1JQ0A

Mutation that destabilize the gp41 core: determinants for stabilizing the siv/cpmac envelope glycoprotein complex. mutant structure.
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
78
structure length
71
Chain Sequence
LAGIVQQQQQLLDLVTRQQELLRLTVWGIKNLQTGGWQEWKRKVDFLEENITALLEEAQIQQEKNMYELQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords gp41 envelope protein
publication title Mutations that destabilize the gp41 core are determinants for stabilizing the simian immunodeficiency virus-CPmac envelope glycoprotein complex.
pubmed doi rcsb
source organism Simian immunodeficiency virus
total genus 33
structure length 71
sequence length 78
ec nomenclature
pdb deposition date 2001-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jq0A00
2EBOA 3CP1A 1SZTA 1DF4A 1QCEA 3B8NA 2X7RB 1Y66A 3GWOA 1K34A 5KA6A 1MOFA 1JQ0A 3MHSC 1DLBA 5CMUA 4JF3A 3B8MA 1JPXA 4FJCC 5KA5A 2EZOA 4N23A 1EBOA 3P30A 4G2KA 1DF5A 1ENVA 3H01A 5H9CA 2MK3A 4N21A 4FK5C 3WFVA 1I5XA 5CN0A 1I5YA 3CYOA 2OT5A 1MG1A 1K33A 2M7WA 4JPRA 1F23A 2EZPA 4E2LA 1QR8A 1QBZA 4JGSA 2LP7A 5HFLA 3B77A 5HFMA 1Y4MA 4FIPC 3MHHC 2P6JA 3K9AA 1QR9A 3M99B
chains in the Genus database with same CATH superfamily
3OM3B 1M93A 1SA0B 2PF4E 4EFBA 4LFAB 5CB4B 2DJVA 5J2TA 1NI8A 5B1BB 1YXBA 1O9HA 2CH7B 2E5LB 3HKCB 1BQ0A 3H1LH 4O4JB 4LNUA 4RQFA 1ZTEA 1L0LH 3SDLA 3ZRWA 4OX9O 4DR5B 3WB0A 4JAAA 4K8XA 2WPDG 5LBQA 1H2LA 1S0VA 4TWKA 3CCQV 3W7UA 1R6TA 3SGIA 2RJZA 5IWAB 2MW2B 4O2AB 3HB3B 4FFBA 1F23A 1BL8A 3AG2B 1ZX3A 4BIUA 3G6EV 1Q86W 2HG5C 4CBCA 2OCHA 2JGDA 4LF7B 4Z1VA 3G6BA 3GWOA 3SYPA 1X59A 1JQ0A 2HP8A 4JF3A 1ZLZA 5LOVA 1S72V 1TVKB 1VQ4V 5KHGA 2QE7G 5LXTA 3CRQA 3ETDA 4B3TO 3M7MX 4JGSA 1XL4A 3UKMA 3KCYA 3ABLB 1N32O 3EFFK 4ZI7B 4X64B 5IY5C 1BHAA 5JJEB 3ABTA 4FMTA 4GKKB 2EILB 2E3CA 4MW8A 1S5HC 1IVSA 2V1DA 1R1BA 3BABA 1IBLB 1M57C 4LF6B 1I5YA 4JYYA 2WLJA 3CYOA 2CE4A 5CBHA 1KP3A 3CCSV 4O4LA 3LNMB 3QO7A 3QF7A 2O57A 2QTSA 4ZIBA 1XMOO 2DYRC 2F4VB 4DV0O 5LL6Y 4J7JA 1VQ8V 4FLZA 4EFEA 3BY6A 4JPRA 5LA6B 2YUAA 4DV1O 2Y0IA 3EHBB 4OPHA 1PL4A 3CCMV 5H6QA 2D2CB 3DC5A 2AHZA 3TK1A 3C3SA 2WLLA 4JAUA 4MTGA 1YCIA 4DK0A 4NVPA 3IAYA 1V54C 4UCRA 2IH3C 4JI0O 4JZGA 3ZRWB 1MNGA 2GSMB 3CD6V 3DSQA 5HFLA 3JAWB 2FTKA 5EBWC 2BTQA 2ZXWC 3FB8C 4G27B 4JYCA 2JS5A 3RT3C 2EJ7A 3BFRA 1EN6A 4FFBB 1R6KA 4EKWA 3CXHF 1KKDA 1MMMA 3VQWA 2E5LO 2YXYA 5DM6V 1KD1W 5KHJA 2FKXA 3WB2A 1FYJA 1VQ7V 4UCOA 4TV8B 5LOVB 4HNAA 3LNNA 1KKCA 2PUSA 2QKSA 5LXTB 1M57B 5LHIA 1WB7A 2HLDG 3T2MA 1SKVA 1T5EA 5IWAO 4K35A 3J81N 3OAAG 3OUSA 2R70A 3APQA 3DGEA 1E79G 4TUYA 4OXSA 2DYRB 1Y76A 5B3SB 4Z1MG 2IJKA 2Q9LA 4QPJA 5B66Z 5KA6A 4IHJA 3JATB 4LF7O 3AG1C 4RAIA 4DR7B 4FM2A 3E35A 3RVYA 5H6RA 1AR5A 1KYOF 4A5UB 1H2GA 4HYOA 4E2LA 2Q5ZA 3LDEA 3LDCA 5D5PA 2PZSA 1W59A 4B3MO 4PDVA 4GKKO 2IJHA 2ZM6B 4PI2A 4G2KA 1COWG 4NYKA 3JD4A 1IBLO 2HJFC 1ZUQA 1I5XA 4H37A 2KB1A 2AGAA 3RFRA 1VF5B 3AG4B 5FPRA 1BHBA 2ZXWB 2UXXA 2RQ6A 2XOKG 4JASA 1GMGA 2WLLB 2F4VO 1SF9A 3FB7C 3SYQA 4JI8B 3OEHG 2CTQA 2V4DA 1QNMA 3QTCA 4DXWA 4JI1B 2BTQB 2GBOA 1B3QA 2UXDB 4LFCB 3UT5A 1X4TA 2W6JG 1R3KC 4MVQA 3JAKB 1RP3B 2E75B 3K58A 3ZHVA 3H1HH 2ZDIA 2GTAA 3CMAV 3CS5A 1GKFA 5DECA 2P22C 3ZHQA 3RN4A 4RO2A 3VQYA 3L71H 1VQ6V 3RYHB 1VP7A 1SQPH 1WB8A 2QM7A 3AG1B 2ZDIC 2ZNIA 1NKDA 3CB2A 1P4RA 4R7CA 3CX5F 1XBLA 1IXMA 1AI7A 1TGOA 1WN7A 1XI1A 5BY1A 4U3JB 1SC5B 1KUQA 1OHHG 5IYZB 3RYIB 1PL0A 3E8BA 2KSDA 3HKEA 3C3TA 1XMQB 1TUBB 3K06A 4TSFG 1CP9A 3OTOO 1OCOC 3OTFA 1RSOA 4G28B 5JVDA 4JAVA 2JVDA 1AR1B 5F2VO 4YHHB 1AJQA 2N05A 3KKYA 2BSKB 5EIBC 2RNBA 1J5EB 3QVNA 1NBMG 3QO5A 4IT5A 1UPGA 1TAEA 1Q6HA 2L35A 2HEPA 4LR3A 4XBFA 5L3GA 5LGTA 3STZC 2VQEB 3VQXA 4EB6B 1NVPB 1WAZA 4DR7O 1A32A 3Q4HA 2Q0AA 3WFVA 1VF6C 3T1HB 1NU1H 1P7GA 2UUCB 1NJIW 4U3FH 4TT3G 2ODMA 3K9AA 5KMGB 4PV1B 2LFRA 5JWPA 3ZHSA 1H2NA 2A7WA 2WLKA 2HVKC 3SPIA 4ASUG 2ZR2A 2GTSA 1ROPA 1YVWA 4NTYA 2ZM6O 3FX7A 2YEVA 4DUZB 2ZCEA 1HWYA 2QA4V 2YIAA 2AHYA 1DGSA 2RN9A 4GX2A 2P06A 2WAMA 1SRYA 5KAIZ 4JTDB 5H5NA 1P7BA 5KHIA 3W7TA 2BTOA 4BIOA 4JI8O 2H8PC 4UV9A 4DV7B 1JJ2U 2ITDC 2QTOA 4IYHA 4JI1O 2LP7A 3AK1A 4NXMB 2UXDO 3FYIB 1FFXB 1DF4A 1OCOB 4LC1A 2WLMA 4JI4B 3B8NA 1FD9A 4KP4A 3CCRV 2BOBC 2YS8A 2CK3G 1DK1A 2GDSA 3CCEV 4X1KB 4KFMA 1G8MA 1LUWA 1YJWV 3D8CA 3OW2U 3PJSK 1Q43A 4DO2A 4WBNB 1ZL8A 4J7ZA 1Q82W 4UFZA 1LUVA 5JVDB 4C7UA 1JA8A 4DK1A 1SS3A 3T1CA 2BCCH 2W6IG 3CE2A 4W4KA 1FXKA 1V55C 1F4NA 3E8HA 3I5DA 2QGNA 3DXRB 5IT9N 4DUYB 5JCOC 1SZXA 1Q8IA 3EVKA 3ZIAG 1F7YA 5KHHA 2DW4A 3ZHRA 1XMQO 2QJ1A 2Y0PA 4WFBV 3CJHA 3UM7A 3FD9A 4UVBA 2ZR3A 4JI2B 1NZ6A 3ASOC 5EYPA 1ENVA 2Q7EA 1TA8A 3D3QA 4X8AA 4U7NA 4YHHO 4TV9B 1BCCH 1Y4MA 3UO2A 5L3EA 2LW1A 1J5EO 4CH6A 1AP5A 4H0LB 1HW7A 1K92A 4LF8O 1XL6A 2VQEO 3BAAA 4GX5A 3E22A 4KXRA 2ZINA 4B3RO 4HZ3A 1UFIA 2VS0A 5BXZA 4DR3B 2B5UA 4B08A 1AI4A 5IYCO 2W0FC 1MG1A 1K33A 2ARHA 3ABKC 2QWRB 2WA3A 3T1HO 5L3CA 4MVUA 2UUCO 1Y67A 2ITCC 3ABMC 4YIOA 4MTXA 4ZOLA 1KU9A 2ZT9B 4F4LA 2CTWA 4YY3B 2QM8A 4FZ0A 4DYLA 3N2KA 1S76D 2DYSC 1H8HG 3W7WA 5GTIZ 1KB9F 3L9DA 1RM1C 5LHHA 3OGCC 2WLIB 2F23A 2XUMA 1D5AA 1JMKC 5KAFZ 1IBKO 1V55B 2EIKC 3FB5C 4MT8A 5D5QA 1K5QA 2FMLA 1ZWIC 3B4SA 3U11A 1P49A 2ILMA 4NXMO 2XAJA 2WA4A 3RGBA 1QU7A 2EBOA 2BE3A 4PA3A 4CH4A 2EINB 3F5TA 3K59A 2C2AA 4JI6B 4JI4O 3ASOB 1HR0B 1R3IC 3JSNA 2HFEC 2YSUB 2WSSG 4LH7A 4O2BA 3RBZA 3AG7A 5EIBD 2ETNA 1QR8A 3ETGA 4I55A 1PD3A 4DW1A 5ITZA 2ZE7A 3CJHB 5JQGA 5A2QN 2X7RB 5JH7B 3CPWU 3IJ4A 4FVMA 4JI7B 3ETEA 1IURA 4B3SO 4JYBA 2QM4A 1XEQA 4X62B 3ZMUA 5C93A 3ABKB 5FL7G 5J2UB 1NT2B 2VQFO 4DUYO 5FNVA 3ABMB 3E86A 4H44B 3A0BZ 3RYCA 2P5OA 1VQMV 2CAZC 3P32A 2JS3A 1B06A 3JD1A 1E1RG 4NB5A 4WF9V 5EBLC 4PA4A 4JI2O 2A0LA 1BZKA 2DYSB 1PNMA 4R6ZA 2LJ2A 4I4TB 4TQFA 1RM1B 1YEWA 1HNWB 1Z2GA 4WCEV 5J2TB 5CBGA 4W4LA 4I7ZB 2P90A 2UUAB 1Y6XA 2EIKB 4AILC 3BA8A 5EC2C 3L74H 1F51A 4LNUB 5LGNA 4MVZA 1US6A 5E79Z 2QEXV 4PHZA 4J42A 1O9GA 2UU9B 1I0HA 2QDOA 1JCHA 3BEHA 4DR3O 3ZJZA 2X6BA 3AK3A 3SPHA 1MZEA 4J7KA 2GUZA 4J9ZB 1D5NA 4UVCA 1R3LC 2RCVA 4LFAO 3O65A 1H38A 1VQPV 4YY3O 2A9HA 4MVMA 3THOA 1VQOV 1SESA 3W7SA 5KUKA 2JGDB 1AVMA 3FKSG 3UO3A 5LYJA 4FM0A 4LF9B 1YTFD 2XAFA 5IY5B 3QG5A 3JASA 4DR5O 4O4HA 4X66B 1YJNV 2HHHB 4I0XA 4DV6B 1SETA 5LMUB 3P3PA 4DR4B 1QLEC 2NR5A 3HKBA 4RUFA 3OE7G 1PKXA 4X1IA 3NR7A 4GT1A 3BVOA 1SZTA 3K79A 2GV9A 4J80A 1GM7A 1W0JG 1OCZC 3UQ8A 3GVMA 2Q68A 3WU2Z 4JI6O 4IIJA 5KA5A 4HBNA 4O4LB 3ZRSA 2M7WA 5HFMA 5KX5A 2B1GA 1Z5WA 4BAYA 4WFAV 1XHXA 1SERA 2JDIG 3JALA 3M99B 3K5NA 3W7XA 4X64O 3AK2A 3KG2A 4MS2A 3B8MA 1SQXH 3FAVA 4WFHA 4H33A 4JI7O 1FJGB 2ADQB 1V54B 4X62O 2IU3A 2AZ0A 3A8TA 4UCVA 1YIJV 4LF6O 3ASNC 1N0JA 1IBMB 1AR4A 4O4IA 3RWRD 1XREA 1FFTB 4PELA 3F5WC 1GM8A 5C8YA 1QCEA 3E8FA 3H9VA 4WFEA 3ZCCA 2DE0X 2IJIA 1RPRA 1H2SB 1EBOA 3H01A 2PY5A 1LR1A 2KKWA 1N33B 3T4ZA 2FL4A 2EULA 1YF2A 3MAQA 4BIZA 3SYOA 3U10A 2YIBA 1HNZB 1HNWO 1XDCA 4DRXA 1AROP 1OZ0A 2Q4PA 2CGOA 3LSQA 3SJBC 2UUAO 1M9NA 2RMKB 5CA0A 1KMIZ 1QLEB 4PI0A 3CC4V 5LYJB 3CCLV 1MABG 4YJ2A 2UU9O 3ICXA 4HNAB 2YXLA 5CBFA 4I5SA 1XHZA 1OCZB 2XAHA 2Q7HA 1R6NA 5EZYA 4X65B 1MA1A 5K1XA 1R3JC 3CCUV 3HKBB 3ZBHA 2ZE5A 5JJJB 4D7TA 1NR1A 2Q6AA 5IYBO 1I7FA 4TUYB 1BE3H 5TISZ 1Y76B 3SYCA 3X2QC 4X1YA 5JJNB 4IHJB 3UCSC 4LF9O 4MVSA 3SPJA 5BMVA 3K5OA 3MDSA 1WNSA 2HHHO 3CHXA 5GTHZ 3DTUB 4MTFA 2Y4TA 5LMUO 4NKGB 3OR6C 3ASNB 3GB7C 4IYIA 3SPCA 1VARA 3B40A 3VOUA 5K1PA 2OIEA 4NTWA 2JIZG 3FAVB 4JV5B 4YIPA 2AXTZ 4LP8A 2QSAA 3TETA 1FAFA 1YSCA 4FLUA 4NTXA 3ZHUA 1Z5VA 1URFA 3ZMZA 4O4IB 4FK5C 4MSWC 3MD0A 4GCZA 2IM9A 1QVGU 2KQXA 4LH6A 1NR7A 2FB5A 4CS3A 3OMIB 4DV2B 2ZKOA 5GONA 3U0ZA 1N4CA 2LGWA 5IJ0A 1VF7A 1WPBA 4CC6A 1W2BU 4QIWF 1PV0A 1VQNV 3MHSC 2HJDA 4BR6A 1HP8A 3CRCA 4QNHB 4ZKIA 1XUQA 3STLC 1KBHA 3N2GA 3UT5B 1FJGO 2QR4A 2B1IA 3ZN1A 4JI3B 4PD4F 1EZVH 1IBMO 3CWBH 3K3WA 5CA1A 1QR9A 5BR8B 1GN3A 5IYDO 3OUFA 1JFFA 1Y74A 4IL6Z 1N34B 2QKAA 4KHPB 2DQ3A 4MVRA 1F4MA 3OMAB 3R65A 3X2QB 4J10A 2OTJV 4I50A 1WA8A 1QBZA 1N33O 4ZBMA 1MSDA 4FIPC 5B1AC 2JEUA 4LFCO 5EBMC 1HNZO 3H1KH 1BS3A 1K34A 1RPOA 3CRRA 1VQLV 1SA0A 3S3XA 3M8AA 4IGGA 4BW5A 4N23A 2YXHA 2IJJA 4BWAA 3JCUZ 5CB4A 1AP6A 3EXAA 3K03A 1GH6A 3HKEB 2CH7A 4GX0A 4GYCB 3HKCA 3JSLA 4UB8Z 3JARA 4O4JA 5LGUA 3JD0A 2YICA 1RSOB 4X65O 5KUMA 3D3IA 4OPAA 2WLNA 3JCZA 1I94B 1D2DA 1FS0G 4DR6B 4TOIA 3T1YB 2A3QA 2HVJC 2JEXA 1GO3F 1N32B 2OTLV 2IW5A 3CC7V 4JI5B 1HNXB 4CS2A 2FYUH 3Q4HB 3K0DA 3WB1A 2JJ1G 1FXKC 3OD4A 5H9CA 4FLXA 2QWNB 3KCXA 3HKDA 3ZEDA 3LSSA 1TVKA 4YJ3A 3TCUA 4KUMA 1XMOB 3TJTA 4LBEC 3E8GA 4X20A 4PJ0Z 4QGPA 2PYJA 2JGUA 3DC6A 4QPKA 4JV5O 1PPJH 2YEVB 4DR2B 1K97A 3SJAC 2QWOB 1VQKV 1LNQA 1CPYA 3H1IH 1S5JA 4JYAB 4DV2O 3ABLC 1PNKA 1OCRC 1EFRG 3AEIA 5GW7A 2R9IA 1PNLA 1WA8B 3L75H 3APOA 4ABMA 3SJCC 3CXCU 3G4SV 1KP2A 5B5EZ 5EK0A 4P30A 2G38A 5LMNB 2YIBD 2EZPA 4DUZO 4WFFA 4JI3O 1G1XB 1YTFB 5LA6A 1ORQC 4P9OA 1QLNA 5BR8O 2UUBB 2YI8A 4QE7A 2Z5UA 1GAXA 1AI6A 1NH2B 2P4KA 1DF5A 1N34O 4KHPO 3A0RA 3IGAC 1ZL8B 3JARB 3PN1A 4DV7O 1W0KG 1J95A 2V7QG 4HAMA 3G67A 1KC8W 2LFSA 2UXNA 4GLXA 2QKCA 5L3FA 3JAWA 5CA3A 1FXKB 4FPPA 1XQ8A 2F1MA 1H8EG 2E74B 4N21A 2VRZA 2QWQB 3G80A 2Q73A 4FLVA 3CC2V 2N74A 2R9AA 3HR0A 3L70H 3AG3C 3ML0A 3D36A 1EN4A 5EYPB 2CUGA 3HKDB 3OEEG 4TV8A 1JPXA 1WJZA 4X88A 4LCUC 3C90A 2VWKA 2DWEC 4NXNB 4YJ3B 1PP9H 2HR3A 1I94O 4DV4B 1ZSPA 3F7YC 1GTOA 3OT7A 1XILA 2EX3A 4X20B 2CTRA 4UVAA 4DR6O 3T1YO 1ZAUA 4B7KA 2JJ2G 3L72H 3D36C 2WWWA 4DV5B 1OCRB 4J11A 1N8RW 4JI5O 1HNXO 1NS1A 3OMNB 4B3MB 1Q7YW 1G6UA 3E22B 3R66A 2AZ2A 4UB6Z 4AHCA 4K8ZA 1AB3A 2KG7A 3JATA 1SQVH 2JRIA 1GM9A 2LO1A 2ZE6A 5IDJA 1FKAO 1K4DC 2DQ0A 3BRCA 1AJNA 1RFYA 2X6CA 3B77A 3OGIB 4ZOLB 2YC0A 1EN5A 1G4YB 1XOUA 1WP7A 5B3SC 5DN6G 1B04A 2LW7A 3CCJV 4DW0A 3N2KB 2UXCB 4DR2O 1HDJA 3LUTB 1GRJA 1YJ9V 2PTMA 5BZBA 1THZA 2OWOA 1YDXA 2LGQA 4K3AA 3CRMA 2OCCC 4JYAO 3I56V 2E76B 3LSUA 3LDDA 2K9PA 1GK9A 4AI8A 3RYFA 4B7EA 4E4EA 4LFBB 1XNRB 5LMNO 4JTCB 3AG4C 3AG3B 3ZN0A 3WG7C 4L8JA 1NTMH 3A2FA 3RVZA 1EM1A 3JAKA 4X9QA 2UUBO 1CXZB 4DV3B 1YITV 3K57A 4O2BB 1NH2D 4LWSA 2MK3A 4I55B 4KL1A 5ITZB 4PDRA 1YHQV 5E1AC 2OT5A 3E89A 5JQGB 2X6AA 2F43G 3J7AU 1BQZA 4XDLA 4LF4B 3BPZA 1KECA 5LP6A 2XASA 3OTOB 3RYHA 2XAQA 3IC9A 4Q20A 5DEDA 4XDJA 4UXNA 3SJQC 4CH3A 5B1OA 3CCVV 1HR0O 3CMEV 4P2ZA 3ZRXA 5FNVB 1V9PA 4FLWA 3ZRVA 1M90W 4GKJB 2P7TC 3RYCB 5LP6C 3BA9A 3KZIZ 4JTAB 2YIDA 4U3JA 4JZ2A 2ZD9A 2EIJC 2LQTA 1M5IA 2KG7B 5H2FZ 5IYZA 3RYIA 2XT9A 4I9QA 1TUBA 1K9MW 4I9WA 2CGNA 2OIGA 4J9YB 1K73W 1SQFA 4CH5A 4NXNO 4F6RA 3JD3A 3CRAA 1JX9A 4DV4O 1EZJA 2DWDC 1S77D 2OCCB 2Q8VA 1Q5OA 2ZIOA 2EIMC 1N0NA 2BSKA 4DV5O 1BSMA 3B09A 3ZHTA 1JOYA 1BMFG 4QE9A 5FLXN 1GN4A 2Q69A 2HKOA 2P67A 1GN6A 4EB6A 2GUZB 2P4VA 4WFGA 4MW3A 2OYQA 1H2MA 2Y48A 1XNQB 1K5SA 4OGQB 4ZHQA 1M1KW 3WG7B 1L8DA 1MSWD 1L0NH 2M6YA 1Y66A 3GWKC 1L1FA 5KMGA 1Q6IA 1U97A 3RYFB 1OCCC 1R73A 5IJ9A 2UXCO 3K5LA 1DTOA 3K04A 1NQTA 1IDSA 2Y4UA 4CC5A 1IXBA 4ICGA 3ZMTA 1M56C 3K9SA 1FXVA 3K5MA 3JASB 2DMXA 4UV8A 5AG2A 4O4HB 3ZX6A 4AQYB 2Y69C 4I0XB 1VIBA 4GX1A 4LWSB 3CSXA 4CZZA 2GHYA 1AJPA 2A79B 1K7DA 3S3WA 4PA6A 2F95B 3L73H 4FLYA 4NR1A 1YZBA 2Z0AA 4X1IB 2ZE8A 4PDLA 5LP6B 3A0HZ 1UJWB 3SR2C 3FFQA 3K0GA 4F6EA 4LFBO 2IBZH 4J41A 1XNRO 2EIJB 3MHHC 4GZRB 4IIJB 1AI5A 3N27A 4R50A 1FFXA 2N04A 4X66O 3P3NA 2ADPA 4DV3O 2F66C 4DV6O 2UXBB 2XTAA 3TXQA 5KX5B 4DR4O 2A06H 2IU0A 4X1KA 5KHKA 2YI9A 3JALB 3K08A 2JK5C 1JVMA 2EIMB 2XHBA 1N36B 2P6JA 4LF4O 4WBNA 4CS4A 3OFNG 4PA7A 4RUEA 4YXWG 2Q7GA 1BGYH 4F6RB 1Q3EA 2CTPA 1S5LZ 4BW9A 3RW0A 1JJOA 2Z3YA 2D3OW 3BCCH 4TQDA 4MTOA 2NLJC 1K3EA 4K0KB 4UCTA 1JR9A 1VQ9V 5CN0A 2NN4A 4L87A 4GKJO 1VF6A 5C8YB 5LHGA 1IX9A 1H2KA 1U96A 3DXRA 4PA9A 2DOSA 3SPGA 4LF8B 2ZQMA 5L3BA 1OCCB 4B3RB 4FJCC 1YI2V 1K8AW 3ABUA 4LF5B 4ZHQB 1M56B 4DR1B 2QWPB 1IZ3A 2VWJA 1SQQH 2AW9A 4DRXB 4RWUA 2Y69B 3ZMVA 4UCSA 3IFXA 3O9OA 4TV9A 1Q6UA 5CA0B 2PGGA 5IJ9B 1MOFA 3TXSA 2PI4A 3E83A 1S3JA 2K1EA 4YJ2B 1GN2A 2NNUA 4D6TH 3VBBA 2XNDG 1NTKH 2ZIMA 4FLTA 1VEWA 1VQ5V 5EZYB 2PI5A 3ETQA 4OX9B 1XNQO 4EEQA 3JYCA 3JAMN 1WLEA 3HPLC 1IBKB 4X89A 2DN9A 2CDYA 1QVFU 2XAGA 1BT8A 3VQVA 2IH1C 4X1YB 1WPXA 4P9PA 4UCUA 1Q90D 5BMVB 5B1NA 3QO8A 5EC1C 4AQYO 3FB6C 1M4UA 3BHPA 4MVOA 3ZMSA 1CEZA 2EJRA 2PYLA 4U7OA 1DLBA 5CMUA 4R8CA 2WLIA 3P30A 4D7SA 1TUEB 5FPOA 5B1BC 3B2EE 4B3TB 4H13B 2RDCA 1FXHA 3F7VC 2WLHA 3H1JH 4O2AA 5JCOA 4Z2WA 1FPOA 3CP1A 4FM1A 4XDKA 5IE9A 2H3OA 3CEIA 4B3SB 3T4DA 1Q81W 1K4CC 1AILA 2R72A 2L6LA 2EZOA 3I55V 3FYEB 2UXBO 1E1QG 5GONB 2B9ZA 1P84F 2VQFB 4UUJC 1NTZH 3NXSA 3SYAA 4PDMA 2BOCC 4Q6GA 1KQSU 5IJ0B 2W0XA 3AG2C 1N36O 5J9PC 4DV0B 2X0LA 2EINC 3N2GB 1VMGA 4ZI7A 1QQCA 5JH7A 2R9RB 1B6QA 3QNEA 3TGUH 4K0KO 5CA1B 4DV1B 1QHTA 2H94A 3E2EA 1OV9A 5J2UA 5B1AB 3IC7A 1JFFB 1Y74B 1SQGA 1PM9A 3JD2A 2Q0OC 1WP8A 3OR7C 4RQEA 5A9GA 2ZNJA 1NVPD 1I08A 2EILC 4I50B 1OJHA 2Q67A 4JI0B 3ZS8C 4FFKA 2F93B 4LF5O 2YDEA 1SQBH 3J80N 4DR1O 4GUNA 2ATKC 1MZFA 4FZ1A 3G71V 5L3DA 4QJFB 5KLVH 4I4TA
chains in the Genus database with same CATH topology
3OM3B 3I56V 4GX2A 1AROP 1OZ0A 2WAMA 1SRYA 3LSQA 4JTDB 1M9NA 5B1BB 1P7BA 3W7TA 3LDDA 1QLEB 2H8PC 3CC4V 4UV9A 1JJ2U 1GK9A 3CCLV 1MABG 2ITDC 2QTOA 4RQFA 2LP7A 4JTCB 3AG4C 3FYIB 5CBFA 3AG3B 4I5SA 3ZN0A 3ZRWA 1OCZB 2XAHA 1DF4A 1OCOB 1R6NA 2WLMA 2WPDG 4LC1A 3B8NA 3WG7C 4KP4A 5LBQA 3CCRV 1S0VA 4TWKA 3RVZA 2BOBC 1R3JC 2CK3G 3CCUV 3CCQV 3W7UA 3CCEV 1YITV 1NH2D 4KFMA 2MK3A 1NR1A 2Q6AA 5IYBO 1G8MA 1YJWV 3HB3B 3OW2U 4PDRA 3PJSK 1YHQV 5E1AC 2OT5A 3E89A 3SYCA 2X6AA 2F43G 1F23A 1BL8A 3X2QC 3AG2B 4DO2A 4XDLA 4BIUA 3G6EV 1Q86W 1KECA 2XASA 2HG5C 4CBCA 1Q82W 4MVSA 3SPJA 2XAQA 4Q20A 3GWOA 3SYPA 4XDJA 1JQ0A 4UXNA 3SJQC 4JF3A 5B1OA 3T1CA 3CCVV 2W6IG 3DTUB 4MTFA 3CMEV 1S72V 1FXKA 1V55C 3OR6C 3ASNB 1VQ4V 4P2ZA 3ZRXA 2QE7G 3GB7C 1M90W 1F4NA 3E8HA 3ZRVA 3ETDA 2P7TC 3SPCA 4JGSA 1XL4A 4JTAB 3UKMA 3ZIAG 3ABLB 3VOUA 3EFFK 2ZD9A 2DW4A 2EIJC 2JIZG 5IY5C 1BHAA 3ABTA 4WFBV 4FMTA 4LP8A 3UM7A 2EILB 4UVBA 3TETA 1K9MW 4I9WA 2ZR3A 4MW8A 1S5HC 2V1DA 1YSCA 3ASOC 1ENVA 1M57C 4J9YB 1K73W 3ZMZA 4FK5C 4MSWC 3MD0A 4GCZA 4X8AA 3JD3A 1I5YA 2WLJA 3CYOA 4U7NA 1QVGU 1JX9A 1EZJA 1NR7A 2DWDC 5CBHA 1Y4MA 1KP3A 2OCCB 1S77D 3OMIB 5L3EA 3CCSV 3LNMB 2EIMC 3QO7A 2DYRC 1VQ8V 1W2BU 1JOYA 4QIWF 1BMFG 1VQNV 3MHSC 1K92A 4QE9A 1XL6A 4QNHB 4ZKIA 4GX5A 3STLC 2Q69A 2HKOA 4HZ3A 2P67A 2B1IA 2B5UA 1AI4A 5IYCO 4WFGA 2W0FC 1MG1A 1K33A 3BY6A 3ABKC 4JPRA 4MW3A 3ZN1A 2Y48A 5L3CA 1K5SA 3EHBB 4MVUA 3K3WA 1M1KW 1QR9A 3WG7B 2ITCC 3ABMC 5IYDO 3CCMV 1MSWD 3OUFA 4MTXA 5H6QA 1Y66A 1L1FA 2AHZA 3TK1A 4F4LA 1OCCC 1R73A 2WLLA 2QM8A 2DQ3A 4JAUA 4MVRA 4MTGA 1F4MA 1DTOA 3K04A 3OMAB 1NQTA 3R65A 1V54C 3X2QB 1S76D 2DYSC 1H8HG 2IH3C 3ZRWB 2GSMB 3W7WA 3ZMTA 2OTJV 1M56C 3CD6V 1QBZA 1FXVA 5HFLA 4ZBMA 4FIPC 4UV8A 1RM1C 2FTKA 5EBWC 5B1AC 2JEUA 2ZXWC 3FB8C 4G27B 5LHHA 2Y69C 5EBMC 3OGCC 4JYCA 2WLIB 4GX1A 1K34A 4CZZA 2GHYA 1AJPA 1RPOA 2A79B 1K7DA 1VQLV 4PA6A 1R6KA 4BW5A 1V55B 4EKWA 4N23A 2EIKC 1KKDA 2IJJA 3FB5C 4MT8A 3K03A 1K5QA 5DM6V 4PDLA 1ZWIC 1UJWB 1KD1W 4GX0A 3K0GA 2EIJB 1VQ7V 2XAJA 3MHHC 2EBOA 4PA3A 1AI5A 4R50A 3JD0A 5LGUA 2EINB 2C2AA 2QKSA 3ASOB 5KUMA 1M57B 3D3IA 5LHIA 1R3IC 2WLNA 3JCZA 2HFEC 2HLDG 3T2MA 1FS0G 2YSUB 2IU0A 3OAAG 2WSSG 3OUSA 2HVJC 3RBZA 3K08A 1QR8A 2JK5C 2JEXA 3DGEA 3ETGA 1E79G 1GO3F 1JVMA 1PD3A 2EIMB 2OTLV 2IW5A 4OXSA 3CC7V 2DYRB 2P6JA 5B3SB 4Z1MG 2IJKA 3OFNG 4PA7A 4QPJA 4RUEA 2X7RB 4YXWG 5KA6A 3AG1C 3K0DA 3CPWU 2JJ1G 4RAIA 3E35A 1FXKC 3ETEA 3RVYA 5H6RA 4JYBA 5H9CA 3RW0A 2Z3YA 2D3OW 3ZMUA 4MTOA 2NLJC 1K3EA 5C93A 3ABKB 5FL7G 1H2GA 5CN0A 1VQ9V 4HYOA 3LSSA 4L87A 4E2LA 5LHGA 3ABMB 3LDEA 3E86A 3LDCA 3TCUA 4KUMA 4LBEC 3E8GA 4PA9A 1VQMV 3SPGA 3P32A 3JD1A 4QPKA 2ZQMA 5L3BA 1E1RG 1OCCB 2YEVB 4PDVA 1K97A 4WF9V 5EBLC 4FJCC 2IJHA 1YI2V 4G2KA 4PA4A 1COWG 2A0LA 3JD4A 1K8AW 3ABUA 2HJFC 2DYSB 1VQKV 1PNMA 1M56B 4R6ZA 1I5XA 1LNQA 4H37A 2KB1A 1CPYA 1RM1B 3AG4B 1BHBA 2ZXWB 2UXXA 2Y69B 3ZMVA 3IFXA 3ABLC 2XOKG 4WCEV 4JASA 5CBGA 1GMGA 2WLLB 1PNKA 1OCRC 2P90A 1MOFA 1EFRG 3AEIA 5GW7A 2EIKB 2PI4A 3FB7C 3E83A 1S3JA 2R9IA 2K1EA 5EC2C 3SYQA 1PNLA 3OEHG 1F51A 5LGNA 3CXCU 3G4SV 4MVZA 2NNUA 2QEXV 4DXWA 1KP2A 5EK0A 3VBBA 2XNDG 4P30A 1JCHA 3BEHA 2EZPA 3ZJZA 4WFFA 1VQ5V 2X6BA 2PI5A 2W6JG 1R3KC 4MVQA 4J9ZB 3SPHA 1YTFB 3JYCA 4UVCA 1ORQC 1WLEA 4P9OA 1R3LC 1QLNA 3HPLC 4QE7A 4X89A 2ZDIA 3CMAV 2Z5UA 1QVFU 1AI6A 1NH2B 2XAGA 1H38A 1GKFA 1DF5A 1VQPV 3A0RA 2IH1C 3IGAC 1WPXA 4P9PA 2A9HA 4RO2A 4MVMA 1VQOV 1SESA 3W7SA 5KUKA 1W0KG 1VQ6V 1J95A 2V7QG 4HAMA 3FKSG 1KC8W 2LFSA 5B1NA 3QO8A 2QM7A 5EC1C 1YTFD 2XAFA 2UXNA 5IY5B 3AG1B 3FB6C 5L3FA 2ZDIC 4MVOA 3ZMSA 1CEZA 1YJNV 2EJRA 1FXKB 5CA3A 4U7OA 1DLBA 1NKDA 5CMUA 4FPPA 4R8CA 1SETA 1P4RA 4R7CA 2WLIA 3P30A 1TUEB 1IXMA 1H8EG 4N21A 5B1BC 1AI7A 1QLEC 4RUFA 1FXHA 3F7VC 3OE7G 1OHHG 1PKXA 2WLHA 1PL0A 4GT1A 3E8BA 3CC2V 3CP1A 1SZTA 3K79A 3AG3C 3ML0A 1GM7A 1W0JG 3D36A 3K06A 1OCZC 1CP9A 4TSFG 4XDKA 1OCOC 2Q68A 3OEEG 3T4DA 1Q81W 1K4CC 1JPXA 5KA5A 4X88A 2EZOA 4LCUC 3I55V 2DWEC 4G28B 4JAVA 3FYEB 1AR1B 2HR3A 1E1QG 1AJQA 4UUJC 3F7YC 1GTOA 3ZRSA 4UVAA 3NXSA 2M7WA 3SYAA 5HFMA 4PDMA 2B1GA 2BOCC 1KQSU 2JJ2G 4BAYA 4WFAV 1SERA 3AG2C 1NBMG 2WWWA 3QO5A 2JDIG 3M99B 5J9PC 1OCRB 1N8RW 4XBFA 3OMNB 5L3GA 2X0LA 1Q7YW 5LGTA 3W7XA 3STZC 2EINC 3KG2A 4MS2A 3B8MA 1NVPB 2R9RB 4WFHA 4H33A 1V54B 1B6QA 3QNEA 2IU3A 1GM9A 3WFVA 5IDJA 1YIJV 1K4DC 3ASNC 2DQ0A 2H94A 3E2EA 1AJNA 2X6CA 3B77A 5B1AB 1NJIW 4TT3G 3IC7A 1G4YB 3K9AA 1FFTB 4PELA 3F5WC 5B3SC 1GM8A 2LFRA 1QCEA 3E8FA 4WFEA 3JD2A 3OR7C 3ZCCA 5DN6G 4RQEA 2WLKA 2IJIA 2HVKC 3SPIA 3CCJV 1RPRA 4ASUG 2ZR2A 1NVPD 1ROPA 1EBOA 2EILC 3LUTB 3H01A 2YEVA 2Q67A 1YJ9V 5BZBA 1THZA 1HWYA 2QA4V 3T4ZA 2ATKC 3G71V 5L3DA 4QJFB 4BIZA 3SYOA 2AHYA 2OCCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EBO A;  3CP1 A;  1SZT A;  1DF4 A;  1QCE A;  3B8N A;  2X7R B;  1Y66 A;  3GWO A;  1K34 A;  5KA6 A;  1MOF A;  1JQ0 A;  3MHS C;  1DLB A;  5CMU A;  4JF3 A;  3B8M A;  1JPX A;  4FJC C;  5KA5 A;  2EZO A;  4N23 A;  1EBO A;  3P30 A;  4G2K A;  1DF5 A;  1ENV A;  3H01 A;  5H9C A;  2MK3 A;  4N21 A;  4FK5 C;  3WFV A;  1I5X A;  5CN0 A;  1I5Y A;  3CYO A;  2OT5 A;  1MG1 A;  1K33 A;  2M7W A;  4JPR A;  1F23 A;  2EZP A;  4E2L A;  1QR8 A;  1QBZ A;  4JGS A;  2LP7 A;  5HFL A;  3B77 A;  5HFM A;  1Y4M A;  4FIP C;  3MHH C;  2P6J A;  3K9A A;  1QR9 A;  3M99 B; 
#chains in the Genus database with same CATH topology
 3OM3 B;  1M93 A;  1SA0 B;  2PF4 E;  4EFB A;  4LFA B;  5CB4 B;  2DJV A;  5J2T A;  1NI8 A;  5B1B B;  1YXB A;  1O9H A;  2CH7 B;  2E5L B;  3HKC B;  1BQ0 A;  3H1L H;  4O4J B;  4LNU A;  4RQF A;  1ZTE A;  1L0L H;  3SDL A;  3ZRW A;  4OX9 O;  4DR5 B;  3WB0 A;  4JAA A;  4K8X A;  2WPD G;  5LBQ A;  1H2L A;  1S0V A;  4TWK A;  3CCQ V;  3W7U A;  1R6T A;  3SGI A;  2RJZ A;  5IWA B;  2MW2 B;  4O2A B;  3HB3 B;  4FFB A;  1F23 A;  1BL8 A;  3AG2 B;  1ZX3 A;  4BIU A;  3G6E V;  1Q86 W;  2HG5 C;  4CBC A;  2OCH A;  2JGD A;  4LF7 B;  4Z1V A;  3G6B A;  3GWO A;  3SYP A;  1X59 A;  1JQ0 A;  2HP8 A;  4JF3 A;  1ZLZ A;  5LOV A;  1S72 V;  1TVK B;  1VQ4 V;  5KHG A;  2QE7 G;  5LXT A;  3CRQ A;  3ETD A;  4B3T O;  3M7M X;  4JGS A;  1XL4 A;  3UKM A;  3KCY A;  3ABL B;  1N32 O;  3EFF K;  4ZI7 B;  4X64 B;  5IY5 C;  1BHA A;  5JJE B;  3ABT A;  4FMT A;  4GKK B;  2EIL B;  2E3C A;  4MW8 A;  1S5H C;  1IVS A;  2V1D A;  1R1B A;  3BAB A;  1IBL B;  1M57 C;  4LF6 B;  1I5Y A;  4JYY A;  2WLJ A;  3CYO A;  2CE4 A;  5CBH A;  1KP3 A;  3CCS V;  4O4L A;  3LNM B;  3QO7 A;  3QF7 A;  2O57 A;  2QTS A;  4ZIB A;  1XMO O;  2DYR C;  2F4V B;  4DV0 O;  5LL6 Y;  4J7J A;  1VQ8 V;  4FLZ A;  4EFE A;  3BY6 A;  4JPR A;  5LA6 B;  2YUA A;  4DV1 O;  2Y0I A;  3EHB B;  4OPH A;  1PL4 A;  3CCM V;  5H6Q A;  2D2C B;  3DC5 A;  2AHZ A;  3TK1 A;  3C3S A;  2WLL A;  4JAU A;  4MTG A;  1YCI A;  4DK0 A;  4NVP A;  3IAY A;  1V54 C;  4UCR A;  2IH3 C;  4JI0 O;  4JZG A;  3ZRW B;  1MNG A;  2GSM B;  3CD6 V;  3DSQ A;  5HFL A;  3JAW B;  2FTK A;  5EBW C;  2BTQ A;  2ZXW C;  3FB8 C;  4G27 B;  4JYC A;  2JS5 A;  3RT3 C;  2EJ7 A;  3BFR A;  1EN6 A;  4FFB B;  1R6K A;  4EKW A;  3CXH F;  1KKD A;  1MMM A;  3VQW A;  2E5L O;  2YXY A;  5DM6 V;  1KD1 W;  5KHJ A;  2FKX A;  3WB2 A;  1FYJ A;  1VQ7 V;  4UCO A;  4TV8 B;  5LOV B;  4HNA A;  3LNN A;  1KKC A;  2PUS A;  2QKS A;  5LXT B;  1M57 B;  5LHI A;  1WB7 A;  2HLD G;  3T2M A;  1SKV A;  1T5E A;  5IWA O;  4K35 A;  3J81 N;  3OAA G;  3OUS A;  2R70 A;  3APQ A;  3DGE A;  1E79 G;  4TUY A;  4OXS A;  2DYR B;  1Y76 A;  5B3S B;  4Z1M G;  2IJK A;  2Q9L A;  4QPJ A;  5B66 Z;  5KA6 A;  4IHJ A;  3JAT B;  4LF7 O;  3AG1 C;  4RAI A;  4DR7 B;  4FM2 A;  3E35 A;  3RVY A;  5H6R A;  1AR5 A;  1KYO F;  4A5U B;  1H2G A;  4HYO A;  4E2L A;  2Q5Z A;  3LDE A;  3LDC A;  5D5P A;  2PZS A;  1W59 A;  4B3M O;  4PDV A;  4GKK O;  2IJH A;  2ZM6 B;  4PI2 A;  4G2K A;  1COW G;  4NYK A;  3JD4 A;  1IBL O;  2HJF C;  1ZUQ A;  1I5X A;  4H37 A;  2KB1 A;  2AGA A;  3RFR A;  1VF5 B;  3AG4 B;  5FPR A;  1BHB A;  2ZXW B;  2UXX A;  2RQ6 A;  2XOK G;  4JAS A;  1GMG A;  2WLL B;  2F4V O;  1SF9 A;  3FB7 C;  3SYQ A;  4JI8 B;  3OEH G;  2CTQ A;  2V4D A;  1QNM A;  3QTC A;  4DXW A;  4JI1 B;  2BTQ B;  2GBO A;  1B3Q A;  2UXD B;  4LFC B;  3UT5 A;  1X4T A;  2W6J G;  1R3K C;  4MVQ A;  3JAK B;  1RP3 B;  2E75 B;  3K58 A;  3ZHV A;  3H1H H;  2ZDI A;  2GTA A;  3CMA V;  3CS5 A;  1GKF A;  5DEC A;  2P22 C;  3ZHQ A;  3RN4 A;  4RO2 A;  3VQY A;  3L71 H;  1VQ6 V;  3RYH B;  1VP7 A;  1SQP H;  1WB8 A;  2QM7 A;  3AG1 B;  2ZDI C;  2ZNI A;  1NKD A;  3CB2 A;  1P4R A;  4R7C A;  3CX5 F;  1XBL A;  1IXM A;  1AI7 A;  1TGO A;  1WN7 A;  1XI1 A;  5BY1 A;  4U3J B;  1SC5 B;  1KUQ A;  1OHH G;  5IYZ B;  3RYI B;  1PL0 A;  3E8B A;  2KSD A;  3HKE A;  3C3T A;  1XMQ B;  1TUB B;  3K06 A;  4TSF G;  1CP9 A;  3OTO O;  1OCO C;  3OTF A;  1RSO A;  4G28 B;  5JVD A;  4JAV A;  2JVD A;  1AR1 B;  5F2V O;  4YHH B;  1AJQ A;  2N05 A;  3KKY A;  2BSK B;  5EIB C;  2RNB A;  1J5E B;  3QVN A;  1NBM G;  3QO5 A;  4IT5 A;  1UPG A;  1TAE A;  1Q6H A;  2L35 A;  2HEP A;  4LR3 A;  4XBF A;  5L3G A;  5LGT A;  3STZ C;  2VQE B;  3VQX A;  4EB6 B;  1NVP B;  1WAZ A;  4DR7 O;  1A32 A;  3Q4H A;  2Q0A A;  3WFV A;  1VF6 C;  3T1H B;  1NU1 H;  1P7G A;  2UUC B;  1NJI W;  4U3F H;  4TT3 G;  2ODM A;  3K9A A;  5KMG B;  4PV1 B;  2LFR A;  5JWP A;  3ZHS A;  1H2N A;  2A7W A;  2WLK A;  2HVK C;  3SPI A;  4ASU G;  2ZR2 A;  2GTS A;  1ROP A;  1YVW A;  4NTY A;  2ZM6 O;  3FX7 A;  2YEV A;  4DUZ B;  2ZCE A;  1HWY A;  2QA4 V;  2YIA A;  2AHY A;  1DGS A;  2RN9 A;  4GX2 A;  2P06 A;  2WAM A;  1SRY A;  5KAI Z;  4JTD B;  5H5N A;  1P7B A;  5KHI A;  3W7T A;  2BTO A;  4BIO A;  4JI8 O;  2H8P C;  4UV9 A;  4DV7 B;  1JJ2 U;  2ITD C;  2QTO A;  4IYH A;  4JI1 O;  2LP7 A;  3AK1 A;  4NXM B;  2UXD O;  3FYI B;  1FFX B;  1DF4 A;  1OCO B;  4LC1 A;  2WLM A;  4JI4 B;  3B8N A;  1FD9 A;  4KP4 A;  3CCR V;  2BOB C;  2YS8 A;  2CK3 G;  1DK1 A;  2GDS A;  3CCE V;  4X1K B;  4KFM A;  1G8M A;  1LUW A;  1YJW V;  3D8C A;  3OW2 U;  3PJS K;  1Q43 A;  4DO2 A;  4WBN B;  1ZL8 A;  4J7Z A;  1Q82 W;  4UFZ A;  1LUV A;  5JVD B;  4C7U A;  1JA8 A;  4DK1 A;  1SS3 A;  3T1C A;  2BCC H;  2W6I G;  3CE2 A;  4W4K A;  1FXK A;  1V55 C;  1F4N A;  3E8H A;  3I5D A;  2QGN A;  3DXR B;  5IT9 N;  4DUY B;  5JCO C;  1SZX A;  1Q8I A;  3EVK A;  3ZIA G;  1F7Y A;  5KHH A;  2DW4 A;  3ZHR A;  1XMQ O;  2QJ1 A;  2Y0P A;  4WFB V;  3CJH A;  3UM7 A;  3FD9 A;  4UVB A;  2ZR3 A;  4JI2 B;  1NZ6 A;  3ASO C;  5EYP A;  1ENV A;  2Q7E A;  1TA8 A;  3D3Q A;  4X8A A;  4U7N A;  4YHH O;  4TV9 B;  1BCC H;  1Y4M A;  3UO2 A;  5L3E A;  2LW1 A;  1J5E O;  4CH6 A;  1AP5 A;  4H0L B;  1HW7 A;  1K92 A;  4LF8 O;  1XL6 A;  2VQE O;  3BAA A;  4GX5 A;  3E22 A;  4KXR A;  2ZIN A;  4B3R O;  4HZ3 A;  1UFI A;  2VS0 A;  5BXZ A;  4DR3 B;  2B5U A;  4B08 A;  1AI4 A;  5IYC O;  2W0F C;  1MG1 A;  1K33 A;  2ARH A;  3ABK C;  2QWR B;  2WA3 A;  3T1H O;  5L3C A;  4MVU A;  2UUC O;  1Y67 A;  2ITC C;  3ABM C;  4YIO A;  4MTX A;  4ZOL A;  1KU9 A;  2ZT9 B;  4F4L A;  2CTW A;  4YY3 B;  2QM8 A;  4FZ0 A;  4DYL A;  3N2K A;  1S76 D;  2DYS C;  1H8H G;  3W7W A;  5GTI Z;  1KB9 F;  3L9D A;  1RM1 C;  5LHH A;  3OGC C;  2WLI B;  2F23 A;  2XUM A;  1D5A A;  1JMK C;  5KAF Z;  1IBK O;  1V55 B;  2EIK C;  3FB5 C;  4MT8 A;  5D5Q A;  1K5Q A;  2FML A;  1ZWI C;  3B4S A;  3U11 A;  1P49 A;  2ILM A;  4NXM O;  2XAJ A;  2WA4 A;  3RGB A;  1QU7 A;  2EBO A;  2BE3 A;  4PA3 A;  4CH4 A;  2EIN B;  3F5T A;  3K59 A;  2C2A A;  4JI6 B;  4JI4 O;  3ASO B;  1HR0 B;  1R3I C;  3JSN A;  2HFE C;  2YSU B;  2WSS G;  4LH7 A;  4O2B A;  3RBZ A;  3AG7 A;  5EIB D;  2ETN A;  1QR8 A;  3ETG A;  4I55 A;  1PD3 A;  4DW1 A;  5ITZ A;  2ZE7 A;  3CJH B;  5JQG A;  5A2Q N;  2X7R B;  5JH7 B;  3CPW U;  3IJ4 A;  4FVM A;  4JI7 B;  3ETE A;  1IUR A;  4B3S O;  4JYB A;  2QM4 A;  1XEQ A;  4X62 B;  3ZMU A;  5C93 A;  3ABK B;  5FL7 G;  5J2U B;  1NT2 B;  2VQF O;  4DUY O;  5FNV A;  3ABM B;  3E86 A;  4H44 B;  3A0B Z;  3RYC A;  2P5O A;  1VQM V;  2CAZ C;  3P32 A;  2JS3 A;  1B06 A;  3JD1 A;  1E1R G;  4NB5 A;  4WF9 V;  5EBL C;  4PA4 A;  4JI2 O;  2A0L A;  1BZK A;  2DYS B;  1PNM A;  4R6Z A;  2LJ2 A;  4I4T B;  4TQF A;  1RM1 B;  1YEW A;  1HNW B;  1Z2G A;  4WCE V;  5J2T B;  5CBG A;  4W4L A;  4I7Z B;  2P90 A;  2UUA B;  1Y6X A;  2EIK B;  4AIL C;  3BA8 A;  5EC2 C;  3L74 H;  1F51 A;  4LNU B;  5LGN A;  4MVZ A;  1US6 A;  5E79 Z;  2QEX V;  4PHZ A;  4J42 A;  1O9G A;  2UU9 B;  1I0H A;  2QDO A;  1JCH A;  3BEH A;  4DR3 O;  3ZJZ A;  2X6B A;  3AK3 A;  3SPH A;  1MZE A;  4J7K A;  2GUZ A;  4J9Z B;  1D5N A;  4UVC A;  1R3L C;  2RCV A;  4LFA O;  3O65 A;  1H38 A;  1VQP V;  4YY3 O;  2A9H A;  4MVM A;  3THO A;  1VQO V;  1SES A;  3W7S A;  5KUK A;  2JGD B;  1AVM A;  3FKS G;  3UO3 A;  5LYJ A;  4FM0 A;  4LF9 B;  1YTF D;  2XAF A;  5IY5 B;  3QG5 A;  3JAS A;  4DR5 O;  4O4H A;  4X66 B;  1YJN V;  2HHH B;  4I0X A;  4DV6 B;  1SET A;  5LMU B;  3P3P A;  4DR4 B;  1QLE C;  2NR5 A;  3HKB A;  4RUF A;  3OE7 G;  1PKX A;  4X1I A;  3NR7 A;  4GT1 A;  3BVO A;  1SZT A;  3K79 A;  2GV9 A;  4J80 A;  1GM7 A;  1W0J G;  1OCZ C;  3UQ8 A;  3GVM A;  2Q68 A;  3WU2 Z;  4JI6 O;  4IIJ A;  5KA5 A;  4HBN A;  4O4L B;  3ZRS A;  2M7W A;  5HFM A;  5KX5 A;  2B1G A;  1Z5W A;  4BAY A;  4WFA V;  1XHX A;  1SER A;  2JDI G;  3JAL A;  3M99 B;  3K5N A;  3W7X A;  4X64 O;  3AK2 A;  3KG2 A;  4MS2 A;  3B8M A;  1SQX H;  3FAV A;  4WFH A;  4H33 A;  4JI7 O;  1FJG B;  2ADQ B;  1V54 B;  4X62 O;  2IU3 A;  2AZ0 A;  3A8T A;  4UCV A;  1YIJ V;  4LF6 O;  3ASN C;  1N0J A;  1IBM B;  1AR4 A;  4O4I A;  3RWR D;  1XRE A;  1FFT B;  4PEL A;  3F5W C;  1GM8 A;  5C8Y A;  1QCE A;  3E8F A;  3H9V A;  4WFE A;  3ZCC A;  2DE0 X;  2IJI A;  1RPR A;  1H2S B;  1EBO A;  3H01 A;  2PY5 A;  1LR1 A;  2KKW A;  1N33 B;  3T4Z A;  2FL4 A;  2EUL A;  1YF2 A;  3MAQ A;  4BIZ A;  3SYO A;  3U10 A;  2YIB A;  1HNZ B;  1HNW O;  1XDC A;  4DRX A;  1ARO P;  1OZ0 A;  2Q4P A;  2CGO A;  3LSQ A;  3SJB C;  2UUA O;  1M9N A;  2RMK B;  5CA0 A;  1KMI Z;  1QLE B;  4PI0 A;  3CC4 V;  5LYJ B;  3CCL V;  1MAB G;  4YJ2 A;  2UU9 O;  3ICX A;  4HNA B;  2YXL A;  5CBF A;  4I5S A;  1XHZ A;  1OCZ B;  2XAH A;  2Q7H A;  1R6N A;  5EZY A;  4X65 B;  1MA1 A;  5K1X A;  1R3J C;  3CCU V;  3HKB B;  3ZBH A;  2ZE5 A;  5JJJ B;  4D7T A;  1NR1 A;  2Q6A A;  5IYB O;  1I7F A;  4TUY B;  1BE3 H;  5TIS Z;  1Y76 B;  3SYC A;  3X2Q C;  4X1Y A;  5JJN B;  4IHJ B;  3UCS C;  4LF9 O;  4MVS A;  3SPJ A;  5BMV A;  3K5O A;  3MDS A;  1WNS A;  2HHH O;  3CHX A;  5GTH Z;  3DTU B;  4MTF A;  2Y4T A;  5LMU O;  4NKG B;  3OR6 C;  3ASN B;  3GB7 C;  4IYI A;  3SPC A;  1VAR A;  3B40 A;  3VOU A;  5K1P A;  2OIE A;  4NTW A;  2JIZ G;  3FAV B;  4JV5 B;  4YIP A;  2AXT Z;  4LP8 A;  2QSA A;  3TET A;  1FAF A;  1YSC A;  4FLU A;  4NTX A;  3ZHU A;  1Z5V A;  1URF A;  3ZMZ A;  4O4I B;  4FK5 C;  4MSW C;  3MD0 A;  4GCZ A;  2IM9 A;  1QVG U;  2KQX A;  4LH6 A;  1NR7 A;  2FB5 A;  4CS3 A;  3OMI B;  4DV2 B;  2ZKO A;  5GON A;  3U0Z A;  1N4C A;  2LGW A;  5IJ0 A;  1VF7 A;  1WPB A;  4CC6 A;  1W2B U;  4QIW F;  1PV0 A;  1VQN V;  3MHS C;  2HJD A;  4BR6 A;  1HP8 A;  3CRC A;  4QNH B;  4ZKI A;  1XUQ A;  3STL C;  1KBH A;  3N2G A;  3UT5 B;  1FJG O;  2QR4 A;  2B1I A;  3ZN1 A;  4JI3 B;  4PD4 F;  1EZV H;  1IBM O;  3CWB H;  3K3W A;  5CA1 A;  1QR9 A;  5BR8 B;  1GN3 A;  5IYD O;  3OUF A;  1JFF A;  1Y74 A;  4IL6 Z;  1N34 B;  2QKA A;  4KHP B;  2DQ3 A;  4MVR A;  1F4M A;  3OMA B;  3R65 A;  3X2Q B;  4J10 A;  2OTJ V;  4I50 A;  1WA8 A;  1QBZ A;  1N33 O;  4ZBM A;  1MSD A;  4FIP C;  5B1A C;  2JEU A;  4LFC O;  5EBM C;  1HNZ O;  3H1K H;  1BS3 A;  1K34 A;  1RPO A;  3CRR A;  1VQL V;  1SA0 A;  3S3X A;  3M8A A;  4IGG A;  4BW5 A;  4N23 A;  2YXH A;  2IJJ A;  4BWA A;  3JCU Z;  5CB4 A;  1AP6 A;  3EXA A;  3K03 A;  1GH6 A;  3HKE B;  2CH7 A;  4GX0 A;  4GYC B;  3HKC A;  3JSL A;  4UB8 Z;  3JAR A;  4O4J A;  5LGU A;  3JD0 A;  2YIC A;  1RSO B;  4X65 O;  5KUM A;  3D3I A;  4OPA A;  2WLN A;  3JCZ A;  1I94 B;  1D2D A;  1FS0 G;  4DR6 B;  4TOI A;  3T1Y B;  2A3Q A;  2HVJ C;  2JEX A;  1GO3 F;  1N32 B;  2OTL V;  2IW5 A;  3CC7 V;  4JI5 B;  1HNX B;  4CS2 A;  2FYU H;  3Q4H B;  3K0D A;  3WB1 A;  2JJ1 G;  1FXK C;  3OD4 A;  5H9C A;  4FLX A;  2QWN B;  3KCX A;  3HKD A;  3ZED A;  3LSS A;  1TVK A;  4YJ3 A;  3TCU A;  4KUM A;  1XMO B;  3TJT A;  4LBE C;  3E8G A;  4X20 A;  4PJ0 Z;  4QGP A;  2PYJ A;  2JGU A;  3DC6 A;  4QPK A;  4JV5 O;  1PPJ H;  2YEV B;  4DR2 B;  1K97 A;  3SJA C;  2QWO B;  1VQK V;  1LNQ A;  1CPY A;  3H1I H;  1S5J A;  4JYA B;  4DV2 O;  3ABL C;  1PNK A;  1OCR C;  1EFR G;  3AEI A;  5GW7 A;  2R9I A;  1PNL A;  1WA8 B;  3L75 H;  3APO A;  4ABM A;  3SJC C;  3CXC U;  3G4S V;  1KP2 A;  5B5E Z;  5EK0 A;  4P30 A;  2G38 A;  5LMN B;  2YIB D;  2EZP A;  4DUZ O;  4WFF A;  4JI3 O;  1G1X B;  1YTF B;  5LA6 A;  1ORQ C;  4P9O A;  1QLN A;  5BR8 O;  2UUB B;  2YI8 A;  4QE7 A;  2Z5U A;  1GAX A;  1AI6 A;  1NH2 B;  2P4K A;  1DF5 A;  1N34 O;  4KHP O;  3A0R A;  3IGA C;  1ZL8 B;  3JAR B;  3PN1 A;  4DV7 O;  1W0K G;  1J95 A;  2V7Q G;  4HAM A;  3G67 A;  1KC8 W;  2LFS A;  2UXN A;  4GLX A;  2QKC A;  5L3F A;  3JAW A;  5CA3 A;  1FXK B;  4FPP A;  1XQ8 A;  2F1M A;  1H8E G;  2E74 B;  4N21 A;  2VRZ A;  2QWQ B;  3G80 A;  2Q73 A;  4FLV A;  3CC2 V;  2N74 A;  2R9A A;  3HR0 A;  3L70 H;  3AG3 C;  3ML0 A;  3D36 A;  1EN4 A;  5EYP B;  2CUG A;  3HKD B;  3OEE G;  4TV8 A;  1JPX A;  1WJZ A;  4X88 A;  4LCU C;  3C90 A;  2VWK A;  2DWE C;  4NXN B;  4YJ3 B;  1PP9 H;  2HR3 A;  1I94 O;  4DV4 B;  1ZSP A;  3F7Y C;  1GTO A;  3OT7 A;  1XIL A;  2EX3 A;  4X20 B;  2CTR A;  4UVA A;  4DR6 O;  3T1Y O;  1ZAU A;  4B7K A;  2JJ2 G;  3L72 H;  3D36 C;  2WWW A;  4DV5 B;  1OCR B;  4J11 A;  1N8R W;  4JI5 O;  1HNX O;  1NS1 A;  3OMN B;  4B3M B;  1Q7Y W;  1G6U A;  3E22 B;  3R66 A;  2AZ2 A;  4UB6 Z;  4AHC A;  4K8Z A;  1AB3 A;  2KG7 A;  3JAT A;  1SQV H;  2JRI A;  1GM9 A;  2LO1 A;  2ZE6 A;  5IDJ A;  1FKA O;  1K4D C;  2DQ0 A;  3BRC A;  1AJN A;  1RFY A;  2X6C A;  3B77 A;  3OGI B;  4ZOL B;  2YC0 A;  1EN5 A;  1G4Y B;  1XOU A;  1WP7 A;  5B3S C;  5DN6 G;  1B04 A;  2LW7 A;  3CCJ V;  4DW0 A;  3N2K B;  2UXC B;  4DR2 O;  1HDJ A;  3LUT B;  1GRJ A;  1YJ9 V;  2PTM A;  5BZB A;  1THZ A;  2OWO A;  1YDX A;  2LGQ A;  4K3A A;  3CRM A;  2OCC C;  4JYA O;  3I56 V;  2E76 B;  3LSU A;  3LDD A;  2K9P A;  1GK9 A;  4AI8 A;  3RYF A;  4B7E A;  4E4E A;  4LFB B;  1XNR B;  5LMN O;  4JTC B;  3AG4 C;  3AG3 B;  3ZN0 A;  3WG7 C;  4L8J A;  1NTM H;  3A2F A;  3RVZ A;  1EM1 A;  3JAK A;  4X9Q A;  2UUB O;  1CXZ B;  4DV3 B;  1YIT V;  3K57 A;  4O2B B;  1NH2 D;  4LWS A;  2MK3 A;  4I55 B;  4KL1 A;  5ITZ B;  4PDR A;  1YHQ V;  5E1A C;  2OT5 A;  3E89 A;  5JQG B;  2X6A A;  2F43 G;  3J7A U;  1BQZ A;  4XDL A;  4LF4 B;  3BPZ A;  1KEC A;  5LP6 A;  2XAS A;  3OTO B;  3RYH A;  2XAQ A;  3IC9 A;  4Q20 A;  5DED A;  4XDJ A;  4UXN A;  3SJQ C;  4CH3 A;  5B1O A;  3CCV V;  1HR0 O;  3CME V;  4P2Z A;  3ZRX A;  5FNV B;  1V9P A;  4FLW A;  3ZRV A;  1M90 W;  4GKJ B;  2P7T C;  3RYC B;  5LP6 C;  3BA9 A;  3KZI Z;  4JTA B;  2YID A;  4U3J A;  4JZ2 A;  2ZD9 A;  2EIJ C;  2LQT A;  1M5I A;  2KG7 B;  5H2F Z;  5IYZ A;  3RYI A;  2XT9 A;  4I9Q A;  1TUB A;  1K9M W;  4I9W A;  2CGN A;  2OIG A;  4J9Y B;  1K73 W;  1SQF A;  4CH5 A;  4NXN O;  4F6R A;  3JD3 A;  3CRA A;  1JX9 A;  4DV4 O;  1EZJ A;  2DWD C;  1S77 D;  2OCC B;  2Q8V A;  1Q5O A;  2ZIO A;  2EIM C;  1N0N A;  2BSK A;  4DV5 O;  1BSM A;  3B09 A;  3ZHT A;  1JOY A;  1BMF G;  4QE9 A;  5FLX N;  1GN4 A;  2Q69 A;  2HKO A;  2P67 A;  1GN6 A;  4EB6 A;  2GUZ B;  2P4V A;  4WFG A;  4MW3 A;  2OYQ A;  1H2M A;  2Y48 A;  1XNQ B;  1K5S A;  4OGQ B;  4ZHQ A;  1M1K W;  3WG7 B;  1L8D A;  1MSW D;  1L0N H;  2M6Y A;  1Y66 A;  3GWK C;  1L1F A;  5KMG A;  1Q6I A;  1U97 A;  3RYF B;  1OCC C;  1R73 A;  5IJ9 A;  2UXC O;  3K5L A;  1DTO A;  3K04 A;  1NQT A;  1IDS A;  2Y4U A;  4CC5 A;  1IXB A;  4ICG A;  3ZMT A;  1M56 C;  3K9S A;  1FXV A;  3K5M A;  3JAS B;  2DMX A;  4UV8 A;  5AG2 A;  4O4H B;  3ZX6 A;  4AQY B;  2Y69 C;  4I0X B;  1VIB A;  4GX1 A;  4LWS B;  3CSX A;  4CZZ A;  2GHY A;  1AJP A;  2A79 B;  1K7D A;  3S3W A;  4PA6 A;  2F95 B;  3L73 H;  4FLY A;  4NR1 A;  1YZB A;  2Z0A A;  4X1I B;  2ZE8 A;  4PDL A;  5LP6 B;  3A0H Z;  1UJW B;  3SR2 C;  3FFQ A;  3K0G A;  4F6E A;  4LFB O;  2IBZ H;  4J41 A;  1XNR O;  2EIJ B;  3MHH C;  4GZR B;  4IIJ B;  1AI5 A;  3N27 A;  4R50 A;  1FFX A;  2N04 A;  4X66 O;  3P3N A;  2ADP A;  4DV3 O;  2F66 C;  4DV6 O;  2UXB B;  2XTA A;  3TXQ A;  5KX5 B;  4DR4 O;  2A06 H;  2IU0 A;  4X1K A;  5KHK A;  2YI9 A;  3JAL B;  3K08 A;  2JK5 C;  1JVM A;  2EIM B;  2XHB A;  1N36 B;  2P6J A;  4LF4 O;  4WBN A;  4CS4 A;  3OFN G;  4PA7 A;  4RUE A;  4YXW G;  2Q7G A;  1BGY H;  4F6R B;  1Q3E A;  2CTP A;  1S5L Z;  4BW9 A;  3RW0 A;  1JJO A;  2Z3Y A;  2D3O W;  3BCC H;  4TQD A;  4MTO A;  2NLJ C;  1K3E A;  4K0K B;  4UCT A;  1JR9 A;  1VQ9 V;  5CN0 A;  2NN4 A;  4L87 A;  4GKJ O;  1VF6 A;  5C8Y B;  5LHG A;  1IX9 A;  1H2K A;  1U96 A;  3DXR A;  4PA9 A;  2DOS A;  3SPG A;  4LF8 B;  2ZQM A;  5L3B A;  1OCC B;  4B3R B;  4FJC C;  1YI2 V;  1K8A W;  3ABU A;  4LF5 B;  4ZHQ B;  1M56 B;  4DR1 B;  2QWP B;  1IZ3 A;  2VWJ A;  1SQQ H;  2AW9 A;  4DRX B;  4RWU A;  2Y69 B;  3ZMV A;  4UCS A;  3IFX A;  3O9O A;  4TV9 A;  1Q6U A;  5CA0 B;  2PGG A;  5IJ9 B;  1MOF A;  3TXS A;  2PI4 A;  3E83 A;  1S3J A;  2K1E A;  4YJ2 B;  1GN2 A;  2NNU A;  4D6T H;  3VBB A;  2XND G;  1NTK H;  2ZIM A;  4FLT A;  1VEW A;  1VQ5 V;  5EZY B;  2PI5 A;  3ETQ A;  4OX9 B;  1XNQ O;  4EEQ A;  3JYC A;  3JAM N;  1WLE A;  3HPL C;  1IBK B;  4X89 A;  2DN9 A;  2CDY A;  1QVF U;  2XAG A;  1BT8 A;  3VQV A;  2IH1 C;  4X1Y B;  1WPX A;  4P9P A;  4UCU A;  1Q90 D;  5BMV B;  5B1N A;  3QO8 A;  5EC1 C;  4AQY O;  3FB6 C;  1M4U A;  3BHP A;  4MVO A;  3ZMS A;  1CEZ A;  2EJR A;  2PYL A;  4U7O A;  1DLB A;  5CMU A;  4R8C A;  2WLI A;  3P30 A;  4D7S A;  1TUE B;  5FPO A;  5B1B C;  3B2E E;  4B3T B;  4H13 B;  2RDC A;  1FXH A;  3F7V C;  2WLH A;  3H1J H;  4O2A A;  5JCO A;  4Z2W A;  1FPO A;  3CP1 A;  4FM1 A;  4XDK A;  5IE9 A;  2H3O A;  3CEI A;  4B3S B;  3T4D A;  1Q81 W;  1K4C C;  1AIL A;  2R72 A;  2L6L A;  2EZO A;  3I55 V;  3FYE B;  2UXB O;  1E1Q G;  5GON B;  2B9Z A;  1P84 F;  2VQF B;  4UUJ C;  1NTZ H;  3NXS A;  3SYA A;  4PDM A;  2BOC C;  4Q6G A;  1KQS U;  5IJ0 B;  2W0X A;  3AG2 C;  1N36 O;  5J9P C;  4DV0 B;  2X0L A;  2EIN C;  3N2G B;  1VMG A;  4ZI7 A;  1QQC A;  5JH7 A;  2R9R B;  1B6Q A;  3QNE A;  3TGU H;  4K0K O;  5CA1 B;  4DV1 B;  1QHT A;  2H94 A;  3E2E A;  1OV9 A;  5J2U A;  5B1A B;  3IC7 A;  1JFF B;  1Y74 B;  1SQG A;  1PM9 A;  3JD2 A;  2Q0O C;  1WP8 A;  3OR7 C;  4RQE A;  5A9G A;  2ZNJ A;  1NVP D;  1I08 A;  2EIL C;  4I50 B;  1OJH A;  2Q67 A;  4JI0 B;  3ZS8 C;  4FFK A;  2F93 B;  4LF5 O;  2YDE A;  1SQB H;  3J80 N;  4DR1 O;  4GUN A;  2ATK C;  1MZF A;  4FZ1 A;  3G71 V;  5L3D A;  4QJF B;  5KLV H;  4I4T A; 
#chains in the Genus database with same CATH homology
 3OM3 B;  3I56 V;  4GX2 A;  1ARO P;  1OZ0 A;  2WAM A;  1SRY A;  3LSQ A;  4JTD B;  1M9N A;  5B1B B;  1P7B A;  3W7T A;  3LDD A;  1QLE B;  2H8P C;  3CC4 V;  4UV9 A;  1JJ2 U;  1GK9 A;  3CCL V;  1MAB G;  2ITD C;  2QTO A;  4RQF A;  2LP7 A;  4JTC B;  3AG4 C;  3FYI B;  5CBF A;  3AG3 B;  4I5S A;  3ZN0 A;  3ZRW A;  1OCZ B;  2XAH A;  1DF4 A;  1OCO B;  1R6N A;  2WLM A;  2WPD G;  4LC1 A;  3B8N A;  3WG7 C;  4KP4 A;  5LBQ A;  3CCR V;  1S0V A;  4TWK A;  3RVZ A;  2BOB C;  1R3J C;  2CK3 G;  3CCU V;  3CCQ V;  3W7U A;  3CCE V;  1YIT V;  1NH2 D;  4KFM A;  2MK3 A;  1NR1 A;  2Q6A A;  5IYB O;  1G8M A;  1YJW V;  3HB3 B;  3OW2 U;  4PDR A;  3PJS K;  1YHQ V;  5E1A C;  2OT5 A;  3E89 A;  3SYC A;  2X6A A;  2F43 G;  1F23 A;  1BL8 A;  3X2Q C;  3AG2 B;  4DO2 A;  4XDL A;  4BIU A;  3G6E V;  1Q86 W;  1KEC A;  2XAS A;  2HG5 C;  4CBC A;  1Q82 W;  4MVS A;  3SPJ A;  2XAQ A;  4Q20 A;  3GWO A;  3SYP A;  4XDJ A;  1JQ0 A;  4UXN A;  3SJQ C;  4JF3 A;  5B1O A;  3T1C A;  3CCV V;  2W6I G;  3DTU B;  4MTF A;  3CME V;  1S72 V;  1FXK A;  1V55 C;  3OR6 C;  3ASN B;  1VQ4 V;  4P2Z A;  3ZRX A;  2QE7 G;  3GB7 C;  1M90 W;  1F4N A;  3E8H A;  3ZRV A;  3ETD A;  2P7T C;  3SPC A;  4JGS A;  1XL4 A;  4JTA B;  3UKM A;  3ZIA G;  3ABL B;  3VOU A;  3EFF K;  2ZD9 A;  2DW4 A;  2EIJ C;  2JIZ G;  5IY5 C;  1BHA A;  3ABT A;  4WFB V;  4FMT A;  4LP8 A;  3UM7 A;  2EIL B;  4UVB A;  3TET A;  1K9M W;  4I9W A;  2ZR3 A;  4MW8 A;  1S5H C;  2V1D A;  1YSC A;  3ASO C;  1ENV A;  1M57 C;  4J9Y B;  1K73 W;  3ZMZ A;  4FK5 C;  4MSW C;  3MD0 A;  4GCZ A;  4X8A A;  3JD3 A;  1I5Y A;  2WLJ A;  3CYO A;  4U7N A;  1QVG U;  1JX9 A;  1EZJ A;  1NR7 A;  2DWD C;  5CBH A;  1Y4M A;  1KP3 A;  2OCC B;  1S77 D;  3OMI B;  5L3E A;  3CCS V;  3LNM B;  2EIM C;  3QO7 A;  2DYR C;  1VQ8 V;  1W2B U;  1JOY A;  4QIW F;  1BMF G;  1VQN V;  3MHS C;  1K92 A;  4QE9 A;  1XL6 A;  4QNH B;  4ZKI A;  4GX5 A;  3STL C;  2Q69 A;  2HKO A;  4HZ3 A;  2P67 A;  2B1I A;  2B5U A;  1AI4 A;  5IYC O;  4WFG A;  2W0F C;  1MG1 A;  1K33 A;  3BY6 A;  3ABK C;  4JPR A;  4MW3 A;  3ZN1 A;  2Y48 A;  5L3C A;  1K5S A;  3EHB B;  4MVU A;  3K3W A;  1M1K W;  1QR9 A;  3WG7 B;  2ITC C;  3ABM C;  5IYD O;  3CCM V;  1MSW D;  3OUF A;  4MTX A;  5H6Q A;  1Y66 A;  1L1F A;  2AHZ A;  3TK1 A;  4F4L A;  1OCC C;  1R73 A;  2WLL A;  2QM8 A;  2DQ3 A;  4JAU A;  4MVR A;  4MTG A;  1F4M A;  1DTO A;  3K04 A;  3OMA B;  1NQT A;  3R65 A;  1V54 C;  3X2Q B;  1S76 D;  2DYS C;  1H8H G;  2IH3 C;  3ZRW B;  2GSM B;  3W7W A;  3ZMT A;  2OTJ V;  1M56 C;  3CD6 V;  1QBZ A;  1FXV A;  5HFL A;  4ZBM A;  4FIP C;  4UV8 A;  1RM1 C;  2FTK A;  5EBW C;  5B1A C;  2JEU A;  2ZXW C;  3FB8 C;  4G27 B;  5LHH A;  2Y69 C;  5EBM C;  3OGC C;  4JYC A;  2WLI B;  4GX1 A;  1K34 A;  4CZZ A;  2GHY A;  1AJP A;  1RPO A;  2A79 B;  1K7D A;  1VQL V;  4PA6 A;  1R6K A;  4BW5 A;  1V55 B;  4EKW A;  4N23 A;  2EIK C;  1KKD A;  2IJJ A;  3FB5 C;  4MT8 A;  3K03 A;  1K5Q A;  5DM6 V;  4PDL A;  1ZWI C;  1UJW B;  1KD1 W;  4GX0 A;  3K0G A;  2EIJ B;  1VQ7 V;  2XAJ A;  3MHH C;  2EBO A;  4PA3 A;  1AI5 A;  4R50 A;  3JD0 A;  5LGU A;  2EIN B;  2C2A A;  2QKS A;  3ASO B;  5KUM A;  1M57 B;  3D3I A;  5LHI A;  1R3I C;  2WLN A;  3JCZ A;  2HFE C;  2HLD G;  3T2M A;  1FS0 G;  2YSU B;  2IU0 A;  3OAA G;  2WSS G;  3OUS A;  2HVJ C;  3RBZ A;  3K08 A;  1QR8 A;  2JK5 C;  2JEX A;  3DGE A;  3ETG A;  1E79 G;  1GO3 F;  1JVM A;  1PD3 A;  2EIM B;  2OTL V;  2IW5 A;  4OXS A;  3CC7 V;  2DYR B;  2P6J A;  5B3S B;  4Z1M G;  2IJK A;  3OFN G;  4PA7 A;  4QPJ A;  4RUE A;  2X7R B;  4YXW G;  5KA6 A;  3AG1 C;  3K0D A;  3CPW U;  2JJ1 G;  4RAI A;  3E35 A;  1FXK C;  3ETE A;  3RVY A;  5H6R A;  4JYB A;  5H9C A;  3RW0 A;  2Z3Y A;  2D3O W;  3ZMU A;  4MTO A;  2NLJ C;  1K3E A;  5C93 A;  3ABK B;  5FL7 G;  1H2G A;  5CN0 A;  1VQ9 V;  4HYO A;  3LSS A;  4L87 A;  4E2L A;  5LHG A;  3ABM B;  3LDE A;  3E86 A;  3LDC A;  3TCU A;  4KUM A;  4LBE C;  3E8G A;  4PA9 A;  1VQM V;  3SPG A;  3P32 A;  3JD1 A;  4QPK A;  2ZQM A;  5L3B A;  1E1R G;  1OCC B;  2YEV B;  4PDV A;  1K97 A;  4WF9 V;  5EBL C;  4FJC C;  2IJH A;  1YI2 V;  4G2K A;  4PA4 A;  1COW G;  2A0L A;  3JD4 A;  1K8A W;  3ABU A;  2HJF C;  2DYS B;  1VQK V;  1PNM A;  1M56 B;  4R6Z A;  1I5X A;  1LNQ A;  4H37 A;  2KB1 A;  1CPY A;  1RM1 B;  3AG4 B;  1BHB A;  2ZXW B;  2UXX A;  2Y69 B;  3ZMV A;  3IFX A;  3ABL C;  2XOK G;  4WCE V;  4JAS A;  5CBG A;  1GMG A;  2WLL B;  1PNK A;  1OCR C;  2P90 A;  1MOF A;  1EFR G;  3AEI A;  5GW7 A;  2EIK B;  2PI4 A;  3FB7 C;  3E83 A;  1S3J A;  2R9I A;  2K1E A;  5EC2 C;  3SYQ A;  1PNL A;  3OEH G;  1F51 A;  5LGN A;  3CXC U;  3G4S V;  4MVZ A;  2NNU A;  2QEX V;  4DXW A;  1KP2 A;  5EK0 A;  3VBB A;  2XND G;  4P30 A;  1JCH A;  3BEH A;  2EZP A;  3ZJZ A;  4WFF A;  1VQ5 V;  2X6B A;  2PI5 A;  2W6J G;  1R3K C;  4MVQ A;  4J9Z B;  3SPH A;  1YTF B;  3JYC A;  4UVC A;  1ORQ C;  1WLE A;  4P9O A;  1R3L C;  1QLN A;  3HPL C;  4QE7 A;  4X89 A;  2ZDI A;  3CMA V;  2Z5U A;  1QVF U;  1AI6 A;  1NH2 B;  2XAG A;  1H38 A;  1GKF A;  1DF5 A;  1VQP V;  3A0R A;  2IH1 C;  3IGA C;  1WPX A;  4P9P A;  2A9H A;  4RO2 A;  4MVM A;  1VQO V;  1SES A;  3W7S A;  5KUK A;  1W0K G;  1VQ6 V;  1J95 A;  2V7Q G;  4HAM A;  3FKS G;  1KC8 W;  2LFS A;  5B1N A;  3QO8 A;  2QM7 A;  5EC1 C;  1YTF D;  2XAF A;  2UXN A;  5IY5 B;  3AG1 B;  3FB6 C;  5L3F A;  2ZDI C;  4MVO A;  3ZMS A;  1CEZ A;  1YJN V;  2EJR A;  1FXK B;  5CA3 A;  4U7O A;  1DLB A;  1NKD A;  5CMU A;  4FPP A;  4R8C A;  1SET A;  1P4R A;  4R7C A;  2WLI A;  3P30 A;  1TUE B;  1IXM A;  1H8E G;  4N21 A;  5B1B C;  1AI7 A;  1QLE C;  4RUF A;  1FXH A;  3F7V C;  3OE7 G;  1OHH G;  1PKX A;  2WLH A;  1PL0 A;  4GT1 A;  3E8B A;  3CC2 V;  3CP1 A;  1SZT A;  3K79 A;  3AG3 C;  3ML0 A;  1GM7 A;  1W0J G;  3D36 A;  3K06 A;  1OCZ C;  1CP9 A;  4TSF G;  4XDK A;  1OCO C;  2Q68 A;  3OEE G;  3T4D A;  1Q81 W;  1K4C C;  1JPX A;  5KA5 A;  4X88 A;  2EZO A;  4LCU C;  3I55 V;  2DWE C;  4G28 B;  4JAV A;  3FYE B;  1AR1 B;  2HR3 A;  1E1Q G;  1AJQ A;  4UUJ C;  3F7Y C;  1GTO A;  3ZRS A;  4UVA A;  3NXS A;  2M7W A;  3SYA A;  5HFM A;  4PDM A;  2B1G A;  2BOC C;  1KQS U;  2JJ2 G;  4BAY A;  4WFA V;  1SER A;  3AG2 C;  1NBM G;  2WWW A;  3QO5 A;  2JDI G;  3M99 B;  5J9P C;  1OCR B;  1N8R W;  4XBF A;  3OMN B;  5L3G A;  2X0L A;  1Q7Y W;  5LGT A;  3W7X A;  3STZ C;  2EIN C;  3KG2 A;  4MS2 A;  3B8M A;  1NVP B;  2R9R B;  4WFH A;  4H33 A;  1V54 B;  1B6Q A;  3QNE A;  2IU3 A;  1GM9 A;  3WFV A;  5IDJ A;  1YIJ V;  1K4D C;  3ASN C;  2DQ0 A;  2H94 A;  3E2E A;  1AJN A;  2X6C A;  3B77 A;  5B1A B;  1NJI W;  4TT3 G;  3IC7 A;  1G4Y B;  3K9A A;  1FFT B;  4PEL A;  3F5W C;  5B3S C;  1GM8 A;  2LFR A;  1QCE A;  3E8F A;  4WFE A;  3JD2 A;  3OR7 C;  3ZCC A;  5DN6 G;  4RQE A;  2WLK A;  2IJI A;  2HVK C;  3SPI A;  3CCJ V;  1RPR A;  4ASU G;  2ZR2 A;  1NVP D;  1ROP A;  1EBO A;  2EIL C;  3LUT B;  3H01 A;  2YEV A;  2Q67 A;  1YJ9 V;  5BZB A;  1THZ A;  1HWY A;  2QA4 V;  3T4Z A;  2ATK C;  3G71 V;  5L3D A;  4QJF B;  4BIZ A;  3SYO A;  2AHY A;  2OCC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...