4HYWA

Pyruvate kinase (pyk) from trypanosoma brucei in the presence of magnesium and f26bp
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
498
structure length
496
Chain Sequence
SQLEHNIGLSIFEPVAKHRANRIVCTIGPSTQSVEALKNLMKSGMSVARMNFSHGSHEYHQTTINNVRAAAAELGLHIGIALDTKGPEIRTGLFGEVSFAPGDIVCVTTDPAYEKVGTKEKFYIDYPQLTNAVRPGGSIYVDDGVMTLRVVSKEDDRTLKCHVNNHHRLTDRRGINLPGCEVDLPAVSEKDRKDLEFGVAQGVDMIFASFIRTAEQVREVRAALGEKGKDILIISKIENHQGVQNIDSIIEASNGIMVARGDLGVEIPAEKVCVAQMCIISKCNVVGKPVICATQMLESMTSNPRPTRAEVSDVANAVLNGADCVMLSGETAKGKYPNEVVQYMARICVEAQSATHDTVMFNSIKNLQKIPMCPEEAVCSSAVASAFEVQAKAMLVLSNTGRSARLISKYRPNCPIICVTTRLQTCRQLNVTRSVVSVFYDAAKSGEDKDKEKRVKLGLDFAKKEKYASTGDVVVVVHADHSVKGYPNQTRLIYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Pyruvate kinase 1
publication title `In crystallo' substrate binding triggers major domain movements and reveals magnesium as a co-activator of Trypanosoma brucei pyruvate kinase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 182
structure length 496
sequence length 498
chains with identical sequence B
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4hywA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 4hywA01
1OY0A 4TV6A 3EOOA 1PKMA 3MA8A 4IP7A 1F8MA 2L5HA 4ROQA 1XG3A 3T0TA 3PP7A 2R82A 4B5TA 3FA3A 3SRDA 3IS4A 4KCTA 4TV5A 1DIKA 1S2VA 4QGCA 4IQDA 4KRZA 1VP8A 2HROA 4HYWA 1VBGA 3QV6A 3R4IA 4KS0A 2HJPA 3HQOA 3M0JA 4LSBA 1E0TA 4B5XA 1IGWA 3HQNA 1VBHA 1KBLA 4QG6A 3ME3A 3LYEA 4L9ZA 1M3UA 2WQDA 4QG8A 1O66A 1U5VA 1DXFA 4RPPA 2VWSA 3BJTA 3H6OA 3M0KA 4B2DD 3KTXA 3PUGA 3QLLA 4YNGA 1GGOA 4QG9A 3HQPA 1A49A 4IMAA 3E0VA 4KCWA 1A5UA 4WJ8A 2KX9A 2XZ9A 3KHDA 3EOEA 2DIKA 2VGFA 3I4EA 1IZCA 4G1NA 1AQFA 2HWGA 3E5BA 2X0SA 2VGBA 3BJFA 2V5JA 3QV9A 3SRKA 1A3XA 4B5SA 2BG5A 1F61A 3EZ4A 1DQUA 1F8IA 4HYVA 2VGGA 4L9YA 3OYZA 4JPGA 2ZE3A 4KCUA 1F3WA 1KC7A 2XZ7A 3SRFA 4B5UA 5JVLA 3FA4A 1S2UA 3OQ8A 1OQFA 1F3XA 4B2DA 3N25A 2V5KA 2G50A 1JDEA 1U5HA 1T57A 1PKLA 3T07A 1DXEA 2HRWA 4IQEA 3GG8A 3P0XA 4DRSA 1SGJA 3SRHA 3G2GA 4L7ZA 1Z6KA 1M1BA 3QQWA 3QV8A 1UJQA 4MF4A 1MUMA 1T5AA 3B8IA 3OYXA 1ZLPA 2DUAA 1O5QA 1PYMA 1PKYA 1S2TA 4L80A 5TAOA 4FXFA 4KCVA 1XG4A 4B5WA 2VWTA 3QZ6A 3T05A 1E0UA 4FXJA 4B5VA 3EOLA 3GQYA 2XDFA 2OLSA 1ZJHA 1O68A 1PKNA 4MG4A 3QTGA 1A3WA 1S2WA 3E0WA 2VGIA 4YJ5A 2E28A 3VAVA 2QIWA 3U2ZA 3LG3A 3QV7A 3GR4A
chains in the Genus database with same CATH superfamily
1YADA 5FL0A 1LT7A 3TAOA 4M1RA 1W9XA 5I7GA 5HQLA 3PZMA 1XWYA 5HNRA 3GTNA 4K7YA 1X38A 4IFKB 1RY0A 1OT1A 3BLLA 3BLDA 3LMZA 3O7UA 4GK8A 3S47A 4AWTA 2V0TA 4GFIA 4Z2HA 1R47A 3KL3A 3QLLA 4HU3A 4AMCA 1EIXA 3OTRA 4Z0JA 3W85A 1J0KA 2PURA 4S2CA 2PCQA 3G1SA 1XLMA 3B0UX 2QJJA 1TUXA 4I90A 4V33A 3OEEG 5DY3A 4C5ZA 1RBOB 4B3LA 1TV2A 4JL1A 1VKFA 4C7GA 5C55A 5T9CE 3S5OA 3URNA 3WLHA 2QUUA 3K1GA 3GC2A 3UXKA 3UCDA 3CV6A 1A5CA 1GG0A 4LYKA 1W3JA 1XIDA 4MZ1A 2R24A 1JCMP 4Y9NA 1ZJBA 1PKLA 4WDUA 1T99A 4F2UA 4WDWA 4DRSA 4BI7A 3V3WA 1XSJA 2OZ0A 1BD0A 2YXXA 3RX2A 3IGHX 2PRLA 1DE6A 3RDKA 1FS0G 4C1NB 3WQOA 2EG8A 1E4MM 2PTWA 2ZTKA 1ONWA 2ZRXA 4FNRA 2OLSA 4IMEA 2QCHA 2BOFX 2GSEA 3W23A 4Q32A 5LIYX 4G7EB 3GVQA 4AZ7A 3N6QA 4Y96A 1YE4A 1JL8A 2D24A 3BLIA 3A22A 1EZ2A 3PBWA 2H8XA 1EJSC 1LT8A 1YDYA 2ZRUA 1TWDA 4MB1A 1RP8A 1J18A 2FZBA 3TYZA 3ZOAA 5JBEA 5HATA 2A1YA 3ZSSA 1JFXA 4WIWA 5A6MA 3OJGA 4TXEA 3NXLA 2OR2A 3EEZA 1RVGA 3E12A 2HLDG 4ASUG 2YDAA 2ZFAA 3K13A 4U5IA 2I1OA 2QVHA 1P0NA 1W8GA 3RILA 2IPJA 3QMRA 4QEHA 3GFYA 4GXPA 3W1MA 5K4XA 5A2AA 4AZCB 3QOMA 2QULA 3EOUA 3HO8A 1MNSA 4XB3A 3EB2A 3W7DA 2OZ3A 1KXQA 4XKYA 3WK1A 1W9VA 1SSGA 1EEXA 3G5EA 2Y2WA 4ZXOA 4GJJA 1JUEA 2GK1B 4UQ9A 2J7EA 3RNDA 1KB3A 4ZB5A 1Z6KA 5FEWA 2OQLA 2ZUUA 3BAIA 3KP0A 3WLOA 3GIPA 1DJWA 3RFAA 1X39A 5CG7A 1JCJA 2P3ZA 3ARXA 4MB5A 4G9PA 1MQPA 3WUBA 1WO2A 3VA8A 1VFUA 3IJ8A 3VCNA 2VC5A 3QYQA 2XFRA 3CIWA 3KOWA 1QWKA 3AWNA 1OZQA 3SRDA 1M5WA 4KCTA 3RK8A 4HSNA 3UT0A 1BGGA 1MW3A 2SFPA 3IEBA 1O5XA 5D8WA 1LBMA 2X42A 2DT0A 1U22A 3S2LA 1O4UA 1GYNA 3Q37A 2AQOA 1AD1A 3HFYA 3IIVA 2FIQA 4JOMA 4AWSA 5KZDA 4P8XA 4MWAD 3PZUA 1BKHA 1RPKA 2BDQA 2TPSA 1KRAC 3BV4A 1TWWA 4PA8A 3BOLA 5IHSA 3R79A 1H7WA 3TLLA 2AGTA 3ITYA 1BFNA 4M1BA 4ZO8A 4B16A 4JTLA 3MKKA 5EMUA 2XH7A 1E5JA 1CLKA 1MEWA 3W7OA 2XZ7A 2ON3A 3VUSA 3EMCA 2FDSA 3USZA 1G69A 4FP1A 4BEUA 1X6LA 3LM7A 3G1FA 1H5VA 1EJ7L 3MVTA 3SY8A 1M1BA 5M03A 3S5ZA 3TA6A 1DWHM 2GGGA 3GIYA 1ZRQA 1IE7C 3WJYA 2NQ5A 2ZRYA 4GYFA 4LOCA 2W62A 1RZMA 1VLIA 3VKAA 1K9EA 1FVPA 3S5NA 2W6IG 3DFPA 3L4YA 1H50A 2TSYA 4ERIA 3QZAA 1OGGA 1UH2A 3PB2A 4NJHA 2FLIA 4LCQA 4H4IA 1UWTA 3SUTA 1XW8A 3QPYA 2P53A 4C7FA 1BHGA 3A4WA 4JEQA 4TOQA 3LQGA 2VEGA 5AHEA 3RR4A 2CYGA 3OVRA 3PG8A 1ISYA 2RH9A 2CBUA 2I56A 2ZZ1A 1VBHA 1S5NA 3DOPA 4H9UA 2EO7A 4L4MA 1FDJA 2WLZA 3GM8A 2PP1A 1R9YA 3AHZA 2VNCA 1Y7VA 2D2OA 4ZTXA 1PBGA 3TXZA 3GNOA 3ZR4A 3OP2A 2CEQA 1YPIA 2C16A 3SN4A 1IXPA 3GXNA 3IV8A 2OYMA 1IR2A 1E6SM 2WSKA 5CSRA 1J2BA 1POKA 3WQWA 2YW4A 4L4LA 4DNMA 1QPKA 2YOCA 5CSYA 1QW7A 4CQDA 4GE8A 3VNYA 2OEJA 5K3VA 3JZEA 1B9BA 2TRSA 2CWXA 3CV2A 1FXQA 4QNEA 2VD9A 4Y9PA 3AYVA 1QTWA 1L6SA 2A3BA 3OZMA 2QCEA 4R7WA 2ACRA 1PYFA 4ZO6A 5CPQA 3GC5A 4Z1DA 3W7KA 2YDQA 2GUYA 5CBJA 3TNOA 3W1QA 3SR7A 2E6AA 3O07A 3W84A 4IX2A 5DN6G 1XX1A 4TUFA 3LCGA 2VX7A 2ALDA 1RCXB 3R6IA 4O14A 3NL3A 4FEZA 4ZE4A 4XZBA 3FJNA 4Q4RA 2IW0A 3IGSA 1H61A 3N9KA 2AOSA 2GJRA 1PZ1A 4H83A 3L0GA 3LERA 4GVIA 3RM4A 1EUAA 3CPGA 3HQOA 3GDRA 1G4PA 3T44A 4LUTB 2ICSA 4UNIA 3N19B 3ITTA 3GHSA 4HNVA 1HJSA 4NZFA 4DQWA 2NUXA 1H1ZA 1IR1A 3BAWA 1H8EG 3MSDA 2YJQA 3A5VA 4UOQA 3VKDA 1PZ3A 3NUKA 4F0KA 1SMAA 3FYPA 4LH8A 3NTYA 3JS3A 3A64A 5C9XA 1UKSA 3O2LA 3EYPA 5CPNA 2PUZA 2Y85A 4HYVA 4DJFA 4HNUA 3UZWA 4QLLA 4A8LA 4U4MA 1VCFA 2FJUB 3KBJA 3FDGA 5A8GA 5I77A 4E0CA 3BWWA 4I6KA 2Y88A 3VM5A 4AYGA 2ISVA 3GNDA 4CNNA 4PSPA 5HBFA 3L0KA 2RHGA 2PAJA 1UASA 5EL1A 4GGHA 2ZX8A 3UCCA 1O5KA 1ZALA 1DV7A 2FZNA 4AH7A 2FDMA 2IPGA 1DJQA 1EDGA 4MAVA 1E4LA 2EKGA 2PDQA 4NT0A 1ZJAA 3B05A 4M6QA 4RZ6A 4A35A 4F0RA 1CXLA 1W56A 3A3XA 2X1TA 4MZYA 1FKXA 2IQTA 2RJHA 3HQNA 5AHMA 1HGWA 4D1JA 3VDAA 1YNYA 4S39A 3SFKA 1YX1A 2PF8A 5D9MA 4MY1A 3B8UA 3LM3A 1CEOA 1TPDA 5CJMA 5AVHA 1S2AA 2YA1A 4F79A 1Q65A 4UC5A 4H7CA 5HJLA 3WX7A 2GVLA 4NQ1A 4KESA 1GQIA 2IKIA 1BG4A 4F8XA 2VX6A 4JIPA 1F05A 3T09A 4K68A 4D8ZA 4UTKA 5JUVA 4TT3G 4BK9A 1JDEA 3T0BA 2Y7EA 2R1MA 1OFOA 3HG5A 3FGCB 3KOYA 4AHQA 4N6FA 5CPOA 1ZP4A 2VX4A 1ODUA 3G24A 4QX4A 1G6CA 3BAYA 2GDUA 4J35A 3Q45A 1O6IA 4PBFA 3U0HA 1MW1A 2WJDA 1LZOA 2PDXA 2DT2A 9RUBA 1D7FA 4DUVA 4M82A 3UWVA 2BASA 3RM9A 4O1DA 3P82A 3HM7A 3A4JA 2WNZA 2XGBA 1OFAA 1X7FA 2VFEA 1MNZA 1E3ZA 3CH0A 1EH9A 3W9ZA 4DAFA 3HIJA 1UKTA 1YDVA 3VCRA 1T8XA 4OIFA 4D8LA 4GZEA 1RPXA 3PP7A 1GT8A 1LQ2A 4O15A 7REQA 3L2MA 1S38A 3LV6A 3EX2A 3RLGA 4C6EA 1YPXA 1TG7A 3RRXA 3HGSA 3DFYA 4DZAA 4Z42C 3S2CA 4L9ZA 4B4FA 4E4UA 4DNHA 1F6PA 2YPIA 1EJTC 3KTXA 2VQUA 2A3EA 2Y5EA 4Q4MA 3WF3A 2WNNA 5BU6A 3CZKA 1PEZA 3ZXWA 1QHPA 1ONEA 4J3SA 4BI6A 3UG5A 1GJPA 1ICPA 5LIXX 2Z6IA 1J9YA 2F84A 1LLOA 3TZNA 3NPXA 4DY1A 1JGMA 1H0IA 2OMAA 2NSXA 2QDHA 1R7OA 1GVQA 1P0EA 5L6UA 2QGHA 1LOQA 3WLSA 3FCPA 2WZMA 5AYIA 4XIAA 1O1ZA 1UWIA 3GK0A 1UD4A 2Q8ZA 3VKCA 3GDMA 1VC4A 3F2CA 4F40A 1S5VA 1S2CA 1EDTA 3LCIA 5A6BA 3VVGA 2WJFA 1GORA 3U5UA 3I68A 3GNPA 1V51A 3HV9A 3QVQA 3QGKC 3XISA 2JFEX 1E4NA 1FX6A 1YBQB 2ALRA 2CHNA 1YTDA 4CD8A 1B30A 1V0KA 3RPMA 2ZADA 3TONA 1Z7AA 1OY0A 4V1XA 4CD7A 1GEQA 4GUIA 1FH7A 4WGXA 4JIRA 4RE2A 1WQ5A 3M7SA 3QYSA 5DY2A 1R30A 1KTCA 3FEMA 4KPLA 1E1CA 2X7VA 4CD6A 4HYWA 2YCEA 1PX8A 1HXJA 2ABAA 4WLCA 1TFVA 4D72A 3T4CA 1IV8A 1FBAA 5FJIA 4HQVA 3V1HA 2QGYA 1HVXA 2DEPA 1BYCA 2HWGA 2V3GA 5BCAA 3OLDA 1Y5VA 4NX0A 4K8HA 3RX3A 3NG3A 1OYCA 3PUEA 4V27A 3VK5A 5FSDC 1W37A 3TSMA 4IIHA 4Q4QA 1YMYA 1RALA 3LHZA 4GC4A 3DYMA 1LBFA 3WD3A 2FZMA 1K7EA 1Q66A 1K9FA 3ZVHA 3LPFA 4HPHA 5AC5A 4YYFA 5I3KA 4D6HA 1TV3A 1BVWA 2OYKA 3FVDA 2YL9A 1B3ZA 3T4WA 2CITA 3BLKA 2ZC1A 2PD9A 1UZ4A 1PTAA 3TJ4A 4LUSB 4AVFA 3N9RA 3NPWA 3HG2A 4E5TA 3FKRA 2DZTA 5CH9A 2XDFA 3STPA 3WF2A 3WNLA 1RQEA 3WLPA 1FP8A 4E3VA 3NZ1A 1GZGA 2RDUA 3ABZA 1SSDA 2Y1HA 3W1RA 4LS0A 1W0JG 1A0DA 3G18A 2BY3A 3EX1A 1VPQA 1VPYA 3WH6A 4DELA 3NIYA 5HINA 4IPIA 4EF8A 1E1EA 2IUZA 1UOZA 4HCDA 1OCNA 2W79A 1PUDA 1HL9A 2X05A 4OGZA 3CUJA 3KBVA 1PCKA 2GSJA 5CZSA 2NUWA 1MUCA 1ME7A 4LALA 5FJUA 2E9LA 1GKPA 3BJTA 1R5YA 2OKTA 1G01A 2Z00A 3MJYA 4E2OA 4ZOBA 1DL3A 3TMQA 3HN3A 1XGEA 4PSRA 4ADTA 3ZJKA 2O55A 3FN9A 3LMYA 2GJNA 3EWYA 2EHHA 4IQLA 3QMSA 3VIHA 2DORA 4B15A 3VKKA 1KXHA 3R0DA 1J79A 3LHUA 1E51A 2NXGA 3PUDA 3ZS4A 1I2OA 2Z28A 4M6VA 4JS3A 1B3WA 1WX0A 4XBSA 3LTPA 3QV8A 1P5BA 4H9YA 4N9DA 3Q2DA 1NDYA 2Q01A 3TUUA 3OVQA 4GI4A 4MNKA 4L6HA 5F4WA 1S46A 1PKNA 2HVOA 3SSZA 3MCMA 2OB3A 3VX1A 5G2WA 3FV9A 4QISA 2WB5A 7XIMA 4GOAA 2D73A 4KW2A 1QPRA 1OIFA 1WUFA 3VGBA 3FNDA 3NXFA 1QK2A 1OZMA 1DIEA 3GTFA 4QJ3B 2HZGA 2WOQA 1EX5A 4WZHA 1RXOB 1GOWA 3ES7A 3APYA 3IVUA 3WK0A 3JRKA 4PTWA 3DGBA 3HQPA 2QW5A 3W25A 5C2XA 4RZBA 4O1CA 1WDPA 3PJWA 4S1FA 4XZMX 3SCUA 2B7NA 1Y0EA 4HGXA 1W9UA 2J9ZA 4MGGA 3WBWA 4PMDA 1YW1A 3L2LA 4ML9A 2VL4A 1FWEC 1L6FA 3NDZA 4LAUA 4FI4A 5H6HA 1BF6A 1QMLA 1P0BA 3A4XA 1CWYA 1Z48A 2A3CA 4LQ1A 4A3YA 2AGKA 4I7WA 1DEDA 1XPGA 3EWCA 4QIUA 1BTCA 1O5QA 3T9PA 5KITA 3W70A 2F9RA 3H8AA 4XD3A 3WEMA 4QJ5B 2XSBA 1HJUA 3SURA 4ZVJA 1ZBVA 3HA1A 3IJLA 2BOGX 3SCOA 1G4EA 1K8ZA 4YXGA 2D23A 1KLYA 1PAMA 5CC7A 3XIMA 4FLRA 4FIRA 1F7BA 3AAMA 4CU7A 1XCFA 5A8NA 2QXWA 3QF0A 2C14A 3IJ9A 2FTWA 5EA9A 2FYMA 1A53A 3V5CA 4PFHA 3C8FA 3CZ8A 3K4WA 1TR9A 4J3VA 1TV8A 5A8PA 5CGMA 1XP3A 2X0HA 2XSAA 4DWSB 3KHDA 2NQJA 4HK5A 2VVNA 3NL2A 4RW3A 1TPC1 1AQFA 4TQTA 4OKDA 1TR1A 3HJEA 2VGBA 1UQZA 3LGGA 1JZ3A 3TN5A 2ZUMA 1WBHA 3LCXA 4I7UA 2JIWA 5M1TA 4NZJA 1K7FA 2WVVA 2OZTA 5A8QA 3OZPA 4C1KA 2CK3G 2C1IA 1RBAA 3OLIA 3VM7A 3AICA 4DXKA 2QDGA 1ALDA 4PTVA 5FI8A 2WMGA 4DJEA 2HEJA 1TMHA 2H3DA 3FDKA 3LBOA 4JYDA 2Z26A 4EANA 3R1ZA 3BARA 1EFZA 1TIWA 2PC4A 5HNUA 4HU4A 3CQ0A 1K77A 4FA3A 1V02A 1MSSA 4IL2A 2HPIA 3GDBA 3THUA 4O53A 1NWTA 3C86A 3D6NA 4XK2A 3EMZA 3OBKA 1C9WA 3CUGA 3CUFA 3MMDA 3KZPA 4LXFA 5CXPA 3WF4A 4CEXC 4YXWG 3LTYA 4LRTA 2VO5A 5G1MA 1P6CA 2ACSA 1JZ7A 1BRLA 1V3HA 2WC3A 1W5QA 1VJZA 2EPNA 3V0TA 4IXXA 1GJWA 3TEVA 3A21A 4P8WA 1PL9A 1E9YB 4DIAA 3UU0A 2CBIA 4FNUA 3BE7A 3LI0A 4WSHA 4OUIA 2WSYA 3ES8A 2WPDG 1J0ZA 4IFRA 2X41A 4JR5A 3OGRA 1UD8A 2XN0A 4O16A 4RNJA 2X0YA 2ZUVA 3WSUA 3UZYA 2PRMA 1JCNA 1UW9A 3LLDA 4K6AA 2NV9A 4DZ5A 1NOFA 5AHLA 1N8WA 1KV8A 5JIWA 1QI2A 3L4XA 1L6GA 2Y70A 3KL0A 2Y8UA 4A22A 1HO1A 3QTPA 3A9BA 4PH6A 1W2PA 2QKFA 3N6JA 5H1WA 4PL2A 5E0KA 2NX3A 4BWLA 4W84A 2JQXA 1JXKA 2OPJA 3PPHA 1MXDA 2PP0A 3BK0A 4MADA 1Z69A 4UTWA 4H1ZA 3GYEA 4CCDA 3A3HA 1AW1A 5T9BG 4U3AA 4WDTA 1F5ZA 4Q6XA 1I1XA 5LZLA 1EHNA 2PWFA 1YDOA 5CZTA 7TAAA 1VD6A 3EXSA 1UG6A 5F1UA 3ZMRA 3B03A 1KFJA 2WZEA 1LLZA 3Q94A 2R6OA 4WOZA 1I75A 5EMMA 4UTMA 4DBEA 2WPGA 3GZAA 4DBSA 2WMIA 4WJ8A 4NAEA 1H7XA 3NO5A 1POJA 4NAFB 4V2XA 3ZFHA 3FXGA 5IDZA 3NQ6A 5AC6A 5E0CA 3HMJG 4PUEA 1XRVA 2ZX6A 1TV4A 4OHQA 3NGJA 2CU0A 4NJKA 2GGHA 4GRSA 3U48A 3JW7A 1NWSA 4JX5A 1DORA 3FJLA 5A5WA 3LZ3A 3GXTA 2GWNA 3S1XA 5C54A 5ECUA 3CO8A 1EOMA 1UOKA 2DVXA 3S9IA 1W1IE 4W7UA 1W3IA 5FAJA 5DQPA 4A8RA 2DSUA 2QPUA 2WBGA 3VD9A 1Y5WA 1JG9A 2ZUSA 4L80A 5GVJA 3N11A 3GRIA 3VDCA 4NKCA 1TJPA 4S3FA 3S5SA 3RX4A 1ZP3A 2W6RA 2GQAA 1JGIA 2QCDB 2XGIA 3BMWA 5FL7G 1QO5A 4RZ4A 3CQIA 2ADAA 3N2BA 3SGGA 2CZVA 4JCLA 3GR4A 1OADA 3ZLHA 3E9AA 1QBBA 3KVLA 2PWUA 3O1NA 1F8MA 2OX4A 4HTBA 3QKEA 2BY1A 2IKGA 2E5BA 4ADSA 1WKEA 3PZIA 5EYWA 1D8WA 5AB3A 1HIZA 4LSBA 2GLKA 2VOTA 2YLLA 1Q13A 2IKJA 4GABA 1KCKA 3MKVA 2O9PA 2PDCA 3CAVA 3CWOX 3M0LA 3G3MA 1Q8JA 4E8DA 1E0WA 1K3UA 4PMZA 4O8AA 5TNVA 4QITA 4UQBA 2FH8A 4W88A 3LDVA 3QR3A 3AJXA 2A7NA 4HCLA 3PC0A 3ZO9A 3V5OA 1ZCOA 1UKQA 1C7SA 3NQ8A 4J1OA 2QPXA 4FNQA 5D2WA 2INEA 4B5NA 4WCJA 5DMMA 3MI6A 1IHIA 3MYOA 1QOQA 4K1WA 2WZTA 3MVIA 1XH2A 1EX1A 1WDQA 2E67A 3SCNA 3KWSA 4ZOEA 1ENUA 4RDWA 3E74A 3P74A 1U5JA 1J0IA 2D2GA 3E0WA 2VGIA 1HW6A 4H6KA 1GJUA 3NQDA 1WDSA 2JJ1G 3V18A 4O0QA 1I9CB 1OC6A 3DFHA 4UFJA 4AF0B 1XLAA 4CD4A 4ONVA 3KM8A 4F0MA 3S2MA 1GVIA 3N34A 2DT1A 1IXOA 4AXKA 4X22A 4IUGA 1LF1A 4PMOA 1US3A 2NLYA 3QQ0A 1V6VA 1H49A 4Z1AA 4BZYA 4WKFA 1J11A 1WXYA 3P8JA 2POZA 3NM1A 1OVDA 3R0UA 4AVNA 1A5LC 2WM0A 2XIQA 1G9HA 2E6DA 1FKWA 1H5YA 4QSFA 4F0HA 5D2XA 4Q8OA 1XINA 2QCMA 2E9MA 3CWNA 1H7NA 1CXEA 5M17A 4IJBA 3WLNA 3OPSA 1XF0A 3SUSA 1A50A 2C1GA 3ARQA 4HKPA 4PODA 4LS1A 3WQPA 4TO8A 2YZRA 3W81A 4B2DA 1A5KC 2IPFA 2FTPA 3I3DA 4S3EA 2YA0A 4HZ7A 3M0MA 1QATA 3N2MA 5I3IA 2BV9A 3H2CA 3SY1A 3UEQA 4RJEA 2Z4GA 4H6QA 4IICA 3R11A 2NLIA 1KM1A 2OO0A 2VZSA 4A3UA 4IUOA 4U28A 2PDMA 4XD5A 3LRMA 1QNVA 4PCTA 1EC8A 4B9YA 4UMCA 1TPFA 5IBXC 1F6YA 1UD3A 3ABQA 3BANA 4P2VA 2QMJA 1BPLB 2C8NA 2E77A 3ARPA 4KRZA 5KINA 3GH5A 4BS0A 1LBLA 4N4QA 1DXIA 3BICA 2ZX9A 1B2YA 4MWAB 2PD5A 4MUPA 6ALDA 1XUUA 3EXRA 3L0NA 2XZ9A 1QBAA 2A7PA 5JXQA 1ODZA 3SZ8A 2D22A 2ASHA 2C6QA 5GJPA 1ADOA 4NSBA 3GVGA 5F4XA 4ATWA 2DQXA 4ROPA 3DHDA 5DANA 1SFJA 3AYTA 2BVWA 4QHRA 4BQ5A 5I0DA 3UF9A 1SFTA 4J7RA 4MMWA 2G50A 5FSEC 4FLSA 1JQVA 3GHUA 1OJXA 4A3HA 1TELA 4JQ3A 2OEKA 5BOEA 3HF3A 2HV5A 4OUEA 1ELSA 1UP0A 3CAQA 4F4RA 4BA0A 1B54A 2JEPA 1K4HA 3WLJA 9XIMA 4NNBA 1TZ9A 2V2DA 2DPEA 1S1RA 3DI0A 4RCXA 3WLTA 4WY0B 2PWDA 1KR0A 3GC4A 5IDIA 3M0HA 1NFPA 1Q5MA 3N2TA 4W89A 1J01A 4UFHA 6REQB 3LCHA 3AXIA 3VI2A 2Z24A 3M5VA 2V2CA 3QY7A 9XIAA 2F8QA 2VZOA 1FWHC 4ZGYA 5A6LA 4LVDA 1SO6A 2E1WA 2WHLA 1XKJA 1XISA 4X60A 1E1FA 3RYSA 1J10A 4M81A 1GOIA 5M3WA 1E0VA 1XLDA 4IM4A 4POCA 1KTNA 2RDXA 1N8FA 2VCBA 4DEFA 3PZTA 3KBMA 3ZWSA 1OD0A 3P84A 1HG3A 4UXDA 5J5DA 4XISA 2J62A 5HWMA 1YXCA 5BXPA 3W01A 1IIGA 1UD6A 1NDVA 4KH2A 3EDDA 4EXBA 1FCQA 3NQGA 3L12A 4HOZA 4H2HA 1DXEA 4NJJA 1G4SA 5EMJA 3MDUA 1O95A 3QY8A 1PCWA 4PB3A 1QOPA 2JF7A 2C0HA 4UMAA 1REQB 5G4HC 3O63A 4LB4A 3T05A 1X6UA 3WNMA 4C6NA 3O06A 5FJJA 1VCGA 3ABSA 4PTDA 4GCAA 1WYIA 3UNTA 1QRQA 2XIOA 3VAVA 1V3JA 4LYRA 5D04C 3W7HA 2J6XA 2PDHA 3WUFA 5EPDA 3MP5A 5AHNA 2C15A 3WNOA 3E1F1 4QP0A 3MHFA 1HQTA 4GX8A 2A0NA 3LB0A 2CZFA 3QQ1A 4DBDA 1XFCA 3NCOA 1E0XA 4GYPC 1WCGA 1NVMA 2GGEA 3CJPA 1JJKA 4ERAA 4MJ2A 4WY0F 5LGZA 2CZEA 3B06A 3WH7A 2GVGA 5F2MA 3ARRA 3DXIA 4ICMA 3EKZA 1G0CA 4YTRA 2Q6ZA 1KNWA 4U33A 1JPKA 1D8CA 3GW0A 4EXAA 2Y5SA 4O1AA 5G4EA 1EJUC 2DDXA 4I9TA 3W7CA 3EEGA 4EF9A 4TMCA 4QDMA 2ZDRA 3TK7A 2V5KA 4HHPA 5DO8A 3S4TA 3WD2A 2PDLA 1ZUAX 4I8DA 4YCOA 3TU9A 5FESA 2G3JA 2ZA3A 3H12A 4RK8A 1Q8AA 3UD6A 4YN5A 1HF6A 1G7VA 3RMJA 1S2TA 3K1DA 3DYOA 4XSLA 3KX6A 4HP5A 1MWOA 2WAGA 4S3GA 3N2CA 4HVXA 3MPGA 3ANVA 2VCCA 4O0KA 4L56A 3ZWTA 1MW2A 1N82A 3MTWA 1EYWA 2Z1SA 3KTCA 1W3KA 4Y6GA 1HKWA 4C6DA 1DJYA 2GGIA 4R7OA 2CZ5A 5I09A 3FYOA 4M7SA 4ROQA 1X97A 5LNVA 3ARYA 5LNSA 5FF7A 3T78A 1UKPA 4LTSA 5C70A 1KKOA 5U4NA 1R2RA 1VBGA 1QR7A 2CCRA 4UOZA 3W22A 2NW0A 3IPWA 5T26A 3LGDA 1Q6EA 3PTMA 1J5SA 2NZLA 3NL6A 3W1TA 1HJQA 4HZ8A 2DIKA 3P81A 5LNWA 1LL4A 4B91A 3VDGA 3E5BA 1SR0A 3G1RA 4R88A 1RCQA 2VDHA 4O28A 3TH6A 4PL1A 2PGEA 5A6JA 2OEMA 2BWGA 4ZSUA 5IFPA 4XO6A 1U30A 4JFUA 3OO2A 1PTDA 3EA1A 4MKVA 3BJSA 1JCYA 1KBKA 3M4HA 3MDWA 3LSBA 3DHUA 3H2OA 4HNOA 4MY9A 3CUXA 1UR8A 2PRHA 1PZ2A 2XYLA 4PCSA 1H63A 2C18A 3WO8A 1T5AA 1LQAA 4BF9A 4IJRA 3S2NA 2V30A 2QE7G 3KL5A 5CZ0A 2VEPA 3M44A 1GHSA 1TIMA 1N7KA 4ASTA 2J7FA 4IPJA 2OOFA 5FIPA 1QPQA 3JZUA 3W86A 2DZSA 2DIJA 3WMCA 4FNPA 1K1DA 4ZB2A 5F1VA 3W53A 1IEIA 1PWMA 1I45A 3CMJA 3KS5A 4Y9OA 3W82A 2R1PA 3ARSA 4RUBA 2R1NA 3P0WA 1OIMA 4Z08A 2RJGA 3COTA 4PUWA 4K7VA 1JAKA 4IPPA 5DX7A 3PN8A 2VTFA 1CNVA 2C1HA 3M0XA 4GNVA 3WBXA 4Z2JA 2HE8A 4XAYA 2BFGA 2RGLA 2YCIX 2E0PA 2OELA 3OB8A 5A2BA 1WXZA 4HHMA 3RMEA 3WY1A 4O1BA 3WLIA 3M0YA 4MPQA 5FKYA 3IIXA 5I79A 3ZVIA 4IFKA 4DLMA 3PVFA 4XZLX 5IXEA 4B5SA 3EDKA 4G6CA 3O05A 3V35A 5A6KA 3LI1A 1VFMA 4ECLA 2FFCA 2GSHA 2VENA 2GJXB 1LWIA 4ZA0A 1XR2A 1DE5A 2O4QA 4HOXA 3KE0A 3G0XA 4N6EA 5TF0A 1RD5A 1SW7A 5I06A 4LJ3A 7ENLA 3VD4A 3KOXA 2C13A 2G95A 1IT0A 2EQDA 3TTEA 4J3UA 1V3MA 2FZDA 3TV8A 4O4VA 1M7OA 4AD1A 1O68A 2GYIA 5D32A 4AIEA 4LVGA 3GW3A 4M51A 3H2EA 1RBLA 1ME8A 1Q7MA 2BXVA 4A2SA 1RA0A 5I3HA 5AYXA 3P7YA 3HPZA 3THCA 4C1NA 3N04A 4LEFA 3LLFA 2WC4A 2QLYA 2DJXA 3S1WA 4LU0A 1KFKA 3W2LA 3WH8A 4JZ5A 3GZ3A 1VENA 4Q8PA 1M04A 4M8UA 1PV8A 4OECA 2ZXAA 1B9ZA 4G7EA 4X63A 4KCWA 1HVQA 1TTQA 2GGJA 1XUZA 3ZSTA 4JN6A 4FB7A 1E43A 4J5NA 1CECA 2P76A 3H55A 3TYBA 5DXXA 3P60A 1OF8A 4K3ZA 1UWQA 4CVUA 4GA8A 4UNLA 2PE4A 1F3XA 3WELA 2BGQA 1WZLA 4H2CA 3RU6A 3IANA 4XUGA 4IIBA 2WWCA 3CS2A 4M6PA 3BSGA 4WHBA 4MSSA 3RLVA 1XYFA 3UJEA 3BTNA 4J3WA 3VKBA 2VZTA 4H6EA 5D2VA 4KBXA 3DAQA 2CXGA 4ML4A 5I2UA 1V03A 4AEFA 5E0FA 5BROA 2EGZA 3PBMA 4DM2A 3VFLA 4AZCA 2QCNA 3WK3A 1LL6A 3PJXA 2W0UA 1XYMA 1JAEA 5IFTA 5GNZA 4BI5A 2OO6A 5HUPA 1KWGA 1E6XM 3FW6A 7A3HA 2XN1A 3N17A 1W1PA 3BC9A 3CHCA 1PX4A 4ZQRA 4L64A 2GK1A 3KCOA 3NYZA 3H70A 3HGOA 4TV6A 1TZZA 1W31A 2DSWA 1JCXA 1KWKA 2PDGA 4KRUA 2Y7DA 3TXVA 5FJRA 1EA9C 3MUCA 4GCXA 3RXZA 4JTCA 3U3HA 3R25A 3WYZA 2QMKA 1XRSA 3R4IA 1P7TB 2VZVA 2WVSA 3IJ6A 1TTIA 3AIRA 2F6XA 3RU8X 4J3XA 3LN3A 2UV8G 5GNYA 4JTJA 1UHVA 1IZCA 1FH8A 2W5FA 5DN1A 4UFMA 4JN7A 1ADDA 1R2TA 1TE1A 3WCZA 3HTWA 4OJYA 4X61A 4AAJA 3OOQA 1FWTA 3WQVA 4QJ4B 3CXOA 1VFOA 1EHAA 5E09A 1EO5A 2CLMA 1QNQA 2ZDSA 5TD4A 2Y63A 4PMYA 3O9NA 5AY7A 4GH1A 3URQA 4CQ9A 3MQTA 1X6NA 8XIAA 3WF1A 1NAL1 1ISVA 1O7AA 3OEHG 1P6WA 1PYMA 1XSIA 3PSVA 4AD3A 2A2IA 1E6NA 4IF2A 4QAIA 4HD5A 4AEOA 3PS7A 4Q8MA 5AECA 3WH5A 4UCFA 3RITA 1MZRA 4N2YA 3ECQA 2WANA 3TQVA 4O54A 3MMTA 1B90A 1JYNA 3V16A 1GZJA 2CC0A 4O50A 5H8UA 3A9IA 5JIPA 3QSTA 1GQKA 2NXIA 4XZHA 1NWRA 3EKGA 2CPUA 4HA0A 3O6DA 1THFD 2GVEA 3ZJ6A 5J04A 5D05A 4IXHA 4EWJA 3B0XA 3AZSA 2EPOA 1XRTA 4AHPA 2QUTA 4CLMA 5MKGB 1LP6A 2ZBTA 1KTBA 1UR3M 3DG6A 3QFWA 4A4AA 5FF4A 3LXCA 2B31A 4LBRA 3BXWA 3DEQA 1H3GA 3GKAA 1H2JA 3VIOA 1TQXA 4V15A 1CXIA 4XTDA 1PIIA 5E6YA 1B1YA 1OFEA 2GJLA 3CTLA 4F9JA 1WA3A 4JICA 3T42A 2Z1BA 2J8FA 3B8SA 4AWUA 1RP9A 3LRLA 3UWYA 2HRWA 1US2A 4LW7A 3MUIA 1BXNA 3DECA 5FOOA 8CGTA 3UVAA 1BEUA 3C5QA 3NPVA 4HMEA 1OK6A 4OQVA 3XINA 3EKLA 4LRSA 3NL5A 1SO5A 2E7FA 2H8ZA 3DG3A 4C6LA 4N4PA 1UUQA 1WDRA 3AU2A 1W17A 5DCBA 1HKJA 2AMGA 2CESA 4CCCA 4AZHA 4H8UA 4GQ0A 1TJ2A 2R82A 3WF0A 1FWNA 4Z2KA 4CUCA 5E9AA 4N0RA 2P8BA 2V38A 2Z25A 1HGYA 2ISDA 3W3OA 1PDYA 3VGEA 1FP9A 3T0DA 2J7HA 3AXMA 4Q8NA 4GQQA 4O57A 4A3QA 3U4AA 1N8IA 4B9ZA 3L4WA 4O13A 1GOXA 1UC4A 4FSAA 1LQ0A 3BSHA 1C91A 5G2HA 1JDFA 1CPUA 4LUTA 1DQXA 5ABGA 4AY7A 4QEEA 2ZVIA 3FJ4A 1JDAA 3MUY1 1W9PA 3WQ5A 2GUUA 5C0QA 2PWHA 3W4RA 3MHGA 1WV2A 1KRCC 3P6LA 3B9NA 1XLJA 2JBMA 3VGHA 2NVCA 1OEPA 2O9TA 4YYCA 1JPIA 5I3FA 3B04A 3UY8A 2P3EA 1LDCA 1NP2A 5C5YA 4XZ9A 1PIGA 1TKKA 3MV01 3VIMA 4AMAA 4JDBA 1FHDA 1FOBA 3CM4A 1C8VA 3WBYA 4DPQA 4S3JA 4IOTA 4WR3A 5TBOA 5REQB 1OX4B 2REQB 4ACZB 5J5RA 4IZGA 3TCEA 5RUBA 4DWDA 3FX4A 4UZUA 3RF9A 3OBEA 3GS6A 3M5XA 4Q8QA 5I00A 2X1SA 4R33A 1BQCA 4GG9A 3MSRA 3IJIA 1Z41A 4PE8A 2QCGA 1K9TA 1QNOA 1OHLA 4GIYA 2BNJA 2WM1A 3BZJA 1O66A 3FY1A 4AD0A 1AMYA 3MJMA 4W7WA 2YW3A 3T2PA 4QLKA 2NUYA 3ITCA 2VM8A 1QI4A 4LB3A 3ABXA 4OOUA 2OSWA 1WDDA 2WCSA 2D69A 2E6FA 3REQB 3BJFA 1HNYA 3QV9A 3R58A 3R10A 1TA3B 5CKSA 4LAKA 1NH6A 4K36A 3HZ3A 3LBMA 4MHBA 3W72A 3ATYA 4HNCA 2WV8A 1KFCA 4P7LA 2P10A 3S9ZA 3BH4A 3ONBA 1GVSA 1CBGA 1K7XA 1LWJA 5BXRA 1BF2A 1Z32X 1JVNA 3TA9A 3ZIZA 1XBXA 4FR6A 3NGFA 1Y65A 5C6MA 3W38A 4GUFA 3G0SA 2XWEA 2E28A 4GJ1A 3FGCA 3INPA 1GHRA 4F2BA 1RUSA 1UH4A 1VB9A 4IP5A 2I5QA 5C9WA 2AAMA 3TVAA 1F4HA 5M2FX 1UWUA 4BY3A 4Y7EA 3MUAA 1XKYA 3TYCA 2PFHA 3SN0A 4GVGA 4J2PA 4QXIA 3ZYZA 1V3IA 4XBJA 3P61A 4IMAA 3IUHA 4JTFA 2EJAA 2GUBA 3EWDA 4GNKB 4LNCA 3TN3A 1Z9AA 5LKYA 2FPVA 5I3JA 4JTDA 5HPCA 4OV4A 1ECEA 2G3IA 1EIBA 3MW7A 5BRQA 5A6TC 3LPGA 2PDWA 3O15A 1L6YA 3MHUA 4E8CA 3RIKA 4L65A 3QC3A 3G22A 4HMCA 5BRPA 5EMYA 2YR1A 3UYIA 4R9OA 1I0BA 4CN1A 5DT7A 5CLWA 3E2VA 4RXFA 4BHYA 1M68A 3EWUA 5CZJA 3PJUA 4DI8A 2VEFA 1CXKA 4QM1A 1XXXA 4L1WA 1AH3A 2QVNA 2QT3A 1ECQA 3SM0A 3BLEA 4ZO9A 2JIEA 3I4KA 1DTNA 5A3HA 1WKYA 1VLWA 4NUWA 4UIOA 2VFFA 3AROA 1OBAA 2H9AB 5JBDA 4ZOAA 2ZZ3A 4M19A 2WJEA 4M6UA 3KAOA 1XPYA 2YBVA 3DCPA 1TX0A 2PDIA 1FDZA 1AJ2A 1YBQA 2W66A 4WKAA 2PLJA 1XQKA 1G5AA 1UPMB 1F76A 4Q4SA 1ZCCA 1N55A 2Z29A 4LUYA 3LSCA 3UA3A 1NU5A 4PZVA 1JYXA 2TYSA 4ZQPA 3VDHA 1UZ1A 5C9RA 4B4HA 4C65A 3QY6A 2GVYA 3DFTA 1E6ZA 3WDPP 4W5UA 1PHWA 3WMBA 1M7PA 2E6YA 2QUVA 2VDIA 2AQVA 1TCDA 1RSCA 5CSSA 1YRRA 1AD4A 1T8QA 3W2NA 1XLHA 1WBJA 2FGLA 1DWGM 4AX6A 3TTYA 4TMBA 4KCVA 1EP3A 3F1QA 4OE7A 1B4EA 1WAUA 4ZTYA 1XLLA 3CL6A 4Q4KA 3OHMB 5L9FA 2Q8XA 2VC7A 3BVJA 3FAXA 5HNNA 4UMBA 1AH0A 4EAYA 1CGXA 2I17A 3AAGA 2HCVA 3U6WA 3EDJA 4IGNA 1L2QA 1XG3A 5ENLA 4LVBA 2FHCA 3AC0A 2JGQA 4LUSA 3RR1A 4C6BA 3I3BA 3FEQA 2HROA 1C3FA 3RM8A 4QQUA 2VEIA 2GZXA 3MS8A 2I16A 6CGTA 5FCZA 1FHLA 3N4AA 3AZRA 2HNEA 3DU0A 5CJ5A 2PU0A 5A95A 3STFA 2O0TA 4ZO7A 1UC5A 3W0KA 2G5WA 2QUNA 1F74A 2YZ5A 4QJ1A 4W5ZA 1GVEA 1MMFA 5CSUA 1B4KA 4MUZA 4WSKA 3SQLA 1OFPA 4A8IA 3L68A 3G3DA 1T0OA 1YKWA 3G77A 2I7GA 4UTFA 1MYRA 4XZIA 2WSQA 5A6AA 2Q09A 1DJGA 1W3TA 4MFEA 4FALA 1SM9A 3PFMA 4AU0A 1W6TA 3U8GA 1JNEA 2YYTA 4P8UA 4LV9A 2ATMA 4Q8WA 1XG4A 3TYAA 1E0UA 1T96A 4KGJA 2OT0A 3SQMA 5EY5A 1J2WA 3I6RA 2VZUA 5BOFA 3AU6A 1EGMA 2BX7A 2J13A 1L6WA 2QF7A 1Q6RA 2A21A 1GVRA 3LNMA 3FJ6A 3S42A 4X9SA 5JBFA 2NQLA 1T7LA 2BGNE 5H2ZA 4FMVA 1UUMA 4FIQA 1R46A 1NQ6A 4GO8A 3ABRA 1GTEA 4XSMA 5JU6A 1SFSA 3B9OA 4CNSA 3T81A 5CJNA 3S1GA 1HKMA 4IMFA 3EAUA 4X9YA 1B0IA 2V68A 5CBBA 3TJIA 4H01A 5LIWX 1MW0A 3IRDA 1I2NA 1AFSA 2HPMA 3S9YA 2PZNA 2NT0A 2PC8A 1XYZA 3T8QA 3S83A 2PPGA 1Q4WA 4XAGA 2QJNA 4TVCA 4Q22A 1U1HA 3MANA 3WQFA 4IIDA 5D9OA 1I1WA 1GNXA 4QLJA 2J47A 3TW6A 3VIPA 1KGXA 1NOWA 5A69A 2HVMA 4ZXLA 4A8NA 2DP3A 3PPCA 4GYKA 4IT1A 3T0CA 2DZUA 4HK7A 3QQWA 4Q4OA 5IOBA 4UZSA 2A3HA 2HDJA 3HG3A 3H7VA 4BQ2A 1F4AA 4Z17A 4J3ZA 1Z8AA 4MZ8A 5I24A 4JY8A 2WSPA 1A3WA 5E9XA 2DU2A 1V93A 5EFDA 2PDFA 1MDRA 1A3HA 1WE5A 3NPUA 4UFIA 1Z44A 2WHMA 3WLRA 3QV7A 2CLFA 1TJRA 4X2RA 1VFTA 2O7SA 2INFA 1C8YA 3E49A 4F0SA 3ANYA 2ZQ0A 3IJDA 1FWGC 3UPBA 1U2YA 3TWBA 3C56A 2PGWA 2PEVA 1MQRA 5AOUA 3B8DA 1I2RA 3GY1A 1AQMA 4NY2A 6TIMA 2PDYA 3IUDA 1KRBC 4ZODA 2QNEA 3VX0A 2FZ9A 5MF5A 4PULA 3R2GA 2ZE0A 3O8AA 1SZNA 1K4GA 2GPTA 4WEVX 2G4FA 1SZEA 3R7MA 1KQZA 2Y8KA 4HA1A 3W6YA 5BYWA 3M9YA 3MUZ1 1UR2A 3I10A 4A3RA 4DWSA 2ZVRA 1KBJA 1RH9A 4WOQA 4KWWA 3F4DA 5DBUA 1W5PA 2XINA 3P8IA 2WMFA 3OYXA 1Z42A 4GO9A 3FAWA 4YWSA 1W1YA 2NXHA 3BSMA 5KZEA 1LRTA 4L5ZA 3VNKA 4PR4A 4FXJA 4QS6A 1AVAA 3BCDA 1QU4A 3AS0A 4GWEA 1JR1A 3U7VA 4YJ5A 1SU5A 3CAWA 2JIZG 2J4GA 2ZWYA 4O52A 2UWFA 4OBTA 1T41A 1SQ7A 3FKKA 7PTDA 4XAZA 1IF2A 4RNHA 1KRMA 3URAA 3S5YA 3R94A 2BOEX 2NT1A 5HK4A 3TFCA 1D3CA 1YQ2A 3UPMA 4R34A 1L9WA 4HZMA 3LLXA 4UB9A 1TVNA 1GG1A 2BHYA 3GNXA 1IT8A 1F73A 3W28A 1KM6A 2VT0A 2Y8VA 1JYWA 2P0OA 1TPWA 3UY7A 1NELA 2DIEA 5LSMA 1G7UA 3U2EA 5BMWA 1OG0A 1F61A 4HHHA 4GVFA 3P5ZA 1YLVA 2E09A 2VURA 4AHOA 4C6QA 2DZXA 3OQ8A 1PX3A 3VUPA 4HMDA 3BW4A 4CQCA 5AYYA 3W07A 4WJEA 4PRRA 2NX1A 2CKRA 1BWLA 3R0KA 4HU8A 2YL5A 1V6XA 2E8ZA 4A05A 1V6UA 4OFCA 2JGYA 2X40A 4HIBA 2D0HA 1QT1A 4ZE5A 3NA8A 1YXYA 3E96A 4AZGA 4PMRA 2ESCA 3CUHA 3AXKA 2G3FA 3V75A 2QV4A 1JULA 3MBFA 1CCWB 4UTTC 4P8VA 3NSNA 4GACA 3TTOA 5FACA 4GBUA 4MYXA 5I78A 2BSLA 3RRAA 4AXNA 3VD7A 4LF1A 1K9DA 1LUCB 1BAGA 3U7BA 3FYYA 3ZLGA 4DF0A 3APGA 3CWHA 5CPSA 1NQKA 6PTDA 3TMLA 1XGZA 2VVSA 3T6CA 3VE7A 1HP5A 4GLEA 1V7YA 3M0KA 4I8YA 3USBA 7ODCA 4DUXA 5GQBA 2Z2UA 1CLXA 3IUIA 2OTDA 1XDMA 2W6JG 3O16A 1WNOA 3MZNA 3ORWA 1FA2A 1QASA 1PE1A 4IPLA 4L4OA 3M5ZA 5BNKA 4QE4A 4UCGA 4NZ4A 1UMLA 2PTXA 1SR9A 3T1GA 5ABTA 3AYRA 3MB9A 1X98A 1CX9A 1I4NA 4B5UA 1SMDA 4J40A 1B31A 1VCVA 1DHPA 2HK0A 2CLPA 2XN2A 1WXJA 2G37A 2XTKA 1JPDX 2UY4A 4H04A 4NAFA 3SRHA 1V77A 3UG4A 3IJ7A 1RD6A 3LPOA 2CLEA 3VILA 4UTWC 3QZ6A 3MWAA 3GNRA 1M7JA 4UOJA 3BCFA 4M56A 1UR4A 1OK4A 2PCEA 3S6OA 2RFGA 1O12A 3L7RA 3VC5A 2X16A 4JTGA 3BW2A 3QGVA 3MA8A 4MJ4A 4KETA 5EMLA 3L4TA 1X1OA 1SW0A 2WSSG 3SCRA 2VQTA 1TZ7A 2NQHA 5C7VA 3MCOA 2DVUA 1UPPA 2QCDA 1E0TA 3AALA 5PTDA 3W7MA 1BQGA 1GZ1A 4AD4A 3CB3A 3B4UA 3AUJA 2C3ZA 3G1VA 4JGDA 2HE5A 5CC3A 4US6A 2CFFA 1IXQA 4LV4A 1SZFA 3SCPA 3B40A 3AXXA 4FS9A 4PMJA 3GKFA 4JFWA 5DCDA 5CC5A 3W00A 4RE0A 3EA3A 4AUBA 4DLFA 1W8SA 5FD0A 4LPCA 3M0IA 1JCLA 3BLPX 4AZIA 1A4LA 4FK9A 4K2SA 2OZ8A 4FXRA 1CIUA 4F3HA 1KO0A 3SBFA 1S39A 3CNYA 4C6OA 3AHYA 3OG2A 5CEWA 4NU7A 1SGJA 4MTVA 3GBDA 4Q8VA 2QHAA 4E6MA 4MF4A 1AUSL 1XLFA 1JQXA 2ZRWA 2ZRVA 4FXFA 2Y7FA 4KWOA 1KCZA 4LAOA 1TMQA 4O18A 1GQLA 2P0IA 2OOGA 2XVNA 1QHZA 2YFOA 3W1AA 1JXJA 3L5LA 2QIWA 2Z1VA 1M6JA 4HN8A 4M5PA 1AL7A 2E4TA 3WQ8A 1XV8A 1RCOB 3HQ1A 1XYCA 3TW7A 6XIMA 5LIKX 2ZZ4A 4LWWA 2VRKA 1E9IA 1RJPA 2PI6A 4QFUA 1KXVA 4EVZA 4DJDA 4QSHA 4GY7A 5BU9A 3LHWA 4EPEC 3CTTA 2UY3A 2HTMA 1TV7A 3L21A 1KCXA 3DFQA 3SCTA 1JPHA 4Q7NA 1UJPA 1XIJA 3DI1A 4AF0A 3IARA 3G6MA 2FVLA 1D3GA 1FFQA 4CQAA 4JFTA 2QDDA 1LTDA 3OHIA 4DUOA 1OT2A 3N15A 2V81A 4JNZA 4TIMA 6A3HA 3HMCA 3OYZA 4KCUA 1AA1B 1IEVA 1KC7A 3W7RA 1NY1A 3LNPA 3PZNA 5DRIA 7TIMA 2VFGA 2NVAA 1AJZA 1H1NA 1BXCA 4PCNA 2C91A 3PSWA 4W8AA 2VJXA 2WYSA 2BY0A 2ODOA 1JUKA 4DYJA 1K70A 2E8YA 4JX6A 1TRDA 5KZMA 3QBUA 1GUVA 3H54A 3DUGA 3QXBA 3WFLA 3CIXA 5FF3A 1RR2A 3NDOA 1GVOA 3VD5A 3N2XA 3PAJA 1AJ0A 1W3NA 1SZRA 3T2OA 3T7VA 2QPSA 1XHGA 1SJBA 2B7PA 3QOKA 3L66A 4C6JA 4IG2B 4FX7A 1XYAA 3W7GA 2E5DA 5BW6A 4QG6A 3IWPA 3MMUA 4I5XA 1FWSA 6ENLA 3EPNA 2F61A 1GYMA 1MXGA 4V1YA 4WX2A 4HTYA 3CU2A 4FAMA 1D2KA 2BVTA 4ATDA 3NVDA 4R85A 2O9RA 2F2KA 1U33A 2VYOA 2C7FA 3ABOA 5KTLA 4AZBA 1QI3A 3A47A 4QCEA 4GZJA 3GVRA 1VBUA 4MM1A 1P1MA 2NV2A 1EJWC 4GYPA 2B81A 1ZBCA 2P5NA 3CPUA 4IX0A 3H4XA 4MWAA 5A1AA 1U5HA 2R1KA 2Z7KA 1V79A 4XD6A 3VNIA 3T8LA 2RGMA 1VF8A 1KFBA 2JDIG 3KCLA 1QNSA 5I3GA 5C7HA 4UUIA 2WNWA 1DJXA 1UR9A 3LUTA 3VMOA 4YVPA 5BRBA 3TAKA 3QHNA 3SY5A 1KQYA 2VEMA 4EPKA 1YNQA 4J28A 2VKZG 3WL0A 3D3AA 1GQNA 1C93A 4MB4A 1VBRA 1QNPA 1FQ0A 3KOFA 2PWEA 3T0TA 3C0JA 1FUYA 3CBWA 3NSXA 1AH4A 1P43A 4WGHA 1TB3A 1UQYA 5F7UA 4LVAA 3V7PA 1BXBA 2V67A 3NQMA 4FX8A 1H11A 4AQLA 5K9XA 1CT5A 4ZMGA 1EPVA 4JTAA 4WY0A 2R14A 1X1ZA 1ZFJA 3VGDA 2DUXA 1SJDA 3DDMA 1DWIM 4R3UA 1BWVA 1ZNNA 2PGRA 3HURA 6REQA 3GAYA 5K4ZA 2CXEA 3GUGA 1F07A 1Q45A 3QRHA 4HA4A 2V63A 3AWOA 2OXNA 3GDKA 3GBEA 5D9PA 3VIKA 5H91A 3SCVA 4C1LA 3EA2A 2FGZA 3CYJA 4ORIA 1G94A 3UWEA 3AYSA 3NZGA 2Z1KA 3FSTA 2GOUA 5KSWA 4BJHA 2ZXDA 2XH0A 3ZT5A 5E1QA 2XOKG 3VD3A 3UJ2A 3T2QA 3EPMA 1NTHA 1M7XA 2JALA 4PCFA 2CWNA 3DX5A 3NURA 4Z1BA 3WENA 1MI3A 1RLDA 1US0A 5CPMA 3W7JA 2CLOA 2YCLB 3CQKA 4PB5A 1XLKA 3QSRA 3PAOA 3HBLA 4LBSA 3THQA 2JEQA 3B8WA 3WLLA 1XI3A 1PS9A 4JHOA 1Q7QA 1UZHA 3EOOA 4HSOA 3PF3A 5DELA 1R7AA 1N2VA 4HT3A 3Q65A 2BVDA 3F7JA 4QAWA 4GBDA 1REQA 1WAWA 3VFCA 4OZOA 3KVKA 3SIMA 2PMQA 1JZ2A 3DERA 4H9TA 2YL8A 4MDOA 3BGAA 3LS9A 1RLCL 1XLBA 4K8EA 4B5XA 1KKRA 4DJFD 3SO7A 1FWAC 5BMXA 5DCEA 1OABA 2XIJA 4O10A 1V8EA 2JKPA 5C2GA 3GXMA 3VOFA 3TIMA 3OVGA 2YX0A 2FHBA 1ISXA 1MZHA 2WCAA 3K5XA 3WJZA 1I2QA 1V0NA 3K4AA 3OG3A 2DSVA 2WCGA 3GH4A 1HUVA 1P0KA 1CGWA 1WZMA 4EPDC 3SJ3A 3HGRA 3IGUA 4CQ8A 6XIAA 5KZ6A 4PMUA 3PWAA 2XIMA 1QUMA 3E2RA 5M5DA 1V0MA 4YHGA 1UP3A 4Q7BA 2XM2A 5C71A 4RKAA 3AISA 3GG1A 4GIEA 3SUVA 1WDWA 4LNYA 3LG3A 1OFRA 1HFBA 3A6OA 1UIOA 2HS6A 2W67A 4DB7A 3MC5A 3PANA 4GQBA 5FF0A 2AKZA 1SO3A 4KWUA 4NASA 3M0ZA 3WQ6A 2ONEA 4ILSA 4Q4PA 1VEOA 4TTGA 3MKCA 1ZPTA 3EBVA 4LYQA 1CW2A 4N9EA 4JXCA 3M6DA 3HB9A 2R8WA 4F48A 3KDOA 1CXFA 5G2IA 3F2BA 3CYVA 3NVTA 1D3HA 3TJXA 4JPGA 2OWWA 3CEPA 1Q6OA 5XINA 5JVLA 1DHKA 4FF5A 1TTJA 1C7TA 4G8TA 4WXZA 3P5YA 1AODA 2GQ3A 2VDGA 5I5RA 1UB3A 2QZRA 1QJWA 1W3HA 4DYEA 1IYXA 3VZXA 1CGYA 1FCBA 4LUIA 2YLAA 1JZ8A 3ARTA 4D6GA 1A5AA 4B5WA 5B7ZA 4DF1A 1XL9A 4GD0A 3RCYA 3E5PA 1B5TA 3PB0A 4PN2A 4IJCA 1T6MA 4N9CA 3W1XA 4AEEA 3MV11 1CGVA 1LORA 4E2BA 3C3NA 4KWVA 1HZYA 3FVMA 3M5YA 2J25A 4QR6A 1TJ1A 3HPFA 5AC7A 3ARUA 4DJDD 2YCKX 2ZUWA 5HDRA 3SFWA 1A5NC 4ZBCA 2BODX 4D6JA 2HXTA 3UGVA 4HHLA 3AFBA 3AMKA 1LYXA 4GMEA 1R0MA 4N42A 2G97A 2OYLA 3TQPA 4REQB 2FJKA 3UG8A 5D37A 1UZDA 2KX9A 1AZ2A 3EOEA 4A29A 3NM3A 4G1NA 4GX9A 3NQ7A 3A13A 2FPYA 3CGTA 4HSHA 5A6BD 1EP2A 1OFDA 5FF2A 3S3GA 4Z1CA 4CU6A 5E5CA 1K6WA 4L61A 4K37A 5CAKA 1KW1A 3ISIX 1ITCA 2A85A 1B3XA 1WKFA 3PBYA 3S46A 3UZZA 4Q6JA 4GPNA 4HA3A 4PUNA 4KGLA 3NO3A 3U4FA 3GR7A 2O4MA 4XQ6A 3P0XA 2VRQA 3G2GA 3ANUA 1VZWA 2PLKA 4LAZA 5EBAA 4ATLA 1O60A 5HULA 1VH7A 3F5JA 1A5MC 5ABHA 3UWQA 1CDGA 3NEHA 3HG4A 3KRSA 2ANUA 4QS5A 4O1FA 3CHFA 1RK5A 4V28A 2GJXA 1WPCA 4YL2A 3SECA 4OTKA 4W86A 4DZIA 3DN5A 1IEWA 2QAPA 1XLCA 5ABFB 4NXSA 3WLQA 4RE4A 1W1ZA 5LHEA 3C2FA 3WUGA 2O56A 4R27A 3W6MA 3C52A 2VP8A 3SEPA 1DJHA 1LRNA 3A3WA 1V02E 1K02A 3N13A 3TR9A 1IGWA 3BV7A 1BYDA 1HN1A 4TSFG 1LROA 3FFSA 1W9BM 4DAIA 4JHMA 1A0CA 4DPPA 4QNWA 3TYEA 4BEQA 2X2GA 3QPEA 4HPJA 3PZ9A 3THAA 3TYDA 4XG1A 1VFLA 1E9ZB 2VGGA 3WQGA 4RZ5A 1AW2A 2A7RA 2CLKA 2YKKA 1GCYA 1C92A 3VOJA 4B3ZA 1GWJA 5F2IA 1XFBA 2TODA 3UZ5A 3PULA 4I9MA 4Z1YA 5HANA 1GVFA 3W2KA 1K03A 1QPNA 1W91A 4NZCA 2BLEA 3VKJA 3VIGA 3LHTA 3EPOA 4C90A 4TVDA 1C8XA 3C2RA 3VPLA 3QR1A 1GEHA 1EYEA 3TP4A 4RL3A 1ZJIA 4H7VA 2D2JA 5I02A 2BTMA 3LOTA 4WVXA 3FLUA 4NI3A 1VEPA 5EMKA 4NXKA 1BTMA 2OLHA 3BQ5A 2Y62A 4AISA 1DWAM 3PPFA 3BAJA 4Z2LA 2FGBA 4XZNX 3G1XA 4JQ2A 4QDWA 3W1LA 3BUVA 4ZQOA 1GYLA 3ITVA 3P93A 4NYUA 1HJWA 3TLQA 2UBPC 5C9UA 1HTIA 1C8QA 1A49A 2H90A 2DZWA 3ARVA 2X0SA 3WEOA 1P4CA 3CQJA 3FHAA 3ZIAG 1LG1A 2PS2A 2ZICA 4ORMA 3OQEA 1P7TA 1OC5A 1VFFA 3FXYA 3W88A 3L4VA 3BG5A 4EWND 4S3DA 4LBUA 4AWEA 4Y8EA 2YXOA 1XLGA 5DBTA 1VYPX 2V5LA 4YMZA 1X8CA 4I6VA 3T07A 3QJAA 4LY4A 5KMYA 4YTQA 3EDEA 4UTUA 5EKYA 1QO2A 4C5YA 2V7QG 4IH3A 4CU8A 1UBPC 3NFUA 3TC3A 3LD5A 1VJIA 1TV5A 1YXDA 1TWSA 1R3QA 4DZHA 2PTDA 1CI1A 4JD4A 4ADUA 3GTXA 1W3LA 1MFUA 1EGZA 4JIEA 4DBUA 1J0JA 1MVYA 4WXYA 3S8HA 3CZEA 3N3TA 4KEZA 5CGQA 3FSUA 1VIWA 1ZSXA 3IS4A 1F9CA 1KFEA 3WLMA 3UXDA 1OF6A 2HK1A 4S38A 5H8PA 3QZEA 1J0YA 5HOSA 1WZAA 4N7QA 4FX6M 2Z2AA 2X1RA 2E3ZA 3VNDA 2GFTA 5HAOA 4XAFA 2DFAA 3UR2A 1X1NA 1E4IA 1CZ1A 3CMGA 5C2CA 2D2HA 1K8YA 2ZTJA 3DBPA 3OODA 2ZUTA 5HR6A 3DC0A 1LL7A 4ERGA 2J78A 4JTTA 4PBGA 4KEUA 3CZLA 4A2RA 2HVNA 3B0PA 1F3WA 4PGLA 2V3FA 2J24A 3W7PA 5GJNA 3N25A 5MKGA 4CN6A 4HCHA 1AW5A 1ZHAA 3UBPC 3ARZA 2QEZA 3CLMA 2XH4A 1NOUA 3KW3A 4GZ7A 1OCBA 1AQHA 3M7WA 4HZ6A 3EDFA 4JTHA 1ZAJA 3AXHA 4DUWA 1QXLA 4QQ3A 1E6RA 2YXGA 3HFTA 3GFZA 2FVKA 1MXSA 4D6DA 4NP7A 2YB1A 3ONCA 1JYVA 1Q85A 4RE3A 2OT1A 2Z1XA 4ZB0A 3ZJ8A 1FHVA 4A6GA 3TC6A 1TWZA 3QH2A 2DJLA 5FEPA 3TZFA 1YPFA 3KLKA 4PRWA 1PXGA 1GVYA 1JCTA 4C6MA 1OX5A 3PBGA 4UR9A 1TRIA 2PZ0A 1XIIA 2I5IA 2ZX7A 1ISWA 3R43A 1ESWA 1JZ5A 1DJZA 3S6DA 2AMXA 3ID7A 4CGTA 4DJED 3VOGA 4F66A 5G1YA 3L2IA 5FJOA 3AMLA 4FZIA 3MBDA 3R8RA 4IGHA 3D46A 4PRTA 3VNLA 3M47A 4O11A 3ERPA 1W5NA 1W9DM 3N9SA 5ABEA 1XLEA 4HK6A 3IK2A 2VUNA 4ZL1A 3M64A 3PZQA 3APTA 1JDDA 3BOXA 2PDKA 4IQJA 2WPBA 5D2YA 3CASA 1BSLA 4KKXA 3WEZA 1CTNA 1LOSA 2B0MA 4ACYA 2ATSA 1JRBA 3LRKA 3FIGA 3LBCA 1NARA 5AYBA 1QI5A 1XYLA 2VWTA 3L9CA 1ZJHA 3PNZA 3AUOA 1KFWA 2GOKA 4KEVA 3CB8A 4WRHA 3UR5A 4Y8FA 1TPB1 4PC8A 4UFLA 3W2JA 4AX7A 2JKEA 4O0ZA 3WQCA 2VC6A 4IL0A 4PUDA 3CHDA 4HU0A 2V6AA 4YWIA 1UIPA 3K30A 4XWUA 4PYSA 3WZ0E 3GWQA 2R1LA 3PM6A 3RCNA 2EPMX 4OVXA 5REQA 1OX4A 3R5EA 4D6FA 2REQA 2VWSA 1ZAIA 4ACZA 1KM2A 1TMLA 3V36A 3G1HA 3OLEA 3C6CA 3TTQA 3LCLA 3I4EA 1R8LA 3WK2A 4A21A 2XJ7A 4P5UA 1AQ0A 2BXYA 1WP6A 2HBVA 1XSKA 3KOZA 1XBZA 1XYBA 1F8IA 3WN6A 4PMNA 1VYSX 3S0CA 3EX6A 5E93A 4H9ZA 1M65A 3SQSA 1IIHA 3KBWA 2P50A 4DXVA 4HJFA 3CK5A 5AHFA 2J88A 3MCNA 4LEQA 3GUWA 3TJLA 4FOJA 1OSEA 2PWGA 3RO8A 4DHGA 3WQEA 1CB7B 4L7ZA 3IK4A 2GVJA 4JTEA 3C2YA 5I3DA 3REQA 4UQDA 3TN6A 2HS8A 4I5UA 1SYTA 2BY2A 1ONRA 1Q6LA 2BBFA 4JX4A 4UTLA 1TA3A 4MAZA 5HR7A 5EGRA 4FXSA 1W2VA 3LXBA 5A8OA 4DYKA 3E0IA 2WKJA 4W4QA 3B0VC 3E2QA 4NIRA 4HOWA 3U2ZA 2PTZA 1MDLA 1J6OA 3TSDA 3GNNA 3H21A 1GOQA 2J66A 4GISA 2AL2B 3ZR5A 1QDSA 4GC3A 1AG1O 3HU7A 2ZCGA 4WJXA 4MDPA 3CC1A 3LHYA 3SI9A 3RLHA 1ZBWA 4JHZA 4RDZA 1ZY9A 4W7VA 4GI9A 3PZVA 1UR1A 4U3CA 3G8RA 3K8MA 4Q33A 1VJSA 4RLIA 1IEQA 3RPDA 3T0AA 1ZL1A 3DG7A 3WMSA 4OWGA 3C2OA 1IWPA 4XVDA 4EXQA 1YNPA 1X8FA 3VOCA 3MT1A 1OGSA 1GQJA 1Q63A 3K8LA 1XICA 2ISWA 2ZE3A 2ZXBA 4GIRA 1FRBA 1V0LA 1TX2A 1YIXA 4TTUA 3FA4A 4AZ6A 4BF5A 1E5NA 2D3NA 1ME9A 3VU2A 3HGJA 2CLIA 1VRDA 2OVLA 5AKQA 2VR5A 1FHUA 3GSMA 2Y6ZA 2ACUA 2YA2A 1JPMA 1J0HA 3BW3A 5E6ZA 3LK6A 4JKMA 4XAPA 5LHFA 1I6NA 3KTSA 3W71A 4B5VA 3EOLA 2QS8A 4M24A 2C0AA 1K6AA 2FHFA 4IHCA 1EWDA 5CBIA 1S2WA 4ICCX 1GPFA 2QYGA 4W9TA 1KBIA 2XVGA 3VOHA 4PMVA 1EXPA 1K8CA 3W76A 3VXGA 1MRQA 1M41A 1EZWA 4G1KA 1YTKA 4JDYA 4IP4A 3GR8A 3FA3A 3O0KA 1PZ0A 3PZOA 2FB2A 4MLJA 4CD5A 3WNKA 4UBPC 3M0JA 1JFHA 2VUYA 2XFYA 1BWKA 4O19A 4H8VA 4PEKA 1E79G 2ACQA 2H3BA 4WQ6A 3M0VA 1XJBA 2QIIA 4Y9MA 1HJXA 1G67A 3UWUA 3QC0A 4XZWA 4AZ5A 5K7JA 1RHCA 2H9AA 4JQAA 2O9OA 1R3WA 4ZFMA 3UESA 3NEVA 2TMDA 4CCEA 2V3EA 1OINA 4LF2A 3FS2A 3OLGA 1QI0A 3EMQA 2E25A 1GKRA 2WMHA 4RW5A 2GDVA 3QW3A 5CLTA 2EPKX 3ZT6A 5K9DA 4H9VA 1OFBA 4LYPA 4C6PA 5LA0A 8TIMA 4GI6A 3LA4A 2V5BA 1XIGA 2DUAA 1ZB5A 4E4FA 2BGSA 5AC4A 3EWBX 1ZTVA 1L8PA 2CNCA 1UH3A 3WD0A 3WFAA 5B80A 3QTGA 3VYLA 2INZA 1J93A 4D6CA 4NZ3A 1H1YA 4MPKA 1E56A 2JF6A 5F4SA 3G1YA 1ITXA 3GTHA 3W75A 4IMCA 4EE9A 2VR2A 1A80A 4ALDA 3TNBA 4KFPA 1E73M 3B97A 4JIQA 1R3YA 1UUOA 1XIHA 1J12A 4L4PA 2WJZA 3U2CA 3PR2A 5AYZA 3IVTA 2V5DA 2HNHA 3GH7A 1I2PA 2ISSA 2WQDA 3ITXA 2OQHA 4XKYB 4B2DD 4DO7A 5MHBA 4JQ4A 4LCSA 3CL7A 4YPJA 1A5SA 1WOAA 1UMYA 1UCWA 4F0LA 2HSAA 4D8AA 1EP1A 2DH3A 4WF7A 1UYQA 4IWWA 2OU4A 4R9XA 1VFSA 3GB6A 3WDQA 3CT2A 1A3XA 1DQUA 3KCJA 3NQFA 4UTJA 5FJPA 1P6BA 2XNDG 1EPXA 4FF7A 1H4PA 4GQGA 2J9XA 3IIZA 4H9XA 5D2TA 3VABA 2EEXA 2H6RA 2EAWA 1F3TA 2VX5A 3M41A 3CIVA 3GVVA 1IZKA 4PB4A 1U1UA 1HX0A 1MUMA 4FLOA 3ZT7A 2X8RA 3NYDA 4W85A 1BG9A 1GTHA 1H62A 2FPTA 4W8LA 5D03A 3AHTA 1DTUA 1I8JA 1NF7A 3OIHA 5LYRA 1Y8BA 1PSCA 4CNPA 2PBOA 4XTIA 3LCWA 3QW4B 2WMJA 3UXAA 3UP8A 1NJJA 3NZQA 1FWJC 4JKLA 3BCJA 4MB3A 1PB0A 3B8TA 3B9EA 4S3BA 1KM5A 4GYJA 4QGCA 4RNFA 1H0GA 2Z27A 3BG3A 4MY8A 4NHVA 5FEZA 1JI1A 2ZIDA 1MUWA 4X0NA 5DT5A 4S3KA 1U5VA 4UTHA 4L1GA 1R86A 3IGXA 4XUYA 3VCCA 1KFLA 1CB2A 3QKZA 5AHIA 3KRBA 1NDZA 3KUMA 5D33A 1GOKA 1T40A 5BWFA 3TC7A 3UVIA 2WZIA 3TCSA 3O6YX 3RJYA 3PUOA 4PFMA 2AQWA 4RDYA 1LM1A 2J27A 1R6WA 3VGGA 3B9DA 3QM3A 1IGSA 4CNOA 3GTIA 2FVMA 4GKLA 1GW1A 5AZ1A 4RX0A 4NG3A 4BR1A 1B57A 4YLWA 3L5MA 1EXBA 3H2NA 4PBEA 4PUUA 3IVSA 3WDJA 3AMDA 2J79A 4J2MA 4MKNA 1EUNA 3M07A 1ZLPA 1KA9F 2NWSA 1W5MA 3C8NA 3GDLA 2XWDA 2HQAA 3WJSA 5KEZA 1QNRA 4FR1A 2HXUA 1TTPA 1OFQA 4GNJA 3N1AA 3KRZA 1KM0A 3W1UA 1E71M 4WUIA 2TAAA 2ZZ7A 2DH2A 1LWHA 2W92A 3LGEA 1V6YA 1W1TA 1V3LA 3SCWA 4BKNA 4W93A 3U5YA 3AS3A 1HP4A 4YTUA 4DO5A 4RV8A 4OV9A 3O0FA 1P48A 1VP8A 3MI3A 1DPMA 5LIUX 4KS0A 3TFXA 4IFOA 4E2DA 3F4VA 3CT7A 4UR8A 4XD4A 1NIUA 1OCJA 3AOFA 2WLYA 4UTTA 4QG9A 1AL8A 4LC8A 1A5UA 4J9JA 1G1YA 1RK6A 3AQUA 1RAKA 3CHEA 2F2HA 2QJIA 1EJRC 3OE7G 4JIIX 1OWQA 1DJNA 2AL1A 1A5OC 4E2VA 2PDBA 3QHMA 1ZS2A 3CZGA 1QFEA 3DGRA 1EF3A 2R94A 3GX9A 2XIIA 1Q2SA 2OGYA 2V8ZA 3UXLA 3RUBL 1ZQ5A 4NL1A 1E6PA 5FL1A 5DF0A 3BOFA 3I65A 4HPNA 2XFWA 4IGMA 1KGWA 4DF2A 1Q3NA 1EDQA 2VFIA 1ONXA 1E72M 2OQYA 2X1UA 4UR7A 4AD5A 2ZA1A 1IT7A 4IPNB 1ITUA 3W2MA 3DYPA 4D6EA 8A3HA 1LG2A 2ZZ5A 1TSIA 3W83A 2EBNA 3H4WA 3W7IA 5F2GA 2X09A 3T55A 2PLCA 2RKXA 2W61A 1XCXA 2V5CA 5DEZA 5EFFA 1VHCA 3CUZA 3BPWA 5C9ZA 3EX4A 2WVTA 2DQWA 2YYUA 2QCFA 2B7QA 3THDA 4HPXA 2V82A 3W87A 1YEYA 4IQDA 4O12A 2W27A 3OA5A 1V3KA 3AIQA 3GXIA 3UWWA 3KBNA 2FH6A 5FAGA 4AVOA 1MEIA 3OGVA 1SVDA 1V6WA 3ZM8A 1FWFC 4KF1A 2QUMA 1D7KA 2X2YA 4JY9A 5A8MA 1OX6A 1QVBA 3H4GA 3E0FA 2YIHA 3TQKA 3II1A 2O7QA 3PJTA 2R91A 2Z2BA 1NFGA 4J27A 1VR6A 3BGJA 1LOLA 1IEXA 3IJQA 2Q3RA 1X96A 4C6FA 4BFAA 4DWSC 4KERA 5IHRA 4R5EA 4XO7A 4GFSA 2CLHA 1S2UA 3POCA 4IMDA 2FZ8A 3UR8A 3H53A 2XU2A 2XVKA 4MNMA 4KWSA 2G3MA 5HMEA 1HKKA 3CL8A 4HNLA 3TW9A 4LX4A 1PWLA 3HJZA 4M29A 3URBA 1VGAA 1SPQA 4PUKA 4B3KA 1EKOA 2POTA 3NQCA 3WD4A 1Y5XA 2YCJA 3D5HA 5CPLA 3TKFA 3OAAG 3PTDA 3BMXA 4ZCWA 3V0SA 1DP0A 2CBVA 1KGUA 3L67A 1UD5A 2J8TA 4LAMA 1J96A 3WNPA 2WWDA 4INFA 2WC7A 1UD2A 1C9DA 4IP7A 2A3AA 1TREA 3E3HA 5HXMA 2I9UA 4O4WA 5T8GA 4HPGA 4L9XA 3S2JA 4JFSA 1VIZA 3KS6A 1FDYA 1W1VA 1VEMA 1VRXA 2OWCA 2JKAA 3P14A 3BAXA 4GUHA 1Z3NA 2XPKA 4LUJA 5G4WA 1DXFA 3GU2A 3VO0A 2E1DA 4NRSA 3GYCA 3RO6A 4MLRA 2DVTA 2YL6A 2V9DA 4JTSA 5BZAA 2OLAA 1LUCA 1TVLA 2PDJA 5IM51 1UWRA 4MOZA 3RG6A 6TAAA 3ALGA 4KMQA 3MO4A 2V5JA 2WHKA 1ZBKA 3DFNA 2YBTA 1W1A1 3SCQA 4H00A 3BAKA 4EX4A 1SW3A 3LZ5A 3BURA 4GXMA 2FKPA 5HJXA 2NSOA 3UW6A 4GUGA 3ITLA 1RY8A 4MNLA 5E70A 3LENA 3WQ4A 3IIPA 3RJXA 4MFDA 3K4DA 3NQVA 1OC7A 1H7OA 3B8IA 5LGXA 1Q6GA 2A79A 2CBJA 2KZHA 5CGTA 3W2UA 7REQB 4LCRA 1YTEA 3D0CA 4AYSA 3G1DA 4HJWA 5CPTA 3SGUA 2BMBA 3NNTA 4JCMA 4NJGA 4MG4A 4YVXA 2NQ9A 4Z1MG 2Q02A 4WK9A 2NQZA 4UQEA 4XBKA 3F4NA 4JYFA 1KLZA 3P67A 3MP3A 3UETA 1TPVA 2L5HA 4UQAA 4XX6A 2Z0IA 1WOBA 2CETA 3EWXA 2XH2A 3PWGA 3SSJA 4DJFC 4YHEA 4OBSA 2W63A 1F3EA 4EP8C 1MO0A 1VYRA 1PHQA 1W54A 3MSGA 2ZKMX 1JEZA 3H6OA 5LNRA 5C8BB 4CN4A 5LA1A 3A4AA 2Z6JA 2R9RA 3CH9A 1EJXC 2HISA 2V2HA 2DZVA 4JKKA 1F6KA 2XUCA 4IISA 3M43A 3ALFA 4NX5A 3FHQA 4GXWA 3GG0A 4FOKA 1A5BA 3H2MA 1O1HA 1XDJA 2FQIA 1OQFA 4GY1A 3W27A 4P61A 1LJYA 3L65A 2YDSA 2FTYA 4K39A 1MEHA 2CHRA 3OW1A 4Q8TA 2OGJA 3UYCA 4N02A 1L2UA 3PBVA 3WIJA 4ZOCA 4DX3A 3F4WA 5U7SA 2Y24A 1FXPA 2DZPA 1DWFM 5HUOA 1E1CB 3STCA 3PWIA 4NJIA 3VZZA 2Y4SA 1NWUA 4FLQA 4GH3A 2J74A 3AHXA 3A24A 3RPTA 1SZGA 3KWXA 3SUUA 3K2GA 4P7NA 4LC6A 3TROA 3RAOA 3W7LA 1J6PA 4D6IA 4US5A 5LA2A 3G0UA 1R9ZA 3GIQA 1X7IA 1G4TA 3NWRA 2BB0A 2GQ9A 3W7EA 2BXZA 1IWBA 4B5TA 1TQJA 4Z0SA 1UWSA 2X30A 1QW9A 4PTMA 1BKSA 1RA5A 1TJ0A 8XIMA 1S5WA 3ZR6A 2DY3A 3IAQA 4FO4A 4W8BA 4U2YA 3ME3A 3AMCA 1TUFA 4QG8A 3DZ1A 2QJMA 5TIMA 5KETA 4JYEA 1EL3A 3ZVHB 4EKJA 2ZUNA 4DXXA 2DSKA 5I6SA 1RVKA 1WKDA 5DLCA 2VR4A 3VOIA 1A47A 3NJ3A 2VEKA 2ZWZA 4XKMA 5J8LA 3NR0A 3S1VA 5A2CA 1SFLA 3TQ0A 3C3UA 3R89A 2JK2A 4U10A 1IXNA 4U31A 1H7RA 2PA6A 4YTTA 5JH1A 5JH2A 3U57A 3PY2A 3QN3A 3MY9A 2HMCA 3AIUA 2VCAA 5HMFA 3STGA 2Y61A 1U83A 2YSWA 2PGFA 4X2PA 5FEXA 2PP3A 3OEXA 1OGBA 3PG9A 2J7CA 3E38A 2CZDA 1XS2A 3LEPA 5FJTA 3M6YA 1C90A 3PPGA 4GIAA 3GU9A 4WSJA 3W73A 3GDTA 5DFAA 3ENLA 4UTIA 3EGJA 4DJDC 3WKZA 4EPBC 2B7OA 1FWCC 2WBKA 1DIKA 1OM0A 4WKHA 2Q71A 4QDPA 4NILA 1JNDA 4NZ1A 1TVPA 4GY0A 2ZYFA 1BSIA 4TX6A 5CCZA 3RGTA 4G5DA 3F5KA 3U2OA 4KIRA 1GGOA 2QF8A 1FWIC 2OJPA 5T91A 2XFFA 4FNSA 1R85A 2WHJA 4GVHA 3ZZ1A 1P1XA 1KD0A 2J7DA 1U1JA 2O92A 4IG2A 1ZU8A 4H3DA 2J6VA 5D02A 5CC6A 4GJIA 4BCEA 5K9CA 4HNNA 4PCPA 5D9NA 4AIUA 2B4GA 4KIEA 4IIEA 4EACA 9CGTA 1IZJA 2QQ6A 1E9LA 1UWAA 2J75A 4TX8A 1XH1A 1R3RA 1JD9A 4PTNA 4GZIA 2AAAA 4CVWA 4LVFA 1UJQA 4F2TA 3VC6A 3I3EA 4HN4A 4TR9A 2X7WA 4EK7A 3LCFA 2OKOA 1JZ6A 5BXSA 5HMSA 3A23A 3F2DA 2QR6A 3WBEA 1UBSA 1EQPA 3HV8A 3H24A 3N73A 3KEHA 3AZTA 1GONA 3ATZA 2GQ8A 1ICSA 1MRAA 4YVVA 1E40A 4TV5A 5CZKA 3QPZA 2Y7GA 4JL2A 3Q58A 4KQNA 2CLLA 2EPHA 5JMUA 2HJPA 3UJSA 1A4MA 5DMLA 1E70M 2OG9A 2DZBA 3N2OA 1M03A 1XQLA 4RPPA 2PU1A 3W1PA 2CERA 2G41A 5LNUA 3W6LA 3LHVA 5CQ1A 4MNJA 4NZ5A 2OFJA 4RR4A 4CKQA 4DBWA 3S1UA 2D0FA 3ELFA 4AC7C 3QFEA 2IS7A 3UJRA 4MWAC 3TOYA 4EOUA 3MI2A 4S2BA 2IXVA 3EB4A 4G2DA 2KAUC 2C71A 2X1IA 3GAKA 3TDFA 1KCLA 2NX9A 1ADSA 1F2JA 1R3VA 1CLVA 1S3TC 3CUIA 1SJAA 2HBXA 5ECVA 4URIA 2WKLA 3H7UA 2VMFA 3D3FA 2OSXA 4ZR8A 2J8GA 4P7RA 3S6TA 1EB3A 3W29A 2UY5A 4ZQMA 3POHA 5TAOA 5IRPA 4LY8A 2EG6A 3DKLA 3UPWA 1OCQA 3W26A 1VAHA 1RQHA 4K8GA 1W1B1 1SUXA 3GQYA 2VHLA 3NAVA 3B3DA 2WZHA 5XIMA 1ZENA 1LRQA 2V69A 1DIOA 2OSYA 1TPEA 3KP1A 3GXDA 1V08A 3T40A 2Y89A 4M80A 3IACA 5HWNA 5XIAA 3F03K 3QGAC 4JTQA 3UZXA 1EBHA 1YYAA 3NDYA 4DO4A 2YCLA 2WVVB 3H2FA 4JTUA 5D09A 5B7YA 1OYAA 2VRJA 3BG9A 4Q3MA 1NEYA 1FCVA 1FTXA 2ZA2A 1IQ8A 3VMPA 3SCSA 2VGFA 3GVWA 3WBAA 1CGTA 3CQHA 3BZGA 4HBKA 2GWGA 1R87A 1LCOA 3SW6A 3B0YA 3KVJA 5EU9A 3B8VA 3WJWA 4NRRA 4L9YA 4L6OA 3V5FA 2OCZA 4LS2A 4BF7A 2DW6A 3VNJA 1W5OA 4EAMA 4PEEA 2PDPA 4KFOA 2WSRA 3Q4DA 3H23A 1VP5A 4NI8A 3WUEA 1AMKA 4TU1A 3T08A 2GL5A 2DGAA 3NOYA 2F6KA 3I6EA 4B90A 3GXFA 2QJHA 1BRLB 3J7HA 3BDKA 5D38A 5I03A 4PTXA 2IQDA 1OYBA 4BQ4A 3DHPA 1S3HA 3PBUA 3M16A 1KXTA 4NVTA 3G8EA 4GKTA 2WVUA 2BHZA 1V4YA 2P1FA 2J7GA 1PKMA 1BYBA 3C0SA 1QK0A 1EO7A 3WH9A 3TOPA 4D9PA 2W91A 3C4UA 4HYRA 4DO6A 8RUCA 3KXQA 5LXEA 1DJIA 3W02A 3ITOA 3MZ2A 4QTGA 4X0VA 1R9XA 5AFDA 3LYEA 3SGZA 3DKJA 3NOEA 3FOKA 3ZJ7A 2VFDA 4Y9AA 3CPRA 2DUZA 4GQRA 4OT7A 4H9MA 3W1NA 5H8MA 1S1PA 3UR7A 3E0VA 1GOOA 3H26A 3MUXA 4OOZA 4XVEA 4PUJA 4MYAA 1QOXA 3AJ7A 1XC6A 4YIWA 1EJVC 4CNTA 3N4FA 3KZSA 5HPOA 3KBSA 1HL8A 4QROA 1OD8A 1Q6FA 4TX9A 4YU1A 5AZ0A 3TX9A 7CGTA 1Q2RA 3GD6A 2DT3A 1NSJA 5D8ZA 1ICQA 3OA3A 3EWWA 2D1ZA 1K8XA 4GHRA 3TWAA 3EXTA 2DV0A 1HKIA 2G96A 2P8CA 4AIOA 3W7QA 5HNTA 3DESA 5CG0A 1E3XA 4IIFA 3VDBA 3FKSG 4C91A 1VS1A 1XM3A 1PKYA 4H19A 3W24A 5SWUA 3H7RA 3DC8A 5HA7A 1EWEA 3H2AA 1DOSA 4JQ1A 2UZ9A 4Y90A 2J77A 4CQBA 4E3TA 2QCLA 3GU1A 4US5D 2WMIB 2XG9A 1TCMA 2YGYA 1E15A 3LY0A 4IIGA 3MMWA 3AHVA 1XIEA 4QE1A 4NAEB 4NF7A 2ZZ2A 4Z2IA 4MKSA 4I5RA 3JU2A 3CO4A 4RDVA 2QCCA 2VOMA 4O17A 4RPQA 2AKMA 2A5HA 4M7TA 3QEZA 3TYUA 1J4EA 1NDWA 2J9YA 3KVMA 3UZJA 1UR0A 2A6LA 3VMNA 1A0EA 1V6TA 4DJEC 1EBGA 3I7QA 3MSYA 3OZYA 3PUGA 3STEA 2I14A 3E02A 4DM1A 1OG6A 1B3OA 4I9AA 2PWVA 2BS9A 3GLCA 2E40A 3N3MA 3SJNA 2ZRZA 4TVUA 2Q8LA 1EOKA 3WG6A 4H41A 4WD0A 1S5MA 1M53A 3P62A 2WKGA 3AMGA 2CKSA 3NQAA 1FWDC 3WDRA 1IWAA 1Q7ZA 4REQA 1T57A 3WFZA 5LXXA 2DSZA