5B66Z

Crystal structure analysis of photosystem ii complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 24
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5b66Z00
5B66Z 4PJ0Z 5GTIZ 5KAIZ 5H2FZ 5B5EZ 4UB6Z 5TISZ 3A0HZ 5E79Z 3KZIZ 3WU2Z 4IL6Z 5GTHZ 2AXTZ 3JCUZ 5KAFZ 1S5LZ 4UB8Z 3A0BZ
chains in the Genus database with same CATH superfamily
2EBOA 4FLXA 4DV7B 2BTQB 2CUGA 1QCEA 3HR0A 4HAMA 2HHHB 4ZOLA 3ABMC 2QM4A 4O4IA 2JS3A 1GN6A 3JATA 4DR3O 3K57A 2Q5ZA 2JEUA 4GX1A 4CH6A 4LF7O 2PUSA 2D3OW 2X7RB 1V54C 3B8MA 4DR1O 5D5QA 1RPRA 4IIJB 2CK3G 4UCTA 3STZC 1Y6XA 1VARA 4J11A 1GK9A 1K4CC 2X0LA 2WLLA 4LWSA 2Y48A 5IWAO 3E22B 4DK0A 5LP6A 2EJRA 4YJ2A 1L8DA 3CMAV 5H5NA 1Y76B 1D5NA 4DR5B 3MD0A 4UV8A 1RPOA 1Y66A 3JARA 2QWQB 4J10A 5KUKA 2IW5A 3RYIA 2B1IA 5GTHZ 2IJHA 4JI6O 5L3EA 1Q7YW 4HZ3A 3HKCB 2P22C 2ZR2A 1F7YA 1X4TA 3A0RA 4NTYA 2K1EA 3B40A 3RYHA 3N2KB 2DWEC 4FZ1A 3L75H 2VQFB 5KX5B 3K79A 5FNVA 1Q86W 4LF8B 2EILC 3B4SA 1QLNA 4X65O 4K0KO 4IYHA 3OEEG 3AG2C 2N74A 2QSAA 5LGUA 2QTSA 5C8YA 4BAYA 4X1IA 1VQ4V 3ZEDA 3CCSV 4JI2B 1TGOA 1NTMH 4LF6O 2P67A 4DV0O 2F66C 3BA8A 1GM9A 1VQ8V 1OCOC 5B1BC 2XHBA 1YEWA 4O4HA 3SPHA 1XNQO 1FD9A 3WFVA 3F7VC 2DQ3A 3IFXA 3ETGA 1XREA 3TJTA 4ZHQA 1VP7A 4B3RO 1KP3A 3HB3B 3P3NA 4JAVA 1OCRB 1Q3EA 3J7AU 3ASNB 3ZS8C 1GM7A 1G4YB 2Q7HA 2LO1A 3D8CA 3CRAA 4J9ZB 4MTOA 1VMGA 3S3WA 4O4LB 4FFKA 1PV0A 3O9OA 4MVUA 4QJFB 1W2BU 2UUBB 2QWOB 4DR6B 4LFBO 4O2BA 1YJWV 2A3QA 4AI8A 3WU2Z 2JGDA 1HP8A 4JI0B 2ARHA 3RFRA 3CCQV 4G2KA 1FFXA 4DRXA 4H37A 4OXSA 4I4TB 1HNWO 5JVDB 3VQVA 3CCMV 1ZUQA 3K5MA 5EC2C 3ZX6A 1S5HC 4QE7A 5IT9N 1VQPV 1MG1A 5BMVA 3SPGA 3QTCA 3VQXA 5LXTA 2Q73A 1SQXH 3H01A 2BSKB 4LF5B 5LOVA 2GUZB 2GTAA 2KQXA 3ABLC 5LMUB 4K8ZA 1YF2A 2WAMA 2ADPA 1XHZA 5CA1A 2IH1C 1I5YA 4LF9O 1GRJA 3JALA 1QLEB 4JTCB 1NJIW 4H0LB 1PM9A 2ETNA 5CA0B 2R70A 2XASA 4X1YB 2IH3C 3ZN1A 1G1XB 3CHXA 1BE3H 3ABKC 4PDRA 3BHPA 5DEDA 4X1KA 2QJ1A 2OTJV 3N2GB 3BPZA 1QR8A 2GHYA 1CPYA 2UXCO 1BGYH 3E2EA 4GLXA 4QIWF 1EN5A 1MSWD 4DV5B 4GKKO 2WLJA 3ZN0A 1F4NA 4PA7A 4RQFA 1N4CA 2M7WA 2UXBO 4DV4O 2PI5A 1P84F 4R8CA 4ZI7B 4YIPA 3L70H 4RUFA 1JJOA 4WF9V 4K35A 4NKGB 1RFYA 1HNXO 1N33O 3KZIZ 1K97A 4JAAA 1PL4A 1KD1W 2XAHA 3L9DA 4X20B 4FLVA 4BIUA 3JSNA 3K59A 4N23A 3DGEA 5B66Z 2YEVA 2ZNIA 2WPDG 3OAAG 1W0JG 1R3JC 3OTOO 1BZKA 3D3QA 4GKJO 4F6EA 2YSUB 1BCCH 2DYRC 1TUBA 1M9NA 1MSDA 5LHHA 3OEHG 4TV9B 2CGOA 3JD3A 5EIBD 5JJJB 1OHHG 2LJ2A 4X62B 4RQEA 4KHPB 4H44B 3X2QB 1FXVA 1W59A 2W0FC 2ZXWB 1K3EA 5J2TB 3FKSG 3RYCA 3OW2U 4FLUA 1Y74B 4E2LA 2HVKC 2WLIA 2ZD9A 4TQFA 2YS8A 2NR5A 2DJVA 5LBQA 3ETQA 3CRQA 3K58A 2BOCC 5CBHA 2QWNB 3APOA 1KKDA 3OE7G 4FM1A 2UUAB 1YTFB 2NLJC 4ICGA 5AG2A 1EFRG 3MDSA 2DMXA 3U10A 1KC8W 4CS3A 2E5LO 1SA0B 3SYOA 3ZMZA 3CWBH 4ZIBA 3APQA 1V55C 3JD2A 3WG7C 1FXHA 4JTDB 2YIAA 1GN2A 1HWYA 4IHJA 2LW1A 3UT5A 5L3GA 1VF7A 1SQPH 3TGUH 4UUJC 4FMTA 1NR7A 4LR3A 3HKBA 4I55A 2JS5A 2N04A 1KP2A 3L72H 3FB7C 1DTOA 2EINC 4DUYB 4ZOLB 2AHZA 3CE2A 3Q4HA 4TQDA 3T1HB 4B3TO 4DR2O 4O4IB 2KG7A 1BQ0A 1OV9A 1XOUA 4CC6A 3JATB 4NXMO 1ZLZA 1QHTA 1SQGA 2UU9O 4QNHB 4I0XA 1XMQO 2Y69B 2Q68A 2IJJA 4JI3B 4DV1B 1JR9A 1XDCA 2IBZH 5JQGA 3UQ8A 4BWAA 1MMMA 2WLLB 1AI6A 1M1KW 3ZMUA 1ORQC 1Q81W 1IBKO 4LWSB 5BY1A 1Q90D 3JYCA 1BMFG 3RT3C 4AQYB 2L6LA 5J2UA 5LP6B 4EB6A 4ZKIA 4YJ2B 4UXNA 3E8FA 1MOFA 2DW4A 3BA9A 4JI4B 1ZSPA 3JARB 2Y0IA 1ZX3A 2QM7A 3LSQA 4FPPA 2FMLA 1O9GA 3RYIB 3DC6A 4K8XA 4DW1A 3JAWA 1IBLB 3U11A 1D2DA 5B1AC 1K4DC 1NH2B 1VQLV 3ABTA 3KCXA 5KHKA 2UXXA 3L71H 3RYHB 3I5DA 2A79B 3EVKA 4JZGA 1Y67A 2CTQA 3BABA 4Z2WA 4JI1O 2HKOA 3RBZA 3B77A 4MVOA 5KLVH 1VF6C 5FNVB 3ASOB 1XNRB 3K5LA 3CCLV 5B5EZ 1I94O 3VOUA 4B3MB 4O4JA 4B7EA 4NTWA 4U7OA 2YI9A 1JQ0A 4O2AA 4X1IB 5KMGA 1KU9A 3AG3B 1FYJA 3ZHQA 4P30A 4F6RA 3CCJV 3IGAC 2HEPA 2YXYA 3IC7A 1YXBA 2LW7A 2ZDIA 4O4HB 4JI4O 2LGWA 1VQ7V 1HNZO 1H2MA 3AG1C 1BT8A 1J5EB 3SGIA 4ZHQB 1JFFA 2E74B 1H2GA 2QEXV 4DR7O 4PHZA 2GDSA 3CCEV 1IBMB 3R66A 1XL6A 1XILA 4JV5B 5GTIZ 2WLMA 5K1XA 1F51A 1T5EA 3JASA 2ZKOA 3CXCU 4KUMA 3SPJA 1YITV 2EIKB 4L87A 1QU7A 4B08A 3H1KH 3WB0A 4DUZB 1SQQH 2WWWA 4TSFG 2YDEA 1UFIA 3RYFA 2LQTA 2D2CB 4O2BB 2UXDO 4JYAB 4K3AA 1D5AA 1WP7A 2JIZG 2JGDB 1NTKH 3NR7A 1VQOV 2ZINA 3FB5C 4KP4A 2LP7A 3CPWU 1FFXB 2HFEC 3B2EE 1M57B 1XHXA 3K0GA 1H38A 1PD3A 2KKWA 1HW7A 2QKSA 2H94A 3ZIAG 3IC9A 5KUMA 5E1AC 5LHIA 1TA8A 3JCUZ 4YHHO 3G6EV 1N34B 5JH7A 2DOSA 2Q69A 1NKDA 2Q7EA 5LXTB 3EFFK 2R9AA 5ITZA 5EK0A 3DSQA 1EM1A 2VS0A 4RUEA 4QPJA 3CRRA 2W6JG 5HFMA 4LFAB 3K03A 3H1HH 4JI8B 5IJ9B 5CA1B 2PY5A 3FD9A 4X66O 3JALB 1MABG 4OX9B 4DR4O 4XDKA 5JJEB 2WA4A 4JTAB 2HLDG 2B9ZA 5IJ0A 2CAZC 4LFCO 4NXNB 5H2FZ 4C7UA 3K0DA 1AR5A 1FXKA 2IU3A 5LMNB 5LYJA 3BCCH 4YJ3A 2VQEB 5F2VO 1FS0G 4X1KB 2AZ2A 1PL0A 4DV7O 2PF4E 4LNUA 1SESA 1WPXA 1W0KG 2HHHO 2L35A 2QM8A 4U7NA 4J7JA 1NTZH 4H33A 3OTFA 2HR3A 3CB2A 3HKEA 2XOKG 5IDJA 5H6RA 2WLKA 1PNMA 4LCUC 2DE0X 5IYCO 1TVKA 1LUVA 3CSXA 1H2NA 4UVAA 2HJDA 3E8GA 1HR0B 1U97A 3A0HZ 3ASNC 5A2QN 2YEVB 4CZZA 2ZE6A 2ZM6B 2HVJC 4WFBV 4JYBA 3P3PA 1TUBB 2F4VB 1L0LH 1SQVH 4DR5O 2XAGA 4DYLA 3OR6C 4UVCA 1IURA 2Y4UA 3T1YB 2W0XA 1PP9H 2MK3A 2OWOA 3FYEB 2LGQA 4MT8A 4WBNA 4IGGA 3SYAA 2DN9A 3U0ZA 1OJHA 2YIDA 3RYCB 3SPCA 3W7SA 2ZNJA 3CCVV 2WLIB 4JI7B 3ZRSA 4P2ZA 1R73A 3QF7A 4I7ZB 2VQFO 2XAJA 3B8NA 5DN6G 1JVMA 3B09A 4YY3B 4LF8O 1Q6HA 2Q7GA 4PA6A 1GKFA 4PI2A 2BOBC 4LF4B 4KL1A 3HPLC 3MHHC 4D6TH 4OPAA 2DYSB 1Q43A 2K9PA 5FLXN 1LNQA 4JI2O 2WLNA 2CGNA 1OCOB 4J80A 1R1BA 1F4MA 1QLEC 1AI4A 2A9HA 1KKCA 1I7FA 1R6KA 4IHJB 3UT5B 3J81N 1VQ6V 1GN3A 1IX9A 3OGCC 4N21A 3D36C 4D7SA 1Z5VA 3HKBB 3KKYA 4FM2A 4I55B 3GB7C 4Z1MG 3AG7A 4UB8Z 4HYOA 2VRZA 2QE7G 3TCUA 2HG5C 4J7ZA 3Q4HB 3BRCA 4J9YB 2KG7B 1AB3A 1ZWIC 3SJBC 4JPRA 1IXMA 3QO8A 4I0XB 3WB1A 2F23A 2P5OA 3K04A 5HFLA 5BR8B 1US6A 2R72A 1H2KA 5JCOA 4JASA 2EIJB 2P7TC 4HNAA 4X8AA 2UUBO 3T2MA 1JJ2U 4DR6O 3G80A 4GT1A 3FB8C 3E89A 1SERA 3SYQA 5JQGB 2YC0A 4JI0O 1R3KC 3UKMA 1QNMA 1SETA 1YI2V 4NR1A 4CBCA 4UVBA 3TXQA 4X64B 5CBGA 2ZQMA 1WP8A 4PV1B 1GO3F 1H2LA 2EIMB 3ETEA 5KAFZ 5J2UB 4EB6B 3TK1A 2X6AA 4HBNA 1LUWA 3C3TA 3LNMB 4W4LA 3A8TA 5FPOA 1CEZA 4MVMA 3JAKA 3LSUA 3ABLB 3G6BA 4LF5O 3SYPA 3CJHA 4RO2A 3JAWB 5LMUO 2Y4TA 2NNUA 3X2QC 1GM8A 2ZXWC 2BTOA 2PYJA 1SZXA 5JJNB 1WNSA 1S77D 1R6TA 4MSWC 2Q0OC 1K7DA 1Q6UA 2ZT9B 1URFA 4O4JB 3BVOA 1VQKV 5EBWC 4GX0A 1AR1B 3RVZA 2PZSA 1DF4A 2ZCEA 1K9MW 4JF3A 3SDLA 4O2AB 5KMGB 2FL4A 3QG5A 5C93A 1M56B 1COWG 1K92A 2E76B 4F6RB 4DV5O 1Z2GA 3O65A 4WFAV 2RDCA 1JOYA 4X9QA 1QVFU 1SF9A 1XBLA 5CB4A 1ZAUA 2YXHA 1GAXA 4PI0A 2WA3A 4DV2B 1QR9A 3L73H 1JFFB 3I55V 3ZHRA 1EZJA 1B6QA 3K06A 2FTKA 4J7KA 2XAQA 1PNKA 3AG4B 2JJ2G 3EHBB 3HKDA 2CH7A 2F1MA 3BY6A 3JASB 3ICXA 3DXRA 1OCCB 1JA8A 1I0HA 2YI8A 5B3SB 1CXZB 5LHGA 2Y69C 2F93B 3RYFB 2NN4A 2X6CA 2PTMA 3W7TA 4G28B 1PPJH 4AHCA 4DV6B 4X62O 4DV3B 3BEHA 4FLWA 4KHPO 1OZ0A 3QVNA 2DWDC 1NVPD 1TUEB 3PJSK 1PKXA 4XBFA 1JCHA 1I08A 3CYOA 1Y4MA 3DTUB 5IYZA 1EN6A 2HP8A 1M5IA 5LP6C 1V9PA 3CC2V 1AROP 5JH7B 2RCVA 3LDCA 2ITDC 5ITZB 2JEXA 4P9PA 2UUAO 1O9HA 1OCZB 3E35A 3ZHUA 4JAUA 4Q6GA 5KHJA 4UCOA 5DECA 2UUCB 4BIZA 3CMEV 3ZCCA 3ZRVA 3WB2A 5H6QA 3E8HA 5TISZ 1L0NH 1DK1A 5IJ0B 3ABUA 1ZL8A 2YIBA 1FXKB 2R9IA 5LYJB 4LH7A 2JVDA 4YJ3B 1MZFA 3CRCA 2EINB 4IT5A 3C3SA 2X6BA 2Q4PA 4TOIA 3UO3A 4A5UB 1SQBH 4J41A 1N36B 4LNUB 4QE9A 4DUYO 3T1HO 4NVPA 2V7QG 4GZRB 5B1NA 4U3FH 3LNNA 3AG3C 2Y0PA 2RNBA 4L8JA 1AJNA 1KBHA 4MTGA 3K9AA 5A9GA 3FAVA 2Q0AA 1FJGB 3HKEB 3QNEA 1VQ9V 4JI3O 4DV1O 5FL7G 3BAAA 3H1LH 4MVQA 1TVKB 2PI4A 3W7XA 3C90A 3ZMVA 1QQCA 1BQZA 3VQYA 2A0LA 3ZHVA 2OIEA 2AGAA 1BS3A 4BIOA 2JDIG 1I5XA 3DC5A 1NR1A 4DO2A 4RAIA 5C8YB 1TAEA 1XMOB 5DM6V 2A06H 1N32B 4JI5B 1P7BA 1WAZA 1FKAO 1YHQV 1YJNV 1AI7A 4KXRA 3SJCC 3CP1A 4AQYO 2O57A 3MAQA 3CS5A 3LUTB 2ZIOA 3M7MX 1Q5OA 4NTXA 1VQ5V 2QWPB 2CE4A 2FKXA 1ROPA 2VWKA 1IBLO 1F23A 4BW9A 2QGNA 4EFEA 4DR3B 1M57C 2KSDA 1B04A 1DLBA 2E75B 3W7UA 2P4VA 4LF7B 4CH4A 1KYOF 1XNRO 4E4EA 5L3BA 1M93A 2OYQA 4DR1B 2LFSA 1K33A 2EULA 3GWOA 4B3MO 1SRYA 4U3JA 3P32A 3ZRWA 3K5NA 2EZOA 4FLYA 1PNLA 3T1CA 1R6NA 5IWAB 3ZHTA 4DRXB 3PN1A 5LA6A 5H9CA 3OGIB 2XUMA 2Q8VA 3RVYA 1RM1B 2R9RB 2GSMB 4UFZA 4X88A 1MZEA 1J5EO 1YSCA 5BMVB 4JI6B 4UB6Z 3SJAC 1XUQA 5IY5B 2CTWA 1IBMO 1AP6A 1E1QG 5LOVB 2OCCB 3J80N 4G27B 5EZYA 4KFMA 4FFBA 2RN9A 4JV5O 1G6UA 4TV8A 1WA8A 3THOA 4JGSA 4PA4A 1H8EG 1XQ8A 1FFTB 3G67A 1Q82W 1SQFA 3R65A 2QWRB 4LP8A 4HNAB 2GTSA 4YIOA 4DUZO 5BZBA 2G38A 2RMKB 2GBOA 3OUFA 2P4KA 1XL4A 4X65B 5KHHA 4K0KB 2IJKA 4JYAO 4F4LA 4MVRA 3ABMB 2XTAA 3ZRXA 1LR1A 4IL6Z 4R6ZA 1U96A 1K5SA 5CN0A 4H13B 4TT3G 4PDLA 5IE9A 5CBFA 1Z5WA 4LF6B 4BW5A 1KECA 1RSOA 1BHAA 4DV0B 2E3CA 3UM7A 4I5SA 4YXWG 3MHSC 3K5OA 1XNQB 1N34O 1V54B 3JAKB 3JCZA 4OPHA 5IYBO 3FYIB 4B3RB 5L3DA 1EN4A 3CJHB 2N05A 4LFAO 3H9VA 1FPOA 4JI8O 1E1RG 1OCRC 5EC1C 4OX9O 4PA9A 3ZMSA 1MNGA 5K1PA 2EZPA 3OT7A 1VIBA 1AJPA 1QVGU 2ZE5A 1J95A 4NXNO 4LFBB 2M6YA 4MTXA 5LMNO 1S5LZ 2VQEO 1MA1A 2ADQB 1YCIA 4JZ2A 1YDXA 3IJ4A 1BHBA 3I56V 3JD4A 4I50A 3CCUV 2CTPA 3G4SV 4MS2A 2DYSC 3JD0A 1HNWB 1SS3A 1G8MA 2AHYA 4WFGA 1VF6A 2EILB 4J42A 5CB4B 3SPIA 1ENVA 5GONA 1B06A 4GX5A 3E86A 5KHGA 3AG2B 3F7YC 4NYKA 4TUYA 4CH5A 2V1DA 4JYCA 3D3IA 2ILMA 3ETDA 3F5TA 2ZE7A 2XT9A 2IU0A 2JRIA 3HKDB 1VQMV 1HR0O 4FVMA 4GCZA 1R3LC 2CH7B 2MW2B 4LF9B 3DXRB 5B1BB 4ASUG 2ZM6O 2VWJA 1NZ6A 2GV9A 3K08A 4AILC 2V4DA 1NI8A 2QDOA 5EYPA 2Q6AA 2YUAA 3CC4V 1WJZA 2EIJC 2F4VO 1KMIZ 2FB5A 1JPXA 3T1YO 1AR4A 4FJCC 2BTQA 5LGTA 2UXCB 5KA6A 2Z3YA 4B3SB 4GYCB 2B5UA 1DF5A 4FM0A 4Z1VA 4OGQB 5KHIA 3VBBA 4XDLA 5EBLC 4GKKB 4MW8A 4JI7O 4I9WA 5IYZB 1H8HG 3M99B 2PYLA 2EIMC 3CD6V 1N0JA 3OR7C 2WSSG 4FLZA 2UXBB 4DV4B 3OMIB 4YY3O 3RN4A 1HNXB 1N33B 5FPRA 4IIJA 1SZTA 4MW3A 4LF4O 1VEWA 1M4UA 5IJ9A 1R3IC 3ZHSA 2BE3A 2ZIMA 3CCRV 2CTRA 2XNDG 5EIBC 4FZ0A 4QPKA 2Z5UA 2H3OA 3N27A 3OTOB 3E22A 4GKJB 2C2AA 4R7CA 1Y76A 1ZL8B 1WN7A 1S3JA 3CC7V 1P7GA 3SR2C 3AK2A 4B3SO 4WFHA 3E8BA 3HKCA 3KCYA 1NT2B 1UJWB 3QO7A 4QGPA 2ITCC 1YZBA 1BSMA 3N2KA 3ZJZA 1Q6IA 2OT5A 1M56C 1WPBA 4PJ0Z 3FAVB 5BR8O 5L3CA 5KAIZ 3ZBHA 2YIBD 5KX5A 3ABKB 3L74H 4CC5A 1UPGA 2ZDIC 3SJQC 2P90A 2ZE8A 4DXWA 1AJQA 1S76D 2E5LB 1ZTEA 1BL8A 1N0NA 3OMNB 1K73W 2XAFA 4UCUA 5LGNA 1GH6A 3GWKC 3LSSA 3AG4C 1NQTA 4LC1A 4X64O 2QKAA 2RJZA 1OCCC 2IM9A 1H2SB 2P6JA 1GTOA 4PD4F 5B3SC 3ZMTA 4PA3A 4MTFA 3CRMA 4PDVA 4LH6A 3JD1A 4FIPC 4WFEA 2W6IG 3KG2A 1YVWA 2H8PC 4B3TB 4DR2B 2Z0AA 3FX7A 3TETA 3W7WA 3IAYA 1WB8A 4EFBA 3AEIA 4NXMB 1YJ9V 2UU9B 2JK5C 1E79G 1XMQB 1KQSU 4O4LA 1NVPB 1THZA 5EBMC 1P49A 2DYRB 5BXZA 3CXHF 4CS4A 1VQNV 5IYDO 1KB9F 3A0BZ 2B1GA 1AI5A 2EX3A 1IZ3A 4CH3A 4FLTA 4UCSA 2OIGA 4PDMA 3UO2A 4U3JB 4PELA 4IYIA 3ZRWB 1OCZC 4I9QA 3QO5A 4RWUA 2BCCH 1NS1A 1IBKB 4I4TA 4X89A 3K9SA 2FYUH 3AK1A 3SYCA 4DK1A 5JVDA 2WLHA 5LA6B 1XI1A 1L1FA 2QR4A 5LL6Y 2HJFC 2YXLA 2UXNA 3T4ZA 1YTFD 2P06A 1K5QA 3E83A 3GVMA 1FXKC 2JGUA 4DV2O 5B1OA 1P4RA 1SKVA 2BSKA 2GUZA 3G71V 4ZBMA 2QKCA 4BR6A 2AXTZ 2CDYA 3UCSC 5EZYB 4FFBB 1K34A 2ATKC 1V55B 3WG7B 4TV8B 1WA8B 1WLEA 2PGGA 1SC5B 3JAMN 5CA0A 4JI1B 4XDJA 1S0VA 4UV9A 3D36A 4X1YA 4LBEC 4DW0A 1AP5A 1I94B 5L3FA 3JSLA 2JJ1G 3ASOC 1IXBA 3H1JH 5J9PC 3N2GA 2DQ0A 4DV6O 1EZVH 1XEQA 4R50A 4DV3O 5CMUA 2QA4V 2F43G 4CS2A 3NXSA 1NBMG 1RSOB 1KUQA 2ZR3A 3T4DA 2EJ7A 3ML0A 4MVZA 4Q20A 3BFRA 1EBOA 3RGBA 2AZ0A 1HNZB 4GUNA 3FFQA 1K8AW 4ZI7A 3OMAB 4DR7B 3A2FA 4UCRA 3CX5F 1IVSA 3LDDA 5E79Z 4UCVA 4X20A 4EEQA 4W4KA 2UUCO 1X59A 1AILA 2IJIA 2QTOA 2OTLV 2F95B 1GMGA 1M90W 1JMKC 3FB6C 3RWRD 1GN4A 4NB5A 1DGSA 1HDJA 1QBZA 3EXAA 2EIKC 4TV9A 4GX2A 2UXDB 3AK3A 4B7KA 3OM3B 1NH2D 1N36O 4ABMA 3VQWA 1IDSA 5B1AB 3TXSA 3F5WC 1JX9A 3CEIA 4I50B 4WBNB 3LDEA 5J2TA 4FK5C 1Y74A 3H1IH 2LFRA 3STLC 1AVMA 3OUSA 3K3WA 4WFFA 3M8AA 4D7TA 1NU1H 1FJGO 4YHHB 2KB1A 1N8RW 4MVSA 1YIJV 2A7WA 5JWPA 1CP9A 5CA3A 3RW0A 1RM1C 5GONB 1FAFA 3P30A 1S72V 4WCEV 4TUYB 3OD4A 1Q8IA 3S3XA 1VF5B 2Q67A 5IY5C 1SA0A 2ODMA 2OCHA 2OCCC 4X66B 1S5JA 5KA5A 1XMOO 2Q9LA 1N32O 4EKWA 4DR4B 4JI5O 4P9OA 3OFNG 2YICA 2AW9A 1WB7A 1B3QA 1A32A 4LFCB 5EYPB 2RQ6A 3AG1B 5D5PA 4JYYA 4TWKA 1RP3B 5JCOC 5GW7A
chains in the Genus database with same CATH topology
5B66Z 4PJ0Z 5GTIZ 5KAIZ 5H2FZ 5B5EZ 4UB6Z 5TISZ 3A0HZ 5E79Z 3KZIZ 3WU2Z 4IL6Z 5GTHZ 2AXTZ 3JCUZ 5KAFZ 1S5LZ 4UB8Z 3A0BZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B66 Z;  4PJ0 Z;  5GTI Z;  5KAI Z;  5H2F Z;  5B5E Z;  4UB6 Z;  5TIS Z;  3A0H Z;  5E79 Z;  3KZI Z;  3WU2 Z;  4IL6 Z;  5GTH Z;  2AXT Z;  3JCU Z;  5KAF Z;  1S5L Z;  4UB8 Z;  3A0B Z; 
#chains in the Genus database with same CATH topology
 2EBO A;  4FLX A;  4DV7 B;  2BTQ B;  2CUG A;  1QCE A;  3HR0 A;  4HAM A;  2HHH B;  4ZOL A;  3ABM C;  2QM4 A;  4O4I A;  2JS3 A;  1GN6 A;  3JAT A;  4DR3 O;  3K57 A;  2Q5Z A;  2JEU A;  4GX1 A;  4CH6 A;  4LF7 O;  2PUS A;  2D3O W;  2X7R B;  1V54 C;  3B8M A;  4DR1 O;  5D5Q A;  1RPR A;  4IIJ B;  2CK3 G;  4UCT A;  3STZ C;  1Y6X A;  1VAR A;  4J11 A;  1GK9 A;  1K4C C;  2X0L A;  2WLL A;  4LWS A;  2Y48 A;  5IWA O;  3E22 B;  4DK0 A;  5LP6 A;  2EJR A;  4YJ2 A;  1L8D A;  3CMA V;  5H5N A;  1Y76 B;  1D5N A;  4DR5 B;  3MD0 A;  4UV8 A;  1RPO A;  1Y66 A;  3JAR A;  2QWQ B;  4J10 A;  5KUK A;  2IW5 A;  3RYI A;  2B1I A;  5GTH Z;  2IJH A;  4JI6 O;  5L3E A;  1Q7Y W;  4HZ3 A;  3HKC B;  2P22 C;  2ZR2 A;  1F7Y A;  1X4T A;  3A0R A;  4NTY A;  2K1E A;  3B40 A;  3RYH A;  3N2K B;  2DWE C;  4FZ1 A;  3L75 H;  2VQF B;  5KX5 B;  3K79 A;  5FNV A;  1Q86 W;  4LF8 B;  2EIL C;  3B4S A;  1QLN A;  4X65 O;  4K0K O;  4IYH A;  3OEE G;  3AG2 C;  2N74 A;  2QSA A;  5LGU A;  2QTS A;  5C8Y A;  4BAY A;  4X1I A;  1VQ4 V;  3ZED A;  3CCS V;  4JI2 B;  1TGO A;  1NTM H;  4LF6 O;  2P67 A;  4DV0 O;  2F66 C;  3BA8 A;  1GM9 A;  1VQ8 V;  1OCO C;  5B1B C;  2XHB A;  1YEW A;  4O4H A;  3SPH A;  1XNQ O;  1FD9 A;  3WFV A;  3F7V C;  2DQ3 A;  3IFX A;  3ETG A;  1XRE A;  3TJT A;  4ZHQ A;  1VP7 A;  4B3R O;  1KP3 A;  3HB3 B;  3P3N A;  4JAV A;  1OCR B;  1Q3E A;  3J7A U;  3ASN B;  3ZS8 C;  1GM7 A;  1G4Y B;  2Q7H A;  2LO1 A;  3D8C A;  3CRA A;  4J9Z B;  4MTO A;  1VMG A;  3S3W A;  4O4L B;  4FFK A;  1PV0 A;  3O9O A;  4MVU A;  4QJF B;  1W2B U;  2UUB B;  2QWO B;  4DR6 B;  4LFB O;  4O2B A;  1YJW V;  2A3Q A;  4AI8 A;  3WU2 Z;  2JGD A;  1HP8 A;  4JI0 B;  2ARH A;  3RFR A;  3CCQ V;  4G2K A;  1FFX A;  4DRX A;  4H37 A;  4OXS A;  4I4T B;  1HNW O;  5JVD B;  3VQV A;  3CCM V;  1ZUQ A;  3K5M A;  5EC2 C;  3ZX6 A;  1S5H C;  4QE7 A;  5IT9 N;  1VQP V;  1MG1 A;  5BMV A;  3SPG A;  3QTC A;  3VQX A;  5LXT A;  2Q73 A;  1SQX H;  3H01 A;  2BSK B;  4LF5 B;  5LOV A;  2GUZ B;  2GTA A;  2KQX A;  3ABL C;  5LMU B;  4K8Z A;  1YF2 A;  2WAM A;  2ADP A;  1XHZ A;  5CA1 A;  2IH1 C;  1I5Y A;  4LF9 O;  1GRJ A;  3JAL A;  1QLE B;  4JTC B;  1NJI W;  4H0L B;  1PM9 A;  2ETN A;  5CA0 B;  2R70 A;  2XAS A;  4X1Y B;  2IH3 C;  3ZN1 A;  1G1X B;  3CHX A;  1BE3 H;  3ABK C;  4PDR A;  3BHP A;  5DED A;  4X1K A;  2QJ1 A;  2OTJ V;  3N2G B;  3BPZ A;  1QR8 A;  2GHY A;  1CPY A;  2UXC O;  1BGY H;  3E2E A;  4GLX A;  4QIW F;  1EN5 A;  1MSW D;  4DV5 B;  4GKK O;  2WLJ A;  3ZN0 A;  1F4N A;  4PA7 A;  4RQF A;  1N4C A;  2M7W A;  2UXB O;  4DV4 O;  2PI5 A;  1P84 F;  4R8C A;  4ZI7 B;  4YIP A;  3L70 H;  4RUF A;  1JJO A;  4WF9 V;  4K35 A;  4NKG B;  1RFY A;  1HNX O;  1N33 O;  3KZI Z;  1K97 A;  4JAA A;  1PL4 A;  1KD1 W;  2XAH A;  3L9D A;  4X20 B;  4FLV A;  4BIU A;  3JSN A;  3K59 A;  4N23 A;  3DGE A;  5B66 Z;  2YEV A;  2ZNI A;  2WPD G;  3OAA G;  1W0J G;  1R3J C;  3OTO O;  1BZK A;  3D3Q A;  4GKJ O;  4F6E A;  2YSU B;  1BCC H;  2DYR C;  1TUB A;  1M9N A;  1MSD A;  5LHH A;  3OEH G;  4TV9 B;  2CGO A;  3JD3 A;  5EIB D;  5JJJ B;  1OHH G;  2LJ2 A;  4X62 B;  4RQE A;  4KHP B;  4H44 B;  3X2Q B;  1FXV A;  1W59 A;  2W0F C;  2ZXW B;  1K3E A;  5J2T B;  3FKS G;  3RYC A;  3OW2 U;  4FLU A;  1Y74 B;  4E2L A;  2HVK C;  2WLI A;  2ZD9 A;  4TQF A;  2YS8 A;  2NR5 A;  2DJV A;  5LBQ A;  3ETQ A;  3CRQ A;  3K58 A;  2BOC C;  5CBH A;  2QWN B;  3APO A;  1KKD A;  3OE7 G;  4FM1 A;  2UUA B;  1YTF B;  2NLJ C;  4ICG A;  5AG2 A;  1EFR G;  3MDS A;  2DMX A;  3U10 A;  1KC8 W;  4CS3 A;  2E5L O;  1SA0 B;  3SYO A;  3ZMZ A;  3CWB H;  4ZIB A;  3APQ A;  1V55 C;  3JD2 A;  3WG7 C;  1FXH A;  4JTD B;  2YIA A;  1GN2 A;  1HWY A;  4IHJ A;  2LW1 A;  3UT5 A;  5L3G A;  1VF7 A;  1SQP H;  3TGU H;  4UUJ C;  4FMT A;  1NR7 A;  4LR3 A;  3HKB A;  4I55 A;  2JS5 A;  2N04 A;  1KP2 A;  3L72 H;  3FB7 C;  1DTO A;  2EIN C;  4DUY B;  4ZOL B;  2AHZ A;  3CE2 A;  3Q4H A;  4TQD A;  3T1H B;  4B3T O;  4DR2 O;  4O4I B;  2KG7 A;  1BQ0 A;  1OV9 A;  1XOU A;  4CC6 A;  3JAT B;  4NXM O;  1ZLZ A;  1QHT A;  1SQG A;  2UU9 O;  4QNH B;  4I0X A;  1XMQ O;  2Y69 B;  2Q68 A;  2IJJ A;  4JI3 B;  4DV1 B;  1JR9 A;  1XDC A;  2IBZ H;  5JQG A;  3UQ8 A;  4BWA A;  1MMM A;  2WLL B;  1AI6 A;  1M1K W;  3ZMU A;  1ORQ C;  1Q81 W;  1IBK O;  4LWS B;  5BY1 A;  1Q90 D;  3JYC A;  1BMF G;  3RT3 C;  4AQY B;  2L6L A;  5J2U A;  5LP6 B;  4EB6 A;  4ZKI A;  4YJ2 B;  4UXN A;  3E8F A;  1MOF A;  2DW4 A;  3BA9 A;  4JI4 B;  1ZSP A;  3JAR B;  2Y0I A;  1ZX3 A;  2QM7 A;  3LSQ A;  4FPP A;  2FML A;  1O9G A;  3RYI B;  3DC6 A;  4K8X A;  4DW1 A;  3JAW A;  1IBL B;  3U11 A;  1D2D A;  5B1A C;  1K4D C;  1NH2 B;  1VQL V;  3ABT A;  3KCX A;  5KHK A;  2UXX A;  3L71 H;  3RYH B;  3I5D A;  2A79 B;  3EVK A;  4JZG A;  1Y67 A;  2CTQ A;  3BAB A;  4Z2W A;  4JI1 O;  2HKO A;  3RBZ A;  3B77 A;  4MVO A;  5KLV H;  1VF6 C;  5FNV B;  3ASO B;  1XNR B;  3K5L A;  3CCL V;  5B5E Z;  1I94 O;  3VOU A;  4B3M B;  4O4J A;  4B7E A;  4NTW A;  4U7O A;  2YI9 A;  1JQ0 A;  4O2A A;  4X1I B;  5KMG A;  1KU9 A;  3AG3 B;  1FYJ A;  3ZHQ A;  4P30 A;  4F6R A;  3CCJ V;  3IGA C;  2HEP A;  2YXY A;  3IC7 A;  1YXB A;  2LW7 A;  2ZDI A;  4O4H B;  4JI4 O;  2LGW A;  1VQ7 V;  1HNZ O;  1H2M A;  3AG1 C;  1BT8 A;  1J5E B;  3SGI A;  4ZHQ B;  1JFF A;  2E74 B;  1H2G A;  2QEX V;  4DR7 O;  4PHZ A;  2GDS A;  3CCE V;  1IBM B;  3R66 A;  1XL6 A;  1XIL A;  4JV5 B;  5GTI Z;  2WLM A;  5K1X A;  1F51 A;  1T5E A;  3JAS A;  2ZKO A;  3CXC U;  4KUM A;  3SPJ A;  1YIT V;  2EIK B;  4L87 A;  1QU7 A;  4B08 A;  3H1K H;  3WB0 A;  4DUZ B;  1SQQ H;  2WWW A;  4TSF G;  2YDE A;  1UFI A;  3RYF A;  2LQT A;  2D2C B;  4O2B B;  2UXD O;  4JYA B;  4K3A A;  1D5A A;  1WP7 A;  2JIZ G;  2JGD B;  1NTK H;  3NR7 A;  1VQO V;  2ZIN A;  3FB5 C;  4KP4 A;  2LP7 A;  3CPW U;  1FFX B;  2HFE C;  3B2E E;  1M57 B;  1XHX A;  3K0G A;  1H38 A;  1PD3 A;  2KKW A;  1HW7 A;  2QKS A;  2H94 A;  3ZIA G;  3IC9 A;  5KUM A;  5E1A C;  5LHI A;  1TA8 A;  3JCU Z;  4YHH O;  3G6E V;  1N34 B;  5JH7 A;  2DOS A;  2Q69 A;  1NKD A;  2Q7E A;  5LXT B;  3EFF K;  2R9A A;  5ITZ A;  5EK0 A;  3DSQ A;  1EM1 A;  2VS0 A;  4RUE A;  4QPJ A;  3CRR A;  2W6J G;  5HFM A;  4LFA B;  3K03 A;  3H1H H;  4JI8 B;  5IJ9 B;  5CA1 B;  2PY5 A;  3FD9 A;  4X66 O;  3JAL B;  1MAB G;  4OX9 B;  4DR4 O;  4XDK A;  5JJE B;  2WA4 A;  4JTA B;  2HLD G;  2B9Z A;  5IJ0 A;  2CAZ C;  4LFC O;  4NXN B;  5H2F Z;  4C7U A;  3K0D A;  1AR5 A;  1FXK A;  2IU3 A;  5LMN B;  5LYJ A;  3BCC H;  4YJ3 A;  2VQE B;  5F2V O;  1FS0 G;  4X1K B;  2AZ2 A;  1PL0 A;  4DV7 O;  2PF4 E;  4LNU A;  1SES A;  1WPX A;  1W0K G;  2HHH O;  2L35 A;  2QM8 A;  4U7N A;  4J7J A;  1NTZ H;  4H33 A;  3OTF A;  2HR3 A;  3CB2 A;  3HKE A;  2XOK G;  5IDJ A;  5H6R A;  2WLK A;  1PNM A;  4LCU C;  2DE0 X;  5IYC O;  1TVK A;  1LUV A;  3CSX A;  1H2N A;  4UVA A;  2HJD A;  3E8G A;  1HR0 B;  1U97 A;  3A0H Z;  3ASN C;  5A2Q N;  2YEV B;  4CZZ A;  2ZE6 A;  2ZM6 B;  2HVJ C;  4WFB V;  4JYB A;  3P3P A;  1TUB B;  2F4V B;  1L0L H;  1SQV H;  4DR5 O;  2XAG A;  4DYL A;  3OR6 C;  4UVC A;  1IUR A;  2Y4U A;  3T1Y B;  2W0X A;  1PP9 H;  2MK3 A;  2OWO A;  3FYE B;  2LGQ A;  4MT8 A;  4WBN A;  4IGG A;  3SYA A;  2DN9 A;  3U0Z A;  1OJH A;  2YID A;  3RYC B;  3SPC A;  3W7S A;  2ZNJ A;  3CCV V;  2WLI B;  4JI7 B;  3ZRS A;  4P2Z A;  1R73 A;  3QF7 A;  4I7Z B;  2VQF O;  2XAJ A;  3B8N A;  5DN6 G;  1JVM A;  3B09 A;  4YY3 B;  4LF8 O;  1Q6H A;  2Q7G A;  4PA6 A;  1GKF A;  4PI2 A;  2BOB C;  4LF4 B;  4KL1 A;  3HPL C;  3MHH C;  4D6T H;  4OPA A;  2DYS B;  1Q43 A;  2K9P A;  5FLX N;  1LNQ A;  4JI2 O;  2WLN A;  2CGN A;  1OCO B;  4J80 A;  1R1B A;  1F4M A;  1QLE C;  1AI4 A;  2A9H A;  1KKC A;  1I7F A;  1R6K A;  4IHJ B;  3UT5 B;  3J81 N;  1VQ6 V;  1GN3 A;  1IX9 A;  3OGC C;  4N21 A;  3D36 C;  4D7S A;  1Z5V A;  3HKB B;  3KKY A;  4FM2 A;  4I55 B;  3GB7 C;  4Z1M G;  3AG7 A;  4UB8 Z;  4HYO A;  2VRZ A;  2QE7 G;  3TCU A;  2HG5 C;  4J7Z A;  3Q4H B;  3BRC A;  4J9Y B;  2KG7 B;  1AB3 A;  1ZWI C;  3SJB C;  4JPR A;  1IXM A;  3QO8 A;  4I0X B;  3WB1 A;  2F23 A;  2P5O A;  3K04 A;  5HFL A;  5BR8 B;  1US6 A;  2R72 A;  1H2K A;  5JCO A;  4JAS A;  2EIJ B;  2P7T C;  4HNA A;  4X8A A;  2UUB O;  3T2M A;  1JJ2 U;  4DR6 O;  3G80 A;  4GT1 A;  3FB8 C;  3E89 A;  1SER A;  3SYQ A;  5JQG B;  2YC0 A;  4JI0 O;  1R3K C;  3UKM A;  1QNM A;  1SET A;  1YI2 V;  4NR1 A;  4CBC A;  4UVB A;  3TXQ A;  4X64 B;  5CBG A;  2ZQM A;  1WP8 A;  4PV1 B;  1GO3 F;  1H2L A;  2EIM B;  3ETE A;  5KAF Z;  5J2U B;  4EB6 B;  3TK1 A;  2X6A A;  4HBN A;  1LUW A;  3C3T A;  3LNM B;  4W4L A;  3A8T A;  5FPO A;  1CEZ A;  4MVM A;  3JAK A;  3LSU A;  3ABL B;  3G6B A;  4LF5 O;  3SYP A;  3CJH A;  4RO2 A;  3JAW B;  5LMU O;  2Y4T A;  2NNU A;  3X2Q C;  1GM8 A;  2ZXW C;  2BTO A;  2PYJ A;  1SZX A;  5JJN B;  1WNS A;  1S77 D;  1R6T A;  4MSW C;  2Q0O C;  1K7D A;  1Q6U A;  2ZT9 B;  1URF A;  4O4J B;  3BVO A;  1VQK V;  5EBW C;  4GX0 A;  1AR1 B;  3RVZ A;  2PZS A;  1DF4 A;  2ZCE A;  1K9M W;  4JF3 A;  3SDL A;  4O2A B;  5KMG B;  2FL4 A;  3QG5 A;  5C93 A;  1M56 B;  1COW G;  1K92 A;  2E76 B;  4F6R B;  4DV5 O;  1Z2G A;  3O65 A;  4WFA V;  2RDC A;  1JOY A;  4X9Q A;  1QVF U;  1SF9 A;  1XBL A;  5CB4 A;  1ZAU A;  2YXH A;  1GAX A;  4PI0 A;  2WA3 A;  4DV2 B;  1QR9 A;  3L73 H;  1JFF B;  3I55 V;  3ZHR A;  1EZJ A;  1B6Q A;  3K06 A;  2FTK A;  4J7K A;  2XAQ A;  1PNK A;  3AG4 B;  2JJ2 G;  3EHB B;  3HKD A;  2CH7 A;  2F1M A;  3BY6 A;  3JAS B;  3ICX A;  3DXR A;  1OCC B;  1JA8 A;  1I0H A;  2YI8 A;  5B3S B;  1CXZ B;  5LHG A;  2Y69 C;  2F93 B;  3RYF B;  2NN4 A;  2X6C A;  2PTM A;  3W7T A;  4G28 B;  1PPJ H;  4AHC A;  4DV6 B;  4X62 O;  4DV3 B;  3BEH A;  4FLW A;  4KHP O;  1OZ0 A;  3QVN A;  2DWD C;  1NVP D;  1TUE B;  3PJS K;  1PKX A;  4XBF A;  1JCH A;  1I08 A;  3CYO A;  1Y4M A;  3DTU B;  5IYZ A;  1EN6 A;  2HP8 A;  1M5I A;  5LP6 C;  1V9P A;  3CC2 V;  1ARO P;  5JH7 B;  2RCV A;  3LDC A;  2ITD C;  5ITZ B;  2JEX A;  4P9P A;  2UUA O;  1O9H A;  1OCZ B;  3E35 A;  3ZHU A;  4JAU A;  4Q6G A;  5KHJ A;  4UCO A;  5DEC A;  2UUC B;  4BIZ A;  3CME V;  3ZCC A;  3ZRV A;  3WB2 A;  5H6Q A;  3E8H A;  5TIS Z;  1L0N H;  1DK1 A;  5IJ0 B;  3ABU A;  1ZL8 A;  2YIB A;  1FXK B;  2R9I A;  5LYJ B;  4LH7 A;  2JVD A;  4YJ3 B;  1MZF A;  3CRC A;  2EIN B;  4IT5 A;  3C3S A;  2X6B A;  2Q4P A;  4TOI A;  3UO3 A;  4A5U B;  1SQB H;  4J41 A;  1N36 B;  4LNU B;  4QE9 A;  4DUY O;  3T1H O;  4NVP A;  2V7Q G;  4GZR B;  5B1N A;  4U3F H;  3LNN A;  3AG3 C;  2Y0P A;  2RNB A;  4L8J A;  1AJN A;  1KBH A;  4MTG A;  3K9A A;  5A9G A;  3FAV A;  2Q0A A;  1FJG B;  3HKE B;  3QNE A;  1VQ9 V;  4JI3 O;  4DV1 O;  5FL7 G;  3BAA A;  3H1L H;  4MVQ A;  1TVK B;  2PI4 A;  3W7X A;  3C90 A;  3ZMV A;  1QQC A;  1BQZ A;  3VQY A;  2A0L A;  3ZHV A;  2OIE A;  2AGA A;  1BS3 A;  4BIO A;  2JDI G;  1I5X A;  3DC5 A;  1NR1 A;  4DO2 A;  4RAI A;  5C8Y B;  1TAE A;  1XMO B;  5DM6 V;  2A06 H;  1N32 B;  4JI5 B;  1P7B A;  1WAZ A;  1FKA O;  1YHQ V;  1YJN V;  1AI7 A;  4KXR A;  3SJC C;  3CP1 A;  4AQY O;  2O57 A;  3MAQ A;  3CS5 A;  3LUT B;  2ZIO A;  3M7M X;  1Q5O A;  4NTX A;  1VQ5 V;  2QWP B;  2CE4 A;  2FKX A;  1ROP A;  2VWK A;  1IBL O;  1F23 A;  4BW9 A;  2QGN A;  4EFE A;  4DR3 B;  1M57 C;  2KSD A;  1B04 A;  1DLB A;  2E75 B;  3W7U A;  2P4V A;  4LF7 B;  4CH4 A;  1KYO F;  1XNR O;  4E4E A;  5L3B A;  1M93 A;  2OYQ A;  4DR1 B;  2LFS A;  1K33 A;  2EUL A;  3GWO A;  4B3M O;  1SRY A;  4U3J A;  3P32 A;  3ZRW A;  3K5N A;  2EZO A;  4FLY A;  1PNL A;  3T1C A;  1R6N A;  5IWA B;  3ZHT A;  4DRX B;  3PN1 A;  5LA6 A;  5H9C A;  3OGI B;  2XUM A;  2Q8V A;  3RVY A;  1RM1 B;  2R9R B;  2GSM B;  4UFZ A;  4X88 A;  1MZE A;  1J5E O;  1YSC A;  5BMV B;  4JI6 B;  4UB6 Z;  3SJA C;  1XUQ A;  5IY5 B;  2CTW A;  1IBM O;  1AP6 A;  1E1Q G;  5LOV B;  2OCC B;  3J80 N;  4G27 B;  5EZY A;  4KFM A;  4FFB A;  2RN9 A;  4JV5 O;  1G6U A;  4TV8 A;  1WA8 A;  3THO A;  4JGS A;  4PA4 A;  1H8E G;  1XQ8 A;  1FFT B;  3G67 A;  1Q82 W;  1SQF A;  3R65 A;  2QWR B;  4LP8 A;  4HNA B;  2GTS A;  4YIO A;  4DUZ O;  5BZB A;  2G38 A;  2RMK B;  2GBO A;  3OUF A;  2P4K A;  1XL4 A;  4X65 B;  5KHH A;  4K0K B;  2IJK A;  4JYA O;  4F4L A;  4MVR A;  3ABM B;  2XTA A;  3ZRX A;  1LR1 A;  4IL6 Z;  4R6Z A;  1U96 A;  1K5S A;  5CN0 A;  4H13 B;  4TT3 G;  4PDL A;  5IE9 A;  5CBF A;  1Z5W A;  4LF6 B;  4BW5 A;  1KEC A;  1RSO A;  1BHA A;  4DV0 B;  2E3C A;  3UM7 A;  4I5S A;  4YXW G;  3MHS C;  3K5O A;  1XNQ B;  1N34 O;  1V54 B;  3JAK B;  3JCZ A;  4OPH A;  5IYB O;  3FYI B;  4B3R B;  5L3D A;  1EN4 A;  3CJH B;  2N05 A;  4LFA O;  3H9V A;  1FPO A;  4JI8 O;  1E1R G;  1OCR C;  5EC1 C;  4OX9 O;  4PA9 A;  3ZMS A;  1MNG A;  5K1P A;  2EZP A;  3OT7 A;  1VIB A;  1AJP A;  1QVG U;  2ZE5 A;  1J95 A;  4NXN O;  4LFB B;  2M6Y A;  4MTX A;  5LMN O;  1S5L Z;  2VQE O;  1MA1 A;  2ADQ B;  1YCI A;  4JZ2 A;  1YDX A;  3IJ4 A;  1BHB A;  3I56 V;  3JD4 A;  4I50 A;  3CCU V;  2CTP A;  3G4S V;  4MS2 A;  2DYS C;  3JD0 A;  1HNW B;  1SS3 A;  1G8M A;  2AHY A;  4WFG A;  1VF6 A;  2EIL B;  4J42 A;  5CB4 B;  3SPI A;  1ENV A;  5GON A;  1B06 A;  4GX5 A;  3E86 A;  5KHG A;  3AG2 B;  3F7Y C;  4NYK A;  4TUY A;  4CH5 A;  2V1D A;  4JYC A;  3D3I A;  2ILM A;  3ETD A;  3F5T A;  2ZE7 A;  2XT9 A;  2IU0 A;  2JRI A;  3HKD B;  1VQM V;  1HR0 O;  4FVM A;  4GCZ A;  1R3L C;  2CH7 B;  2MW2 B;  4LF9 B;  3DXR B;  5B1B B;  4ASU G;  2ZM6 O;  2VWJ A;  1NZ6 A;  2GV9 A;  3K08 A;  4AIL C;  2V4D A;  1NI8 A;  2QDO A;  5EYP A;  2Q6A A;  2YUA A;  3CC4 V;  1WJZ A;  2EIJ C;  2F4V O;  1KMI Z;  2FB5 A;  1JPX A;  3T1Y O;  1AR4 A;  4FJC C;  2BTQ A;  5LGT A;  2UXC B;  5KA6 A;  2Z3Y A;  4B3S B;  4GYC B;  2B5U A;  1DF5 A;  4FM0 A;  4Z1V A;  4OGQ B;  5KHI A;  3VBB A;  4XDL A;  5EBL C;  4GKK B;  4MW8 A;  4JI7 O;  4I9W A;  5IYZ B;  1H8H G;  3M99 B;  2PYL A;  2EIM C;  3CD6 V;  1N0J A;  3OR7 C;  2WSS G;  4FLZ A;  2UXB B;  4DV4 B;  3OMI B;  4YY3 O;  3RN4 A;  1HNX B;  1N33 B;  5FPR A;  4IIJ A;  1SZT A;  4MW3 A;  4LF4 O;  1VEW A;  1M4U A;  5IJ9 A;  1R3I C;  3ZHS A;  2BE3 A;  2ZIM A;  3CCR V;  2CTR A;  2XND G;  5EIB C;  4FZ0 A;  4QPK A;  2Z5U A;  2H3O A;  3N27 A;  3OTO B;  3E22 A;  4GKJ B;  2C2A A;  4R7C A;  1Y76 A;  1ZL8 B;  1WN7 A;  1S3J A;  3CC7 V;  1P7G A;  3SR2 C;  3AK2 A;  4B3S O;  4WFH A;  3E8B A;  3HKC A;  3KCY A;  1NT2 B;  1UJW B;  3QO7 A;  4QGP A;  2ITC C;  1YZB A;  1BSM A;  3N2K A;  3ZJZ A;  1Q6I A;  2OT5 A;  1M56 C;  1WPB A;  4PJ0 Z;  3FAV B;  5BR8 O;  5L3C A;  5KAI Z;  3ZBH A;  2YIB D;  5KX5 A;  3ABK B;  3L74 H;  4CC5 A;  1UPG A;  2ZDI C;  3SJQ C;  2P90 A;  2ZE8 A;  4DXW A;  1AJQ A;  1S76 D;  2E5L B;  1ZTE A;  1BL8 A;  1N0N A;  3OMN B;  1K73 W;  2XAF A;  4UCU A;  5LGN A;  1GH6 A;  3GWK C;  3LSS A;  3AG4 C;  1NQT A;  4LC1 A;  4X64 O;  2QKA A;  2RJZ A;  1OCC C;  2IM9 A;  1H2S B;  2P6J A;  1GTO A;  4PD4 F;  5B3S C;  3ZMT A;  4PA3 A;  4MTF A;  3CRM A;  4PDV A;  4LH6 A;  3JD1 A;  4FIP C;  4WFE A;  2W6I G;  3KG2 A;  1YVW A;  2H8P C;  4B3T B;  4DR2 B;  2Z0A A;  3FX7 A;  3TET A;  3W7W A;  3IAY A;  1WB8 A;  4EFB A;  3AEI A;  4NXM B;  1YJ9 V;  2UU9 B;  2JK5 C;  1E79 G;  1XMQ B;  1KQS U;  4O4L A;  1NVP B;  1THZ A;  5EBM C;  1P49 A;  2DYR B;  5BXZ A;  3CXH F;  4CS4 A;  1VQN V;  5IYD O;  1KB9 F;  3A0B Z;  2B1G A;  1AI5 A;  2EX3 A;  1IZ3 A;  4CH3 A;  4FLT A;  4UCS A;  2OIG A;  4PDM A;  3UO2 A;  4U3J B;  4PEL A;  4IYI A;  3ZRW B;  1OCZ C;  4I9Q A;  3QO5 A;  4RWU A;  2BCC H;  1NS1 A;  1IBK B;  4I4T A;  4X89 A;  3K9S A;  2FYU H;  3AK1 A;  3SYC A;  4DK1 A;  5JVD A;  2WLH A;  5LA6 B;  1XI1 A;  1L1F A;  2QR4 A;  5LL6 Y;  2HJF C;  2YXL A;  2UXN A;  3T4Z A;  1YTF D;  2P06 A;  1K5Q A;  3E83 A;  3GVM A;  1FXK C;  2JGU A;  4DV2 O;  5B1O A;  1P4R A;  1SKV A;  2BSK A;  2GUZ A;  3G71 V;  4ZBM A;  2QKC A;  4BR6 A;  2AXT Z;  2CDY A;  3UCS C;  5EZY B;  4FFB B;  1K34 A;  2ATK C;  1V55 B;  3WG7 B;  4TV8 B;  1WA8 B;  1WLE A;  2PGG A;  1SC5 B;  3JAM N;  5CA0 A;  4JI1 B;  4XDJ A;  1S0V A;  4UV9 A;  3D36 A;  4X1Y A;  4LBE C;  4DW0 A;  1AP5 A;  1I94 B;  5L3F A;  3JSL A;  2JJ1 G;  3ASO C;  1IXB A;  3H1J H;  5J9P C;  3N2G A;  2DQ0 A;  4DV6 O;  1EZV H;  1XEQ A;  4R50 A;  4DV3 O;  5CMU A;  2QA4 V;  2F43 G;  4CS2 A;  3NXS A;  1NBM G;  1RSO B;  1KUQ A;  2ZR3 A;  3T4D A;  2EJ7 A;  3ML0 A;  4MVZ A;  4Q20 A;  3BFR A;  1EBO A;  3RGB A;  2AZ0 A;  1HNZ B;  4GUN A;  3FFQ A;  1K8A W;  4ZI7 A;  3OMA B;  4DR7 B;  3A2F A;  4UCR A;  3CX5 F;  1IVS A;  3LDD A;  5E79 Z;  4UCV A;  4X20 A;  4EEQ A;  4W4K A;  2UUC O;  1X59 A;  1AIL A;  2IJI A;  2QTO A;  2OTL V;  2F95 B;  1GMG A;  1M90 W;  1JMK C;  3FB6 C;  3RWR D;  1GN4 A;  4NB5 A;  1DGS A;  1HDJ A;  1QBZ A;  3EXA A;  2EIK C;  4TV9 A;  4GX2 A;  2UXD B;  3AK3 A;  4B7K A;  3OM3 B;  1NH2 D;  1N36 O;  4ABM A;  3VQW A;  1IDS A;  5B1A B;  3TXS A;  3F5W C;  1JX9 A;  3CEI A;  4I50 B;  4WBN B;  3LDE A;  5J2T A;  4FK5 C;  1Y74 A;  3H1I H;  2LFR A;  3STL C;  1AVM A;  3OUS A;  3K3W A;  4WFF A;  3M8A A;  4D7T A;  1NU1 H;  1FJG O;  4YHH B;  2KB1 A;  1N8R W;  4MVS A;  1YIJ V;  2A7W A;  5JWP A;  1CP9 A;  5CA3 A;  3RW0 A;  1RM1 C;  5GON B;  1FAF A;  3P30 A;  1S72 V;  4WCE V;  4TUY B;  3OD4 A;  1Q8I A;  3S3X A;  1VF5 B;  2Q67 A;  5IY5 C;  1SA0 A;  2ODM A;  2OCH A;  2OCC C;  4X66 B;  1S5J A;  5KA5 A;  1XMO O;  2Q9L A;  1N32 O;  4EKW A;  4DR4 B;  4JI5 O;  4P9O A;  3OFN G;  2YIC A;  2AW9 A;  1WB7 A;  1B3Q A;  1A32 A;  4LFC B;  5EYP B;  2RQ6 A;  3AG1 B;  5D5P A;  4JYY A;  4TWK A;  1RP3 B;  5JCO C;  5GW7 A; 
#chains in the Genus database with same CATH homology
 5B66 Z;  4PJ0 Z;  5GTI Z;  5KAI Z;  5H2F Z;  5B5E Z;  4UB6 Z;  5TIS Z;  3A0H Z;  5E79 Z;  3KZI Z;  3WU2 Z;  4IL6 Z;  5GTH Z;  2AXT Z;  3JCU Z;  5KAF Z;  1S5L Z;  4UB8 Z;  3A0B Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...