4HYVA

Pyruvate kinase (pyk) from trypanosoma brucei in the presence of magnesium, pep and f26bp
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
498
structure length
498
Chain Sequence
SQLEHNIGLSIFEPVAKHRANRIVCTIGPSTQSVEALKNLMKSGMSVARMNFSHGSHEYHQTTINNVRAAAAELGLHIGIALDTKGPEIRTGLFKDGEVSFAPGDIVCVTTDPAYEKVGTKEKFYIDYPQLTNAVRPGGSIYVDDGVMTLRVVSKEDDRTLKCHVNNHHRLTDRRGINLPGCEVDLPAVSEKDRKDLEFGVAQGVDMIFASFIRTAEQVREVRAALGEKGKDILIISKIENHQGVQNIDSIIEASNGIMVARGDLGVEIPAEKVCVAQMCIISKCNVVGKPVICATQMLESMTSNPRPTRAEVSDVANAVLNGADCVMLSGETAKGKYPNEVVQYMARICVEAQSATHDTVMFNSIKNLQKIPMCPEEAVCSSAVASAFEVQAKAMLVLSNTGRSARLISKYRPNCPIICVTTRLQTCRQLNVTRSVVSVFYDAAKSGEDKDKEKRVKLGLDFAKKEKYASTGDVVVVVHADHSVKGYPNQTRLIYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyruvate kinase 1
publication title `In crystallo' substrate binding triggers major domain movements and reveals magnesium as a co-activator of Trypanosoma brucei pyruvate kinase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
total genus 186
structure length 498
sequence length 498
chains with identical sequence B
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4hyvA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 4hyvA01
5JVLA 3EOEA 1DIKA 4IP7A 3IS4A 1A3XA 3QV7A 1A5UA 3R4IA 4L80A 4IMAA 1MUMA 2V5KA 2R82A 4WJ8A 4YNGA 4B5TA 4IQEA 2QIWA 1S2TA 3B8IA 3LYEA 5TAOA 1M1BA 3QQWA 3QZ6A 2XZ9A 4YJ5A 1IZCA 2V5JA 3OQ8A 3GG8A 1E0UA 4L9ZA 2E28A 1O5QA 4IQDA 1F8MA 3EZ4A 2G50A 3MA8A 1F3XA 1SGJA 4KRZA 1OY0A 1S2VA 3U2ZA 4L7ZA 2ZE3A 3QTGA 4HYWA 1XG3A 1ZJHA 1KC7A 3HQPA 2XZ7A 4DRSA 2HJPA 3M0KA 1PKNA 3KHDA 3HQNA 1F3WA 1UJQA 1PKMA 3FA4A 3N25A 4MG4A 4QGCA 4KCUA 1GGOA 3P0XA 4B2DA 3E0WA 1F61A 2VWTA 1Z6KA 4TV5A 1KBLA 3EOLA 3QV8A 3G2GA 1DXEA 1S2WA 4QG9A 3ME3A 3KTXA 1PYMA 4B5SA 2HWGA 1ZLPA 2WQDA 4HYVA 4B2DD 2VGFA 1U5HA 2OLSA 3I4EA 1O68A 2KX9A 2XDFA 3E0VA 2X0SA 3VAVA 3T0TA 2VGIA 3SRKA 2VGBA 1JDEA 4RPPA 4MF4A 1PKYA 4B5UA 1VBGA 1A49A 4B5XA 4KCWA 2DUAA 3FA3A 3BJTA 4KCTA 4TV6A 4ROQA 3GR4A 4LSBA 3SRFA 3LG3A 1AQFA 3GQYA 4B5VA 3HQOA 4B5WA 3T07A 1A3WA 1U5VA 2VGGA 3QV9A 3M0JA 1VBHA 4L9YA 3PUGA 2BG5A 4FXJA 1DQUA 1IGWA 3SRHA 4G1NA 2HRWA 3T05A 2VWSA 3BJFA 3QLLA 2DIKA 1T5AA 1E0TA 4FXFA 1T57A 3QV6A 1DXFA 2HROA 4QG6A 3OYZA 1XG4A 4KCVA 4KS0A 2L5HA 3PP7A 4JPGA 1O66A 1F8IA 3EOOA 1PKLA 3OYXA 3E5BA 1OQFA 1M3UA 3SRDA 3H6OA 1VP8A 1S2UA 4QG8A
chains in the Genus database with same CATH superfamily
3FS2A 3MANA 1N8FA 1TV8A 4JS3A 2BVTA 3H2NA 4HHLA 1FTXA 3LYEA 3WNNA 1M1BA 4QSHA 2OWWA 3E49A 3ZLFA 6XIMA 5FSDC 1EUNA 3C2VA 3JUGA 4ZTYA 1GK8A 3UP8A 4K7YA 4BF7A 3AJ7A 5BW6A 2O7QA 2TSYA 3WLHA 4DJDC 2WANA 4QP0A 4Z1DA 4D8ZA 1PE1A 2IPFA 3HGJA 4F0SA 2DORA 2J6XA 2VT0A 1OFRA 2R24A 4TX8A 5A8QA 3A24A 2YCIX 2C0HA 4HA0A 4W85A 4UZSA 1O7AA 4W88A 1TWSA 2DH3A 2OKOA 4EKJA 4KPLA 2VRKA 5H91A 1J01A 1C29A 1RPKA 2J79A 3FYYA 3GXPA 4ZB2A 3VDHA 2NT1A 2A6LA 2WVSA 2Y63A 1LWIA 4X2RA 2P10A 3WKZA 5M3WA 5LA2A 1AUSL 1WKYA 3UR7A 5EMUA 4DWSD 5C9UA 2DZTA 2INZA 3Q37A 2XGBA 2YFNA 4EANA 1S5TA 2E7FA 2GWGA 4KWVA 4RZ5A 3H7UA 4JZ5A 1H60A 2Y7EA 1E6XM 4PRTA 3AIBA 2GYIA 3MJMA 3ZVHB 1HIZA 1GVIA 4QJ3B 2GGHA 2PBOA 4MIMA 2QF7A 3N4EA 2CW6A 2VR5A 3G1DA 3KOYA 4HHHA 2RKXA 4X3ZA 1L6GA 5GVJA 3AIWA 4CNNA 3W2NA 2WM1A 1BKSA 4NJGA 1PZ2A 2P0IA 2ZZ2A 3M7WA 4H7CA 1FS0G 3N2XA 2XOKG 1SFLA 1Q6DA 4AHPA 4JKLA 1SQ7A 3S9ZA 3K1DA 2OGJA 4EX4A 3IARA 3GBEA 3GNNA 1NVMA 3CAQA 3C0SA 1RCXB 2ZYFA 2ALRA 4QAIA 4HOWA 1YYAA 1TZ7A 4IT1A 1VYRA 4KBXA 2BP1A 1W0MA 1P0DA 1RLDA 2CETA 1M65A 5E9AA 5HQLA 1QBAA 5EKYA 6CGTA 3G3MA 3S0CA 4RJEA 5KITA 1PDZA 5T9CE 4HGXA 1ONWA 1XPGA 4MB4A 4BA0A 5HXMA 3MO4A 3KEHA 3PS7A 3VCRA 3BG5A 2GZXA 1JZ3A 2GGGA 4L9XA 2B81A 4N6FA 4Q7NA 3SW6A 4MZ1A 3GTNA 3ONBA 4F2TA 3CBWA 4N6EA 1O12A 2ZX7A 1TJRA 3BCJA 2F8QA 2PC8A 3QPYA 4RK8A 1VJSA 4DO6A 2E6YA 3AHZA 3CV7A 3DKJA 3GKFA 2XN1A 1DP0A 4ERAA 4QGCA 1X1NA 4XKYA 3VNKA 5DT7A 2VVSA 1RK5A 2DT2A 4MKVA 2ADAA 4IG2A 3HB9A 1CXLA 4B5SA 8A3HA 3CUGA 1OCQA 3GFZA 1MI3A 3LPOA 1W1A1 3EKZA 1VFUA 2O56A 4IPJA 5BU9A 2GJPA 1D7KA 4KGJA 4HOXA 5ECUA 3I3BA 1AK5A 1GVEA 3SRHA 4WXYA 1F07A 1E1FA 2GJRA 1XJBA 2UWFA 1GOQA 4A4AA 3R25A 2W79A 3VCCA 3U7BA 3R0UA 1KM6A 5I02A 1DTNA 5BRQA 1OB0A 2BS9A 3H2EA 3W7CA 1XI3A 5HA7A 2BFGA 4JQ4A 4AWSA 3AXXA 3BH4A 3LPGA 1B0IA 3UZ5A 2D24A 3PTMA 4Z1BA 1PIIA 1Q2SA 5I23A 1DXIA 1PL9A 2OSXA 1IEWA 2C71A 1XW8A 2PP0A 4HPGA 1XLCA 1ZL1A 1I4NA 1V3HA 4W8BA 2XZ7A 4GKTA 5HMSA 1XLAA 3WLSA 5CZJA 2GK1A 4PTMA 3NURA 1VH7A 1W9DM 3QSRA 2H3BA 2W6JG 4D1JA 1KO0A 3EPNA 5FL7G 4TV5A 5MKGB 2WMIB 2VFIA 1VS1A 2OT0A 3VNZA 2F9RA 5I24A 5DY3A 2Z1BA 1J0KA 2VC5A 4ACYA 4MNKA 1CXFA 2VEIA 3STEA 3AMDA 3EYPA 4WDWA 3UWYA 3STCA 1VENA 1MSSA 5FCZA 1TE6A 4PTXA 1V0KA 4INFA 2HSAA 1POJA 1OYAA 2BWGA 4OTKA 3VD3A 1K77A 1TR9A 3POCA 2YJQA 3H26A 3B9OA 4HN4A 3R6IA 1Y7VA 1ONRA 1H7WA 1GT8A 5B7YA 2DEPA 2WBKA 3B9EA 2DIJA 3G1YA 3M0HA 2OWCA 3H53A 4XTIA 1X6LA 3ZR5A 3N4FA 5GNZA 4UZUA 4C91A 1BXBA 2X42A 1IIHA 1TYGA 3E0LA 4R9OA 2CEQA 3QV7A 2XIBA 2V5KA 2G41A 3CUZA 3WD4A 1IIGA 1KBKA 4JKKA 4TT3G 1R85A 2R91A 4RX0A 4QS5A 3SSZA 7REQB 4OECA 3U4AA 1XIMA 3CUFA 1FWGC 2WSYA 4G1KA 3T0DA 1YDYA 3ZWTA 2HISA 4OKDA 5DXXA 2GUUA 1KM4A 3UZJA 4QCFA 3H7VA 1UMYA 2F6KA 1KXVA 2DFAA 2QPXA 3SECA 5LSMA 3N2BA 4O0ZA 3BV7A 3NDOA 5F4XA 5G4EA 1A5LC 3G6MA 3WX7A 5LXEA 3SFWA 3VIKA 2NUWA 5IHRA 3G8RA 3K4DA 4R85A 5JIWA 2QJGA 2HWGA 1D3CA 3GXNA 3FVDA 5IDIA 7XIMA 5F1UA 3N15A 2CITA 2CLLA 1KQZA 1EP1A 1GOXA 4U5KA 1HX0A 2X1IA 3VGDA 4M6PA 5D9PA 1AQ0A 3C8NA 1EQPA 3VKDA 2WKLA 4MWAB 3CQIA 3P2VA 2ABAA 3OZMA 4ILSA 1TV4A 4QJ4B 3G1AA 2WCSA 3CTTA 4H1ZA 5I6SA 3K5XA 1WDDA 3GVQA 4ZXOA 3N2TA 1E51A 5AC8A 4MLJA 2B0MA 1EJXC 3AS2A 4Y6GA 2VYOA 3S47A 1XXXA 3VMPA 3S2LA 4AWEA 4AZHA 3STFA 5G4HC 4YYFA 3L65A 4LYPA 1M04A 1F6PA 6REQB 4EE9A 3AO0A 5KZDA 5AC5A 5EYWA 3FY1A 3LGEA 2E40A 2G97A 3H55A 1QOXA 2Y8KA 4HKPA 3QVQA 4S3BA 3M0KA 3GG1A 1TV2A 1MQPA 2W92A 3R11A 4FXRA 2G3JA 2ZX9A 4X22A 2BLEA 2BVYA 3PBYA 4LAUA 2XISA 4KF1A 1G7UA 4A3UA 2YCLA 3BLIA 4HOZA 2PD9A 4GQGA 5LIWX 5ABGA 5IXEA 2FZBA 4DO7A 3B05A 2PDJA 2C1IA 5ENLA 3LGDA 3RM9A 4B5VA 1YBQA 4LCQA 1PWMA 1JPKA 3WNOA 1VBHA 4Q7BA 3RX3A 5CZKA 1GTEA 3JRKA 4JCMA 4MPKA 3LY0A 4RNHA 2ZDRA 3W07A 2CZFA 3PULA 5C7HA 4LB4A 3T8QA 2VCBA 2PDYA 1FHLA 4M6QA 3GRIA 3EKLA 3HFTA 3L4XA 4JTSA 2J77A 2WO5A 1AH3A 5CC7A 4IQEA 3TZFA 4A35A 1NF7A 3B8IA 2D73A 2DIEA 4KWWA 1NM9A 1OY0A 1S2VA 2YBUA 3TKFA 8RUCA 1J6OA 1EWEA 4BWLC 3W76A 1IT8A 4XUGA 3N04A 4GVHA 1F3WA 1OX4A 2DW6A 1PKMA 2WVVA 3U6WA 3FA4A 2ISVA 4K8HA 3P0XA 1F74A 3V5CA 3AI0A 1UASA 1RSCA 4WIWA 1K4GA 4YHEA 4ZO9A 5AOUA 4DI8A 4K1GA 1DORA 1KR0A 3W74A 4PMJA 1YNPA 3DFTA 4ATLA 4J4KA 2Y0FA 3M6YA 1XYAA 3UVAA 4GA8A 2F7FA 4LSBA 4IMDA 1ZAHA 2NLIA 4R7WA 4HU4A 4RUBA 1E4MM 2QGHA 3R0DA 3WG6A 4BI6A 2QUTA 4ENLA 4J2MA 1W3IA 1TPDA 3NZQA 5HNTA 2BY3A 2XFWA 2QDHA 3O1NA 1EH9A 4KERA 5HJXA 2XFRA 2DH2A 4HZMA 2PRHA 3DUGA 2O9OA 3VX0A 3K30A 3VKBA 3KXQA 3ZJ6A 1I0DA 3B8SA 3COTA 4QDPA 1ITUA 4LBUA 3BWWA 3BLDA 5I7GA 3E2VA 2C15A 4FZIA 2BOEX 2IPJA 3IJ9A 2SFPA 4O52A 3DG3A 4C7DA 1LUCB 3QF0A 2DP3A 4NI3A 3ITYA 2TAAA 1VYSX 2WLYA 3PPHA 2OJPA 2VM8A 5DMMA 3VGFA 1UMLA 3TYDA 4Y9OA 1NIUA 3G1RA 5AVNA 3LK6A 2HS8A 1OCNA 2NVCA 4KWSA 1VAHA 4JEJA 3ABOA 5AZ1A 2P88A 1YDNA 3WLLA 3AZSA 1QWKA 4O1CA 2NQJA 1JDEA 4KETA 4RZ4A 3MO7A 2VELA 4F9JA 3N11A 4UR9A 4P8XA 3TC7A 2QF8A 2XUCA 3MV01 3L2MA 3TROA 3WK1A 2NT0A 5I78A 1H63A 1KRMA 4FXFA 5PTDA 3WL1A 3LEPA 5REQA 1OFDA 1FWJC 3BMVA 1AQMA 4I9MA 4EPBC 2ZZ7A 1OK4A 5ABFA 1RD6A 4MJ2A 4AWTA 2RAGA 6PTDA 3SO7A 3ALFA 1EDGA 7ODCA 3LHUA 1G67A 2QNEA 4N2YA 2WV8A 1H3GA 2XYLA 1XBYA 5DO8A 1IZCA 3OQ8A 4IQDA 2QUMA 1S3HA 1CZ1A 1U1JA 1W9VA 4LCSA 3ZFHA 1SPQA 3VIIA 4CCCA 1XG3A 2ISWA 4XUYA 1V51A 3IIPA 4YVVA 2X1UA 3LLDA 4M7TA 1YW1A 4ERIA 4H83A 1UJQA 1KKRA 3QMSA 3BVJA 4QNWA 3MI2A 4A3QA 2WHKA 2JJ1G 8XIMA 1HVXA 3H7RA 1K7EA 4HJFA 1O94A 2I16A 4BZYA 1CGYA 4QE1A 2X30A 4CU6A 3MC5A 4HYVA 2RGMA 4DJDD 2FHBA 5DELA 2OLSA 2O9RA 2Y89A 4DNHA 1YTKA 2AGKA 4DIAA 1POKA 3CWNA 2WPGA 4DZHA 1LM1A 4JTKA 3HQOA 1MEWA 3WD2A 3TDFA 1JDCA 3CMGA 1OBAA 2REQB 4KKXA 2H90A 2CXEA 3NAVA 3PPGA 1AW2A 3NIYA 3KX6A 1D8WA 1TKKA 4AVNA 5EB8A 4H6RA 1W5OA 3WBWA 3FIGA 1R8LA 4Y96A 4I5UA 3EA2A 1RR2A 3DX5A 3A64A 4RXGA 4G7EB 4AAJA 2P3ZA 2HTMA 2D2GA 2V67A 4GY7A 5KZMA 4ORMA 5AHFA 4AIOA 4UIOA 1QI0A 2WZEA 1ICQA 5D09A 3ZXWA 2A21A 4HHMA 4Y9NA 4U2ZA 1HL9A 1X8CA 3LMYA 3NSMA 5C0QA 3WYZA 2GQAA 5AYXA 3CH0A 1O95A 1S2CA 4KRUA 5C9WA 4AZ5A 5CCZA 3OVRA 2V3GA 4F0KA 3M0LA 5E9XA 3KS6A 3OA3A 4WSHA 1SSGA 5CPOA 1A5AA 1SO5A 1EFZA 2XSXA 3KS5A 4IX0A 4TMCA 2OKTA 4AD5A 1EDQA 2XM2A 2FFCA 1OF8A 1RK6A 1VJIA 3TIMA 4MDPA 4LUSB 1PXGA 1GVRA 3UWUA 3P8JA 3V75A 4ZZ9A 5L6UA 1ZRQA 4N02A 4MAZA 2MNRA 4ZTXA 2ZA2A 1X1ZA 4G1NA 1W6TA 1TO3A 2EKGA 1EF2A 3BGJA 4V1XA 1Q4NX 1DXFA 2W66A 1BQCA 2V3EA 2ACUA 2OGYA 1J4EA 4U2YA 3M0MA 4HSNA 4F0HA 3M47A 3KVJA 2VOMA 1F4HA 3N17A 1ZY9A 1PWLA 3O7UA 3SY5A 3KCOA 1Q63A 3CV6A 5C9XA 3PZOA 3DYOA 3HZ3A 1DWAM 1TELA 5K4ZA 1R9YA 4HSOA 1R7AA 3GW3A 3V1HA 5AZ0A 5BROA 2QAFA 4DXXA 1A0DA 2G3FA 2HV5A 2YCEA 1QHOA 5FJTA 2CESA 5MHBA 3CO8A 1GVFA 2D2OA 1KCZA 1XP3A 3V5FA 1T96A 4R7OA 4Q8UA 1PIFA 3HA1A 4RR4A 1BF2A 1KV5A 4UOJA 3G5EA 3N6QA 2FKPA 5C9RA 4H6EA 1FWHC 4PUNA 3VIPA 1OD8A 2YXGA 4WUIA 1QAPA 2FVKA 1RHCA 4W5ZA 4Z2JA 3GH7A 1VRXA 5LYRA 3BSMA 5CXPA 3WLOA 4IHCA 4RZ6A 4EP8C 1RPXA 1TUXA 2D2JA 3WLTA 2VFHA 4QTGA 3T81A 3UD6A 4YTQA 1W56A 4XVDA 4HMDA 5C71A 1EEPA 3S8HA 3KOFA 1E1CA 4TSFG 3A21A 1Q6RA 2IKGA 1F8IA 1W5NA 1YMYA 1YNQA 2AL2A 3U9IA 3PAOA 1NFBA 3IGSA 3DHPA 5C55A 2P53A 4C6FA 3IK4A 4WVXA 1UUQA 4G2DA 5AYZA 3S1XA 4HU3A 3VZZA 4G5DA 2O9TA 3SCQA 2QCEA 4O1FA 1G4SA 4LF2A 3T0CA 1WAUA 4O13A 3S1GA 3WQWA 3REQB 5LNUA 3NPXA 1QW7A 3W70A 5HUOA 4FLSA 4DYKA 5CEWA 4XZNX 4JBRA 2XIJA 3JZEA 5U7SA 1W1PA 2NUXA 4O18A 3VNLA 4R27A 4CU8A 1AH4A 2E6FA 3FSUA 3ECQA 3W53A 1Z44A 1YTDA 2C13A 2W6RA 1VIZA 2R94A 1O5KA 3LB0A 4PYSA 3N14A 2PGEA 2Z24A 2DZVA 3VD7A 5A2CA 5FJIA 1NARA 1KFCA 3LENA 3KZSA 3I3EA 3E74A 1AQFA 1LLOA 2HE8A 4PL2A 4D6DA 1T8XA 3N3TA 5TIMA 4ZE5A 1RLCL 1W3JA 3KRSA 4K8GA 1QK0A 4S1FA 3VABA 3SUWA 2IPWA 4KQNA 2VZOA 3S1UA 1V6WA 1C91A 4JHZA 2J7DA 3TOYA 3MBDA 1FVPA 2V6AA 5M03A 4QG8A 4PBEA 3W2UA 1T7LA 1JR1A 3B3DA 3KRZA 3N6JA 5IRPA 1EJVC 3N3MA 3T55A 1I2OA 3KBJA 1LBMA 2CU0A 3A47A 1OGSA 3E0FA 3EZ4A 1XGZA 3VIOA 4A8NA 4CVWA 1EXPA 3RO8A 4RE0A 3NM1A 2NSXA 1E71M 1TREA 2DZPA 5HJLA 1A4LA 3IUIA 3WN6A 4EXBA 1EUAA 1AFSA 5AN7A 2TRSA 1QCWA 3AS0A 1BHGA 1LL4A 4MG4A 2QE7G 2I1OA 1TQXA 1JDAA 2JKEA 3ZIZA 2FH8A 4GE8A 1XR2A 4PTDA 4HMCA 1ODUA 1PTAA 3ZZ1A 4B2DD 1H0IA 3UERA 2ZX6A 2R1KA 2J25A 4J5NA 4ZO7A 3V36A 5FACA 4NX5A 1PKYA 4FMVA 1W2VA 1GG0A 4DUOA 5GJNA 2Y2WA 1XIEA 4F9DA 1W8GA 2BG5A 3NTYA 4N9DA 1Y5WA 4JYDA 3FOKA 2FMNA 4MWAC 3P14A 1PAMA 4EXAA 2YPIA 4JFSA 1KTBA 3DG7A 4GG9A 3UESA 3BSHA 4DUWA 5E0CA 2D2HA 1E9ZB 2QZRA 3GR8A 5CKSA 4QNEA 3GHSA 1OF6A 3LHYA 5EL1A 4I3GA 1XKYA 4R33A 3BICA 3QGVA 1KQYA 2VEFA 5C6MA 1VJZA 3DFQA 1RBLA 1B57A 1X98A 1DV7A 2PDPA 1QPOA 2QJHA 3BE7A 3TAKA 2GOUA 1TE1A 4ORIA 2BV9A 3SIMA 3ANUA 2C18A 3W7MA 3W24A 2V3DA 1UC4A 1O5RA 4XX6A 1MEIA 5DBUA 3GFYA 4ZOAA 1L6FA 2NQZA 4FNTA 1IT0A 2VFDA 3POHA 5H8UA 2OZTA 4O1EA 4RPPA 3IVUA 3ZSTA 2GJLA 2QEZA 3EWCA 1XICA 1HGYA 4L6DA 3QYSA 3ZQ9A 3CV1A 1DTUA 4AZBA 3BJFA 3EWUA 2OEKA 4HZ8A 5M5DA 5JXQA 2FB2A 3B8DA 3LQGA 1O66A 2XTKA 1F4AA 4JTGA 3OLEA 4HA4A 2I5QA 3D3FA 4CUCA 1Q13A 1VP8A 1XSJA 4K38A 1ZZMA 5C2CA 4Q32A 3ONCA 4QJ5B 1R6WA 2FQIA 4J3ZA 4L4OA 5I3HA 4OQVA 5HDRA 1NOUA 3E12A 1JZ4A 1NOFA 4ECLA 4ZQPA 2E28A 4GC3A 2ONEA 3LCHA 2D20A 1ADSA 3RJYA 2GVEA 4LAZA 4ACZA 3PBWA 2XSAA 3R0KA 4WHBA 2A3HA 3AQUA 5A6JA 3N34A 1J96A 2OZ8A 1JQVA 4BI5A 2VTFA 2Z27A 3FK4A 1L6WA 1XLDA 3KWSA 1JL8A 2NXIA 3E0WA 4Z1MG 1B90A 5CPSA 1SZRA 4FPSA 3KBVA 1J93A 1THFD 2XG9A 2ISSA 3H4WA 4ZO8A 3UZXA 5CGMA 1AQHA 2ZUNA 2VGFA 3KRBA 2RDTA 2POTA 2A85A 5XIMA 4O8AA 2PGFA 2J7FA 1K3UA 3FA5A 3FX4A 1TTQA 4O14A 3QOKA 1G69A 5CSYA 2OTDA 3N9RA 2XVPA 3GVGA 4LALA 3WMCA 4LT9A 3WY1A 4ZQMA 4ML9A 2V8ZA 2YDSA 2ZE0A 1KM0A 1XUUA 1RQBA 4CD8A 4AZCA 3GW0A 3R4IA 1V6TA 2JQXA 1HNYA 5I5RA 4C6EA 1E15A 3VIFA 1FP8A 3KE0A 1XHGA 3QZ6A 4S3GA 3EA3A 2NVAA 1UWUA 4AZGA 4PUJA 5TF0A 2D3NA 4GXPA 1EJWC 3OOQA 3RIKA 3VUPA 2CLOA 3B0VC 4HNNA 5EY5A 4Y2WA 2WPBA 1J0ZA 2FDMA 1OFOA 4DB7A 4PBFA 1IR1A 3WQ6A 1XYFA 1O1HA 5FAGA 1QWGA 4DXVA 1BTCA 2QCCA 1P6WA 1GQKA 2B31A 3M5YA 4JQ1A 4PR4A 2GDVA 1QOQA 4L4MA 1TIMA 2OB3A 5AHMA 1GVYA 4ATDA 4MM1A 3R5EA 4QITA 1TMQA 1SJDA 4IP4A 2P76A 4E3VA 2CNCA 2WJFA 2ZC8A 1VBRA 3A22A 3E1F1 1VBJA 1GQLA 5T9BG 4JKMA 4W8AA 5DX7A 1AH0A 2Z2AA 3II1A 4LAMA 1NF0A 3L66A 3RPTA 1G0CA 3TW6A 1DJWA 4ML4A 3N9SA 3A4WA 4JTAA 2VWSA 3TQVA 1LJYA 1LT8A 1FH8A 3M5ZA 1L2QA 4PE8A 1QBBA 3BQ6A 5CSRA 4GD0A 3DC8A 1F73A 2E1WA 1EOMA 3NQGA 3QW3A 4E2OA 1VFHA 2WMHA 1M5WA 1Z8AA 4JR5A 5HMEA 4W9TA 4M3PA 4NZ1A 1D3GA 5JVLA 1W3NA 2NV2A 1QATA 5A6BA 4C1KA 4S38A 1MUMA 1V6UA 4H9YA 4JIRA 4OU1A 2PWHA 1SJCA 3QY8A 5BZAA 3MDUA 5DXYA 1KCKA 1M7JA 2Y8VA 4ZSUA 1MZRA 4JGDA 1VHCA 3C2YA 5DRCA 4FNSA 4C6OA 4J1OA 3IIOA 2FHCA 4TTUA 3AXKA 3C3NA 3PF3A 1W54A 9CGTA 3VIMA 1UZ4A 4AYSA 3GU9A 4GX9A 3OIXA 4HPXA 1LROA 2Z7GA 4H8UA 3UZZA 2J8FA 4AW7A 1JCLA 4EPDC 4IFKB 1R46A 3BG3A 1Q7QA 2EEXA 4ZEPA 3S9IA 1DPMA 4XBJA 1XDJA 1Z32X 4QSFA 2YA2A 5D2YA 3BJTA 4ADSA 2VVNA 2ICSA 1SO4A 3GKAA 3DFHA 2G8ZA 3CEUA 4EF8A 3S2JA 3T07A 1XIJA 1T8QA 2YDRA 1H1NA 5KTLA 1AD4A 3PHAA 4ZGYA 2HMCA 3T05A 2HRWA 3SGZA 1FUYA 3AXIA 1WDSA 1N2VA 1A80A 2OQYA 4S3KA 1OK6A 4DEFA 1E43A 3S83A 3S6DA 1IHIA 4WZHA 4PMDA 1LTDA 4YWIA 4PSRA 3WH9A 2VX4A 1OYCA 4Q6JA 4UTIA 3ZLHA 5HBFA 2DJLA 1O4UA 4YMZA 1OVDA 4ZO6A 2CLIA 3F5KA 2QCFA 1NEYA 3VPLA 3WJXA 4WJEA 4C5YA 2OX4A 3S46A 3T40A 2RUSA 3UZWA 1YPXA 3L4ZA 1S3TC 1ITXA 5I3GA 1F3XA 4TMBA 1KXTA 4OJYA 1TV5A 5HPOA 3FJNA 4MKSA 3ZT6A 1BTMA 1Q6QA 2ZXAA 3CHVA 3S5ZA 3R79A 2HNHA 4B3LA 4A05A 4PC8A 3C4UA 2Y5JA 5K7JA 3B03A 3ARXA 3CZGA 1KR1A 3OTRA 1V3KA 3BZGA 3QC3A 2P1FA 4PRWA 4H6KA 1VPXA 2J78A 3BMWA 3AHYA 4B16A 3MUCA 2BBFA 1HTIA 2J9XA 4GI8A 1GVQA 4NL1A 4GHRA 4LV4A 1QNQA 1NFGA 1PX8A 4AX7A 4MPQA 4MJMA 4HVXA 3GQYA 4MJ4A 4B4HA 1W5QA 4JX5A 2FJKA 4JIHA 4CNSA 3OAAG 4OOUA 5B80A 3M41A 3TR2A 3NZPA 1DQWA 2ZRXA 3WK3A 2C7FA 1DWHM 3P5ZA 4R3UA 3B04A 5D38A 4Z1YA 3AISA 3BAIA 5LZLA 3O0KA 3WQVA 4GQ0A 2OYMA 3BOLA 2R9RA 4RNIA 3CT7A 4FLRA 1CECA 3KBNA 3PG8A 2NQHA 1CNVA 3ARZA 4P7LA 1IT7A 1JF6A 3PM6A 2Y7DA 4O10A 1EB3A 3EWZA 5LIUX 2JKPA 3RCYA 1M6JA 3WF0A 3GVRA 1H5VA 5I03A 5J8LA 4AFYA 3VYLA 3H2AA 3WUFA 3WF1A 2XN2A 5HAOA 1PSCA 3PPFA 3SCOA 4FR6A 3AMGA 1G4TA 1NDWA 2WW5A 3H22A 1J18A 3BLEA 1CPUA 3CT2A 3UR8A 1PKNA 4CD4A 3ZR6A 1TPWA 1UIOA 2JGYA 2VI0A 1HJVA 3MWCA 1Y8BA 2VFGA 3WZ0E 3ZR4A 2VUYA 1OFEA 2V0TA 4U33A 3MMDA 3VNJA 4CNPA 1WUFA 2NW0A 4DF0A 1PCWA 2ZZ3A 3FEQA 3G1FA 1GW9A 3NQMA 1S5MA 4NILA 4B15A 1XYBA 3TJIA 1EL3A 3SCSA 3CASA 3NGFA 1OCJA 4XKYB 1BPLB 1ZB5A 3B0PA 1ZBWA 4IQLA 4C1LA 5A5WA 5M1TA 1R3VA 4LS2A 2VCAA 5CAKA 1JDDA 4NG3A 4LYRA 2POZA 1H7XA 1VFLA 2J9ZA 5D03A 3L5AA 3UGVA 5E5CA 2XINA 4NZFA 3LS9A 1KM1A 3A3HA 3PBMA 5EMMA 4YTUA 4XSLA 4DPPA 5M2FX 1KWKA 3UETA 2C19A 2VX7A 2YBTA 1GYNA 5DMLA 5T91A 3GH5A 2VJXA 5CJMA 1PS9A 3TN6A 4L9ZA 2QCDA 3L9CA 4DBUA 4BWLA 2ZWYA 3HG5A 1FWRA 2ZADA 4Z0JA 1FWWA 3GXIA 2EPMX 3TC6A 2VZVA 3GU1A 3QRHA 4JTRA 3VGEA 3MKVA 4RE3A 2OZ3A 4AEEA 1LQAA 1B3VA 1CX9A 1IEQA 1G4EA 5DQPA 1TTIA 3AXMA 3WBAA 2CZEA 3EOLA 2PLKA 4AF0A 3UF9A 4CQDA 2BASA 4KWOA 1S5NA 2E1DA 3VDBA 3QOMA 3GB6A 5F4WA 2NV9A 4YS1A 1X6NA 3VOJA 3V0UA 2G5WA 4AZ6A 3AJXA 2HNEA 3QR3A 3NPWA 3VU2A 4GC4A 4KMQA 3GG0A 2FIQA 2JK2A 3PWAA 4K1WA 3DG6A 1QI2A 1MDLA 2HE5A 1ME9A 4E8GA 3MUAA 3SR7A 4ZXLA 3LRKA 4K7VA 2WWDA 4MWAE 1TR1A 3S2CA 3W2JA 1RUSA 1TA3A 2YKKA 4LYQA 3ENLA 2OG9A 3QBUA 1GZ1A 3ITLA 1WOBA 4X0NA 2OLAA 3THDA 1MNZA 5CSSA 3I10A 1OHLA 1IYXA 4FNRA 1W0JG 2YYTA 4HPHA 4PMYA 4IUOA 4A3YA 2GVJA 2I56A 1RY0A 3BLKA 2A3EA 1TWZA 1V0LA 2PBGA 4LVFA 3NNTA 4Q8VA 1SM9A 3N9KA 4GO9A 3R13A 2RDXA 1KTCA 4GBDA 1J2BA 4YCPA 5H8PA 1R2SA 5FOOA 1IWPA 4WQ6A 1NDVA 1Q3NA 3W7HA 1BYBA 1MUWA 1J0IA 3M4HA 4A6GA 1TUFA 3I4EA 3Q4DA 3PZQA 1E56A 3SSJA 3EWXA 1FWDC 3VA8A 4AYGA 1QMLA 2G3IA 3VMNA 2QDEA 4GCAA 4FEZA 3TNOA 3PG9A 2XH2A 1H61A 1XCXA 5F1VA 1U22A 4E0CA 3WLPA 4KS0A 1B3WA 5CSUA 3M46A 4MVAA 3KLLA 4NRSA 3EX6A 4C6PA 4O28A 1TCDA 3HIJA 2WJZA 7TAAA 1ESWA 1VEMA 3Q58A 4JY8A 2CBUA 4OUIA 4ZFMA 5LHEA 4UFJA 3VNMA 4XIAA 3IS4A 3W26A 1A3XA 1A5UA 3L21A 4ZB0A 2OEJA 2R82A 2BGNE 2J62A 1BEUA 1JDFA 3TE9A 3IGUA 4UNIA 1SJAA 3FKSG 3CV2A 4S3JA 4FNQA 1EJUC 3UZYA 3VK5A 2DDXA 5HNRA 3GZAA 1EX1A 1WX0A 1VD6A 1V3IA 3WJSA 1FCUA 1HN1A 2WZIA 2OO0A 3RDKA 4NZ3A 1WZLA 3NO1A 1QPRA 4QDMA 1UPPA 1NSJA 4XZWA 4GIRA 1FH9A 3WH6A 3E6EA 4LNCA 1PTDA 3T2OA 5D33A 1W9UA 3EX3A 2HBXA 3QPZA 4IXXA 4S3EA 1QO2A 1V4YA 4E2DA 1W1B1 1YKWA 4N42A 2VXNA 3DXIA 1TX2A 1KNWA 4V28A 3SRKA 1EBHA 1VCFA 1QFEA 3T2QA 4JYFA 4DWSB 3UWWA 4TX9A 2VP8A 1I1XA 1XRTA 3QHMA 2PF0A 3AC0A 1ADDA 3RJXA 4HZ6A 3BDKA 2CLPA 3T0AA 2B7QA 2FTYA 3B06A 1Z69A 3UJEA 1UA3A 2HEJA 5BU6A 1UD5A 4F0RA 1A4MA 5ABTA 4LAKA 1KWGA 3G77A 3UXKA 1XIDA 4XB3A 1W1YA 1FWCC 1HG3A 5K4XA 4P5UA 3GR7A 4N9EA 1CLXA 3EDJA 4LY4A 3HTWA 4W84A 1J6PA 2UY5A 4LH8A 3N29A 1ODZA 3RR4A 2KZHA 1BF6A 3ABSA 3DGBA 3PZTA 4JNZA 3R2GA 3ZVHA 3AS1A 4O19A 1ITCA 3L68A 1QVBA 2QCLA 3E2RA 3UBPC 4HA3A 1FX6A 3PK7A 1NWUA 1US0A 4MFEA 1TPH1 1ZJHA 2QVNA 2QCMA 4YVPA 3LN3A 2CKSA 3HG4A 3LV5A 3WF3A 2X05A 1VFFA 4S3AA 5H2ZA 1UWSA 2PU1A 4R34A 1CIUA 4M56A 5I2UA 5FJUA 2Z1VA 2BMBA 4DLMA 3FSTA 4GWEA 3NQEA 1WUEA 1SSDA 2YZRA 1J2WA 5EBUA 4J35A 4NZ4A 4RDWA 3U2CA 4DJFA 1EC7A 1MVYA 1S2WA 1CWYA 3BXWA 1AA1B 1UKSA 1KGXA 4O54A 2DSZA 3TYEA 1U5HA 1OX4B 3OBEA 5FF4A 3RLVA 2PD5A 6A3HA 1B3OA 2CERA 3GDBA 3DGRA 3UWZA 2DIKA 4N9BA 1UKOA 2R1LA 3C8FA 1EBGA 5FD0A 2PWVA 1GOOA 5CPQA 3VX1A 1AW1A 4JY9A 3HGRA 3W1AA 4XO7A 4IPLA 4G6CA 4LUIA 4UCGA 2ZX8A 3ZM8A 4DF2A 1MRAA 1N7KA 1E0VA 1R5YA 2Z2BA 3P80A 4BY3A 3SCVA 3L2IA 5IFTA 4P8WA 5DLCA 4A3HA 2V68A 3VDAA 3NXLA 1A53A 4AD2A 1H49A 4HMNA 1TQJA 4CU7A 3MSDA 3TMLA 3H12A 2PSNA 1HP4A 3D46A 3HG3A 3PUEA 3NVDA 4RNJA 1F3TA 2HBVA 4DF1A 3LM7A 2VRJA 2XH0A 4L1WA 1R3WA 1E3XA 1LG1A 2Z6IA 4IFRA 1X96A 5LNRA 1EWDA 2UV8G 2WZHA 4JDBA 1GGOA 5FAJA 3BLOA 4ZOCA 5DN1A 5K2ZA 4JTUA 2Z1WA 1SVDA 2B7PA 3C3UA 4NI8A 3XISA 3QGKC 2VZUA 3E0VA 4JTDA 3GXFA 3T0TA 1N8IA 5LIYX 2VQUA 2EPNA 3ATZA 2VDGA 2PA6A 1A49A 3PY2A 4H9UA 3RM4A 4Q8OA 1U33A 4XWUA 3S6TA 4IOTA 1VLWA 4C6BA 3G1VA 3GIYA 1QTWA 2NXHA 4QQUA 4HTYA 2E5CA 3P74A 4YLWA 4LB3A 2H3DA 4UOZA 4C6NA 1V0MA 2VD9A 1UKQA 4NAEB 3SCWA 1S2AA 1TB3A 4LS0A 2IXUA 1TV7A 9RUBA 2AMXA 3TYZA 4HNTA 1NWRA 3O3RA 1W17A 4N4QA 4GH3A 2VX6A 2PP3A 5K3VA 2E6AA 4F66A 5E70A 1UH3A 3UG5A 3WMLA 3BAWA 5REQB 3UG4A 3R7MA 1OT1A 2PDHA 5ABFB 2VHLA 3DEQA 5CPLA 3CAVA 4ALDA 3HGSA 4J7RA 3EX4A 4OFCA 4X63A 3AYSA 4GH1A 5LIKX 2XWEA 5IOBA 4ZQOA 4PODA 2JIEA 2JIWA 2PLCA 3GG7A 3LSBA 3NQVA 1BLIA 5DF0A 2BHUA 3RNDA 1LQ2A 3VC5A 5MKGA 2FGZA 2WMIA 4X0VA 3NWRA 1E55A 4CN1A 5D04C 3WLNA 4NYUA 3MY9A 1PVNA 3PJXA 4PL1A 4Q6XA 2Y7GA 7A3HA 2J4GA 1JZ8A 2WVUA 4TV6A 3O07A 3WDPP 1OM0A 5I3DA 1H1ZA 1BVNP 4MMWA 1JI2A 4XSMA 1T57A 3ZLGA 2V5CA 3PZGA 2NQ5A 4AD3A 1SUXA 3VNDA 5LHFA 4M6UA 2PWDA 3R8GA 4OGZA 4UQEA 3WCZA 1V8EA 3CMJA 5EBAA 3V16A 1WXYA 4HU8A 1PO9A 4EVZA 2WCGA 3KL5A 1ZTVA 5LXXA 3W22A 3QLDA 5G1TA 2NX1A 4L80A 2V3FA 4PB3A 1BG4A 2ESCA 5A6MA 3DBNA 3MKKA 1B4KA 3DFPA 2VCCA 4M6VA 1CT5A 1M41A 1PBGA 1J9YA 1DJQA 2X1SA 1EPVA 1JGMA 1SZEA 3MHFA 3PBUA 1OFQA 3F2BA 2ISDA 3UEQA 1VIWA 8TIMA 3OGRA 3KOXA 4EPEC 3AXHA 1XQLA 3FKKA 4L65A 4XAGA 3KL3A 1IXOA 1IF2A 2O0TA 3BMXA 1JF5A 1NFPA 1Q6OA 1XH2A 4GINA 3TJXA 3L4VA 3NOEA 2NUYA 3NZGA 2WZTA 5ABHA 4PTWA 1WZKA 1ZLPA 3U5YA 3B9DA 1FY6A 3W23A 1CBGA 4M1BA 3F7JA 2XDFA 2ZX5A 4XAZA 2E6DA 2BY2A 2XSBA 3PR2A 5AYYA 4A22A 3IV3A 1BGAA 4J3UA 1LL7A 2KAUC 4MWAA 3AMLA 4E2VA 3U4FA 1UWAA 2J8TA 4UTFA 4U3AA 3WEOA 1WXZA 3LLXA 1TRDA 4GPNA 1E5NA 1P6BA 4GOAA 1OX5A 3R58A 3P3BA 1FOBA 3I65A 4M1RA 4EXQA 5HR7A 6XIAA 4MUPA 2F38A 2A1YA 4B5TA 3AIQA 4HK7A 2CBJA 5CZ0A 1A3HA 1V7YA 4DBEA 2JE8A 2QULA 1TG7A 3WK0A 3SM0A 3DI0A 1FXQA 4GABA 1EA9C 2E3ZA 2ANUA 2OODA 2XVGA 3OO2A 3W6LA 4H9VA 1U1UA 1P1XA 4Q7IA 1VQTA 2YB1A 3G0SA 4TO8A 3KL0A 1JQXA 2DQWA 4IJBA 3SN0A 3T4WA 1KGUA 1TWDA 2FLIA 3OLGA 4LEFA 3WH7A 3SN4A 2KX9A 1HKMA 3IJIA 1GHSA 2BB0A 3SUVA 3LG3A 5CPNA 2O4MA 3HPZA 3KP0A 3UPBA 3CHDA 4BFAA 1F9CA 4FXJA 1FCQA 1WP6A 2V2CA 3GS6A 2DT3A 3NDYA 3VZYA 1HUVA 1EYEA 1X1OA 2EG6A 1JYXA 3UPMA 3PSWA 1KFWA 4WR3A 3EPOA 1CEOA 3STGA 1A5MC 3EWWA 2XIMA 2PGRA 1KLYA 2PPGA 3EOEA 4V33A 2FPYA 5HATA 3PTQA 4GVGA 4MAVA 4AHOA 1AJ2A 4I6KA 4RDVA 4WOQA 1EJ7L 2HK1A 2BZNA 3W83A 3MWAA 4IJRA 3WD3A 3BW3A 4NF7A 1ZSXA 1VEPA 3V18A 2BHZA 4MB1A 4B92A 4XKMA 1E6SM 3KM8A 3RCMA 1F05A 3DESA 3HFYA 2DUZA 1E79G 3VOCA 1A0EA 4R5EA 1JIBA 1KFEA 3VUSA 2CWNA 4UTKA 1JCYA 5DMNA 3GVVA 2V5LA 5EMLA 4BQ5A 2PZNA 5LIXX 1E4LA 3HJZA 3C0LA 4HCDA 1QOPA 1LOQA 3L7RA 3IRDA 2RJGA 5HQMA 2QS8A 1XGDA 2FVMA 2PMQA 4HHPA 3RMJA 1UYQA 2WMGA 3AIRA 4B5XA 4IPNB 1FBAA 2WKGA 4RZBA 1AZ2A 3GTXA 4QBXA 3NPUA 1E0XA 1ALDA 1EIXA 5A8NA 3TVAA 2ODOA 4DYEA 1L6YA 1HKVA 3TYAA 4KH2A 5KMYA 3BURA 4J9JA 4WGXA 4F0LA 4L64A 2NLYA 1CDGA 3JVAA 4UTWC 1BGGA 2UY3A 3QZEA 4IP7A 5XINA 3SQMA 1R86A 2XFYA 4NNBA 4BQ2A 3GE7A 1A5NC 3GAYA 2X1RA 3NGJA 4PN2A 5FEZA 4J28A 3TTOA 3AALA 3L4YA 1E0UA 2YL6A 5HNNA 3LXAA 4J3XA 4P8UA 1M7OA 3TN5A 1LUCA 4XD6A 3VMOA 1YQ2A 1H7RA 1UHVA 5G1MA 1BSIA 1IEXA 1IV8A 3CXOA 5HK4A 2GUYA 3W2LA 1XIFA 4GY1A 3B0XA 4BQ4A 4LY8A 3BL3A 3T0BA 1AW5A 4V15A 3MHGA 4HYRA 1GKRA 3LGGA 3TXVA 4Q4KA 3WDHA 4CD7A 3UA4A 5ECVA 3RR1A 1U1HA 3CB3A 5C9ZA 4U4MA 4JN8A 2R1PA 3MW7A 2H6RA 1LBLA 1DWGM 3CL6A 1QPNA 4GZIA 3A13A 3QSTA 7PTDA 1LCOA 3QXBA 2DV0A 3L0NA 1QW9A 4MNJA 4S23A 3OB8A 1VYPX 1R2RA 3QJAA 2C1GA 2Y5SA 3ANVA 4EOUA 1EC8A 4JQ3A 3MUZ1 3WQDA 4UUIA 1SZGA 3CEPA 1K02A 2J66A 1L9WA 2QXWA 2EJ1A 3P60A 3W1RA 4PH6A 3XINA 4BF5A 1V93A 3FJ6A 1ONEA 3IJ6A 5FF7A 4UTJA 3PZMA 5DCBA 3U2ZA 2ZOXA 4O0QA 4DJEA 2LLEA 4AB4A 2ZTJA 1BD0A 3A4XA 3KOWA 4WRHA 4HNOA 1PZ3A 4AY8A 1VFSA 1JCXA 1XFCA 3HG2A 1E3ZA 1TPEA 3VKKA 3PANA 3TJLA 5FKYA 4FA3A 4IIGA 3NVTA 4MSSA 1DWJM 5IDZA 1L6SA 4H4IA 1OGGA 3AYRA 2YCJA 5CBBA 1VR6A 2WCAA 4TX6A 3WQCA 5KETA 1PX4A 1NY1A 1DXEA 3UCCA 1NQ6A 1XSIA 5G4WA 1NAL1 4GYFA 5BRBA 3E2SA 3J7HA 4GUFA 3MHUA 1VFTA 1QNRA 3BOFA 4MYAA 2IQTA 4HNLA 3TW9A 4M81A 5E6ZA 3AROA 3DYMA 3TX9A 4AY1A 3CC1A 2V82A 2WVTA 3MT1A 5LGXA 1ZJAA 3W27A 3N12A 2NQLA 2E4TA 4NHVA 3K1GA 1P0KA 2REQA 1SR0A 2XH7A 3HM7A 2DY3A 2R1MA 3YPIA 2FPTA 3WQ5A 2FZ8A 1WO2A 3W87A 4LV9A 2Z7KA 3EX1A 3OEHG 3T08A 1ZBCA 3FAWA 2BVWA 3OBKA 4O1DA 3VE9A 4BHYA 3IPWA 4N7QA 4G7EA 2WMKA 3MP4A 3N2MA 1YDOA 3P81A 2QIWA 1XS2A 3VM7A 2W5FA 1DE6A 4YJ5A 1VLIA 4IH3A 4L6HA 1DE5A 3A9BA 2WSSG 1UWRA 5CZTA 4LF1A 4WLCA 3OP2A 3IAQA 4M5PA 4L5ZA 5CG0A 4REQB 4MJZA 4H8VA 5CLWA 3BPWA 1VPYA 1KC7A 3GDTA 2HVMA 1HGWA 4LTSA 2OMAA 1UPMB 3NO3A 4LJ3A 4A8IA 4LRTA 3AS3A 1K9TA 3NYZA 3HPSA 3NL5A 2WOQA 3RFAA 4D6FA 2CBIA 3WBXA 4W86A 3QV8A 1QRQA 1TJPA 1XIBA 3UNDA 3OBAA 1LRQA 4AIBA 4AH7A 2XVLA 4A2SA 5HUPA 4WSKA 1VCVA 4P8VA 2ZRUA 4V27A 2ALDA 3L5LA 3LCXA 1IWAA 3S42A 5FL0A 1MEHA 4LUSA 1CXIA 4KCWA 2HCVA 4LUTB 4FX8A 5IM51 4WDTA 4HP5A 4HA1A 3BGGA 3MMTA 1DJYA 1C8XA 5C2GA 1OABA 3M0JA 4IGMA 1R2TA 4XZIA 1BYCA 2OEMA 4NIRA 1RXOB 1ZCOA 2IS7A 3NQFA 3ID7A 4MNLA 3SN1A 4C1NA 3CIWA 4WGHA 1GEQA 4DZIA 3WBYA 4A29A 1RD5A 3E5BA 3W7LA 1SJBA 3CHCA 1NWTA 3L4UA 1UR3M 1K9EA 2RJHA 1QASA 2GUBA 4IMAA 3GTIA 2ZZ4A 4ZB5A 1R47A 1Q5MA 3ANYA 1L8PA 1TPB1 5D37A 3T1GA 3SADA 1GZGA 4GO8A 3VNIA 4YTRA 3SCTA 3HV8A 3M0XA 4GRSA 4J3VA 3IJDA 4AZCB 1I60A 1G6CA 3W1TA 3NA8A 2GLKA 1QPQA 5D4YA 3RLGA 1Q8AA 4UR7A 3DAQA 1I1WA 2WMFA 3N73A 4GFSA 4Q8QA 4KEMA 1XH1A 2ZRVA 3W29A 3TONA 4UFLA 4S39A 1QW8A 5A8OA 2ZXQA 1BXNA 2FZMA 3QTPA 3AOFA 1GW1A 5HINA 3O6DA 2CZ5A 3W71A 1NTHA 4Z08A 3SIZA 1A5KC 2ACRA 3W7KA 3BV4A 4WOZA 4DAFA 4RDYA 3VVGA 3OZPA 3TTSA 3NZRA 3W7EA 1VGAA 2V9DA 1HXJA 5F2GA 3GNXA 3I7SA 3R10A 3UJFA 1C8VA 3O6YX 2QIIA 4CNUA 3KP1A 1W1ZA 4Z17A 1UD6A 3PP7A 3CAWA 2A6NA 3VILA 3MCNA 1KRBC 1FHVA 4NAFA 4U31A 1LLWA 1TCMA 3WEZA 4PUKA 3VGGA 4I8DA 2XNDG 4RPQA 3CS2A 2DGAA 3W82A 3QQWA 2ZZ1A 1NQKA 2VX5A 1HZYA 1MFUA 2J74A 2QJJA 1D3HA 3OGSA 5A6KA 3ES7A 1OT2A 4AEOA 4D72A 3WJZA 1E72M 4JYEA 3REQA 1TTPA 9XIMA 2QPUA 3MMWA 3TFCA 1M9HA 2FMOA 2E9LA 4CQ8A 2QAPA 2WKJA 2Q02A 4NKCA 2FJUB 2HPMA 1S1PA 3U7VA 1X97A 4PUMA 1MNSA 4QEEA 4L4PA 1TVLA 1MXGA 4CQ9A 1XDMA 1UR2A 1XINA 2HS6A 3VM5A 3BW4A 2CC0A 4D8LA 2PEVA 3LX9A 3F4NA 3KVMA 1E4IA 1OYBA 2IKHA 1EEXA 3WQPA 3W86A 2ACQA 2OFJA 2PS2A 3MVTA 4MGGA 3APYA 3CQJA 4H6QA 3W7QA 1UD2A 3NQCA 2RDWA 4AD4A 1IZKA 5CPTA 3FXGA 4LANA 4O17A 1AJZA 4I8YA 1ZAJA 4PEEA 4MZ8A 1UBPC 3H4XA 4G56A 4US5A 4EPKA 3WH5A 4WK9A 3GHUA 3TLLA 1EA0A 3LCIA 1BVWA 3O63A 1JPHA 4AC1X 3G1XA 1BVZA 2E09A 5HMFA 3M0IA 4NXSA 1BWKA 4OWGA 1TMHA 3RX2A 1H4PA 2H9AB 2VENA 1XIGA 3V1PA 3HQPA 2PGWA 3GZ3A 2D0FA 3EMZA 3C6CA 3UJ2A 5CQ1A 1HFBA 1XUZA 4LW7A 3O8AA 2FH6A 4KCUA 3NEVA 1TJ0A 1Z42A 3ZSSA 5A6TC 5C2XA 3U5UA 2AGTA 1TMLA 1P7TB 2PB1A 2DSKA 1S38A 4GCXA 1LDCA 4BS0A 4W7UA 3FW6A 3C0QA 3RAOA 3FEMA 4ICNA 5KZEA 3OZYA 2WZMA 1EJSC 1R3SA 4ONVA 5AC6A 1KXQA 3W75A 1W8SA 4JTJA 4O8RA 4WY0F 3BOXA 1G4PA 5BWFA 3ZJKA 1MO0A 1UWQA 4DLFA 3IIZA 3ERPA 1LL6A 3VO0A 1W9BM 3OYXA 3LI1A 5FEWA 1IXQA 1XH0A 1FQ0A 1Z3NA 1ITQA 4CEUC 4NJKA 1EF3A 3PZ9A 1PHQA 4HIBA 2I9EA 4GISA 4PTNA 1W9XA 1WZMA 1RH9A 3GX9A 3NQ8A 4MY9A 2QV5A 2F2HA 2CFFA 1GNXA 4DM1A 2ZE3A 1JCMP 2I14A 4BI7A 4DBSA 2Y88A 3GYCA 4OBTA 3S1WA 3TYBA 4E5TA 1XFBA 3KDNA 1KA9F 1IR2A 2TPSA 1XLIA 1H2JA 3WELA 4J3WA 3H24A 1JZ6A 2CZVA 1W3TA 2EGZA 2ZBTA 3DI1A 1T41A 1KB3A 1LP6A 2DPEA 3TZNA 1OC6A 4ZMGA 1CXHA 4POCA 2OU4A 2YZ5A 2X40A 3UW6A 2VGIA 3GU2A 3ARRA 2ZUSA 4Y9AA 4JXCA 2VC9A 3G24A 4OE7A 3WFAA 1ZBKA 1KCXA 4K37A 2UZ9A 4NNAA 3LTPA 3M5XA 4GYKA 4CKQA 5AHLA 2W61A 3NJ3A 2DSVA 3DENA 1C7TA 3C5QA 1HL2A 1UC5A 4PUUA 2ZRYA 3W7PA 2BGQA 2MANA 4BCEA 1E4NA 4PZVA 4UQCA 1Q4WA 2GVYA 1GCYA 1BRLA 2C14A 2HPIA 2BX7A 4FLQA 7CGTA 2E68A 2QJNA 3DIPA 2PDUA 2Q8LA 3F5LA 1GONA 2PDBA 3ALGA 3IJLA 1EGZA 4QROA 2VFFA 1U30A 3L4TA 3LZ5A 3NSNA 1UKPA 2WLZA 2IXVA 2J7BA 4TVCA 4Z2HA 1BKHA 3BZJA 4KFNA 3NL2A 2FFIA 5AC4A 4D1IA 3W37A 1A5BA 2ATSA 3FGCB 1EP2A 1C7SA 4FF5A 1GVOA 2ASHA 5AFDA 1KRAC 1ZFJA 3QR0A 4GI9A 5ABEA 5I00A 3BLPX 1K8YA 3ME3A 1HL8A 1YIXA 1CCWB 3RF9A 4XZMX 1W1VA 3WO8A 2NZLA 2EPLX 1N82A 4IPPA 3AMCA 1ZHAA 2G4JA 4CNOA 1Q6EA 3CZKA 4FI4A 2EG7A 4Q33A 2C1HA 4YVXA 3UR2A 4B9YA 2WXDM 1PYFA 3RPMA 2G4FA 3C2EA 3UJSA 4GLEA 3KOZA 3LMZA 4UXDA 1P0EA 2Q09A 4B90A 2YDQA 3D47A 1IXNA 2I5GA 2ZIDA 4Z0SA 1GVSA 1DBTA 4GXMA 3M1ZA 3TSMA 5GPRA 3FKRA 1XKJA 1GJUA 2PCEA 3CAKA 3W88A 1Y5VA 3EOSA 1WDQA 1UZHA 4MKNA 2D3LA 3GNDA 1CLVA 1M68A 4K3ZA 1MW0A 4E4UA 3V0TA 3HQ1A 3KUMA 3CWOX 1QI4A 3AHVA 3ZJ7A 2EPKX 1O5QA 5B7ZA 3GYEA 1E6PA 1TA3B 5JU6A 2YGYA 2EPHA 3OJGA 2G3MA 2EPOA 1H8EG 4ZQNA 2OR2A 2VR4A 2B4GA 3OU8A 4HNCA 2A7RA 2PUZA 2PDKA 4DJFC 4XISA 4UB9A 3FLUA 4P2VA 3ATYA 1TJ2A 2J7CA 3W1QA 1TWWA 1Z6KA 5FESA 1VZWA 1CLKA 3KTCA 4EACA 3TXZA 1H50A 3W01A 4ADUA 3G1SA 4J27A 5AHEA 4DY1A 3CZJA 3FV9A 5I3IA 3EBVA 4WF7A 5HNUA 1K8XA 1P43A 5EGRA 4RW3A 3OGVA 2E8YA 2G3NA 3VE7A 3WQEA 3NYDA 2A3BA 2CK3G 2D0GA 3TLQA 3KBMA 4JDYA 4FHAA 3EA1A 3C0JA 1XG4A 4NU7A 3GDKA 2O7SA 3IVTA 2R6OA 3DERA 4TIMA 4QLKA 2G95A 3NZ1A 4IM4A 1JVNA 3QPEA 3K13A 3PUDA 1W9PA 3MSRA 4LC8A 3MB9A 2GJXB 1LOLA 1YHTA 4H9TA 4H9MA 3RILA 1ME7A 1V03A 4Q4PA 3HMCA 4DXKA 5CG7A 2VR2A 4TOQA 3TA6A 4AHQA 3CYJA 4GZJA 3TMQA 3MKCA 3RGTA 4EWJA 4IUGA 3M7SA 2OZ0A 4DWDA 1CI1A 5DBTA 1W32A 2A3CA 1MW2A 3FVMA 1NJJA 4M0XA 5M17A 1HQTA 4XD3A 2CWXA 3UYIA 3IK2A 4NSBA 1FDZA 1XSKA 1CTNA 5FIPA 3S9YA 1FWFC 3GUWA 1CGWA 1NP2A 3E38A 3INPA 2WNZA 2C0AA 3T42A 3MV11 2PDWA 4DQWA 4IFKA 5G2HA 4UQDA 1O6IA 1P4CA 2FB3A 1EKOA 2B7NA 3RYSA 3PSVA 1CB2A 2W27A 3F2CA 4HT3A 4G7FA 3MUIA 3NG3A 3LTYA 2FZDA 4B5NA 3W1NA 2Z0IA 3XIMA 1JYWA 2WJDA 1XBXA 2HXTA 2Y85A 1GOWA 2RH9A 3A3WA 4ASTA 2XJ7A 1Q45A 3EX2A 3TQPA 4E8CA 3DFNA 3TK7A 1F3EA 4HMEA 1YLVA 3QY7A 2ZVRA 4H8HA 3AYTA 5D2TA 5A8MA 1RA0A 2V2HA 3DDMA 2E77A 5BOOA 4XAPA 4D2JA 1H1YA 2DZUA 2WHLA 4EIVA 5DN6G 2G0WA 3S5OA 5A6BD 2ON3A 4XBKA 3USZA 3M07A 2CLMA 1TV3A 1XL9A 4PMRA 3QTGA 1ZP3A 1JD7A 3L67A 1WDRA 3ARQA 4RE4A 4DUVA 3ZVIA 3QHNA 1AJ0A 2VRQA 2FYMA 4YWSA 2NSOA 1TIWA 4C6DA 3T8LA 1ZNNA 5H6HA 3SI9A 1XLFA 4RKAA 2QUNA 3F4VA 5EMKA 4DO5A 3VKAA 2FTPA 3BCDA 4QDWA 1KM5A 4OT7A 4H19A 1G01A 4ROPA 3L12A 4MB5A 4DNMA 3OPSA 3CL7A 2C79A 1E40A 4XD4A 4IIBA 4QCEA 3HO8A 2Q71A 2V69A 4FR1A 3BAXA 1KRCC 1XRVA 1ISXA 5A3HA 3NQ2A 4X9SA 5J5RA 3VFCA 2WMJA 4GACA 1H51A 3LPPA 1JGIA 3WFLA 4NY2A 3WF2A 3W84A 3CIVA 2V2DA 4WSJA 2PAJA 5E93A 1FWAC 1AG1O 1XQKA 3WLMA 3HJEA 2PP1A 3S2MA 1REQB 1LRTA 2GSHA 2CZDA 3JR2A 1UIPA 1YTEA 5J5DA 1G5AA 3B40A 2CHOA 4RXFA 4L4LA 1JI1A 4KEUA 3HMJG 1M53A 4NJJA 3NQ6A 4QIUA 2E5BA 2HJPA 3TU9A 1M03A 5K9CA 2I5IA 3OVPA 3HQNA 3S3GA 4Q4RA 4KW2A 4JX6A 1TRIA 3K8MA 1IEVA 2PF8A 1KBLA 4IIHA 3PJTA 1YRRA 1TVPA 4A2RA 4W87A 1FWNA 3H23A 4DUXA 3QZAA 1NELA 4JIQA 3I6RA 4WY0B 3CL8A 2PU0A 2EAWA 2QV4A 1QNVA 3VXGA 2DUAA 4ES4A 3WSUA 4CNTA 2UY2A 4ZFCA 4YCOA 4O4VA 1RP9A 1BWVA 1FP9A 2JFEX 3IAPA 1U5JA 1DQUA 4JOMA 4IZGA 4UR8A 1K9DA 2ZUVA 4RE2A 4DZAA 3MDWA 3Q65A 3U2OA 5A2BA 1KCLA 2O92A 1PKLA 5TBOA 4KESA 5GQBA 2PWFA 4W5UA 3W7JA 1FDJA 1EJTC 1GPWA 3GTHA 3AICA 2GVGA 3LNMA 2EO7A 3PN8A 2VZTA 5TNVA 4TUFA 2YA0A 3FJLA 3N1AA 1Q7MA 1UP3A 3E02A 2CLHA 1SW3A 5LGZA 4S3CA 4XIMA 3UT0A 5BMWA 1KXHA 4ZSTA 5FJOA 1DJGA 1QK2A 1VF8A 3G1HA 4UNLA 1E70M 4IL0A 1OGBA 4HYWA 1KBJA 2NWRA 3AUJA 1OINA 2Z2UA 7ENLA 5EA9A 3SAZA 1XLGA 1ICPA 3MPGA 4JFWA 4J3SA 1W2PA 5FSEC 4XQ6A 1KW1A 3TN3A 4O11A 4J40A 4OZOA 3M9YA 1RCOB 3KBSA 1P0BA 3CUJA 3RU6A 2NX9A 4PCFA 2PWUA 1KBBA 4YPJA 3EDFA 4QAWA 3SGGA 4GQBA 3TOPA 2GPTA 1V6XA 3H54A 3TTQA 3DHFA 1I0BA 4GMEA 5FL1A 2XPKA 3THAA 1EHNA 3B8UA 2VNCA 2EF9A 1BFNA 2Y24A 3QV9A 5CC5A 1X39A 2IQ0A 3WLJA 1KFLA 4C65A 3ZT5A 4NNCA 3V4BA 1B3ZA 4UTWA 3DHUA 2OYKA 4X9YA 3QYQA 1E9IA 4PCPA 5JUVA 1US3A 1XWYA 2IW0A 1DHPA 2DZXA 5GJMA 2YA1A 2JJ2G 3I6EA 3A5FA 4PEKA 1SU5A 1XYZA 3STPA 4C6MA 2RHGA 3TSBA 1JZ5A 3W3OA 2D69A 5BNKA 2PTZA 1K1DA 4L1GA 2QCGA 1BYDA 2XHYA 3JU2A 4I5RA 4IGNA 3KAOA 4IIFA 3B0UX 1V77A 1YEYA 4NZ5A 4I7UA 5FI8A 1FWSA 1Z9AA 4YTTA 3DOPA 5D8WA 2X09A 4UMBA 4H2CA 1H62A 1R9XA 4KWUA 4MTVA 3WLKX 4BKNA 5E1QA 3CHEA 4FIRA 3RO6A 3N25A 2J7GA 4DX3A 2E67A 1JG9A 5I77A 2Y1HA 2YYUA 4NJHA 2IPGA 3SDOA 3HOJA 1M01A 2EG8A 4NP7A 3P67A 4YN5A 3OEXA 4Q4QA 2WK2A 3G22A 1HJUA 4C6JA 1MW1A 3K4WA 1P1MA 4QR6A 2NV1A 5A6LA 1IXPA 1ZBVA 3Q67A 3E2QA 4LOCA 3ABRA 2Z4GA 2YDAA 4GYPA 4I90A 1DIDA 3W2KA 1HF6A 1C8YA 1QUMA 3LDVA 3MBFA 3HPXA 1B9BA 4AXKA 4IICA 4CVUA 2JALA 3H70A 3ICJA 4W7VA 2VURA 2OPJA 4MUZA 1OQFA 1J11A 4GIYA 4MB3A 3FJ4A 5A1AA 3PBVA 3TWBA 3GBDA 2DVXA 3WLQA 1I2PA 3RUBL 1XV8A 4KIEA 3ARTA 3ELFA 3EWYA 1UWTA 4Y8FA 2C3ZA 2QHAA 4DBWA 1KM2A 1SW7A 4WKAA 2YL8A 4GXWA 4UMCA 4UQBA 4PCNA 4DELA 4PMUA 3TH6A 4L7ZA 2GQ8A 2DQXA 4HCHA 2YXOA 1UP0A 3WJYA 1FHUA 2WC3A 5AECA 1J5SA 1VC4A 1IQ8A 4PB5A 1B3XA 1OFBA 1OEPA 4X2PA 4OUEA 4LVGA 3C2FA 3A9IA 1JYVA 1DHKA 4DPQA 4HN8A 3KTXA 3W6YA 4O53A 4IIEA 3F2DA 2GL5A 2PI6A 3NM3A 3FNDA 4NJIA 4PFMA 3H2OA 1R0MA 3WNPA 3EXSA 1XLLA 3TQKA 3FAXA 1B4EA 1B31A 4GI4A 4K8EA 1SFTA 5D30A 4DWSA 5BXPA 1U5VA 4NUWA 2YX0A 1WDWA 4N0RA 3DFSA 4FXSA 5D32A 1GORA 3KVKA 4ZR8A 3PFMA 3K4AA 3UQNA 1QT1A 2BTMA 2TODA 5BOEA 4LWWA 1M7PA 2BODX 1HJQA 3H6OA 1CGVA 5HULA 5CPMA 1EP3A 1XYMA 2NQ9A 1W5MA 3TNBA 1GKPA 3RK8A 4GJ1A 4JHMA 1T0OA 4DJEC 3KFTA 4BEUA 4AVFA 1CENA 3MUXA 4P7NA 3PZNA 3AZTA 5BXRA 1WQ5A 1SGJA 1C8QA 2YLLA 2Q01A 5I0DA 2Z6JA 3DZ1A 3O6CA 3S4TA 1DWIM 2PTDA 1MYRA 3BLLA 2QMKA 3BANA 4DRSA 1WB0A 1UQYA 3HBLA 4B4FA 4F8XA 2OCZA 1H41A 2ZWZA 1YXDA 1Q6LA 4KEZA 2HVNA 1ZJBA 3ZO9A 1MFVA 5KINA 4I7VA 1Z41A 2Z1KA 4LEQA 4HQVA 1US2A 2HLDG 3QMTA 3JW7A 2F61A 3SEPA 4YTSA 4FP1A 4WKHA 1VHNA 1TWIA 4GNJA 3IIXA 2WC4A 3A23A 2EBNA 2PDIA 3KCLA 4I5XA 2XWDA 1JULA 4E3TA 3MSYA 4RL3A 4O16A 3OW1A 3PB0A 3IEBA 4CQCA 1EGVA 3TYUA 1EZWA 2JKAA 1H09A 4WD0A 2VD8A 1TTJA 1CYGA 2OLHA 3W9ZA 1EIBA 3ITOA 5CBIA 1PIGA 2OQHA 1JCNA 3R94A 3UXIA 4KT2A 3WNMA 2YL5A 2ZDSA 4UCFA 5DEZA 1UBSA 5CLTA 1OIMA 4Y9PA 3CB8A 4GQQA 1E6NA 1ECEA 3THUA 2EKCA 5F4SA 3MQTA 3O2LA 1GZJA 3FN9A 1XF0A 3QHOA 3CQHA 1UD3A 1Q6FA 3CZ8A 2F2KA 1DKWA 1LG2A 1CGTA 4JNYA 4JL2A 1YXCA 1ZJIA 1HO1A 3P93A 1I2QA 3PNZA 3CPUA 2FZNA 1XCFA 1G7VA 1R9ZA 4FB7A 5A69A 4ZODA 3WF4A 4DJFD 2P8CA 3V5OA 2OQLA 1V6VA 2ZVIA 5D9MA 4ZA0A 4TTGA 2W4XA 2DJXA 3UPWA 1V3LA 3AIVA 3UNTA 4PMOA 2J47A 2P50A 3DH7A 3CZEA 4AQLA 3N19B 3V0SA 2QYGA 4GFIA 1HP5A 1E9YB 1V5XA 1XDLA 3GVWA 1P5BA 4NAEA 3CUIA 5E0FA 1C90A 3PAJA 4I9AA 3EAUA 4Q8MA 5T26A 2X7VA 2INFA 1NDYA 2ZXDA 3K46A 4ZBCA 3A12A 1JUBA 3UYCA 4F79A 2DT0A 1B9ZA 4YNGA 4FALA 2J7HA 4LNYA 5K9DA 3IANA 4WDUA 4F3HA 4R7JA 1FWBC 4JFTA 2QT3A 5HQEA 1QJWA 4AX6A 3EDEA 1ZPTA 4Y9MA 3MCOA 5FF3A 1EJRC 4UFMA 1UP2A 4XZBA 1RQHA 2XIOA 2Z1SA 1AODA 4E38A 2VDHA 3B9AA 3P61A 3QQ1A 3BO9A 3GNOA 3ITGA 1GQIA 5LA1A 2QR6A 1SZFA 2BHYA 2X1TA 1VPQA 1GOMA 2CIPA 3KCJA 4K68A 2Q3OA 3GAKA 2R8WA 4IG2B 2Y70A 1QHZA 4D6IA 1MZHA 5C54A 1B2YA 1S46A 1YE4A 2CYGA 2RGLA 4D6JA 1I9CB 3W85A 1VRDA 4S2CA 5AKQA 1PZ1A 3CPRA 3UWVA 3NEHA 3VI2A 2J8GA 2CHRA 4LVAA 1EYWA 1EOKA 4JD4A 2QDDA 5JH2A 2Y61A 1B30A 1O60A 2AQVA 2FDSA 3LPFA 5D8ZA 3WNKA 1DJZA 4YXWG 4ICCX 4OHQA 4ZOEA 4DN1A 4TU1A 2E9MA 2XU2A 1HKJA 3SB0A 3KWXA 4IMEA 2CKRA 3ITTA 3GDMA 2DVTA 1IZJA 3RRAA 1GYMA 2VKZG 4RDZA 4O12A 9XIAA 2ACSA 2IMRA 2QUVA 3TA9A 8CGTA 1TPC1 1UOKA 3FCPA 4HTBA 4M8UA 2E8ZA 1Q7ZA 4QE5A 3GWQA 1TFVA 3WQOA 1F8MA 1K7FA 3MA8A 1LT7A 3PFRA 3TYCA 3TWAA 3WBEA 1PX3A 4ZE4A 3O9NA 1NOWA 1Y5XA 4IMCA 1N55A 5LKYA 5DCEA 3CU2A 1YNYA 4DM2A 2VOTA 2GK1B 3FHAA 4ZOBA 3UCDA 3WL0A 1EHAA 1UUMA 3P82A 3IJ8A 4AIUA 4HSHA 4MNMA 1G9HA 2DU2A 3F4DA 4CN4A 3NO5A 3NDZA 2AQWA 2W67A 4Y8EA 3THCA 4TXEA 2WQDA 1S39A 3KRUA 4XTDA 3SFKA 2YIHA 3VOIA 4FX7A 3K8LA 1R30A 2GQ9A 4R88A 4KGLA 1ZP4A 4HPNA 2D1ZA 5G2WA 4KCTA 1SR9A 3CM4A 1AMKA 5HMDA 3GHRA 5FF2A 3TCSA 2OXNA 5CGQA 1K6WA 1JFXA 1AL8A 4D71A 4GI6A 4LS1A 3VCNA 4L56A 4AMCA 3OLIA 1C9WA 3AHTA 1JFHA 1HVQA 5CC3A 5A94A 1CXEA 4JTHA 4D6EA 4GJJA 1EO7A 3V7PA 3QKZA 5D02A 1G1YA 1FWIC 1QU4A 1UROA 4O15A 4M19A 4C1NB 4YYCA 5A8GA 3B8WA 2NVDA 3OG2A 1DJNA 3E9AA 1R3RA 5GNXA 5XIAA 2FGBA 2DZBA 1XLHA 3RHGA 3CUXA 3N6HA 2WHMA 5A2AA 1A0CA 3WDRA 1UZ1A 2W62A 4GIAA 2HZGA 2PLJA 3DC0A 2XH4A 4AWUA 4PBGA 1ZENA 3I7RA 3UXAA 4Q8NA 1TX0A 2X2YA 4IJCA 3FYOA 3E0IA 3OODA 3B0YA 1VFOA 2ZZ6A 4HK6A 4CQBA 2WNWA 3ARVA 5DMYA 3PZUA 4UOQA 1XGEA 5JH1A 4FNUA 2R14A 5MF5A 1JEZA 1E6ZA 3LHZA 3SBFA 3AU2A 3C86A 1VEOA 1UQZA 4JN7A 3ES8A 4JIPA 1A47A 3TP4A 1C9DA 3VD9A 1Z48A 1WAWA 2W63A 4BR1A 2VZSA 6TIMA 3APGA 4HCLA 3S1VA 3L0GA 1ZUAX 4KCVA 3GM8A 3M6DA 3GFXA 3MUY1 4MWAD 4ZL1A 2GGIA 2Y6ZA 4PUEA 4QISA 2HK0A 1PHWA 3EEZA 3IV8A 5E6YA 1MDRA 2JF7A 1HJWA 3ORWA 4AG0A 3WLRA 1S2UA 2XFFA 2YW4A 2PODA 1UG6A 3G0UA 2AKMA 4ERGA 2PDGA 3CPGA 1SFJA 3LA4A 1EX5A 4KFPA 4NAFB 1OD0A 5IBXC 3NFUA 4AMAA 2AKZA 2PWEA 4AIEA 5BYWA 2VEGA 4HNVA 1OWQA 4GK8A 3AU6A 2W3ZA 1OADA 4WKFA 4QEHA 1XLEA 1YX1A 2PE4A 4GUHA 3RXZA 2Y7FA 5J04A 4GUJA 1RCQA 3GXTA 4K2SA 3WFZA 2XM1A 4IGHA 3O05A 2XIIA 1ISZA 2PRLA 5D9NA 4Q8PA 1YADA 1RBOB 3OVQA 1JRBA 1OZMA 4FSAA 2YCLB 1PYMA 1I6NA 1HKKA 3BLFA 1TSIA 3M16A 4LVDA 4KRTA 2PC4A 2O55A 4QS6A 3QM3A 3VIGA 2VGBA 1SFSA 2X8RA 4E4PA 3L4WA 3U2EA 1MRQA 3LBOA 5I3KA 2ATMA 3GUGA 4CLMA 2O4QA 1YBQB 2Z00A 1X7FA 3LZ3A 4URIA 1ZS2A 4FS9A 4H04A 1F6YA 3P5YA 1GYLA 1LQ0A 3KDOA 3KW3A 1RALA 3EXRA 4CEXC 4AC7C 1J10A 3ZWSA 1WKFA 4FNPA 2VO5A 1W91A 3WUGA 3W00A 4LQ1A 4JFUA 3LBMA 1AVAA 2I57A 3H4GA 3UJRA 1B5TA 3DFYA 5BXSA 4J3TA 3PWGA 4W93A 2CLEA 2E0PA 3I3DA 3SCRA 2YXXA 1Q66A 2AL1A 2C16A 5AHIA 3NR0A 1J79A 2XGZA 1DEDA 2GFTA 3HPAA 4LVBA 3TN4A 2VEMA 3RCNA 3SZ8A 3U48A 2J75A 3KBWA 1SZNA 3CQ0A 2WVVB 5SWUA 1WCGA 1H7NA 3OLDA 1X6UA 1K4HA 2W9MA 2YFOA 1F6KA 3AUOA 3T6CA 4TR9A 2QCNA 2BXZA 4QQ3A 5IFPA 2Z26A 2A7NA 4QG9A 5BWAA 3BG9A 4UQAA 2QDGA 2W91A 5F7UA 1ZU8A 2W6IG 4UFHA 2GSEA 4QFUA 2RDUA 2E9BA 4HK5A 2QW5A 4IIDA 3WEMA 3SRFA 3O6AA 3ZMRA 1PPIA 5C70A 2VGGA 2V38A 1WNOA 1Z7AA 3ITXA 4S3DA 5I79A 4HBKA 4R53A 1ECQA 3QGAC 1MQQA 1UD8A 2TYSA 4TVUA 1OC7A 4EAMA 1GQNA 5I3JA 3EOOA 1ME8A 4UTMA 1DJIA 1H0GA 3VKJA 2ZKMX 5CZSA 1BXCA 3W1UA 4UTTA 3RU8X 2YB4A 5EU9A 2V63A 3VFLA 4CCZA 2PDNA 4HZ7A 4IF2A 2WNNA 5AYIA 3TTEA 1JPDX 4ICMA 3V35A 3LU2A 2VL4A 2OELA 2FZ9A 1C92A 2PTYA 3F1QA 4U10A 4XD5A 3KHJA 4BEQA 4C60A 1KGWA 5DANA 3W2MA 4DHGA 4JX4A 4DJDA 3AIEA 1QO5A 1Z89A 4PCSA 5EPDA 4NZCA 1ELSA 1PB0A 2EQDA 5CJ5A 1WXJA 4H8NA 4BJHA 1WDPA 2XVNA 4PB4A 5EFFA 4EF9A 2HDJA 3LNPA 3IGXA 4GQRA 5D2VA 3IUDA 3LTSA 3TEVA 1VB9A 3VC6A 4B5UA 1T99A 2VEKA 1WKDA 3O15A 1MQRA 1X38A 3GH4A 3C56A 4ROQA 4B5WA 3CIXA 5CBJA 2JEPA 2WB5A 4L9YA 2GGEA 4G8TA 4B91A 1H7PA 2WWCA 4MADA 3VKCA 3WQGA 3NOYA 3N13A 1RAKA 2QUUA 3OYZA 4PMVA 5I06A 1O1ZA 3WMBA 1UH2A 1UCWA 2DZWA 1O5XA 3APTA 2QGYA 3M0YA 5A6AA 1Q2RA 4YHGA 2F6XA 3QFWA 4LUYA 3WIJA 1UZDA 3SQLA 2ZZ5A 3OVGA 5CAHA 1V7AA 3W28A 4XBSA 1FWTA 1YPIA 4JTQA 2AAAA 4AD0A 4Z42C 4UFIA 1XISA 1ICSA 1S5VA 4XK2A 4LRSA 4PULA 3LLFA 4C90A 3LI0A 4REQA 1FXPA 2VC7A 1BRLB 3N18A 2Z1XA 3CTLA 1JJKA 1UR8A 5T8GA 1QXLA 3NQDA 4JIEA 4DJED 4A8LA 3VZXA 3WD0A 1XRSA 4GZEA 1F76A 3T7VA 4AVOA 1E6QM 1DYSA 3R8HA 2GJNA 3EKGA 3LHVA 1I45A 3TAOA 3WDQA 3MYOA 1I2NA 3VD4A 2XN0A 3VIHA 3W25A 5CC6A 1JCTA 2DT1A 3ISIX 4OBRA 3I6TA 3FA3A 5AY7A 2INEA 3GR4A 5CGTA 1XD0A 1YE6A 4E8DA 4LUTA 2EJAA 4C6LA 3OG3A 4KIRA 3MS8A 5LA0A 3UR5A 1E6RA 1W3KA 3PUGA 3VD5A 4GY0A 4NASA 3O0FA 4JAWA 3GXDA 1DJHA 2QPSA 3PBGA 4X60A 3VINA 4BK9A 1H5YA 1HW6A 2P5NA 4XZLX 3BK0A 2DZSA 1XIIA 2OYLA 2FTWA 2OO6A 3VOFA 4D9PA 1K8CA 7REQA 4GYJA 4LX4A 3OA5A 4U5IA 6ENLA 2ISFA 2A4AA 1E0WA 1T6MA 2YCKX 2WNQA 4JCLA 3T09A 5C5YA 5LNVA 1KD0A 3KZPA 4UTHA 3LCFA 2PDQA 1OSEA 2Q8ZA 4V2XA 3B4YA 2OX1A 2OSYA 5CH9A 3QY6A 4H9XA 3BC9A 3TV8A 4JICA 3EGJA 1EQCA 2J88A 2CXGA 3BAJA 4DO4A 3NUKA 1GTHA 3VOHA 5EFDA 2IUZA 1OJXA 3R12A 2XGIA 3BQ5A 3GD6A 2WHJA 4MDOA 2ZRZA 3B8TA 4B9ZA 1UH4A 4CGTA 3DU0A 3LUTA 1ISYA 2XIQA 3VAVA 2EXOA 1DQXA 3OHIA 4MF4A 4FO4A 1JNDA 4GNVA 1WOAA 4JTEA 1A3WA 1CGUA 4G9PA 3T2PA 3UA3A 3B8VA 2BNJA 1V6YA 3L5MA 4RV8A 4FAMA 1A5CA 3DHDA 3QV6A 3A6OA 4JQAA 2HROA 3W4RA 1KLZA 4GKLA 6REQA 5G1YA 4S2BA 4OOZA 1XBVA 1H7OA 1XRFA 3H2FA 1XC6A 1MXDA 3QEZA 2G96A 3C52A 1OZQA 1RBAA 2O9PA 4FF7A 1BYAA 2AMGA 2CLKA 2TMDA 3SUTA 3W7RA 2ZUTA 4N4PA 1AL7A 4R9XA 3LOTA 3LSCA 3W81A 3OE7G 3DCPA 3GNRA 3T44A 8XIAA 1JYNA 5FEPA 4H7VA 3AWNA 4Z2KA 1W1IE 4PA8A 2BXYA 3S6OA 2GSJA 3QW4B 4H2HA 6TAAA 2BOGX 5EMYA 5JQ9A 2X41A 3ABQA 3USBA 1LYXA 2BVDA 5JBFA 4OIFA 1UR4A 2MUCA 3BUVA 3F4CA 4GUIA 3BW2A 5BCAA 5AHNA 3VTRA 4UTLA 1C93A 5BOFA 2GDUA 2AOSA 2YW3A 2YOCA 3LQLA 4O1BA 3Q94A 2BSLA 3SCPA 2I17A 3QKEA 1BQGA 4GX8A 3R43A 4EAYA 1L2UA 3ARYA 1L8NA 3QLLA 5KZ6A 1FHDA 5AB3A 1E1CB 3IRSA 3G6LA 2PLMA 3GXMA 1V0NA 3CQKA 3C2OA 3BGAA 3CHFA 2AL2B 3WUEA 3WDJA 3A4AA 3BCFA 5H8MA 1JZ2A 1M3UA 1GPFA 1RJRA 2DSWA 4D6GA 4MHBA 1BWLA 2WSQA 1UWIA 1NP0A 1LRNA 2IKJA 3UGRA 1U83A 1AZ1A 2E25A 2ZUMA 1B1YA 5I07A 5IHSA 3N2OA 3S5SA 1TJ1A 3O16A 4O0KA 1DJXA 3ARWA 3GHTA 1FRBA 3LXBA 1QI3A 5F2MA 3PB2A 3RMEA 2H9AA 5TQLA 1XX1A 5BMXA 4A21A 3H8AA 1QHPA 4ATWA 1CXKA 3A3XA 4M29A 4GVIA 1V3JA 4U3CA 1XLJA 4B2DA 4B3ZA 5JBDA 4L6OA 3GTFA 1HJXA 3BTNA 4HU0A 4QM1A 1HJSA 3G2GA 3MP5A 1I8JA 3URBA 1P7TA 3AAMA 5K9XA 2G37A 4IGSA 4WJXA 1L0PA 3BSGA 1FFQA 2X2GA 4C6CA 3CZLA 4AZIA 5DT5A 3HGOA 1AMYA 4LBSA 4NX0A 2D0HA 3IJ7A 1JD9A 2WYSA 2FVLA 3MSGA 2PWGA 3NL3A 3SJNA 1YDVA 4FX6M 1JXJA 4Z2GA 2Y5EA 5HR6A 5KEZA 1XCWA 1T5AA 1FH7A 1ZCCA 3U57A 4FOUA 2ZUWA 2L5HA 1RQEA 1RJQA 5D05A 2NX3A 5RUBA 1Q8JA 3IIVA 4IMGA 1WBJA 3FYPA 3URNA 1Q6GA 3TR9A 3UG3A 4O57A 3EB3A 1MMFA 4DI9A 2Z28A 5A8PA 1GJWA 4US5D 1HKIA 2ZC1A 2VFEA 3VIJA 2ABBA 3ZOAA 1PTGA 3WUBA 4I6VA 1ONXA 4Y90A 4RLIA 5FF0A 3QMRA 2I7GA 3MZNA 4ZCWA 3LRMA 4KRZA 3RITA 1OCBA 4B3KA 1EO5A 3MI3A 4K6AA 1JNEA 1PCKA 2EHHA 4O50A 2FGLA 1GEHA 4Q8WA 4Z2IA 3KHDA 3NQBA 3OHMB 2DUXA 4L1XA 3FFSA 2X7WA 3OZOA 1EZ2A 3EB2A 1AD1A 3FXYA 4MYXA 4XO6A 4UC5A 1PDYA 4GGBA 4NYYA 3PTDA 2ZXBA 3NCOA 4F0MA 3ITVA 2VMFA 3HU7A 4EWND 4GYPC 4ASUG 2F84A 3QC0A 4XAYA 1J0HA 5G5IA 1NU5A 1WA3A 3GNPA 3RX4A 2VQTA 1F5ZA 4PCTA 1IGWA 3MU7A 1E0TA 2PDLA 2FPVA 1R3TA 4D6HA 3A4JA 3MTWA 4JNMA 4AZ7A 3WNLA 1OX6A 2VDIA 3S5YA 3IWPA 5FJJA 4JN6A 3ARSA 3D5HA 2V30A 1JAKA 3C61A 1UUOA 4LCRA 1X7IA 1N8WA 3PJUA 1KTNA 3SUSA 1XLMA 4NZJA 3IACA 3AWOA 1ZALA 4RCXA 2XZ9A 1DL3A 3UXLA 3GG8A 4J2PA 4IWWA 3DBPA 2I9UA 3EOUA 3VGHA 3S2NA 3UFYA 3TTYA 3CJPA 4Z2LA 1W37A 2FHFA 4AXNA 4C6KA 2DW7A 3FGCA 3M0VA 1JPMA 4XAFA 4PMZA 4Q8TA 3WQ4A 4LU0A 1XBZA 2P8BA 1K6AA 3GC4A 3L23A 1EPXA 5EMJA 4DWSC 2BXVA 3G0XA 4W89A 3T4CA 4JTLA 1LZOA 1GUVA 3ABXA 3DECA 1PUDA 2GDQA 1UOZA 4E4FA 3GK0A 3QFEA 4DAIA 2PZ0A 3PWIA 1QNSA 3QR1A 3SQSA 2OWXA 3MMUA 1NWSA 1U2YA 1HKWA 4PSPA 4GGHA 4F40A 4JTCA 2PCQA 1VCGA 3ZJ8A 1XYCA 1D7FA 1ML1A 4FOJA 2OSWA 4KEVA 4AISA 3QH2A 5U4NA 3Q2DA 2BDQA 3GC5A 3GDLA 1GJPA 2PDXA 4Q4SA 1R3QA 3T9PA 3PUOA 2BGSA 1PV8A 2JDIG 3OEEG 3W1PA 3ZYZA 5BXTA 5GJPA 4D6CA 1W1TA 1DIOA 3V3WA 3N4AA 1W5PA 3MCMA 3LCLA 5AYBA 4DBDA 1UR9A 2CLFA 5AC7A 1KM3A 3H2MA 3RG6A 3RM8A 4AEFA 3MJYA 4WXZA 1MUCA 4CD6A 3KVLA 4ACZB 2V5DA 5AVHA 3W1MA 2D23A 4GNKB 3K8KA 4OBSA 4F48A 4NT0A 2PURA 4QLJA 1KFBA 4IXHA 2HQAA 3PJWA 3UU0A 3E3HA 2H8ZA 1VKFA 2YR1A 5F2LA 2DZAA 1FA2A 4A8RA 3L0KA 3RLHA 2CBVA 4F4RA 4H9ZA 1IE7C 3HV9A 2DSUA 1V02E 4Z1AA 4PRRA 3ZS4A 3CLWA 1GKQA 3PTKA 4QXIA 1A5OC 3B9NA 2V7QG 3W6MA 1B3YA 2RFGA 2JBMA 1ISWA 3U3HA 1BAGA 2A79A 3BJSA 3GDRA 3W0KA 3P0WA 4IPIA 4M24A 4XV0A 3LCGA 1UKTA 5I09A 1LLZA 4GJIA 2QQ6A 2WM0A 3C2RA 1YPFA 4IX2A 3IVSA 4JIIX 3MYPA 5E0KA 1OFPA 2C91A 4H41A 3VOGA 1KKOA 3MI6A 3R89A 3TUUA 5CJNA 2A3LA 2GJXA 2XVKA 1OFAA 3DYPA 1BG9A 3LHWA 1GOKA 3LV6A