4HYVA

Pyruvate kinase (pyk) from trypanosoma brucei in the presence of magnesium, pep and f26bp
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
498
structure length
498
Chain Sequence
SQLEHNIGLSIFEPVAKHRANRIVCTIGPSTQSVEALKNLMKSGMSVARMNFSHGSHEYHQTTINNVRAAAAELGLHIGIALDTKGPEIRTGLFKDGEVSFAPGDIVCVTTDPAYEKVGTKEKFYIDYPQLTNAVRPGGSIYVDDGVMTLRVVSKEDDRTLKCHVNNHHRLTDRRGINLPGCEVDLPAVSEKDRKDLEFGVAQGVDMIFASFIRTAEQVREVRAALGEKGKDILIISKIENHQGVQNIDSIIEASNGIMVARGDLGVEIPAEKVCVAQMCIISKCNVVGKPVICATQMLESMTSNPRPTRAEVSDVANAVLNGADCVMLSGETAKGKYPNEVVQYMARICVEAQSATHDTVMFNSIKNLQKIPMCPEEAVCSSAVASAFEVQAKAMLVLSNTGRSARLISKYRPNCPIICVTTRLQTCRQLNVTRSVVSVFYDAAKSGEDKDKEKRVKLGLDFAKKEKYASTGDVVVVVHADHSVKGYPNQTRLIYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title `In crystallo' substrate binding triggers major domain movements and reveals magnesium as a co-activator of Trypanosoma brucei pyruvate kinase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
molecule keywords Pyruvate kinase 1
total genus 186
structure length 498
sequence length 498
chains with identical sequence B
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4hyvA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 4hyvA01
4HYWA 1Z6KA 3P0XA 3QQWA 3N25A 3M0KA 2ZE3A 4B5WA 3H6OA 1S2TA 3SRDA 2DIKA 4MF4A 1XG4A 3EZ4A 1AQFA 4L9YA 3HQNA 1F61A 1KC7A 1A49A 3HQOA 1F8MA 1PKNA 4QG6A 2XZ7A 2V5JA 1T5AA 4RPPA 1ZJHA 4KCVA 3QV8A 2DUAA 2X0SA 3PP7A 4WJ8A 3FA3A 4LSBA 3ME3A 3OYXA 4IMAA 3GQYA 2VWSA 2HROA 4IQEA 3E5BA 3BJFA 1IZCA 4YJ5A 1DIKA 3I4EA 2VGBA 1E0TA 4B5TA 4JPGA 3QTGA 1VP8A 4B2DA 4QG9A 1DQUA 1PKMA 1U5VA 2L5HA 4ROQA 1S2UA 3QLLA 1IGWA 1VBHA 2XDFA 3FA4A 4KCWA 3EOOA 1JDEA 1M1BA 3LG3A 1DXFA 3HQPA 1T57A 4B5VA 4HYVA 4TV6A 2R82A 1U5HA 3G2GA 4KRZA 1MUMA 3EOLA 3R4IA 1O5QA 4KCTA 3BJTA 4IQDA 1PKYA 1A3WA 1O66A 4L7ZA 2HWGA 4KCUA 2BG5A 2WQDA 1GGOA 1SGJA 2VWTA 2XZ9A 3T0TA 3T07A 4B5SA 3QV6A 2HJPA 3M0JA 4G1NA 2KX9A 4QG8A 2VGGA 3QV9A 4L80A 4B5XA 3U2ZA 1S2VA 4FXFA 1XG3A 4L9ZA 3KTXA 4DRSA 1A5UA 2V5KA 3VAVA 5TAOA 3PUGA 2E28A 4IP7A 3GG8A 3SRFA 3E0VA 2G50A 3QZ6A 4B5UA 3MA8A 3QV7A 2VGFA 1F8IA 1A3XA 3OYZA 4FXJA 3E0WA 3IS4A 4TV5A 3SRHA 1S2WA 3KHDA 3SRKA 2OLSA 3B8IA 1DXEA 1PKLA 1KBLA 1ZLPA 4B2DD 1F3WA 3GR4A 5JVLA 4QGCA 2QIWA 1O68A 1VBGA 1OY0A 1E0UA 4YNGA 1OQFA 4KS0A 1M3UA 1PYMA 3EOEA 3LYEA 1UJQA 4MG4A 3OQ8A 1F3XA 3T05A 2VGIA 2HRWA
chains in the Genus database with same CATH superfamily
3NEVA 5HR7A 3ZWSA 4HYWA 2OQLA 1H5VA 1L6GA 1KBBA 1GEQA 2JQXA 1AD4A 2H9AA 1QNRA 4DWSB 3APYA 3L4WA 1Q6DA 6REQB 2AGTA 3E5BA 2YL8A 4XAZA 5FF3A 4DO7A 5A6AA 2E9BA 4OE7A 4Z0SA 1TTJA 1B3YA 3H54A 2DSVA 3ALFA 2HVMA 2OX1A 3SW6A 3GIYA 4CU6A 3PHAA 4HKPA 4YS1A 1XH0A 3LG3A 4W5ZA 5G1TA 3OGRA 4QE4A 3S42A 3VNZA 1V6VA 3FOKA 4XAFA 1R86A 4Y2WA 2DDXA 1V5XA 1PTDA 4ONVA 3MW7A 1H7WA 4QS6A 3OQEA 2GWNA 1E4IA 2DP3A 1KM1A 1W1VA 3P14A 1NWUA 3V5FA 1FP9A 1GQNA 2R8WA 3EDKA 3W27A 3TMQA 3EGJA 3SSJA 3THQA 3P67A 5G2WA 3EKZA 1PIGA 3AYVA 1TWZA 1SFJA 3TROA 4AY1A 4YYFA 3OA3A 3I65A 2GYIA 2G50A 4C6BA 5REQA 5BRPA 2Z1XA 1KXVA 5ABFA 4MY8A 4UC5A 5FI8A 4P7LA 3GIQA 3ATZA 3LOTA 2NQ9A 2EPLX 3QY8A 2HXUA 1A5AA 3DEQA 1Y7VA 4XVEA 4LUTB 3VCNA 1F3XA 4AZBA 1MRAA 2VYOA 1G6CA 1DPMA 4PRWA 4JBRA 2XIBA 3NXLA 2WHJA 4JN7A 1ONXA 2VI0A 4MM1A 1KBJA 3QYSA 2W62A 3WQVA 3AMCA 3V0TA 3N18A 3AS0A 1AG1O 3KVLA 3ERPA 4NL1A 2HSAA 2VFEA 3W4RA 3OZOA 4ZFCA 1BVNP 1LQ2A 4C5ZA 1W3JA 1C7SA 4K68A 3EOLA 1AFSA 3NWRA 4Q6JA 4F2TA 3CAWA 3NZQA 5IDZA 3SUVA 1E9IA 4CQAA 4AMCA 2YLAA 4HA1A 1W3TA 2V5DA 1UW9A 3F5JA 1V4YA 4TR9A 3UWQA 1XBZA 2BWGA 2ON3A 3P2VA 1ZBWA 3NOYA 3XINA 2CESA 3QKEA 4M5PA 1D7FA 1PAMA 3QZAA 3QOKA 1UD4A 3IRDA 2REQB 1AW5A 1UZ1A 3K1DA 2RKXA 2E4TA 4MAZA 3MP4A 4QEHA 4F0MA 1JPHA 2JFEX 1UP3A 4ATDA 3P0XA 4A2SA 4ZOEA 5EBUA 3W6LA 3H26A 1RV8A 1OFQA 3E49A 1YPFA 3BARA 4D8LA 2CLMA 1LOQA 4GNJA 3TZNA 4LVDA 4ZB0A 2ZXQA 1CNVA 1JIBA 3GDTA 2G3FA 2BODX 2I5IA 4R7WA 5DRIA 4X3ZA 3S5SA 1EC9A 2C14A 3IJQA 2DT1A 5JBFA 1SFSA 1XYLA 4H6QA 5K3VA 4IPIA 4CVWA 1GEHA 4Q4SA 3LLXA 2Z2BA 4FNRA 2WVVA 1A4MA 4UMBA 1IQ8A 2VR5A 4B4HA 1N8IA 1XSKA 3MYPA 2QW5A 3NQCA 2GVJA 5GQBA 5C9XA 2RGMA 1OJXA 1XQLA 3OZMA 4AW7A 2J78A 1QHOA 2FH6A 1UR1A 3W2UA 4RX0A 2C16A 2OEMA 5GPRA 5C6MA 1PHQA 3O9NA 4XWUA 3NOEA 4C6OA 4QCFA 3ABZA 2I16A 2BOFX 1L8NA 1U1UA 2DT0A 1LBFA 4IJRA 3WY1A 3W75A 4I6VA 1J10A 5FA5A 3LGEA 3N6JA 3NG3A 3O7UA 2J7GA 2OU4A 4R34A 3URNA 4XZMX 4JTUA 1E1CB 3GVGA 2BMBA 4LFYA 2GJNA 2A6NA 4RE2A 3NQEA 3NGFA 1AK5A 1Q6CA 4CEXC 3VX1A 3BQ5A 1HVXA 4NZFA 2WKLA 4H4IA 4E2BA 1B3VA 1DQUA 4W7WA 3DCPA 3BGJA 1FWTA 3CB3A 4PMYA 1E3ZA 2VFFA 1W8SA 2ZDRA 4NZ3A 2QCFA 3N2OA 2NX1A 4QQUA 4FIRA 4MAVA 5E09A 1YE4A 1LJYA 3EEGA 2D0GA 1WOAA 4X60A 4FB7A 1TWDA 1S39A 4WDUA 1VHCA 3EWZA 2CZFA 4FLSA 3MBDA 3EWUA 3T0DA 4H7CA 1H49A 2OFJA 3K46A 3CHEA 5J5RA 2PDFA 5HR6A 4AYSA 1ONRA 3G6LA 1JZ7A 2VXNA 2VGFA 1ZPTA 5FEZA 4Q32A 1VFHA 4PTMA 4IFKA 3WFAA 3KZSA 2CLHA 5T9BG 4QGCA 4TSFG 1QI2A 2AQOA 4K8EA 3VIPA 4RKAA 4I9MA 2DT3A 1XLJA 4LS2A 3W7NA 3CAKA 3WO8A 4C6DA 1E9LA 3BGAA 3IV8A 3HIJA 1XLDA 4H9XA 2Z1SA 3SQLA 3RAOA 1TV3A 1EF3A 1KFWA 1ZALA 1J4EA 1PKNA 3DFNA 2JIWA 3NQVA 2UWFA 2JALA 3GW0A 2G5WA 5DCEA 1ML1A 2WC4A 4GE8A 1UZDA 4BR1A 4GLEA 3BG5A 4DZHA 3VPLA 3V0UA 1HO1A 2A3CA 2AMXA 3WUFA 1R87A 4MFDA 2BZNA 1J11A 3LHTA 2EPNA 3N3MA 5TD4A 3VOJA 1TSIA 1O95A 1O7AA 3I7QA 2JEQA 1ZBKA 2A3HA 2Z25A 5I78A 2ZUTA 2PDIA 5FF0A 3KBJA 1KWGA 1QXLA 4L4OA 1GVRA 4YYCA 6REQA 4PMZA 3IJDA 3VIFA 2VT0A 2HXTA 3NZRA 3W7HA 2XPKA 1P7TB 3WF4A 3B9DA 2ZKMX 2WZTA 4BY3A 1V77A 3SJ3A 1LRTA 2E28A 1WO2A 4PUJA 4WGHA 1CXKA 3KL3A 3HG2A 1W17A 3K1GA 4AVOA 2X0HA 3TQ0A 5GJPA 4WVXA 1WKEA 2ESCA 1NFPA 1KB3A 1ISVA 2A7RA 5AHIA 2VOTA 5EA9A 1LUCA 2CC0A 4JHOA 2I14A 3WH8A 4V33A 4H2HA 2PSNA 3M9YA 4C5YA 2P88A 1W3LA 3UG8A 5F4SA 1IV8A 2VRJA 4WY0F 5I6SA 3W38A 5LXXA 3LM3A 1CGWA 4YXGA 1F4HA 3I6TA 5G2IA 2RJHA 3RITA 2O9RA 5LA2A 4ZXLA 1KRMA 3MMTA 3CH0A 3H7VA 2HROA 3N2BA 3VNJA 3EA3A 5G4EA 4AF0A 4DJDC 2TSYA 1ISYA 4B9ZA 1W3NA 4MSSA 3EX2A 4GI4A 2IUZA 1G5AA 1XIGA 3C2RA 1FWGC 2W61A 3UD6A 3WQCA 1IWBA 1M7JA 1MUMA 5CBJA 3EDFA 4W88A 4X9SA 1OEPA 3GTIA 4Q8QA 1HZYA 5CH9A 2PD9A 3LBMA 4PTVA 4ZQMA 3WLHA 5KETA 2Z2AA 4JDYA 1LWHA 1I8JA 4AVNA 4UTTA 2J75A 4EF8A 2RGLA 1FCVA 3BL3A 1R3WA 2X40A 1TJ1A 3U2ZA 3BE7A 5A8NA 2BDQA 1FWCC 3DFOA 2V6AA 5EPDA 4GZJA 9XIMA 3ICJA 1LROA 1GQIA 2NXGA 1N55A 4MVAA 1TJ0A 4LV9A 5T9CE 3UERA 2WSSG 1E9ZB 2J6XA 3MWAA 3LN3A 2O9OA 4HVXA 1HP4A 3A21A 3WLMA 8RUCA 1XIEA 2OLHA 3LNMA 4HMDA 4M1RA 4MNLA 4L9XA 3NDOA 4HJFA 3TOPA 3ZWTA 1S1PA 2E77A 3QPYA 3BLFA 3IV3A 2A1YA 5EB8A 3TV8A 3W83A 1AA1B 4KCVA 3P5ZA 4H9UA 4GXMA 5FJIA 3MKCA 3SO7A 3W22A 4TMBA 2IPJA 5AVNA 5BRQA 3NZGA 4XTIA 1KBIA 4EIVA 1TZ9A 2ZUSA 3GNOA 1K6AA 2OXNA 1SYTA 4PMVA 3AAMA 3W87A 3PVFA 5E6YA 4FOJA 4KWUA 3ZIZA 4DB7A 2YCKX 4H41A 3FV9A 1K9FA 3CV1A 2CFFA 1EP1A 2OO0A 1E1CA 2FZNA 3N9RA 1IGSA 4LBUA 2XH7A 3QHNA 1KCXA 3AYTA 2A79A 3IUHA 3LCWA 3IWPA 5CCZA 1O1HA 1EJ7L 3DFPA 4Q4PA 3AHTA 3DGRA 1B54A 2VEFA 1AZ1A 3SUUA 2XFRA 1QPKA 1H11A 3VNLA 3ES8A 4OOUA 1NP2A 4GBUA 3WQEA 2F6KA 4C7DA 2R1NA 3VIHA 1KM6A 4Q33A 3SCPA 2ZTKA 1TWSA 2WZHA 2FJKA 4CN1A 1C8VA 4MDPA 1YLVA 4L4LA 5DY3A 3W23A 2H3DA 5FF2A 4MJ4A 2QUUA 3FY1A 3HFTA 4ZQCA 1OINA 3JU2A 4HNVA 3W6MA 3DHDA 3QV8A 3WL0A 5K9XA 1JCJA 4NUWA 4M6UA 1QBBA 2CLFA 3CGTA 1U83A 4PB5A 6ENLA 2XISA 4JIHA 2EG8A 2VCAA 1U22A 1HT6A 4E0CA 4AH7A 3EA1A 4C6FA 4D6JA 7ENLA 5JBDA 4MADA 3FYYA 1IZKA 1MW3A 3POHA 4GJJA 4CQCA 4Y9PA 3U2CA 2ATMA 3PJTA 2OT0A 4LV4A 2XU2A 4CNOA 4CCCA 3BO9A 4Z2JA 4QR6A 4L5ZA 1PV8A 1US2A 3IIZA 4DJFA 5BWFA 2DFAA 3SURA 1KKOA 1LWIA 3SN0A 5HWNA 1B9ZA 3F4WA 2YA0A 4S2CA 4IHCA 4WJEA 2XSBA 4W7UA 5EMUA 1TO3A 3UA3A 4C7GA 1XG3A 4ADUA 4WDXA 4DI8A 1JUEA 3BV4A 3NYZA 4DXXA 1SR9A 4Z1CA 3WDJA 2J9XA 5AZ0A 3ZR4A 2VX5A 3S5YA 3LK6A 1B57A 3R94A 1PKLA 2EPOA 3R0KA 4JS3A 3WLJA 2DY3A 1FWJC 1VBGA 1ITCA 5I3HA 3DYOA 5D9NA 3W9ZA 1L8PA 2Z0IA 2CPUA 2D73A 5HWJA 3KFTA 3UXIA 4C65A 3UNDA 3WQ6A 2CW6A 1AJZA 4AZ6A 3O0KA 3EBVA 5AVHA 4BF5A 1T5AA 4PTWA 3QR1A 3NQMA 3RPTA 3BJFA 3CO4A 1DIKA 5FAJA 3A3XA 1W5PA 1YXCA 4F0HA 2WLZA 4Q4QA 4OJYA 4B2DA 5HJYA 2CBJA 4KRUA 1H8EG 1P0DA 1BYAA 2NSXA 3UESA 3TAKA 3LHZA 3WQ5A 2JK2A 3ZR6A 3RLVA 1K1DA 1RVGA 2P5NA 1GGOA 3IGUA 5H2ZA 1VD6A 2UY5A 4C6CA 4WQ6A 1ISXA 3M1ZA 5EFFA 3CUIA 5E5CA 2E3ZA 1RBLA 1AJ0A 2PE4A 4OV9A 4DWSC 5K9DA 5EMJA 4MIMA 1E51A 3EX4A 5D05A 4CU8A 4REQB 3R5EA 2VVSA 1O1ZA 2EG6A 1G4SA 1C29A 3GNNA 1VGAA 5AYIA 2YL9A 1T40A 3P62A 6A3HA 4DO4A 5AC4A 2ABBA 2QF8A 2C18A 2EQDA 4A8IA 2YZRA 2AOSA 4UQDA 5I09A 1TR1A 1CW2A 1D3CA 3B9OA 1MWOA 4NX0A 4DJDD 1EHAA 4ERGA 4JTCA 2OZTA 4ZQPA 1O6IA 3WF2A 1Y0EA 3WJWA 3NM1A 3NUKA 4ZSUA 1E73M 7TAAA 1J2WA 3M6YA 3T1GA 4KKXA 4GFIA 1QT1A 1VENA 2P76A 4QIUA 3E0FA 1ZJHA 1RA0A 4N9CA 1NOFA 1GOMA 4JQ1A 1GOIA 1MVYA 1B31A 1MRQA 5LGXA 3PZVA 4RE0A 2PDYA 3VK5A 3M47A 1B1YA 4D8AA 3ZLHA 5A2AA 3NM3A 3U7VA 1JPDX 4WGXA 3VMPA 1G4PA 3PZ9A 3SUTA 1XSIA 2P53A 2X1IA 1XIHA 3FIGA 1AQ0A 4NAEA 1AQMA 3U0HA 3SBFA 4IPPA 4XO7A 2Z1VA 1J18A 1DBTA 4LAMA 4WY0B 1XCWA 1E71M 1REQA 1WE5A 4A29A 3LGDA 2TAAA 4D6GA 1A5LC 1NDZA 1BG9A 1DORA 5HNNA 3GG0A 2EO7A 1XCFA 2VD9A 1WBJA 3BAYA 3QKZA 1UA7A 3WQOA 1JYNA 4OECA 1KBLA 3WLPA 2W63A 1WKYA 3VDHA 2FB2A 4CNNA 4F9JA 2Z2UA 1G4EA 4JICA 1VFFA 3IIXA 3CMJA 4LRTA 4B3ZA 4NZ4A 3PNZA 5KZEA 4E8CA 4WKAA 3SAZA 3KDNA 5HPCA 4ZB5A 3LZ5A 4IFOA 1CXLA 4I7UA 2A2IA 4GX8A 3FW6A 3A3WA 4D1JA 1UH4A 2Z26A 4O10A 1XI3A 5EL1A 4C6MA 3HOJA 1Y5VA 4XD4A 1VF8A 4J1OA 1BWLA 1E4LA 2OYLA 5DCBA 1ISWA 4HHMA 1P6BA 4U4MA 3A13A 1Q3NA 3MMWA 2QV4A 3HQPA 3LI0A 3NURA 1FCBA 4RL3A 1XC6A 1W91A 1TTPA 1Q85A 2E5DA 3TJXA 1XIDA 2W79A 1JCYA 4L7ZA 1DWGM 3REQB 2V81A 4JCMA 5DBUA 1O94A 3TJ4A 1E55A 1XLLA 1PIFA 4ZGYA 2ZXAA 3GK0A 2Y85A 5JQ9A 3BMVA 4GUIA 4XAPA 2QGYA 4HU0A 1XKYA 5CC5A 3MI2A 3C61A 2YGYA 1I2NA 2XIMA 1UZ4A 4I7WA 1GONA 1QPQA 3H2FA 2YXOA 2JKAA 3UCDA 5BMWA 5C9WA 5H8MA 3OEHG 2I9UA 4HMEA 4M6QA 3TSBA 1UKOA 3LCFA 4EXBA 3R11A 2VMFA 3HGSA 4IG2B 1UKTA 1WV2A 2EGZA 1R46A 4IX0A 2ZE3A 5A8OA 4JDBA 1KTNA 3HQNA 5DMYA 4EAYA 3L0KA 3SEPA 2PLCA 3F4VA 2HZGA 2PU0A 2DQXA 4PUKA 4KGJA 3WD3A 2CKRA 1OFDA 2VD8A 3WQGA 2BNJA 1AVAA 1NU5A 4LCQA 3ZSTA 3PPCA 3S1XA 3G18A 5LNVA 3U2OA 2ACQA 1UD2A 5BOFA 3TYZA 3OPSA 4GGBA 3ZVHA 3CK5A 3CTLA 2IXVA 3SCSA 2YJQA 3H2CA 2GUUA 3YPIA 4N9EA 1P0NA 3PBMA 3CZJA 3H23A 1EYWA 5ENLA 3NTYA 2Y63A 3BQ6A 4GXPA 3N9SA 1WZKA 3ZOAA 4IIDA 1J12A 3BANA 2GJXB 4BEUA 1Q65A 3G1HA 3ZVHB 4UR8A 4DUWA 3RK8A 1MW2A 2D2JA 1V93A 3WK1A 2WJZA 1RJPA 4A3YA 1NY1A 3W7DA 1EB3A 3CZ8A 5I06A 5TAOA 1RLCL 1OADA 2YOCA 3W7QA 3NL2A 3QGKC 3CL7A 1I1XA 4OOZA 3PZGA 5EBAA 1K02A 2GUYA 5DQPA 4JX6A 3HMCA 1TA3A 2B4GA 1OY0A 1TMHA 3QOMA 4RE4A 3AHVA 1KFCA 2XVKA 3GNDA 4IUGA 1ITXA 3VMNA 3N25A 3W7JA 3AU2A 4QFUA 2NUWA 3L7RA 1WPCA 1LBLA 1Y8BA 2WMIA 1M68A 1GCYA 5LNUA 1TKKA 2OWCA 4JIPA 5I3GA 1IZCA 3GDMA 1BRLA 3G3DA 4DWSD 1F3EA 4DWDA 2W3ZA 1KXHA 3TCEA 2WBGA 4NT0A 2X16A 4FX6M 4Q8NA 2RUSA 4GYPC 1NQ6A 4IFRA 5FJOA 1WYIA 1EJTC 1TTQA 4UQCA 1S5TA 2XTKA 2PRLA 4MWAC 3TK7A 4AVFA 4Q4OA 3CUFA 1UKSA 5TNVA 4RUBA 1KWKA 3QF0A 1QI4A 4ZODA 2PF0A 1GZJA 1R6WA 3CV6A 3G5EA 1FWSA 3P3BA 4KIEA 4H8UA 4B92A 3LDVA 1RK5A 5AHEA 2MANA 3TXVA 2FGZA 5FL0A 4GI6A 1XLHA 3LYEA 3NYDA 1LZOA 1IZJA 2WMHA 2X42A 3W3OA 5H8PA 1V3IA 4FNUA 2ZRUA 4WSHA 3OLEA 1W5MA 4B5WA 4R7OA 5I02A 1FWNA 3A12A 5IHSA 1SR0A 4YCPA 1A49A 3S46A 3UZYA 1VQTA 3DUGA 3BV7A 1MMFA 1XGDA 1E0VA 1E6SM 4H7ZA 4X0VA 1LBMA 4S3EA 1MEWA 1JVNA 4FXRA 4A8NA 3B0UX 3DFYA 3FLUA 1K03A 4CCZA 1U1HA 1PX3A 5MKGB 1W3HA 3PJUA 1XIBA 4JYEA 4UTTC 2FQIA 1F6YA 5CZTA 2D2OA 3WNPA 3VIIA 2Q01A 4FHAA 1Q6EA 4OQVA 1PJ9A 2GDQA 3WCZA 2R14A 2WMGA 2C3ZA 4NAFA 3G6MA 3UETA 2HE8A 4YTUA 3NCOA 4IM4A 1TMQA 4XZBA 2PEVA 1DVJA 5LNSA 1YIXA 4EE9A 3W7MA 2WHMA 2VURA 4F0LA 3UU0A 1QOPA 3S1VA 3WBWA 5DX7A 3U7BA 1F3TA 3DC0A 2FPVA 1CI1A 1GWJA 8A3HA 3AUJA 3LRKA 3T4CA 3NDZA 1IIGA 5CPOA 5D37A 3EWXA 2R91A 2DGAA 4EOUA 3GXFA 1QNQA 4Q8UA 2CEQA 3KE0A 4OT7A 3E96A 3PFMA 1Q4NX 3BAXA 1H0GA 2RAGA 1NWTA 5I00A 4BK9A 4GVFA 1OYBA 2VX6A 4NZ1A 4HSHA 3UJEA 4PB3A 3SFWA 1V0LA 4DYKA 5C2CA 4C1NA 1KLZA 4CD7A 5TBOA 1WAUA 4ERIA 3WK0A 2FLIA 3M0YA 1LT7A 1VP8A 2OZ8A 3KCJA 1XLMA 1W2PA 1D9EA 3WMSA 4M24A 3W1QA 3VNYA 2ZA1A 4DLMA 4HHPA 1XBVA 2YIHA 4MKSA 3R8RA 4GZ7A 4HPJA 3W73A 2FJUB 3H2MA 5E70A 3T8QA 1H09A 4O0ZA 1TX2A 4D71A 5CC3A 3B9NA 2YCEA 1FWBC 4J2MA 3UR5A 4AWEA 4DYJA 1HJVA 1KGXA 1I75A 2XN2A 4C6NA 1R2RA 3OVGA 3TC3A 4UIOA 3M0JA 5CAHA 4HA0A 3KRSA 2W92A 4ACZB 4GHRA 4G8TA 1HGWA 4FP1A 1Q6OA 3S2LA 3U57A 2V2DA 4U33A 1X7FA 3W7RA 1R85A 4TQTA 2WNWA 3W86A 5CPTA 2GK1B 4CNTA 1Z48A 3IJLA 4ROPA 1RA5A 2F2KA 3S0CA 3K4WA 1WQ5A 4Q8VA 3U8GA 1GQJA 5DMMA 4MUZA 2PWVA 3A5VA 1JJKA 1QVBA 3LRLA 4HNCA 4LF2A 3WJXA 5AHLA 5FCZA 1V0NA 2AQVA 1D7KA 1Z41A 3SRDA 3V5CA 4L6OA 2ZVRA 2RFGA 2QKFA 1L6WA 5D2WA 1MZRA 2Y5EA 5DO8A 4CCEA 1BWKA 3B3DA 3L68A 5HJLA 1QW7A 3KTCA 1N82A 5KZMA 3BAJA 2ABAA 2VEPA 3KWXA 1C8XA 1ICPA 1NELA 2Y2WA 4NJJA 2YA2A 4DX3A 4DQWA 1Z8AA 3UYIA 3AICA 4M56A 2DSKA 3UZZA 2F8QA 1NDWA 1XL9A 4KEMA 2X2YA 1HO4A 3PPGA 2JF7A 4NI8A 3T78A 1PCKA 1QK0A 4DUOA 4UMCA 3WLKX 4JQ3A 1WCGA 4D6FA 4F2BA 4LYQA 3L5AA 1KCZA 1W5QA 3ONCA 2CLIA 5CGTA 2IKHA 1IYXA 3QVQA 3F4DA 1UWQA 2WMFA 3GG8A 4C1LA 3S1UA 4H2CA 3GDRA 2R1KA 5A6KA 4Q8MA 5IRPA 1LL7A 1QOQA 3S6OA 1SZNA 5DMNA 1JG9A 1VPXA 2IPFA 3EWDA 2AKMA 4RPQA 2PI6A 3GKAA 4ICMA 4AX6A 2GPTA 2POTA 3R8HA 3E2RA 3LTSA 3V4BA 5XIMA 1JNDA 1U5JA 3DG3A 2CCRA 1MXGA 3TSDA 2J4GA 1BAGA 3BMWA 4ZL1A 3W76A 3NL3A 1X7IA 4WF7A 1RQHA 2CZDA 3G1YA 1VFLA 3S9YA 3V1PA 1Q4WA 3PUEA 1T99A 4AZCB 1TMLA 1EC8A 2ZOXA 1UC5A 3T0CA 4PMQA 1W56A 3WNNA 1JCMP 2GJXA 3QPZA 1A0DA 3MCMA 4RJEA 4Q4RA 1W1TA 3JRKA 1ODUA 1SU5A 1Q7MA 3STPA 4DI9A 1C92A 4N6FA 2DH3A 4I5UA 2B0MA 5HAOA 4ZOAA 1QPRA 5HOSA 3F5LA 2VOMA 5FL1A 4ML4A 4XBSA 3AYSA 4GABA 1XGZA 3CWHA 3H53A 3VOGA 2CYGA 4U3AA 2VEMA 1SO4A 2OLSA 1T7LA 2A7NA 3HBLA 4UCGA 3G1RA 3IJ8A 3GYEA 4LAOA 4NU7A 3M7SA 3FHAA 1ZENA 4GX9A 1JFXA 4QROA 2OG9A 1G0CA 1OZMA 3VFCA 1NOUA 1JQXA 2W9MA 4LC6A 4LUJA 3WMBA 1Q6GA 2OODA 4JFVA 4L4MA 3B8VA 3WD1A 3T0AA 4AWUA 4AFYA 2W6RA 5KSWA 2ZVIA 3NZ1A 4O52A 3CQKA 2VRQA 2B81A 3UEQA 1O5KA 3WK2A 3UZ5A 1TJRA 2ZICA 4LUYA 4B5NA 4O57A 3QTPA 1ECEA 2HTMA 3H55A 2X1UA 2VFHA 3KS5A 3VD5A 2O4QA 4H8HA 1ZRQA 3AZRA 1BGGA 4EWJA 1EEXA 3GNPA 2G4JA 1E40A 4R27A 4O50A 1PKYA 3LHUA 2P0IA 3T0TA 1LLOA 1QMLA 1ZAIA 2DVXA 4QBXA 4F2UA 4DM2A 2E7FA 2DJLA 3OGVA 5DF0A 1JD9A 3R13A 4LTSA 3A9IA 2GSHA 4GKLA 3AMLA 4PBGA 1BQGA 1BKHA 2OSYA 1K4GA 1F8IA 2IKGA 1YPIA 4GPNA 1QOXA 3DKJA 1EIXA 1E56A 2IQTA 3ALGA 2WHKA 3IK4A 1PE1A 1W31A 3M07A 4MHBA 1GKPA 2AKZA 3AXHA 1CGYA 5FL7G 3F2DA 5FSDC 4AQLA 2NUYA 2I57A 2Z29A 3CUHA 1DV7A 5J04A 1CLKA 1IR1A 3M5XA 3R79A 2EKCA 3H6OA 3B9EA 2W6IG 3QC3A 1VBUA 2P50A 4W84A 1V6WA 4IIBA 3ENLA 3MKVA 4PA8A 1EJSC 3PPHA 1UPMB 1FDYA 3N29A 2ISVA 5IOBA 3G8RA 5A2CA 3ELFA 3HJEA 4EPBC 3E74A 3KBMA 4M3PA 4ZBCA 3EDDA 3LXAA 1E70M 2EJAA 1FWFC 1J6PA 1KRAC 1FP8A 2VENA 2FMNA 3R0UA 3U5YA 2J25A 3VO0A 1IWPA 3NPUA 4E3VA 2PP3A 1JZ3A 4UTJA 3CLMA 3DBNA 2ISFA 2HV5A 3EEZA 3K4AA 3QLDA 5M5DA 3GFXA 3NO1A 3ARYA 3LA4A 5DT5A 2WLYA 3W07A 4UR7A 3CL6A 3ZIAG 4GINA 2J7HA 2JKPA 3BMXA 4GGHA 2J88A 3CT2A 4DHGA 1H4PA 3MO4A 1ZJBA 4IICA 2RJGA 1PHWA 4BJHA 4R88A 5D09A 3UJFA 1UKPA 1K8XA 5CEWA 3EOEA 3TJIA 3DYMA 4P7NA 3GY1A 3TR9A 5LIXX 3HTWA 3L65A 1QTWA 5BYWA 4Y8EA 4Q6XA 3TE9A 1W32A 3VKDA 4R9XA 5MKGA 3BLDA 3A64A 2DT2A 1R5YA 1XLCA 3STFA 4Y8FA 5FSEC 4P8VA 3WEOA 3GD6A 3C2FA 3O06A 2DZAA 3QSTA 1EO7A 2CHRA 5G4HC 4DNMA 1CXIA 2PGFA 3UWWA 3G0SA 1DTUA 1A50A 3WF3A 1E6QM 1UYQA 2V3GA 4IJCA 2Y62A 1VCFA 4RZBA 2V3EA 2SFPA 2L5HA 3PFRA 4KCWA 1YNPA 4GY7A 4GMEA 3UXLA 4LJ3A 1L6SA 1YW1A 4AIOA 2PMQA 1QI0A 1HFBA 3F4NA 3DH7A 1QNSA 1JYVA 1XLAA 4DWSA 1B90A 1F5ZA 1XS2A 1NH6A 3FYPA 1G01A 4M80A 1DJYA 2NUXA 3WFZA 1ZAJA 4GWEA 1GVFA 3GR7A 3PF3A 3GTHA 4Q3MA 2GVYA 3W7GA 3EOSA 3EWWA 4FK9A 4IIEA 2XFWA 3VINA 3UWEA 3WEMA 2PDLA 3FK4A 2AGKA 4D9PA 1RQEA 3O8AA 3PG9A 3KHJA 5M17A 3MDUA 3GHTA 3VMOA 4CLMA 5DY2A 4WEVX 4L56A 2NSOA 4GIRA 1V03A 2Y0FA 3PY2A 2OT1A 2QCHA 3EZ4A 1CECA 1ZHAA 2V30A 3WQ8A 1QNPA 3R12A 2ZWZA 1ADDA 3HB9A 2IS7A 1W5NA 9CGTA 3AO0A 4UMAA 4K3ZA 3L4UA 3UXAA 3LENA 2QPUA 3SCVA 1ZJIA 2GQ8A 6CGTA 1BG4A 1Q8AA 2BVWA 2BOEX 2F9RA 3IAQA 4OV4A 1W9XA 5F7UA 4PMDA 1KW1A 1POJA 1F2JA 1KM2A 2PDPA 3EKGA 2WC3A 4QJ1A 4JN6A 3WJSA 4B90A 2GUBA 3FYOA 1NP0A 5F4XA 3SJNA 2Y5SA 1TR9A 3T0BA 2VP8A 5KMYA 1NIUA 4MJMA 1H63A 4MB3A 3PBYA 4A3QA 4S3FA 2BGQA 3AZSA 5F1UA 3NQAA 4BF7A 3KL0A 2DSWA 4FXJA 4GC4A 2WVUA 4GISA 1JAKA 4WCJA 4ECLA 3LNPA 3OG2A 5AECA 3GX9A 4X2RA 3LU2A 1DIOA 5G5IA 3H24A 3GAKA 4NHVA 2Q02A 3FJ6A 4KQNA 1GVIA 2WSKA 1EX1A 3BLEA 4TVUA 2J27A 1S5NA 4ZO9A 2W6JG 4UUIA 3L2LA 3OEXA 4E2VA 2OPJA 4UCFA 1HKJA 2TRSA 3QRHA 1YDYA 2OVLA 3BPWA 4JQ2A 4Z1AA 2FVMA 3F2BA 4C90A 1GORA 1RH9A 4ASTA 1TUFA 2G37A 3AS3A 1MI3A 1ZP4A 2OLAA 3ARTA 3ZJ6A 1YBQB 3W24A 1ZNNA 4IIHA 4AZCA 2O7QA 1P1MA 1RY8A 1NF7A 3ZT7A 4D6DA 3W29A 3PAOA 3HU7A 2FHFA 1MUWA 2VQUA 4RK8A 4F40A 2CZVA 3B9AA 4O54A 5IHRA 2A3EA 3NVDA 1I0BA 2HPIA 2OJPA 4G1NA 3ZYZA 1J0HA 4BI7A 5K4XA 3KXQA 8CGTA 3VE7A 1VPQA 3IARA 4JX5A 4J27A 1BTMA 1UH3A 3QJAA 2WW5A 1VHNA 2J7EA 3C0SA 3I4KA 1KQYA 1FHVA 3ZJ8A 3GC2A 3AIRA 1AMKA 4W8AA 3NVTA 2DIEA 1VYSX 2YW3A 3SCUA 1YQ2A 1AD1A 3O16A 4NJIA 5CZSA 1S2VA 1WDQA 1XF0A 2HRWA 5U7SA 4UFMA 2G3IA 2WC7A 4EKJA 1RY0A 2FHCA 2Z6IA 4QJ3B 4YU1A 5D8ZA 1UQYA 1DE6A 4IPLA 4OHQA 2EEXA 1OG0A 1TE6A 5I2UA 5K7JA 1J93A 4WZHA 4LYRA 3N13A 3ME3A 2ZX6A 4ZENA 4G7EA 5C9UA 1MW0A 1MYRA 1IXNA 1UOKA 1G9HA 1L2UA 1UOZA 2WPDG 2QCCA 4IMCA 3WDIA 2YDQA 4GZEA 3V3WA 1OM0A 3C3UA 3IAPA 3QSRA 1CGXA 2PWHA 1CXHA 1G94A 1R2TA 3MSRA 3ZVIA 2QCGA 1J0KA 5FJTA 3ARUA 1WUFA 2NT0A 1T8QA 3VOFA 2NW0A 2VQTA 2XFYA 4NXSA 2BB0A 4QM1A 1RUSA 5SWUA 3B0VC 1P43A 4WOQA 3CWNA 4Q4MA 2PF8A 5XIAA 2E40A 3E0VA 5DELA 4IP4A 1DJHA 3C8NA 3TLQA 3RX2A 1SO3A 2EPKX 4P8XA 4NZJA 3AROA 1LM1A 1V02A 4JQ4A 1E3XA 1X8CA 4ES4A 4DXVA 4J5NA 1HUVA 1XDLA 4DJDA 3KUMA 1KM0A 4LUSA 4G56A 2C19A 1TFVA 3MWCA 1KFBA 2ZRWA 2YFNA 2PTWA 3D47A 3LTPA 2WVTA 3N12A 3VDGA 1H0IA 2Z1KA 2GL5A 3WUBA 3S3GA 1R9ZA 4JTGA 3MY9A 3B97A 1SZFA 3HGJA 3NPVA 1O12A 4XBKA 3GC4A 4O1BA 3DU0A 4Z1DA 2PCQA 3WKZA 4DAFA 1M1BA 4XTDA 4D6IA 3U3HA 1HJSA 4EX4A 3LPPA 3GYCA 2ZIDA 3VNMA 1HN1A 2YPIA 4PFMA 1U5HA 3GH4A 2FVLA 4JFSA 1OHLA 4ATWA 4GVIA 2WMKA 3NJ3A 2HBXA 2JIEA 4RW5A 3PG8A 4KEUA 3ARRA 3PUOA 1W6TA 2VC9A 3ABXA 5HULA 1UIPA 3HN3A 4L80A 3OODA 4B5XA 1I2OA 1ZQ5A 1JZ8A 4AC7C 4G2DA 3H22A 2VKZG 4MZ1A 5EMMA 1KRCC 2FGLA 1GHSA 1CTNA 1H7OA 5GJNA 3GXPA 2YYUA 3T7VA 6XIMA 4UTHA 4XKYB 5M03A 4AHPA 3UWYA 4A8RA 1DP0A 2Q8XA 3FDGA 2NLIA 1OD8A 4QJ4B 1UJQA 1XUUA 2OKOA 5CSYA 1SZEA 4F4RA 2VCCA 1JXJA 1PZ2A 1TVNA 2YDRA 4D6CA 3OBAA 3CQ0A 5HINA 2QGHA 5CG7A 5F2MA 1Q6FA 4H9MA 4IQLA 4XBJA 3IJ7A 4GVGA 3KTSA 1RP9A 1BF6A 2FFIA 1WAWA 5I23A 1UUQA 1PZ1A 2A6LA 2PDNA 3U48A 3RX3A 5L6UA 4YTRA 3FA5A 3DESA 3FDKA 5C55A 1A4LA 1DTNA 1CZ1A 2BXVA 3L4XA 3SFKA 3CHFA 4M51A 1S5VA 4LNCA 1PIIA 3CUZA 2CXGA 1ADOA 3CPUA 1HTIA 3ABSA 2FTYA 4TO8A 2Z28A 3UPMA 4DJEA 2XZ9A 1RBAA 4LOCA 3R58A 3WLNA 1ZB5A 1PSCA 2WWDA 3C4UA 2YXXA 4ZQRA 2WJEA 7REQB 1IHIA 2O55A 2YW4A 1RCQA 3AWNA 3V1HA 3M44A 1AQHA 3HQ1A 5A8PA 1BLIA 2XIQA 2E6AA 3PTMA 3A5FA 4QQ3A 3CV2A 4B2DD 1GKRA 1LORA 1IEXA 1TE1A 2VRKA 1N7KA 4L65A 3WELA 4JAWA 3TEVA 2GQ9A 1GOWA 2F2HA 1RZMA 2CLPA 4NNCA 5LXEA 2GVEA 3VYLA 4J7RA 4UTIA 2QLYA 2BV9A 3AHYA 3QFWA 5GVJA 1OC6A 1L6YA 1DOSA 2QCDA 2WJDA 4W93A 2VL4A 3HPXA 1EXPA 2CIPA 3CS2A 5D9OA 2FKPA 5D9PA 4U5KA 3LCGA 3AU6A 1VFUA 4PN2A 1FQ0A 4FI4A 3UJ2A 1E0TA 1E6PA 4U10A 3GTNA 3RRAA 4W7VA 1YTKA 4ILSA 1XH1A 1QPNA 2PGWA 2FTWA 4US5A 4Y9OA 1Q2RA 1OFPA 3QYQA 2Y89A 2AL2B 2BHUA 4FNSA 4C1KA 2BFGA 4IGSA 2QS8A 3AHXA 2PA6A 1N2VA 1V3LA 1KM3A 4PMUA 5BMXA 3PR2A 4ZO7A 4QX4A 2NX9A 3WH6A 2H6RA 3L0GA 2ZZ7A 3KLKA 2XUCA 3QH2A 2QAFA 4P8WA 2Y1HA 4CQ8A 4GYFA 4B16A 1GVQA 1TPB1 1XICA 1A47A 2VVNA 4G7EB 3VCCA 4H6RA 4LUIA 2F84A 2OSWA 3CM4A 2ZUUA 2PBGA 5LZLA 1TZ7A 1BYDA 4QTGA 3NFUA 4AHQA 3BJSA 5EKYA 1EUNA 3VD3A 3OAAG 1PDYA 4ACYA 2Y7FA 1W9VA 4KW2A 5LYRA 3QQ1A 4LVAA 2QQ6A 4QP0A 2YL6A 1XLEA 1A0CA 4QLLA 2W66A 1XISA 4Q4KA 5T26A 4ZO8A 5AC6A 2P10A 1LWJA 4QS5A 1AQFA 4Z0JA 4E4FA 5D8WA 2GDVA 3RIKA 3CAQA 3BCDA 4ZOCA 3UBPC 4H3DA 1EGMA 4KEZA 3DKLA 3JS3A 1NEYA 3OVPA 4KFNA 3VD9A 4XUYA 1OX4B 3BXWA 4H8VA 5GNZA 1FH8A 1PBGA 3L4VA 3N3TA 4H83A 1QO5A 3I3BA 2JIZG 2XWEA 1DEDA 4XZWA 3BAKA 2HQAA 4NNAA 2NV9A 1TJPA 4HMNA 1YRRA 4YVVA 1Y5WA 3FX4A 2XSAA 3B8DA 4W87A 4A8LA 4S3DA 4UOQA 3OZPA 4MGGA 4R53A 1BD0A 2HWGA 1B4EA 5E0CA 3STGA 2QHAA 3AXXA 5C7VA 4J4KA 3BLOA 3EAUA 4I9TA 3VUSA 3KBSA 2E6FA 4IG2A 2JJ2G 3RM4A 3Q37A 1MDRA 4QEEA 3KBVA 3EPNA 3HPAA 3NPWA 3N14A 1JR1A 1EBGA 2P1FA 4GQGA 4JKLA 3VGGA 5A1AA 4GYJA 5BROA 4EF9A 4DY1A 1FHLA 1J5TA 5E9AA 2XH0A 2UY2A 1JD7A 4MKVA 5I3KA 3BK0A 5JU6A 1SO5A 3N04A 2O9PA 5EFDA 5IDIA 3LTYA 2CZEA 2ZE0A 3QQWA 3P0WA 5DXYA 3SGUA 2PFHA 1QATA 4INFA 3EX1A 1UJPA 4Y90A 1UUMA 2ZZ2A 2J24A 3HG4A 1NFBA 3OB8A 3QC0A 2X7WA 5H91A 2P3ZA 2VM8A 4PL1A 3NQ6A 1DWHM 4LSBA 6ALDA 2WVVB 5E0FA 1HXJA 4NRSA 3I3EA 3MT1A 4U31A 3PBVA 3W2JA 1W9UA 1DJXA 3IPWA 1FWIC 3Q45A 3TNOA 1HVQA 1XRVA 5D4YA 1TWWA 2PRMA 3W2KA 1EA0A 1R3VA 3WNMA 5F1VA 1EIBA 4DF2A 2XYLA 2BOGX 3TKFA 3W7LA 3FAWA 4A2RA 2A4AA 3SDOA 2VWTA 1VYPX 1P5BA 1VKFA 2YCIX 3RRXA 5CJNA 2DU2A 4FNTA 1W54A 3R7MA 4DF0A 3K30A 2HEJA 3HGRA 4ZQNA 4HCDA 2HBVA 2JDIG 3KLLA 4QITA 1GVOA 4YMZA 4AD4A 3VZZA 1P6WA 1JCXA 2CNCA 1ONEA 3HURA 2D23A 2NWRA 1R8LA 1UMYA 3VVGA 1ZBCA 4AY7A 1ADSA 1IE7C 3C5QA 4G9PA 1JDDA 5G1YA 3F5KA 3MYOA 3WYZA 1JL8A 2XZ7A 1JI1A 2J66A 4DJEC 5FJUA 4HK7A 3P61A 4PTNA 5HK4A 4XUGA 3W01A 1Z32X 1TYGA 1EDQA 4AXNA 4KRTA 5TQLA 1FH9A 3HMJG 1IWAA 3WH7A 2EKGA 3KCLA 3TSMA 5EY5A 4P7RA 1KTBA 1EWEA 3DZ1A 4HU8A 4AU0A 1X97A 2PWUA 1JYWA 3WLSA 4JTHA 3LMZA 3QW3A 4FXSA 1FHDA 2HMCA 1V7AA 4H01A 2BVTA 1XRSA 1WBHA 3PWIA 3TCSA 4YWIA 3MHGA 1D2KA 1O66A 3II1A 3SR7A 4R7JA 3BCJA 3WD0A 4DBEA 4JN8A 4HP5A 1DKWA 1XBXA 1YXYA 3UZXA 2DJXA 4HQVA 3W1RA 3CXOA 2GOKA 3S1GA 1JFHA 1OGSA 1OT1A 5CG0A 4J3VA 4BF9A 5AYXA 2B31A 1QJWA 5HMFA 2E9LA 3PK7A 2QE7G 3WFLA 5HBFA 4RE3A 4CNUA 4DPPA 1GUVA 3VKBA 1MEIA 4W85A 1ZLPA 5CSSA 3O63A 1I60A 1OK4A 1FUYA 1BTCA 1UROA 4YXWG 4K8HA 2QDHA 3N2TA 1RALA 1IR2A 3H70A 1PVNA 3DHUA 1QW9A 2YB4A 1WB0A 2C8NA 1MO0A 4Q7BA 3AWOA 2G4FA 1VIZA 4ZXOA 1VBJA 2J13A 3OYXA 1M41A 4GH1A 2X2GA 1EGVA 1MQQA 2X41A 1EOKA 3L4TA 1HL9A 1FKXA 4DELA 5I0DA 3G0UA 2NXHA 1KV5A 3BZGA 2WBKA 4AIEA 2V0TA 2CERA 2XGZA 1XFCA 3KVKA 2FIQA 2VFDA 4KCTA 3RLHA 1T8XA 3ZSSA 1KFLA 1EWDA 4RNFA 2J9YA 4EPEC 4UNLA 4XZLX 2NXIA 5ABFB 4PZVA 1IXPA 4EP8C 5C54A 4UNIA 3EB4A 2E1WA 3ARXA 4IXXA 4E38A 4Z2KA 2RDTA 1X1NA 4LY8A 1FKWA 3S9IA 4C7FA 3LS9A 1UBPC 3A6OA 4LAKA 4LCRA 3IS4A 2C1IA 2UV8G 3GKFA 4ZTYA 3TQPA 2JBMA 4H9VA 4F66A 4EK7A 7TIMA 2QDDA 3QM3A 3UR8A 3DAQA 3N34A 4MYAA 1CGVA 1J01A 5LSMA 4XD6A 3SY5A 2BY1A 4LNYA 3W81A 3VFLA 2GQ3A 5JMUA 3WQDA 2HNHA 1G69A 2GFTA 4IMFA 2POZA 1H7XA 4EPDC 1F8MA 1E1EA 4C6JA 4RNJA 3KCOA 3CUXA 3FAXA 3FVDA 5HUPA 2C6QA 3OBKA 2C13A 2ASHA 2Q6ZA 2Y8VA 1XP3A 1R2SA 1SJDA 4YIWA 2XINA 5FEWA 1KBKA 5DANA 4MB5A 4JPGA 2WZMA 3QLLA 1UR8A 3QN3A 1GYLA 3ZR5A 3SY1A 4IPNB 5G2HA 1KTCA 3AMKA 1UMLA 2DZUA 1RAKA 1KNWA 3RO6A 4PE8A 4AEEA 1ZJAA 5AC5A 1TQXA 2JGQA 3I3DA 3BZJA 4E5TA 3AIUA 3QV9A 1U33A 4MZYA 5HMSA 2AAAA 1TELA 2DUXA 1LT8A 4XV0A 1DQXA 1SM9A 3O6DA 4WOZA 3ZXWA 4JKMA 4B5UA 3QV7A 1SZGA 4O53A 4TX6A 2OQYA 3P6LA 1R38A 2CITA 4HPNA 3WJZA 3IGSA 5BXRA 1O68A 3H2OA 2GSJA 1J96A 3M4HA 2NV2A 1SZRA 2VNCA 3FKKA 1E15A 4HBKA 1WDWA 4TX8A 3NPXA 2PLMA 3NSNA 2IXUA 1VCGA 4ZB2A 1H1ZA 2WMIB 5AKQA 3L67A 2XH4A 3OEEG 4QRNA 3ABOA 4XZIA 4XG1A 4QSHA 1IEIA 3FJNA 3R0DA 2Y7GA 5CPMA 1I1WA 3WSUA 4MWAD 3RM9A 2TYSA 3ZLFA 2PDCA 5B7YA 3A22A 1AZ2A 1IT0A 1FXPA 4PCSA 4LCSA 3VNIA 2VZSA 3GDKA 3DN5A 2QVHA 2HCVA 1IXQA 1Q6QA 4MDOA 1SW0A 3N19B 4ROQA 4RNHA 4C6KA 4GI9A 3G1DA 2PURA 1YBQA 3HG5A 4N6EA 4URIA 2X30A 2ZXDA 3R4IA 1VZWA 2QIIA 3CPGA 1X96A 3MHFA 1E0XA 4GG9A 4QAWA 1MZHA 2VC7A 4JNZA 3VGHA 4TOQA 4O1CA 3EX6A 3E1F1 3KVMA 4FLRA 5MF5A 2GGEA 4GI8A 3V36A 3Q94A 1V3JA 3OJGA 3SRFA 3HPZA 1JF5A 1ZFJA 1NJJA 4CQBA 3UVAA 3KM8A 3USBA 3V0SA 4I8DA 3W0KA 1E0WA 3CL8A 2BP1A 1OGBA 1QK2A 5D2XA 3U2EA 3FS2A 4UTLA 2ZX8A 1Z69A 2XVPA 4UFKA 1C8QA 4G5DA 4GY1A 3NGJA 4WXZA 4HNLA 2Y8KA 3WG6A 4CNSA 5AC7A 3H2EA 5AHNA 1SJCA 5HPOA 3D0CA 4JEQA 4BCEA 3MUIA 1FXQA 4N0RA 4NQ1A 4S3BA 5D2VA 3UZJA 2C15A 4LYKA 4W86A 2FGBA 3SN4A 4S3KA 4O19A 2O9TA 4BQ3A 3FXYA 2OTDA 1UQZA 2ZZ1A 2CU0A 2J79A 4M81A 2O92A 2Z7GA 5HANA 1A5MC 4XSMA 1JDAA 1FFQA 5F2GA 3TUUA 3ZFHA 1CB7B 4D6EA 1AJ2A 4LXFA 1ENUA 4YL2A 2TMDA 4HSNA 1M7OA 3U9IA 1UWTA 2ISWA 3EX3A 1QFEA 2I17A 2ZYFA 1QCWA 1JUKA 2QJGA 5KINA 1W3IA 1O5QA 4HHHA 3RGTA 2CKSA 4OFCA 2GVGA 3PBGA 1Q2SA 3HM7A 1XCXA 1B3WA 2UBPC 4JHZA 5DFAA 1XQKA 3APGA 3EDJA 4NYUA 1XHGA 1PS9A 3D5HA 4PEKA 7XIMA 3URQA 1HG3A 3S6DA 3WN6A 2QDGA 4FX7A 5CZKA 1HKVA 2YB1A 2DPEA 4ZOBA 3NO3A 3MQTA 1JPIA 4O1DA 1WXYA 2PDGA 3AS2A 3KRZA 4GJ1A 3ORWA 1VCVA 3IEBA 4M19A 3IK2A 1PTGA 2X8RA 4IWWA 2GDUA 3VKKA 2BTMA 4V1XA 3QPEA 3VD7A 1MFVA 5GJMA 5A6JA 1RLDA 2DIKA 2O7SA 2V69A 3P84A 5BXSA 4HNUA 3V16A 2V5JA 3KX6A 1GQKA 1UWSA 4WK9A 1CENA 1JULA 1RCXB 3UJRA 1PO9A 1MUCA 4Z08A 5CBBA 5CKSA 3QTGA 4OGZA 2V5LA 2F6XA 3GBDA 2B7OA 1KD0A 4M6VA 3URAA 1GG0A 2ODOA 1PWLA 3W25A 2H9AB 4FOKA 3LY0A 1QRQA 3HV8A 4AD1A 4K2SA 4LBRA 1JZ6A 2Y7DA 1T96A 2DZXA 3OLIA 3LUTA 1TPDA 1CWYA 4FNQA 1OG6A 3UPBA 3T9PA 3I7RA 1OGGA 4IGNA 3QV6A 4ZFMA 1JYXA 1K7EA 3FSTA 1XRTA 3EPOA 1WXZA 2WZIA 2W27A 1D3GA 3G22A 4DRSA 1H50A 2FHBA 4NI3A 3MVIA 4GC3A 1XLBA 1R9XA 2DVTA 3T2PA 1XPGA 5AYBA 1LG2A 4L4PA 4TV5A 4HA3A 2PBOA 2XM2A 3LHVA 4YCOA 5D2YA 3WF1A 1LQAA 5J5DA 3MS8A 1NSJA 1S5WA 3RDKA 4O18A 5CAKA 1SJAA 1Q6RA 3G1FA 4N4PA 3OVRA 1UD8A 3WEZA 3TX9A 4ICCX 2E8ZA 3CNYA 3LRMA 3B0YA 2E09A 3FSUA 8XIAA 3DFQA 1VRDA 4JNMA 2IW0A 1E4MM 3ARQA 3BDKA 3ISIX 3MV01 3O07A 3TW9A 2QF7A 2DZSA 1PL9A 5A6BA 2FVKA 1X98A 4K6AA 1TCMA 4NAFB 4XZHA 3BICA 3CZGA 3G3MA 1R7OA 1ESWA 1S1RA 4I5RA 3LEPA 1DQWA 4PC8A 3E6EA 1MW1A 2QPXA 2BY0A 1R47A 2HS8A 4CCDA 1RSCA 3BSHA 3L12A 3ONBA 1TB3A 3CZKA 1WOBA 2NT1A 4K36A 4I7VA 4KPLA 3H7UA 3L2IA 1TRDA 3EDEA 1TPVA 1P7TA 5HNTA 3PTQA 4J2PA 4CN6A 3VXGA 3CIVA 3ARZA 3G1AA 1NAL1 4Y9MA 1GOOA 2VCBA 4BQ2A 2PCEA 3UR2A 4ZCWA 3QHMA 1RVKA 5HMDA 1M6JA 1EJUC 2PDKA 4HZ7A 4JTLA 3O6AA 5CC7A 2G96A 3KOZA 2OWWA 1ISZA 3UVIA 4RNIA 1DJIA 3N73A 3TDFA 3TFXA 1QI3A 2PDJA 4AD3A 2BXZA 4H00A 3W1AA 3FKRA 2XG9A 3CHCA 1EH9A 2E68A 1CT5A 2XSXA 2WQPA 4AXKA 4AWTA 4FOUA 1LDCA 3PS7A 5CLTA 1H3GA 3ATYA 1E6NA 1PPIA 1N8FA 2GGHA 1AW2A 4WY0A 1FRBA 2V5BA 2Q09A 1B9BA 1JPMA 4N9BA 2DUAA 1L2QA 2YBTA 3ARWA 3OLGA 1XJBA 4O4WA 4GH3A 4EWND 4S3GA 5K2ZA 3TYAA 3VDCA 3P8JA 2FDSA 3CWOX 3S2JA 1CXFA 4AY8A 1QWKA 1UASA 4M8UA 3UWZA 1UCWA 3ZMRA 1Q7QA 2PDUA 2EXOA 1G1YA 1H61A 4GYPA 1XYMA 4AB4A 2RHGA 4H1ZA 4PRTA 1AH0A 4D72A 3R43A 4NSBA 3WQWA 1QW8A 4AZIA 1I9CB 3N15A 2ZTJA 3L5LA 4P7OA 1DWFM 2C71A 3WBAA 4DJED 1I4NA 2FZ9A 3E3HA 3R6IA 1LP6A 1WDPA 2VFIA 3PUGA 4Z1BA 3VDBA 4UNKA 4HOZA 5C9RA 1ZGDA 4PUDA 4HOWA 3VNKA 4ORMA 1F3WA 5FF4A 1E0UA 1XLIA 4KS0A 4LBSA 5M3WA 3ZT5A 2DSUA 4HCLA 1TPWA 3WUGA 5AY7A 4PMJA 1UHVA 4O4VA 1NWRA 5FAGA 3IJ6A 2DZPA 5CGQA 1RXOB 1UUOA 2HVOA 3T09A 2DEPA 4GUHA 3HQOA 3P8IA 4OZOA 3UNTA 5A8MA 3UGVA 1A53A 4L1GA 5D2TA 1HJUA 3FXGA 1DJNA 4DF1A 3TTOA 4YTQA 3G77A 1JRCA 1ME7A 2ZC1A 3NSMA 3TN5A 2TODA 1KV8A 2PTYA 4KESA 4PTDA 3SCRA 1SUXA 3U5UA 4Q8PA 3S6TA 3C2EA 1OCJA 3AALA 3EMZA 1FHUA 3AZTA 1S3HA 4FMVA 4QJ5B 3QZEA 1V51A 2AQWA 3C0QA 3FNDA 3AQUA 4AIBA 2C1GA 2F38A 3GHUA 5AOUA 3RUBL 4HTBA 3S5NA 2HJPA 1FBAA 3WLQA 2XIJA 4HNNA 1EJVC 5B80A 3TWBA 2YXGA 3T2OA 3USZA 2MNRA 4YTTA 2PU1A 3QZ6A 3G0XA 1QNVA 2EJ1A 1RD6A 2PDBA 5LIWX 2J47A 4RDWA 1GKQA 2D20A 5I77A 4Y9AA 1O4UA 2DH2A 1VJIA 1OCQA 1GJPA 4ICNA 4UFIA 4IGHA 2BASA 1M7PA 4IISA 3EWYA 3S2CA 2OYMA 4PUWA 3M0KA 1XSJA 4R3UA 4KWWA 3IANA 1HKKA 3K8MA 3A4JA 3GXMA 3W85A 3PTKA 1TPFA 2VDHA 2XIOA 1ITUA 3A4AA 2DQWA 3PP7A 3LSCA 4ZTXA 1W1YA 1TG7A 1CCWB 3TYBA 1OIMA 5ABGA 4Z1YA 5FOOA 3TZFA 3GVWA 2JF6A 2QCEA 4JTKA 2X05A 4BFAA 5E1QA 2XN0A 4GUFA 1W1ZA 1XUZA 3TVAA 4REQA 5FF7A 3ITOA 4M82A 3RYSA 2UY4A 5PTDA 4CQ9A 2HPMA 4UWMA 4F0RA 4WKHA 3W00A 5CGMA 4H6EA 3AC0A 5CC6A 3JUGA 4I9AA 3PBUA 1US0A 1JEZA 2VX4A 4AZ7A 4MYXA 4C60A 4H9ZA 1WKFA 2QDEA 1RCOB 3C0JA 3E02A 4GO9A 3ANUA 2XGIA 4GUGA 4O1AA 4TVDA 2E5BA 2NWSA 1I0DA 4YNGA 4NY2A 1RK6A 1PWMA 3NO5A 4PCFA 5KITA 2OEJA 3GB6A 2Q8ZA 3PULA 2VELA 2XOKG 5A8GA 1K9DA 1OSEA 1SW7A 4S1FA 1JQVA 5A95A 3CQHA 1WXJA 1X38A 1JZ5A 1OYAA 3RFAA 5AHMA 4S3JA 4GUJA 5JUVA 1KC7A 4UBPC 3VIMA 1SO6A 1F73A 1OC7A 5U4NA 1I2PA 3NQGA 1TPEA 4C1NB 1C93A 5AB3A 3LQGA 4UOJA 3LBCA 4JFUA 2OEKA 3CHVA 3QMRA 4MUPA 1VLIA 4EAMA 5JXQA 1A5BA 4QHRA 4ZO6A 4CUCA 4O0QA 2NQZA 3LX9A 4DZ5A 2NVAA 3UW6A 2LLEA 1PX4A 1XDJA 3W88A 3ITYA 1EUAA 2ZUVA 4AEFA 3WLRA 4NXKA 2Z24A 3EMCA 3C0LA 1ZAHA 3BG9A 4OIFA 3VA8A 4F9DA 1EJXC 1TPUA 3NA8A 1L9WA 1A5NC 1OD0A 5ABEA 3MDWA 2YYTA 3DG7A 3BLKA 1VB9A 4TX9A 3OHMB 1O5XA 1Q8JA 3B06A 1AL7A 3W53A 5GNYA 2GQAA 5FEPA 4JOMA 3MB9A 3FFSA 4I3GA 1ZUAX 2FYMA 4FLQA 4MFEA 3RNDA 1CXEA 1EXBA 3UY7A 4GQBA 4J3SA 4LY4A 5CLWA 4GK8A 1EGZA 1M3UA 1XYFA 1VEOA 4WLCA 1V7YA 2XH2A 3QGAC 2IKIA 4HHLA 3BURA 4M29A 4GCAA 4DN1A 4Y9NA 5CJ5A 4QE1A 2IMRA 4F8XA 2QAPA 2PTZA 1K6WA 5BW6A 1CBGA 3GU9A 4UZUA 3UG3A 5KZDA 1CGTA 1GW9A 1IF2A 5JBEA 3NXFA 3TN6A 3BTNA 4L1XA 2WSQA 1HKWA 4PBEA 3CASA 1XGEA 1SMDA 5C71A 3G8EA 4XO6A 4IUOA 1PDZA 2YSWA 1CX9A 3V18A 3CUGA 1DIEA 4KMQA 4QDWA 3L4YA 4UFHA 4LAUA 3N2XA 4NZ5A 4AD5A 4B5VA 1J8VA 1H51A 3MU7A 3NZPA 4J40A 2V63A 5LHEA 2JJ1G 4WDTA 1OIFA 3O15A 3B8TA 2OZ3A 1OWQA 1LF1A 1K70A 5GNXA 1LLWA 4AEOA 1HL8A 3W1UA 3T2QA 2INFA 4L9ZA 3KTXA 3ZLGA 1H7NA 2B7PA 4JX4A 3KOXA 2OX4A 4DZIA 1BXBA 3SRHA 5JH1A 7PTDA 3N4FA 3B8IA 5IBXA 1F7BA 3AJ7A 4ERAA 3GR8A 2WNNA 3KBWA 3WH9A 1CGUA 3SY8A 1JGMA 3SGGA 2V38A 3B04A 3TA6A 9XIAA 3AYRA 4FX8A 1V6TA 2NVDA 3TOYA 2DV0A 3GM8A 2Q3RA 4N2YA 2OCZA 2CLEA 1KFKA 3CPRA 2V82A 3NEHA 1GZ1A 3GIPA 2ZA3A 3UYCA 3QBUA 4R33A 3DFHA 2BBFA 2R9RA 3TFCA 2PZNA 4AZGA 3C86A 2ONEA 2PWDA 3AXKA 2ZZ5A 4YTSA 5BU6A 4WUIA 3RU6A 3RR1A 2XVNA 3WZ0E 4OBRA 3M0XA 1EPVA 3W1PA 3OU8A 1K4HA 2FFCA 4JY9A 3H7RA 3HG3A 3D3FA 3MP3A 1BHGA 1ICSA 3VDAA 1VFTA 4O16A 1GK8A 3ZZ1A 1HJXA 3N11A 4M0XA 2QULA 1V6YA 3TQKA 4IP7A 3M5ZA 2DZWA 1ME8A 4MPQA 3S2NA 3HV9A 4W9TA 2ZX9A 4UTMA 3RX4A 1GG1A 5LA1A 4AZ5A 4XKMA 5JVLA 2QIWA 2WZEA 1X6UA 2CWXA 4XIAA 2A5HA 2A7PA 3GTXA 5HQLA 3ITLA 3DXIA 3WBYA 3GU1A 4MNKA 4MF4A 4US5D 3NL6A 3WENA 1F6KA 4K1GA 3PJXA 1V79A 3TQVA 4E2DA 3WLIA 4Z2IA 1IT8A 3LHYA 3QY6A 3I10A 3OBEA 1KQZA 3I4EA 4B3LA 2ZQ0A 4JTIA 5I79A 3VKCA 3N1AA 3NQBA 4JL1A 4QG9A 4NILA 4CD8A 1FWAC 3R2GA 5KZ6A 2ZRXA 4S2BA 1SVDA 3LD5A 4DBWA 1TQJA 1YTDA 4JNYA 1SFLA 4MY1A 3DC8A 1J0IA 5FJJA 2QUMA 5I24A 3PJWA 4XZNX 3GHRA 5L9FA 4PEEA 4C91A 3A9BA 1R9YA 1DXIA 1V3KA 3MCNA 3W02A 4MPKA 1R3RA 3GUWA 2PS2A 1XRFA 2OO6A 4KGLA 3T40A 3VIKA 2VGGA 3GWQA 4FPSA 4PODA 1F05A 5FJRA 2QUTA 1XBYA 3GU2A 4OBTA 5MHBA 3E38A 2GLKA 1W37A 4HN4A 3GDLA 3P74A 3PAJA 4HCHA 1VJZA 4KETA 2W91A 3W2LA 1YDNA 3BG3A 1FWHC 4PRRA 1S2AA 1OABA 4M1BA 3VIJA 5BOOA 4YHEA 4MOZA 1KLYA 2Z7KA 2RDXA 3MC5A 2HE5A 3IVUA 3VM7A 3TMLA 4BA0A 3L0NA 1ZU8A 2WPGA 4JIEA 5E9XA 3BVJA 1SMAA 4RPPA 4FR1A 2V68A 3TW7A 4LEQA 4O1EA 3HA1A 4GJIA 3URBA 2NLYA 2ZC8A 3CZLA 3VKAA 2WO5A 3A47A 2J8GA 3NQ2A 1V6XA 1MEHA 3K8LA 1W5OA 3M46A 3PZIA 3ANYA 1GPWA 2RH9A 4GQQA 4NX5A 1XD0A 2BHYA 3KRBA 3B8SA 4TV6A 4GIYA 3VNDA 1S2CA 1A5SA 4HNOA 2J77A 3RO8A 3XISA 1SGJA 3VIOA 5C2GA 2WWCA 4PTXA 1EQCA 2YBVA 4HGXA 3AIVA 3E5PA 4P2VA 3VAVA 1J5SA 2VC6A 5FACA 3OG3A 4IZGA 4LGXA 4TVCA 4DYEA 3THCA 2G3NA 3TLLA 3SCWA 2J6VA 3NQDA 7ODCA 3K4DA 1ZCCA 5CQ1A 2YCLB 4XVDA 1EL3A 2VZOA 4JTDA 1EDGA 2G97A 2ISSA 3BAIA 3NNTA 3MZ2A 1IEVA 2DIJA 2FZMA 1MQRA 2D0FA 4D6HA 3Q65A 4CN4A 3RG6A 4EXAA 3I6EA 1E6RA 3P93A 1CIUA 1Q45A 3KOFA 2Y7EA 3B0XA 2J7DA 4FSAA 1KGWA 4GVHA 1TJ2A 3TTEA 3K8KA 3HGOA 4E8DA 4WJ8A 3MUZ1 3UT0A 5D32A 5IFTA 2BGSA 4LUSB 1H41A 4RV8A 4XZ9A 1XYBA 2D24A 1KR0A 1GPFA 3WQFA 3ZO9A 1CPUA 1OX6A 4ORIA 1PTAA 3AJXA 1P0KA 1M65A 3CEPA 1THFD 3P5YA 3QY7A 4O11A 3SQMA 1TV5A 3QQ0A 2YCJA 1YHTA 4EXQA 4J3WA 3F2CA 1ZSXA 2UY3A 3S47A 4JIRA 1PYFA 2OQHA 3PSVA 5RUBA 1R3SA 2WMJA 3OZYA 1WUEA 2G41A 5LKYA 2J8FA 3R1ZA 1XW8A 3SI9A 3L9CA 3D46A 3TWAA 4W8LA 1KFJA 3OHIA 3AI0A 3C8FA 1FWDC 3E0WA 1LCOA 3PUDA 2DZBA 1S2WA 3QHOA 1DXEA 1WZLA 1GOKA 3HPSA 5E93A 3GVRA 2C79A 3BW3A 4ZVJA 1ZBVA 3A4XA 3KDOA 2Z1WA 2RDWA 3P82A 1W9PA 3B4UA 3PBWA 2V3DA 1UWUA 1DWJM 3VI2A 2YZ5A 2XJ7A 3W7EA 4J35A 1LYXA 1XLKA 3WQPA 2WSPA 2PLKA 3I68A 4XAGA 1UG6A 1UWRA 2NQLA 3C52A 1J0JA 1Z44A 4ZR8A 4GFSA 2X0SA 3FA3A 1XXXA 2Q3OA 1WA3A 4KEVA 4QAIA 3ABRA 1D8CA 4MNJA 2OMAA 1OX5A 2PWFA 3SCOA 3WH5A 2WSRA 2PP0A 4X61A 3WLTA 3K5XA 3BCFA 1LRNA 1UB3A 4LT9A 4BHYA 1E1FA 4PMOA 4MWAA 3KP1A 4EVZA 3VE9A 1TIWA 2ALDA 5HATA 3I7SA 4P61A 4UTFA 4HTYA 5I03A 4N7QA 2WKJA 4JIQA 4F0SA 1FDZA 3ITXA 3RF9A 1TPH1 2V5KA 3QW4B 3BGGA 3DI0A 3TYUA 4KF1A 3GHSA 1A5CA 4FR6A 3D6NA 5C8BB 3IACA 2JEPA 1CYGA 3W28A 5C7HA 3WMCA 5A5WA 4LB3A 2GK1A 1M9HA 4KFPA 3ZJKA 1T0OA 2OOGA 3W7IA 3MCOA 1AL8A 3SUSA 1MXDA 2EG7A 2JGYA 4FF7A 3GE7A 2V2CA 4RR4A 2ZXBA 1C7TA 3PB0A 2PLJA 5HQEA 3STCA 1T6MA 3EXRA 3UZWA 4LQ1A 4IQEA 2A85A 2X1TA 4CD4A 4MWAE 4O8AA 1NFGA 2HNEA 1KCKA 3KZPA 3DG6A 3L5MA 1TUXA 3N2CA 2V5CA 2XIIA 1UD6A 5BU9A 2BS9A 2VX7A 5REQB 4N4QA 4I90A 1PB0A 2OKTA 5CZJA 3V7PA 1GZGA 1R3QA 1ZL1A 3TONA 5EU9A 2PWEA 3L21A 2ZCGA 4LVFA 3D3AA 3MSYA 5D04C 5G4WA 3S9ZA 1EYEA 3S83A 5C0QA 4V27A 3EA2A 3ITVA 5D38A 1L0PA 2CLKA 4KERA 1U30A 2D3LA 2PUZA 4KFOA 5BCAA 3HZ3A 3R89A 2YR1A 4OVXA 4DZAA 1A5UA 2D69A 1NQKA 4H6KA 4ZEPA 4QNEA 2C7FA 4G1KA 3TNBA 3TTQA 1SW3A 5I3FA 3CUJA 1B5TA 3IGHX 4NF7A 4CKQA 1JZ4A 1KM4A 3WBXA 3LXBA 4L64A 1UPPA 3E0IA 4IOTA 4I5XA 4KBXA 2ZRVA 3RCMA 1OVDA 5DN1A 4IGMA 4MMWA 2QYGA 3T05A 3MI6A 5BXTA 4GO8A 1OB0A 4BI6A 4W89A 3N6QA 1J0YA 3PWAA 1B3ZA 4LVGA 1PZ3A 1QAPA 4Z42C 4LUTA 3VABA 4UQEA 5HQMA 2B7NA 3L66A 5EMYA 3UCCA 1UKQA 1X39A 3GQYA 4PMRA 3Q67A 4NRRA 2Q8LA 1XLFA 2VGBA 5CPLA 3CYJA 3OIHA 1W0JG 1CDGA 1W1B1 4JTAA 4PUEA 3TAOA 4A35A 4GACA 1B0IA 3MUCA 4IT1A 3W1LA 1VBHA 1YNQA 3F1QA 1EP3A 2OYKA 1OFOA 3TP4A 3SCQA 3INPA 4HZ6A 4HYVA 4RZ4A 5BOEA 6TIMA 1Q13A 1G4TA 1OX4A 4F0KA 2INEA 1U1JA 2EPMX 2BG5A 2WQDA 4U2YA 1W9BM 2QMKA 2E0PA 3T42A 3GXDA 1YDOA 4QG8A 3R8GA 1I2RA 3LSBA 4K1WA 3PWGA 3LV6A 1UBSA 2I1OA 4AD0A 3TYEA 3BOFA 2A0NA 2PDXA 1BF2A 1GVSA 4Q8WA 3NR0A 1HP5A 2RDUA 2VEGA 4WRHA 3DX5A 3OE7G 3MHUA 1B2YA 4I9JA 1RPXA 4BWLC 3DI1A 4WDWA 3W7KA 2I5QA 3K13A 1U2YA 5CPNA 3BW4A 3VZXA 2VTFA 1SFTA 3GNRA 3MSDA 4HMCA 4B91A 3GTFA 1W8GA 2G0WA 3ABQA 1F61A 1QO2A 3GZAA 2J9ZA 3NQ8A 4QISA 1KFEA 1GT8A 1UP2A 1SSDA 3SSZA 1SQ7A 1VR6A 1HKMA 2FB3A 4R9OA 4XIMA 3ARPA 1NARA 3DENA 3WNKA 4FALA 4MZ8A 4FO4A 4ZZ9A 1MNSA 1V8EA 3LPOA 3N2MA 4BS0A 1X1ZA 4ML9A 3WDHA 7A3HA 4DNHA 6XIAA 2B7QA 3C6CA 3LI1A 3M5VA 1WP6A 2BX7A 4GOAA 4Q7NA 5C2XA 4DBUA 4MLJA 2DW7A 3GXTA 1TVLA 4JTSA 1JAEA 2R1MA 2WCAA 4CNPA 2WKGA 5JIWA 2EAWA 4IP5A 4KH2A 1OFBA 3AMGA 2VJXA 3UFYA 2ZDSA 3LXCA 1OYCA 4C6LA 1AW1A 4UTWC 2YDAA 1EBHA 1VIWA 1K9EA 1ZP3A 1HIZA 2H8XA 3CHDA 4ADTA 1EJRC 1I2QA 5FESA 1B30A 4C6PA 4DO6A 3WLOA 3OTRA 1V0MA 4O0KA 1A80A 1E43A 2X1RA 3QGVA 2YCLA 4UOZA 4UFJA 3M0ZA 3VD4A 5CSUA 3OA5A 4DUXA 1PX8A 4POCA 1OFEA 3NQFA 4JTRA 2WNZA 3UP8A 4UFLA 5A6MA 1V02E 5CBIA 3FGCB 4Z2LA 3IIOA 2HISA 2J7BA 3OOQA 1EA9C 1W1PA 4CQDA 1EP2A 4WHBA 4NKCA 2PDWA 4LEFA 2GOUA 2WB5A 1HGYA 3EXSA 5FKYA 1FVPA 3B4YA 2DORA 2YX0A 2J7FA 3DHPA 3GUGA 4NG3A 1EZ2A 1S2UA 3E2VA 4HK5A 3OP2A 4PFHA 2XDFA 1JDFA 3LPFA 3PN8A 1TIMA 3CIXA 3UR7A 4S38A 1AH4A 4DLFA 2QV5A 3PZUA 1HQTA 1EFZA 2FZDA 1GOXA 2QNEA 3HF3A 3N9KA 3QMSA 1FDJA 4BWLA 2PDMA 4AUBA 2ZZ6A 4MTVA 3GNXA 3LPGA 2QT3A 3OLDA 2BVDA 2YDSA 3SM0A 2WV8A 4KT2A 4YVPA 2XN1A 3FEMA 3LBOA 2WXDM 3PPFA 3MSGA 4MB4A 1TWIA 2CWNA 4CD6A 1B3XA 4E6MA 1T41A 1FOBA 4UQ9A 1DWIM 1OQFA 1KR1A 4WX2A 1GYMA 1NOWA 1BXNA 1H7RA 1OCBA 1MQPA 4ATLA 3AOFA 3M0LA 2QUVA 2DW6A 3VCRA 2CHOA 1JCTA 1G7VA 1SSGA 1B4KA 2E67A 2XWDA 1W9DM 4AHOA 1HNYA 1K3UA 5LIUX 3C2OA 3IUIA 3P7YA 4A05A 2XFFA 4JTTA 3THDA 3FGCA 2I9EA 2J8TA 1OBAA 5AZ1A 1XDMA 6TAAA 1ONWA 1WZAA 3LB0A 4H9TA 4UZSA 4ENLA 3NQ7A 3SIMA 1ZY9A 3W1NA 5HNUA 3TIMA 2YKKA 3RMEA 3ITTA 1RR2A 3O6YX 2ZUWA 1P1XA 4IQJA 2ZZ3A 1LUCB 4GNVA 4NNBA 3DIPA 4Y6GA 4AG0A 3NAVA 1UD5A 3LCLA 4NJGA 2VDIA 3IRSA 4QCEA 4S3AA 2GSEA 3RJXA 3APTA 4OWGA 3UXKA 1VYRA 4V15A 3B03A 4FF5A 3RLGA 4IMEA 4O13A 1E6XM 2ZZ4A 4HU4A 2Y8UA 4JY8A 5JIPA 1H2JA 3AISA 2P3EA 1EC7A 1FA2A 1KXQA 4W5UA 2Y4SA 2GWGA 2PTXA 5HJXA 5ABHA 3M0IA 3GDBA 4LB4A 1DJZA 3CMFA 4IMGA 4Z17A 3G1XA 4PSPA 5DCDA 2VGIA 3ARSA 3M0HA 3M41A 3MMDA 1Z6KA 2GZXA 5C5YA 1S2TA 3W70A 2PB1A 4Q7IA 2WANA 1XIIA 1FCUA 3GAYA 1FWWA 2PGRA 3OFNG 4JIIX 1XWYA 2YA1A 2A21A 1H62A 4B5TA 4Q22A 4AC1X 1U5VA 1OT2A 3B8WA 4HPGA 1GW1A 4PL2A 5CJMA 2TPSA 2C0HA 1UR9A 3CLWA 4JTJA 5A69A 5F2IA 2GGIA 1PZ0A 4OU1A 4M6PA 3T55A 2BSLA 3RCNA 4JTQA 1UIOA 1H1NA 3M16A 4LAZA 4PBFA 3PZOA 1BYBA 1FS0G 4UB9A 2YLLA 4B4FA 2AMGA 4UTWA 3M5YA 1EF2A 2A3LA 2WJFA 1HKIA 5LIYX 5IM51 2D2GA 2WHLA 3VOIA 4BKNA 1LLZA 3TXZA 4J3TA 1EDTA 3QMTA 2QZRA 1UC4A 5CXPA 1IEWA 1LL6A 3KRUA 5M1TA 3PZNA 2I5GA 3PC0A 3W82A 5HUOA 1M04A 2KAUC 3PANA 3CV7A 1KGUA 1E79G 5LNRA 4NYYA 3VU2A 1Q63A 1BRLB 4PCTA 2CXEA 4WJXA 3S1WA 2X1SA 3H4WA 4ZA0A 5LIKX 2QPSA 1JRBA 1TZZA 2PP1A 3G1VA 1TA3B 3O05A 1JDCA 3V75A 5A2BA 5ABTA 2G95A 1JNEA 5AYYA 4M7SA 4YVXA 2R6OA 1KRBC 2DVUA 4AYGA 3IVSA 4MJ2A 3MI3A 2FH8A 2Z6JA 2CBVA 3F03K 3OW1A 5AN7A 1QHZA 5LGZA 5EYWA 1O5RA 4RDYA 2P8BA 1Q6LA 3FVMA 4AMAA 5FEXA 1V3MA 2ZUNA 4DIAA 2E25A 4XISA 1IEQA 4P8UA 1J6OA 8XIMA 4ZSTA 4YPJA 2ZBTA 1BKSA 4Q8TA 1VRXA 3L2MA 4IL0A 4HZ8A 1VFMA 2NVCA 4GIAA 2VZTA 2PGEA 3EMQA 4GA8A 5F4WA 2ZFAA 2O56A 3ZM8A 1RP8A 2VR4A 3M43A 4AAJA 1WDRA 4HOXA 4MLRA 4X22A 1N8WA 3RM8A 1QDSA 4V1YA 3PSWA 1US3A 2VUYA 3IIVA 1AUSL 5I3JA 3S4TA 2R1LA 2VUNA 5FD0A 5XINA 3VM5A 1C9WA 2NQHA 4AIUA 1C91A 4JGDA 2PDHA 2Q71A 1ZS2A 2G3JA 4HN8A 1YPXA 2Z4GA 4NZCA 2E5CA 4RZ5A 4BI5A 1GJWA 3RR4A 4D2JA 3GXIA 2FDMA 3MVTA 3W1XA 3U6WA 4KWOA 4S39A 4PUMA 1W2VA 3LLDA 4XK2A 1P48A 1HJWA 4E4UA 1QHPA 1UR3M 3QR0A 3IGXA 3F4CA 2PD5A 4K7VA 5H6HA 1QPOA 3DFTA 1A3HA 1PCWA 5I5RA 2X7VA 3RPMA 3B8UA 5LNWA 5AC8A 2HDJA 1YTEA 1YDVA 2PDQA 2ZADA 4XD3A 1YYAA 2VWSA 4FA3A 3UG4A 2O0TA 1K8ZA 4ZQOA 4QLKA 3WUEA 3UJSA 3MUXA 2W5FA 4XAYA 3M64A 3UGRA 3BOXA 3W2MA 5DRCA 3N4EA 4MY9A 1EKOA 3W7OA 4BZYA 3DDMA 2QR6A 3N17A 2VO5A 5DEZA 3G2GA 3GO2A 1GNXA 4GQ0A 3AIEA 4QE5A 2ZRYA 5CPQA 4L1WA 2OGYA 4G6CA 1FCQA 2D3NA 2W4XA 3PZQA 1JI2A 1PXGA 3E12A 1KO0A 2OB3A 4N02A 5HMEA 1FWRA 1P6CA 4H19A 5J8LA 2NV1A 1GJUA 3U4AA 1AH3A 1WNOA 4R85A 4ADSA 4HD5A 4FLOA 3H2AA 3R25A 1UP0A 2WCGA 1FY6A 2IQDA 1JF6A 3DYPA 3POCA 4E3TA 4TTUA 2OWXA 3IJ9A 4DVOA 4NVTA 1NWSA 4A3RA 4MKNA 4WSKA 4QXIA 4GXWA 4LANA 4UTUA 4GQRA 4UQBA 3PB2A 4CU7A 4PSRA 1M53A 4TIMA 5HDRA 3ITCA 3ID7A 2A3BA 3TR2A 4Q8OA 2J7CA 5IFPA 2PC8A 1JGIA 3TW6A 4NIRA 3KOYA 3GZ3A 2EPHA 2WM0A 3W26A 3AUOA 1WX0A 1P0BA 3DOPA 2QCNA 3KW3A 2Z00A 3P60A 4FS9A 1T57A 1WDSA 2V67A 1RJQA 1KM5A 5LA0A 1VPYA 3SIZA 1KCLA 3LHWA 1VFSA 5FIPA 3QFEA 1BGAA 5D02A 3HJZA 3WBEA 4XD5A 5CSRA 2KX9A 4AF0B 1A0EA 1YKWA 1IIHA 2W67A 5DLCA 3WX7A 1JXKA 4S3CA 3H21A 4FAMA 1L6FA 3TN4A 4ACZA 4O12A 2H8ZA 3TC6A 4DEFA 1ZTVA 3CYVA 4LALA 2JE8A 5FJPA 5HNRA 5AYZA 4HPHA 2ZX5A 3CMGA 3OIXA 4HPXA 3UG5A 1AMYA 3JR2A 1HF6A 2QJHA 5DN6G 3MKKA 3T08A 1YMYA 2E8YA 1DIDA 3KP0A 3NSXA 3UQNA 4QSFA 1R3YA 2E9MA 4GNKB 4IPJA 2HK0A 2WOQA 4D1IA 2Y24A 2OGJA 2WM1A 5H1WA 3SGZA 1YXDA 4IMAA 2J74A 2OR2A 2C1HA 2AL2A 4ALDA 4YJ5A 2Z27A 3H4XA 5BXPA 1GVYA 2D22A 4R5EA 3EYPA 1EHNA 4PR4A 1DYSA 1G67A 2CZ5A 1OCNA 3LM7A 2BGNE 3THUA 4KWVA 1DXFA 4DXKA 2VC5A 1TRIA 2Y61A 4JD4A 3E2QA 3TC7A 4DUVA 4J28A 2G8ZA 3U4FA 1NTHA 3LERA 3UF9A 1IXOA 1ODZA 2QJMA 1OFAA 1TX0A 4G7FA 5D9MA 2GJPA 2P0OA 4S23A 2YFOA 4XSLA 4WXYA 1QNOA 2V3FA 4ZE4A 3WIJA 2Y88A 3F7JA 1VBRA 4K37A 1XIJA 2XVLA 1JCNA 3M0VA 3B05A 1R7AA 2REQA 2WPBA 2V9DA 1WKDA 5KEZA 4J3XA 3A3HA 2GJLA 4HJWA 4NASA 1DJWA 3SADA 1DWAM 4GKTA 4X0NA 3CU2A 2VDGA 3AIWA 3BAWA 3REQA 3BSGA 3C2VA 3L23A 1TV2A 1F07A 4RDVA 3AXMA 3PTDA 4H8NA 4JXCA 3N4AA 5D03A 3BW2A 2QJNA 3BC9A 1RQBA 1GVEA 5G1MA 3EWCA 1DHPA 4FZIA 3WK3A 4DJFD 4X63A 4WR3A 1QWGA 4D8ZA 3ZQ9A 4H9YA 1RBOB 4RLIA 2CBUA 4PH6A 3O3RA 1BYCA 4LW7A 1IT7A 2DZTA 5E0KA 2AL1A 2H90A 4A21A 4LH8A 1E4NA 4TMCA 1VS1A 3VGFA 1E5JA 3S2MA 2WNQA 4A4AA 2G3MA 1QASA 2QCMA 3VKJA 1BFNA 1EX5A 4NJKA 3GFYA 3GXNA 2I56A 3VTRA 1V3HA 1VH7A 1ECQA 4DM1A 4HA4A 2EF9A 3WDPP 3CT7A 1OFRA 1EOMA 2BXYA 1P4CA 1OF6A 1P0EA 2QUNA 4F79A 3WF0A 3H8AA 3WL1A 3CBWA 2QCDB 5A8QA 3C56A 2J62A 3S5OA 3SRKA 1M03A 4FNPA 3B40A 2PODA 4FEZA 3GVVA 1QUMA 3T81A 4QDMA 5M2FX 3Q2DA 3GC5A 5DBTA 3HO8A 5TF0A 4J3UA 5A94A 1S38A 1X8FA 1GTEA 3G1SA 3IUDA 2OZ0A 5A3HA 1J0ZA 1BVZA 1Z42A 1XYAA 3TU9A 1X6NA 1HJQA 4O1FA 3Q4DA 4TUFA 3V5OA 2MUCA 4W8BA 1VLWA 3IIPA 3JW7A 1VC4A 3KAOA 3T8LA 3FA4A 4PYSA 2ALRA 3GLCA 3H4GA 2DZVA 3G24A 4OBSA 1XR2A 2OSXA 1C90A 3TH6A 2R82A 3BWWA 4WIWA 4JHMA 3WD2A 1CB2A 3ZJ7A 4KCUA 3CTTA 4JEJA 1ZCOA 1XX1A 4LPCA 1HW6A 2CLLA 3VGEA 5I07A 3KOWA 4W4QA 3GH5A 2C0AA 3RLUA 1ME9A 4LF1A 3KWSA 4C6EA 1UA3A 4JFWA 2I7GA 3EXTA 4IMDA 4OUEA 2CETA 3OYZA 4PUNA 4RW3A 2V2HA 1EJWC 1KA9F 1S46A 4CGTA 1RD5A 4BEQA 2BY3A 3PZMA 2PAJA 2F7FA 5K9CA 1TV7A 1GYNA 4C6QA 4ZE5A 3W7PA 1H1YA 3BOLA 3H12A 2OELA 1AODA 5TIMA 2YBUA 3M0MA 1G7UA 3QEZA 4RXGA 1XG4A 4AX7A 3SN1A 4LU0A 2IPWA 2XHYA 4AD2A 1TVPA 5CZ0A 3SCNA 1RJRA 1H60A 2D1ZA 4ASUG 1EQPA 4E8GA 3EPMA 1BSLA 4UXDA 5A6SA 3AS1A 1Q7ZA 1B3OA 3MTWA 3VOHA 5HXMA 1F9CA 2E6YA 5C9ZA 1JDEA 4IXHA 4E4PA 3P81A 2EBNA 3AFBA 1UZHA 1CLXA 4CEUC 1YE6A 3BLIA 3UCQA 4IH3A 3UPWA 4C6IA 4IQDA 3RMJA 5A6LA 4PMNA 3M7WA 3ECQA 1V6UA 3IJIA 1KKRA 4J9JA