3WU2Z

Crystal structure analysis of photosystem ii complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
total genus 24
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 3wu2Z00
4UB8Z 3A0BZ 4UB6Z 3A0HZ 5GTIZ 5H2FZ 1S5LZ 5KAIZ 5TISZ 5B66Z 4PJ0Z 3KZIZ 5KAFZ 3JCUZ 5B5EZ 4IL6Z 5E79Z 3WU2Z 2AXTZ 5GTHZ
chains in the Genus database with same CATH superfamily
2GTAA 3LDEA 2X7RB 2R9RB 4MT8A 2LQTA 1WB7A 1EFRG 4O2AB 4O2BB 3RFRA 3K9SA 4PA4A 3UT5B 5B3SB 3CP1A 1I5YA 1JQ0A 2UU9O 1MSWD 4I7ZB 2F4VO 3CCLV 1S5JA 3IJ4A 1S5HC 1XNQO 1OCRC 2CE4A 1VQMV 3AG4B 4DV7O 3ASOC 3ZMUA 4JF3A 2R70A 4FLXA 1NU1H 5H2FZ 4LF4B 3ASOB 2QM4A 2ZNIA 1HDJA 4YJ3A 5HFMA 4F6EA 2CGNA 2IJHA 2EIMC 4J7JA 1AILA 5KUKA 3R66A 3JARB 4I9QA 1S0VA 5DM6V 3QO8A 1NI8A 2V7QG 3RYFA 5DEDA 4FLYA 1RPRA 1WA8A 3G67A 1HR0O 4JI4B 2HEPA 3UM7A 4E4EA 5EYPB 3JATB 1BHAA 2HLDG 2JS5A 2E75B 2PTMA 2HJFC 1S72V 1GN3A 4JYAO 4UB8Z 5DECA 3K5NA 2UU9B 2F4VB 5KA5A 1N33O 1XNQB 5IJ0A 2IBZH 3H1HH 3K0DA 1VQOV 5KHGA 2YC0A 5H6RA 5LHGA 3GWKC 4GX5A 5BXZA 1ZX3A 3T4ZA 1PV0A 3A2FA 4O4LA 4DR2O 2YSUB 4CC5A 4WFBV 4ZBMA 3CJHA 3ABKC 3FYEB 1QHTA 4LF7O 1TGOA 1SQBH 3JAKB 2OWOA 4UV9A 5JJJB 4R7CA 1K73W 4JTCB 2K1EA 3EVKA 1P7GA 1NH2B 5H6QA 2CTPA 3ASNC 2QJ1A 2X6AA 4YIOA 4DR6B 2PYJA 4X1YB 2HP8A 4X65B 1FD9A 4EKWA 2HHHO 4JYAB 1N0JA 2GUZB 4FVMA 5EBWC 3VQWA 4FZ1A 5LHIA 3APOA 1N33B 1ORQC 3JAWB 3SYCA 2YXLA 3GB7C 4HNAB 4MTFA 4EB6B 3RYHA 5D5QA 1XDCA 4MVMA 4PI2A 1KBHA 1LNQA 1VQKV 4RWUA 4X1IA 2YI9A 1KD1W 4ZHQA 1Q82W 5DN6G 1IBLO 2QR4A 2JJ1G 4DK0A 4FZ0A 4DR2B 3DC6A 1KKDA 2QWRB 1TA8A 2CDYA 1QLEC 1GN4A 1H38A 2RN9A 1ROPA 5LOVA 1V55B 2MW2B 4PHZA 2RQ6A 4QGPA 1QLEB 3IFXA 4PDRA 2OIEA 5KAIZ 2Q5ZA 2GDSA 4JTDB 5J2UB 1K5QA 3CXCU 5KA6A 4X8AA 3CWBH 4LNUB 1V54C 3BVOA 4FFBA 2P4KA 2JGUA 5JVDB 4DV0B 1EN6A 3VOUA 4NXNO 4WCEV 3D36C 3JD0A 2ZR2A 2X6CA 3N2GB 3OR6C 1SS3A 2HHHB 1PNLA 2XUMA 2OCHA 4W4KA 2OYQA 3FKSG 4FPPA 1GKFA 2GV9A 4LF5O 5IWAO 4EEQA 5EBLC 4PDLA 5LYJB 1FAFA 4MVZA 3W7WA 1NKDA 5CA0B 3A8TA 3QNEA 1E79G 2A3QA 5KHIA 5KMGB 4MSWC 3RWRD 3Q4HB 3B77A 2WWWA 3ETGA 1BQ0A 1R3IC 1PKXA 4CH4A 2IM9A 3HPLC 2Z0AA 2QWQB 5D5PA 3SJCC 2B9ZA 1RSOB 1SC5B 1Z5VA 5BZBA 2HJDA 4I5SA 3L71H 2PYLA 3F5TA 1MMMA 2B5UA 1J5EB 2A79B 2VQFO 3C3TA 2LFRA 2F95B 4X64O 3T2MA 1CEZA 3K57A 2AHYA 3N27A 4BIOA 2ADPA 3OUFA 4LWSA 3G80A 4FLWA 1KC8W 5FPRA 2OCCC 4IYHA 2X6BA 3ZMVA 3OTOO 1Q86W 3SPCA 4UCUA 4YIPA 3D36A 1D2DA 3SPHA 1SKVA 4OGQB 4WFAV 3HKDA 2H94A 1NR7A 3MHHC 1L1FA 2DQ3A 2Y0PA 2LO1A 2ATKC 4TV9A 1Y4MA 4X88A 4NKGB 2F66C 4AI8A 3WB1A 4JI2O 1AJPA 3CRCA 3I5DA 1OCOC 4CS4A 4JZ2A 1PNKA 4JZGA 3JCZA 3DXRA 3OEHG 1QBZA 3W7XA 1N8RW 4MTGA 3UKMA 2P5OA 4IL6Z 1XILA 1QCEA 3E8HA 1EZJA 4HZ3A 3WB2A 1R3JC 1SQQH 2Q0OC 1K4DC 5B1BC 4I55A 4X64B 1S5LZ 5JWPA 2Q73A 2DW4A 1SQPH 4DRXA 4LF8O 1TVKB 3CD6V 1YTFD 4PI0A 3BAAA 3OTOB 4DUYO 5C8YB 1THZA 4WFGA 1RM1B 2QEXV 1CXZB 3ZRVA 1XMQO 1MSDA 3HKCB 2ZM6O 2HG5C 3SDLA 1HP8A 3L72H 4MTOA 1WAZA 3FAVB 4RUFA 5CB4B 4K0KO 4JI2B 2E5LO 5HFLA 3RYIB 1I7FA 1Q90D 2EIJC 1X59A 4A5UB 4DR1O 4F6RA 1QVGU 1BS3A 1MABG 4LC1A 3CCMV 4DR4O 1XREA 4JI7O 2YIAA 3H1JH 4IT5A 5J2TB 3BPZA 4DV6O 3O9OA 2NR5A 1G6UA 2F23A 1Y67A 3E86A 1NBMG 3M8AA 3JALB 3WFVA 2DOSA 4P9PA 3EHBB 2BSKB 4FFKA 5EIBC 2ODMA 1M57B 4YY3O 3K03A 3UO3A 4DV1B 5B1AB 1FJGB 2UXCO 1M9NA 1SETA 2ZT9B 1IX9A 2CK3G 2QM7A 2W6JG 4DUYB 4UUJC 2Q69A 4CH5A 4X1KB 4N21A 3RW0A 1DGSA 1JOYA 2JVDA 1XI1A 1XMQB 1R1BA 3N2KA 2LGQA 2W0FC 3IGAC 4YHHO 3LDDA 2PI5A 1D5NA 4YJ2A 3LDCA 4FLVA 4K0KB 1L0LH 1E1RG 1XNRO 2E5LB 5CA1A 1N34B 1IXBA 1XEQA 4FJCC 5GW7A 5BR8B 4TWKA 4O4IB 5ITZB 4CH6A 5JH7A 3BFRA 3T1CA 1L0NH 4J9YB 4DV6B 3E35A 4WFHA 4B08A 3D3IA 3HKBA 4Z1MG 4JAAA 3FFQA 1TUBB 5LGUA 1FFXB 2AHZA 4XDJA 4RQFA 3ZJZA 3ZX6A 5TISZ 2IJJA 3T1YB 1Y76A 3CCQV 2UXCB 4WBNA 4JI8O 2NNUA 5EZYA 4I50B 2NN4A 2C2AA 4IYIA 4OXSA 3G6EV 2XNDG 1I08A 4L87A 3A0BZ 3K5LA 3CRQA 3KKYA 3OD4A 3CSXA 3BEHA 1Y74A 1XOUA 3CB2A 4B3MO 1XL6A 3AK3A 4QPJA 3G71V 4UVAA 3IC9A 4TV8A 1MG1A 3QF7A 5L3BA 3K5OA 1G4YB 1GN2A 2Q9LA 1AJNA 3JSNA 4X66O 4I0XA 4YJ3B 5GTIZ 5LMUO 2BE3A 4YXWG 3HR0A 4PD4F 3B4SA 1TUEB 2R9AA 5FLXN 1VQPV 3EXAA 2XT9A 5J9PC 1OHHG 3RYFB 3ZMSA 5B3SC 4H44B 4LBEC 1IBKB 5IYBO 4JV5O 3O65A 2Y48A 1HNZB 4CBCA 4DV2O 5IY5B 5CBFA 3E2EA 2UUCB 3AG4C 1SERA 2YXYA 2JGDB 1BQZA 3RYCA 2RDCA 2QKAA 4KXRA 4U3FH 3CCEV 5B5EZ 3GVMA 2R9IA 2P7TC 1R6KA 1UPGA 3ZHRA 5LP6A 3JSLA 4ZIBA 4B3MB 2UXDO 4B3TO 5CN0A 3LSSA 3CCUV 1JVMA 1S76D 2BTQA 4MVUA 5IJ9A 1JA8A 4TQDA 2D2CB 4O4LB 3JCUZ 3AEIA 1U96A 1AR5A 1EN5A 2DJVA 1AR1B 5LMUB 3CJHB 4P2ZA 4TUYB 1IXMA 2GTSA 2LP7A 1VP7A 1N4CA 4DV5B 3B40A 2YDEA 3S3WA 4GX2A 3KCXA 1NS1A 4JYCA 3VQYA 2JS3A 1RPOA 3M99B 1F23A 1KMIZ 2V4DA 1YJNV 4U7OA 1QLNA 4N23A 1VARA 2KSDA 3CCSV 1DF4A 3CMAV 4JV5B 1PPJH 3QG5A 3KCYA 4QNHB 4DV2B 1P49A 4O4JA 4UV8A 3ETDA 1FXKC 2WLLB 4B3SO 1YJ9V 1NTKH 2Y4UA 5EC2C 5LXTB 5LGTA 1K5SA 1R3KC 3ABMB 5IYZA 2QGNA 1FXKB 3FD9A 1K97A 2P06A 4DV7B 2IJIA 4J80A 1N0NA 2EBOA 4TQFA 2UXDB 4B3TB 5JQGA 3BY6A 3MAQA 1FYJA 1LR1A 3VBBA 4H33A 5CMUA 2B1GA 4DV3O 3CE2A 2ZNJA 1WPBA 2CH7A 5LOVB 4NYKA 2WPDG 1E1QG 1M56B 3OR7C 3ZN0A 1ZL8A 5GONA 4H13B 3AG1B 3BCCH 1AI6A 2YIDA 3CXHF 1HR0B 1PL4A 3MHSC 4K35A 1YDXA 4FFBB 1KECA 2VS0A 3JARA 2Q67A 1SQFA 3TETA 4B3SB 1GM8A 1IBMO 4LFBO 4PA7A 2Q7HA 4LR3A 4GT1A 2Y69B 4FMTA 1P4RA 4LH6A 4QPKA 1WJZA 3K0GA 1NT2B 5EYPA 4R8CA 2EIKC 3JATA 1Q6IA 2IH1C 3TK1A 3SJAC 2UUAO 3ZMZA 2EIKB 1V55C 4NTWA 5CA3A 5IYCO 3SYOA 1YSCA 2RCVA 4PA3A 3H1IH 1YF2A 3JD2A 2P22C 3OGIB 1YIJV 2FB5A 1B04A 4LF7B 3NR7A 4NVPA 5K1XA 2Q4PA 4RUEA 3RBZA 4G28B 2ZXWB 2JDIG 4JI3O 3APQA 3LNMB 1OJHA 1IVSA 4CS2A 3L9DA 2QDOA 3CEIA 1FXHA 1KUQA 4OPAA 2UXXA 3WB0A 1NVPD 1PM9A 4IHJA 2Y0IA 4W4LA 4DR7O 2R72A 4Z1VA 2PGGA 3JAKA 2E76B 4LFBB 1YCIA 1VEWA 1JJ2U 4LFAO 1BT8A 1V9PA 4X62O 4R6ZA 1OZ0A 1AI4A 1MZFA 4ICGA 3G4SV 1VQ5V 1VMGA 3FYIB 2ITDC 3B8MA 4X1YA 2VWJA 4TT3G 3THOA 2UUAB 4JGSA 3SGIA 1IBLB 3ABLB 3JAWA 4R50A 1DTOA 3L74H 2XTAA 1DLBA 1K34A 1IZ3A 3FX7A 4HNAA 4EB6A 4P30A 2YICA 5KX5B 4TV9B 4TOIA 4EFBA 1XUQA 1BZKA 4LCUC 2DWDC 2GHYA 2ZDIC 2ZINA 4MVQA 2CAZC 1YEWA 2Y4TA 3VQXA 1AJQA 3SJBC 1FFTB 4UVBA 3JASA 1YXBA 1M93A 4BR6A 2PZSA 2GBOA 4QE9A 4JI3B 2FL4A 3DXRB 3STZC 3LSQA 5CBHA 2MK3A 2ZD9A 1SESA 1GMGA 1W59A 1HW7A 3E8BA 4NXNB 4DR7B 1WNSA 1FKAO 1LUVA 5J2UA 1Q7YW 1K7DA 4LNUA 1HNXO 2AXTZ 3DC5A 2Z5UA 4LF5B 5JCOC 5IWAB 4L8JA 4AQYO 1K92A 5JVDA 4BAYA 4MTXA 3FB8C 4DRXB 1VQ4V 2W6IG 2W0XA 5IE9A 2FYUH 1JFFA 1ZSPA 4O4HB 3U11A 1WPXA 2LJ2A 4RQEA 2CUGA 2YEVA 5FNVB 1SF9A 1K8AW 3OEEG 3OTFA 2Q7GA 5KAFZ 5LYJA 1S3JA 2JIZG 2QSAA 5KHJA 4GKJO 2K9PA 3IAYA 5CA0A 2WLIB 2A0LA 2GSMB 2WLHA 3ZRWA 4KUMA 5EBMC 4PJ0Z 1YI2V 4BW5A 4H0LB 4F6RB 5LMNO 1AB3A 2YUAA 1SQVH 1P84F 4J41A 5L3FA 2Q6AA 3VQVA 4NTXA 4LF6O 2YS8A 1SA0B 2ZKOA 4KL1A 5AG2A 4ZI7A 4GYCB 3CRRA 2VQFB 3QTCA 5K1PA 1Q6UA 1HNXB 2L35A 2NLJC 4D6TH 4PDMA 1XMOO 5FPOA 2QKCA 1RM1C 5B1NA 4AQYB 5JJEB 1EM1A 3BA9A 2PF4E 4ASUG 5EC1C 1KP3A 4UFZA 2OT5A 5LHHA 4FM1A 4GKKO 2XAFA 1AP6A 2M7WA 1JR9A 1OCCB 1URFA 2KG7A 5F2VO 4EFEA 4I9WA 2Q68A 1N36O 3AG3B 1EBOA 4KHPO 2DYRB 5BY1A 4P9OA 5CBGA 3CS5A 2EILC 3QO7A 3OMIB 3KG2A 1QR9A 3P30A 5A2QN 1H2SB 4MVOA 5CA1B 1G8MA 5LA6B 1ENVA 3A0RA 2EILB 2IH3C 5LMNB 2N05A 1BE3H 2YXHA 1CP9A 2WLJA 3JD3A 2A7WA 2AGAA 2LW7A 4MW8A 1A32A 3ZHUA 3SR2C 4LF6B 1M57C 3G6BA 3NXSA 4DR5O 1I0HA 4UXNA 1MA1A 5B1AC 4U3JA 2G38A 3SYQA 1FS0G 1DF5A 1QR8A 3ZHSA 5IDJA 1HWYA 4LF8B 3ZN1A 4IIJA 3CCVV 4G2KA 4J42A 2WLKA 1FXVA 1AROP 3FB6C 3K59A 5EZYB 4GKKB 1B6QA 1F4MA 2CTRA 2XOKG 2ZM6B 1N36B 2DWEC 1Y74B 2QKSA 1LUWA 4KHPB 4DO2A 3AG2C 1CPYA 1ZUQA 2LFSA 3SPGA 3SYAA 4TV8B 1GN6A 1PL0A 2CGOA 4G27B 1I94O 1VQ9V 4DR1B 3AG2B 4NR1A 3ZS8C 4C7UA 1W0JG 4DR4B 4I0XB 4I4TA 3L75H 3U0ZA 4JI7B 2KKWA 2OTLV 1YZBA 2WLMA 5CB4A 3K58A 1R73A 3TXSA 3RYIA 4Q6GA 4QE7A 1TAEA 3AG7A 4D7TA 4PA6A 2Z3YA 3P32A 2CTWA 4YY3B 3I55V 2BOCC 2OIGA 5J2TA 1WLEA 4JI0O 4FM2A 4FIPC 3B09A 3JALA 3HKEA 2JEUA 2ZIMA 2BSKA 2QWNB 3OMAB 3X2QB 4B7EA 1YTFB 1Q43A 3OW2U 1F7YA 4HYOA 3T4DA 4OX9O 1SZTA 4YHHB 3ETEA 5LP6B 2EZPA 3T1HO 4X1KA 2ZE5A 1ZTEA 5KUMA 4PELA 1XNRB 1T5EA 5IJ9B 4CH3A 3C90A 2EINB 3UCSC 1H8EG 4ZOLA 1IDSA 3ZHTA 3TJTA 4X89A 1SRYA 1D5AA 2N74A 2EZOA 4JYBA 4X20A 4LF4O 3R65A 4DV4O 4RAIA 5IY5C 2D3OW 1NTMH 1WA8B 3E89A 1L8DA 1B3QA 1VQ7V 1PD3A 4JI8B 4JI0B 1NH2D 2FKXA 1KP2A 3LNNA 3KZIZ 1NZ6A 2QM8A 1BL8A 3SJQC 1QNMA 2E74B 1GM9A 2ILMA 2M6YA 5IJ0B 5BMVA 3K04A 5IYZB 2QWOB 3WG7B 1NTZH 2ZQMA 1YITV 4OX9B 1I5XA 2HFEC 4I50A 2XHBA 3RN4A 4XDKA 4E2LA 3T1HB 1H2LA 2WSSG 5JQGB 1Q5OA 4X66B 1ZAUA 1WP7A 3MDSA 2DQ0A 1H2KA 4CC6A 3TCUA 3ZEDA 1UJWB 3GWOA 2CH7B 4MS2A 3P3PA 1OCRB 1KU9A 1R6TA 2DE0X 2YIBA 3M7MX 1PP9H 2JJ2G 1Q3EA 2V1DA 1PNMA 4DV4B 2KB1A 2XAGA 1ZL8B 5GONB 4ZKIA 2BTOA 1NQTA 4GUNA 2HVKC 1BSMA 4JI5O 3W7TA 2Q0AA 1VQ6V 2LW1A 3F7VC 3ABMC 1N32O 1GTOA 2N04A 1K3EA 4UB6Z 3CRMA 2EIMB 3E22A 2WA4A 4FM0A 3H9VA 1XQ8A 4IGGA 1K4CC 2P90A 1X4TA 4O2AA 1FPOA 2F1MA 2KQXA 4O2BA 3UT5A 3RVYA 1Y66A 2WLNA 3RYHB 4DR6O 1BMFG 4X65O 2JGDA 4X1IB 4ZHQB 1G1XB 5A9GA 3ZRSA 4B3RO 1F4NA 4H37A 3BHPA 4UCTA 1O9HA 4MW3A 1US6A 2PUSA 1M56C 3AG1C 3ABUA 1JX9A 2VRZA 1Z2GA 4WF9V 1VQ8V 2UXNA 1EN4A 2ZE8A 3RT3C 3H1LH 3H01A 2BOBC 4PDVA 1KB9F 4TUYA 4JI5B 4LP8A 4FK5C 2Y69C 1KKCA 3ZCCA 1SZXA 5L3GA 4GCZA 2P67A 2ZE7A 1N32B 1XBLA 4IHJB 4K8ZA 2DN9A 3S3XA 2AZ0A 2PI4A 4RO2A 1JPXA 3E8FA 2PY5A 1H2NA 1VQLV 3E8GA 4K3AA 3ABKB 4LFCO 3ZIAG 2ZR3A 1P7BA 4DV0O 5C93A 3J81N 2WLLA 3IC7A 4UCRA 5LXTA 1AVMA 2XAQA 1MNGA 3DGEA 4LH7A 3CYOA 3ASNB 1OCZC 2JEXA 4MVSA 4XDLA 3OUSA 2FMLA 4B3RB 5L3EA 3OE7G 1FXKA 4J7KA 4DV3B 4DW1A 3ZMTA 3JD4A 4DR3O 2B1IA 1Q8IA 1UFIA 3LUTB 4JTAB 1OCZB 4PA9A 4LF9O 3UQ8A 1AR4A 2DMXA 2ZXWC 3CX5F 2Q8VA 3F7YC 3RVZA 5EK0A 4K8XA 2QA4V 4JI1O 2ZE6A 3JASB 1OV9A 1XHXA 5FL7G 3WU2Z 3ZHQA 4FLZA 3ML0A 2XAHA 1IBMB 1H2MA 2F43G 4PV1B 1F51A 4OPHA 3ETQA 1VF5B 1ZWIC 2VQEO 3MD0A 4LWSB 3FB5C 4LFCB 3ABLC 1O9GA 3JYCA 3JAMN 2L6LA 1V54B 5GTHZ 2GUZA 1J5EO 3HB3B 4J9ZB 2ITCC 4BIUA 1JFFB 3TGUH 2H3OA 3A0HZ 4WFFA 3CCRV 2UUBO 1VIBA 2EULA 4DR3B 3HKDB 3CC4V 4DUZO 2YEVB 5B66Z 4U7NA 3E83A 1BHBA 4LF9B 4B7KA 2LGWA 3OM3B 3OMNB 4Q20A 1M4UA 2P6JA 4JI1B 3ZRWB 3K08A 3PJSK 3J80N 1JJOA 4JASA 5B1OA 1GRJA 2RJZA 1W0KG 2QTOA 3K06A 4NTYA 4FLTA 1COWG 3K9AA 1VQNV 5KHHA 2JRIA 3OGCC 4I55B 3STLC 4ZI7B 3FB7C 1YVWA 3K5MA 3C3SA 4LFAB 2EX3A 4X62B 2A9HA 2VQEB 1R3LC 1ZLZA 3H1KH 2IU0A 5LBQA 3L70H 3N2GA 2AZ2A 5E1AC 3LSUA 1Q6HA 3OT7A 2KG7B 5EIBD 3B8NA 2UUBB 5E79Z 1BCCH 2P4VA 3JD1A 4GZRB 3P3NA 4DUZB 3K79A 3L73H 1NR1A 1BGYH 4GX0A 3D3QA 1WP8A 1VF6C 5LL6Y 1J95A 4UCOA 2DYSC 1RFYA 5L3CA 5KMGA 2OCCB 2RMKB 4TSFG 3Q4HA 4NXMO 2UXBO 2DYSB 5KX5A 2ZCEA 1JCHA 2IW5A 1U97A 1MOFA 1NVPB 2QWPB 1GM7A 4U3JB 4HBNA 2BCCH 2ZDIA 1NJIW 1RSOA 1GO3F 1OCCC 1OCOB 3PN1A 2ADQB 3CPWU 4IIJB 2X0LA 3AG3C 2DYRC 2QTSA 3CMEV 1YJWV 1W2BU 2ARHA 5LGNA 3ABTA 3SPJA 2VWKA 3BABA 5H9CA 4DV1O 3EFFK 1FJGO 3N2KB 5B1BB 1VF7A 2OTJV 2IU3A 1K9MW 4GKJB 4YJ2B 4KP4A 5JCOA 1K33A 4O4HA 3J7AU 4BWAA 4QIWF 3CHXA 4DYLA 5FNVA 2HKOA 4UVCA 4J11A 1H8HG 1QVFU 4NXMB 3BA8A 2UXBB 2WAMA 1RP3B 2YIBD 4I4TB 5JH7B 4X9QA 4DK1A 1S77D 2WLIA 4AHCA 5KLVH 1SQXH 3SYPA 1N34O 2E3CA 5JJNB 3HKBB 5BR8O 3UO2A 1SQGA 1VF6A 3CC7V 3K3WA 1GH6A 1M5IA 1H2GA 1XMOB 3SPIA 3TXQA 2EIJB 1Y76B 4GLXA 2XAJA 4ABMA 4D7SA 5IYDO 4WBNB 2WA3A 2JK5C 2ETNA 1SA0A 2XASA 4J7ZA 5L3DA 3HKEB 2A06H 4Z2WA 1KQSU 3QO5A 1Q81W 3ZBHA 1HNWO 3T1YO 5KHKA 4BIZA 1TVKA 1QQCA 4JAUA 5C8YA 4UCVA 1KYOF 2AW9A 4QJFB 3D8CA 3HKCA 4UCSA 1AI5A 4JAVA 3FAVA 2F93B 3I56V 4F4LA 2CTQA 1GAXA 4ZOLB 2FTKA 1R6NA 4XBFA 4JI6O 1AP5A 3F5WC 1EZVH 4DR5B 3U10A 2ZIOA 4X20B 1GK9A 5LA6A 2EJ7A 1DK1A 4MVRA 5H5NA 4KFMA 2QE7G 3X2QC 3W7SA 1JMKC 3DSQA 3CCJV 3OFNG 1Y6XA 2HR3A 2IJKA 3RGBA 4CZZA 5LP6C 3ZRXA 3W7UA 4BW9A 3ICXA 3RYCB 1IBKO 4DXWA 3OAAG 1YHQV 1HNWB 1HNZO 4JYYA 5BMVB 2HVJC 3BRCA 3AK2A 1MZEA 1M1KW 2UUCO 4J10A 2EINC 5IT9N 2EJRA 4NB5A 1WN7A 1XHZA 2BTQB 1I94B 2O57A 4WFEA 1WB8A 3B2EE 2YI8A 2RNBA 3QVNA 4CS3A 3AK1A 1XL4A 4DW0A 3ZHVA 3CRAA 4JI6B 4FLUA 1AI7A 1QU7A 4O4IA 5ITZA 2Q7EA 1Z5WA 4JPRA 3DTUB 4DV5O 4GX1A 1B06A 4O4JB 4AILC 3WG7C 1TUBA 1M90W 1FFXA 3E22B 4HAMA 4JI4O 3CC2V 1IURA 2H8PC
chains in the Genus database with same CATH topology
4UB8Z 3A0BZ 4UB6Z 3A0HZ 5GTIZ 5H2FZ 1S5LZ 5KAIZ 5TISZ 5B66Z 4PJ0Z 3KZIZ 5KAFZ 3JCUZ 5B5EZ 4IL6Z 5E79Z 3WU2Z 2AXTZ 5GTHZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 Z;  3A0B Z;  4UB6 Z;  3A0H Z;  5GTI Z;  5H2F Z;  1S5L Z;  5KAI Z;  5TIS Z;  5B66 Z;  4PJ0 Z;  3KZI Z;  5KAF Z;  3JCU Z;  5B5E Z;  4IL6 Z;  5E79 Z;  3WU2 Z;  2AXT Z;  5GTH Z; 
#chains in the Genus database with same CATH topology
 2GTA A;  3LDE A;  2X7R B;  2R9R B;  4MT8 A;  2LQT A;  1WB7 A;  1EFR G;  4O2A B;  4O2B B;  3RFR A;  3K9S A;  4PA4 A;  3UT5 B;  5B3S B;  3CP1 A;  1I5Y A;  1JQ0 A;  2UU9 O;  1MSW D;  4I7Z B;  2F4V O;  3CCL V;  1S5J A;  3IJ4 A;  1S5H C;  1XNQ O;  1OCR C;  2CE4 A;  1VQM V;  3AG4 B;  4DV7 O;  3ASO C;  3ZMU A;  4JF3 A;  2R70 A;  4FLX A;  1NU1 H;  5H2F Z;  4LF4 B;  3ASO B;  2QM4 A;  2ZNI A;  1HDJ A;  4YJ3 A;  5HFM A;  4F6E A;  2CGN A;  2IJH A;  2EIM C;  4J7J A;  1AIL A;  5KUK A;  3R66 A;  3JAR B;  4I9Q A;  1S0V A;  5DM6 V;  3QO8 A;  1NI8 A;  2V7Q G;  3RYF A;  5DED A;  4FLY A;  1RPR A;  1WA8 A;  3G67 A;  1HR0 O;  4JI4 B;  2HEP A;  3UM7 A;  4E4E A;  5EYP B;  3JAT B;  1BHA A;  2HLD G;  2JS5 A;  2E75 B;  2PTM A;  2HJF C;  1S72 V;  1GN3 A;  4JYA O;  4UB8 Z;  5DEC A;  3K5N A;  2UU9 B;  2F4V B;  5KA5 A;  1N33 O;  1XNQ B;  5IJ0 A;  2IBZ H;  3H1H H;  3K0D A;  1VQO V;  5KHG A;  2YC0 A;  5H6R A;  5LHG A;  3GWK C;  4GX5 A;  5BXZ A;  1ZX3 A;  3T4Z A;  1PV0 A;  3A2F A;  4O4L A;  4DR2 O;  2YSU B;  4CC5 A;  4WFB V;  4ZBM A;  3CJH A;  3ABK C;  3FYE B;  1QHT A;  4LF7 O;  1TGO A;  1SQB H;  3JAK B;  2OWO A;  4UV9 A;  5JJJ B;  4R7C A;  1K73 W;  4JTC B;  2K1E A;  3EVK A;  1P7G A;  1NH2 B;  5H6Q A;  2CTP A;  3ASN C;  2QJ1 A;  2X6A A;  4YIO A;  4DR6 B;  2PYJ A;  4X1Y B;  2HP8 A;  4X65 B;  1FD9 A;  4EKW A;  2HHH O;  4JYA B;  1N0J A;  2GUZ B;  4FVM A;  5EBW C;  3VQW A;  4FZ1 A;  5LHI A;  3APO A;  1N33 B;  1ORQ C;  3JAW B;  3SYC A;  2YXL A;  3GB7 C;  4HNA B;  4MTF A;  4EB6 B;  3RYH A;  5D5Q A;  1XDC A;  4MVM A;  4PI2 A;  1KBH A;  1LNQ A;  1VQK V;  4RWU A;  4X1I A;  2YI9 A;  1KD1 W;  4ZHQ A;  1Q82 W;  5DN6 G;  1IBL O;  2QR4 A;  2JJ1 G;  4DK0 A;  4FZ0 A;  4DR2 B;  3DC6 A;  1KKD A;  2QWR B;  1TA8 A;  2CDY A;  1QLE C;  1GN4 A;  1H38 A;  2RN9 A;  1ROP A;  5LOV A;  1V55 B;  2MW2 B;  4PHZ A;  2RQ6 A;  4QGP A;  1QLE B;  3IFX A;  4PDR A;  2OIE A;  5KAI Z;  2Q5Z A;  2GDS A;  4JTD B;  5J2U B;  1K5Q A;  3CXC U;  5KA6 A;  4X8A A;  3CWB H;  4LNU B;  1V54 C;  3BVO A;  4FFB A;  2P4K A;  2JGU A;  5JVD B;  4DV0 B;  1EN6 A;  3VOU A;  4NXN O;  4WCE V;  3D36 C;  3JD0 A;  2ZR2 A;  2X6C A;  3N2G B;  3OR6 C;  1SS3 A;  2HHH B;  1PNL A;  2XUM A;  2OCH A;  4W4K A;  2OYQ A;  3FKS G;  4FPP A;  1GKF A;  2GV9 A;  4LF5 O;  5IWA O;  4EEQ A;  5EBL C;  4PDL A;  5LYJ B;  1FAF A;  4MVZ A;  3W7W A;  1NKD A;  5CA0 B;  3A8T A;  3QNE A;  1E79 G;  2A3Q A;  5KHI A;  5KMG B;  4MSW C;  3RWR D;  3Q4H B;  3B77 A;  2WWW A;  3ETG A;  1BQ0 A;  1R3I C;  1PKX A;  4CH4 A;  2IM9 A;  3HPL C;  2Z0A A;  2QWQ B;  5D5P A;  3SJC C;  2B9Z A;  1RSO B;  1SC5 B;  1Z5V A;  5BZB A;  2HJD A;  4I5S A;  3L71 H;  2PYL A;  3F5T A;  1MMM A;  2B5U A;  1J5E B;  2A79 B;  2VQF O;  3C3T A;  2LFR A;  2F95 B;  4X64 O;  3T2M A;  1CEZ A;  3K57 A;  2AHY A;  3N27 A;  4BIO A;  2ADP A;  3OUF A;  4LWS A;  3G80 A;  4FLW A;  1KC8 W;  5FPR A;  2OCC C;  4IYH A;  2X6B A;  3ZMV A;  3OTO O;  1Q86 W;  3SPC A;  4UCU A;  4YIP A;  3D36 A;  1D2D A;  3SPH A;  1SKV A;  4OGQ B;  4WFA V;  3HKD A;  2H94 A;  1NR7 A;  3MHH C;  1L1F A;  2DQ3 A;  2Y0P A;  2LO1 A;  2ATK C;  4TV9 A;  1Y4M A;  4X88 A;  4NKG B;  2F66 C;  4AI8 A;  3WB1 A;  4JI2 O;  1AJP A;  3CRC A;  3I5D A;  1OCO C;  4CS4 A;  4JZ2 A;  1PNK A;  4JZG A;  3JCZ A;  3DXR A;  3OEH G;  1QBZ A;  3W7X A;  1N8R W;  4MTG A;  3UKM A;  2P5O A;  4IL6 Z;  1XIL A;  1QCE A;  3E8H A;  1EZJ A;  4HZ3 A;  3WB2 A;  1R3J C;  1SQQ H;  2Q0O C;  1K4D C;  5B1B C;  4I55 A;  4X64 B;  1S5L Z;  5JWP A;  2Q73 A;  2DW4 A;  1SQP H;  4DRX A;  4LF8 O;  1TVK B;  3CD6 V;  1YTF D;  4PI0 A;  3BAA A;  3OTO B;  4DUY O;  5C8Y B;  1THZ A;  4WFG A;  1RM1 B;  2QEX V;  1CXZ B;  3ZRV A;  1XMQ O;  1MSD A;  3HKC B;  2ZM6 O;  2HG5 C;  3SDL A;  1HP8 A;  3L72 H;  4MTO A;  1WAZ A;  3FAV B;  4RUF A;  5CB4 B;  4K0K O;  4JI2 B;  2E5L O;  5HFL A;  3RYI B;  1I7F A;  1Q90 D;  2EIJ C;  1X59 A;  4A5U B;  4DR1 O;  4F6R A;  1QVG U;  1BS3 A;  1MAB G;  4LC1 A;  3CCM V;  4DR4 O;  1XRE A;  4JI7 O;  2YIA A;  3H1J H;  4IT5 A;  5J2T B;  3BPZ A;  4DV6 O;  3O9O A;  2NR5 A;  1G6U A;  2F23 A;  1Y67 A;  3E86 A;  1NBM G;  3M8A A;  3JAL B;  3WFV A;  2DOS A;  4P9P A;  3EHB B;  2BSK B;  4FFK A;  5EIB C;  2ODM A;  1M57 B;  4YY3 O;  3K03 A;  3UO3 A;  4DV1 B;  5B1A B;  1FJG B;  2UXC O;  1M9N A;  1SET A;  2ZT9 B;  1IX9 A;  2CK3 G;  2QM7 A;  2W6J G;  4DUY B;  4UUJ C;  2Q69 A;  4CH5 A;  4X1K B;  4N21 A;  3RW0 A;  1DGS A;  1JOY A;  2JVD A;  1XI1 A;  1XMQ B;  1R1B A;  3N2K A;  2LGQ A;  2W0F C;  3IGA C;  4YHH O;  3LDD A;  2PI5 A;  1D5N A;  4YJ2 A;  3LDC A;  4FLV A;  4K0K B;  1L0L H;  1E1R G;  1XNR O;  2E5L B;  5CA1 A;  1N34 B;  1IXB A;  1XEQ A;  4FJC C;  5GW7 A;  5BR8 B;  4TWK A;  4O4I B;  5ITZ B;  4CH6 A;  5JH7 A;  3BFR A;  3T1C A;  1L0N H;  4J9Y B;  4DV6 B;  3E35 A;  4WFH A;  4B08 A;  3D3I A;  3HKB A;  4Z1M G;  4JAA A;  3FFQ A;  1TUB B;  5LGU A;  1FFX B;  2AHZ A;  4XDJ A;  4RQF A;  3ZJZ A;  3ZX6 A;  5TIS Z;  2IJJ A;  3T1Y B;  1Y76 A;  3CCQ V;  2UXC B;  4WBN A;  4JI8 O;  2NNU A;  5EZY A;  4I50 B;  2NN4 A;  2C2A A;  4IYI A;  4OXS A;  3G6E V;  2XND G;  1I08 A;  4L87 A;  3A0B Z;  3K5L A;  3CRQ A;  3KKY A;  3OD4 A;  3CSX A;  3BEH A;  1Y74 A;  1XOU A;  3CB2 A;  4B3M O;  1XL6 A;  3AK3 A;  4QPJ A;  3G71 V;  4UVA A;  3IC9 A;  4TV8 A;  1MG1 A;  3QF7 A;  5L3B A;  3K5O A;  1G4Y B;  1GN2 A;  2Q9L A;  1AJN A;  3JSN A;  4X66 O;  4I0X A;  4YJ3 B;  5GTI Z;  5LMU O;  2BE3 A;  4YXW G;  3HR0 A;  4PD4 F;  3B4S A;  1TUE B;  2R9A A;  5FLX N;  1VQP V;  3EXA A;  2XT9 A;  5J9P C;  1OHH G;  3RYF B;  3ZMS A;  5B3S C;  4H44 B;  4LBE C;  1IBK B;  5IYB O;  4JV5 O;  3O65 A;  2Y48 A;  1HNZ B;  4CBC A;  4DV2 O;  5IY5 B;  5CBF A;  3E2E A;  2UUC B;  3AG4 C;  1SER A;  2YXY A;  2JGD B;  1BQZ A;  3RYC A;  2RDC A;  2QKA A;  4KXR A;  4U3F H;  3CCE V;  5B5E Z;  3GVM A;  2R9I A;  2P7T C;  1R6K A;  1UPG A;  3ZHR A;  5LP6 A;  3JSL A;  4ZIB A;  4B3M B;  2UXD O;  4B3T O;  5CN0 A;  3LSS A;  3CCU V;  1JVM A;  1S76 D;  2BTQ A;  4MVU A;  5IJ9 A;  1JA8 A;  4TQD A;  2D2C B;  4O4L B;  3JCU Z;  3AEI A;  1U96 A;  1AR5 A;  1EN5 A;  2DJV A;  1AR1 B;  5LMU B;  3CJH B;  4P2Z A;  4TUY B;  1IXM A;  2GTS A;  2LP7 A;  1VP7 A;  1N4C A;  4DV5 B;  3B40 A;  2YDE A;  3S3W A;  4GX2 A;  3KCX A;  1NS1 A;  4JYC A;  3VQY A;  2JS3 A;  1RPO A;  3M99 B;  1F23 A;  1KMI Z;  2V4D A;  1YJN V;  4U7O A;  1QLN A;  4N23 A;  1VAR A;  2KSD A;  3CCS V;  1DF4 A;  3CMA V;  4JV5 B;  1PPJ H;  3QG5 A;  3KCY A;  4QNH B;  4DV2 B;  1P49 A;  4O4J A;  4UV8 A;  3ETD A;  1FXK C;  2WLL B;  4B3S O;  1YJ9 V;  1NTK H;  2Y4U A;  5EC2 C;  5LXT B;  5LGT A;  1K5S A;  1R3K C;  3ABM B;  5IYZ A;  2QGN A;  1FXK B;  3FD9 A;  1K97 A;  2P06 A;  4DV7 B;  2IJI A;  4J80 A;  1N0N A;  2EBO A;  4TQF A;  2UXD B;  4B3T B;  5JQG A;  3BY6 A;  3MAQ A;  1FYJ A;  1LR1 A;  3VBB A;  4H33 A;  5CMU A;  2B1G A;  4DV3 O;  3CE2 A;  2ZNJ A;  1WPB A;  2CH7 A;  5LOV B;  4NYK A;  2WPD G;  1E1Q G;  1M56 B;  3OR7 C;  3ZN0 A;  1ZL8 A;  5GON A;  4H13 B;  3AG1 B;  3BCC H;  1AI6 A;  2YID A;  3CXH F;  1HR0 B;  1PL4 A;  3MHS C;  4K35 A;  1YDX A;  4FFB B;  1KEC A;  2VS0 A;  3JAR A;  2Q67 A;  1SQF A;  3TET A;  4B3S B;  1GM8 A;  1IBM O;  4LFB O;  4PA7 A;  2Q7H A;  4LR3 A;  4GT1 A;  2Y69 B;  4FMT A;  1P4R A;  4LH6 A;  4QPK A;  1WJZ A;  3K0G A;  1NT2 B;  5EYP A;  4R8C A;  2EIK C;  3JAT A;  1Q6I A;  2IH1 C;  3TK1 A;  3SJA C;  2UUA O;  3ZMZ A;  2EIK B;  1V55 C;  4NTW A;  5CA3 A;  5IYC O;  3SYO A;  1YSC A;  2RCV A;  4PA3 A;  3H1I H;  1YF2 A;  3JD2 A;  2P22 C;  3OGI B;  1YIJ V;  2FB5 A;  1B04 A;  4LF7 B;  3NR7 A;  4NVP A;  5K1X A;  2Q4P A;  4RUE A;  3RBZ A;  4G28 B;  2ZXW B;  2JDI G;  4JI3 O;  3APQ A;  3LNM B;  1OJH A;  1IVS A;  4CS2 A;  3L9D A;  2QDO A;  3CEI A;  1FXH A;  1KUQ A;  4OPA A;  2UXX A;  3WB0 A;  1NVP D;  1PM9 A;  4IHJ A;  2Y0I A;  4W4L A;  4DR7 O;  2R72 A;  4Z1V A;  2PGG A;  3JAK A;  2E76 B;  4LFB B;  1YCI A;  1VEW A;  1JJ2 U;  4LFA O;  1BT8 A;  1V9P A;  4X62 O;  4R6Z A;  1OZ0 A;  1AI4 A;  1MZF A;  4ICG A;  3G4S V;  1VQ5 V;  1VMG A;  3FYI B;  2ITD C;  3B8M A;  4X1Y A;  2VWJ A;  4TT3 G;  3THO A;  2UUA B;  4JGS A;  3SGI A;  1IBL B;  3ABL B;  3JAW A;  4R50 A;  1DTO A;  3L74 H;  2XTA A;  1DLB A;  1K34 A;  1IZ3 A;  3FX7 A;  4HNA A;  4EB6 A;  4P30 A;  2YIC A;  5KX5 B;  4TV9 B;  4TOI A;  4EFB A;  1XUQ A;  1BZK A;  4LCU C;  2DWD C;  2GHY A;  2ZDI C;  2ZIN A;  4MVQ A;  2CAZ C;  1YEW A;  2Y4T A;  3VQX A;  1AJQ A;  3SJB C;  1FFT B;  4UVB A;  3JAS A;  1YXB A;  1M93 A;  4BR6 A;  2PZS A;  2GBO A;  4QE9 A;  4JI3 B;  2FL4 A;  3DXR B;  3STZ C;  3LSQ A;  5CBH A;  2MK3 A;  2ZD9 A;  1SES A;  1GMG A;  1W59 A;  1HW7 A;  3E8B A;  4NXN B;  4DR7 B;  1WNS A;  1FKA O;  1LUV A;  5J2U A;  1Q7Y W;  1K7D A;  4LNU A;  1HNX O;  2AXT Z;  3DC5 A;  2Z5U A;  4LF5 B;  5JCO C;  5IWA B;  4L8J A;  4AQY O;  1K92 A;  5JVD A;  4BAY A;  4MTX A;  3FB8 C;  4DRX B;  1VQ4 V;  2W6I G;  2W0X A;  5IE9 A;  2FYU H;  1JFF A;  1ZSP A;  4O4H B;  3U11 A;  1WPX A;  2LJ2 A;  4RQE A;  2CUG A;  2YEV A;  5FNV B;  1SF9 A;  1K8A W;  3OEE G;  3OTF A;  2Q7G A;  5KAF Z;  5LYJ A;  1S3J A;  2JIZ G;  2QSA A;  5KHJ A;  4GKJ O;  2K9P A;  3IAY A;  5CA0 A;  2WLI B;  2A0L A;  2GSM B;  2WLH A;  3ZRW A;  4KUM A;  5EBM C;  4PJ0 Z;  1YI2 V;  4BW5 A;  4H0L B;  4F6R B;  5LMN O;  1AB3 A;  2YUA A;  1SQV H;  1P84 F;  4J41 A;  5L3F A;  2Q6A A;  3VQV A;  4NTX A;  4LF6 O;  2YS8 A;  1SA0 B;  2ZKO A;  4KL1 A;  5AG2 A;  4ZI7 A;  4GYC B;  3CRR A;  2VQF B;  3QTC A;  5K1P A;  1Q6U A;  1HNX B;  2L35 A;  2NLJ C;  4D6T H;  4PDM A;  1XMO O;  5FPO A;  2QKC A;  1RM1 C;  5B1N A;  4AQY B;  5JJE B;  1EM1 A;  3BA9 A;  2PF4 E;  4ASU G;  5EC1 C;  1KP3 A;  4UFZ A;  2OT5 A;  5LHH A;  4FM1 A;  4GKK O;  2XAF A;  1AP6 A;  2M7W A;  1JR9 A;  1OCC B;  1URF A;  2KG7 A;  5F2V O;  4EFE A;  4I9W A;  2Q68 A;  1N36 O;  3AG3 B;  1EBO A;  4KHP O;  2DYR B;  5BY1 A;  4P9O A;  5CBG A;  3CS5 A;  2EIL C;  3QO7 A;  3OMI B;  3KG2 A;  1QR9 A;  3P30 A;  5A2Q N;  1H2S B;  4MVO A;  5CA1 B;  1G8M A;  5LA6 B;  1ENV A;  3A0R A;  2EIL B;  2IH3 C;  5LMN B;  2N05 A;  1BE3 H;  2YXH A;  1CP9 A;  2WLJ A;  3JD3 A;  2A7W A;  2AGA A;  2LW7 A;  4MW8 A;  1A32 A;  3ZHU A;  3SR2 C;  4LF6 B;  1M57 C;  3G6B A;  3NXS A;  4DR5 O;  1I0H A;  4UXN A;  1MA1 A;  5B1A C;  4U3J A;  2G38 A;  3SYQ A;  1FS0 G;  1DF5 A;  1QR8 A;  3ZHS A;  5IDJ A;  1HWY A;  4LF8 B;  3ZN1 A;  4IIJ A;  3CCV V;  4G2K A;  4J42 A;  2WLK A;  1FXV A;  1ARO P;  3FB6 C;  3K59 A;  5EZY B;  4GKK B;  1B6Q A;  1F4M A;  2CTR A;  2XOK G;  2ZM6 B;  1N36 B;  2DWE C;  1Y74 B;  2QKS A;  1LUW A;  4KHP B;  4DO2 A;  3AG2 C;  1CPY A;  1ZUQ A;  2LFS A;  3SPG A;  3SYA A;  4TV8 B;  1GN6 A;  1PL0 A;  2CGO A;  4G27 B;  1I94 O;  1VQ9 V;  4DR1 B;  3AG2 B;  4NR1 A;  3ZS8 C;  4C7U A;  1W0J G;  4DR4 B;  4I0X B;  4I4T A;  3L75 H;  3U0Z A;  4JI7 B;  2KKW A;  2OTL V;  1YZB A;  2WLM A;  5CB4 A;  3K58 A;  1R73 A;  3TXS A;  3RYI A;  4Q6G A;  4QE7 A;  1TAE A;  3AG7 A;  4D7T A;  4PA6 A;  2Z3Y A;  3P32 A;  2CTW A;  4YY3 B;  3I55 V;  2BOC C;  2OIG A;  5J2T A;  1WLE A;  4JI0 O;  4FM2 A;  4FIP C;  3B09 A;  3JAL A;  3HKE A;  2JEU A;  2ZIM A;  2BSK A;  2QWN B;  3OMA B;  3X2Q B;  4B7E A;  1YTF B;  1Q43 A;  3OW2 U;  1F7Y A;  4HYO A;  3T4D A;  4OX9 O;  1SZT A;  4YHH B;  3ETE A;  5LP6 B;  2EZP A;  3T1H O;  4X1K A;  2ZE5 A;  1ZTE A;  5KUM A;  4PEL A;  1XNR B;  1T5E A;  5IJ9 B;  4CH3 A;  3C90 A;  2EIN B;  3UCS C;  1H8E G;  4ZOL A;  1IDS A;  3ZHT A;  3TJT A;  4X89 A;  1SRY A;  1D5A A;  2N74 A;  2EZO A;  4JYB A;  4X20 A;  4LF4 O;  3R65 A;  4DV4 O;  4RAI A;  5IY5 C;  2D3O W;  1NTM H;  1WA8 B;  3E89 A;  1L8D A;  1B3Q A;  1VQ7 V;  1PD3 A;  4JI8 B;  4JI0 B;  1NH2 D;  2FKX A;  1KP2 A;  3LNN A;  3KZI Z;  1NZ6 A;  2QM8 A;  1BL8 A;  3SJQ C;  1QNM A;  2E74 B;  1GM9 A;  2ILM A;  2M6Y A;  5IJ0 B;  5BMV A;  3K04 A;  5IYZ B;  2QWO B;  3WG7 B;  1NTZ H;  2ZQM A;  1YIT V;  4OX9 B;  1I5X A;  2HFE C;  4I50 A;  2XHB A;  3RN4 A;  4XDK A;  4E2L A;  3T1H B;  1H2L A;  2WSS G;  5JQG B;  1Q5O A;  4X66 B;  1ZAU A;  1WP7 A;  3MDS A;  2DQ0 A;  1H2K A;  4CC6 A;  3TCU A;  3ZED A;  1UJW B;  3GWO A;  2CH7 B;  4MS2 A;  3P3P A;  1OCR B;  1KU9 A;  1R6T A;  2DE0 X;  2YIB A;  3M7M X;  1PP9 H;  2JJ2 G;  1Q3E A;  2V1D A;  1PNM A;  4DV4 B;  2KB1 A;  2XAG A;  1ZL8 B;  5GON B;  4ZKI A;  2BTO A;  1NQT A;  4GUN A;  2HVK C;  1BSM A;  4JI5 O;  3W7T A;  2Q0A A;  1VQ6 V;  2LW1 A;  3F7V C;  3ABM C;  1N32 O;  1GTO A;  2N04 A;  1K3E A;  4UB6 Z;  3CRM A;  2EIM B;  3E22 A;  2WA4 A;  4FM0 A;  3H9V A;  1XQ8 A;  4IGG A;  1K4C C;  2P90 A;  1X4T A;  4O2A A;  1FPO A;  2F1M A;  2KQX A;  4O2B A;  3UT5 A;  3RVY A;  1Y66 A;  2WLN A;  3RYH B;  4DR6 O;  1BMF G;  4X65 O;  2JGD A;  4X1I B;  4ZHQ B;  1G1X B;  5A9G A;  3ZRS A;  4B3R O;  1F4N A;  4H37 A;  3BHP A;  4UCT A;  1O9H A;  4MW3 A;  1US6 A;  2PUS A;  1M56 C;  3AG1 C;  3ABU A;  1JX9 A;  2VRZ A;  1Z2G A;  4WF9 V;  1VQ8 V;  2UXN A;  1EN4 A;  2ZE8 A;  3RT3 C;  3H1L H;  3H01 A;  2BOB C;  4PDV A;  1KB9 F;  4TUY A;  4JI5 B;  4LP8 A;  4FK5 C;  2Y69 C;  1KKC A;  3ZCC A;  1SZX A;  5L3G A;  4GCZ A;  2P67 A;  2ZE7 A;  1N32 B;  1XBL A;  4IHJ B;  4K8Z A;  2DN9 A;  3S3X A;  2AZ0 A;  2PI4 A;  4RO2 A;  1JPX A;  3E8F A;  2PY5 A;  1H2N A;  1VQL V;  3E8G A;  4K3A A;  3ABK B;  4LFC O;  3ZIA G;  2ZR3 A;  1P7B A;  4DV0 O;  5C93 A;  3J81 N;  2WLL A;  3IC7 A;  4UCR A;  5LXT A;  1AVM A;  2XAQ A;  1MNG A;  3DGE A;  4LH7 A;  3CYO A;  3ASN B;  1OCZ C;  2JEX A;  4MVS A;  4XDL A;  3OUS A;  2FML A;  4B3R B;  5L3E A;  3OE7 G;  1FXK A;  4J7K A;  4DV3 B;  4DW1 A;  3ZMT A;  3JD4 A;  4DR3 O;  2B1I A;  1Q8I A;  1UFI A;  3LUT B;  4JTA B;  1OCZ B;  4PA9 A;  4LF9 O;  3UQ8 A;  1AR4 A;  2DMX A;  2ZXW C;  3CX5 F;  2Q8V A;  3F7Y C;  3RVZ A;  5EK0 A;  4K8X A;  2QA4 V;  4JI1 O;  2ZE6 A;  3JAS B;  1OV9 A;  1XHX A;  5FL7 G;  3WU2 Z;  3ZHQ A;  4FLZ A;  3ML0 A;  2XAH A;  1IBM B;  1H2M A;  2F43 G;  4PV1 B;  1F51 A;  4OPH A;  3ETQ A;  1VF5 B;  1ZWI C;  2VQE O;  3MD0 A;  4LWS B;  3FB5 C;  4LFC B;  3ABL C;  1O9G A;  3JYC A;  3JAM N;  2L6L A;  1V54 B;  5GTH Z;  2GUZ A;  1J5E O;  3HB3 B;  4J9Z B;  2ITC C;  4BIU A;  1JFF B;  3TGU H;  2H3O A;  3A0H Z;  4WFF A;  3CCR V;  2UUB O;  1VIB A;  2EUL A;  4DR3 B;  3HKD B;  3CC4 V;  4DUZ O;  2YEV B;  5B66 Z;  4U7N A;  3E83 A;  1BHB A;  4LF9 B;  4B7K A;  2LGW A;  3OM3 B;  3OMN B;  4Q20 A;  1M4U A;  2P6J A;  4JI1 B;  3ZRW B;  3K08 A;  3PJS K;  3J80 N;  1JJO A;  4JAS A;  5B1O A;  1GRJ A;  2RJZ A;  1W0K G;  2QTO A;  3K06 A;  4NTY A;  4FLT A;  1COW G;  3K9A A;  1VQN V;  5KHH A;  2JRI A;  3OGC C;  4I55 B;  3STL C;  4ZI7 B;  3FB7 C;  1YVW A;  3K5M A;  3C3S A;  4LFA B;  2EX3 A;  4X62 B;  2A9H A;  2VQE B;  1R3L C;  1ZLZ A;  3H1K H;  2IU0 A;  5LBQ A;  3L70 H;  3N2G A;  2AZ2 A;  5E1A C;  3LSU A;  1Q6H A;  3OT7 A;  2KG7 B;  5EIB D;  3B8N A;  2UUB B;  5E79 Z;  1BCC H;  2P4V A;  3JD1 A;  4GZR B;  3P3N A;  4DUZ B;  3K79 A;  3L73 H;  1NR1 A;  1BGY H;  4GX0 A;  3D3Q A;  1WP8 A;  1VF6 C;  5LL6 Y;  1J95 A;  4UCO A;  2DYS C;  1RFY A;  5L3C A;  5KMG A;  2OCC B;  2RMK B;  4TSF G;  3Q4H A;  4NXM O;  2UXB O;  2DYS B;  5KX5 A;  2ZCE A;  1JCH A;  2IW5 A;  1U97 A;  1MOF A;  1NVP B;  2QWP B;  1GM7 A;  4U3J B;  4HBN A;  2BCC H;  2ZDI A;  1NJI W;  1RSO A;  1GO3 F;  1OCC C;  1OCO B;  3PN1 A;  2ADQ B;  3CPW U;  4IIJ B;  2X0L A;  3AG3 C;  2DYR C;  2QTS A;  3CME V;  1YJW V;  1W2B U;  2ARH A;  5LGN A;  3ABT A;  3SPJ A;  2VWK A;  3BAB A;  5H9C A;  4DV1 O;  3EFF K;  1FJG O;  3N2K B;  5B1B B;  1VF7 A;  2OTJ V;  2IU3 A;  1K9M W;  4GKJ B;  4YJ2 B;  4KP4 A;  5JCO A;  1K33 A;  4O4H A;  3J7A U;  4BWA A;  4QIW F;  3CHX A;  4DYL A;  5FNV A;  2HKO A;  4UVC A;  4J11 A;  1H8H G;  1QVF U;  4NXM B;  3BA8 A;  2UXB B;  2WAM A;  1RP3 B;  2YIB D;  4I4T B;  5JH7 B;  4X9Q A;  4DK1 A;  1S77 D;  2WLI A;  4AHC A;  5KLV H;  1SQX H;  3SYP A;  1N34 O;  2E3C A;  5JJN B;  3HKB B;  5BR8 O;  3UO2 A;  1SQG A;  1VF6 A;  3CC7 V;  3K3W A;  1GH6 A;  1M5I A;  1H2G A;  1XMO B;  3SPI A;  3TXQ A;  2EIJ B;  1Y76 B;  4GLX A;  2XAJ A;  4ABM A;  4D7S A;  5IYD O;  4WBN B;  2WA3 A;  2JK5 C;  2ETN A;  1SA0 A;  2XAS A;  4J7Z A;  5L3D A;  3HKE B;  2A06 H;  4Z2W A;  1KQS U;  3QO5 A;  1Q81 W;  3ZBH A;  1HNW O;  3T1Y O;  5KHK A;  4BIZ A;  1TVK A;  1QQC A;  4JAU A;  5C8Y A;  4UCV A;  1KYO F;  2AW9 A;  4QJF B;  3D8C A;  3HKC A;  4UCS A;  1AI5 A;  4JAV A;  3FAV A;  2F93 B;  3I56 V;  4F4L A;  2CTQ A;  1GAX A;  4ZOL B;  2FTK A;  1R6N A;  4XBF A;  4JI6 O;  1AP5 A;  3F5W C;  1EZV H;  4DR5 B;  3U10 A;  2ZIO A;  4X20 B;  1GK9 A;  5LA6 A;  2EJ7 A;  1DK1 A;  4MVR A;  5H5N A;  4KFM A;  2QE7 G;  3X2Q C;  3W7S A;  1JMK C;  3DSQ A;  3CCJ V;  3OFN G;  1Y6X A;  2HR3 A;  2IJK A;  3RGB A;  4CZZ A;  5LP6 C;  3ZRX A;  3W7U A;  4BW9 A;  3ICX A;  3RYC B;  1IBK O;  4DXW A;  3OAA G;  1YHQ V;  1HNW B;  1HNZ O;  4JYY A;  5BMV B;  2HVJ C;  3BRC A;  3AK2 A;  1MZE A;  1M1K W;  2UUC O;  4J10 A;  2EIN C;  5IT9 N;  2EJR A;  4NB5 A;  1WN7 A;  1XHZ A;  2BTQ B;  1I94 B;  2O57 A;  4WFE A;  1WB8 A;  3B2E E;  2YI8 A;  2RNB A;  3QVN A;  4CS3 A;  3AK1 A;  1XL4 A;  4DW0 A;  3ZHV A;  3CRA A;  4JI6 B;  4FLU A;  1AI7 A;  1QU7 A;  4O4I A;  5ITZ A;  2Q7E A;  1Z5W A;  4JPR A;  3DTU B;  4DV5 O;  4GX1 A;  1B06 A;  4O4J B;  4AIL C;  3WG7 C;  1TUB A;  1M90 W;  1FFX A;  3E22 B;  4HAM A;  4JI4 O;  3CC2 V;  1IUR A;  2H8P C; 
#chains in the Genus database with same CATH homology
 4UB8 Z;  3A0B Z;  4UB6 Z;  3A0H Z;  5GTI Z;  5H2F Z;  1S5L Z;  5KAI Z;  5TIS Z;  5B66 Z;  4PJ0 Z;  3KZI Z;  5KAF Z;  3JCU Z;  5B5E Z;  4IL6 Z;  5E79 Z;  3WU2 Z;  2AXT Z;  5GTH Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...