4PJ0Z

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
b'MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
molecule tags Oxidoreductase, electron transport
total genus 24
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 4pj0Z00
5GTIZ 3A0BZ 3KZIZ 5B66Z 3A0HZ 5B5EZ 4UB6Z 4IL6Z 5KAFZ 3WU2Z 5TISZ 4UB8Z 5GTHZ 1S5LZ 5E79Z 2AXTZ 3JCUZ 4PJ0Z 5H2FZ 5KAIZ
chains in the Genus database with same CATH superfamily
1W59A 1O9GA 4QE9A 2WA4A 4FZ0A 5CB4B 2YEVB 1BCCH 4ASUG 2E75B 1R6TA 1Z2GA 2GHYA 2JGUA 2DYSB 1PM9A 2Y4UA 1N4CA 5FNVA 3X2QC 1RM1B 2IJHA 2EJ7A 3TK1A 1VIBA 2EBOA 2R9RB 2IH3C 3JAWB 4UVCA 4LF6B 3H01A 4TQDA 1VARA 2IBZH 3BFRA 5B1AB 1SS3A 3OR7C 3J80N 2AGAA 4YY3O 2D3OW 4D6TH 1IBMB 3K58A 3FX7A 2WAMA 4UCUA 3CCUV 2JEUA 4DR6B 3ZRVA 4YJ2B 2Q6AA 4IIJA 3T4ZA 3RYHB 4PA6A 1F7YA 3K79A 5B1BC 2EILC 2IJJA 1NTKH 1SETA 1Q6UA 1VF6A 4YJ3A 4CH3A 4QE7A 4JV5O 4OPAA 3ABLC 3UKMA 5BZBA 4DUYB 1QU7A 4IGGA 4AHCA 5J2TA 5H9CA 1OCRC 4ZOLA 4TUYB 2JGDB 1PKXA 4I7ZB 2B5UA 2A9HA 3S3WA 4UUJC 1H2LA 2DWDC 4BAYA 1JJOA 1S3JA 1I94B 4UVAA 1VQ7V 1P49A 1H8HG 1K7DA 4PA7A 3JSLA 1HNXO 3G80A 3E8BA 4WF9V 1YXBA 4JI7B 3Q4HA 2F1MA 2JEXA 1ZAUA 3ZRWB 2OTLV 2EIMC 1WA8A 3QNEA 1WN7A 3TXSA 4H33A 3UQ8A 3NXSA 3MD0A 4LFBO 2P90A 3H1LH 3SYPA 3K08A 2N05A 2BSKB 5A2QN 1NVPB 1FXKC 4LF7O 1PP9H 4ZHQA 3IGAC 4IYHA 1YHQV 3JALA 3JAMN 4JI5O 1KYOF 2EIJC 4BW5A 1IDSA 2W6IG 2IU0A 3DXRA 2EULA 4BWAA 1TA8A 5LA6A 1EN6A 2W0FC 3L73H 1XNQO 3BVOA 2PF4E 5IY5B 3RYCA 3CWBH 4Q6GA 3LSUA 5B66Z 2NLJC 3AG4B 1VQNV 3TJTA 2PYJA 1FFXB 3U11A 3CCSV 4JI2O 4UB8Z 4JI1B 4K0KO 4UXNA 2PUSA 1I0HA 3K0GA 5LYJA 2H3OA 1CEZA 3CE2A 4X20A 1M56C 3JCZA 3IJ4A 4B3SB 3HKBA 5DM6V 2RCVA 3CSXA 4MTFA 4CH4A 3SJAC 2XTAA 4IL6Z 3J81N 1X4TA 4DR2B 4D7TA 3CMEV 4DRXB 1AR1B 3P32A 3ABKB 1M57C 4BR6A 4JF3A 1NBMG 1S77D 1P84F 1EN5A 1KKDA 1LUVA 1Y76A 1VEWA 1MG1A 5CMUA 3CMAV 3ZMZA 4PA9A 1Q82W 4UV9A 1R6KA 2QWPB 1J95A 4DV6B 2YIDA 3MHHC 5JQGA 3WB0A 2A06H 1YJ9V 1IBKB 4GZRB 3ZMSA 4MVZA 1FKAO 3ETGA 5FNVB 3RBZA 3OTFA 5BMVA 1V55C 2X6BA 5LXTA 1ORQC 1FD9A 3MAQA 1DLBA 2LFSA 4KHPO 4PDVA 3JD0A 3LSQA 1N34O 5L3FA 4E2LA 3OMNB 2YI9A 1WAZA 1L8DA 5LP6A 3HKDA 1B06A 1OCCB 3BPZA 3T1HB 1Z5WA 3L74H 4LFCB 2DOSA 5LGNA 4X65B 4PDLA 2AHZA 2C2AA 4FLUA 2DN9A 3H1KH 5HFMA 2K9PA 3K06A 3ETQA 2LP7A 5IYBO 5B3SC 4YJ3B 1THZA 5JJEB 4JYAB 3D8CA 1P7BA 4DV5B 1TVKA 4JZ2A 3CCMV 1URFA 4G2KA 1JFFA 5KUMA 5J2TB 4L87A 1SQVH 1D5AA 1XI1A 1WB8A 2AZ2A 1V54C 5LGUA 3W7WA 5CA1B 4TQFA 1GK9A 1R3IC 1WP7A 4JYCA 1N8RW 4JI6B 1VQ9V 2OCCB 2ZKOA 2QM8A 3F5TA 1KQSU 1KBHA 3L75H 1NR7A 2X6CA 4B3TO 3Q4HB 4FLXA 2YEVA 1DF4A 5EBMC 4QJFB 5L3BA 4DR4O 5IJ9B 4RAIA 1W2BU 2FYUH 1H2SB 3QG5A 1P7GA 2F4VO 1WA8B 4DK0A 3FB6C 1VQ4V 2ZT9B 3HPLC 2QGNA 3H1HH 4LF8B 2PGGA 1UJWB 4ZHQB 2QKSA 5KHIA 2UU9B 4NXMB 2Y69C 3N27A 4HBNA 5B1OA 2GDSA 3JALB 3OUSA 1GM8A 4CBCA 2JS5A 3WG7B 2XAHA 1H2NA 2Q7HA 4X66O 1XMOO 1VQ8V 2ZXWB 1QBZA 5EIBC 3RYHA 1KP3A 2HHHO 3RYCB 4BIZA 4WFBV 3STZC 1S5JA 2VRZA 1ZSPA 3AEIA 3A0BZ 1T5EA 2EJRA 3RYIA 2IJKA 5LYJB 3B40A 4X89A 4X20B 2WWWA 1IX9A 1N0NA 1GN2A 2LO1A 5TISZ 3FD9A 4MW8A 3ZRSA 3BHPA 4O2BB 3CRMA 2XAJA 2YIBD 4X9QA 3SDLA 3R65A 3CD6V 5EC1C 2H94A 2V4DA 1D5NA 3FFQA 3GWOA 1NI8A 3D36A 1K4CC 2CTPA 4MVQA 4RO2A 4FK5C 1X59A 2P6JA 3H1IH 3VQXA 3TGUH 1Q3EA 3T2MA 3UO2A 5KAIZ 1AB3A 2QM7A 5IJ0A 2E5LB 1DK1A 2YI8A 4JTAB 2ETNA 1OCZC 1Q5OA 2BTOA 2ZM6B 2UUCO 5JQGB 1AI6A 1SRYA 2HP8A 2XASA 4F6EA 4EFBA 3LNNA 4TV9A 3EFFK 1PV0A 4JI4B 2VQEB 5BMVB 3FB5C 3ABUA 4LF4O 3E8FA 4J7KA 2JS3A 3VQYA 2ZE6A 3KZIZ 2PI5A 2YUAA 3HKCA 1U97A 2QWQB 4GKJB 1VQPV 5LP6B 3HKDB 4FZ1A 4PA3A 1NS1A 3JASA 3ABMC 3AK1A 4HZ3A 3ASOB 4OX9O 1YF2A 2Y48A 1BQ0A 3EVKA 1XBLA 2FL4A 1VQMV 3CJHA 2HVJC 1N36O 2UUBB 1BE3H 4K8XA 1UPGA 4I4TB 2ILMA 4TV8A 3OW2U 5EZYB 4Z1MG 3LNMB 3E22B 2L6LA 2ZE5A 2EIKB 4AILC 1G1XB 3E35A 1I7FA 5CBGA 5JH7A 3IC9A 3NR7A 4JAVA 3IFXA 2E3CA 4DR5B 3B2EE 1JFFB 2EINB 3UT5A 2UXDO 1KUQA 1GTOA 1LR1A 3SPGA 1IBLO 3W7TA 3E86A 4J10A 1EZJA 4I50A 4TWKA 4PV1B 3I55V 2RJZA 1QQCA 1K34A 4R8CA 1FAFA 2XOKG 4ZI7A 3OEEG 4PI0A 2QSAA 1Q8IA 2GUZA 2Q7EA 3AG2C 3AG7A 2ADQB 2JK5C 2JVDA 3QTCA 1JVMA 4GX2A 1N33B 4GUNA 4YY3B 2HEPA 5FPRA 5KHKA 5FL7G 4DO2A 5C93A 1HNZO 4YXWG 2LW7A 1QLEB 4LR3A 1F23A 2P67A 4NTXA 4AQYO 4O4IA 1QVFU 2QTSA 4IT5A 1IXMA 4JV5B 1NVPD 1D2DA 2QM4A 2CAZC 2VQFO 4J7ZA 4FIPC 3PJSK 5EBWC 3F5WC 1VQOV 4O2AA 3L70H 3W7SA 3K59A 2X6AA 3FAVA 2WLNA 1KECA 1ZX3A 2DYRB 4EB6A 1OJHA 5LHGA 4EKWA 1RSOA 1EM1A 1GN4A 1VF6C 1SC5B 3QO7A 1AVMA 2WLKA 4X1YA 3JD1A 1VQLV 2CTRA 3OTOO 1P4RA 3UM7A 3W7UA 4J42A 5D5QA 3VBBA 1NQTA 4DR1B 1XQ8A 3A8TA 2OWOA 5FLXN 3RVYA 1SZXA 3RYIB 3KG2A 1HP8A 4B3MB 2CTWA 3JAKB 4LF6O 1G4YB 1MABG 3F7VC 4DV2B 3JATA 5LGTA 5CA1A 1KC8W 4MVMA 3K5OA 3T4DA 1GMGA 4J41A 3WU2Z 1KU9A 4CC6A 1IBMO 1J5EB 1Q86W 4UCSA 2WA3A 1R1BA 4FMTA 2ITCC 4LFBB 2UXCO 4DR7B 4ZBMA 3K57A 3QO5A 5ITZA 3B8NA 2D2CB 4LF7B 3LDCA 2Q0OC 1L1FA 3PN1A 3SYQA 3RN4A 4JI0O 3U0ZA 4CC5A 2HVKC 5IJ9A 1H2GA 5IJ0B 4NKGB 1YJWV 4ABMA 4P30A 1XL6A 3JD3A 2LJ2A 4DUYO 3O9OA 2GTAA 1AJPA 2JIZG 2QDOA 2F93B 3ASNB 3TCUA 1VF7A 2QR4A 2WPDG 3DGEA 4TV9B 4CS2A 3CCRV 4DV7O 2PTMA 2QKAA 4DYLA 4I55A 4X1KA 1SQBH 4JI2B 1SQQH 3CC4V 2MW2B 3C3TA 4W4KA 4X64B 2GV9A 2UUAB 3HKCB 2HJFC 4OGQB 3W7XA 4MVSA 1R3LC 1KP2A 3JASB 2VWKA 2AZ0A 4QNHB 1FXKA 1PL4A 2QA4V 2GTSA 2Z0AA 4CS3A 3CJHB 4WBNA 4TV8B 3RWRD 1YVWA 1Q90D 3E89A 4XDKA 1K33A 3OGIB 1M90W 3I5DA 4NXNO 5GW7A 1FXVA 1SF9A 5JH7B 2JDIG 3FB7C 2V7QG 3UT5B 4O2BA 3BA9A 3E2EA 1JCHA 3AG1B 4NR1A 3JYCA 2Q0AA 5L3DA 3K5MA 4I50B 5H2FZ 5KX5B 1WB7A 1QLNA 3OUFA 1EFRG 1TGOA 5IWAB 1H8EG 3ZCCA 3KCYA 5K1XA 3RVZA 1ROPA 2RNBA 4KXRA 5IYDO 2LGWA 1SQPH 4ZI7B 4OXSA 4KHPB 5CN0A 1PPJH 3RYFB 2GUZB 1N34B 1HDJA 5LMNB 3CX5F 2Q5ZA 3APOA 3OMAB 5HFLA 2CH7A 3E8GA 4B7KA 3ZMVA 1QNMA 3S3XA 2L35A 3I56V 2FB5A 4QPKA 2F23A 5BY1A 3ZEDA 2H8PC 2WLLA 4DR2O 1R6NA 4O4IB 3AG3C 1E1RG 3HR0A 3SJCC 4N21A 5LP6C 4FJCC 2KG7B 1Y6XA 1PL0A 3ASOC 3H1JH 5BR8O 1YI2V 1SKVA 4Z1VA 4DV0O 3X2QB 1OZ0A 4O2AB 1XMQB 4EEQA 2FMLA 1FJGB 4UVBA 5KA6A 3FAVB 4UB6Z 3OE7G 3G67A 3ICXA 4EB6B 1IVSA 1RSOB 4I4TA 4LF5B 5EZYA 1GKFA 4DV6O 4GKKB 4X1YB 2Q7GA 3E22A 2DW4A 2RMKB 2Z3YA 1G6UA 1R73A 1BS3A 4B3RO 3G6BA 5KHJA 5LBQA 2BE3A 3CYOA 1Q43A 1OCOC 5B1BB 2EILB 2YDEA 4LBEC 3RGBA 3JATB 5J2UA 4J9YB 4DR4B 1V9PA 2QWOB 4JI8O 2F43G 3ABLB 3T1HO 2G38A 2P7TC 4JYYA 2XAQA 4WCEV 1BZKA 1BT8A 3F7YC 1OCRB 1NZ6A 3JARA 3OM3B 4XDJA 5KAFZ 5ITZB 3SYOA 2OT5A 2CGNA 2DMXA 2Q68A 1GRJA 4IHJA 2DYSC 5JJJB 4BIUA 4KFMA 4JASA 1Q81W 2PY5A 4JYAO 2DQ0A 4GX1A 4X66B 1RM1C 1XMOB 4DV5O 1XEQA 1WPXA 3CCQV 1CPYA 3B77A 2KSDA 2HHHB 2GBOA 4I0XB 4JYBA 5B1AC 3K9AA 4MVUA 3JD4A 3QO8A 4UCVA 4I55B 1PNMA 4X1KB 4DV4O 1YDXA 2K1EA 1IXBA 4P9OA 4JI6O 1GN3A 3LDDA 2NR5A 3M7MX 1K8AW 2EIMB 2MK3A 2Z5UA 2R72A 5JCOA 2W6JG 1ZWIC 3LSSA 4DR3B 3G4SV 2EZPA 1K9MW 1AR4A 4FLTA 1COWG 1FXKB 2CK3G 3APQA 3ZX6A 1NR1A 2HR3A 1H2KA 1HR0B 2XT9A 3OD4A 2Y0PA 4LP8A 5GTIZ 4WBNB 1W0JG 2UXBB 3VQVA 2UXNA 4DXWA 4MSWC 4NVPA 1WJZA 4DW1A 4XDLA 1N32O 1VF5B 4MVOA 3JAKA 1YSCA 2OCHA 5E79Z 2Q9LA 1JR9A 3RW0A 1XHZA 2CE4A 3ZMTA 5KLVH 3K9SA 3WB1A 4NXMO 3FYIB 4FLYA 4GCZA 2ARHA 1B04A 2P5OA 2UUCB 1F4NA 3D36C 4ZKIA 2IW5A 2JRIA 1IURA 4HNAA 4FPPA 4DV3B 3SGIA 1EBOA 1M56B 2AW9A 1YCIA 1AR5A 1ZLZA 4O4LB 1BGYH 1CP9A 4LH6A 1GAXA 4GX5A 4MTGA 4CH5A 2ZIOA 3STLC 4Q20A 2HFEC 3P3NA 2CH7B 1QHTA 2N74A 1M57B 1LUWA 5KUKA 3HKEB 3K5LA 4OX9B 3QVNA 2ZIMA 4P2ZA 5KMGA 5EBLC 1FPOA 2XAFA 5KA5A 1N36B 5AG2A 2YICA 3TXQA 1HNWO 1VQKV 4LF9O 2WLLB 1HWYA 3CRAA 2X7RB 4JPRA 1GN6A 1GO3F 3ZHUA 2A3QA 4WFHA 4UV8A 5IY5C 3ZHQA 1XNRO 5LMUO 3UCSC 3ZHRA 4FFKA 3AG4C 2UXDB 1K5QA 1PNLA 4DV1B 1SZTA 1O9HA 5H6QA 1IBLB 4LFAO 3BAAA 4O4JA 2ZDIC 4F6RA 1FXHA 1ZTEA 2QJ1A 1Y74A 1VQ5V 1DF5A 1B3QA 4RWUA 4UCRA 2P4VA 4MTXA 3CHXA 5H6RA 1N0JA 1TUEB 4PD4F 4O4HA 4JI4O 1XOUA 4MTOA 4I9WA 2EX3A 4OPHA 5IYZB 4X1IB 3ABKC 5J2UB 5E1AC 4J80A 2A79B 2HLDG 4FLVA 2WLIA 3K0DA 4ICGA 5B3SB 1NT2B 2ZR2A 5KX5A 4PI2A 2GSMB 3VQWA 4DUZO 4YHHO 1S5LZ 2Q69A 3CEIA 3C90A 4JI3O 1GH6A 2P06A 4LWSA 1MNGA 1VP7A 3JARB 1B6QA 1DGSA 3RT3C 1NU1H 3RYFA 2Q67A 2LW1A 1K97A 2VS0A 2DE0X 1V54B 1WPBA 4AI8A 2VQFB 4IHJB 1L0NH 4BW9A 4MT8A 1L0LH 3T1YO 1AI4A 3GB7C 5CBHA 1KMIZ 4U3JA 3CCJV 4DR5O 2YXHA 3IC7A 3OEHG 3ZIAG 1YIJV 1XILA 4K35A 4X8AA 3ETDA 3GVMA 3VOUA 3LDEA 3SPIA 5EYPA 1ENVA 3OTOB 4R50A 2WLJA 1OCCC 2Y4TA 2IJIA 2KG7A 4NTYA 4WFGA 4YIPA 1M93A 4K3AA 4DK1A 1QCEA 4X62O 2LFRA 2PYLA 1QR9A 4L8JA 4D7SA 4FFBA 5FPOA 1GM7A 1I5XA 2BTQA 2R9AA 1N33O 2OYQA 1AJNA 2Y69B 1U96A 4RQEA 2XUMA 1ZL8A 3IAYA 1HNXB 2YC0A 2UXCB 5B1NA 1FYJA 3BY6A 3SPHA 4I5SA 2B9ZA 1SA0B 2DWEC 1NH2B 1BHBA 4JI0B 4H37A 3L72H 3BRCA 3CRCA 4F4LA 3ML0A 4JGSA 2LQTA 2OCCC 2QKCA 5IT9N 4WFFA 4DR6O 2AHYA 4HNAB 5DN6G 1YTFD 4LCUC 3K5NA 1JA8A 4R7CA 1K73W 4DV7B 4RUEA 2CTQA 5LHHA 1WLEA 3D3IA 4JI5B 4DR1O 2BOCC 2QTOA 1Q6IA 2R9IA 3JD2A 2OIEA 3BA8A 4B3MO 3ZN1A 1DTOA 1XNQB 2VWJA 4I0XA 1AP6A 5D5PA 5L3EA 3TETA 4PDMA 3ZS8C 4H0LB 3FKSG 5KMGB 2CGOA 2PZSA 4DV2O 2XNDG 3CC7V 1AI7A 4LNUA 2Q4PA 1I94O 1E1QG 3GWKC 3ZJZA 3WG7C 4K0KB 1XHXA 2B1IA 1J5EO 4A5UB 2ZXWC 4KL1A 1OCZB 4NXNB 1G8MA 3P3PA 4DR7O 4W4LA 3L9DA 3BEHA 2JJ2G 3N2GA 1VQ6V 1AP5A 4JAUA 1US6A 1XREA 5K1PA 4JI7O 2FKXA 1GM9A 5LOVA 3CS5A 2CDYA 1PNKA 2ZR3A 3R66A 5GTHZ 3B8MA 4O4JB 2RDCA 4F6RB 3HB3B 1YITV 1Y74B 4J9ZB 2ZQMA 3ABMB 4O4HB 3L71H 4YIOA 5F2VO 2YIAA 5CA0A 3N2KA 2ZCEA 3EXAA 1RFYA 1I08A 4PA4A 3CB2A 1SQXH 2F66C 4X64O 2NN4A 2UUAO 1TUBA 3ZHVA 2WLIB 1YTFB 1CXZB 1OHHG 2N04A 3C3SA 4BIOA 2P4KA 3SJQC 4O4LA 4FM1A 4LWSB 3CRQA 4P9PA 4KP4A 2ZNIA 1SQFA 1ZUQA 2YXYA 5KHHA 5A9GA 4QPJA 4JI1O 2CUGA 1NTZH 4WFEA 3SPJA 1LNQA 1BQZA 5BR8B 1K92A 4DV0B 3HKEA 3H9VA 1MOFA 1UFIA 4PHZA 3DC5A 3MHSC 1SESA 5CBFA 1FFTB 4U3JB 5L3CA 4PDRA 4B3SO 2JJ1G 1K4DC 4G28B 3A0RA 5L3GA 1SQGA 1R3KC 3E83A 3O65A 4HYOA 3AG2B 5EYPB 1H2MA 2E74B 1XUQA 3CXCU 4JAAA 4B3RB 2IU3A 3OFNG 4FM0A 2YS8A 1M5IA 5IWAO 3A0HZ 4FVMA 5BXZA 2ADPA 1Y67A 3SR2C 2B1GA 5JWPA 5GONA 1QR8A 2YSUB 1FS0G 1A32A 2RN9A 1YJNV 5JVDA 5LMNO 4FFBB 2ZNJA 2HG5C 4U3FH 2EIKC 2BTQB 1JMKC 4JI8B 1PD3A 2A7WA 3OGCC 3ABTA 1M4UA 4NYKA 4B08A 2O57A 3EHBB 1IBKO 2EINC 1ZL8B 5C8YA 1Z5VA 4IIJB 3G6EV 3OMIB 1K3EA 3B09A 3G71V 4B3TB 5IYZA 4X1IA 1R3JC 4U7NA 3OR6C 2YXLA 5KHGA 1HW7A 2P22C 2NNUA 2XAGA 3OAAG 1EN4A 2F4VB 3ETEA 3ZHTA 4K8ZA 4LFCO 2YIBA 2OTJV 4ZOLB 1XMQO 1FJGO 4C7UA 4X65O 1I5YA 1KKCA 2ATKC 4LF5O 2ITDC 3K03A 3P30A 5DECA 4TSFG 4GKKO 3JCUZ 1Q7YW 3BCCH 3DC6A 5DEDA 3ZRXA 3RFRA 4DV4B 2Q8VA 3ZMUA 1JX9A 3ZHSA 3KKYA 1QLEC 1EZVH 1S5HC 3CP1A 2ODMA 2OIGA 1S0VA 4LC1A 4U7OA 5EC2C 1JPXA 2FTKA 2V1DA 4EFEA 1KD1W 2IH1C 5CB4A 2UXXA 4NTWA 1RP3B 5JJNB 1MZFA 2W0XA 4LNUB 1JJ2U 4H13B 2RQ6A 4N23A 3T1CA 4HAMA 4GT1A 3JSNA 3CCEV 2IM9A 1W0KG 2ZD9A 2BCCH 4UFZA 1N32B 5JCOC 3JAWA 2DYRC 3CXHF 4ZIBA 2Y0IA 2HKOA 1KB9F 3N2GB 5LL6Y 3AK3A 4JZGA 1AROP 1XL4A 5LOVB 1M1KW 3QF7A 1JOYA 2DJVA 3DXRB 2Q73A 2EIJB 4YJ2A 5CA3A 1BL8A 3LUTB 5LA6B 3THOA 1RPOA 1MSDA 2QE7G 4RUFA 2QWRB 4H44B 1YZBA 3FYEB 1QVGU 3ZN0A 4LF8O 1SA0A 3SPCA 4G27B 5IYCO 3WFVA 5CA0B 1NTMH 3N2KB 1S72V 2UU9O 1IZ3A 1Y66A 3AK2A 1TUBB 5B5EZ 4IYIA 3U10A 4I9QA 2EZOA 4TUYA 2M7WA 5IDJA 1NKDA 2JGDA 4QGPA 4DR3O 3J7AU 4PELA 3HKBB 4GYCB 4MVRA 4LF4B 3ZBHA 2ZE8A 4PJ0Z 1HNWB 3MDSA 4LF9B 1Y4MA 3SYCA 2XHBA 4MS2A 1MZEA 1HR0O 4RQFA 1K5SA 4NB5A 1OV9A 2UXBO 2PI4A 3A2FA 4R6ZA 2WSSG 4CZZA 1Q6HA 3ASNC 3DSQA 3CCVV 2QEXV 2DQ3A 1XNRB 5LMUB 1AI5A 1Y76B 2M6YA 1WP8A 4QIWF 1AILA 4FLZA 1XDCA 4XBFA 2ZINA 4LFAB 3CCLV 3ZRWA 4GX0A 2KB1A 4JTCB 4CS4A 4DV3O 4KUMA 2QWNB 2BSKA 3UO3A 1WNSA 2BOBC 5LXTB 3SJBC 1V55B 4Z2WA 2R70A 4TT3G 2KKWA 5GONB 4GLXA 5J9PC 2LGQA 5JVDB 4FM2A 2E76B 5LHIA 1JQ0A 2E5LO 3AG3B 5IE9A 4FLWA 3M8AA 1F51A 1AJQA 4MW3A 2ZM6O 1H38A 4DUZB 4YHHB 3OT7A 4JI3B 4X88A 1MMMA 1M9NA 1F4MA 3CPWU 4WFAV 3M99B 5H5NA 5C8YB 2VQEO 2X0LA 1FFXA 2KQXA 3AG1C 2HJDA 4LH7A 3K3WA 1NJIW 3CC2V 5EIBD 1BMFG 1S76D 3CRRA 2ZDIA 3KCXA 1MA1A 1NH2D 1E79G 4B7EA 4GKJO 1HNZB 4UCTA 3T1YB 3WB2A 1TVKB 2WLHA 5EK0A 3BABA 2ZE7A 4AQYB 4DW0A 4DV1O 1VMGA 2UUBO 4CH6A 3SYAA 4DRXA 1OCOB 3B4SA 2A0LA 2F95B 1MSWD 4JTDB 4UCOA 3FB8C 2WLMA 3E8HA 1SERA 4TOIA 1TAEA 1YEWA 1BHAA 4X62B 4J11A 4E4EA 2AXTZ 3DTUB 1BSMA 3D3QA 4J7JA 1RPRA 3K04A
chains in the Genus database with same CATH topology
5GTIZ 3A0BZ 3KZIZ 5B66Z 3A0HZ 5B5EZ 4UB6Z 4IL6Z 5KAFZ 3WU2Z 5TISZ 4UB8Z 5GTHZ 1S5LZ 5E79Z 2AXTZ 3JCUZ 4PJ0Z 5H2FZ 5KAIZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTI Z;  3A0B Z;  3KZI Z;  5B66 Z;  3A0H Z;  5B5E Z;  4UB6 Z;  4IL6 Z;  5KAF Z;  3WU2 Z;  5TIS Z;  4UB8 Z;  5GTH Z;  1S5L Z;  5E79 Z;  2AXT Z;  3JCU Z;  4PJ0 Z;  5H2F Z;  5KAI Z; 
#chains in the Genus database with same CATH topology
 1W59 A;  1O9G A;  4QE9 A;  2WA4 A;  4FZ0 A;  5CB4 B;  2YEV B;  1BCC H;  4ASU G;  2E75 B;  1R6T A;  1Z2G A;  2GHY A;  2JGU A;  2DYS B;  1PM9 A;  2Y4U A;  1N4C A;  5FNV A;  3X2Q C;  1RM1 B;  2IJH A;  2EJ7 A;  3TK1 A;  1VIB A;  2EBO A;  2R9R B;  2IH3 C;  3JAW B;  4UVC A;  4LF6 B;  3H01 A;  4TQD A;  1VAR A;  2IBZ H;  3BFR A;  5B1A B;  1SS3 A;  3OR7 C;  3J80 N;  2AGA A;  4YY3 O;  2D3O W;  4D6T H;  1IBM B;  3K58 A;  3FX7 A;  2WAM A;  4UCU A;  3CCU V;  2JEU A;  4DR6 B;  3ZRV A;  4YJ2 B;  2Q6A A;  4IIJ A;  3T4Z A;  3RYH B;  4PA6 A;  1F7Y A;  3K79 A;  5B1B C;  2EIL C;  2IJJ A;  1NTK H;  1SET A;  1Q6U A;  1VF6 A;  4YJ3 A;  4CH3 A;  4QE7 A;  4JV5 O;  4OPA A;  3ABL C;  3UKM A;  5BZB A;  4DUY B;  1QU7 A;  4IGG A;  4AHC A;  5J2T A;  5H9C A;  1OCR C;  4ZOL A;  4TUY B;  2JGD B;  1PKX A;  4I7Z B;  2B5U A;  2A9H A;  3S3W A;  4UUJ C;  1H2L A;  2DWD C;  4BAY A;  1JJO A;  1S3J A;  1I94 B;  4UVA A;  1VQ7 V;  1P49 A;  1H8H G;  1K7D A;  4PA7 A;  3JSL A;  1HNX O;  3G80 A;  3E8B A;  4WF9 V;  1YXB A;  4JI7 B;  3Q4H A;  2F1M A;  2JEX A;  1ZAU A;  3ZRW B;  2OTL V;  2EIM C;  1WA8 A;  3QNE A;  1WN7 A;  3TXS A;  4H33 A;  3UQ8 A;  3NXS A;  3MD0 A;  4LFB O;  2P90 A;  3H1L H;  3SYP A;  3K08 A;  2N05 A;  2BSK B;  5A2Q N;  1NVP B;  1FXK C;  4LF7 O;  1PP9 H;  4ZHQ A;  3IGA C;  4IYH A;  1YHQ V;  3JAL A;  3JAM N;  4JI5 O;  1KYO F;  2EIJ C;  4BW5 A;  1IDS A;  2W6I G;  2IU0 A;  3DXR A;  2EUL A;  4BWA A;  1TA8 A;  5LA6 A;  1EN6 A;  2W0F C;  3L73 H;  1XNQ O;  3BVO A;  2PF4 E;  5IY5 B;  3RYC A;  3CWB H;  4Q6G A;  3LSU A;  5B66 Z;  2NLJ C;  3AG4 B;  1VQN V;  3TJT A;  2PYJ A;  1FFX B;  3U11 A;  3CCS V;  4JI2 O;  4UB8 Z;  4JI1 B;  4K0K O;  4UXN A;  2PUS A;  1I0H A;  3K0G A;  5LYJ A;  2H3O A;  1CEZ A;  3CE2 A;  4X20 A;  1M56 C;  3JCZ A;  3IJ4 A;  4B3S B;  3HKB A;  5DM6 V;  2RCV A;  3CSX A;  4MTF A;  4CH4 A;  3SJA C;  2XTA A;  4IL6 Z;  3J81 N;  1X4T A;  4DR2 B;  4D7T A;  3CME V;  4DRX B;  1AR1 B;  3P32 A;  3ABK B;  1M57 C;  4BR6 A;  4JF3 A;  1NBM G;  1S77 D;  1P84 F;  1EN5 A;  1KKD A;  1LUV A;  1Y76 A;  1VEW A;  1MG1 A;  5CMU A;  3CMA V;  3ZMZ A;  4PA9 A;  1Q82 W;  4UV9 A;  1R6K A;  2QWP B;  1J95 A;  4DV6 B;  2YID A;  3MHH C;  5JQG A;  3WB0 A;  2A06 H;  1YJ9 V;  1IBK B;  4GZR B;  3ZMS A;  4MVZ A;  1FKA O;  3ETG A;  5FNV B;  3RBZ A;  3OTF A;  5BMV A;  1V55 C;  2X6B A;  5LXT A;  1ORQ C;  1FD9 A;  3MAQ A;  1DLB A;  2LFS A;  4KHP O;  4PDV A;  3JD0 A;  3LSQ A;  1N34 O;  5L3F A;  4E2L A;  3OMN B;  2YI9 A;  1WAZ A;  1L8D A;  5LP6 A;  3HKD A;  1B06 A;  1OCC B;  3BPZ A;  3T1H B;  1Z5W A;  3L74 H;  4LFC B;  2DOS A;  5LGN A;  4X65 B;  4PDL A;  2AHZ A;  2C2A A;  4FLU A;  2DN9 A;  3H1K H;  5HFM A;  2K9P A;  3K06 A;  3ETQ A;  2LP7 A;  5IYB O;  5B3S C;  4YJ3 B;  1THZ A;  5JJE B;  4JYA B;  3D8C A;  1P7B A;  4DV5 B;  1TVK A;  4JZ2 A;  3CCM V;  1URF A;  4G2K A;  1JFF A;  5KUM A;  5J2T B;  4L87 A;  1SQV H;  1D5A A;  1XI1 A;  1WB8 A;  2AZ2 A;  1V54 C;  5LGU A;  3W7W A;  5CA1 B;  4TQF A;  1GK9 A;  1R3I C;  1WP7 A;  4JYC A;  1N8R W;  4JI6 B;  1VQ9 V;  2OCC B;  2ZKO A;  2QM8 A;  3F5T A;  1KQS U;  1KBH A;  3L75 H;  1NR7 A;  2X6C A;  4B3T O;  3Q4H B;  4FLX A;  2YEV A;  1DF4 A;  5EBM C;  4QJF B;  5L3B A;  4DR4 O;  5IJ9 B;  4RAI A;  1W2B U;  2FYU H;  1H2S B;  3QG5 A;  1P7G A;  2F4V O;  1WA8 B;  4DK0 A;  3FB6 C;  1VQ4 V;  2ZT9 B;  3HPL C;  2QGN A;  3H1H H;  4LF8 B;  2PGG A;  1UJW B;  4ZHQ B;  2QKS A;  5KHI A;  2UU9 B;  4NXM B;  2Y69 C;  3N27 A;  4HBN A;  5B1O A;  2GDS A;  3JAL B;  3OUS A;  1GM8 A;  4CBC A;  2JS5 A;  3WG7 B;  2XAH A;  1H2N A;  2Q7H A;  4X66 O;  1XMO O;  1VQ8 V;  2ZXW B;  1QBZ A;  5EIB C;  3RYH A;  1KP3 A;  2HHH O;  3RYC B;  4BIZ A;  4WFB V;  3STZ C;  1S5J A;  2VRZ A;  1ZSP A;  3AEI A;  3A0B Z;  1T5E A;  2EJR A;  3RYI A;  2IJK A;  5LYJ B;  3B40 A;  4X89 A;  4X20 B;  2WWW A;  1IX9 A;  1N0N A;  1GN2 A;  2LO1 A;  5TIS Z;  3FD9 A;  4MW8 A;  3ZRS A;  3BHP A;  4O2B B;  3CRM A;  2XAJ A;  2YIB D;  4X9Q A;  3SDL A;  3R65 A;  3CD6 V;  5EC1 C;  2H94 A;  2V4D A;  1D5N A;  3FFQ A;  3GWO A;  1NI8 A;  3D36 A;  1K4C C;  2CTP A;  4MVQ A;  4RO2 A;  4FK5 C;  1X59 A;  2P6J A;  3H1I H;  3VQX A;  3TGU H;  1Q3E A;  3T2M A;  3UO2 A;  5KAI Z;  1AB3 A;  2QM7 A;  5IJ0 A;  2E5L B;  1DK1 A;  2YI8 A;  4JTA B;  2ETN A;  1OCZ C;  1Q5O A;  2BTO A;  2ZM6 B;  2UUC O;  5JQG B;  1AI6 A;  1SRY A;  2HP8 A;  2XAS A;  4F6E A;  4EFB A;  3LNN A;  4TV9 A;  3EFF K;  1PV0 A;  4JI4 B;  2VQE B;  5BMV B;  3FB5 C;  3ABU A;  4LF4 O;  3E8F A;  4J7K A;  2JS3 A;  3VQY A;  2ZE6 A;  3KZI Z;  2PI5 A;  2YUA A;  3HKC A;  1U97 A;  2QWQ B;  4GKJ B;  1VQP V;  5LP6 B;  3HKD B;  4FZ1 A;  4PA3 A;  1NS1 A;  3JAS A;  3ABM C;  3AK1 A;  4HZ3 A;  3ASO B;  4OX9 O;  1YF2 A;  2Y48 A;  1BQ0 A;  3EVK A;  1XBL A;  2FL4 A;  1VQM V;  3CJH A;  2HVJ C;  1N36 O;  2UUB B;  1BE3 H;  4K8X A;  1UPG A;  4I4T B;  2ILM A;  4TV8 A;  3OW2 U;  5EZY B;  4Z1M G;  3LNM B;  3E22 B;  2L6L A;  2ZE5 A;  2EIK B;  4AIL C;  1G1X B;  3E35 A;  1I7F A;  5CBG A;  5JH7 A;  3IC9 A;  3NR7 A;  4JAV A;  3IFX A;  2E3C A;  4DR5 B;  3B2E E;  1JFF B;  2EIN B;  3UT5 A;  2UXD O;  1KUQ A;  1GTO A;  1LR1 A;  3SPG A;  1IBL O;  3W7T A;  3E86 A;  4J10 A;  1EZJ A;  4I50 A;  4TWK A;  4PV1 B;  3I55 V;  2RJZ A;  1QQC A;  1K34 A;  4R8C A;  1FAF A;  2XOK G;  4ZI7 A;  3OEE G;  4PI0 A;  2QSA A;  1Q8I A;  2GUZ A;  2Q7E A;  3AG2 C;  3AG7 A;  2ADQ B;  2JK5 C;  2JVD A;  3QTC A;  1JVM A;  4GX2 A;  1N33 B;  4GUN A;  4YY3 B;  2HEP A;  5FPR A;  5KHK A;  5FL7 G;  4DO2 A;  5C93 A;  1HNZ O;  4YXW G;  2LW7 A;  1QLE B;  4LR3 A;  1F23 A;  2P67 A;  4NTX A;  4AQY O;  4O4I A;  1QVF U;  2QTS A;  4IT5 A;  1IXM A;  4JV5 B;  1NVP D;  1D2D A;  2QM4 A;  2CAZ C;  2VQF O;  4J7Z A;  4FIP C;  3PJS K;  5EBW C;  3F5W C;  1VQO V;  4O2A A;  3L70 H;  3W7S A;  3K59 A;  2X6A A;  3FAV A;  2WLN A;  1KEC A;  1ZX3 A;  2DYR B;  4EB6 A;  1OJH A;  5LHG A;  4EKW A;  1RSO A;  1EM1 A;  1GN4 A;  1VF6 C;  1SC5 B;  3QO7 A;  1AVM A;  2WLK A;  4X1Y A;  3JD1 A;  1VQL V;  2CTR A;  3OTO O;  1P4R A;  3UM7 A;  3W7U A;  4J42 A;  5D5Q A;  3VBB A;  1NQT A;  4DR1 B;  1XQ8 A;  3A8T A;  2OWO A;  5FLX N;  3RVY A;  1SZX A;  3RYI B;  3KG2 A;  1HP8 A;  4B3M B;  2CTW A;  3JAK B;  4LF6 O;  1G4Y B;  1MAB G;  3F7V C;  4DV2 B;  3JAT A;  5LGT A;  5CA1 A;  1KC8 W;  4MVM A;  3K5O A;  3T4D A;  1GMG A;  4J41 A;  3WU2 Z;  1KU9 A;  4CC6 A;  1IBM O;  1J5E B;  1Q86 W;  4UCS A;  2WA3 A;  1R1B A;  4FMT A;  2ITC C;  4LFB B;  2UXC O;  4DR7 B;  4ZBM A;  3K57 A;  3QO5 A;  5ITZ A;  3B8N A;  2D2C B;  4LF7 B;  3LDC A;  2Q0O C;  1L1F A;  3PN1 A;  3SYQ A;  3RN4 A;  4JI0 O;  3U0Z A;  4CC5 A;  2HVK C;  5IJ9 A;  1H2G A;  5IJ0 B;  4NKG B;  1YJW V;  4ABM A;  4P30 A;  1XL6 A;  3JD3 A;  2LJ2 A;  4DUY O;  3O9O A;  2GTA A;  1AJP A;  2JIZ G;  2QDO A;  2F93 B;  3ASN B;  3TCU A;  1VF7 A;  2QR4 A;  2WPD G;  3DGE A;  4TV9 B;  4CS2 A;  3CCR V;  4DV7 O;  2PTM A;  2QKA A;  4DYL A;  4I55 A;  4X1K A;  1SQB H;  4JI2 B;  1SQQ H;  3CC4 V;  2MW2 B;  3C3T A;  4W4K A;  4X64 B;  2GV9 A;  2UUA B;  3HKC B;  2HJF C;  4OGQ B;  3W7X A;  4MVS A;  1R3L C;  1KP2 A;  3JAS B;  2VWK A;  2AZ0 A;  4QNH B;  1FXK A;  1PL4 A;  2QA4 V;  2GTS A;  2Z0A A;  4CS3 A;  3CJH B;  4WBN A;  4TV8 B;  3RWR D;  1YVW A;  1Q90 D;  3E89 A;  4XDK A;  1K33 A;  3OGI B;  1M90 W;  3I5D A;  4NXN O;  5GW7 A;  1FXV A;  1SF9 A;  5JH7 B;  2JDI G;  3FB7 C;  2V7Q G;  3UT5 B;  4O2B A;  3BA9 A;  3E2E A;  1JCH A;  3AG1 B;  4NR1 A;  3JYC A;  2Q0A A;  5L3D A;  3K5M A;  4I50 B;  5H2F Z;  5KX5 B;  1WB7 A;  1QLN A;  3OUF A;  1EFR G;  1TGO A;  5IWA B;  1H8E G;  3ZCC A;  3KCY A;  5K1X A;  3RVZ A;  1ROP A;  2RNB A;  4KXR A;  5IYD O;  2LGW A;  1SQP H;  4ZI7 B;  4OXS A;  4KHP B;  5CN0 A;  1PPJ H;  3RYF B;  2GUZ B;  1N34 B;  1HDJ A;  5LMN B;  3CX5 F;  2Q5Z A;  3APO A;  3OMA B;  5HFL A;  2CH7 A;  3E8G A;  4B7K A;  3ZMV A;  1QNM A;  3S3X A;  2L35 A;  3I56 V;  2FB5 A;  4QPK A;  2F23 A;  5BY1 A;  3ZED A;  2H8P C;  2WLL A;  4DR2 O;  1R6N A;  4O4I B;  3AG3 C;  1E1R G;  3HR0 A;  3SJC C;  4N21 A;  5LP6 C;  4FJC C;  2KG7 B;  1Y6X A;  1PL0 A;  3ASO C;  3H1J H;  5BR8 O;  1YI2 V;  1SKV A;  4Z1V A;  4DV0 O;  3X2Q B;  1OZ0 A;  4O2A B;  1XMQ B;  4EEQ A;  2FML A;  1FJG B;  4UVB A;  5KA6 A;  3FAV B;  4UB6 Z;  3OE7 G;  3G67 A;  3ICX A;  4EB6 B;  1IVS A;  1RSO B;  4I4T A;  4LF5 B;  5EZY A;  1GKF A;  4DV6 O;  4GKK B;  4X1Y B;  2Q7G A;  3E22 A;  2DW4 A;  2RMK B;  2Z3Y A;  1G6U A;  1R73 A;  1BS3 A;  4B3R O;  3G6B A;  5KHJ A;  5LBQ A;  2BE3 A;  3CYO A;  1Q43 A;  1OCO C;  5B1B B;  2EIL B;  2YDE A;  4LBE C;  3RGB A;  3JAT B;  5J2U A;  4J9Y B;  4DR4 B;  1V9P A;  2QWO B;  4JI8 O;  2F43 G;  3ABL B;  3T1H O;  2G38 A;  2P7T C;  4JYY A;  2XAQ A;  4WCE V;  1BZK A;  1BT8 A;  3F7Y C;  1OCR B;  1NZ6 A;  3JAR A;  3OM3 B;  4XDJ A;  5KAF Z;  5ITZ B;  3SYO A;  2OT5 A;  2CGN A;  2DMX A;  2Q68 A;  1GRJ A;  4IHJ A;  2DYS C;  5JJJ B;  4BIU A;  4KFM A;  4JAS A;  1Q81 W;  2PY5 A;  4JYA O;  2DQ0 A;  4GX1 A;  4X66 B;  1RM1 C;  1XMO B;  4DV5 O;  1XEQ A;  1WPX A;  3CCQ V;  1CPY A;  3B77 A;  2KSD A;  2HHH B;  2GBO A;  4I0X B;  4JYB A;  5B1A C;  3K9A A;  4MVU A;  3JD4 A;  3QO8 A;  4UCV A;  4I55 B;  1PNM A;  4X1K B;  4DV4 O;  1YDX A;  2K1E A;  1IXB A;  4P9O A;  4JI6 O;  1GN3 A;  3LDD A;  2NR5 A;  3M7M X;  1K8A W;  2EIM B;  2MK3 A;  2Z5U A;  2R72 A;  5JCO A;  2W6J G;  1ZWI C;  3LSS A;  4DR3 B;  3G4S V;  2EZP A;  1K9M W;  1AR4 A;  4FLT A;  1COW G;  1FXK B;  2CK3 G;  3APQ A;  3ZX6 A;  1NR1 A;  2HR3 A;  1H2K A;  1HR0 B;  2XT9 A;  3OD4 A;  2Y0P A;  4LP8 A;  5GTI Z;  4WBN B;  1W0J G;  2UXB B;  3VQV A;  2UXN A;  4DXW A;  4MSW C;  4NVP A;  1WJZ A;  4DW1 A;  4XDL A;  1N32 O;  1VF5 B;  4MVO A;  3JAK A;  1YSC A;  2OCH A;  5E79 Z;  2Q9L A;  1JR9 A;  3RW0 A;  1XHZ A;  2CE4 A;  3ZMT A;  5KLV H;  3K9S A;  3WB1 A;  4NXM O;  3FYI B;  4FLY A;  4GCZ A;  2ARH A;  1B04 A;  2P5O A;  2UUC B;  1F4N A;  3D36 C;  4ZKI A;  2IW5 A;  2JRI A;  1IUR A;  4HNA A;  4FPP A;  4DV3 B;  3SGI A;  1EBO A;  1M56 B;  2AW9 A;  1YCI A;  1AR5 A;  1ZLZ A;  4O4L B;  1BGY H;  1CP9 A;  4LH6 A;  1GAX A;  4GX5 A;  4MTG A;  4CH5 A;  2ZIO A;  3STL C;  4Q20 A;  2HFE C;  3P3N A;  2CH7 B;  1QHT A;  2N74 A;  1M57 B;  1LUW A;  5KUK A;  3HKE B;  3K5L A;  4OX9 B;  3QVN A;  2ZIM A;  4P2Z A;  5KMG A;  5EBL C;  1FPO A;  2XAF A;  5KA5 A;  1N36 B;  5AG2 A;  2YIC A;  3TXQ A;  1HNW O;  1VQK V;  4LF9 O;  2WLL B;  1HWY A;  3CRA A;  2X7R B;  4JPR A;  1GN6 A;  1GO3 F;  3ZHU A;  2A3Q A;  4WFH A;  4UV8 A;  5IY5 C;  3ZHQ A;  1XNR O;  5LMU O;  3UCS C;  3ZHR A;  4FFK A;  3AG4 C;  2UXD B;  1K5Q A;  1PNL A;  4DV1 B;  1SZT A;  1O9H A;  5H6Q A;  1IBL B;  4LFA O;  3BAA A;  4O4J A;  2ZDI C;  4F6R A;  1FXH A;  1ZTE A;  2QJ1 A;  1Y74 A;  1VQ5 V;  1DF5 A;  1B3Q A;  4RWU A;  4UCR A;  2P4V A;  4MTX A;  3CHX A;  5H6R A;  1N0J A;  1TUE B;  4PD4 F;  4O4H A;  4JI4 O;  1XOU A;  4MTO A;  4I9W A;  2EX3 A;  4OPH A;  5IYZ B;  4X1I B;  3ABK C;  5J2U B;  5E1A C;  4J80 A;  2A79 B;  2HLD G;  4FLV A;  2WLI A;  3K0D A;  4ICG A;  5B3S B;  1NT2 B;  2ZR2 A;  5KX5 A;  4PI2 A;  2GSM B;  3VQW A;  4DUZ O;  4YHH O;  1S5L Z;  2Q69 A;  3CEI A;  3C90 A;  4JI3 O;  1GH6 A;  2P06 A;  4LWS A;  1MNG A;  1VP7 A;  3JAR B;  1B6Q A;  1DGS A;  3RT3 C;  1NU1 H;  3RYF A;  2Q67 A;  2LW1 A;  1K97 A;  2VS0 A;  2DE0 X;  1V54 B;  1WPB A;  4AI8 A;  2VQF B;  4IHJ B;  1L0N H;  4BW9 A;  4MT8 A;  1L0L H;  3T1Y O;  1AI4 A;  3GB7 C;  5CBH A;  1KMI Z;  4U3J A;  3CCJ V;  4DR5 O;  2YXH A;  3IC7 A;  3OEH G;  3ZIA G;  1YIJ V;  1XIL A;  4K35 A;  4X8A A;  3ETD A;  3GVM A;  3VOU A;  3LDE A;  3SPI A;  5EYP A;  1ENV A;  3OTO B;  4R50 A;  2WLJ A;  1OCC C;  2Y4T A;  2IJI A;  2KG7 A;  4NTY A;  4WFG A;  4YIP A;  1M93 A;  4K3A A;  4DK1 A;  1QCE A;  4X62 O;  2LFR A;  2PYL A;  1QR9 A;  4L8J A;  4D7S A;  4FFB A;  5FPO A;  1GM7 A;  1I5X A;  2BTQ A;  2R9A A;  1N33 O;  2OYQ A;  1AJN A;  2Y69 B;  1U96 A;  4RQE A;  2XUM A;  1ZL8 A;  3IAY A;  1HNX B;  2YC0 A;  2UXC B;  5B1N A;  1FYJ A;  3BY6 A;  3SPH A;  4I5S A;  2B9Z A;  1SA0 B;  2DWE C;  1NH2 B;  1BHB A;  4JI0 B;  4H37 A;  3L72 H;  3BRC A;  3CRC A;  4F4L A;  3ML0 A;  4JGS A;  2LQT A;  2OCC C;  2QKC A;  5IT9 N;  4WFF A;  4DR6 O;  2AHY A;  4HNA B;  5DN6 G;  1YTF D;  4LCU C;  3K5N A;  1JA8 A;  4R7C A;  1K73 W;  4DV7 B;  4RUE A;  2CTQ A;  5LHH A;  1WLE A;  3D3I A;  4JI5 B;  4DR1 O;  2BOC C;  2QTO A;  1Q6I A;  2R9I A;  3JD2 A;  2OIE A;  3BA8 A;  4B3M O;  3ZN1 A;  1DTO A;  1XNQ B;  2VWJ A;  4I0X A;  1AP6 A;  5D5P A;  5L3E A;  3TET A;  4PDM A;  3ZS8 C;  4H0L B;  3FKS G;  5KMG B;  2CGO A;  2PZS A;  4DV2 O;  2XND G;  3CC7 V;  1AI7 A;  4LNU A;  2Q4P A;  1I94 O;  1E1Q G;  3GWK C;  3ZJZ A;  3WG7 C;  4K0K B;  1XHX A;  2B1I A;  1J5E O;  4A5U B;  2ZXW C;  4KL1 A;  1OCZ B;  4NXN B;  1G8M A;  3P3P A;  4DR7 O;  4W4L A;  3L9D A;  3BEH A;  2JJ2 G;  3N2G A;  1VQ6 V;  1AP5 A;  4JAU A;  1US6 A;  1XRE A;  5K1P A;  4JI7 O;  2FKX A;  1GM9 A;  5LOV A;  3CS5 A;  2CDY A;  1PNK A;  2ZR3 A;  3R66 A;  5GTH Z;  3B8M A;  4O4J B;  2RDC A;  4F6R B;  3HB3 B;  1YIT V;  1Y74 B;  4J9Z B;  2ZQM A;  3ABM B;  4O4H B;  3L71 H;  4YIO A;  5F2V O;  2YIA A;  5CA0 A;  3N2K A;  2ZCE A;  3EXA A;  1RFY A;  1I08 A;  4PA4 A;  3CB2 A;  1SQX H;  2F66 C;  4X64 O;  2NN4 A;  2UUA O;  1TUB A;  3ZHV A;  2WLI B;  1YTF B;  1CXZ B;  1OHH G;  2N04 A;  3C3S A;  4BIO A;  2P4K A;  3SJQ C;  4O4L A;  4FM1 A;  4LWS B;  3CRQ A;  4P9P A;  4KP4 A;  2ZNI A;  1SQF A;  1ZUQ A;  2YXY A;  5KHH A;  5A9G A;  4QPJ A;  4JI1 O;  2CUG A;  1NTZ H;  4WFE A;  3SPJ A;  1LNQ A;  1BQZ A;  5BR8 B;  1K92 A;  4DV0 B;  3HKE A;  3H9V A;  1MOF A;  1UFI A;  4PHZ A;  3DC5 A;  3MHS C;  1SES A;  5CBF A;  1FFT B;  4U3J B;  5L3C A;  4PDR A;  4B3S O;  2JJ1 G;  1K4D C;  4G28 B;  3A0R A;  5L3G A;  1SQG A;  1R3K C;  3E83 A;  3O65 A;  4HYO A;  3AG2 B;  5EYP B;  1H2M A;  2E74 B;  1XUQ A;  3CXC U;  4JAA A;  4B3R B;  2IU3 A;  3OFN G;  4FM0 A;  2YS8 A;  1M5I A;  5IWA O;  3A0H Z;  4FVM A;  5BXZ A;  2ADP A;  1Y67 A;  3SR2 C;  2B1G A;  5JWP A;  5GON A;  1QR8 A;  2YSU B;  1FS0 G;  1A32 A;  2RN9 A;  1YJN V;  5JVD A;  5LMN O;  4FFB B;  2ZNJ A;  2HG5 C;  4U3F H;  2EIK C;  2BTQ B;  1JMK C;  4JI8 B;  1PD3 A;  2A7W A;  3OGC C;  3ABT A;  1M4U A;  4NYK A;  4B08 A;  2O57 A;  3EHB B;  1IBK O;  2EIN C;  1ZL8 B;  5C8Y A;  1Z5V A;  4IIJ B;  3G6E V;  3OMI B;  1K3E A;  3B09 A;  3G71 V;  4B3T B;  5IYZ A;  4X1I A;  1R3J C;  4U7N A;  3OR6 C;  2YXL A;  5KHG A;  1HW7 A;  2P22 C;  2NNU A;  2XAG A;  3OAA G;  1EN4 A;  2F4V B;  3ETE A;  3ZHT A;  4K8Z A;  4LFC O;  2YIB A;  2OTJ V;  4ZOL B;  1XMQ O;  1FJG O;  4C7U A;  4X65 O;  1I5Y A;  1KKC A;  2ATK C;  4LF5 O;  2ITD C;  3K03 A;  3P30 A;  5DEC A;  4TSF G;  4GKK O;  3JCU Z;  1Q7Y W;  3BCC H;  3DC6 A;  5DED A;  3ZRX A;  3RFR A;  4DV4 B;  2Q8V A;  3ZMU A;  1JX9 A;  3ZHS A;  3KKY A;  1QLE C;  1EZV H;  1S5H C;  3CP1 A;  2ODM A;  2OIG A;  1S0V A;  4LC1 A;  4U7O A;  5EC2 C;  1JPX A;  2FTK A;  2V1D A;  4EFE A;  1KD1 W;  2IH1 C;  5CB4 A;  2UXX A;  4NTW A;  1RP3 B;  5JJN B;  1MZF A;  2W0X A;  4LNU B;  1JJ2 U;  4H13 B;  2RQ6 A;  4N23 A;  3T1C A;  4HAM A;  4GT1 A;  3JSN A;  3CCE V;  2IM9 A;  1W0K G;  2ZD9 A;  2BCC H;  4UFZ A;  1N32 B;  5JCO C;  3JAW A;  2DYR C;  3CXH F;  4ZIB A;  2Y0I A;  2HKO A;  1KB9 F;  3N2G B;  5LL6 Y;  3AK3 A;  4JZG A;  1ARO P;  1XL4 A;  5LOV B;  1M1K W;  3QF7 A;  1JOY A;  2DJV A;  3DXR B;  2Q73 A;  2EIJ B;  4YJ2 A;  5CA3 A;  1BL8 A;  3LUT B;  5LA6 B;  3THO A;  1RPO A;  1MSD A;  2QE7 G;  4RUF A;  2QWR B;  4H44 B;  1YZB A;  3FYE B;  1QVG U;  3ZN0 A;  4LF8 O;  1SA0 A;  3SPC A;  4G27 B;  5IYC O;  3WFV A;  5CA0 B;  1NTM H;  3N2K B;  1S72 V;  2UU9 O;  1IZ3 A;  1Y66 A;  3AK2 A;  1TUB B;  5B5E Z;  4IYI A;  3U10 A;  4I9Q A;  2EZO A;  4TUY A;  2M7W A;  5IDJ A;  1NKD A;  2JGD A;  4QGP A;  4DR3 O;  3J7A U;  4PEL A;  3HKB B;  4GYC B;  4MVR A;  4LF4 B;  3ZBH A;  2ZE8 A;  4PJ0 Z;  1HNW B;  3MDS A;  4LF9 B;  1Y4M A;  3SYC A;  2XHB A;  4MS2 A;  1MZE A;  1HR0 O;  4RQF A;  1K5S A;  4NB5 A;  1OV9 A;  2UXB O;  2PI4 A;  3A2F A;  4R6Z A;  2WSS G;  4CZZ A;  1Q6H A;  3ASN C;  3DSQ A;  3CCV V;  2QEX V;  2DQ3 A;  1XNR B;  5LMU B;  1AI5 A;  1Y76 B;  2M6Y A;  1WP8 A;  4QIW F;  1AIL A;  4FLZ A;  1XDC A;  4XBF A;  2ZIN A;  4LFA B;  3CCL V;  3ZRW A;  4GX0 A;  2KB1 A;  4JTC B;  4CS4 A;  4DV3 O;  4KUM A;  2QWN B;  2BSK A;  3UO3 A;  1WNS A;  2BOB C;  5LXT B;  3SJB C;  1V55 B;  4Z2W A;  2R70 A;  4TT3 G;  2KKW A;  5GON B;  4GLX A;  5J9P C;  2LGQ A;  5JVD B;  4FM2 A;  2E76 B;  5LHI A;  1JQ0 A;  2E5L O;  3AG3 B;  5IE9 A;  4FLW A;  3M8A A;  1F51 A;  1AJQ A;  4MW3 A;  2ZM6 O;  1H38 A;  4DUZ B;  4YHH B;  3OT7 A;  4JI3 B;  4X88 A;  1MMM A;  1M9N A;  1F4M A;  3CPW U;  4WFA V;  3M99 B;  5H5N A;  5C8Y B;  2VQE O;  2X0L A;  1FFX A;  2KQX A;  3AG1 C;  2HJD A;  4LH7 A;  3K3W A;  1NJI W;  3CC2 V;  5EIB D;  1BMF G;  1S76 D;  3CRR A;  2ZDI A;  3KCX A;  1MA1 A;  1NH2 D;  1E79 G;  4B7E A;  4GKJ O;  1HNZ B;  4UCT A;  3T1Y B;  3WB2 A;  1TVK B;  2WLH A;  5EK0 A;  3BAB A;  2ZE7 A;  4AQY B;  4DW0 A;  4DV1 O;  1VMG A;  2UUB O;  4CH6 A;  3SYA A;  4DRX A;  1OCO B;  3B4S A;  2A0L A;  2F95 B;  1MSW D;  4JTD B;  4UCO A;  3FB8 C;  2WLM A;  3E8H A;  1SER A;  4TOI A;  1TAE A;  1YEW A;  1BHA A;  4X62 B;  4J11 A;  4E4E A;  2AXT Z;  3DTU B;  1BSM A;  3D3Q A;  4J7J A;  1RPR A;  3K04 A; 
#chains in the Genus database with same CATH homology
 5GTI Z;  3A0B Z;  3KZI Z;  5B66 Z;  3A0H Z;  5B5E Z;  4UB6 Z;  4IL6 Z;  5KAF Z;  3WU2 Z;  5TIS Z;  4UB8 Z;  5GTH Z;  1S5L Z;  5E79 Z;  2AXT Z;  3JCU Z;  4PJ0 Z;  5H2F Z;  5KAI Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...