4HYWA

Pyruvate kinase (pyk) from trypanosoma brucei in the presence of magnesium and f26bp
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
498
structure length
496
Chain Sequence
b'SQLEHNIGLSIFEPVAKHRANRIVCTIGPSTQSVEALKNLMKSGMSVARMNFSHGSHEYHQTTINNVRAAAAELGLHIGIALDTKGPEIRTGLFGEVSFAPGDIVCVTTDPAYEKVGTKEKFYIDYPQLTNAVRPGGSIYVDDGVMTLRVVSKEDDRTLKCHVNNHHRLTDRRGINLPGCEVDLPAVSEKDRKDLEFGVAQGVDMIFASFIRTAEQVREVRAALGEKGKDILIISKIENHQGVQNIDSIIEASNGIMVARGDLGVEIPAEKVCVAQMCIISKCNVVGKPVICATQMLESMTSNPRPTRAEVSDVANAVLNGADCVMLSGETAKGKYPNEVVQYMARICVEAQSATHDTVMFNSIKNLQKIPMCPEEAVCSSAVASAFEVQAKAMLVLSNTGRSARLISKYRPNCPIICVTTRLQTCRQLNVTRSVVSVFYDAAKSGEDKDKEKRVKLGLDFAKKEKYASTGDVVVVVHADHSVKGYPNQTRLIYLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyruvate kinase 1
publication title `In crystallo' substrate binding triggers major domain movements and reveals magnesium as a co-activator of Trypanosoma brucei pyruvate kinase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
total genus 182
structure length 496
sequence length 498
chains with identical sequence B
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4hywA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 4hywA01
4B5XA 3N25A 2R82A 3MA8A 3QV6A 3HQPA 4TV6A 1S2UA 3U2ZA 1U5VA 2VGIA 2ZE3A 2E28A 1A49A 4B5UA 3QLLA 4IMAA 4B2DA 3PP7A 4KCVA 2L5HA 1XG3A 4LSBA 3EOLA 4IP7A 2HROA 2VWSA 5TAOA 2OLSA 3KHDA 1A3WA 1O5QA 1M3UA 1AQFA 3H6OA 4DRSA 4MF4A 4QG8A 3HQNA 3E5BA 3M0KA 4RPPA 1A5UA 1A3XA 3T05A 3QZ6A 3SRFA 3VAVA 4L9YA 1S2TA 2VWTA 3HQOA 4FXJA 1VBHA 1VBGA 4YJ5A 3E0VA 1PKLA 3SRHA 1ZLPA 4B5VA 1O68A 2QIWA 4JPGA 3B8IA 4B5TA 3IS4A 3I4EA 4FXFA 2X0SA 1T57A 2V5JA 1S2VA 2VGFA 3OQ8A 1XG4A 3BJFA 4QG6A 3M0JA 1DIKA 4QG9A 3E0WA 3LYEA 4TV5A 4B2DD 4L7ZA 1KBLA 1O66A 1PKYA 2XDFA 2XZ9A 3QQWA 4HYWA 1E0UA 3QV7A 1U5HA 2VGGA 1GGOA 3G2GA 2BG5A 1PYMA 1F8MA 4KCTA 3OYXA 3PUGA 4WJ8A 4IQDA 3GQYA 3T0TA 2V5KA 4YNGA 3EOOA 3FA3A 1F8IA 1Z6KA 3SRKA 1T5AA 1JDEA 3EOEA 3QTGA 4KRZA 3P0XA 4KS0A 2HRWA 2HWGA 1S2WA 3KTXA 4L9ZA 1DQUA 3BJTA 1M1BA 1PKNA 1DXEA 3GG8A 4IQEA 1F3WA 4G1NA 1ZJHA 3GR4A 1F61A 4KCUA 4ROQA 2DUAA 1DXFA 1UJQA 1IZCA 2KX9A 4QGCA 2DIKA 1E0TA 1OQFA 2VGBA 1VP8A 1MUMA 2XZ7A 3LG3A 4B5SA 4KCWA 3FA4A 3T07A 4L80A 1F3XA 4B5WA 2WQDA 3SRDA 3R4IA 2G50A 4HYVA 2HJPA 3EZ4A 1IGWA 1PKMA 3QV9A 5JVLA 1SGJA 3ME3A 3OYZA 1OY0A 1KC7A 3QV8A 4MG4A
chains in the Genus database with same CATH superfamily
2R94A 2OSXA 3ZJ7A 5I7GA 2ISSA 3GNXA 1Q7MA 4V15A 3DG7A 3FVDA 4UTHA 1R3TA 3QLLA 2E8ZA 1DHPA 2X16A 1YMYA 3CUGA 4UFJA 5TAOA 4IPPA 2ZWYA 3EMCA 1V3KA 4NZ3A 4JDBA 3UZWA 4ZENA 4QCEA 3L4UA 5D8WA 3LXBA 1B3XA 2PDXA 4Q4KA 1DWGM 4RL3A 4R33A 3W7QA 3UPWA 4MOZA 4XQ6A 4EKJA 1KBLA 5EYWA 1VBUA 3PTDA 4YTUA 1CZ1A 4TU1A 1S1PA 2VP8A 3AIVA 4JL2A 5A2BA 3VYLA 5HNUA 5C2CA 4PTNA 5H1WA 1WKYA 1ZNNA 4GNKB 4IPJA 1J8VA 2UBPC 2H3DA 5BRPA 1C8VA 5G2HA 3P0XA 1JZ5A 2BFGA 1EO7A 2E09A 1K9TA 4P8UA 3LA4A 4FIQA 3NQAA 5IDIA 3GDTA 3ZIAG 1W1PA 1ZJAA 3NQFA 2QUMA 3OLDA 2IW0A 1MNZA 3BLKA 4A3HA 1VIZA 3IIVA 2VFDA 4DJDC 4YYCA 2ZUTA 3SUVA 3ITTA 2V5BA 4CD6A 1HXJA 2Y85A 4BFAA 3FJ6A 3FIGA 2CZ5A 1P7TB 1QI0A 3S4TA 5AECA 3BARA 2PLJA 5DRCA 4AF0A 4J27A 3L4WA 3QSRA 3OHMB 4F0MA 1TZZA 3M0KA 3ELFA 2Z1XA 2X0YA 2VUYA 3AIEA 2CZDA 1PKLA 1OD0A 4TX8A 4LXFA 4IQJA 2QS8A 1PUDA 3PWAA 5HULA 1EDQA 4RNHA 2R9RA 4ERGA 1PKYA 4QISA 2XZ9A 3OB8A 1W1A1 3B8DA 4ML9A 1UUOA 1QNRA 1M03A 1FKXA 4OOZA 3A3WA 1KD0A 3WH7A 3PTQA 4ZXOA 5EMLA 4IIDA 1LLWA 1WKFA 4GE8A 3W7KA 5F7UA 5GNYA 4DPQA 4US5A 1K9FA 1C91A 2IXUA 1RD6A 2OSWA 3MQTA 1E6NA 3AXXA 3L23A 3T44A 1ODUA 5AHEA 4WJEA 5CZTA 3VDBA 1UUQA 2F6XA 1MUMA 2CBJA 2IPJA 1RUSA 3QRHA 4DJED 1R0MA 3WLJA 3FGCB 4IXHA 2OJPA 3AMKA 2VRJA 2A3LA 4C91A 4HK6A 2OU4A 4Q8VA 1D9EA 1ZTVA 3S1VA 4XVEA 2OZ8A 4J2PA 5BCAA 3QHOA 1Z7AA 3SGUA 3QLDA 4G56A 1RY0A 3MKVA 2PDUA 5FCZA 2C91A 4WDWA 4RXGA 1W1B1 2GQ9A 3SAZA 3V0SA 2YPIA 1Q8AA 1UZHA 1XSJA 3WYZA 4YMZA 3M9YA 4AU0A 1ZENA 2EKCA 2WO5A 3TZFA 1CPUA 2TPSA 1TRDA 5FEXA 3QY6A 3TCSA 4JTAA 1WZKA 1A5MC 3QW4B 3WEZA 1IEIA 4LUTA 2IKJA 2OZTA 4DUOA 2G4JA 4QJ1A 1SMAA 2ZOXA 2YDSA 4LCQA 5LIYX 3CJPA 3S2CA 3VCRA 1IZJA 4KWVA 3QV7A 4IPIA 1KCKA 1Q2RA 2VZVA 1H5VA 4UTLA 3HGRA 2YA2A 1O1ZA 4DYKA 2Q6ZA 1BWLA 1XSKA 4ZMGA 3B0XA 3UPBA 2ZZ4A 1XI3A 2OKTA 3KRBA 3S5NA 4I7VA 2D2GA 4RUBA 3W24A 5D4YA 2PLKA 2RH9A 3IGXA 3HU7A 3N29A 2QF8A 3PZIA 4MZYA 1OVDA 2NW0A 3BZGA 1L2UA 2AQVA 3LLDA 1UR2A 2Y8VA 5REQB 5D09A 5PTDA 3F5KA 1RQBA 1UUMA 3N2OA 4GVIA 2HBVA 3W7PA 4HQVA 3VGDA 3N04A 2WHJA 4QLLA 4QR6A 4LVBA 2UWFA 4HSOA 2J79A 1JGMA 1LQ0A 3DIPA 1B5TA 3GAYA 4XZBA 3IAPA 2DDXA 5CPMA 2PUZA 2W79A 1CX9A 3TOYA 4PTXA 3CWOX 2VENA 4LNCA 3Q58A 1CLKA 1HJVA 1SJBA 1OZMA 2X0SA 1KQZA 4PMRA 3V7PA 2QHAA 2D20A 3K8MA 1PL9A 1G4PA 2ON3A 1GPFA 2ZRXA 4CCDA 4DEFA 1HL8A 3W85A 4AWEA 1QNVA 2Z1SA 3CV1A 3W1NA 1PTDA 1XRFA 3CK5A 1X6NA 4LT9A 2V38A 1W2PA 4I7WA 4ALDA 2REQA 4M51A 3P80A 5ABTA 3RYSA 5EFFA 3C2RA 5I24A 1K8YA 3GDKA 2CLHA 4UTWA 1C8YA 4NI3A 1SJCA 3RJYA 3GZAA 1XFCA 1JI2A 5AVNA 1JCXA 2IPFA 3WD3A 3EZ4A 1PKMA 2G0WA 3THQA 1SR0A 2QMJA 4ICMA 1R7AA 4ICNA 1EWDA 3KTSA 3APGA 3O6YX 3VNDA 3KOXA 2ZIDA 3E2SA 3GH5A 3S9ZA 2HNHA 5HOSA 1H1ZA 3IIZA 4WEVX 3W6MA 1V79A 3CLMA 2ZZ6A 4L1WA 3ZLFA 4GYKA 4DLFA 3AS1A 2XFWA 4JIRA 4XB3A 4QG8A 3WBXA 4K1GA 5EPDA 1H51A 3WH6A 3U5UA 2BMBA 4MGGA 3CZLA 4LUTB 4PMOA 2WLYA 4GI8A 1DJXA 3DZ1A 3BH4A 2POTA 3WMSA 1N8WA 3GX9A 4MHBA 1US2A 3FV9A 4EPEC 1MEHA 1OCQA 2D3NA 3L4ZA 1UR8A 4JTFA 2VGGA 3B8SA 4BY3A 4QDWA 3MUAA 4NQ1A 1ECQA 1SR9A 4DI9A 1Q5MA 4LTSA 4KS0A 2OPJA 4L6DA 2X7WA 3IUDA 1E1FA 1IE7C 2DVXA 3UXLA 4ZE5A 4XBJA 3RFAA 3H70A 2CETA 1HKWA 1LCOA 3V18A 2BDQA 1HGYA 1QBAA 4HYRA 5I02A 1PSCA 4Q7BA 4ZB0A 3R79A 2F8QA 3K5XA 4DXKA 2BX7A 1J0IA 4X22A 4R5EA 5BROA 3XINA 3N2BA 3A23A 1N55A 5KTLA 3C61A 3RK8A 2XOKG 2O4QA 1WYIA 3OIHA 1U22A 3SCPA 2FH6A 4AX7A 4EF9A 5F1VA 4PFHA 4XIAA 3RRAA 4Z1CA 3IGHX 3OJGA 1H7OA 1QJWA 5A94A 5LNUA 3SUTA 4KIEA 4IJRA 4OGZA 3PPHA 1QOQA 1HTIA 4GC4A 2QIIA 3W87A 3C2VA 5EU9A 1Z8AA 2H9AA 4GH1A 3GR8A 2ZDRA 4FR1A 3TSBA 4AEFA 2R24A 3N2CA 4GGBA 4JTHA 3M46A 1GQLA 4JQ3A 3IJLA 4KBXA 4XWUA 2REQB 4FXSA 2DSVA 2CPUA 3U6WA 1F9CA 1I2RA 2DJLA 5C9WA 4IF2A 3V3WA 4WF7A 5ABFA 2YZ5A 2YXXA 5RUBA 1FFRA 1OC7A 5JQ9A 2VX7A 2GJLA 3W1LA 1C29A 1UKPA 1KKRA 4S3GA 5LNSA 1UJQA 3V4BA 1OD8A 1WBHA 3D6NA 1OYBA 2P3ZA 5HINA 3VD9A 4KEUA 2YIHA 1OK6A 3EPMA 3TSMA 4Y96A 1UQZA 3FW6A 1V08A 1W9PA 1LQ2A 4US5D 1OG6A 4I9JA 1QPKA 2A21A 3O8AA 3P61A 4PCSA 3S9IA 2WWDA 3HPFA 3W26A 1C93A 1C90A 3CPUA 3T0DA 1BVNP 4LBRA 2WBKA 5IDZA 3K1GA 1P5BA 2I7GA 1WX0A 3N6JA 4C1NA 2BVTA 3HQ1A 1YBQA 1NFGA 3WH5A 4QG9A 2YCLB 3LYEA 2V5LA 3TEVA 2PWVA 2F61A 2WMKA 1Q6EA 1LF1A 1SZEA 3MHGA 4C5ZA 2ADAA 3BPWA 3B0YA 1S2CA 3ZT5A 1B3ZA 3VIJA 4ATLA 3G8RA 1E6SM 1Z6KA 1NFBA 2Z6JA 4JKLA 1NQKA 3W53A 3AXIA 2PGFA 3MP4A 4BEQA 1MFVA 3TYEA 3EEZA 3E5PA 1SVDA 3S5ZA 1EJRC 1WA3A 5AKQA 5JIWA 1ADDA 4AXNA 3NOEA 1H0GA 4JFWA 3B8VA 2FGBA 3GIPA 3GXIA 2EPMX 4A05A 3ITYA 1WAWA 3PF3A 1K9DA 1ZGDA 1I45A 1AQHA 1VJSA 1FWHC 2G96A 4G5DA 1VFLA 1EKOA 1NY1A 1E3ZA 1A80A 3EDEA 5K9DA 4IMGA 4JQ1A 3CQIA 1AH3A 4MYXA 4CQ9A 4XSLA 4WSKA 3BOFA 4AZIA 3CL6A 3M7WA 1TKKA 2QCCA 2B7QA 4HSHA 1E6QM 2XVKA 5DMMA 2XN0A 5AC6A 3VD7A 2J7BA 1IEWA 3WL0A 1XYFA 2J9XA 4A3QA 8CGTA 1DQWA 3HO8A 5HPOA 2JQXA 3B0UX 1XLAA 2D2HA 3UZXA 4HU3A 3E0WA 3WZ0E 4MB5A 4O8AA 3B9EA 4FP1A 1ALDA 1VLWA 5HWNA 2H9AB 1FTXA 4Y8EA 1NQ6A 2TSYA 3K46A 3VE9A 1Q63A 1VBRA 4AD2A 2DPEA 4Z1YA 3O6CA 3IWPA 1GUVA 1V0MA 2YL8A 5LA1A 2UY4A 1NFPA 1DQUA 2YR1A 4HIBA 1R9XA 1VQTA 1QWKA 5KMYA 3ABSA 3ISIX 3G18A 4ADSA 1KXVA 3BG5A 3GBEA 4UR9A 1O7AA 1KFBA 1LORA 5HDRA 2OTDA 3UD6A 4HYVA 4JHZA 3VK5A 2YFNA 4QHRA 4BK9A 2BODX 1TJPA 1MQPA 1T40A 3NYZA 3DX5A 3WCZA 2Y0FA 1W37A 4FR6A 1DWAM 4HGXA 2UY3A 4DX3A 1UIPA 2YYTA 4JIPA 2WYSA 4U2ZA 2VZOA 5AC7A 1WAUA 5FF7A 3BL3A 1MUCA 2FGZA 3G24A 1QBBA 1Y5WA 1EF3A 2F38A 1KFKA 3ID7A 1GHSA 4GYJA 4NYYA 4GQQA 1G94A 2PWUA 2V69A 3CEUA 1J01A 4M5PA 1JYVA 3VKCA 1AK5A 3UXKA 1RCQA 1VFSA 1PS9A 3KUMA 2FVMA 3URQA 4H6KA 1CLVA 1HZYA 4QE5A 1V8EA 3N2XA 3EDKA 1QI2A 5I3KA 1U5JA 4LALA 1I6NA 3V35A 3VI2A 3BQ5A 4GK8A 1OEPA 3WFLA 2Z27A 1CIUA 3N14A 3VABA 4NIRA 2YYUA 4MY1A 1BG9A 3T8QA 3VUSA 4N9DA 3NG3A 1ZJHA 3N4EA 1ADSA 5A5WA 4IGMA 1SYTA 5EMJA 1QUMA 4BWLC 3WLHA 2QJNA 3CUFA 3GY1A 4JTKA 9RUBA 1AH4A 1G69A 3I3DA 1LRTA 1DJWA 1QVBA 1E4IA 1MQQA 1BTCA 1SSDA 3T78A 1XBVA 4DBEA 3NQ7A 2AOSA 3ENLA 3H7RA 1WUEA 4IMCA 3OE7G 2Y89A 2VDHA 3BGGA 4CD7A 5EBUA 1KRCC 4GNJA 1M7OA 1B90A 1R3RA 2ZICA 2J8TA 2VX6A 3FY1A 5F2IA 4KETA 4R9OA 3QHMA 4HVXA 2BB0A 4FNSA 4MFDA 2AGKA 1KCLA 4MY9A 5HAOA 3G3MA 5LIKX 3F7JA 4F2TA 1KFJA 5FAGA 1KNWA 3MKCA 1XG4A 3PULA 2XGBA 3WMBA 1CWYA 4ASTA 3DFYA 5T91A 4WUIA 1PAMA 2WV8A 3E02A 4CNPA 3CZGA 5JBFA 2WSRA 1GKQA 1KTCA 1V3HA 1E15A 2NZLA 1X1ZA 2VD8A 2JBMA 1JDEA 1OFEA 2XIBA 5CJNA 4KFPA 1F3EA 1XV8A 2OX4A 2TMDA 4JTDA 3E2VA 4JQAA 2E0PA 3T9PA 2CBVA 1SJAA 4UZUA 3HG2A 1H49A 5T9CE 1GZJA 3SCUA 1G4EA 3THUA 2G50A 2GPTA 1XRSA 1EDGA 1ODZA 3DHFA 2OB3A 2WQPA 4N9EA 3DEQA 1ZALA 1AZ1A 3DCPA 4LC6A 2VZTA 1N7KA 1K8XA 4GIRA 2HPMA 3R7MA 4CQ8A 3SQSA 1GJPA 4FMVA 1YADA 4R7OA 1AJZA 4JIHA 3W28A 3WNNA 3QKZA 2VC7A 2I9UA 2G5WA 1MYRA 3VAVA 2VEFA 4N02A 3KL0A 1PB0A 3MBDA 5HA7A 1VFHA 2EQDA 1I1XA 4MNJA 2CITA 1IIGA 1CXIA 2E6AA 2RHGA 5BMXA 1GG0A 2NXHA 3UR2A 1EP3A 2XDFA 5HK4A 4HA3A 4LWWA 4C6FA 3VU2A 4QS6A 4LEQA 5A8OA 4B4FA 2FZ9A 4AW7A 2YCEA 2V68A 3KCJA 4KWSA 1A5BA 1W5QA 4YCOA 1POKA 4Q7NA 2X7VA 3FDGA 4H1ZA 5CSSA 5BXRA 2XSAA 3KTXA 3WELA 3LHZA 4FNPA 2OO6A 4PMJA 3TWBA 1F6PA 4CQCA 5FAJA 4GQBA 2WMIA 1PO9A 3IK4A 4UFHA 5EFDA 2ZC8A 4DUVA 3UR5A 1FWJC 3KTCA 3RAOA 5G2IA 5AY7A 2VCAA 2A3HA 4O8RA 4GIYA 4MB4A 4GJ1A 1FWDC 1S1RA 1DTUA 3QR3A 2RGLA 3IV3A 3E74A 2EHHA 3SZ8A 4J9JA 2RGMA 3DECA 4IPNB 3EMZA 4O1CA 3QTPA 1X96A 2X42A 4XZLX 1MEWA 4QE1A 4M6PA 3TQVA 3WQFA 2GUBA 3VGBA 4XO7A 4OIFA 2NWRA 5BRQA 5I23A 1GOWA 3QZ6A 3TW7A 3SURA 5K9CA 2PI6A 3WLSA 3W81A 3IAQA 4U4MA 2NVAA 3SCWA 4O1DA 1OCBA 3HMCA 4UMAA 4QG6A 3QFEA 4Z2KA 3VUPA 1YXDA 2HV5A 5AOUA 4J3ZA 4ZQCA 1GCYA 1NF0A 3N3MA 3WBEA 3EXSA 1JPKA 2WKJA 1XX1A 3KWSA 3VPLA 3IARA 3WLNA 3ZJ6A 4AYSA 4JTUA 4RW5A 4DO6A 4ADTA 1GVRA 1Q6QA 4TMCA 1NP0A 2Y24A 2GVGA 4HNNA 3UWZA 1UHVA 1HKMA 5HJLA 3H54A 1J9YA 2C1GA 6CGTA 4HZMA 4URIA 1QRQA 4REQB 3QQ1A 4I5UA 5AN7A 3WK1A 4BHYA 4OZOA 1XYMA 1Y5XA 3NIYA 2GGHA 2BBFA 3L9CA 1K7XA 4GFSA 3DH7A 4C1KA 3M64A 3W7LA 3W01A 2A0NA 1U5VA 1H63A 5B80A 4EE9A 3U2EA 3AJ7A 3SY8A 3W22A 4Q8TA 3S83A 1G5AA 4NZJA 2R1NA 1X38A 2EBNA 3JUGA 4L1XA 3VX0A 3FSUA 3GYEA 4LBUA 5BXTA 5J04A 5CJMA 1FH7A 1XDJA 1A5AA 2JEQA 1G4SA 4C7DA 1Z69A 3VGEA 4JTQA 3OG2A 4GZEA 1W9VA 2ZTKA 1O5RA 4ZVJA 3UXAA 3WLMA 4AC1X 5E5CA 1NM9A 3D3FA 2VXNA 2J13A 1XDLA 4AC7C 3UJFA 4XAYA 4F0LA 4HTBA 4C6OA 3GWQA 2B0MA 2C18A 4W5UA 5E93A 5HNRA 2DT1A 4UBPC 3WLLA 1UIOA 1FWIC 5EA9A 1XDMA 1DHKA 3GLCA 4BF5A 4E4FA 3GR4A 3TV8A 3G1AA 3MUZ1 3NQEA 1H41A 1KA9F 1NEYA 2WMIB 4L80A 3EA2A 1GK8A 1TUFA 3OOQA 2XNDG 4Z1BA 2WMFA 1FH8A 4JX5A 7TAAA 2XPKA 2QDEA 3VD3A 1W3TA 4Q22A 1M65A 2ISDA 1XUZA 3ARZA 2IKIA 3CASA 1ZHAA 4QNWA 2WZEA 2VEKA 3APYA 2ZUNA 4Q8NA 1REQB 4ZE4A 1TWZA 4LSBA 5FJTA 1ME9A 2V6AA 1JJKA 1A3WA 1R3WA 1LT8A 3FVMA 3N9RA 2WMJA 3VKKA 3C86A 2X05A 4L4OA 1R3VA 3T05A 3OVPA 3PB2A 3C5QA 3EWXA 4L4PA 2Q8LA 1GJUA 5EMMA 3TN5A 3VTRA 3QPEA 5CBBA 3NR0A 1FHDA 3W84A 1J5TA 3CUJA 3HG4A 3U4FA 2W62A 3SUUA 2DH3A 3NA8A 2ALRA 4TVDA 4ZQPA 4WY0B 4KFOA 4JTIA 4Y9MA 4K39A 3UY8A 3IACA 1K02A 3T0AA 2D3LA 2Y6ZA 3RLHA 3LHTA 1YPXA 4AY1A 3V1HA 5C9UA 2QDDA 4LS0A 2FVKA 5I2UA 1PKNA 3WG6A 1W3KA 4L56A 4G1NA 3MMUA 3UNTA 4LQ1A 4XUGA 2BVDA 4JN8A 2SFPA 2BGNE 1ML1A 1VP8A 2AQWA 4EPBC 2PCEA 1XSIA 3S0CA 2AAAA 1ISXA 4ADUA 4U10A 2ODOA 1DJGA 2AKZA 3A21A 4AHOA 3M5ZA 2C1IA 1XCXA 2WZHA 1WXJA 1HKJA 2ZX9A 4EAYA 1I2PA 5JMUA 3VDGA 2XVGA 4UTWC 3ALFA 5FJIA 1IZKA 2YOCA 5D04C 2O92A 2FPVA 4F48A 2ABAA 3F4NA 3WQDA 3BAWA 4NL1A 2R14A 3LS9A 3E5BA 1EL3A 1MNSA 3S47A 5G1TA 4C6JA 2CCRA 4B9ZA 4W84A 4B5TA 1XKJA 1VS1A 2YXGA 3QW3A 2CHOA 4O15A 1VPYA 1DOSA 1J6OA 4TR9A 3RGTA 5I09A 1ICQA 4FEZA 2P3EA 2Y5EA 3FAWA 4E8GA 1D7KA 1TJ1A 1H0IA 3BGAA 4HPHA 3K1DA 3GG1A 2CU0A 3TMLA 3WLPA 4XO6A 3AUOA 4F0KA 2J7FA 2DZSA 2ZCGA 4DO5A 5DELA 1TE6A 4US6A 3TW9A 5LHFA 1CTNA 4LANA 1LOQA 1XLGA 5KETA 3NL6A 3QR1A 2GUYA 1WDDA 2ZZ5A 5IFPA 1ZCOA 4DI8A 1ECEA 4XK2A 2ZXAA 1NOFA 3UR8A 4EIVA 3WQ6A 2EG6A 1P4CA 1WZAA 4A8NA 1L6WA 1SZGA 1JRCA 4Q4MA 3WF0A 3GYCA 4E3VA 3WF1A 3MV01 3VNMA 2XWEA 2JJ2G 3EOLA 2Y70A 1UWIA 4CNNA 1TVPA 1VEOA 4C60A 4GINA 1DQXA 2VFIA 3AS0A 2BXVA 1BD0A 4FS9A 1J10A 1RA0A 4AVNA 4O52A 2E5BA 2WSYA 1VBHA 5EB8A 5C54A 3WDHA 1G1YA 4PCNA 3LI1A 4F0RA 3GC2A 3HPAA 1KGWA 4ZTYA 4FALA 3OLIA 4B90A 3PBUA 2E3ZA 2DZWA 3W7NA 3MV11 1BGAA 4NJGA 3BUVA 5I00A 1GOXA 1KCZA 1V6XA 4QJ5B 4C6QA 4WZHA 3QGAC 2IS7A 2YCJA 3LCLA 1SFTA 5TBOA 5HPCA 1TE1A 1NSJA 2WSQA 3W3OA 1GQKA 4WLCA 4J28A 3DI1A 4UC5A 3BSGA 1PZ0A 1M5WA 2D0HA 3HN3A 2GVLA 2YDQA 4NP7A 2VFGA 3O0FA 3SRDA 2ONEA 1NH6A 2C0HA 2FZBA 1EWEA 1MEIA 3PJUA 1J6PA 2PDGA 4R85A 3COTA 1E1CB 1S2AA 3TFXA 1BYBA 1ZFJA 4TV6A 4FXRA 2XM2A 2AL1A 2NQZA 1SPQA 4UNKA 5BU6A 4MNMA 3M43A 2YDAA 1P0DA 3CHCA 4O10A 5M1TA 1UA7A 2QUUA 2NUWA 3MO4A 4JTTA 3AU6A 2QJJA 2VR5A 4WR3A 4M6VA 4UNLA 1S38A 4N2YA 4O57A 3VKJA 4AVFA 4J3XA 1F07A 3UXIA 2WANA 4LRSA 2GFTA 2O0TA 3ITXA 4GLEA 6REQA 3BOXA 3UJ2A 4HPXA 5HUOA 3CHFA 3NCOA 3WNKA 3TX9A 4H4IA 4HCHA 5DY2A 3WDJA 4A2RA 1V3IA 2VRKA 1H61A 3STGA 1HNYA 1QW8A 5BZAA 1TPFA 5IM51 3DG3A 1IV8A 2ACQA 3EEGA 1SO3A 4WSJA 5AHIA 3H4WA 3SIZA 4UQCA 1YX1A 3GAKA 1MVYA 4BQ5A 3MWAA 4GKTA 4CD4A 1Q6GA 5FL0A 4KEVA 4UOQA 1RVKA 2AMXA 1J11A 4RNJA 4GY7A 1E6RA 1SGJA 5AYYA 2ZA2A 4ZO6A 4Y2WA 3VIOA 5GQBA 3IRSA 6ENLA 4WHBA 4FK9A 1ITQA 4H2HA 5HNNA 4IICA 3R8GA 5G5IA 4LOCA 3UWUA 4ONVA 3U2CA 3V36A 1W6TA 2JDIG 3HIJA 3P67A 4YN5A 1QU4A 1F2JA 2JALA 3NQBA 1TWWA 3MI2A 3LPFA 4E2OA 2PDNA 1WDPA 1UD2A 3JVAA 2D22A 1PZ1A 3ARPA 3HM7A 3ES7A 1R3YA 3EX1A 1T41A 2O9PA 3WQCA 3I7SA 3VILA 4H7VA 2OO0A 4A6GA 2ZTJA 3E3HA 2QAPA 3CZJA 3R94A 5J5DA 4C6IA 3NEHA 4ENLA 2CLIA 3B9NA 1AW2A 1P1MA 3NQVA 4A8RA 2GGEA 4AEOA 1OIFA 1R38A 3T8LA 1Q45A 1YTEA 4H9TA 1BHGA 1ZZMA 1ESWA 2CZEA 1MRQA 3H22A 5HXMA 2FH8A 2I5IA 5DF0A 1WZMA 1F6YA 1UD8A 2EJAA 1EEPA 3A3HA 4NAFB 3DC8A 4QGCA 2WPDG 3LPPA 3S46A 4DYJA 4FPSA 1AZ2A 2FTYA 4PR4A 2YKKA 1A0EA 5CXPA 1E0XA 4PTWA 3C4UA 5DBTA 2V82A 3CLWA 3FYPA 2NSOA 1U33A 1VHCA 3OYZA 5A2CA 2WC3A 3KVJA 2RUSA 1UD5A 3KLKA 1J93A 3BAXA 1UBSA 1B3VA 4Q4QA 3CC1A 1YKWA 3MTWA 1QW9A 4CD5A 3VINA 3AMGA 4MWAE 4GZ7A 1LRQA 1B30A 3TTOA 4UTJA 1ZJIA 3OG3A 1JCLA 1TRIA 4GA8A 3DFOA 2Z4GA 4DPPA 3HG5A 1RPKA 3UWWA 4LYQA 1SMDA 4IGNA 2WVVA 6REQB 1C9WA 1JRBA 1QFEA 2Q3RA 1TWSA 1Q2SA 4Z2LA 5FSDC 1E9YB 4HJWA 2WZIA 4ZEPA 2PURA 3QHNA 4YVXA 3V0TA 1H8EG 4AAJA 2Y88A 4EX4A 3B40A 1YNQA 3BC9A 5HQLA 1XF0A 3QYSA 4H8HA 1HP5A 3OEEG 1X6UA 1FY6A 2QLYA 3NYDA 5CSRA 2NVCA 3L0GA 4M19A 5JUVA 3GVVA 2FFCA 2XZ7A 5HUPA 3MP3A 3GKAA 3EWUA 4R53A 2J9YA 3N11A 1IGWA 3WL1A 2IQ0A 3NQDA 3TN6A 4H41A 4GO8A 3BMVA 4Y9OA 2YA0A 2P8BA 3CUHA 4L64A 3PJWA 4Z0SA 1AG1O 2WZMA 3CMFA 2EPHA 4B5UA 3WF3A 1CXKA 1PBGA 3EAUA 2J9ZA 2UY2A 4H3DA 3CAVA 3TLLA 3MVTA 1LT7A 3HBLA 4HMEA 3AHVA 4O4WA 1JYWA 1CXFA 2PD9A 3T81A 2ZUSA 4NU7A 3M41A 4JQ2A 4M0XA 1XH2A 2DZBA 1DV7A 5D9OA 3MS8A 3EKLA 5DT5A 3W7MA 3BXWA 2W4XA 1LROA 4K1WA 1HQTA 1UZ4A 4L4MA 1BPLB 2HS6A 3L5AA 2O4MA 1OC5A 3BWWA 1W91A 3FX4A 9CGTA 5I07A 4H01A 2ACUA 4G7FA 2HQAA 2ZKMX 1WNOA 1Q6DA 3S1UA 1A3HA 3P14A 5T26A 2DSZA 4M6QA 4IIGA 2IMRA 3WK2A 2QKFA 1X1OA 2WAGA 5DCBA 6TIMA 4GJIA 1HP4A 4AIUA 3PUEA 1XCWA 1KFCA 1LTDA 1QWGA 3R13A 3FLUA 3LB0A 1V02A 3VNZA 1WXYA 4PCTA 2IKGA 3QYQA 2GQ3A 3WNOA 1TZ7A 3G1YA 4PMQA 1P0EA 3F03K 1GOIA 3WQ4A 4O1BA 4Y9AA 4ZO9A 1WPCA 3RUBL 1KXQA 2VZSA 4GYPA 3REQB 1K7EA 2QGHA 3LRMA 1JNEA 2GJRA 1UG6A 3CHDA 2CWXA 3EB2A 3WLTA 4UR8A 3ZOAA 4Z2JA 3ITVA 3O05A 2YXOA 1G7UA 3VOCA 3ZJ8A 5E0KA 1ZY9A 5CPLA 1SU5A 3KBMA 1CGVA 3F2BA 3R1ZA 3GK0A 2R1PA 3R0UA 3TC7A 3PP7A 3VC5A 1IR1A 2PPGA 3AYRA 1RBOB 3LM3A 4PUMA 4DM2A 3MBFA 1LOLA 1Z9AA 5JBDA 3NZGA 1WXZA 1F7BA 4MJ2A 1L6FA 4D8ZA 4A8LA 2V2DA 4UZSA 4IISA 1P6BA 1XLCA 1SJDA 4CD8A 1XIMA 1NWUA 2GSHA 3NVDA 1OFQA 3E38A 2FYMA 1JCMP 1E55A 4DO4A 5A6BA 1K3UA 4DM1A 3MHFA 2QPXA 3NSMA 4RE0A 3H2FA 4ACYA 2XUCA 3Q94A 2VEPA 3L67A 2F9RA 4G6CA 1J0ZA 1BAGA 2HVNA 2V5KA 4H04A 3M0MA 4FX8A 1FWGC 6A3HA 2BGSA 3MSRA 4IZGA 3RIKA 2J24A 2HWGA 3BJTA 2HDJA 4UTKA 1Q65A 1ZAJA 4YTSA 3M0YA 4DWSA 1M9HA 4NJHA 4D6DA 4LW7A 4ZSUA 3T0CA 4F40A 4ES4A 1E0TA 2OLHA 2R1LA 1TPEA 4Q8QA 2Z24A 4YTRA 3UG8A 3TLQA 3TJXA 3MI6A 5G1MA 3PC0A 1H09A 3IGUA 4DF1A 1BYAA 5BWAA 3SN0A 1QHZA 1XIFA 3W83A 2QQ6A 4MKSA 4XD4A 1Z89A 2G41A 1FCUA 2Z7KA 1M53A 4RE3A 4NZCA 1VP5A 3KWXA 4HNOA 1QOXA 1R2RA 1FCBA 2LLEA 2NXIA 5FJRA 2OGJA 2C14A 4HZ7A 2BXYA 3KCOA 1TA3A 3GTHA 4M29A 2O9TA 3SQLA 4AX6A 5FEPA 1Q85A 3W2JA 3CPRA 2YSWA 4MKNA 1P48A 3N1AA 2I17A 4Q6XA 4NNBA 4PB5A 4MJ4A 2J25A 1WDSA 2BVYA 4OV9A 4UUIA 4DAIA 1Q4NX 2DSWA 3G1HA 2EXOA 2BY1A 3FA3A 4GCXA 1BF6A 1M04A 4QAIA 4B4HA 4JTSA 1I9CB 1OWQA 2Y1HA 4JFUA 3CUXA 1M1BA 1QI5A 1S3HA 4W7WA 2JF6A 4PMUA 1AL7A 9XIMA 2W6JG 1IEXA 3OQEA 2Y2WA 1KKOA 1B4KA 4X9YA 3NO5A 3NQCA 4S23A 4NXKA 4W5ZA 3UVIA 1M7PA 3WQPA 5CG7A 3KXQA 3AIUA 4E0CA 1Q13A 3TYAA 3ZYZA 3VOHA 4Z2HA 2HMCA 1KWGA 4GVGA 1WOBA 1SZFA 4XIMA 1XC4A 4P8VA 5H91A 4LNYA 1TPH1 5D30A 1IXQA 1J4EA 1EZWA 2O7QA 3FXYA 2ACRA 4JNMA 3PWGA 2FIQA 4GMEA 1JPMA 3FYYA 3U7VA 1XLMA 3W7GA 4X63A 3S9YA 2W67A 4A29A 1KFWA 3IPWA 3JRKA 3LLXA 3NFUA 1EGZA 3H2AA 3P62A 4XD6A 4WKHA 4JPGA 4DUXA 5K2ZA 3VM5A 5M2FX 1S39A 1R9ZA 4IIFA 3R8RA 5FJUA 3RJXA 3RLVA 3MVIA 2D1ZA 1S5TA 4IX0A 3AALA 3T2PA 3BLDA 1BWVA 2A1YA 4JEJA 1PHWA 4QSHA 1ZS2A 4RNFA 1IT8A 4PEKA 4PMVA 2ZXBA 1JD7A 4GUJA 3PBMA 3CAQA 1TG7A 3M5YA 3W7RA 1IR2A 4TTGA 1PPIA 1K03A 3KP0A 1BSLA 3SJNA 4DF0A 3LGDA 4QEHA 1P0NA 3VKBA 1AD4A 1GVEA 4DWSB 3STCA 3T0BA 5G2WA 3KBSA 4Q33A 5AC8A 7PTDA 3JW7A 1ZAHA 2J6XA 2P1FA 3I6RA 3KOYA 4OT7A 1D8WA 1OY0A 3TP4A 2J6VA 4F2UA 4ZODA 1CEOA 3SM0A 5DN1A 3EPOA 3N4FA 2BXZA 3QH2A 1IHIA 1A47A 2DU2A 3VA8A 2B4GA 2OT0A 4XD3A 4ROPA 1J5SA 4FB7A 1IGSA 1C3FA 4LPCA 3RX3A 5D03A 2X40A 2OLSA 3MMDA 1US0A 1UCWA 3HPSA 3INPA 1H60A 4DRSA 3ZR6A 1E3XA 3GRIA 3R58A 4OJYA 1Q4WA 2VWTA 5DEZA 1ZU8A 3F5JA 1O68A 3E96A 3W2KA 1EPVA 1PZ2A 3M0JA 1KBIA 3KS6A 3HMJG 7XIMA 1VJIA 5JIPA 7ODCA 2E40A 2V2HA 5FJPA 4XZHA 4MJZA 4HYWA 4WCJA 4YU1A 4S2BA 2QJIA 1CENA 1HGWA 1XHGA 1E4NA 3CO8A 4IMEA 3W86A 4LJ3A 3I6TA 4QTGA 4J4KA 4HNLA 4R27A 3NNTA 3SN1A 2BOFX 5EGRA 3T1GA 2VCCA 1DPMA 1QOPA 3DYOA 4JN6A 3LG3A 2P0IA 4E2BA 2GSJA 4DQWA 2HVMA 3OW1A 4QM1A 1EZ2A 4LAZA 5CZSA 4XBKA 3TMQA 1HW6A 3ZWTA 3DC0A 4XAGA 4LYKA 1H11A 5LKYA 4Z1MG 1S2UA 1UYQA 3B8WA 1ZP4A 3V5CA 1SO6A 2PC4A 3QY8A 3O1NA 5DXXA 1TPB1 4EWJA 3FOKA 4IP4A 1EQPA 4GC3A 4ILSA 3DENA 3GZ3A 1O5XA 1OK4A 4O11A 3W6YA 4K6AA 1QT1A 1HX0A 2B7PA 4I90A 3LTYA 3GUGA 3CHVA 3P8IA 3LCFA 4WKFA 3LERA 1NF7A 1TWDA 4GUHA 4KEMA 4LF1A 4AXKA 3GBDA 4TVUA 3P74A 3U7BA 1JUBA 2BV9A 4CNSA 3FJ4A 2QR6A 4GIEA 3URBA 2EO7A 3AC0A 3KBVA 3KL5A 2DORA 2TYSA 5CH9A 4J3UA 1GWJA 4JZ5A 1R2TA 2PCQA 2Q3OA 4WQ6A 5I3DA 2PWGA 3IANA 2HLDG 4AEEA 4C6EA 3GE7A 4PL2A 2QPSA 3K4AA 4IQEA 3GDLA 1TV8A 1JCTA 3PY2A 4PMDA 2DIEA 4NJKA 2ALDA 4XZ9A 5A6BD 3EB3A 2CERA 1TV3A 1V5XA 1MQRA 5IOBA 3OP2A 3RM9A 1QPOA 3W88A 5ABHA 4EP8C 4QRNA 1F05A 4J7RA 3L4TA 3C2FA 3ARSA 4AHQA 4AY7A 2GWGA 4F2BA 1YTKA 1FVPA 1XGZA 2RJHA 3HQPA 3KZSA 4FLQA 4C7FA 1R6WA 4Y7EA 4F0HA 2ZZ7A 2OT1A 2VFHA 4DWSD 4RPQA 1Q8JA 4AHPA 1HKIA 1SFSA 1UOZA 4HMCA 3UWVA 4MM1A 4XKYA 1SFLA 1FWEC 3AIQA 2HISA 3ORWA 3T4WA 1WBJA 2P10A 3DG6A 5D33A 1DE6A 1K7FA 3TONA 1YDNA 1V3JA 4UIOA 2PDIA 3HQOA 3HTWA 1J12A 4C6KA 1HO1A 3EWZA 2FPYA 3ZIZA 2PDMA 1IEVA 2ZRUA 3TJ4A 4GG9A 3MANA 4LEFA 4HPJA 1TR9A 1JYXA 1OBAA 1KBKA 1F76A 2WMGA 1UR1A 3KAOA 4A22A 1B1YA 4LBSA 4OE7A 2B7OA 3USZA 3C6CA 3URAA 3EDFA 3AUJA 3B9AA 1X7FA 2VD9A 5LXXA 2WVSA 4XVDA 4H9MA 1ZAIA 4BZYA 2CFFA 3LI0A 3L7RA 3UXDA 1F3WA 4V1XA 5D9NA 4I8DA 2VX4A 4JIEA 3B0VC 2PD5A 1XJBA 2QPUA 2VC9A 1ZBCA 2V5CA 2VT0A 1OSEA 3OAAG 2R1MA 2OEMA 1TZ9A 3N15A 3NQ8A 4ZSTA 1EJXC 4D9PA 3UYIA 1YPFA 5HJYA 5LA0A 4DZ5A 3C0SA 2H8ZA 4I5XA 4CQBA 2VI0A 1XFBA 3VKDA 3KOWA 3OZYA 1Z32X 4OTKA 1OFRA 1QXLA 3DUGA 4GVHA 3NSXA 4MWAC 3UYCA 4C6MA 2DT0A 3H7VA 3TFCA 3A6OA 2I5GA 3V5OA 3BZJA 1OGGA 4OV4A 4RPPA 2VEIA 2Q02A 1UP3A 2CKSA 4GRSA 4HNCA 5KZEA 3RR4A 1LQAA 2CEQA 4MZ1A 1Y8BA 3GS6A 3M1ZA 3RM8A 1AD1A 3L4YA 2NT0A 3LV5A 1JXJA 1V0KA 4LFYA 4AWTA 1XLDA 3LU2A 2PP1A 4TX9A 1B4EA 1IYXA 3UR7A 1EHNA 3G2GA 3LBCA 2DZXA 4PBFA 1CECA 3VD5A 2V0TA 1VCFA 4WJ8A 3FEMA 2FDSA 5TIMA 2P76A 1O1HA 3DOPA 3FGCA 1DJYA 1H7PA 3L12A 1JQXA 1FWCC 2V2CA 3LGEA 1LWJA 1VR6A 4ECLA 3C0LA 2DIJA 5JH2A 1DIEA 3G1VA 4FHAA 2QCNA 4NHVA 1ZL1A 3RLUA 5CBJA 4F66A 1B57A 2VOTA 3BQ6A 4TT3G 1H7RA 4LC8A 4OBRA 3GU9A 4LAOA 3TR2A 4CNTA 2CBUA 2AKMA 3UETA 3W1QA 1KM4A 4XAFA 4PRWA 2HE5A 1RCXB 3W27A 4UMBA 1KV8A 2VUNA 3VIPA 3KDNA 3L65A 1EO5A 4HP5A 1JPHA 3LHYA 3LX9A 4RE2A 3DYMA 1NWRA 4UCGA 4XKYB 1F4HA 3PSWA 2A7PA 3V5FA 3C52A 4Q32A 3WLOA 1LP6A 4LVAA 2WCSA 3U3HA 5FF3A 2OGYA 1NJJA 3BANA 3W70A 1ZRQA 2BSLA 3RO8A 3L0KA 1ZCCA 5FD0A 5BXSA 1GVSA 3I4EA 3ZT6A 3WQ8A 3NDYA 3CEPA 3CGTA 3EDDA 1YIXA 2WJDA 1CBGA 1NU5A 1N8IA 4XZNX 2V81A 3U0HA 4TUFA 1GHRA 1I8JA 3LCGA 1Q6OA 4FF5A 1VFOA 4O14A 3TAOA 2BHUA 3L2LA 3AHXA 4M8UA 1EJVC 3BGJA 4ML4A 1IXOA 3MCOA 3QKEA 3DDMA 3LSBA 5REQA 1X98A 1W3HA 1CYGA 4DJDA 4K37A 4ZOCA 5MKGB 4IGHA 3K30A 3MW7A 1R8LA 1BLIA 3MUXA 4B16A 3P7YA 4XTDA 1MO0A 3CH0A 4N4PA 1VFUA 4QS5A 3TH6A 4B3ZA 4O18A 1TJ2A 2WJZA 3O07A 1RJPA 3JZUA 2OYKA 4PN2A 8A3HA 4XG1A 4PA8A 3II1A 3NPVA 4CU8A 5GNZA 4PB3A 2CC0A 3CYVA 4ZFCA 1O5QA 3EXRA 1YDOA 1YW1A 2DZPA 3SCRA 4Q6JA 1W1IE 2HBXA 1ZUAX 1D3HA 4WY0F 3ARRA 1TV5A 3BSMA 5GJPA 1JZ8A 3DHUA 2CLKA 2FLIA 3ZM8A 3S1WA 2VR2A 2FJKA 2OLAA 2NLIA 4PSPA 2XGIA 1TJRA 2XISA 4YHGA 1OC6A 3TC3A 4CNOA 2PDLA 2I56A 4RV3A 4L65A 4I5RA 3G22A 1BVWA 4HA0A 1MI3A 3KRUA 4FSAA 1JPIA 1KR0A 4BQ4A 3GM8A 5BWFA 1I75A 3AZTA 2XIQA 3B8UA 4MDOA 1Z41A 2VL4A 4UTFA 3B4YA 2DW7A 4JD4A 3PS7A 1W9XA 1A5CA 2DT3A 4GQGA 2PC8A 4ATDA 3MSYA 1ZBVA 3OLGA 2P88A 3ZR5A 1UMLA 4P7NA 1LG2A 5D2TA 4MAZA 3MKKA 4DO7A 4QQ3A 4XAZA 3TZNA 2VURA 6PTDA 3QV6A 2EG8A 1I0DA 2VELA 2BOGX 1BRLB 1J0YA 3AHTA 4B5NA 5T8GA 3OTRA 4X0VA 4QROA 4MB1A 5CSUA 3LHVA 4KWOA 5CZKA 1AODA 4CVUA 1FWRA 3W29A 3EOUA 4EK7A 2BP1A 2IKHA 3QF0A 2Z29A 3ZO9A 1RV8A 3A64A 1W3NA 3HG3A 4MF4A 3GFZA 2G4FA 2HXTA 3RR1A 1AMYA 5A1AA 4FXJA 1H1NA 3L0NA 3CB8A 1EH9A 3PZGA 4ZQOA 2Z6IA 1R7OA 3ANUA 3GC5A 5C7VA 4Z1DA 3N73A 4PMZA 5BYWA 4A3YA 1W0MA 4NI8A 2YGYA 3SSJA 4H00A 5C7HA 2HZGA 4D8AA 4D72A 3NXLA 3H7UA 3GXDA 3A4WA 5ENLA 3NM1A 2Q01A 1C92A 2WWCA 1J2BA 1D2KA 4A21A 4MNLA 4XZIA 3N6QA 4RZBA 1MDRA 5JXQA 4ROQA 1XQLA 5A6LA 4U5IA 3RG6A 4AH7A 1DXFA 4JQ4A 1CGXA 3QC0A 3G77A 3FA5A 1NDZA 3E2RA 4DELA 2HVOA 1XIJA 2BY2A 1SZNA 2F7FA 3W00A 1KM5A 3HJZA 3G1SA 2O55A 3TN4A 1V6TA 2E6DA 4IIEA 1FWSA 1THFD 1RA5A 5J8LA 4L6OA 3LXAA 2CW6A 2G8ZA 2QCEA 1JDCA 2WSKA 3E6EA 1BEUA 1QATA 3PPCA 3RDKA 1OADA 3NZRA 4GXMA 3OBKA 2HSAA 2NWSA 4OU1A 4GYPC 2VRQA 3AXHA 4R7JA 1W9UA 1QHPA 1XISA 2QDGA 3ZT7A 3AU2A 2ZUVA 2YCIX 2YFOA 1M7JA 4W93A 2OQYA 4WGHA 3I68A 1EJSC 3AIWA 2PTYA 1JUKA 2PRMA 3WQOA 5DFAA 3GIQA 3H2CA 1XQKA 3BV7A 5D32A 3TNBA 4RLIA 1E9LA 1VENA 1UJPA 3EX6A 2OCZA 1FHLA 3A4JA 2NX1A 3NURA 3NUKA 4INFA 3S2LA 4B15A 2FTPA 2DV0A 3T2QA 3ZFHA 4Y9NA 1JCNA 1TELA 1ME8A 1U1HA 1MZRA 4RW3A 3UG5A 5EMKA 4P8XA 4ZB5A 4E8CA 1GZ1A 3GKFA 3A5FA 2PWHA 5LHEA 4BA0A 1GQIA 1KRBC 1RLCL 3L4XA 1RBLA 4KWUA 2X1UA 4W7VA 3VIGA 3LBMA 1V3MA 4UTTA 2ZZ2A 4RDWA 3THDA 3NJ3A 2C7FA 3W02A 3WIJA 4O54A 2EAWA 3V16A 3WJWA 5K4XA 2J62A 3TYBA 2NUYA 4YHEA 2W61A 3SECA 5EMUA 1D3CA 1KBJA 1YNYA 5CKSA 1NTHA 3NPUA 1WUFA 2PZNA 3WUGA 3SCVA 4L1GA 2YCLA 4RNIA 4DWSC 1GJWA 2VEGA 1AMKA 3FS2A 4KGJA 1ENUA 1AQFA 4QIUA 3GU2A 2NLYA 3U8GA 3MUY1 1JNDA 2WKLA 3GVGA 3CIWA 4B5VA 1FWWA 3B03A 1FFQA 3NOYA 2J74A 3VIFA 4FOJA 2XH4A 2ZX6A 3LM7A 4MPQA 1UZDA 2JKPA 3ARTA 4GQ0A 3HJEA 1K6WA 1E0UA 2XIOA 4S1FA 2QV5A 4PUEA 5BMWA 1TJ0A 4FAMA 3LN3A 3UP8A 3T4CA 3CYJA 4D6EA 1B3OA 4JTLA 3USBA 1QI3A 4GFIA 4JX4A 1XW8A 1V6WA 5U4NA 1AUSL 3STFA 5LA2A 5C70A 2QCMA 1IQ8A 3ZR4A 1EBHA 4M82A 1W31A 1Q7ZA 1VH7A 2VO5A 2ZXQA 1IZCA 1Z3NA 3P82A 2OX1A 1E56A 2J8GA 3EPNA 5GPRA 2GL5A 4K38A 3MI3A 4FZIA 1EJUC 3W75A 1E0WA 2PF8A 3QOKA 2DH2A 3M47A 1A0CA 4HCDA 4I8YA 1GW9A 5U7SA 1DEDA 1UD6A 3W25A 1G01A 2F2KA 1XD0A 4I3GA 2EJ1A 2QJHA 2QEZA 2R91A 3WFAA 3U4AA 4DJDD 1QTWA 3AROA 2E25A 2H8XA 4PCFA 2E9BA 4ACZB 2CNCA 3AZSA 4OBSA 2J8FA 5DMYA 2E1WA 2G3FA 2V8ZA 2WHLA 4PUKA 3KOZA 2HNEA 4RR4A 4LH8A 3CUIA 4LYRA 4ASUG 3PB0A 4W86A 1PV8A 5A6MA 2NVDA 4N0RA 3EKGA 3DFQA 3CIVA 3CMGA 1HKVA 1B9BA 3K4WA 5BXPA 3BLIA 3CB3A 4IFKA 3TW6A 1OM0A 1BFNA 2Z1VA 4WSHA 3VMPA 5F1UA 1DTNA 3PTMA 4EPDC 3BDKA 1B3YA 4O53A 1JI1A 2XG9A 4DN1A 2OEKA 4N6FA 1N2VA 4WDXA 3NDZA 1XYAA 3R11A 2GVYA 1ZB5A 1XWYA 1SSGA 1PDZA 3C0QA 4J1OA 5F4WA 4M3PA 3JS3A 4DB7A 1WCGA 5CBIA 4RE4A 3P60A 4GGHA 4RZ5A 4G8TA 3VXGA 4DBWA 2QGYA 4Q8PA 2AAMA 2G95A 4E2DA 1J0KA 3O9NA 3ONBA 3R2GA 3DBPA 4JN7A 2OODA 5A8MA 4BEUA 1BG4A 2WM0A 1OF8A 3PN8A 1XYLA 3P2VA 2X0HA 4PYSA 3A5VA 3FK4A 3CO4A 5I78A 4MY8A 3VIMA 3TYZA 4L61A 1I2QA 4TMBA 1OB0A 2DVUA 1TV2A 3WX7A 3TC6A 5DLCA 5FF0A 5CCZA 2FJUB 1TTIA 3NO3A 1WQ5A 2YDRA 3HA1A 1AW5A 4NYUA 3VMNA 4O12A 3OVQA 2D69A 5AHMA 5IHRA 4S3JA 5F2MA 1BXNA 4UTMA 2JGYA 1CLXA 2XHYA 3D46A 1UWTA 1EGMA 1PYMA 3XIMA 1WZLA 4DXVA 1EC9A 1LL6A 1UWAA 3LHUA 3G0XA 4IPLA 1ISVA 5GJMA 2Q09A 4ZB2A 1E5NA 4E38A 5H8PA 5LIWX 1H5YA 3UESA 2CLLA 3TXVA 4J3WA 2DUAA 1EC8A 1DXIA 3SGZA 3BE7A 2Q8XA 4DLMA 4LVDA 3FJLA 3G0UA 3UA4A 3SI9A 2A7NA 2XH2A 3NQ2A 3SW6A 6XIAA 1VAHA 3ZVHB 2YW3A 1EFZA 2JKAA 1M6JA 1PIGA 4JCMA 2X30A 1XLIA 1MFUA 1VC4A 4E8DA 4JFSA 3MZNA 4RCXA 3WEMA 3C2OA 4EVZA 3KHDA 3GG0A 4XBSA 4FNQA 4GOAA 5C8BB 3FYOA 1XUUA 1KCXA 1WDRA 3DBNA 4B9YA 5HR7A 4N9BA 1GOOA 2C8NA 3E9AA 2V5JA 3EMQA 3GVRA 1K8CA 1KGXA 3GNDA 2Z25A 1PCWA 2RDXA 3EA3A 3VOIA 1NDYA 2PTWA 4NJIA 3BV4A 1YXCA 1VFMA 4IFKB 3A4AA 3FAXA 3N13A 4EAMA 3IJ9A 3VGFA 3WDQA 2PDFA 1O5KA 3SCSA 5BOEA 1A50A 3P3BA 3DFPA 1JD9A 1SW3A 2YLLA 4DJEC 2GVEA 1JULA 1TIWA 3OA3A 1JYNA 4HNTA 3KW3A 2A3CA 2Z28A 1V0NA 2PDWA 3D3AA 4I7UA 3EWDA 5BNKA 5LIUX 3BICA 2VC6A 3O7UA 1W0JG 4PRRA 4QE4A 1TO3A 1CGUA 1CGYA 1BKSA 3QV9A 1L8NA 2PU0A 3P8JA 1UR4A 3C3NA 1V6YA 4ERIA 2J7CA 4DYEA 4Q4OA 5DN6G 4ATWA 2VEMA 3TE9A 5A95A 3STPA 4J3SA 1OIMA 1SFJA 3PK7A 4XTIA 3LCHA 5HQEA 1P6WA 1UP0A 3KEHA 4QSFA 3BAIA 1VIWA 2WKGA 1OFOA 4U28A 1SW7A 2NQ5A 3K2GA 2MANA 3O6DA 4V28A 4YTQA 1HG3A 2WPBA 2PDHA 4CEUC 4AZBA 3IIOA 4HN8A 3UJSA 1A5UA 4X3ZA 1H4PA 1FCVA 1S2TA 3CZEA 2CHRA 1CI1A 1X39A 3IIPA 4HK7A 2F6UA 3DKJA 1WKDA 4HMDA 2G3MA 1S5MA 1J2WA 2XFFA 3B8TA 1FP8A 2PDJA 4WK9A 2J4GA 3IGSA 2E67A 2PODA 2GLKA 4RDVA 4X61A 4IJBA 5LSMA 2XVPA 1R3SA 3CV2A 1XKYA 1KM3A 3WQWA 4FOUA 5C71A 3GH4A 1UD3A 2GOUA 2HTMA 4JTEA 3UNDA 1MW2A 1V93A 1G67A 2BVWA 2W6RA 4HD5A 1Z44A 3ICJA 4O16A 1FCQA 3H26A 2D2OA 1A0DA 3VX1A 1A5LC 4HHPA 1XIGA 4C6CA 1W1YA 5CLTA 4BWLA 3VO0A 3E0IA 2X1TA 1W54A 1HKKA 2VGBA 4MUZA 3BVJA 2NT1A 1VFFA 1UR0A 1C8XA 4D6HA 4GY0A 3LV6A 3KDOA 4U5KA 1JZ2A 3SCQA 4H9VA 1UKOA 4Z08A 3F5LA 1Y5VA 5E9XA 2BASA 3GDRA 5CAHA 1QW7A 5IBXC 4HU8A 1VBJA 3IUHA 3LGGA 1W17A 3UCDA 2E9LA 3CV6A 3KVMA 2QUTA 1CB2A 1I2NA 4XAPA 4IL2A 3BLLA 4S39A 4EWND 1IXNA 4AMCA 4PZVA 1ZJBA 1Z42A 4M7TA 3P93A 3B06A 2ZX5A 1HUVA 3ZZ1A 4S3DA 1XP3A 5KZMA 4C6NA 1W5MA 3DHPA 2V5DA 3VC6A 3SB0A 1U5HA 2E1DA 3XISA 2QYGA 1YEYA 3EBVA 4HK5A 4BKNA 3MWCA 4HU4A 3OYXA 3U9IA 4BI5A 2F6KA 4JYEA 3UBPC 3ARXA 1BKHA 4REQA 1HJWA 3LLFA 1NAL1 2JF7A 2TAAA 4JTCA 1RJQA 2FPTA 4GNVA 4O13A 1VYRA 1TMHA 3PBWA 1XYCA 1E1EA 3RLGA 2JFEX 2DSUA 1NELA 5FJJA 1V6UA 1Q6RA 5A69A 1KC7A 5JBEA 4M6UA 2YL9A 4AZGA 3MDUA 3ARWA 3S5YA 1EBGA 4GI6A 3N17A 1DL3A 5LGXA 3CQJA 2E28A 3J7HA 3ERPA 4O28A 1FP9A 3O2LA 4N6EA 3FXGA 4IX2A 3W9ZA 5E9AA 1SO4A 1V7YA 1E0VA 4R88A 1RP8A 1ME7A 3PUDA 4XSMA 5LNWA 4KEZA 1DP0A 5D2YA 1ISYA 2F84A 2ZRWA 4FXFA 3H4GA 3OGSA 2I1OA 2ZVIA 1IWPA 6TAAA 1DWIM 5KEZA 1FXQA 3ATYA 3MUIA 3P81A 4YLWA 7ENLA 4TOQA 3R8HA 1TTPA 1CW2A 3VZZA 1KM2A 3MY9A 4JHMA 2PA6A 1L0PA 1TPDA 5BW6A 3QPZA 1GONA 4MMWA 2MNRA 1W5PA 3EOEA 4BF9A 4NX0A 4Z0JA 2Y7FA 4JHOA 3AI0A 3BCJA 1XIDA 3CTLA 4I9TA 1DXEA 3VGHA 5G4EA 4ZA0A 4EXQA 5I0DA 4HA4A 5FESA 5FACA 2O9OA 5BRBA 1REQA 3TN3A 3SEPA 4P7RA 3HFTA 2FHBA 1Y65A 1HJUA 3L2MA 3EX4A 4PMYA 1IWBA 5IFTA 1TV7A 2HJPA 3SY1A 3WUEA 3QGVA 1AFSA 2EPNA 1Z48A 3ARVA 3NQ6A 1ZBWA 3T55A 2WVUA 1VEMA 3VE7A 3WY1A 4RXFA 3MA8A 2QCDA 1BXCA 3T08A 3DFTA 3QEZA 1RALA 3FKSG 5AYBA 2VFFA 1PZ3A 3OBAA 3W1PA 1LBLA 2ISWA 1ITCA 1JAEA 3ZWSA 1EIXA 3GXTA 3OVRA 4X0NA 4WY0A 5CC5A 1F6KA 2P8CA 5GVJA 1XLKA 1DWJM 1GT8A 1GVYA 3VMOA 2ZFAA 3GVWA 1T57A 4PC8A 2XFRA 2J75A 1EPXA 2J88A 3WJZA 2NX9A 2YA1A 4IXXA 4O17A 3RCMA 3SFKA 1UPPA 1ISWA 4QJ3B 2J7DA 3N19B 3B04A 3LNPA 5CGQA 3LEPA 4KRZA 3VIHA 5I03A 1FOBA 4JYFA 2W63A 3TDFA 4DUWA 4EXBA 3RNDA 2GQ8A 4GJJA 1F61A 3CNYA 5I6SA 1AQ0A 3WMLA 5MHBA 3RU6A 3DYPA 2JIWA 3H12A 3PM6A 3UGRA 1KM1A 1J0JA 2PSNA 4GY1A 3E2QA 4GD0A 5CAKA 1EX1A 3PVFA 1R9YA 3GHSA 4P5UA 2OZ0A 5G4WA 3GTNA 2CLEA 3QY7A 4AWUA 1EUNA 1JZ6A 4OKDA 1MDLA 4Y90A 2D0GA 2HROA 5AHLA 3IJ8A 2PWDA 4K8GA 3CH9A 4PMNA 2FGLA 2Z2UA 3A4XA 2FMNA 4F3HA 4Q4SA 2GDVA 3FFSA 2XIMA 1QNSA 3AWNA 1KLYA 3S8HA 3A12A 4WXYA 3THAA 4H8NA 2PTXA 5K7JA 4P8WA 2NV9A 5I3GA 5B7YA 1HFBA 2V67A 2PTZA 3JZEA 1J79A 4JY8A 4KCTA 4MKVA 2JE8A 1G6CA 1V77A 4AG0A 4EOUA 1JF5A 3SCOA 3ARQA 1GG1A 2DZVA 2D73A 5KZDA 2GSEA 2HRWA 5G4HC 1Q3NA 3GU1A 1QHOA 2GDUA 4OHQA 1LRNA 1LG1A 2Z1KA 4I9AA 1UBPC 4JTGA 3DXIA 1BWKA 2V30A 3UG3A 2DIKA 6XIMA 4NY2A 3T07A 5HR6A 4U2YA 3MU7A 2XIJA 4IUOA 3FDKA 5C2GA 4NVTA 4BQ3A 4C6BA 4MG4A 3EDJA 1LL4A 1N8FA 2VM8A 2QCDB 1L6GA 3PJXA 3MO7A 4NT0A 3PZMA 5A6TC 1H7XA 1RVGA 4DVOA 1YE6A 1C7TA 2L5HA 5BU9A 1TPVA 3LCIA 3CV7A 3T2OA 4MLJA 1UROA 3VM7A 4C1LA 4YTTA 4PL1A 1OJXA 2VNCA 3CMJA 3WJXA 4TIMA 3TJIA 4EPKA 3I7RA 2WPGA 3M5XA 1XBXA 3RXZA 3WJSA 3DKLA 4D6IA 2CXEA 5KITA 4QQUA 4TXEA 4GUIA 2NX3A 1OABA 3CT2A 4V2XA 3OQ8A 1HJXA 1V0LA 1PXGA 4NRSA 4TX6A 3S5OA 4AF0B 4L7ZA 3IRDA 1BXBA 4UMCA 3L5MA 4KW2A 1XBZA 5EMYA 3BLPX 1P6CA 1KTNA 4S3KA 4UR7A 4NNAA 3ITOA 2J7EA 5A6AA 4MZ8A 1CB7B 4U31A 2R6OA 3TSDA 4TSFG 4ZCWA 5FOOA 2DZTA 2NUXA 1E1CA 5TD4A 2WW5A 3LOTA 4LRTA 1E51A 1EP2A 4JNZA 4ZO7A 1VGAA 1IT7A 4BS0A 4NZ4A 4Q4RA 1HJQA 1GQNA 5HNTA 1JZ3A 3WLKX 4W8AA 3UZJA 3IJIA 4JXCA 3AIRA 3KP1A 1K77A 3V75A 2DGAA 3OA5A 4MFEA 1HL9A 3AIBA 5AYZA 4H9YA 2ISFA 2V7QG 3WLIA 2E6YA 4IQLA 3C3UA 3G1XA 2C1HA 3PHAA 3BW4A 4OECA 4JBRA 3PZTA 3TTSA 1H3GA 2YW4A 1O4UA 4D2JA 1US3A 4HB7A 4ZBCA 4X60A 3QR0A 4RJEA 4UTTC 4ZQNA 4D8LA 2VVNA 4HCLA 5F4SA 3PUOA 4JFTA 2RKXA 4DNHA 4WOQA 3VFLA 2QIWA 1LM1A 4UFIA 3NVTA 4A3RA 1VFTA 1L9WA 4DY1A 3MMWA 4LAMA 3W7CA 4PBEA 2EGZA 2OWCA 2PZ0A 4C6PA 5H2ZA 1T96A 3LDVA 1YYAA 2XH0A 1K6AA 3MJMA 1S5VA 4LGXA 3M0IA 4MYAA 2OR2A 2VQUA 3R25A 1YNPA 4X9SA 4CQAA 4YWIA 2EPOA 1XC6A 3B9DA 4UQBA 4UTIA 5AB3A 3WD1A 3W72A 1R5YA 2ATMA 4LVGA 3H2OA 3TQ0A 3GXPA 2QVNA 5A8NA 2UZ9A 3PZUA 3GNPA 3NQGA 3WBYA 4BQ2A 1AW1A 3R0DA 3CS2A 3RX2A 1XG3A 3O15A 3WKZA 4DJFA 5K3VA 5DT7A 2R1KA 2ZUMA 4AMAA 2CLMA 4FF7A 1YDVA 1V7AA 1QAPA 3AMLA 3I65A 1UC5A 3TWAA 4NZFA 2QVHA 4FOKA 1S2VA 4E2VA 4PGLA 3GDMA 5D05A 5A3HA 4MIMA 2PDBA 2X2YA 3PBVA 5E6ZA 5ABGA 3CQ0A 5DCEA 2VCBA 4CNUA 3VDCA 4NAFA 2FHFA 2Z7GA 5XIMA 1HVQA 1GYLA 1E6XM 4JNYA 1F4AA 1R47A 5LXEA 2XVNA 3OHIA 5LGZA 3W0KA 4E4PA 5C2XA 2KAUC 5A6KA 3GG8A 2RJGA 1XPYA 2GGIA 4NSBA 1X1NA 1HO4A 2DW6A 5I3JA 4G7EA 1XICA 2V3DA 1PVNA 3V1PA 3L21A 3FKKA 1E79G 4AISA 3C2YA 2W0UA 5AC4A 4XUYA 4EXAA 5IHSA 4V1YA 4GXPA 3UJEA 3DESA 2ZQ0A 2G37A 3HZ3A 3FJNA 4MPKA 3MPGA 2BGQA 1EQCA 3QOMA 5C9ZA 3WBAA 3M0XA 3HOJA 4AD5A 4H9UA 3DHDA 3ZQ9A 4FNUA 5D38A 3W74A 2XWDA 1G4TA 3KBWA 2DVTA 3UT0A 4MJMA 4Z17A 3C8FA 1NP2A 4O0KA 3NQMA 4IIBA 3QPYA 3DGRA 1QK0A 2QUNA 3W1UA 3AOFA 3SRHA 3WO8A 4M1RA 2AL2A 2VGFA 3A9BA 2OSYA 2YJQA 2C79A 1T0OA 2A85A 3ZSSA 4B91A 1GVOA 3M4HA 2ZA3A 1JEZA 5HMDA 8XIAA 3TIMA 1ADOA 2INFA 4AZ6A 3W1AA 1XLBA 5DCDA 2XH7A 3GD6A 4G2DA 2W5FA 4GACA 1P0BA 2YLAA 3PFMA 2C19A 2Y62A 3TOPA 3LRLA 1PWMA 1UWSA 1FWBC 1U83A 5LIXX 2GVJA 3UFYA 3EWBX 4YL2A 3LNMA 4OUIA 1U2YA 4D1JA 4I9MA 1JDAA 3HV8A 1UWQA 3AYTA 4XZWA 2NXGA 2NV1A 1PTAA 4Z2IA 3O0KA 3PG9A 4UWMA 2XTKA 4KT2A 2JIZG 2PFHA 2YZRA 4P7QA 3VNYA 4CCEA 2QE7G 1R85A 3UEQA 3IJDA 3MP5A 1RBAA 2INEA 4W9TA 1TFVA 3I7QA 4N9CA 3N2TA 4H2CA 3WUFA 2DSKA 2WSSG 2EKGA 5HATA 4O19A 4DNMA 1C9DA 2HS8A 3ECQA 5F2GA 3NZ1A 4KKXA 5DMLA 2C3ZA 2WVTA 2J27A 3BOLA 3NXFA 4PEEA 5H8UA 3JR2A 2DP3A 1RK6A 1JCYA 1S5NA 3GNRA 3L66A 1TV4A 5LNVA 4HHHA 4N42A 1K70A 3CPGA 5D02A 4IFOA 4LU0A 3W73A 1KM0A 5KSWA 1U30A 3B4UA 3ZJKA 4E3TA 1PE1A 1X8FA 5K9XA 3GHTA 4ZGYA 5CPQA 3FSTA 5C5YA 2QDHA 4NJJA 3PANA 4XZMX 3SRKA 2FZDA 1T5AA 3GFYA 3REQA 4RK8A 2WXDM 1KM6A 5CJ5A 5F2LA 3AMDA 3CUZA 4R9XA 2OELA 4GWEA 2PBGA 3AJXA 4G7EB 4XV0A 3CL7A 2CWNA 2WNZA 1EJTC 2A2IA 1KV5A 1W56A 3GHRA 2OZ3A 1LLZA 2Z00A 1L2QA 2OOGA 3C8NA 3W2UA 2YB4A 4XKMA 3ZVIA 4OQVA 3C2EA 3KBNA 5ABFB 1B3WA 4W88A 1XD1A 1BQGA 1FWTA 3A9IA 1O6IA 4S3EA 4G9PA 2ZADA 2UV8G 2E4TA 3IJQA 1YE4A 5HQMA 3UWQA 1QO2A 4FIRA 1UWUA 4PRTA 5JH1A 3O6AA 1FDYA 4CLMA 4GO9A 1EYEA 3KZPA 2CLFA 3LCWA 3LMZA 1VBGA 2E7FA 3H55A 3D47A 3ZLGA 4HZ8A 2AL2B 3P6LA 4JAWA 3DFNA 3RILA 2ISVA 4IFRA 9XIAA 2QULA 2GDQA 2PDKA 3PFRA 5A8PA 3QZAA 4JICA 1OX6A 4NG3A 1OT1A 2D24A 4JYDA 5CPSA 5FEWA 2BHZA 1AL8A 3UW6A 4RDZA 3PNZA 4C1NB 2IUZA 3C56A 2XN1A 2NQLA 1DWHM 1YBQB 2V3EA 1I1WA 2WSPA 4LS1A 3C0JA 4NUWA 4AZ5A 1EHAA 1XXXA 4AUBA 3ABZA 3LQGA 1LBMA 1ZPTA 2VQTA 2WZTA 4NZ5A 1RLDA 2DQXA 1RR2A 3MZ2A 1OQFA 3UZYA 4CCZA 3P5YA 3SY5A 3R4IA 2QCHA 2DUXA 2ZUWA 2GJNA 2Y63A 1FWAC 3W38A 1ITUA 2W92A 3TVAA 3S6OA 3GHUA 4WJXA 3PZQA 3UF9A 4KMQA 3O63A 1OYAA 1TCMA 4I6VA 4YPJA 4AD3A 1F74A 3WUBA 1IEQA 3BLEA 3LUTA 2X41A 4ZL1A 1K4GA 3PPGA 1EA0A 3OZMA 5CZ0A 2CLOA 3PJTA 3HQNA 4B3KA 1TIMA 1VRDA 3R10A 3LSCA 3BMXA 1MSSA 2E5CA 2GWNA 3MYOA 4Z42C 4AWSA 1SUXA 2GGJA 1Q7QA 2OWWA 2CESA 3BJFA 4P7LA 3WF4A 1DIKA 3L2IA 3ES8A 1PWLA 2J47A 4DJFD 1QMLA 5CEWA 3ABOA 3BCFA 2X1IA 4POCA 3HPXA 3S42A 3TXZA 1AJ2A 1MXSA 4DBUA 3NPXA 2WBGA 1Y0EA 1TTQA 2O9RA 3TQPA 4E6MA 1F8IA 2INZA 1XLHA 3WD0A 4GX9A 2QCGA 3HB9A 4PUJA 3AZRA 1UR3M 2JK2A 4O1EA 3M7SA 3WK0A 1H50A 1ICPA 3AAGA 5M17A 5L9FA 3LQLA 3QMRA 2HXUA 2FZNA 1YDYA 3I10A 5A2AA 1X6LA 2Y61A 5E70A 3Q45A 1JR1A 4QITA 5XINA 4IOTA 4D6JA 4AIOA 1VJZA 4GBUA 2CLPA 4AFYA 1K8ZA 2X09A 4WIWA 1QI4A 5KZ6A 4IP7A 3GXNA 3G1RA 3DU0A 3POCA 2POZA 5A8QA 2IXVA 2J66A 4GI4A 1R30A 3QMTA 2PP0A 4UFKA 3OO2A 1QNPA 3MB9A 3G6MA 3E0VA 4Y9PA 1Q6LA 2HK1A 1U1JA 2XJ7A 3IVTA 3QN3A 4MDPA 4ZXLA 3VCCA 1MMFA 3QBUA 4V33A 1HT6A 3VFCA 4DXXA 3GC4A 4WOZA 1FH9A 3R43A 2PEVA 4M56A 3QGKC 1E4MM 5TQLA 4HJFA 2H3BA 4LV4A 2E5DA 5KINA 4C65A 4GZJA 4FNTA 1ITXA 5CG0A 4AYGA 5AVHA 4JIQA 3TA6A 2HK0A 4UCFA 3H2EA 3SQMA 4JL1A 5DO8A 1RSCA 3TROA 3E49A 3RF9A 1CGWA 1TPC1 4Q8MA 3EGJA 4WRHA 1V51A 5K4ZA 3L4VA 2ICSA 5C0QA 3PSVA 4O50A 1GOQA 4DZIA 2YBVA 5ABEA 4PUNA 4U3CA 5CGMA 3OLEA 1VCVA 4QDMA 1EIBA 4WKAA 4U3AA 5E1QA 2VGIA 1T8QA 5E0CA 4PTDA 1OFPA 5T9BG 1UZ1A 1KR1A 5D9PA 2WLZA 2B7NA 1KFLA 3KVLA 4KCVA 1CXHA 3WNPA 1DIOA 1GOMA 1TX0A 4AIEA 1BSIA 2CXGA 4PFMA 1GVIA 2Q8ZA 5CSYA 4HPNA 2ZRVA 3QSTA 1O12A 2ZDSA 5GJNA 3H24A 3A13A 3T42A 4F79A 3GXFA 3JU2A 1WP6A 1D8CA 1LLOA 1PIIA 2BHYA 1ONXA 2OKOA 4I6KA 1B9ZA 4QLKA 4YXWG 2A3EA 2VFEA 1VD6A 2PE4A 3R0KA 3UCQA 3TJLA 3LTSA 3ZSTA 2BOEX 2IQTA 4YVPA 2A5HA 2YL6A 3EWCA 1ZP3A 3GIYA 5BOFA 3QMSA 4MUPA 3S2MA 1QR7A 1A5OC 4C7GA 4O0QA 1XR2A 3QFWA 2BG5A 1F8MA 3U48A 3DERA 4QJ4B 4FX6M 4IQDA 1T7LA 2C6QA 1P0KA 3RITA 4HKPA 3QM3A 2BLEA 2P5NA 1X7IA 4ORMA 4W4QA 4BR1A 2ABBA 2ZVRA 2Y8UA 1H7WA 4NKCA 8RUCA 1F3XA 3Q2DA 2WQDA 2Y5SA 3NAVA 2OXNA 1ICSA 3RPDA 1V02E 2B31A 3RO6A 1L8PA 2W3ZA 3UA3A 2BY0A 3U5YA 1W3LA 2AGTA 4UQDA 1XLEA 1BTMA 3PZVA 3SADA 4KRTA 1QK2A 3RPTA 1KW1A 2ZA1A 3ZS4A 2I9EA 5FF2A 4HOXA 5EKYA 4UQ9A 3T7VA 4JKKA 4CCCA 4YXGA 4A2SA 1IXPA 3CAKA 3GTFA 3Q67A 4PE8A 3CU2A 5D8ZA 2PDYA 2NQ9A 3V0UA 4DIAA 3DAQA 8TIMA 5DRIA 2FFIA 3GO2A 4A8IA 3BO9A 2WOQA 3KLLA 2QUVA 3TA9A 4E5TA 3BAJA 1ELSA 5D37A 1TVLA 4AZCA 3N6HA 1Q6FA 1RP9A 2P53A 4G1KA 4UFLA 2OYMA 3NGJA 3F2DA 1GTHA 1JCJA 3KVKA 3E0LA 1VHNA 1I2OA 3PBYA 4FLSA 1LL7A 1WKEA 4AIBA 3S6TA 3GSMA 1TCDA 5AZ0A 1XS2A 3BG3A 3TTYA 4K68A 4KCUA 1BQCA 1PX8A 1HF6A 3PZOA 3TNOA 4HNVA 1BYCA 1GNXA 1YHTA 2VOMA 4KESA 3AHZA 4KCWA 2E6FA 3MCMA 2PAJA 3EX3A 1V6VA 4LAKA 1MXGA 4YCPA 1UR9A 2VJXA 1MRAA 2DQWA 2DEPA 5C9RA 1ONEA 1QNOA 1UH2A 3TAKA 2WCGA 3H4XA 1TQJA 3N18A 4Y8FA 4LUYA 1E6ZA 3DN5A 3K13A 3KCLA 1WE5A 4AD1A 1VCGA 1B54A 1GEHA 1RHCA 7CGTA 3STEA 3VDHA 5FL7G 3KRZA 4A4AA 4C6DA 3NGFA 1LJYA 2J7GA 4UFMA 1U1UA 5MF5A 2Z2AA 5DQPA 3LRKA 4AVOA 3HF3A 4PTMA 1O95A 3RX4A 5CPNA 4OWGA 1ISZA 2V3GA 2QXWA 1E70M 4LF2A 1W2VA 3TKFA 3D0CA 2FMOA 3PAOA 2MUCA 3AO0A 1GGOA 4HOWA 2A3AA 3OIXA 2JJ1G 5DY3A 4HHLA 1PDYA 2QZRA 4O1AA 3QZEA 1OT2A 2P0OA 3K8KA 3F4DA 4HU0A 1E43A 3B05A 3R89A 4KGLA 3WDIA 1RQEA 2RDUA 4GPNA 4IMDA 3ZXWA 4CN6A 5D2VA 4B5SA 1ZQ5A 2OVLA 3BMWA 1GVFA 4XISA 2Z1WA 3GH7A 4ZFMA 3SBFA 2WCAA 4JKMA 2WJEA 3UJRA 1DJQA 1EP1A 5G1YA 3Q37A 4ERAA 1A49A 5TNVA 3RMJA 2G3JA 1EF2A 2H6RA 3OZOA 5LYRA 3FEQA 3K4DA 2TRSA 1PTGA 5CQ1A 2ZWZA 2JKEA 2GJXA 3H2MA 1UKTA 1X8CA 1ZSXA 4KPLA 1A3XA 4MVAA 1TUXA 3FKRA 4LY8A 2I16A 4Q8UA 1JDDA 4CN1A 3QVQA 5IXEA 4UQAA 1TREA 1W5OA 2QAFA 3M0LA 3KE0A 3WQEA 4MSSA 4GUGA 3WSUA 4AZCB 3ALGA 4ZOAA 1XCFA 3EXTA 1TMQA 4GKLA 3T40A 5CPTA 4B92A 2G3IA 1K1DA 3HGSA 2C0AA 4YNGA 3AICA 2VKZG 3MUCA 1LDCA 1B2YA 4PB4A 4DZHA 5FSEC 1PX3A 1RK5A 2PGRA 1YLVA 3AS2A 3URNA 2GOKA 1WO2A 3H8AA 5A8GA 3CBWA 5EL1A 3LTPA 2A6LA 1M41A 1SO5A 4DHGA 2C13A 4WD0A 3FHQA 2DJXA 3UG4A 4ICCX 3E12A 1XIEA 2PBOA 3SR7A 2EF9A 1JG9A 1GQJA 5JU6A 2ZX8A 2ZE3A 3M07A 3GXMA 4NNCA 1V3LA 4IL0A 1UH4A 1TQXA 4J40A 4H6RA 4JOMA 3S5SA 5XIAA 4LCRA 1AQMA 1T6MA 1XGEA 5GNXA 2PGWA 4MB3A 1FQ0A 3LZ3A 5CC6A 3SRFA 4B3LA 4GYFA 1JUEA 1JVNA 3LXCA 1W9DM 1FX6A 3M16A 4UOJA 3IEBA 4XX6A 2CKRA 3AYSA 2WHMA 1P43A 1GORA 3NDOA 4DBDA 1UWRA 4H19A 4AY8A 4S3FA 4UXDA 1FA2A 2W66A 4QLJA 4DJFC 2AQOA 3SN4A 4AZHA 3IVSA 1SW0A 4PBGA 1CT5A 5MKGA 1F73A 3NTYA 1A5KC 1UKQA 2GUUA 1M7XA 2KZHA 4CU7A 4O0ZA 4QXIA 2XYLA 3W76A 2G3NA 1GEQA 4J35A 3TYDA 3U57A 3W1TA 2Z26A 3UWYA 2PLCA 4GBDA 1DJIA 2C16A 1YTDA 3GTIA 1UA3A 3IK2A 1QNQA 3DFSA 4CN4A 1UB3A 2Y8KA 4KRUA 5FIPA 1DKWA 3CM4A 1YPIA 4MWAA 2XIIA 4PULA 3W7JA 1JQVA 1MXDA 3O16A 4PCPA 1XLLA 1FWNA 4NF7A 5DX7A 2BS9A 3VOGA 3H53A 3W37A 1OZQA 2GJXB 2I5QA 1FHUA 1K9EA 3WDRA 1CCWB 4F9JA 4IP5A 3QJAA 4XD5A 4S38A 3ITCA 3HGJA 1XINA 4PUUA 4BF7A 4HTYA 3M6YA 3NEVA 4S3BA 1VZWA 3NZPA 2G97A 3W1MA 3OVGA 1JFHA 5AHFA 2XN2A 3BG9A 4P2VA 1P1XA 3HURA 1TMLA 4JS3A 4PTVA 3MSGA 4HBKA 2IPWA 3EOSA 1CXEA 1EUAA 1XRVA 1I0BA 5H6HA 4TO8A 2WNWA 1EEXA 4UTUA 2PDQA 3M6DA 1KQYA 3NSNA 3EWYA 3M44A 1FUYA 1XGDA 1WV2A 1GKPA 1T99A 3BAKA 1QASA 3MT1A 4V27A 3YPIA 4LUJA 5FI8A 2OQLA 1BRLA 3F4WA 3W7OA 3VIIA 1KGUA 5FL1A 1XPGA 3LK6A 1ZBKA 1OHLA 5BOOA 4QNEA 3EKZA 1RY8A 1LWIA 1ONRA 2PDCA 4LB3A 1O94A 1IT0A 2VDGA 1NWSA 1I4NA 3LPOA 4KQNA 4HSNA 2WJFA 4GUFA 1GYMA 1UPMB 3A22A 4L5ZA 3S1GA 1E6PA 2ZBTA 5HWJA 3G8EA 4K7YA 3UQNA 4ZR8A 2PLMA 2OOFA 2VHLA 3LHWA 3UY7A 2A6NA 1PJ9A 3WJYA 3WD2A 3CZKA 3VCNA 1GPWA 2Y5JA 4OFCA 1EJ7L 3OEHG 2GYIA 4JTRA 3MCNA 1RPXA 1VYSX 4OBTA 1VPXA 3TTQA 3GW3A 2WNQA 3WF2A 1E4LA 2V3FA 4FLOA 3VIKA 1O66A 3CWHA 3M0ZA 4RZ6A 3BTNA 3ATZA 3VNJA 2CZFA 3WH8A 2H90A 4YYFA 1C7SA 4RDYA 2ACSA 3W7DA 4PMXA 3T0TA 5I77A 3LCXA 3QTGA 4FO4A 1EX5A 3DGBA 4GCAA 3WEOA 2YBTA 3VD4A 5CGTA 2D2JA 2ZC1A 3VZYA 1QPRA 1DWFM 3A3XA 2VDIA 1VEPA 1FRBA 3F2CA 3R12A 3SCTA 3WMCA 3KX6A 3TYCA 1A53A 3WH9A 4QX4A 3CAWA 1W9BM 5M3WA 1KFEA 3BURA 5M03A 3KS5A 3VOFA 4MWAB 5E0FA 4O1FA 3SDOA 2D23A 1A5SA 4PUDA 1L6YA 4DBSA 1R86A 1OGBA 1BYDA 1UP2A 4P61A 1NDVA 3ABQA 4O4VA 3OU8A 2RAGA 4J2MA 4Q8OA 4DZAA 3SUWA 3WDPP 3CQHA 1R46A 4IH3A 4NAEA 4CKQA 3QC3A 3S1XA 1XRTA 2F2HA 1PEZA 2NV2A 2ZE0A 1VYPX 2OMAA 2PRHA 3AXMA 5FJOA 4U33A 4BJHA 2ZXDA 2OG9A 2HE8A 5ECUA 2EG7A 1F5ZA 1IWAA 1WB0A 4GQRA 1K4HA 2ZUUA 1LYXA 1UMYA 2QJGA 3R6IA 3NO1A 1RJRA 3GVQA 1PHQA 1VB9A 3BSHA 5SWUA 3O06A 1XIIA 1OGSA 4EF8A 4UOZA 2RDWA 3WLQA 1TB3A 3AHYA 2TODA 3K8LA 3EOOA 1VPQA 4W85A 2OYLA 4UB9A 5AYXA 3OGRA 3LENA 4J5NA 2W9MA 4K7VA 1JGIA 1EXBA 1EB3A 2FQIA 1G9HA 5A6JA 3W4RA 2EEXA 4ZOBA 1OF6A 1TTJA 2VX5A 1TPWA 4IMFA 2QNEA 4J3TA 4PSRA 1W1ZA 1DE5A 1KO0A 3MYPA 4Z2GA 2FZMA 4B5XA 3DFHA 4J3VA 4WDTA 4TQTA 4Z1AA 4NXSA 3NPWA 2DZAA 3NL2A 3GB6A 2C71A 4IMAA 4FI4A 1UD4A 1H1YA 3OPSA 2E68A 4M24A 3ZMRA 4TVCA 3H6OA 1YQ2A 2BY3A 1JXKA 3N2MA 3NZQA 2A3BA 1QDSA 1UASA 1XIBA 1W32A 4D1IA 1A5NC 3RRXA 4OUEA 3ONCA 5D2WA 1B0IA 1H2JA 4ZTXA 3EWWA 4LV9A 4D6CA 4HPGA 3PBGA 1FKWA 3O3RA 3F4VA 3PUGA 3GQYA 1XLJA 1JIBA 4WXZA 3ITGA 3S6DA 2VVSA 2FHCA 5CC3A 4IUGA 3G1DA 1DYSA 2DUZA 3ANVA 3APTA 3LBOA 3N12A 3SCNA 3W7IA 2VZUA 1NDWA 3WLRA 3UPMA 5ECVA 2E77A 1Y7VA 3RHGA 2CBIA 1OCJA 2HCVA 1TSIA 3W1XA 1KTBA 3GG7A 4HNUA 3LD5A 4RV8A 1LUCA 3OBEA 1AA1B 5FKYA 4ACZA 3E1F1 3VNIA 1HL2A 1Q6CA 4CQDA 2PDPA 1N82A 3U2ZA 4LAUA 1WOAA 4K3ZA 2PTDA 1TWIA 2OWXA 4LCSA 2E9MA 1UW9A 3AISA 3PR2A 3WNLA 4B2DA 2WMHA 3IJ7A 2Z1BA 3KM8A 2Q71A 1DORA 4AQLA 4ZZ9A 1HIZA 4QCFA 1AVAA 2PP3A 4NAEB 4W8BA 1JZ7A 1HN1A 4ZOEA 4Q4PA 2ZZ3A 3N34A 7REQA 3WBWA 2VMFA 1FWFC 4MWAD 3PZNA 2ZX7A 5EBAA 4M7SA 1RQHA 1S46A 1HVXA 4UQEA 3GNNA 2J7HA 1FDZA 4LVFA 8XIMA 5C9XA 3W2MA 1DJZA 4QBXA 4GISA 5I79A 1FDJA 2GK1A 1R3QA 2EPLX 4KH2A 5LZLA 4FX7A 3L68A 1L6SA 1YXYA 4F9DA 4IGSA 1W1VA 3SFWA 2PWEA 2B81A 3H21A 3G1FA 3I6EA 4H6EA 3UERA 3PNUA 1RCOB 4LB4A 1X97A 4JR5A 2X2GA 3M5VA 3FNDA 1RZMA 2OQHA 1E71M 2R8WA 2WVVB 3OZPA 2FVLA 1A4LA 4QEEA 4H8VA 4H9XA 5FEZA 4MNKA 3W6LA 3BAYA 4ZQMA 2W27A 4H7ZA 1IIHA 3W71A 4OVXA 5JVLA