4HYVA

Pyruvate kinase (pyk) from trypanosoma brucei in the presence of magnesium, pep and f26bp
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
498
structure length
498
Chain Sequence
SQLEHNIGLSIFEPVAKHRANRIVCTIGPSTQSVEALKNLMKSGMSVARMNFSHGSHEYHQTTINNVRAAAAELGLHIGIALDTKGPEIRTGLFKDGEVSFAPGDIVCVTTDPAYEKVGTKEKFYIDYPQLTNAVRPGGSIYVDDGVMTLRVVSKEDDRTLKCHVNNHHRLTDRRGINLPGCEVDLPAVSEKDRKDLEFGVAQGVDMIFASFIRTAEQVREVRAALGEKGKDILIISKIENHQGVQNIDSIIEASNGIMVARGDLGVEIPAEKVCVAQMCIISKCNVVGKPVICATQMLESMTSNPRPTRAEVSDVANAVLNGADCVMLSGETAKGKYPNEVVQYMARICVEAQSATHDTVMFNSIKNLQKIPMCPEEAVCSSAVASAFEVQAKAMLVLSNTGRSARLISKYRPNCPIICVTTRLQTCRQLNVTRSVVSVFYDAAKSGEDKDKEKRVKLGLDFAKKEKYASTGDVVVVVHADHSVKGYPNQTRLIYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Pyruvate kinase 1
publication title `In crystallo' substrate binding triggers major domain movements and reveals magnesium as a co-activator of Trypanosoma brucei pyruvate kinase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 186
structure length 498
sequence length 498
chains with identical sequence B
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4hyvA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 4hyvA01
2V5KA 4WJ8A 3OQ8A 2VGGA 2R82A 2XDFA 4L9ZA 1S2WA 2V5JA 4KCWA 3T0TA 1OQFA 1JDEA 3LG3A 1KBLA 1U5HA 1A3XA 2XZ7A 3B8IA 1F8IA 3E5BA 3N25A 3PP7A 3T05A 1PKNA 2VWTA 4B2DD 4JPGA 3BJFA 3GQYA 3EOEA 3FA3A 4DRSA 1O5QA 1DIKA 4TV6A 3QV7A 1VBHA 2VWSA 3T07A 3QV9A 4ROQA 1DXFA 1VP8A 5TAOA 1M3UA 3LYEA 3VAVA 1KC7A 4QG8A 1XG3A 3I4EA 4QG6A 4IMAA 4MF4A 2KX9A 4RPPA 3SRKA 1AQFA 3QZ6A 4B5VA 2OLSA 4YJ5A 1SGJA 2ZE3A 1MUMA 2XZ9A 2DUAA 1S2VA 4FXFA 2HJPA 2QIWA 1A3WA 3EOOA 1UJQA 5JVLA 3E0VA 3KTXA 2VGFA 1PKMA 3H6OA 4L9YA 3MA8A 3QTGA 1F3WA 3PUGA 1PKLA 2E28A 1OY0A 2G50A 2X0SA 3KHDA 1M1BA 3GG8A 1ZJHA 4IQEA 3P0XA 4QG9A 3SRHA 2L5HA 1T5AA 3BJTA 3M0JA 4LSBA 1PKYA 3U2ZA 1PYMA 2HROA 3QV8A 3R4IA 1ZLPA 4KCTA 4B5TA 1DXEA 4L7ZA 3ME3A 3OYXA 1IGWA 2VGBA 4B5SA 3HQNA 1Z6KA 1XG4A 2VGIA 3E0WA 4KRZA 4TV5A 3EOLA 2HWGA 3FA4A 3HQOA 4B5WA 1DQUA 4QGCA 4HYVA 4MG4A 3SRFA 3QLLA 3QQWA 3QV6A 4HYWA 2WQDA 3SRDA 1IZCA 1E0UA 3G2GA 4B5XA 4IP7A 3EZ4A 1F8MA 4IQDA 1T57A 3IS4A 4FXJA 1A49A 4B2DA 1U5VA 1O66A 1E0TA 4KS0A 4G1NA 4KCVA 4YNGA 3M0KA 2DIKA 1S2TA 4B5UA 1F61A 1GGOA 2HRWA 1S2UA 3OYZA 1F3XA 3HQPA 1VBGA 4L80A 3GR4A 4KCUA 2BG5A 1A5UA 1O68A
chains in the Genus database with same CATH superfamily
1MNSA 1ISXA 1V8EA 3EPOA 3PJWA 5AC7A 2E5DA 4WZHA 3GR8A 4V2XA 2WNWA 3WDIA 4GACA 3LYEA 2FIQA 1U5JA 4YTTA 1OGBA 3XISA 2FLIA 1VD6A 1VEPA 1JUBA 4JIIX 4XZNX 2NUWA 1A3WA 4LX4A 3NAVA 3P67A 5CGMA 3SSJA 5CEWA 3WJYA 2QIIA 1JFXA 1Q8JA 3WIJA 3ZIAG 1XLMA 1ZJBA 1E6SM 1W8GA 1XW8A 4PUKA 2FZDA 2I14A 4UTHA 1PDYA 3P61A 3W1NA 4TO8A 1SFLA 1DIEA 1UKQA 4Q8NA 2A7RA 3QGKC 4RW5A 3N73A 1E4IA 3B0VC 1MZHA 1KFBA 3V0SA 4QEHA 4UZSA 1AA1B 3AC0A 2ISFA 4K1GA 4XG1A 4B5XA 2OGYA 3IJ7A 4DO4A 1NWRA 3M0KA 1GVFA 1C9WA 5FIPA 1PX8A 1PE1A 4DM2A 1OC7A 1JJKA 2Z1VA 5K9XA 1THFD 1PV8A 1OFEA 2CEQA 1U5HA 1EF3A 2CBVA 4GA8A 4P8UA 4C1NA 2BGSA 3LCGA 1J5TA 3WNLA 2VNCA 2GJLA 4FIRA 4M3PA 2Q71A 3THDA 4MHBA 3PNZA 3IJ6A 3PZVA 3SUVA 2ZCGA 4MDPA 4CD6A 5CSRA 1FA2A 3ZOAA 5AHIA 1CDGA 4FXFA 1O6IA 2TSYA 3NNTA 2VCAA 1EJTC 1DVJA 1X38A 4NZFA 1JVNA 1UBSA 2C0AA 3IARA 1FWAC 4L56A 2OXNA 1UROA 5LIKX 4O14A 5C54A 2TRSA 4ZB0A 1GK8A 4EXBA 4GQBA 1YDYA 1KRBC 4DF2A 3H2FA 3BAXA 5HR7A 4P8VA 4CN6A 4B91A 4DO5A 2YL6A 3VUSA 4HU4A 3CPUA 4ACZA 5DMLA 2QNEA 3MHGA 2GVYA 3RM8A 4GVFA 1XUUA 4DYEA 3OIHA 3CUGA 4M24A 1OK4A 2VT0A 3WUBA 1IZJA 2O4MA 4GO8A 1IIGA 4J3ZA 4P8WA 1TKKA 4XQ6A 3WSUA 5HMFA 2R1KA 3EWBX 4HNCA 2WSQA 1QTWA 1BF2A 3AHYA 3GVRA 1FHLA 4AWTA 1SSGA 2ZA2A 4R34A 3KBNA 1ZU8A 3QPEA 4GY0A 3IGSA 3VPLA 1O7AA 5CCZA 2P10A 2VTFA 1UA3A 1RVKA 3AS0A 4MUPA 4DQWA 3QEZA 2W6RA 4PMJA 4O57A 1ZP4A 1KRCC 4Y7EA 4LC6A 3MI6A 5AC6A 3KCOA 4Z2KA 1KBJA 1R3SA 4GFSA 1PX3A 5CC5A 3CB3A 2PDCA 4J3TA 2BP1A 1LROA 1QHPA 2W5FA 2YYTA 3PPCA 5D32A 3OQEA 2EKGA 6TAAA 1I0BA 1V93A 5DXYA 2QCLA 4JYFA 3C2YA 3CAVA 4H6QA 4KT2A 3EDKA 2UY5A 1WE5A 4K2SA 4XK2A 1RY8A 3LQGA 4S3KA 1LORA 1X97A 4D8AA 1XSIA 2XHYA 7PTDA 1PKYA 4IIGA 1A0CA 4F40A 1VJIA 5D4YA 4ZB5A 1HN1A 2FZ9A 2PLKA 5CG7A 4QNWA 2J8GA 1XG4A 3EKGA 4GC3A 4YPJA 3HQOA 3RCMA 3P80A 4O52A 1TWDA 3KRZA 1UUOA 2VX6A 4C6IA 4J3UA 3WBXA 1MFVA 1U5VA 3NQCA 2XN1A 1H1ZA 2ZRUA 3CWNA 3E0LA 5A8PA 3C56A 1TFVA 3MMWA 2INZA 3WNPA 4PMUA 3MI3A 1RQEA 4UTJA 1GTEA 4WKAA 2X0YA 1MQPA 5HJXA 1UOZA 4U33A 1REQA 2TODA 3PB2A 3N2TA 3B03A 2IPJA 3VKJA 4JNYA 4OIFA 1DXFA 4YCOA 2HPIA 5DCBA 3EOUA 1M04A 2V6AA 2GSJA 5FSDC 4LBUA 1UB3A 1IXOA 2EF9A 2NXIA 2X1IA 1ZBKA 4NZCA 1IT0A 3HF3A 4JICA 4C1LA 4EF9A 2BODX 2PODA 2OX1A 2QPXA 4MFDA 3AIEA 1FBAA 4GBUA 3HM7A 3LBCA 3ABZA 4GH3A 4TR9A 1JF5A 1TJ2A 3GTXA 4XO7A 5D09A 4DJFA 5C2GA 3TYEA 3MS8A 1XRVA 1ZUAX 3U2OA 3II1A 5EFDA 3HJZA 5BRBA 3IGXA 3GXIA 1V6TA 1F5ZA 3SQMA 3S8HA 4H00A 1QASA 1P1MA 4V1XA 4DWSB 3IS4A 3GXMA 1JNEA 1HL9A 2QS8A 4MMWA 1TTPA 2YCJA 4HK6A 4UFMA 2G4JA 1XWYA 4Z2JA 1CGVA 3R0KA 1TRDA 2GJXA 1N2VA 1UR4A 1F9CA 3IJIA 3IGHX 2Q09A 1TV4A 3T44A 1RPXA 3WF0A 4MJ2A 2DZVA 3UXKA 1XKJA 4HPXA 4UIOA 5EB8A 2PF0A 1VLIA 4CQBA 3A9IA 3B8VA 3NWRA 4BFAA 1EJXC 3AS3A 3P3BA 3MTWA 2NUYA 3RU6A 2CLHA 4W8LA 2W4XA 3PUOA 4DBWA 1M6JA 1X7IA 4UFIA 2YLLA 5CLWA 1H5YA 2GVEA 3WMBA 1HKWA 1LLZA 4XO6A 2HV5A 3B0YA 1XLEA 4Q8UA 1ONWA 4J27A 2X40A 2VC7A 3TOPA 3BICA 2HISA 3M0HA 2ZXDA 3L65A 1E40A 2CZEA 3SO7A 3OBAA 1FY6A 3QYSA 3UZZA 5LNWA 2YL9A 4I6KA 1IEWA 1UCWA 4ADSA 2WCAA 1EJWC 1IGSA 1QPKA 2DORA 5ENLA 2GQAA 3AICA 4DJEA 3ZJKA 1AG1O 3F4NA 1LZOA 4FR1A 1MI3A 3V36A 2QW5A 4NJHA 1S3TC 2JF6A 4HVXA 1S5MA 4JGDA 4AHQA 4KEZA 3SAZA 1XM3A 3G24A 1SJAA 1EH9A 3ZVHB 1GGOA 1YE6A 4IQLA 3TZFA 1CZ1A 3OU8A 4W7WA 2QV4A 4PCFA 4BWLA 4JTLA 1SW0A 2GGJA 3UWWA 1AJZA 2J7BA 4WSJA 4Y9MA 2FB3A 1GQIA 4B4FA 5E6ZA 1AQ0A 5M5DA 1T6MA 1XIHA 4W89A 4Q4KA 4W9TA 1UG6A 1DPMA 1E9IA 2GJNA 3APTA 3T2PA 5AKQA 1U33A 3CJPA 3ALFA 2J6XA 4JTCA 4F0RA 2G97A 4O54A 1NP2A 3R10A 4QG6A 4BEQA 3MBDA 3QZ6A 1EWDA 2R94A 3C3NA 3RLGA 3BL3A 4GLEA 5GPRA 1ZHAA 4XD3A 1HVQA 4DBUA 1G67A 1QI5A 3NQ7A 1E71M 1JXJA 3A3WA 3GHRA 3I7QA 3M6DA 4HMCA 1VGAA 1BWLA 1W5NA 1EIXA 3TTQA 4IG2B 1OC5A 1UR2A 1UP3A 2Y7FA 1ZP3A 2I16A 5M03A 2JEPA 2H8ZA 2CXGA 4L6HA 2C18A 3QZEA 4B15A 3TQVA 4CNTA 2R1LA 1D8CA 1IWPA 1L2UA 3ES7A 3U7BA 2G95A 4ZMGA 2X2GA 3EEZA 2NX1A 3K1DA 4I7UA 3LCLA 2QR6A 3ZLGA 3GU9A 1G6CA 4HT3A 4KWUA 4ERAA 3AXMA 3NGFA 4K8HA 2GGEA 4ZQMA 5HWMA 2CLPA 5FOOA 3S46A 4JIQA 5CZKA 1OT1A 1EX1A 4KWOA 2J7DA 2XU2A 1XRTA 2Z4GA 1AVAA 3W4RA 3LDVA 1AODA 3MKKA 2G3JA 5FI8A 3W84A 4X60A 1UD4A 5LIYX 4PBGA 5BYWA 1VCVA 2P50A 2VZOA 4GYJA 1FHVA 2OLSA 2DZWA 2XM2A 1QPQA 2YL8A 5FSEC 4JIPA 1VLWA 4QJ3B 1C93A 3GC2A 1WXZA 3MMDA 1W3JA 4KWVA 1CB2A 4GRSA 4LWWA 5CH9A 4LFYA 4IM4A 4AB4A 3SRHA 3P8IA 3S6TA 2AQWA 1LWHA 1QO2A 5FESA 1UKOA 1EQPA 4DM1A 2W63A 1GPFA 5G4EA 4NXSA 4I90A 3W71A 5J8LA 2DSZA 1G1YA 1FWRA 5ABHA 2UZ9A 3MUY1 1OJXA 3PANA 4PBEA 4YLWA 3EX1A 2XH0A 5E0FA 2DZAA 2R91A 4IQDA 1UD5A 2BWGA 3ARXA 3A21A 4PMZA 4YNGA 1AZ2A 1QPNA 1JD9A 2CLIA 3FYOA 1A5BA 3FEMA 3VIFA 4IUOA 4W7UA 4WJ8A 4DXVA 3W7OA 3T0TA 2XH7A 1TWSA 1R3RA 3GNPA 1ZZMA 1QRQA 3L9CA 3DZ1A 1E1CA 5A6TC 1P6WA 4J2MA 1AW2A 2Y4SA 5A5WA 1KTNA 2HNHA 1MNZA 1OINA 4F0HA 5MHBA 1ODUA 2B7NA 3FK4A 5KZ6A 3IAQA 1DIOA 2OSYA 4WOQA 4FHAA 1MUMA 1TPDA 1DL3A 2PDNA 3HOJA 2Y8KA 1M5WA 2CZ5A 3R12A 2BXZA 2VVSA 3ATYA 1R47A 1O1HA 3NGJA 4XBSA 3WL0A 3VNKA 4NT0A 5D2YA 2GFTA 3AYRA 1EL3A 4C7GA 2W79A 2GLKA 3LCHA 3MSYA 3RG6A 2BV9A 3KLKA 3TC6A 1WDWA 1NDYA 2B0MA 3BXWA 1FWDC 3C2FA 3TLQA 2OT1A 4F2UA 3M44A 2Y61A 2G3NA 1E0UA 3U57A 4KESA 3LGDA 1S39A 2REQB 2CBUA 2E6YA 3G1VA 1DJHA 4WIWA 4MYAA 2EBNA 3TH6A 2LLEA 1S2UA 1J8VA 1OFAA 1U83A 2C71A 3V1HA 3TFCA 2PMQA 3LV6A 1R7AA 3NZQA 3FYPA 1Q4WA 5MKGB 5E0KA 2CWNA 1XIBA 2A3EA 4WQ6A 4EPKA 4A8RA 5HR6A 3PBMA 1QOQA 1Z89A 4MZ8A 3AXIA 1J0KA 3FN9A 2AOSA 3GU1A 5F2LA 2W0UA 4ASTA 3N18A 3D5HA 1AD1A 2QAPA 2D3NA 4IXXA 3G3DA 3WQDA 4A05A 3ORWA 1G4TA 1S2VA 1CGTA 8XIMA 3DUGA 3IJQA 4CQAA 1FCQA 5DELA 2A7NA 1LOLA 2RKXA 3OOQA 3WQ5A 3MMUA 2G37A 3DBPA 1T0OA 5ABFB 2F38A 4NZ4A 1YW1A 3QSTA 5A3HA 2RDTA 1R9ZA 3EWXA 3Q37A 4ZFMA 2PDXA 2ISVA 2B7OA 3VIJA 2HVNA 3QRHA 1G69A 4D72A 1CGWA 3UCCA 1KM2A 3OJGA 2VOTA 5CBJA 4YHGA 3B3DA 3FJ4A 1V77A 3BW4A 1V3LA 4OT7A 1ITQA 5HA7A 2E1DA 4I7VA 4DJFC 4RDZA 3V18A 1XLIA 2WHKA 1AH3A 4YVVA 4JQAA 1F2JA 1PX4A 3AYTA 1TV2A 4HK5A 3MBFA 4JTKA 4ZENA 3LHWA 2Y70A 3MVTA 2CNCA 3VGDA 3HPFA 4KWWA 2ZTKA 1BYAA 1KA9F 4C6OA 3CZ8A 3P74A 1VPXA 3PP7A 2YFOA 3QR3A 5DRIA 3EOEA 5HWNA 3Q58A 1L6FA 4ROPA 4S23A 4LBSA 3FHQA 1B31A 1G01A 1JCYA 3DFOA 1RJPA 1PPIA 1PBGA 4DF1A 3P5ZA 4XKMA 3JVAA 3BCFA 2OEKA 2MANA 5A6SA 1UUQA 2VR5A 3ZR4A 4A3RA 1UJQA 2O7QA 3ITLA 1OABA 4A3HA 1P6BA 1E4LA 3S1VA 2G50A 2E28A 1VJZA 3H2NA 2Q3OA 5C6MA 1E3XA 4GH1A 4NJGA 4LNCA 2L5HA 1W1A1 3SSZA 4D6IA 3M7SA 1GZJA 1V03A 4DXKA 3N1AA 4H9ZA 2OSXA 1Z6KA 3E0WA 3JW7A 4GI6A 2WMFA 2QDGA 4E8CA 5CSSA 1UWSA 4IGHA 3UNTA 2WLYA 4DJEC 2QCFA 3TTOA 2WVUA 7ODCA 5JH2A 5C9RA 2P5NA 3BMXA 1XP3A 2IXUA 4LGXA 1KV8A 2TYSA 5BRQA 2DGAA 1MRQA 2QCCA 1A3XA 3QQ0A 1B2YA 4BWLC 2RDUA 3M0LA 5U7SA 3CYVA 1XISA 4REQB 1E79G 2ZKMX 2QZRA 4ES4A 3N19B 3AXXA 2VRQA 3WLPA 2JJ1G 3OE7G 3G1XA 2R24A 1CPUA 1S2CA 2GGIA 5FD0A 3G1DA 4MNMA 3UU0A 1KGXA 3GH4A 2I5IA 3UJRA 5CPLA 1TWIA 4A29A 1DWIM 3LXAA 3H24A 3QTGA 5GNYA 4QE4A 3AXKA 2VKZG 3S1UA 3W2UA 4IFKB 2O9PA 4CCEA 3NUKA 2NQLA 2IKHA 2HXTA 4A8NA 2ABAA 4RNFA 1E6QM 4D6DA 1W1IE 5JIWA 2CLKA 4LUTB 4JHOA 1JAEA 3WX7A 4XB3A 3TYCA 4AVFA 1D8WA 4MUZA 2ESCA 1EJSC 4WGHA 4MLJA 1EXPA 3WLSA 4HB7A 4H8HA 3B9NA 2PDQA 1S2TA 1K3UA 3FEQA 3FW6A 3MP5A 1LRTA 4POCA 2OTDA 3SB0A 1L8PA 5DLCA 3JU2A 2WSRA 3WBEA 3CL8A 4DLMA 3LUTA 3DGBA 3G1AA 5AOUA 1KBLA 4I6VA 1MXDA 3KVLA 2YW4A 1V0LA 2J78A 2QF8A 3ZMRA 4R7OA 3LBMA 1E15A 3QKZA 4U28A 2YFNA 4CNOA 1E5NA 2ZX7A 4R27A 2J79A 2A1YA 4HZ7A 5REQB 3IUIA 1EIBA 5IOBA 1J11A 4H01A 3POHA 2ZWZA 4TT3G 2XWDA 4S3DA 4E2VA 3UPMA 1SJBA 3U7VA 2D2JA 3D47A 3K4WA 3JS3A 3W7MA 3P14A 4GNJA 2W91A 5D2VA 3ES8A 3LTSA 3HPXA 3NSNA 4IP5A 1R6WA 4KEMA 3RO8A 1TA3B 2A3CA 3N3MA 3ZYZA 1XD0A 2XG9A 3G0UA 4D8LA 5I03A 4IGNA 1R5YA 4YHEA 4K1WA 3B04A 4HHPA 5BNKA 2XINA 3N11A 4DAIA 1B30A 1RLCL 4H6KA 1WDQA 3QY6A 1JZ2A 2NV9A 2AMXA 4BCEA 4CCCA 3OG3A 1V02E 2PDGA 1HJWA 2YZ5A 1XLGA 2WMKA 4LQ1A 2GWNA 4IP4A 2YPIA 4J28A 4TTUA 5EBAA 4UOZA 1X7FA 4H83A 3TDFA 5H8MA 3SY1A 4XV0A 3PJUA 1WZMA 3LCFA 3RLUA 4K8GA 3EX3A 5D30A 4WUIA 3OB8A 4WGXA 3G0XA 2WOQA 2HDJA 3O6AA 4L4OA 4NI8A 4TX9A 3LENA 1E51A 3UBPC 4LYKA 1LQ0A 2V3EA 2DFAA 1OF6A 1W9UA 2Z1SA 4A8IA 2J47A 1L6WA 3CEUA 1QK2A 1WBHA 1A5NC 2V7QG 3LSCA 4CKQA 3BOFA 1OHLA 8A3HA 3FGCA 2BLEA 3BMWA 1X98A 1KGWA 1OFPA 1WKYA 1H5VA 5AHLA 3SFKA 4IMEA 4C6LA 3N9RA 1FWTA 4IICA 2YYUA 2YOCA 3N4FA 1XRSA 3CV1A 1NARA 2AKMA 4UQDA 3P62A 4NAEA 2ZUVA 2CU0A 2EGZA 4AW7A 1QT1A 4R53A 4LVDA 4PGLA 3DIPA 4GKLA 4BZYA 4XSMA 1MEWA 1VYSX 2RAGA 4N0RA 1EBGA 5FEZA 5G1TA 5HXMA 3COTA 4M51A 3E74A 2VZVA 4J3SA 2FPTA 1NIUA 4XAYA 2R6OA 1WKEA 3A12A 3ERPA 1GOWA 1XSKA 3POCA 5G5IA 3H2CA 2FHFA 2GSEA 4D8ZA 5HNTA 2XFRA 4LS0A 5D37A 3VGHA 4JFSA 1JZ6A 5LSMA 2PWUA 3PJTA 4MYXA 5FJJA 2PCQA 3TSDA 5CG0A 3W01A 1LT8A 1JYWA 4LAZA 1KW1A 1GW9A 5T9CE 3ITXA 4Z42C 1V3HA 2A6LA 4LAMA 5JBFA 2DPEA 2PFHA 3CM4A 5JBEA 3SECA 4R85A 3U8GA 4O19A 1MMFA 1Q6QA 4E4FA 3ISIX 4KW2A 2DEPA 2YDSA 1EP1A 3QQ1A 3LNMA 1P0BA 4H8VA 2VUNA 5FAGA 2NUXA 2NVAA 2GUUA 2PPGA 2WSYA 3SW6A 1TPB1 4DI8A 2PDFA 3SY5A 4IX0A 4GKTA 2R8WA 3NPXA 3WQCA 3MU7A 3TR2A 3IIOA 3KE0A 1O12A 4WD0A 3M4HA 1ONXA 4AD1A 1MQQA 5FJPA 2XSXA 2XM1A 4YXWG 1Q6OA 3TAOA 3R8GA 3NURA 4FX6M 1MDLA 5FJOA 1BAGA 5EMUA 3PZQA 4EP8C 2D0FA 2D2HA 2WC7A 4CD8A 3C5QA 1TTQA 2OLHA 2J24A 2WJDA 4PRTA 3BW3A 1Q6DA 3AJXA 3MWAA 3SQSA 3R8RA 4JFTA 5CAHA 4D2JA 3W7RA 4FLOA 3ZT6A 1ALDA 2NQZA 3VCRA 3HQPA 2P8BA 2GK1B 2HK1A 1CBGA 4PL1A 2NW0A 2P88A 4M6VA 1VIWA 5GVJA 2ZZ4A 4NU7A 4ZQPA 1H7RA 5HWJA 2H9AB 1C90A 3L2IA 2C19A 4XKYB 1WZKA 1LM1A 4LW7A 1UWQA 3LA4A 4ZQCA 2EPMX 3OO2A 4TSFG 1B5TA 1XH0A 3GDMA 1KFCA 4FNSA 4IMAA 1K9TA 2F6XA 3WEZA 1W2VA 2QKFA 1DJZA 1JNDA 4PR4A 4AD5A 1X8FA 1IWBA 1RCXB 4NX0A 1Q7QA 3AIVA 2XVLA 4L4MA 3GHTA 3SCWA 4Q6JA 1E6PA 3R7MA 4W84A 3ARRA 2DSKA 4WSKA 1R3YA 4U4MA 1WKFA 1SJCA 1E43A 2DDXA 3SUTA 2B31A 4Q4PA 1TZZA 5KSWA 1HL2A 4QJ1A 1EPVA 3N4AA 4OE7A 4AVNA 1R9XA 3VNMA 1RP8A 1O5XA 3GNOA 4GYKA 2CIPA 1HJSA 3I68A 4Q4OA 1TO3A 1XQKA 4XD6A 3IWPA 4CGTA 2DUZA 1GOOA 3T78A 3W07A 4MJZA 5CC6A 2PWVA 4RDVA 4JQ3A 4EF8A 4LANA 4ZE5A 1S46A 4IISA 1XYLA 3CUHA 3P84A 4PYSA 5EBUA 2HBXA 4OQVA 1XIDA 3TXVA 2W67A 3PWAA 4ZGYA 2VFGA 2PTZA 1HGWA 4Q8PA 1A5UA 5T26A 4GG9A 4O0ZA 3TTSA 3BUVA 1FP8A 4A21A 1ZRQA 3T8QA 1UZDA 2ZX6A 3PZIA 2WZTA 2ZX5A 4DF0A 3B8DA 3QV7A 4JDBA 4EACA 2VELA 1K6AA 2J7FA 3DYMA 1I2PA 4E8DA 4S3BA 1U1HA 1GJPA 2OZ3A 2D24A 3DDMA 4NI3A 1IEXA 2OFJA 2ZE3A 4BI7A 3BWWA 4U3AA 3HGRA 1C7TA 3UWQA 4O0QA 3EOOA 1TJPA 3ITOA 1I9CB 4BQ3A 1CLXA 3N2MA 4UMCA 5B7ZA 1NWSA 3TLLA 1E6RA 5K4ZA 3PZNA 4JAWA 1PXGA 5HK4A 2OO6A 3PM6A 3B0UX 2J7CA 4GJJA 4L1WA 1F3WA 1J93A 1PO9A 4MB3A 4ZZ9A 4OJYA 2ZX9A 3BC9A 5IBXA 1LBFA 3KL0A 3NQDA 1U1UA 2PU1A 3C8NA 3GNNA 1UWUA 4HMNA 1GOKA 3WD4A 3SRFA 2OQYA 1WCGA 4HHHA 4U5IA 1OBAA 4J35A 4DZIA 5K3VA 4B2DA 1KRAC 2FFIA 1TV7A 4QLLA 1A5KC 3H70A 1F4AA 2W6JG 1V08A 2YGYA 4WF7A 3A23A 1R2RA 1Q6FA 3JZEA 3CV7A 1M7JA 5JQ9A 3BTNA 3ITVA 2OJPA 5C7VA 4GQ0A 2W62A 1LP6A 3O16A 3NO3A 1BTMA 2EQDA 5D9OA 1WA3A 3FCPA 1ENUA 3IUHA 2MUCA 3TEVA 1YNQA 1QCWA 3BGAA 4D6GA 1KXHA 2OODA 5JBDA 3VIMA 1RLDA 3M43A 4EOUA 2QUUA 1YIXA 3W85A 4H8NA 3W1MA 1FH9A 1S5VA 2YXOA 1GJWA 1OCJA 2FVMA 4Q7BA 1CNVA 2PP0A 2VFIA 3WUFA 4GZJA 4YL2A 1W54A 3EOSA 3QOMA 3NQ6A 3CS2A 4Y9PA 4QR6A 3AALA 2VDHA 1KLZA 3V5CA 4R7WA 2OYKA 2VDGA 5JUVA 1BFNA 3L4ZA 1IZKA 1VFLA 3KLLA 5CPMA 4HOZA 4TVDA 1BHGA 2A3AA 3WLKX 2DT0A 5D2WA 3CIXA 3NQ8A 3CTTA 5AVNA 3ICJA 3NYZA 3KP0A 1WOAA 2PWEA 3EZ4A 3URQA 4JTQA 1JZ8A 3AUJA 5D8WA 1EGMA 3KOFA 3PZOA 4RK8A 1CWYA 3O0KA 5HBFA 1FDYA 2PEVA 1OX4B 1CB7B 3UWVA 3BH4A 3VC6A 3MW7A 1S2WA 2JALA 3H7UA 1KCKA 1AH0A 2ZQ0A 5CBBA 2CETA 4AISA 1HFBA 1HKMA 1ONEA 1WX0A 1MW0A 1JZ4A 3O2LA 5AVHA 3QBUA 1TE6A 2V8ZA 1Q6RA 2GPTA 4XZBA 4IMDA 2QDEA 1J0JA 4AF0A 3L66A 2IKJA 2FFCA 4RPPA 4GGBA 7CGTA 4KPLA 4X3ZA 1KWKA 4UNLA 4GUJA 2NQHA 6TIMA 1GW1A 4O4WA 3P6LA 5EMKA 4P7RA 1EC9A 3AHTA 3DHUA 3AWOA 1QI0A 3L0NA 4NQ1A 4RV3A 2PRLA 3TE9A 5I78A 1UMYA 3E2RA 1Z42A 2WJFA 5DBTA 3LHZA 8XIAA 3VO0A 4A6GA 1TZ9A 3CGTA 3PFMA 4AX6A 2YSWA 1MUCA 4B9ZA 4IMFA 1GORA 1ZLPA 3ZVHA 4Q8VA 4CVWA 5DBUA 1JG9A 1W37A 3KOXA 1RBLA 1R85A 1KM1A 1M41A 8RUCA 4X0NA 3OGRA 4GI8A 2WZIA 3HURA 4H19A 4MFEA 2BZNA 2PBOA 4FOUA 4XD4A 5EFFA 2P0IA 1M7XA 1OYBA 1MYRA 2ZVRA 3VUPA 1W1ZA 4MNLA 4IMGA 1RA0A 1GYMA 3SCNA 2VGGA 1PHQA 2WVVB 3HPSA 1V6XA 1WUEA 5TBOA 4Q6XA 3CB8A 3VOCA 3AZTA 1EHAA 1PZ1A 4QX4A 2QJGA 4X63A 3ZIZA 1M53A 4U5KA 5G4WA 5CJNA 1FWHC 1BWKA 1V02A 1QNVA 3O05A 4M6UA 4I9MA 3N14A 3Q2DA 2D1ZA 2ZZ5A 1KFWA 3YPIA 1H1YA 1O1ZA 2ZADA 3ARUA 1XIIA 9RUBA 3CQIA 2F9RA 2HVOA 1XPYA 1TV8A 1XBVA 3GB6A 3UERA 1Z32X 1UD3A 1W5OA 5HUPA 2R1MA 1G0CA 3P0XA 4EE9A 9XIAA 2GWGA 4PMVA 3QC3A 2A3BA 1L6YA 1JYNA 6ENLA 3B05A 5XIAA 4RNHA 1RH9A 3AUOA 1Z44A 4WVXA 2BXYA 1KFJA 1GKQA 2OO0A 3E0FA 1Z69A 2YIHA 1EGZA 1BTCA 3MKCA 2HQAA 1SO4A 2VFDA 3NVTA 4JN6A 3MY9A 1FFQA 4HSHA 3VYLA 3GXPA 2PAJA 2CLFA 1MW1A 4DZHA 1KXTA 1N82A 3S5NA 5LZLA 4LUIA 2ZTJA 4F0MA 4KFNA 1UIOA 1FCVA 3OG2A 3T2QA 3W37A 1BVZA 3CPGA 3CZEA 3MDWA 3IJ8A 3OHMB 2QJIA 3M41A 5BWFA 4YN5A 2XIOA 3WK0A 4BKNA 3MZNA 1GT8A 4PB4A 3HGSA 3KBMA 1L9WA 2BVTA 3BMVA 2PU0A 2O9OA 3Q65A 4E2OA 2ZOXA 4Y8EA 3L0GA 3HBLA 1C92A 3IK4A 3HG2A 1VEOA 4M1BA 5AHNA 2J9YA 2VHLA 1VFMA 1UC5A 1ZTVA 4PTWA 1MEIA 4HSNA 7ENLA 4HJWA 3VGGA 3WF4A 3B8SA 2DSUA 4L1GA 2BBFA 2QJNA 3IK2A 4JYDA 2YXXA 1J0YA 5FJIA 1L6SA 1HP5A 4DJDD 3DI1A 1OZMA 3K8KA 5IXEA 4N42A 1T5AA 1WDRA 1YE4A 1BKHA 4XISA 4Y2WA 1XPGA 4Z2GA 1IGWA 3T55A 1SZGA 1TVLA 3FNDA 1LBLA 4KWSA 4HMDA 5C9WA 2DZPA 4HYVA 4LUSB 5A8OA 3NXLA 2O0TA 3QV6A 2HMCA 3MO7A 1TPVA 2BY3A 1E9ZB 5BROA 1R38A 1F3EA 2OYMA 1D7FA 2DV0A 5DN1A 1R3WA 2OPJA 5DMYA 2XYLA 3AFBA 4QSHA 4PCNA 2IQTA 2QCGA 4GVIA 1UR8A 4QROA 4DO6A 3PWGA 5I00A 3H21A 3LZ5A 3UWEA 4WHBA 3F4WA 1V3KA 1XXXA 3FOKA 2O92A 3F5KA 3H2EA 3LGGA 1N7KA 1ZENA 3WF3A 3W1TA 4JPGA 3WH6A 2WPDG 3DHDA 4AZHA 3VGFA 4AHPA 3OEEG 3OAAG 2Z0IA 5GNXA 1KC7A 3BCJA 3WDHA 2V3FA 1OVDA 1FKWA 1A5SA 2WW5A 4OBSA 5CGQA 4C5YA 1P5BA 3VM7A 3OVQA 4JY9A 4GQQA 5C2CA 3ANYA 4ZO8A 4C6JA 2DZTA 1I8JA 3U4FA 1DTNA 2HE5A 5HAOA 2JFEX 4L64A 4M5PA 3RUBL 2NVDA 1LJYA 2REQA 2EPOA 2XGIA 2DH2A 2ATMA 2Z1BA 5LKYA 3LPFA 3O63A 4FIQA 1HP4A 2HZGA 5F4SA 2FGZA 1W3TA 4N2YA 2WMIB 3DYPA 4NHVA 5IBXC 1AL8A 1IZCA 2OELA 5MKGA 3LMZA 4O10A 5L9FA 3A13A 3ITCA 1EKOA 3DH7A 3SI9A 1EO7A 5D9NA 1AMKA 1KFLA 2TMDA 4ACYA 3WY1A 4JHZA 5LGXA 4GNVA 1RXOB 3GDLA 3BJTA 1O68A 4PMNA 4Q8QA 2KAUC 1K77A 5E70A 5KZMA 3CQHA 4OOUA 4IIFA 1UIPA 4IMCA 4DRSA 2ABBA 1VBHA 3U5YA 3PC0A 2QUTA 3CHCA 3S1GA 1HJXA 2E0PA 3PN8A 2QCEA 2BVWA 2ZVIA 1VF8A 3AOFA 4MB1A 3VAVA 5CJ5A 3E02A 3SFWA 1NOFA 4GXPA 5ABFA 5DX7A 2A79A 4Z1MG 1KWGA 1AH4A 3C3UA 2PDBA 1LL7A 5I0DA 3INPA 2XIQA 4D1IA 2BY2A 1KM4A 4DHGA 1JZ3A 1XINA 4Y6GA 4C7DA 2PGEA 1R86A 2DU2A 4AZCB 1ISZA 3WQEA 3TAKA 1B9ZA 5AC8A 1XX1A 1OSEA 2NSOA 2OMAA 4L9YA 5A6LA 1RCQA 3SCVA 5A6KA 4GXWA 3BO9A 1OZQA 2QULA 4WY0F 1V0KA 4IXHA 4B9YA 3MUXA 2NVCA 1H60A 4LSBA 4A22A 1R30A 3WUEA 4N9BA 4C6PA 1GEQA 3L4UA 1GOIA 3TV8A 4B5SA 2YDQA 4OWGA 1A5AA 4HPHA 5I24A 1KXQA 4GQRA 1L0PA 2WC3A 3L12A 3W81A 4HHMA 4NYUA 3QTPA 2Y6ZA 4A2SA 4V28A 1Q3NA 4H9MA 5IRPA 1P4CA 1TTIA 3AS1A 1F3XA 3KFTA 3TROA 1HJUA 3NJ3A 1WKDA 2Z6IA 3KWSA 4GNKB 4UC5A 1PUDA 3VOJA 3OEXA 4XIAA 4AD2A 1T8XA 2PDIA 2WHLA 1XBYA 4MZ1A 3PFRA 4HPNA 4GY1A 4NJKA 3WBYA 2UV8G 1EB3A 2JGQA 3I65A 5EA9A 3WLRA 3BLPX 1YNPA 2E09A 3CHDA 5CPTA 5J04A 4L6DA 2PLJA 4YYFA 5XIMA 2WCGA 4ICNA 4ADTA 1AQFA 2D2GA 4OGZA 1E1EA 4LY4A 4H7VA 4PBFA 4O11A 3W0KA 3MO4A 1E55A 4BQ4A 1DJYA 5JXQA 3DEQA 1PKMA 4OU1A 2D2OA 4GZEA 3N3TA 1UQYA 3RJYA 3IV8A 1PYFA 3GVVA 1QDSA 3WKZA 3VOGA 2OWWA 1A4MA 3K46A 2Y5EA 3AU6A 5A8NA 1W1YA 3MCNA 3SCRA 1XLFA 4BS0A 1EDQA 1K7XA 4O1FA 1ZJIA 5DN6G 1LRQA 3K5XA 3PTKA 1VYRA 4J2PA 4FXRA 1DTUA 2XVGA 5IHRA 4H7CA 1D2KA 1GOXA 4XBKA 3SCQA 4J9JA 3LTYA 3P7YA 3A22A 1Y65A 3IAPA 1GQNA 4AWSA 5JU6A 4WJXA 4REQA 4X0VA 4MAZA 1VBGA 4UBPC 3TQKA 3DFTA 3QYQA 4JN8A 1AFSA 1L8NA 1H63A 3UGVA 2XFWA 2DZBA 1F6KA 1QOXA 3PZMA 5ECUA 3TX9A 3F1QA 4AZGA 1JPDX 3P60A 2BB0A 3RX2A 5CJMA 3BG5A 2WMJA 2C6QA 3AXHA 4FEZA 4IFKA 1NDZA 2V68A 1NELA 4WDXA 4EPDC 2DUAA 1UWRA 1DWFM 2EPLX 1BPLB 3D46A 1BXBA 3S0CA 2E67A 2ALRA 1SSDA 3PPGA 3E49A 1BQGA 4LUTA 4MM1A 3SR7A 1M7OA 1WYIA 3UZ5A 2PP1A 3V16A 3AQUA 3EDFA 1PYMA 4RZ4A 3OPSA 4JN7A 1TPFA 4LYPA 4B5TA 1OYAA 1Q5MA 3P0WA 1ONRA 3TMQA 4GJ1A 2NX3A 3HA1A 4L9XA 3W02A 3KBVA 4B3ZA 3BSMA 1VFOA 3S83A 1DJIA 3W6MA 2YCLB 4JCMA 3W7HA 2BGNE 4RCXA 4M81A 1Q4NX 2AMGA 4BJHA 3TSBA 3VNLA 4ZSUA 3TKFA 5A6JA 4HZMA 5REQA 3G3MA 1JDEA 1BLIA 3RX4A 2E9BA 1PCKA 4L4PA 4MZYA 3MCOA 5C0QA 3EGJA 4GABA 4XD5A 7REQB 4B4HA 3FAXA 3A64A 3GUGA 3NYDA 4A3QA 3CLMA 4KERA 3CQJA 3FFSA 3TJ4A 1K1DA 1H50A 2GVJA 1TA3A 3MJYA 1ELSA 5E6YA 3UZJA 4U2ZA 4NJJA 2V2HA 3VE7A 1G5AA 4O4VA 1WUFA 3E3HA 4K6AA 5A2AA 1OG0A 4YTUA 4W87A 4H9XA 4NYYA 3F2CA 1RZMA 4G8TA 3KL5A 3TSMA 2CPUA 1I2QA 3TVAA 2WBGA 4DWSD 4Z1BA 1ADSA 3T0CA 4JTDA 2ACQA 4JQ2A 1B3OA 4MJMA 1QI2A 3HV8A 2VGBA 2XSAA 5AZ0A 5E5CA 9XIMA 2WM0A 3EOLA 3C2VA 4ZQNA 3WLJA 2W61A 4UFHA 5G2WA 3QGAC 4NZ1A 3W74A 1NF7A 1F61A 4CEXC 1MO0A 4QAWA 4OV9A 3W76A 1KM6A 3LPPA 4YYCA 4UOQA 3ZVIA 5TD4A 1BXCA 3WQ6A 2PRHA 1TPC1 2QCDB 4LYRA 1A5OC 1H62A 2P3ZA 5I3JA 5I2UA 2Y7GA 5D04C 1XR2A 2VEIA 1EZ2A 4JTFA 2C79A 2YCEA 3SUUA 2OLAA 3ITTA 3UG3A 2DVTA 3CTLA 1NF0A 1XG3A 3IUDA 4GPNA 4UXDA 5B80A 3BE7A 2XOKG 2VFEA 4OHQA 3LHVA 1EYWA 2FPYA 3DGRA 2QUMA 3OGSA 4GUFA 1I0DA 1VQTA 3PPHA 3G6MA 4RXGA 1I4NA 3BLFA 1EEXA 1FHUA 2EG7A 3RRAA 4LUJA 3QM3A 3GTFA 3BLEA 5DFAA 3RJXA 3VTRA 4HPJA 3UJSA 5HUOA 3FDGA 4PMRA 1GJUA 4O17A 3H2MA 2WWDA 3TC3A 2QLYA 1VBUA 1YDNA 3AMKA 1JIBA 5H6HA 1H09A 2NT0A 1I1XA 4QLKA 3EX4A 3C8FA 4K7YA 1DP0A 1T99A 3NL5A 5A2CA 5EMLA 3VINA 2AGTA 4W5ZA 2E5BA 3TA6A 4FLRA 1DWJM 2Y85A 1ML1A 4IPLA 1YPIA 2VUYA 3BURA 1S5TA 4DAFA 3GR4A 3GYEA 3OVRA 3NM3A 3THQA 5IFTA 2QVNA 1VYPX 3E96A 3SBFA 3DFSA 3WL1A 4AG0A 4TIMA 1A0EA 1W0MA 1PTDA 1SFJA 1BF6A 4GGHA 3VIKA 2R9RA 3MANA 5I77A 3T0DA 4X61A 2X1TA 3M16A 2V2CA 2G96A 2I9EA 1D3GA 1K7EA 1PTAA 4YS1A 2C3ZA 3NQBA 3LHUA 1W56A 4P5UA 1XGEA 3VE9A 4R9XA 2VOMA 2Q6ZA 1H4PA 2YB4A 4TUFA 1NDWA 1LQ2A 1VCGA 4MWAD 3NZGA 1GZGA 4XZMX 1F6PA 4NNAA 4R7JA 4XAFA 1UH4A 2DIEA 1EDTA 3OIXA 5LA2A 3I4KA 2PC4A 3UR2A 4AYSA 4GVHA 3ALGA 2VURA 1RP9A 3QPYA 1IXQA 3GVGA 4A3UA 3IACA 3W87A 3OLDA 2X09A 2BY1A 3H2AA 5KEZA 4MY8A 3IIVA 4K39A 1PVNA 4JTEA 4U3CA 4DLFA 2PGWA 2GK1A 2Y5SA 1A53A 1VFUA 1QI3A 4JTAA 3KBSA 1G4SA 4HBKA 4LEFA 4NVTA 2H9AA 2CZVA 3NFUA 2IW0A 1E0VA 1UKSA 2J25A 3FVMA 3GXFA 5DY2A 4WLCA 3DAQA 4XKYA 1SO3A 6REQB 1VFSA 2FHBA 4H6EA 4KCUA 4GUGA 2PTWA 5DANA 5FF2A 2PDLA 1O94A 3U2EA 5CXPA 2V5CA 3E5BA 2PS2A 3LTPA 4YTSA 4RDYA 2F6KA 3PB0A 3OVPA 3NL2A 3QY7A 1CXEA 3S2MA 5GJPA 5TNVA 1EPXA 3WH5A 2VR4A 5I3IA 1UOKA 3EMQA 1RUSA 4MADA 3NSMA 4HTYA 3GTIA 5AN7A 1YRRA 1JYVA 2HNEA 4LU0A 1UH2A 4LVBA 4M19A 1SFTA 1SUXA 1IIHA 2WO5A 4J1OA 4UQEA 3BAYA 2P1FA 3WD1A 3TYUA 5CAKA 2J7EA 3EYPA 1KCLA 1DXIA 3V0UA 1G7UA 4JY8A 4DIAA 3A3XA 1OY0A 3URBA 1CENA 2PD9A 2OR2A 3AYSA 3U9IA 3A4JA 3BQ6A 1REQB 1ZFJA 3ARSA 3S5OA 3KOYA 3STFA 5FF4A 1ZCCA 2DIJA 2WZEA 3IRDA 3R4IA 3UPWA 3CZKA 3WLMA 1OIFA 4G9PA 1P7TB 3LI0A 3TR9A 4IIBA 5BOEA 3FA4A 4OKDA 3W1XA 3O0FA 2ZXQA 3EDDA 2ZA3A 2WSKA 3QMRA 1WDDA 3LZ3A 4PB3A 2E3ZA 2PSNA 3NG3A 4U10A 4XZIA 4W8AA 1HQTA 3OP2A 2FGLA 4GX8A 4Y9NA 3T81A 3RAOA 4EWND 1XYZA 4UTIA 1VC4A 3E0IA 1JD7A 3HG4A 1LTDA 2EAWA 2FZ8A 5EU9A 1SQ7A 4HA4A 2ONEA 5FEWA 3OODA 4Q8OA 1VFFA 1I6NA 2J77A 3PBVA 2QYGA 3UEQA 3AIUA 3EWDA 3ATZA 4L61A 3VABA 2DW6A 4UTFA 3NQAA 3WFAA 1J4EA 1GVRA 3S47A 4GZ7A 1UASA 2ZC1A 5DT5A 5F4XA 1QNSA 3SQLA 5BU6A 2QEZA 2VD8A 3P2VA 1FCBA 5A8MA 3M5VA 2OEMA 3H2OA 3OHIA 4W5UA 1G7VA 1DORA 2PZNA 3RF9A 3MZ2A 3UY7A 1JCMP 2GDQA 3XIMA 2PDYA 3ZLHA 4KF1A 4JNZA 2X7WA 4QSFA 1ICSA 3DOPA 3G1RA 1W1B1 1HXJA 4AC7C 3AROA 1C91A 2XFYA 2VZTA 1HKIA 4PE8A 1L2QA 3R25A 4NJIA 4UFLA 3FKSG 5LNVA 4L65A 4ENLA 5SWUA 1EFZA 5I23A 1B3XA 1RJRA 2NLIA 4BY3A 3N6HA 1G94A 4HCDA 5HMDA 1TQXA 3E2SA 3VIHA 1BWVA 1XCWA 4HA0A 3UT0A 1T57A 1VR6A 4B5UA 3UFYA 3RK8A 4ZCWA 3KRUA 2ZYFA 1NTHA 3VDBA 2F61A 1O5QA 4TV6A 3W72A 4PRRA 1VJSA 4ML4A 5LNRA 4TOQA 4N4QA 5LIUX 1KGUA 4NL1A 2ZZ6A 3AI0A 2PBGA 5FAJA 1DIDA 2V5LA 4IX2A 2V38A 3G22A 3NDZA 2PE4A 2Y5JA 2OCZA 4AMAA 4D71A 1C8VA 1ZJAA 4MY9A 3KS5A 3EPMA 1A5MC 2V82A 3DHFA 2ICSA 4Q22A 5M3WA 1GVEA 4X2RA 4D1JA 2W27A 4ONVA 1W9BM 4QNEA 3DXIA 3PBWA 1TPWA 5CLTA 1OX4A 3AIWA 3WDPP 3VNYA 4LCRA 3UETA 3T9PA 4YVPA 1E70M 5JMUA 5F4WA 1WPCA 5CPNA 2NX9A 4GHRA 3MSGA 5AY7A 4AD4A 1ISYA 3UWZA 1VCFA 3MUCA 3M5YA 4DUXA 3UXLA 3S9ZA 2OT0A 3UESA 3OVGA 1TUXA 3G1FA 4CU6A 4U2YA 4JFWA 4C6EA 4QDPA 1VHNA 4UNIA 2RUSA 2ZDSA 4H04A 3REQA 4QIUA 1J2BA 2VWSA 2WK2A 2YLAA 3AIBA 1Q2RA 3N6QA 3U5UA 2D3LA 2IS7A 4ZQOA 3UZXA 3H4XA 1Q6CA 1R7OA 2Z26A 1DE6A 1HZYA 1N8WA 2XZ9A 1J96A 2GOUA 4JOMA 4N9CA 1UWIA 1XFCA 1N8FA 2VEFA 2HJPA 5D38A 4F4RA 3W1PA 4HOXA 3WK2A 2JE8A 1PKLA 3BAJA 1JPHA 2VEPA 1W3NA 4ZBCA 2FB2A 2P53A 2Y8VA 2OB3A 3I7SA 3C2EA 3L4XA 2PDUA 2ZUSA 2X1UA 3AMGA 1Q85A 2HWGA 1Q66A 3BG3A 4B5WA 2DVXA 2FYMA 1UMLA 3HU7A 4DNMA 2WVVA 4IIDA 1W9PA 2VYOA 3SRDA 1EX5A 3PG8A 3RGTA 2ZFAA 4S38A 1CW2A 1YPXA 3WQFA 1JR1A 3G8EA 1VRXA 2I5QA 4O1DA 3IJLA 3EKLA 1DJGA 3PHAA 3UYCA 3NQFA 1I60A 2PDHA 4HK7A 4PUUA 5FF3A 3S6DA 2A85A 2DT3A 1R2TA 4HKPA 2DJXA 2XZ7A 1PZ3A 5CKSA 4OOZA 3B0XA 1W5MA 4S3GA 3EDJA 3VNIA 4M7TA 3TK7A 2HK0A 4PCSA 3QJAA 3WH7A 1NQ6A 4RX0A 1P0KA 4QG8A 1FH8A 4M7SA 4KGLA 1TV5A 5HQEA 2VC5A 3QZAA 2E9LA 3TA9A 4IPNB 3L7RA 2PDMA 3SCOA 3T6CA 3DENA 1W9XA 4GVGA 3NZ1A 1VBRA 3Q45A 3OFNG 3OGVA 1SJDA 5K9DA 2OEJA 3NPWA 3KX6A 4DBSA 3VCNA 1H41A 3IVTA 1RD6A 4R88A 1WDPA 2YL5A 1JAKA 1Z41A 2V69A 3KM8A 5AHFA 4HNVA 5G1MA 1UQZA 3V75A 4S1FA 4Q7NA 5CPSA 1CLVA 4Q33A 3VGBA 5EPDA 4HCHA 4BHYA 1KCXA 4ERGA 1CYGA 4L7ZA 3IIPA 5E0CA 3UQNA 2YDRA 5EYWA 1FWCC 1XQLA 4AYGA 2Y24A 3DHPA 4KRZA 1DQUA 5GQBA 3NL3A 3PBGA 2E5CA 1BSLA 3VDAA 3CZJA 1DKWA 3BDKA 3CYJA 4E6MA 4QFUA 1FCUA 5I5RA 1QW9A 3ARVA 5D2TA 1NU5A 4EPBC 2PTXA 4IGSA 3DBNA 3UG4A 4P7OA 2X7VA 4DZAA 3GM8A 5F7UA 4XX6A 1XDLA 2FMNA 2VQUA 2POTA 3GFXA 1Y0EA 3KOWA 2WXDM 1HKKA 5C70A 2W6IG 3UW6A 3TYAA 2DJLA 1IEVA 2GSHA 4GJIA 2TPSA 1YEYA 3CU2A 2OZ0A 1WB0A 1YHTA 1GHSA 3ELFA 3OZYA 4GO9A 3GDTA 1JGIA 4NAFB 5C7HA 4JXCA 1MRAA 8CGTA 1IWAA 1UD6A 2XN0A 2PUZA 1QNOA 1FWGC 3AMLA 5T8GA 4PSPA 1HX0A 2VFFA 3GO2A 1SR9A 4MWAB 3NDYA 3CWHA 2RDXA 1IEIA 1UUMA 4UB9A 4LUSA 4F0SA 4DO7A 3H22A 3GZAA 2DZSA 1FDZA 3G18A 3IJ9A 3QKEA 4BQ5A 4RE2A 3VIGA 3GSMA 1DXEA 4C6MA 1GYLA 1QNPA 1W6TA 2Z1XA 3VK5A 4PL2A 1PL9A 5EY5A 1JQXA 1IT7A 1ZB5A 1KV5A 2QMKA 5IDIA 1FWIC 2DSVA 1C7SA 1EA9C 3GLCA 4UR8A 4WSHA 3HFTA 1RA5A 3GE7A 3GC4A 3ITYA 3ECQA 4WCJA 1V3IA 4UUIA 3W22A 1H3GA 2HPMA 3CIWA 2G41A 4IJCA 3TNBA 4B16A 1UP2A 3W75A 3KL3A 1TCMA 5G2IA 2B4GA 2V5JA 3KDOA 4TXEA 2WMGA 2XJ7A 2E40A 4BA0A 3W24A 5H8UA 1IE7C 3UP8A 2WHMA 1H7OA 1VFHA 1GG0A 1TTJA 1A50A 4WDTA 3MDUA 3TW6A 3I3DA 3H53A 3SRKA 4B5VA 1A5LC 3VCCA 3S9IA 4LUYA 4PUJA 3DN5A 1PWMA 3B9OA 4JTRA 1NWTA 2OKTA 3RDKA 4IPJA 3R8HA 5BZAA 3EDEA 3VILA 3BG9A 5I3KA 3VKKA 3W2KA 3VX0A 4LJ3A 2WMIA 3UXAA 3BSHA 1FWWA 4JL2A 4QG9A 4CN1A 2JDIG 3IEBA 3ZJ8A 2O9TA 3CL6A 4KCTA 4MNJA 3TW7A 3GDBA 2J27A 3GRIA 1YXDA 4ZEPA 4DWDA 3VXGA 2X1SA 5I3DA 3ARYA 4JX5A 1YPFA 3ZZ1A 4UZUA 1POJA 1SW7A 1FFRA 1UHVA 3QQWA 3URAA 3O1NA 3W7JA 4P2VA 3WD3A 3GG1A 2E6AA 1LL6A 1JFHA 2Z25A 3R79A 5CZSA 2PP3A 3R2GA 3TOYA 3U0HA 2VENA 4GMEA 2YDAA 4WK9A 4AU0A 4I3GA 4KCWA 1LCOA 1OQFA 2PDWA 2NLYA 1LLWA 2C1HA 1W3IA 3V0TA 3TJLA 2QGYA 3GYCA 3FA3A 2XPKA 4BI6A 3FHAA 2D0GA 1NP0A 3T1GA 5FACA 3TW9A 4AZCA 4F48A 3DG6A 1K03A 2VI0A 1RD5A 4Q8TA 4ICCX 2WSPA 2FH6A 1P0DA 3AMCA 3NTYA 5K9CA 2FPVA 2NWRA 1US3A 3V3WA 3EWUA 3KZSA 3TWAA 4LVGA 2IMRA 1Q63A 4IT1A 3E0VA 4AZ7A 2FVKA 3C2OA 2VC9A 1XUZA 2RDWA 2WPGA 1IF2A 2Y7DA 5CZ0A 4PCPA 3ZQ9A 3FJNA 3DYOA 1RK6A 1X96A 2IPGA 2DUXA 3ME3A 1YTKA 4IFRA 1CXLA 5BOOA 3VM5A 3DG3A 1PSCA 4GINA 4E8GA 2YBUA 2BVDA 4WOZA 2QAFA 3CAKA 1US2A 3CPRA 4K36A 5K2ZA 3S2JA 1AJ2A 1NFGA 2Z2UA 4WEVX 1W3KA 2VX7A 3W6YA 1BEUA 4J3VA 1TJ1A 4K7VA 1E5JA 1JF6A 3CUIA 3UCDA 4FF5A 3LM3A 1XCFA 1TVPA 3ZS4A 4IOTA 3W7EA 4V15A 1FKXA 1X39A 2WNZA 2BG5A 4N9DA 2ZIDA 5D02A 2UBPC 4DBDA 3B8IA 3WNOA 1V7AA 2EG8A 3THAA 1QK0A 1FXQA 1RBOB 3AJ7A 4NNBA 4LY8A 2ACUA 3GIPA 4Z1AA 3MPGA 1FDJA 3OLEA 4RKAA 2GQ8A 3KEHA 2BHUA 5EGRA 2XTKA 2VD9A 3WLTA 2FTWA 3FIGA 4KQNA 2OGJA 4EX4A 2VR2A 1HGYA 1FOBA 3ABXA 1M7PA 1C3FA 2YA2A 2CBIA 2WWCA 4RLIA 4IIHA 1BGGA 1KFEA 3FAWA 3DFQA 1TB3A 5PTDA 4G2DA 3O6YX 3FVDA 3L68A 1B90A 4M0XA 2WANA 2ZUNA 3NVDA 2ZZ2A 2Y0FA 1GQJA 3IPWA 5H1WA 3S2LA 3SIZA 1QOPA 1UH3A 3I6TA 5C9XA 1HG3A 3QW4B 2TAAA 3ARWA 3WLIA 1KKOA 2NZLA 3OBEA 4GIRA 1V51A 4FB7A 1EA0A 4UOJA 2DVUA 3N34A 1YLVA 1ZY9A 1UD2A 2IUZA 1S1RA 3TYDA 3WMCA 3F03K 4H2HA 3O9NA 5HNUA 4I5RA 4N6EA 3LLDA 2QCHA 2V5KA 4XSLA 3V5OA 5DMMA 1T7LA 3SGZA 1B57A 1KB3A 5DEZA 3RR1A 1JCLA 1CXHA 2FZBA 4AC1X 3DECA 3AZSA 3UYIA 3GK0A 2AL2B 1UKPA 1GWJA 1H7PA 3TTEA 3SIMA 1U2YA 4WDWA 1PIFA 2PDPA 3N15A 4LH8A 3SUSA 1LDCA 3PSWA 4P7LA 4G6CA 2QF7A 2Y7EA 1ZBWA 2VJXA 1YDOA 3H6OA 3NPVA 3IRSA 1JDDA 2PLMA 1NQKA 2CLLA 1U30A 4JIRA 3BJSA 4X22A 4BEUA 3E2QA 3LY0A 3ZXWA 2YCLA 2VEMA 2Q01A 2J4GA 1ICPA 2VP8A 1XC4A 1ZALA 5DY3A 3ONCA 4LAOA 5FF0A 3E38A 1OB0A 3TP4A 3HFYA 3R5EA 4HPGA 2XIBA 2CITA 1ITCA 4MNKA 4US5D 4LTSA 5D9PA 3CXOA 3ANUA 3NEVA 7REQA 2EXOA 1CCWB 1XSJA 3M5XA 3PUEA 2IPWA 4JYEA 1F4HA 3ONBA 4E0CA 3EBVA 4CD7A 3R11A 1XBZA 5C71A 3SN4A 4C6CA 5C9UA 4JD4A 3H54A 3IV3A 1Y5VA 4JR5A 2ZUMA 4KMQA 1LQAA 3L67A 1JI2A 5GNZA 3L4YA 3UPBA 3VD3A 2BSLA 2EKCA 4CLMA 1CI1A 3S4TA 4UNKA 1LLOA 1RBAA 1TE1A 2P0OA 3ZR5A 1W8SA 3SCSA 2QHAA 2VZSA 3VD5A 4OBRA 1XKYA 2X05A 1EF2A 2WVTA 1GG1A 1HW6A 2UY2A 4IPIA 5T9BG 3W73A 4F79A 1J12A 2J13A 4NXKA 5AHEA 1XI3A 2QXWA 5CZJA 3ARTA 4AZ6A 3D6NA 3THUA 2QCDA 1H1NA 4TTGA 5LHFA 3A4AA 2VEGA 1TIWA 3ZSSA 4S39A 2ACSA 2WKGA 3VKCA 3UR7A 3N9SA 3BSGA 3NQ2A 2Z29A 3N9KA 3N17A 4RDWA 4XTIA 1K8XA 2ZX8A 2PRMA 3TQ0A 3WLQA 1FQ0A 2Q8LA 4C6FA 1QBBA 4IIEA 2I7GA 5ABEA 1M03A 4QE5A 1E4NA 1DQXA 1MW2A 2R1PA 5M17A 3SEPA 3EEGA 3WBAA 1ZNNA 1QHZA 4O1CA 3NQEA 2ALDA 3UY8A 5I07A 1Q6LA 1VRDA 3M0YA 1IEQA 5C8BB 4KIEA 5I3HA 1ADOA 4E4UA 2I1OA 3G5EA 3RNDA 4DJDA 2RJGA 3VU2A 1TWZA 3QGVA 2WAGA 2OWCA 4I8DA 1S1PA 2YW3A 7TIMA 1Q8AA 2C8NA 3KHJA 1VPYA 2E1WA 4M80A 3RHGA 5FEXA 5HQMA 4QQ3A 3HO8A 2J88A 4AY1A 3EMCA 1KRMA 4QEEA 5EMMA 1FXPA 1SO5A 4XAPA 3PTMA 1GKPA 4C6KA 3HG5A 1HT6A 2JBMA 4MWAE 1C8YA 2DQWA 1P1XA 5HOSA 3GKAA 3WQ8A 1BRLB 1E6NA 4HHLA 1XV8A 5FCZA 1H7NA 1SYTA 1W32A 5KETA 3UJ2A 1BD0A 4IFOA 4QLJA 2A21A 1WV2A 4FK9A 2JGYA 3KVMA 3H8AA 2WCSA 4UFKA 1DOSA 3LCWA 4AVOA 2OZ8A 2DT1A 4L80A 2ADAA 3M0VA 4F3HA 3SJ3A 4LC8A 3TJIA 2WNQA 3GIYA 4W88A 3FS2A 1EYEA 4NKCA 4Q4RA 4MLRA 1H0IA 4PTNA 1KM0A 3A47A 2ZDRA 1V4YA 4GIAA 1NY1A 4BR1A 3FA5A 1GUVA 2BHYA 1OX5A 1CX9A 3FV9A 4OUEA 1XFBA 1NM9A 3RU8X 3WJXA 3STCA 4JTGA 2RGMA 4JHMA 5A1AA 4CNUA 3R94A 2J74A 5AC4A 3H12A 2XGBA 4AXNA 3KCLA 4XVDA 1V0MA 4DEFA 3WQVA 2DZXA 1ICQA 3WDRA 2GYIA 5KTLA 4YWSA 2PWGA 1XYCA 2VL4A 5TQLA 3CH0A 2W66A 4UMAA 4EIVA 4MAVA 1SM9A 4NZJA 6REQA 2WJEA 1E0XA 1TX2A 3ZR6A 4DXXA 5BMWA 2GDUA 4UTUA 1X6NA 3W7DA 4J4KA 4EAYA 4EWJA 2PWDA 2IKIA 2WQDA 1CLKA 4O12A 3VZZA 1QAPA 2FQIA 3CASA 4KS0A 2QGHA 4F9DA 4A3YA 1HIZA 3ARPA 2GUYA 4B3LA 3OYZA 4PTXA 3F4DA 1QATA 1HF6A 4AEOA 2IKGA 4TVCA 1HVXA 1J0HA 3W7LA 4BF5A 2G0WA 2XH4A 3BCDA 3VKAA 4CQDA 4FX7A 3GG0A 3WD0A 4IQJA 1UZ4A 1MXGA 2HS6A 4S2BA 1KM3A 1PTGA 2JK2A 3RX3A 1EJUC 3P82A 3M1ZA 3W6LA 1IR2A 3HN3A 3TXZA 4Y9OA 5F1UA 4GISA 1B3ZA 3EA2A 3VOFA 1QO5A 1F74A 2ZXBA 4BK9A 1FWBC 1TWWA 1P7TA 4LS1A 3PTQA 4Q3MA 1JYXA 2XNDG 3GVWA 1Z48A 4V33A 3GDRA 3WUGA 4Q4MA 2YX0A 2YZRA 2RHGA 1OWQA 4LB4A 1BKSA 4ILSA 4D6JA 4CU8A 4LXFA 3W1UA 5LNSA 1Q65A 3M9YA 3VKBA 5IFPA 2ACRA 3EWWA 1R46A 3UVAA 4J3XA 3N2CA 4CN4A 3OLIA 2Y62A 1XRFA 3W82A 3NZPA 1PAMA 1S2AA 1A49A 4DVOA 3O7UA 4WY0B 4N7QA 3BGGA 1OEPA 4P7NA 3SCPA 1OIMA 3T4CA 3O07A 1GQKA 1PIIA 1AQMA 4Y8FA 3S1WA 1QNRA 4UTWA 5AZ1A 3H23A 3CZGA 1KTCA 4OFCA 4S3CA 1CXIA 1XLAA 1XH2A 2ZUUA 3QPZA 4W86A 1GEHA 4QAIA 3W2NA 3W7IA 3LMYA 3BLKA 2H3DA 1EBHA 1W9VA 3SM0A 3M64A 3T0BA 2C15A 2VC6A 1H49A 4DN1A 2KX9A 1JZ5A 3WZ0E 3WH9A 1GONA 4YJ5A 1T41A 4Q4SA 1DWGM 1R9YA 3THCA 2V67A 1KKRA 4ZA0A 5EL1A 2X41A 2QQ6A 3H26A 3S5SA 3OLGA 2WYSA 4K8EA 5BXPA 3R0DA 3ZSTA 3DCPA 1V6WA 4IHCA 3M6YA 2HSAA 1M68A 2PDKA 1V5XA 3MC5A 3PULA 1D9EA 2V30A 1J0ZA 6A3HA 1C29A 3WYZA 3NZRA 4JX6A 4NUWA 1UR0A 3UR8A 4JIEA 2XIMA 1AQHA 1X6LA 1LUCB 5I3GA 5CC7A 3HGOA 4FMVA 2GVLA 5D33A 3QLLA 4AF0B 3S42A 1V0NA 3KWXA 5AYZA 4KRTA 6XIMA 1XYFA 4LF1A 4Z0JA 1NDVA 1J2WA 3DFYA 4Y9AA 3W7NA 3AMDA 4H41A 2V0TA 1EXBA 1XDMA 1J01A 1EJRC 1AMYA 1K9DA 3QN3A 2XDFA 1WNOA 3M47A 3BANA 4GI9A 2W3ZA 2DY3A 1HNYA 3UR5A 1CIUA 2EG6A 4GE8A 4XUYA 3N04A 3CMFA 3GTNA 1C8XA 4JX4A 1VP8A 3M0IA 4C5ZA 1XLJA 3NA8A 1Z3NA 2C7FA 2VXNA 3WEMA 4E5TA 3BVJA 2BMBA 3QMTA 2IPFA 4MKNA 4FNQA 5AECA 4I8YA 1AW5A 3E9AA 2PWHA 3H4GA 1BG9A 2H8XA 1C8QA 5CGTA 4EPEC 3TMLA 2J8TA 3SZ8A 1ZAJA 1XH1A 5CZTA 4Z2HA 4YCPA 1YKWA 3KRBA 4DUOA 1MXSA 1H51A 2PB1A 3M46A 4F9JA 1A5CA 3GWQA 2CC0A 3W26A 1YX1A 4RE4A 1FH7A 2WBKA 2VRKA 1B4EA 3K4AA 3ZO9A 3OYXA 4G1KA 4YMZA 1LF1A 4ZE4A 1ISVA 1K7FA 2VCBA 1QBAA 4NSBA 2OVLA 3G1HA 1XJBA 2GZXA 3VIOA 3GZ3A 3AHVA 3EXRA 3CUZA 1OG6A 3FXGA 2V3DA 2FZMA 3MP3A 3CZLA 1ZQ5A 2H6RA 2P76A 2FJUB 2WB5A 4RUBA 4XTDA 5KITA 3M7WA 5ABGA 2CZFA 3W53A 3WLOA 2BTMA 2BOFX 1PKNA 3CV6A 2ASHA 4PUWA 2GJRA 4PFMA 4GXMA 2YBVA 3GU2A 5C5YA 1H8EG 1SPQA 4U31A 3RMJA 3L0KA 1QPOA 1ITUA 2OKOA 1F7BA 4HQVA 1W2PA 1JCXA 4FALA 3C61A 4DWSA 5HJYA 3WLNA 1VENA 4UQAA 5HPOA 1MFUA 2DP3A 5LXEA 1PZ0A 5BW6A 4O13A 1WOBA 1LG2A 1G9HA 3RRXA 1J79A 4DJDC 3CT7A 4LS2A 3KOZA 4TVUA 3AISA 1H0GA 1B1YA 1K9EA 4PCTA 3TN4A 1GHRA 3GH5A 4K68A 4LT9A 5CQ1A 2AL1A 3VMOA 3WFZA 1E9LA 3ZWSA 3XINA 4DZ5A 3ABQA 4HA3A 4L6OA 1ZPTA 3AAMA 3PZGA 3RILA 4F66A 4ZOAA 3CV2A 1LYXA 2JIWA 2YA1A 3BPWA 4QP0A 4TV5A 3S2NA 4TX8A 4E3TA 1R0MA 5BRPA 2EEXA 3C0QA 3VNJA 2ZUTA 3QR0A 2Z2BA 4XBJA 1Z8AA 4CUCA 5LA0A 4LAUA 1VZWA 4GY7A 1CGUA 3RM4A 1TG7A 2AAAA 1Z7AA 1XIMA 3W7KA 3T2OA 1ZL1A 3AAGA 4PUEA 2HLDG 1YTDA 1CXFA 1IQ8A 3RLHA 4NG3A 3KDNA 2JEQA 4PB5A 3CBWA 4E38A 4W93A 4TQTA 3GXTA 3HIJA 3QW3A 1A47A 1DIKA 3T40A 2CKSA 1EOKA 2FZNA 3WDQA 5TAOA 3CH9A 3JRKA 1B3VA 3IIZA 1TMHA 4KH2A 1F76A 3SGGA 4TU1A 3GNRA 2H90A 4KFPA 4H4IA 1J6PA 3WELA 3KTCA 1WP6A 3EXSA 1EDGA 3APYA 1JPIA 3FDKA 4NZ5A 4C1KA 2A5HA 1MEHA 3DERA 4IJRA 2PF8A 5LGZA 3F7JA 2G5WA 4HIBA 2YBTA 2PA6A 2GGHA 3UG5A 1F05A 3BZGA 2Z6JA 2X0HA 4CVUA 4F0LA 4OZOA 3L5AA 3CUXA 5FEPA 4XAZA 5I79A 1GVOA 1LL4A 1JRBA 4AWEA 3B40A 3ARZA 1GCYA 1ZBVA 2J66A 4JL1A 3RMEA 4ZO9A 5A6BD 3CEPA 3BW2A 3K30A 4O8AA 4XWUA 4X9YA 4AEFA 4ASUG 3MJMA 1POKA 4ORIA 3LV5A 3WQOA 1EZWA 2E9MA 5M1TA 3N13A 2WKLA 2FKPA 4H8UA 2PTYA 3PZUA 2OU4A 3DG7A 5C55A 1P0NA 3CC1A 4RZ6A 3BLDA 3STGA 4NAFA 1XLKA 2CLOA 4IG2A 2PDJA 4HN8A 5LA1A 4NASA 5DCDA 3USZA 1O4UA 3RPMA 3BJFA 3J7HA 2EJAA 4JQ1A 4H3DA 1ZAIA 4MWAA 3RPDA 2NXGA 4ROQA 4EVZA 5IHSA 2E25A 1E6ZA 4ORMA 2CKRA 4ZTYA 2QCNA 1T8QA 5AC5A 3GDKA 5HANA 2HE8A 3BLOA 3LHTA 2B81A 2WKJA 4WDUA 3P81A 3GD6A 3PUDA 4Z2LA 4LRSA 1UR9A 1XDJA 1TSIA 3NIYA 3VFCA 2QPSA 3GX9A 5HNNA 3CAWA 3PF3A 3F5LA 1B3WA 2ZBTA 5IDZA 3RCNA 3KS6A 4Q8MA 4ADUA 1K02A 2ISSA 1ZJHA 4O1EA 2AKZA 4FA3A 4MVAA 3A6OA 4O16A 5L6UA 4XAGA 3KVKA 3M07A 4NILA 2J7HA 2A6NA 3WCZA 2ISWA 2NSXA 4C7FA 3D0CA 4RNIA 3W1RA 1UR3M 3A24A 4UCFA 3BV7A 3GHUA 5J5RA 2ZC8A 4WR3A 4HNOA 3JZUA 4MOZA 3A4XA 3PNUA 3D3AA 4GI4A 4QDMA 4RJEA 1QR7A 4E2DA 2F2KA 3ZT5A 1TV3A 1GYNA 5LYRA 4UCGA 4G7EB 5B7YA 2XH2A 4MDOA 2NXHA 4LALA 1HKJA 5K4XA 4YTQA 3TN5A 2BY0A 1PB0A 2BXVA 4UTWC 3RYSA 1JPKA 1BSIA 4M6QA 4IZGA 3ZJ6A 1JL8A 4DI9A 1MSSA 3UXIA 3VZXA 2BASA 2FJKA 3GNXA 5RUBA 1YADA 1US0A 1SO6A 5FL1A 2FDSA 2I9UA 3TYZA 3C86A 1CT5A 2CXEA 2Z7KA 1OADA 4MPQA 2PZ0A 3KBJA 2VQTA 2WSSG 3JR2A 1BVWA 2JKEA 1GKRA 1KLYA 3O6CA 2VGFA 1B3YA 1J10A 1KD0A 3T8LA 1Q6GA 4M29A 3AHXA 1M1BA 4PEEA 3LERA 5GJNA 4IF2A 4S3FA 3S6OA 2Z1KA 4MY1A 1W3HA 3P93A 2ZRVA 3W1QA 4AUBA 3U4AA 4AD3A 3TU9A 1RV8A 4XZWA 2DH3A 1KTBA 1SFSA 5CBIA 5CPQA 4JTIA 4P8XA 2WZMA 1BYBA 3B4YA 3QFEA 1TPH1 1XCXA 3LOTA 4AXKA 4D6FA 3RO6A 1MVYA 4GD0A 3C0SA 3QVQA 1BXNA 1I2OA 1IR1A 5D05A 3U48A 1WXYA 1KO0A 3ABSA 3KRSA 3CAQA 4DUVA 4GX9A 5BCAA 5ECVA 4R5EA 1SR0A 2YCKX 3G6LA 4B92A 2ZZ3A 1SU5A 5E93A 4NX5A 3Q94A 3QC0A 3WK3A 1EP3A 1A80A 3BOXA 2RJHA 3ZM8A 4LCSA 5I06A 3PVFA 5HMEA 2HCVA 2XVPA 1J18A 4KKXA 1I1WA 4H9YA 2DQXA 4UTTA 1FWFC 3QFWA 3ZWTA 1X8CA 4AAJA 1F73A 5HATA 4AIEA 1UKTA 3C4UA 4D6EA 1QW8A 5H8PA 2ZRXA 3MA8A 3QHOA 4O50A 4QITA 3PBYA 1M9HA 4QBXA 2XGZA 5HNRA 3U2ZA 1GVIA 5BWAA 2OX4A 1D7KA 3VGEA 4LCQA 2NQ9A 1UW9A 4UR7A 3H7RA 3OZMA 4C6NA 4AIBA 1ZGDA 3I3EA 4AY8A 3I6EA 3GW3A 4QJ4B 1EP2A 1D3CA 1S5NA 3UWYA 1L6GA 1O66A 1TQJA 1W5QA 5IM51 4Z1DA 3MYOA 4CQ9A 1HUVA 2ZICA 3ZLFA 4C91A 1FVPA 2V5BA 3IVUA 4HNLA 2O7SA 2NV2A 1TMQA 4N9EA 4TMBA 1RALA 3BQ5A 4FNTA 4Q8WA 1KM5A 1FP9A 4EK7A 2D0HA 5FJUA 4NNCA 3C0LA 4QISA 4DNHA 1QPRA 4CCZA 4YIWA 3LGEA 1K4GA 3FY1A 3RCYA 4KEVA 1UR1A 1HJQA 5DF0A 4MSSA 1X1NA 3QSRA 3BAWA 3OZOA 1HO1A 1RJQA 4Z17A 1AW1A 1VHCA 1XIEA 3U6WA 3W1LA 4S3AA 3PY2A 4ATWA 2ZRYA 3S5ZA 3B0PA 1B54A 4HJFA 4DWSC 1VAHA 1OC6A 3WENA 1VP5A 4PTMA 1JXKA 4ECLA 3HPZA 2POZA 3W7PA 4ZO6A 2OQHA 3DU0A 3VIPA 2CLMA 2XSBA 3P8JA 5HMSA 1QU4A 4ATDA 4QCEA 4EXQA 4UQBA 3HQNA 3N12A 4UQ9A 2QT3A 3CHEA 3B06A 3NO5A 3WN6A 4Z1YA 4HYWA 2O4QA 4LB3A 1KNWA 4ZXLA 3LEPA 1O60A 4RE3A 4G1NA 2GVGA 2MNRA 3WQ4A 4DJFD 4C6QA 3VI2A 3VD4A 2R1NA 2Y63A 1FHDA 4UTMA 3AS2A 4PMQA 3LBOA 2PGRA 3OBKA 3USBA 3CHVA 2AL2A 3RM9A 3W9ZA 4FS9A 1W3LA 4PSRA 4ZOEA 1A4LA 1GVQA 3GQYA 3RIKA 3C0JA 5M2FX 5A6AA 3EMZA 3QV9A 2CLEA 4PC8A 3KVJA 5XINA 4H9UA 4D9PA 4RNJA 4V27A 1QUMA 4W7VA 4DBEA 1MW3A 1FWSA 1HKVA 1MDRA 4ZXOA 3TFXA 1XLBA 3WQGA 4DB7A 3KW3A 3TYBA 2PURA 4MJ4A 1OFQA 3LX9A 1UZ1A 5K7JA 1R3VA 2QUVA 3NL6A 3RITA 1B4KA 3BARA 1GQLA 3WQWA 1X6UA 3B8WA 1VFTA 4CU7A 1FRBA 3VD7A 4WX2A 3LRMA 5BXSA 1ZAHA 2UY3A 1VIZA 4KFOA 1IXNA 4CCDA 4JS3A 1LWIA 2DZUA 3R58A 4LVAA 1W17A 4HSOA 4TX6A 3S9YA 5DMNA 1CEOA 2JKPA 1OFOA 4N02A 1KBKA 4HP5A 1SVDA 5I3FA 3LSBA 1DQWA 3VMPA 1G4EA 1XHGA 4FOKA 3DC0A 4KIRA 4M6PA 3SGUA 3MI2A 4QXIA 1VEMA 4DJED 3W2JA 3G1YA 1R3QA 5C9ZA 2FMOA 1JDAA 2ANUA 2HEJA 3VDGA 1QVBA 3WNMA 2G4FA 2UWFA 4HD5A 6CGTA 1H7XA 1TELA 1YYAA 2BS9A 2O9RA 1WDSA 2PCEA 2NQJA 3WD2A 2VZUA 5F2GA 4M56A 3PSVA 5BXTA 3NQMA 3VZYA 2VVNA 3V35A 3W00A 4JCLA 3HGJA 3W2LA 4D6HA 3NQVA 4YWIA 4ZFCA 4HN4A 4KEUA 4FXSA 5BMXA 3M0XA 3TN3A 4D6CA 3C6CA 2EPNA 4AD0A 4MWAC 4HCLA 4INFA 4IL2A 3VD9A 4PN2A 3VKDA 4Z08A 4FR6A 1BGAA 3SCTA 2C0HA 1YBQB 3FKRA 3DC8A 5EMYA 2NV1A 2D22A 3UD6A 3QR1A 2IQ0A 3R1ZA 3UGRA 2V2DA 2G3MA 1Y5XA 1SMAA 3R0UA 4OBTA 3BAKA 2CHOA 3SUWA 3T0AA 2ATSA 3AZRA 5JIPA 2OZTA 1XLDA 2ON3A 1GNXA 1JEZA 3WEOA 1LBMA 2E6FA 3GY1A 2CZDA 3GBDA 4AFYA 4FXJA 4W8BA 4ZL1A 1E0TA 1H7WA 4CQCA 4A8LA 3HJEA 1IHIA 2FDMA 3UNDA 4J40A 4AZ5A 5FA5A 3I7RA 4CEUC 4JKMA 4MB5A 4ML9A 1UP0A 4Z2IA 3WJSA 4C65A 1GZ1A 4PZVA 5H2ZA 5A2BA 9CGTA 1OK6A 1E56A 3JUGA 5AYXA 3PBUA 3NDOA 1W9DM 3VMNA 1DYSA 2A7PA 3N6JA 3AIQA 3ZJ7A 5HINA 4E4PA 2GGGA 2Q8ZA 5A8GA 3TIMA 4C90A 1BQCA 2HBVA 3W23A 4I5XA 1WQ5A 4JTHA 1EJVC 4H9VA 1J9YA 1BRLA 3WF1A 3FXYA 4FNUA 4ZB2A 3CMGA 1JDCA 3HMCA 3PUGA 2C91A 3DKLA 6XIAA 4US6A 1J6OA 4A2RA 3B9AA 2FHCA 4X9SA 3L5MA 2QJMA 2VRJA 4GFIA 3TNOA 4LVFA 2X42A 1ZCOA 4PMXA 2AQOA 3SJNA 4LF2A 3WG6A 3SY8A 1QW7A 3K1GA 1TZ7A 3LRLA 1MZRA 1E3ZA 4QE1A 2CHRA 1NJJA 4GC4A 2XVKA 3WK1A 4F0KA 1UD8A 1ME8A 2Z28A 1UZHA 1JULA 3LK6A 5KZDA 4Q4QA 1JUKA 4FNPA 4PA8A 3WJZA 4MIMA 3CO4A 2BFGA 2PD5A 5FKYA 1SZFA 2P8CA 5C2XA 1ME7A 1V7YA 4ICMA 3VA8A 3V5FA 1E4MM 2D20A 3VOHA 3I6RA 1WZAA 2Z27A 3N2XA 4PRWA 4CD4A 4I9TA 1QWKA 4WXZA 4HA1A 4DY1A 3F4CA 4HNNA 1VKFA 4B90A 3RN6A 3LLXA 4CD5A 3LPOA 2I57A 1ECEA 2CYGA 1W91A 3HZ3A 3ABOA 1EC7A 3LPGA 1K8CA 2W92A 4FOJA 4GIYA 3E12A 3TWBA 1PZ2A 4IH3A 4DPPA 4IJBA 1SZEA 2WZHA 3QHMA 3GXDA 5A94A 3W27A 4RZ5A 1OM0A 4C1NB 3ZT7A 5FL0A 3EB2A 1SZRA 1W1PA 1YXYA 4IUGA 1FWNA 4GYPA 1WZLA 4UTTC 3C52A 1TJRA 4F8XA 3UA3A 3A5FA 1OCNA 1K8YA 3PS7A 2JIZG 1D3HA 3B9EA 1HJVA 1P0EA 3QV8A 4MKSA 2QDDA 3EXTA 3UJFA 2CHNA 2XVNA 2WC4A 1P43A 4L1XA 3L2MA 1EQCA 3TQPA 1JCJA 3GHSA 2WLZA 1Q7ZA 3MT1A 2CFFA 2AQVA 4JKKA 1F8MA 2Z7GA 3L23A 3PWIA 4FP1A 1FWEC 4O53A 1U1JA 5FF7A 3T7VA 1UPPA 3QOKA 2HRWA 4QCFA 4HU3A 3NXFA 4ACZB 4C6DA 1TPUA 4ATLA 4BF9A 2J75A 1LOQA 4YU1A 5E09A 2CK3G 6PTDA 4JEJA 3T4WA 3WF2A 4LOCA 1N55A 1YXCA 4ZVJA 5KZEA 2CBJA 3N25A 3SCUA 2VDIA 1MQRA 2F6UA 2XIJA 5AHMA 4A4AA 4I9JA 3AO0A 1AL7A 1M3UA 3LU2A 2GDVA 4LEQA 5LIXX 4NF7A 3LS9A 2PC8A 4JTSA 1AZ1A 1O5KA 2C1GA 5LXXA 1O95A 3PG9A 5FJRA 3W3OA 3IJDA 3MKVA 3MHFA 2ODOA 3DI0A 3RFAA 3MQTA 4ERIA 5CC3A 1TVNA 2OG9A 3BGJA 3ID7A 2X1RA 4AZBA 2Y89A 4FAMA 2W9MA 3PAOA 3HPAA 3CIVA 3EB4A 3QH2A 4JQ4A 3UF9A 4ZO7A 2FGBA 5I09A 2BOEX 4AHOA 2C1IA 5A6MA 5LNUA 4WY0A 3HQ1A 1PS9A 2JKAA 4MPKA 2I56A 4HU8A 1Z9AA 5HJLA 1YNYA 2OYLA 2J7GA 1JCTA 4PODA 5D03A 4E3VA 3G2GA 3QLDA 2BGQA 3ABRA 2PLCA 3TCEA 3GFYA 3TC7A 1Q2SA 1DBTA 4M1RA 1GPWA 3KUMA 3UA4A 3STEA 4ZQRA 4GIEA 2E4TA 4YTRA 1EUAA 3W88A 4CNNA 3WJWA 3HB9A 4FNRA 2GQ3A 1H61A 4A35A 1S38A 3KTSA 2IXVA 1E6XM 2VX4A 3F5JA 4AX7A 3CL7A 4HZ8A 2VO5A 2E6DA 3GIQA 1ME9A 1W1VA 2EJ1A 1Y5WA 1ZBCA 1SW3A 3PJXA 5GJMA 1W0JG 2Z00A 4F2TA 3E2VA 1BYDA 5FL7G 3SN1A 3MSRA 1LUCA 2PWFA 4JDYA 3MYPA 4PFHA 4PMYA 3H4WA 1Q7MA 1KQYA 1DWHM 5AYBA 4MGGA 4FF7A 4WJEA 4G56A 5LIWX 3O06A 2ZA1A 1V6VA 2WVSA 4UFJA 1DJNA 3PK7A 2GUBA 2Y88A 4TMCA 8TIMA 3E5PA 4FLQA 4JBRA 3AHZA 3REQB 3E1F1 4PULA 4FSAA 2E77A 3NOEA 4XZHA 1DJWA 1MWOA 4OVXA 3SN0A 2VEKA 3WQPA 1EHNA 3IGUA 4PH6A 3KP1A 1NH6A 1YDVA 2QDHA 4H7ZA 2VX5A 2ZXAA 2V63A 3TJXA 4UTKA 3MVIA 1EGVA 3A9BA 5G1YA 2P3EA 1XLCA 4DYJA 4XVEA 4XIMA 4OTKA 3UZYA 3GC5A 1VPQA 4M82A 1ESWA 1EJ7L 4WKFA 1F6YA 3WBWA 3N2BA 3T08A 4O18A 1W31A 1PEZA 3FSUA 2YA0A 3V4BA 2GJXB 3GKFA 3I4EA 3L5LA 1XYMA 4MF4A 2R14A 2FVLA 3HTWA 1SGJA 4S3JA 5G2HA 1R2SA 2C16A 3L4TA 3I10A 2ZRZA 4X2PA 2QIWA 5BOFA 1QMLA 1K8ZA 1OX6A 2PGFA 2KZHA 2OOGA 2OSWA 4FZIA 2JIEA 2EPKX 2Z1WA 2EO7A 4IL0A 4NIRA 1YTEA 3EKZA 1IXPA 4G7FA 5HQLA 3OA3A 4HMEA 5AB3A 4US5A 2F8QA 4W4QA 4Z1CA 3CT2A 1FX6A 2BOGX 2D23A 1S5WA 3IANA 1Q6EA 4R33A 3G77A 2Q3RA 2VMFA 3GR7A 2A3LA 1RQBA 1XYAA 1O5RA 2OWXA 4GYFA 4IP7A 4ZODA 1DWAM 4CNSA 1EWEA 2B7PA 2CW6A 2WJZA 1IYXA 3V1PA 2YR1A 3RPTA 3CUFA 2NQ5A 1UPMB 4OECA 1HO4A 4LV9A 2X8RA 2ZE0A 1K9FA 1QWGA 2O55A 4JTJA 1JGMA 1F8IA 1XF0A 4GZIA 4H2CA 4DUWA 1OCBA 3MP4A 4K37A 1NFPA 1U22A 3UXDA 1QFEA 1I75A 3WH8A 3S5YA 1JZ7A 1OGSA 3A5VA 4JEQA 3VX1A 1DEDA 4PUMA 3V7PA 3O3RA 1RPKA 2Q8XA 1EEPA 2VCCA 4HNTA 2E7FA 3EWYA 4ZSTA 2YB1A 2DW7A 2J6VA 5U4NA 3K13A 2C14A 2J9ZA 3EX6A 4R3UA 4DX3A 3DFHA 2INEA 4RW3A 4AMCA 7XIMA 1A0DA 5J5DA 5D9MA 2X0SA 1PWLA 3NCOA 1KQZA 4RR4A 3FKKA 3LD5A 3K4DA 5A8QA 1CGXA 2X2YA 1TJ0A 3OZPA 1JCNA 2JQXA 7TAAA 7A3HA 3WMLA 1OT2A 1PIGA 1RY0A 1TRIA 2GL5A 1TUFA 4H9TA 1JRCA 1P6CA 1XL9A 1QJWA 2AAMA 1BVNP 3UJEA 2A2IA 3MHUA 4WXYA 4UMBA 2V3GA 3LLFA 3MMTA 1PDZA 3CNYA 4W85A 5D2XA 3TONA 4DYKA 3H55A 3T05A 2YCIX 4N4PA 4WKHA 3T07A 4V1YA 1FS0G 4JFUA 2E68A 3SADA 4OV4A 3WLHA 3MB9A 3AYVA 1K4HA 3D3FA 3FX4A 3OW1A 3BLIA 2HVMA 2Z2AA 4RE0A 3B8TA 4AH7A 2Q02A 1ZSXA 4MKVA 4AY7A 2C13A 3WO8A 1EO5A 3M5ZA 1C9DA 5AYIA 2WNNA 1B0IA 3FLUA 3LCXA 1OFBA 4B5NA 4I7WA 1UYQA 4NY2A