4HYWA

Pyruvate kinase (pyk) from trypanosoma brucei in the presence of magnesium and f26bp
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
498
structure length
496
Chain Sequence
SQLEHNIGLSIFEPVAKHRANRIVCTIGPSTQSVEALKNLMKSGMSVARMNFSHGSHEYHQTTINNVRAAAAELGLHIGIALDTKGPEIRTGLFGEVSFAPGDIVCVTTDPAYEKVGTKEKFYIDYPQLTNAVRPGGSIYVDDGVMTLRVVSKEDDRTLKCHVNNHHRLTDRRGINLPGCEVDLPAVSEKDRKDLEFGVAQGVDMIFASFIRTAEQVREVRAALGEKGKDILIISKIENHQGVQNIDSIIEASNGIMVARGDLGVEIPAEKVCVAQMCIISKCNVVGKPVICATQMLESMTSNPRPTRAEVSDVANAVLNGADCVMLSGETAKGKYPNEVVQYMARICVEAQSATHDTVMFNSIKNLQKIPMCPEEAVCSSAVASAFEVQAKAMLVLSNTGRSARLISKYRPNCPIICVTTRLQTCRQLNVTRSVVSVFYDAAKSGEDKDKEKRVKLGLDFAKKEKYASTGDVVVVVHADHSVKGYPNQTRLIYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title `In crystallo' substrate binding triggers major domain movements and reveals magnesium as a co-activator of Trypanosoma brucei pyruvate kinase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
molecule keywords Pyruvate kinase 1
total genus 182
structure length 496
sequence length 498
chains with identical sequence B
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4hywA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 4hywA01
1VP8A 3LG3A 3EOEA 1E0TA 1VBGA 3PUGA 1AQFA 1PYMA 1U5HA 1DXEA 1MUMA 3KTXA 3ME3A 4QG8A 3QV8A 2V5KA 2VWTA 2WQDA 3QTGA 3VAVA 1UJQA 1XG3A 4IP7A 3U2ZA 1A3WA 1A49A 3EOOA 4B2DA 3P0XA 2XDFA 3SRFA 3QZ6A 1PKLA 3B8IA 3M0KA 3T05A 1IZCA 1SGJA 2HROA 2QIWA 2VGBA 3EZ4A 1JDEA 3E0WA 1IGWA 2VGGA 1Z6KA 2HWGA 3SRDA 5TAOA 2G50A 1A5UA 4G1NA 2KX9A 1DQUA 3QV9A 2R82A 4L9ZA 1KBLA 1T5AA 2ZE3A 1A3XA 1M1BA 3EOLA 2XZ7A 1F61A 4KS0A 4KCVA 4L80A 4L9YA 4MG4A 3FA3A 4IQEA 4HYWA 1F3WA 2VGIA 4B5XA 4B5TA 2BG5A 1GGOA 4IQDA 2DUAA 1ZLPA 4DRSA 1S2TA 2V5JA 3OYZA 4WJ8A 1O68A 3QV7A 1KC7A 4B5WA 3E0VA 3IS4A 1F8IA 1U5VA 2XZ9A 1O66A 3H6OA 4B5SA 3HQNA 4YNGA 1E0UA 1S2VA 1M3UA 2OLSA 1ZJHA 4LSBA 4KCWA 3GQYA 1F8MA 1OY0A 1XG4A 3G2GA 3OYXA 3HQPA 4TV5A 4KCTA 3M0JA 1PKYA 3SRHA 2DIKA 2VWSA 3HQOA 4RPPA 3OQ8A 2HRWA 1DXFA 2X0SA 4IMAA 4QG6A 4YJ5A 4B2DD 4HYVA 1T57A 1S2WA 3FA4A 3QQWA 2VGFA 2HJPA 1F3XA 3LYEA 3T07A 1S2UA 4FXJA 3GG8A 4TV6A 1VBHA 4JPGA 5JVLA 3N25A 2L5HA 3GR4A 3SRKA 3KHDA 3T0TA 1DIKA 3R4IA 3E5BA 3I4EA 3BJFA 1O5QA 3BJTA 4QGCA 4B5VA 2E28A 3QLLA 3PP7A 1PKNA 1OQFA 3MA8A 4QG9A 4FXFA 4ROQA 4MF4A 4L7ZA 1PKMA 4KRZA 4B5UA 3QV6A 4KCUA
chains in the Genus database with same CATH superfamily
2FZDA 3CZKA 4H3DA 4UTLA 1VBGA 1XQKA 3MBDA 1QNVA 1IT7A 1HW6A 2DUXA 2XGBA 2CZDA 4J3XA 4AZCB 3CHEA 3VK5A 1BHGA 3W6MA 3FN9A 1SM9A 4W87A 1QRQA 3S2LA 2FTYA 4ZO9A 1LQ0A 2RDTA 1S2CA 1JGIA 4HGXA 2QDDA 5EMLA 4JTEA 5BU9A 3W7MA 2WZIA 2WCSA 3LDVA 3FYYA 4IQDA 5BCAA 3RPDA 2DUAA 1IT8A 3HQ1A 4CKQA 4RXGA 4PBFA 1E0UA 2FFIA 3W86A 4ACYA 1B5TA 3MUZ1 3AMKA 4TUFA 3N2XA 1YE6A 4XTIA 3MZNA 3AU6A 3U4AA 3GM8A 1Z41A 2XN1A 1EGZA 4LWWA 3B97A 3TMLA 4DZ5A 2YYUA 3MO4A 1BF2A 3CGTA 4MZ8A 2YA1A 2P53A 2R91A 2HCVA 3N25A 2WV8A 2E6AA 1ITXA 4FMVA 1BKHA 2FZNA 3N9SA 2YFOA 1NWRA 5HMFA 1TJ1A 1AQ0A 3CV7A 3ZXWA 1WXYA 5CC5A 2OFJA 2Q8LA 3A23A 4C7GA 1BSIA 1Q63A 4UTTA 2GQ8A 1VGAA 3PB0A 4F0LA 2PZ0A 2WNQA 1QVBA 3ABQA 3ZJ6A 1CGTA 2OELA 1RCQA 4JBRA 3E38A 1QASA 5D38A 1SUXA 4G9PA 1W31A 4BS0A 2KAUC 2E68A 1N82A 3WBWA 4AD3A 4J3VA 3UZYA 4YXGA 1NJJA 5G4EA 4PC8A 1KBLA 4O18A 4AZBA 4KCVA 3OHIA 1FWCC 3QRHA 4A6GA 3CIVA 1PDZA 1Q5MA 1FWBC 3CTTA 5BXTA 1AQHA 4XBJA 1VEPA 3TFCA 5A8MA 1C8QA 1F07A 4GZEA 1K6AA 1WKYA 2O9OA 4IGNA 4KCWA 3P2VA 3BSMA 4QROA 5DMYA 4X3ZA 4JGDA 2CITA 4XWUA 1RXOB 1MXDA 1XINA 5CAHA 4ROPA 1SZNA 4JL1A 5HMEA 1NIUA 1GTEA 2PF0A 1GPFA 1SQ7A 4PRRA 3SCUA 3W1QA 3AIRA 4YXWG 3JU2A 3SUSA 4IZGA 3TJXA 2XM2A 3WJZA 4TSFG 1KFLA 1AZ1A 1JIBA 1HO1A 1YTKA 2ZBTA 4DELA 1J10A 5AC8A 3G0UA 3BCJA 3AIQA 3KTXA 1JUKA 2Z1SA 4B91A 1UWSA 3B8VA 3RX4A 3BV4A 2EXOA 1JNEA 3REQB 1FH8A 2PDFA 3OBKA 3VC6A 4L1GA 3ZWTA 3BGGA 5D30A 3Q2DA 4Q8OA 1SGJA 3B03A 2IS7A 1Z6KA 5C71A 4WSHA 1HKMA 4ZQRA 4FEZA 4MG4A 1I1XA 2PTWA 4L9YA 1A4LA 3W53A 3R89A 3LBCA 5LGZA 1OFBA 4NP7A 2XFRA 5FIPA 4B15A 3T0BA 1KCKA 1KBKA 3THDA 3AO0A 3EKGA 4C5YA 5C54A 2PDWA 2WVVB 4K8GA 4YNGA 4JY9A 1AW2A 3ITXA 1C93A 2DT2A 4H19A 3Q94A 2PDKA 3GWQA 3ABZA 3OZMA 4E2OA 2ACRA 3GB6A 5M03A 5FF3A 1CCWB 3L7RA 1FWNA 4HK7A 3AWOA 3WQ4A 1XYBA 2HPIA 1AD4A 2WNWA 1HKVA 1F6KA 3QQ1A 2YOCA 3A6OA 1VFHA 3VIMA 3BMXA 3TTOA 1L0PA 4I8YA 3SUWA 3LV5A 2YLLA 3BV7A 3LZ5A 3E5PA 3H4WA 3UJFA 1UWIA 2PB1A 4UOQA 4IM4A 3WUBA 1SZRA 3PBUA 4FNUA 4CGTA 3WY1A 2WZTA 2QR6A 1YXYA 2V2HA 4DWSB 4Z1DA 5HDRA 1IF2A 4HHHA 4AD4A 3C2EA 3N9KA 1Q3NA 1QMLA 3HB9A 2ZX7A 2A7PA 2DZAA 3G8RA 3DFOA 2P0OA 1ZL1A 3N3MA 4K7YA 2DIEA 1DQUA 3I6TA 3OFNG 3AFBA 4E4FA 1W3KA 3GZ3A 4R3UA 2AKZA 3QVQA 3UXIA 4EK7A 6TIMA 3M47A 1S2TA 1A5SA 3BGAA 3FVDA 4O57A 3OG2A 5DXYA 3F2DA 3NSNA 1HJWA 4O15A 5ABFA 2A85A 5HXMA 2WVSA 2D1ZA 4HNOA 2YW4A 4I9JA 4ERGA 1XYZA 3V36A 1UUQA 5BYWA 4FNSA 1G4EA 4KEMA 3DFTA 2JFEX 1A5MC 3VYLA 1FWGC 4D9PA 1GJPA 5CPSA 3KL0A 3F4NA 3VGGA 3I4EA 4X22A 4RE0A 3TOPA 4IGSA 3UEQA 1JCMP 1XDMA 5I3GA 1UP3A 3TH6A 3W37A 4KEVA 3N6JA 1R9YA 4TMCA 3CAKA 7A3HA 4DN1A 5A6KA 3ES7A 4N4QA 3PTMA 3UZXA 4Y9PA 1QHZA 3KXQA 3LM7A 1UOZA 4NZ1A 5ABTA 3RJYA 3GAYA 5A94A 4GC4A 3UYIA 1K03A 1EA9C 2ZRUA 3THCA 3A21A 1IZCA 1CI1A 3V4BA 1A5OC 1VFFA 4DI9A 1TB3A 3AMDA 2WLZA 1F61A 1DP0A 5XINA 5DMNA 1RY0A 3KRSA 1JCLA 3SUUA 1JGMA 4WLCA 3AC0A 3MMUA 4MDOA 2VL4A 3LPFA 3B0XA 1DWJM 3BAYA 1MXSA 4H9TA 1FCUA 2GSEA 3MV11 3C6CA 3M16A 3B4UA 5BROA 2PWFA 3GE7A 4Q3MA 4A8IA 1H7OA 5HWMA 1XBXA 3BWWA 1G0CA 3SFKA 1V6WA 3M0ZA 2YL8A 1KBIA 4UCGA 3LPGA 5I79A 2E5CA 1E0VA 5EU9A 4KGLA 2NUWA 1WDPA 1WPCA 4DUWA 1BVZA 1XIEA 4RZBA 4MSSA 7ENLA 2PBOA 3HZ3A 4JAWA 5DFAA 4LRTA 2HE5A 2C0AA 4LCRA 3UNDA 3B8TA 3PHAA 3W7NA 2J7BA 4WJXA 5MKGB 3BLPX 3PANA 2VJXA 4J3ZA 3QFEA 1AJZA 3RMJA 2CBUA 2CBVA 4ACZA 4HSHA 2P1FA 3EOEA 4JNMA 1VJSA 4B3LA 5HR7A 1J9YA 1MDRA 3LOTA 1TTJA 3QGAC 4L1XA 4B3KA 2AMXA 4WEVX 3GG1A 4GKTA 3FDGA 2OJPA 3II1A 4RNHA 3QH2A 2OTDA 2FZMA 4ZOAA 1MWOA 4AWTA 1F2JA 3A24A 1HT6A 1FP8A 1HTIA 1W9XA 4GY1A 4BQ2A 5AC7A 2TODA 2WC7A 3ATYA 3R7MA 2OYLA 1LUCA 1PIFA 3W7RA 1JD7A 2E6DA 2E5DA 1K9FA 1IR2A 1ZJHA 4PMUA 2B81A 3RPMA 4MUZA 3FVMA 3BOLA 3LM3A 4ICCX 1GZJA 5A6BD 1TMQA 3QZEA 3CQIA 4Q7BA 5D2YA 2C7FA 1C9WA 1IIGA 3P80A 2R1KA 5FL7G 1PBGA 1XSKA 3TW7A 2Y89A 3KBMA 3W1NA 1EIBA 3CV6A 3BE7A 3DFQA 3HPAA 4MFEA 3H8AA 2X7VA 3KE0A 1GNXA 1PKMA 4DBEA 4Z1CA 1JNDA 1FWDC 1OWQA 3EGJA 1H62A 3N4EA 1JQVA 5JU6A 2IKJA 3EOOA 4IFKA 4CN1A 1SW3A 2AMGA 1KW1A 2Z6JA 1CT5A 1LROA 2DVUA 2VFHA 3T4CA 4UZSA 2V9DA 5TAOA 3EPMA 2DZPA 1NWSA 2E9MA 3NQCA 4H4IA 3NSXA 2BVYA 3KOYA 4HIBA 2BGNE 2VYOA 4JKMA 1WDQA 3IJQA 3BH4A 3VM7A 2FHCA 4O1EA 2OLSA 3GK0A 2FDSA 4QBXA 4IPNB 1IR1A 1O94A 1XH1A 4MWAD 2BXYA 4H9VA 3OB8A 1E79G 3RGTA 4FR6A 5TNVA 3SY8A 4K2SA 4JZ5A 3EX3A 3H23A 4R5EA 1VC4A 4NNAA 4TOQA 2DU2A 1XLDA 1H0GA 4UC5A 1OABA 3MY9A 1O6IA 2DT3A 4DY1A 1R0MA 4JIQA 1GVYA 1D3CA 4W5ZA 1C90A 1QBAA 4O11A 1KKRA 1UJPA 3EX1A 1B3WA 2ZDSA 1B3ZA 3AHTA 4ZVJA 3U4FA 3VNJA 1HP4A 1I0BA 1QAPA 3GXMA 3VNDA 3ARXA 2PAJA 2CLHA 1VYPX 2WYSA 4GX8A 5H8PA 4UQEA 4IP7A 1EX5A 3QMTA 4Z2IA 3BANA 2P88A 1E40A 2XTKA 2PDNA 1ZU8A 4JTGA 1XDJA 2YA2A 1B90A 3GIQA 3W85A 4WOZA 1RLDA 1RHCA 1HP5A 4Q8VA 1X97A 3LGEA 3S46A 5E93A 1MQPA 3R43A 1M7PA 3IVUA 4Q4PA 2IQTA 2NQZA 2QMJA 2OWXA 2DZWA 2Q01A 3S6TA 2YCJA 4RZ5A 4HN8A 4LV4A 2EQDA 2C1HA 2I1OA 5GQBA 2VUNA 1A5BA 4NAEB 4PSRA 4DWSD 3UZ5A 2W61A 4JTHA 3NOEA 5A8QA 4B2DD 2NVDA 5CLWA 2V5DA 3LA4A 5A5WA 4MNJA 1KRBC 2A6NA 3I3BA 3LNMA 1Q6GA 1M41A 2GJRA 3NO1A 2CBIA 1ICQA 1CYGA 3BLDA 3IJ7A 1E9LA 2HPMA 1XW8A 2I7GA 2WPGA 4HVXA 3RF9A 2HZGA 4HNVA 1ADSA 2CLKA 1EC7A 1I75A 3T0CA 3AXMA 5IFPA 3R94A 3QC3A 3NAVA 3A9BA 4CCCA 1NP0A 4OV4A 4QAIA 3I3DA 1W32A 3O2LA 1UHVA 2QPSA 1FH9A 3K13A 4YLWA 1PPIA 3TDFA 3ANVA 1A5NC 1P48A 4G1KA 3APTA 2WBGA 4C6FA 2INEA 2JBMA 1LOLA 4E3VA 4JL2A 3A4WA 5IDZA 4B90A 1LT8A 1H50A 1ZJAA 2WZEA 2E4TA 1ZBWA 4S1FA 2ZVIA 3E2SA 1UUOA 3KW3A 4O0KA 1EO5A 2PTXA 2XFFA 3GDRA 3IRDA 3AJXA 4FO4A 3V1PA 2CCRA 3FOKA 5HMSA 5T91A 1OGSA 4A8RA 3KWXA 3HQOA 3CZGA 1EPXA 1Q7QA 4WDTA 4HZ6A 4DO6A 2G0WA 2Z1WA 3ABRA 2FKPA 1TPWA 2WZMA 4S23A 3L23A 2ZX8A 1KXVA 2VHLA 1EJ7L 1KM4A 5C9UA 1UROA 2HBXA 1GW1A 4HZ8A 4FXJA 4AQLA 1CIUA 1RBLA 2D73A 1W1B1 3WFZA 3QYQA 1FOBA 3VDAA 3W23A 5J04A 2A3LA 2VCBA 3GVQA 3GS6A 5A2BA 1RBOB 1CXKA 4XKYB 4N9BA 3BQ6A 4AMCA 1A50A 2YGYA 4Y7EA 3AS0A 4HA4A 4UQDA 3IJ6A 2GVLA 1IT0A 3N04A 2XVLA 2WOQA 1HQTA 2NWRA 1RLCL 3P0XA 3W38A 2ZC8A 3QW4B 1IXNA 3WDIA 2PDMA 2QF7A 4KEZA 2VGBA 4OECA 3AHVA 2ZA3A 1G7UA 4Z1MG 1G4TA 2YDQA 4DUXA 3N34A 1E56A 3I3EA 1H7NA 2VZOA 3MO7A 5D05A 3VC5A 4ZZ9A 3E74A 2PZNA 2V3DA 1JCNA 1EHNA 3USBA 2I5IA 3M0IA 5HK4A 1ITUA 2WJEA 3L68A 3VX1A 2WVTA 5FEXA 4GI8A 1V02A 1M9HA 2ZZ6A 3B0PA 5FEWA 3PUEA 3ABXA 2Z0IA 3ITCA 3ZM8A 4ZCWA 2DY3A 1NU5A 1DEDA 3NQEA 5FAGA 2VURA 4JD4A 3BW2A 3FXYA 2JIEA 1GQIA 1R9ZA 3HBLA 3BDKA 3BL3A 4S3AA 1S2UA 2V2DA 3M4HA 5A6JA 2BDQA 4GYKA 1DIKA 2AKMA 1LORA 1V3KA 1GKQA 4GQRA 5I3HA 1W37A 4P7NA 5DN1A 3WF2A 1R7OA 3ZJ7A 1JZ3A 4GZIA 2XVKA 3COTA 3N73A 1HVQA 4K36A 1SJDA 1EJUC 4H00A 4O1DA 3W71A 3ZYZA 4M19A 2OB3A 3WD4A 3K4DA 4ILSA 4AVOA 2CPUA 3QZ6A 1QWGA 3BGJA 3TNOA 1JYVA 1FWWA 1W5NA 3ITGA 4A3RA 3NPXA 1ODZA 4H83A 2OT1A 3RX2A 4QR6A 2V38A 1XDLA 3UZZA 1UD3A 1F3TA 5IBXA 1HKKA 5CXPA 4LAOA 2WMHA 4WHBA 1NDVA 3RLVA 1R3YA 1XH2A 2XZ9A 3VDCA 3H6OA 4BQ3A 3BK0A 4AZHA 3JS3A 1ZB5A 4Z0JA 4YCPA 4WY0A 4A3UA 1JFHA 3C0JA 2XN0A 4LCQA 4AAJA 1EJWC 3T42A 4DXKA 1GKPA 1TFVA 4O13A 1GJWA 4YTTA 1BAGA 2FZ8A 1UB3A 1AW1A 3AS1A 1H51A 3ARVA 3SN4A 2XIIA 3LI0A 5AHEA 2QJMA 4CQ8A 2G3JA 1LBLA 4KFOA 4FOJA 1FH7A 3WQGA 3UXDA 1RK5A 2NXGA 4WF7A 4A4AA 1NOFA 2ZUMA 4HMCA 1RA5A 3RLGA 1KCXA 3WN6A 3O06A 4NAEA 4U4MA 1W2PA 1XR2A 4ZQPA 2GOKA 3LG3A 1WUFA 4E8DA 2VWTA 4F3HA 1PE1A 4PTWA 4H1ZA 3ZLGA 3MKVA 5A2CA 1NDWA 1O5KA 3SADA 3IJIA 3NQGA 3W87A 4ORMA 2WQPA 4RW5A 5JBDA 3FYOA 4FX6M 2CXEA 2VC7A 3FFSA 5I06A 4WOQA 1SR9A 3V5CA 5EMMA 1F9CA 2ATMA 2QEZA 4MY1A 3TJIA 3V7PA 4GQ0A 2W0UA 3CT2A 3FKRA 4GIAA 3FJNA 1MQRA 4C6MA 1W6TA 3CHVA 3OYZA 1FWHC 5DBUA 3W84A 2NSOA 2CBJA 3UF9A 3SCPA 3C2VA 3VOHA 3EDFA 4PL2A 3RM4A 2C13A 3NFUA 1R7AA 4JFTA 1OY0A 1FXQA 5EFDA 2QDGA 3HMCA 4CD8A 3W1MA 3NVDA 2OG9A 4U31A 1OIFA 3GBDA 3GH4A 1W9PA 2H3DA 3BAXA 4EX4A 4DB7A 4YJ5A 1NDZA 2CC0A 4DZHA 1IEXA 4M80A 1LM1A 3LSCA 1JULA 4MY8A 2FVMA 2F6UA 2YCLA 3GC2A 3LNPA 2QYGA 2F84A 1MSSA 4V1YA 3QC0A 1ELSA 4MTVA 4LS0A 1WDWA 2TAAA 5CJMA 3QKEA 4B5UA 3AMCA 3VIOA 4V33A 4GK8A 1L8NA 1E5JA 1W56A 2G3MA 4PMQA 3GLCA 4C6PA 1G5AA 2CWXA 4PTDA 4Q6JA 1MW1A 1XIFA 4YS1A 4QEHA 4XD5A 4Z2GA 2VQTA 2YBUA 1S1PA 2XH0A 3PBWA 4NF7A 1XC6A 5E5CA 1XYLA 4UOJA 5K9DA 3WQCA 2E5BA 1XPGA 4UXDA 3VD3A 2PWVA 3ZVIA 1DWGM 4A2RA 3GXFA 3CPGA 1QPKA 1RJRA 3UP8A 3CMJA 2WO5A 5T9BG 1MUWA 1FFQA 1KGXA 3CL6A 4L64A 4O1CA 1YTDA 3LS9A 3RM9A 3BURA 5CLTA 3MANA 2QQ6A 4YTSA 4XSLA 4IF2A 4FOUA 1H4PA 1TPFA 1YW1A 4H6EA 4RPQA 3UCDA 4AY7A 3VGEA 3AIBA 4H2CA 4RNIA 4LVAA 5D2XA 3THQA 4IQLA 4QLKA 2C3ZA 1F3XA 3O0KA 5DCEA 2OZ8A 4JTLA 5EBAA 4ZOEA 2IXVA 2J78A 3EWCA 4KEUA 5F1UA 2PFHA 3VZYA 3GDTA 4AYGA 4OIFA 1M7JA 3N2OA 3F2BA 1PKNA 2PGWA 1PVNA 1BQCA 3B05A 1UH4A 3RIKA 3N29A 3MSGA 4OGZA 3HFTA 1UC5A 3O07A 3QR1A 3WMSA 2H90A 3VAVA 4KKXA 1B4KA 4E4UA 4RKAA 3WKZA 1E0WA 2BP1A 2IPJA 3NZ1A 2G95A 3MP5A 1NQKA 3APGA 1XIJA 4S3FA 2WLYA 3CC1A 4CCDA 3NQDA 5CC7A 2Z24A 1FY6A 1OGGA 2I9UA 4O28A 3V0UA 2KX9A 3UJSA 2WM0A 3A5VA 4UTJA 2XZ7A 3W7LA 2YL9A 4HNLA 2V5JA 1TG7A 2BXZA 3YPIA 3C2OA 3CZLA 1FWFC 3VIIA 4LF2A 4UBPC 4HHLA 2CYGA 3W7GA 3P74A 1XLCA 5FJIA 1BXNA 1Q2SA 2XVGA 2ICSA 1RVKA 1SW7A 4ACZB 4KT2A 1GOXA 5E1QA 1HO4A 1MEIA 5A6TC 1B9ZA 2POZA 6XIMA 1DXFA 4D8LA 4AEOA 5EMUA 4HYVA 3LHUA 4RUBA 5AYZA 1SFLA 2EKGA 1LWHA 3GU2A 5I03A 2D0FA 5JVLA 2WW5A 3LCGA 2R24A 5KZDA 1TPEA 2AOSA 5LIUX 2IKHA 4L65A 5CZSA 3SCQA 3W7KA 5LIWX 3WDPP 4AC7C 3PK7A 5G2WA 3BQ5A 3U7BA 3MI6A 3P5ZA 3VIFA 3EDDA 4GINA 4BEUA 2OMAA 1N8WA 4MPQA 7XIMA 3NQMA 3EOSA 4HMNA 5CSSA 4DPPA 4Q4RA 5LIKX 4JQ2A 3ARZA 4AD0A 5LKYA 1F73A 5CG7A 3AHXA 5DXXA 3WH5A 3PUDA 1JDEA 2VDIA 1TVNA 2VD9A 1BFNA 1E6ZA 1EEPA 2WMIA 1X39A 1TVLA 5HQEA 1LOQA 4ZR8A 4OZOA 1XV8A 1K6WA 1XUUA 3RMEA 4OUEA 3BJSA 1TZZA 2B0MA 3TIMA 3TJ4A 1WDSA 1T7LA 3RLHA 1G7VA 1R38A 4WKAA 5C5YA 1UKPA 2D0HA 3V16A 2CHRA 4L9XA 3KZPA 3KBNA 4GABA 4XIMA 5JMUA 1TSIA 1MNSA 2TYSA 1OX4A 3PWIA 2X09A 1BWKA 5T9CE 3TROA 4YTUA 3EKZA 1WBHA 2V30A 3IIZA 3BG9A 1KXHA 2OOFA 4N2YA 4K1GA 1DJHA 2IQ0A 1T8QA 4JPGA 2PGRA 1MFVA 1WX0A 4HP5A 2XIQA 1TCMA 3UXAA 1NSJA 4U5IA 4IICA 3O16A 4XZHA 2R94A 2FB2A 5A2AA 3T44A 3WEOA 3OVRA 1C92A 4HZ7A 3GRIA 3CUIA 3RN6A 3UGRA 3V0TA 2GJPA 1VP8A 1HX0A 4NAFB 2VEIA 1X7FA 3OVPA 4AZ6A 4RLIA 3KEHA 3Q65A 4PCSA 1W9DM 1G67A 2Q8XA 1UMYA 3L12A 3OTRA 1GVQA 4JTIA 3OO2A 3TW6A 1ALDA 1H8EG 1UWUA 1C8XA 3BAIA 3GDMA 3WG6A 2PDXA 3BLKA 3L4VA 1UKQA 5HUPA 1JYNA 1CLKA 4JICA 1WB0A 2FVKA 4B3ZA 3ZWSA 4DWSC 3S2CA 1JXKA 9XIMA 5D9NA 4B92A 2ALRA 3IS4A 3TQ0A 2A7NA 3SGZA 4ADTA 4LNCA 4HT3A 1XKJA 4GMEA 1YQ2A 3PZVA 3P8IA 3SCSA 3TXZA 3O63A 3R0KA 2YL6A 1FWIC 3M0JA 3SIZA 4AWEA 4HB7A 1R3RA 2DZBA 1CB2A 4AW7A 4HSOA 3GYCA 4YVVA 2PDLA 4HHPA 3EB3A 4M7TA 2Y0FA 4NJGA 5K9CA 3QQWA 2JKEA 1W54A 2DH3A 1BRLA 2YB4A 3EEZA 4MPKA 3S3GA 4AZ5A 3OVQA 3DERA 3DEQA 5JBEA 4IL0A 3WF4A 2ZZ7A 3DYMA 5EKYA 4JEJA 2PDJA 5F2MA 3GU1A 4CVUA 4MJZA 4MYXA 1WOAA 1V0KA 3STFA 3K4AA 5D9PA 1OJXA 2VCAA 2Q09A 3SUVA 2J47A 2XSAA 3CL7A 4CQAA 1F3EA 4F8XA 1NTHA 1GHSA 2X41A 2IQDA 3DHPA 4IPIA 4W9TA 4ZQMA 3IK4A 2HMCA 2Z25A 1OC7A 2NV1A 5LHEA 3CLWA 4LS1A 4M3PA 5A8PA 1DHKA 3VTRA 1ME8A 3T8QA 3VI2A 1ZAIA 4JYDA 1V4YA 4BJHA 4J3WA 4LAZA 3OIXA 4L4OA 3T7VA 1J4EA 2XIJA 1SJCA 1P0EA 1LL7A 3AZTA 5A8GA 3REQA 1GK8A 1XYAA 3TCSA 1DWAM 2R6OA 5LZLA 4MNKA 2BFGA 3EDJA 3L67A 3HQPA 1E51A 5FJJA 3POCA 6REQB 4R85A 4LU0A 1R8LA 3HPXA 3IGHX 2R1NA 5EYWA 3H7UA 1TX0A 3NYDA 2X1TA 3ZMRA 3ARSA 1Q7MA 1XKYA 2WPDG 1KBBA 3PJTA 3IK2A 1O7AA 2CLFA 4GO8A 4CVWA 5BMWA 4Y90A 3KL3A 2XWEA 1B57A 2X8RA 1JZ7A 2D0GA 1B3YA 1VFSA 1GZGA 1DJYA 1SZFA 4BQ4A 1R2TA 3PN8A 3G1DA 2G3IA 4TVCA 3TC3A 3NQVA 4GQGA 4HTBA 2QGYA 3W27A 1BD0A 5REQB 4Z08A 4XVEA 3EDKA 3WNOA 1UD5A 1WXJA 3C52A 1LYXA 2HEJA 1KFCA 1UW9A 1QNOA 3QV9A 2R1LA 4BFAA 1KA9F 1K7FA 4A3HA 4MLJA 1J2WA 4UR9A 4Z1AA 3OZYA 3VD4A 4ADUA 3F7JA 3WD1A 3Q67A 3UBPC 4DRSA 2V63A 3SN0A 1V3LA 4UB9A 1EJTC 3KTCA 3M46A 4XBKA 3T1GA 5D02A 1S2VA 4YVPA 2QCNA 1REQA 3RDKA 3G24A 2OGYA 3AAGA 4I9TA 1BYBA 4IIEA 3GVRA 2VEPA 1E9ZB 3DIPA 5JBFA 1QWKA 3PB2A 3VFCA 4QXIA 1VP5A 4J28A 1Z69A 1EZ2A 4HJWA 1RJQA 1UA3A 1VYRA 5BW6A 1X38A 3CH9A 3OLGA 4ASTA 4JN7A 5KSWA 4A2SA 2B7QA 1U1HA 3UR8A 1YMYA 3K1DA 3NZPA 4XZ9A 4EANA 2V67A 4K37A 4PMXA 1KFBA 3RCMA 1XS2A 2B4GA 4BF5A 4AEEA 1IXOA 3GVVA 3NL6A 3UQNA 1S3TC 3B40A 1GUVA 1UG6A 2XM1A 1NWTA 4JTJA 3B9EA 3D46A 2DQWA 2NT1A 1H2JA 2PDYA 3LEPA 5CPOA 2HSAA 3WLRA 2BWGA 2VRQA 1F5ZA 4ZQNA 1P5BA 1BWVA 3UJRA 3VO0A 2GSJA 1AL8A 1UR9A 2QXWA 1OFQA 4LUSB 3M6DA 4ZXOA 4Q4MA 2JGQA 3STEA 4JIPA 3B8SA 2GUYA 4AG0A 5C2XA 1TX2A 1ZQ5A 5FF0A 1DBTA 3UZJA 2PP1A 2P8BA 1HFBA 1PWMA 5KEZA 1JDFA 3HPFA 1M7OA 2JIWA 4W8BA 5HATA 4R9XA 4H7CA 3E2QA 4IMEA 5JH1A 5FL1A 4PA8A 2ATSA 1TCDA 5DT7A 3AROA 3VINA 3PWAA 1JG9A 3IANA 3TU9A 5A69A 4WDUA 3WBEA 5FEPA 2ZCGA 3GDBA 2YDAA 1OBAA 2O9TA 1SFTA 4PMOA 1DPMA 1X8CA 1TMLA 5AHMA 4TV6A 3GVGA 3KM8A 1F6YA 1HL2A 1L2UA 3LTYA 3L2MA 4FLSA 1WZMA 1JL8A 4U5KA 3LGGA 1VZWA 3UPBA 5A95A 4N02A 3HN3A 1T99A 1TZ9A 2X7WA 3CEUA 1OC5A 3G1FA 5AYIA 3LXBA 3E96A 4JFWA 4CUCA 3WK0A 3WX7A 1V3HA 4NX5A 4ZOCA 1DVJA 4L1WA 1DORA 1W5QA 1VYSX 4NZ5A 2Y85A 4WGHA 1THFD 2PI6A 4XD4A 1XIDA 1JZ5A 2AAAA 1UPPA 1UKOA 1J0HA 3WQFA 2QVHA 3EDEA 3GC5A 3W01A 4NZ4A 4O8AA 2BY1A 2CKRA 4S2CA 3KS6A 1A5UA 4DF2A 4HU0A 4GHRA 3EAUA 2C6QA 3QOKA 3URBA 4AIOA 4NZJA 4F4RA 1YYAA 2JDIG 1Q85A 3M0MA 3N6QA 1A0EA 4S3GA 4JYFA 3QF0A 3QMSA 2XHYA 1XD0A 2XIBA 4C6KA 3I7SA 4BHYA 2DIJA 1LP6A 2YDSA 2W63A 4S3JA 4D6IA 5LNSA 5A6AA 3URAA 4NJJA 5FL0A 1V6YA 4H6QA 1BSLA 4DZIA 2J88A 2VRKA 3I68A 2J9YA 4DUVA 3VGBA 2PP0A 2INZA 2QV4A 5F4WA 1W1VA 3CBWA 4IG2B 2GJXB 4OOZA 4GUFA 5KZ6A 5CCZA 5FI8A 3ZQ9A 4PH6A 3C0SA 1MW3A 1OD0A 4J2MA 1LT7A 4GGHA 4J9JA 1JXJA 1G4PA 1ZCOA 3VKDA 3QV6A 3ZS4A 1H60A 4YPJA 1PYMA 1S5WA 2OZ3A 1PHWA 1EF2A 4IL2A 4U3AA 3G1VA 1GQKA 5CSUA 3PPHA 3SQLA 3E02A 1GQNA 4FA3A 1T41A 2CFFA 4G7EA 4US6A 4FIRA 3BVJA 3VKKA 3SCNA 3MPGA 2ISFA 1WDDA 1BG4A 2QUMA 3MMDA 5K4XA 3ZT7A 4KH2A 3OZPA 2PGEA 4LVDA 3W7CA 5LGXA 3BZJA 1WO2A 3WUEA 1E0XA 3OW1A 4XUGA 4QE1A 1UD2A 3O05A 1PIIA 3EA1A 1AJ2A 3G18A 3G1SA 4H8VA 2GDUA 3STGA 4PE8A 3GD6A 3ZLFA 1B3VA 1NEYA 4IGMA 1H7XA 4AIBA 4IPJA 1YRRA 2HVMA 4Z0SA 3RJXA 1KQYA 4LANA 1JZ6A 4HJFA 3KS5A 4JTTA 1FRBA 2VT0A 5E09A 4LUTA 4P8XA 4UQ9A 3VFLA 1J12A 3NGFA 2HK1A 3G2GA 3IIOA 3NR0A 3VUPA 3KP0A 2OLHA 1D2KA 3O15A 4TV5A 3CUGA 1RBAA 2C1IA 3GKAA 5HJXA 4MHBA 4S3KA 4GISA 4GQBA 4WD0A 4X0VA 2BASA 4C60A 3IGXA 3E0IA 1PX8A 2EJ1A 2HNEA 2ZWZA 4C5ZA 3CPUA 5DMLA 1UC4A 2Y7DA 1DQXA 4CQBA 3IGSA 4FHAA 3PY2A 2FJKA 4PUEA 1OZMA 1B3OA 4EXBA 2DZVA 2V5KA 1TJ0A 4LUIA 1Q4NX 4Q4QA 1VB9A 3QW3A 4I5RA 3LX9A 2QCGA 2JGYA 1KGUA 3E12A 3IAQA 3BAKA 3ZZ1A 2PP3A 3UR2A 3MJYA 1R3QA 4HKPA 3LHVA 4FOKA 3ZT6A 5DN6G 2WKGA 3L4XA 1QCWA 4WK9A 4DLMA 3C8FA 1TJPA 5JXQA 1NFGA 3WDRA 5CPQA 1EPVA 1TUXA 2ZXQA 5F7UA 4TX9A 1ZSXA 3DFNA 4LAUA 1I2NA 6A3HA 2WKJA 5M1TA 1UKTA 3HGJA 4LW7A 5U4NA 1GOMA 5H8MA 4D2JA 4OKDA 4I7VA 4CN4A 4MJ4A 1Z89A 2DIKA 5BRBA 3LQLA 5IBXC 4GYPC 5HWJA 5GVJA 3M0LA 4WY0F 3USZA 1V51A 4LB4A 3GNXA 1QI2A 4UTWA 4Y2WA 2A5HA 4H01A 3IIVA 5B7ZA 4KETA 3WQ5A 1OG6A 1CZ1A 3NZRA 2F2KA 4I9AA 3LMZA 3CAQA 2W66A 3KWSA 1P0DA 3C86A 1QI3A 2OODA 1HGYA 2V2CA 4XAZA 2OEJA 4J1OA 1FWTA 2J9ZA 3MZ2A 1OFRA 1XUZA 2Z1VA 3WFLA 4DNMA 5EFFA 1UZDA 2PE4A 2EG6A 1BVWA 1IEVA 4BWLA 4D6CA 2VX7A 1TTPA 5AZ0A 4HU4A 3PC0A 3PZNA 1VR6A 1LQAA 2PLJA 3TX9A 4B5NA 1CXHA 2GK1B 2VEGA 1M7XA 4AHPA 3TSMA 4MZ1A 3G5EA 1VEOA 3HG2A 3S83A 5HINA 4KS0A 2CKSA 3N12A 3PFMA 4JDBA 2QNEA 3DZ1A 1VEMA 3FKSG 1E9YB 1RP8A 3DG6A 3VIGA 3QV7A 3SO7A 5AYYA 3FAXA 5IM51 3P67A 4X63A 2VXNA 4TVDA 3QKZA 1ZENA 1CBGA 1E6XM 1TYGA 4EPKA 4YYFA 3FLUA 4MMWA 1P0KA 3CPRA 3P6LA 3NTYA 2DORA 1RJPA 3EWBX 5F4XA 2VMFA 2Y24A 2Y4SA 2EPLX 4GXWA 2CLOA 1PJ9A 4NY2A 1XLFA 2PPGA 1XISA 3W7QA 3V75A 3B8DA 1EHAA 1MRQA 4DZAA 4TVUA 6REQA 3MVIA 4IMFA 1OX5A 2DSKA 2Y62A 4KPLA 1EF3A 6TAAA 3W7JA 2Q3RA 1QO5A 1MRAA 3FEQA 4QG9A 1AA1B 2BB0A 4JN8A 3UU0A 4JHMA 5LNUA 1B9BA 4PUUA 4G2DA 3GDLA 3TN3A 2ZRVA 3SECA 3P8JA 4ML9A 4NZCA 3SEPA 3NM3A 3TA6A 5A6BA 3OP2A 1EDTA 4GOAA 1E4IA 2W5FA 5BZAA 3IUHA 2Z7GA 3VM5A 4C65A 3ITYA 3GAKA 3TONA 3IACA 2I5GA 4DVOA 1PS9A 2ZDRA 4V27A 1TPB1 4C91A 3S9ZA 3VMOA 3M0XA 5HOSA 3KP1A 3AYTA 4FX8A 4DM2A 5CPNA 4JIRA 4MKNA 1PSCA 3NQ7A 1LDCA 1QNSA 3QOMA 1UZHA 2OPJA 3E2RA 3MCOA 5C7VA 5C55A 2B31A 1Y8BA 3FJ4A 4N42A 4EXAA 1RV8A 4O19A 4EKJA 2HNHA 4FS9A 2WXDM 1K9DA 4LC6A 1VQTA 4GC3A 1TJ2A 4YWIA 9XIAA 1OEPA 1S39A 3VD5A 4HTYA 3W1LA 4BCEA 4QHRA 2PD5A 3JZEA 3UPWA 2JF6A 1WDRA 1RALA 4EAYA 5JIPA 4CQCA 4DQWA 2VVNA 3E6EA 1MEWA 3E5BA 3MS8A 3IIPA 2JE8A 1TVPA 3C8NA 2V5CA 2X16A 4RZ6A 5GNXA 1K8XA 1N8IA 2GOUA 3RCYA 4UTWC 3EMZA 4QFUA 2X2YA 2E1WA 4RCXA 2VOMA 3HURA 3WF0A 5DY3A 1BGGA 1E0TA 1YNQA 5MHBA 3EWWA 3WLNA 1DIOA 4KWWA 1QOXA 3T0DA 2WWCA 4F0HA 3L5MA 3NGJA 5L6UA 2NUXA 1TWIA 4WY0B 1M53A 3IAPA 5ENLA 2VR2A 4ZFCA 4H7ZA 4O17A 1ISVA 4G1NA 3SSZA 3RM8A 2XPKA 1EZWA 4ZB5A 5D37A 2DUZA 4NAFA 4BWLC 1O4UA 4KF1A 3STCA 3TQKA 1TIMA 3B8WA 3ARPA 1EP3A 2WCGA 4B5WA 3N4FA 1CGVA 4G5DA 1TWSA 2CIPA 2J8FA 1US2A 4EE9A 4C6NA 1H63A 1HL9A 1ZP3A 3GR8A 3RR1A 3M0YA 1GORA 2ZZ3A 4GWEA 4DX3A 2C14A 1US3A 1K77A 2J77A 1VRXA 2ZOXA 5FESA 5PTDA 1P7TA 4QM1A 2PLMA 3DOPA 1JVNA 2DDXA 4IMDA 4U33A 2NT0A 3OEHG 4AWSA 4GZ7A 3CB8A 2AL1A 1W3IA 1ZUAX 2J13A 1XIBA 3HMJG 3MSDA 3M5VA 3RPTA 4W85A 4K7VA 1ODUA 4N9DA 4MB3A 3KLLA 3U2OA 2P5NA 3R5EA 1B31A 3OBAA 4FAMA 2BY0A 1JZ8A 1S46A 5C9RA 3N9RA 5I3FA 5M3WA 3UESA 1EC8A 2C8NA 5I3IA 2W3ZA 5AN7A 2PA6A 2X30A 2J9XA 1CENA 1HJQA 4UFMA 3U9IA 3TOYA 2WK2A 1Q7ZA 1UPMB 3QR0A 1R3VA 4F0MA 2BOFX 1K1DA 2OYKA 2YJQA 4YWSA 4C6QA 5AB3A 2BHUA 2QZRA 2J7HA 2W62A 3VDBA 1AZ2A 3K8KA 5E70A 4ZSUA 1MYRA 2ZZ4A 1R2RA 3CIXA 1I60A 3U48A 1GWJA 3G6MA 3TYAA 4C7DA 1LTDA 2GGEA 3H12A 1MO0A 1FDJA 3WMBA 4NJHA 1KNWA 3GDKA 4M8UA 3ABOA 1KM3A 1TA3A 3WYZA 3KBWA 1Q6RA 1TKKA 3CL8A 1OT1A 2EPMX 4XD3A 3WQPA 1PX4A 3L0GA 2OLAA 4KRTA 1U5JA 1W1ZA 1LWJA 4XKYA 4V15A 4UMBA 1TUFA 2NX3A 3W81A 3R10A 4AEFA 1T40A 4H2HA 3TN4A 4AVFA 2G96A 4FPSA 1VBJA 1V6VA 3LHYA 8CGTA 2Z29A 1P6WA 5AHIA 4C6OA 4O53A 3LXAA 2NV2A 5AC5A 3T0AA 3AYRA 3IGUA 3INPA 4B2DA 4ADSA 2XVNA 1SFJA 2FPTA 4DJEA 4TX8A 4UQBA 4Z2LA 2QCDA 3RX3A 3LRKA 5I0DA 4TR9A 1I0DA 3A3HA 3MUY1 3TC7A 1CLVA 2CESA 5HNTA 1OVDA 3F03K 3GFYA 2DW7A 3PSWA 4L80A 4YCOA 2R8WA 1J8VA 5A8OA 1FWRA 4GVIA 2VFDA 3CV1A 3VIJA 1WKFA 4Z17A 1ECEA 4AUBA 2FZBA 3PTKA 5I23A 4WQ6A 2CNCA 4PCNA 5CGMA 3CUJA 3WLJA 4DI8A 4Y9NA 3GXIA 1ZBCA 2D24A 3NL5A 2WHLA 3HA1A 4PCPA 1EWDA 3KOWA 5KITA 3AIVA 5C9ZA 2ACQA 5A3HA 1EWEA 4W7VA 3N14A 1DJWA 4IWWA 3B0UX 4ZTXA 3T78A 3PVFA 1DIDA 4IT1A 5TD4A 3AZRA 2PU1A 1EA0A 3QLDA 4PZVA 2GQAA 3OOQA 4O0ZA 2H3BA 3GSMA 4GGBA 2A0NA 3BSHA 3WNLA 3SCRA 1OCQA 5DF0A 3OGVA 1LJYA 4OE7A 4AXNA 3BC9A 3CQ0A 3T2OA 3MA8A 4NG3A 3SCVA 3W3OA 2QS8A 3EX4A 3T9PA 5FJTA 2OSXA 3A3WA 3EKLA 1GVEA 3DX5A 2VFIA 1ONXA 1U22A 5IHRA 5EA9A 5FSDC 1XLGA 1OFAA 4IP4A 4ALDA 3O6DA 4UNKA 1V79A 3GFXA 1MW0A 1T5AA 4YHGA 3NCOA 3AJ7A 2PODA 3A22A 2Q02A 3FA3A 3GTFA 5E0KA 3GUGA 3RAOA 3OPSA 2YCEA 2QUNA 2ZUNA 5DBTA 1W3LA 4R53A 1XLAA 4MDPA 4PTNA 3LD5A 5AKQA 1TV4A 1E4NA 2HBVA 5K2ZA 4HNNA 4QITA 1VCGA 4M82A 4Q4SA 3QEZA 3SZ8A 3S9YA 1TE6A 2RUSA 1ZFJA 4NNCA 5ABGA 2GYIA 4DLFA 4PRTA 5CKSA 3GNNA 1OINA 4Z1BA 3QSTA 3W7EA 2DSVA 1RUSA 4B4HA 3MTWA 3LGDA 1W9UA 4V1XA 1V3MA 3RR4A 4DNHA 2OO0A 4NRRA 3R4IA 4E2DA 3GTNA 4UFJA 2RGLA 3H2MA 1PYFA 5D33A 1UR4A 1KKOA 1E4MM 2ZADA 5D04C 3EPOA 3ONCA 3DG3A 4U2YA 3OJGA 1EBGA 1Q6LA 3R25A 3UWEA 5FOOA 2HE8A 3PG9A 3CIWA 3NA8A 4ZSTA 1PTDA 3MU7A 1LRNA 4DBUA 2ISDA 1D3GA 4FP1A 1DKWA 2GJLA 2PSNA 3UWQA 2WCAA 4F0SA 4UTFA 4JNZA 3LN3A 3MKKA 2J75A 2NVAA 1GOQA 4XAPA 5C9XA 4X2RA 3NSMA 2Z28A 2V7QG 4DUOA 1OHLA 2WC3A 1GCYA 1WOBA 4QDWA 3FY1A 3VMNA 4LTSA 4K8HA 3LSBA 4RK8A 3QPEA 1AUSL 5DMMA 3BXWA 4EPBC 3LBMA 2FZ9A 2J62A 3JVAA 3SQSA 5I00A 1VF8A 3MYOA 3MHGA 4MB4A 4LPCA 2QUTA 1DTUA 1KCLA 4H41A 3AS3A 3S5SA 1SO4A 3B0YA 3ARWA 1H5VA 5AHFA 3T2QA 5CH9A 4G8TA 3SJ3A 3PJWA 1E3XA 3N2TA 4G6CA 2B7NA 3MDUA 3U2EA 1LWIA 2OWCA 4D71A 2F2HA 2E40A 3PWGA 4F9JA 1V7AA 4LB3A 2VKZG 3UWYA 1W5OA 3HGSA 1TRIA 4JEQA 4JQAA 1SW0A 1V03A 3UCCA 4DO5A 1KO0A 4M81A 3AISA 2VEFA 3TLLA 4CD6A 2P76A 1UWQA 2PTZA 1D7KA 1UWAA 1Y5VA 3B3DA 5K4ZA 3AS2A 1H7PA 4CNPA 1S2AA 1PL9A 1P4CA 1GVRA 1QNPA 3VA8A 1ZBKA 4L9ZA 1R85A 4RX0A 4ZO6A 4WCJA 4IIHA 3DCPA 2C15A 6ENLA 3LB0A 2JALA 2W6IG 1D8CA 1MFUA 1WZLA 4XV0A 3Q37A 1VAHA 1V77A 2D69A 2CXGA 1M6JA 1F74A 1JI2A 1VKFA 3CHCA 4QJ5B 3LTSA 1YPIA 1SJAA 4KFNA 1LBMA 3G1XA 3VOCA 2VWSA 3W4RA 4MZYA 8A3HA 1H0IA 1RD5A 1GYNA 1JCXA 2D2GA 1QATA 3GG7A 2HJPA 1VJZA 4LV9A 3KOFA 4ZBCA 1ONEA 3CO8A 4XKMA 4WDWA 1YLVA 3GUWA 1SO5A 1K8YA 4O1BA 3M9YA 5AVNA 1BGAA 2JJ2G 4S3DA 3EXTA 4Q4KA 1XH0A 4N0RA 4XZWA 2GUUA 1Q66A 3P93A 1VFUA 3UA3A 4BF9A 3UD6A 1EKOA 1CECA 1IYXA 4WSKA 2WQDA 2QF8A 4CD5A 4HA0A 4HPGA 1GVOA 1ECQA 1SMAA 2BMBA 4DF0A 3VNYA 3F4CA 2VVSA 2WSYA 3CHFA 3F4WA 3HO8A 4CNNA 4EWND 4W88A 1DJGA 1HJSA 1MQQA 2VQUA 4KIEA 2INFA 1K9TA 2V8ZA 1EGVA 1K9EA 4CEXC 1XBYA 1CW2A 3HG3A 7TIMA 3IARA 4YU1A 4IIDA 1KWKA 1S5MA 4MNMA 1QPOA 3NUKA 5DRCA 2X0HA 3NXLA 1MZRA 1XM3A 1XSIA 2QDEA 3T09A 1FQ0A 1YDNA 1JCYA 4OJYA 2GSHA 1J0JA 3L2IA 4PUMA 4GYFA 1YXDA 1DJNA 4GFSA 3W1UA 1ZPTA 4LOCA 3QHOA 2UY3A 3G0SA 4MUPA 5LXEA 2D3LA 4TTUA 3WLPA 2QVNA 4KW2A 3AUJA 4I6VA 4GIEA 1FHLA 4R9OA 1QUMA 1DJIA 3ECQA 4LBRA 3MCNA 1A0CA 1C3FA 5J5RA 4QCEA 4QGCA 4Q32A 4NASA 4HU3A 2FDMA 3A12A 3RK8A 2X1UA 1H1ZA 4GUHA 1IXPA 1LOSA 4P8VA 1WAWA 4MFDA 4O54A 5H2ZA 3BMWA 5CQ1A 3W88A 2EPOA 4CNOA 4DJFC 2QCEA 1HGWA 3VIPA 4HNCA 4AU0A 2I57A 1BPLB 4I5UA 1XL9A 3KCJA 4CEUC 2DZTA 1L2QA 2HROA 4F0KA 4FLQA 3GZAA 2HWGA 3AIWA 3FJLA 2C18A 4DF1A 3BCFA 2ZRYA 4JTKA 2ZQ0A 2ABBA 5FF2A 3T40A 4CQ9A 1GW9A 4JKLA 1UBSA 2PMQA 2OEMA 1MDLA 2RDXA 4C6IA 4GX9A 1JYXA 1SVDA 2E6YA 2TSYA 6ALDA 3DC0A 4GJIA 1M3UA 1OG0A 3M6YA 4JFVA 4H9UA 4GACA 3LCWA 4W4QA 3EA3A 2C79A 1W91A 3R8HA 4AHOA 1I8JA 2YR1A 4DWSA 1ZZMA 3EEGA 3WLKX 4WDXA 5FKYA 3FYPA 2V5LA 1VCVA 3TTEA 2C71A 4Y8FA 3O7UA 1B0IA 2WJDA 5ECUA 4WSJA 2YSWA 2Z2AA 3P5YA 4XBSA 1TTQA 1OSEA 1OYAA 1W0JG 1DWFM 3C2YA 3Q45A 2J4GA 3UY7A 4H8NA 4B4FA 3WD2A 3TYBA 1BKSA 3D3AA 3QGVA 4UMCA 5G4WA 1ITCA 4IX2A 1JRBA 4A22A 3TTSA 3HIJA 2XOKG 4AYSA 4S3CA 3VIHA 1X6UA 3ME3A 4JN6A 4WIWA 3QV8A 5LNRA 1ONRA 3RRXA 1L9WA 3G0XA 4LF1A 2DP3A 1NF0A 4IISA 3UA4A 4EOUA 3W1AA 3HJEA 4LVFA 4ZMGA 5LYRA 5I78A 4QNWA 2EJAA 3DH7A 4PUDA 3VDGA 2GQ3A 2VZVA 2WVVA 4OU1A 3VVGA 1K8ZA 3VGFA 3H24A 1GYMA 3CMGA 3ARUA 5CZTA 1F05A 3UNTA 3HG5A 3A9IA 1EQPA 1XBVA 2HTMA 3NL2A 4RV8A 3EWUA 2C1GA 4FLOA 4WRHA 4MADA 4AXKA 2UY4A 4PTMA 1TPH1 2OZ0A 5HAOA 5I77A 4M5PA 4UIOA 3RU8X 5TIMA 4JOMA 1UQYA 2WSKA 3OQEA 4O4VA 3U57A 3AOFA 1GQJA 3QBUA 2GDVA 4G7FA 2SFPA 5AYBA 3RRAA 3W83A 1NELA 4QSFA 1BXBA 4HPXA 3W07A 1KGWA 1O5QA 4J5NA 1W17A 4C6JA 4B5VA 1VFLA 4L61A 4V28A 1GKRA 2E9LA 3T2PA 1OQFA 3F1QA 1GG0A 3WLMA 4HN4A 3GNOA 3ITOA 4L6HA 5AZ1A 1FWAC 3XISA 3WLSA 4GUJA 1U83A 4H9XA 3TAKA 2VC9A 2DJLA 4K6AA 1ITQA 3C2FA 2Y88A 1DQWA 3BTNA 3KX6A 2C16A 1XRVA 3BPWA 3LLXA 1XRSA 1TV3A 3PZTA 5CEWA 3W7PA 1Y5WA 5C6MA 3M0KA 1XSJA 1XIMA 3IV3A 5L9FA 1FS0G 2E77A 3GNDA 1QW8A 7TAAA 1T57A 4MVAA 1NY1A 4HPNA 3G1HA 3UERA 4DO7A 1TV8A 2OSYA 2ZRXA 3GFZA 1U5VA 1CB7B 1X96A 4LUJA 1PDYA 3W72A 1GTHA 1RCOB 3EWDA 4M6UA 3U6WA 2QT3A 4HQVA 4FK9A 4G56A 2FLIA 3B0VC 3Q4DA 1QTWA 2ASHA 4P5UA 4MNLA 5KZEA 4KCTA 1MNZA 4NQ1A 5DCBA 3WF1A 2HRWA 1CEOA 1BF6A 3VD7A 2H8XA 2WWDA 5FJUA 2QHAA 2FFCA 1BWLA 4YMZA 3BO9A 1W1TA 3TFXA 3ZIAG 1IZJA 1TIWA 2VZSA 4ZENA 2YPIA 7REQA 4IJRA 4GRSA 3K8MA 2V81A 3NQFA 4JNYA 1OK4A 3CNYA 3WQDA 4HD5A 3EB4A 4GA8A 4O16A 3DFHA 5G5IA 4QG8A 5CZKA 2J6VA 4U3CA 3PPCA 3W1TA 3N15A 3MVTA 1WP6A 1XLHA 1EJRC 3WDJA 1V6XA 4C90A 4QJ1A 4Z42C 2A79A 1XLKA 1TV2A 1LG2A 3C2RA 4FSAA 3CEPA 1QHOA 4M1BA 3RXZA 3E0VA 2PCEA 1PWLA 4C7FA 5I02A 3FNDA 2FHBA 1VD6A 1JAEA 1IGSA 3K46A 3AWNA 1ISZA 4L56A 3UZWA 4A05A 4TIMA 3LZ3A 1QR7A 2ZUSA 3S1GA 1XLBA 3POHA 3AYSA 1SSDA 1TZ7A 2RH9A 2YXOA 2BGQA 4Q4OA 1EXBA 2EGZA 1QNQA 4WXYA 4DYEA 1KRMA 2FGZA 5I09A 5G1TA 4AZ7A 1Z8AA 4IIBA 4Y8EA 5A6LA 1C91A 3T08A 1QK2A 4PYSA 4DJFD 4F0RA 1F76A 4IGHA 1DE6A 3E2VA 3LUTA 2CZVA 4ERAA 5BXSA 3FV9A 1A5CA 4HPJA 1PXGA 1O60A 1ZALA 3N2BA 3G1AA 4AH7A 4IJCA 1W2VA 4FXFA 4LUSA 2IUZA 2UY2A 3PBYA 3F5LA 3VILA 1W8SA 3WLIA 3H70A 1W9VA 1ZCCA 3H2AA 4J3UA 4UTKA 3W2MA 1E6QM 3TXVA 3RFAA 4NI8A 4WKFA 3MC5A 2EPNA 4NVTA 3LLDA 4KIRA 3C4UA 3O6AA 2QE7G 1HKIA 1H41A 5CGQA 3TUUA 3N1AA 4FR1A 3L66A 3EYPA 1GQLA 3XIMA 4MB5A 4Y9OA 3AU2A 4D6DA 2YIHA 1S38A 4GBDA 1OT2A 1KD0A 3LHZA 1F3WA 1HIZA 3FHQA 4HNTA 4INFA 3L4ZA 1A53A 4O0QA 2X1SA 5HWNA 1FP9A 4F2BA 2A3CA 3BAJA 1IEWA 2PWHA 4RR4A 2OO6A 3R6IA 3NQ6A 2ZWYA 3DUGA 4AD5A 1JCTA 3KBSA 3WF3A 1E72M 1EQCA 4UWMA 2EKCA 1FKXA 1FHVA 2RDWA 4OBTA 3QGKC 3N2CA 2GL5A 2BVWA 3CH0A 3V1HA 3S1XA 2E7FA 4WGXA 1Q6DA 5ABFB 2YYTA 2NLYA 2J25A 3KHDA 4C1NA 1S1RA 1YDVA 1Z7AA 2ZTJA 3ITTA 3WK3A 1OADA 2DZXA 5AYXA 2WHMA 1J0IA 3TQVA 2AGTA 4X60A 4RDVA 1VJIA 3FS2A 1PZ1A 2VR5A 3AUOA 1XD1A 3SAZA 4Q33A 1CXFA 4NL1A 2FMNA 5CPTA 5EPDA 1J0KA 3VUSA 3SCOA 3WBXA 1TQXA 4FIQA 2XU2A 1OCJA 3URNA 4CNUA 2J8GA 1VFTA 4GY7A 4B9YA 4PRWA 1FTXA 1YEYA 3RNDA 3P7YA 3LCFA 4RZ4A 3QJAA 2A21A 3OODA 2VOTA 3VKJA 1XP3A 1GONA 3M5ZA 2CERA 4O50A 3MUAA 3H7RA 3ERPA 3RO6A 3VIKA 1QPNA 1EH9A 4LX4A 4Q7IA 3W73A 2HVNA 5HULA 3WUFA 4BQ5A 3IVSA 3EBVA 4UFLA 3I6RA 2XGZA 1B1YA 3UXKA 1M04A 4IJBA 1B2YA 3M7WA 3PNZA 1NFBA 4F9DA 3UG5A 1W0MA 4GVHA 2BOGX 3TSDA 2QJIA 1XCXA 1GEQA 1YBQA 3CQKA 4OWGA 3F4VA 1UH2A 3Q58A 2Q6ZA 1C7TA 3TWBA 3MWAA 3UCQA 4JTAA 1KR1A 2DH2A 5CJNA 1RA0A 3SCTA 4P7OA 1E71M 4OBRA 1LRTA 5C2GA 4ZQCA 2HDJA 1AODA 2Z6IA 5CJ5A 3CV2A 1PCKA 2V0TA 4TTGA 2A3EA 1VIZA 1Y5XA 1PO9A 3QPZA 1VHNA 1OCNA 5DEZA 2IKGA 3DENA 3VCRA 3KVJA 3VNLA 1G69A 1E1CA 3W7HA 4N4PA 3CUFA 4LVBA 3O0FA 3OE7G 4QIUA 5CPLA 2A3HA 3M41A 5KZMA 4LUTB 2G3FA 1OFPA 3C3UA 3TLQA 1UWRA 4B16A 3VD9A 3WNKA 2GPTA 1CNVA 1XGZA 2RJHA 3I65A 2VGIA 3C3NA 2BG5A 1E70M 4JIEA 3PBMA 3SY1A 4GXMA 1E43A 2H9AB 3M5XA 1EYEA 5HNNA 1E4LA 2OCZA 3P3BA 1OC6A 2J8TA 3FK4A 2WJFA 4LNYA 1LG1A 2AQOA 3GXDA 1OFOA 3FA5A 3NQBA 4H9ZA 3W24A 3ITLA 4CD4A 2OQHA 3GXPA 2XG9A 3ANYA 4AZIA 1EOKA 2XFWA 4RPPA 2C0HA 3DKLA 1U2YA 8XIAA 2ADAA 2PURA 4C6DA 2NQ9A 2QPUA 4QE4A 3FA4A 2ZX5A 2HK0A 4JTCA 4MGGA 3PAJA 3PR2A 1VLIA 3DESA 3JW7A 4GE8A 3VOIA 3MMWA 1YTEA 4KMQA 3ITVA 1HNYA 1V02E 2QCHA 2IPWA 1W1IE 4LBSA 4MF4A 4LGXA 2GGIA 4UR8A 3SRFA 1R46A 1HJUA 1AQFA 1RCXB 3LI1A 4QS5A 1JPIA 1SYTA 1A4MA 1H1NA 1GEHA 2ZXDA 1A5AA 2QW5A 1BTCA 2D22A 2FTWA 1DE5A 2VC5A 3VNMA 3TCEA 1FWJC 4X9YA 4E8GA 2Y2WA 1H1YA 1QBBA 2HXTA 3WQVA 1K4GA 5E0CA 4GXPA 3L0NA 3NQ8A 4PMJA 5DX7A 1UMLA 3UG8A 2QAPA 4PCFA 1GGOA 2YXXA 3S2MA 1HF6A 2G41A 5HANA 4HYRA 3EX2A 4NT0A 2XH2A 5AOUA 3M43A 4FNRA 3IRSA 4GJJA 1N55A 2PDUA 2I17A 5BWAA 3GXTA 3JZUA 2WMKA 1JDAA 4LYPA 4E3TA 1MEHA 5M17A 3VPLA 3DHFA 2VFEA 3T8LA 1GVIA 4ZGYA 4O52A 5DELA 2QCFA 3DECA 4YTQA 2G37A 1VH7A 1XGDA 2Z26A 2JJ1G 3EB2A 3N19B 2EF9A 4L6OA 3GR4A 4QLLA 5EMKA 4R33A 1TPDA 2PU0A 4HCLA 2O56A 1MW2A 3PZUA 1MUCA 2EBNA 1UP0A 3SI9A 4TQTA 3EXSA 1R87A 2GQ9A 4IUGA 1WAUA 2F38A 4NIRA 3EX6A 3SQMA 4S39A 1UJQA 3VOJA 5D9MA 1EOMA 4AD1A 1PTGA 2GVJA 3BG5A 3PULA 4P61A 1YNYA 3MI2A 1KFKA 1GOOA 2PDGA 4L6DA 1HXJA 1UR2A 2CLEA 5A6MA 5JQ9A 4GIRA 1PCWA 4EPEC 3TYCA 2HISA 2R82A 4RW3A 1L6YA 1A3XA 4PMYA 3THAA 4HYWA 3K8LA 4PB3A 3MWCA 2QJJA 4I7UA 2WKLA 1V93A 4MB1A 3DAQA 3QR3A 3WH6A 5CBBA 2JIZG 4ZO8A 3SURA 1ADDA 3WLHA 3AICA 2RHGA 1KB3A 2D2OA 4K38A 5BOOA 2ZIDA 1Q2RA 1VPXA 3CXOA 2CW6A 1SZGA 1AD1A 4QX4A 2AL2B 3LV6A 3BARA 3OVGA 1R86A 1D3HA 2QJHA 3R12A 4ERIA 4S3BA 3P82A 4H8UA 3FIGA 3VOFA 1A5LC 4IPPA 4GNKB 4EIVA 1OK6A 2RGMA 2GGJA 2Y5JA 1TREA 5CAKA 2O92A 4F2TA 1JJKA 2YZ5A 2BHZA 1XLMA 4AD2A 5DQPA 2ISWA 1QPQA 4AB4A 3L65A 2A2IA 4Q8WA 4LQ1A 2ZE0A 3MT1A 4IUOA 2XFYA 3SDOA 5DCDA 1X6LA 3JR2A 3SRDA 1KFJA 6XIAA 3EOLA 4J3TA 1JYWA 4LALA 4H6KA 3HJZA 3IUDA 1K4HA 3VMPA 4GKLA 5LHFA 2XIOA 3GO2A 4AY1A 4X9SA 3KHJA 2VO5A 1F4AA 2JEQA 2FPYA 1DTNA 3DKJA 3PUOA 1RP9A 2VRJA 1JDCA 4NHVA 4QDMA 4DBSA 2RFGA 4OOUA 1XLIA 1GG1A 2I5QA 1JR1A 2FVLA 1KTCA 1E6PA 1RR2A 2OR2A 2UZ9A 3H2CA 3L9CA 4AHQA 5F2GA 2YXGA 3T07A 3UY8A 1X1OA 3UVIA 5H6HA 1KM1A 2DPEA 3DYOA 4JTSA 3NZGA 3WNMA 3PP7A 1QW7A 5IXEA 3H54A 4MY9A 5LA2A 1NWUA 2BNJA 4GVFA 1H5YA 4FNTA 1EL3A 2AAMA 2WJZA 3L4UA 5FJRA 1KV8A 3DBNA 5C2CA 3L5AA 1X98A 2Z2UA 3GVWA 3KLKA 4C1KA 3BLFA 4MM1A 3M7SA 4R7JA 4D6FA 1QU4A 3A4AA 4DXXA 2CZ5A 3PS7A 1R3TA 1RAKA 2Y7EA 4P8WA 4B5TA 2XVPA 1XIIA 3I6EA 3L2LA 2PBGA 1UIOA 3CHDA 1B30A 2VDGA 2F9RA 5DRIA 2ZZ5A 3RUBL 3ALFA 5KINA 1RVGA 4DAFA 2P3ZA 1J0ZA 2PDIA 4L4LA 3GC4A 4KGJA 4JY8A 2DVTA 1AW5A 2W79A 2WPBA 3PAOA 4UMAA 4K8EA 1A0DA 3CWHA 2GGHA 4IFRA 1Z44A 3NEVA 3H4XA 1V0NA 2FB3A 3UXLA 5HMDA 4AF0B 3LCIA 2DVXA 2OZTA 3P62A 2ON3A 3ZT5A 1IZKA 5EL1A 3A5FA 1AVAA 1S3HA 2DW6A 2X40A 2GK1A 4QLJA 2MANA 2WAGA 3H53A 2NX1A 4ROQA 4XZMX 5DANA 1FXPA 4GLEA 3WQWA 3A3XA 4E38A 4PR4A 2QV5A 3S1UA 1L8PA 4Q8TA 3PG8A 3FGCA 1G9HA 2A3AA 4RXFA 1Q8JA 3W6YA 3U2ZA 1TJRA 4A35A 2Y70A 3CMFA 3G8EA 2E25A 3CB3A 2CZFA 1H11A 4ML4A 1WYIA 4HZMA 3MUXA 4LH8A 4RJEA 3UFYA 5I24A 1JPDX 2H6RA 3LU2A 2W91A 1IGWA 8XIMA 1J96A 4J4KA 2VFFA 2PUZA 4DJDA 5SWUA 1G4SA 1M65A 4JDYA 1XCWA 4H8HA 4JQ4A 3NZQA 1ZJIA 2ZX6A 4QCFA 1GOWA 2XGIA 2FIQA 3IJDA 1NQ6A 1NH6A 4D72A 1ZS2A 2HQAA 2YBVA 3AALA 4XZNX 4U2ZA 3N17A 3KOZA 4IMAA 4ENLA 1Q6QA 1V3IA 4P8UA 4ICNA 4PTXA 3DDMA 3VCNA 1R3WA 4LYRA 3NL3A 3U8GA 1FBAA 3LYEA 2A6LA 3ENLA 2GVYA 4UTUA 2VZUA 1AK5A 4GUIA 3EWZA 4QNEA 2AL2A 1V08A 4MOZA 1UASA 4W89A 2ZUTA 3OBEA 2J27A 4MIMA 1P1MA 5GNYA 4POCA 2W67A 3QY8A 3VZXA 5LXXA 4LVGA 1EIXA 1EB3A 2O7SA 4ZQOA 4LCSA 5HQLA 2YL5A 4NKCA 1LLWA 2OYMA 2A4AA 2Q71A 3QTPA 4CNSA 2VDHA 4PFHA 1R30A 3R13A 1X1NA 2Y8VA 1IV8A 1EDQA 4HMEA 3V0SA 2CEQA 3M44A 3OEEG 3W1RA 1CDGA 2XH7A 3EWYA 4PBGA 3BCDA 4GNVA 3AMGA 5FEZA 3NG3A 5B7YA 1IWBA 3CM4A 1XIHA 3SR7A 2QCMA 1J2BA 1O66A 2FJUB 4IIGA 3H2OA 5HR6A 2FGLA 4Z1YA 4CU7A 4XB3A 2FH8A 1CLXA 2PD9A 4J3SA 4QQ3A 2J7GA 1W9BM 5BOFA 2EEXA 4IX0A 2BY3A 2P10A 4Q7NA 4NZFA 5D8WA 2VR4A 1PX3A 4S38A 4GQQA 3W22A 4JX5A 1VFMA 1BRLB 4D1IA 3P60A 3SUTA 1EP1A 1DJZA 1KBJA 2PEVA 3K4WA 3J7HA 3KVMA 3T4WA 5AC6A 4GCAA 1CPUA 2Y6ZA 4D8AA 2V3FA 4ZO7A 5TQLA 1DOSA 3UYCA 1AH3A 4H04A 2NWSA 3ORWA 2J66A 4GYPA 1HJXA 3FDKA 3ARYA 3CZEA 2VX5A 1QOPA 2Z27A 1GVSA 2WC4A 1QI4A 3SW6A 3PPFA 1H09A 4JHZA 1OYBA 1LBFA 4B9ZA 5H91A 1X6NA 3C0QA 3TTYA 1TO3A 2F6KA 1JFXA 3I7QA 4EPDC 1P6CA 4M6VA 1RQEA 5IHSA 1QHPA 3EWXA 3LCHA 1RPKA 2OVLA 3MCMA 1YNPA 3K1GA 4K3ZA 2NXHA 3TN6A 1QFEA 4PUJA 1EFZA 1XF0A 1GYLA 3B9AA 3KVLA 4ATDA 1ZAHA 4BK9A 5FAJA 1FHUA 4J40A 3SB0A 2AGKA 2ZFAA 3CYVA 3KVKA 1PAMA 1DJXA 2AQWA 1ICPA 4REQA 2EG7A 3U3HA 3HQNA 3PTQA 3SGUA 5CG0A 3SJNA 3KTSA 1KRAC 4BEQA 4CU8A 4QSHA 2HV5A 3S1WA 3I7RA 1YPFA 1JDDA 3UPMA 1DWHM 1XX1A 1DL3A 4UNLA 1ICSA 1MXGA 4PEKA 1JPKA 3W02A 1WV2A 1XWYA 4RNJA 4LEFA 5CBJA 3MSYA 1TV5A 3B9OA 1ISWA 3ARRA 3LMYA 2L5HA 1GHRA 1RD6A 2Y61A 3NWRA 2DT0A 1YKWA 4L4PA 2O9PA 3SFWA 1HZYA 3QLLA 3GBEA 4GI9A 2B7OA 5FJPA 3W28A 2ANUA 4MYAA 1WZKA 1FUYA 3B9DA 1VFOA 2XIMA 4ZB0A 4Y96A 2GZXA 4XQ6A 1U1UA 3A4JA 2DEPA 4E5TA 3MP4A 5I7GA 3AHYA 1B54A 4DHGA 4F40A 1W3NA 3W2UA 4Z2HA 4C6EA 3VNZA 5C0QA 4WVXA 3LENA 2NQJA 3ZSTA 2G50A 1QDSA 2VC6A 1EJVC 2NXIA 4ZXLA 1KXTA 4B5XA 1D7FA 2PWUA 3PSVA 4CU6A 4W8LA 1GOIA 2WSQA 3P0WA 1KTBA 1O68A 1TR1A 4HCDA 1Z48A 4W93A 9CGTA 2FHFA 1AH4A 3IJLA 1XYMA 2YDRA 4GI4A 4PULA 3URQA 1US0A 1VS1A 2X1RA 1CXLA 4O1FA 2W92A 1V0MA 4AY8A 3ABSA 3GIYA 4GY0A 1WKDA 4MAZA 4O10A 1XRFA 3TWAA 2YA0A 4PTVA 4EF8A 1IQ8A 3DG7A 1ZP4A 4RNFA 1JZ4A 4ZE5A 4JCLA 5BMXA 1JZ2A 2NW0A 1W5PA 4N9CA 2E6FA 3CUXA 4O1AA 4QJ3B 1Z32X 3CLMA 1J5SA 5LNVA 1ZBVA 2XSBA 4OTKA 4FF5A 3W00A 1TWWA 1XFBA 1OFDA 1SPQA 2ALDA 3SM0A 2PDCA 4Q6XA 4ONVA 5D2VA 1R6WA 2TRSA 3AI0A 4LS2A 1FCBA 3WH8A 1ENUA 2V6AA 2ZA2A 3UETA 4KWSA 5AC4A 3LLFA 4O12A 1OZQA 4PB4A 1UD8A 3LK6A 3BICA 1QK0A 2FYMA 2H8ZA 4M51A 1DWIM 1E15A 1TV7A 1EJSC 3UWUA 4C6LA 4KESA 3FJ6A 3QM3A 2QKFA 1WE5A 5JIWA 3TJLA 1CGYA 1NDYA 5DO8A 1KLZA 3IPWA 4JIHA 1DYSA 3BSGA 5D2TA 1R2SA 3TA9A 4UNIA 3S9IA 1E5NA 3NURA 1EUAA 1K7XA 3OU8A 1F7BA 3UR7A 3GTIA 3IJ9A 1NVMA 2HS6A 1JPMA 4W86A 2JK2A 1BLIA 1OF6A 2FMOA 2GJNA 4KBXA 2CLIA 3DYPA 4CQDA 4UFHA 3OLEA 4UQAA 1AJ0A 4DM1A 2BGSA 3GYEA 2QIIA 4PMVA 2ZXBA 5REQA 5TF0A 4GH3A 3U5YA 2OQLA 3SIMA 2Z7KA 4NSBA 3NPVA 4GFIA 4NRSA 5T8GA 3PUGA 9RUBA 4PN2A 2ZUVA 3U2CA 4HNUA 4US5A 4IFKB 4H7VA 4MKVA 2NZLA 2PRHA 4GYJA 4P7RA 2MNRA 3MHFA 2HVOA 1SR0A 3AHZA 1HKJA 2QCLA 4R7OA 4DIAA 1UZ4A 3G3MA 3CAWA 5M2FX 3PF3A 3MB9A 4GNJA 4ZB2A 1PZ2A 4Z2KA 3WQ6A 3W2NA 3E49A 2P0IA 2R9RA 3O6CA 2UWFA 3AIEA 2I14A 1OX6A 2QGHA 3HV9A 1LRQA 2YKKA 3ONBA 4LSBA 3MW7A 2ZVRA 3R58A 4J2PA 3SSJA 1POKA 2PWDA 2E3ZA 2P8CA 4YN5A 3GY1A 1W1A1 1NFPA 3L0KA 3N6HA 4OVXA 2VTFA 2YCLB 4H6RA 3HF3A 4M1RA 4RDZA 2BXVA 4XO6A 3GG8A 3UJ2A 2W9MA 8RUCA 3PZGA 1LF1A 5BRPA 2PTDA 1W5MA 5HNUA 1U30A 3WIJA 3M64A 2BSLA 4H9MA 4KRZA 3TTQA 1LCOA 1S5VA 4JXCA 3PJUA 2XWDA 5LNWA 3NO5A 5GJPA 4XZLX 3O3RA 1JAKA 3G1YA 4KWOA 2J7DA 4AFYA 4ZOBA 4WR3A 3UG3A 3HPZA 3TR9A 3W9ZA 2VGGA 1ISXA 4DJED 5K9XA 3B06A 3QFWA 3WLTA 5BWFA 3AZSA 1XYCA 2C19A 3NOYA 3WMCA 5DT5A 4IQEA 3UR5A 4Q8NA 2D3NA 3SN1A 4D1JA 5CPMA 4DYKA 3W82A 4KQNA 4RE2A 4E0CA 1UR8A 1Q65A 4TXEA 3PZOA 4GPNA 4TMBA 1SZEA 4AC1X 4QTGA 1YXCA 3DN5A 1SFSA 2V68A 4BI7A 1BXCA 2CK3G 3DI0A 1KM6A 3TC6A 4EWJA 2E8YA 5CZ0A 4EXQA 1UIPA 1HVXA 4Y9MA 2R14A 3ES8A 1Z42A 1RSCA 1BVNP 2G8ZA 3SY5A 7REQB 3D47A 1UQZA 3CASA 2REQB 1TELA 3V18A 7PTDA 4HMDA 1Q6CA 1XFCA 3L4TA 1TE1A 3WCZA 1HJVA 5I3DA 1KXQA 4WXZA 5AHLA 1EGMA 2ZTKA 3WK1A 2XINA 2DJXA 1ISYA 4M24A 3C5QA 4GIYA 3AAMA 2Y7FA 2Y7GA 3PTDA 4OBSA 1UR3M 2PDQA 4AVNA 2A1YA 8TIMA 5RUBA 5E6YA 2RDUA 4YL2A 4UTIA 4NUWA 2VENA 1R5YA 3VNIA 1I6NA 1QJWA 5CZJA 3C0LA 1I2RA 4PCTA 4F79A 3B4YA 1FWEC 3MDWA 4RE3A 3WLLA 2WSPA 3VDHA 4CLMA 1PZ3A 4GVGA 4LYQA 1GVFA 1DHPA 4D6JA 3OGSA 5GNZA 5GJNA 2I56A 3N2MA 1F8IA 2KZHA 2G4JA 3P14A 2CU0A 3PPGA 3W2KA 4HBKA 1FKWA 4R7WA 3UWZA 3GQYA 3ZR6A 4DBDA 1LLOA 3GHRA 1FWSA 2ZKMX 5FSEC 3M1ZA 1XBZA 5FF7A 3FX4A 2Q3OA 3H2NA 3W7IA 2D20A 1UOKA 3L5LA 2BX7A 2VZTA 2YZRA 3A64A 4GO9A 2BVDA 1N2VA 2BS9A 5E6ZA 2WMIB 5XIAA 3SRKA 3GH5A 1C29A 3RYSA 1XXXA 4OT7A 5G4HC 5E9XA 3CYJA 3H55A 2WHKA 4RV3A 4EP8C 2QMKA 1RZMA 3A4XA 3G22A 1KM5A 3LHWA 2REQA 1FDYA 4LRSA 2O4QA 4IIFA 2BOEX 1V3JA 2VD8A 2CHOA 5BRQA 2QLYA 4OHQA 3CQHA 3H26A 3TE9A 1C9DA 3GG0A 5EB8A 4UTMA 2Y63A 1V0LA 1TWZA 2A3BA 3H4GA 2NVCA 2PCQA 3VGHA 3WQEA 2G5WA 3GHSA 2GUBA 2E1DA 1M1BA 4P7LA 3ATZA 3VCCA 1KTNA 2NQHA 2X0YA 3W74A 4BY3A 2ESCA 1EYWA 3CO4A 1OYCA 4RDYA 1OB0A 1Y7VA 4PODA 3S42A 5CC3A 3CAVA 3WEZA 3XINA 4JFUA 4F66A 4IP5A 4PUNA 2BODX 1NARA 4L5ZA 1H61A 4S3EA 3M07A 4XZBA 5A1AA 3ZSSA 4AIEA 5KTLA 2VM8A 4QS6A 2QUVA 2ABAA 2G97A 4JKKA 4HCHA 3TZNA 1HL8A 2OEKA 3CU2A 1O95A 2DZUA 1HG3A 3FSTA 4IPLA 4K1WA 3E1F1 4FXSA 1XIGA 1J0YA 3W26A 3SGGA 4I9MA 3AXKA 4C6CA 1F4HA 1LZOA 4GZJA 5GJMA 3KCLA 4HK6A 3WNNA 3SBFA 1BYAA 3W70A 3IWPA 3U7VA 5FD0A 1J6PA 1G6CA 2A7RA 4P7QA 3SCWA 4N9EA 4BZYA 3NIYA 3ZR4A 1I4NA 4DPQA 4ES4A 2NQ5A 1S5TA 4I7WA 4M29A 3W2JA 1RY8A 3EOUA 4PUWA 3PZQA 2E9BA 4JS3A 1IXQA 3BAWA 4YHEA 3NYZA 1OFEA 2RKXA 1MZHA 4P2VA 1UCWA 3NDOA 3QN3A 1OIMA 1QT1A 3IUIA 3O8AA 4ZE4A 2PF8A 2VCCA 3H7VA 4WJ8A 3ARQA 3QMRA 2C91A 3WBYA 5ABEA 3NDZA 3ZOAA 2PRMA 3OEXA 4UTHA 3R8RA 1EC9A 3H2EA 4NZ3A 3PZIA 3WH9A 4ORIA 3LCLA 4GBUA 5ECVA 1KM2A 4IXXA 2E09A 3NJ3A 4NYYA 2EPKX 1ZY9A 3NPUA 1GT8A 2Z00A 3GNPA 1FFRA 2OOGA 2RAGA 3U5UA 3WJXA 1SO3A 3M5YA 2XJ7A 3BJTA 1PEZA 4UCFA 2E28A 4DWDA 1G94A 2YX0A 4UZUA 2BTMA 3IJ8A 4NX0A 3GXNA 2GLKA 4PUKA 1NOUA 2O0TA 3ELFA 1T6MA 2HXUA 4XAGA 2DSWA 3MBFA 4YIWA 3FKKA 3QQ0A 4X2PA 3BG3A 1P6BA 1YHTA 1PKLA 1VENA 4FX7A 3RU6A 2POTA 1ME7A 3KRBA 1ESWA 4GH1A 1YIXA 2IXUA 5F4SA 1T96A 3MV01 1M03A 3DHDA 1BTMA 2CWNA 2ISVA 1EJXC 2J7CA 2CLMA 1JI1A 1OD8A 2VUYA 4QJ4B 5HPOA 1Q6OA 1JQXA 3W2LA 2PTYA 2J6XA 2OU4A 3GR7A 4W5UA 2ZZ1A 1XHGA 3THUA 3LCXA 4HA1A 3ZFHA 3S2JA 4JIIX 3P61A 1N8FA 4KERA 3QPYA 2RJGA 4BI6A 2YB1A 3LRLA 3VKAA 4C1LA 3VU2A 4A3YA 1QW9A 1K70A 2PDPA 4LEQA 5D32A 4RE4A 3CT7A 1KV5A 4LUYA 2TMDA 3BW3A 2OKTA 1EP2A 1FCVA 2ZUWA 1MI3A 5BXRA 5FCZA 3FAWA 3N3TA 1BYDA 3BW4A 3FHAA 1X7IA 1HUVA 1UR1A 3RLUA 3KBJA 3S1VA 5A6SA 3S6OA 1ADOA 2WSSG 5LIYX 3ISIX 1SMDA 2IPFA 1A49A 2WANA 3D0CA 1IE7C 1AMKA 4MKSA 4GCXA 1AH0A 3GKFA 1EO7A 4A21A 1P7TB 2OT0A 3T05A 4D6EA 1JRCA 4QISA 3VGDA 3W75A 4DJFA 1UD4A 1VCFA 2OXNA 3WQOA 2ZICA 4PFMA 2I16A 3QXBA 4ZTYA 1B3XA 1E6RA 1UR0A 2VP8A 2G4FA 3MJMA 1KC7A 4K68A 4QQUA 6CGTA 2XUCA 3S6DA 1CGXA 1P43A 4Z2JA 4HOZA 4PGLA 3RILA 3E9AA 4JX6A 1FCQA 3PBVA 3WL1A 2BBFA 1ZNNA 4FXRA 2YCKX 4R88A 1ZHAA 4M7SA 2WM1A 3LPPA 2J7FA 1M5WA 2Y8UA 3A13A 5J8LA 5IOBA 3LBOA 3S47A 3ZLHA 4OQVA 3UT0A 2P50A 5U7SA 1RQBA 2ZRWA 3IVTA 4YVXA 3GX9A 3DU0A 2DSZA 1M01A 5G1MA 3ARTA 4RDWA 3F2CA 1S5NA 1VBRA 4JTQA 5K3VA 3WLQA 5CSYA 1UKSA 1LUCB 1UA7A 4FALA 3PNUA 1A3WA 1EUNA 1XLJA 3U0HA 2XDFA 4ZFMA 2HLDG 4H9YA 2J74A 3KZSA 1JPHA 4I8DA 4UQCA 1PB0A 4AWUA 2QIWA 4ZA0A 4XG1A 3CUHA 4JTUA 3N18A 1AL7A 2NX9A 3I10A 1W1YA 2EHHA 5I3KA 3WLOA 3VXGA 7CGTA 1J93A 4NU7A 7ODCA 1T8XA 4MJ2A 1CTNA 4DBWA 5E9AA 2Z4GA 2BZNA 3GH7A 5LSMA 1PUDA 1L6SA 5C70A 5CC6A 1CX9A 2D23A 5JUVA 4LAKA 1F8MA 4ECLA 3HGRA 3V3WA 1NP2A 5MKGA 3OQ8A 4PB5A 3GW0A 3OGRA 1I9CB 1D8WA 2UBPC 3B04A 3GTXA 1DJQA 2AQVA 2Z1BA 3H22A 2HS8A 3TYEA 2OWWA 4WX2A 5XIMA 4O4WA 4HPHA 1A5KC 1XLLA 3PFRA 3DC8A 3MQTA 3VNKA 5LIXX 4W84A 5F2LA 4W7UA 2DFAA 4CD7A 2VX4A 5CSRA 1R47A 3WJWA 4MJMA 5D9OA 4WZHA 3TMQA 3O6YX 1LL4A 3AQUA 2VELA 4GI6A 4FZIA 4FLRA 4JQ1A 1CGUA 2FH6A 4XUYA 1KRCC 4Q8PA 1EX1A 3TQPA 3LQGA 3VZZA 1Q45A 1O1HA 4MWAE 3WENA 2X1IA 5EBUA 4BF7A 1E1EA 2Y8KA 4DJDD 1W1PA 2EAWA 3GW3A 2PDBA 4TU1A 4XVDA 3BOFA 2WZHA 5EMYA 4ICMA 3TK7A 1XG4A 1J01A 3OYXA 2J7EA 3A47A 3W0KA 1C8YA 3OZOA 3WO8A 1UWTA 1E6NA 2WMGA 3R8GA 2NQLA 3SRHA 3HGOA 1P1XA 3WFAA 4N6FA 3HU7A 3WL0A 4AX7A 3HPSA 3ALGA 3RG6A 1I2QA 3UGVA 1E1FA 1KWGA 5AHNA 1WZAA 4JYEA 1WA3A 3NQAA 3BMVA 3TVAA 2BHYA 2JEPA 4AX6A 4LAMA 1ME9A 1U1JA 2R1MA 2F7FA 1UUMA 4GJ1A 4J7RA 4DJEC 4HSNA 1IEIA 3TNBA 3TW9A 2QCCA 4HU8A 4KCUA 4NXSA 5C8BB 2V82A 1DXEA 4URIA 3PZ9A 1N7KA 4AISA 4UFIA 1SU5A 4WUIA 4LYKA 4MWAA 1XC4A 4I90A 4LFYA 2YCIX 4CN6A 3CZJA 3L21A 3KRZA 4TT3G 3ICJA 1ZAJA 1KR0A 2GGGA 2J24A 2OSWA 3N4AA 3OG3A 1XCFA 1TQJA 4IMCA 5E0FA 2X05A 1QOQA 3DXIA 2YFNA 1T0OA 1G1YA 2GWNA 3RCNA 3C56A 3CWOX 3ZIZA 5I2UA 4IOTA 5F1VA 4PL1A 1B4EA 2PRLA 2PLKA 2PGFA 2QCDB 3TAOA 3TSBA 3KOXA 5CBIA 4TX6A 2PWEA 4WJEA 4B5SA 1XPYA 3LRMA 2EO7A 3WD3A 4JHOA 4D6HA 1GPWA 3AXHA 3W76A 4GUGA 3KDNA 4V2XA 4X0NA 2J79A 2QULA 4QE5A 3WJSA 1EXPA 2IW0A 3DBPA 3FGCB 2IPGA 2XISA 3OLDA 1J5TA 3DFPA 3OAAG 1I2OA 3ZJKA 1J11A 3TKFA 2P3EA 4OFCA 3T0TA 3CQJA 1WNOA 2CETA 3LTPA 1TA3B 1ZTVA 4Q8MA 1K7EA 3D3FA 5JH2A 3EMQA 1QNRA 1YDYA 2O9RA 4E4PA 4WKHA 2FQIA 2OX1A 1UH3A 3WNPA 1LLZA 3OIHA 1E73M 4NXKA 4Y6GA 3W7OA 3MYPA 4LY4A 2JF7A 4BKNA 3DGRA 3VE9A 3ANUA 1W3JA 1RQHA 3QTGA 3DI1A 3PJXA 1K3UA 2FPVA 3MMTA 1POJA 2Y5EA 3LY0A 1O5RA 4D6GA 3TN5A 4HHMA 4D8ZA 3G77A 2D2HA 1W3HA 3B8IA 1JEZA 4PMRA 3GTHA 5I3JA 4FB7A 4PMZA 3MI3A 4R27A 3WH7A 2ZYFA 4JTRA 3CWNA 4AMAA 2Y5SA 1TMHA 4NNBA 3QYSA 1BYCA 1EEXA 1ZJBA 3QHMA 2ZA1A 1L6GA 3TYZA 1VPQA 1R9XA 1YPXA 4PSPA 3KUMA 1V7YA 3ZO9A 1TPVA 4A29A 5BXPA 1OM0A 2NLIA 1WUEA 4DO4A 5HNRA 1PTAA 4EACA 1L6WA 1SO6A 2ACSA 4DXVA 2CZEA