1JQ0A

Mutation that destabilize the gp41 core: determinants for stabilizing the siv/cpmac envelope glycoprotein complex. mutant structure.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
78
structure length
71
Chain Sequence
b'LAGIVQQQQQLLDLVTRQQELLRLTVWGIKNLQTGGWQEWKRKVDFLEENITALLEEAQIQQEKNMYELQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gp41 envelope protein
publication title Mutations that destabilize the gp41 core are determinants for stabilizing the simian immunodeficiency virus-CPmac envelope glycoprotein complex.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Viral protein
total genus 33
structure length 71
sequence length 78
ec nomenclature
pdb deposition date 2001-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jq0A00
2X7RB 1I5YA 2EZPA 4E2LA 1QR9A 1K34A 1DF5A 2LP7A 1K33A 3WFVA 1Y4MA 1F23A 2MK3A 5CN0A 1MG1A 4FIPC 4JPRA 4JF3A 1JQ0A 2OT5A 2P6JA 3GWOA 2M7WA 5KA5A 3CP1A 1I5XA 1SZTA 1EBOA 3H01A 3B8NA 3MHHC 2EBOA 1QBZA 4FJCC 5CMUA 3B77A 5HFMA 1MOFA 1DLBA 2EZOA 5H9CA 1ENVA 1DF4A 4N21A 5HFLA 3M99B 3MHSC 3CYOA 4G2KA 3P30A 5KA6A 1Y66A 4JGSA 3B8MA 4FK5C 1JPXA 1QCEA 3K9AA 1QR8A 4N23A
chains in the Genus database with same CATH superfamily
1GMGA 3FKSG 5LP6A 5GW7A 1TAEA 1WAZA 2K9PA 3SPHA 2XAJA 2HHHB 1YVWA 3SPGA 3LDCA 5L3CA 1Q7YW 1KUQA 3ZHVA 1H8EG 1Q90D 3S3XA 1PNMA 3L70H 1R3IC 1KMIZ 1RPOA 1E1QG 3JARA 1XHZA 2UU9B 3DGEA 1L0NH 1HW7A 3OEHG 1Q82W 3K9SA 1IBKB 4DO2A 2GTAA 5EC2C 2CH7A 1AJPA 4MVMA 1B3QA 2ATKC 3ZHTA 1IBMB 4FZ0A 2ZDIA 1X4TA 4EFBA 4RUFA 4NXMO 3B09A 4G27B 4FMTA 4RUEA 1BGYH 1GN6A 4DV3B 4LF9B 3W7UA 3N27A 1XMQB 1PL0A 2QWRB 2BSKA 5B3SC 2H94A 2IH3C 2QDOA 5BXZA 1SQFA 1H2GA 4JZGA 3CRRA 1NVPD 1KU9A 3K03A 4ZHQA 4UCSA 3PJSK 3RW0A 2EJ7A 4KHPO 1SQXH 3ZN1A 1AVMA 4BWAA 4GKJO 4J9YB 2IBZH 4C7UA 1B6QA 2N04A 4UB8Z 5IYZA 3T1YB 2Q6AA 3FAVB 4JI3O 1Z2GA 2LFSA 4X64B 5CMUA 2OIEA 4GKKB 4JYAO 1VIBA 5JQGA 1DGSA 3OR6C 5LHIA 4F4LA 5B1NA 1IURA 3OTFA 1K5SA 2N05A 5H6QA 4DR6O 2ZIOA 1VQ8V 1SQBH 4K8XA 2ARHA 2CTWA 1KBHA 4YY3O 4CH3A 4FJCC 2GSMB 1JCHA 5CA1B 4WFEA 2Q9LA 1BE3H 4MS2A 3JD4A 1XHXA 2WLIB 2EJRA 3LSQA 3JSLA 2P6JA 4LCUC 1LUWA 3ABMC 2V1DA 1QLEB 3ZRXA 2WLJA 2EBOA 4YHHO 2UUAO 4J7KA 1O9HA 4NXMB 4ZBMA 1WB7A 2A7WA 3N2GB 1I7FA 4KL1A 2RCVA 1EN6A 1HNXO 4TV8B 1YF2A 2M6YA 3EHBB 2H8PC 1TVKB 3SYPA 1RPRA 2DJVA 2KQXA 1XL4A 3K06A 5GTIZ 2X6BA 2Q67A 5B1BC 4D7TA 3X2QC 3F5TA 4B08A 4DR7O 2QTOA 5FNVB 1OV9A 5LA6A 4GKJB 4F6RB 1FXKB 1AJNA 1IZ3A 4DR3B 1FAFA 4TQDA 3CXHF 4JI3B 3T4ZA 1WA8A 4DV5O 2JK5C 4K8ZA 1GTOA 3P32A 1KKCA 3KZIZ 2OYQA 4TWKA 5KUKA 4JYAB 4DV2O 4LFBO 4DV1B 3L73H 1KYOF 1G1XB 4CZZA 1KD1W 4DR6B 3JATB 4B3SO 4YY3B 2HLDG 3O65A 1MNGA 1NH2B 3W7WA 4BIUA 5JJEB 2QR4A 2QWQB 4KXRA 2JVDA 3HR0A 3PN1A 3SJAC 5K1PA 3NR7A 4TSFG 4DR5B 2EX3A 4B7KA 2PYJA 1COWG 3JAWB 3UM7A 3T4DA 2F43G 4LNUA 4JTCB 4X1IA 5KHJA 3ETEA 1ZAUA 3C3SA 1L8DA 5JJJB 5D5PA 3ETDA 4WFBV 3A0BZ 4FM0A 1BQZA 1JMKC 2ITCC 2UUAB 3BPZA 1VF6A 3AG3B 1HNZO 4ABMA 3E22B 4OX9O 1P4RA 3SYCA 3ZMVA 1GKFA 1DF5A 3TXQA 2KG7B 5EIBC 3CCEV 4JI6O 3SYOA 2GDSA 1HR0O 1EBOA 4PDLA 2CDYA 5JVDB 2RNBA 3QO5A 2JJ2G 4XDKA 4UB6Z 1URFA 5BZBA 4DR7B 5BY1A 3VQXA 4CC6A 2Q5ZA 3M7MX 2DQ3A 4O2BB 1K33A 4UCOA 1SA0B 2HP8A 4DV0O 3KG2A 5KLVH 3Q4HA 4UVBA 3J80N 1GM9A 5LBQA 4OPHA 2Q69A 3ETGA 3IGAC 4I0XB 3JALA 4DV2B 2YICA 1FS0G 1G6UA 2WAMA 3ETQA 3JSNA 1AB3A 4X1KB 4MVQA 4YIPA 4L87A 3IFXA 4JF3A 1Q3EA 2M7WA 4BIOA 1H2MA 2ZR3A 3UT5A 1I08A 3W7XA 5B1OA 1MSWD 5LGNA 3B77A 5LYJA 1VF7A 1AJQA 4AQYB 5KA6A 3G4SV 5EYPB 2PI4A 1QCEA 2W6JG 3L9DA 4J7JA 2B1IA 2YSUB 2EINB 4X65O 3JD3A 2P22C 2FMLA 5IY5B 1VARA 3CXCU 2UUCO 1HWYA 1WPBA 1GH6A 1F51A 1VQ4V 3B40A 3RVYA 5KX5B 3DC6A 1HNZB 2WLHA 2BOCC 1QNMA 4WFFA 1NTMH 2YUAA 3AEIA 1N34O 1S5JA 3LNNA 2VS0A 3HKCA 2EZPA 4MVZA 1W59A 5IYBO 1N8RW 1LR1A 2Q0OC 5B66Z 4JYBA 4UV8A 4JAUA 3JAKA 2P4KA 3A0HZ 2E75B 1HR0B 2L35A 1R6NA 2F4VO 5HFLA 4YJ3A 1W0KG 2FYUH 3QG5A 5GONA 2ZIMA 3DC5A 1RSOA 1FKAO 1PNLA 2HFEC 3RN4A 4DK1A 4YJ2A 5IYDO 4ZOLB 5A2QN 2QM8A 4UCRA 4DV0B 2QKAA 4X20A 4ZI7B 4O4JB 4B7EA 3QTCA 1FXKC 2UXBO 4FPPA 4U3JA 4ASUG 2BCCH 1YSCA 3OMAB 3W7TA 1Y76A 5E79Z 1K8AW 3D36A 2GUZA 4MTFA 1G4YB 3E2EA 4UCUA 5J9PC 2XNDG 2F95B 3ZJZA 4ZIBA 5EC1C 4JAAA 1ZUQA 4EB6B 2GBOA 1YDXA 3CRMA 2QEXV 3FFQA 3OMIB 3LNMB 1VQ6V 1OZ0A 2EIMB 4DR1O 3O9OA 1IBLO 4X65B 4PJ0Z 4HBNA 4HNAA 2JEUA 2UUCB 4LFAO 4F6EA 1KB9F 4LWSA 2HJFC 3SYQA 1YEWA 4I7ZB 4JI4B 3APOA 1MMMA 2LGWA 1TUBB 3TK1A 4NVPA 4U7NA 4XDLA 1ROPA 3RYCA 3ZX6A 3M99B 4MTXA 2QWPB 3E35A 4QE7A 3JARB 2PTMA 4DYLA 2WA4A 3QF7A 1YJ9V 2H3OA 3AG3C 2NR5A 2Q7HA 4IT5A 2CUGA 4DV6O 1Q8IA 3ZRSA 2X6CA 5ITZA 2F4VB 1K97A 1DLBA 2LW1A 5LL6Y 3L71H 1BMFG 2RDCA 1AP5A 2ZNJA 1H2KA 2RMKB 2XTAA 4X89A 1V9PA 5IJ0B 1BT8A 1YITV 2FTKA 4NXNO 2BSKB 4NR1A 1NKDA 2OTJV 3AG1B 5EBWC 4KP4A 2UXBB 1DF4A 1DK1A 1Q6UA 5LGTA 2DMXA 1P7BA 4ZHQB 1QR8A 4QNHB 1KP3A 3E89A 2EIJB 3K3WA 1N36O 3OE7G 2ZE6A 5FL7G 1N33O 3D3IA 5CB4A 5IYZB 2Y69B 3OD4A 4LF7O 1P49A 1TGOA 3CYOA 3R66A 3JYCA 2HJDA 3ZEDA 3JD0A 1XMOO 1IBLB 3OUFA 1R1BA 4FLUA 2ADQB 4JI8O 1VQLV 3CEIA 5EZYB 1GAXA 1SQPH 3DXRA 2P06A 4JI7O 4LFAB 2R9IA 1BL8A 2X0LA 4GCZA 2V4DA 4DUYO 2ITDC 3L72H 5B5EZ 4CH6A 2GV9A 1A32A 2D2CB 3RYHB 2EINC 4J9ZB 2DWEC 2QKSA 5IY5C 5J2UB 3ZHUA 2XUMA 5EK0A 4FFBA 3ABUA 2IM9A 5BR8B 2YDEA 3I5DA 3VOUA 2LO1A 3ZRWB 1NVPB 1N32B 2Q7GA 2Q68A 3N2KA 4P9OA 4UXNA 3VQVA 1SC5B 4DV6B 3BAAA 4NTXA 2QWOB 1SZXA 2NNUA 1K7DA 1WJZA 3MHHC 2XHBA 3CMEV 1DTOA 1VQ7V 4H37A 2HR3A 1M56B 4IIJA 3SJQC 1U96A 4PELA 2AZ0A 4PDMA 2X6AA 2A3QA 5BMVA 1VQ9V 4J10A 1SESA 3ASNB 1HDJA 2QWNB 1JVMA 4UUJC 4DW0A 4I4TA 4NXNB 4U7OA 1OCZB 5KHGA 2XOKG 3I56V 4KFMA 2XT9A 1XNRB 4JI0O 4X66O 1QR9A 2QE7G 5J2TA 3WFVA 4HAMA 1H38A 3OAAG 1N36B 4TV9A 3BHPA 3VBBA 3LSSA 1N33B 4DRXB 1Q86W 1XREA 5IWAO 3CP1A 1VEWA 2ZD9A 4P30A 1WA8B 1PV0A 3HKDB 1Y74A 1Q81W 4LF7B 3P3NA 4N21A 2CTRA 4B3RO 4DR2O 4JGSA 3RBZA 4IHJB 4KUMA 2YIDA 2YS8A 5L3GA 2RN9A 1BHAA 3NXSA 4UV9A 1XMOB 4O2AA 4JI8B 1NI8A 2QKCA 5GTHZ 5KMGA 4JI7B 5EIBD 3ZMTA 2F1MA 1SQGA 3EXAA 4DUYB 4I50A 2EIMC 4J41A 1SZTA 2MW2B 1D2DA 1D5AA 2Y0PA 4P2ZA 4UVCA 1NU1H 3LUTB 1IX9A 3RT3C 4WFAV 4ICGA 3E8HA 4MW8A 2R9AA 4O4HB 2OIGA 3HKEA 1WN7A 1BS3A 3ZHQA 3K5MA 4X1IB 4GT1A 1JQ0A 2FKXA 2P7TC 4MSWC 3UO2A 1NQTA 1SF9A 3APQA 4J42A 2EZOA 1FD9A 1E79G 1L0LH 1KC8W 4JI1O 2A79B 3LDEA 1YI2V 1BCCH 3KKYA 1NS1A 2N74A 4FLVA 3STLC 1U97A 3ML0A 1XILA 2HVJC 2JIZG 1EN5A 2KB1A 2XAHA 4LF4O 1BHBA 3H9VA 1F4MA 4AI8A 1VQMV 1FJGO 3SPJA 3G71V 1JFFA 1PP9H 1GRJA 2HG5C 2BTOA 3ABTA 4K3AA 4TOIA 1XBLA 2P5OA 4JI0B 3C3TA 4MVRA 3U10A 1I5YA 4LBEC 4KHPB 4X66B 1R3LC 3AG1C 4OGQB 4NKGB 2YEVA 5CBHA 1WP8A 2BTQA 1GK9A 1O9GA 3J7AU 1YCIA 5IE9A 1NZ6A 1W2BU 4L8JA 2QM7A 5IWAB 5JCOA 3Q4HB 2XAQA 3U0ZA 2Q73A 2GHYA 1H2LA 2EIJC 4DR2B 4WBNB 2WSSG 2WWWA 2AW9A 2RQ6A 1WLEA 2Y69C 2R72A 3WB2A 3IC7A 3HKBA 2CK3G 5CBGA 2YI8A 4RQEA 3IJ4A 3TETA 1XEQA 3B8NA 3UT5B 1R3JC 1PM9A 5K1XA 1E1RG 4O4IA 4R50A 3K59A 1Y66A 3IAYA 4YXWG 3FD9A 4FZ1A 2QSAA 4RWUA 5JH7A 5D5QA 3E86A 3A0RA 2P90A 4P9PA 1UJWB 3CC2V 1NT2B 4YHHB 1K3EA 3BRCA 4CS4A 1B06A 4BW9A 4R8CA 3K58A 2K1EA 4JI1B 3ZHRA 4JYCA 2WLIA 4PA3A 1GN4A 4Z1VA 1SS3A 4BR6A 3ZMUA 1HNXB 1M56C 5LXTB 3OUSA 3JAKB 4LF4B 2VWJA 4W4KA 2JDIG 1FJGB 4O4LB 3ASNC 2ZE7A 4YJ3B 1FPOA 5GONB 4Q6GA 1OCCB 3ZN0A 4YJ2B 1M4UA 2Y4TA 2DYSB 1OCZC 4H33A 2CE4A 1NH2D 4LP8A 4JPRA 4JTAB 1TA8A 1S5LZ 2E5LO 4OXSA 2VQEO 4DV5B 1M1KW 3L74H 2Z5UA 4U3JB 3SJCC 4LFBB 5FNVA 2JGDB 2GUZB 2AHYA 2WLNA 3T1CA 3E8FA 2CTQA 1S3JA 2ZR2A 3H1LH 5H6RA 1OCRB 4GX1A 4JV5O 2WPDG 1L1FA 4B3SB 4MTOA 3IC9A 4MVUA 2EULA 1ZL8A 1AR1B 2LGQA 3H1IH 3EFFK 1PPJH 5LMUO 1M5IA 3CCVV 3AK2A 1G8MA 1QHTA 1MSDA 2W6IG 3C90A 4HNAB 2ZINA 4FM1A 5KA5A 2ZNIA 4QGPA 1CXZB 1ZSPA 3ABKB 3D8CA 3MHSC 1V54B 2WLLB 3RYCB 2OCCC 3HPLC 2LW7A 3ZS8C 1QVGU 2Q8VA 4OX9B 3QO8A 2YC0A 1VF6C 4QIWF 5C93A 4GZRB 2OT5A 2HKOA 1YTFB 3CJHB 1I5XA 4JI6B 5ITZB 2IJHA 3RGBA 4YIOA 1F4NA 2XAGA 4FK5C 1JPXA 2PUSA 3KCYA 3DSQA 4UVAA 4LR3A 3BVOA 3TCUA 3LSUA 1M9NA 4CH4A 2E76B 1JA8A 3JAMN 1AI4A 3RYIA 3OMNB 2IJIA 3JD1A 4A5UB 5JVDA 2E5LB 1KECA 3K79A 2VQEB 3FYIB 4J11A 4D7SA 3CX5F 3CCUV 4J7ZA 1Y67A 2QM4A 1V55B 2BOBC 2L6LA 4GX0A 2ZCEA 4GYCB 4I9WA 4LF8O 2A06H 2IU3A 2F66C 2F23A 2UUBO 1AI7A 5CA3A 4JV5B 3TJTA 5CB4B 2JEXA 3G67A 1MZFA 3VQWA 1IVSA 4WFHA 4DV4O 4DK0A 1WPXA 1SQVH 2ZM6O 5CBFA 4XDJA 5LP6B 2ZQMA 3DXRB 2CGNA 2IW5A 1EM1A 1QBZA 1ZX3A 3FB7C 4AHCA 1JX9A 1MABG 4LFCO 1K4CC 1N34B 1YHQV 1GO3F 3FX7A 3SR2C 2V7QG 4FLWA 2ODMA 1S5HC 4IYIA 2YI9A 3CCQV 5CA0A 2NN4A 1R73A 2CH7B 1XQ8A 3WB0A 2B5UA 3K0GA 1JOYA 3OGCC 2E74B 3P30A 5KAIZ 1M93A 3ICXA 3OTOO 4H13B 2Q4PA 3JCZA 2X7RB 2IJKA 2D3OW 5BMVB 1W0JG 3BA9A 1GM8A 2YIBD 1OCCC 1OHHG 1PNKA 4I5SA 3DTUB 5DN6G 3BCCH 1S77D 4I4TB 3JCUZ 2DYSC 1GM7A 3E83A 3ABLB 1RM1B 1CPYA 2EILB 4I55A 1MA1A 3U11A 1OJHA 3D3QA 2KSDA 4LF9O 1TUEB 3BA8A 4TV9B 1EZVH 4I9QA 5FPOA 4O4JA 1J95A 4X1YA 3D36C 3QO7A 1Y74B 2XAFA 4DUZO 1QU7A 4QPKA 4DV4B 3G6BA 5JQGB 1NTKH 1OCRC 2RJZA 1R6KA 4DR1B 1FYJA 2ZE5A 1NR1A 3B4SA 4O2AB 3K08A 5KMGB 4TUYA 3SPCA 3MAQA 3OW2U 2P4VA 3RWRD 3BY6A 4I50B 4Q20A 1FFXA 4LH7A 2QGNA 2YIBA 2IJJA 4K35A 3CCMV 3GWKC 3B8MA 4LFCB 3F5WC 1HP8A 2ADPA 3CS5A 2YXYA 3JASA 4NTYA 5IJ9A 5KHIA 1AI6A 3J81N 3ABKC 3HKEB 1V54C 2MK3A 1Z5WA 5L3FA 2HEPA 2ZT9B 3THOA 4U3FH 1TUBA 2Z0AA 4CH5A 2AXTZ 1K92A 2O57A 3H1KH 3OTOB 4EEQA 3H1JH 2W0XA 3OEEG 1LNQA 2XASA 1VMGA 4Z2WA 1MG1A 4BIZA 4FLTA 4GX5A 2IH1C 3RFRA 1OCOB 4HZ3A 5C8YA 4IGGA 2Y0IA 1HNWO 1H2SB 1JFFB 4PI2A 1MZEA 3I55V 5LA6B 3G6EV 4WFGA 5IJ0A 2YEVB 2BTQB 1V55C 1US6A 4JZ2A 4B3MO 5LOVA 1EN4A 2CAZC 4PDRA 1N0JA 4DUZB 3OFNG 1ZLZA 3SGIA 2HVKC 4JAVA 4IYHA 3S3WA 2LP7A 3RYFA 4DR3O 3WU2Z 2YIAA 5CN0A 3HKBB 1S72V 3AG4B 2Y4UA 1I94O 1Q6IA 1ENVA 5LP6C 1XOUA 4O4IB 1Q43A 3CCSV 4OPAA 2UXDO 3VQYA 4DV1O 4FLZA 1SKVA 4QPJA 5EZYA 5JH7B 3UCSC 3FB8C 1H8HG 5EBLC 1F23A 2YXLA 4FIPC 2OCCB 4LNUB 4PHZA 1Q5OA 2JS3A 4D6TH 1R3KC 3RYHA 4DV7O 1CEZA 1BSMA 4H44B 5JJNB 1UFIA 1NJIW 5J2UA 1ORQC 2DWDC 1VQ5V 2ILMA 4DR5O 3CMAV 1P7GA 3FB6C 2JS5A 2AGAA 3WG7B 3ZRWA 2OCHA 2Q7EA 4GLXA 1Y4MA 4BW5A 5F2VO 2ZDIC 2QA4V 1VQOV 4EKWA 1QLNA 1YJWV 4GX2A 1HNWB 5KAFZ 5LHGA 2A9HA 1GN2A 3F7VC 1GN3A 2CTPA 3ABLC 1J5EO 1K34A 1RM1C 2EILC 2VRZA 1XNQO 5FLXN 1VQPV 4TQFA 3R65A 4B3MB 4G28B 3STZC 1KKDA 4LC1A 3WB1A 4B3RB 4DR4O 4BAYA 3JALB 1FXHA 3OR7C 1QVFU 2R9RB 1T5EA 5A9GA 2Z3YA 1YIJV 3JD2A 3K0DA 4DRXA 1NTZH 3FAVA 3T1HO 3KCXA 1IXBA 4QJFB 3HKDA 1YJNV 1I94B 4PV1B 5KHHA 2PGGA 1AP6A 1CP9A 4IHJA 1WNSA 5KUMA 1ZL8B 5DEDA 5LYJB 4WCEV 4NB5A 4JI2O 1UPGA 2OTLV 2UXDB 1AR4A 3QVNA 4E2LA 5LHHA 1M57B 4B3TO 5DECA 3H1HH 3FYEB 3E8GA 4DV7B 3BFRA 3SDLA 3H01A 1K73W 4AQYO 4G2KA 1Z5VA 5CA1A 5L3EA 4O4HA 1K4DC 2Q0AA 3HKCB 2IU0A 3RVZA 1S76D 1X59A 1ZTEA 3K04A 1YZBA 1XDCA 4WF9V 1F7YA 2DN9A 3BABA 4EFEA 3FB5C 3K57A 1ZWIC 3N2GA 2EIKB 3P3PA 1FFTB 4PA4A 1BZKA 2DYRB 1RSOB 5H9CA 2PI5A 1J5EB 1OCOC 4TV8A 1WP7A 1XNQB 4IL6Z 3CRQA 1IXMA 3CB2A 1TVKA 1AR5A 3ASOB 3CWBH 3RYIB 2AHZA 4CC5A 4K0KO 3K5NA 4X20B 4FM2A 4DR4B 1P84F 3B2EE 4X62O 1Y76B 2ZXWB 4F6RA 5JCOC 1FXKA 2B1GA 2CGOA 4R7CA 3T1HB 5TISZ 4CS3A 1FXVA 2QTSA 2UXNA 2P67A 3ZMSA 2JGUA 4WBNA 5KHKA 1K5QA 1BQ0A 3A2FA 4JI2B 3AG4C 2B9ZA 3EVKA 1AILA 4H0LB 2LFRA 4MVSA 4JTDB 4PA7A 4UCTA 5H2FZ 3CCJV 4LF6O 3AG2B 2WA3A 4LH6A 4W4LA 4PDVA 4B3TB 3JATA 5B1AB 2VQFO 4LWSB 1D5NA 3GVMA 3ZHSA 3OM3B 5FPRA 3AK3A 2FB5A 3QNEA 2BE3A 3JAWA 4MW3A 4N23A 4MVOA 4LF5O 3MDSA 3K5OA 2DE0X 3GB7C 1IDSA 4JI4O 4JYYA 3LDDA 5CA0B 3WG7C 4CS2A 4FLYA 3CE2A 1M90W 3E22A 1AROP 2ZKOA 4QE9A 1QLEC 4TT3G 5L3DA 5L3BA 3TGUH 2KKWA 2KG7A 5LXTA 4JI5O 1R6TA 1YXBA 3W7SA 1S0VA 2C2AA 4O4LA 4K0KB 1JJ2U 1B04A 3OT7A 4X8AA 3CPWU 1Y6XA 2DOSA 1KP2A 4CBCA 3UQ8A 4I55B 1VQKV 4FLXA 4X62B 4RAIA 2GTSA 5B3SB 1MOFA 4O2BA 2PZSA 1SRYA 3UKMA 1SA0A 1I0HA 4FFKA 2PYLA 3CSXA 2UXCO 4X1YB 1WB8A 4I0XA 1EFRG 2WLKA 4Z1MG 2JGDA 3CC7V 1XI1A 4PI0A 5LMUB 1YTFD 4RO2A 4X1KA 5LMNO 3CRCA 5DM6V 3A8TA 4LF6B 3ZMZA 1PL4A 4PA6A 2NLJC 4TUYB 4AILC 1Q6HA 2DW4A 2VQFB 4PD4F 3G80A 5HFMA 4PA9A 3M8AA 3HB3B 1FFXB 2LQTA 1K9MW 1M57C 5EYPA 1RP3B 2JRIA 3BEHA 4DXWA 1AI5A 3SJBC 4FFBB 4GUNA 4LF5B 3JASB 5IJ9B 1VF5B 2VWKA 1JR9A 2AZ2A 4XBFA 3CCRV 2HHHO 2UXXA 3CHXA 3N2KB 3UO3A 3ZCCA 3CRAA 5KX5A 1SERA 1H2NA 2YXHA 2WLLA 1VQNV 3OGIB 1RFYA 1NBMG 5AG2A 5H5NA 5BR8O 3CCLV 5IYCO 4IIJB 3ABMB 2UU9O 4E4EA 4JASA 2ETNA 4MTGA 4HYOA 1N32O 1PD3A 4FVMA 1VP7A 3AK1A 4JI5B 1IBKO 2FL4A 5LGUA 2G38A 3CJHA 3E8BA 1THZA 2EIKC 3GWOA 4ZKIA 1EZJA 4X88A 2DYRC 1SQQH 2A0LA 3CC4V 2WLMA 4UCVA 1IBMO 3T2MA 5IDJA 4MT8A 5C8YB 4RQFA 2R70A 1XUQA 2DQ0A 3L75H 3ASOC 1N0NA 3SPIA 4ZOLA 5E1AC 1N4CA 4X9QA 5JWPA 4LF8B 4DV3O 1KQSU 2JJ1G 5B1BB 5J2TB 3X2QB 4NYKA 4UFZA 2UUBB 1XMQO 2UXCB 4ZI7A 4J80A 1LUVA 2ZXWC 5LOVB 1NR7A 2Y48A 2ZE8A 3ZIAG 1JJOA 1XNRO 3MD0A 2W0FC 3SYAA 1SETA 3AG7A 5LMNB 3F7YC 4R6ZA 2ZM6B 1PKXA 3ZRVA 2PY5A 3RYFB 2LJ2A 3ZBHA 3K5LA 4DW1A 3T1YO 4NTWA 2F93B 2QJ1A 1XL6A 4EB6A 5EBMC 4X64O 2E3CA 2PF4E 3AG2C 5IT9N 2OWOA 4GKKO 3CD6V 3K9AA 1QQCA 5B1AC 3TXSA
chains in the Genus database with same CATH topology
4MTFA 1G4YB 3E2EA 2DYSB 1GMGA 1OCZC 3FKSG 4H33A 5GW7A 1NH2D 3SPHA 1Y4MA 2XAJA 4LP8A 4BW5A 5J9PC 2XNDG 4JPRA 3ZJZA 4JTAB 3SPGA 3LDCA 5L3CA 1Q7YW 2ZDIC 5EC1C 2QA4V 1H8EG 1VQOV 4OXSA 4EKWA 1QLNA 1PNMA 1R3IC 1YJWV 1M1KW 2QEXV 4GX2A 2Z5UA 1RPOA 5LHGA 3OMIB 3LNMB 1VQ6V 2A9HA 1OZ0A 1E1QG 3F7VC 2EIMB 3DGEA 3ABLC 3OEHG 1K34A 1Q82W 1RM1C 2AHYA 2EILC 2WLNA 4DO2A 2JEUA 3T1CA 5EC2C 3E8FA 1VQPV 1AJPA 2HJFC 3SYQA 3R65A 4MVMA 1S3JA 3ZRWA 2ATKC 2ZR2A 5H6RA 1OCRB 4GX1A 2WPDG 1L1FA 4G28B 4MTOA 3TK1A 3STZC 1KKDA 4U7NA 4MVUA 1ROPA 4XDLA 3M99B 4LC1A 1AR1B 4BAYA 3EFFK 2ZDIA 4MTXA 4RUFA 4G27B 4FMTA 4QE7A 3E35A 1FXHA 3OR7C 4RUEA 1QVFU 3CCVV 2R9RB 1YJ9V 2Z3YA 1G8MA 1YIJV 3AG3C 2W6IG 3W7UA 3JD2A 3K0DA 1PL0A 4QJFB 5B3SC 5KA5A 2H94A 2IH3C 1YJNV 3ZRSA 2X6CA 1K97A 1H2GA 1DLBA 1CP9A 3ABKB 3MHSC 1V54B 1NVPD 2WLLB 5KUMA 4WCEV 2OCCC 3K03A 1BMFG 3HPLC 3PJSK 2OTLV 3RW0A 1QVGU 3QO8A 3ZN1A 4E2LA 4J9YB 5LHHA 1B6QA 4X89A 1M57B 4QIWF 5C93A 2OT5A 2HKOA 2Q6AA 3FYEB 1YTFB 1YITV 3E8GA 2FTKA 1I5XA 1NKDA 2LFSA 3H01A 2OTJV 5CMUA 2IJHA 3AG1B 5EBWC 4KP4A 1K73W 1DF4A 1F4NA 4G2KA 2XAGA 4FK5C 5LGTA 3OR6C 1JPXA 5LHIA 5L3EA 1P7BA 1QR8A 4UVAA 4F4LA 5B1NA 3TCUA 4QNHB 1M9NA 1K4DC 1KP3A 3E89A 1K5SA 2EIJB 2IU0A 3K3WA 5H6QA 3RVZA 3OE7G 1S76D 1AI4A 5FL7G 1VQ8V 3D3IA 3OMNB 2IJIA 3JD1A 2Y69B 3K04A 1KECA 3K79A 4FJCC 4WF9V 3FYIB 3CYOA 3FB5C 2GSMB 1JCHA 3CCUV 1ZWIC 2EIKB 1V55B 1FFTB 2BOBC 4PA4A 4GX0A 2DYRB 3JYCA 4WFEA 3JD0A 5H9CA 4I9WA 3OUFA 2PI5A 4MS2A 1VQLV 1OCOC 3JD4A 2WLIB 2EJRA 3LSQA 2IU3A 1IXMA 1AI7A 2P6JA 2R9IA 1BL8A 2X0LA 5CA3A 4GCZA 4LCUC 2ITDC 3ABMC 3ASOB 2AHZA 2JEXA 1QLEB 2V1DA 3ZRXA 2WLJA 2EBOA 2EINC 4J9ZB 2DWEC 2QKSA 5IY5C 5EK0A 4WFHA 1WPXA 4ZBMA 3ABUA 2ZXWB 1FXKA 3VOUA 3ZRWB 1NVPB 2B1GA 5CBFA 4XDJA 2ZQMA 2Q68A 4P9OA 4UXNA 3EHBB 4R7CA 2H8PC 2IW5A 1FXVA 2NNUA 1K7DA 2UXNA 3SYPA 1RPRA 2P67A 3MHHC 1QBZA 3ZMSA 1XL4A 1DTOA 3K06A 3CMEV 3FB7C 1VQ7V 2X6BA 4H37A 2Q67A 1K5QA 1JX9A 2HR3A 5B1BC 1MABG 1M56B 3X2QC 3AG4C 3SJQC 1K4CC 4PELA 2QTOA 1YHQV 1GO3F 4PDMA 2LFRA 2X6AA 4MVSA 4JTDB 4PA7A 2V7QG 1FXKB 1AJNA 3CCJV 1VQ9V 1SESA 3ASNB 3AG2B 1JVMA 1S5HC 4UUJC 4PDVA 3CCQV 3T4ZA 1R73A 5B1AB 3OM3B 4U7OA 2JK5C 1OCZB 1GTOA 3P32A 2B5UA 3K0GA 3QNEA 2XOKG 3I56V 1JOYA 4TWKA 3OGCC 5KUKA 3P30A 4KFMA 3JCZA 4MW3A 4N23A 2X7RB 4MVOA 1QR9A 2IJKA 2D3OW 2QE7G 3WFVA 4HAMA 1H38A 3OAAG 3GB7C 1W0JG 4CZZA 3VBBA 1GM8A 3LSSA 1KD1W 1OCCC 1OHHG 1PNKA 1Q86W 4I5SA 3LDDA 3DTUB 5DN6G 3CP1A 2HLDG 3WG7C 1S77D 2ZD9A 2DYSC 4P30A 1NH2B 3W7WA 1GM7A 3E83A 4BIUA 1Q81W 3ABLB 4N21A 1RM1B 1CPYA 2EILB 4JGSA 3RBZA 4KUMA 1M90W 4TSFG 1AROP 5L3GA 1COWG 4QE9A 1QLEC 3NXSA 4TT3G 5L3DA 5L3BA 4UV9A 1BHAA 3UM7A 3T4DA 2F43G 4JTCB 1TUEB 3ETEA 3ZMTA 3W7SA 1J95A 2EIMC 1S0VA 2C2AA 3QO7A 1SZTA 4WFBV 3ETDA 2ITCC 1JJ2U 2XAFA 4X8AA 3AG3B 4P2ZA 4UVCA 3CPWU 4QPKA 3LUTB 1KP2A 4CBCA 1VQKV 4WFAV 4RAIA 3E8HA 4MW8A 1OCRC 5B3SB 1MOFA 1P4RA 1R6KA 3SYCA 3ZMVA 1GKFA 1NR1A 1DF5A 1SRYA 3UKMA 3CCEV 3K08A 3SPCA 4GT1A 1JQ0A 2P7TC 4MSWC 3OW2U 3SYOA 1NQTA 3BY6A 1EBOA 4PDLA 4Q20A 3QO5A 2EZOA 1EFRG 2WLKA 2IJJA 2JJ2G 3CCMV 4Z1MG 1E79G 4XDKA 3B8MA 3CC7V 3F5WC 5BZBA 1KC8W 1YTFD 2A79B 4RO2A 1AI6A 5DM6V 2DQ3A 3LDEA 1K33A 3ABKC 1YI2V 1V54C 3ZMZA 2MK3A 4PA6A 5L3FA 2NLJC 3STLC 3KG2A 3ML0A 2DW4A 2HVJC 4UVBA 2JIZG 2KB1A 1GM9A 2XAHA 5LBQA 5HFMA 4PA9A 1BHBA 1K92A 2Q69A 1F4MA 3HB3B 3ETGA 1VQMV 3IGAC 3SPJA 1M57C 3G71V 2HG5C 1K9MW 3ABTA 3BEHA 4DXWA 1AI5A 1FS0G 4MVRA 2WAMA 1I5YA 4LBEC 3OEEG 1R3LC 3AG1C 4MVQA 1LNQA 2YEVA 5CBHA 2XASA 1MG1A 4XBFA 3CCRV 1GK9A 2UXXA 3IFXA 4L87A 4JF3A 4BIZA 1W2BU 2M7WA 2QM7A 3ZCCA 3W7XA 2ZR3A 4GX5A 2XAQA 5B1OA 1MSWD 1SERA 5LGNA 3B77A 2IH1C 2WLLA 1VQNV 1OCOB 2GHYA 1AJQA 2EIJC 4HZ3A 5KA6A 1NBMG 3G4SV 2WSSG 2PI4A 1QCEA 2W6JG 2WWWA 3CCLV 5IYCO 1WLEA 2Y69C 2B1IA 3ABMB 3I55V 4JASA 2YSUB 4MTGA 3IC7A 4HYOA 1PD3A 2EINB 3JD3A 3G6EV 2CK3G 4WFGA 5CBGA 5IY5B 4RQEA 2YEVB 5LGUA 3CXCU 1HWYA 3E8BA 1THZA 2EIKC 1V55C 3GWOA 1EZJA 4ZKIA 3TETA 4X88A 2DYRC 1F51A 1VQ4V 2A0LA 3RVYA 3B8NA 3CC4V 2WLMA 1R3JC 4PDRA 1E1RG 4R50A 3T2MA 5IDJA 1Y66A 3OFNG 2WLHA 4MT8A 4YXWG 2BOCC 4RQFA 4WFFA 3AEIA 2DQ0A 2HVKC 4JAVA 3ASOC 3E86A 3A0RA 4MVZA 2EZPA 2P90A 3SPIA 4P9PA 5E1AC 1UJWB 5IYBO 1N8RW 2LP7A 5CN0A 1KQSU 2JJ1G 4JYBA 4UV8A 5B1BB 4JAUA 3CC2V 3X2QB 1S72V 3AG4B 2ZXWC 1R6NA 1NR7A 1K3EA 5HFLA 1ENVA 2Y48A 1W0KG 3ZIAG 4R8CA 3CCSV 3MD0A 1PNLA 2HFEC 2W0FC 3SYAA 1SETA 2K1EA 4JYCA 4QPJA 3F7YC 4R6ZA 5IYDO 2WLIA 4PA3A 1PKXA 3FB8C 3ZRVA 1H8HG 2QM8A 5EBLC 1F23A 3ZMUA 4FIPC 1M56C 2OCCB 3OUSA 1XL6A 1R3KC 1CEZA 5EBMC 1NJIW 1FXKC 2JDIG 1ORQC 2DWDC 4FPPA 3ASNC 4ASUG 3AG2C 1VQ5V 1YSCA 3OMAB 3CMAV 3W7TA 3FB6C 3CD6V 1OCCB 3K9AA 5B1AC 1K8AW 3D36A 3ZN0A 3WG7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X7R B;  1I5Y A;  2EZP A;  4E2L A;  1QR9 A;  1K34 A;  1DF5 A;  2LP7 A;  1K33 A;  3WFV A;  1Y4M A;  1F23 A;  2MK3 A;  5CN0 A;  1MG1 A;  4FIP C;  4JPR A;  4JF3 A;  1JQ0 A;  2OT5 A;  2P6J A;  3GWO A;  2M7W A;  5KA5 A;  3CP1 A;  1I5X A;  1SZT A;  1EBO A;  3H01 A;  3B8N A;  3MHH C;  2EBO A;  1QBZ A;  4FJC C;  5CMU A;  3B77 A;  5HFM A;  1MOF A;  1DLB A;  2EZO A;  5H9C A;  1ENV A;  1DF4 A;  4N21 A;  5HFL A;  3M99 B;  3MHS C;  3CYO A;  4G2K A;  3P30 A;  5KA6 A;  1Y66 A;  4JGS A;  3B8M A;  4FK5 C;  1JPX A;  1QCE A;  3K9A A;  1QR8 A;  4N23 A; 
#chains in the Genus database with same CATH topology
 1GMG A;  3FKS G;  5LP6 A;  5GW7 A;  1TAE A;  1WAZ A;  2K9P A;  3SPH A;  2XAJ A;  2HHH B;  1YVW A;  3SPG A;  3LDC A;  5L3C A;  1Q7Y W;  1KUQ A;  3ZHV A;  1H8E G;  1Q90 D;  3S3X A;  1PNM A;  3L70 H;  1R3I C;  1KMI Z;  1RPO A;  1E1Q G;  3JAR A;  1XHZ A;  2UU9 B;  3DGE A;  1L0N H;  1HW7 A;  3OEH G;  1Q82 W;  3K9S A;  1IBK B;  4DO2 A;  2GTA A;  5EC2 C;  2CH7 A;  1AJP A;  4MVM A;  1B3Q A;  2ATK C;  3ZHT A;  1IBM B;  4FZ0 A;  2ZDI A;  1X4T A;  4EFB A;  4RUF A;  4NXM O;  3B09 A;  4G27 B;  4FMT A;  4RUE A;  1BGY H;  1GN6 A;  4DV3 B;  4LF9 B;  3W7U A;  3N27 A;  1XMQ B;  1PL0 A;  2QWR B;  2BSK A;  5B3S C;  2H94 A;  2IH3 C;  2QDO A;  5BXZ A;  1SQF A;  1H2G A;  4JZG A;  3CRR A;  1NVP D;  1KU9 A;  3K03 A;  4ZHQ A;  4UCS A;  3PJS K;  3RW0 A;  2EJ7 A;  4KHP O;  1SQX H;  3ZN1 A;  1AVM A;  4BWA A;  4GKJ O;  4J9Y B;  2IBZ H;  4C7U A;  1B6Q A;  2N04 A;  4UB8 Z;  5IYZ A;  3T1Y B;  2Q6A A;  3FAV B;  4JI3 O;  1Z2G A;  2LFS A;  4X64 B;  5CMU A;  2OIE A;  4GKK B;  4JYA O;  1VIB A;  5JQG A;  1DGS A;  3OR6 C;  5LHI A;  4F4L A;  5B1N A;  1IUR A;  3OTF A;  1K5S A;  2N05 A;  5H6Q A;  4DR6 O;  2ZIO A;  1VQ8 V;  1SQB H;  4K8X A;  2ARH A;  2CTW A;  1KBH A;  4YY3 O;  4CH3 A;  4FJC C;  2GSM B;  1JCH A;  5CA1 B;  4WFE A;  2Q9L A;  1BE3 H;  4MS2 A;  3JD4 A;  1XHX A;  2WLI B;  2EJR A;  3LSQ A;  3JSL A;  2P6J A;  4LCU C;  1LUW A;  3ABM C;  2V1D A;  1QLE B;  3ZRX A;  2WLJ A;  2EBO A;  4YHH O;  2UUA O;  4J7K A;  1O9H A;  4NXM B;  4ZBM A;  1WB7 A;  2A7W A;  3N2G B;  1I7F A;  4KL1 A;  2RCV A;  1EN6 A;  1HNX O;  4TV8 B;  1YF2 A;  2M6Y A;  3EHB B;  2H8P C;  1TVK B;  3SYP A;  1RPR A;  2DJV A;  2KQX A;  1XL4 A;  3K06 A;  5GTI Z;  2X6B A;  2Q67 A;  5B1B C;  4D7T A;  3X2Q C;  3F5T A;  4B08 A;  4DR7 O;  2QTO A;  5FNV B;  1OV9 A;  5LA6 A;  4GKJ B;  4F6R B;  1FXK B;  1AJN A;  1IZ3 A;  4DR3 B;  1FAF A;  4TQD A;  3CXH F;  4JI3 B;  3T4Z A;  1WA8 A;  4DV5 O;  2JK5 C;  4K8Z A;  1GTO A;  3P32 A;  1KKC A;  3KZI Z;  2OYQ A;  4TWK A;  5KUK A;  4JYA B;  4DV2 O;  4LFB O;  4DV1 B;  3L73 H;  1KYO F;  1G1X B;  4CZZ A;  1KD1 W;  4DR6 B;  3JAT B;  4B3S O;  4YY3 B;  2HLD G;  3O65 A;  1MNG A;  1NH2 B;  3W7W A;  4BIU A;  5JJE B;  2QR4 A;  2QWQ B;  4KXR A;  2JVD A;  3HR0 A;  3PN1 A;  3SJA C;  5K1P A;  3NR7 A;  4TSF G;  4DR5 B;  2EX3 A;  4B7K A;  2PYJ A;  1COW G;  3JAW B;  3UM7 A;  3T4D A;  2F43 G;  4LNU A;  4JTC B;  4X1I A;  5KHJ A;  3ETE A;  1ZAU A;  3C3S A;  1L8D A;  5JJJ B;  5D5P A;  3ETD A;  4WFB V;  3A0B Z;  4FM0 A;  1BQZ A;  1JMK C;  2ITC C;  2UUA B;  3BPZ A;  1VF6 A;  3AG3 B;  1HNZ O;  4ABM A;  3E22 B;  4OX9 O;  1P4R A;  3SYC A;  3ZMV A;  1GKF A;  1DF5 A;  3TXQ A;  2KG7 B;  5EIB C;  3CCE V;  4JI6 O;  3SYO A;  2GDS A;  1HR0 O;  1EBO A;  4PDL A;  2CDY A;  5JVD B;  2RNB A;  3QO5 A;  2JJ2 G;  4XDK A;  4UB6 Z;  1URF A;  5BZB A;  4DR7 B;  5BY1 A;  3VQX A;  4CC6 A;  2Q5Z A;  3M7M X;  2DQ3 A;  4O2B B;  1K33 A;  4UCO A;  1SA0 B;  2HP8 A;  4DV0 O;  3KG2 A;  5KLV H;  3Q4H A;  4UVB A;  3J80 N;  1GM9 A;  5LBQ A;  4OPH A;  2Q69 A;  3ETG A;  3IGA C;  4I0X B;  3JAL A;  4DV2 B;  2YIC A;  1FS0 G;  1G6U A;  2WAM A;  3ETQ A;  3JSN A;  1AB3 A;  4X1K B;  4MVQ A;  4YIP A;  4L87 A;  3IFX A;  4JF3 A;  1Q3E A;  2M7W A;  4BIO A;  1H2M A;  2ZR3 A;  3UT5 A;  1I08 A;  3W7X A;  5B1O A;  1MSW D;  5LGN A;  3B77 A;  5LYJ A;  1VF7 A;  1AJQ A;  4AQY B;  5KA6 A;  3G4S V;  5EYP B;  2PI4 A;  1QCE A;  2W6J G;  3L9D A;  4J7J A;  2B1I A;  2YSU B;  2EIN B;  4X65 O;  3JD3 A;  2P22 C;  2FML A;  5IY5 B;  1VAR A;  3CXC U;  2UUC O;  1HWY A;  1WPB A;  1GH6 A;  1F51 A;  1VQ4 V;  3B40 A;  3RVY A;  5KX5 B;  3DC6 A;  1HNZ B;  2WLH A;  2BOC C;  1QNM A;  4WFF A;  1NTM H;  2YUA A;  3AEI A;  1N34 O;  1S5J A;  3LNN A;  2VS0 A;  3HKC A;  2EZP A;  4MVZ A;  1W59 A;  5IYB O;  1N8R W;  1LR1 A;  2Q0O C;  5B66 Z;  4JYB A;  4UV8 A;  4JAU A;  3JAK A;  2P4K A;  3A0H Z;  2E75 B;  1HR0 B;  2L35 A;  1R6N A;  2F4V O;  5HFL A;  4YJ3 A;  1W0K G;  2FYU H;  3QG5 A;  5GON A;  2ZIM A;  3DC5 A;  1RSO A;  1FKA O;  1PNL A;  2HFE C;  3RN4 A;  4DK1 A;  4YJ2 A;  5IYD O;  4ZOL B;  5A2Q N;  2QM8 A;  4UCR A;  4DV0 B;  2QKA A;  4X20 A;  4ZI7 B;  4O4J B;  4B7E A;  3QTC A;  1FXK C;  2UXB O;  4FPP A;  4U3J A;  4ASU G;  2BCC H;  1YSC A;  3OMA B;  3W7T A;  1Y76 A;  5E79 Z;  1K8A W;  3D36 A;  2GUZ A;  4MTF A;  1G4Y B;  3E2E A;  4UCU A;  5J9P C;  2XND G;  2F95 B;  3ZJZ A;  4ZIB A;  5EC1 C;  4JAA A;  1ZUQ A;  4EB6 B;  2GBO A;  1YDX A;  3CRM A;  2QEX V;  3FFQ A;  3OMI B;  3LNM B;  1VQ6 V;  1OZ0 A;  2EIM B;  4DR1 O;  3O9O A;  1IBL O;  4X65 B;  4PJ0 Z;  4HBN A;  4HNA A;  2JEU A;  2UUC B;  4LFA O;  4F6E A;  1KB9 F;  4LWS A;  2HJF C;  3SYQ A;  1YEW A;  4I7Z B;  4JI4 B;  3APO A;  1MMM A;  2LGW A;  1TUB B;  3TK1 A;  4NVP A;  4U7N A;  4XDL A;  1ROP A;  3RYC A;  3ZX6 A;  3M99 B;  4MTX A;  2QWP B;  3E35 A;  4QE7 A;  3JAR B;  2PTM A;  4DYL A;  2WA4 A;  3QF7 A;  1YJ9 V;  2H3O A;  3AG3 C;  2NR5 A;  2Q7H A;  4IT5 A;  2CUG A;  4DV6 O;  1Q8I A;  3ZRS A;  2X6C A;  5ITZ A;  2F4V B;  1K97 A;  1DLB A;  2LW1 A;  5LL6 Y;  3L71 H;  1BMF G;  2RDC A;  1AP5 A;  2ZNJ A;  1H2K A;  2RMK B;  2XTA A;  4X89 A;  1V9P A;  5IJ0 B;  1BT8 A;  1YIT V;  2FTK A;  4NXN O;  2BSK B;  4NR1 A;  1NKD A;  2OTJ V;  3AG1 B;  5EBW C;  4KP4 A;  2UXB B;  1DF4 A;  1DK1 A;  1Q6U A;  5LGT A;  2DMX A;  1P7B A;  4ZHQ B;  1QR8 A;  4QNH B;  1KP3 A;  3E89 A;  2EIJ B;  3K3W A;  1N36 O;  3OE7 G;  2ZE6 A;  5FL7 G;  1N33 O;  3D3I A;  5CB4 A;  5IYZ B;  2Y69 B;  3OD4 A;  4LF7 O;  1P49 A;  1TGO A;  3CYO A;  3R66 A;  3JYC A;  2HJD A;  3ZED A;  3JD0 A;  1XMO O;  1IBL B;  3OUF A;  1R1B A;  4FLU A;  2ADQ B;  4JI8 O;  1VQL V;  3CEI A;  5EZY B;  1GAX A;  1SQP H;  3DXR A;  2P06 A;  4JI7 O;  4LFA B;  2R9I A;  1BL8 A;  2X0L A;  4GCZ A;  2V4D A;  4DUY O;  2ITD C;  3L72 H;  5B5E Z;  4CH6 A;  2GV9 A;  1A32 A;  2D2C B;  3RYH B;  2EIN C;  4J9Z B;  2DWE C;  2QKS A;  5IY5 C;  5J2U B;  3ZHU A;  2XUM A;  5EK0 A;  4FFB A;  3ABU A;  2IM9 A;  5BR8 B;  2YDE A;  3I5D A;  3VOU A;  2LO1 A;  3ZRW B;  1NVP B;  1N32 B;  2Q7G A;  2Q68 A;  3N2K A;  4P9O A;  4UXN A;  3VQV A;  1SC5 B;  4DV6 B;  3BAA A;  4NTX A;  2QWO B;  1SZX A;  2NNU A;  1K7D A;  1WJZ A;  3MHH C;  2XHB A;  3CME V;  1DTO A;  1VQ7 V;  4H37 A;  2HR3 A;  1M56 B;  4IIJ A;  3SJQ C;  1U96 A;  4PEL A;  2AZ0 A;  4PDM A;  2X6A A;  2A3Q A;  5BMV A;  1VQ9 V;  4J10 A;  1SES A;  3ASN B;  1HDJ A;  2QWN B;  1JVM A;  4UUJ C;  4DW0 A;  4I4T A;  4NXN B;  4U7O A;  1OCZ B;  5KHG A;  2XOK G;  3I56 V;  4KFM A;  2XT9 A;  1XNR B;  4JI0 O;  4X66 O;  1QR9 A;  2QE7 G;  5J2T A;  3WFV A;  4HAM A;  1H38 A;  3OAA G;  1N36 B;  4TV9 A;  3BHP A;  3VBB A;  3LSS A;  1N33 B;  4DRX B;  1Q86 W;  1XRE A;  5IWA O;  3CP1 A;  1VEW A;  2ZD9 A;  4P30 A;  1WA8 B;  1PV0 A;  3HKD B;  1Y74 A;  1Q81 W;  4LF7 B;  3P3N A;  4N21 A;  2CTR A;  4B3R O;  4DR2 O;  4JGS A;  3RBZ A;  4IHJ B;  4KUM A;  2YID A;  2YS8 A;  5L3G A;  2RN9 A;  1BHA A;  3NXS A;  4UV9 A;  1XMO B;  4O2A A;  4JI8 B;  1NI8 A;  2QKC A;  5GTH Z;  5KMG A;  4JI7 B;  5EIB D;  3ZMT A;  2F1M A;  1SQG A;  3EXA A;  4DUY B;  4I50 A;  2EIM C;  4J41 A;  1SZT A;  2MW2 B;  1D2D A;  1D5A A;  2Y0P A;  4P2Z A;  4UVC A;  1NU1 H;  3LUT B;  1IX9 A;  3RT3 C;  4WFA V;  4ICG A;  3E8H A;  4MW8 A;  2R9A A;  4O4H B;  2OIG A;  3HKE A;  1WN7 A;  1BS3 A;  3ZHQ A;  3K5M A;  4X1I B;  4GT1 A;  1JQ0 A;  2FKX A;  2P7T C;  4MSW C;  3UO2 A;  1NQT A;  1SF9 A;  3APQ A;  4J42 A;  2EZO A;  1FD9 A;  1E79 G;  1L0L H;  1KC8 W;  4JI1 O;  2A79 B;  3LDE A;  1YI2 V;  1BCC H;  3KKY A;  1NS1 A;  2N74 A;  4FLV A;  3STL C;  1U97 A;  3ML0 A;  1XIL A;  2HVJ C;  2JIZ G;  1EN5 A;  2KB1 A;  2XAH A;  4LF4 O;  1BHB A;  3H9V A;  1F4M A;  4AI8 A;  1VQM V;  1FJG O;  3SPJ A;  3G71 V;  1JFF A;  1PP9 H;  1GRJ A;  2HG5 C;  2BTO A;  3ABT A;  4K3A A;  4TOI A;  1XBL A;  2P5O A;  4JI0 B;  3C3T A;  4MVR A;  3U10 A;  1I5Y A;  4LBE C;  4KHP B;  4X66 B;  1R3L C;  3AG1 C;  4OGQ B;  4NKG B;  2YEV A;  5CBH A;  1WP8 A;  2BTQ A;  1GK9 A;  1O9G A;  3J7A U;  1YCI A;  5IE9 A;  1NZ6 A;  1W2B U;  4L8J A;  2QM7 A;  5IWA B;  5JCO A;  3Q4H B;  2XAQ A;  3U0Z A;  2Q73 A;  2GHY A;  1H2L A;  2EIJ C;  4DR2 B;  4WBN B;  2WSS G;  2WWW A;  2AW9 A;  2RQ6 A;  1WLE A;  2Y69 C;  2R72 A;  3WB2 A;  3IC7 A;  3HKB A;  2CK3 G;  5CBG A;  2YI8 A;  4RQE A;  3IJ4 A;  3TET A;  1XEQ A;  3B8N A;  3UT5 B;  1R3J C;  1PM9 A;  5K1X A;  1E1R G;  4O4I A;  4R50 A;  3K59 A;  1Y66 A;  3IAY A;  4YXW G;  3FD9 A;  4FZ1 A;  2QSA A;  4RWU A;  5JH7 A;  5D5Q A;  3E86 A;  3A0R A;  2P90 A;  4P9P A;  1UJW B;  3CC2 V;  1NT2 B;  4YHH B;  1K3E A;  3BRC A;  4CS4 A;  1B06 A;  4BW9 A;  4R8C A;  3K58 A;  2K1E A;  4JI1 B;  3ZHR A;  4JYC A;  2WLI A;  4PA3 A;  1GN4 A;  4Z1V A;  1SS3 A;  4BR6 A;  3ZMU A;  1HNX B;  1M56 C;  5LXT B;  3OUS A;  3JAK B;  4LF4 B;  2VWJ A;  4W4K A;  2JDI G;  1FJG B;  4O4L B;  3ASN C;  2ZE7 A;  4YJ3 B;  1FPO A;  5GON B;  4Q6G A;  1OCC B;  3ZN0 A;  4YJ2 B;  1M4U A;  2Y4T A;  2DYS B;  1OCZ C;  4H33 A;  2CE4 A;  1NH2 D;  4LP8 A;  4JPR A;  4JTA B;  1TA8 A;  1S5L Z;  2E5L O;  4OXS A;  2VQE O;  4DV5 B;  1M1K W;  3L74 H;  2Z5U A;  4U3J B;  3SJC C;  4LFB B;  5FNV A;  2JGD B;  2GUZ B;  2AHY A;  2WLN A;  3T1C A;  3E8F A;  2CTQ A;  1S3J A;  2ZR2 A;  3H1L H;  5H6R A;  1OCR B;  4GX1 A;  4JV5 O;  2WPD G;  1L1F A;  4B3S B;  4MTO A;  3IC9 A;  4MVU A;  2EUL A;  1ZL8 A;  1AR1 B;  2LGQ A;  3H1I H;  3EFF K;  1PPJ H;  5LMU O;  1M5I A;  3CCV V;  3AK2 A;  1G8M A;  1QHT A;  1MSD A;  2W6I G;  3C90 A;  4HNA B;  2ZIN A;  4FM1 A;  5KA5 A;  2ZNI A;  4QGP A;  1CXZ B;  1ZSP A;  3ABK B;  3D8C A;  3MHS C;  1V54 B;  2WLL B;  3RYC B;  2OCC C;  3HPL C;  2LW7 A;  3ZS8 C;  1QVG U;  2Q8V A;  4OX9 B;  3QO8 A;  2YC0 A;  1VF6 C;  4QIW F;  5C93 A;  4GZR B;  2OT5 A;  2HKO A;  1YTF B;  3CJH B;  1I5X A;  4JI6 B;  5ITZ B;  2IJH A;  3RGB A;  4YIO A;  1F4N A;  2XAG A;  4FK5 C;  1JPX A;  2PUS A;  3KCY A;  3DSQ A;  4UVA A;  4LR3 A;  3BVO A;  3TCU A;  3LSU A;  1M9N A;  4CH4 A;  2E76 B;  1JA8 A;  3JAM N;  1AI4 A;  3RYI A;  3OMN B;  2IJI A;  3JD1 A;  4A5U B;  5JVD A;  2E5L B;  1KEC A;  3K79 A;  2VQE B;  3FYI B;  4J11 A;  4D7S A;  3CX5 F;  3CCU V;  4J7Z A;  1Y67 A;  2QM4 A;  1V55 B;  2BOB C;  2L6L A;  4GX0 A;  2ZCE A;  4GYC B;  4I9W A;  4LF8 O;  2A06 H;  2IU3 A;  2F66 C;  2F23 A;  2UUB O;  1AI7 A;  5CA3 A;  4JV5 B;  3TJT A;  5CB4 B;  2JEX A;  3G67 A;  1MZF A;  3VQW A;  1IVS A;  4WFH A;  4DV4 O;  4DK0 A;  1WPX A;  1SQV H;  2ZM6 O;  5CBF A;  4XDJ A;  5LP6 B;  2ZQM A;  3DXR B;  2CGN A;  2IW5 A;  1EM1 A;  1QBZ A;  1ZX3 A;  3FB7 C;  4AHC A;  1JX9 A;  1MAB G;  4LFC O;  1K4C C;  1N34 B;  1YHQ V;  1GO3 F;  3FX7 A;  3SR2 C;  2V7Q G;  4FLW A;  2ODM A;  1S5H C;  4IYI A;  2YI9 A;  3CCQ V;  5CA0 A;  2NN4 A;  1R73 A;  2CH7 B;  1XQ8 A;  3WB0 A;  2B5U A;  3K0G A;  1JOY A;  3OGC C;  2E74 B;  3P30 A;  5KAI Z;  1M93 A;  3ICX A;  3OTO O;  4H13 B;  2Q4P A;  3JCZ A;  2X7R B;  2IJK A;  2D3O W;  5BMV B;  1W0J G;  3BA9 A;  1GM8 A;  2YIB D;  1OCC C;  1OHH G;  1PNK A;  4I5S A;  3DTU B;  5DN6 G;  3BCC H;  1S77 D;  4I4T B;  3JCU Z;  2DYS C;  1GM7 A;  3E83 A;  3ABL B;  1RM1 B;  1CPY A;  2EIL B;  4I55 A;  1MA1 A;  3U11 A;  1OJH A;  3D3Q A;  2KSD A;  4LF9 O;  1TUE B;  3BA8 A;  4TV9 B;  1EZV H;  4I9Q A;  5FPO A;  4O4J A;  1J95 A;  4X1Y A;  3D36 C;  3QO7 A;  1Y74 B;  2XAF A;  4DUZ O;  1QU7 A;  4QPK A;  4DV4 B;  3G6B A;  5JQG B;  1NTK H;  1OCR C;  2RJZ A;  1R6K A;  4DR1 B;  1FYJ A;  2ZE5 A;  1NR1 A;  3B4S A;  4O2A B;  3K08 A;  5KMG B;  4TUY A;  3SPC A;  3MAQ A;  3OW2 U;  2P4V A;  3RWR D;  3BY6 A;  4I50 B;  4Q20 A;  1FFX A;  4LH7 A;  2QGN A;  2YIB A;  2IJJ A;  4K35 A;  3CCM V;  3GWK C;  3B8M A;  4LFC B;  3F5W C;  1HP8 A;  2ADP A;  3CS5 A;  2YXY A;  3JAS A;  4NTY A;  5IJ9 A;  5KHI A;  1AI6 A;  3J81 N;  3ABK C;  3HKE B;  1V54 C;  2MK3 A;  1Z5W A;  5L3F A;  2HEP A;  2ZT9 B;  3THO A;  4U3F H;  1TUB A;  2Z0A A;  4CH5 A;  2AXT Z;  1K92 A;  2O57 A;  3H1K H;  3OTO B;  4EEQ A;  3H1J H;  2W0X A;  3OEE G;  1LNQ A;  2XAS A;  1VMG A;  4Z2W A;  1MG1 A;  4BIZ A;  4FLT A;  4GX5 A;  2IH1 C;  3RFR A;  1OCO B;  4HZ3 A;  5C8Y A;  4IGG A;  2Y0I A;  1HNW O;  1H2S B;  1JFF B;  4PI2 A;  1MZE A;  3I55 V;  5LA6 B;  3G6E V;  4WFG A;  5IJ0 A;  2YEV B;  2BTQ B;  1V55 C;  1US6 A;  4JZ2 A;  4B3M O;  5LOV A;  1EN4 A;  2CAZ C;  4PDR A;  1N0J A;  4DUZ B;  3OFN G;  1ZLZ A;  3SGI A;  2HVK C;  4JAV A;  4IYH A;  3S3W A;  2LP7 A;  3RYF A;  4DR3 O;  3WU2 Z;  2YIA A;  5CN0 A;  3HKB B;  1S72 V;  3AG4 B;  2Y4U A;  1I94 O;  1Q6I A;  1ENV A;  5LP6 C;  1XOU A;  4O4I B;  1Q43 A;  3CCS V;  4OPA A;  2UXD O;  3VQY A;  4DV1 O;  4FLZ A;  1SKV A;  4QPJ A;  5EZY A;  5JH7 B;  3UCS C;  3FB8 C;  1H8H G;  5EBL C;  1F23 A;  2YXL A;  4FIP C;  2OCC B;  4LNU B;  4PHZ A;  1Q5O A;  2JS3 A;  4D6T H;  1R3K C;  3RYH A;  4DV7 O;  1CEZ A;  1BSM A;  4H44 B;  5JJN B;  1UFI A;  1NJI W;  5J2U A;  1ORQ C;  2DWD C;  1VQ5 V;  2ILM A;  4DR5 O;  3CMA V;  1P7G A;  3FB6 C;  2JS5 A;  2AGA A;  3WG7 B;  3ZRW A;  2OCH A;  2Q7E A;  4GLX A;  1Y4M A;  4BW5 A;  5F2V O;  2ZDI C;  2QA4 V;  1VQO V;  4EKW A;  1QLN A;  1YJW V;  4GX2 A;  1HNW B;  5KAF Z;  5LHG A;  2A9H A;  1GN2 A;  3F7V C;  1GN3 A;  2CTP A;  3ABL C;  1J5E O;  1K34 A;  1RM1 C;  2EIL C;  2VRZ A;  1XNQ O;  5FLX N;  1VQP V;  4TQF A;  3R65 A;  4B3M B;  4G28 B;  3STZ C;  1KKD A;  4LC1 A;  3WB1 A;  4B3R B;  4DR4 O;  4BAY A;  3JAL B;  1FXH A;  3OR7 C;  1QVF U;  2R9R B;  1T5E A;  5A9G A;  2Z3Y A;  1YIJ V;  3JD2 A;  3K0D A;  4DRX A;  1NTZ H;  3FAV A;  3T1H O;  3KCX A;  1IXB A;  4QJF B;  3HKD A;  1YJN V;  1I94 B;  4PV1 B;  5KHH A;  2PGG A;  1AP6 A;  1CP9 A;  4IHJ A;  1WNS A;  5KUM A;  1ZL8 B;  5DED A;  5LYJ B;  4WCE V;  4NB5 A;  4JI2 O;  1UPG A;  2OTL V;  2UXD B;  1AR4 A;  3QVN A;  4E2L A;  5LHH A;  1M57 B;  4B3T O;  5DEC A;  3H1H H;  3FYE B;  3E8G A;  4DV7 B;  3BFR A;  3SDL A;  3H01 A;  1K73 W;  4AQY O;  4G2K A;  1Z5V A;  5CA1 A;  5L3E A;  4O4H A;  1K4D C;  2Q0A A;  3HKC B;  2IU0 A;  3RVZ A;  1S76 D;  1X59 A;  1ZTE A;  3K04 A;  1YZB A;  1XDC A;  4WF9 V;  1F7Y A;  2DN9 A;  3BAB A;  4EFE A;  3FB5 C;  3K57 A;  1ZWI C;  3N2G A;  2EIK B;  3P3P A;  1FFT B;  4PA4 A;  1BZK A;  2DYR B;  1RSO B;  5H9C A;  2PI5 A;  1J5E B;  1OCO C;  4TV8 A;  1WP7 A;  1XNQ B;  4IL6 Z;  3CRQ A;  1IXM A;  3CB2 A;  1TVK A;  1AR5 A;  3ASO B;  3CWB H;  3RYI B;  2AHZ A;  4CC5 A;  4K0K O;  3K5N A;  4X20 B;  4FM2 A;  4DR4 B;  1P84 F;  3B2E E;  4X62 O;  1Y76 B;  2ZXW B;  4F6R A;  5JCO C;  1FXK A;  2B1G A;  2CGO A;  4R7C A;  3T1H B;  5TIS Z;  4CS3 A;  1FXV A;  2QTS A;  2UXN A;  2P67 A;  3ZMS A;  2JGU A;  4WBN A;  5KHK A;  1K5Q A;  1BQ0 A;  3A2F A;  4JI2 B;  3AG4 C;  2B9Z A;  3EVK A;  1AIL A;  4H0L B;  2LFR A;  4MVS A;  4JTD B;  4PA7 A;  4UCT A;  5H2F Z;  3CCJ V;  4LF6 O;  3AG2 B;  2WA3 A;  4LH6 A;  4W4L A;  4PDV A;  4B3T B;  3JAT A;  5B1A B;  2VQF O;  4LWS B;  1D5N A;  3GVM A;  3ZHS A;  3OM3 B;  5FPR A;  3AK3 A;  2FB5 A;  3QNE A;  2BE3 A;  3JAW A;  4MW3 A;  4N23 A;  4MVO A;  4LF5 O;  3MDS A;  3K5O A;  2DE0 X;  3GB7 C;  1IDS A;  4JI4 O;  4JYY A;  3LDD A;  5CA0 B;  3WG7 C;  4CS2 A;  4FLY A;  3CE2 A;  1M90 W;  3E22 A;  1ARO P;  2ZKO A;  4QE9 A;  1QLE C;  4TT3 G;  5L3D A;  5L3B A;  3TGU H;  2KKW A;  2KG7 A;  5LXT A;  4JI5 O;  1R6T A;  1YXB A;  3W7S A;  1S0V A;  2C2A A;  4O4L A;  4K0K B;  1JJ2 U;  1B04 A;  3OT7 A;  4X8A A;  3CPW U;  1Y6X A;  2DOS A;  1KP2 A;  4CBC A;  3UQ8 A;  4I55 B;  1VQK V;  4FLX A;  4X62 B;  4RAI A;  2GTS A;  5B3S B;  1MOF A;  4O2B A;  2PZS A;  1SRY A;  3UKM A;  1SA0 A;  1I0H A;  4FFK A;  2PYL A;  3CSX A;  2UXC O;  4X1Y B;  1WB8 A;  4I0X A;  1EFR G;  2WLK A;  4Z1M G;  2JGD A;  3CC7 V;  1XI1 A;  4PI0 A;  5LMU B;  1YTF D;  4RO2 A;  4X1K A;  5LMN O;  3CRC A;  5DM6 V;  3A8T A;  4LF6 B;  3ZMZ A;  1PL4 A;  4PA6 A;  2NLJ C;  4TUY B;  4AIL C;  1Q6H A;  2DW4 A;  2VQF B;  4PD4 F;  3G80 A;  5HFM A;  4PA9 A;  3M8A A;  3HB3 B;  1FFX B;  2LQT A;  1K9M W;  1M57 C;  5EYP A;  1RP3 B;  2JRI A;  3BEH A;  4DXW A;  1AI5 A;  3SJB C;  4FFB B;  4GUN A;  4LF5 B;  3JAS B;  5IJ9 B;  1VF5 B;  2VWK A;  1JR9 A;  2AZ2 A;  4XBF A;  3CCR V;  2HHH O;  2UXX A;  3CHX A;  3N2K B;  3UO3 A;  3ZCC A;  3CRA A;  5KX5 A;  1SER A;  1H2N A;  2YXH A;  2WLL A;  1VQN V;  3OGI B;  1RFY A;  1NBM G;  5AG2 A;  5H5N A;  5BR8 O;  3CCL V;  5IYC O;  4IIJ B;  3ABM B;  2UU9 O;  4E4E A;  4JAS A;  2ETN A;  4MTG A;  4HYO A;  1N32 O;  1PD3 A;  4FVM A;  1VP7 A;  3AK1 A;  4JI5 B;  1IBK O;  2FL4 A;  5LGU A;  2G38 A;  3CJH A;  3E8B A;  1THZ A;  2EIK C;  3GWO A;  4ZKI A;  1EZJ A;  4X88 A;  2DYR C;  1SQQ H;  2A0L A;  3CC4 V;  2WLM A;  4UCV A;  1IBM O;  3T2M A;  5IDJ A;  4MT8 A;  5C8Y B;  4RQF A;  2R70 A;  1XUQ A;  2DQ0 A;  3L75 H;  3ASO C;  1N0N A;  3SPI A;  4ZOL A;  5E1A C;  1N4C A;  4X9Q A;  5JWP A;  4LF8 B;  4DV3 O;  1KQS U;  2JJ1 G;  5B1B B;  5J2T B;  3X2Q B;  4NYK A;  4UFZ A;  2UUB B;  1XMQ O;  2UXC B;  4ZI7 A;  4J80 A;  1LUV A;  2ZXW C;  5LOV B;  1NR7 A;  2Y48 A;  2ZE8 A;  3ZIA G;  1JJO A;  1XNR O;  3MD0 A;  2W0F C;  3SYA A;  1SET A;  3AG7 A;  5LMN B;  3F7Y C;  4R6Z A;  2ZM6 B;  1PKX A;  3ZRV A;  2PY5 A;  3RYF B;  2LJ2 A;  3ZBH A;  3K5L A;  4DW1 A;  3T1Y O;  4NTW A;  2F93 B;  2QJ1 A;  1XL6 A;  4EB6 A;  5EBM C;  4X64 O;  2E3C A;  2PF4 E;  3AG2 C;  5IT9 N;  2OWO A;  4GKK O;  3CD6 V;  3K9A A;  1QQC A;  5B1A C;  3TXS A; 
#chains in the Genus database with same CATH homology
 4MTF A;  1G4Y B;  3E2E A;  2DYS B;  1GMG A;  1OCZ C;  3FKS G;  4H33 A;  5GW7 A;  1NH2 D;  3SPH A;  1Y4M A;  2XAJ A;  4LP8 A;  4BW5 A;  5J9P C;  2XND G;  4JPR A;  3ZJZ A;  4JTA B;  3SPG A;  3LDC A;  5L3C A;  1Q7Y W;  2ZDI C;  5EC1 C;  2QA4 V;  1H8E G;  1VQO V;  4OXS A;  4EKW A;  1QLN A;  1PNM A;  1R3I C;  1YJW V;  1M1K W;  2QEX V;  4GX2 A;  2Z5U A;  1RPO A;  5LHG A;  3OMI B;  3LNM B;  1VQ6 V;  2A9H A;  1OZ0 A;  1E1Q G;  3F7V C;  2EIM B;  3DGE A;  3ABL C;  3OEH G;  1K34 A;  1Q82 W;  1RM1 C;  2AHY A;  2EIL C;  2WLN A;  4DO2 A;  2JEU A;  3T1C A;  5EC2 C;  3E8F A;  1VQP V;  1AJP A;  2HJF C;  3SYQ A;  3R65 A;  4MVM A;  1S3J A;  3ZRW A;  2ATK C;  2ZR2 A;  5H6R A;  1OCR B;  4GX1 A;  2WPD G;  1L1F A;  4G28 B;  4MTO A;  3TK1 A;  3STZ C;  1KKD A;  4U7N A;  4MVU A;  1ROP A;  4XDL A;  3M99 B;  4LC1 A;  1AR1 B;  4BAY A;  3EFF K;  2ZDI A;  4MTX A;  4RUF A;  4G27 B;  4FMT A;  4QE7 A;  3E35 A;  1FXH A;  3OR7 C;  4RUE A;  1QVF U;  3CCV V;  2R9R B;  1YJ9 V;  2Z3Y A;  1G8M A;  1YIJ V;  3AG3 C;  2W6I G;  3W7U A;  3JD2 A;  3K0D A;  1PL0 A;  4QJF B;  5B3S C;  5KA5 A;  2H94 A;  2IH3 C;  1YJN V;  3ZRS A;  2X6C A;  1K97 A;  1H2G A;  1DLB A;  1CP9 A;  3ABK B;  3MHS C;  1V54 B;  1NVP D;  2WLL B;  5KUM A;  4WCE V;  2OCC C;  3K03 A;  1BMF G;  3HPL C;  3PJS K;  2OTL V;  3RW0 A;  1QVG U;  3QO8 A;  3ZN1 A;  4E2L A;  4J9Y B;  5LHH A;  1B6Q A;  4X89 A;  1M57 B;  4QIW F;  5C93 A;  2OT5 A;  2HKO A;  2Q6A A;  3FYE B;  1YTF B;  1YIT V;  3E8G A;  2FTK A;  1I5X A;  1NKD A;  2LFS A;  3H01 A;  2OTJ V;  5CMU A;  2IJH A;  3AG1 B;  5EBW C;  4KP4 A;  1K73 W;  1DF4 A;  1F4N A;  4G2K A;  2XAG A;  4FK5 C;  5LGT A;  3OR6 C;  1JPX A;  5LHI A;  5L3E A;  1P7B A;  1QR8 A;  4UVA A;  4F4L A;  5B1N A;  3TCU A;  4QNH B;  1M9N A;  1K4D C;  1KP3 A;  3E89 A;  1K5S A;  2EIJ B;  2IU0 A;  3K3W A;  5H6Q A;  3RVZ A;  3OE7 G;  1S76 D;  1AI4 A;  5FL7 G;  1VQ8 V;  3D3I A;  3OMN B;  2IJI A;  3JD1 A;  2Y69 B;  3K04 A;  1KEC A;  3K79 A;  4FJC C;  4WF9 V;  3FYI B;  3CYO A;  3FB5 C;  2GSM B;  1JCH A;  3CCU V;  1ZWI C;  2EIK B;  1V55 B;  1FFT B;  2BOB C;  4PA4 A;  4GX0 A;  2DYR B;  3JYC A;  4WFE A;  3JD0 A;  5H9C A;  4I9W A;  3OUF A;  2PI5 A;  4MS2 A;  1VQL V;  1OCO C;  3JD4 A;  2WLI B;  2EJR A;  3LSQ A;  2IU3 A;  1IXM A;  1AI7 A;  2P6J A;  2R9I A;  1BL8 A;  2X0L A;  5CA3 A;  4GCZ A;  4LCU C;  2ITD C;  3ABM C;  3ASO B;  2AHZ A;  2JEX A;  1QLE B;  2V1D A;  3ZRX A;  2WLJ A;  2EBO A;  2EIN C;  4J9Z B;  2DWE C;  2QKS A;  5IY5 C;  5EK0 A;  4WFH A;  1WPX A;  4ZBM A;  3ABU A;  2ZXW B;  1FXK A;  3VOU A;  3ZRW B;  1NVP B;  2B1G A;  5CBF A;  4XDJ A;  2ZQM A;  2Q68 A;  4P9O A;  4UXN A;  3EHB B;  4R7C A;  2H8P C;  2IW5 A;  1FXV A;  2NNU A;  1K7D A;  2UXN A;  3SYP A;  1RPR A;  2P67 A;  3MHH C;  1QBZ A;  3ZMS A;  1XL4 A;  1DTO A;  3K06 A;  3CME V;  3FB7 C;  1VQ7 V;  2X6B A;  4H37 A;  2Q67 A;  1K5Q A;  1JX9 A;  2HR3 A;  5B1B C;  1MAB G;  1M56 B;  3X2Q C;  3AG4 C;  3SJQ C;  1K4C C;  4PEL A;  2QTO A;  1YHQ V;  1GO3 F;  4PDM A;  2LFR A;  2X6A A;  4MVS A;  4JTD B;  4PA7 A;  2V7Q G;  1FXK B;  1AJN A;  3CCJ V;  1VQ9 V;  1SES A;  3ASN B;  3AG2 B;  1JVM A;  1S5H C;  4UUJ C;  4PDV A;  3CCQ V;  3T4Z A;  1R73 A;  5B1A B;  3OM3 B;  4U7O A;  2JK5 C;  1OCZ B;  1GTO A;  3P32 A;  2B5U A;  3K0G A;  3QNE A;  2XOK G;  3I56 V;  1JOY A;  4TWK A;  3OGC C;  5KUK A;  3P30 A;  4KFM A;  3JCZ A;  4MW3 A;  4N23 A;  2X7R B;  4MVO A;  1QR9 A;  2IJK A;  2D3O W;  2QE7 G;  3WFV A;  4HAM A;  1H38 A;  3OAA G;  3GB7 C;  1W0J G;  4CZZ A;  3VBB A;  1GM8 A;  3LSS A;  1KD1 W;  1OCC C;  1OHH G;  1PNK A;  1Q86 W;  4I5S A;  3LDD A;  3DTU B;  5DN6 G;  3CP1 A;  2HLD G;  3WG7 C;  1S77 D;  2ZD9 A;  2DYS C;  4P30 A;  1NH2 B;  3W7W A;  1GM7 A;  3E83 A;  4BIU A;  1Q81 W;  3ABL B;  4N21 A;  1RM1 B;  1CPY A;  2EIL B;  4JGS A;  3RBZ A;  4KUM A;  1M90 W;  4TSF G;  1ARO P;  5L3G A;  1COW G;  4QE9 A;  1QLE C;  3NXS A;  4TT3 G;  5L3D A;  5L3B A;  4UV9 A;  1BHA A;  3UM7 A;  3T4D A;  2F43 G;  4JTC B;  1TUE B;  3ETE A;  3ZMT A;  3W7S A;  1J95 A;  2EIM C;  1S0V A;  2C2A A;  3QO7 A;  1SZT A;  4WFB V;  3ETD A;  2ITC C;  1JJ2 U;  2XAF A;  4X8A A;  3AG3 B;  4P2Z A;  4UVC A;  3CPW U;  4QPK A;  3LUT B;  1KP2 A;  4CBC A;  1VQK V;  4WFA V;  4RAI A;  3E8H A;  4MW8 A;  1OCR C;  5B3S B;  1MOF A;  1P4R A;  1R6K A;  3SYC A;  3ZMV A;  1GKF A;  1NR1 A;  1DF5 A;  1SRY A;  3UKM A;  3CCE V;  3K08 A;  3SPC A;  4GT1 A;  1JQ0 A;  2P7T C;  4MSW C;  3OW2 U;  3SYO A;  1NQT A;  3BY6 A;  1EBO A;  4PDL A;  4Q20 A;  3QO5 A;  2EZO A;  1EFR G;  2WLK A;  2IJJ A;  2JJ2 G;  3CCM V;  4Z1M G;  1E79 G;  4XDK A;  3B8M A;  3CC7 V;  3F5W C;  5BZB A;  1KC8 W;  1YTF D;  2A79 B;  4RO2 A;  1AI6 A;  5DM6 V;  2DQ3 A;  3LDE A;  1K33 A;  3ABK C;  1YI2 V;  1V54 C;  3ZMZ A;  2MK3 A;  4PA6 A;  5L3F A;  2NLJ C;  3STL C;  3KG2 A;  3ML0 A;  2DW4 A;  2HVJ C;  4UVB A;  2JIZ G;  2KB1 A;  1GM9 A;  2XAH A;  5LBQ A;  5HFM A;  4PA9 A;  1BHB A;  1K92 A;  2Q69 A;  1F4M A;  3HB3 B;  3ETG A;  1VQM V;  3IGA C;  3SPJ A;  1M57 C;  3G71 V;  2HG5 C;  1K9M W;  3ABT A;  3BEH A;  4DXW A;  1AI5 A;  1FS0 G;  4MVR A;  2WAM A;  1I5Y A;  4LBE C;  3OEE G;  1R3L C;  3AG1 C;  4MVQ A;  1LNQ A;  2YEV A;  5CBH A;  2XAS A;  1MG1 A;  4XBF A;  3CCR V;  1GK9 A;  2UXX A;  3IFX A;  4L87 A;  4JF3 A;  4BIZ A;  1W2B U;  2M7W A;  2QM7 A;  3ZCC A;  3W7X A;  2ZR3 A;  4GX5 A;  2XAQ A;  5B1O A;  1MSW D;  1SER A;  5LGN A;  3B77 A;  2IH1 C;  2WLL A;  1VQN V;  1OCO B;  2GHY A;  1AJQ A;  2EIJ C;  4HZ3 A;  5KA6 A;  1NBM G;  3G4S V;  2WSS G;  2PI4 A;  1QCE A;  2W6J G;  2WWW A;  3CCL V;  5IYC O;  1WLE A;  2Y69 C;  2B1I A;  3ABM B;  3I55 V;  4JAS A;  2YSU B;  4MTG A;  3IC7 A;  4HYO A;  1PD3 A;  2EIN B;  3JD3 A;  3G6E V;  2CK3 G;  4WFG A;  5CBG A;  5IY5 B;  4RQE A;  2YEV B;  5LGU A;  3CXC U;  1HWY A;  3E8B A;  1THZ A;  2EIK C;  1V55 C;  3GWO A;  1EZJ A;  4ZKI A;  3TET A;  4X88 A;  2DYR C;  1F51 A;  1VQ4 V;  2A0L A;  3RVY A;  3B8N A;  3CC4 V;  2WLM A;  1R3J C;  4PDR A;  1E1R G;  4R50 A;  3T2M A;  5IDJ A;  1Y66 A;  3OFN G;  2WLH A;  4MT8 A;  4YXW G;  2BOC C;  4RQF A;  4WFF A;  3AEI A;  2DQ0 A;  2HVK C;  4JAV A;  3ASO C;  3E86 A;  3A0R A;  4MVZ A;  2EZP A;  2P90 A;  3SPI A;  4P9P A;  5E1A C;  1UJW B;  5IYB O;  1N8R W;  2LP7 A;  5CN0 A;  1KQS U;  2JJ1 G;  4JYB A;  4UV8 A;  5B1B B;  4JAU A;  3CC2 V;  3X2Q B;  1S72 V;  3AG4 B;  2ZXW C;  1R6N A;  1NR7 A;  1K3E A;  5HFL A;  1ENV A;  2Y48 A;  1W0K G;  3ZIA G;  4R8C A;  3CCS V;  3MD0 A;  1PNL A;  2HFE C;  2W0F C;  3SYA A;  1SET A;  2K1E A;  4JYC A;  4QPJ A;  3F7Y C;  4R6Z A;  5IYD O;  2WLI A;  4PA3 A;  1PKX A;  3FB8 C;  3ZRV A;  1H8H G;  2QM8 A;  5EBL C;  1F23 A;  3ZMU A;  4FIP C;  1M56 C;  2OCC B;  3OUS A;  1XL6 A;  1R3K C;  1CEZ A;  5EBM C;  1NJI W;  1FXK C;  2JDI G;  1ORQ C;  2DWD C;  4FPP A;  3ASN C;  4ASU G;  3AG2 C;  1VQ5 V;  1YSC A;  3OMA B;  3CMA V;  3W7T A;  3FB6 C;  3CD6 V;  1OCC B;  3K9A A;  5B1A C;  1K8A W;  3D36 A;  3ZN0 A;  3WG7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...