4PJ0Z

Structure of t.elongatus photosystem ii, rows of dimers crystal packing
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase, electron transport
molecule keywords Photosystem Q(B) protein 1
publication title Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
pubmed doi rcsb
total genus 24
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2014-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 4pj0Z00
5TISZ 4UB6Z 4UB8Z 5GTIZ 3A0HZ 5KAFZ 5KAIZ 4PJ0Z 3A0BZ 2AXTZ 3JCUZ 1S5LZ 5B5EZ 5H2FZ 3WU2Z 5GTHZ 5E79Z 5B66Z 3KZIZ 4IL6Z
chains in the Genus database with same CATH superfamily
5LP6C 3CMEV 5EIBD 5KHIA 1S0VA 4Z2WA 2P22C 4GX0A 4GT1A 5JWPA 4Z1MG 4LF5O 3CC4V 4W4KA 3SYCA 3OMNB 1NU1H 1BS3A 1U97A 5DM6V 2ZE7A 3ICXA 4ZHQA 2YS8A 2XTAA 4JI5O 4PDLA 1CXZB 2FMLA 1KQSU 3QF7A 2FYUH 4X64O 3RYFA 5KUKA 3FB8C 2Q7GA 4I0XA 2E75B 5JQGB 5J9PC 2R9IA 3CS5A 2DOSA 3D36C 4PA6A 1L0LH 5FNVB 2DYSC 2JK5C 3JD3A 3GVMA 4EFBA 4KP4A 1NJIW 4JI6O 4FFKA 3JCUZ 2FTKA 5C93A 2K1EA 4BW5A 3GB7C 3HB3B 2WAMA 3G67A 2CTWA 2ADQB 1JR9A 2UU9O 3RVZA 4B3TB 4MW8A 4KXRA 1TUBB 3DXRB 1VQLV 4O2BB 2AZ0A 1VF6C 3W7XA 4LF4B 2WLNA 5B1BB 3AG4B 2WLHA 3OTOB 1VARA 4IIJA 2B9ZA 2YDEA 3SJBC 2DN9A 3J7AU 3U10A 2CDYA 2F4VO 3IC7A 3W7TA 4O4LA 5IYDO 1K4CC 3D3IA 3LSSA 4N21A 3OE7G 4ZKIA 4B3SO 4B3MO 2UXCB 1GKFA 4IGGA 3E86A 2XASA 3EHBB 5D5QA 3QG5A 2XUMA 4O4IA 4X1KA 4JI4O 1MSWD 1QLEC 5J2UB 1NTKH 4PA7A 4H44B 4O4HB 3B8NA 1QBZA 3CSXA 1SQPH 1OV9A 1JCHA 5EC2C 1WB7A 1R3IC 2LFRA 4NXNB 3VBBA 4MVUA 2C2AA 3N27A 4PV1B 3G80A 4J7JA 2RCVA 2YXLA 4PA4A 1QU7A 1QCEA 1JPXA 1Q5OA 2A7WA 2OIGA 2XAJA 3E35A 5EYPA 4TV9B 4B3RO 3QO8A 3E22A 2WLLA 3JAWB 4MS2A 2HP8A 2PYJA 1F51A 2HR3A 3HKEA 5CA3A 1URFA 2ZM6B 4OX9O 3KKYA 2WA3A 1AI6A 4IHJA 4F6EA 1KYOF 1X59A 5EBMC 4YXWG 4FM1A 1ENVA 4CH3A 1VF5B 1AR1B 4DR1O 3E8HA 4I55A 4OXSA 3B8MA 3H1LH 1G4YB 1IBKB 1XMOO 2IU3A 3APOA 3B40A 1Q6UA 2WA4A 4X62O 5EC1C 1S3JA 4DR5B 1I5XA 5ITZA 1B04A 3T1CA 4HBNA 5B3SB 5CB4A 4IT5A 3DSQA 1EM1A 1KUQA 3N2KA 5LA6B 3OUSA 3F7YC 1N36O 4AQYB 1QR9A 4LP8A 2KB1A 4JI3O 3X2QC 4GCZA 5L3DA 4JI2O 1IBLB 1W2BU 5A9GA 3PJSK 3THOA 2HG5C 5LYJA 1IBMO 2R9RB 3F5WC 1Y4MA 1WN7A 4JPRA 4PDMA 3T1HO 5B3SC 4PDRA 4ASUG 2UXDB 5EIBC 5CN0A 2BSKA 4I50A 3CRCA 3LNNA 1MNGA 3O65A 4MW3A 3ZRWA 4MVSA 5KMGB 1LNQA 4YJ2A 4EB6B 2UUAB 3R65A 3Q4HB 4TUYA 3T4DA 4DV0O 1FJGB 1I94O 2WLIB 2WLKA 4K8XA 3MDSA 4UCRA 2PYLA 2A3QA 3OTFA 1GN2A 4J7ZA 1YI2V 5KHGA 3HKDA 4YHHB 4LF9B 3APQA 3STLC 3DTUB 3A8TA 3L73H 2UXNA 5KAFZ 1I08A 3FAVB 1H2LA 4FM0A 1NVPB 1SC5B 1J5EB 4U3FH 4GLXA 2WPDG 3WFVA 4P30A 4UVAA 2IH3C 4DV4B 4LF6O 1PD3A 3I5DA 1VQ5V 1UPGA 2QTSA 3TK1A 4DV6B 1HWYA 1YVWA 4I4TA 3QO5A 1EFRG 2GV9A 1RP3B 1HNWB 3K5OA 2Q69A 1CEZA 1LR1A 1QVFU 2EIMB 5JVDB 5KHKA 2OCCB 1BMFG 4FLUA 5L3CA 5LL6Y 4TT3G 2ITDC 1WPXA 5KUMA 4YJ3A 3EVKA 1YZBA 3B09A 3K06A 4Q20A 1BT8A 5EK0A 3RYIB 1EN5A 5HFLA 4JZ2A 4LF4O 1PNMA 2Z3YA 5KX5A 4I5SA 1J95A 1JFFB 4UXNA 5E1AC 2CGNA 3ZX6A 3SR2C 1SQGA 2D2CB 4Z1VA 5F2VO 2QGNA 5GTIZ 4MVMA 4JI1O 4UCUA 1B3QA 4LCUC 4D7TA 2YXYA 3OFNG 4U7NA 1EBOA 5C8YB 4I9QA 3CJHA 4JI0B 2UUBB 4NTWA 2CAZC 1YTFB 4WFEA 1W0KG 1VQ4V 1MSDA 4RAIA 2XAQA 1VF7A 4QIWF 3FB5C 4DW1A 1GK9A 4NXNO 1JQ0A 4ZI7B 1AJNA 1K73W 3CPWU 2ODMA 4D7SA 3ABMB 3ZHQA 3RYCB 4JYYA 4F4LA 1S77D 1SESA 1HNXO 2EZPA 1OJHA 4AI8A 2FB5A 4O4JA 2Q0OC 1MG1A 4FZ0A 3EXAA 2P90A 2PI5A 4PD4F 3F7VC 4J9YB 2WSSG 4CH5A 1WLEA 5JH7A 3LDEA 4ZOLA 4PDVA 5B1AB 3ABMC 3ASNC 3OMIB 1T5EA 3E89A 5L3BA 5JCOA 1XI1A 1BCCH 1Q43A 2JRIA 2JGDB 4JTCB 1IBKO 4LH6A 5GONA 1DK1A 4JZGA 4Q6GA 5D5PA 1M1KW 4NXMB 1IURA 3LDDA 4DR5O 3K3WA 1YXBA 5L3FA 4LF7B 1OCOB 1GM8A 4ZHQB 1Z2GA 1F4NA 3ASOB 1K5QA 4C7UA 3KCXA 3FYIB 1SETA 5B1AC 3K5LA 4B7EA 4G2KA 5CA0B 1GAXA 3ZHRA 1IBLO 2YEVA 1N32B 1KU9A 3C3TA 1Y6XA 2YICA 4A5UB 3A0BZ 3VQVA 2UXBO 3RN4A 4WFFA 1FFXA 2P7TC 5IT9N 4ZBMA 3CEIA 4KHPB 1AVMA 1OCOC 4X88A 5CA1B 2IH1C 5H5NA 1TVKB 2UXDO 4NR1A 3OAAG 3ABTA 1F23A 2OYQA 3CRAA 3CX5F 3LSUA 2XHBA 3HPLC 4DUYO 3CRRA 1GN6A 5IYZB 1ORQC 3P32A 4CS2A 1PP9H 4X9QA 3L74H 4MT8A 1YDXA 5LHIA 1MA1A 4NYKA 2HVKC 1NTMH 4DXWA 1MMMA 2B1GA 1FKAO 5H6QA 1OCCC 4YHHO 1AB3A 1DF5A 3OW2U 3STZC 5JJJB 3ZJZA 2ZIMA 3JATB 3SGIA 4K35A 3RVYA 2LW1A 4JI8B 1H8EG 3K59A 2F23A 2Y69B 1BGYH 1YF2A 3CCSV 3LNMB 4LFCB 5BMVA 4CC5A 5CBHA 3NR7A 3T4ZA 4FLTA 2RQ6A 1JA8A 1F4MA 3AG3C 2DE0X 5LXTB 3BY6A 4DV4O 3DGEA 1Q82W 1XUQA 4F6RA 1NT2B 5KAIZ 2CH7B 4YY3B 4PA9A 1XHXA 5EBWC 1AP6A 4WFHA 3H9VA 1JX9A 1S72V 1SQQH 4X66B 1V55B 2Y69C 2WLLB 1ZAUA 3ZMTA 1QNMA 3T2MA 1SA0A 5IJ9B 1IZ3A 1YJNV 4FFBB 4WFGA 1YIJV 1LUWA 4O2AB 1ZL8B 3RT3C 5BXZA 2VQFB 3I55V 1H38A 4FLXA 4X1IB 4JV5B 4HNAB 5FL7G 4DR3B 1KKDA 2QWOB 3HKCB 4QE7A 1MOFA 1V55C 4BW9A 2QEXV 2A9HA 4PELA 2DYSB 1MZFA 1NR7A 4GZRB 4P9PA 1FXHA 4R8CA 3N2GB 1NKDA 1K92A 3JAMN 1QR8A 1NR1A 3SPCA 5KHJA 4JF3A 1NQTA 3JASB 3N2KB 1N4CA 1O9HA 5LMUB 2UUBO 4GKJO 2DYRC 5EZYB 1I5YA 1FFTB 1WA8B 2P4KA 2IJJA 4J11A 4B08A 3ML0A 3S3XA 2KG7A 5IJ0B 4PI0A 4DR4B 1NBMG 2EJ7A 1Y76B 2M7WA 3UT5A 3RYHB 3QVNA 1JJ2U 2WLJA 4JYAO 4JYBA 2IJIA 4LFBB 5DN6G 1KKCA 1SRYA 3CB2A 1F7YA 2IJHA 3EFFK 3W7WA 2GUZA 4NVPA 2X6BA 1AROP 1NTZH 1L8DA 4OPHA 1QLEB 4TUYB 1IXMA 1W0JG 1H2GA 3K5MA 4U3JB 2ZDIA 4L87A 1NI8A 3MD0A 3ZMUA 4BIUA 5BR8O 3ETDA 3NXSA 3JALB 3HKDB 3TXSA 4NKGB 2UUCB 1WNSA 4J42A 5HFMA 2W6IG 3ZBHA 3JAKA 3WB2A 3BHPA 2LGQA 3CCUV 4X1YA 1K34A 4HAMA 3SYOA 2HHHO 4WFAV 2DJVA 2BTQB 1IVSA 3BVOA 2QM4A 5KHHA 1M5IA 2JDIG 1VEWA 2EINB 3HKBA 2UXXA 2H94A 1KP2A 2Q68A 2HJDA 2IJKA 1N34O 1P7GA 1BHBA 1AI4A 4CBCA 1R73A 1H2KA 2V4DA 4KHPO 4N23A 5GW7A 4PHZA 3ZN1A 4X20A 4DV3O 4DV7O 4YJ3B 4K0KO 1M56C 1KB9F 1M90W 1M93A 1HR0O 4LF8O 2VRZA 2EINC 4NTXA 4RO2A 5LP6A 3BEHA 1XMQO 2Y0PA 3OR6C 3CCVV 3B2EE 2P6JA 3X2QB 1QQCA 1FYJA 4DK0A 1Q6IA 2BOCC 4FIPC 1AP5A 3P30A 3GWOA 1TUEB 3ZHUA 4G28B 1YEWA 1KMIZ 1IX9A 1GO3F 3ABLB 3K57A 4LWSB 1Q81W 3TGUH 3L75H 3H1IH 4QGPA 3BABA 1EN4A 3D36A 4DR6B 3CWBH 1BL8A 2AHZA 4K8ZA 4TV8B 1FD9A 2ILMA 2E5LB 2R72A 5LOVB 3W7SA 3UO3A 3TXQA 2WWWA 2KQXA 1DTOA 1RSOB 1SERA 1XREA 4DR7O 4JTAB 3SPGA 3W7UA 5BZBA 4H37A 3TETA 1SZTA 3C90A 4WCEV 1COWG 3ABLC 2ZT9B 4X66O 1VF6A 5JQGA 4X8AA 3ETEA 3ZMVA 5IE9A 2HVJC 1M4UA 3QNEA 1ZUQA 1FXVA 4X65B 5FNVA 3T1YB 4U7OA 4H13B 3JD2A 3K5NA 1Q6HA 3O9OA 3CHXA 2RJZA 1XHZA 1OCRC 2QWNB 4EEQA 2N74A 2LW7A 4DUZB 2YC0A 2VQFO 1BQZA 1PNKA 3KG2A 2YIBA 3RWRD 1TUBA 3DXRA 4O2BA 2QWPB 4UCVA 4FJCC 4UB6Z 3K9AA 2E3CA 2EIKC 4GKKB 1N0JA 3FD9A 5FPRA 2Y0IA 2GTSA 5IYBO 3G71V 3CP1A 2R9AA 3H1HH 1Q3EA 3B77A 4LNUB 1OHHG 2F93B 3WU2Z 2CTQA 3A2FA 2Q4PA 4UVBA 2ZNJA 3CYOA 4H0LB 1SQFA 2JEXA 5LMUO 1B06A 2LFSA 3SJAC 4YIPA 1UJWB 1ZLZA 1X4TA 3JD1A 5JCOC 2YIAA 1LUVA 2LJ2A 2Q7HA 4LBEC 3WB1A 1JJOA 1N0NA 4JASA 1AR4A 5J2UA 4RUFA 4R50A 4MTXA 1Y66A 5J2TB 1V54C 2LQTA 4O4HA 4BIOA 1G8MA 5LMNB 1VQ7V 1YJWV 4WBNB 4DR2B 3RFRA 3ZRXA 4B3TO 4B7KA 3JARB 2HLDG 4TV9A 3JAWA 1P49A 3OTOO 4MTGA 2CTRA 2GDSA 1WAZA 1D5NA 5B66Z 1VQOV 5IYCO 4GX2A 3BA8A 1XL6A 2YI9A 2NN4A 3MAQA 2MW2B 1IXBA 2L6LA 1XNQB 4P9OA 3G6EV 2DQ0A 2JS5A 1FXKB 2ZKOA 1Q90D 2ZE8A 1JVMA 4ZIBA 1YJ9V 2UXCO 4NTYA 3I56V 2QTOA 3SDLA 3AG1B 4BAYA 3GWKC 4LF5B 1XQ8A 1HP8A 4QJFB 1G1XB 4XDLA 3PN1A 2F43G 3ETGA 2BTOA 2EIJC 4JI5B 5LA6A 2Z5UA 4KFMA 1FXKC 4LFAB 2HFEC 3BA9A 3ASNB 4X64B 3K03A 2KKWA 1YCIA 5H6RA 1XILA 1GMGA 4GYCB 3P3PA 2QJ1A 2N05A 3AG1C 4OPAA 2ZM6O 5JJEB 3A0HZ 1R3KC 4ABMA 1EN6A 2P06A 1MZEA 3OGIB 3AG7A 3CD6V 1AI7A 3WB0A 3SYPA 1RFYA 1QLNA 2UU9B 3RBZA 2EBOA 5KLVH 2RNBA 1K9MW 3ZCCA 2F95B 3K0GA 4D6TH 5KMGA 4EB6A 2IM9A 1IDSA 2HJFC 3U0ZA 1FPOA 4MTOA 3J80N 1A32A 2WLIA 4RQFA 1WB8A 1GN4A 4FLVA 1VQNV 2N04A 5KA5A 5LGNA 2LO1A 1Q7YW 2W0XA 4DR6O 4DW0A 4AILC 4E4EA 1VQ9V 3RYFB 4AQYO 2RDCA 2BOBC 4B3SB 1H8HG 4I0XB 2E5LO 3A0RA 5B1OA 1PL0A 3TJTA 2DWEC 3E8GA 3FAVA 4E2LA 5K1PA 4WF9V 1PL4A 1M57C 2JVDA 1R6TA 1ZWIC 2JJ2G 1ROPA 5JJNB 4FLWA 2QKAA 2DWDC 1DGSA 4JI4B 2Q7EA 3UT5B 1E1QG 2CE4A 5LBQA 1EZVH 2YUAA 1OCCB 2K9PA 3K08A 3VQWA 1H2NA 2XAFA 2YIBD 3K04A 4X65O 3T1YO 3E83A 4EKWA 3L72H 2L35A 2B5UA 1PV0A 5JVDA 1FS0G 1PKXA 2UUAO 3KCYA 2CK3G 2QKSA 5B5EZ 4DUZO 4DV1B 1S5HC 1FJGO 1HW7A 1GN3A 3AG3B 4IIJB 4WFBV 2RMKB 2OTLV 4UV9A 3RYIA 4DRXA 1YHQV 4LF9O 1WP8A 5FPOA 3D3QA 1BQ0A 4O4LB 1JFFA 3ABUA 4BIZA 2PUSA 1WPBA 1N8RW 1J5EO 4TOIA 5GTHZ 4PA3A 3E2EA 2FL4A 2W6JG 4IL6Z 1AI5A 4X1KB 4O4IB 3K9SA 2ZCEA 2BCCH 5C8YA 3ZN0A 3SPHA 1SZXA 5LGTA 4DV6O 1AR5A 4IYIA 4R6ZA 1K4DC 1AILA 4XDJA 1HNWO 5H9CA 1K7DA 1SF9A 3CCRV 5EYPB 4MVZA 4W4LA 3CMAV 3E22B 5LMNO 4UCOA 4BWAA 4DV5B 3S3WA 3HKEB 4ZI7A 3ZHTA 2QDOA 3OR7C 3RYCA 1E79G 4IHJB 3T1HB 1O9GA 2QWQB 1WP7A 1M9NA 2LGWA 1L1FA 1OCZB 2DYRB 4DK1A 3JYCA 4I55B 3BFRA 1NH2D 2GTAA 1AJQA 2D3OW 2GBOA 4CH4A 2Q67A 1I94B 4J7KA 5IY5B 5ITZB 4JTDB 1JOYA 5AG2A 3LSQA 5CB4B 3CCEV 2JGDA 2AZ2A 2R70A 4JI0O 1OCZC 3E8FA 4LC1A 3BAAA 3HR0A 3U11A 4PJ0Z 2BE3A 3CE2A 2Q8VA 2JEUA 2ZXWC 1BZKA 2X0LA 4CZZA 3CCJV 2EJRA 5LYJB 4FMTA 4LFAO 5IY5C 2YIDA 5CA0A 4LR3A 2VS0A 3CC7V 2A0LA 4LF6B 2AGAA 1XEQA 4MVQA 4FPPA 1P7BA 3OEHG 4IYHA 1GM9A 4MSWC 2BSKB 4I50B 2NLJC 1XL4A 4RQEA 2OTJV 3JSNA 2Y48A 1MABG 2AXTZ 5CA1A 4DV2B 3ZRWB 1TVKA 4YJ2B 3AG2B 4FVMA 2EILB 1VQMV 4H33A 4JI7B 3CCQV 2DMXA 1S5JA 4J41A 3SJCC 1QHTA 4R7CA 5BY1A 3ABKB 1W59A 5IYZA 4RWUA 5DEDA 1N33B 4FK5C 3LUTB 3OUFA 3VQXA 3FB6C 2CGOA 4TQDA 4NXMO 3IJ4A 1NVPD 4LF7O 3AG2C 1L0NH 2EILC 1M56B 2IW5A 4JI1B 1VIBA 1KC8W 3JATA 2X7RB 3ZMSA 4DO2A 3ABKC 2P5OA 3ZS8C 3E8BA 1R3JC 5B1BC 4P2ZA 1N32O 3AG4C 5KA6A 1U96A 1BHAA 2ZR3A 3G4SV 4I4TB 2E76B 5FLXN 2LP7A 5LXTA 1RPRA 4K3AA 2GSMB 3H1JH 5IWAB 3IAYA 2CH7A 1Y74A 4AHCA 1D5AA 3JD4A 1HNZB 4HYOA 1GH6A 1TAEA 2A79B 3BPZA 1VMGA 1HNXB 4GX5A 4HZ3A 2Q0AA 5KX5B 3CRMA 5IJ9A 2E74B 2YI8A 4DV1O 3KZIZ 3AK3A 1QVGU 4FFBA 2HKOA 2JGUA 4QNHB 2HEPA 4TQFA 4O2AA 1ZL8A 4YIOA 3C3SA 1K97A 4FM2A 1SQXH 1TGOA 4X1IA 1TA8A 4HNAA 3BCCH 3QO7A 3OGCC 3HKCA 4JI8O 1NH2B 1P84F 2ITCC 2PY5A 3CJHB 3AK2A 4LFCO 1VQKV 1YTFD 3SJQC 2QKCA 3UQ8A 5CBFA 2KSDA 4I7ZB 3UCSC 3N2GA 1OCRB 1S76D 3F5TA 2QE7G 4YY3O 3JASA 1RPOA 4G27B 5IDJA 5E79Z 2ZE5A 5EZYA 2V1DA 3SPIA 3K79A 1WA8A 2VQEB 2YSUB 3SPJA 2EIKB 4MVOA 4O4JB 4DV5O 2X6AA 5IJ0A 1XDCA 1PNLA 1H2SB 1Y76A 2IBZH 2ZIOA 1Z5VA 2UXBB 3RYHA 1R3LC 2V7QG 2VWJA 2Y4UA 1GTOA 3MHHC 1PPJH 5JH7B 2PZSA 3IGAC 4JV5O 4ZOLB 4DR3O 1R6NA 4UCTA 2ZNIA 5LHHA 4DUYB 1XNRB 2M6YA 4MTFA 4DYLA 4QPJA 5GONB 3L71H 2Q73A 1V54B 2X6CA 4U3JA 3OM3B 4LH7A 1GRJA 2QM7A 2F66C 3JALA 1Q86W 5TISZ 3WG7B 2NR5A 5EBLC 1SS3A 1PM9A 2ARHA 3VQYA 4NB5A 1FAFA 5K1XA 2YEVB 4CH6A 4DR4O 1K3EA 4J80A 1AJPA 3M8AA 2BTQA 4PI2A 1VQ6V 2H8PC 1HDJA 1DF4A 2PF4E 4BR6A 1FFXB 3M99B 4JGSA 3OMAB 3IFXA 4LFBO 3WG7C 5LGUA 1KBHA 2ZE6A 2W0FC 4UUJC 1VQ8V 2XT9A 1R6KA 4UVCA 2A06H 2GHYA 4DV2O 4GX1A 3TCUA 2PGGA 4JI7O 1NZ6A 3ZRVA 3D8CA 3OEEG 2EX3A 3DC6A 4UB8Z 4UV8A 2XNDG 2Q9LA 3RGBA 2EIJB 4XBFA 4DRXB 4TWKA 2UUCO 2VWKA 3SYAA 1N33O 1JMKC 4I9WA 3M7MX 2QM8A 3VOUA 1B6QA 3L9DA 2EIMC 2NNUA 2OCCC 3MHSC 4JAAA 5BMVB 1YITV 4JYCA 1KD1W 5CBGA 2QR4A 3JD0A 2Y4TA 4LWSA 4MVRA 2OIEA 1WJZA 1EZJA 1I0HA 3LDCA 4F6RB 1CP9A 5CMUA 3JSLA 1K5SA 1XOUA 4TV8A 2YXHA 4GKJB 1SQBH 3FYEB 5LOVA 3CCLV 1RSOA 4KL1A 3OD4A 1K33A 2PTMA 1SA0B 5IWAO 3UM7A 1CPYA 3CC2V 3CXHF 3ZRSA 3CRQA 4ICGA 3H01A 1ZSPA 4JI6B 2QA4V 1HNZO 2QWRB 4QE9A 4JYAB 4FLYA 2RN9A 3G6BA 2Q5ZA 1M57B 3FFQA 3Q4HA 2ZINA 1D2DA 2Z0AA 3JCZA 2ADPA 4XDKA 5L3EA 2PI4A 4FLZA 3R66A 4TSFG 5BR8B 3J81N 1GM7A 1ZX3A 3OT7A 2F4VB 3FB7C 1H2MA 3QTCA 4RUEA 3FX7A 4B3MB 3CXCU 3BRCA 1SKVA 3IC9A 4LNUA 4OGQB 5A2QN 3K0DA 3FKSG 3L70H 2KG7B 2HHHB 4FZ1A 2XAHA 1US6A 1E1RG 5H2FZ 3DC5A 2FKXA 3UKMA 4GUNA 4CC6A 2JIZG 3AEIA 1BSMA 2IU0A 1P4RA 4JAUA 3K58A 2VQEO 1THZA 3ZHSA 2XAGA 1G6UA 2Q6AA 1N34B 2JS3A 2MK3A 1KECA 1OZ0A 1I7FA 5J2TA 2DW4A 2GUZB 4B3RB 2ATKC 3AK1A 4WBNA 4DV3B 4DV7B 4OX9B 5LHGA 3ASOC 4UFZA 3H1KH 4K0KB 2ZQMA 4EFEA 3JARA 4UCSA 5L3GA 4KUMA 1UFIA 1ZTEA 1HR0B 4LF8B 1XNRO 1VP7A 4GKKO 1XMQB 4DR1B 3ETQA 2P4VA 3JAKB 3ZMZA 4X1YB 2OCHA 1XMOB 1RM1B 1NS1A 3CCMV 2AHYA 4X62B 3ZEDA 1FXKA 4QPKA 2EZOA 2AW9A 2ZDIC 2OWOA 2QSAA 3HKBB 2O57A 2F1MA 3ZHVA 3P3NA 4CS3A 2OT5A 1S5LZ 2P67A 2CUGA 1N36B 1V9PA 3RW0A 1SQVH 4JI3B 2EULA 3SYQA 4JI2B 2XOKG 1RM1C 5B1NA 4DR7B 2CTPA 4X20B 4DR2O 1IBMB 2JJ1G 2G38A 1Y74B 1VQPV 2B1IA 1BE3H 2ZD9A 4CS4A 1Y67A 5LP6B 1XBLA 1KP3A 3UO2A 4X89A 2H3OA 1Q8IA 2WLMA 2ETNA 1Z5WA 4JAVA 1K8AW 3ZIAG 5DECA 2DQ3A 2ZXWB 3B4SA 1YSCA 4L8JA 4J9ZB 4DV0B 1XNQO 2ZR2A 1DLBA 4J10A 1R1BA
chains in the Genus database with same CATH topology
5TISZ 4UB6Z 4UB8Z 5GTIZ 3A0HZ 5KAFZ 5KAIZ 4PJ0Z 3A0BZ 2AXTZ 3JCUZ 1S5LZ 5B5EZ 5H2FZ 3WU2Z 5GTHZ 5E79Z 5B66Z 3KZIZ 4IL6Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS Z;  4UB6 Z;  4UB8 Z;  5GTI Z;  3A0H Z;  5KAF Z;  5KAI Z;  4PJ0 Z;  3A0B Z;  2AXT Z;  3JCU Z;  1S5L Z;  5B5E Z;  5H2F Z;  3WU2 Z;  5GTH Z;  5E79 Z;  5B66 Z;  3KZI Z;  4IL6 Z; 
#chains in the Genus database with same CATH topology
 5LP6 C;  3CME V;  5EIB D;  5KHI A;  1S0V A;  4Z2W A;  2P22 C;  4GX0 A;  4GT1 A;  5JWP A;  4Z1M G;  4LF5 O;  3CC4 V;  4W4K A;  3SYC A;  3OMN B;  1NU1 H;  1BS3 A;  1U97 A;  5DM6 V;  2ZE7 A;  3ICX A;  4ZHQ A;  2YS8 A;  2XTA A;  4JI5 O;  4PDL A;  1CXZ B;  2FML A;  1KQS U;  3QF7 A;  2FYU H;  4X64 O;  3RYF A;  5KUK A;  3FB8 C;  2Q7G A;  4I0X A;  2E75 B;  5JQG B;  5J9P C;  2R9I A;  3CS5 A;  2DOS A;  3D36 C;  4PA6 A;  1L0L H;  5FNV B;  2DYS C;  2JK5 C;  3JD3 A;  3GVM A;  4EFB A;  4KP4 A;  1NJI W;  4JI6 O;  4FFK A;  3JCU Z;  2FTK A;  5C93 A;  2K1E A;  4BW5 A;  3GB7 C;  3HB3 B;  2WAM A;  3G67 A;  2CTW A;  2ADQ B;  1JR9 A;  2UU9 O;  3RVZ A;  4B3T B;  4MW8 A;  4KXR A;  1TUB B;  3DXR B;  1VQL V;  4O2B B;  2AZ0 A;  1VF6 C;  3W7X A;  4LF4 B;  2WLN A;  5B1B B;  3AG4 B;  2WLH A;  3OTO B;  1VAR A;  4IIJ A;  2B9Z A;  2YDE A;  3SJB C;  2DN9 A;  3J7A U;  3U10 A;  2CDY A;  2F4V O;  3IC7 A;  3W7T A;  4O4L A;  5IYD O;  1K4C C;  3D3I A;  3LSS A;  4N21 A;  3OE7 G;  4ZKI A;  4B3S O;  4B3M O;  2UXC B;  1GKF A;  4IGG A;  3E86 A;  2XAS A;  3EHB B;  5D5Q A;  3QG5 A;  2XUM A;  4O4I A;  4X1K A;  4JI4 O;  1MSW D;  1QLE C;  5J2U B;  1NTK H;  4PA7 A;  4H44 B;  4O4H B;  3B8N A;  1QBZ A;  3CSX A;  1SQP H;  1OV9 A;  1JCH A;  5EC2 C;  1WB7 A;  1R3I C;  2LFR A;  4NXN B;  3VBB A;  4MVU A;  2C2A A;  3N27 A;  4PV1 B;  3G80 A;  4J7J A;  2RCV A;  2YXL A;  4PA4 A;  1QU7 A;  1QCE A;  1JPX A;  1Q5O A;  2A7W A;  2OIG A;  2XAJ A;  3E35 A;  5EYP A;  4TV9 B;  4B3R O;  3QO8 A;  3E22 A;  2WLL A;  3JAW B;  4MS2 A;  2HP8 A;  2PYJ A;  1F51 A;  2HR3 A;  3HKE A;  5CA3 A;  1URF A;  2ZM6 B;  4OX9 O;  3KKY A;  2WA3 A;  1AI6 A;  4IHJ A;  4F6E A;  1KYO F;  1X59 A;  5EBM C;  4YXW G;  4FM1 A;  1ENV A;  4CH3 A;  1VF5 B;  1AR1 B;  4DR1 O;  3E8H A;  4I55 A;  4OXS A;  3B8M A;  3H1L H;  1G4Y B;  1IBK B;  1XMO O;  2IU3 A;  3APO A;  3B40 A;  1Q6U A;  2WA4 A;  4X62 O;  5EC1 C;  1S3J A;  4DR5 B;  1I5X A;  5ITZ A;  1B04 A;  3T1C A;  4HBN A;  5B3S B;  5CB4 A;  4IT5 A;  3DSQ A;  1EM1 A;  1KUQ A;  3N2K A;  5LA6 B;  3OUS A;  3F7Y C;  1N36 O;  4AQY B;  1QR9 A;  4LP8 A;  2KB1 A;  4JI3 O;  3X2Q C;  4GCZ A;  5L3D A;  4JI2 O;  1IBL B;  1W2B U;  5A9G A;  3PJS K;  3THO A;  2HG5 C;  5LYJ A;  1IBM O;  2R9R B;  3F5W C;  1Y4M A;  1WN7 A;  4JPR A;  4PDM A;  3T1H O;  5B3S C;  4PDR A;  4ASU G;  2UXD B;  5EIB C;  5CN0 A;  2BSK A;  4I50 A;  3CRC A;  3LNN A;  1MNG A;  3O65 A;  4MW3 A;  3ZRW A;  4MVS A;  5KMG B;  1LNQ A;  4YJ2 A;  4EB6 B;  2UUA B;  3R65 A;  3Q4H B;  4TUY A;  3T4D A;  4DV0 O;  1FJG B;  1I94 O;  2WLI B;  2WLK A;  4K8X A;  3MDS A;  4UCR A;  2PYL A;  2A3Q A;  3OTF A;  1GN2 A;  4J7Z A;  1YI2 V;  5KHG A;  3HKD A;  4YHH B;  4LF9 B;  3APQ A;  3STL C;  3DTU B;  3A8T A;  3L73 H;  2UXN A;  5KAF Z;  1I08 A;  3FAV B;  1H2L A;  4FM0 A;  1NVP B;  1SC5 B;  1J5E B;  4U3F H;  4GLX A;  2WPD G;  3WFV A;  4P30 A;  4UVA A;  2IH3 C;  4DV4 B;  4LF6 O;  1PD3 A;  3I5D A;  1VQ5 V;  1UPG A;  2QTS A;  3TK1 A;  4DV6 B;  1HWY A;  1YVW A;  4I4T A;  3QO5 A;  1EFR G;  2GV9 A;  1RP3 B;  1HNW B;  3K5O A;  2Q69 A;  1CEZ A;  1LR1 A;  1QVF U;  2EIM B;  5JVD B;  5KHK A;  2OCC B;  1BMF G;  4FLU A;  5L3C A;  5LL6 Y;  4TT3 G;  2ITD C;  1WPX A;  5KUM A;  4YJ3 A;  3EVK A;  1YZB A;  3B09 A;  3K06 A;  4Q20 A;  1BT8 A;  5EK0 A;  3RYI B;  1EN5 A;  5HFL A;  4JZ2 A;  4LF4 O;  1PNM A;  2Z3Y A;  5KX5 A;  4I5S A;  1J95 A;  1JFF B;  4UXN A;  5E1A C;  2CGN A;  3ZX6 A;  3SR2 C;  1SQG A;  2D2C B;  4Z1V A;  5F2V O;  2QGN A;  5GTI Z;  4MVM A;  4JI1 O;  4UCU A;  1B3Q A;  4LCU C;  4D7T A;  2YXY A;  3OFN G;  4U7N A;  1EBO A;  5C8Y B;  4I9Q A;  3CJH A;  4JI0 B;  2UUB B;  4NTW A;  2CAZ C;  1YTF B;  4WFE A;  1W0K G;  1VQ4 V;  1MSD A;  4RAI A;  2XAQ A;  1VF7 A;  4QIW F;  3FB5 C;  4DW1 A;  1GK9 A;  4NXN O;  1JQ0 A;  4ZI7 B;  1AJN A;  1K73 W;  3CPW U;  2ODM A;  4D7S A;  3ABM B;  3ZHQ A;  3RYC B;  4JYY A;  4F4L A;  1S77 D;  1SES A;  1HNX O;  2EZP A;  1OJH A;  4AI8 A;  2FB5 A;  4O4J A;  2Q0O C;  1MG1 A;  4FZ0 A;  3EXA A;  2P90 A;  2PI5 A;  4PD4 F;  3F7V C;  4J9Y B;  2WSS G;  4CH5 A;  1WLE A;  5JH7 A;  3LDE A;  4ZOL A;  4PDV A;  5B1A B;  3ABM C;  3ASN C;  3OMI B;  1T5E A;  3E89 A;  5L3B A;  5JCO A;  1XI1 A;  1BCC H;  1Q43 A;  2JRI A;  2JGD B;  4JTC B;  1IBK O;  4LH6 A;  5GON A;  1DK1 A;  4JZG A;  4Q6G A;  5D5P A;  1M1K W;  4NXM B;  1IUR A;  3LDD A;  4DR5 O;  3K3W A;  1YXB A;  5L3F A;  4LF7 B;  1OCO B;  1GM8 A;  4ZHQ B;  1Z2G A;  1F4N A;  3ASO B;  1K5Q A;  4C7U A;  3KCX A;  3FYI B;  1SET A;  5B1A C;  3K5L A;  4B7E A;  4G2K A;  5CA0 B;  1GAX A;  3ZHR A;  1IBL O;  2YEV A;  1N32 B;  1KU9 A;  3C3T A;  1Y6X A;  2YIC A;  4A5U B;  3A0B Z;  3VQV A;  2UXB O;  3RN4 A;  4WFF A;  1FFX A;  2P7T C;  5IT9 N;  4ZBM A;  3CEI A;  4KHP B;  1AVM A;  1OCO C;  4X88 A;  5CA1 B;  2IH1 C;  5H5N A;  1TVK B;  2UXD O;  4NR1 A;  3OAA G;  3ABT A;  1F23 A;  2OYQ A;  3CRA A;  3CX5 F;  3LSU A;  2XHB A;  3HPL C;  4DUY O;  3CRR A;  1GN6 A;  5IYZ B;  1ORQ C;  3P32 A;  4CS2 A;  1PP9 H;  4X9Q A;  3L74 H;  4MT8 A;  1YDX A;  5LHI A;  1MA1 A;  4NYK A;  2HVK C;  1NTM H;  4DXW A;  1MMM A;  2B1G A;  1FKA O;  5H6Q A;  1OCC C;  4YHH O;  1AB3 A;  1DF5 A;  3OW2 U;  3STZ C;  5JJJ B;  3ZJZ A;  2ZIM A;  3JAT B;  3SGI A;  4K35 A;  3RVY A;  2LW1 A;  4JI8 B;  1H8E G;  3K59 A;  2F23 A;  2Y69 B;  1BGY H;  1YF2 A;  3CCS V;  3LNM B;  4LFC B;  5BMV A;  4CC5 A;  5CBH A;  3NR7 A;  3T4Z A;  4FLT A;  2RQ6 A;  1JA8 A;  1F4M A;  3AG3 C;  2DE0 X;  5LXT B;  3BY6 A;  4DV4 O;  3DGE A;  1Q82 W;  1XUQ A;  4F6R A;  1NT2 B;  5KAI Z;  2CH7 B;  4YY3 B;  4PA9 A;  1XHX A;  5EBW C;  1AP6 A;  4WFH A;  3H9V A;  1JX9 A;  1S72 V;  1SQQ H;  4X66 B;  1V55 B;  2Y69 C;  2WLL B;  1ZAU A;  3ZMT A;  1QNM A;  3T2M A;  1SA0 A;  5IJ9 B;  1IZ3 A;  1YJN V;  4FFB B;  4WFG A;  1YIJ V;  1LUW A;  4O2A B;  1ZL8 B;  3RT3 C;  5BXZ A;  2VQF B;  3I55 V;  1H38 A;  4FLX A;  4X1I B;  4JV5 B;  4HNA B;  5FL7 G;  4DR3 B;  1KKD A;  2QWO B;  3HKC B;  4QE7 A;  1MOF A;  1V55 C;  4BW9 A;  2QEX V;  2A9H A;  4PEL A;  2DYS B;  1MZF A;  1NR7 A;  4GZR B;  4P9P A;  1FXH A;  4R8C A;  3N2G B;  1NKD A;  1K92 A;  3JAM N;  1QR8 A;  1NR1 A;  3SPC A;  5KHJ A;  4JF3 A;  1NQT A;  3JAS B;  3N2K B;  1N4C A;  1O9H A;  5LMU B;  2UUB O;  4GKJ O;  2DYR C;  5EZY B;  1I5Y A;  1FFT B;  1WA8 B;  2P4K A;  2IJJ A;  4J11 A;  4B08 A;  3ML0 A;  3S3X A;  2KG7 A;  5IJ0 B;  4PI0 A;  4DR4 B;  1NBM G;  2EJ7 A;  1Y76 B;  2M7W A;  3UT5 A;  3RYH B;  3QVN A;  1JJ2 U;  2WLJ A;  4JYA O;  4JYB A;  2IJI A;  4LFB B;  5DN6 G;  1KKC A;  1SRY A;  3CB2 A;  1F7Y A;  2IJH A;  3EFF K;  3W7W A;  2GUZ A;  4NVP A;  2X6B A;  1ARO P;  1NTZ H;  1L8D A;  4OPH A;  1QLE B;  4TUY B;  1IXM A;  1W0J G;  1H2G A;  3K5M A;  4U3J B;  2ZDI A;  4L87 A;  1NI8 A;  3MD0 A;  3ZMU A;  4BIU A;  5BR8 O;  3ETD A;  3NXS A;  3JAL B;  3HKD B;  3TXS A;  4NKG B;  2UUC B;  1WNS A;  4J42 A;  5HFM A;  2W6I G;  3ZBH A;  3JAK A;  3WB2 A;  3BHP A;  2LGQ A;  3CCU V;  4X1Y A;  1K34 A;  4HAM A;  3SYO A;  2HHH O;  4WFA V;  2DJV A;  2BTQ B;  1IVS A;  3BVO A;  2QM4 A;  5KHH A;  1M5I A;  2JDI G;  1VEW A;  2EIN B;  3HKB A;  2UXX A;  2H94 A;  1KP2 A;  2Q68 A;  2HJD A;  2IJK A;  1N34 O;  1P7G A;  1BHB A;  1AI4 A;  4CBC A;  1R73 A;  1H2K A;  2V4D A;  4KHP O;  4N23 A;  5GW7 A;  4PHZ A;  3ZN1 A;  4X20 A;  4DV3 O;  4DV7 O;  4YJ3 B;  4K0K O;  1M56 C;  1KB9 F;  1M90 W;  1M93 A;  1HR0 O;  4LF8 O;  2VRZ A;  2EIN C;  4NTX A;  4RO2 A;  5LP6 A;  3BEH A;  1XMQ O;  2Y0P A;  3OR6 C;  3CCV V;  3B2E E;  2P6J A;  3X2Q B;  1QQC A;  1FYJ A;  4DK0 A;  1Q6I A;  2BOC C;  4FIP C;  1AP5 A;  3P30 A;  3GWO A;  1TUE B;  3ZHU A;  4G28 B;  1YEW A;  1KMI Z;  1IX9 A;  1GO3 F;  3ABL B;  3K57 A;  4LWS B;  1Q81 W;  3TGU H;  3L75 H;  3H1I H;  4QGP A;  3BAB A;  1EN4 A;  3D36 A;  4DR6 B;  3CWB H;  1BL8 A;  2AHZ A;  4K8Z A;  4TV8 B;  1FD9 A;  2ILM A;  2E5L B;  2R72 A;  5LOV B;  3W7S A;  3UO3 A;  3TXQ A;  2WWW A;  2KQX A;  1DTO A;  1RSO B;  1SER A;  1XRE A;  4DR7 O;  4JTA B;  3SPG A;  3W7U A;  5BZB A;  4H37 A;  3TET A;  1SZT A;  3C90 A;  4WCE V;  1COW G;  3ABL C;  2ZT9 B;  4X66 O;  1VF6 A;  5JQG A;  4X8A A;  3ETE A;  3ZMV A;  5IE9 A;  2HVJ C;  1M4U A;  3QNE A;  1ZUQ A;  1FXV A;  4X65 B;  5FNV A;  3T1Y B;  4U7O A;  4H13 B;  3JD2 A;  3K5N A;  1Q6H A;  3O9O A;  3CHX A;  2RJZ A;  1XHZ A;  1OCR C;  2QWN B;  4EEQ A;  2N74 A;  2LW7 A;  4DUZ B;  2YC0 A;  2VQF O;  1BQZ A;  1PNK A;  3KG2 A;  2YIB A;  3RWR D;  1TUB A;  3DXR A;  4O2B A;  2QWP B;  4UCV A;  4FJC C;  4UB6 Z;  3K9A A;  2E3C A;  2EIK C;  4GKK B;  1N0J A;  3FD9 A;  5FPR A;  2Y0I A;  2GTS A;  5IYB O;  3G71 V;  3CP1 A;  2R9A A;  3H1H H;  1Q3E A;  3B77 A;  4LNU B;  1OHH G;  2F93 B;  3WU2 Z;  2CTQ A;  3A2F A;  2Q4P A;  4UVB A;  2ZNJ A;  3CYO A;  4H0L B;  1SQF A;  2JEX A;  5LMU O;  1B06 A;  2LFS A;  3SJA C;  4YIP A;  1UJW B;  1ZLZ A;  1X4T A;  3JD1 A;  5JCO C;  2YIA A;  1LUV A;  2LJ2 A;  2Q7H A;  4LBE C;  3WB1 A;  1JJO A;  1N0N A;  4JAS A;  1AR4 A;  5J2U A;  4RUF A;  4R50 A;  4MTX A;  1Y66 A;  5J2T B;  1V54 C;  2LQT A;  4O4H A;  4BIO A;  1G8M A;  5LMN B;  1VQ7 V;  1YJW V;  4WBN B;  4DR2 B;  3RFR A;  3ZRX A;  4B3T O;  4B7K A;  3JAR B;  2HLD G;  4TV9 A;  3JAW A;  1P49 A;  3OTO O;  4MTG A;  2CTR A;  2GDS A;  1WAZ A;  1D5N A;  5B66 Z;  1VQO V;  5IYC O;  4GX2 A;  3BA8 A;  1XL6 A;  2YI9 A;  2NN4 A;  3MAQ A;  2MW2 B;  1IXB A;  2L6L A;  1XNQ B;  4P9O A;  3G6E V;  2DQ0 A;  2JS5 A;  1FXK B;  2ZKO A;  1Q90 D;  2ZE8 A;  1JVM A;  4ZIB A;  1YJ9 V;  2UXC O;  4NTY A;  3I56 V;  2QTO A;  3SDL A;  3AG1 B;  4BAY A;  3GWK C;  4LF5 B;  1XQ8 A;  1HP8 A;  4QJF B;  1G1X B;  4XDL A;  3PN1 A;  2F43 G;  3ETG A;  2BTO A;  2EIJ C;  4JI5 B;  5LA6 A;  2Z5U A;  4KFM A;  1FXK C;  4LFA B;  2HFE C;  3BA9 A;  3ASN B;  4X64 B;  3K03 A;  2KKW A;  1YCI A;  5H6R A;  1XIL A;  1GMG A;  4GYC B;  3P3P A;  2QJ1 A;  2N05 A;  3AG1 C;  4OPA A;  2ZM6 O;  5JJE B;  3A0H Z;  1R3K C;  4ABM A;  1EN6 A;  2P06 A;  1MZE A;  3OGI B;  3AG7 A;  3CD6 V;  1AI7 A;  3WB0 A;  3SYP A;  1RFY A;  1QLN A;  2UU9 B;  3RBZ A;  2EBO A;  5KLV H;  2RNB A;  1K9M W;  3ZCC A;  2F95 B;  3K0G A;  4D6T H;  5KMG A;  4EB6 A;  2IM9 A;  1IDS A;  2HJF C;  3U0Z A;  1FPO A;  4MTO A;  3J80 N;  1A32 A;  2WLI A;  4RQF A;  1WB8 A;  1GN4 A;  4FLV A;  1VQN V;  2N04 A;  5KA5 A;  5LGN A;  2LO1 A;  1Q7Y W;  2W0X A;  4DR6 O;  4DW0 A;  4AIL C;  4E4E A;  1VQ9 V;  3RYF B;  4AQY O;  2RDC A;  2BOB C;  4B3S B;  1H8H G;  4I0X B;  2E5L O;  3A0R A;  5B1O A;  1PL0 A;  3TJT A;  2DWE C;  3E8G A;  3FAV A;  4E2L A;  5K1P A;  4WF9 V;  1PL4 A;  1M57 C;  2JVD A;  1R6T A;  1ZWI C;  2JJ2 G;  1ROP A;  5JJN B;  4FLW A;  2QKA A;  2DWD C;  1DGS A;  4JI4 B;  2Q7E A;  3UT5 B;  1E1Q G;  2CE4 A;  5LBQ A;  1EZV H;  2YUA A;  1OCC B;  2K9P A;  3K08 A;  3VQW A;  1H2N A;  2XAF A;  2YIB D;  3K04 A;  4X65 O;  3T1Y O;  3E83 A;  4EKW A;  3L72 H;  2L35 A;  2B5U A;  1PV0 A;  5JVD A;  1FS0 G;  1PKX A;  2UUA O;  3KCY A;  2CK3 G;  2QKS A;  5B5E Z;  4DUZ O;  4DV1 B;  1S5H C;  1FJG O;  1HW7 A;  1GN3 A;  3AG3 B;  4IIJ B;  4WFB V;  2RMK B;  2OTL V;  4UV9 A;  3RYI A;  4DRX A;  1YHQ V;  4LF9 O;  1WP8 A;  5FPO A;  3D3Q A;  1BQ0 A;  4O4L B;  1JFF A;  3ABU A;  4BIZ A;  2PUS A;  1WPB A;  1N8R W;  1J5E O;  4TOI A;  5GTH Z;  4PA3 A;  3E2E A;  2FL4 A;  2W6J G;  4IL6 Z;  1AI5 A;  4X1K B;  4O4I B;  3K9S A;  2ZCE A;  2BCC H;  5C8Y A;  3ZN0 A;  3SPH A;  1SZX A;  5LGT A;  4DV6 O;  1AR5 A;  4IYI A;  4R6Z A;  1K4D C;  1AIL A;  4XDJ A;  1HNW O;  5H9C A;  1K7D A;  1SF9 A;  3CCR V;  5EYP B;  4MVZ A;  4W4L A;  3CMA V;  3E22 B;  5LMN O;  4UCO A;  4BWA A;  4DV5 B;  3S3W A;  3HKE B;  4ZI7 A;  3ZHT A;  2QDO A;  3OR7 C;  3RYC A;  1E79 G;  4IHJ B;  3T1H B;  1O9G A;  2QWQ B;  1WP7 A;  1M9N A;  2LGW A;  1L1F A;  1OCZ B;  2DYR B;  4DK1 A;  3JYC A;  4I55 B;  3BFR A;  1NH2 D;  2GTA A;  1AJQ A;  2D3O W;  2GBO A;  4CH4 A;  2Q67 A;  1I94 B;  4J7K A;  5IY5 B;  5ITZ B;  4JTD B;  1JOY A;  5AG2 A;  3LSQ A;  5CB4 B;  3CCE V;  2JGD A;  2AZ2 A;  2R70 A;  4JI0 O;  1OCZ C;  3E8F A;  4LC1 A;  3BAA A;  3HR0 A;  3U11 A;  4PJ0 Z;  2BE3 A;  3CE2 A;  2Q8V A;  2JEU A;  2ZXW C;  1BZK A;  2X0L A;  4CZZ A;  3CCJ V;  2EJR A;  5LYJ B;  4FMT A;  4LFA O;  5IY5 C;  2YID A;  5CA0 A;  4LR3 A;  2VS0 A;  3CC7 V;  2A0L A;  4LF6 B;  2AGA A;  1XEQ A;  4MVQ A;  4FPP A;  1P7B A;  3OEH G;  4IYH A;  1GM9 A;  4MSW C;  2BSK B;  4I50 B;  2NLJ C;  1XL4 A;  4RQE A;  2OTJ V;  3JSN A;  2Y48 A;  1MAB G;  2AXT Z;  5CA1 A;  4DV2 B;  3ZRW B;  1TVK A;  4YJ2 B;  3AG2 B;  4FVM A;  2EIL B;  1VQM V;  4H33 A;  4JI7 B;  3CCQ V;  2DMX A;  1S5J A;  4J41 A;  3SJC C;  1QHT A;  4R7C A;  5BY1 A;  3ABK B;  1W59 A;  5IYZ A;  4RWU A;  5DED A;  1N33 B;  4FK5 C;  3LUT B;  3OUF A;  3VQX A;  3FB6 C;  2CGO A;  4TQD A;  4NXM O;  3IJ4 A;  1NVP D;  4LF7 O;  3AG2 C;  1L0N H;  2EIL C;  1M56 B;  2IW5 A;  4JI1 B;  1VIB A;  1KC8 W;  3JAT A;  2X7R B;  3ZMS A;  4DO2 A;  3ABK C;  2P5O A;  3ZS8 C;  3E8B A;  1R3J C;  5B1B C;  4P2Z A;  1N32 O;  3AG4 C;  5KA6 A;  1U96 A;  1BHA A;  2ZR3 A;  3G4S V;  4I4T B;  2E76 B;  5FLX N;  2LP7 A;  5LXT A;  1RPR A;  4K3A A;  2GSM B;  3H1J H;  5IWA B;  3IAY A;  2CH7 A;  1Y74 A;  4AHC A;  1D5A A;  3JD4 A;  1HNZ B;  4HYO A;  1GH6 A;  1TAE A;  2A79 B;  3BPZ A;  1VMG A;  1HNX B;  4GX5 A;  4HZ3 A;  2Q0A A;  5KX5 B;  3CRM A;  5IJ9 A;  2E74 B;  2YI8 A;  4DV1 O;  3KZI Z;  3AK3 A;  1QVG U;  4FFB A;  2HKO A;  2JGU A;  4QNH B;  2HEP A;  4TQF A;  4O2A A;  1ZL8 A;  4YIO A;  3C3S A;  1K97 A;  4FM2 A;  1SQX H;  1TGO A;  4X1I A;  1TA8 A;  4HNA A;  3BCC H;  3QO7 A;  3OGC C;  3HKC A;  4JI8 O;  1NH2 B;  1P84 F;  2ITC C;  2PY5 A;  3CJH B;  3AK2 A;  4LFC O;  1VQK V;  1YTF D;  3SJQ C;  2QKC A;  3UQ8 A;  5CBF A;  2KSD A;  4I7Z B;  3UCS C;  3N2G A;  1OCR B;  1S76 D;  3F5T A;  2QE7 G;  4YY3 O;  3JAS A;  1RPO A;  4G27 B;  5IDJ A;  5E79 Z;  2ZE5 A;  5EZY A;  2V1D A;  3SPI A;  3K79 A;  1WA8 A;  2VQE B;  2YSU B;  3SPJ A;  2EIK B;  4MVO A;  4O4J B;  4DV5 O;  2X6A A;  5IJ0 A;  1XDC A;  1PNL A;  1H2S B;  1Y76 A;  2IBZ H;  2ZIO A;  1Z5V A;  2UXB B;  3RYH A;  1R3L C;  2V7Q G;  2VWJ A;  2Y4U A;  1GTO A;  3MHH C;  1PPJ H;  5JH7 B;  2PZS A;  3IGA C;  4JV5 O;  4ZOL B;  4DR3 O;  1R6N A;  4UCT A;  2ZNI A;  5LHH A;  4DUY B;  1XNR B;  2M6Y A;  4MTF A;  4DYL A;  4QPJ A;  5GON B;  3L71 H;  2Q73 A;  1V54 B;  2X6C A;  4U3J A;  3OM3 B;  4LH7 A;  1GRJ A;  2QM7 A;  2F66 C;  3JAL A;  1Q86 W;  5TIS Z;  3WG7 B;  2NR5 A;  5EBL C;  1SS3 A;  1PM9 A;  2ARH A;  3VQY A;  4NB5 A;  1FAF A;  5K1X A;  2YEV B;  4CH6 A;  4DR4 O;  1K3E A;  4J80 A;  1AJP A;  3M8A A;  2BTQ A;  4PI2 A;  1VQ6 V;  2H8P C;  1HDJ A;  1DF4 A;  2PF4 E;  4BR6 A;  1FFX B;  3M99 B;  4JGS A;  3OMA B;  3IFX A;  4LFB O;  3WG7 C;  5LGU A;  1KBH A;  2ZE6 A;  2W0F C;  4UUJ C;  1VQ8 V;  2XT9 A;  1R6K A;  4UVC A;  2A06 H;  2GHY A;  4DV2 O;  4GX1 A;  3TCU A;  2PGG A;  4JI7 O;  1NZ6 A;  3ZRV A;  3D8C A;  3OEE G;  2EX3 A;  3DC6 A;  4UB8 Z;  4UV8 A;  2XND G;  2Q9L A;  3RGB A;  2EIJ B;  4XBF A;  4DRX B;  4TWK A;  2UUC O;  2VWK A;  3SYA A;  1N33 O;  1JMK C;  4I9W A;  3M7M X;  2QM8 A;  3VOU A;  1B6Q A;  3L9D A;  2EIM C;  2NNU A;  2OCC C;  3MHS C;  4JAA A;  5BMV B;  1YIT V;  4JYC A;  1KD1 W;  5CBG A;  2QR4 A;  3JD0 A;  2Y4T A;  4LWS A;  4MVR A;  2OIE A;  1WJZ A;  1EZJ A;  1I0H A;  3LDC A;  4F6R B;  1CP9 A;  5CMU A;  3JSL A;  1K5S A;  1XOU A;  4TV8 A;  2YXH A;  4GKJ B;  1SQB H;  3FYE B;  5LOV A;  3CCL V;  1RSO A;  4KL1 A;  3OD4 A;  1K33 A;  2PTM A;  1SA0 B;  5IWA O;  3UM7 A;  1CPY A;  3CC2 V;  3CXH F;  3ZRS A;  3CRQ A;  4ICG A;  3H01 A;  1ZSP A;  4JI6 B;  2QA4 V;  1HNZ O;  2QWR B;  4QE9 A;  4JYA B;  4FLY A;  2RN9 A;  3G6B A;  2Q5Z A;  1M57 B;  3FFQ A;  3Q4H A;  2ZIN A;  1D2D A;  2Z0A A;  3JCZ A;  2ADP A;  4XDK A;  5L3E A;  2PI4 A;  4FLZ A;  3R66 A;  4TSF G;  5BR8 B;  3J81 N;  1GM7 A;  1ZX3 A;  3OT7 A;  2F4V B;  3FB7 C;  1H2M A;  3QTC A;  4RUE A;  3FX7 A;  4B3M B;  3CXC U;  3BRC A;  1SKV A;  3IC9 A;  4LNU A;  4OGQ B;  5A2Q N;  3K0D A;  3FKS G;  3L70 H;  2KG7 B;  2HHH B;  4FZ1 A;  2XAH A;  1US6 A;  1E1R G;  5H2F Z;  3DC5 A;  2FKX A;  3UKM A;  4GUN A;  4CC6 A;  2JIZ G;  3AEI A;  1BSM A;  2IU0 A;  1P4R A;  4JAU A;  3K58 A;  2VQE O;  1THZ A;  3ZHS A;  2XAG A;  1G6U A;  2Q6A A;  1N34 B;  2JS3 A;  2MK3 A;  1KEC A;  1OZ0 A;  1I7F A;  5J2T A;  2DW4 A;  2GUZ B;  4B3R B;  2ATK C;  3AK1 A;  4WBN A;  4DV3 B;  4DV7 B;  4OX9 B;  5LHG A;  3ASO C;  4UFZ A;  3H1K H;  4K0K B;  2ZQM A;  4EFE A;  3JAR A;  4UCS A;  5L3G A;  4KUM A;  1UFI A;  1ZTE A;  1HR0 B;  4LF8 B;  1XNR O;  1VP7 A;  4GKK O;  1XMQ B;  4DR1 B;  3ETQ A;  2P4V A;  3JAK B;  3ZMZ A;  4X1Y B;  2OCH A;  1XMO B;  1RM1 B;  1NS1 A;  3CCM V;  2AHY A;  4X62 B;  3ZED A;  1FXK A;  4QPK A;  2EZO A;  2AW9 A;  2ZDI C;  2OWO A;  2QSA A;  3HKB B;  2O57 A;  2F1M A;  3ZHV A;  3P3N A;  4CS3 A;  2OT5 A;  1S5L Z;  2P67 A;  2CUG A;  1N36 B;  1V9P A;  3RW0 A;  1SQV H;  4JI3 B;  2EUL A;  3SYQ A;  4JI2 B;  2XOK G;  1RM1 C;  5B1N A;  4DR7 B;  2CTP A;  4X20 B;  4DR2 O;  1IBM B;  2JJ1 G;  2G38 A;  1Y74 B;  1VQP V;  2B1I A;  1BE3 H;  2ZD9 A;  4CS4 A;  1Y67 A;  5LP6 B;  1XBL A;  1KP3 A;  3UO2 A;  4X89 A;  2H3O A;  1Q8I A;  2WLM A;  2ETN A;  1Z5W A;  4JAV A;  1K8A W;  3ZIA G;  5DEC A;  2DQ3 A;  2ZXW B;  3B4S A;  1YSC A;  4L8J A;  4J9Z B;  4DV0 B;  1XNQ O;  2ZR2 A;  1DLB A;  4J10 A;  1R1B A; 
#chains in the Genus database with same CATH homology
 5TIS Z;  4UB6 Z;  4UB8 Z;  5GTI Z;  3A0H Z;  5KAF Z;  5KAI Z;  4PJ0 Z;  3A0B Z;  2AXT Z;  3JCU Z;  1S5L Z;  5B5E Z;  5H2F Z;  3WU2 Z;  5GTH Z;  5E79 Z;  5B66 Z;  3KZI Z;  4IL6 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...