTF A;  3QTC A;  1M56 B;  1SS3 A;  4U7O A;  3T1Y O;  4DUZ O;  4W4K A;  4X1Y B;  5K1P A;  2WA3 A;  3ETE A;  3JAT B;  5CB4 B;  2JJ1 G;  1QU7 A;  3ZBH A;  4PA4 A;  4X66 B;  4MVR A;  2E74 B;  1TVK A;  4TV8 B;  4PDL A;  1VMG A;  5D5Q A;  5LGN A;  3JAL A;  4P2Z A;  3L70 H;  3D36 A;  5EK0 A;  1PD3 A;  3CCJ V;  1B04 A;  4TV9 B;  4O4J A;  2OIE A;  5H2F Z;  4K8X A;  3K06 A;  4QGP A;  4EKW A;  5JJE B;  3FYI B;  1Q3E A;  3GVM A;  2EUL A;  5KMG B;  3S3X A;  2Q7E A;  2YI8 A;  4LF9 B;  1Q6H A;  4FLZ A;  4DR6 B;  1ARO P;  1S0V A;  4I0X A;  3RYC B;  4GZR B;  4DR7 O;  3WFV A;  3E22 B;  1ORQ C;  2PUS A;  3A8T A;  2IU0 A; 
#chains in the Genus database with same CATH homology
 3ZRS A;  3E8B A;  3OR6 C;  2EIL C;  1WLE A;  5LHH A;  3CCR V;  1SET A;  1NVP D;  2Y69 C;  4RQE A;  5CN0 A;  3M99 B;  3ZMV A;  2GHY A;  2KB1 A;  4QJF B;  3H01 A;  1KP2 A;  3OUF A;  3I56 V;  3OW2 U;  2OT5 A;  1GM7 A;  3CPW U;  5L3E A;  4E2L A;  1SRY A;  3AG1 B;  3ASO C;  2ATK C;  2X0L A;  1KQS U;  5B1B B;  3ZRX A;  2Z3Y A;  2XAQ A;  4UV8 A;  1LNQ A;  1FFT B;  2EIN C;  1YJW V;  2V1D A;  3MHS C;  1M57 C;  5CBF A;  2IJH A;  4MT8 A;  2ITC C;  3FYE B;  3K0D A;  4KP4 A;  4FIP C;  4DXW A;  1VQ9 V;  1YTF D;  2Y69 B;  3F5W C;  3G4S V;  3ZRV A;  4LCU C;  2ZQM A;  4J9Z B;  3CCL V;  1KKD A;  3LDC A;  3DTU B;  5LGU A;  3SJQ C;  3OMN B;  2QA4 V;  4X88 A;  4PA7 A;  2P6J A;  2HJF C;  3AG3 B;  4Q20 A;  1FXH A;  3ASO B;  1THZ A;  2Z5U A;  3K0G A;  4DO2 A;  1AI7 A;  3ABK C;  3AG2 B;  3P30 A;  3SYQ A;  1W2B U;  1K33 A;  4GX0 A;  2EIN B;  2WLN A;  2P67 A;  2A0L A;  3ZMS A;  5L3C A;  3CC4 V;  1NR1 A;  2JJ2 G;  4MVM A;  1E1Q G;  5EC1 C;  4BAY A;  4MS2 A;  3RBZ A;  2HVJ C;  4QPJ A;  3SYO A;  3W7S A;  1V54 C;  4JTD B;  1VQO V;  4MVS A;  1YI2 V;  1PKX A;  1RM1 C;  1SES A;  1K34 A;  1BHA A;  3E8F A;  3BY6 A;  3OMA B;  5BZB A;  2HKO A;  2ZDI C;  1F51 A;  4KFM A;  2QE7 G;  3T1C A;  3ASN C;  3OEE G;  4CBC A;  3ZJZ A;  1EBO A;  2QEX V;  4FK5 C;  2X7R B;  1DF4 A;  1CEZ A;  5B1A C;  4JF3 A;  1YJ9 V;  3SPJ A;  3RVZ A;  4MTO A;  3CC2 V;  3OGC C;  2X6A A;  2AHY A;  4PA3 A;  1H2G A;  3GB7 C;  3LDD A;  2XOK G;  1VQ4 V;  3JD4 A;  1QLE C;  3IC7 A;  4RAI A;  1R3J C;  3ABT A;  5HFL A;  1QLN A;  3CYO A;  1GK9 A;  1R3L C;  1QCE A;  2MK3 A;  2XND G;  2W6I G;  2OTL V;  2JDI G;  1EFR G;  2B5U A;  3CC7 V;  3K04 A;  4UXN A;  1VQN V;  4H37 A;  3F7Y C;  3E83 A;  4I9W A;  4WFG A;  5EBM C;  5EBW C;  1KD1 W;  1Q81 W;  3TCU A;  5EBL C;  1RPR A;  1XL4 A;  1NJI W;  4WFH A;  4TSF G;  5B1A B;  3SYP A;  3ZMU A;  5FL7 G;  1V55 C;  3SPG A;  3LSS A;  3ABL B;  4ZBM A;  2IJJ A;  2ZD9 A;  4JTC B;  4WCE V;  4LC1 A;  3D3I A;  4UVC A;  1AI4 A;  2UXN A;  4LP8 A;  4GX1 A;  1GM9 A;  2QM7 A;  1VQ6 V;  1QLE B;  2JEU A;  1OCZ B;  4I5S A;  3OEH G;  2Q69 A;  3B8N A;  3DGE A;  1GTO A;  4KUM A;  2DWD C;  3AG4 C;  3ABM B;  3EHB B;  4P9O A;  3JD0 A;  3K03 A;  2NNU A;  3E86 A;  1FXK A;  2X6C A;  3OM3 B;  5E1A C;  4JYC A;  2D3O W;  1VQ7 V;  1BL8 A;  4JAU A;  1IXM A;  4QIW F;  1OZ0 A;  2X6B A;  2EBO A;  1K9M W;  1GMG A;  3MD0 A;  1H8H G;  1F4M A;  1H38 A;  2OCC B;  1NH2 D;  3K3W A;  4XDL A;  2IH1 C;  2WSS G;  2NLJ C;  5B1N A;  1OCO B;  2ZDI A;  1L1F A;  2F43 G;  1K5S A;  4WFF A;  4MW8 A;  5LGT A;  2LFR A;  1ZWI C;  1NVP B;  1GM8 A;  1OCC C;  1OHH G;  2P90 A;  3QNE A;  2W6J G;  5L3D A;  3CMA V;  3JYC A;  1M90 W;  2C2A A;  3AG4 B;  4LBE C;  2EIL B;  5GW7 A;  5IY5 C;  2GSM B;  3T4D A;  5IYB O;  1HWY A;  1K4C C;  4BIZ A;  1KC8 W;  3W7T A;  4HZ3 A;  2XAF A;  4MVQ A;  5CBH A;  1E1R G;  1W0J G;  5CBG A;  1QBZ A;  4UUJ C;  1MSW D;  1PNK A;  4HAM A;  3G6E V;  3OR7 C;  4PA6 A;  4PDR A;  2Q6A A;  3ABU A;  1R73 A;  4BW5 A;  4PDM A;  1M1K W;  3A0R A;  3F7V C;  5B1O A;  2B1G A;  4PA9 A;  2ZR2 A;  2P7T C;  1JVM A;  4PDV A;  1MG1 A;  2IW5 A;  4JAS A;  3SYA A;  4MW3 A;  1F23 A;  3FB6 C;  2ITD C;  2Q67 A;  3IFX A;  2BOB C;  2A79 B;  4XDJ A;  1OCC B;  4JTA B;  1YTF B;  1FXK C;  1M57 B;  3E8H A;  4WFA V;  1K73 W;  3E35 A;  3T2M A;  1JOY A;  5IY5 B;  3OMI B;  4FJC C;  1R6K A;  5KA5 A;  2WLK A;  1NKD A;  1K5Q A;  3JD3 A;  4TWK A;  3ZN1 A;  1AJN A;  3T4Z A;  5KUK A;  2LP7 A;  4G2K A;  1EZJ A;  2LFS A;  3FB7 C;  1NQT A;  3MHH C;  4GX5 A;  3ZN0 A;  5L3B A;  2WLL B;  1K92 A;  4R7C A;  1VQP V;  3K9A A;  3B77 A;  2YEV A;  4GT1 A;  1MOF A;  3ZMT A;  3P32 A;  3QO5 A;  5KA6 A;  2DQ0 A;  3ZCC A;  1Q7Y W;  3KG2 A;  1OCR C;  1QR8 A;  2DWE C;  5DM6 V;  2CK3 G;  3R65 A;  4U7N A;  3ABK B;  1RPO A;  2UXX A;  5B3S C;  5HFM A;  3X2Q C;  3W7U A;  2V7Q G;  3OE7 G;  2IH3 C;  2JK5 C;  2ZXW C;  3HB3 B;  1FXK B;  1WPX A;  2DYR C;  1COW G;  1K4D C;  2QTO A;  3ETG A;  3OFN G;  3CCU V;  2EZO A;  2WLM A;  1S77 D;  1V54 B;  2HG5 C;  2K1E A;  1RM1 B;  1DTO A;  5CA3 A;  3FB5 C;  2XAJ A;  2W0F C;  1S5H C;  1JJ2 U;  1GKF A;  3AEI A;  2EJR A;  2DQ3 A;  2B1I A;  2OTJ V;  3ASN B;  4ASU G;  4WFE A;  4MTG A;  1FXV A;  4XDK A;  3EFF K;  1OCR B;  1AJQ A;  1F4N A;  2HR3 A;  4X89 A;  4P30 A;  4H33 A;  4J9Y B;  3NXS A;  4X8A A;  3FKS G;  3X2Q B;  3TK1 A;  4UVB A;  2WLL A;  1K7D A;  5LHG A;  2DYR B;  1PNM A;  1W0K G;  4R50 A;  4QE9 A;  2WLJ A;  1UJW B;  1Y4M A;  3CCQ V;  4RQF A;  1K8A W;  1B6Q A;  2JIZ G;  3BEH A;  3E8G A;  3LUT B;  2HLD G;  4BIU A;  2YSU B;  5LBQ A;  4P9P A;  2WPD G;  3CCV V;  3RVY A;  4XBF A;  1VQK V;  4G27 B;  4QPK A;  1ROP A;  5B1B C;  3G71 V;  1SER A;  1CP9 A;  2H94 A;  3CP1 A;  1VQM V;  3K08 A;  1V55 B;  3TET A;  2DW4 A;  3ETD A;  3W7X A;  5IYD O;  1JQ0 A;  1KEC A;  4OXS A;  1YIJ V;  1QVF U;  2R9I A;  1PL0 A;  1GO3 F;  2JEX A;  4FPP A;  3SPI A;  2XAH A;  2H8P C;  1DF5 A;  2ZR3 A;  1PNL A;  2YEV B;  4FMT A;  2QKS A;  2IJI A;  3I55 V;  3CCS V;  2A9H A;  3IGA C;  2QM8 A;  5H9C A;  1VQ8 V;  1M9N A;  2EZP A;  1R3K C;  4TT3 G;  1K97 A;  1ENV A;  1TUE B;  4RUE A;  3LDE A;  4UV9 A;  3ZRW B;  1YIT V;  4ZKI A;  4MVZ A;  2Q68 A;  1NH2 B;  4GCZ A;  1VQL V;  1BHB A;  4RUF A;  1JCH A;  3AG3 C;  3WG7 C;  3CCE V;  3JD1 A;  1I5X A;  3AG2 C;  3JCZ A;  3OUS A;  2WLI A;  2EIK C;  1YJN V;  5EC2 C;  4JYB A;  1Q86 W;  2M7W A;  1Y66 A;  2BOC C;  1AR1 B;  1M56 C;  4WF9 V;  1BMF G;  2IJK A;  4HYO A;  3STZ C;  3VBB A;  1AJP A;  5L3F A;  3UKM A;  3CME V;  3GWO A;  4UVA A;  3QO8 A;  3E89 A;  3PJS K;  3LNM B;  2Y48 A;  4L87 A;  5IYC O;  4R8C A;  3RW0 A;  3FB8 C;  4Z1M G;  2PI4 A;  3WG7 B;  4MVU A;  2WLH A;  3JD2 A;  2WAM A;  2IU3 A;  1KP3 A;  1R3I C;  1S3J A;  2WWW A;  2EIM C;  2EIK B;  5KUM A;  3STL C;  4QNH B;  2DYS C;  1DLB A;  5J9P C;  5H6R A;  3K79 A;  3ZRW A;  4MTF A;  3ZMZ A;  5LHI A;  1J95 A;  1M56 B;  4U7O A;  5IDJ A;  1CPY A;  4QE7 A;  1P4R A;  2HVK C;  3ETE A;  1NR7 A;  2JJ1 G;  3CXC U;  4CZZ A;  4PA4 A;  4G28 B;  4MVR A;  1JX9 A;  1QVG U;  3W7W A;  1YHQ V;  4WFB V;  4JGS A;  4PDL A;  2HFE C;  3LSQ A;  1VQ5 V;  4MVO A;  2XAG A;  1AI6 A;  3SYC A;  1NBM G;  4PEL A;  5LGN A;  4P2Z A;  3SPH A;  2FTK A;  3ML0 A;  3B8M A;  3D36 A;  5EK0 A;  2EIJ C;  3ABL C;  4GX2 A;  2EIM B;  4JAV A;  1PD3 A;  3CCJ V;  2DYS B;  1N8R W;  5DN6 G;  2R9R B;  2XAS A;  3UM7 A;  3CD6 V;  4YXW G;  1FS0 G;  3CCM V;  5B3S B;  1OCZ C;  3K06 A;  1S76 D;  1G8M A;  5H6Q A;  1XL6 A;  4EKW A;  2ZXW B;  3VOU A;  1I5Y A;  3FYI B;  1H8E G;  1QR9 A;  3ABM C;  3ZIA G;  4F4L A;  5CMU A;  1AI5 A;  1Q82 W;  3OAA G;  4N21 A;  4MTX A;  3E2E A;  1S72 V;  1SZT A;  1JPX A;  2WLI B;  1K3E A;  1MAB G;  1YSC A;  1G4Y B;  3HPL C;  3QO7 A;  2OCC C;  4JPR A;  2EIJ B;  5L3G A;  1ARO P;  1E79 G;  3AG1 C;  1S0V A;  1OCO C;  1R6N A;  4MSW C;  3WFV A;  5C93 A;  2PI5 A;  3SPC A;  2AHZ A;  4N23 A;  1ORQ C;  4RO2 A;  4R6Z A;  2IU0 A;  1P7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...