3STZC

Kcsa potassium channel mutant y82c with nitroxide spin label
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
102
structure length
102
Chain Sequence
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLCPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of Cd(2+) Coordination during Slow Inactivation in Potassium Channels.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 44
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2011-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3stzC00
2EINC 4P30A 4RO2A 3K04A 2Q6AA 2P7TC 2W0FC 3LNMB 5EK0A 3E8GA 2WLJA 3AG2C 3E86A 5B1BC 4XDJA 1XL6A 3LDCA 3SYPA 2A0LA 1G4YB 3RVZA 3IFXA 3FB8C 4LBEC 3SPGA 1BL8A 4EKWA 4XDKA 4X88A 2EILC 3AG4C 4MS2A 2QKSA 1OCOC 2HVKC 4J9YB 2WLKA 3F5WC 3BEHA 5KUMA 3ABLC 4P9PA 3E83A 4WFEA 2ATKC 3GB7C 3SJQC 1LNQA 3EFFK 2DWDC 3E8HA 3SYOA 1JVMA 3AG1C 3F7VC 2WLHA 5CBFA 2ZD9A 4LCUC 3SPHA 3F7YC 1OCZC 1R3IC 1R3LC 2KB1A 4G27B 2Q69A 3E8FA 3WG7C 5CBGA 1ZWIC 1M57C 3UM7A 2HJFC 4JTDB 5IY5C 2ZXWC 4MSWC 4R7CA 3TETA 3STZC 1V55C 2R9RB 4QE9A 2X6BA 4MVQA 3SYCA 2ITDC 3JYCA 5J9PC 3IGAC 4H37A 2AHZA 2HFEC 3FB6C 3ASNC 3K0GA 3R65A 4MW8A 2BOBC 3OUFA 2WLMA 4R6ZA 3T4DA 5EC2C 3ASOC 3KG2A 5EC1C 3SYAA 3K03A 4DXWA 4JTCB 2DWEC 2X6CA 4MVSA 4WFGA 4UUJC 5E1AC 2A79B 4GX0A 4LP8A 4PA3A 3LUTB 2BOCC 2X6AA 4OXSA 4MTFA 4HZ3A 1R3JC 2OCCC 3TCUA 4GX5A 4RUFA 4ZBMA 2DYRC 3E8BA 4PA4A 3UKMA 1M56C 4QNHB 4PA9A 4WFFA 4PA7A 3OR6C 4XDLA 1V54C 5EBLC 2HVJC 3K08A 1OCRC 3FB5C 4PDMA 2Y69C 4RUEA 3T4ZA 1XL4A 1K4CC 5CBHA 4GX1A 2JK5C 4G28B 1K4DC 4H33A 4KFMA 3OUSA 4X8AA 4TWKA 3FB7C 3ZJZA 4J9ZB 4F4LA 1P7BA 2A9HA 3HPLC 4HYOA 2Q67A 5KUKA 2HG5C 2K1EA 4PDRA 4I9WA 2EIJC 2YEVA 5B3SC 2IH1C 4MVOA 1R3KC 3K06A 3T1CA 3SPIA 4PDLA 3LDEA 3PJSK 4RAIA 3ZRSA 4BW5A 3RW0A 1ORQC 2WLIA 3ABKC 4GX2A 3STLC 2EIKC 2WLIB 2QTOA 4MVUA 4QE7A 4R50A 3X2QC 4P2ZA 1J95A 3E89A 4PA6A 3RVYA 4CBCA 2Q68A 3SPCA 1QLEC 1S5HC 4PDVA 2H8PC 5BZBA 2AHYA 2NLJC 2WLNA 3SYQA 3RBZA 4MVMA 3T2MA 3ABMC 3LDDA 4MVZA 4WFHA 3SPJA 5EBMC 4MTOA 2WLLA 2DYSC 4P9OA 4MVRA 4X89A 5B1AC 2WLLB 3OGCC 2IH3C 3AG3C 2ITCC 2EIMC 4R8CA 5EBWC 4JTAB 3VOUA 1KKDA 1OCCC 4MTGA 4MW3A 3K0DA 3OR7C
chains in the Genus database with same CATH superfamily
2JGDA 2M6YA 1SC5B 1P84F 5IY5B 5CB4B 3D3IA 2D3OW 4X88A 2QKSA 3ZRVA 4J9YB 3ABLC 1YITV 1SQVH 1E79G 3SJQC 1LNQA 4ABMA 2HHHB 2HR3A 3JAKA 1P49A 1R3LC 1CPYA 2PF4E 1KD1W 2HJFC 2ZIOA 4EB6B 1BQ0A 3DXRB 5KMGB 3HKEB 2JVDA 4JI5O 1IZ3A 2QDOA 3RYHB 4MVSA 4WFGA 1DF4A 5D5PA 2KQXA 3F5TA 1XEQA 1M4UA 1TVKB 2FMLA 5IYBO 3H1IH 1MSDA 1VF7A 2P4VA 4LWSB 4DW1A 5LYJA 4DR5O 1O9HA 4ZKIA 5IDJA 1S3JA 3HPLC 1I7FA 3CCSV 1EZJA 3W7WA 1FFXA 2EIJC 5LMUB 1GN3A 1N32B 5LMNO 3LSUA 3QVNA 4QJFB 5DECA 3STLC 2P90A 4NXMO 2JEUA 4DR1O 5LP6C 1OCCB 3X2QB 2OTLV 2GBOA 1Y6XA 1QLEC 5B1BB 3GWOA 4TUYB 1NR7A 4W4KA 2NLJC 3WB0A 5CA1B 2IJHA 3CB2A 5IJ0A 2WLLB 3HKCA 4JI0B 3AG3C 5KX5B 2DW4A 4OGQB 3LNNA 4FLZA 2F66C 1FPOA 3K0DA 3K04A 5J2UB 4PV1B 2ZCEA 3RVZA 4EKWA 2Y69B 4J80A 1PNMA 1SS3A 1BHBA 4WFBV 4LF5B 1BT8A 5ITZB 3Q4HA 3JAMN 2BTQB 1X59A 2DWDC 1AILA 3MDSA 4R7CA 5KHIA 3G71V 2X6BA 1DTOA 2CAZC 3AK3A 3U10A 1I08A 4KP4A 3SJAC 2X6CA 1KMIZ 5E79Z 1VP7A 1VQKV 4X1YA 3T1HB 4DV4B 1BSMA 4N21A 1SA0B 2IJJA 3A0RA 3H1HH 4QNHB 4PA7A 4I4TB 1QBZA 4B3TO 1CEZA 3WB2A 1HR0B 3GWKC 1H2LA 1FXHA 5L3GA 2QSAA 3UO2A 4L8JA 3M8AA 1Q8IA 4TOIA 3ABLB 1M93A 3ZS8C 1K34A 2N74A 2LFSA 1J5EB 1RSOA 4NKGB 2L35A 3VQVA 2X0LA 4UCSA 4GX2A 4GKKB 2WLIB 2ZE7A 1WA8B 1Y67A 1XUQA 3CS5A 3AK2A 1HNWB 3FD9A 3RBZA 4MVMA 1NZ6A 2EILB 2QWQB 1S0VA 2ZIMA 4PELA 2DQ0A 1R6KA 1H8HG 3N2KA 4X1KB 4YJ2B 1VQ7V 2CTWA 5IJ9A 4FLXA 1Y4MA 1G4YB 2ZM6B 4JAVA 1V55B 3IFXA 1Y76A 4J10A 4DV0O 2WLHA 3SPHA 3CJHB 4X65O 5BMVA 1B06A 5LXTA 3W7XA 5LOVB 1GM7A 1YZBA 1OJHA 3B09A 3RGBA 3VQYA 3H1KH 1KU9A 4DV1B 3D36A 1BHAA 3I56V 2QEXV 1AP6A 2A79B 3K9AA 3QTCA 2GUZB 2Y48A 5DM6V 4PA4A 1F23A 4IIJB 4U3FH 4XDLA 4FM2A 2QR4A 3K08A 4PDMA 1XL4A 3L70H 1RM1C 2JK5C 3D36C 5B1NA 2D2CB 1Y66A 4TWKA 3ZRWA 3IC9A 2A9HA 3OE7G 5DN6G 1BCCH 1W0KG 5EYPA 4JPRA 4X66O 4F6RB 3CC7V 2EIKC 2YI9A 5JJNB 3ZEDA 4YIPA 2YDEA 3TXSA 4JV5B 4H44B 3MHSC 2ZNIA 2M7WA 4LF6O 3P32A 1V9PA 4ZI7B 3SYQA 3ABMC 1R1BA 4K0KB 3CEIA 4JYBA 1VARA 2V4DA 5FL7G 2EINC 2L6LA 3AG2C 4LH6A 1Q81W 2UU9B 4JI7O 1A32A 1M5IA 4X64B 4MS2A 4LR3A 1EN5A 4DV2B 4TV9B 2RQ6A 1FS0G 3E83A 4ZHQA 1DF5A 3EFFK 4DR2O 4LF8O 2F4VO 2H94A 2FB5A 3F7YC 3H1JH 2RN9A 1NS1A 4TQDA 2ZQMA 3KZIZ 2ZNJA 4CZZA 3R65A 3T4DA 4X20B 3CCJV 1VQMV 2XAFA 1Q82W 5C8YA 4FFBA 2PY5A 5JQGA 4LP8A 4CS2A 3OW2U 1B6QA 3B40A 1S5JA 3NXSA 2OTJV 4OXSA 1HNZO 2OCCC 1WNSA 2LJ2A 3J81N 2KSDA 1XNQO 4DK1A 3CRAA 4LNUB 2XTAA 2HKOA 1H2NA 1WN7A 5LA6A 1NVPD 1YF2A 4O4IB 2NR5A 2AZ0A 4JI6B 3RYCA 3THOA 2YEVB 1HDJA 1XHZA 4U3JA 3WFVA 4WFAV 4LF7O 3ZHQA 2H3OA 3OMIB 2PYJA 1COWG 1KKCA 5J2TA 5CB4A 4CBCA 4JI1B 2RDCA 3CCEV 3CRQA 4YXWG 2LP7A 2H8PC 3TJTA 2AHYA 2Q0OC 1F51A 4KHPB 3UT5B 4J7ZA 4MVZA 1K3EA 1IDSA 2EJRA 2AZ2A 4DV3O 4O2AB 2QM4A 3OTOB 3ZN0A 4CS3A 4FJCC 2ZE6A 3K9SA 4KXRA 1YJ9V 2UUCO 5KMGA 1L8DA 3HKEA 2Q7GA 4UVCA 1ZUQA 3ZMTA 4LFCB 3SPGA 3K5LA 4JYCA 4JI4O 4LF9O 3K5OA 1Q90D 1RM1B 2B1IA 1XDCA 4BAYA 1NH2B 3L73H 2MW2B 1RP3B 3JALB 5KHHA 3K5NA 1TVKA 1AJNA 1AI6A 4ASUG 3HKBB 1R3IC 2KB1A 3JD3A 5JH7B 2Y0PA 4CS4A 4PI0A 3MD0A 4LWSA 3W7UA 1KYOF 4DR4B 2ZINA 4B3MO 1EBOA 2NNUA 4RQEA 3APOA 1DK1A 3ZHSA 5EIBD 3G80A 3MHHC 1FD9A 3LUTB 3ABMB 3PN1A 4HZ3A 1AI5A 1ZTEA 1FXKB 2EX3A 3D3QA 4I0XB 4GYCB 2HP8A 2ZE8A 1S5LZ 4FZ1A 1V54C 4A5UB 2EINB 4TUYA 2UXCO 1K5QA 2Q5ZA 5CA1A 1QVFU 4X62B 5LL6Y 3BAAA 4HYOA 2HHHO 2Q73A 1ZL8B 5IE9A 2E76B 4MVOA 2CGOA 4B7KA 1YEWA 1AI4A 1MMMA 3WU2Z 1YTFB 5J2UA 4C7UA 1XI1A 3QG5A 1AI7A 1K97A 4L87A 3EVKA 1VQ6V 1VQ8V 4I9QA 2P06A 4FIPC 4I55B 2QTSA 2P4KA 4DR7B 1N0NA 4P9OA 4MVRA 1VIBA 4GKJB 3K3WA 4O4LA 4OPAA 2R70A 4JI8O 1W0JG 4LBEC 4LFAB 2OCCB 1ROPA 3WG7B 5CA3A 1YXBA 1M57B 5FNVA 3JATA 5EZYB 2JEXA 2UUBO 5IYCO 1IXMA 4P9PA 2IJIA 3N2GB 1GN4A 1PL4A 1JVMA 5KA5A 1OCZC 2GDSA 3JD2A 1ZWIC 4YIOA 1VEWA 4B3RO 3JYCA 2VQFB 1N33O 1VQPV 1VF5B 4UV8A 3SYAA 3OFNG 4JI3O 2GHYA 3CX5F 4B3SO 1F4NA 3BFRA 4UCVA 1VMGA 3ETEA 4FK5C 4FM1A 4IYIA 1WA8A 4PA9A 1SQFA 4UCUA 4LC1A 1PPJH 2P67A 4GZRB 1Q6IA 4DV5B 3A0HZ 4HAMA 2CTPA 4DR6O 1W59A 4PDRA 1H2KA 4MTXA 1AP5A 4NTXA 1R3KC 2AGAA 4O4HB 1YJWV 3T1CA 3VQWA 4X1KA 4YJ2A 1RFYA 3ZMUA 2EJ7A 4UVBA 2XUMA 2XHBA 2VWJA 2UUAO 1JPXA 1J95A 1K92A 4PA6A 5KA6A 3T1YO 4DV6O 1XMQO 3H1LH 4DV4O 5H9CA 3P30A 4JYYA 3ZBHA 1GN2A 1PNLA 5AG2A 1Q6HA 2DJVA 1L1FA 2ITCC 4RQFA 2E75B 4JTAB 2YXHA 4WF9V 4TV8B 5EK0A 1JCHA 5KAFZ 2WPDG 4G2KA 4DR3O 2LGWA 2UXBO 1SRYA 2V1DA 4JI2O 1LUWA 1FJGB 4WCEV 4FM0A 1I94B 2PI4A 4GKKO 2BSKA 5CBFA 2YIBA 1VQLV 4YY3O 4DUYO 1UPGA 3UM7A 4CC6A 3FYEB 2A3QA 4JZGA 4QE9A 3ZHUA 1NJIW 2ITDC 4FLVA 4FVMA 2N04A 2HFEC 3ASNC 3K79A 2BOBC 5TISZ 4BIOA 2HJDA 4BIUA 5DEDA 4JTCB 4TT3G 1WAZA 1P4RA 4UUJC 3E22B 1GAXA 1QLNA 4F6RA 4DUZO 3H9VA 2YI8A 3E8BA 3JASA 5B66Z 1NVPB 2YIDA 2F23A 2QWPB 2BTOA 1HNXO 1NH2D 2LQTA 4ZI7A 1NI8A 3TK1A 1T5EA 3ZJZA 4LFBO 1AJPA 3RN4A 5B3SC 5KHJA 5L3DA 4HNAA 2GTAA 4RAIA 5IYDO 3A0BZ 4X1IA 4UV9A 3CHXA 3HB3B 2JDIG 1US6A 2FTKA 2Q68A 1S77D 2Y0IA 2QE7G 1L0LH 3ICXA 4DR5B 4UXNA 5KHKA 4WBNB 2XAHA 4U7NA 3ZHRA 2DYSC 1N0JA 5B1AC 4O2BA 3SJCC 5KHGA 3E2EA 3CMEV 5LGTA 1YDXA 4JAUA 2YXYA 5LMNB 1GH6A 2W0FC 2E74B 1WP8A 1K33A 2JGDB 3E86A 1U97A 4J11A 4X20A 3BPZA 4NXMB 1PKXA 3CCLV 1YTFD 5GTIZ 1ZSPA 4UVAA 1SF9A 3E8HA 3AG1C 3F7VC 4D7TA 2WWWA 3BABA 3FAVB 2OIGA 1GN6A 2ZR2A 2ZXWC 3AG7A 2YUAA 3TETA 1IBMB 4KL1A 3RFRA 3TXQA 3JARB 4MVQA 3MAQA 1F7YA 5JVDA 2WSSG 3ASOC 3WB1A 2VS0A 2QWNB 2VRZA 4FLTA 2PUSA 3APQA 2IW5A 1IBKO 4GX5A 3UKMA 2EIJB 3G6EV 4K8ZA 1XNRB 2A06H 1M56C 1JJOA 3K58A 5EBLC 1EFRG 3FB5C 1WPBA 5LYJB 1MABG 3CWBH 3RT3C 1MSWD 5LP6B 3W7TA 2R9AA 2DQ3A 5HFLA 2Z3YA 4DV7O 1QLEB 1LUVA 2CH7A 2IH1C 1N34O 2OT5A 4YJ3B 1Y74A 1KP3A 1QHTA 3AG3B 1D2DA 3OAAG 1Q86W 1VQOV 5CA0A 2E5LB 5LHGA 3C3SA 4B3TB 3BVOA 3ASNB 4Q6GA 2DMXA 3R66A 4FFKA 1GK9A 3LSQA 1WB8A 3ZMVA 3HKBA 4JYAO 4MTOA 2F93B 4X89A 5JH7A 2ODMA 5JJJB 1S76D 4MTGA 5LHHA 3SJBC 2P7TC 1FYJA 5FPRA 3LDCA 3SYPA 1N36O 2DOSA 3AG4C 5GONB 3EHBB 3AEIA 4I0XA 3Q4HB 4YHHO 3SYOA 5L3EA 2VQEO 5B3SB 2EULA 4QIWF 1Z5WA 3FFQA 4KUMA 5JJEB 1KECA 4I7ZB 1K8AW 2AHZA 1LR1A 4DXWA 2LGQA 2DWEC 3CC4V 2BOCC 4OPHA 4DV0B 2DYSB 1IBLO 1GTOA 3DGEA 3ZX6A 4H13B 5D5QA 4GX1A 1KP2A 4I55A 1K73W 4F6EA 1SQGA 3J7AU 3QO8A 1K7DA 3A2FA 3O9OA 3HKDA 3K57A 3E35A 2PZSA 1HW7A 1ENVA 1N4CA 2W6IG 1U96A 1FFTB 1MOFA 3CRRA 3P3NA 5IWAO 1ORQC 1YHQV 2BCCH 1JJ2U 1RSOB 3ABKC 4NXNO 4GT1A 4R50A 4X9QA 4J41A 2R72A 1TUBB 1WB7A 1GM9A 1N8RW 2UXDO 4X66B 2EZOA 3N2KB 4RO2A 4P30A 4GUNA 2Q6AA 3CMAV 3C90A 4XDJA 5IJ9B 2A0LA 1WJZA 4NB5A 1FKAO 4UB8Z 2FKXA 2QKCA 4PI2A 4IYHA 1OCOC 1PL0A 3B8NA 3CXHF 4PHZA 4LF6B 5BR8O 2JS3A 3U11A 1UJWB 2ATKC 1NT2B 5C93A 1TAEA 5IY5C 5JCOA 4EB6A 3DXRA 3SYCA 1XMOO 2HLDG 3DTUB 3FB6C 2IJKA 2WLMA 4JI7B 1I5XA 3KG2A 1JQ0A 3RYHA 1QVGU 3VQXA 4O4HA 5GTHZ 2Q9LA 1E1QG 4RUFA 4DR2B 4LF8B 3ETGA 3CRMA 4NR1A 2F4VB 3S3XA 1G8MA 4AQYO 2KG7B 2EIKB 1AR4A 3OM3B 3LSSA 3G4SV 4OX9O 2CTRA 3QO7A 4ZOLB 4K8XA 4QPKA 5EYPB 1D5NA 4BW5A 4K3AA 3JD1A 1SESA 3NR7A 1HNZB 1JMKC 3K59A 3I5DA 4FLUA 3IAYA 3RVYA 3CXCU 3U0ZA 1XNQB 2QM8A 2YXLA 3AG2B 2YS8A 2QKAA 1BGYH 2B9ZA 2ZDIA 4H0LB 2WLLA 4J7JA 1TUEB 4LF4B 2IH3C 4IHJB 5KX5A 4R8CA 3L75H 1OCCC 3M7MX 4PJ0Z 3X2QC 2ADPA 1M90W 3FYIB 3LNMB 4LF7B 4FPPA 5B1BC 1JOYA 1SQPH 2OIEA 3BHPA 4D6TH 1VQ9V 1NU1H 2W6JG 1BL8A 1KBHA 3ZMZA 5ITZA 3KCYA 3E22A 1JX9A 4EFBA 2BTQA 2Y4TA 2P6JA 4ZHQB 4FLWA 3CRCA 3E8FA 4DV3B 1KUQA 4DRXB 1SQBH 2ARHA 1XILA 4JZ2A 3H01A 3D8CA 1X4TA 2UUCB 4E2LA 2V7QG 1AB3A 1JFFB 4JI4B 4LF9B 5LMUO 1N32O 3S3WA 4NTWA 4GX0A 5JQGB 2KKWA 1SA0A 3DC5A 2XNDG 4I4TA 1H8EG 2PYLA 3RYFB 2XAQA 4G28B 3JD0A 4X8AA 3IJ4A 2G38A 2IM9A 3JD4A 5LA6B 4J9ZB 3CC2V 4B3MB 2QJ1A 2Q67A 4JI0O 2B5UA 3CYOA 5H6RA 2ZE5A 3JAWB 4U3JB 1PP9H 2WLIA 2GSMB 3CSXA 5IYZB 5FPOA 2QTOA 2HEPA 5J2TB 4D7SA 1JA8A 3G67A 1GMGA 1D5AA 1OV9A 4LF5O 2UXCB 1R6TA 1QR8A 2Q4PA 2Z5UA 3CE2A 2VWKA 3FAVA 2IU0A 4P2ZA 3JARA 4DYLA 3UQ8A 2WLJA 1WPXA 4DW0A 1XOUA 1PV0A 2EILC 2RMKB 1B04A 2WA4A 3T1HO 1EN6A 5KUMA 2A7WA 1URFA 5H5NA 3CJHA 5F2VO 2ZD9A 5EIBC 4BWAA 4FLYA 1GO3F 4J7KA 5LOVA 1V55C 4JI8B 3JSNA 1HR0O 5KLVH 5LP6A 1V54B 3OUFA 4IL6Z 1K9MW 2OCHA 3K03A 4CH5A 1IURA 1Z5VA 5BXZA 2QA4V 1ZLZA 5LBQA 2UUBB 5E1AC 1TGOA 2GUZA 1J5EO 1FXVA 4YJ3A 1M1KW 2B1GA 1H2MA 3DSQA 1L0NH 2DN9A 4IIJA 5A9GA 3OR6C 4RUEA 3T4ZA 4B3RB 1K4CC 2JJ2G 1HNWO 4ICGA 4KFMA 1NKDA 3JSLA 1N33B 4F4LA 3OEHG 2PTMA 4AI8A 2K1EA 1IVSA 4RWUA 4B7EA 4JI3B 4TSFG 1IBMO 4B3SB 4PDLA 3RYIB 1EZVH 1KQSU 1RPRA 3W7SA 1SKVA 2ZM6O 3FKSG 3P3PA 5GONA 1AJQA 1S5HC 1UFIA 4O4JB 1S72V 2XAJA 4NTYA 3ZRXA 4JI5B 1XNRO 4DR6B 1NR1A 1SQXH 2YSUB 4UCRA 4O4LB 3K5MA 1KKDA 1IXBA 2LO1A 5BZBA 3OR7C 1OCZB 1PM9A 1XL6A 2FL4A 4FMTA 3OTFA 2UUAB 5FNVB 1SERA 4DV1O 3JATB 2CTQA 4TV9A 2Q7EA 4I50B 2Z0AA 3BEHA 1QNMA 5K1XA 4DV6B 1BS3A 3T1YB 1XMQB 2CE4A 1Q6UA 1XBLA 5H6QA 2Q69A 2JIZG 1CXZB 3B4SA 1BQZA 4MSWC 4XBFA 2E5LO 3ZMSA 2Y4UA 2OYQA 1R6NA 2CGNA 1OZ0A 2RJZA 4CH3A 2LFRA 1AR5A 4MW8A 4DR1B 1Q5OA 4DR3B 2QWOB 5EC1C 1FAFA 2UXBB 3CPWU 4JI2B 3L74H 4CH4A 1MG1A 1Z2GA 1R3JC 3TCUA 3L9DA 5BY1A 3TGUH 3CD6V 3UCSC 3JAKB 2OWOA 3N27A 2W0XA 3SDLA 4AILC 4JV5O 4YY3B 4DUYB 5B1OA 2HVJC 1OCRC 4LNUA 3ZIAG 5K1PA 2RCVA 1YI2V 3G6BA 5JWPA 1K4DC 4H33A 4O4IA 3ZHTA 2Q0AA 4E4EA 3FB7C 1TUBA 4JGSA 1VQ5V 2EBOA 4K0KO 1PNKA 2HG5C 3IC7A 3CCQV 3ML0A 4I9WA 1XQ8A 2YEVA 1GKFA 2DE0X 3SPIA 2IBZH 4UCTA 3ZRSA 2XT9A 2XASA 4DUZB 2UU9O 4DO2A 4B08A 4EEQA 3EXAA 4X64O 4AHCA 1HNXB 2AXTZ 3L72H 4DV2O 1JR9A 4PDVA 3UT5A 3GVMA 4I5SA 4IGGA 1M9NA 1GRJA 4WFHA 1G1XB 5EBMC 2QM7A 4LFBB 1P7GA 1THZA 4O2AA 1FFXB 3OGCC 2ZT9B 1EN4A 3ETQA 2EIMC 1VQ4V 3OD4A 5H2FZ 3E8GA 1QQCA 5L3BA 1I0HA 3FB8C 1HP8A 4XDKA 2HVKC 2JGUA 3F5WC 3OMAB 2UXNA 3JALA 4FZ0A 3VBBA 2JS5A 4WFEA 3B2EE 2LW7A 2IU3A 2GTSA 5IJ0B 2BSKB 1SZXA 1CP9A 3HKCB 4JTDB 2KG7A 1H2SB 3BCCH 5J9PC 1RPOA 4IT5A 1F4MA 4JI6O 1BE3H 4GCZA 4ZOLA 1W2BU 3CCRV 1SZTA 3JCZA 1FXKA 2X6AA 4W4LA 3J80N 2UXXA 1I5YA 2DYRC 3OT7A 5GW7A 1YSCA 3JASB 1NTZH 2XOKG 4JI1O 4ZIBA 1Q43A 4NYKA 5HFMA 4KHPO 4PD4F 3QNEA 2CUGA 4Z1MG 2P5OA 5KUKA 1ZL8A 3B8MA 1FXKC 3RWRD 1H2GA 3DC6A 4IHJA 1K5SA 3OTOO 4X1YB 1MNGA 2ZR3A 4UB6Z 4HNAB 5B1AB 2AW9A 5CN0A 1IBKB 4X1IB 2ETNA 3BA9A 1OHHG 3UO3A 3A8TA 4MVUA 4QE7A 4LFCO 4X65B 2ILMA 3SPCA 3OGIB 1PD3A 3SGIA 1SETA 3LDDA 2F95B 4N23A 4Z2WA 2ADQB 1AROP 1O9GA 4DV7B 3AK1A 1MZEA 4O2BB 4BW9A 4DRXA 1N34B 5LGUA 3AG1B 1ZX3A 5B5EZ 2LW1A 4DR4O 2X7RB 1QCEA 4EFEA 2ZXWB 5EZYA 1B3QA 4Z1VA 5LHIA 1OCRB 3OMNB 1JFFA 1R73A 2N05A 2YC0A 3N2GA 1BMFG 3ASOB 2FYUH 2CDYA 4LCUC 4G27B 4JYAB 3WG7C 5CBGA 1M57C 4JASA 4UFZA 3STZC 2R9RB 3B77A 3RYFA 1E1RG 2QWRB 4JAAA 1WLEA 4K35A 4H37A 4X62O 1M56B 2PGGA 3HR0A 3K0GA 4R6ZA 1KC8W 1N36B 1VQNV 5JVDB 5L3CA 4LF4O 1Y76B 4U7OA 1SQQH 4PA3A 2P22C 1YJNV 3JAWA 1YCIA 4ZBMA 3ZN1A 4YHHB 2NN4A 2RNBA 5IYZA 2VQEB 2R9IA 3M99B 4CH6A 3CCUV 2EIMB 1WP7A 5BMVB 1XHXA 2K9PA 3BA8A 5LXTB 3FX7A 2YIAA 3C3TA 3OUSA 3O65A 3CP1A 4DR7O 1IX9A 1YIJV 3ABTA 4GKJO 3ZCCA 2F43G 2C2AA 2CH7B 4TQFA 2PI5A 4LFAO 3LDEA 1NQTA 4GLXA 2JRIA 1Q7YW 3SR2C 1Y74B 5A2QN 5JCOC 1BZKA 3L71H 1IBLB 1MA1A 5CA0B 3E89A 4UCOA 4NVPA 3ZRWB 3AG4B 2MK3A 5FLXN 1G6UA 5IT9N 1MZFA 3VOUA 4TV8A 2VQFO 2DYRB 4Q20A 5IWAB 1GM8A 5CMUA 2F1MA 4NXNB 2Q8VA 4J42A 3KCXA 1TA8A 2WLKA 3GB7C 1DLBA 3QO5A 1YVWA 2YICA 1ZAUA 1AVMA 3I55V 3BRCA 4DK0A 2BE3A 2O57A 1HWYA 4LH7A 2UXDB 4CC5A 5KAIZ 2E3CA 3IGAC 5L3FA 4DV5O 4MT8A 1QR9A 1NBMG 5EC2C 3KKYA 2ZDIC 5LGNA 2ZKOA 2WA3A 4HBNA 3RYIA 5BR8B 4MTFA 3ETDA 1DGSA 4WFFA 1AR1B 2GV9A 2Y69C 3ABKB 1VF6A 2QGNA 4O4JA 5CBHA 3BY6A 2YIBD 1XMOB 4QPJA 1P7BA 2JJ1G 3QF7A 3HKDB 3CCVV 3OEEG 5C8YB 3K06A 4QGPA 4FFBB 1Q3EA 3PJSK 3RW0A 2EZPA 1NTMH 1NTKH 1VF6C 2CK3G 1H38A 4BIZA 1XREA 3ZHVA 4AQYB 1FJGO 2WAMA 4I50A 3JCUZ 4JF3A 1KB9F 1I94O 3ABUA 2WLNA 4WBNA 2Q7HA 3T2MA 3SPJA 1OCOB 1EM1A 4OX9B 3RYCB 3CCMV 1QU7A 5EBWC 2XAGA 4MW3A 4BR6A
chains in the Genus database with same CATH topology
1YJ9V 2P7TC 1XL6A 3LDCA 4FMTA 4UVCA 3SYPA 3ZMTA 5IY5B 1SERA 3SPGA 3D3IA 4JYCA 2D3OW 4X88A 3AG4C 2QKSA 1RM1B 3EHBB 3ZRVA 4J9YB 3AEIA 2B1IA 4BAYA 1NH2B 3BEHA 3ABLC 1YITV 1E79G 3SJQC 1LNQA 3SYOA 1AI6A 1AJNA 5L3EA 4ASUG 2HR3A 1R3IC 1R3LC 2KB1A 5B3SB 1CPYA 5H6QA 2Q69A 3JD3A 1KD1W 2JIZG 3MD0A 2HJFC 4MSWC 4XBFA 4QIWF 3ZMSA 3W7UA 4KUMA 1R6NA 1KECA 1OZ0A 1K8AW 1EBOA 2AHZA 2LFRA 4MW8A 2NNUA 4RQEA 5EC1C 4DXWA 3CPWU 2DWEC 4MVSA 4WFGA 1DF4A 3MHHC 3CC4V 1MG1A 3LUTB 2BOCC 3ABMB 4HZ3A 1AI5A 1FXKB 1R3JC 3TCUA 2DYSB 3CD6V 1GTOA 3DGEA 5IYBO 1V54C 5B1OA 2HVJC 1OCRC 3ZIAG 2EINB 4GX1A 1YI2V 1K5QA 1KP2A 1K73W 1K4DC 4H33A 1QVFU 3FB7C 4ZKIA 4JGSA 5IDJA 1VQ5V 1S3JA 3HPLC 1K7DA 2EBOA 3QO8A 4HYOA 1PNKA 3CCSV 2HG5C 3IC7A 1EZJA 3E35A 3CCQV 3W7WA 3ML0A 2EIJC 4I9WA 2YEVA 1ENVA 4MVOA 1GKFA 2W6IG 3SPIA 1FFTB 1MOFA 5LHHA 3ZRSA 1AI4A 1ORQC 1YHQV 1JJ2U 4QJFB 1YTFB 3ABKC 3STLC 2XASA 2P90A 4DO2A 2JEUA 4GT1A 1AI7A 1K97A 4L87A 4R50A 1OCCB 1VQ6V 3X2QB 1VQ8V 2OTLV 1QLEC 3GWOA 5B1BB 4PDVA 4FIPC 1NR7A 4I5SA 2NLJC 1M9NA 4WFHA 5EBMC 2QM7A 2IJHA 4P9OA 1THZA 4MVRA 2WLLB 1GM9A 3K3WA 3OGCC 3AG3C 2EIMC 1N8RW 2DW4A 1W0JG 2EZOA 4LBEC 2OCCB 3K0DA 1VQ4V 4RO2A 4P30A 3K04A 2Q6AA 3CMAV 1ROPA 3WG7B 3E8GA 5CA3A 1M57B 4XDJA 2A0LA 3RVZA 5L3BA 2JEXA 3FB8C 4EKWA 2Y69B 1PNMA 4XDKA 1OCOC 1BHBA 1PL0A 2HVKC 3B8NA 4WFBV 5IYCO 3F5WC 1IXMA 3OMAB 2UXNA 4P9PA 2IJIA 3VBBA 4WFEA 1UJWB 2ATKC 2DWDC 2IU3A 1JVMA 5KA5A 1OCZC 5C93A 3JD2A 1CP9A 1ZWIC 4JTDB 5IY5C 4R7CA 3G71V 2X6BA 3SYCA 3JYCA 1DTOA 5J9PC 2HLDG 3DTUB 1VQPV 3FB6C 1RPOA 1F4MA 2IJKA 2WLMA 1I5XA 3KG2A 4GCZA 1JQ0A 4UV8A 3SYAA 4KP4A 3OFNG 1QVGU 1W2BU 2X6CA 2GHYA 3CCRV 1SZTA 1VQKV 3JCZA 1FXKA 2X6AA 4N21A 1F4NA 2UXXA 1E1QG 1I5YA 4RUFA 3ETEA 2DYRC 4FK5C 2IJJA 3ETGA 5GW7A 1YSCA 3A0RA 1G8MA 2XOKG 4QNHB 4PA9A 4PA7A 1QBZA 4LC1A 2P67A 2EIKB 1CEZA 5HFMA 3OM3B 3QNEA 3LSSA 3G4SV 1FXHA 5L3GA 4Z1MG 4HAMA 5KUKA 3B8MA 4PDRA 1FXKC 1H2GA 3QO7A 4MTXA 1K5SA 1R3KC 3ABLB 4QPKA 1YJWV 3T1CA 2ZR3A 1K34A 2LFSA 4BW5A 3ZMUA 2X0LA 4UVBA 5B1AB 4GX2A 3JD1A 1SESA 5CN0A 2WLIB 1OHHG 4MVUA 4QE7A 1JPXA 1J95A 3RVYA 1K92A 4PA6A 3CXCU 3SPCA 2QM8A 5KA6A 3AG2B 1PD3A 5H9CA 1SETA 3RBZA 4MVMA 3LDDA 2ZDIA 2EILB 3P30A 1S0VA 4N23A 2WLLA 1TUEB 1AROP 4PELA 1PNLA 2IH3C 2DQ0A 1L1FA 1R6KA 2ITCC 1H8HG 4RQFA 4R8CA 4JTAB 5LGUA 3AG1B 1OCCC 1VQ7V 3X2QC 1M90W 4WF9V 2X7RB 3FYIB 3LNMB 1QCEA 5EK0A 1JCHA 4FPPA 5B1BC 1Y4MA 1JOYA 2ZXWB 1G4YB 2WPDG 4G2KA 4JAVA 1VQ9V 1V55B 5LHIA 3IFXA 2W6JG 1SRYA 1BL8A 1OCRB 2V1DA 3OMNB 3ZMZA 1R73A 4WCEV 1JX9A 1BMFG 3ASOB 2P6JA 2WLHA 2PI4A 5CBFA 4LCUC 3SPHA 4G27B 1VQLV 3E8FA 3WG7C 5CBGA 1M57C 3UM7A 4JASA 3FYEB 3STZC 2R9RB 3B77A 1E1RG 3H01A 4QE9A 3W7XA 1GM7A 1NJIW 1WLEA 2ITDC 4H37A 1M56B 3K0GA 2HFEC 3ASNC 3K79A 4E2LA 4R6ZA 2BOBC 1KC8W 1VQNV 4BIUA 3D36A 2V7QG 5L3CA 1BHAA 4JTCB 3I56V 2QEXV 4TT3G 4U7OA 1P4RA 4UUJC 2A79B 4GX0A 4PA3A 3K9AA 1QLNA 1YJNV 2Y48A 5DM6V 4ZBMA 3ZN1A 3E8BA 4PA4A 1NVPB 1F23A 2R9IA 3M99B 3CCUV 2XNDG 1NH2D 2EIMB 4XDLA 3K08A 1H8EG 4PDMA 1XL4A 2XAQA 1RM1C 2JK5C 4G28B 3JD0A 4X8AA 5B1NA 1Y66A 3OUSA 3TK1A 4TWKA 3JD4A 3CC2V 3ZJZA 3CP1A 4J9ZB 3ZRWA 2A9HA 1YIJV 2Q67A 3OE7G 3ABTA 5DN6G 1AJPA 3ZCCA 1W0KG 2F43G 5B3SC 2B5UA 4JPRA 2C2AA 3CYOA 5L3DA 2PI5A 3LDEA 4RAIA 5H6RA 1NQTA 5IYDO 3CC7V 1Q7YW 2WLIA 4UV9A 2GSMB 2EIKC 3HB3B 2QTOA 2JDIG 3E89A 2FTKA 2Q68A 1S77D 3MHSC 1GMGA 2M7WA 2QE7G 3P32A 3SYQA 4UXNA 3ZRWB 3ABMC 1QR8A 2XAHA 3AG4B 4U7NA 2MK3A 2Z5UA 2DYSC 5B1AC 4JYBA 3E2EA 2IU0A 3CMEV 3VOUA 5LGTA 4JAUA 4P2ZA 5FL7G 2EINC 2DYRB 4Q20A 2W0FC 2WLJA 1K33A 1WPXA 3AG2C 1GM8A 3E86A 5CMUA 1Q81W 1PKXA 2EILC 4MS2A 3CCLV 1YTFD 2WLKA 5KUMA 1FS0G 3E83A 4UVAA 3GB7C 1DLBA 1DF5A 3E8HA 3EFFK 3QO5A 3AG1C 3F7VC 2H94A 2ZD9A 3I55V 2WWWA 3F7YC 2ZR2A 2ZXWC 1GO3F 3TETA 1HWYA 1V55C 4MVQA 2ZQMA 3IGAC 5L3FA 4CZZA 3R65A 4MT8A 3T4DA 1QR9A 1NBMG 1V54B 2WSSG 3OUFA 5EC2C 1K9MW 3ASOC 3CCJV 1VQMV 3K03A 2ZDIC 2QA4V 5LGNA 2XAFA 1Q82W 5LBQA 5E1AC 4LP8A 3OW2U 1FXVA 1B6QA 3NXSA 1M1KW 4OXSA 2B1GA 4MTFA 2OTJV 2IW5A 2OCCC 3ETDA 4GX5A 3UKMA 2EIJB 3G6EV 1M56C 4WFFA 3OR6C 5EBLC 1EFRG 1AR1B 4RUEA 3FB5C 3T4ZA 2Y69C 3ABKB 1K4CC 2JJ2G 1MABG 5CBHA 2HKOA 1MSWD 4KFMA 3BY6A 1NKDA 1NVPD 4QPJA 4F4LA 1P7BA 3OEHG 3W7TA 2DQ3A 2JJ1G 2Z3YA 5HFLA 1QLEB 2K1EA 3CCVV 2IH1C 3OEEG 4TSFG 2YEVB 3K06A 2OT5A 4PDLA 3PJSK 3RW0A 2EZPA 3WFVA 4WFAV 1KP3A 1KQSU 1RPRA 3OMIB 3W7SA 3AG3B 1COWG 2CK3G 3FKSG 3OAAG 1Q86W 1H38A 1VQOV 4BIZA 4CBCA 5LHGA 1AJQA 3CCEV 2WAMA 1S5HC 4YXWG 4JF3A 2LP7A 2H8PC 1S72V 2XAJA 2AHYA 3ABUA 3ASNB 1F51A 2WLNA 3T2MA 4MVZA 1GK9A 1K3EA 2EJRA 3LSQA 3SPJA 3ZRXA 3ZMVA 1OCOB 4MTOA 4X89A 1NR1A 3CCMV 2YSUB 5EBWC 3ZN0A 1KKDA 2XAGA 1S76D 4FJCC 4MTGA 4MW3A 5BZBA 3OR7C 1OCZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIN C;  4P30 A;  4RO2 A;  3K04 A;  2Q6A A;  2P7T C;  2W0F C;  3LNM B;  5EK0 A;  3E8G A;  2WLJ A;  3AG2 C;  3E86 A;  5B1B C;  4XDJ A;  1XL6 A;  3LDC A;  3SYP A;  2A0L A;  1G4Y B;  3RVZ A;  3IFX A;  3FB8 C;  4LBE C;  3SPG A;  1BL8 A;  4EKW A;  4XDK A;  4X88 A;  2EIL C;  3AG4 C;  4MS2 A;  2QKS A;  1OCO C;  2HVK C;  4J9Y B;  2WLK A;  3F5W C;  3BEH A;  5KUM A;  3ABL C;  4P9P A;  3E83 A;  4WFE A;  2ATK C;  3GB7 C;  3SJQ C;  1LNQ A;  3EFF K;  2DWD C;  3E8H A;  3SYO A;  1JVM A;  3AG1 C;  3F7V C;  2WLH A;  5CBF A;  2ZD9 A;  4LCU C;  3SPH A;  3F7Y C;  1OCZ C;  1R3I C;  1R3L C;  2KB1 A;  4G27 B;  2Q69 A;  3E8F A;  3WG7 C;  5CBG A;  1ZWI C;  1M57 C;  3UM7 A;  2HJF C;  4JTD B;  5IY5 C;  2ZXW C;  4MSW C;  4R7C A;  3TET A;  3STZ C;  1V55 C;  2R9R B;  4QE9 A;  2X6B A;  4MVQ A;  3SYC A;  2ITD C;  3JYC A;  5J9P C;  3IGA C;  4H37 A;  2AHZ A;  2HFE C;  3FB6 C;  3ASN C;  3K0G A;  3R65 A;  4MW8 A;  2BOB C;  3OUF A;  2WLM A;  4R6Z A;  3T4D A;  5EC2 C;  3ASO C;  3KG2 A;  5EC1 C;  3SYA A;  3K03 A;  4DXW A;  4JTC B;  2DWE C;  2X6C A;  4MVS A;  4WFG A;  4UUJ C;  5E1A C;  2A79 B;  4GX0 A;  4LP8 A;  4PA3 A;  3LUT B;  2BOC C;  2X6A A;  4OXS A;  4MTF A;  4HZ3 A;  1R3J C;  2OCC C;  3TCU A;  4GX5 A;  4RUF A;  4ZBM A;  2DYR C;  3E8B A;  4PA4 A;  3UKM A;  1M56 C;  4QNH B;  4PA9 A;  4WFF A;  4PA7 A;  3OR6 C;  4XDL A;  1V54 C;  5EBL C;  2HVJ C;  3K08 A;  1OCR C;  3FB5 C;  4PDM A;  2Y69 C;  4RUE A;  3T4Z A;  1XL4 A;  1K4C C;  5CBH A;  4GX1 A;  2JK5 C;  4G28 B;  1K4D C;  4H33 A;  4KFM A;  3OUS A;  4X8A A;  4TWK A;  3FB7 C;  3ZJZ A;  4J9Z B;  4F4L A;  1P7B A;  2A9H A;  3HPL C;  4HYO A;  2Q67 A;  5KUK A;  2HG5 C;  2K1E A;  4PDR A;  4I9W A;  2EIJ C;  2YEV A;  5B3S C;  2IH1 C;  4MVO A;  1R3K C;  3K06 A;  3T1C A;  3SPI A;  4PDL A;  3LDE A;  3PJS K;  4RAI A;  3ZRS A;  4BW5 A;  3RW0 A;  1ORQ C;  2WLI A;  3ABK C;  4GX2 A;  3STL C;  2EIK C;  2WLI B;  2QTO A;  4MVU A;  4QE7 A;  4R50 A;  3X2Q C;  4P2Z A;  1J95 A;  3E89 A;  4PA6 A;  3RVY A;  4CBC A;  2Q68 A;  3SPC A;  1QLE C;  1S5H C;  4PDV A;  2H8P C;  5BZB A;  2AHY A;  2NLJ C;  2WLN A;  3SYQ A;  3RBZ A;  4MVM A;  3T2M A;  3ABM C;  3LDD A;  4MVZ A;  4WFH A;  3SPJ A;  5EBM C;  4MTO A;  2WLL A;  2DYS C;  4P9O A;  4MVR A;  4X89 A;  5B1A C;  2WLL B;  3OGC C;  2IH3 C;  3AG3 C;  2ITC C;  2EIM C;  4R8C A;  5EBW C;  4JTA B;  3VOU A;  1KKD A;  1OCC C;  4MTG A;  4MW3 A;  3K0D A;  3OR7 C; 
#chains in the Genus database with same CATH topology
 2JGD A;  2M6Y A;  1SC5 B;  1P84 F;  5IY5 B;  5CB4 B;  3D3I A;  2D3O W;  4X88 A;  2QKS A;  3ZRV A;  4J9Y B;  3ABL C;  1YIT V;  1SQV H;  1E79 G;  3SJQ C;  1LNQ A;  4ABM A;  2HHH B;  2HR3 A;  3JAK A;  1P49 A;  1R3L C;  1CPY A;  2PF4 E;  1KD1 W;  2HJF C;  2ZIO A;  4EB6 B;  1BQ0 A;  3DXR B;  5KMG B;  3HKE B;  2JVD A;  4JI5 O;  1IZ3 A;  2QDO A;  3RYH B;  4MVS A;  4WFG A;  1DF4 A;  5D5P A;  2KQX A;  3F5T A;  1XEQ A;  1M4U A;  1TVK B;  2FML A;  5IYB O;  3H1I H;  1MSD A;  1VF7 A;  2P4V A;  4LWS B;  4DW1 A;  5LYJ A;  4DR5 O;  1O9H A;  4ZKI A;  5IDJ A;  1S3J A;  3HPL C;  1I7F A;  3CCS V;  1EZJ A;  3W7W A;  1FFX A;  2EIJ C;  5LMU B;  1GN3 A;  1N32 B;  5LMN O;  3LSU A;  3QVN A;  4QJF B;  5DEC A;  3STL C;  2P90 A;  4NXM O;  2JEU A;  4DR1 O;  5LP6 C;  1OCC B;  3X2Q B;  2OTL V;  2GBO A;  1Y6X A;  1QLE C;  5B1B B;  3GWO A;  4TUY B;  1NR7 A;  4W4K A;  2NLJ C;  3WB0 A;  5CA1 B;  2IJH A;  3CB2 A;  5IJ0 A;  2WLL B;  3HKC A;  4JI0 B;  3AG3 C;  5KX5 B;  2DW4 A;  4OGQ B;  3LNN A;  4FLZ A;  2F66 C;  1FPO A;  3K0D A;  3K04 A;  5J2U B;  4PV1 B;  2ZCE A;  3RVZ A;  4EKW A;  2Y69 B;  4J80 A;  1PNM A;  1SS3 A;  1BHB A;  4WFB V;  4LF5 B;  1BT8 A;  5ITZ B;  3Q4H A;  3JAM N;  2BTQ B;  1X59 A;  2DWD C;  1AIL A;  3MDS A;  4R7C A;  5KHI A;  3G71 V;  2X6B A;  1DTO A;  2CAZ C;  3AK3 A;  3U10 A;  1I08 A;  4KP4 A;  3SJA C;  2X6C A;  1KMI Z;  5E79 Z;  1VP7 A;  1VQK V;  4X1Y A;  3T1H B;  4DV4 B;  1BSM A;  4N21 A;  1SA0 B;  2IJJ A;  3A0R A;  3H1H H;  4QNH B;  4PA7 A;  4I4T B;  1QBZ A;  4B3T O;  1CEZ A;  3WB2 A;  1HR0 B;  3GWK C;  1H2L A;  1FXH A;  5L3G A;  2QSA A;  3UO2 A;  4L8J A;  3M8A A;  1Q8I A;  4TOI A;  3ABL B;  1M93 A;  3ZS8 C;  1K34 A;  2N74 A;  2LFS A;  1J5E B;  1RSO A;  4NKG B;  2L35 A;  3VQV A;  2X0L A;  4UCS A;  4GX2 A;  4GKK B;  2WLI B;  2ZE7 A;  1WA8 B;  1Y67 A;  1XUQ A;  3CS5 A;  3AK2 A;  1HNW B;  3FD9 A;  3RBZ A;  4MVM A;  1NZ6 A;  2EIL B;  2QWQ B;  1S0V A;  2ZIM A;  4PEL A;  2DQ0 A;  1R6K A;  1H8H G;  3N2K A;  4X1K B;  4YJ2 B;  1VQ7 V;  2CTW A;  5IJ9 A;  4FLX A;  1Y4M A;  1G4Y B;  2ZM6 B;  4JAV A;  1V55 B;  3IFX A;  1Y76 A;  4J10 A;  4DV0 O;  2WLH A;  3SPH A;  3CJH B;  4X65 O;  5BMV A;  1B06 A;  5LXT A;  3W7X A;  5LOV B;  1GM7 A;  1YZB A;  1OJH A;  3B09 A;  3RGB A;  3VQY A;  3H1K H;  1KU9 A;  4DV1 B;  3D36 A;  1BHA A;  3I56 V;  2QEX V;  1AP6 A;  2A79 B;  3K9A A;  3QTC A;  2GUZ B;  2Y48 A;  5DM6 V;  4PA4 A;  1F23 A;  4IIJ B;  4U3F H;  4XDL A;  4FM2 A;  2QR4 A;  3K08 A;  4PDM A;  1XL4 A;  3L70 H;  1RM1 C;  2JK5 C;  3D36 C;  5B1N A;  2D2C B;  1Y66 A;  4TWK A;  3ZRW A;  3IC9 A;  2A9H A;  3OE7 G;  5DN6 G;  1BCC H;  1W0K G;  5EYP A;  4JPR A;  4X66 O;  4F6R B;  3CC7 V;  2EIK C;  2YI9 A;  5JJN B;  3ZED A;  4YIP A;  2YDE A;  3TXS A;  4JV5 B;  4H44 B;  3MHS C;  2ZNI A;  2M7W A;  4LF6 O;  3P32 A;  1V9P A;  4ZI7 B;  3SYQ A;  3ABM C;  1R1B A;  4K0K B;  3CEI A;  4JYB A;  1VAR A;  2V4D A;  5FL7 G;  2EIN C;  2L6L A;  3AG2 C;  4LH6 A;  1Q81 W;  2UU9 B;  4JI7 O;  1A32 A;  1M5I A;  4X64 B;  4MS2 A;  4LR3 A;  1EN5 A;  4DV2 B;  4TV9 B;  2RQ6 A;  1FS0 G;  3E83 A;  4ZHQ A;  1DF5 A;  3EFF K;  4DR2 O;  4LF8 O;  2F4V O;  2H94 A;  2FB5 A;  3F7Y C;  3H1J H;  2RN9 A;  1NS1 A;  4TQD A;  2ZQM A;  3KZI Z;  2ZNJ A;  4CZZ A;  3R65 A;  3T4D A;  4X20 B;  3CCJ V;  1VQM V;  2XAF A;  1Q82 W;  5C8Y A;  4FFB A;  2PY5 A;  5JQG A;  4LP8 A;  4CS2 A;  3OW2 U;  1B6Q A;  3B40 A;  1S5J A;  3NXS A;  2OTJ V;  4OXS A;  1HNZ O;  2OCC C;  1WNS A;  2LJ2 A;  3J81 N;  2KSD A;  1XNQ O;  4DK1 A;  3CRA A;  4LNU B;  2XTA A;  2HKO A;  1H2N A;  1WN7 A;  5LA6 A;  1NVP D;  1YF2 A;  4O4I B;  2NR5 A;  2AZ0 A;  4JI6 B;  3RYC A;  3THO A;  2YEV B;  1HDJ A;  1XHZ A;  4U3J A;  3WFV A;  4WFA V;  4LF7 O;  3ZHQ A;  2H3O A;  3OMI B;  2PYJ A;  1COW G;  1KKC A;  5J2T A;  5CB4 A;  4CBC A;  4JI1 B;  2RDC A;  3CCE V;  3CRQ A;  4YXW G;  2LP7 A;  2H8P C;  3TJT A;  2AHY A;  2Q0O C;  1F51 A;  4KHP B;  3UT5 B;  4J7Z A;  4MVZ A;  1K3E A;  1IDS A;  2EJR A;  2AZ2 A;  4DV3 O;  4O2A B;  2QM4 A;  3OTO B;  3ZN0 A;  4CS3 A;  4FJC C;  2ZE6 A;  3K9S A;  4KXR A;  1YJ9 V;  2UUC O;  5KMG A;  1L8D A;  3HKE A;  2Q7G A;  4UVC A;  1ZUQ A;  3ZMT A;  4LFC B;  3SPG A;  3K5L A;  4JYC A;  4JI4 O;  4LF9 O;  3K5O A;  1Q90 D;  1RM1 B;  2B1I A;  1XDC A;  4BAY A;  1NH2 B;  3L73 H;  2MW2 B;  1RP3 B;  3JAL B;  5KHH A;  3K5N A;  1TVK A;  1AJN A;  1AI6 A;  4ASU G;  3HKB B;  1R3I C;  2KB1 A;  3JD3 A;  5JH7 B;  2Y0P A;  4CS4 A;  4PI0 A;  3MD0 A;  4LWS A;  3W7U A;  1KYO F;  4DR4 B;  2ZIN A;  4B3M O;  1EBO A;  2NNU A;  4RQE A;  3APO A;  1DK1 A;  3ZHS A;  5EIB D;  3G80 A;  3MHH C;  1FD9 A;  3LUT B;  3ABM B;  3PN1 A;  4HZ3 A;  1AI5 A;  1ZTE A;  1FXK B;  2EX3 A;  3D3Q A;  4I0X B;  4GYC B;  2HP8 A;  2ZE8 A;  1S5L Z;  4FZ1 A;  1V54 C;  4A5U B;  2EIN B;  4TUY A;  2UXC O;  1K5Q A;  2Q5Z A;  5CA1 A;  1QVF U;  4X62 B;  5LL6 Y;  3BAA A;  4HYO A;  2HHH O;  2Q73 A;  1ZL8 B;  5IE9 A;  2E76 B;  4MVO A;  2CGO A;  4B7K A;  1YEW A;  1AI4 A;  1MMM A;  3WU2 Z;  1YTF B;  5J2U A;  4C7U A;  1XI1 A;  3QG5 A;  1AI7 A;  1K97 A;  4L87 A;  3EVK A;  1VQ6 V;  1VQ8 V;  4I9Q A;  2P06 A;  4FIP C;  4I55 B;  2QTS A;  2P4K A;  4DR7 B;  1N0N A;  4P9O A;  4MVR A;  1VIB A;  4GKJ B;  3K3W A;  4O4L A;  4OPA A;  2R70 A;  4JI8 O;  1W0J G;  4LBE C;  4LFA B;  2OCC B;  1ROP A;  3WG7 B;  5CA3 A;  1YXB A;  1M57 B;  5FNV A;  3JAT A;  5EZY B;  2JEX A;  2UUB O;  5IYC O;  1IXM A;  4P9P A;  2IJI A;  3N2G B;  1GN4 A;  1PL4 A;  1JVM A;  5KA5 A;  1OCZ C;  2GDS A;  3JD2 A;  1ZWI C;  4YIO A;  1VEW A;  4B3R O;  3JYC A;  2VQF B;  1N33 O;  1VQP V;  1VF5 B;  4UV8 A;  3SYA A;  3OFN G;  4JI3 O;  2GHY A;  3CX5 F;  4B3S O;  1F4N A;  3BFR A;  4UCV A;  1VMG A;  3ETE A;  4FK5 C;  4FM1 A;  4IYI A;  1WA8 A;  4PA9 A;  1SQF A;  4UCU A;  4LC1 A;  1PPJ H;  2P67 A;  4GZR B;  1Q6I A;  4DV5 B;  3A0H Z;  4HAM A;  2CTP A;  4DR6 O;  1W59 A;  4PDR A;  1H2K A;  4MTX A;  1AP5 A;  4NTX A;  1R3K C;  2AGA A;  4O4H B;  1YJW V;  3T1C A;  3VQW A;  4X1K A;  4YJ2 A;  1RFY A;  3ZMU A;  2EJ7 A;  4UVB A;  2XUM A;  2XHB A;  2VWJ A;  2UUA O;  1JPX A;  1J95 A;  1K92 A;  4PA6 A;  5KA6 A;  3T1Y O;  4DV6 O;  1XMQ O;  3H1L H;  4DV4 O;  5H9C A;  3P30 A;  4JYY A;  3ZBH A;  1GN2 A;  1PNL A;  5AG2 A;  1Q6H A;  2DJV A;  1L1F A;  2ITC C;  4RQF A;  2E75 B;  4JTA B;  2YXH A;  4WF9 V;  4TV8 B;  5EK0 A;  1JCH A;  5KAF Z;  2WPD G;  4G2K A;  4DR3 O;  2LGW A;  2UXB O;  1SRY A;  2V1D A;  4JI2 O;  1LUW A;  1FJG B;  4WCE V;  4FM0 A;  1I94 B;  2PI4 A;  4GKK O;  2BSK A;  5CBF A;  2YIB A;  1VQL V;  4YY3 O;  4DUY O;  1UPG A;  3UM7 A;  4CC6 A;  3FYE B;  2A3Q A;  4JZG A;  4QE9 A;  3ZHU A;  1NJI W;  2ITD C;  4FLV A;  4FVM A;  2N04 A;  2HFE C;  3ASN C;  3K79 A;  2BOB C;  5TIS Z;  4BIO A;  2HJD A;  4BIU A;  5DED A;  4JTC B;  4TT3 G;  1WAZ A;  1P4R A;  4UUJ C;  3E22 B;  1GAX A;  1QLN A;  4F6R A;  4DUZ O;  3H9V A;  2YI8 A;  3E8B A;  3JAS A;  5B66 Z;  1NVP B;  2YID A;  2F23 A;  2QWP B;  2BTO A;  1HNX O;  1NH2 D;  2LQT A;  4ZI7 A;  1NI8 A;  3TK1 A;  1T5E A;  3ZJZ A;  4LFB O;  1AJP A;  3RN4 A;  5B3S C;  5KHJ A;  5L3D A;  4HNA A;  2GTA A;  4RAI A;  5IYD O;  3A0B Z;  4X1I A;  4UV9 A;  3CHX A;  3HB3 B;  2JDI G;  1US6 A;  2FTK A;  2Q68 A;  1S77 D;  2Y0I A;  2QE7 G;  1L0L H;  3ICX A;  4DR5 B;  4UXN A;  5KHK A;  4WBN B;  2XAH A;  4U7N A;  3ZHR A;  2DYS C;  1N0J A;  5B1A C;  4O2B A;  3SJC C;  5KHG A;  3E2E A;  3CME V;  5LGT A;  1YDX A;  4JAU A;  2YXY A;  5LMN B;  1GH6 A;  2W0F C;  2E74 B;  1WP8 A;  1K33 A;  2JGD B;  3E86 A;  1U97 A;  4J11 A;  4X20 A;  3BPZ A;  4NXM B;  1PKX A;  3CCL V;  1YTF D;  5GTI Z;  1ZSP A;  4UVA A;  1SF9 A;  3E8H A;  3AG1 C;  3F7V C;  4D7T A;  2WWW A;  3BAB A;  3FAV B;  2OIG A;  1GN6 A;  2ZR2 A;  2ZXW C;  3AG7 A;  2YUA A;  3TET A;  1IBM B;  4KL1 A;  3RFR A;  3TXQ A;  3JAR B;  4MVQ A;  3MAQ A;  1F7Y A;  5JVD A;  2WSS G;  3ASO C;  3WB1 A;  2VS0 A;  2QWN B;  2VRZ A;  4FLT A;  2PUS A;  3APQ A;  2IW5 A;  1IBK O;  4GX5 A;  3UKM A;  2EIJ B;  3G6E V;  4K8Z A;  1XNR B;  2A06 H;  1M56 C;  1JJO A;  3K58 A;  5EBL C;  1EFR G;  3FB5 C;  1WPB A;  5LYJ B;  1MAB G;  3CWB H;  3RT3 C;  1MSW D;  5LP6 B;  3W7T A;  2R9A A;  2DQ3 A;  5HFL A;  2Z3Y A;  4DV7 O;  1QLE B;  1LUV A;  2CH7 A;  2IH1 C;  1N34 O;  2OT5 A;  4YJ3 B;  1Y74 A;  1KP3 A;  1QHT A;  3AG3 B;  1D2D A;  3OAA G;  1Q86 W;  1VQO V;  5CA0 A;  2E5L B;  5LHG A;  3C3S A;  4B3T B;  3BVO A;  3ASN B;  4Q6G A;  2DMX A;  3R66 A;  4FFK A;  1GK9 A;  3LSQ A;  1WB8 A;  3ZMV A;  3HKB A;  4JYA O;  4MTO A;  2F93 B;  4X89 A;  5JH7 A;  2ODM A;  5JJJ B;  1S76 D;  4MTG A;  5LHH A;  3SJB C;  2P7T C;  1FYJ A;  5FPR A;  3LDC A;  3SYP A;  1N36 O;  2DOS A;  3AG4 C;  5GON B;  3EHB B;  3AEI A;  4I0X A;  3Q4H B;  4YHH O;  3SYO A;  5L3E A;  2VQE O;  5B3S B;  2EUL A;  4QIW F;  1Z5W A;  3FFQ A;  4KUM A;  5JJE B;  1KEC A;  4I7Z B;  1K8A W;  2AHZ A;  1LR1 A;  4DXW A;  2LGQ A;  2DWE C;  3CC4 V;  2BOC C;  4OPH A;  4DV0 B;  2DYS B;  1IBL O;  1GTO A;  3DGE A;  3ZX6 A;  4H13 B;  5D5Q A;  4GX1 A;  1KP2 A;  4I55 A;  1K73 W;  4F6E A;  1SQG A;  3J7A U;  3QO8 A;  1K7D A;  3A2F A;  3O9O A;  3HKD A;  3K57 A;  3E35 A;  2PZS A;  1HW7 A;  1ENV A;  1N4C A;  2W6I G;  1U96 A;  1FFT B;  1MOF A;  3CRR A;  3P3N A;  5IWA O;  1ORQ C;  1YHQ V;  2BCC H;  1JJ2 U;  1RSO B;  3ABK C;  4NXN O;  4GT1 A;  4R50 A;  4X9Q A;  4J41 A;  2R72 A;  1TUB B;  1WB7 A;  1GM9 A;  1N8R W;  2UXD O;  4X66 B;  2EZO A;  3N2K B;  4RO2 A;  4P30 A;  4GUN A;  2Q6A A;  3CMA V;  3C90 A;  4XDJ A;  5IJ9 B;  2A0L A;  1WJZ A;  4NB5 A;  1FKA O;  4UB8 Z;  2FKX A;  2QKC A;  4PI2 A;  4IYH A;  1OCO C;  1PL0 A;  3B8N A;  3CXH F;  4PHZ A;  4LF6 B;  5BR8 O;  2JS3 A;  3U11 A;  1UJW B;  2ATK C;  1NT2 B;  5C93 A;  1TAE A;  5IY5 C;  5JCO A;  4EB6 A;  3DXR A;  3SYC A;  1XMO O;  2HLD G;  3DTU B;  3FB6 C;  2IJK A;  2WLM A;  4JI7 B;  1I5X A;  3KG2 A;  1JQ0 A;  3RYH A;  1QVG U;  3VQX A;  4O4H A;  5GTH Z;  2Q9L A;  1E1Q G;  4RUF A;  4DR2 B;  4LF8 B;  3ETG A;  3CRM A;  4NR1 A;  2F4V B;  3S3X A;  1G8M A;  4AQY O;  2KG7 B;  2EIK B;  1AR4 A;  3OM3 B;  3LSS A;  3G4S V;  4OX9 O;  2CTR A;  3QO7 A;  4ZOL B;  4K8X A;  4QPK A;  5EYP B;  1D5N A;  4BW5 A;  4K3A A;  3JD1 A;  1SES A;  3NR7 A;  1HNZ B;  1JMK C;  3K59 A;  3I5D A;  4FLU A;  3IAY A;  3RVY A;  3CXC U;  3U0Z A;  1XNQ B;  2QM8 A;  2YXL A;  3AG2 B;  2YS8 A;  2QKA A;  1BGY H;  2B9Z A;  2ZDI A;  4H0L B;  2WLL A;  4J7J A;  1TUE B;  4LF4 B;  2IH3 C;  4IHJ B;  5KX5 A;  4R8C A;  3L75 H;  1OCC C;  3M7M X;  4PJ0 Z;  3X2Q C;  2ADP A;  1M90 W;  3FYI B;  3LNM B;  4LF7 B;  4FPP A;  5B1B C;  1JOY A;  1SQP H;  2OIE A;  3BHP A;  4D6T H;  1VQ9 V;  1NU1 H;  2W6J G;  1BL8 A;  1KBH A;  3ZMZ A;  5ITZ A;  3KCY A;  3E22 A;  1JX9 A;  4EFB A;  2BTQ A;  2Y4T A;  2P6J A;  4ZHQ B;  4FLW A;  3CRC A;  3E8F A;  4DV3 B;  1KUQ A;  4DRX B;  1SQB H;  2ARH A;  1XIL A;  4JZ2 A;  3H01 A;  3D8C A;  1X4T A;  2UUC B;  4E2L A;  2V7Q G;  1AB3 A;  1JFF B;  4JI4 B;  4LF9 B;  5LMU O;  1N32 O;  3S3W A;  4NTW A;  4GX0 A;  5JQG B;  2KKW A;  1SA0 A;  3DC5 A;  2XND G;  4I4T A;  1H8E G;  2PYL A;  3RYF B;  2XAQ A;  4G28 B;  3JD0 A;  4X8A A;  3IJ4 A;  2G38 A;  2IM9 A;  3JD4 A;  5LA6 B;  4J9Z B;  3CC2 V;  4B3M B;  2QJ1 A;  2Q67 A;  4JI0 O;  2B5U A;  3CYO A;  5H6R A;  2ZE5 A;  3JAW B;  4U3J B;  1PP9 H;  2WLI A;  2GSM B;  3CSX A;  5IYZ B;  5FPO A;  2QTO A;  2HEP A;  5J2T B;  4D7S A;  1JA8 A;  3G67 A;  1GMG A;  1D5A A;  1OV9 A;  4LF5 O;  2UXC B;  1R6T A;  1QR8 A;  2Q4P A;  2Z5U A;  3CE2 A;  2VWK A;  3FAV A;  2IU0 A;  4P2Z A;  3JAR A;  4DYL A;  3UQ8 A;  2WLJ A;  1WPX A;  4DW0 A;  1XOU A;  1PV0 A;  2EIL C;  2RMK B;  1B04 A;  2WA4 A;  3T1H O;  1EN6 A;  5KUM A;  2A7W A;  1URF A;  5H5N A;  3CJH A;  5F2V O;  2ZD9 A;  5EIB C;  4BWA A;  4FLY A;  1GO3 F;  4J7K A;  5LOV A;  1V55 C;  4JI8 B;  3JSN A;  1HR0 O;  5KLV H;  5LP6 A;  1V54 B;  3OUF A;  4IL6 Z;  1K9M W;  2OCH A;  3K03 A;  4CH5 A;  1IUR A;  1Z5V A;  5BXZ A;  2QA4 V;  1ZLZ A;  5LBQ A;  2UUB B;  5E1A C;  1TGO A;  2GUZ A;  1J5E O;  1FXV A;  4YJ3 A;  1M1K W;  2B1G A;  1H2M A;  3DSQ A;  1L0N H;  2DN9 A;  4IIJ A;  5A9G A;  3OR6 C;  4RUE A;  3T4Z A;  4B3R B;  1K4C C;  2JJ2 G;  1HNW O;  4ICG A;  4KFM A;  1NKD A;  3JSL A;  1N33 B;  4F4L A;  3OEH G;  2PTM A;  4AI8 A;  2K1E A;  1IVS A;  4RWU A;  4B7E A;  4JI3 B;  4TSF G;  1IBM O;  4B3S B;  4PDL A;  3RYI B;  1EZV H;  1KQS U;  1RPR A;  3W7S A;  1SKV A;  2ZM6 O;  3FKS G;  3P3P A;  5GON A;  1AJQ A;  1S5H C;  1UFI A;  4O4J B;  1S72 V;  2XAJ A;  4NTY A;  3ZRX A;  4JI5 B;  1XNR O;  4DR6 B;  1NR1 A;  1SQX H;  2YSU B;  4UCR A;  4O4L B;  3K5M A;  1KKD A;  1IXB A;  2LO1 A;  5BZB A;  3OR7 C;  1OCZ B;  1PM9 A;  1XL6 A;  2FL4 A;  4FMT A;  3OTF A;  2UUA B;  5FNV B;  1SER A;  4DV1 O;  3JAT B;  2CTQ A;  4TV9 A;  2Q7E A;  4I50 B;  2Z0A A;  3BEH A;  1QNM A;  5K1X A;  4DV6 B;  1BS3 A;  3T1Y B;  1XMQ B;  2CE4 A;  1Q6U A;  1XBL A;  5H6Q A;  2Q69 A;  2JIZ G;  1CXZ B;  3B4S A;  1BQZ A;  4MSW C;  4XBF A;  2E5L O;  3ZMS A;  2Y4U A;  2OYQ A;  1R6N A;  2CGN A;  1OZ0 A;  2RJZ A;  4CH3 A;  2LFR A;  1AR5 A;  4MW8 A;  4DR1 B;  1Q5O A;  4DR3 B;  2QWO B;  5EC1 C;  1FAF A;  2UXB B;  3CPW U;  4JI2 B;  3L74 H;  4CH4 A;  1MG1 A;  1Z2G A;  1R3J C;  3TCU A;  3L9D A;  5BY1 A;  3TGU H;  3CD6 V;  3UCS C;  3JAK B;  2OWO A;  3N27 A;  2W0X A;  3SDL A;  4AIL C;  4JV5 O;  4YY3 B;  4DUY B;  5B1O A;  2HVJ C;  1OCR C;  4LNU A;  3ZIA G;  5K1P A;  2RCV A;  1YI2 V;  3G6B A;  5JWP A;  1K4D C;  4H33 A;  4O4I A;  3ZHT A;  2Q0A A;  4E4E A;  3FB7 C;  1TUB A;  4JGS A;  1VQ5 V;  2EBO A;  4K0K O;  1PNK A;  2HG5 C;  3IC7 A;  3CCQ V;  3ML0 A;  4I9W A;  1XQ8 A;  2YEV A;  1GKF A;  2DE0 X;  3SPI A;  2IBZ H;  4UCT A;  3ZRS A;  2XT9 A;  2XAS A;  4DUZ B;  2UU9 O;  4DO2 A;  4B08 A;  4EEQ A;  3EXA A;  4X64 O;  4AHC A;  1HNX B;  2AXT Z;  3L72 H;  4DV2 O;  1JR9 A;  4PDV A;  3UT5 A;  3GVM A;  4I5S A;  4IGG A;  1M9N A;  1GRJ A;  4WFH A;  1G1X B;  5EBM C;  2QM7 A;  4LFB B;  1P7G A;  1THZ A;  4O2A A;  1FFX B;  3OGC C;  2ZT9 B;  1EN4 A;  3ETQ A;  2EIM C;  1VQ4 V;  3OD4 A;  5H2F Z;  3E8G A;  1QQC A;  5L3B A;  1I0H A;  3FB8 C;  1HP8 A;  4XDK A;  2HVK C;  2JGU A;  3F5W C;  3OMA B;  2UXN A;  3JAL A;  4FZ0 A;  3VBB A;  2JS5 A;  4WFE A;  3B2E E;  2LW7 A;  2IU3 A;  2GTS A;  5IJ0 B;  2BSK B;  1SZX A;  1CP9 A;  3HKC B;  4JTD B;  2KG7 A;  1H2S B;  3BCC H;  5J9P C;  1RPO A;  4IT5 A;  1F4M A;  4JI6 O;  1BE3 H;  4GCZ A;  4ZOL A;  1W2B U;  3CCR V;  1SZT A;  3JCZ A;  1FXK A;  2X6A A;  4W4L A;  3J80 N;  2UXX A;  1I5Y A;  2DYR C;  3OT7 A;  5GW7 A;  1YSC A;  3JAS B;  1NTZ H;  2XOK G;  4JI1 O;  4ZIB A;  1Q43 A;  4NYK A;  5HFM A;  4KHP O;  4PD4 F;  3QNE A;  2CUG A;  4Z1M G;  2P5O A;  5KUK A;  1ZL8 A;  3B8M A;  1FXK C;  3RWR D;  1H2G A;  3DC6 A;  4IHJ A;  1K5S A;  3OTO O;  4X1Y B;  1MNG A;  2ZR3 A;  4UB6 Z;  4HNA B;  5B1A B;  2AW9 A;  5CN0 A;  1IBK B;  4X1I B;  2ETN A;  3BA9 A;  1OHH G;  3UO3 A;  3A8T A;  4MVU A;  4QE7 A;  4LFC O;  4X65 B;  2ILM A;  3SPC A;  3OGI B;  1PD3 A;  3SGI A;  1SET A;  3LDD A;  2F95 B;  4N23 A;  4Z2W A;  2ADQ B;  1ARO P;  1O9G A;  4DV7 B;  3AK1 A;  1MZE A;  4O2B B;  4BW9 A;  4DRX A;  1N34 B;  5LGU A;  3AG1 B;  1ZX3 A;  5B5E Z;  2LW1 A;  4DR4 O;  2X7R B;  1QCE A;  4EFE A;  2ZXW B;  5EZY A;  1B3Q A;  4Z1V A;  5LHI A;  1OCR B;  3OMN B;  1JFF A;  1R73 A;  2N05 A;  2YC0 A;  3N2G A;  1BMF G;  3ASO B;  2FYU H;  2CDY A;  4LCU C;  4G27 B;  4JYA B;  3WG7 C;  5CBG A;  1M57 C;  4JAS A;  4UFZ A;  3STZ C;  2R9R B;  3B77 A;  3RYF A;  1E1R G;  2QWR B;  4JAA A;  1WLE A;  4K35 A;  4H37 A;  4X62 O;  1M56 B;  2PGG A;  3HR0 A;  3K0G A;  4R6Z A;  1KC8 W;  1N36 B;  1VQN V;  5JVD B;  5L3C A;  4LF4 O;  1Y76 B;  4U7O A;  1SQQ H;  4PA3 A;  2P22 C;  1YJN V;  3JAW A;  1YCI A;  4ZBM A;  3ZN1 A;  4YHH B;  2NN4 A;  2RNB A;  5IYZ A;  2VQE B;  2R9I A;  3M99 B;  4CH6 A;  3CCU V;  2EIM B;  1WP7 A;  5BMV B;  1XHX A;  2K9P A;  3BA8 A;  5LXT B;  3FX7 A;  2YIA A;  3C3T A;  3OUS A;  3O65 A;  3CP1 A;  4DR7 O;  1IX9 A;  1YIJ V;  3ABT A;  4GKJ O;  3ZCC A;  2F43 G;  2C2A A;  2CH7 B;  4TQF A;  2PI5 A;  4LFA O;  3LDE A;  1NQT A;  4GLX A;  2JRI A;  1Q7Y W;  3SR2 C;  1Y74 B;  5A2Q N;  5JCO C;  1BZK A;  3L71 H;  1IBL B;  1MA1 A;  5CA0 B;  3E89 A;  4UCO A;  4NVP A;  3ZRW B;  3AG4 B;  2MK3 A;  5FLX N;  1G6U A;  5IT9 N;  1MZF A;  3VOU A;  4TV8 A;  2VQF O;  2DYR B;  4Q20 A;  5IWA B;  1GM8 A;  5CMU A;  2F1M A;  4NXN B;  2Q8V A;  4J42 A;  3KCX A;  1TA8 A;  2WLK A;  3GB7 C;  1DLB A;  3QO5 A;  1YVW A;  2YIC A;  1ZAU A;  1AVM A;  3I55 V;  3BRC A;  4DK0 A;  2BE3 A;  2O57 A;  1HWY A;  4LH7 A;  2UXD B;  4CC5 A;  5KAI Z;  2E3C A;  3IGA C;  5L3F A;  4DV5 O;  4MT8 A;  1QR9 A;  1NBM G;  5EC2 C;  3KKY A;  2ZDI C;  5LGN A;  2ZKO A;  2WA3 A;  4HBN A;  3RYI A;  5BR8 B;  4MTF A;  3ETD A;  1DGS A;  4WFF A;  1AR1 B;  2GV9 A;  2Y69 C;  3ABK B;  1VF6 A;  2QGN A;  4O4J A;  5CBH A;  3BY6 A;  2YIB D;  1XMO B;  4QPJ A;  1P7B A;  2JJ1 G;  3QF7 A;  3HKD B;  3CCV V;  3OEE G;  5C8Y B;  3K06 A;  4QGP A;  4FFB B;  1Q3E A;  3PJS K;  3RW0 A;  2EZP A;  1NTM H;  1NTK H;  1VF6 C;  2CK3 G;  1H38 A;  4BIZ A;  1XRE A;  3ZHV A;  4AQY B;  1FJG O;  2WAM A;  4I50 A;  3JCU Z;  4JF3 A;  1KB9 F;  1I94 O;  3ABU A;  2WLN A;  4WBN A;  2Q7H A;  3T2M A;  3SPJ A;  1OCO B;  1EM1 A;  4OX9 B;  3RYC B;  3CCM V;  1QU7 A;  5EBW C;  2XAG A;  4MW3 A;  4BR6 A; 
#chains in the Genus database with same CATH homology
 1YJ9 V;  2P7T C;  1XL6 A;  3LDC A;  4FMT A;  4UVC A;  3SYP A;  3ZMT A;  5IY5 B;  1SER A;  3SPG A;  3D3I A;  4JYC A;  2D3O W;  4X88 A;  3AG4 C;  2QKS A;  1RM1 B;  3EHB B;  3ZRV A;  4J9Y B;  3AEI A;  2B1I A;  4BAY A;  1NH2 B;  3BEH A;  3ABL C;  1YIT V;  1E79 G;  3SJQ C;  1LNQ A;  3SYO A;  1AI6 A;  1AJN A;  5L3E A;  4ASU G;  2HR3 A;  1R3I C;  1R3L C;  2KB1 A;  5B3S B;  1CPY A;  5H6Q A;  2Q69 A;  3JD3 A;  1KD1 W;  2JIZ G;  3MD0 A;  2HJF C;  4MSW C;  4XBF A;  4QIW F;  3ZMS A;  3W7U A;  4KUM A;  1R6N A;  1KEC A;  1OZ0 A;  1K8A W;  1EBO A;  2AHZ A;  2LFR A;  4MW8 A;  2NNU A;  4RQE A;  5EC1 C;  4DXW A;  3CPW U;  2DWE C;  4MVS A;  4WFG A;  1DF4 A;  3MHH C;  3CC4 V;  1MG1 A;  3LUT B;  2BOC C;  3ABM B;  4HZ3 A;  1AI5 A;  1FXK B;  1R3J C;  3TCU A;  2DYS B;  3CD6 V;  1GTO A;  3DGE A;  5IYB O;  1V54 C;  5B1O A;  2HVJ C;  1OCR C;  3ZIA G;  2EIN B;  4GX1 A;  1YI2 V;  1K5Q A;  1KP2 A;  1K73 W;  1K4D C;  4H33 A;  1QVF U;  3FB7 C;  4ZKI A;  4JGS A;  5IDJ A;  1VQ5 V;  1S3J A;  3HPL C;  1K7D A;  2EBO A;  3QO8 A;  4HYO A;  1PNK A;  3CCS V;  2HG5 C;  3IC7 A;  1EZJ A;  3E35 A;  3CCQ V;  3W7W A;  3ML0 A;  2EIJ C;  4I9W A;  2YEV A;  1ENV A;  4MVO A;  1GKF A;  2W6I G;  3SPI A;  1FFT B;  1MOF A;  5LHH A;  3ZRS A;  1AI4 A;  1ORQ C;  1YHQ V;  1JJ2 U;  4QJF B;  1YTF B;  3ABK C;  3STL C;  2XAS A;  2P90 A;  4DO2 A;  2JEU A;  4GT1 A;  1AI7 A;  1K97 A;  4L87 A;  4R50 A;  1OCC B;  1VQ6 V;  3X2Q B;  1VQ8 V;  2OTL V;  1QLE C;  3GWO A;  5B1B B;  4PDV A;  4FIP C;  1NR7 A;  4I5S A;  2NLJ C;  1M9N A;  4WFH A;  5EBM C;  2QM7 A;  2IJH A;  4P9O A;  1THZ A;  4MVR A;  2WLL B;  1GM9 A;  3K3W A;  3OGC C;  3AG3 C;  2EIM C;  1N8R W;  2DW4 A;  1W0J G;  2EZO A;  4LBE C;  2OCC B;  3K0D A;  1VQ4 V;  4RO2 A;  4P30 A;  3K04 A;  2Q6A A;  3CMA V;  1ROP A;  3WG7 B;  3E8G A;  5CA3 A;  1M57 B;  4XDJ A;  2A0L A;  3RVZ A;  5L3B A;  2JEX A;  3FB8 C;  4EKW A;  2Y69 B;  1PNM A;  4XDK A;  1OCO C;  1BHB A;  1PL0 A;  2HVK C;  3B8N A;  4WFB V;  5IYC O;  3F5W C;  1IXM A;  3OMA B;  2UXN A;  4P9P A;  2IJI A;  3VBB A;  4WFE A;  1UJW B;  2ATK C;  2DWD C;  2IU3 A;  1JVM A;  5KA5 A;  1OCZ C;  5C93 A;  3JD2 A;  1CP9 A;  1ZWI C;  4JTD B;  5IY5 C;  4R7C A;  3G71 V;  2X6B A;  3SYC A;  3JYC A;  1DTO A;  5J9P C;  2HLD G;  3DTU B;  1VQP V;  3FB6 C;  1RPO A;  1F4M A;  2IJK A;  2WLM A;  1I5X A;  3KG2 A;  4GCZ A;  1JQ0 A;  4UV8 A;  3SYA A;  4KP4 A;  3OFN G;  1QVG U;  1W2B U;  2X6C A;  2GHY A;  3CCR V;  1SZT A;  1VQK V;  3JCZ A;  1FXK A;  2X6A A;  4N21 A;  1F4N A;  2UXX A;  1E1Q G;  1I5Y A;  4RUF A;  3ETE A;  2DYR C;  4FK5 C;  2IJJ A;  3ETG A;  5GW7 A;  1YSC A;  3A0R A;  1G8M A;  2XOK G;  4QNH B;  4PA9 A;  4PA7 A;  1QBZ A;  4LC1 A;  2P67 A;  2EIK B;  1CEZ A;  5HFM A;  3OM3 B;  3QNE A;  3LSS A;  3G4S V;  1FXH A;  5L3G A;  4Z1M G;  4HAM A;  5KUK A;  3B8M A;  4PDR A;  1FXK C;  1H2G A;  3QO7 A;  4MTX A;  1K5S A;  1R3K C;  3ABL B;  4QPK A;  1YJW V;  3T1C A;  2ZR3 A;  1K34 A;  2LFS A;  4BW5 A;  3ZMU A;  2X0L A;  4UVB A;  5B1A B;  4GX2 A;  3JD1 A;  1SES A;  5CN0 A;  2WLI B;  1OHH G;  4MVU A;  4QE7 A;  1JPX A;  1J95 A;  3RVY A;  1K92 A;  4PA6 A;  3CXC U;  3SPC A;  2QM8 A;  5KA6 A;  3AG2 B;  1PD3 A;  5H9C A;  1SET A;  3RBZ A;  4MVM A;  3LDD A;  2ZDI A;  2EIL B;  3P30 A;  1S0V A;  4N23 A;  2WLL A;  1TUE B;  1ARO P;  4PEL A;  1PNL A;  2IH3 C;  2DQ0 A;  1L1F A;  1R6K A;  2ITC C;  1H8H G;  4RQF A;  4R8C A;  4JTA B;  5LGU A;  3AG1 B;  1OCC C;  1VQ7 V;  3X2Q C;  1M90 W;  4WF9 V;  2X7R B;  3FYI B;  3LNM B;  1QCE A;  5EK0 A;  1JCH A;  4FPP A;  5B1B C;  1Y4M A;  1JOY A;  2ZXW B;  1G4Y B;  2WPD G;  4G2K A;  4JAV A;  1VQ9 V;  1V55 B;  5LHI A;  3IFX A;  2W6J G;  1SRY A;  1BL8 A;  1OCR B;  2V1D A;  3OMN B;  3ZMZ A;  1R73 A;  4WCE V;  1JX9 A;  1BMF G;  3ASO B;  2P6J A;  2WLH A;  2PI4 A;  5CBF A;  4LCU C;  3SPH A;  4G27 B;  1VQL V;  3E8F A;  3WG7 C;  5CBG A;  1M57 C;  3UM7 A;  4JAS A;  3FYE B;  3STZ C;  2R9R B;  3B77 A;  1E1R G;  3H01 A;  4QE9 A;  3W7X A;  1GM7 A;  1NJI W;  1WLE A;  2ITD C;  4H37 A;  1M56 B;  3K0G A;  2HFE C;  3ASN C;  3K79 A;  4E2L A;  4R6Z A;  2BOB C;  1KC8 W;  1VQN V;  4BIU A;  3D36 A;  2V7Q G;  5L3C A;  1BHA A;  4JTC B;  3I56 V;  2QEX V;  4TT3 G;  4U7O A;  1P4R A;  4UUJ C;  2A79 B;  4GX0 A;  4PA3 A;  3K9A A;  1QLN A;  1YJN V;  2Y48 A;  5DM6 V;  4ZBM A;  3ZN1 A;  3E8B A;  4PA4 A;  1NVP B;  1F23 A;  2R9I A;  3M99 B;  3CCU V;  2XND G;  1NH2 D;  2EIM B;  4XDL A;  3K08 A;  1H8E G;  4PDM A;  1XL4 A;  2XAQ A;  1RM1 C;  2JK5 C;  4G28 B;  3JD0 A;  4X8A A;  5B1N A;  1Y66 A;  3OUS A;  3TK1 A;  4TWK A;  3JD4 A;  3CC2 V;  3ZJZ A;  3CP1 A;  4J9Z B;  3ZRW A;  2A9H A;  1YIJ V;  2Q67 A;  3OE7 G;  3ABT A;  5DN6 G;  1AJP A;  3ZCC A;  1W0K G;  2F43 G;  5B3S C;  2B5U A;  4JPR A;  2C2A A;  3CYO A;  5L3D A;  2PI5 A;  3LDE A;  4RAI A;  5H6R A;  1NQT A;  5IYD O;  3CC7 V;  1Q7Y W;  2WLI A;  4UV9 A;  2GSM B;  2EIK C;  3HB3 B;  2QTO A;  2JDI G;  3E89 A;  2FTK A;  2Q68 A;  1S77 D;  3MHS C;  1GMG A;  2M7W A;  2QE7 G;  3P32 A;  3SYQ A;  4UXN A;  3ZRW B;  3ABM C;  1QR8 A;  2XAH A;  3AG4 B;  4U7N A;  2MK3 A;  2Z5U A;  2DYS C;  5B1A C;  4JYB A;  3E2E A;  2IU0 A;  3CME V;  3VOU A;  5LGT A;  4JAU A;  4P2Z A;  5FL7 G;  2EIN C;  2DYR B;  4Q20 A;  2W0F C;  2WLJ A;  1K33 A;  1WPX A;  3AG2 C;  1GM8 A;  3E86 A;  5CMU A;  1Q81 W;  1PKX A;  2EIL C;  4MS2 A;  3CCL V;  1YTF D;  2WLK A;  5KUM A;  1FS0 G;  3E83 A;  4UVA A;  3GB7 C;  1DLB A;  1DF5 A;  3E8H A;  3EFF K;  3QO5 A;  3AG1 C;  3F7V C;  2H94 A;  2ZD9 A;  3I55 V;  2WWW A;  3F7Y C;  2ZR2 A;  2ZXW C;  1GO3 F;  3TET A;  1HWY A;  1V55 C;  4MVQ A;  2ZQM A;  3IGA C;  5L3F A;  4CZZ A;  3R65 A;  4MT8 A;  3T4D A;  1QR9 A;  1NBM G;  1V54 B;  2WSS G;  3OUF A;  5EC2 C;  1K9M W;  3ASO C;  3CCJ V;  1VQM V;  3K03 A;  2ZDI C;  2QA4 V;  5LGN A;  2XAF A;  1Q82 W;  5LBQ A;  5E1A C;  4LP8 A;  3OW2 U;  1FXV A;  1B6Q A;  3NXS A;  1M1K W;  4OXS A;  2B1G A;  4MTF A;  2OTJ V;  2IW5 A;  2OCC C;  3ETD A;  4GX5 A;  3UKM A;  2EIJ B;  3G6E V;  1M56 C;  4WFF A;  3OR6 C;  5EBL C;  1EFR G;  1AR1 B;  4RUE A;  3FB5 C;  3T4Z A;  2Y69 C;  3ABK B;  1K4C C;  2JJ2 G;  1MAB G;  5CBH A;  2HKO A;  1MSW D;  4KFM A;  3BY6 A;  1NKD A;  1NVP D;  4QPJ A;  4F4L A;  1P7B A;  3OEH G;  3W7T A;  2DQ3 A;  2JJ1 G;  2Z3Y A;  5HFL A;  1QLE B;  2K1E A;  3CCV V;  2IH1 C;  3OEE G;  4TSF G;  2YEV B;  3K06 A;  2OT5 A;  4PDL A;  3PJS K;  3RW0 A;  2EZP A;  3WFV A;  4WFA V;  1KP3 A;  1KQS U;  1RPR A;  3OMI B;  3W7S A;  3AG3 B;  1COW G;  2CK3 G;  3FKS G;  3OAA G;  1Q86 W;  1H38 A;  1VQO V;  4BIZ A;  4CBC A;  5LHG A;  1AJQ A;  3CCE V;  2WAM A;  1S5H C;  4YXW G;  4JF3 A;  2LP7 A;  2H8P C;  1S72 V;  2XAJ A;  2AHY A;  3ABU A;  3ASN B;  1F51 A;  2WLN A;  3T2M A;  4MVZ A;  1GK9 A;  1K3E A;  2EJR A;  3LSQ A;  3SPJ A;  3ZRX A;  3ZMV A;  1OCO B;  4MTO A;  4X89 A;  1NR1 A;  3CCM V;  2YSU B;  5EBW C;  3ZN0 A;  1KKD A;  2XAG A;  1S76 D;  4FJC C;  4MTG A;  4MW3 A;  5BZB A;  3OR7 C;  1OCZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...