5B5EZ

Crystal structure analysis of photosystem ii complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 26
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5b5eZ00
5GTIZ 5KAIZ 5GTHZ 4UB6Z 5B5EZ 5E79Z 3KZIZ 3A0BZ 5H2FZ 5B66Z 3JCUZ 3WU2Z 5TISZ 4PJ0Z 5KAFZ 4UB8Z 1S5LZ 2AXTZ 3A0HZ 4IL6Z
chains in the Genus database with same CATH superfamily
3TETA 5BXZA 1EBOA 4FLYA 2QWQB 2ZE7A 4FIPC 1XEQA 1JJOA 5AG2A 1E1QG 4NYKA 4FLUA 1HWYA 4DV2B 1M4UA 5CA3A 4PJ0Z 1VP7A 3T1CA 5DM6V 5CBHA 1RP3B 3P32A 3THOA 1THZA 3O9OA 4KXRA 3BRCA 1KQSU 1Q90D 1M93A 1OCZC 1BHBA 3H1HH 4JZGA 4R8CA 3K04A 4ZHQA 4EEQA 2V1DA 1VQ8V 3FYEB 2CH7A 2PTMA 4MTFA 1YJWV 3ZMTA 3KCYA 3SYCA 1J5EB 1IBMO 3ZHSA 2W6IG 1R3JC 4LNUA 1NQTA 1OCZB 1PNKA 3M8AA 1H2KA 4BW9A 4ZI7A 4JI1B 3KKYA 3MHHC 1IBKB 4DR3B 3G71V 2PI5A 5KUKA 3K9SA 4E4EA 1NTZH 1Q5OA 2LO1A 1XILA 1NT2B 4MVZA 1NTKH 3CD6V 4U7NA 2YIAA 4QJFB 3H1IH 2H3OA 2QWOB 4DR5O 1SERA 2Y0IA 4JYAB 5BMVA 4DV4O 3BEHA 4DV5B 3ZN0A 3TXSA 3CCUV 2CTPA 2F66C 4ABMA 4X64B 4PI0A 5B3SC 3E2EA 3VQYA 5LMUO 1KBHA 1SRYA 2EZOA 4KUMA 4O4HA 1XNQO 3VQXA 1B06A 3FD9A 1HNWO 3BY6A 4PDVA 5FPRA 2EILC 5H6QA 3P3PA 2Q0OC 1RPOA 5DEDA 4X1IB 4DW0A 3TK1A 2GBOA 1DLBA 2DYRC 3H9VA 1S3JA 3JD0A 4BR6A 1WB7A 2GV9A 4O2BA 1K34A 2PZSA 4GUNA 2ZCEA 3ABUA 3FX7A 4FZ1A 1F4MA 2FMLA 1N0NA 4J9YB 1AR1B 2F4VO 1XBLA 3HKBA 2E74B 2CE4A 3RT3C 1KYOF 1ZX3A 3RVZA 2VQFO 1IBMB 1K97A 2KKWA 2JJ2G 4O4IB 2EIKC 2UXDO 1Q6HA 2ZD9A 1PPJH 2P90A 4X65B 3K59A 2BE3A 2RCVA 1VQ5V 1AI6A 1NJIW 2H8PC 4LFCO 2GUZB 4JI4O 3L73H 4NTYA 4XDLA 2N05A 4JI3O 3AG7A 3U11A 2UUAB 4I9QA 1Y6XA 5A2QN 5CA1B 4LF5O 2QTSA 5K1PA 4DR6B 5L3BA 3JAWA 2ZM6O 2R72A 3CCSV 4LH6A 3W7XA 5J2UA 4LWSA 3E8GA 3QG5A 2EIMC 3RYIB 3F5TA 3OW2U 3KCXA 4PHZA 3A8TA 1KP3A 1X4TA 4RUEA 1JOYA 4D6TH 4O2AB 4JAVA 1CXZB 2BTQB 3UO2A 5JVDA 4LF6O 3RW0A 4J7JA 2HKOA 1IBLO 1XNQB 2BOBC 3IC7A 4PI2A 1SQGA 2N04A 1H2MA 2B1IA 1GAXA 4IYHA 3CMAV 1PKXA 3S3XA 2Q67A 4WFFA 5IE9A 3E8BA 2DJVA 4UCUA 4G2KA 3ZRVA 3CPWU 4I0XB 1EN6A 1X59A 2DE0X 4F6RB 2Q69A 2ZT9B 4B3TB 4MW8A 2VQEO 1QLEB 4PA4A 2P4VA 1MABG 1WNSA 1SKVA 2CGNA 3OE7G 3SPHA 2QKAA 2YI9A 4R50A 1URFA 2F93B 2QR4A 3T1YB 2CK3G 5EIBD 4P30A 4YIOA 4NXMO 3QNEA 4HAMA 1I94B 4UCOA 3CCQV 1B6QA 1HP8A 3QO5A 2UUBO 5F2VO 1YJNV 3JALB 2ZE5A 1RPRA 3STLC 3DGEA 1BE3H 3JD3A 5LXTB 4LF7B 1WP8A 2CAZC 4NB5A 3D36A 4WFGA 4UCRA 4FLZA 2HJDA 3L71H 2ZM6B 1RSOB 1K92A 3LDEA 1NU1H 3ZCCA 5LA6A 3PJSK 1JJ2U 4TSFG 3SPJA 4DR4B 4DV0B 1YZBA 1VQ4V 4RQEA 2NR5A 3OMAB 3WB2A 4BW5A 3OM3B 2YXLA 1GTOA 3W7TA 4N21A 4BIOA 1QLNA 1S5LZ 2HR3A 1Q81W 1AP5A 1BQ0A 3DSQA 4DV7O 1YF2A 4BAYA 4MTXA 2YSUB 5BZBA 4WBNB 5KMGB 2WLNA 1ORQC 4LBEC 4JTCB 4GKJO 5HFMA 1R3KC 4DR2B 2Y0PA 1ZL8B 4LF8B 4X1IA 1XL6A 2WLHA 4CBCA 1NBMG 1Q7YW 2E5LB 4NXNO 3H01A 1T5EA 3CE2A 3ABTA 3CCEV 3ZRXA 5EBMC 3CC4V 4DUYB 3UO3A 2W0XA 2IH1C 1OCRB 2IM9A 4TUYA 2QDOA 3KG2A 3ETQA 1K8AW 2ITDC 3X2QC 2OIGA 5KHKA 1RFYA 3HKDB 5GTHZ 3OUFA 1GKFA 5D5PA 4O4IA 4PDLA 2O57A 3OGCC 5JH7B 2R9RB 4CH3A 2Z3YA 4BIUA 3LSUA 3JATB 2WWWA 1FXHA 4OGQB 4H37A 4KHPB 4HZ3A 4JZ2A 2PGGA 1D5AA 5J9PC 1XNRO 3ZX6A 4GX2A 4DV6O 3X2QB 4WFAV 4JI0B 2M7WA 4GLXA 2OIEA 4GKKB 4YY3O 2OCCC 4I9WA 3FB7C 2EINB 1YSCA 1EZVH 4UXNA 4FM1A 5B1BC 3SYQA 1Y74B 1S0VA 3LSQA 3RYIA 2EJ7A 2ETNA 3P30A 1N33O 2ADPA 5EC1C 3F5WC 3I5DA 4H0LB 1AROP 3B2EE 2P06A 1Y76B 4Z2WA 1HR0B 4ZBMA 4O2AA 3PN1A 2ARHA 2KSDA 3E35A 4TV9B 2BTQA 4MT8A 2OCCB 4FJCC 2D3OW 5JCOC 4J11A 1I7FA 2HFEC 1WN7A 4PELA 1P4RA 2FTKA 3DC5A 3IJ4A 3OEEG 2BSKB 3RYHB 2VWJA 1ZUQA 2L6LA 2ZE8A 5LMNB 3AK1A 1K73W 1QBZA 3ZMZA 4I0XA 1YVWA 4JASA 1U96A 1GM7A 5L3FA 4F6RA 1VF6C 4B3SB 3I55V 1Z5WA 5DN6G 4K35A 2EIJC 1XI1A 1US6A 1R73A 1KECA 1WAZA 5IYBO 3E8HA 4DR7B 3L74H 1JR9A 2LFSA 1HNZO 1JPXA 4PA3A 3VBBA 1B04A 5EBLC 3E86A 3CS5A 1FYJA 2AGAA 3JALA 5LXTA 3H1KH 3JCUZ 1LUVA 3CJHB 5IWAB 5KA6A 2EIJB 3CRQA 1YHQV 4BIZA 1PP9H 4XDKA 4QGPA 3AG3C 4JAAA 1PNLA 2DQ3A 1XHZA 1U97A 2MK3A 2H94A 3K03A 4UCTA 3HPLC 4QE7A 3BFRA 2UXNA 3M99B 4J42A 4YY3B 2NLJC 4DV3B 2QM4A 2ZDIA 3BA8A 1RSOA 4MVUA 3BHPA 4ZIBA 3SPCA 4GCZA 3RYCA 1JFFB 1Y67A 3LSSA 2LP7A 4CS4A 2XAJA 3N2KB 2R70A 3AG3B 3TCUA 4OPHA 2IBZH 1KP2A 1M5IA 1SZTA 3QO7A 4JYCA 3SJCC 3RYFB 4JI6O 2GTSA 5EK0A 4DK1A 2QWNB 4WFHA 4NTXA 2CTWA 4IIJB 4MVOA 2ZIMA 4Q20A 3AG2C 2DWEC 4JTDB 3SJBC 1KC8W 1MOFA 1AB3A 4K0KB 5KMGA 4WBNA 4JTAB 1DTOA 2QTOA 1F23A 4I5SA 2PUSA 4EFEA 2UU9O 2WLIB 3UKMA 1BMFG 2UXXA 1ZL8A 5E1AC 3S3WA 5ITZB 2UUCB 5BR8O 1GK9A 4H44B 1K3EA 1VQPV 2HHHB 2WPDG 2IU0A 3AG2B 1UJWB 5IJ0B 4LF9O 1Z2GA 3ABKB 1N36O 1BQZA 5LP6C 4A5UB 1NTMH 2KQXA 3K08A 4DUZB 3RGBA 4IYIA 1H2GA 3OR6C 4YHHB 5LYJB 5E79Z 5H6RA 4B3RB 1VQOV 3T4DA 4FFKA 4W4KA 2ZE6A 2UXBO 2HP8A 2QWRB 4WFEA 2ZXWC 3JATA 4B08A 5H9CA 3ZBHA 2YEVA 3BPZA 3E83A 1NH2B 3OTFA 1YITV 1VQKV 1Q82W 3KZIZ 2EX3A 3CRRA 5JJEB 5KHGA 4JI8B 4UV8A 3W7WA 4X66B 4MTOA 2OT5A 1QVGU 2OTLV 5FLXN 1YI2V 1XMQB 2HJFC 3K0DA 1VF5B 1Y74A 4U3JA 1OZ0A 2Q8VA 1Q6UA 4JI2O 3CXCU 1OV9A 3QO8A 2Q4PA 2QKSA 2VRZA 2JGDB 3OEHG 3Q4HB 1W0JG 1Y76A 4IT5A 1I5YA 5JJNB 4OX9O 4HNAB 1PL0A 5TISZ 4NR1A 4TV9A 4FM2A 1QHTA 2G38A 2F1MA 1R3LC 3ZHTA 4X1YB 1AR5A 1AJNA 1Q43A 3B77A 2Q68A 4K8ZA 3K58A 2AZ2A 3SJAC 2BSKA 3RYHA 5B1AC 4FFBB 2PI4A 1CPYA 1GH6A 2B5UA 2IW5A 4LC1A 2FB5A 5JCOA 1VQ9V 1N32O 1V9PA 3RN4A 4UV9A 1XHXA 1S76D 5EBWC 3B4SA 1FXKA 5B3SB 1QQCA 2QWPB 1YTFB 1CEZA 1SQPH 2WLKA 3SDLA 1TVKB 1Q6IA 3F7YC 2KB1A 1PD3A 1SESA 1TA8A 1YXBA 2EILB 1FFXB 4B7EA 1N8RW 3JCZA 2F43G 4D7SA 2P67A 3BAAA 4H33A 4ZKIA 4MTGA 3ABMC 3ETGA 5JWPA 3CJHA 2DYRB 4L87A 4B3MO 4JAUA 1WB8A 3TXQA 5L3GA 4YXWG 1MZEA 4R7CA 4KL1A 1VQ7V 5B66Z 5JQGB 3CRCA 1Z5VA 5D5QA 1SQVH 3BABA 1BHAA 2E3CA 3CP1A 3GB7C 2JEUA 3WB1A 1NI8A 1JFFA 3N27A 3QTCA 4MVMA 3JAMN 4I4TB 4DR1O 3IAYA 2EIKB 2ODMA 2WSSG 1TUBB 1AI5A 3N2KA 4J9ZB 2JVDA 2F95B 4DR5B 3K5MA 3FB5C 1PM9A 2YS8A 4DV4B 1R6TA 1SETA 1NR1A 3RYFA 5IY5C 2RJZA 3ZHRA 1N34O 4IIJA 2XAHA 4F4LA 5LMUB 3JARB 5LL6Y 3E8FA 1IXMA 1R6KA 1HNWB 2OTJV 3IFXA 1SC5B 2VS0A 4HBNA 3MHSC 2EIMB 4J7KA 5ITZA 4Q6GA 1VMGA 3E22B 1HDJA 2JJ1G 3AG4C 5IJ0A 4GT1A 1YTFD 3OR7C 1AP6A 1XUQA 3C3SA 3ZRSA 1QNMA 3SJQC 1AJQA 1QCEA 4LP8A 4DRXB 4ICGA 1GMGA 3FAVB 2F4VB 2W6JG 5LYJA 2Q9LA 4X62O 3H1LH 2M6YA 2VQFB 3F7VC 2P6JA 2UXDB 1F7YA 3CXHF 1M57C 2X0LA 1D2DA 4MVQA 4LR3A 2JGUA 3WB0A 1KUQA 3ML0A 4H13B 4NKGB 4YJ3B 4QPKA 1SZXA 4LFCB 3CEIA 3W7SA 4JI4B 2WA4A 3HKCB 4JI3B 2YI8A 2CGOA 2XASA 3DXRB 3L72H 3RBZA 4CS3A 2CUGA 4LF5B 4EB6B 5KHIA 3HB3B 1DF5A 1M57B 2XT9A 3CCVV 2WLLB 4X20B 1FFTB 2Y69C 4TQFA 3CSXA 3ETDA 2JGDA 2XAQA 5IT9N 2LFRA 3H1JH 3Q4HA 1UPGA 1LR1A 1V55C 2W0FC 4UB8Z 1VF7A 4LF6B 1IBLB 4HNAA 1I08A 3G6EV 5LHHA 1IDSA 1BS3A 1P49A 3T4ZA 3E89A 1H8EG 1SS3A 4X1YA 3K5LA 4FLXA 1M90W 1XQ8A 3LDDA 4J7ZA 2JRIA 2WLJA 4X9QA 3GWKC 2QEXV 1SF9A 2JDIG 2K1EA 4P9PA 1DF4A 3ICXA 5CA0B 2VQEB 2EBOA 4RUFA 3UT5B 1HNXO 1XMOO 3VQWA 4PA6A 3LNNA 4TQDA 4HYOA 5H5NA 4NXMB 1G1XB 1R6NA 2NNUA 1FFXA 2UUBB 2Q6AA 2YC0A 4TWKA 4CZZA 4LFBO 4FVMA 3ZN1A 1F4NA 2IJKA 4I55B 1EFRG 1GRJA 3T1HO 2RDCA 4W4LA 1G8MA 1Q8IA 2V4DA 4K8XA 3SGIA 3R66A 1TAEA 3OMIB 5JQGA 4PDRA 1L1FA 4UVBA 4AHCA 1MG1A 2GUZA 1NKDA 3OD4A 2A3QA 5IYDO 1AJPA 4I4TA 5CA1A 1M1KW 2UXCO 2XTAA 2JS5A 1EN5A 4U3FH 3RFRA 1TUBA 3NXSA 1H8HG 4EFBA 5J2TB 1NZ6A 5KX5B 1WPXA 3GVMA 1L0NH 1GM9A 1DGSA 4I50B 4JGSA 3CCJV 3ETEA 3ZRWB 1M9NA 3L70H 1JVMA 4DV7B 1FJGO 5FNVB 2AHYA 3A2FA 1V54C 3APOA 3JARA 3VQVA 3JD2A 1TGOA 1J95A 2DMXA 3K5OA 4FZ0A 5B1BB 1BL8A 4GKJB 1SQFA 2OYQA 3FB6C 4JI5O 4ZOLB 5GW7A 4FLWA 1O9GA 3K5NA 4J10A 1XMOB 5LGTA 3E22A 1H38A 3BA9A 2GDSA 4NXNB 1K9MW 1V54B 4RQFA 4R6ZA 2P22C 2X6AA 2PF4E 1MMMA 3ZMVA 1OJHA 2KG7B 2OWOA 4DRXA 4JI7O 2DOSA 2JK5C 4AI8A 3K0GA 4G27B 3VOUA 3OTOO 3J7AU 3OGIB 4IGGA 1KMIZ 4UCSA 2CTRA 4IHJB 5LOVB 5LGNA 4YJ3A 4RAIA 2E76B 3G80A 3K9AA 4DV2O 1XNRB 2RNBA 2QM8A 3ZEDA 4DV6B 3HKCA 2NN4A 2R9AA 1PV0A 4PDMA 1BZKA 4PA7A 2A06H 5A9GA 4LFAO 4EB6A 5B5EZ 3L9DA 1OHHG 3DC6A 3FB8C 3OUSA 2X7RB 1OCOC 5L3CA 1AR4A 4GX0A 5L3EA 3LNMB 2WLLA 3CYOA 4X20A 1MNGA 1I0HA 3QVNA 1GN3A 2WLMA 2OCHA 1N33B 5EYPB 5KHHA 4PA9A 2BCCH 5L3DA 2ZNJA 1Y4MA 4JF3A 3ZIAG 3ZHVA 5FPOA 2DN9A 4P9OA 4JI5B 2D2CB 2GTAA 4GX5A 4JI1O 4N23A 1IBKO 4DR3O 5LGUA 4LWSB 3ABLC 5CN0A 1SQXH 3UQ8A 2ATKC 4DW1A 3GWOA 5CA0A 2X6BA 3K79A 3JD4A 3UT5A 4DXWA 1Q3EA 4QNHB 2DQ0A 5JVDB 5KLVH 1GN6A 4C7UA 4DV5O 4AILC 5LBQA 1HNZB 4YIPA 1GN2A 2YXYA 2LW7A 3SR2C 4X64O 1RM1C 1EN4A 2HVKC 4FM0A 4LF4O 1F51A 1G6UA 1A32A 1JMKC 2FL4A 2PY5A 2Q5ZA 1KD1W 2IJJA 1Y66A 2V7QG 3HKDA 2P7TC 4I55A 3EVKA 2QA4V 1XOUA 4JYBA 5LP6B 1K4CC 1K7DA 2P5OA 5JH7A 4GYCB 3WG7C 4LFAB 2XHBA 1KKDA 1RM1B 1GM8A 3CWBH 3D36C 3UM7A 1VIBA 1ENVA 1M56C 1JA8A 3JAKB 3AK2A 1P84F 2Q7HA 3STZC 1VQNV 5KUMA 2YICA 5J2TA 3CCMV 2ZXWB 3WG7B 5KX5A 4JI6B 1FPOA 4I50A 1GN4A 3ZRWA 1M56B 2HLDG 2EJRA 1IVSA 2Q73A 5FNVA 4X65O 3MAQA 3JASB 1P7GA 4XDJA 1BT8A 2UU9B 2BOCC 2XUMA 5LA6B 1W59A 5B1NA 3FFQA 5CBFA 2UUAO 1EZJA 4AQYO 1JQ0A 4ZOLA 4B7KA 4UFZA 5BR8B 4DR6O 2E75B 4UVAA 2A79B 3OAAG 1KKCA 2YIBD 3A0RA 4WFBV 4BWAA 4LF9B 2JEXA 1N36B 1XL4A 2ADQB 1NVPB 3WU2Z 1WA8B 2B9ZA 4UVCA 3OMNB 4KFMA 1YEWA 2XNDG 1ZTEA 3MDSA 4FPPA 4LF4B 2KG7A 4U7OA 4IL6Z 3K57A 5GONB 3G4SV 5FL7G 3EXAA 4X89A 5B1AB 4NVPA 3RWRD 3CMEV 3ZHUA 1WPBA 1E1RG 2YUAA 1QU7A 1VQMV 5EIBC 1IXBA 2UXBB 1VF6A 1K5SA 1P7BA 4IHJA 4FLVA 5LOVA 3SYOA 4RWUA 3K06A 1NH2D 3CRMA 1BCCH 2JIZG 2IU3A 4B3TO 4TUYB 3B8NA 1HW7A 1WLEA 3J81N 1SA0B 1D5NA 4PV1B 2YDEA 3I56V 4OPAA 1PNMA 5IYZB 3T1YO 1ZWIC 4FMTA 5KAFZ 3ABMB 1L8DA 2A7WA 2ZIOA 1I94O 4JI2B 4LH7A 4NTWA 3OT7A 4UUJC 5EYPA 2YXHA 4LF7O 4GZRB 4OX9B 3ASNC 4J80A 4XBFA 2X6CA 1AILA 4KP4A 4AQYB 4CH5A 4QIWF 3OFNG 4O4JB 2Q7GA 3JSNA 3HKEB 4G28B 2K9PA 3CHXA 4O4LB 2ZR3A 1ROPA 3BVOA 3ZHQA 4TV8B 4CH4A 4FLTA 5CBGA 1H2LA 2VWKA 2WLIA 3AEIA 1NVPD 4X1KB 4DR4O 3D3QA 3ASNB 5IY5B 4JPRA 4DV0O 1N32B 2QJ1A 2RQ6A 1Q86W 3P3NA 2YIBA 2LGQA 1G4YB 1H2NA 4P2ZA 1N0JA 4Z1MG 3T2MA 4CH6A 4DYLA 1QLEC 4FK5C 3JSLA 1K4DC 3D3IA 3R65A 3FYIB 3U0ZA 3C3TA 1W2BU 4F6EA 5IYCO 3TGUH 2LJ2A 4MVRA 3AG1C 1KB9F 1K5QA 4D7TA 4B3MB 3U10A 2AXTZ 3AG4B 4DR2O 1GO3F 4LF8O 3N2GB 3C90A 5LP6A 3FKSG 2R9IA 3IC9A 3A0BZ 4DK0A 5H2FZ 2E5LO 3CC2V 2Y4TA 2LGWA 4DUYO 4YJ2B 3JAKA 3AG1B 4DR1B 2ZDIC 5IJ9B 1VEWA 1PL4A 3W7UA 4J41A 1L0LH 4EKWA 2MW2B 3K3WA 1QR9A 2PYJA 4CC6A 3SYAA 2YIDA 1COWG 3IGAC 1AI4A 2GSMB 1N34B 1ZLZA 2AW9A 4Z1VA 3B40A 4JV5O 2HEPA 4KHPO 3JASA 1O9HA 1S77D 3A0HZ 3RYCB 1NR7A 4UCVA 2FYUH 4JI0O 4GKKO 2Y69B 2ZKOA 3HR0A 5C8YB 2ZQMA 2N74A 5JJJB 2A0LA 4E2LA 1VQLV 4FFBA 1V55B 4L8JA 4DV1O 1WA8A 3RVYA 3CCLV 3BCCH 2PYLA 2IJHA 5LHIA 1HR0O 1B3QA 5EZYB 5CB4B 3CCRV 1OCRC 1BGYH 4X62B 5GONA 2DWDC 2WAMA 4DO2A 1MA1A 1TVKA 2BTOA 2QE7G 3J80N 4RO2A 4QPJA 1LUWA 2WA3A 1FD9A 2LW1A 3G67A 1S5JA 5LMNO 5GTIZ 2XAFA 4X88A 4GX1A 1NS1A 3JD1A 2QKCA 1DK1A 3MD0A 1TUEB 2ZINA 1S72V 5LHGA 1BSMA 4B3SO 1VARA 1SA0A 3ASOC 1FXVA 4MVSA 1H2SB 4QE9A 5IYZA 4DR7O 1E79G 1R1BA 5KHJA 5EC2C 3EHBB 1YCIA 4MSWC 4CS2A 4ZHQB 4WF9V 1VQ6V 2EINC 2GHYA 3EFFK 2CH7B 1SQQH 3L75H 2YEVB 4JV5B 5IWAO 3ASOB 1I5XA 2FKXA 2P4KA 3QF7A 4LNUB 4I7ZB 2HVJC 4LCUC 4X8AA 5CMUA 3CC7V 1W0KG 3O65A 4MW3A 4ZI7B 1JX9A 4DV3O 4O4JA 1QR8A 2ZR2A 3B09A 3HKEA 2ILMA 3ZS8C 4WCEV 3WFVA 1CP9A 4O4LA 2AHZA 4U3JB 4TV8A 5K1XA 1MZFA 4DV1B 2CDYA 4X1KA 2DW4A 2A9HA 2XAGA 2HG5C 1HNXB 1FAFA 2DYSC 5BY1A 3CRAA 1UFIA 2B1GA 3UCSC 2RN9A 2IH3C 5BMVB 2Q7EA 3ZMSA 2RMKB 4TT3G 1YJ9V 2QGNA 1S5HC 2JS3A 1FXKC 1YIJV 3B8MA 4LFBB 2EULA 4K0KO 3SPGA 3FAVA 4O4HB 1IX9A 5B1OA 2QSAA 1JCHA 2DYSB 3T1HB 4CC5A 4TOIA 1K33A 5HFLA 2UUCO 2Y48A 2IJIA 3N2GA 1FS0G 5DECA 1R3IC 2HHHO 1WP7A 1IZ3A 1FXKB 2C2AA 2L35A 4O2BB 1XDCA 3TJTA 3ZMUA 2Z5UA 3AK3A 4DUZO 2XOKG 2CTQA 4YJ2A 3APQA 1YDXA 1MSDA 3CB2A 3LUTB 3DXRA 4UB6Z 2UXCB 4YHHO 3ZJZA 4K3AA 3HKBB 5IJ9A 2ITCC 3CX5F 2QM7A 4MS2A 1FKAO 1QVFU 1OCCC 1AI7A 4B3RO 3SYPA 1ZSPA 5C93A 1FJGB 1SQBH 5KAIZ 1J5EO 1WJZA 3NR7A 1OCOB 1ZAUA 4JI8O 1OCCB 2AZ0A 2Y4UA 3G6BA 4X66O 4OXSA 3M7MX 3JAWB 2Q0AA 5C8YA 4PD4F 1XMQO 5J2UB 1IURA 1KU9A 2F23A 4ASUG 2EZPA 3LDCA 5KA5A 4JYYA 1MSWD 1N4CA 1LNQA 2Z0AA 1AVMA 3SPIA 5IDJA 3ABKC 4JYAO 2LQTA 5EZYA 1EM1A 3JYCA 5CB4A 2ZNIA 4JI7B 3DTUB 1XREA 3ABLB 3OTOB 3D8CA
chains in the Genus database with same CATH topology
5GTIZ 5KAIZ 5GTHZ 4UB6Z 5B5EZ 5E79Z 3KZIZ 3A0BZ 5H2FZ 5B66Z 3JCUZ 3WU2Z 5TISZ 4PJ0Z 5KAFZ 4UB8Z 1S5LZ 2AXTZ 3A0HZ 4IL6Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTI Z;  5KAI Z;  5GTH Z;  4UB6 Z;  5B5E Z;  5E79 Z;  3KZI Z;  3A0B Z;  5H2F Z;  5B66 Z;  3JCU Z;  3WU2 Z;  5TIS Z;  4PJ0 Z;  5KAF Z;  4UB8 Z;  1S5L Z;  2AXT Z;  3A0H Z;  4IL6 Z; 
#chains in the Genus database with same CATH topology
 3TET A;  5BXZ A;  1EBO A;  4FLY A;  2QWQ B;  2ZE7 A;  4FIP C;  1XEQ A;  1JJO A;  5AG2 A;  1E1Q G;  4NYK A;  4FLU A;  1HWY A;  4DV2 B;  1M4U A;  5CA3 A;  4PJ0 Z;  1VP7 A;  3T1C A;  5DM6 V;  5CBH A;  1RP3 B;  3P32 A;  3THO A;  1THZ A;  3O9O A;  4KXR A;  3BRC A;  1KQS U;  1Q90 D;  1M93 A;  1OCZ C;  1BHB A;  3H1H H;  4JZG A;  4R8C A;  3K04 A;  4ZHQ A;  4EEQ A;  2V1D A;  1VQ8 V;  3FYE B;  2CH7 A;  2PTM A;  4MTF A;  1YJW V;  3ZMT A;  3KCY A;  3SYC A;  1J5E B;  1IBM O;  3ZHS A;  2W6I G;  1R3J C;  4LNU A;  1NQT A;  1OCZ B;  1PNK A;  3M8A A;  1H2K A;  4BW9 A;  4ZI7 A;  4JI1 B;  3KKY A;  3MHH C;  1IBK B;  4DR3 B;  3G71 V;  2PI5 A;  5KUK A;  3K9S A;  4E4E A;  1NTZ H;  1Q5O A;  2LO1 A;  1XIL A;  1NT2 B;  4MVZ A;  1NTK H;  3CD6 V;  4U7N A;  2YIA A;  4QJF B;  3H1I H;  2H3O A;  2QWO B;  4DR5 O;  1SER A;  2Y0I A;  4JYA B;  5BMV A;  4DV4 O;  3BEH A;  4DV5 B;  3ZN0 A;  3TXS A;  3CCU V;  2CTP A;  2F66 C;  4ABM A;  4X64 B;  4PI0 A;  5B3S C;  3E2E A;  3VQY A;  5LMU O;  1KBH A;  1SRY A;  2EZO A;  4KUM A;  4O4H A;  1XNQ O;  3VQX A;  1B06 A;  3FD9 A;  1HNW O;  3BY6 A;  4PDV A;  5FPR A;  2EIL C;  5H6Q A;  3P3P A;  2Q0O C;  1RPO A;  5DED A;  4X1I B;  4DW0 A;  3TK1 A;  2GBO A;  1DLB A;  2DYR C;  3H9V A;  1S3J A;  3JD0 A;  4BR6 A;  1WB7 A;  2GV9 A;  4O2B A;  1K34 A;  2PZS A;  4GUN A;  2ZCE A;  3ABU A;  3FX7 A;  4FZ1 A;  1F4M A;  2FML A;  1N0N A;  4J9Y B;  1AR1 B;  2F4V O;  1XBL A;  3HKB A;  2E74 B;  2CE4 A;  3RT3 C;  1KYO F;  1ZX3 A;  3RVZ A;  2VQF O;  1IBM B;  1K97 A;  2KKW A;  2JJ2 G;  4O4I B;  2EIK C;  2UXD O;  1Q6H A;  2ZD9 A;  1PPJ H;  2P90 A;  4X65 B;  3K59 A;  2BE3 A;  2RCV A;  1VQ5 V;  1AI6 A;  1NJI W;  2H8P C;  4LFC O;  2GUZ B;  4JI4 O;  3L73 H;  4NTY A;  4XDL A;  2N05 A;  4JI3 O;  3AG7 A;  3U11 A;  2UUA B;  4I9Q A;  1Y6X A;  5A2Q N;  5CA1 B;  4LF5 O;  2QTS A;  5K1P A;  4DR6 B;  5L3B A;  3JAW A;  2ZM6 O;  2R72 A;  3CCS V;  4LH6 A;  3W7X A;  5J2U A;  4LWS A;  3E8G A;  3QG5 A;  2EIM C;  3RYI B;  3F5T A;  3OW2 U;  3KCX A;  4PHZ A;  3A8T A;  1KP3 A;  1X4T A;  4RUE A;  1JOY A;  4D6T H;  4O2A B;  4JAV A;  1CXZ B;  2BTQ B;  3UO2 A;  5JVD A;  4LF6 O;  3RW0 A;  4J7J A;  2HKO A;  1IBL O;  1XNQ B;  2BOB C;  3IC7 A;  4PI2 A;  1SQG A;  2N04 A;  1H2M A;  2B1I A;  1GAX A;  4IYH A;  3CMA V;  1PKX A;  3S3X A;  2Q67 A;  4WFF A;  5IE9 A;  3E8B A;  2DJV A;  4UCU A;  4G2K A;  3ZRV A;  3CPW U;  4I0X B;  1EN6 A;  1X59 A;  2DE0 X;  4F6R B;  2Q69 A;  2ZT9 B;  4B3T B;  4MW8 A;  2VQE O;  1QLE B;  4PA4 A;  2P4V A;  1MAB G;  1WNS A;  1SKV A;  2CGN A;  3OE7 G;  3SPH A;  2QKA A;  2YI9 A;  4R50 A;  1URF A;  2F93 B;  2QR4 A;  3T1Y B;  2CK3 G;  5EIB D;  4P30 A;  4YIO A;  4NXM O;  3QNE A;  4HAM A;  1I94 B;  4UCO A;  3CCQ V;  1B6Q A;  1HP8 A;  3QO5 A;  2UUB O;  5F2V O;  1YJN V;  3JAL B;  2ZE5 A;  1RPR A;  3STL C;  3DGE A;  1BE3 H;  3JD3 A;  5LXT B;  4LF7 B;  1WP8 A;  2CAZ C;  4NB5 A;  3D36 A;  4WFG A;  4UCR A;  4FLZ A;  2HJD A;  3L71 H;  2ZM6 B;  1RSO B;  1K92 A;  3LDE A;  1NU1 H;  3ZCC A;  5LA6 A;  3PJS K;  1JJ2 U;  4TSF G;  3SPJ A;  4DR4 B;  4DV0 B;  1YZB A;  1VQ4 V;  4RQE A;  2NR5 A;  3OMA B;  3WB2 A;  4BW5 A;  3OM3 B;  2YXL A;  1GTO A;  3W7T A;  4N21 A;  4BIO A;  1QLN A;  1S5L Z;  2HR3 A;  1Q81 W;  1AP5 A;  1BQ0 A;  3DSQ A;  4DV7 O;  1YF2 A;  4BAY A;  4MTX A;  2YSU B;  5BZB A;  4WBN B;  5KMG B;  2WLN A;  1ORQ C;  4LBE C;  4JTC B;  4GKJ O;  5HFM A;  1R3K C;  4DR2 B;  2Y0P A;  1ZL8 B;  4LF8 B;  4X1I A;  1XL6 A;  2WLH A;  4CBC A;  1NBM G;  1Q7Y W;  2E5L B;  4NXN O;  3H01 A;  1T5E A;  3CE2 A;  3ABT A;  3CCE V;  3ZRX A;  5EBM C;  3CC4 V;  4DUY B;  3UO3 A;  2W0X A;  2IH1 C;  1OCR B;  2IM9 A;  4TUY A;  2QDO A;  3KG2 A;  3ETQ A;  1K8A W;  2ITD C;  3X2Q C;  2OIG A;  5KHK A;  1RFY A;  3HKD B;  5GTH Z;  3OUF A;  1GKF A;  5D5P A;  4O4I A;  4PDL A;  2O57 A;  3OGC C;  5JH7 B;  2R9R B;  4CH3 A;  2Z3Y A;  4BIU A;  3LSU A;  3JAT B;  2WWW A;  1FXH A;  4OGQ B;  4H37 A;  4KHP B;  4HZ3 A;  4JZ2 A;  2PGG A;  1D5A A;  5J9P C;  1XNR O;  3ZX6 A;  4GX2 A;  4DV6 O;  3X2Q B;  4WFA V;  4JI0 B;  2M7W A;  4GLX A;  2OIE A;  4GKK B;  4YY3 O;  2OCC C;  4I9W A;  3FB7 C;  2EIN B;  1YSC A;  1EZV H;  4UXN A;  4FM1 A;  5B1B C;  3SYQ A;  1Y74 B;  1S0V A;  3LSQ A;  3RYI A;  2EJ7 A;  2ETN A;  3P30 A;  1N33 O;  2ADP A;  5EC1 C;  3F5W C;  3I5D A;  4H0L B;  1ARO P;  3B2E E;  2P06 A;  1Y76 B;  4Z2W A;  1HR0 B;  4ZBM A;  4O2A A;  3PN1 A;  2ARH A;  2KSD A;  3E35 A;  4TV9 B;  2BTQ A;  4MT8 A;  2OCC B;  4FJC C;  2D3O W;  5JCO C;  4J11 A;  1I7F A;  2HFE C;  1WN7 A;  4PEL A;  1P4R A;  2FTK A;  3DC5 A;  3IJ4 A;  3OEE G;  2BSK B;  3RYH B;  2VWJ A;  1ZUQ A;  2L6L A;  2ZE8 A;  5LMN B;  3AK1 A;  1K73 W;  1QBZ A;  3ZMZ A;  4I0X A;  1YVW A;  4JAS A;  1U96 A;  1GM7 A;  5L3F A;  4F6R A;  1VF6 C;  4B3S B;  3I55 V;  1Z5W A;  5DN6 G;  4K35 A;  2EIJ C;  1XI1 A;  1US6 A;  1R73 A;  1KEC A;  1WAZ A;  5IYB O;  3E8H A;  4DR7 B;  3L74 H;  1JR9 A;  2LFS A;  1HNZ O;  1JPX A;  4PA3 A;  3VBB A;  1B04 A;  5EBL C;  3E86 A;  3CS5 A;  1FYJ A;  2AGA A;  3JAL A;  5LXT A;  3H1K H;  3JCU Z;  1LUV A;  3CJH B;  5IWA B;  5KA6 A;  2EIJ B;  3CRQ A;  1YHQ V;  4BIZ A;  1PP9 H;  4XDK A;  4QGP A;  3AG3 C;  4JAA A;  1PNL A;  2DQ3 A;  1XHZ A;  1U97 A;  2MK3 A;  2H94 A;  3K03 A;  4UCT A;  3HPL C;  4QE7 A;  3BFR A;  2UXN A;  3M99 B;  4J42 A;  4YY3 B;  2NLJ C;  4DV3 B;  2QM4 A;  2ZDI A;  3BA8 A;  1RSO A;  4MVU A;  3BHP A;  4ZIB A;  3SPC A;  4GCZ A;  3RYC A;  1JFF B;  1Y67 A;  3LSS A;  2LP7 A;  4CS4 A;  2XAJ A;  3N2K B;  2R70 A;  3AG3 B;  3TCU A;  4OPH A;  2IBZ H;  1KP2 A;  1M5I A;  1SZT A;  3QO7 A;  4JYC A;  3SJC C;  3RYF B;  4JI6 O;  2GTS A;  5EK0 A;  4DK1 A;  2QWN B;  4WFH A;  4NTX A;  2CTW A;  4IIJ B;  4MVO A;  2ZIM A;  4Q20 A;  3AG2 C;  2DWE C;  4JTD B;  3SJB C;  1KC8 W;  1MOF A;  1AB3 A;  4K0K B;  5KMG A;  4WBN A;  4JTA B;  1DTO A;  2QTO A;  1F23 A;  4I5S A;  2PUS A;  4EFE A;  2UU9 O;  2WLI B;  3UKM A;  1BMF G;  2UXX A;  1ZL8 A;  5E1A C;  3S3W A;  5ITZ B;  2UUC B;  5BR8 O;  1GK9 A;  4H44 B;  1K3E A;  1VQP V;  2HHH B;  2WPD G;  2IU0 A;  3AG2 B;  1UJW B;  5IJ0 B;  4LF9 O;  1Z2G A;  3ABK B;  1N36 O;  1BQZ A;  5LP6 C;  4A5U B;  1NTM H;  2KQX A;  3K08 A;  4DUZ B;  3RGB A;  4IYI A;  1H2G A;  3OR6 C;  4YHH B;  5LYJ B;  5E79 Z;  5H6R A;  4B3R B;  1VQO V;  3T4D A;  4FFK A;  4W4K A;  2ZE6 A;  2UXB O;  2HP8 A;  2QWR B;  4WFE A;  2ZXW C;  3JAT A;  4B08 A;  5H9C A;  3ZBH A;  2YEV A;  3BPZ A;  3E83 A;  1NH2 B;  3OTF A;  1YIT V;  1VQK V;  1Q82 W;  3KZI Z;  2EX3 A;  3CRR A;  5JJE B;  5KHG A;  4JI8 B;  4UV8 A;  3W7W A;  4X66 B;  4MTO A;  2OT5 A;  1QVG U;  2OTL V;  5FLX N;  1YI2 V;  1XMQ B;  2HJF C;  3K0D A;  1VF5 B;  1Y74 A;  4U3J A;  1OZ0 A;  2Q8V A;  1Q6U A;  4JI2 O;  3CXC U;  1OV9 A;  3QO8 A;  2Q4P A;  2QKS A;  2VRZ A;  2JGD B;  3OEH G;  3Q4H B;  1W0J G;  1Y76 A;  4IT5 A;  1I5Y A;  5JJN B;  4OX9 O;  4HNA B;  1PL0 A;  5TIS Z;  4NR1 A;  4TV9 A;  4FM2 A;  1QHT A;  2G38 A;  2F1M A;  1R3L C;  3ZHT A;  4X1Y B;  1AR5 A;  1AJN A;  1Q43 A;  3B77 A;  2Q68 A;  4K8Z A;  3K58 A;  2AZ2 A;  3SJA C;  2BSK A;  3RYH A;  5B1A C;  4FFB B;  2PI4 A;  1CPY A;  1GH6 A;  2B5U A;  2IW5 A;  4LC1 A;  2FB5 A;  5JCO A;  1VQ9 V;  1N32 O;  1V9P A;  3RN4 A;  4UV9 A;  1XHX A;  1S76 D;  5EBW C;  3B4S A;  1FXK A;  5B3S B;  1QQC A;  2QWP B;  1YTF B;  1CEZ A;  1SQP H;  2WLK A;  3SDL A;  1TVK B;  1Q6I A;  3F7Y C;  2KB1 A;  1PD3 A;  1SES A;  1TA8 A;  1YXB A;  2EIL B;  1FFX B;  4B7E A;  1N8R W;  3JCZ A;  2F43 G;  4D7S A;  2P67 A;  3BAA A;  4H33 A;  4ZKI A;  4MTG A;  3ABM C;  3ETG A;  5JWP A;  3CJH A;  2DYR B;  4L87 A;  4B3M O;  4JAU A;  1WB8 A;  3TXQ A;  5L3G A;  4YXW G;  1MZE A;  4R7C A;  4KL1 A;  1VQ7 V;  5B66 Z;  5JQG B;  3CRC A;  1Z5V A;  5D5Q A;  1SQV H;  3BAB A;  1BHA A;  2E3C A;  3CP1 A;  3GB7 C;  2JEU A;  3WB1 A;  1NI8 A;  1JFF A;  3N27 A;  3QTC A;  4MVM A;  3JAM N;  4I4T B;  4DR1 O;  3IAY A;  2EIK B;  2ODM A;  2WSS G;  1TUB B;  1AI5 A;  3N2K A;  4J9Z B;  2JVD A;  2F95 B;  4DR5 B;  3K5M A;  3FB5 C;  1PM9 A;  2YS8 A;  4DV4 B;  1R6T A;  1SET A;  1NR1 A;  3RYF A;  5IY5 C;  2RJZ A;  3ZHR A;  1N34 O;  4IIJ A;  2XAH A;  4F4L A;  5LMU B;  3JAR B;  5LL6 Y;  3E8F A;  1IXM A;  1R6K A;  1HNW B;  2OTJ V;  3IFX A;  1SC5 B;  2VS0 A;  4HBN A;  3MHS C;  2EIM B;  4J7K A;  5ITZ A;  4Q6G A;  1VMG A;  3E22 B;  1HDJ A;  2JJ1 G;  3AG4 C;  5IJ0 A;  4GT1 A;  1YTF D;  3OR7 C;  1AP6 A;  1XUQ A;  3C3S A;  3ZRS A;  1QNM A;  3SJQ C;  1AJQ A;  1QCE A;  4LP8 A;  4DRX B;  4ICG A;  1GMG A;  3FAV B;  2F4V B;  2W6J G;  5LYJ A;  2Q9L A;  4X62 O;  3H1L H;  2M6Y A;  2VQF B;  3F7V C;  2P6J A;  2UXD B;  1F7Y A;  3CXH F;  1M57 C;  2X0L A;  1D2D A;  4MVQ A;  4LR3 A;  2JGU A;  3WB0 A;  1KUQ A;  3ML0 A;  4H13 B;  4NKG B;  4YJ3 B;  4QPK A;  1SZX A;  4LFC B;  3CEI A;  3W7S A;  4JI4 B;  2WA4 A;  3HKC B;  4JI3 B;  2YI8 A;  2CGO A;  2XAS A;  3DXR B;  3L72 H;  3RBZ A;  4CS3 A;  2CUG A;  4LF5 B;  4EB6 B;  5KHI A;  3HB3 B;  1DF5 A;  1M57 B;  2XT9 A;  3CCV V;  2WLL B;  4X20 B;  1FFT B;  2Y69 C;  4TQF A;  3CSX A;  3ETD A;  2JGD A;  2XAQ A;  5IT9 N;  2LFR A;  3H1J H;  3Q4H A;  1UPG A;  1LR1 A;  1V55 C;  2W0F C;  4UB8 Z;  1VF7 A;  4LF6 B;  1IBL B;  4HNA A;  1I08 A;  3G6E V;  5LHH A;  1IDS A;  1BS3 A;  1P49 A;  3T4Z A;  3E89 A;  1H8E G;  1SS3 A;  4X1Y A;  3K5L A;  4FLX A;  1M90 W;  1XQ8 A;  3LDD A;  4J7Z A;  2JRI A;  2WLJ A;  4X9Q A;  3GWK C;  2QEX V;  1SF9 A;  2JDI G;  2K1E A;  4P9P A;  1DF4 A;  3ICX A;  5CA0 B;  2VQE B;  2EBO A;  4RUF A;  3UT5 B;  1HNX O;  1XMO O;  3VQW A;  4PA6 A;  3LNN A;  4TQD A;  4HYO A;  5H5N A;  4NXM B;  1G1X B;  1R6N A;  2NNU A;  1FFX A;  2UUB B;  2Q6A A;  2YC0 A;  4TWK A;  4CZZ A;  4LFB O;  4FVM A;  3ZN1 A;  1F4N A;  2IJK A;  4I55 B;  1EFR G;  1GRJ A;  3T1H O;  2RDC A;  4W4L A;  1G8M A;  1Q8I A;  2V4D A;  4K8X A;  3SGI A;  3R66 A;  1TAE A;  3OMI B;  5JQG A;  4PDR A;  1L1F A;  4UVB A;  4AHC A;  1MG1 A;  2GUZ A;  1NKD A;  3OD4 A;  2A3Q A;  5IYD O;  1AJP A;  4I4T A;  5CA1 A;  1M1K W;  2UXC O;  2XTA A;  2JS5 A;  1EN5 A;  4U3F H;  3RFR A;  1TUB A;  3NXS A;  1H8H G;  4EFB A;  5J2T B;  1NZ6 A;  5KX5 B;  1WPX A;  3GVM A;  1L0N H;  1GM9 A;  1DGS A;  4I50 B;  4JGS A;  3CCJ V;  3ETE A;  3ZRW B;  1M9N A;  3L70 H;  1JVM A;  4DV7 B;  1FJG O;  5FNV B;  2AHY A;  3A2F A;  1V54 C;  3APO A;  3JAR A;  3VQV A;  3JD2 A;  1TGO A;  1J95 A;  2DMX A;  3K5O A;  4FZ0 A;  5B1B B;  1BL8 A;  4GKJ B;  1SQF A;  2OYQ A;  3FB6 C;  4JI5 O;  4ZOL B;  5GW7 A;  4FLW A;  1O9G A;  3K5N A;  4J10 A;  1XMO B;  5LGT A;  3E22 A;  1H38 A;  3BA9 A;  2GDS A;  4NXN B;  1K9M W;  1V54 B;  4RQF A;  4R6Z A;  2P22 C;  2X6A A;  2PF4 E;  1MMM A;  3ZMV A;  1OJH A;  2KG7 B;  2OWO A;  4DRX A;  4JI7 O;  2DOS A;  2JK5 C;  4AI8 A;  3K0G A;  4G27 B;  3VOU A;  3OTO O;  3J7A U;  3OGI B;  4IGG A;  1KMI Z;  4UCS A;  2CTR A;  4IHJ B;  5LOV B;  5LGN A;  4YJ3 A;  4RAI A;  2E76 B;  3G80 A;  3K9A A;  4DV2 O;  1XNR B;  2RNB A;  2QM8 A;  3ZED A;  4DV6 B;  3HKC A;  2NN4 A;  2R9A A;  1PV0 A;  4PDM A;  1BZK A;  4PA7 A;  2A06 H;  5A9G A;  4LFA O;  4EB6 A;  5B5E Z;  3L9D A;  1OHH G;  3DC6 A;  3FB8 C;  3OUS A;  2X7R B;  1OCO C;  5L3C A;  1AR4 A;  4GX0 A;  5L3E A;  3LNM B;  2WLL A;  3CYO A;  4X20 A;  1MNG A;  1I0H A;  3QVN A;  1GN3 A;  2WLM A;  2OCH A;  1N33 B;  5EYP B;  5KHH A;  4PA9 A;  2BCC H;  5L3D A;  2ZNJ A;  1Y4M A;  4JF3 A;  3ZIA G;  3ZHV A;  5FPO A;  2DN9 A;  4P9O A;  4JI5 B;  2D2C B;  2GTA A;  4GX5 A;  4JI1 O;  4N23 A;  1IBK O;  4DR3 O;  5LGU A;  4LWS B;  3ABL C;  5CN0 A;  1SQX H;  3UQ8 A;  2ATK C;  4DW1 A;  3GWO A;  5CA0 A;  2X6B A;  3K79 A;  3JD4 A;  3UT5 A;  4DXW A;  1Q3E A;  4QNH B;  2DQ0 A;  5JVD B;  5KLV H;  1GN6 A;  4C7U A;  4DV5 O;  4AIL C;  5LBQ A;  1HNZ B;  4YIP A;  1GN2 A;  2YXY A;  2LW7 A;  3SR2 C;  4X64 O;  1RM1 C;  1EN4 A;  2HVK C;  4FM0 A;  4LF4 O;  1F51 A;  1G6U A;  1A32 A;  1JMK C;  2FL4 A;  2PY5 A;  2Q5Z A;  1KD1 W;  2IJJ A;  1Y66 A;  2V7Q G;  3HKD A;  2P7T C;  4I55 A;  3EVK A;  2QA4 V;  1XOU A;  4JYB A;  5LP6 B;  1K4C C;  1K7D A;  2P5O A;  5JH7 A;  4GYC B;  3WG7 C;  4LFA B;  2XHB A;  1KKD A;  1RM1 B;  1GM8 A;  3CWB H;  3D36 C;  3UM7 A;  1VIB A;  1ENV A;  1M56 C;  1JA8 A;  3JAK B;  3AK2 A;  1P84 F;  2Q7H A;  3STZ C;  1VQN V;  5KUM A;  2YIC A;  5J2T A;  3CCM V;  2ZXW B;  3WG7 B;  5KX5 A;  4JI6 B;  1FPO A;  4I50 A;  1GN4 A;  3ZRW A;  1M56 B;  2HLD G;  2EJR A;  1IVS A;  2Q73 A;  5FNV A;  4X65 O;  3MAQ A;  3JAS B;  1P7G A;  4XDJ A;  1BT8 A;  2UU9 B;  2BOC C;  2XUM A;  5LA6 B;  1W59 A;  5B1N A;  3FFQ A;  5CBF A;  2UUA O;  1EZJ A;  4AQY O;  1JQ0 A;  4ZOL A;  4B7K A;  4UFZ A;  5BR8 B;  4DR6 O;  2E75 B;  4UVA A;  2A79 B;  3OAA G;  1KKC A;  2YIB D;  3A0R A;  4WFB V;  4BWA A;  4LF9 B;  2JEX A;  1N36 B;  1XL4 A;  2ADQ B;  1NVP B;  3WU2 Z;  1WA8 B;  2B9Z A;  4UVC A;  3OMN B;  4KFM A;  1YEW A;  2XND G;  1ZTE A;  3MDS A;  4FPP A;  4LF4 B;  2KG7 A;  4U7O A;  4IL6 Z;  3K57 A;  5GON B;  3G4S V;  5FL7 G;  3EXA A;  4X89 A;  5B1A B;  4NVP A;  3RWR D;  3CME V;  3ZHU A;  1WPB A;  1E1R G;  2YUA A;  1QU7 A;  1VQM V;  5EIB C;  1IXB A;  2UXB B;  1VF6 A;  1K5S A;  1P7B A;  4IHJ A;  4FLV A;  5LOV A;  3SYO A;  4RWU A;  3K06 A;  1NH2 D;  3CRM A;  1BCC H;  2JIZ G;  2IU3 A;  4B3T O;  4TUY B;  3B8N A;  1HW7 A;  1WLE A;  3J81 N;  1SA0 B;  1D5N A;  4PV1 B;  2YDE A;  3I56 V;  4OPA A;  1PNM A;  5IYZ B;  3T1Y O;  1ZWI C;  4FMT A;  5KAF Z;  3ABM B;  1L8D A;  2A7W A;  2ZIO A;  1I94 O;  4JI2 B;  4LH7 A;  4NTW A;  3OT7 A;  4UUJ C;  5EYP A;  2YXH A;  4LF7 O;  4GZR B;  4OX9 B;  3ASN C;  4J80 A;  4XBF A;  2X6C A;  1AIL A;  4KP4 A;  4AQY B;  4CH5 A;  4QIW F;  3OFN G;  4O4J B;  2Q7G A;  3JSN A;  3HKE B;  4G28 B;  2K9P A;  3CHX A;  4O4L B;  2ZR3 A;  1ROP A;  3BVO A;  3ZHQ A;  4TV8 B;  4CH4 A;  4FLT A;  5CBG A;  1H2L A;  2VWK A;  2WLI A;  3AEI A;  1NVP D;  4X1K B;  4DR4 O;  3D3Q A;  3ASN B;  5IY5 B;  4JPR A;  4DV0 O;  1N32 B;  2QJ1 A;  2RQ6 A;  1Q86 W;  3P3N A;  2YIB A;  2LGQ A;  1G4Y B;  1H2N A;  4P2Z A;  1N0J A;  4Z1M G;  3T2M A;  4CH6 A;  4DYL A;  1QLE C;  4FK5 C;  3JSL A;  1K4D C;  3D3I A;  3R65 A;  3FYI B;  3U0Z A;  3C3T A;  1W2B U;  4F6E A;  5IYC O;  3TGU H;  2LJ2 A;  4MVR A;  3AG1 C;  1KB9 F;  1K5Q A;  4D7T A;  4B3M B;  3U10 A;  2AXT Z;  3AG4 B;  4DR2 O;  1GO3 F;  4LF8 O;  3N2G B;  3C90 A;  5LP6 A;  3FKS G;  2R9I A;  3IC9 A;  3A0B Z;  4DK0 A;  5H2F Z;  2E5L O;  3CC2 V;  2Y4T A;  2LGW A;  4DUY O;  4YJ2 B;  3JAK A;  3AG1 B;  4DR1 B;  2ZDI C;  5IJ9 B;  1VEW A;  1PL4 A;  3W7U A;  4J41 A;  1L0L H;  4EKW A;  2MW2 B;  3K3W A;  1QR9 A;  2PYJ A;  4CC6 A;  3SYA A;  2YID A;  1COW G;  3IGA C;  1AI4 A;  2GSM B;  1N34 B;  1ZLZ A;  2AW9 A;  4Z1V A;  3B40 A;  4JV5 O;  2HEP A;  4KHP O;  3JAS A;  1O9H A;  1S77 D;  3A0H Z;  3RYC B;  1NR7 A;  4UCV A;  2FYU H;  4JI0 O;  4GKK O;  2Y69 B;  2ZKO A;  3HR0 A;  5C8Y B;  2ZQM A;  2N74 A;  5JJJ B;  2A0L A;  4E2L A;  1VQL V;  4FFB A;  1V55 B;  4L8J A;  4DV1 O;  1WA8 A;  3RVY A;  3CCL V;  3BCC H;  2PYL A;  2IJH A;  5LHI A;  1HR0 O;  1B3Q A;  5EZY B;  5CB4 B;  3CCR V;  1OCR C;  1BGY H;  4X62 B;  5GON A;  2DWD C;  2WAM A;  4DO2 A;  1MA1 A;  1TVK A;  2BTO A;  2QE7 G;  3J80 N;  4RO2 A;  4QPJ A;  1LUW A;  2WA3 A;  1FD9 A;  2LW1 A;  3G67 A;  1S5J A;  5LMN O;  5GTI Z;  2XAF A;  4X88 A;  4GX1 A;  1NS1 A;  3JD1 A;  2QKC A;  1DK1 A;  3MD0 A;  1TUE B;  2ZIN A;  1S72 V;  5LHG A;  1BSM A;  4B3S O;  1VAR A;  1SA0 A;  3ASO C;  1FXV A;  4MVS A;  1H2S B;  4QE9 A;  5IYZ A;  4DR7 O;  1E79 G;  1R1B A;  5KHJ A;  5EC2 C;  3EHB B;  1YCI A;  4MSW C;  4CS2 A;  4ZHQ B;  4WF9 V;  1VQ6 V;  2EIN C;  2GHY A;  3EFF K;  2CH7 B;  1SQQ H;  3L75 H;  2YEV B;  4JV5 B;  5IWA O;  3ASO B;  1I5X A;  2FKX A;  2P4K A;  3QF7 A;  4LNU B;  4I7Z B;  2HVJ C;  4LCU C;  4X8A A;  5CMU A;  3CC7 V;  1W0K G;  3O65 A;  4MW3 A;  4ZI7 B;  1JX9 A;  4DV3 O;  4O4J A;  1QR8 A;  2ZR2 A;  3B09 A;  3HKE A;  2ILM A;  3ZS8 C;  4WCE V;  3WFV A;  1CP9 A;  4O4L A;  2AHZ A;  4U3J B;  4TV8 A;  5K1X A;  1MZF A;  4DV1 B;  2CDY A;  4X1K A;  2DW4 A;  2A9H A;  2XAG A;  2HG5 C;  1HNX B;  1FAF A;  2DYS C;  5BY1 A;  3CRA A;  1UFI A;  2B1G A;  3UCS C;  2RN9 A;  2IH3 C;  5BMV B;  2Q7E A;  3ZMS A;  2RMK B;  4TT3 G;  1YJ9 V;  2QGN A;  1S5H C;  2JS3 A;  1FXK C;  1YIJ V;  3B8M A;  4LFB B;  2EUL A;  4K0K O;  3SPG A;  3FAV A;  4O4H B;  1IX9 A;  5B1O A;  2QSA A;  1JCH A;  2DYS B;  3T1H B;  4CC5 A;  4TOI A;  1K33 A;  5HFL A;  2UUC O;  2Y48 A;  2IJI A;  3N2G A;  1FS0 G;  5DEC A;  1R3I C;  2HHH O;  1WP7 A;  1IZ3 A;  1FXK B;  2C2A A;  2L35 A;  4O2B B;  1XDC A;  3TJT A;  3ZMU A;  2Z5U A;  3AK3 A;  4DUZ O;  2XOK G;  2CTQ A;  4YJ2 A;  3APQ A;  1YDX A;  1MSD A;  3CB2 A;  3LUT B;  3DXR A;  4UB6 Z;  2UXC B;  4YHH O;  3ZJZ A;  4K3A A;  3HKB B;  5IJ9 A;  2ITC C;  3CX5 F;  2QM7 A;  4MS2 A;  1FKA O;  1QVF U;  1OCC C;  1AI7 A;  4B3R O;  3SYP A;  1ZSP A;  5C93 A;  1FJG B;  1SQB H;  5KAI Z;  1J5E O;  1WJZ A;  3NR7 A;  1OCO B;  1ZAU A;  4JI8 O;  1OCC B;  2AZ0 A;  2Y4U A;  3G6B A;  4X66 O;  4OXS A;  3M7M X;  3JAW B;  2Q0A A;  5C8Y A;  4PD4 F;  1XMQ O;  5J2U B;  1IUR A;  1KU9 A;  2F23 A;  4ASU G;  2EZP A;  3LDC A;  5KA5 A;  4JYY A;  1MSW D;  1N4C A;  1LNQ A;  2Z0A A;  1AVM A;  3SPI A;  5IDJ A;  3ABK C;  4JYA O;  2LQT A;  5EZY A;  1EM1 A;  3JYC A;  5CB4 A;  2ZNI A;  4JI7 B;  3DTU B;  1XRE A;  3ABL B;  3OTO B;  3D8C A; 
#chains in the Genus database with same CATH homology
 5GTI Z;  5KAI Z;  5GTH Z;  4UB6 Z;  5B5E Z;  5E79 Z;  3KZI Z;  3A0B Z;  5H2F Z;  5B66 Z;  3JCU Z;  3WU2 Z;  5TIS Z;  4PJ0 Z;  5KAF Z;  4UB8 Z;  1S5L Z;  2AXT Z;  3A0H Z;  4IL6 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...