4HYWA

Pyruvate kinase (pyk) from trypanosoma brucei in the presence of magnesium and f26bp
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
498
structure length
496
Chain Sequence
SQLEHNIGLSIFEPVAKHRANRIVCTIGPSTQSVEALKNLMKSGMSVARMNFSHGSHEYHQTTINNVRAAAAELGLHIGIALDTKGPEIRTGLFGEVSFAPGDIVCVTTDPAYEKVGTKEKFYIDYPQLTNAVRPGGSIYVDDGVMTLRVVSKEDDRTLKCHVNNHHRLTDRRGINLPGCEVDLPAVSEKDRKDLEFGVAQGVDMIFASFIRTAEQVREVRAALGEKGKDILIISKIENHQGVQNIDSIIEASNGIMVARGDLGVEIPAEKVCVAQMCIISKCNVVGKPVICATQMLESMTSNPRPTRAEVSDVANAVLNGADCVMLSGETAKGKYPNEVVQYMARICVEAQSATHDTVMFNSIKNLQKIPMCPEEAVCSSAVASAFEVQAKAMLVLSNTGRSARLISKYRPNCPIICVTTRLQTCRQLNVTRSVVSVFYDAAKSGEDKDKEKRVKLGLDFAKKEKYASTGDVVVVVHADHSVKGYPNQTRLIYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyruvate kinase 1
publication title `In crystallo' substrate binding triggers major domain movements and reveals magnesium as a co-activator of Trypanosoma brucei pyruvate kinase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
total genus 182
structure length 496
sequence length 498
chains with identical sequence B
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4hywA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 4hywA01
2DUAA 3ME3A 3GQYA 4IP7A 3QV7A 4QG8A 3U2ZA 2VGFA 1OQFA 1JDEA 4WJ8A 1E0UA 1O5QA 2V5JA 1DIKA 2HWGA 2L5HA 3PP7A 1T5AA 2XZ9A 4HYWA 3GG8A 4L7ZA 1VBHA 3OYZA 4ROQA 1F3WA 4QGCA 1PYMA 2BG5A 3N25A 1O68A 1KBLA 3SRDA 2WQDA 1Z6KA 3QQWA 1F8IA 4MG4A 3T05A 4B5SA 3QLLA 1IZCA 4L80A 4B5UA 2XZ7A 1T57A 3H6OA 3VAVA 3FA4A 1OY0A 1MUMA 1GGOA 3OQ8A 1KC7A 1S2WA 2HROA 4RPPA 1AQFA 1A3WA 3BJTA 3SRKA 3QTGA 3T07A 3HQNA 4B5XA 1O66A 4KRZA 1XG4A 4IQDA 1DXFA 2VGGA 1F3XA 2HJPA 4TV5A 3BJFA 4KS0A 2X0SA 3FA3A 3M0JA 3IS4A 4LSBA 1XG3A 1U5HA 3EOLA 4QG6A 4B2DA 3HQPA 3EOEA 3KHDA 4L9ZA 1ZLPA 3EZ4A 3I4EA 3P0XA 3LYEA 1M1BA 2HRWA 3SRFA 1PKNA 3QV9A 2KX9A 4HYVA 1F8MA 3MA8A 3G2GA 4G1NA 1PKYA 4IQEA 1SGJA 4B2DD 3R4IA 1DXEA 1VBGA 4TV6A 4B5TA 2VWTA 1S2TA 3E0VA 4KCWA 2DIKA 3E0WA 1VP8A 1IGWA 3LG3A 1UJQA 2V5KA 3QZ6A 1S2VA 4QG9A 1S2UA 4KCUA 2ZE3A 1U5VA 3GR4A 4YNGA 2E28A 4KCVA 4B5WA 2OLSA 4L9YA 3OYXA 4B5VA 2QIWA 2R82A 3E5BA 4FXFA 5TAOA 3PUGA 2VGIA 2G50A 1F61A 2VGBA 4IMAA 1M3UA 1PKMA 3T0TA 3KTXA 4JPGA 4MF4A 3M0KA 3QV8A 3B8IA 1ZJHA 3QV6A 1DQUA 1A49A 3SRHA 1A5UA 4KCTA 2XDFA 3HQOA 4FXJA 1PKLA 3EOOA 2VWSA 4YJ5A 4DRSA 5JVLA 1A3XA 1E0TA
chains in the Genus database with same CATH superfamily
2ZCGA 4C1NA 2ISVA 2VFIA 5G4WA 4YHGA 1F2JA 4TU1A 4B4FA 4AFYA 4HK7A 4RR4A 1WZAA 5AHIA 5IDZA 4HCHA 3WFAA 4HA0A 1Z9AA 3LRMA 4MNLA 1XICA 3E74A 4QNEA 3TROA 2VDIA 2BP1A 4OHQA 4Q7IA 4X2RA 1H2JA 2C15A 2QCCA 3OLGA 4UCGA 5D9OA 1OCQA 2FDSA 1B31A 2I57A 3UWYA 5F4XA 4ERAA 1C7TA 2GK1B 2BSLA 5CJNA 3AROA 3GDRA 4WKFA 2FZ8A 2YOCA 4U5IA 4AHQA 5A8GA 1YKWA 4S3AA 1P48A 2UY3A 3GYCA 3ZSSA 2QLYA 1HW6A 5DO8A 4ZGYA 4UR8A 4MAZA 3LQLA 3VNIA 1XV8A 2KAUC 3EYPA 2Z1BA 4PBFA 4JY8A 1AJ2A 4E2BA 3RX2A 3EXTA 3QHNA 2XH7A 2VR4A 4ATLA 3U7BA 4DLMA 2OU4A 4IL2A 4NZ4A 1CLVA 3NDZA 3PB2A 4C6CA 3AHYA 2CHRA 2ZA2A 3TA9A 3UG3A 1LP6A 3USZA 4MWAC 4IMCA 5FJOA 1WV2A 4KEZA 2I9EA 4V2XA 4AXNA 3BAWA 5K7JA 4IMAA 3W2KA 5HINA 1FP8A 3LPGA 4MF4A 1TZZA 1H60A 1LF1A 4QBXA 1V08A 1GYLA 3PUEA 1EJ7L 1UP2A 3EXSA 1PIIA 3DKJA 1TG7A 3RX4A 4MPQA 1NTHA 4PL2A 1WXZA 3FEQA 4A3YA 5FL7G 4HNTA 3R43A 1TX2A 3G1SA 5IBXA 1T99A 4PULA 1W3IA 5EBUA 2DQXA 3RLGA 1TWWA 2V2HA 4HHHA 1MUCA 5CLTA 1PJ9A 2WPDG 4JKMA 1J79A 1XF0A 4TX6A 2FTPA 3EWWA 4O57A 5D30A 4DJFC 4F3HA 4AVFA 5LNUA 4F48A 3A9BA 1L6YA 3VNDA 3MUZ1 2YB4A 4RPPA 1VJZA 1M01A 2FGBA 1H1NA 3T07A 4P7NA 4PCTA 4MWAE 1KM6A 2BASA 4ZFMA 1L2QA 3G0UA 4O18A 1H7OA 2VX4A 2VX6A 3VIKA 4PFHA 3LERA 4MZYA 1RJRA 1VFMA 3TJLA 2XU2A 1X1NA 2CK3G 5D8ZA 1W5OA 2J6XA 4PGLA 1P1XA 2OZ3A 4HNLA 3RUBL 5FAJA 3ZSTA 3WLTA 3CZEA 1W0JG 3VCRA 5LIYX 5JIWA 4IPLA 1HJSA 3W4RA 4JKLA 3H4GA 1XM3A 1QI4A 3ARPA 4JS3A 4IFRA 3BK0A 3HPFA 1HF6A 3RU8X 3DFYA 3H2OA 1UWAA 5AC4A 4QLLA 2PI6A 1W9BM 2XFWA 4O50A 3UYIA 1W3JA 2PUZA 3LLXA 2VO5A 3MPGA 4GNVA 3I6RA 5FJUA 1V6YA 4PEKA 4MSSA 3AIRA 2MNRA 3NSXA 4Y96A 1E6NA 1UJPA 2XPKA 2QCFA 3UT0A 2VUNA 4CD8A 2ZZ2A 3IEBA 5CAHA 2YCEA 1A5MC 5JIPA 1PYMA 3B9NA 4PUMA 4AYGA 2WHMA 4D6IA 4WIWA 4HHLA 3DFNA 3WNMA 2DEPA 2X2YA 4PMXA 1DE5A 1EXBA 3NXLA 1W37A 2PGRA 4HMDA 1B3YA 1JPMA 2E25A 3KLLA 4E2DA 2NX1A 2J4GA 3VXGA 3PZIA 4MJ2A 4P8VA 4TR9A 3IPWA 4I5UA 1EQCA 3QM3A 5FCZA 5FEXA 4JX4A 4GYPA 4B16A 2CLHA 5A6SA 2EO7A 2GWNA 2QE7G 2BBFA 4G7FA 4EAMA 3LTPA 3MZNA 4PTXA 2A3LA 4UTFA 3UU0A 5CPOA 4ZZ9A 1R30A 1ZBVA 3DHDA 1XL9A 2OKTA 5AHEA 2QJMA 3HG3A 3UZWA 1I60A 5DT7A 4K36A 2QMKA 1VBJA 1RPKA 4MKSA 1GPWA 4JTSA 1GOMA 3QFWA 4QJ3B 2Y5JA 1W3HA 1Q6GA 4P7LA 2C6QA 1JPKA 1V77A 2DUAA 3W26A 4GIEA 5C54A 5TNVA 1TUFA 4AY7A 3IUHA 1S5VA 3WLOA 3D47A 1KR1A 2P53A 1AJ0A 1UZDA 4PB5A 3EOUA 4QCFA 5AVNA 3QLLA 1YTKA 4NXKA 4AU0A 1Q85A 5A6MA 2PGWA 3WF4A 4IISA 1O66A 2CZDA 2IKIA 5TIMA 3N4EA 4GZJA 1UD6A 3LCLA 2R94A 4LS0A 4M51A 3TOYA 2F2KA 4CEUC 1DL3A 1R2RA 2VZTA 4LWWA 3AYSA 3EB2A 4DBWA 3DEQA 2PAJA 1XBVA 5A6KA 4LY4A 3LHWA 2OWWA 4KWVA 3CHCA 1TJPA 3L0NA 5DBTA 2GDVA 5DY3A 4YVVA 2J7EA 2NVAA 3OO2A 2OSYA 4LNCA 4JCLA 2GUBA 3THCA 3BAXA 3SB0A 2NQ5A 2B0MA 1SW3A 4RNJA 4CCZA 3K4AA 1U5VA 1G0CA 1U5JA 2EPMX 1SJCA 3K8LA 2W27A 2DZBA 2W9MA 1JZ8A 3AMDA 5BNKA 3NPVA 1XRTA 3LB0A 1VFFA 1X7FA 4GJ1A 3WMSA 4QDWA 1LLWA 3QV8A 4H83A 4OFCA 2IW0A 5HWMA 3KOXA 5AYIA 3QC0A 4FEZA 1VYSX 1J2WA 3DN5A 2DDXA 3GG8A 3MBFA 1JD7A 2VNCA 5A2BA 1M7OA 4TXEA 1HQTA 3FDGA 3R7MA 4C6JA 3V16A 3BOFA 1R3RA 4JYFA 3KBWA 4GGHA 2HXUA 2BVDA 2CNCA 2W6IG 5ABTA 4G1KA 3CWOX 1MRAA 1XIIA 1UYQA 3E5PA 1KCKA 4NKCA 3CZ8A 4DO6A 4N02A 1BTMA 1IT8A 4J3VA 3WBYA 4HPJA 1HVXA 1XDMA 2ZXAA 2PDBA 3F4CA 3M0JA 3VM5A 1M04A 2A1YA 4Q7BA 5D2WA 4AW7A 1JF5A 4KW2A 5G2IA 1R47A 3C2OA 5B7YA 4JTLA 1JDDA 2PA6A 2E0PA 5F1VA 4FALA 4WF7A 1NJJA 4WXYA 1J12A 2TRSA 3MB9A 4U5KA 3MMWA 1PIGA 4F9JA 4C6PA 1KWKA 1JD9A 1TELA 2HXTA 4O14A 3R6IA 1X96A 3W72A 1E0WA 4WJXA 3T0DA 5FACA 1J0JA 4JTGA 4M8UA 1ZJHA 3WMBA 4GH3A 2WW5A 1C9WA 4LYQA 1QTWA 1BYBA 2XVKA 1E70M 1EHNA 4GHRA 1UPMB 5KINA 4RE0A 4A3HA 3MUY1 2YCIX 2KZHA 4U2YA 2NQLA 4DYEA 3GRIA 3I3EA 5LYRA 4LW7A 3VCCA 4TTUA 3T05A 4L6DA 4WDUA 3UBPC 1JF6A 1BKSA 4NXSA 4GMEA 3BVJA 2PS2A 1N8FA 3LCHA 3PZUA 4B5XA 4H2CA 1JFXA 2BY0A 4WD0A 4MMWA 4TV5A 3F2BA 5C9WA 4LUTA 2QJJA 1UWRA 3A4WA 1S2AA 1ONEA 5EBAA 1JIBA 3L5MA 2P76A 4CKQA 4HVXA 2J62A 1J10A 1F8MA 1HN1A 4ZSTA 1LORA 3SIMA 2WBKA 2EBNA 5DXYA 4B3KA 2V81A 4OGZA 4NJIA 3C6CA 3R4IA 3C52A 1JCMP 3MV01 4MNKA 4IM4A 1NH6A 4GNJA 4W9TA 4TUFA 2GQAA 3GO2A 1IT0A 4IP4A 2QCMA 1ZBWA 3TYCA 2PU0A 4C5YA 1X6UA 3CV2A 3C8FA 2NLIA 4O8AA 3E38A 4KRUA 1A0EA 3R0KA 4GWEA 4O4VA 2VTFA 5CGTA 1UIOA 3EOOA 1R2TA 3MT1A 4DN1A 3IACA 3GXIA 3IANA 3BAYA 2E67A 3MUIA 4ICNA 4M6PA 1IWPA 2DZUA 1NP0A 1FKXA 3TXVA 4Q4PA 1VBHA 1GTEA 3OYZA 2BOFX 2GGJA 1P43A 3MMDA 1NY1A 4UOQA 3L4WA 1Z42A 2Q8XA 2Z4GA 4C6OA 1VPQA 4CNUA 3SN1A 3G1AA 3E3HA 1SW0A 3MUAA 5FSDC 4GA8A 4HPHA 4PBEA 1Q65A 1SJBA 3QY6A 4Q7NA 2OXNA 4PMOA 3U9IA 4NZJA 5KMYA 5C55A 3MCNA 2VFDA 4ZCWA 3PG8A 3P81A 2VC9A 2ACRA 4K1GA 4LCRA 3WBEA 3LHYA 5BWFA 4KKXA 3G1XA 4HSOA 2WMIA 1SZGA 2QIIA 1VS1A 4LRTA 1LWHA 1ISYA 3W2LA 3STPA 2NVCA 3NQ8A 4UQBA 2P5NA 4W7UA 4HU0A 3PG9A 2F8QA 3PNZA 3TTEA 3H24A 2ZTJA 2OYLA 3NQCA 3THDA 1DJGA 1H0IA 4H19A 1U1JA 3SZ8A 1TIWA 3ARVA 1LBLA 3O06A 4NHVA 2QDHA 4FXJA 4ASTA 4C6NA 3GS6A 1QUMA 3LBOA 5FJPA 3WUFA 3QHOA 3F4NA 5A2CA 2PEVA 3GB6A 3P8IA 5HANA 3QOMA 4Z1BA 3TC7A 2IKHA 1XPGA 1SFJA 3CUGA 4S2BA 3K1DA 2J7DA 1AMKA 2V5LA 3PR2A 3VD7A 1OY0A 2XIOA 4PRRA 1KRMA 3H12A 5I79A 4CNNA 4F9DA 3ABOA 3VD9A 4ZVJA 3H22A 1RBAA 3M64A 1XYMA 4AZBA 3WFZA 3ENLA 3N9SA 2XIMA 2E6FA 3WENA 3QW3A 2E1WA 3NO3A 2B31A 3LNPA 3WL1A 3ABZA 4O17A 3WNPA 3CT7A 3URBA 4O10A 3GHSA 5KZ6A 4ADUA 3GKFA 1UD4A 3EBVA 2KX9A 1BXNA 1QWGA 4N9DA 3WH8A 1H1ZA 1OK6A 2DZVA 1KFKA 2GSJA 1AD1A 1W3KA 4RNHA 2XIJA 3HJEA 3HPAA 1ICSA 2GJLA 3B8DA 1Q8JA 2HK1A 3THUA 3V0SA 3NYDA 1HX0A 5HQLA 5FJRA 5A94A 1UKQA 1EH9A 4K2SA 3QH2A 4QS6A 1VC4A 2NUYA 3ZMRA 5GPRA 4XWUA 3ZS4A 4IF2A 1A0DA 1ZALA 4NJJA 1UUOA 3WK2A 4RXFA 3N29A 1CWYA 2YKKA 1JRCA 2H9AA 3ECQA 3WYZA 1HG3A 5LXXA 4AC7C 1NF7A 3B8TA 1PO9A 3WELA 2QCDB 3QF0A 1K7EA 1MNSA 4FS9A 2HVOA 3BLPX 3W7EA 5LIUX 1W56A 3O6AA 5G2HA 4M56A 4DIAA 1GT8A 3TV8A 3C2EA 1BQCA 4WOQA 3FFSA 3WBAA 2ZXBA 2V2CA 1EQPA 3RF9A 2G3FA 1WDDA 1AZ2A 4X63A 1C8QA 5C5YA 3THQA 3W7DA 4OWGA 3LPOA 4NILA 1REQA 2Y7EA 1DXEA 1RH9A 1O12A 1D7KA 1QHPA 3WDJA 1GEHA 1KW1A 3TTYA 1V6TA 1TR1A 4C6KA 3GXDA 2ON3A 4GUJA 5LHFA 2VGIA 2R6OA 4AZHA 4HYRA 4LV9A 1R5YA 1Y5WA 3VDBA 4JPGA 3IWPA 4LGXA 3AIQA 3UXKA 4IPIA 1QI3A 1CB7B 1YE6A 3WO8A 1T6MA 1H7PA 4C1KA 1GKRA 4JQ3A 3GBDA 3S9YA 1IXOA 3R10A 3ES8A 1K02A 3AYVA 3E6EA 2OMAA 3FYOA 1A80A 3T40A 4AC1X 1DIKA 4HKPA 3TJXA 2ALDA 1DXIA 1BD0A 2QDGA 3TFCA 1WO2A 1ONRA 3U5YA 4YS1A 3B0PA 3AXXA 2XM2A 3SRDA 4HOXA 1MDRA 1EUAA 1IZCA 8A3HA 5GJPA 4N9CA 1UQYA 2QVHA 2PB1A 3K1GA 4DWSD 4K3ZA 1QO2A 3P7YA 1VD6A 4CEXC 1BF2A 2E8YA 4Y8EA 2QPSA 3CHFA 3KZSA 2EPOA 1G4TA 1E3ZA 5DEZA 3ZYZA 4JAWA 2XIIA 2ZA3A 3JZEA 4GUGA 1D3GA 1PVNA 1C3FA 3S2LA 3ZOAA 3AHVA 3E1F1 4GYKA 4L4MA 4BKNA 4DXXA 4TX9A 1R0MA 3SCVA 2CBIA 3TN3A 2WJEA 4I6KA 3HBLA 3SURA 3S47A 1MQQA 1B3VA 1VP8A 1ZBKA 3GBEA 3CHEA 3SGZA 3B4YA 3W76A 4DNMA 3S6TA 3T4WA 4F0SA 3UWWA 2R1MA 3VKAA 3EDDA 1JI2A 4IG2A 4DI9A 3MHGA 3CMFA 4W4QA 1V6VA 4MFDA 2GWGA 3P2VA 1V5XA 2OZ8A 1PSCA 1HKWA 5FF2A 1FFQA 3CHVA 3SBFA 3W6YA 4D6CA 3MI6A 1T5AA 2ZX8A 3G1DA 4OQVA 3L9CA 1EJRC 2GUYA 2WMHA 3OHIA 2VDHA 1EP3A 1NFPA 3TU9A 3E49A 3UESA 4AD5A 2VVNA 3SFWA 3EDEA 3S4TA 1UUMA 5LNWA 2PDUA 3BWWA 1V03A 1CXKA 3HG5A 5CZJA 4IXXA 3IJ7A 2IQ0A 1BPLB 3LENA 3NM1A 2OZTA 5E6ZA 1X1OA 3RM4A 4AUBA 5AC8A 3TSDA 1SFLA 3N18A 5FIPA 3LSBA 3G2GA 4EPDC 5J04A 2XIBA 3R8RA 2G3IA 4HNOA 2VMFA 4ZL1A 1VFLA 1KM4A 4Z2KA 1B30A 1F3EA 1GQLA 2PLMA 1XCWA 1OZQA 2ZUMA 7TAAA 4B9ZA 2J9ZA 2OSXA 1E56A 2FVKA 4MTVA 1DP0A 3AJ7A 5H1WA 4U2ZA 1WZKA 1NEYA 3SCNA 3VM7A 3GXPA 4DBDA 5LNVA 3S5OA 3WG6A 1B57A 3PZOA 4MWAD 1EXPA 2NQHA 2WHJA 3BGJA 2WLYA 2A3BA 3OA3A 1SVDA 1TE6A 2E5CA 4D6DA 2Q3RA 2FJUB 2Y62A 3QTGA 5IRPA 2G96A 4HK5A 2J7GA 3P93A 1TR9A 3NVDA 1LLOA 1QW7A 4FR6A 3DI0A 5HNTA 4E4UA 2ZA1A 2DZWA 2V5DA 3LRKA 1F74A 3K5XA 4FLOA 4XG1A 3C2YA 3B9AA 3TUUA 3W1QA 2Y63A 3UEQA 2C3ZA 1MVYA 4DJFD 3WQPA 1BQGA 4C7GA 2D0HA 1R3YA 3LI0A 2DT1A 1V0MA 3SCOA 3B3DA 1UJQA 4J4KA 4Z1MG 3W2NA 1XLHA 1YMYA 3AALA 3AMCA 2PDGA 2J25A 2E28A 3MJYA 1FVPA 2RH9A 3HTWA 3WEMA 3RLHA 5KZMA 1J5SA 3RXZA 3VKDA 1FX6A 1PZ2A 5I77A 1X8CA 2C16A 4Q33A 4C6EA 2DZXA 4JGDA 2CLOA 1FHDA 3HB9A 3KTXA 2PWEA 1HKVA 4E5TA 4C1NB 2J88A 2NLYA 5BXPA 3VABA 2ZRXA 3V7PA 4Q4QA 6PTDA 3EMZA 3RJYA 1R85A 3ITVA 2TYSA 4HHPA 2FVLA 1A47A 3ZXWA 5FSEC 3GDKA 1C93A 4GIRA 1MW0A 2NV2A 5TF0A 2JIWA 3WJYA 3MP4A 3FA4A 3R12A 3WNOA 1EYEA 3P8JA 3F5KA 1C8YA 2ZRWA 3MSDA 3ERPA 1G7UA 3K4WA 3S6OA 3ZVHA 1YDYA 1B5TA 1EP2A 3BLLA 1VH7A 4FMVA 1JNEA 3KDOA 1AH4A 3L65A 3S1VA 2A7NA 3ANYA 4JKKA 3TSBA 1K70A 2X0HA 1MQPA 3O05A 4JOMA 3OZOA 4LUYA 1M65A 2QF7A 3TCSA 2EJ1A 3WD0A 3BAJA 1M1BA 4M6UA 1EX5A 5GQBA 1GKQA 3ITXA 3VX1A 5HNUA 4HIBA 4D1IA 1CXFA 3N11A 1MUWA 4YTTA 4LS1A 3VZXA 2NV9A 1OC7A 4KCVA 4L5ZA 3TYDA 3OYXA 1WUFA 1I0BA 3ITYA 3L66A 3UERA 2PDPA 2CHNA 2G0WA 4HPNA 3RGTA 1EDTA 1OZMA 2CIPA 1B2YA 1ZQ5A 1PUDA 2JKPA 4DYJA 5DFAA 3GE7A 4CCDA 3LCIA 1LT8A 3P80A 4AXKA 4HQVA 5I23A 4UOZA 4GZIA 4PCFA 3WLLA 1IV8A 2ZUVA 4R7JA 4QCEA 4XAPA 3VPLA 4O0QA 1P0DA 4WVXA 4E2OA 1UKOA 4NNCA 3LN3A 3P61A 2OVLA 4DBEA 1N8WA 2RGLA 3AO0A 4C6BA 3KM8A 3ES7A 4XD5A 3KS5A 1RP8A 5E0KA 2IUZA 2R1PA 3TQVA 2V2DA 4LVDA 3RN6A 1A3WA 3BJTA 3D46A 3FV9A 4HSHA 4LRSA 4PRTA 2OQYA 3DCPA 4IQJA 2HNEA 4JFSA 3UJEA 3VE9A 4JIPA 3H54A 3PBMA 3UD6A 3KX6A 1XI3A 1H61A 1BTCA 3G22A 3VNZA 2VRQA 2NT0A 1KFCA 2I5IA 2PTDA 3GTFA 4BA0A 1IWBA 2QV4A 4EE9A 2XSAA 1NWUA 2IXUA 1E6RA 3HM7A 4B4HA 3EWZA 4B2DD 1VP5A 1BRLA 3GTNA 3WQVA 3GR8A 4J3UA 1V0NA 2AMGA 1XISA 4HZMA 3AUOA 1EOMA 5MF5A 3ONBA 1IHIA 2NT1A 3NWRA 4IPNB 1TPVA 1E73M 2NWSA 4BEUA 3BANA 3BG5A 4IMEA 1I2PA 2X09A 2QDDA 2WNQA 5I3HA 2JGYA 4R7WA 2BY3A 2X42A 3REQA 2WVUA 3XISA 4NP7A 4H9UA 1LROA 3WNLA 5DN1A 3MP3A 3CQ0A 4FNTA 3A64A 4IUGA 2UY4A 3KS6A 1UB3A 4P8UA 3O0FA 1J0ZA 4W8BA 2Y70A 3BH4A 5AN7A 1FRBA 2XFFA 1EJSC 2VM8A 2PSNA 1IIHA 4M82A 2XVLA 3SGUA 5HXMA 2ZX5A 3T08A 4LNYA 3AUJA 4JHOA 1FOBA 2JGQA 3VNJA 1XKJA 2XISA 5HJXA 2NW0A 1XD0A 4NYYA 2DUZA 1RR2A 3IS4A 1F6PA 1E3XA 1TZ9A 3S5YA 2QUMA 1OFQA 3CS2A 3AC0A 1EC7A 3GTIA 5BW6A 2PFHA 4B91A 3I3BA 2PDMA 5EMMA 1H1YA 4JQ2A 3WSUA 3LX9A 4G7EA 4K7VA 2PTWA 3CLWA 5BU9A 2WZEA 3PVFA 4D8LA 5FEPA 4M5PA 4PBGA 3WX7A 3CO4A 4ORIA 3KCLA 1S46A 3PM6A 4Q32A 3RLVA 4A3QA 1QATA 5H8MA 5GNYA 2CBVA 4AIUA 3L67A 1Q7ZA 4UFHA 3WF2A 1MZHA 2D73A 3DC0A 1YPXA 3G6LA 1CEOA 3MSRA 1XBYA 2PWGA 3BUVA 3PPCA 3DX5A 3TW7A 5C9RA 1PTDA 1J4EA 5DBUA 4ICMA 2E3ZA 2A6NA 7ODCA 3NQEA 1WYIA 3N19B 1V3HA 4L80A 2WSYA 4JR5A 1FWHC 2XGIA 1KQYA 1VEPA 1S3TC 1ZL1A 1C91A 2EEXA 1T96A 3BV7A 3WBXA 4J28A 4ZEPA 5CC5A 1OG6A 3W7GA 4PL1A 1XD1A 2PDLA 5BU6A 5G1YA 1ZS2A 5JH2A 2EG7A 2WC3A 3AIVA 3TTQA 1VFUA 1GYNA 4F0HA 3R0UA 1FBAA 1G1YA 1QOPA 3TYEA 2PU1A 2PD9A 5D2TA 2VX5A 2WMFA 2IKGA 1DWGM 3N34A 3CYVA 3V18A 2VJXA 2JKAA 3E2VA 2PRLA 2F61A 2V5KA 1ZY9A 1EJXC 2H3BA 5E0CA 4IXHA 3H53A 3QKEA 2W61A 3B0XA 2WXDM 5D09A 2PBOA 4DLFA 1UKSA 1BG9A 3F2CA 2J8GA 3ZLFA 2C7FA 2BXVA 2UBPC 4O28A 1B4EA 1T8QA 4WLCA 3A4XA 4AZ5A 5IBXC 5IDIA 1RY8A 3PJUA 1A5SA 3RYSA 4MUPA 1PAMA 2JFEX 1TWIA 2QR6A 1HP4A 3EWYA 1AA1B 4H6RA 1E9IA 4MJ4A 5T9CE 4JIIX 2ZUWA 4OZOA 4KETA 1GJUA 1H11A 2NQZA 5SWUA 2QXWA 4ZQPA 2VEMA 3PTDA 2OPJA 1U83A 3R8GA 5GNZA 1TPH1 1PX4A 5AZ0A 1XLGA 4XIAA 1XG4A 1KA9F 2ZZ6A 5A8OA 3QSTA 3CM4A 4HN8A 3SIZA 3TE9A 3WLQA 3BDKA 4RDWA 1DJIA 5A1AA 3OAAG 1EKOA 1UKTA 4HPXA 4AX6A 2X1IA 3ZT7A 4DHGA 5A5WA 3VA8A 3PBGA 3W1TA 4O53A 1PKNA 2V3FA 3N4FA 3O3RA 2I14A 4S3KA 3F1QA 3C2RA 1C29A 3SEPA 2RJHA 4C6MA 4KCUA 1N55A 3WQ6A 1WDQA 1D2KA 4OOZA 3DFOA 3H7UA 4DF2A 4LAOA 2YL6A 1OM0A 2J13A 3PZNA 3SUTA 3EDJA 1BXBA 1PKMA 4XD4A 1TTJA 4CU7A 4RXGA 2DVTA 3BJSA 1YW1A 4FX8A 2CKRA 5DF0A 3W7PA 4FAMA 3DBNA 1LOSA 4XZIA 1ZNNA 4D9PA 2A79A 2C18A 3VX0A 3IRDA 3EX4A 2WMJA 1XWYA 2DVUA 4FXSA 5CPNA 3GNRA 3MQTA 3WJSA 3EMCA 5HK4A 3QRHA 3FDKA 1DWJM 5DT5A 4ADSA 3UG8A 4E2VA 8RUCA 4JBRA 3LXAA 3LA4A 1XLJA 1GOXA 4FLRA 2YDQA 5JQ9A 3G3DA 4O1AA 2JBMA 3II1A 4RL3A 4LUTB 1UR4A 4DUXA 4DXKA 3WCZA 5D02A 5K4XA 5AC6A 1V3JA 4GYPC 3HOJA 3WZ0E 3IGHX 4QG6A 1TTIA 1ZAIA 1KXTA 2DT0A 4YCPA 1O1ZA 3K13A 4PCNA 2FB2A 3GG1A 1LWIA 2V5CA 3DAQA 4ZB0A 3U7VA 4B5TA 3R25A 2GJNA 3UW6A 3TWAA 1V7AA 2ZE3A 2HE5A 5KZDA 3M0IA 1R6WA 2B7PA 3ARZA 4DZIA 4ML9A 1SO4A 3W00A 1R9YA 1TPUA 2FPVA 3LHZA 1AW2A 5BXRA 2PDKA 4EPEC 1SO6A 4P2VA 2WNWA 2OTDA 4XAYA 5AC5A 4GYFA 1S3HA 4M3PA 1LL4A 2QCLA 5DCDA 1QHOA 4YWSA 1CGYA 1VLWA 3ZIZA 3AWNA 5PTDA 4OJYA 4MB3A 3STFA 4A8IA 5I5RA 1KTNA 3QYQA 3MS8A 1FDJA 4C6IA 3W7OA 3FAXA 1DJXA 2RDTA 4LUIA 3TFXA 1SO5A 1JR1A 1CLXA 1MFVA 1FQ0A 5F2LA 1BWVA 2V3GA 4OTKA 1KLZA 3OU8A 5CAKA 5TD4A 1YTDA 4TVDA 1YDOA 3CV7A 1R7OA 4QJ5B 2FH6A 4GBUA 3P67A 3RIKA 1VHNA 3ARSA 3EMQA 3GC2A 2WMIB 3F2DA 1VRXA 1QK2A 4B9YA 1U22A 1D8CA 2P3EA 3EDKA 1F3TA 1RQBA 3VD4A 4PEEA 1S5WA 1UHVA 2QCNA 5EPDA 1JZ5A 1DJHA 1WUEA 4X22A 3C0QA 3WH5A 3HQ1A 4UMAA 4NZFA 1B9BA 3ANVA 3DECA 1ZZMA 1PPIA 3OGRA 4U4MA 4JNZA 2VC6A 4AEFA 3UVIA 2O56A 1E1FA 3RHGA 1S1PA 1IYXA 3WMLA 3VC5A 3DHPA 2G4FA 3N17A 2BHZA 2J77A 5H8UA 4IMFA 4X61A 4CNPA 2ZC8A 5D2YA 2ZUNA 1VCVA 3C61A 2Z29A 2QULA 1I75A 4NUWA 3XINA 2ZKMX 5FJIA 4ZO9A 3B0UX 3ICJA 1LDCA 3U2OA 3WD3A 1ISZA 2CITA 1R9ZA 2ICSA 4UMCA 3A13A 4KGJA 3W81A 3HG2A 1KD0A 3VILA 1CGXA 2V0TA 1E6PA 2VZUA 4KBXA 3OVGA 3RG6A 4QE1A 5GVJA 3H2MA 1NFBA 4H4IA 3CUFA 1PEZA 2HK0A 3ZT6A 4EPKA 1UBSA 3GUWA 3WFLA 3EOEA 2G8ZA 3S8HA 1WAUA 4ROPA 2BVWA 3TSMA 3TH6A 4EPBC 3PZ9A 3MA8A 3N9KA 3PTMA 3AXMA 3N6HA 4UFLA 1GVRA 1AW5A 2YX0A 5D2VA 2VDGA 1OC5A 4A05A 4W5ZA 4GVGA 4QIUA 4CQBA 3QC3A 4MPKA 2AMXA 2DZSA 1KB3A 1E43A 4ZQOA 1T40A 3W9ZA 1F61A 4EK7A 2I1OA 2O4MA 3W73A 3OIHA 3M6DA 1FHLA 5HDRA 1JJKA 3CEUA 1V0KA 4US6A 1K7XA 3P5YA 3GVVA 1JYXA 1RUSA 3TTSA 4IH3A 1XQLA 3POHA 3T8LA 1MXGA 1B3OA 1JCXA 1RY0A 4IUOA 2CU0A 3GXFA 4RE3A 5HBFA 2H9AB 1JDCA 5BZAA 3VFCA 3FJLA 4HCLA 3GG0A 3N13A 2Z1KA 1Z48A 4FR1A 3PZVA 3KBJA 2J8FA 4JZ5A 4HU4A 1JQXA 3ABQA 4FA3A 4QS5A 3FJ4A 4UTLA 2XH4A 1KXQA 1WP6A 3WDQA 4AIBA 1PDYA 4IMGA 4JIHA 4WKAA 1JXKA 2WJDA 3TJIA 3LCWA 4IHCA 1KR0A 1XIDA 2CLMA 3T2QA 2FZ9A 3I4KA 1REQB 1A53A 3PJWA 4XZBA 2JIEA 3LDVA 4N0RA 4X0NA 2BVTA 3RLUA 4O13A 5M3WA 4PODA 1GQIA 4LBRA 3CMGA 4LV4A 2Z24A 2IPGA 4AIOA 3VU2A 1FH8A 1T41A 2YGYA 5LA1A 2FJKA 5BWAA 3R1ZA 2D2GA 5A6BD 3QOKA 4K8GA 4UCFA 4NIRA 3LV6A 2QPXA 3VZYA 1OT1A 1OADA 2C0AA 3HG4A 3FOKA 1AMYA 2YA2A 1RK5A 1H50A 1ADOA 3KP0A 4PUUA 4FI4A 1G01A 2Y7DA 3P62A 1LG1A 3P5ZA 2PDFA 1QOQA 2CZFA 2GQ3A 2XWEA 2C71A 4LC8A 4MIMA 1EOKA 3N9RA 4FOJA 4LANA 3PSWA 4MJMA 1R86A 1RA5A 1OFAA 1VHCA 4ZO7A 2NX9A 4Y9AA 3W70A 3L12A 4O0KA 4JTAA 2FHBA 1TUXA 3H6OA 4WKHA 3UWEA 3LMZA 1Q3NA 4FLQA 3WF3A 1QI2A 4WGXA 2WB5A 1ZU8A 1WKYA 2YYTA 1J5TA 1RLDA 3H2AA 3SCPA 2RUSA 3VIJA 5D8WA 1EIBA 5KETA 4FLSA 2A3CA 4EOUA 3O2LA 5TBOA 3OOQA 3VIFA 2VQTA 1JPIA 1NAL1 4HU3A 1X39A 5LIWX 1FWSA 1J6OA 4H04A 3RILA 3O7UA 1KM2A 1GK8A 3DERA 4J2MA 2ZZ7A 1JCYA 1WB0A 1F6KA 2FGLA 5E6YA 4IG2B 4R34A 2VVSA 3DG7A 2C8NA 1JAKA 3UCDA 2VFFA 4AD3A 3G1VA 2OQHA 3BLDA 3HMJG 3ELFA 4HZ7A 2QCGA 5F7UA 1XUUA 3AS1A 2W4XA 1XLDA 4ZFCA 3BG9A 2E77A 3A9IA 1J9YA 3AZSA 3PNUA 4LVFA 4KGLA 4PUNA 5HMDA 3O63A 1M9HA 3R2GA 1L6FA 3IGXA 3AU6A 4NZ1A 1J01A 2Z1WA 3PN8A 1MW3A 3RM9A 3M0XA 2Z6JA 1POJA 5F2MA 1RD5A 3C2VA 4YVPA 1BSIA 1LOLA 3UYCA 3Q4DA 1CXLA 1GZ1A 4S2CA 4EXQA 4PMZA 1TJ1A 3W2UA 3L4XA 2ACUA 1OHLA 3TDFA 4Q6XA 2XGZA 1IWAA 4HN4A 3VOGA 1CPUA 2OEKA 3AAGA 1TVLA 4Z1CA 2EPNA 2HVNA 2OLSA 3AS0A 1ZP4A 2Z6IA 4X3ZA 3ARXA 4Q8NA 3MTWA 2VCCA 4LU0A 1EDGA 4RJEA 3GDMA 3FKKA 3CUHA 1O7AA 2OT0A 5I24A 5JMUA 2FTYA 4LYKA 1E5JA 1T8XA 3ZJ7A 1FWGC 3KRUA 1M03A 3EWCA 3QJAA 4F0RA 4UNIA 2OEJA 1AODA 4UNLA 3LHUA 4LT9A 4B5NA 4EVZA 1X6LA 4J3WA 1W0MA 1IZJA 1E51A 3PPHA 3IGUA 1AW1A 4BQ5A 4LAZA 2RHGA 4MNMA 4HPGA 3CB3A 3B8WA 4M24A 3DG6A 3GSMA 3VIGA 4C65A 4MY9A 4JD4A 3EX1A 4LPCA 1VEMA 4RNFA 1YXYA 5EGRA 2YCJA 1US3A 3OEHG 1M53A 2HEJA 4M6VA 3KCJA 3QGKC 4JQ4A 4NASA 1B90A 4GO9A 1EUNA 1OCJA 2CERA 4JN8A 2P88A 3NO5A 4WSHA 1PIFA 3CUJA 4MY8A 4U10A 1W31A 3GFZA 1M6JA 1J6PA 1C90A 1GWJA 4XUYA 1GOOA 3GIYA 1YXCA 4H7CA 2HBVA 2OGJA 5AFDA 1E72M 3M0VA 4YTRA 1ZBCA 3GVGA 4FHAA 1KFWA 1TQXA 4NF7A 1SFTA 6XIMA 3A4AA 3RAOA 4YMZA 5C9ZA 1WDSA 1CLKA 3QQ0A 4MKVA 8TIMA 1BEUA 1DVJA 1XDLA 3LEPA 2X7WA 4H7ZA 1VZWA 3PFRA 1P4CA 3OVQA 1LWJA 1L6WA 5DMYA 5F4SA 2ISSA 3ARUA 4J9JA 3M47A 1Q8AA 3GNDA 4OUIA 4DAFA 2V9DA 2V5JA 1GONA 5EMLA 4NJGA 3WQEA 1QCWA 5E9AA 4DYKA 3HJZA 3GC4A 4DJDA 4GQ0A 4W93A 1W1VA 3TR2A 1Z6KA 1J11A 2IKJA 1PX8A 1MXSA 1GVIA 3OBEA 3OG3A 2FB3A 3GVQA 3ZVHB 3IVSA 2VQUA 3W88A 3NQ7A 3UNTA 4KRZA 5LKYA 4S23A 4HP5A 4MDPA 2A3EA 4H6KA 3LGGA 1ISWA 2WAGA 1WE5A 1K8ZA 3B0VC 2FZMA 3SSJA 4WEVX 4E3TA 1HKJA 3VIMA 1I9CB 3AISA 3NQ6A 4W88A 5AZ1A 3G6MA 2X0YA 3NDYA 2ZXDA 1BFNA 3WN6A 2J27A 1JGMA 4FNSA 5IHRA 1XC6A 3NTYA 5B80A 3GAYA 5C70A 3M46A 4K7YA 1WDRA 3CQKA 3L4YA 1F7BA 1Z44A 4E0CA 1SZNA 1WCGA 2XFRA 3BV4A 5K2ZA 3VDAA 4S1FA 1Q2RA 2OG9A 1QNRA 3DHUA 3QPYA 3SUVA 3WLJA 4O1DA 2PLKA 4Z08A 1A49A 4KFPA 3RJXA 4ZBCA 3SUSA 4RW5A 5J8LA 1V7YA 3KUMA 1QI0A 1K8CA 1W5QA 1J2BA 2F9RA 4IIBA 5HUOA 4MLRA 1K7FA 3W23A 4QGCA 4JXCA 3M7SA 1XJBA 5CZKA 1DHKA 4I5RA 1JYNA 2O9RA 3DHFA 3SDOA 4JTHA 3G24A 3FHAA 3C2FA 2PLCA 3C56A 1QBAA 1YPIA 1JAEA 1W8GA 2VKZG 1DQXA 4F4RA 1EGVA 3T4CA 1Y5VA 2A5HA 2XSBA 4A22A 3VKCA 5I06A 3E2SA 5D37A 2X40A 4ECLA 1AVAA 1O6IA 4GJIA 1YTEA 6ENLA 4GY0A 3TNBA 1E4NA 2VRJA 3WQDA 1U5HA 2E09A 4MDOA 3I65A 4GX8A 5FL1A 3LUTA 4BY3A 4QITA 3S3GA 1C8VA 1BRLB 2IS7A 1FWFC 3T9PA 1XLLA 2GJXA 3WD4A 2PDIA 5AECA 4QEHA 4KIRA 4M0XA 5L9FA 1Q7MA 4WCJA 3IIXA 5DANA 1SUXA 3REQB 3FHQA 4W85A 1N7KA 1TV7A 5A8PA 4S38A 4NY2A 3H21A 4AIEA 4KWOA 1DWAM 2CYGA 3IIOA 1XIMA 4HNNA 1A5OC 3WDRA 2WSPA 2XINA 1KKRA 2WYSA 4A6GA 4UTMA 4K1WA 4N42A 4JTTA 1WKDA 1GVYA 3GNXA 2GOUA 3AU2A 1QAPA 5GJMA 2PWUA 1B3ZA 1F3WA 1FHUA 3BLEA 3MYOA 1I4NA 2CLLA 1E0XA 2HV5A 3OQEA 4YTUA 5BOOA 7REQA 1LM1A 4AZGA 1AH0A 4AD0A 3DH7A 3CIVA 2QJIA 4H2HA 2NUWA 2P0OA 4IIFA 3Q58A 4JHMA 4U31A 3GUGA 4HNUA 5EA9A 3WQ5A 2PWHA 2NUXA 4QE5A 5HAOA 4C6FA 3G8RA 3L21A 1WQ5A 2CKSA 3N4AA 3BLIA 3FA3A 3BO9A 2BLEA 5HQMA 3WQFA 2AQOA 4JTRA 3ARRA 2D69A 2OFJA 2GZXA 5U4NA 4GXMA 1BXCA 4R85A 1BWKA 4G7EB 3LK6A 1Y65A 4QNWA 3F03K 4BQ3A 1FY6A 3A12A 1AL7A 1GW9A 4PB3A 1EGMA 3V1PA 1GOWA 4NNAA 5CSRA 3UA4A 1RV8A 1SM9A 1QNOA 2V7QG 3A47A 1UD5A 1OIFA 2CW6A 4R88A 5J5DA 3AFBA 4POCA 3VO0A 4JTJA 3WD2A 4YIWA 7XIMA 1XCFA 1BGAA 4I7UA 4O11A 4E4FA 4C1LA 3D6NA 4TVCA 3U8GA 4HA1A 3BC9A 3N2MA 3B40A 3ID7A 2Z0IA 1TJ0A 1HJWA 4BWLA 1CXEA 1ZCOA 1GQNA 3STGA 3W2MA 2Y5SA 2RJGA 1I2RA 5E1QA 4DM1A 1P0BA 4J5NA 4KESA 4ZTYA 5HOSA 1XS2A 1DBTA 1KXVA 4RW3A 3VC6A 1QXLA 1LL7A 2X05A 4Y9OA 2DGAA 1BYCA 3QXBA 4S3EA 5T26A 2WZMA 1CGTA 2DIJA 3I6EA 2G3MA 5AKQA 3KFTA 4GCXA 4PZVA 3M5YA 1V51A 4DJEA 4QDPA 2D3LA 4PMQA 2IPJA 1DWFM 2H6RA 2ZZ3A 2FZBA 4L9XA 1K6AA 1IZKA 5H8PA 2WMGA 3A3XA 3RMEA 3YPIA 1VRDA 3MMTA 3DZ1A 3N1AA 1EJTC 4YXGA 1TPC1 2X2GA 4OE7A 1ICQA 2VEKA 2FGZA 2UV8G 3COTA 1LQ0A 5AHNA 3R13A 3BL3A 3GM8A 4CU8A 1CXIA 1WKFA 2ABBA 3SR7A 2PDQA 4MHBA 1PTAA 1XGDA 3NZPA 2E7FA 1GQKA 3NDOA 3B0YA 1YNQA 3GXMA 1CBGA 2OGYA 3DYOA 1OINA 1TTQA 4EWJA 4M1RA 4PR4A 1RBOB 3WDPP 5XINA 2WNZA 2D0GA 4EIVA 2QKFA 2VI0A 1S5TA 2XHYA 1J18A 3AZRA 2B4GA 3VD5A 1AZ1A 1HKKA 4IT1A 1ADDA 2VYOA 3BG3A 4ZOAA 4CQ8A 4Q8PA 3CAKA 4V27A 4EKJA 4ATDA 4GFIA 2ZVRA 4O1CA 3N3TA 5FF3A 3GW3A 1WBHA 2W92A 1IGWA 2ODOA 1S1RA 2P3ZA 2WM0A 3NQAA 3AHTA 5T91A 4HNVA 3AMGA 3B97A 4S3DA 4R7OA 2Y7GA 2Y89A 3LI1A 2OELA 4JTIA 4D6FA 2PGFA 3MW7A 2GDQA 2XN1A 3LHVA 3O6CA 3VIHA 4INFA 2W91A 2DSVA 1H62A 2ZE0A 4RK8A 1MI3A 4KF1A 1DV7A 1GKPA 4RLIA 3FVDA 2OZ0A 1OFPA 4W5UA 1UASA 1A0CA 1CNVA 3FVMA 1W1ZA 3UXAA 5A6TC 2DV0A 3PP7A 5H2ZA 1OGGA 2G5WA 4ROQA 3N25A 3ZQ9A 3S5ZA 4MVAA 4FB7A 1VCGA 4HB7A 4UR9A 4AWEA 4B5SA 1L6SA 3LOTA 1RALA 2QJNA 1OX5A 1I0DA 4UTWA 1GGOA 4S3FA 1UH4A 4Q4MA 1V6XA 2WZHA 1GVOA 2F2HA 2NWRA 2VL4A 1W5MA 1Z69A 3H4XA 3W6MA 3R11A 3IJLA 3N2TA 4FXRA 1W5PA 3WUGA 3E12A 4IGNA 1S5MA 1Z8AA 1OT2A 2F38A 4RV3A 3VI2A 3PK7A 3A6OA 2GQ8A 4Q22A 3CMJA 1PHWA 2J8TA 2O9TA 1XRVA 5I3DA 5CBIA 3IGSA 3MMUA 4FOKA 4ZQCA 4CNTA 4GQRA 2VUYA 3WKZA 1SR0A 1WA3A 1QNQA 4XK2A 1MEHA 1GUVA 1EC8A 4NQ1A 2QIWA 1AQ0A 1EBHA 4CD4A 3EWBX 1GPFA 4HOWA 1BVZA 3OB8A 5E93A 3T78A 2J79A 4QLJA 3M07A 3Q94A 2A21A 1QBBA 3LLDA 4EWND 1GVFA 4EANA 3WY1A 3A23A 5DMLA 3MKVA 3NGFA 4AHPA 3NNTA 1B4KA 1VF8A 3IIZA 5K9CA 3CGTA 2YZ5A 2GGHA 3EA1A 5C0QA 1KM0A 4GO8A 3QR1A 2CLPA 3PAOA 1UC5A 2VENA 1LT7A 2J7CA 1TMLA 1HVQA 2HPMA 1VR6A 1K1DA 1HZYA 1LLZA 3E0LA 4M7TA 1DYSA 1CTNA 1AQHA 2WPBA 1W1IE 5JU6A 3GFXA 3GC5A 1DTUA 2A2IA 4QROA 1J0IA 3URQA 3MC5A 3KHDA 1AH3A 3CL7A 3EA2A 4NT0A 3GVRA 5GJNA 2VD8A 3PBYA 4NU7A 9RUBA 1W9PA 3MUXA 3TTOA 3LBMA 3M6YA 3WUBA 1VEOA 7TIMA 4UTJA 1JQVA 3FGCA 1JZ6A 1JUBA 1WPCA 2FMOA 4PRWA 3R94A 2XJ7A 3HIJA 1Q6RA 2XG9A 2E9LA 1XLFA 5I6SA 1UOZA 4REQA 4XAZA 4P8WA 1W54A 3ARYA 1ME8A 3NZQA 1WXYA 1FCBA 3VCNA 3AYRA 1Y7VA 3A3HA 3PWGA 3M4HA 4MB5A 2PD5A 2VT0A 3W74A 4IP7A 4ZR8A 2Z00A 1P0KA 3SI9A 4GVIA 2C79A 4UTKA 4N2YA 5CH9A 4UZSA 2HWGA 2FFCA 3NAVA 3NL2A 1UZ1A 5DRCA 3S1GA 3SQMA 1FHVA 1O68A 4MOZA 3BARA 2WQDA 2DVXA 5C71A 7PTDA 2BWGA 4Q4OA 1XCXA 1EBGA 5D2XA 4DY1A 3T2OA 3QY8A 4OKDA 1YRRA 1H7NA 1XH1A 4G5DA 1K3UA 1H7WA 2XWDA 1S2CA 4P8XA 1QVBA 4KWWA 4GX9A 3GIPA 3APTA 1UCWA 1F3XA 4XX6A 1PWMA 4L1XA 3GHTA 1CW2A 2X0SA 1IEXA 3ZR5A 3NG3A 4H8HA 2PDXA 1Q6EA 1ZENA 4HYVA 5CZTA 2BODX 3VIIA 5I7GA 3VKJA 4MFEA 2Y5EA 2D2OA 4PMDA 3ZIAG 6REQA 1BG4A 2ESCA 2PDWA 4LTSA 4XZLX 5EMJA 3LNMA 4UUIA 4UTIA 4PFMA 4LVBA 1DJZA 1I2QA 1CECA 4HMNA 4AMCA 3W29A 4MYAA 3APGA 1W1PA 4NZ5A 5A6AA 2E5DA 1C7SA 3C4UA 2VC5A 3SCQA 5HWNA 1FWIC 4GACA 4EF9A 2XM1A 2Q09A 4F2TA 2C1IA 4IFKA 2OR2A 5HJLA 4MAVA 5BRQA 2OO6A 2QVNA 4AWUA 2ZXQA 1Q63A 1F5ZA 1DKWA 1E0UA 5IM51 1QASA 4XZWA 1TRDA 4DX3A 3RCNA 4GE8A 1XYLA 4WQ6A 1BYAA 4ACZA 3CQJA 3GX9A 2ZYFA 4WR3A 5FKYA 1CIUA 2VURA 1TJRA 1X97A 2YCLA 4UIOA 4C91A 1GZGA 3WJWA 4XZNX 4K37A 5I2UA 2BXZA 1FA2A 1TPB1 3SRKA 4OBTA 2FZDA 1R9XA 1IE7C 1E9LA 1SZFA 3LQGA 3FA5A 2R8WA 4RDVA 4RDYA 5LSMA 1V79A 2VRKA 2CWXA 1QWKA 2PF0A 1CXHA 3FY1A 3S83A 4JFTA 3ZZ1A 2OSWA 3HGJA 2GDUA 5A2AA 3S2NA 1EZ2A 3GTHA 3DOPA 2OEMA 4LEFA 4WDTA 3P14A 2DSUA 2DSWA 5ABEA 1NDWA 5CC3A 2VEPA 1S2UA 2CCRA 1KNWA 4LS2A 5FESA 1MO0A 3W28A 1O4UA 5FJJA 3D0CA 5XIAA 3M5VA 4F40A 4XZ9A 3NCOA 1I1WA 4RV8A 2WKJA 4H8NA 4A8LA 3QKZA 3ITOA 3EKGA 3TKFA 3VGEA 2WVVA 1JDFA 4AD2A 1R3SA 4W86A 1Q4WA 4HJWA 4F2UA 2EPKX 4ZXLA 2EQDA 4OECA 2PZ0A 4P7RA 4GC4A 4CN4A 3PWAA 1QPOA 2OLAA 4F66A 3VD3A 2DW7A 4H41A 4MKNA 2O4QA 2QYGA 1F8IA 4KEMA 3UWZA 2W79A 3VGHA 2HDJA 4HT3A 5BROA 3UJFA 5EYWA 1GJPA 3A3WA 4L6OA 3LGDA 3SUWA 3GU1A 3F4WA 5XIMA 1ZPTA 1OFBA 4DO4A 2VD9A 4FF5A 1H5VA 4CQ9A 1TWDA 1YBQA 1J0KA 5ECVA 3LSCA 4P7QA 2UY2A 4IGMA 1TCDA 3N2XA 3LYEA 5B7ZA 3QV9A 1YIXA 3QHMA 4O19A 1KLYA 3URNA 4LC6A 1PKYA 4AVNA 2BY1A 3F4VA 2B7NA 3RCMA 3UZXA 4MB1A 3W1RA 2R24A 1ZB5A 4M80A 1EEPA 2PE4A 3LG3A 2FHCA 5D03A 4A21A 3CYJA 3L4ZA 3QR0A 2C0HA 1OFEA 3A21A 3NFUA 2PZNA 2QCHA 3T0TA 5DY2A 2Z25A 3V36A 2ASHA 4TX8A 2ALRA 4YWIA 5HULA 1PKLA 3BLOA 3VE7A 1RVKA 2FMNA 2PTZA 1A5LC 3BGAA 4I9MA 2TMDA 3RO8A 2JK2A 2V3EA 4XZMX 3F4DA 4BI5A 3GU2A 1EJUC 1CT5A 2XVNA 4IPJA 1B0IA 4NG3A 4Z2HA 1V3IA 1BVWA 5TQLA 1E71M 2YFNA 3K8MA 2XN0A 3TZNA 1Z32X 1GEQA 2OT1A 1UR9A 3BLKA 4IL0A 4W84A 1P6BA 4GI4A 3EGJA 2ZRYA 2POTA 1P5BA 4AAJA 5M17A 4W87A 1EGZA 3S9IA 1SQ7A 1W9XA 3EZ4A 4Y2WA 4Q8VA 4KIEA 2IPFA 4OV9A 3POCA 3SSZA 1W91A 2PDHA 4N6FA 3UF9A 4PN2A 4XD6A 1O95A 2VWTA 1CCWB 4RUBA 5D04C 1E4MM 1V3KA 1KM3A 4AYSA 1KTCA 1TJ2A 1XIGA 1DEDA 2J47A 4B5VA 3OLIA 3HURA 3IUIA 2CZ5A 2J9YA 1RPXA 2VZVA 3NM3A 1L0PA 1PV8A 3UJRA 3LY0A 1XYZA 1KRAC 3FS2A 4AX7A 1XLBA 1KFLA 3RRAA 2VC7A 3BTNA 1DQUA 3BW2A 4GUHA 2ZX9A 3O1NA 1ADSA 1YNPA 4JFUA 2DH3A 3CIWA 3F5LA 3U2ZA 3VGFA 4B3LA 4XO7A 4S3BA 1OX4A 4IFOA 3TNOA 2Z27A 3UNDA 1L8NA 1XBZA 4IJCA 3DGBA 1UOKA 4GISA 5DCEA 2ZADA 1AD4A 1R46A 2NSXA 1ZJIA 3UWQA 3W87A 2YL9A 4G6CA 3MKCA 3TVAA 4B5UA 3WQCA 4HOZA 3DU0A 3DFSA 2ZZ4A 4J1OA 4PMNA 2ZIDA 1SJAA 2WVTA 4Z0JA 1UUQA 1SMAA 3KVLA 1F05A 1NOUA 1JPDX 2D20A 4OOUA 4WDWA 4R9XA 3LTSA 2I5GA 5FAGA 5IFTA 4E38A 2XIQA 4I90A 4JQAA 1FXPA 5ABFA 8XIAA 1XSJA 5CC6A 2XUCA 3VINA 3VK5A 1HKIA 1FCQA 4BHYA 1H41A 3SO7A 2VCBA 2LLEA 2XVGA 1Q7QA 4BJHA 2V82A 3RPTA 1P6WA 1JCJA 3SJ3A 3K2GA 5K9DA 3CZLA 4GINA 1UPPA 3RFAA 3GR4A 4L9YA 3EA3A 2R82A 4IZGA 3AXIA 4AHOA 3UCCA 3VNYA 2E68A 3DYMA 4X0VA 1JXJA 1FWDC 5AHLA 2YA0A 1LQ2A 2ACSA 3TP4A 3B8IA 4RKAA 1G5AA 3CJPA 3SY1A 4HBKA 1GVSA 4NJHA 2X7VA 3TMLA 3WEZA 1F6YA 4ES4A 1Q6CA 2V5BA 5CZSA 1VFHA 2VOMA 3I3DA 2XZ9A 1DTNA 3BSGA 3KXQA 4CQAA 1GW1A 3B8SA 3FXYA 4AZ7A 3AMLA 5D9MA 4GGBA 4MG4A 3IK2A 3SCSA 3VKKA 1Q66A 3WLRA 2DT2A 2ZVIA 2DFAA 4PTDA 3UXIA 4U28A 4R27A 5EFFA 3TW6A 3OZYA 4UFJA 3QN3A 1KFJA 4MB4A 2D2HA 4YLWA 1FWBC 1TV8A 3TOPA 2ZUSA 4BFAA 4US5A 1N8IA 1KXHA 2YW4A 3FN9A 4E8CA 3W22A 1VLIA 1GCYA 1ZJBA 5KTLA 1EDQA 1EEXA 4G1NA 1JYWA 4ZE4A 3O6YX 1YDNA 3R79A 2P50A 3NQVA 3UG4A 3A4JA 1W2VA 4XTIA 5DXXA 4JEQA 1HO4A 3BW3A 3EPMA 3ZR6A 4O1BA 4XKYA 3U0HA 3W1NA 1XHGA 4IWWA 4FX6M 4DELA 3ZJ6A 4WXZA 1UBPC 1A4MA 2A0NA 2BB0A 3SCTA 4XV0A 3FLUA 2FPYA 2WLZA 2DY3A 2CEQA 1Q5MA 1XR2A 2AGKA 5C2CA 3HQOA 3B05A 4FIQA 3URAA 4ZQMA 3TIMA 4BS0A 1UIPA 5LZLA 3V0TA 2ZUTA 2HPIA 3WK0A 2DU2A 2DJXA 2WNNA 2WZTA 3UR8A 3AZTA 3D5HA 3FCPA 3L2LA 3NJ3A 4N9BA 3OVPA 1VGAA 1KBLA 3G8EA 1IF2A 5EFDA 4ZO8A 1TV3A 2Y4SA 2F6XA 1CENA 1PCKA 3PTKA 4J2PA 2EG6A 2BS9A 3E02A 1IEVA 1OC6A 1E40A 3MBDA 4LQ1A 4X60A 1FWJC 3VUPA 1WBJA 1OGSA 2ZUUA 1OCBA 3JZUA 4W7VA 2YL5A 1XIJA 1EL3A 3AICA 1XLAA 1XYCA 3TZFA 1RJPA 5C6MA 5LGZA 3H7VA 1QU4A 1DWHM 1QNPA 1OYAA 4UQCA 3PY2A 3CHDA 4JYDA 1UD3A 2GJXB 3N73A 3M5ZA 2QCEA 1FCUA 1DWIM 3WLMA 3OLDA 1PBGA 3EXRA 5CPQA 4OIFA 1V3LA 4F2BA 5IFPA 3ZO9A 1VYPX 2J74A 2AAMA 1TA3A 4NVTA 4PMVA 2UY5A 2ZQ0A 1AG1O 2WOQA 5D9PA 5A95A 3VFLA 3VKBA 1AQMA 1Q13A 1UROA 2O9PA 4TTGA 4H7VA 1R2SA 1VJIA 1FWRA 5A8NA 5DRIA 3WMCA 5F1UA 1A5UA 2YDAA 4YCOA 1LRTA 5AVHA 3TQ0A 5JVLA 3UGVA 2O92A 4LYRA 4Y7EA 2DZTA 3T8QA 4MYXA 1NVMA 1XRSA 4GK8A 4XKMA 2HISA 2ONEA 1OGBA 1MW2A 7REQB 1H51A 4HTYA 5KSWA 1M7PA 2WCSA 5BMXA 2EG8A 3W1UA 3QPEA 2EAWA 2BX7A 1G6CA 3H70A 1WZLA 4V15A 4ZOCA 1SZRA 1J0YA 2PC4A 2X8RA 1PX3A 2D0FA 1GOKA 4LB4A 1G94A 5A6LA 4Z2JA 4WHBA 4PCSA 5HPOA 3Q37A 4KS0A 4DZHA 2E5BA 4O16A 6TAAA 3VMPA 2QAFA 1NOFA 2WHKA 3H2FA 3TN4A 3UETA 2VELA 4IQLA 4CVWA 3KW3A 2PMQA 2QPUA 1ALDA 3G1RA 4ILSA 1QPKA 4UQ9A 1V02A 5CJ5A 3EPNA 4AMAA 4R3UA 2Z2UA 3VDHA 1ZFJA 1W1A1 2XNDG 1NELA 5G4EA 1VENA 2WMKA 3DFPA 1ISVA 4NL1A 2XOKG 4HNCA 3NSNA 4HZ6A 4AF0A 1XYBA 4Z1AA 2YA1A 2AAAA 3AIWA 3VYLA 4CD5A 1MQRA 4KWUA 3WL0A 1O5XA 3LLFA 5CXPA 3PUGA 4B90A 3LZ3A 1TWZA 3OHMB 2J7BA 3TMQA 4ZOBA 5CG7A 4JEJA 4X9YA 2H90A 1M41A 1R8LA 4DJDC 3OG2A 2AL2A 2X30A 5JBFA 1UQZA 3C5QA 1VYRA 3IJ6A 3WQ8A 3L2IA 2BXYA 3TLQA 2VP8A 1W5NA 3VUSA 3GW0A 4HJFA 1EIXA 4UTUA 1TRIA 1PCWA 3CU2A 4YYFA 2JIZG 4N7QA 5G2WA 1MUMA 1TB3A 1E4IA 3L5LA 3OJGA 1I2NA 3W2JA 4AEEA 5HATA 4JX6A 3A24A 3NPUA 4K68A 1RK6A 3ABRA 2E9BA 3P0WA 5ENLA 2DW6A 3INPA 2QDEA 3SW6A 3NQBA 1EWEA 2YIHA 4LSBA 2V38A 2WJZA 3Q2DA 2WWCA 3GLCA 3EKLA 2Z26A 1V93A 4NI3A 5D33A 3ORWA 3QMRA 3KZPA 3RX3A 1UD8A 3UZJA 3M5XA 3USBA 3LHTA 2HS6A 3W83A 4L4PA 2V30A 4DPQA 4WUIA 1E15A 4LBSA 1LCOA 3ALGA 4AY8A 3WLPA 4JN7A 3NYZA 4MNJA 2ISDA 2GSHA 3VOFA 2BDQA 2WVSA 4GKTA 4LXFA 3B8VA 4PE8A 5IOBA 1HJXA 1XW8A 3PBWA 5CG0A 3CH0A 1MZRA 3QGVA 4NAFA 3G18A 1HXJA 1DJNA 3KOYA 1K9FA 4QG8A 1HFBA 3I7RA 3NVTA 1VJSA 1ONWA 1EJWC 1QPRA 4WJ8A 4J35A 3S2CA 1M5WA 4CVUA 1GG0A 4DAIA 1YHTA 3QEZA 5CSUA 4PSPA 1XIFA 1SSDA 4UOJA 3S2JA 4S39A 5ABGA 1YQ2A 3C0JA 4JTQA 2FIQA 1SJDA 1A3HA 1ESWA 2J75A 3GR7A 3AI0A 1FH7A 3MUCA 1LG2A 2XH0A 1K4HA 1RXOB 1KRBC 3NEHA 3W71A 2BGNE 2UZ9A 5AHMA 4V28A 4L61A 3PHAA 3T81A 3BXWA 3SRFA 1TVPA 1NDVA 4CLMA 5REQA 4IX2A 2HSAA 3QR3A 1WAWA 4H9TA 1W9VA 1JL8A 3S5SA 3U3HA 4JHZA 3W86A 1WDWA 1OD0A 4GI8A 1F4AA 5FF0A 4PUDA 3GK0A 3VIPA 4GH1A 2WWDA 1ELSA 5JUVA 2W66A 3GWQA 2I56A 3GTXA 2VHLA 3KL3A 2VGBA 4GC3A 4GVHA 3L4UA 1KBIA 3UGRA 2PF8A 2R91A 5HA7A 5C2GA 2W67A 1RCXB 4LBUA 1QOXA 5I3JA 1E1CA 1NQKA 3W7IA 2GVLA 3W82A 4FPSA 4NX0A 4YU1A 3FYYA 5FA5A 1W3LA 2WC4A 5M5DA 3E9AA 1IGSA 3A5VA 1F07A 3WH9A 3OZPA 1IT7A 2V8ZA 4H9MA 1SR9A 4L6HA 2XVPA 2CLFA 3DXIA 1Q6OA 3ITCA 1G7VA 3TWBA 4LCSA 4J7RA 5JH1A 3HQNA 4C60A 4S3CA 4R33A 2BV9A 2V67A 1EO7A 3PFMA 4WY0A 1HGYA 2AOSA 4XSMA 2C13A 2ZX7A 3PS7A 3CASA 3L5AA 4AWSA 2G4JA 2D23A 1UZHA 1TV2A 1PZ0A 3GKAA 3UR7A 2AQVA 2QJHA 3QGAC 3H7RA 4PMJA 3JR2A 4QX4A 4JQ1A 3M43A 4XIMA 4ORMA 1L9WA 2WSRA 4GXWA 3Q67A 3E0WA 3GAKA 5DMMA 2Y0FA 3HV9A 1QR7A 2REQA 3BSMA 4Z2LA 2PODA 4RZ4A 5BXTA 2VFGA 3LRLA 5C7VA 5TAOA 2YBUA 1OF8A 3VNLA 1OG0A 3TAKA 4R5EA 1ZRQA 4ZQNA 2PGEA 2DZPA 3L0GA 1GORA 3PSVA 1ME7A 2GVJA 2CLIA 3K8KA 1K77A 3HF3A 3MP5A 4F0MA 4IMDA 4J3XA 2GOKA 4FOUA 5IXEA 1RP9A 1NSJA 1H49A 2W3ZA 4BWLC 1WOBA 1XGEA 1I6NA 3M44A 3T09A 1ZSXA 3QVQA 1E6XM 3GDTA 4PTWA 1XLIA 5CBJA 1CI1A 4GXPA 4DI8A 1JG9A 4DUVA 4JTFA 1ITQA 2RDXA 5LIKX 3OEXA 1TIMA 4NRSA 4PMRA 3GU9A 1TMQA 4LALA 1WXJA 2CHOA 3O8AA 1W2PA 3NZRA 4ASUG 1B1YA 4A3UA 1VIWA 2PWFA 4Y9MA 2DT3A 2VGGA 3EEZA 3TQPA 2YBVA 2RKXA 4DJEC 4BI6A 1B3XA 5EMUA 4H6QA 4P7OA 5KITA 3TN6A 1GHSA 4UQDA 2GQ9A 1O5RA 1UP3A 3WEOA 1MMFA 4LJ3A 4PUKA 3O6DA 3FGCB 3TX9A 2R1LA 1TREA 1UH2A 3CBWA 1Q6LA 5LNSA 4Q3MA 1LL6A 3NPXA 3SCWA 3CL8A 3BAIA 1QPQA 3GHUA 4REQB 3IUDA 2PPGA 1CGWA 1XGZA 5LHEA 2EPLX 3GVWA 2Q3OA 2F7FA 4O1FA 1FCVA 3PBUA 3HU7A 1SSGA 3MDWA 3KEHA 4LOCA 3MANA 4IOTA 3A22A 1QNSA 4DO7A 3BLFA 1WKEA 1PZ1A 2EKGA 3CQHA 1FFRA 3OLEA 3RK8A 1OYBA 5MKGA 4TVUA 1CGUA 4S3JA 5AYBA 5LA0A 2BVYA 1CB2A 5LIXX 3ZWSA 1UR1A 2PLJA 4QEEA 2W6JG 3IJ8A 4K6AA 2C91A 3M41A 4PTMA 3GXTA 2I7GA 5ECUA 3G0XA 3PULA 2P0IA 1S5NA 4JIEA 2YYUA 1KWGA 1TSIA 2FLIA 1YYAA 4JDYA 6CGTA 3S9ZA 3ARWA 1FUYA 4GABA 3CAQA 5I78A 4HMCA 1QW9A 2EGZA 3UJSA 3S6DA 4BF5A 3ATYA 3FEMA 1M7JA 3ZM8A 3KHJA 2WSKA 4QLKA 4MJZA 2XH2A 1OSEA 4ACYA 1EF2A 4GLEA 1DORA 1VBGA 6REQB 3ZR4A 2JKEA 3B9EA 4CN6A 3ATZA 4RZ5A 3BSHA 2O55A 1SO3A 1UH3A 5HMFA 3GG7A 4EAYA 2Q8LA 4FXFA 2OOFA 2AQWA 3AIBA 3UQNA 5EMYA 3IARA 2XN2A 1R7AA 3IK4A 3RMJA 3AXKA 3PUOA 1OFRA 4IFKB 1MW1A 4URIA 4UTHA 1JZ2A 1EFZA 5DELA 2GGIA 3PWIA 4M7SA 4EP8C 4DZ5A 1E0TA 3ALFA 2ADAA 4XTDA 4XQ6A 3CIXA 3T44A 4L64A 4ACZB 6A3HA 4UTWC 3SM0A 1NIUA 3IV8A 1ECEA 1FDZA 4EXBA 3E2QA 2VR5A 4JTDA 4GQQA 3VGDA 4I6VA 2PURA 2YCLB 3KLKA 1XLEA 4JL1A 4IJRA 3SAZA 3TAOA 1G4SA 4A3RA 4C6DA 2DP3A 1QFEA 2JF7A 1OB0A 2ZDRA 2VEGA 1Q45A 3UPBA 2OJPA 3HO8A 3NURA 3BQ5A 4J27A 3W7RA 4AZIA 3Q65A 2A4AA 2CLEA 3VNKA 1FP9A 1HJQA 2V3DA 3IIVA 1XRFA 1PYFA 3UXLA 1JZ4A 3PPGA 3BICA 3STEA 2R9RA 2HNHA 4Q8UA 4D6HA 5C9XA 2F84A 1KTBA 4ZE5A 1PDZA 1IXPA 3OP2A 2NV1A 4WX2A 3ITGA 2WHLA 1G4EA 3PB0A 4ZQRA 3S42A 2WZIA 4AY1A 3CK5A 2WJFA 3G1HA 3GDBA 2EPHA 4RE4A 2YJQA 3SADA 2WVVB 2Z1VA 1TFVA 1QI5A 4DZAA 3APYA 2YXGA 3BZJA 4LF1A 1X38A 1XKYA 4L1WA 3WD1A 2VGFA 2EJAA 4UQAA 5C8BB 4RZ6A 1ME9A 4ADTA 5HJYA 4MUZA 2B7QA 4H6EA 4LEQA 2CBJA 1V0LA 2E6YA 2HTMA 5HMEA 1JCLA 3KRSA 3E2RA 2Y8VA 2JEPA 3CZGA 1T7LA 4L4OA 3ZLHA 3BW4A 4BQ2A 3WQWA 5CGQA 3KL5A 1BKHA 3N12A 1KQZA 4JTEA 4NSBA 4L65A 5E0FA 1W3TA 1YBQB 3NR0A 2ACQA 1LBFA 2JF6A 4JFWA 2NXHA 1EB3A 3HQPA 4A4AA 4IICA 4YHEA 2WANA 1FDYA 3SGGA 3V1HA 4QR6A 4MY1A 3THAA 3W7HA 1HIZA 2V68A 3T0CA 3B4UA 4KCWA 3K46A 1H3GA 3QZ6A 4NRRA 2D3NA 3ZVIA 2Z2AA 3U57A 1JZ3A 1CX9A 1LQAA 2YXXA 3NQMA 1PL9A 3FX4A 2ZRUA 3KRBA 5CPLA 3BE7A 4GRSA 1MEWA 3ITTA 2QQ6A 5CGMA 4GZ7A 2Q8ZA 2RAGA 3V5CA 2Y1HA 1TKKA 3DGRA 1VQTA 2Y2WA 4IPPA 1YADA 2C1HA 1BGGA 3TC3A 1RZMA 3VOJA 3WIJA 4DUOA 2QUNA 4CCEA 3P6LA 3CEPA 3V35A 2Z28A 1LUCA 3PUDA 1KM1A 1A5KC 2FH8A 3G5EA 1UR8A 3LM7A 1MEIA 3SCUA 3WLNA 5K4ZA 1RLCL 1R38A 4NI8A 2WBGA 4U3CA 1HJUA 4Q4RA 1JGIA 4IX0A 5I3FA 2B81A 1YE4A 1EPXA 5I07A 4PB4A 3IAPA 3UY7A 2CC0A 1A5BA 3O9NA 3NO1A 3ZJ8A 1G9HA 2Y24A 4KT2A 1C9DA 4UTTA 2V6AA 3D3AA 4A29A 1DE6A 2WV8A 3VZZA 4GUFA 1W17A 2JQXA 3UR2A 1E55A 1N2VA 4EACA 2I17A 4QISA 1UZ4A 4O15A 1HKMA 4YNGA 1THFD 2QHAA 4G56A 5HNNA 3TONA 4DF0A 1VAHA 2AKZA 3VTRA 5F4WA 1KGWA 4KEVA 4X9SA 4FX7A 2IXVA 3WJXA 1EJVC 1GNXA 3DFTA 3EX3A 5I09A 3CTLA 2A3HA 5KZEA 4UFMA 1UWQA 2ZWZA 1OX4B 3DYPA 1TV4A 1VBRA 1HL8A 1OQFA 1YLVA 2YZRA 4O12A 1MDLA 3N14A 4CQCA 4O8RA 2EKCA 2JDIG 1TMHA 2D24A 5CKSA 5MHBA 1BAGA 2QZRA 2R1NA 3LPFA 1ZAHA 2PRHA 3L23A 1OVDA 2Z7KA 2HROA 1XFBA 4ZSUA 4QHRA 3RRXA 5I3KA 1C92A 4E6MA 2SFPA 1BLIA 4O52A 4ZA0A 3VMNA 3BJFA 5ABFB 1EA0A 3VDCA 4JIRA 3EX6A 3U2EA 3V5FA 3SCRA 1FWWA 1PTGA 4HU8A 1EX1A 1KRCC 2XFYA 4NYUA 3UWUA 1RQEA 4A2SA 2ZBTA 1BF6A 1TV5A 4JL2A 1VFSA 3TYUA 4LAMA 4Y8FA 3CLMA 3BCDA 4F0LA 2BOEX 5EU9A 1X98A 4MZ1A 1G69A 3G1FA 1M3UA 3T6CA 3PAJA 3CL6A 3CO8A 3FAWA 3TA6A 2XDFA 5F2GA 1YDVA 2DPEA 2QGHA 3VNMA 2TAAA 3BQ6A 4D8AA 4XBSA 1OD8A 4IIEA 4FNRA 5HPCA 4W8LA 4DBUA 2YLAA 2CESA 4DWSA 2DZAA 3T42A 1QW8A 2VR2A 4LVAA 3SN0A 4JFVA 4I7VA 1NARA 1K8YA 3DIPA 2I9UA 3OQ8A 5CCZA 4PUEA 1S2WA 1UR0A 1PXGA 1A5NC 1VPYA 4A2RA 2E40A 3QZAA 1GTHA 2X1UA 1D7FA 5CPTA 4ZMGA 3RNDA 4QSHA 4GIAA 1E9YB 3IVTA 3W7MA 4M1BA 4PA8A 4TO8A 3CWNA 5E09A 3KBMA 1K6WA 4IIGA 4D6EA 1E79G 4LVGA 3RITA 3S1WA 4B92A 2OYMA 1SGJA 1V8EA 2EF9A 3AOFA 4XKYB 1NM9A 4IP5A 4DB7A 4HCDA 4QG9A 1UWIA 2NQJA 2ABAA 1O5KA 3EB4A 1PS9A 3PZMA 2G50A 4XSLA 3S1XA 3WDIA 1XINA 4NJKA 1I8JA 1FKWA 1UC4A 3NL3A 3MVIA 4QAWA 4WY0F 5K9XA 1UA3A 2OB3A 3MCOA 2GGEA 3WF0A 3A5FA 5I3GA 2BTMA 3W84A 4I9AA 2E6AA 4BCEA 2P8BA 3GNPA 2BG5A 5DQPA 2YPIA 5G5IA 1IIGA 2G97A 4BI7A 2OOGA 4DJDD 2GSEA 1GYMA 3MHUA 2W6RA 2PP1A 2A7RA 4Q8TA 1KBKA 2P8CA 1OF6A 4KPLA 5I0DA 1J93A 3M1ZA 2Q71A 3NA8A 3VOHA 3EOLA 4QQ3A 4QJ1A 3CH9A 3R89A 4UZUA 3U2CA 4NAEA 4H9VA 3MCMA 4Z42C 1KCLA 4ICCX 4GYJA 1W9UA 1TA3B 5D9NA 4WDXA 2BOGX 2AGTA 1SW7A 4OUEA 2TPSA 3W3OA 1B54A 4FNPA 3F7JA 1P7TA 3B9OA 2NVDA 3MJMA 4YVXA 1FXQA 4K38A 1WNOA 1OEPA 4LB3A 1IEQA 3GYEA 4H8UA 3DESA 4HHMA 3UCQA 3BPWA 4NNBA 1TZ7A 3WK1A 5EKYA 1RCOB 4MWAA 3MU7A 3TJ4A 1VFTA 1JRBA 3CNYA 1QPNA 1O5QA 3TN5A 1SZEA 4V1YA 1FWEC 1XFCA 3B8UA 4L7ZA 4C5ZA 1IEWA 4RCXA 2B7OA 4UC5A 3WK3A 2CFFA 3CV6A 1WDPA 3C3NA 3IVUA 4A35A 3AS2A 4BQ4A 1HP5A 4CGTA 3VAVA 4UBPC 5L6UA 3LXBA 5AHFA 3W07A 1MNZA 3U5UA 2X16A 4XD3A 2OO0A 3TC6A 1VBUA 2YFOA 1TVNA 3WH6A 1CDGA 1JUKA 5BRBA 3KP1A 4DJFA 2OLHA 5A69A 3NL5A 3KOFA 2VZOA 1RJQA 4MM1A 3SY8A 4ZB2A 3FJNA 2FTWA 3K4DA 1R3WA 2ZWYA 1D9EA 4H1ZA 4PMUA 3W7CA 1SFSA 3GXNA 3O0KA 2J24A 3CT2A 4AF0B 5D05A 3N2OA 3IAQA 3KWXA 4TV6A 3TR9A 5EL1A 3NUKA 4JX5A 4IJBA 3HN3A 4C7FA 4RNIA 4FF7A 1I2OA 1YEYA 4UWMA 1ITXA 1I45A 2QV5A 2QUTA 3FNDA 1L2UA 2GFTA 2C14A 3PPFA 3B04A 2AL2B 2FHFA 3ONCA 3PTQA 1RBLA 3DFQA 3W24A 3ZJKA 4OT7A 3B06A 4DRSA 1TO3A 3V3WA 5G1TA 2WCAA 1K4GA 4ZODA 2ZICA 2CWNA 4HYWA 2A85A 3NPWA 5M03A 7ENLA 4GI9A 1UR3M 1AL8A 3W6LA 1XXXA 2GJRA 2VEIA 3DKLA 4WSJA 3CWHA 4JTKA 1W1YA 2XZ7A 3PANA 3T7VA 2QEZA 1F9CA 2H8XA 4I8YA 4XISA 5I02A 1XH2A 2PDCA 3MO7A 1O94A 3FJ6A 3U48A 1TPWA 1NDYA 1XUZA 4FNQA 2EXOA 5FF4A 4YPJA 2HS8A 2GUUA 4V33A 2PDNA 4GZEA 3KRZA 2E9MA 3H55A 4QDMA 4LUSA 3S5NA 1ZGDA 4HK6A 2HRWA 3CUIA 1TX0A 2BGQA 3G1YA 2VX7A 4QXIA 4JTUA 3U4FA 1KM5A 3O07A 4YTQA 1YX1A 1AJZA 3GNOA 5K3VA 2Q02A 5FI8A 3EWUA 6XIAA 3JS3A 4PUJA 4LAKA 3GD6A 3KOZA 1RD6A 3C0SA 1EPVA 4XO6A 4LFYA 3ZT5A 4DPPA 1IQ8A 4NAFB 1W3NA 4HA3A 1J0HA 2YLLA 3EOSA 3CQIA 3GZAA 3MDUA 3NEVA 3CPUA 3HGOA 5AC7A 1Q6QA 3AIEA 1JEZA 3OVRA 1UMLA 4AZCA 3BURA 4PMYA 2ZC1A 3P84A 4QQUA 2L5HA 3BOLA 4DWDA 2D2JA 3W01A 2WSQA 5LXEA 5AYYA 3W27A 5E5CA 3L4TA 4KQNA 1MSSA 1MWOA 3BMWA 4B15A 4AH7A 5A8QA 4LX4A 4XAGA 3T0AA 4XZHA 4KMQA 1W8SA 3CC1A 1U33A 2GLKA 3DG3A 4XAFA 3W7JA 4GVFA 1J96A 4UQEA 4LUJA 6ALDA 1HO1A 2GK1A 3WLIA 5IHSA 3VGGA 3GNNA 3W7NA 2O7QA 1NWSA 1EHAA 4B2DA 3XIMA 5REQB 4LY8A 3OZMA 2OX4A 4XVDA 1AFSA 1N82A 3RPMA 2VOTA 3RM8A 4CD7A 3EEGA 3EB3A 2WPGA 4ALDA 2F6UA 1LRNA 2DIKA 3UXDA 1R3TA 2YW3A 3LU2A 2E4TA 4HGXA 1K9EA 1BWLA 3DI1A 4NX5A 5KEZA 3PZQA 3RR4A 2NQ9A 2R1KA 4BK9A 4LYPA 4DJED 4DQWA 1JCTA 1GOQA 2PRMA 4PTNA 3TXZA 1ITCA 4XB3A 3HPSA 3QV6A 1E1CB 3SRHA 3VGBA 1FTXA 3M16A 4GI6A 5EB8A 5DN6G 1SYTA 3LGEA 1HJVA 4GJJA 8CGTA 2Q01A 3TYZA 4XBKA 3Q45A 1TE1A 1JDEA 4N9EA 1FWNA 2G3NA 1A5CA 5C9UA 4IGHA 3CPGA 4TIMA 4YYCA 4GNKB 3V75A 4G2DA 3QPZA 4BF7A 1LJYA 1AUSL 2J9XA 5FD0A 3UP8A 2RDUA 4N4PA 1T57A 3EPOA 4FO4A 5CPMA 1F73A 1QNVA 1ZUAX 2DH2A 4WY0B 3VMOA 3N6QA 4LF2A 3AHXA 3OBKA 3R5EA 1ZTVA 1E5NA 1L8PA 4CNOA 5H6HA 4WK9A 4ONVA 4R9OA 1ICPA 4YN5A 3CUZA 3IJIA 1ENUA 2RFGA 4GUIA 5FL0A 2HCVA 4ZENA 2JJ2G 2INEA 3HZ3A 1RHCA 3PBVA 5BOFA 4Y9NA 1TPEA 2REQB 4ZO6A 5CEWA 5F2IA 3STCA 1Y5XA 3V0UA 4AQLA 4JIQA 4CN1A 1Z3NA 4OBSA 1RAKA 4UFIA 1SMDA 3AJXA 2YDSA 3FYPA 1X7IA 5FEWA 3E96A 4MGGA 4AWTA 4ZTXA 2Y7FA 3FK4A 1OYCA 4BEQA 3W7QA 1YNYA 1W1B1 2BZNA 3GZ3A 3EWDA 2PP0A 1OFOA 3JU2A 3EDFA 1V02E 2AL1A 3ME3A 1DJYA 1U30A 3I7SA 4V1XA 4HMEA 5JBEA 3DDMA 1DJQA 4RE2A 3W25A 2ZFAA 4KFNA 2OCZA 1EA9C 1D3HA 2A3AA 4Z2GA 5I3IA 4PC8A 2DIEA 4D72A 3SQSA 2FQIA 5CBBA 1U2YA 1KGXA 3LMYA 2ISFA 1RA0A 3LD5A 4KRTA 2E6DA 4TSFG 2QGYA 1LZOA 1AQFA 4K8EA 1Z89A 2AKMA 1KCXA 5HNRA 1E9ZB 2I16A 3RU6A 1P0EA 3W0KA 2ZDSA 4OU1A 4RDZA 3R8HA 4FZIA 3FKRA 4ENLA 3I10A 1GQJA 4YXWG 1Y0EA 1VKFA 3FSUA 3I4EA 2QUUA 3E0FA 1POKA 1OK4A 3KVMA 1JI1A 3NOEA 3R0DA 1JDAA 1ZHAA 2A7PA 3BMXA 1T0OA 1V3MA 3NOYA 1KV5A 2JALA 4M29A 4K39A 3NQFA 2QF8A 3MV11 2PDJA 4RZBA 3KDNA 4J3TA 1ONXA 3MZ2A 4Z0SA 2CZEA 4C7DA 5A3HA 1NOWA 1A5AA 4HSNA 1QJWA 2HLDG 1HNYA 2ZZ1A 3TLLA 2NXIA 3I6TA 1XIHA 5LNRA 1HTIA 3QV7A 3WLHA 3BCJA 1XBXA 3BAKA 2BGSA 5D38A 4FIRA 2DJLA 2YSWA 1H7XA 4C6LA 1G4PA 2Q6ZA 1ZJAA 2POZA 5MKGB 2V63A 2X1RA 4QJ4B 1Q4NX 2X1SA 2X1TA 4Z2IA 1DIOA 3M7WA 1LRQA 4LAUA 1JYVA 3JVAA 1M7XA 5DCBA 1QT1A 2CETA 1KC7A 1HT6A 4UFKA 1JZ7A 1C8XA 1A4LA 3QY7A 4P61A 3M0ZA 4GY7A 2OKOA 1FWTA 1BHGA 2WQPA 4JCMA 4L56A 1NDZA 3LCGA 1W1TA 1F76A 1Q2SA 1S38A 1ZLPA 2OQLA 1K03A 3MO4A 1XPYA 1E6QM 1GJWA 3TW9A 1DIDA 1UR2A 4D6JA 4E8GA 3QW4B 4C6QA 4JNMA 1Z41A 1NWTA 1S2VA 1K9DA 2C1GA 1J8VA 4X2PA 3H8AA 4H9YA 4B5WA 4I5XA 4AVOA 5BXSA 3N6JA 4DNHA 3WLKX 2HZGA 3GH4A 3UA3A 2WC7A 3BZGA 3K30A 1JVNA 4GBDA 3CAVA 3NQGA 4ZXOA 4I3GA 3I68A 4FSAA 4UNKA 1DIEA 3WUEA 3AQUA 3M0HA 1UWSA 1GHRA 4Q4SA 3F5JA 3H23A 2XSXA 3SJNA 2PC8A 3L7RA 2PDYA 1FS0G 2J7HA 2A6LA 3BCFA 2PWVA 2WM1A 3OGSA 3OEEG 5BYWA 2J66A 3FKSG 1R3VA 4DO5A 4P5UA 1X6NA 2DUXA 3FXGA 4DM2A 2Y8UA 2Y8KA 2UWFA 3KBSA 4Z1YA 1D3CA 5E9XA 2E1DA 2D22A 4WOZA 2W62A 2CXEA 5DX7A 3T55A 1P6CA 1W32A 1UD2A 4H8VA 3UVAA 4QE4A 4QP0A 4GPNA 4CD6A 3HFYA 3C0LA 5CPSA 4BF9A 2FDMA 3AYTA 3PC0A 3L0KA 1PHQA 3DFHA 2OYKA 1K8XA 4NZ3A 4JYEA 1P0NA 3UPMA 3W38A 3KTCA 3L4VA 1GVEA 1XIBA 2G41A 2WCGA 3C3UA 1EWDA 3SN4A 4UB9A 3WDHA 4JICA 3HFTA 4CU6A 3D3FA 4EF8A 1R87A 2JEQA 5CC7A 4F79A 4E3VA 3CTTA 9CGTA 5FOOA 3UG5A 5G4HC 3KL0A 1VFOA 5FF7A 1EC9A 3ZWTA 2XGBA 1QDSA 1W6TA 4GY1A 3HV8A 3RDKA 3KVJA 1KBBA 3UZ5A 4D6GA 4LH8A 3CZKA 2J7FA 4JDBA 3OGVA 1SPQA 2NX3A 2NSOA 3OODA 4Q8WA 5ABHA 1TYGA 2C19A 3GH5A 3H26A 2ZX6A 3OFNG 1UA7A 3VVGA 3QQWA 4DF1A 1ODUA 3AAMA 2FVMA 4FK9A 1NP2A 1ECQA 3H2NA 2WKLA 3KCOA 1ISXA 3G3MA 1WZMA 3BMVA 1RCQA 3FIGA 4W7WA 5CLWA 3VDGA 1DXFA 4QAIA 5HUPA 4JY9A 1OX6A 3HGSA 2VXNA 4WRHA 1U1HA 5RUBA 4XVEA 2GJPA 1KGUA 3O16A 4C90A 2WO5A 4MLJA 1KBJA 4QTGA 1NFGA 3P0XA 3OE7G 3N2CA 1KCZA 7A3HA 1IXNA 1GG1A 2OODA 2O7SA 2PTXA 3GY1A 3G0SA 3I7QA 4FNUA 3CZJA 3M9YA 3E0VA 4GKLA 3UPWA 1XYAA 3PJTA 1X1ZA 5JXQA 3T0BA 1P1MA 4H01A 4PTVA 4R53A 1V4YA 4F8XA 4YTSA 4OBRA 4GQBA 5C2XA 3W7KA <