4PJ0Z

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
molecule tags Oxidoreductase, electron transport
total genus 24
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 4pj0Z00
1S5LZ 4IL6Z 3A0BZ 5E79Z 3WU2Z 5H2FZ 2AXTZ 5KAIZ 5B5EZ 4UB6Z 3KZIZ 3JCUZ 4UB8Z 5TISZ 4PJ0Z 5KAFZ 5B66Z 3A0HZ 5GTHZ 5GTIZ
chains in the Genus database with same CATH superfamily
5CBFA 4DUZO 1HWYA 1LR1A 4FK5C 2XT9A 3CYOA 1SQPH 5F2VO 3K3WA 1BS3A 4G28B 4YY3O 4F6EA 1ZL8B 1H2NA 2IU0A 3K5NA 5L3EA 5BY1A 2Q5ZA 2KB1A 3BEHA 3ABLB 4UCRA 1L8DA 1LUVA 3JALA 5FL7G 3LDCA 4RWUA 4JYBA 2WA3A 1N34B 5BMVB 3FX7A 2G38A 5CMUA 4I50A 4H0LB 2JK5C 4WFGA 1NTZH 4LFAO 3K5MA 1FJGO 3RYIA 2R72A 2WLJA 2DQ3A 2ZE8A 2IH1C 4DR1O 1YJNV 4QPJA 2CTPA 4ICGA 3CB2A 2XAHA 2DWEC 1S3JA 1T5EA 3L70H 3M7MX 2Q68A 1ENVA 2Y4TA 3HKDB 2AGAA 5FPOA 4JI4O 2WWWA 4LCUC 2DYSC 3JAMN 4WFFA 3JARB 1XUQA 3N2GB 2QDOA 3ZIAG 1GO3F 3X2QB 4BW9A 4KP4A 2LQTA 4NXNB 1W59A 2R9AA 3K03A 4H37A 2E75B 4DO2A 1ZL8A 2LW7A 2QR4A 4MTGA 1XNQB 3K79A 2UXCB 4DK0A 2JS3A 4LF5B 2CGNA 5BMVA 2OT5A 1I5XA 1Q6UA 4O4HB 5CA1B 2YIBD 3OMAB 1NQTA 1N8RW 2P5OA 1JQ0A 4MVQA 3JATB 3QVNA 1AI6A 4DUYB 2Y0IA 4DR6B 1QHTA 1X59A 4EEQA 5DECA 4B3MB 3GWKC 3BA8A 1AP6A 1VEWA 1VIBA 3E8HA 1SA0B 3G4SV 3CC7V 1BHAA 2LFRA 2RJZA 1OJHA 3UQ8A 3VQXA 3P30A 3SPGA 4LNUB 4GX1A 3JARA 5C8YB 2F4VO 1XL6A 3N2GA 3BFRA 3I55V 5LHHA 3EVKA 4QGPA 1GN4A 4FLWA 1GM8A 2WLHA 4X64O 3AK3A 3MD0A 2VRZA 2Z0AA 3VQWA 2LGWA 4FM2A 4JTCB 2FYUH 3SDLA 3TXQA 2YS8A 4JI1B 4LFBO 2QA4V 3LNMB 2DYSB 1XBLA 3DC6A 3H1LH 2Y69C 2QTSA 2BE3A 4O4HA 5CA1A 4LWSB 4F4LA 5IE9A 4AQYO 5B1NA 3C3TA 3JATA 2P7TC 4FLUA 1NS1A 4PDRA 1MNGA 3CS5A 4FM1A 3P3PA 2A06H 3C3SA 4XDKA 4B3RO 2EZPA 1VQ5V 3T2MA 3ZBHA 1QU7A 1S77D 4ZHQB 2ZXWB 3J7AU 1SA0A 1YSCA 1AILA 3EFFK 1R3KC 1RPOA 1JJOA 3B09A 4JI3O 3HR0A 2QKAA 5GONB 1YJWV 4DR2B 1NKDA 3RVYA 4LNUA 3SYAA 2LO1A 3JAWB 5C8YA 4O2AA 2CDYA 3BVOA 1NR1A 3L75H 3OUSA 4DR7O 4DV4B 3OTFA 4DRXB 1DK1A 1ORQC 1U97A 1CPYA 3SPCA 5LGNA 4J80A 4X1KB 3FKSG 4PDVA 4PA7A 1VQ4V 5H6RA 3ZHRA 4LF9O 2IJJA 2QSAA 5L3GA 4LFCB 2B1GA 1SQFA 3H9VA 1MSWD 3KZIZ 2CE4A 4J7JA 1IBLO 1R3IC 4LWSA 1Q3EA 1Q43A 4ABMA 2GTSA 2YI8A 5LHGA 3RN4A 2ITCC 4DV5B 3ZHSA 3CRRA 2UUCO 3CCEV 3MDSA 5LXTB 2EIMC 2QKSA 2Q7EA 1IX9A 1YTFB 3CHXA 5EIBC 4ZHQA 1SQXH 2PTMA 3BAAA 2ARHA 1I08A 1NZ6A 2QWOB 4YJ2B 5GONA 1N36B 4UFZA 2OTLV 5L3DA 5FNVA 1EBOA 5KHGA 1K97A 3JAWA 4J9YB 2V1DA 2NNUA 2PI5A 3OTOO 4F6RB 1G8MA 4NB5A 1XEQA 4DRXA 2RN9A 3J80N 2UU9O 1RSOB 1HP8A 4JASA 1GAXA 4NXMO 4I0XB 1K9MW 2ZM6B 1Y74B 2K9PA 4X1KA 2JJ1G 3CEIA 3U11A 2HLDG 4YIOA 5J2TB 5JCOC 1L1FA 4DUZB 4E4EA 3CX5F 2HHHB 3UO3A 5LMUB 1NVPB 3U0ZA 4YY3B 4W4LA 1E1RG 3I56V 2RDCA 5FPRA 3AG1B 4BAYA 1VQMV 3OD4A 2Q8VA 3F5WC 2EX3A 2JRIA 2QM4A 4BIZA 1MSDA 1P7GA 4KXRA 3T4DA 3OR6C 5KA5A 3CXCU 3L74H 5LXTA 4JI5O 5KA6A 1H38A 3BY6A 3ETGA 4LFAB 2DYRC 1H2SB 2QKCA 1FJGB 4O4LB 4L87A 1HW7A 4YJ2A 5EBLC 1AROP 2PUSA 4P30A 4U7NA 1GM7A 2UXXA 2A3QA 2EIMB 4GX0A 2WLKA 4B3TO 3N2KB 5C93A 2VS0A 3OEEG 1PV0A 4F6RA 2LP7A 1AJPA 2ZCEA 1RSOA 4JI0O 1NT2B 4I0XA 1IDSA 5KX5B 1Y74A 4QE7A 1YI2V 2QWPB 4JI4B 4JAVA 3E35A 2XASA 5J2TA 4WFEA 5B66Z 4DV1O 2ILMA 1XILA 2YIDA 2ZE7A 2EBOA 4OXSA 3H01A 2W6JG 1N0NA 4J41A 2P4KA 3CC2V 1SQBH 2O57A 3ABTA 3BABA 1M93A 1SQGA 3VQYA 1PL4A 2F66C 4K0KO 5GTHZ 1PM9A 4TSFG 5H6QA 4H44B 3K58A 4O4LA 3SPJA 1EN6A 4J9ZB 3JYCA 4FLYA 4EFBA 3JD0A 5BR8B 3WB1A 1KBHA 4LF4O 3UO2A 4LH6A 5HFMA 3N2KA 1AJNA 5D5PA 2OIEA 5H9CA 4I4TB 5KX5A 4YHHO 3H1KH 4I9QA 2BCCH 5E79Z 4GKJO 4MVZA 3Q4HB 1YVWA 5EZYB 2WPDG 3A8TA 2HR3A 2E74B 3T1YO 2H94A 2D3OW 4TWKA 2Q67A 1O9GA 2ZQMA 1XOUA 4R7CA 3ZEDA 1K34A 5EC1C 4CBCA 5K1PA 3E2EA 3A0HZ 4X64B 2IJIA 3ML0A 1OCRC 1YIJV 2M6YA 2IBZH 2XAQA 3OFNG 3A0BZ 1QNMA 3B8NA 3ZS8C 4LFBB 4D6TH 1DGSA 5JCOA 1A32A 3K5OA 2WLLB 4C7UA 1HNWB 5EC2C 4MT8A 1QVGU 2EINC 4X65O 5IT9N 3CRCA 1YF2A 1HR0O 2QWRB 3HKEB 1M57B 1MA1A 4QIWF 1VQOV 1YXBA 3ZHQA 1QLNA 3AG3C 4JI8O 2YI9A 4CH6A 1K4DC 3D3QA 3LDEA 1RM1C 2QGNA 3W7WA 4I4TA 4DV0O 4JYAB 3JAKB 3Q4HA 1N32B 5EZYA 2YDEA 4CS3A 3HB3B 4ZIBA 5DN6G 5JH7B 1PD3A 1VQ6V 1UJWB 3G80A 1GH6A 4NTYA 4NVPA 4K8ZA 3L71H 2UUBO 3C90A 4LF9B 1XHXA 2JIZG 4TOIA 1H2GA 3B77A 4NTXA 2N04A 2WLLA 2P90A 2HEPA 4LF6B 4FLXA 5IWAO 1WPBA 1AJQA 4DR4O 1OCRB 4CC6A 4GT1A 3RYFB 2QTOA 3W7XA 2UUCB 3RVZA 4YXWG 2R70A 3HKEA 4KUMA 1OCZC 2Q73A 2WLMA 1JX9A 3OEHG 3ZRSA 1MZEA 1TA8A 3FB5C 5A2QN 3CCQV 2D2CB 5E1AC 5TISZ 2VWJA 5EBWC 2EIKC 3CSXA 4I9WA 5L3BA 2CGOA 5AG2A 3JAKA 1FFTB 1TGOA 4JPRA 3ASNC 1HDJA 1DLBA 3J81N 4JI6O 3OTOB 3AG3B 4IYHA 5JH7A 1RM1B 4NXMB 3A2FA 1EZVH 4BIOA 5A9GA 1AR4A 5EK0A 4KHPO 1THZA 4X8AA 4J42A 1GMGA 3MAQA 5KLVH 1IXMA 5IYDO 4N23A 2X7RB 1ZWIC 4UV9A 2HP8A 4MS2A 1UFIA 3D36C 1F23A 1FXKC 1CP9A 4XBFA 3OT7A 2FKXA 3GVMA 1TAEA 3ABUA 1BHBA 2Y4UA 2QM7A 2CTWA 3LSQA 4JI5B 2IJHA 5ITZB 3HKCB 3ZJZA 3CWBH 1H8EG 3SJCC 2PGGA 3B2EE 1P4RA 1KUQA 2IH3C 4RUEA 4X9QA 4QNHB 1QR8A 4JTAB 1K5QA 4R50A 3DXRB 3EXAA 3JCUZ 1JOYA 1WAZA 1J95A 1YDXA 1NTKH 4PA3A 1OCZB 3K57A 1G6UA 3TXSA 2HKOA 1H2KA 2WA4A 3MHHC 2AHZA 1V9PA 4X89A 1OCOC 4JI0B 3E89A 2ZR3A 3AEIA 4UCOA 2EIKB 3HKDA 3KCYA 1F4MA 3E8FA 3K0GA 4PI2A 4ASUG 4PA6A 1Y6XA 3U10A 4UCTA 4JF3A 4H13B 3ASNB 1KECA 3UKMA 5LYJB 1LUWA 4B08A 4PHZA 1O9HA 2Q7HA 2W6IG 3L9DA 4GYCB 4DK1A 4LF8B 3KKYA 5LOVB 4X1IB 5LHIA 5ITZA 3HKCA 4K0KB 3AG2C 4D7SA 4IHJB 1Y67A 2VQEO 2OIGA 3ETEA 1XMOO 4JTDB 4OPHA 4I55B 1FXKB 3DXRA 1RFYA 2ZE6A 5LMNO 3CRMA 2PF4E 4LF4B 2Z5UA 4DW1A 4ZI7B 1Q6IA 1DTOA 2C2AA 3TGUH 4DV7O 4X66O 1Q86W 4DW0A 3OM3B 4O4JB 1Y66A 4YHHB 4YIPA 1GRJA 1JFFB 4D7TA 4GKJB 5JJNB 3PN1A 3IC7A 1M5IA 1Q7YW 4QE9A 2RMKB 3SGIA 4X62O 2WAMA 3SYPA 1QLEC 4WBNB 3OGIB 5LYJA 1PNKA 2CAZC 4GKKO 4DV3O 4LF7O 1OCOB 2XAJA 1LNQA 3SYCA 2UXBO 1Z5WA 1GN2A 2KSDA 2HFEC 1Q5OA 5IYBO 1JJ2U 4QPKA 1KD1W 5LOVA 4X1IA 4J7ZA 1AI5A 3S3WA 4IHJA 1WB8A 1V54C 4PD4F 3R65A 4X65B 1KQSU 4I55A 1FXKA 4Z1MG 1HR0B 3CCMV 4GCZA 2FB5A 1S0VA 3NR7A 4R6ZA 4ZI7A 2HVKC 2Y69B 4GX2A 4JI8B 3AG2B 1ZTEA 5EYPB 1NI8A 1Y76B 3CD6V 4O4JA 2GV9A 1NH2B 1R6TA 1TUBB 2ZKOA 3QO8A 1JFFA 5JVDB 3S3XA 3VBBA 4B7EA 2N74A 4OX9O 1DF4A 4B3SB 4IL6Z 2GHYA 3SJAC 1N34O 4UCSA 1CXZB 1KKDA 1IBMO 4WBNA 3ASOC 3T1HO 3CE2A 3JASB 1GK9A 2UUBB 1QR9A 3P3NA 4JV5O 2BTOA 3GB7C 4K35A 3ABMC 1RP3B 1I94O 2Q0AA 3TCUA 2GBOA 4DV2O 4MTOA 2ADQB 4U7OA 2XHBA 4CH4A 4DR4B 4MVRA 2PZSA 1W0JG 3AG7A 2UXDO 1ZLZA 2Z3YA 2VQFO 1L0NH 4P9OA 5EYPA 2E76B 5JJJB 3OE7G 1Y76A 3RYCB 2XAGA 4CS4A 2AXTZ 1L0LH 3MHSC 1K92A 4JZGA 2QM8A 2DN9A 2ITDC 3OMNB 1TUBA 2Y48A 4IIJB 5JVDA 1URFA 1EN4A 1WB7A 1XNRO 5IJ9B 2PYJA 1AI7A 1XHZA 2P22C 2CTRA 4DR1B 1XNQO 3ZMTA 2UXCO 4BWAA 4MVMA 1S5LZ 3WB2A 4MTFA 2Q0OC 2RQ6A 3RBZA 3WU2Z 2QE7G 3JASA 3APQA 4AI8A 2UUAO 4UB6Z 5LP6C 1P7BA 5KHIA 4UB8Z 2LFSA 3BA9A 4DUYO 4O2BB 2ATKC 2JS5A 1XMQO 5FLXN 2F95B 3ASOB 1D2DA 1AP5A 5IDJA 3K5LA 2RCVA 2M7WA 1M1KW 4I5SA 1VQKV 3B40A 3ABMB 3SYQA 1YTFD 1YJ9V 2DQ0A 1JR9A 2ETNA 2E3CA 3CJHB 5KMGB 4CZZA 3T1CA 2GSMB 4W4KA 5LGTA 4QJFB 2N05A 3RYCA 3G6BA 3GWOA 4IIJA 2JVDA 4DR3O 3VOUA 1NJIW 1MZFA 1XL4A 5IJ9A 1D5NA 3SPIA 3CCVV 4PDMA 3JD2A 2CTQA 1AR1B 1P84F 3LDDA 4PI0A 4UXNA 3THOA 2OCCC 1QQCA 1US6A 2DYRB 3PJSK 1W0KG 2W0XA 5L3FA 1V55C 1TUEB 2W0FC 1MABG 1BCCH 1NVPD 1BGYH 1GM9A 3FB8C 3ZRVA 4O2BA 3RT3C 1KC8W 4FLVA 2F4VB 1PP9H 2P6JA 1S5JA 4RAIA 1Z2GA 3K9AA 2X6BA 3JD1A 1WP7A 1BT8A 5BZBA 2CK3G 2X0LA 4FLTA 1VMGA 3CXHF 4EB6B 1YEWA 1P49A 1IVSA 2FMLA 5LP6B 4EKWA 3UCSC 4HZ3A 3SJQC 3E86A 1KB9F 5IY5C 1VF5B 2YUAA 3CJHA 2ZE5A 4OGQB 5KMGA 1VARA 3FB6C 4CH3A 1JMKC 3RW0A 2VQEB 4JZ2A 1XMOB 3DSQA 2L35A 4AQYB 1FPOA 4FFBB 3IC9A 4JYCA 4XDJA 4FZ1A 1J5EO 3ZRWB 2EILC 3KCXA 3LSUA 4IT5A 2GTAA 1YCIA 4MW8A 1H2LA 3CCJV 4JI2O 4B3RB 4DV7B 3HKBB 3CMEV 4DXWA 1ROPA 2H3OA 5B1BC 4JI3B 1G4YB 2ZT9B 2AHYA 3W7TA 1QCEA 4X62B 1G1XB 3LSSA 1PPJH 2ZD9A 3DTUB 5DM6V 3E83A 2OCHA 4DR7B 1N33O 4GKKB 1IBKO 2LGQA 4DV3B 3DGEA 2XNDG 2QWNB 2YSUB 4EB6A 2UXBB 1V55B 5IYZB 1F7YA 5LP6A 3OGCC 3QG5A 1EZJA 1N36O 4N21A 1S72V 2LW1A 4FJCC 2JEXA 2PY5A 2P67A 3K04A 4WCEV 1MMMA 4CH5A 4P9PA 2WSSG 1GKFA 2H8PC 3CPWU 1FD9A 1IBLB 2CUGA 4MVSA 4TT3G 3W7UA 2Y0PA 5H5NA 3D3IA 1U96A 1KYOF 4FFBA 2ZM6O 2KQXA 5HFLA 3ZRWA 1R3JC 4X1YB 1YITV 1N4CA 5IY5B 4IYIA 2HJFC 2B1IA 4UCUA 2XTAA 2HHHO 5LMUO 1VQNV 4G27B 1JPXA 3HKBA 3CCUV 1OZ0A 1K73W 1X4TA 5KUMA 4JAAA 2EINB 1M56C 2VWKA 4DV6O 1WA8B 5CA0B 1VQ9V 2EILB 1FXHA 2B9ZA 4OX9B 3JCZA 3TETA 4J10A 1XDCA 2MK3A 4TQDA 2E5LO 1ZUQA 1IBMB 5LGUA 1KU9A 3DC5A 2XAFA 3QF7A 3T1HB 3OUFA 4G2KA 1H2MA 2UU9B 3ICXA 5B1BB 4Q20A 3N27A 5DEDA 5IYZA 4JV5B 1KMIZ 4MVUA 5KHJA 3SPHA 1AVMA 2YIBA 1I94B 4I7ZB 4E2LA 3TK1A 3CP1A 1OCCC 3H1HH 4DV2B 4HBNA 1BQZA 4PA9A 3QO5A 2F93B 1HNZO 4B7KA 4Z1VA 3LUTB 4FMTA 2HG5C 4RO2A 3RYFA 1SZTA 3O9OA 2UXDB 4X1YA 1GTOA 1RPRA 3E8BA 2VQFB 3SYOA 4LC1A 1M9NA 2A9HA 3IGAC 1WP8A 2EJRA 4A5UB 4ZOLB 2ZIMA 4O4IB 1KP2A 1AR5A 5LL6Y 5L3CA 3ZN1A 1XNRB 1WA8A 5CA0A 4IGGA 4PA4A 4LBEC 3K59A 4K3AA 1Q8IA 1FS0G 3EHBB 2BSKB 4WFAV 2PI4A 4RQFA 2X6CA 1H8HG 4B3TB 3ABKC 1D5AA 1EM1A 3ZHTA 1PKXA 1NTMH 2Q69A 1XREA 4WF9V 1DF5A 2ZXWC 2YEVB 2UUAB 5D5QA 1M56B 1BZKA 2MW2B 4H33A 3RWRD 2V7QG 3OMIB 3B4SA 3I5DA 2IJKA 5B1AC 3M99B 5BR8O 4DV1B 1XMQB 1WJZA 2KG7B 1CEZA 1F51A 4JI7O 2Q9LA 1M90W 3W7SA 3ZX6A 1BQ0A 2KKWA 5LBQA 3B8MA 3BPZA 3BCCH 5KHHA 4TV8B 1BMFG 4GLXA 2DMXA 2ZR2A 1OCCB 1HNXO 4O2AB 1F4NA 1Q6HA 2QEXV 3O65A 1GN3A 5IYCO 1QBZA 3CCSV 1NU1H 5GTIZ 4ZOLA 3F5TA 4O4IA 3ETDA 4DR3B 2EULA 3R66A 3ZMZA 2BSKA 4MSWC 3E8GA 4FLZA 4PJ0Z 5B1OA 4LH7A 1HNWO 2YC0A 4BR6A 2YEVA 3NXSA 2AW9A 1R6KA 3ZMUA 4J11A 5CN0A 2Q7GA 5J9PC 3FAVB 1Y4MA 2JEUA 1OV9A 3L73H 2HJDA 3T1YB 4Q6GA 2KG7A 3ABKB 5JWPA 3SR2C 2DW4A 3IAYA 4HAMA 2BTQB 2L6LA 4MW3A 4GZRB 3CCRV 5CBHA 4JYAO 4TV8A 5FNVB 4J7KA 4X20B 1N32O 2FL4A 2JGUA 1SRYA 1PL0A 5B1AB 1EN5A 1SC5B 4FPPA 1VF7A 4DR5O 3JD4A 3ZMSA 3P32A 5J2UB 4UUJC 5CB4B 3D36A 3AG1C 2PYLA 4PELA 1J5EB 3BRCA 5JJEB 4GUNA 4L8JA 3HPLC 1M4UA 1SF9A 5LA6B 1YHQV 3CCLV 2P4VA 4KFMA 4JI2B 2ZDIC 4FM0A 4NR1A 3K06A 4LF6O 3IJ4A 3F7VC 1FFXB 3STZC 1SS3A 2IU3A 4YJ3B 1BL8A 4DV0B 1VQ8V 3FAVA 2JGDB 2OTJV 3E22B 2R9RB 4OPAA 2HVJC 4Z2WA 1QVFU 1E79G 3JSLA 1XI1A 1N33B 1IBKB 1I0HA 4FFKA 4JYYA 2BTQA 2OWOA 1SERA 1S5HC 2WLIB 4R8CA 3K08A 4X20A 1WN7A 2RNBA 1I7FA 3H1IH 3JSNA 1ZAUA 1VQ7V 1COWG 3L72H 3ZHUA 1QLEB 3BHPA 2V4DA 1AI4A 1K33A 2EZOA 5J2UA 4AHCA 1R6NA 5CB4A 2DOSA 4UVAA 3OW2U 5B3SC 5IWAB 1ZX3A 4TV9B 4JGSA 4BW5A 4HYOA 4AILC 2XUMA 5LA6A 2P06A 4P2ZA 3VQVA 2YXLA 1VF6C 2EIJC 4WFBV 3CC4V 4EFEA 2ZIOA 1UPGA 4PDLA 1FKAO 4U3FH 1V54B 1FFXA 4NXNO 1Q90D 3FYIB 1K8AW 4YJ3A 1FXVA 1ZSPA 4DV6B 3G6EV 3KG2A 3ZRXA 4NKGB 3STLC 3AK1A 2JGDA 3RYHB 3E22A 2F43G 4HNAB 4JAUA 1I5YA 1MG1A 3UT5B 2DE0X 3OAAG 3QTCA 2E5LB 2DWDC 4LF5O 4GX5A 4JI6B 4CC5A 4RQEA 3H1JH 3T4ZA 2JDIG 3M8AA 3K9SA 4TUYB 4KHPB 2WLIA 3FD9A 2GDSA 2XOKG 3ZMVA 4DR6O 3QO7A 2CH7B 2YXHA 2ZNIA 3CRAA 5KHKA 1HNZB 3RGBA 4B3MO 1BSMA 2X6AA 1GN6A 3CMAV 4TV9A 5H2FZ 4U3JB 4UCVA 4FVMA 3SJBC 4PV1B 4MVOA 1NH2D 1K5SA 1WPXA 1SQQH 4KL1A 4MTXA 1E1QG 2NN4A 1SZXA 2F23A 2Q6AA 1W2BU 5B3SB 5JQGB 5KUKA 3ETQA 1MOFA 4NYKA 3WG7C 2K1EA 5IJ0B 3TJTA 4LF8O 2FTKA 2ZINA 3RYHA 4JI1O 4HNAA 1WLEA 2EIJB 1M57C 1IZ3A 3UT5A 3AG4C 4BIUA 3CRQA 3FYEB 2ZDIA 2Q4PA 4DYLA 1PNLA 2UXNA 2LJ2A 1TVKB 4K8XA 1NR7A 1JCHA 1BE3H 4TUYA 5GW7A 3AK2A 4X88A 4RUFA 2QWQB 4LR3A 2CH7A 2R9IA 1K4CC 4UVCA 4JI7B 1R3LC 3F7YC 5KAFZ 3ZCCA 1SESA 5CA3A 1B6QA 1K3EA 4U3JA 3IFXA 4ZBMA 3ZHVA 3K0DA 4DR2O 5KAIZ 5CBGA 4UV8A 1HNXB 2F1MA 2OYQA 1Z5VA 1B06A 3QNEA 4DV4O 4ZKIA 1WNSA 3UM7A 2A79B 3D8CA 5JQGA 2WLNA 2EJ7A 5BXZA 2YXYA 1N0JA 5IJ0A 5LMNB 2YICA 2GUZB 1JA8A 2BOBC 3ABLC 5EIBD 2AZ0A 1VF6A 2NLJC 1Q81W 2A7WA 1K7DA 5B5EZ 1XQ8A 1KKCA 3APOA 4UVBA 4LFCO 2ADPA 1B04A 5K1XA 4X66B 3FB7C 1SQVH 1TVKA 2A0LA 1R1BA 1S76D 1IXBA 3WG7B 4DV5O 4CS2A 1B3QA 3LNNA 4WFHA 1VQPV 3JALB 1FAFA 2AZ2A 3AG4B 4I50B 2YIAA 4FIPC 2JJ2G 2QJ1A 1Q82W 2OCCB 4LF7B 1VP7A 1IURA 2B5UA 1PNMA 1AB3A 3RYIB 2ZNJA 3A0RA 3G67A 1EFRG 3WB0A 4B3SO 3JD3A 3WFVA 3ZN0A 3G71V 4DR5B 2IM9A 4TQFA 3OR7C 1JVMA 1FYJA 1SKVA 3X2QC 1VQLV 1YZBA 4LP8A 1OHHG 4NTWA 1SETA 2NR5A 1KP3A 4XDLA 1R73A 2BOCC 1NBMG 2DJVA 5EBMC 4FZ0A 3FFQA 3RFRA 2ODMA 2IW5A 2GUZA
chains in the Genus database with same CATH topology
1S5LZ 4IL6Z 3A0BZ 5E79Z 3WU2Z 5H2FZ 2AXTZ 5KAIZ 5B5EZ 4UB6Z 3KZIZ 3JCUZ 4UB8Z 5TISZ 4PJ0Z 5KAFZ 5B66Z 3A0HZ 5GTHZ 5GTIZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L Z;  4IL6 Z;  3A0B Z;  5E79 Z;  3WU2 Z;  5H2F Z;  2AXT Z;  5KAI Z;  5B5E Z;  4UB6 Z;  3KZI Z;  3JCU Z;  4UB8 Z;  5TIS Z;  4PJ0 Z;  5KAF Z;  5B66 Z;  3A0H Z;  5GTH Z;  5GTI Z; 
#chains in the Genus database with same CATH topology
 5CBF A;  4DUZ O;  1HWY A;  1LR1 A;  4FK5 C;  2XT9 A;  3CYO A;  1SQP H;  5F2V O;  3K3W A;  1BS3 A;  4G28 B;  4YY3 O;  4F6E A;  1ZL8 B;  1H2N A;  2IU0 A;  3K5N A;  5L3E A;  5BY1 A;  2Q5Z A;  2KB1 A;  3BEH A;  3ABL B;  4UCR A;  1L8D A;  1LUV A;  3JAL A;  5FL7 G;  3LDC A;  4RWU A;  4JYB A;  2WA3 A;  1N34 B;  5BMV B;  3FX7 A;  2G38 A;  5CMU A;  4I50 A;  4H0L B;  2JK5 C;  4WFG A;  1NTZ H;  4LFA O;  3K5M A;  1FJG O;  3RYI A;  2R72 A;  2WLJ A;  2DQ3 A;  2ZE8 A;  2IH1 C;  4DR1 O;  1YJN V;  4QPJ A;  2CTP A;  4ICG A;  3CB2 A;  2XAH A;  2DWE C;  1S3J A;  1T5E A;  3L70 H;  3M7M X;  2Q68 A;  1ENV A;  2Y4T A;  3HKD B;  2AGA A;  5FPO A;  4JI4 O;  2WWW A;  4LCU C;  2DYS C;  3JAM N;  4WFF A;  3JAR B;  1XUQ A;  3N2G B;  2QDO A;  3ZIA G;  1GO3 F;  3X2Q B;  4BW9 A;  4KP4 A;  2LQT A;  4NXN B;  1W59 A;  2R9A A;  3K03 A;  4H37 A;  2E75 B;  4DO2 A;  1ZL8 A;  2LW7 A;  2QR4 A;  4MTG A;  1XNQ B;  3K79 A;  2UXC B;  4DK0 A;  2JS3 A;  4LF5 B;  2CGN A;  5BMV A;  2OT5 A;  1I5X A;  1Q6U A;  4O4H B;  5CA1 B;  2YIB D;  3OMA B;  1NQT A;  1N8R W;  2P5O A;  1JQ0 A;  4MVQ A;  3JAT B;  3QVN A;  1AI6 A;  4DUY B;  2Y0I A;  4DR6 B;  1QHT A;  1X59 A;  4EEQ A;  5DEC A;  4B3M B;  3GWK C;  3BA8 A;  1AP6 A;  1VEW A;  1VIB A;  3E8H A;  1SA0 B;  3G4S V;  3CC7 V;  1BHA A;  2LFR A;  2RJZ A;  1OJH A;  3UQ8 A;  3VQX A;  3P30 A;  3SPG A;  4LNU B;  4GX1 A;  3JAR A;  5C8Y B;  2F4V O;  1XL6 A;  3N2G A;  3BFR A;  3I55 V;  5LHH A;  3EVK A;  4QGP A;  1GN4 A;  4FLW A;  1GM8 A;  2WLH A;  4X64 O;  3AK3 A;  3MD0 A;  2VRZ A;  2Z0A A;  3VQW A;  2LGW A;  4FM2 A;  4JTC B;  2FYU H;  3SDL A;  3TXQ A;  2YS8 A;  4JI1 B;  4LFB O;  2QA4 V;  3LNM B;  2DYS B;  1XBL A;  3DC6 A;  3H1L H;  2Y69 C;  2QTS A;  2BE3 A;  4O4H A;  5CA1 A;  4LWS B;  4F4L A;  5IE9 A;  4AQY O;  5B1N A;  3C3T A;  3JAT A;  2P7T C;  4FLU A;  1NS1 A;  4PDR A;  1MNG A;  3CS5 A;  4FM1 A;  3P3P A;  2A06 H;  3C3S A;  4XDK A;  4B3R O;  2EZP A;  1VQ5 V;  3T2M A;  3ZBH A;  1QU7 A;  1S77 D;  4ZHQ B;  2ZXW B;  3J7A U;  1SA0 A;  1YSC A;  1AIL A;  3EFF K;  1R3K C;  1RPO A;  1JJO A;  3B09 A;  4JI3 O;  3HR0 A;  2QKA A;  5GON B;  1YJW V;  4DR2 B;  1NKD A;  3RVY A;  4LNU A;  3SYA A;  2LO1 A;  3JAW B;  5C8Y A;  4O2A A;  2CDY A;  3BVO A;  1NR1 A;  3L75 H;  3OUS A;  4DR7 O;  4DV4 B;  3OTF A;  4DRX B;  1DK1 A;  1ORQ C;  1U97 A;  1CPY A;  3SPC A;  5LGN A;  4J80 A;  4X1K B;  3FKS G;  4PDV A;  4PA7 A;  1VQ4 V;  5H6R A;  3ZHR A;  4LF9 O;  2IJJ A;  2QSA A;  5L3G A;  4LFC B;  2B1G A;  1SQF A;  3H9V A;  1MSW D;  3KZI Z;  2CE4 A;  4J7J A;  1IBL O;  1R3I C;  4LWS A;  1Q3E A;  1Q43 A;  4ABM A;  2GTS A;  2YI8 A;  5LHG A;  3RN4 A;  2ITC C;  4DV5 B;  3ZHS A;  3CRR A;  2UUC O;  3CCE V;  3MDS A;  5LXT B;  2EIM C;  2QKS A;  2Q7E A;  1IX9 A;  1YTF B;  3CHX A;  5EIB C;  4ZHQ A;  1SQX H;  2PTM A;  3BAA A;  2ARH A;  1I08 A;  1NZ6 A;  2QWO B;  4YJ2 B;  5GON A;  1N36 B;  4UFZ A;  2OTL V;  5L3D A;  5FNV A;  1EBO A;  5KHG A;  1K97 A;  3JAW A;  4J9Y B;  2V1D A;  2NNU A;  2PI5 A;  3OTO O;  4F6R B;  1G8M A;  4NB5 A;  1XEQ A;  4DRX A;  2RN9 A;  3J80 N;  2UU9 O;  1RSO B;  1HP8 A;  4JAS A;  1GAX A;  4NXM O;  4I0X B;  1K9M W;  2ZM6 B;  1Y74 B;  2K9P A;  4X1K A;  2JJ1 G;  3CEI A;  3U11 A;  2HLD G;  4YIO A;  5J2T B;  5JCO C;  1L1F A;  4DUZ B;  4E4E A;  3CX5 F;  2HHH B;  3UO3 A;  5LMU B;  1NVP B;  3U0Z A;  4YY3 B;  4W4L A;  1E1R G;  3I56 V;  2RDC A;  5FPR A;  3AG1 B;  4BAY A;  1VQM V;  3OD4 A;  2Q8V A;  3F5W C;  2EX3 A;  2JRI A;  2QM4 A;  4BIZ A;  1MSD A;  1P7G A;  4KXR A;  3T4D A;  3OR6 C;  5KA5 A;  3CXC U;  3L74 H;  5LXT A;  4JI5 O;  5KA6 A;  1H38 A;  3BY6 A;  3ETG A;  4LFA B;  2DYR C;  1H2S B;  2QKC A;  1FJG B;  4O4L B;  4L87 A;  1HW7 A;  4YJ2 A;  5EBL C;  1ARO P;  2PUS A;  4P30 A;  4U7N A;  1GM7 A;  2UXX A;  2A3Q A;  2EIM B;  4GX0 A;  2WLK A;  4B3T O;  3N2K B;  5C93 A;  2VS0 A;  3OEE G;  1PV0 A;  4F6R A;  2LP7 A;  1AJP A;  2ZCE A;  1RSO A;  4JI0 O;  1NT2 B;  4I0X A;  1IDS A;  5KX5 B;  1Y74 A;  4QE7 A;  1YI2 V;  2QWP B;  4JI4 B;  4JAV A;  3E35 A;  2XAS A;  5J2T A;  4WFE A;  5B66 Z;  4DV1 O;  2ILM A;  1XIL A;  2YID A;  2ZE7 A;  2EBO A;  4OXS A;  3H01 A;  2W6J G;  1N0N A;  4J41 A;  2P4K A;  3CC2 V;  1SQB H;  2O57 A;  3ABT A;  3BAB A;  1M93 A;  1SQG A;  3VQY A;  1PL4 A;  2F66 C;  4K0K O;  5GTH Z;  1PM9 A;  4TSF G;  5H6Q A;  4H44 B;  3K58 A;  4O4L A;  3SPJ A;  1EN6 A;  4J9Z B;  3JYC A;  4FLY A;  4EFB A;  3JD0 A;  5BR8 B;  3WB1 A;  1KBH A;  4LF4 O;  3UO2 A;  4LH6 A;  5HFM A;  3N2K A;  1AJN A;  5D5P A;  2OIE A;  5H9C A;  4I4T B;  5KX5 A;  4YHH O;  3H1K H;  4I9Q A;  2BCC H;  5E79 Z;  4GKJ O;  4MVZ A;  3Q4H B;  1YVW A;  5EZY B;  2WPD G;  3A8T A;  2HR3 A;  2E74 B;  3T1Y O;  2H94 A;  2D3O W;  4TWK A;  2Q67 A;  1O9G A;  2ZQM A;  1XOU A;  4R7C A;  3ZED A;  1K34 A;  5EC1 C;  4CBC A;  5K1P A;  3E2E A;  3A0H Z;  4X64 B;  2IJI A;  3ML0 A;  1OCR C;  1YIJ V;  2M6Y A;  2IBZ H;  2XAQ A;  3OFN G;  3A0B Z;  1QNM A;  3B8N A;  3ZS8 C;  4LFB B;  4D6T H;  1DGS A;  5JCO A;  1A32 A;  3K5O A;  2WLL B;  4C7U A;  1HNW B;  5EC2 C;  4MT8 A;  1QVG U;  2EIN C;  4X65 O;  5IT9 N;  3CRC A;  1YF2 A;  1HR0 O;  2QWR B;  3HKE B;  1M57 B;  1MA1 A;  4QIW F;  1VQO V;  1YXB A;  3ZHQ A;  1QLN A;  3AG3 C;  4JI8 O;  2YI9 A;  4CH6 A;  1K4D C;  3D3Q A;  3LDE A;  1RM1 C;  2QGN A;  3W7W A;  4I4T A;  4DV0 O;  4JYA B;  3JAK B;  3Q4H A;  1N32 B;  5EZY A;  2YDE A;  4CS3 A;  3HB3 B;  4ZIB A;  5DN6 G;  5JH7 B;  1PD3 A;  1VQ6 V;  1UJW B;  3G80 A;  1GH6 A;  4NTY A;  4NVP A;  4K8Z A;  3L71 H;  2UUB O;  3C90 A;  4LF9 B;  1XHX A;  2JIZ G;  4TOI A;  1H2G A;  3B77 A;  4NTX A;  2N04 A;  2WLL A;  2P90 A;  2HEP A;  4LF6 B;  4FLX A;  5IWA O;  1WPB A;  1AJQ A;  4DR4 O;  1OCR B;  4CC6 A;  4GT1 A;  3RYF B;  2QTO A;  3W7X A;  2UUC B;  3RVZ A;  4YXW G;  2R70 A;  3HKE A;  4KUM A;  1OCZ C;  2Q73 A;  2WLM A;  1JX9 A;  3OEH G;  3ZRS A;  1MZE A;  1TA8 A;  3FB5 C;  5A2Q N;  3CCQ V;  2D2C B;  5E1A C;  5TIS Z;  2VWJ A;  5EBW C;  2EIK C;  3CSX A;  4I9W A;  5L3B A;  2CGO A;  5AG2 A;  3JAK A;  1FFT B;  1TGO A;  4JPR A;  3ASN C;  1HDJ A;  1DLB A;  3J81 N;  4JI6 O;  3OTO B;  3AG3 B;  4IYH A;  5JH7 A;  1RM1 B;  4NXM B;  3A2F A;  1EZV H;  4BIO A;  5A9G A;  1AR4 A;  5EK0 A;  4KHP O;  1THZ A;  4X8A A;  4J42 A;  1GMG A;  3MAQ A;  5KLV H;  1IXM A;  5IYD O;  4N23 A;  2X7R B;  1ZWI C;  4UV9 A;  2HP8 A;  4MS2 A;  1UFI A;  3D36 C;  1F23 A;  1FXK C;  1CP9 A;  4XBF A;  3OT7 A;  2FKX A;  3GVM A;  1TAE A;  3ABU A;  1BHB A;  2Y4U A;  2QM7 A;  2CTW A;  3LSQ A;  4JI5 B;  2IJH A;  5ITZ B;  3HKC B;  3ZJZ A;  3CWB H;  1H8E G;  3SJC C;  2PGG A;  3B2E E;  1P4R A;  1KUQ A;  2IH3 C;  4RUE A;  4X9Q A;  4QNH B;  1QR8 A;  4JTA B;  1K5Q A;  4R50 A;  3DXR B;  3EXA A;  3JCU Z;  1JOY A;  1WAZ A;  1J95 A;  1YDX A;  1NTK H;  4PA3 A;  1OCZ B;  3K57 A;  1G6U A;  3TXS A;  2HKO A;  1H2K A;  2WA4 A;  3MHH C;  2AHZ A;  1V9P A;  4X89 A;  1OCO C;  4JI0 B;  3E89 A;  2ZR3 A;  3AEI A;  4UCO A;  2EIK B;  3HKD A;  3KCY A;  1F4M A;  3E8F A;  3K0G A;  4PI2 A;  4ASU G;  4PA6 A;  1Y6X A;  3U10 A;  4UCT A;  4JF3 A;  4H13 B;  3ASN B;  1KEC A;  3UKM A;  5LYJ B;  1LUW A;  4B08 A;  4PHZ A;  1O9H A;  2Q7H A;  2W6I G;  3L9D A;  4GYC B;  4DK1 A;  4LF8 B;  3KKY A;  5LOV B;  4X1I B;  5LHI A;  5ITZ A;  3HKC A;  4K0K B;  3AG2 C;  4D7S A;  4IHJ B;  1Y67 A;  2VQE O;  2OIG A;  3ETE A;  1XMO O;  4JTD B;  4OPH A;  4I55 B;  1FXK B;  3DXR A;  1RFY A;  2ZE6 A;  5LMN O;  3CRM A;  2PF4 E;  4LF4 B;  2Z5U A;  4DW1 A;  4ZI7 B;  1Q6I A;  1DTO A;  2C2A A;  3TGU H;  4DV7 O;  4X66 O;  1Q86 W;  4DW0 A;  3OM3 B;  4O4J B;  1Y66 A;  4YHH B;  4YIP A;  1GRJ A;  1JFF B;  4D7T A;  4GKJ B;  5JJN B;  3PN1 A;  3IC7 A;  1M5I A;  1Q7Y W;  4QE9 A;  2RMK B;  3SGI A;  4X62 O;  2WAM A;  3SYP A;  1QLE C;  4WBN B;  3OGI B;  5LYJ A;  1PNK A;  2CAZ C;  4GKK O;  4DV3 O;  4LF7 O;  1OCO B;  2XAJ A;  1LNQ A;  3SYC A;  2UXB O;  1Z5W A;  1GN2 A;  2KSD A;  2HFE C;  1Q5O A;  5IYB O;  1JJ2 U;  4QPK A;  1KD1 W;  5LOV A;  4X1I A;  4J7Z A;  1AI5 A;  3S3W A;  4IHJ A;  1WB8 A;  1V54 C;  4PD4 F;  3R65 A;  4X65 B;  1KQS U;  4I55 A;  1FXK A;  4Z1M G;  1HR0 B;  3CCM V;  4GCZ A;  2FB5 A;  1S0V A;  3NR7 A;  4R6Z A;  4ZI7 A;  2HVK C;  2Y69 B;  4GX2 A;  4JI8 B;  3AG2 B;  1ZTE A;  5EYP B;  1NI8 A;  1Y76 B;  3CD6 V;  4O4J A;  2GV9 A;  1NH2 B;  1R6T A;  1TUB B;  2ZKO A;  3QO8 A;  1JFF A;  5JVD B;  3S3X A;  3VBB A;  4B7E A;  2N74 A;  4OX9 O;  1DF4 A;  4B3S B;  4IL6 Z;  2GHY A;  3SJA C;  1N34 O;  4UCS A;  1CXZ B;  1KKD A;  1IBM O;  4WBN A;  3ASO C;  3T1H O;  3CE2 A;  3JAS B;  1GK9 A;  2UUB B;  1QR9 A;  3P3N A;  4JV5 O;  2BTO A;  3GB7 C;  4K35 A;  3ABM C;  1RP3 B;  1I94 O;  2Q0A A;  3TCU A;  2GBO A;  4DV2 O;  4MTO A;  2ADQ B;  4U7O A;  2XHB A;  4CH4 A;  4DR4 B;  4MVR A;  2PZS A;  1W0J G;  3AG7 A;  2UXD O;  1ZLZ A;  2Z3Y A;  2VQF O;  1L0N H;  4P9O A;  5EYP A;  2E76 B;  5JJJ B;  3OE7 G;  1Y76 A;  3RYC B;  2XAG A;  4CS4 A;  2AXT Z;  1L0L H;  3MHS C;  1K92 A;  4JZG A;  2QM8 A;  2DN9 A;  2ITD C;  3OMN B;  1TUB A;  2Y48 A;  4IIJ B;  5JVD A;  1URF A;  1EN4 A;  1WB7 A;  1XNR O;  5IJ9 B;  2PYJ A;  1AI7 A;  1XHZ A;  2P22 C;  2CTR A;  4DR1 B;  1XNQ O;  3ZMT A;  2UXC O;  4BWA A;  4MVM A;  1S5L Z;  3WB2 A;  4MTF A;  2Q0O C;  2RQ6 A;  3RBZ A;  3WU2 Z;  2QE7 G;  3JAS A;  3APQ A;  4AI8 A;  2UUA O;  4UB6 Z;  5LP6 C;  1P7B A;  5KHI A;  4UB8 Z;  2LFS A;  3BA9 A;  4DUY O;  4O2B B;  2ATK C;  2JS5 A;  1XMQ O;  5FLX N;  2F95 B;  3ASO B;  1D2D A;  1AP5 A;  5IDJ A;  3K5L A;  2RCV A;  2M7W A;  1M1K W;  4I5S A;  1VQK V;  3B40 A;  3ABM B;  3SYQ A;  1YTF D;  1YJ9 V;  2DQ0 A;  1JR9 A;  2ETN A;  2E3C A;  3CJH B;  5KMG B;  4CZZ A;  3T1C A;  2GSM B;  4W4K A;  5LGT A;  4QJF B;  2N05 A;  3RYC A;  3G6B A;  3GWO A;  4IIJ A;  2JVD A;  4DR3 O;  3VOU A;  1NJI W;  1MZF A;  1XL4 A;  5IJ9 A;  1D5N A;  3SPI A;  3CCV V;  4PDM A;  3JD2 A;  2CTQ A;  1AR1 B;  1P84 F;  3LDD A;  4PI0 A;  4UXN A;  3THO A;  2OCC C;  1QQC A;  1US6 A;  2DYR B;  3PJS K;  1W0K G;  2W0X A;  5L3F A;  1V55 C;  1TUE B;  2W0F C;  1MAB G;  1BCC H;  1NVP D;  1BGY H;  1GM9 A;  3FB8 C;  3ZRV A;  4O2B A;  3RT3 C;  1KC8 W;  4FLV A;  2F4V B;  1PP9 H;  2P6J A;  1S5J A;  4RAI A;  1Z2G A;  3K9A A;  2X6B A;  3JD1 A;  1WP7 A;  1BT8 A;  5BZB A;  2CK3 G;  2X0L A;  4FLT A;  1VMG A;  3CXH F;  4EB6 B;  1YEW A;  1P49 A;  1IVS A;  2FML A;  5LP6 B;  4EKW A;  3UCS C;  4HZ3 A;  3SJQ C;  3E86 A;  1KB9 F;  5IY5 C;  1VF5 B;  2YUA A;  3CJH A;  2ZE5 A;  4OGQ B;  5KMG A;  1VAR A;  3FB6 C;  4CH3 A;  1JMK C;  3RW0 A;  2VQE B;  4JZ2 A;  1XMO B;  3DSQ A;  2L35 A;  4AQY B;  1FPO A;  4FFB B;  3IC9 A;  4JYC A;  4XDJ A;  4FZ1 A;  1J5E O;  3ZRW B;  2EIL C;  3KCX A;  3LSU A;  4IT5 A;  2GTA A;  1YCI A;  4MW8 A;  1H2L A;  3CCJ V;  4JI2 O;  4B3R B;  4DV7 B;  3HKB B;  3CME V;  4DXW A;  1ROP A;  2H3O A;  5B1B C;  4JI3 B;  1G4Y B;  2ZT9 B;  2AHY A;  3W7T A;  1QCE A;  4X62 B;  1G1X B;  3LSS A;  1PPJ H;  2ZD9 A;  3DTU B;  5DM6 V;  3E83 A;  2OCH A;  4DR7 B;  1N33 O;  4GKK B;  1IBK O;  2LGQ A;  4DV3 B;  3DGE A;  2XND G;  2QWN B;  2YSU B;  4EB6 A;  2UXB B;  1V55 B;  5IYZ B;  1F7Y A;  5LP6 A;  3OGC C;  3QG5 A;  1EZJ A;  1N36 O;  4N21 A;  1S72 V;  2LW1 A;  4FJC C;  2JEX A;  2PY5 A;  2P67 A;  3K04 A;  4WCE V;  1MMM A;  4CH5 A;  4P9P A;  2WSS G;  1GKF A;  2H8P C;  3CPW U;  1FD9 A;  1IBL B;  2CUG A;  4MVS A;  4TT3 G;  3W7U A;  2Y0P A;  5H5N A;  3D3I A;  1U96 A;  1KYO F;  4FFB A;  2ZM6 O;  2KQX A;  5HFL A;  3ZRW A;  1R3J C;  4X1Y B;  1YIT V;  1N4C A;  5IY5 B;  4IYI A;  2HJF C;  2B1I A;  4UCU A;  2XTA A;  2HHH O;  5LMU O;  1VQN V;  4G27 B;  1JPX A;  3HKB A;  3CCU V;  1OZ0 A;  1K73 W;  1X4T A;  5KUM A;  4JAA A;  2EIN B;  1M56 C;  2VWK A;  4DV6 O;  1WA8 B;  5CA0 B;  1VQ9 V;  2EIL B;  1FXH A;  2B9Z A;  4OX9 B;  3JCZ A;  3TET A;  4J10 A;  1XDC A;  2MK3 A;  4TQD A;  2E5L O;  1ZUQ A;  1IBM B;  5LGU A;  1KU9 A;  3DC5 A;  2XAF A;  3QF7 A;  3T1H B;  3OUF A;  4G2K A;  1H2M A;  2UU9 B;  3ICX A;  5B1B B;  4Q20 A;  3N27 A;  5DED A;  5IYZ A;  4JV5 B;  1KMI Z;  4MVU A;  5KHJ A;  3SPH A;  1AVM A;  2YIB A;  1I94 B;  4I7Z B;  4E2L A;  3TK1 A;  3CP1 A;  1OCC C;  3H1H H;  4DV2 B;  4HBN A;  1BQZ A;  4PA9 A;  3QO5 A;  2F93 B;  1HNZ O;  4B7K A;  4Z1V A;  3LUT B;  4FMT A;  2HG5 C;  4RO2 A;  3RYF A;  1SZT A;  3O9O A;  2UXD B;  4X1Y A;  1GTO A;  1RPR A;  3E8B A;  2VQF B;  3SYO A;  4LC1 A;  1M9N A;  2A9H A;  3IGA C;  1WP8 A;  2EJR A;  4A5U B;  4ZOL B;  2ZIM A;  4O4I B;  1KP2 A;  1AR5 A;  5LL6 Y;  5L3C A;  3ZN1 A;  1XNR B;  1WA8 A;  5CA0 A;  4IGG A;  4PA4 A;  4LBE C;  3K59 A;  4K3A A;  1Q8I A;  1FS0 G;  3EHB B;  2BSK B;  4WFA V;  2PI4 A;  4RQF A;  2X6C A;  1H8H G;  4B3T B;  3ABK C;  1D5A A;  1EM1 A;  3ZHT A;  1PKX A;  1NTM H;  2Q69 A;  1XRE A;  4WF9 V;  1DF5 A;  2ZXW C;  2YEV B;  2UUA B;  5D5Q A;  1M56 B;  1BZK A;  2MW2 B;  4H33 A;  3RWR D;  2V7Q G;  3OMI B;  3B4S A;  3I5D A;  2IJK A;  5B1A C;  3M99 B;  5BR8 O;  4DV1 B;  1XMQ B;  1WJZ A;  2KG7 B;  1CEZ A;  1F51 A;  4JI7 O;  2Q9L A;  1M90 W;  3W7S A;  3ZX6 A;  1BQ0 A;  2KKW A;  5LBQ A;  3B8M A;  3BPZ A;  3BCC H;  5KHH A;  4TV8 B;  1BMF G;  4GLX A;  2DMX A;  2ZR2 A;  1OCC B;  1HNX O;  4O2A B;  1F4N A;  1Q6H A;  2QEX V;  3O65 A;  1GN3 A;  5IYC O;  1QBZ A;  3CCS V;  1NU1 H;  5GTI Z;  4ZOL A;  3F5T A;  4O4I A;  3ETD A;  4DR3 B;  2EUL A;  3R66 A;  3ZMZ A;  2BSK A;  4MSW C;  3E8G A;  4FLZ A;  4PJ0 Z;  5B1O A;  4LH7 A;  1HNW O;  2YC0 A;  4BR6 A;  2YEV A;  3NXS A;  2AW9 A;  1R6K A;  3ZMU A;  4J11 A;  5CN0 A;  2Q7G A;  5J9P C;  3FAV B;  1Y4M A;  2JEU A;  1OV9 A;  3L73 H;  2HJD A;  3T1Y B;  4Q6G A;  2KG7 A;  3ABK B;  5JWP A;  3SR2 C;  2DW4 A;  3IAY A;  4HAM A;  2BTQ B;  2L6L A;  4MW3 A;  4GZR B;  3CCR V;  5CBH A;  4JYA O;  4TV8 A;  5FNV B;  4J7K A;  4X20 B;  1N32 O;  2FL4 A;  2JGU A;  1SRY A;  1PL0 A;  5B1A B;  1EN5 A;  1SC5 B;  4FPP A;  1VF7 A;  4DR5 O;  3JD4 A;  3ZMS A;  3P32 A;  5J2U B;  4UUJ C;  5CB4 B;  3D36 A;  3AG1 C;  2PYL A;  4PEL A;  1J5E B;  3BRC A;  5JJE B;  4GUN A;  4L8J A;  3HPL C;  1M4U A;  1SF9 A;  5LA6 B;  1YHQ V;  3CCL V;  2P4V A;  4KFM A;  4JI2 B;  2ZDI C;  4FM0 A;  4NR1 A;  3K06 A;  4LF6 O;  3IJ4 A;  3F7V C;  1FFX B;  3STZ C;  1SS3 A;  2IU3 A;  4YJ3 B;  1BL8 A;  4DV0 B;  1VQ8 V;  3FAV A;  2JGD B;  2OTJ V;  3E22 B;  2R9R B;  4OPA A;  2HVJ C;  4Z2W A;  1QVF U;  1E79 G;  3JSL A;  1XI1 A;  1N33 B;  1IBK B;  1I0H A;  4FFK A;  4JYY A;  2BTQ A;  2OWO A;  1SER A;  1S5H C;  2WLI B;  4R8C A;  3K08 A;  4X20 A;  1WN7 A;  2RNB A;  1I7F A;  3H1I H;  3JSN A;  1ZAU A;  1VQ7 V;  1COW G;  3L72 H;  3ZHU A;  1QLE B;  3BHP A;  2V4D A;  1AI4 A;  1K33 A;  2EZO A;  5J2U A;  4AHC A;  1R6N A;  5CB4 A;  2DOS A;  4UVA A;  3OW2 U;  5B3S C;  5IWA B;  1ZX3 A;  4TV9 B;  4JGS A;  4BW5 A;  4HYO A;  4AIL C;  2XUM A;  5LA6 A;  2P06 A;  4P2Z A;  3VQV A;  2YXL A;  1VF6 C;  2EIJ C;  4WFB V;  3CC4 V;  4EFE A;  2ZIO A;  1UPG A;  4PDL A;  1FKA O;  4U3F H;  1V54 B;  1FFX A;  4NXN O;  1Q90 D;  3FYI B;  1K8A W;  4YJ3 A;  1FXV A;  1ZSP A;  4DV6 B;  3G6E V;  3KG2 A;  3ZRX A;  4NKG B;  3STL C;  3AK1 A;  2JGD A;  3RYH B;  3E22 A;  2F43 G;  4HNA B;  4JAU A;  1I5Y A;  1MG1 A;  3UT5 B;  2DE0 X;  3OAA G;  3QTC A;  2E5L B;  2DWD C;  4LF5 O;  4GX5 A;  4JI6 B;  4CC5 A;  4RQE A;  3H1J H;  3T4Z A;  2JDI G;  3M8A A;  3K9S A;  4TUY B;  4KHP B;  2WLI A;  3FD9 A;  2GDS A;  2XOK G;  3ZMV A;  4DR6 O;  3QO7 A;  2CH7 B;  2YXH A;  2ZNI A;  3CRA A;  5KHK A;  1HNZ B;  3RGB A;  4B3M O;  1BSM A;  2X6A A;  1GN6 A;  3CMA V;  4TV9 A;  5H2F Z;  4U3J B;  4UCV A;  4FVM A;  3SJB C;  4PV1 B;  4MVO A;  1NH2 D;  1K5S A;  1WPX A;  1SQQ H;  4KL1 A;  4MTX A;  1E1Q G;  2NN4 A;  1SZX A;  2F23 A;  2Q6A A;  1W2B U;  5B3S B;  5JQG B;  5KUK A;  3ETQ A;  1MOF A;  4NYK A;  3WG7 C;  2K1E A;  5IJ0 B;  3TJT A;  4LF8 O;  2FTK A;  2ZIN A;  3RYH A;  4JI1 O;  4HNA A;  1WLE A;  2EIJ B;  1M57 C;  1IZ3 A;  3UT5 A;  3AG4 C;  4BIU A;  3CRQ A;  3FYE B;  2ZDI A;  2Q4P A;  4DYL A;  1PNL A;  2UXN A;  2LJ2 A;  1TVK B;  4K8X A;  1NR7 A;  1JCH A;  1BE3 H;  4TUY A;  5GW7 A;  3AK2 A;  4X88 A;  4RUF A;  2QWQ B;  4LR3 A;  2CH7 A;  2R9I A;  1K4C C;  4UVC A;  4JI7 B;  1R3L C;  3F7Y C;  5KAF Z;  3ZCC A;  1SES A;  5CA3 A;  1B6Q A;  1K3E A;  4U3J A;  3IFX A;  4ZBM A;  3ZHV A;  3K0D A;  4DR2 O;  5KAI Z;  5CBG A;  4UV8 A;  1HNX B;  2F1M A;  2OYQ A;  1Z5V A;  1B06 A;  3QNE A;  4DV4 O;  4ZKI A;  1WNS A;  3UM7 A;  2A79 B;  3D8C A;  5JQG A;  2WLN A;  2EJ7 A;  5BXZ A;  2YXY A;  1N0J A;  5IJ0 A;  5LMN B;  2YIC A;  2GUZ B;  1JA8 A;  2BOB C;  3ABL C;  5EIB D;  2AZ0 A;  1VF6 A;  2NLJ C;  1Q81 W;  2A7W A;  1K7D A;  5B5E Z;  1XQ8 A;  1KKC A;  3APO A;  4UVB A;  4LFC O;  2ADP A;  1B04 A;  5K1X A;  4X66 B;  3FB7 C;  1SQV H;  1TVK A;  2A0L A;  1R1B A;  1S76 D;  1IXB A;  3WG7 B;  4DV5 O;  4CS2 A;  1B3Q A;  3LNN A;  4WFH A;  1VQP V;  3JAL B;  1FAF A;  2AZ2 A;  3AG4 B;  4I50 B;  2YIA A;  4FIP C;  2JJ2 G;  2QJ1 A;  1Q82 W;  2OCC B;  4LF7 B;  1VP7 A;  1IUR A;  2B5U A;  1PNM A;  1AB3 A;  3RYI B;  2ZNJ A;  3A0R A;  3G67 A;  1EFR G;  3WB0 A;  4B3S O;  3JD3 A;  3WFV A;  3ZN0 A;  3G71 V;  4DR5 B;  2IM9 A;  4TQF A;  3OR7 C;  1JVM A;  1FYJ A;  1SKV A;  3X2Q C;  1VQL V;  1YZB A;  4LP8 A;  1OHH G;  4NTW A;  1SET A;  2NR5 A;  1KP3 A;  4XDL A;  1R73 A;  2BOC C;  1NBM G;  2DJV A;  5EBM C;  4FZ0 A;  3FFQ A;  3RFR A;  2ODM A;  2IW5 A;  2GUZ A; 
#chains in the Genus database with same CATH homology
 1S5L Z;  4IL6 Z;  3A0B Z;  5E79 Z;  3WU2 Z;  5H2F Z;  2AXT Z;  5KAI Z;  5B5E Z;  4UB6 Z;  3KZI Z;  3JCU Z;  4UB8 Z;  5TIS Z;  4PJ0 Z;  5KAF Z;  5B66 Z;  3A0H Z;  5GTH Z;  5GTI Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...