1JQ0A

Mutation that destabilize the gp41 core: determinants for stabilizing the siv/cpmac envelope glycoprotein complex. mutant structure.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
78
structure length
71
Chain Sequence
LAGIVQQQQQLLDLVTRQQELLRLTVWGIKNLQTGGWQEWKRKVDFLEENITALLEEAQIQQEKNMYELQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gp41 envelope protein
publication title Mutations that destabilize the gp41 core are determinants for stabilizing the simian immunodeficiency virus-CPmac envelope glycoprotein complex.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Viral protein
total genus 33
structure length 71
sequence length 78
ec nomenclature
pdb deposition date 2001-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jq0A00
1SZTA 1JQ0A 2EZOA 3CYOA 2EBOA 3GWOA 3K9AA 1K33A 3B8NA 3MHHC 2OT5A 1ENVA 2P6JA 3MHSC 5HFLA 2M7WA 1MG1A 1K34A 2LP7A 4E2LA 4FIPC 3H01A 3CP1A 1Y4MA 2X7RB 1I5YA 4FJCC 2MK3A 1F23A 1DLBA 4JPRA 4N21A 1QBZA 2EZPA 5CN0A 4G2KA 3WFVA 1QCEA 4JF3A 5CMUA 1MOFA 1JPXA 1EBOA 5KA5A 3P30A 1QR8A 1Y66A 1DF5A 3B8MA 5KA6A 3M99B 4FK5C 1DF4A 1QR9A 1I5XA 3B77A 4N23A 5H9CA 5HFMA 4JGSA
chains in the Genus database with same CATH superfamily
3THOA 3J80N 5KMGB 4I0XB 3KZIZ 4R7CA 4IIJB 1VMGA 4ZOLA 2QM4A 3IGAC 5LXTA 2ZE7A 5FPOA 3RYHA 2CGNA 3B4SA 2QDOA 5IY5C 1HNZB 4TQDA 4HNAB 4F4LA 2JRIA 5CA0A 1MMMA 1Q90D 3AEIA 3BCCH 5CB4B 4UV9A 1SC5B 1UPGA 4B3SB 2QWRB 4J7KA 4JI5O 1ENVA 5JJEB 4K3AA 1MA1A 2HKOA 3JAMN 2V1DA 3K59A 1XMQO 4JI8O 4EFEA 2P4KA 1QHTA 3JD3A 2R9IA 2BOBC 5EYPB 1YZBA 3B77A 4F6EA 4FM1A 1M57B 2Q6AA 1PL0A 3ZMUA 3ETDA 4DV6B 3JD0A 5KHGA 4JTCB 4GLXA 1XILA 1EN6A 2QWNB 2B1IA 1BQZA 5J2UA 2AHYA 1BSMA 1RP3B 3M8AA 4LH6A 3UO2A 3ABMB 1YITV 3FFQA 4OGQB 4GX5A 3T4ZA 4U3JA 4FLVA 1MABG 1AR5A 2ZD9A 4PV1B 2X6BA 3RFRA 3K06A 2B9ZA 1K5QA 5IYBO 4B3RO 2Z0AA 2F23A 1I0HA 2F95B 2DJVA 3ZMTA 1XUQA 2HVKC 4IT5A 1GM9A 1V55C 2OIEA 1SA0B 3ETQA 1NKDA 5B1OA 3N27A 3SPIA 5CN0A 3DC6A 4DV5O 4X66B 3KKYA 2Y0PA 1W0KG 4LNUA 3K79A 5J2TB 2YUAA 4U3FH 5JCOA 4MW3A 5JWPA 3HKEB 3AG7A 3CCUV 2PZSA 2BTQB 3ABLC 4PA9A 2JGDA 2ATKC 3AK3A 1PL4A 3K5MA 4DR4O 2W6IG 4KFMA 2XT9A 1K97A 4OPHA 4Z2WA 1S76D 3IJ4A 2Q8VA 2A3QA 2OT5A 1KBHA 2UUCO 4TOIA 1N34O 1JJ2U 1G4YB 3WG7B 1U96A 5B1NA 1KKCA 1AR4A 3U10A 3E8BA 4RQEA 3X2QC 2H94A 4N23A 5IJ9B 1HR0O 1LUWA 2GUZA 5B66Z 5EBLC 4B7KA 3KG2A 4J9YB 3SYOA 1TVKB 2BE3A 3OE7G 1S0VA 1VQ7V 3EHBB 1E79G 3W7TA 1VP7A 4MVSA 1K7DA 4NVPA 1URFA 4WFEA 2KKWA 2ZXWB 1AP6A 1YTFD 3P30A 1K9MW 4B3TO 4UB8Z 4TUYA 1ZX3A 1OV9A 4PA7A 3FB7C 3LUTB 1SERA 1P7GA 2FYUH 1GKFA 3P32A 4O4HA 5L3EA 2HLDG 5EK0A 2UUAO 2F4VB 4JI1B 3CCQV 4DUZB 2DQ0A 4MW8A 1YHQV 4X89A 2LGQA 4X1KB 4IYHA 3SYCA 1X4TA 3WFVA 1M5IA 5IY5B 1XBLA 2NN4A 2Y4UA 4MVMA 4X1YB 5IYCO 2ZNJA 1QNMA 2YI9A 4EFBA 4JI0B 4DV4B 5LGNA 2HFEC 3LDDA 1K34A 3JD4A 4MVUA 4PA4A 3W7XA 3CD6V 4UV8A 2RMKB 5H6RA 5JCOC 4DV0B 1D2DA 2PGGA 1L8DA 1JOYA 1DF5A 4X1IA 3STZC 4JI6O 4K0KO 2QE7G 1JA8A 2CH7A 3U0ZA 3APQA 4PJ0Z 1L0LH 5F2VO 2EULA 2LW1A 3FAVB 3P3NA 3L70H 2XAGA 4J9ZB 2VQFB 2WLJA 2PYLA 5FNVB 4GKKB 2EJRA 2QWQB 4P9OA 1B06A 1KKDA 4PHZA 4Q6GA 4DV3O 2ITDC 1ZL8A 3CRQA 3RYCB 1SKVA 3ABKC 1AI5A 1FS0G 3RYFB 5D5QA 1P49A 1DTOA 2DW4A 4FZ1A 3CRCA 4PA3A 3OM3B 1GAXA 4RUEA 2Q67A 5IDJA 1WP8A 3N2KA 4G27B 4LF7B 2RJZA 2UUBB 2XOKG 1N33O 4JYAB 5JH7B 4Q20A 3B8NA 2XAQA 3ABLB 4X64B 2E5LO 4DR2O 4DR5B 3I55V 3JYCA 2P67A 1OZ0A 4JYBA 2ADPA 4LF5O 3SPCA 5LHIA 1MZEA 2A7WA 1AILA 4ZOLB 3AG4C 4FLTA 2QJ1A 1H2NA 4DR7O 2UXXA 1VQ5V 3RYHB 3W7WA 4PDVA 4LFCO 2CTPA 2PY5A 1FD9A 4YHHB 3C3TA 3ZRXA 2CTQA 3HKBB 5H9CA 3QO8A 3X2QB 2UXBO 5KAIZ 2HHHB 2JEUA 3Q4HA 4CH4A 5IWAB 2LJ2A 1J5EO 3ZJZA 3E86A 1Y6XA 1ZTEA 4R8CA 4LF9B 2Q4PA 2K1EA 2BOCC 2AHZA 3VQXA 3A0BZ 3OAAG 3SJQC 4E4EA 1AP5A 4FLUA 2XASA 3E2EA 1BGYH 5J2UB 3E8FA 3HKCA 4O2BA 2ZM6O 5BMVA 2N04A 2LW7A 2A0LA 4B7EA 1Z2GA 1QLEC 1YTFB 1RSOA 3IFXA 4H13B 2ZKOA 2UXDB 1I5YA 2CUGA 3SR2C 3U11A 4NB5A 2EZPA 4WCEV 3DXRA 2ARHA 3CC2V 1K4DC 4YY3B 3SJAC 4GUNA 4DK1A 3LSQA 3F5TA 2W6JG 3CE2A 1VQKV 1R6KA 1XOUA 4DV7B 1JFFA 1MG1A 2ZE8A 2RQ6A 2GHYA 4JI7B 4QE7A 1FKAO 4LNUB 2DQ3A 2C2AA 4DR3O 3OW2U 3K5NA 2BTOA 4LFBB 1D5AA 1LUVA 3ICXA 4NYKA 2JGDB 3ZHSA 2FKXA 1WLEA 1PP9H 1Q5OA 1N36O 2R9RB 2F43G 2DOSA 1THZA 2E75B 3C90A 1XNQO 5BR8B 1F23A 4IL6Z 1N32B 1N8RW 4X88A 4JI2B 1Q82W 2ZCEA 1IURA 4J7ZA 1DF4A 2OCCC 1XL6A 4JI4O 3QO7A 3ABKB 3L72H 1F4NA 1PD3A 3MHHC 4PDMA 3K9SA 4CS3A 4LBEC 2N05A 1EFRG 3RYIA 5IJ0A 4I9WA 1FYJA 1XL4A 4UFZA 1Y76A 4J80A 3CCSV 2X0LA 1VF5B 1SQVH 2GUZB 3AK1A 4K35A 3QVNA 2QGNA 1Q81W 1YI2V 2QWOB 1Q6IA 4O2AB 1Y67A 1VQNV 2Q68A 3SYPA 3ASOC 1AJPA 1B6QA 1F4MA 3TXQA 3CX5F 3BABA 1ZUQA 4FVMA 4KXRA 5B1BB 5KAFZ 2VWKA 4TUYB 4JV5B 3ZMVA 5LBQA 1DGSA 4O4HB 1SS3A 4CH6A 3G6BA 4LF4B 1IBMO 1H8HG 1GN2A 3AG4B 1QVFU 4JAVA 2QTOA 4ZHQB 2IM9A 1TGOA 4RWUA 5LGTA 4FFKA 3DC5A 2JEXA 1WP7A 3K04A 1JR9A 3UKMA 1K5SA 1E1RG 3AG1C 4NXNO 4DR2B 3A8TA 4O4LA 3ZS8C 2EILC 2YEVA 4JI3O 2WLKA 2F66C 3OGCC 4OX9O 3CMAV 4J41A 4K8ZA 3DGEA 4H37A 5LMUO 5LHGA 3K58A 3KCYA 1Q8IA 4X1IB 5JQGA 3RVZA 2GBOA 3VOUA 1K4CC 4AILC 2CH7B 5EC1C 2Z5UA 2H3OA 2Y48A 4X9QA 5CBFA 2IU0A 2BSKA 1J95A 4LFAO 4HBNA 3FB5C 4KL1A 4DR6O 1N0JA 3BHPA 4NTYA 1BCCH 4UCOA 2ZIMA 4FM2A 4QIWF 3L73H 1LR1A 4PDLA 5GONA 1QLEB 3JALA 1ZL8B 4MVZA 5LMNB 3T1HB 2RCVA 2JDIG 1GH6A 1R1BA 1HWYA 3FYIB 2QA4V 4LH7A 1H2GA 1WN7A 2DMXA 4JZ2A 2ZM6B 2VQEO 1IXBA 1HNXO 2Q7GA 1DK1A 1AB3A 1QR8A 1KQSU 5EC2C 3UCSC 1FXHA 5ITZA 1OHHG 4DV2O 4TSFG 3H1HH 2OWOA 1KMIZ 1ORQC 1KC8W 3L74H 4KUMA 2V7QG 4QPKA 5KX5A 3ZIAG 1Q86W 3BRCA 2JJ2G 4G2KA 1XEQA 2R72A 4YIOA 1F7YA 4NKGB 1GN3A 4RO2A 3CCVV 4QE9A 2OCCB 4U7NA 1UJWB 2UXCB 3CXHF 5D5PA 5AG2A 1NU1H 2EX3A 5E79Z 3OMAB 1O9GA 1I94B 1Q6UA 1YDXA 2IH3C 1AI7A 4ICGA 3SPHA 4CS4A 4LF8B 1HNWO 4L87A 4FLWA 2PUSA 4NXMB 4DR1B 5J9PC 1G8MA 4MT8A 3FYEB 4GKJB 2P06A 3G67A 3OUSA 1XREA 3K3WA 3H1JH 4ABMA 2QWPB 3ASOB 3W7UA 3CP1A 1XHXA 2ODMA 1SETA 3K5OA 3HKDA 3UQ8A 2FB5A 5GTHZ 1P4RA 1PKXA 3HKCB 4O2BB 5BMVB 1KP3A 3L71H 2IBZH 1WA8A 2QKAA 1IBLO 4YJ2A 2B1GA 4I55A 3A2FA 1RSOB 3JCUZ 4I50A 3E83A 4D6TH 1WAZA 3ASNC 1TA8A 3M7MX 1RFYA 3DXRB 4MTFA 5E1AC 2W0FC 2XAFA 4QGPA 3J7AU 2YIBA 3AG1B 1FFTB 1M93A 3F5WC 1GRJA 1AVMA 2PI5A 1IBKB 2G38A 3TXSA 3VQYA 1JFFB 2EILB 3T1CA 2Q69A 1VQ9V 2WLLA 1W0JG 5KHIA 2KQXA 2CE4A 5LL6Y 3E22A 3R65A 3AG2C 4KHPO 3SGIA 2P90A 1U97A 1W59A 1XQ8A 4DO2A 3ML0A 4HYOA 1WB8A 1FJGO 1IVSA 3K9AA 4X65B 4FMTA 2QM8A 1XMOO 3I5DA 3CRAA 3C3SA 3K5LA 3WB1A 2JS5A 4WFBV 1NTMH 4UUJC 2KG7A 3BA9A 3JASA 5FPRA 2UU9O 4OX9B 5KA6A 5HFMA 1VARA 4OXSA 4AQYO 1NQTA 1SZTA 3CYOA 2ZINA 3JATA 5EZYA 1QQCA 1BZKA 3E8HA 3RYIB 2Q0OC 1XHZA 5L3CA 5L3DA 2ZNIA 1Y76B 3OR7C 1N0NA 5KLVH 3RVYA 3EVKA 4DV1O 5LOVA 3JSLA 2NNUA 2QSAA 2F1MA 3ZCCA 4WFAV 2FMLA 1SQGA 4R6ZA 1Q6HA 4FFBA 1IXMA 3CJHA 3QTCA 3K57A 4JI5B 2EINC 1OCOC 1JX9A 4BW9A 1XMQB 4J42A 4JI8B 4I4TA 2YIBD 1IZ3A 1HNXB 1TUBA 1O9HA 2EBOA 1RM1C 2IJJA 4B3MO 2ZR2A 1NTZH 1SQPH 4O4IA 1RPRA 2FTKA 1Q43A 5L3GA 4O4LB 2LGWA 3CRRA 1YJWV 1G6UA 2YEVB 3GWOA 4CS2A 5BZBA 4AHCA 4JYCA 5DEDA 2L35A 3PJSK 4B3RB 5B1BC 5JQGB 3T1YO 3ZRWA 3IAYA 4RUFA 3W7SA 2BSKB 3B40A 4MVQA 3LNMB 1IDSA 3QNEA 4X62O 4JAAA 4YXWG 2AZ0A 4DV5B 2N74A 3H1KH 4L8JA 5GONB 4B08A 5LXTB 1BQ0A 4XDJA 3JALB 3ASNB 2P5OA 1Y4MA 4FLZA 5CA0B 2E3CA 1SF9A 2WA3A 3DTUB 1S5LZ 4LP8A 3CXCU 1NJIW 2QEXV 3APOA 4JZGA 5IT9N 2YS8A 2VWJA 1CPYA 2GV9A 4U7OA 1H2MA 1K92A 3TCUA 4DR4B 1E1QG 1IBLB 3H01A 4W4KA 4H0LB 4CBCA 4P2ZA 1HP8A 1IX9A 1YIJV 2UUCB 1N34B 3AG2B 5KA5A 3CHXA 2GSMB 5ITZB 4FK5C 1Y74A 4NR1A 5JJJB 3BY6A 1EZVH 3HKEA 5KX5B 1HNZO 3CMEV 2CGOA 4UXNA 4WFFA 1HR0B 3SJCC 1TAEA 5LP6A 4C7UA 4U3JB 5DECA 3WB0A 2CTWA 2YI8A 1Q3EA 1NZ6A 3ZMZA 4FJCC 3LNNA 4GX2A 5FL7G 3HPLC 2JVDA 3CS5A 4IGGA 4JAUA 2Y0IA 3G80A 1KYOF 5KUKA 2PYJA 3R66A 4WFHA 2YXLA 1BS3A 4B3TB 2DWEC 3LSSA 1FAFA 2WWWA 1VQOV 1G1XB 3FX7A 2WLIA 3JARA 4DV6O 2UUAB 1NS1A 4G28B 2ETNA 3BAAA 3CB2A 2PTMA 4GX1A 3ZN1A 4LF6O 1WJZA 1PNMA 1OJHA 2DN9A 3HKDB 4NTXA 5KHHA 1H2LA 2HP8A 3ZN0A 4MS2A 4DK0A 2EINB 1OCOB 3I56V 2YIAA 2EIKC 4AI8A 1WA8B 2YXYA 1SRYA 4YJ2B 2AW9A 5A9GA 1BMFG 4I55B 5H6QA 3ZHQA 1M1KW 1VQ4V 1MSDA 3CRMA 1AI4A 3OTFA 1XNRO 5LGUA 2YXHA 4I50B 2DE0X 1SESA 4ZIBA 3ABUA 2WA4A 4YIPA 4ZI7A 1RM1B 1YJ9V 4Z1VA 4JI6B 4X66O 3G6EV 1VIBA 4K0KB 3FD9A 4DYLA 3PN1A 4HZ3A 4CC5A 1PNKA 1FXVA 2V4DA 1PNLA 2YC0A 1MOFA 1KD1W 4DW0A 1YJNV 1WNSA 3CC7V 1R3KC 5IYDO 1D5NA 2WLLB 3CPWU 4UVCA 3ZHRA 5CBGA 1EN5A 4DV3B 4WBNA 3BEHA 3E22B 2X6AA 1UFIA 5CA1A 2VRZA 3ZHUA 3BFRA 3M99B 4EB6A 3TJTA 4I7ZB 2F93B 3S3XA 1Z5WA 1JVMA 5LP6C 3ETGA 4DRXA 2P7TC 2NR5A 1N33B 3OGIB 1SQFA 2KG7B 1KB9F 1AJQA 3B09A 3TGUH 3JASB 3JSNA 1QCEA 2L6LA 1JPXA 2EJ7A 4F6RA 3CSXA 3JATB 2E5LB 5EZYB 1L0NH 2IH1C 4GT1A 1AROP 3OMIB 1SQBH 3MHSC 4LF5B 5HFLA 5LYJA 4FM0A 1R3LC 5L3BA 5LOVB 2ZQMA 1DLBA 1LNQA 4YJ3A 4DR7B 1I08A 1QLNA 4O4JA 4LFCB 2F4VO 2QKCA 4JI1O 1I5XA 1K73W 4DUZO 3VQVA 4MSWC 4X8AA 1K33A 4IYIA 4FFBB 4FLYA 3CJHB 2IU3A 3CCLV 4D7TA 2OIGA 2UXBB 3JCZA 4D7SA 3O65A 4Z1MG 2X7RB 1GN6A 1VF7A 4LR3A 2IJHA 1J5EB 3A0RA 4JI0O 4I4TB 4MVOA 4DV4O 1TUBB 3FB8C 2Q7EA 3ZHTA 1R6TA 1ZWIC 5GW7A 4UVBA 1R3JC 2WLNA 3RW0A 4J7JA 4O4IB 4DV0O 2Q5ZA 5K1XA 3JAWA 4GYCB 2ZDIA 4CH5A 1Q7YW 4CH3A 1GK9A 3D3IA 3N2KB 1MZFA 2JS3A 3OEHG 4TV9A 2W0XA 5FLXN 1HW7A 1K3EA 1KP2A 2VQFO 2DWDC 3HKBA 1R6NA 1GTOA 3ZBHA 1L1FA 2XUMA 4I9QA 4GKKO 3CEIA 2JJ1G 1A32A 3WB2A 3F7VC 3ZRWB 3AG3B 3G4SV 4GZRB 1YSCA 5JJNB 1ROPA 2GTAA 1MNGA 3K03A 2PF4E 1GM8A 3GB7C 4IHJA 1S3JA 4NTWA 2EIKB 4UCVA 3TK1A 2A06H 2R70A 1OCCC 2XTAA 4DR3B 4RAIA 3CCRV 1SQQH 2NLJC 3STLC 4LF7O 3QO5A 3OUFA 2UUBO 4X20A 3T4DA 4JYAO 1BL8A 3CCMV 4LF6B 2RDCA 2P22C 4TV8A 1B3QA 1N36B 1QR9A 3AK2A 3HR0A 1KU9A 1XNQB 3Q4HB 4JGSA 4X64O 1XDCA 1S5HC 4DR5O 4UB6Z 5CA3A 3UO3A 3EFFK 4XDKA 4XBFA 4JI4B 1XNRB 2DYRC 3OT7A 3SYQA 2MK3A 1R73A 3H1LH 4DW1A 4WF9V 1VQPV 1QBZA 1Y74B 1YCIA 1WPXA 4BIZA 3RGBA 4TT3G 4EKWA 2PI4A 2ZR3A 2EZOA 1V54C 5LP6B 4YHHO 3JAKA 1QVGU 4LWSA 1US6A 4FZ0A 1K8AW 2RNBA 4BIOA 3NXSA 2Q7HA 3ZRSA 2HHHO 5IWAO 2LFRA 4H33A 1T5EA 1GN4A 3H9VA 1TUEB 1QU7A 4LF9O 2XNDG 4RQFA 2ZDIC 1AJNA 1ZAUA 1P7BA 2CAZC 1FXKA 2R9AA 2E76B 2M7WA 2WLIB 3ZRVA 3JARB 3CC4V 3ETEA 3ZHVA 1ZSPA 1M56C 5K1PA 1IBMB 1NT2B 1VQMV 2IJIA 3RN4A 3J81N 2XHBA 5C8YA 2KSDA 2Q9LA 3GWKC 5KUMA 1H8EG 1M9NA 2UXDO 3KCXA 2OCHA 2HEPA 4NXNB 4O2AA 1NBMG 4JYYA 3UT5A 3OFNG 4E2LA 3RT3C 1B04A 4P30A 2QR4A 4I5SA 4YY3O 1CP9A 4ASUG 2FL4A 4JI3B 5CBHA 5JVDA 1M4UA 4DV7O 3SYAA 5KHKA 4ZI7B 5LMUB 4JI7O 1R3IC 1NTKH 4BIUA 3NR7A 5IJ0B 4TWKA 2EIMC 1RPOA 4ZHQA 5LA6A 4LFAB 1BE3H 4LFBO 2EIJC 4DR6B 2OTJV 3OTOO 2QTSA 4DUYO 3FB6C 3SPGA 4PELA 2Q73A 1S77D 3JD1A 1JQ0A 4PI0A 4XDLA 2HR3A 5IYZA 4WBNB 5BR8O 1N32O 4PD4F 3N2GA 1PM9A 1VF6A 4JI2O 5CA1B 5EIBD 3LSUA 2ZIOA 2BCCH 2GDSA 3K0GA 2D2CB 3MD0A 2LFSA 1P84F 1W2BU 2JIZG 4EB6B 2CDYA 1EBOA 2Q0AA 1Y66A 3ZX6A 3LDCA 1FFXA 5B1AC 1NI8A 5EIBC 2VQEB 1PV0A 4FLXA 2AGAA 4DRXB 2GTSA 5B3SC 3P3PA 4QNHB 1OCCB 4HAMA 2P6JA 3F7YC 1COWG 5IE9A 5KMGA 5BY1A 4I0XA 2RN9A 4KP4A 3S3WA 4IIJA 4DV2B 1NR1A 2HJFC 4F6RB 1NR7A 3D8CA 2H8PC 1YF2A 4ZKIA 4HNAA 1FXKC 2JK5C 3H1IH 5CB4A 2WLHA 3JD2A 3BA8A 3G71V 2X6CA 2DYSC 1F51A 1YVWA 5LYJB 1JCHA 2HG5C 4QPJA 4A5UB 4JV5O 2IW5A 4YJ3B 1V55B 1KECA 4R50A 2XAJA 3D36A 4O4JB 2DYRB 4LF4O 3A0HZ 1N4CA 1HNWB 5KHJA 1CEZA 5EYPA 5DN6G 3CCEV 3SDLA 3OD4A 3L9DA 3E35A 1NH2D 3B2EE 1V54B 2ILMA 4H44B 3RWRD 2HJDA 2VS0A 1BHAA 4JPRA 1JJOA 2WSSG 3LDEA 2WPDG 4WFGA 1V9PA 3JAWB 5A2QN 1YEWA 4JTAB 3MAQA 2Y69C 2ZE5A 4PDRA 4TV9B 1NVPD 3HB3B 1FPOA 1M56B 4LCUC 1OCZC 1SA0A 2K9PA 5TISZ 3FKSG 4PI2A 1S72V 4GX0A 1M90W 4J10A 2LQTA 2MW2B 1VF6C 3SPJA 2XAHA 3WU2Z 5J2TA 4JTDB 2YSUB 3ABTA 3E8GA 3OEEG 5LMNO 3T1HO 2CK3G 3OR6C 3VQWA 5H5NA 3QG5A 2M6YA 2BTQA 3DSQA 5B5EZ 4B3SO 3MDSA 4IHJB 3E89A 5EBWC 4MTXA 1OCRC 2Y4TA 3GVMA 2ITCC 2A9HA 2QKSA 1H2KA 3IC7A 4KHPB 3QF7A 2UXNA 1BT8A 4X20B 4QJFB 1MSWD 5BXZA 4FIPC 3OMNB 3CCJV 2EIMB 5EBMC 1FJGB 4TV8B 4N21A 2EIJB 5CMUA 1XMOB 5LHHA 4EEQA 1YXBA 5GTIZ 1AR1B 1X59A 4W4LA 3ZEDA 5IJ9A 1EZJA 3L75H 3D36C 2UU9B 3AG3C 4JASA 3T2MA 1TVKA 2KB1A 4UCRA 4AQYB 2A79B 1KUQA 2IJKA 3IC9A 2UXCO 2E74B 4FPPA 2D3OW 4JF3A 2ZE6A 1I94O 1M57C 4LF8O 3OTOB 4DUYB 5B1AB 4BWAA 3JAKB 1WPBA 4NXMO 4DR1O 2QM7A 5C93A 4DV1B 3K0DA 4LWSB 5B3SB 2WLMA 3UM7A 1VEWA 4GKJO 3ABMC 1Z5VA 3K08A 2CTRA 5DM6V 2OYQA 1H38A 1ZLZA 4MTOA 4X1KA 3B8MA 2OTLV 4BR6A 1FXKB 4MVRA 2ADQB 1GO3F 2JGUA 2YDEA 1AI6A 4X1YA 2DYSB 4UCSA 2LP7A 3TETA 1I7FA 4B3MB 5C8YB 4TQFA 4J11A 1VQ6V 4LC1A 1CXZB 3CWBH 2LO1A 2YIDA 4P9PA 4MTGA 3UT5B 4K8XA 2AXTZ 2HVJC 1H2SB 1PPJH 5H2FZ 3FAVA 2YICA 5JVDB 1IBKO 1NH2B 4CC6A 5FNVA 1HDJA 4ZBMA 2AZ2A 3O9OA 1XI1A 2ZT9B 4DXWA 3EXAA 3T1YB 4UVAA 1WB7A 1SQXH 3RYCA 3SJBC 3BVOA 4BW5A 1EM1A 3RYFA 2Z3YA 5LA6B 3WG7C 1S5JA 1JMKC 2Y69B 1SZXA 4X62B 4UCTA 1GMGA 3VBBA 3BPZA 2WAMA 4X65O 1VQLV 1BHBA 5L3FA 1OCZB 2O57A 2P4VA 5IYZB 4UCUA 3N2GB 1NVPB 4PA6A 3RBZA 5JH7A 4OPAA 2B5UA 3D3QA 4GCZA 1VQ8V 4CZZA 2ZXWC 1EN4A 1FFXB 4BAYA 1OCRB 1GM7A 3ZMSA
chains in the Genus database with same CATH topology
2XNDG 4RQFA 2YEVB 2ZDIC 3GWOA 1AJNA 5BZBA 1P7BA 4R7CA 4JYCA 1FXKA 1WLEA 3PJSK 2M7WA 2WLIB 3ZRVA 3CC4V 3IGAC 2R9RB 3ETEA 5B1BC 2F43G 1THZA 1M56C 3ZRWA 1VQMV 1F23A 5IY5C 2IJIA 4F4LA 1N8RW 4X88A 4RUFA 3W7SA 1Q82W 3AEIA 4MVQA 4UV9A 1DF4A 3LNMB 2OCCC 1XL6A 5KUMA 1H8EG 3QO7A 3QNEA 3ABKB 1M9NA 1F4NA 1PD3A 3MHHC 4PDMA 1ENVA 4YXWG 1NBMG 4LBEC 2HKOA 2V1DA 4E2LA 3OFNG 1EFRG 4XDJA 3ASNB 4P30A 1Y4MA 4I9WA 4I5SA 3JD3A 1XL4A 2R9IA 3CCSV 1CP9A 2BOBC 2X0LA 3DTUB 4ASUG 5CBHA 4LP8A 3B77A 3SYAA 1M57B 2Q6AA 3CXCU 1YI2V 1PL0A 1Q81W 3ZMUA 3ETDA 1NJIW 3JD0A 2QEXV 4JTCB 1CPYA 1R3IC 4U7OA 1VQNV 2B1IA 1K92A 2Q68A 3SYPA 4BIUA 3ASOC 3TCUA 1AJPA 1B6QA 1F4MA 2AHYA 4TWKA 1E1QG 2EIMC 1RPOA 3ABMB 1YITV 3H01A 4CBCA 5B1BB 4GX5A 4P2ZA 2EIJC 3T4ZA 2OTJV 1MABG 2ZD9A 1YIJV 3FB6C 3SPGA 2X6BA 3AG2B 4PELA 5KA5A 2GSMB 3K06A 1K5QA 5IYBO 4FK5C 3ZMVA 5LBQA 1S77D 3BY6A 3JD1A 1JQ0A 4XDLA 2HR3A 1H8HG 3AG4B 3ZMTA 1QVFU 2HVKC 4JAVA 2QTOA 3CMEV 1GM9A 4UXNA 4WFFA 1V55C 5LGTA 1NKDA 5B1OA 3SPIA 3K0GA 3ZMZA 2JEXA 4FJCC 4GX2A 3K04A 5FL7G 3HPLC 3MD0A 2LFSA 1W2BU 2JIZG 5CN0A 3UKMA 1K5SA 1EBOA 1E1RG 3AG1C 1Y66A 1W0KG 3K79A 3LDCA 4JAUA 5B1AC 4MW3A 2EILC 5KUKA 5B3SC 4QNHB 1OCCB 4HAMA 3CCUV 2P6JA 3F7YC 1COWG 2YEVA 3ABLC 4WFHA 2WLKA 2DWEC 4PA9A 3OGCC 2ATKC 3LSSA 4KP4A 2WWWA 1VQOV 1NR1A 3CMAV 2WLIA 3DGEA 4H37A 2HJFC 5LHGA 1NR7A 3RVZA 2H8PC 3VOUA 1K4CC 4G28B 5EC1C 4ZKIA 2Z5UA 2W6IG 2Y48A 1FXKC 5CBFA 2JK5C 4KFMA 2IU0A 1K97A 1S76D 2WLHA 3JD2A 1J95A 3G71V 4GX1A 2X6CA 3FB5C 2DYSC 1F51A 2OT5A 3ZN1A 1JJ2U 1JCHA 4QIWF 1G4YB 2HG5C 4QPJA 1PNMA 3WG7B 2IW5A 4PDLA 1V55B 5B1NA 1QLEB 1KECA 4R50A 3ZN0A 2XAJA 3D36A 2DYRB 4MS2A 4MVZA 2EINB 1OCOB 3I56V 3E8BA 2EIKC 4RQEA 1CEZA 2JDIG 5DN6G 1SRYA 3X2QC 1VQ4V 2H94A 3CCEV 1BMFG 1HWYA 4N23A 5H6QA 1M1KW 3FYIB 1AI4A 2QA4V 3E35A 1NH2D 5EBLC 5LGUA 3KG2A 4J9YB 1SESA 3SYOA 3ABUA 3OE7G 1V54B 1S0VA 1VQ7V 1RM1B 1YJ9V 3EHBB 1E79G 3G6EV 1H2GA 3W7TA 4MVSA 1K7DA 4HZ3A 1PNKA 4WFEA 1BHAA 4JPRA 1FXVA 1PNLA 2WSSG 2ZXWB 1MOFA 3LDEA 1KD1W 3P30A 1QR8A 1YTFD 1KQSU 1K9MW 1YJNV 2WPDG 5EC2C 3CC7V 1R3KC 1FXHA 4PA7A 3FB7C 4WFGA 5IYDO 3LUTB 1OHHG 1SERA 1GKFA 3P32A 2WLLB 4TSFG 5L3EA 4UVCA 5CBGA 3CPWU 2HLDG 4JTAB 5EK0A 2Y69C 1ORQC 1KC8W 3CCQV 4PDRA 4KUMA 2V7QG 3BEHA 4QPKA 3ZIAG 2DQ0A 4MW8A 1YHQV 1NVPD 2X6AA 1Q86W 3HB3B 4X89A 1M56B 4LCUC 3SYCA 1OCZC 2JJ2G 3WFVA 4G2KA 5IY5B 3FKSG 1S72V 3M99B 4GX0A 4MVMA 1M90W 4RO2A 3CCVV 4QE9A 3SPJA 2XAHA 2OCCB 4U7NA 1UJWB 5IYCO 1JVMA 4JTDB 2YSUB 3ABTA 3E8GA 3OEEG 3ETGA 3OMAB 5LGNA 2CK3G 3OR6C 2HFEC 1AI7A 2IH3C 2P7TC 3LDDA 1K34A 3SPHA 4L87A 3JD4A 4MVUA 4PA4A 1AJQA 3W7XA 3CD6V 5J9PC 4UV8A 5H6RA 3E89A 5EBWC 4MTXA 1OCRC 1G8MA 4MT8A 1QCEA 3FYEB 1JPXA 2ITCC 1JOYA 1DF5A 3STZC 2A9HA 2QE7G 2QKSA 3OUSA 3K3WA 2IH1C 3IC7A 4GT1A 1AROP 3OMIB 2UXNA 2XAGA 3MHSC 4J9ZB 5HFLA 4QJFB 2WLJA 1MSWD 3ASOB 3W7UA 1R3LC 3OMNB 4FIPC 2EIMB 3CP1A 5EBMC 5L3BA 3CCJV 2EJRA 4P9OA 2ZQMA 1SETA 4N21A 1DLBA 1LNQA 2EIJB 1KKDA 1QLNA 5CMUA 1P4RA 2ITDC 5LHHA 1PKXA 3ABKC 1I5XA 1AR1B 1K73W 1AI5A 1KP3A 1FS0G 4MSWC 4X8AA 2B1GA 1K33A 1EZJA 1DTOA 2DW4A 3E83A 2IU3A 3AG3C 4JASA 3T2MA 3CCLV 2KB1A 3OM3B 4PA3A 3ASNC 4RUEA 2Q67A 5IDJA 3JCZA 2A79B 2IJKA 4Z1MG 2X7RB 4MTFA 5E1AC 2W0FC 2XAFA 2IJHA 3A0RA 4FPPA 2D3OW 4JF3A 4G27B 4MVOA 3FB8C 1M57C 3AG1B 1ZWIC 5GW7A 2XOKG 1FFTB 3F5WC 4UVBA 5B1AB 2PI5A 4Q20A 1R3JC 2WLNA 3B8NA 2QM7A 5C93A 2EILB 3T1CA 3K0DA 2Q69A 5B3SB 2WLMA 3RW0A 3UM7A 1VQ9V 2XAQA 2WLLA 3ABLB 2ZDIA 1W0JG 3ABMC 1Q7YW 1GK9A 3D3IA 3I55V 3K08A 3OEHG 5DM6V 3JYCA 3R65A 3AG2C 1H38A 2P67A 4MTOA 1OZ0A 2P90A 4JYBA 3B8MA 1K3EA 1KP2A 3SPCA 4DO2A 3ML0A 4HYOA 2DWDC 1R6NA 1GTOA 5LHIA 2OTLV 1FXKB 4MVRA 1L1FA 3K9AA 3AG4C 4FMTA 1GO3F 2JJ1G 1AI6A 2QM8A 2DYSB 2UXXA 1VQ5V 3W7WA 3F7VC 3ZRWB 2LP7A 3AG3B 4PDVA 3G4SV 3TETA 1YSCA 4WFBV 4UUJC 1ROPA 3K03A 1VQ6V 1GM8A 3GB7C 4LC1A 3ZRXA 1S3JA 5KA6A 2EIKB 5HFMA 5H9CA 3QO8A 3TK1A 3X2QB 4OXSA 4P9PA 1NQTA 1SZTA 3CYOA 1OCCC 2JEUA 4MTGA 4RAIA 3CCRV 3E8HA 2HVJC 2NLJC 3ZJZA 3E86A 5L3CA 5L3DA 3STLC 4R8CA 3OR7C 3QO5A 3OUFA 3T4DA 1BL8A 2K1EA 3CCMV 2BOCC 2AHZA 1NH2B 4ZBMA 3OAAG 3RVYA 3SJQC 2XASA 2NNUA 1QR9A 4DXWA 3E2EA 4JGSA 4UVAA 1S5HC 3ZCCA 3E8FA 4WFAV 4BW5A 5CA3A 3EFFK 4XDKA 4R6ZA 2A0LA 2Z3YA 3WG7C 4XBFA 2Y69B 1QLEC 1YTFB 1IXMA 3IFXA 1GMGA 2DYRC 3VBBA 1I5YA 3SYQA 2MK3A 1R73A 2EINC 4WF9V 2WAMA 1OCOC 1VQPV 1QBZA 2EZPA 4WCEV 1VQLV 1JX9A 1BHBA 5L3FA 1OCZB 1WPXA 3CC2V 4BIZA 1K4DC 4TT3G 4EKWA 2PI4A 2ZR3A 3LSQA 2W6JG 2EZOA 1VQKV 2EBOA 1V54C 1NVPB 1RM1C 2IJJA 1R6KA 4PA6A 3RBZA 2ZR2A 1MG1A 2B5UA 1QVGU 4GCZA 2GHYA 1K8AW 1VQ8V 4QE7A 4CZZA 1RPRA 2ZXWC 3NXSA 2DQ3A 3ZRSA 2FTKA 2C2AA 4BAYA 2LFRA 5L3GA 4H33A 1OCRB 3OW2U 1TUEB 1GM7A 3ZMSA 1YJWV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZT A;  1JQ0 A;  2EZO A;  3CYO A;  2EBO A;  3GWO A;  3K9A A;  1K33 A;  3B8N A;  3MHH C;  2OT5 A;  1ENV A;  2P6J A;  3MHS C;  5HFL A;  2M7W A;  1MG1 A;  1K34 A;  2LP7 A;  4E2L A;  4FIP C;  3H01 A;  3CP1 A;  1Y4M A;  2X7R B;  1I5Y A;  4FJC C;  2MK3 A;  1F23 A;  1DLB A;  4JPR A;  4N21 A;  1QBZ A;  2EZP A;  5CN0 A;  4G2K A;  3WFV A;  1QCE A;  4JF3 A;  5CMU A;  1MOF A;  1JPX A;  1EBO A;  5KA5 A;  3P30 A;  1QR8 A;  1Y66 A;  1DF5 A;  3B8M A;  5KA6 A;  3M99 B;  4FK5 C;  1DF4 A;  1QR9 A;  1I5X A;  3B77 A;  4N23 A;  5H9C A;  5HFM A;  4JGS A; 
#chains in the Genus database with same CATH topology
 3THO A;  3J80 N;  5KMG B;  4I0X B;  3KZI Z;  4R7C A;  4IIJ B;  1VMG A;  4ZOL A;  2QM4 A;  3IGA C;  5LXT A;  2ZE7 A;  5FPO A;  3RYH A;  2CGN A;  3B4S A;  2QDO A;  5IY5 C;  1HNZ B;  4TQD A;  4HNA B;  4F4L A;  2JRI A;  5CA0 A;  1MMM A;  1Q90 D;  3AEI A;  3BCC H;  5CB4 B;  4UV9 A;  1SC5 B;  1UPG A;  4B3S B;  2QWR B;  4J7K A;  4JI5 O;  1ENV A;  5JJE B;  4K3A A;  1MA1 A;  2HKO A;  3JAM N;  2V1D A;  3K59 A;  1XMQ O;  4JI8 O;  4EFE A;  2P4K A;  1QHT A;  3JD3 A;  2R9I A;  2BOB C;  5EYP B;  1YZB A;  3B77 A;  4F6E A;  4FM1 A;  1M57 B;  2Q6A A;  1PL0 A;  3ZMU A;  3ETD A;  4DV6 B;  3JD0 A;  5KHG A;  4JTC B;  4GLX A;  1XIL A;  1EN6 A;  2QWN B;  2B1I A;  1BQZ A;  5J2U A;  2AHY A;  1BSM A;  1RP3 B;  3M8A A;  4LH6 A;  3UO2 A;  3ABM B;  1YIT V;  3FFQ A;  4OGQ B;  4GX5 A;  3T4Z A;  4U3J A;  4FLV A;  1MAB G;  1AR5 A;  2ZD9 A;  4PV1 B;  2X6B A;  3RFR A;  3K06 A;  2B9Z A;  1K5Q A;  5IYB O;  4B3R O;  2Z0A A;  2F23 A;  1I0H A;  2F95 B;  2DJV A;  3ZMT A;  1XUQ A;  2HVK C;  4IT5 A;  1GM9 A;  1V55 C;  2OIE A;  1SA0 B;  3ETQ A;  1NKD A;  5B1O A;  3N27 A;  3SPI A;  5CN0 A;  3DC6 A;  4DV5 O;  4X66 B;  3KKY A;  2Y0P A;  1W0K G;  4LNU A;  3K79 A;  5J2T B;  2YUA A;  4U3F H;  5JCO A;  4MW3 A;  5JWP A;  3HKE B;  3AG7 A;  3CCU V;  2PZS A;  2BTQ B;  3ABL C;  4PA9 A;  2JGD A;  2ATK C;  3AK3 A;  1PL4 A;  3K5M A;  4DR4 O;  2W6I G;  4KFM A;  2XT9 A;  1K97 A;  4OPH A;  4Z2W A;  1S76 D;  3IJ4 A;  2Q8V A;  2A3Q A;  2OT5 A;  1KBH A;  2UUC O;  4TOI A;  1N34 O;  1JJ2 U;  1G4Y B;  3WG7 B;  1U96 A;  5B1N A;  1KKC A;  1AR4 A;  3U10 A;  3E8B A;  4RQE A;  3X2Q C;  2H94 A;  4N23 A;  5IJ9 B;  1HR0 O;  1LUW A;  2GUZ A;  5B66 Z;  5EBL C;  4B7K A;  3KG2 A;  4J9Y B;  3SYO A;  1TVK B;  2BE3 A;  3OE7 G;  1S0V A;  1VQ7 V;  3EHB B;  1E79 G;  3W7T A;  1VP7 A;  4MVS A;  1K7D A;  4NVP A;  1URF A;  4WFE A;  2KKW A;  2ZXW B;  1AP6 A;  1YTF D;  3P30 A;  1K9M W;  4B3T O;  4UB8 Z;  4TUY A;  1ZX3 A;  1OV9 A;  4PA7 A;  3FB7 C;  3LUT B;  1SER A;  1P7G A;  2FYU H;  1GKF A;  3P32 A;  4O4H A;  5L3E A;  2HLD G;  5EK0 A;  2UUA O;  2F4V B;  4JI1 B;  3CCQ V;  4DUZ B;  2DQ0 A;  4MW8 A;  1YHQ V;  4X89 A;  2LGQ A;  4X1K B;  4IYH A;  3SYC A;  1X4T A;  3WFV A;  1M5I A;  5IY5 B;  1XBL A;  2NN4 A;  2Y4U A;  4MVM A;  4X1Y B;  5IYC O;  2ZNJ A;  1QNM A;  2YI9 A;  4EFB A;  4JI0 B;  4DV4 B;  5LGN A;  2HFE C;  3LDD A;  1K34 A;  3JD4 A;  4MVU A;  4PA4 A;  3W7X A;  3CD6 V;  4UV8 A;  2RMK B;  5H6R A;  5JCO C;  4DV0 B;  1D2D A;  2PGG A;  1L8D A;  1JOY A;  1DF5 A;  4X1I A;  3STZ C;  4JI6 O;  4K0K O;  2QE7 G;  1JA8 A;  2CH7 A;  3U0Z A;  3APQ A;  4PJ0 Z;  1L0L H;  5F2V O;  2EUL A;  2LW1 A;  3FAV B;  3P3N A;  3L70 H;  2XAG A;  4J9Z B;  2VQF B;  2WLJ A;  2PYL A;  5FNV B;  4GKK B;  2EJR A;  2QWQ B;  4P9O A;  1B06 A;  1KKD A;  4PHZ A;  4Q6G A;  4DV3 O;  2ITD C;  1ZL8 A;  3CRQ A;  3RYC B;  1SKV A;  3ABK C;  1AI5 A;  1FS0 G;  3RYF B;  5D5Q A;  1P49 A;  1DTO A;  2DW4 A;  4FZ1 A;  3CRC A;  4PA3 A;  3OM3 B;  1GAX A;  4RUE A;  2Q67 A;  5IDJ A;  1WP8 A;  3N2K A;  4G27 B;  4LF7 B;  2RJZ A;  2UUB B;  2XOK G;  1N33 O;  4JYA B;  5JH7 B;  4Q20 A;  3B8N A;  2XAQ A;  3ABL B;  4X64 B;  2E5L O;  4DR2 O;  4DR5 B;  3I55 V;  3JYC A;  2P67 A;  1OZ0 A;  4JYB A;  2ADP A;  4LF5 O;  3SPC A;  5LHI A;  1MZE A;  2A7W A;  1AIL A;  4ZOL B;  3AG4 C;  4FLT A;  2QJ1 A;  1H2N A;  4DR7 O;  2UXX A;  1VQ5 V;  3RYH B;  3W7W A;  4PDV A;  4LFC O;  2CTP A;  2PY5 A;  1FD9 A;  4YHH B;  3C3T A;  3ZRX A;  2CTQ A;  3HKB B;  5H9C A;  3QO8 A;  3X2Q B;  2UXB O;  5KAI Z;  2HHH B;  2JEU A;  3Q4H A;  4CH4 A;  5IWA B;  2LJ2 A;  1J5E O;  3ZJZ A;  3E86 A;  1Y6X A;  1ZTE A;  4R8C A;  4LF9 B;  2Q4P A;  2K1E A;  2BOC C;  2AHZ A;  3VQX A;  3A0B Z;  3OAA G;  3SJQ C;  4E4E A;  1AP5 A;  4FLU A;  2XAS A;  3E2E A;  1BGY H;  5J2U B;  3E8F A;  3HKC A;  4O2B A;  2ZM6 O;  5BMV A;  2N04 A;  2LW7 A;  2A0L A;  4B7E A;  1Z2G A;  1QLE C;  1YTF B;  1RSO A;  3IFX A;  4H13 B;  2ZKO A;  2UXD B;  1I5Y A;  2CUG A;  3SR2 C;  3U11 A;  4NB5 A;  2EZP A;  4WCE V;  3DXR A;  2ARH A;  3CC2 V;  1K4D C;  4YY3 B;  3SJA C;  4GUN A;  4DK1 A;  3LSQ A;  3F5T A;  2W6J G;  3CE2 A;  1VQK V;  1R6K A;  1XOU A;  4DV7 B;  1JFF A;  1MG1 A;  2ZE8 A;  2RQ6 A;  2GHY A;  4JI7 B;  4QE7 A;  1FKA O;  4LNU B;  2DQ3 A;  2C2A A;  4DR3 O;  3OW2 U;  3K5N A;  2BTO A;  4LFB B;  1D5A A;  1LUV A;  3ICX A;  4NYK A;  2JGD B;  3ZHS A;  2FKX A;  1WLE A;  1PP9 H;  1Q5O A;  1N36 O;  2R9R B;  2F43 G;  2DOS A;  1THZ A;  2E75 B;  3C90 A;  1XNQ O;  5BR8 B;  1F23 A;  4IL6 Z;  1N32 B;  1N8R W;  4X88 A;  4JI2 B;  1Q82 W;  2ZCE A;  1IUR A;  4J7Z A;  1DF4 A;  2OCC C;  1XL6 A;  4JI4 O;  3QO7 A;  3ABK B;  3L72 H;  1F4N A;  1PD3 A;  3MHH C;  4PDM A;  3K9S A;  4CS3 A;  4LBE C;  2N05 A;  1EFR G;  3RYI A;  5IJ0 A;  4I9W A;  1FYJ A;  1XL4 A;  4UFZ A;  1Y76 A;  4J80 A;  3CCS V;  2X0L A;  1VF5 B;  1SQV H;  2GUZ B;  3AK1 A;  4K35 A;  3QVN A;  2QGN A;  1Q81 W;  1YI2 V;  2QWO B;  1Q6I A;  4O2A B;  1Y67 A;  1VQN V;  2Q68 A;  3SYP A;  3ASO C;  1AJP A;  1B6Q A;  1F4M A;  3TXQ A;  3CX5 F;  3BAB A;  1ZUQ A;  4FVM A;  4KXR A;  5B1B B;  5KAF Z;  2VWK A;  4TUY B;  4JV5 B;  3ZMV A;  5LBQ A;  1DGS A;  4O4H B;  1SS3 A;  4CH6 A;  3G6B A;  4LF4 B;  1IBM O;  1H8H G;  1GN2 A;  3AG4 B;  1QVF U;  4JAV A;  2QTO A;  4ZHQ B;  2IM9 A;  1TGO A;  4RWU A;  5LGT A;  4FFK A;  3DC5 A;  2JEX A;  1WP7 A;  3K04 A;  1JR9 A;  3UKM A;  1K5S A;  1E1R G;  3AG1 C;  4NXN O;  4DR2 B;  3A8T A;  4O4L A;  3ZS8 C;  2EIL C;  2YEV A;  4JI3 O;  2WLK A;  2F66 C;  3OGC C;  4OX9 O;  3CMA V;  4J41 A;  4K8Z A;  3DGE A;  4H37 A;  5LMU O;  5LHG A;  3K58 A;  3KCY A;  1Q8I A;  4X1I B;  5JQG A;  3RVZ A;  2GBO A;  3VOU A;  1K4C C;  4AIL C;  2CH7 B;  5EC1 C;  2Z5U A;  2H3O A;  2Y48 A;  4X9Q A;  5CBF A;  2IU0 A;  2BSK A;  1J95 A;  4LFA O;  4HBN A;  3FB5 C;  4KL1 A;  4DR6 O;  1N0J A;  3BHP A;  4NTY A;  1BCC H;  4UCO A;  2ZIM A;  4FM2 A;  4QIW F;  3L73 H;  1LR1 A;  4PDL A;  5GON A;  1QLE B;  3JAL A;  1ZL8 B;  4MVZ A;  5LMN B;  3T1H B;  2RCV A;  2JDI G;  1GH6 A;  1R1B A;  1HWY A;  3FYI B;  2QA4 V;  4LH7 A;  1H2G A;  1WN7 A;  2DMX A;  4JZ2 A;  2ZM6 B;  2VQE O;  1IXB A;  1HNX O;  2Q7G A;  1DK1 A;  1AB3 A;  1QR8 A;  1KQS U;  5EC2 C;  3UCS C;  1FXH A;  5ITZ A;  1OHH G;  4DV2 O;  4TSF G;  3H1H H;  2OWO A;  1KMI Z;  1ORQ C;  1KC8 W;  3L74 H;  4KUM A;  2V7Q G;  4QPK A;  5KX5 A;  3ZIA G;  1Q86 W;  3BRC A;  2JJ2 G;  4G2K A;  1XEQ A;  2R72 A;  4YIO A;  1F7Y A;  4NKG B;  1GN3 A;  4RO2 A;  3CCV V;  4QE9 A;  2OCC B;  4U7N A;  1UJW B;  2UXC B;  3CXH F;  5D5P A;  5AG2 A;  1NU1 H;  2EX3 A;  5E79 Z;  3OMA B;  1O9G A;  1I94 B;  1Q6U A;  1YDX A;  2IH3 C;  1AI7 A;  4ICG A;  3SPH A;  4CS4 A;  4LF8 B;  1HNW O;  4L87 A;  4FLW A;  2PUS A;  4NXM B;  4DR1 B;  5J9P C;  1G8M A;  4MT8 A;  3FYE B;  4GKJ B;  2P06 A;  3G67 A;  3OUS A;  1XRE A;  3K3W A;  3H1J H;  4ABM A;  2QWP B;  3ASO B;  3W7U A;  3CP1 A;  1XHX A;  2ODM A;  1SET A;  3K5O A;  3HKD A;  3UQ8 A;  2FB5 A;  5GTH Z;  1P4R A;  1PKX A;  3HKC B;  4O2B B;  5BMV B;  1KP3 A;  3L71 H;  2IBZ H;  1WA8 A;  2QKA A;  1IBL O;  4YJ2 A;  2B1G A;  4I55 A;  3A2F A;  1RSO B;  3JCU Z;  4I50 A;  3E83 A;  4D6T H;  1WAZ A;  3ASN C;  1TA8 A;  3M7M X;  1RFY A;  3DXR B;  4MTF A;  5E1A C;  2W0F C;  2XAF A;  4QGP A;  3J7A U;  2YIB A;  3AG1 B;  1FFT B;  1M93 A;  3F5W C;  1GRJ A;  1AVM A;  2PI5 A;  1IBK B;  2G38 A;  3TXS A;  3VQY A;  1JFF B;  2EIL B;  3T1C A;  2Q69 A;  1VQ9 V;  2WLL A;  1W0J G;  5KHI A;  2KQX A;  2CE4 A;  5LL6 Y;  3E22 A;  3R65 A;  3AG2 C;  4KHP O;  3SGI A;  2P90 A;  1U97 A;  1W59 A;  1XQ8 A;  4DO2 A;  3ML0 A;  4HYO A;  1WB8 A;  1FJG O;  1IVS A;  3K9A A;  4X65 B;  4FMT A;  2QM8 A;  1XMO O;  3I5D A;  3CRA A;  3C3S A;  3K5L A;  3WB1 A;  2JS5 A;  4WFB V;  1NTM H;  4UUJ C;  2KG7 A;  3BA9 A;  3JAS A;  5FPR A;  2UU9 O;  4OX9 B;  5KA6 A;  5HFM A;  1VAR A;  4OXS A;  4AQY O;  1NQT A;  1SZT A;  3CYO A;  2ZIN A;  3JAT A;  5EZY A;  1QQC A;  1BZK A;  3E8H A;  3RYI B;  2Q0O C;  1XHZ A;  5L3C A;  5L3D A;  2ZNI A;  1Y76 B;  3OR7 C;  1N0N A;  5KLV H;  3RVY A;  3EVK A;  4DV1 O;  5LOV A;  3JSL A;  2NNU A;  2QSA A;  2F1M A;  3ZCC A;  4WFA V;  2FML A;  1SQG A;  4R6Z A;  1Q6H A;  4FFB A;  1IXM A;  3CJH A;  3QTC A;  3K57 A;  4JI5 B;  2EIN C;  1OCO C;  1JX9 A;  4BW9 A;  1XMQ B;  4J42 A;  4JI8 B;  4I4T A;  2YIB D;  1IZ3 A;  1HNX B;  1TUB A;  1O9H A;  2EBO A;  1RM1 C;  2IJJ A;  4B3M O;  2ZR2 A;  1NTZ H;  1SQP H;  4O4I A;  1RPR A;  2FTK A;  1Q43 A;  5L3G A;  4O4L B;  2LGW A;  3CRR A;  1YJW V;  1G6U A;  2YEV B;  3GWO A;  4CS2 A;  5BZB A;  4AHC A;  4JYC A;  5DED A;  2L35 A;  3PJS K;  4B3R B;  5B1B C;  5JQG B;  3T1Y O;  3ZRW A;  3IAY A;  4RUF A;  3W7S A;  2BSK B;  3B40 A;  4MVQ A;  3LNM B;  1IDS A;  3QNE A;  4X62 O;  4JAA A;  4YXW G;  2AZ0 A;  4DV5 B;  2N74 A;  3H1K H;  4L8J A;  5GON B;  4B08 A;  5LXT B;  1BQ0 A;  4XDJ A;  3JAL B;  3ASN B;  2P5O A;  1Y4M A;  4FLZ A;  5CA0 B;  2E3C A;  1SF9 A;  2WA3 A;  3DTU B;  1S5L Z;  4LP8 A;  3CXC U;  1NJI W;  2QEX V;  3APO A;  4JZG A;  5IT9 N;  2YS8 A;  2VWJ A;  1CPY A;  2GV9 A;  4U7O A;  1H2M A;  1K92 A;  3TCU A;  4DR4 B;  1E1Q G;  1IBL B;  3H01 A;  4W4K A;  4H0L B;  4CBC A;  4P2Z A;  1HP8 A;  1IX9 A;  1YIJ V;  2UUC B;  1N34 B;  3AG2 B;  5KA5 A;  3CHX A;  2GSM B;  5ITZ B;  4FK5 C;  1Y74 A;  4NR1 A;  5JJJ B;  3BY6 A;  1EZV H;  3HKE A;  5KX5 B;  1HNZ O;  3CME V;  2CGO A;  4UXN A;  4WFF A;  1HR0 B;  3SJC C;  1TAE A;  5LP6 A;  4C7U A;  4U3J B;  5DEC A;  3WB0 A;  2CTW A;  2YI8 A;  1Q3E A;  1NZ6 A;  3ZMZ A;  4FJC C;  3LNN A;  4GX2 A;  5FL7 G;  3HPL C;  2JVD A;  3CS5 A;  4IGG A;  4JAU A;  2Y0I A;  3G80 A;  1KYO F;  5KUK A;  2PYJ A;  3R66 A;  4WFH A;  2YXL A;  1BS3 A;  4B3T B;  2DWE C;  3LSS A;  1FAF A;  2WWW A;  1VQO V;  1G1X B;  3FX7 A;  2WLI A;  3JAR A;  4DV6 O;  2UUA B;  1NS1 A;  4G28 B;  2ETN A;  3BAA A;  3CB2 A;  2PTM A;  4GX1 A;  3ZN1 A;  4LF6 O;  1WJZ A;  1PNM A;  1OJH A;  2DN9 A;  3HKD B;  4NTX A;  5KHH A;  1H2L A;  2HP8 A;  3ZN0 A;  4MS2 A;  4DK0 A;  2EIN B;  1OCO B;  3I56 V;  2YIA A;  2EIK C;  4AI8 A;  1WA8 B;  2YXY A;  1SRY A;  4YJ2 B;  2AW9 A;  5A9G A;  1BMF G;  4I55 B;  5H6Q A;  3ZHQ A;  1M1K W;  1VQ4 V;  1MSD A;  3CRM A;  1AI4 A;  3OTF A;  1XNR O;  5LGU A;  2YXH A;  4I50 B;  2DE0 X;  1SES A;  4ZIB A;  3ABU A;  2WA4 A;  4YIP A;  4ZI7 A;  1RM1 B;  1YJ9 V;  4Z1V A;  4JI6 B;  4X66 O;  3G6E V;  1VIB A;  4K0K B;  3FD9 A;  4DYL A;  3PN1 A;  4HZ3 A;  4CC5 A;  1PNK A;  1FXV A;  2V4D A;  1PNL A;  2YC0 A;  1MOF A;  1KD1 W;  4DW0 A;  1YJN V;  1WNS A;  3CC7 V;  1R3K C;  5IYD O;  1D5N A;  2WLL B;  3CPW U;  4UVC A;  3ZHR A;  5CBG A;  1EN5 A;  4DV3 B;  4WBN A;  3BEH A;  3E22 B;  2X6A A;  1UFI A;  5CA1 A;  2VRZ A;  3ZHU A;  3BFR A;  3M99 B;  4EB6 A;  3TJT A;  4I7Z B;  2F93 B;  3S3X A;  1Z5W A;  1JVM A;  5LP6 C;  3ETG A;  4DRX A;  2P7T C;  2NR5 A;  1N33 B;  3OGI B;  1SQF A;  2KG7 B;  1KB9 F;  1AJQ A;  3B09 A;  3TGU H;  3JAS B;  3JSN A;  1QCE A;  2L6L A;  1JPX A;  2EJ7 A;  4F6R A;  3CSX A;  3JAT B;  2E5L B;  5EZY B;  1L0N H;  2IH1 C;  4GT1 A;  1ARO P;  3OMI B;  1SQB H;  3MHS C;  4LF5 B;  5HFL A;  5LYJ A;  4FM0 A;  1R3L C;  5L3B A;  5LOV B;  2ZQM A;  1DLB A;  1LNQ A;  4YJ3 A;  4DR7 B;  1I08 A;  1QLN A;  4O4J A;  4LFC B;  2F4V O;  2QKC A;  4JI1 O;  1I5X A;  1K73 W;  4DUZ O;  3VQV A;  4MSW C;  4X8A A;  1K33 A;  4IYI A;  4FFB B;  4FLY A;  3CJH B;  2IU3 A;  3CCL V;  4D7T A;  2OIG A;  2UXB B;  3JCZ A;  4D7S A;  3O65 A;  4Z1M G;  2X7R B;  1GN6 A;  1VF7 A;  4LR3 A;  2IJH A;  1J5E B;  3A0R A;  4JI0 O;  4I4T B;  4MVO A;  4DV4 O;  1TUB B;  3FB8 C;  2Q7E A;  3ZHT A;  1R6T A;  1ZWI C;  5GW7 A;  4UVB A;  1R3J C;  2WLN A;  3RW0 A;  4J7J A;  4O4I B;  4DV0 O;  2Q5Z A;  5K1X A;  3JAW A;  4GYC B;  2ZDI A;  4CH5 A;  1Q7Y W;  4CH3 A;  1GK9 A;  3D3I A;  3N2K B;  1MZF A;  2JS3 A;  3OEH G;  4TV9 A;  2W0X A;  5FLX N;  1HW7 A;  1K3E A;  1KP2 A;  2VQF O;  2DWD C;  3HKB A;  1R6N A;  1GTO A;  3ZBH A;  1L1F A;  2XUM A;  4I9Q A;  4GKK O;  3CEI A;  2JJ1 G;  1A32 A;  3WB2 A;  3F7V C;  3ZRW B;  3AG3 B;  3G4S V;  4GZR B;  1YSC A;  5JJN B;  1ROP A;  2GTA A;  1MNG A;  3K03 A;  2PF4 E;  1GM8 A;  3GB7 C;  4IHJ A;  1S3J A;  4NTW A;  2EIK B;  4UCV A;  3TK1 A;  2A06 H;  2R70 A;  1OCC C;  2XTA A;  4DR3 B;  4RAI A;  3CCR V;  1SQQ H;  2NLJ C;  3STL C;  4LF7 O;  3QO5 A;  3OUF A;  2UUB O;  4X20 A;  3T4D A;  4JYA O;  1BL8 A;  3CCM V;  4LF6 B;  2RDC A;  2P22 C;  4TV8 A;  1B3Q A;  1N36 B;  1QR9 A;  3AK2 A;  3HR0 A;  1KU9 A;  1XNQ B;  3Q4H B;  4JGS A;  4X64 O;  1XDC A;  1S5H C;  4DR5 O;  4UB6 Z;  5CA3 A;  3UO3 A;  3EFF K;  4XDK A;  4XBF A;  4JI4 B;  1XNR B;  2DYR C;  3OT7 A;  3SYQ A;  2MK3 A;  1R73 A;  3H1L H;  4DW1 A;  4WF9 V;  1VQP V;  1QBZ A;  1Y74 B;  1YCI A;  1WPX A;  4BIZ A;  3RGB A;  4TT3 G;  4EKW A;  2PI4 A;  2ZR3 A;  2EZO A;  1V54 C;  5LP6 B;  4YHH O;  3JAK A;  1QVG U;  4LWS A;  1US6 A;  4FZ0 A;  1K8A W;  2RNB A;  4BIO A;  3NXS A;  2Q7H A;  3ZRS A;  2HHH O;  5IWA O;  2LFR A;  4H33 A;  1T5E A;  1GN4 A;  3H9V A;  1TUE B;  1QU7 A;  4LF9 O;  2XND G;  4RQF A;  2ZDI C;  1AJN A;  1ZAU A;  1P7B A;  2CAZ C;  1FXK A;  2R9A A;  2E76 B;  2M7W A;  2WLI B;  3ZRV A;  3JAR B;  3CC4 V;  3ETE A;  3ZHV A;  1ZSP A;  1M56 C;  5K1P A;  1IBM B;  1NT2 B;  1VQM V;  2IJI A;  3RN4 A;  3J81 N;  2XHB A;  5C8Y A;  2KSD A;  2Q9L A;  3GWK C;  5KUM A;  1H8E G;  1M9N A;  2UXD O;  3KCX A;  2OCH A;  2HEP A;  4NXN B;  4O2A A;  1NBM G;  4JYY A;  3UT5 A;  3OFN G;  4E2L A;  3RT3 C;  1B04 A;  4P30 A;  2QR4 A;  4I5S A;  4YY3 O;  1CP9 A;  4ASU G;  2FL4 A;  4JI3 B;  5CBH A;  5JVD A;  1M4U A;  4DV7 O;  3SYA A;  5KHK A;  4ZI7 B;  5LMU B;  4JI7 O;  1R3I C;  1NTK H;  4BIU A;  3NR7 A;  5IJ0 B;  4TWK A;  2EIM C;  1RPO A;  4ZHQ A;  5LA6 A;  4LFA B;  1BE3 H;  4LFB O;  2EIJ C;  4DR6 B;  2OTJ V;  3OTO O;  2QTS A;  4DUY O;  3FB6 C;  3SPG A;  4PEL A;  2Q73 A;  1S77 D;  3JD1 A;  1JQ0 A;  4PI0 A;  4XDL A;  2HR3 A;  5IYZ A;  4WBN B;  5BR8 O;  1N32 O;  4PD4 F;  3N2G A;  1PM9 A;  1VF6 A;  4JI2 O;  5CA1 B;  5EIB D;  3LSU A;  2ZIO A;  2BCC H;  2GDS A;  3K0G A;  2D2C B;  3MD0 A;  2LFS A;  1P84 F;  1W2B U;  2JIZ G;  4EB6 B;  2CDY A;  1EBO A;  2Q0A A;  1Y66 A;  3ZX6 A;  3LDC A;  1FFX A;  5B1A C;  1NI8 A;  5EIB C;  2VQE B;  1PV0 A;  4FLX A;  2AGA A;  4DRX B;  2GTS A;  5B3S C;  3P3P A;  4QNH B;  1OCC B;  4HAM A;  2P6J A;  3F7Y C;  1COW G;  5IE9 A;  5KMG A;  5BY1 A;  4I0X A;  2RN9 A;  4KP4 A;  3S3W A;  4IIJ A;  4DV2 B;  1NR1 A;  2HJF C;  4F6R B;  1NR7 A;  3D8C A;  2H8P C;  1YF2 A;  4ZKI A;  4HNA A;  1FXK C;  2JK5 C;  3H1I H;  5CB4 A;  2WLH A;  3JD2 A;  3BA8 A;  3G71 V;  2X6C A;  2DYS C;  1F51 A;  1YVW A;  5LYJ B;  1JCH A;  2HG5 C;  4QPJ A;  4A5U B;  4JV5 O;  2IW5 A;  4YJ3 B;  1V55 B;  1KEC A;  4R50 A;  2XAJ A;  3D36 A;  4O4J B;  2DYR B;  4LF4 O;  3A0H Z;  1N4C A;  1HNW B;  5KHJ A;  1CEZ A;  5EYP A;  5DN6 G;  3CCE V;  3SDL A;  3OD4 A;  3L9D A;  3E35 A;  1NH2 D;  3B2E E;  1V54 B;  2ILM A;  4H44 B;  3RWR D;  2HJD A;  2VS0 A;  1BHA A;  4JPR A;  1JJO A;  2WSS G;  3LDE A;  2WPD G;  4WFG A;  1V9P A;  3JAW B;  5A2Q N;  1YEW A;  4JTA B;  3MAQ A;  2Y69 C;  2ZE5 A;  4PDR A;  4TV9 B;  1NVP D;  3HB3 B;  1FPO A;  1M56 B;  4LCU C;  1OCZ C;  1SA0 A;  2K9P A;  5TIS Z;  3FKS G;  4PI2 A;  1S72 V;  4GX0 A;  1M90 W;  4J10 A;  2LQT A;  2MW2 B;  1VF6 C;  3SPJ A;  2XAH A;  3WU2 Z;  5J2T A;  4JTD B;  2YSU B;  3ABT A;  3E8G A;  3OEE G;  5LMN O;  3T1H O;  2CK3 G;  3OR6 C;  3VQW A;  5H5N A;  3QG5 A;  2M6Y A;  2BTQ A;  3DSQ A;  5B5E Z;  4B3S O;  3MDS A;  4IHJ B;  3E89 A;  5EBW C;  4MTX A;  1OCR C;  2Y4T A;  3GVM A;  2ITC C;  2A9H A;  2QKS A;  1H2K A;  3IC7 A;  4KHP B;  3QF7 A;  2UXN A;  1BT8 A;  4X20 B;  4QJF B;  1MSW D;  5BXZ A;  4FIP C;  3OMN B;  3CCJ V;  2EIM B;  5EBM C;  1FJG B;  4TV8 B;  4N21 A;  2EIJ B;  5CMU A;  1XMO B;  5LHH A;  4EEQ A;  1YXB A;  5GTI Z;  1AR1 B;  1X59 A;  4W4L A;  3ZED A;  5IJ9 A;  1EZJ A;  3L75 H;  3D36 C;  2UU9 B;  3AG3 C;  4JAS A;  3T2M A;  1TVK A;  2KB1 A;  4UCR A;  4AQY B;  2A79 B;  1KUQ A;  2IJK A;  3IC9 A;  2UXC O;  2E74 B;  4FPP A;  2D3O W;  4JF3 A;  2ZE6 A;  1I94 O;  1M57 C;  4LF8 O;  3OTO B;  4DUY B;  5B1A B;  4BWA A;  3JAK B;  1WPB A;  4NXM O;  4DR1 O;  2QM7 A;  5C93 A;  4DV1 B;  3K0D A;  4LWS B;  5B3S B;  2WLM A;  3UM7 A;  1VEW A;  4GKJ O;  3ABM C;  1Z5V A;  3K08 A;  2CTR A;  5DM6 V;  2OYQ A;  1H38 A;  1ZLZ A;  4MTO A;  4X1K A;  3B8M A;  2OTL V;  4BR6 A;  1FXK B;  4MVR A;  2ADQ B;  1GO3 F;  2JGU A;  2YDE A;  1AI6 A;  4X1Y A;  2DYS B;  4UCS A;  2LP7 A;  3TET A;  1I7F A;  4B3M B;  5C8Y B;  4TQF A;  4J11 A;  1VQ6 V;  4LC1 A;  1CXZ B;  3CWB H;  2LO1 A;  2YID A;  4P9P A;  4MTG A;  3UT5 B;  4K8X A;  2AXT Z;  2HVJ C;  1H2S B;  1PPJ H;  5H2F Z;  3FAV A;  2YIC A;  5JVD B;  1IBK O;  1NH2 B;  4CC6 A;  5FNV A;  1HDJ A;  4ZBM A;  2AZ2 A;  3O9O A;  1XI1 A;  2ZT9 B;  4DXW A;  3EXA A;  3T1Y B;  4UVA A;  1WB7 A;  1SQX H;  3RYC A;  3SJB C;  3BVO A;  4BW5 A;  1EM1 A;  3RYF A;  2Z3Y A;  5LA6 B;  3WG7 C;  1S5J A;  1JMK C;  2Y69 B;  1SZX A;  4X62 B;  4UCT A;  1GMG A;  3VBB A;  3BPZ A;  2WAM A;  4X65 O;  1VQL V;  1BHB A;  5L3F A;  1OCZ B;  2O57 A;  2P4V A;  5IYZ B;  4UCU A;  3N2G B;  1NVP B;  4PA6 A;  3RBZ A;  5JH7 A;  4OPA A;  2B5U A;  3D3Q A;  4GCZ A;  1VQ8 V;  4CZZ A;  2ZXW C;  1EN4 A;  1FFX B;  4BAY A;  1OCR B;  1GM7 A;  3ZMS A; 
#chains in the Genus database with same CATH homology
 2XND G;  4RQF A;  2YEV B;  2ZDI C;  3GWO A;  1AJN A;  5BZB A;  1P7B A;  4R7C A;  4JYC A;  1FXK A;  1WLE A;  3PJS K;  2M7W A;  2WLI B;  3ZRV A;  3CC4 V;  3IGA C;  2R9R B;  3ETE A;  5B1B C;  2F43 G;  1THZ A;  1M56 C;  3ZRW A;  1VQM V;  1F23 A;  5IY5 C;  2IJI A;  4F4L A;  1N8R W;  4X88 A;  4RUF A;  3W7S A;  1Q82 W;  3AEI A;  4MVQ A;  4UV9 A;  1DF4 A;  3LNM B;  2OCC C;  1XL6 A;  5KUM A;  1H8E G;  3QO7 A;  3QNE A;  3ABK B;  1M9N A;  1F4N A;  1PD3 A;  3MHH C;  4PDM A;  1ENV A;  4YXW G;  1NBM G;  4LBE C;  2HKO A;  2V1D A;  4E2L A;  3OFN G;  1EFR G;  4XDJ A;  3ASN B;  4P30 A;  1Y4M A;  4I9W A;  4I5S A;  3JD3 A;  1XL4 A;  2R9I A;  3CCS V;  1CP9 A;  2BOB C;  2X0L A;  3DTU B;  4ASU G;  5CBH A;  4LP8 A;  3B77 A;  3SYA A;  1M57 B;  2Q6A A;  3CXC U;  1YI2 V;  1PL0 A;  1Q81 W;  3ZMU A;  3ETD A;  1NJI W;  3JD0 A;  2QEX V;  4JTC B;  1CPY A;  1R3I C;  4U7O A;  1VQN V;  2B1I A;  1K92 A;  2Q68 A;  3SYP A;  4BIU A;  3ASO C;  3TCU A;  1AJP A;  1B6Q A;  1F4M A;  2AHY A;  4TWK A;  1E1Q G;  2EIM C;  1RPO A;  3ABM B;  1YIT V;  3H01 A;  4CBC A;  5B1B B;  4GX5 A;  4P2Z A;  2EIJ C;  3T4Z A;  2OTJ V;  1MAB G;  2ZD9 A;  1YIJ V;  3FB6 C;  3SPG A;  2X6B A;  3AG2 B;  4PEL A;  5KA5 A;  2GSM B;  3K06 A;  1K5Q A;  5IYB O;  4FK5 C;  3ZMV A;  5LBQ A;  1S77 D;  3BY6 A;  3JD1 A;  1JQ0 A;  4XDL A;  2HR3 A;  1H8H G;  3AG4 B;  3ZMT A;  1QVF U;  2HVK C;  4JAV A;  2QTO A;  3CME V;  1GM9 A;  4UXN A;  4WFF A;  1V55 C;  5LGT A;  1NKD A;  5B1O A;  3SPI A;  3K0G A;  3ZMZ A;  2JEX A;  4FJC C;  4GX2 A;  3K04 A;  5FL7 G;  3HPL C;  3MD0 A;  2LFS A;  1W2B U;  2JIZ G;  5CN0 A;  3UKM A;  1K5S A;  1EBO A;  1E1R G;  3AG1 C;  1Y66 A;  1W0K G;  3K79 A;  3LDC A;  4JAU A;  5B1A C;  4MW3 A;  2EIL C;  5KUK A;  5B3S C;  4QNH B;  1OCC B;  4HAM A;  3CCU V;  2P6J A;  3F7Y C;  1COW G;  2YEV A;  3ABL C;  4WFH A;  2WLK A;  2DWE C;  4PA9 A;  3OGC C;  2ATK C;  3LSS A;  4KP4 A;  2WWW A;  1VQO V;  1NR1 A;  3CMA V;  2WLI A;  3DGE A;  4H37 A;  2HJF C;  5LHG A;  1NR7 A;  3RVZ A;  2H8P C;  3VOU A;  1K4C C;  4G28 B;  5EC1 C;  4ZKI A;  2Z5U A;  2W6I G;  2Y48 A;  1FXK C;  5CBF A;  2JK5 C;  4KFM A;  2IU0 A;  1K97 A;  1S76 D;  2WLH A;  3JD2 A;  1J95 A;  3G71 V;  4GX1 A;  2X6C A;  3FB5 C;  2DYS C;  1F51 A;  2OT5 A;  3ZN1 A;  1JJ2 U;  1JCH A;  4QIW F;  1G4Y B;  2HG5 C;  4QPJ A;  1PNM A;  3WG7 B;  2IW5 A;  4PDL A;  1V55 B;  5B1N A;  1QLE B;  1KEC A;  4R50 A;  3ZN0 A;  2XAJ A;  3D36 A;  2DYR B;  4MS2 A;  4MVZ A;  2EIN B;  1OCO B;  3I56 V;  3E8B A;  2EIK C;  4RQE A;  1CEZ A;  2JDI G;  5DN6 G;  1SRY A;  3X2Q C;  1VQ4 V;  2H94 A;  3CCE V;  1BMF G;  1HWY A;  4N23 A;  5H6Q A;  1M1K W;  3FYI B;  1AI4 A;  2QA4 V;  3E35 A;  1NH2 D;  5EBL C;  5LGU A;  3KG2 A;  4J9Y B;  1SES A;  3SYO A;  3ABU A;  3OE7 G;  1V54 B;  1S0V A;  1VQ7 V;  1RM1 B;  1YJ9 V;  3EHB B;  1E79 G;  3G6E V;  1H2G A;  3W7T A;  4MVS A;  1K7D A;  4HZ3 A;  1PNK A;  4WFE A;  1BHA A;  4JPR A;  1FXV A;  1PNL A;  2WSS G;  2ZXW B;  1MOF A;  3LDE A;  1KD1 W;  3P30 A;  1QR8 A;  1YTF D;  1KQS U;  1K9M W;  1YJN V;  2WPD G;  5EC2 C;  3CC7 V;  1R3K C;  1FXH A;  4PA7 A;  3FB7 C;  4WFG A;  5IYD O;  3LUT B;  1OHH G;  1SER A;  1GKF A;  3P32 A;  2WLL B;  4TSF G;  5L3E A;  4UVC A;  5CBG A;  3CPW U;  2HLD G;  4JTA B;  5EK0 A;  2Y69 C;  1ORQ C;  1KC8 W;  3CCQ V;  4PDR A;  4KUM A;  2V7Q G;  3BEH A;  4QPK A;  3ZIA G;  2DQ0 A;  4MW8 A;  1YHQ V;  1NVP D;  2X6A A;  1Q86 W;  3HB3 B;  4X89 A;  1M56 B;  4LCU C;  3SYC A;  1OCZ C;  2JJ2 G;  3WFV A;  4G2K A;  5IY5 B;  3FKS G;  1S72 V;  3M99 B;  4GX0 A;  4MVM A;  1M90 W;  4RO2 A;  3CCV V;  4QE9 A;  3SPJ A;  2XAH A;  2OCC B;  4U7N A;  1UJW B;  5IYC O;  1JVM A;  4JTD B;  2YSU B;  3ABT A;  3E8G A;  3OEE G;  3ETG A;  3OMA B;  5LGN A;  2CK3 G;  3OR6 C;  2HFE C;  1AI7 A;  2IH3 C;  2P7T C;  3LDD A;  1K34 A;  3SPH A;  4L87 A;  3JD4 A;  4MVU A;  4PA4 A;  1AJQ A;  3W7X A;  3CD6 V;  5J9P C;  4UV8 A;  5H6R A;  3E89 A;  5EBW C;  4MTX A;  1OCR C;  1G8M A;  4MT8 A;  1QCE A;  3FYE B;  1JPX A;  2ITC C;  1JOY A;  1DF5 A;  3STZ C;  2A9H A;  2QE7 G;  2QKS A;  3OUS A;  3K3W A;  2IH1 C;  3IC7 A;  4GT1 A;  1ARO P;  3OMI B;  2UXN A;  2XAG A;  3MHS C;  4J9Z B;  5HFL A;  4QJF B;  2WLJ A;  1MSW D;  3ASO B;  3W7U A;  1R3L C;  3OMN B;  4FIP C;  2EIM B;  3CP1 A;  5EBM C;  5L3B A;  3CCJ V;  2EJR A;  4P9O A;  2ZQM A;  1SET A;  4N21 A;  1DLB A;  1LNQ A;  2EIJ B;  1KKD A;  1QLN A;  5CMU A;  1P4R A;  2ITD C;  5LHH A;  1PKX A;  3ABK C;  1I5X A;  1AR1 B;  1K73 W;  1AI5 A;  1KP3 A;  1FS0 G;  4MSW C;  4X8A A;  2B1G A;  1K33 A;  1EZJ A;  1DTO A;  2DW4 A;  3E83 A;  2IU3 A;  3AG3 C;  4JAS A;  3T2M A;  3CCL V;  2KB1 A;  3OM3 B;  4PA3 A;  3ASN C;  4RUE A;  2Q67 A;  5IDJ A;  3JCZ A;  2A79 B;  2IJK A;  4Z1M G;  2X7R B;  4MTF A;  5E1A C;  2W0F C;  2XAF A;  2IJH A;  3A0R A;  4FPP A;  2D3O W;  4JF3 A;  4G27 B;  4MVO A;  3FB8 C;  1M57 C;  3AG1 B;  1ZWI C;  5GW7 A;  2XOK G;  1FFT B;  3F5W C;  4UVB A;  5B1A B;  2PI5 A;  4Q20 A;  1R3J C;  2WLN A;  3B8N A;  2QM7 A;  5C93 A;  2EIL B;  3T1C A;  3K0D A;  2Q69 A;  5B3S B;  2WLM A;  3RW0 A;  3UM7 A;  1VQ9 V;  2XAQ A;  2WLL A;  3ABL B;  2ZDI A;  1W0J G;  3ABM C;  1Q7Y W;  1GK9 A;  3D3I A;  3I55 V;  3K08 A;  3OEH G;  5DM6 V;  3JYC A;  3R65 A;  3AG2 C;  1H38 A;  2P67 A;  4MTO A;  1OZ0 A;  2P90 A;  4JYB A;  3B8M A;  1K3E A;  1KP2 A;  3SPC A;  4DO2 A;  3ML0 A;  4HYO A;  2DWD C;  1R6N A;  1GTO A;  5LHI A;  2OTL V;  1FXK B;  4MVR A;  1L1F A;  3K9A A;  3AG4 C;  4FMT A;  1GO3 F;  2JJ1 G;  1AI6 A;  2QM8 A;  2DYS B;  2UXX A;  1VQ5 V;  3W7W A;  3F7V C;  3ZRW B;  2LP7 A;  3AG3 B;  4PDV A;  3G4S V;  3TET A;  1YSC A;  4WFB V;  4UUJ C;  1ROP A;  3K03 A;  1VQ6 V;  1GM8 A;  3GB7 C;  4LC1 A;  3ZRX A;  1S3J A;  5KA6 A;  2EIK B;  5HFM A;  5H9C A;  3QO8 A;  3TK1 A;  3X2Q B;  4OXS A;  4P9P A;  1NQT A;  1SZT A;  3CYO A;  1OCC C;  2JEU A;  4MTG A;  4RAI A;  3CCR V;  3E8H A;  2HVJ C;  2NLJ C;  3ZJZ A;  3E86 A;  5L3C A;  5L3D A;  3STL C;  4R8C A;  3OR7 C;  3QO5 A;  3OUF A;  3T4D A;  1BL8 A;  2K1E A;  3CCM V;  2BOC C;  2AHZ A;  1NH2 B;  4ZBM A;  3OAA G;  3RVY A;  3SJQ C;  2XAS A;  2NNU A;  1QR9 A;  4DXW A;  3E2E A;  4JGS A;  4UVA A;  1S5H C;  3ZCC A;  3E8F A;  4WFA V;  4BW5 A;  5CA3 A;  3EFF K;  4XDK A;  4R6Z A;  2A0L A;  2Z3Y A;  3WG7 C;  4XBF A;  2Y69 B;  1QLE C;  1YTF B;  1IXM A;  3IFX A;  1GMG A;  2DYR C;  3VBB A;  1I5Y A;  3SYQ A;  2MK3 A;  1R73 A;  2EIN C;  4WF9 V;  2WAM A;  1OCO C;  1VQP V;  1QBZ A;  2EZP A;  4WCE V;  1VQL V;  1JX9 A;  1BHB A;  5L3F A;  1OCZ B;  1WPX A;  3CC2 V;  4BIZ A;  1K4D C;  4TT3 G;  4EKW A;  2PI4 A;  2ZR3 A;  3LSQ A;  2W6J G;  2EZO A;  1VQK V;  2EBO A;  1V54 C;  1NVP B;  1RM1 C;  2IJJ A;  1R6K A;  4PA6 A;  3RBZ A;  2ZR2 A;  1MG1 A;  2B5U A;  1QVG U;  4GCZ A;  2GHY A;  1K8A W;  1VQ8 V;  4QE7 A;  4CZZ A;  1RPR A;  2ZXW C;  3NXS A;  2DQ3 A;  3ZRS A;  2FTK A;  2C2A A;  4BAY A;  2LFR A;  5L3G A;  4H33 A;  1OCR B;  3OW2 U;  1TUE B;  1GM7 A;  3ZMS A;  1YJW V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...