4HYWA

Pyruvate kinase (pyk) from trypanosoma brucei in the presence of magnesium and f26bp
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
498
structure length
496
Chain Sequence
b'SQLEHNIGLSIFEPVAKHRANRIVCTIGPSTQSVEALKNLMKSGMSVARMNFSHGSHEYHQTTINNVRAAAAELGLHIGIALDTKGPEIRTGLFGEVSFAPGDIVCVTTDPAYEKVGTKEKFYIDYPQLTNAVRPGGSIYVDDGVMTLRVVSKEDDRTLKCHVNNHHRLTDRRGINLPGCEVDLPAVSEKDRKDLEFGVAQGVDMIFASFIRTAEQVREVRAALGEKGKDILIISKIENHQGVQNIDSIIEASNGIMVARGDLGVEIPAEKVCVAQMCIISKCNVVGKPVICATQMLESMTSNPRPTRAEVSDVANAVLNGADCVMLSGETAKGKYPNEVVQYMARICVEAQSATHDTVMFNSIKNLQKIPMCPEEAVCSSAVASAFEVQAKAMLVLSNTGRSARLISKYRPNCPIICVTTRLQTCRQLNVTRSVVSVFYDAAKSGEDKDKEKRVKLGLDFAKKEKYASTGDVVVVVHADHSVKGYPNQTRLIYLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyruvate kinase 1
molecule tags Transferase
source organism Trypanosoma brucei brucei
publication title `In crystallo' substrate binding triggers major domain movements and reveals magnesium as a co-activator of Trypanosoma brucei pyruvate kinase.
pubmed doi rcsb
total genus 182
structure length 496
sequence length 498
chains with identical sequence B
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4hywA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 4hywA01
1F8MA 1VBHA 3EOOA 4QGCA 1U5HA 4HYWA 1S2UA 4KCWA 3R4IA 4B2DA 2QIWA 3GG8A 3M0KA 4FXFA 4YNGA 3VAVA 4KCVA 1M1BA 1PKLA 4KCUA 3SRDA 2KX9A 3I4EA 4QG9A 2VGGA 2VGIA 3SRFA 1O5QA 1A5UA 1A3XA 2XZ7A 3LYEA 2E28A 3FA3A 3QTGA 4B5TA 3EOEA 2HJPA 1O68A 1A49A 3GR4A 3M0JA 4B5XA 1KBLA 3KHDA 1OQFA 3EOLA 4L80A 1F61A 4TV6A 4ROQA 3T0TA 2VWSA 3GQYA 4MG4A 1T5AA 4KCTA 3N25A 1SGJA 4YJ5A 1S2WA 3BJTA 3G2GA 1DXFA 1IGWA 4LSBA 2XZ9A 4KRZA 3B8IA 2R82A 1T57A 3E0VA 3QV6A 1UJQA 1M3UA 2VGBA 2HROA 3BJFA 3IS4A 2V5JA 3PUGA 3QZ6A 4B5VA 1U5VA 1F3WA 2G50A 4QG8A 4IP7A 2HWGA 2ZE3A 1AQFA 3PP7A 1DIKA 3QV7A 1S2TA 1E0UA 4RPPA 2WQDA 3EZ4A 4B2DD 2DUAA 1DXEA 3MA8A 4IMAA 1F8IA 1MUMA 1O66A 4TV5A 3E5BA 1GGOA 1Z6KA 2HRWA 2XDFA 4DRSA 5TAOA 1VP8A 2VWTA 4IQDA 3HQNA 2V5KA 3OYXA 1PKNA 3OQ8A 4FXJA 4L7ZA 2L5HA 3T07A 4B5WA 3LG3A 3FA4A 4WJ8A 1PYMA 1XG4A 4HYVA 4IQEA 2BG5A 3SRKA 4B5SA 1KC7A 4L9ZA 4MF4A 2OLSA 4L9YA 3QLLA 2DIKA 1PKMA 3HQPA 3E0WA 4B5UA 3T05A 3QV8A 5JVLA 3QQWA 4KS0A 3HQOA 1ZJHA 2X0SA 3SRHA 4JPGA 1OY0A 1A3WA 1JDEA 3KTXA 3U2ZA 4QG6A 1IZCA 3P0XA 4G1NA 1XG3A 3H6OA 1S2VA 3OYZA 1ZLPA 3ME3A 1PKYA 2VGFA 1VBGA 1F3XA 3QV9A 1E0TA 1DQUA
chains in the Genus database with same CATH superfamily
4FIRA 3LMYA 3SUUA 2YCKX 1T0OA 1H7OA 2HBVA 4R9OA 4LAKA 4PE8A 4UTLA 2XIOA 1TJ1A 1Q66A 3TW7A 1AW1A 5M1TA 1JAEA 1CX9A 1KTNA 2BXVA 1HVQA 1A50A 2J9ZA 3ZWSA 4LYRA 1FWTA 4WX2A 2VM8A 1JI2A 1P43A 1QPRA 3DHUA 3LGDA 4Y2WA 4GYKA 2XN1A 5BZAA 4FOKA 2OQLA 3VZYA 3TH6A 3QKEA 2A4AA 4S3JA 4H7VA 3WQVA 5KSWA 4H7CA 4NX0A 2EKGA 5A94A 5DBTA 3CQJA 1RCOB 1OK4A 1E55A 5LA2A 3CHEA 3CB8A 1JZ5A 1FH7A 4Z42C 2NQ5A 4XIAA 3OGSA 3H23A 3J7HA 2X2GA 3PFMA 3OG3A 1JYNA 1U22A 3PUEA 2VFHA 4ZQMA 2A3AA 3QLDA 1US3A 1XH1A 2VDIA 3BO9A 5FJJA 3MT1A 2IS7A 2Y1HA 4W8AA 2V8ZA 4I5UA 4GK8A 1VS1A 4Y9AA 1YTEA 4UTWC 3MJMA 1TO3A 1P0KA 1TQXA 2NWSA 1UPPA 2AAAA 4ILSA 4NI8A 4HT3A 3OLIA 2FIQA 1XCXA 3PHAA 1E6PA 1XQKA 4WUIA 1SSDA 1VPYA 2O7SA 2VR5A 1OABA 3TQKA 1A5LC 4TTUA 1PKLA 3ARPA 5A8GA 3Q94A 3W70A 1G4SA 3L4ZA 3BSMA 5EFFA 4WY0F 1OWQA 2VQTA 3TTQA 5D30A 3P5ZA 1R86A 4MZYA 4B4HA 4F9JA 1PVNA 2ONEA 3K13A 4LB3A 3WQGA 3SCOA 3ZOAA 5IRPA 1H4PA 1T5AA 4DPQA 4PRRA 3MY9A 3CEPA 4ERGA 1UD8A 3QHMA 4IFKA 2WSKA 3UETA 3Q65A 5DEZA 1DJWA 4LUTA 1M53A 4U33A 3TYEA 3THUA 2J47A 1P0BA 1J11A 5E6ZA 3MI2A 1UC5A 3CV2A 4UTKA 1EEPA 1DXEA 2QJNA 1ONEA 1BVZA 3N2MA 4KERA 5EPDA 1CGVA 5A8OA 3KTCA 5FJOA 4U2ZA 4Y9PA 4HYVA 2BOEX 3WLRA 2X16A 3A9IA 1FWFC 2JKEA 4PUEA 3RILA 1QO2A 2PTZA 4ZXOA 2BGNE 1ZJHA 3H4GA 1IWAA 2E40A 3RLUA 3IAQA 4K3ZA 4LBUA 3WJYA 3E2SA 2ZIDA 1BAGA 3HF3A 3RN6A 5BOEA 1V6WA 1H0IA 2WHMA 2DSKA 2YZ5A 2QLYA 3MTWA 2BFGA 3AIVA 4LEQA 1GVIA 4BI7A 1GVEA 1I2PA 4E2OA 1XIGA 4DWDA 4UIOA 1CLXA 3VDCA 4O10A 1E1CA 1Q6RA 1O60A 2PRHA 1M7PA 3WG6A 2VTFA 1W2PA 4G8TA 5FJPA 5BYWA 2ISDA 1JPIA 2YOCA 3N3MA 1I8JA 1GZ1A 1B30A 1WZMA 3EYPA 3W82A 4LV9A 5L9FA 3MU7A 6XIAA 4E6MA 1W2VA 2J4GA 3ARUA 1DJIA 3WBXA 3FA5A 2Y0FA 4RE3A 3PF3A 3QSTA 3GC4A 4YYFA 4L61A 5C2GA 1Q3NA 1FKWA 1XKJA 4LVDA 4LCSA 3GNPA 4B90A 1SMAA 3FEQA 1HO1A 1QNOA 4NILA 4GQBA 2JE8A 2JJ2G 3ATZA 4XUYA 4S1FA 1MVYA 1PUDA 3HA1A 1WZAA 3BOLA 1H3GA 1E3ZA 2G95A 4OBTA 1E72M 2Z6IA 1YPFA 4UOQA 1DWGM 4V15A 4IPLA 4WDWA 1TIMA 1JDEA 1QK2A 1SW7A 4ZGYA 1W37A 4YHGA 1PYFA 2F8QA 3P81A 3O8AA 3W25A 4H9VA 1AA1B 2F6UA 2YGYA 5A6SA 1XYFA 2PDKA 3LUTA 2QUUA 4IGHA 3URBA 1O94A 4D1JA 1O5RA 3KP1A 4DYKA 3DBNA 3KL5A 1L6SA 3OEHG 4PTNA 5FA5A 3EWUA 4HD5A 3SM0A 1LG2A 2E6YA 4CVWA 4G56A 1YXDA 3GVGA 4GXMA 4CQBA 4QE1A 5CSUA 5D9NA 4QLKA 2UZ9A 5JH2A 3PTKA 1IT0A 4Q4KA 4R27A 2DT1A 4OT7A 3W6MA 5A95A 1OVDA 2OOGA 1OIMA 5FACA 3BE7A 3T09A 1KTCA 4KF1A 2H90A 4R33A 3CYJA 1XIMA 5A6AA 3HPSA 3LBCA 1VRDA 2XGIA 2WYSA 1LUCA 2BODX 3AZSA 4Q8MA 4UQCA 3RX4A 5HPOA 3AIUA 4DQWA 4UFHA 1SM9A 4Z2GA 4OOZA 2E9LA 3QV8A 1W5NA 2YLAA 1WNOA 1SZFA 2ZUNA 2NUYA 3NFUA 1BYBA 1LLZA 1LP6A 3GNXA 3PNZA 3S6DA 5C54A 4UFIA 2C1GA 5FL7G 4I6KA 1ZY9A 4H04A 3G6MA 4GCXA 3C2YA 1UB3A 4HNCA 1E6NA 1E0WA 2WSYA 3RFAA 3UVIA 1NFGA 4XG1A 3VK5A 3W73A 4O1FA 4XIMA 4L4LA 4HPXA 1FA2A 1SZRA 1LCOA 4HMEA 4UC5A 4CQ9A 5XIMA 5LGZA 2PMQA 3RMJA 1UD6A 1WX0A 2OR2A 1IXQA 3S9YA 2VFFA 3WK2A 3R6IA 1DXFA 3W1RA 1OFOA 3NM1A 3KRZA 1TCMA 1F5ZA 2PWDA 4WEVX 4NRRA 4XQ6A 2OEKA 4C90A 2GQAA 2PP3A 2QVHA 8TIMA 3F4NA 4IP5A 3VNYA 2ZA2A 1GYNA 1FKXA 3G3MA 3NOEA 3HV8A 4A05A 4XVEA 4L5ZA 1GORA 4JEQA 4AVFA 1FS0G 1UD4A 1PB0A 4TXEA 3UYCA 2H9AA 4PMZA 2HS6A 4C7GA 3KX6A 4IUOA 3OP2A 1HL8A 1SFTA 2ON3A 3CBWA 2HE8A 4B16A 1JCNA 1JZ7A 1OY0A 2Z1VA 1SYTA 5G1YA 1X97A 2PWUA 3OYZA 2BY1A 3VNLA 5CPMA 4AWUA 1XLJA 3C61A 1V8EA 1KGUA 2FGLA 4J9JA 3M47A 3ITYA 5REQA 7ENLA 4I8DA 4DELA 4GJIA 1GPWA 2EPLX 3FDKA 4KWOA 3B9EA 3GU9A 2X0YA 1EUAA 3BQ6A 4MWAE 3QY6A 3VFCA 1A0CA 1KNWA 2GGJA 5A5WA 3ZO9A 1XD0A 4KEUA 1EGVA 3UZWA 4N02A 4UTTA 3V36A 4LAUA 3NL2A 3LTSA 2NT1A 2PD9A 3ATYA 2ASHA 2ZZ5A 2F6KA 1RHCA 4F0LA 2PA6A 2VGBA 1AUSL 1L0PA 4C6IA 1Z44A 4NUWA 3BWWA 1IXPA 2RDWA 1SO6A 2PLMA 3PFRA 1WDDA 4TT3G 3IVTA 2X1IA 1JGIA 1PKNA 4Z2KA 5KZDA 4WJ8A 3KAOA 3LHWA 3R5EA 2FPTA 3ZFHA 2WCSA 3EPMA 2Y63A 2ZVRA 1XH0A 4L6HA 4M8UA 4J27A 4Q4OA 3RMEA 4MY1A 4GYJA 1Y65A 3P0XA 2QT3A 4DJFC 3WFAA 3MB9A 2VEPA 5D09A 3QV9A 2V5LA 2V67A 3S1VA 3UF9A 1P48A 4EPEC 3TUUA 5JUVA 3L9CA 4PSPA 3VOGA 1EJ7L 4AUBA 2PDBA 2YJQA 3I4EA 3SUTA 3FN9A 4A35A 3EEGA 1N55A 4LY4A 3VX0A 4UTFA 1RVKA 3O05A 4AZHA 1E6XM 1ZBVA 2D0GA 1AK5A 3POCA 1M03A 1WKFA 2DUXA 1VEOA 5I03A 2Y88A 3QH2A 4JFSA 5KZEA 1RAKA 3VNMA 1XINA 2VQUA 3IIPA 4MGGA 3C2RA 5K9CA 2DP3A 4H1ZA 4XKYA 3WH7A 3EA1A 3VFLA 5FCZA 1VBRA 1KFLA 4MY8A 3NG3A 3BLEA 1JNDA 4S23A 1QBAA 5GNZA 2YBUA 3B8SA 2WZTA 1IWBA 1KQYA 3B8WA 2PP0A 2I9EA 3O0FA 4DI8A 1B54A 2J7BA 2OWWA 2H8XA 3DKLA 5HMFA 3DXIA 3E9AA 2ZZ6A 2VZUA 4O15A 4TUFA 1E1FA 4UBPC 4HP5A 1H7PA 4XZ9A 4GGBA 4A29A 3UGRA 4JCMA 1BYCA 3NPWA 4MADA 1S2VA 1I6NA 3SN1A 1WBJA 4XD3A 1V6VA 3WUBA 2NVAA 1NDYA 1S39A 1I2OA 3C0JA 5CPLA 1KCLA 2V2HA 2VC5A 3CPUA 4A8LA 2POZA 1LG1A 3ES7A 2VRKA 1A49A 2KZHA 3KS6A 4R7OA 1LQAA 2EPNA 4BWLC 4F48A 1XUUA 3CL8A 4K6AA 1UZDA 3ZSTA 2R1MA 1VYPX 3O1NA 2R82A 1J0YA 4E5TA 1LUCB 5AC6A 1UR2A 1CTNA 2CBIA 3V18A 3HMCA 1TWSA 1X6LA 1BGGA 1UR3M 3AXKA 1GOIA 4UTMA 1TSIA 3MSYA 4HMCA 5AVNA 4NI3A 3V3WA 4URIA 2UWFA 2B7QA 5TD4A 3AMLA 5AZ1A 3E0FA 3QMSA 4LAOA 3GVRA 4AY8A 2OZ3A 1CXFA 3EA2A 3L4UA 2ZXAA 2WB5A 3L65A 3FY1A 3UJ2A 2I1OA 4S2CA 2F9RA 4FZIA 5DXYA 3TMQA 3WX7A 5DCEA 3K8LA 5ABEA 2ZE0A 1T99A 3AHTA 1YNYA 4EX4A 3BW4A 1XLLA 4Q7NA 4F0MA 3D3AA 1KV5A 4PEEA 2D73A 2G3NA 1JXJA 5EY5A 3WNMA 4PBEA 2OODA 4N4PA 2D24A 2W79A 1GJPA 1DQUA 2D2GA 3GS6A 2OLHA 3GXPA 4NZFA 2B31A 1BGAA 3A4XA 1W3KA 5IBXC 1G7UA 3AI0A 3FVMA 1A5UA 4LS1A 1TIWA 3QTGA 1W3LA 1KGWA 3QR0A 2AGKA 4PL1A 4RKAA 4AZCB 3T1GA 3UXLA 3L0KA 4L4OA 1DBTA 3BJTA 3QJAA 3CWOX 4TIMA 2FTPA 2JKPA 4YPJA 3O15A 2J9YA 2AMXA 2HROA 1JEZA 4H9MA 4DXVA 5CH9A 2BXYA 4QHRA 5D9OA 3GVWA 4BF9A 3WJZA 1AQFA 2WC4A 3GNDA 3TNBA 1ITXA 2H9AB 3RM8A 3CASA 4B2DD 1E15A 1ZSXA 5HWMA 4C6OA 5DMMA 3XINA 1R7AA 3LM3A 1W3IA 4O57A 5I78A 3VM7A 3UBPC 4X60A 3UG8A 2Z7GA 4XD6A 5H6HA 5E09A 1Q4NX 6A3HA 1MRAA 5AHIA 5HK4A 5JH1A 4IX2A 4IGSA 1XIFA 3MC5A 3GSMA 4JQAA 1NJJA 4GZIA 3BG5A 4B3KA 1JZ8A 2B7NA 5I07A 3PULA 4LXFA 3WUGA 2VVSA 1KRAC 2WBKA 2QW5A 2VGFA 2WSPA 1Q6EA 3F2BA 5A2AA 2YXXA 4MVAA 1UKTA 4PCFA 4H9XA 1W1IE 4N4QA 1EX5A 2XN2A 1MZHA 1UG6A 3LLFA 3TFXA 1A3XA 4U5IA 5L6UA 3WQCA 1HGWA 3TA9A 4KEVA 1POKA 3THAA 1LOLA 3ANYA 1NQ6A 1R2TA 3T0CA 4GNKB 2CHOA 1FFRA 3N3TA 5D33A 3N2XA 4NNBA 3NO1A 1B3VA 4K1WA 2YB4A 2C15A 2VFIA 2YYUA 2W63A 2OYKA 3W7OA 3L12A 4NF7A 3PP7A 3EXSA 3KWSA 2GVYA 3DGBA 3R25A 1TPC1 1J12A 2VOMA 2WMIA 3E5BA 1PPIA 1VFFA 3F5LA 4AQLA 2JIWA 3QEZA 4E4PA 4K68A 4DUWA 4Q33A 3DZ1A 2ZOXA 4GYFA 2X8RA 1N7KA 2GJLA 3SURA 1H49A 4H8NA 2QJHA 1CW2A 1ZBWA 2C6QA 1J96A 2YDAA 3ECQA 4MNJA 4MJ2A 1QHPA 5HWJA 1K9FA 2HNHA 1QOPA 2ISSA 3R12A 5GVJA 4C6EA 3HJZA 3MMTA 1KKOA 2DSZA 3LLXA 3L5AA 4W88A 4JNZA 4ENLA 1JZ3A 1GQLA 1OFDA 3RIKA 2NV9A 3EWDA 2Y61A 2JALA 1B5TA 1JZ6A 4UQBA 5KETA 3PZMA 1MXSA 4MDPA 1TV5A 4ADSA 4V2XA 1R9YA 1EBHA 2QGYA 5LA1A 2VOTA 1RSCA 3FDGA 4P7RA 4PMVA 3W1MA 4KFOA 1XDMA 3HOJA 2BV9A 5G2IA 4HNTA 3KE0A 2A3EA 2OVLA 2J6XA 6TIMA 1XH2A 3G1RA 5FEWA 4W5ZA 4CD6A 4DJEA 4AB4A 3EOSA 5CC5A 5KITA 3DYPA 3HG2A 3EWWA 1GJWA 1SW3A 2VDHA 2XFYA 1LJYA 3DG6A 2BY3A 1OF6A 3DHPA 3BARA 2OG9A 2OO0A 1X1NA 3N34A 2DT0A 2V81A 3GRIA 2ZTKA 4PB3A 4RDYA 2QMJA 4GVFA 2CPUA 3ARYA 2JDIG 3LV6A 3ITLA 3R58A 3NTYA 2ZUWA 2OYLA 3W7EA 4QFUA 4DO7A 3EXTA 4JCLA 2O9OA 1I2NA 4Q7IA 4N9DA 4LVGA 3OLEA 1AVAA 1OCJA 4M19A 3W22A 2I57A 4RLIA 1O5QA 1FWBC 3OZOA 1VFMA 4NNCA 4I9MA 1KM6A 2WM0A 4J40A 2W6IG 1SU5A 3OIHA 1KBLA 1XBYA 4GG9A 2OXNA 1G0CA 1E4LA 1YTKA 1PXGA 1YDVA 2QCLA 5ENLA 2UY5A 4KGLA 3GXFA 3SN0A 2GZXA 1TZ7A 4NZ5A 5HWNA 1TREA 3R1ZA 3KVKA 3PC0A 2WVTA 2ZZ4A 2LLEA 4JNMA 4D6IA 1EC9A 1E40A 1BTCA 1DYSA 3GG0A 2WCAA 3TW6A 4GX8A 3IIZA 1AW5A 1KC7A 5A8PA 2ALRA 3B03A 1FRBA 1TPWA 4GUFA 4TX8A 3LU2A 1C9DA 5I02A 1GTHA 1G4EA 3L21A 4S3DA 2YCEA 2CXEA 4DO6A 4RW3A 1UASA 2VR4A 2YFOA 3OA5A 3TDFA 5LIUX 1A5CA 2ZADA 1VLIA 3KVLA 3VDAA 2F38A 2VD8A 2V38A 3GD6A 2I9UA 4LU0A 4Y96A 2FZNA 3N12A 2XH7A 2GJNA 4PBFA 1E4IA 1UUQA 2I5IA 3LXBA 5GQBA 3SQSA 3WQ5A 3WQ4A 4IM4A 4GI8A 4YVVA 4ML4A 3ALFA 3GNRA 3ITXA 4CQAA 4YTTA 3W2KA 4E4UA 1EWDA 3W86A 4RW5A 4CUCA 1QUMA 3VGGA 1PO9A 3WNLA 2QPSA 1K8CA 3CZEA 3DFOA 4OJYA 3CL6A 3BMWA 4AHOA 1P0DA 2EAWA 4TVCA 1R9XA 1ADOA 2PAJA 4CQDA 2GJRA 1CI1A 2DH3A 4O13A 2A79A 2V3DA 5CJMA 4LPCA 2X1SA 1Q13A 1GJUA 4J2MA 3BAJA 3W87A 1XSJA 4HNLA 4AG0A 1ZU8A 1C90A 3NQAA 2OB3A 4RZBA 1XQLA 1LTDA 1T41A 1DQXA 2Q8ZA 3A64A 3A3WA 4HSHA 1H5YA 3WF4A 4DVOA 3PJTA 1P0NA 2JK2A 2A85A 4OBSA 4C6LA 3O9NA 1EUNA 1WV2A 1Q6OA 4ZOCA 2O9RA 3QHNA 1FFQA 1X8FA 3KBJA 1TV8A 1EQCA 4IISA 1MYRA 2PODA 4FR1A 3B0UX 2NLYA 1ISWA 1YRRA 1RZMA 1X7IA 1KFKA 4D8AA 1E0TA 3PBYA 5K9XA 3NURA 4DO5A 5TF0A 1W3NA 3WIJA 1T7LA 2WQPA 2ZDSA 2Y8KA 2PLKA 3BMXA 2BNJA 2H3DA 3FOKA 2Q6ZA 3B9OA 4PCPA 4EXBA 4Z1CA 2PDFA 1VKFA 3S2NA 1Q6QA 3FA3A 4DJFD 5XIAA 1R85A 3KCJA 2BOGX 3PBWA 3AROA 4JBRA 2MANA 1RA5A 1I0BA 1DXIA 5HNUA 1KKRA 4N9EA 3N2OA 3M43A 5DQPA 3ZJ6A 3TYCA 1E3XA 1E73M 2ZRZA 1W1VA 2FPYA 3B3DA 4WD0A 2XHYA 1YDOA 4GNJA 2Z2UA 3WL0A 3N2TA 2ATMA 1G01A 3AIEA 1XXXA 1BHGA 3EWZA 5AHMA 4HYRA 4XZBA 3RU6A 4XZMX 4MKSA 1O66A 3W38A 4L1GA 1G5AA 3E96A 3I68A 5I3HA 4NJGA 4HSNA 9CGTA 1WQ5A 4HPGA 5AOUA 3I4KA 4NG3A 3VOFA 3KOZA 2QV4A 1TCDA 1GVOA 1JD9A 2GWNA 4HOZA 5JVLA 1XFCA 3S5ZA 4DUOA 3ZIAG 4K1GA 3FSUA 1TJ0A 2R6OA 4IFOA 3DBPA 3ZS4A 3GYEA 2P8CA 4NXKA 3LA4A 4FNSA 5FAJA 2BHZA 4KIRA 3T0BA 3TKFA 4G1KA 2D3NA 4U2YA 4GIRA 4BA0A 1TE1A 3VGBA 3T55A 4DBUA 5H91A 1EDGA 3BLFA 1NWUA 3AYSA 4GYPA 1O12A 4GFSA 3UU0A 3W74A 5F4SA 1A5NC 1HVXA 2YL8A 4MY9A 1W5QA 5C9ZA 5AC5A 2VWSA 1J10A 5DT5A 3S2JA 1CB7B 3M0HA 4HMNA 3VMOA 2E8YA 1IGWA 3AYTA 2XZ9A 4GABA 2YDRA 5ABFA 4AFYA 1MUCA 3TYAA 4EAMA 1Q7ZA 4PH6A 3HGOA 3TEVA 4HPHA 5FESA 3H2FA 3TOPA 5CC3A 1FWCC 3QF0A 3CL7A 4Z1BA 3B0XA 5IFTA 5HATA 2E25A 3WK1A 1F2JA 3VYLA 3MDUA 3BLIA 3QC0A 3C0SA 4RR4A 1A4MA 2DDXA 1S1PA 4O18A 1VPQA 1QK0A 3GB6A 1P6WA 3AXHA 1BD0A 5HA7A 4MF4A 1WBHA 4DLFA 2VKZG 4H6QA 1WDRA 3P74A 1W31A 3BG3A 3M44A 2RJGA 1VEMA 1TMQA 5F2MA 2C1IA 4GY1A 4PEKA 5A6BA 1DJGA 3V16A 2EF9A 4C5YA 4J5NA 2ZX5A 3GKFA 2A2IA 4JL1A 1IE7C 5CKSA 1RR2A 2PDNA 4L65A 4LF1A 3QTPA 3WF3A 4GUGA 1VCFA 3W3OA 3VKDA 1GHRA 1PX4A 4AIUA 4D6FA 2ZRWA 1M1BA 4XZHA 3JW7A 1VB9A 4EOUA 1UZHA 1MQPA 2ODOA 1YEYA 4GQRA 4PTWA 1KXVA 3MSRA 5ABFB 1AQ0A 1VF8A 3WJSA 2ZZ1A 1UD2A 4X2PA 4A22A 3N6HA 4PCNA 2PLJA 4YWSA 1QASA 3SB0A 3U2OA 1L6YA 3E0IA 3IIVA 3GC5A 3S46A 1C8XA 1ISXA 4GQ0A 1OFPA 4E2BA 4NASA 4ZQCA 5A6KA 3VKAA 6ALDA 2E67A 4K7YA 2C14A 2PDGA 4IF2A 1TB3A 3CYVA 1Z3NA 4ZQPA 1O5KA 4V33A 3MUXA 3WFLA 4L56A 3LRKA 2JEQA 3D46A 4ATWA 5ABHA 2WHJA 2BLEA 3QC3A 1CGUA 3O6AA 1VIWA 1TYGA 7TAAA 1TWWA 2PDLA 3FA4A 3QHOA 1V02E 4IIGA 4JTQA 1FWHC 4OUEA 1LL6A 3RJYA 5ABGA 2WC3A 2NX1A 1VPXA 4R34A 2J25A 3N6QA 2BHUA 4NP7A 5CBBA 1NWRA 4DBSA 4GLEA 2GSJA 4NX5A 1K77A 4ACZA 4CKQA 1EBGA 1XR2A 3BLOA 2FDMA 1TRIA 3S2MA 1V0NA 2RJHA 4AC7C 1KXHA 4YXGA 5LXEA 3T44A 3IIOA 3GW0A 4I6VA 5GPRA 4H9TA 1OGGA 1J01A 2OSXA 4LCQA 3LK6A 3WK3A 2AL2A 1SZEA 3I7SA 1EH9A 5DBUA 4EXAA 2NZLA 4RK8A 4D2JA 1R3YA 3IVUA 1KCXA 3P61A 1W5MA 2G3JA 4WVXA 4NL1A 4DUVA 3WH6A 1XSKA 4DX3A 3KWXA 2WVVA 4BQ5A 3N25A 2PDIA 3I3BA 2R8WA 2NQZA 4ICNA 2PTDA 3LD5A 4GXPA 2YXOA 4NU7A 3B8IA 1JJKA 2PU0A 5FSEC 4GBUA 3WNNA 3UZZA 1SZNA 1IIGA 1EO7A 2ZE3A 1RQBA 4WF7A 2X40A 2P1FA 2F2HA 4EPKA 4NZ3A 2OSWA 4W7UA 1H63A 4ZB5A 2E4TA 2NT0A 3BCJA 3MW7A 3SY5A 1RA0A 4B9ZA 1F9CA 1X1ZA 2P5NA 3HG5A 1GOOA 3SUVA 4JIHA 4FXJA 2FTWA 4QX4A 2VO5A 5M17A 4B5WA 4O8RA 4N6FA 4IT1A 3H2OA 1CPUA 3BOFA 4IGNA 1SJAA 2QIIA 3W7GA 1XG3A 4M82A 2AL2B 3IUHA 3UNDA 3UCQA 3MQTA 3LCXA 1MFVA 1JQXA 4Z1AA 3CUHA 1EJUC 3K1DA 4L1XA 2RGMA 3AYRA 1XIHA 4F66A 1GOKA 1CCWB 5AYYA 4UR8A 4LS2A 5H8MA 4C6JA 4B5TA 3EOEA 9XIAA 1M9HA 5HOSA 1CGXA 1U30A 4KIEA 1S3HA 3RX3A 3ARWA 3FX4A 2XN0A 1Q7MA 4JQ1A 4DAIA 3TLQA 1EOMA 4LSBA 1ICQA 1Y5XA 2OZ0A 3PWGA 2QR6A 4AD1A 4MPKA 5BMXA 2DEPA 4JTSA 2BY0A 2GVEA 4Q4MA 1PX3A 1KLZA 3TN5A 1GVFA 3OOQA 3U0HA 3HN3A 1WB0A 1YE6A 2INZA 3M0XA 2CHNA 2QCFA 3BLDA 1PSCA 4JEJA 1V08A 5DCDA 4FALA 1XG4A 4I90A 1J0HA 1CBGA 3MJYA 3OO2A 1Q7QA 4AD5A 4P5UA 2EJAA 1WDPA 3A12A 1W1B1 3IEBA 2WMHA 4R5EA 1VAHA 2FGBA 3H2NA 2G37A 3WF1A 1VP5A 1J0IA 1HUVA 5I06A 3HGSA 4GO9A 2B4GA 2HSAA 5DN6G 4F0HA 5C7VA 4H83A 3MPGA 2IQDA 3W24A 4YVXA 1GPFA 3AAMA 4Q7BA 3VNKA 1K6WA 3UWQA 2Q3OA 2I17A 3LPPA 4RUBA 4H6KA 1LL4A 1FCBA 2EXOA 2FZ9A 2KX9A 3EDJA 2INEA 3CQ0A 4JGDA 4M3PA 1OCBA 1H7NA 4DN1A 2FTYA 3L4VA 3M7SA 3WLOA 2W67A 5LIKX 2QJIA 1JYXA 4A8NA 3IJQA 3W88A 3MI6A 5CPNA 3XIMA 4HMDA 4XZWA 4MKNA 3RM4A 1QWKA 2R14A 1RY8A 5ABTA 3IS4A 1EHAA 2GVJA 5CZ0A 1US0A 1XV8A 1VC4A 2HLDG 4FNTA 2PF8A 1JCJA 1ONXA 3NL6A 2BBFA 4GH1A 2V63A 1K8XA 1EGZA 3NQCA 4ZOAA 1SQ7A 2B81A 4UFJA 4HCLA 4RXGA 5BRPA 3E12A 1X98A 4AMCA 2PZNA 4H3DA 2RKXA 3W27A 4DJDD 1KBKA 3MV01 4H6RA 1HKJA 3IJIA 2TPSA 4L9YA 5D4YA 5BROA 3LCHA 1OYAA 2DZXA 3DIPA 3NAVA 1WZKA 1JR1A 1G1YA 1XRSA 4HPNA 1VJSA 5CJNA 4PA8A 3D5HA 3AWOA 3ZR6A 1BVNP 1TTJA 3IK2A 4AWSA 2Y7GA 3LV5A 5HUOA 1ONRA 4WRHA 3MHFA 2NV1A 4NJIA 3B9DA 1E5NA 3MKKA 2BS9A 2D0HA 2CK3G 3A24A 5I3JA 1XI3A 3ITVA 2J62A 2C79A 2JF6A 2Y5JA 5HJXA 1M68A 3OHMB 1XLBA 1OZQA 4NAFA 4H2CA 3KBWA 3U5YA 3NPUA 3APTA 4HOXA 2OOFA 3USBA 2MNRA 1DWIM 3T0TA 3GTIA 4WY0B 5C9UA 3FIGA 1FDYA 1WUEA 2VELA 1Z42A 3EX4A 2ACSA 4U3CA 1A5AA 3EPNA 2V82A 4GIAA 3E0VA 3CIWA 3EBVA 3QV6A 1PHWA 2A7RA 2QAFA 5T9CE 3GG1A 4JDYA 5LSMA 3NQVA 2Z27A 5G5IA 2PGFA 3TROA 4MIMA 1YNQA 3HO8A 4JZ5A 1QWGA 4DNHA 5CG7A 3WDIA 1F8IA 1VD6A 3DX5A 3SCVA 1AJ0A 4E8DA 3DHFA 2V3EA 2FHBA 1WE5A 4ZQRA 3CAKA 2EBNA 1VHNA 2E0PA 3UPBA 3DFHA 1R2SA 4F2TA 1Q6FA 1HN1A 2PUZA 3WLQA 4D8ZA 2F2KA 1KA9F 1E1EA 3PPHA 1MI3A 4ACYA 2J24A 3S1GA 1UQYA 1ZBKA 1R3TA 2WPDG 3CM4A 4DB7A 1MQRA 1CECA 4IICA 4M81A 3WD0A 4GJ1A 3M5VA 5I7GA 4HTBA 4MAZA 5ECVA 3IRSA 1HKKA 2AQWA 4NJJA 4W8LA 1F3EA 3ITCA 4RDWA 1QTWA 3N4AA 4MWAA 4U3AA 2GPTA 2D20A 2OSYA 4E8GA 3GTNA 1NY1A 1I0DA 4KKXA 4UMCA 2BWGA 1XF0A 3AALA 3CUXA 4Z2IA 3CB3A 5C2XA 3F2DA 2WK2A 3W7KA 2VC9A 4GUHA 3KM8A 1CB2A 5IFPA 1DJNA 4DZAA 3G3DA 1SO3A 2ZCGA 3IACA 4ICMA 4JTJA 4HHLA 1C9WA 4UZUA 4AEEA 1H41A 1OF8A 2TMDA 1OYBA 3AHVA 3VD3A 1XLAA 4DY1A 2C19A 2HTMA 3H2MA 5FD0A 4WJXA 2WQDA 1S2CA 1WPCA 1YBQB 3EMQA 1KFBA 2EPMX 1TPUA 1PBGA 1AJZA 1X8CA 3NJ3A 4LAMA 3UT0A 1UKSA 1DORA 2Y70A 2CLKA 4DUXA 4QM1A 4JTTA 2D2OA 1DHPA 2ESCA 2YXGA 4KS0A 2G41A 3BG9A 3PZOA 1VH7A 5D8ZA 1FVPA 3M0YA 3VE7A 7TIMA 3PZNA 4RXFA 2E6FA 2O0TA 2OX4A 2WLYA 3IPWA 2QCHA 1XIBA 1KTBA 4DI9A 1UCWA 3DG7A 3QPYA 4YTUA 3LI0A 1RY0A 1SSGA 1UOKA 1UD3A 3RJXA 4XKMA 4QRNA 3P62A 3EMZA 4F2BA 3BICA 4F4RA 3VOJA 1UZ1A 1FWSA 3K4DA 3LENA 4TV6A 4PMDA 4Z08A 5A2CA 4GFIA 2DFAA 3RLHA 2CLPA 2IXVA 3PVFA 1YBQA 3TK7A 4NIRA 1ITQA 2WWDA 3JRKA 1KR0A 3BW2A 1QAPA 2GUBA 4WY0A 3TV8A 1NOUA 3O07A 4UTUA 1UR4A 4D8LA 4Z0SA 3CZGA 3M9YA 1V4YA 3MUZ1 3MZNA 2NWRA 1UMLA 3VIHA 4JY9A 3REQB 2PEVA 2WZIA 4ERAA 4D9PA 4NYYA 1UKPA 4OU1A 2GDVA 2AQOA 1G4TA 3DDMA 4ECLA 2Q02A 3UA4A 3ABXA 2ZZ7A 3TN3A 4A6GA 2VFEA 3BURA 3H7UA 3HFYA 1G4PA 3QQ1A 1GEQA 4OTKA 1FTXA 4S38A 3WQWA 3H8AA 3H24A 1U5HA 2PC8A 3M5YA 3T81A 1FH9A 1WAUA 2VJXA 8XIAA 5E70A 1B3WA 4D6GA 4GUJA 3BK0A 1P7TA 1XLDA 1AH0A 4DZIA 1V7YA 1K70A 3LYEA 1OM0A 3EWBX 2ABAA 1QU4A 5EU9A 2BOFX 4P61A 1YE4A 3U57A 4Z2HA 3NQDA 4OQVA 3NQ2A 4C60A 1XM3A 2NSOA 1M3UA 3S5SA 1W0JG 4HCHA 4HCDA 2GOKA 1OT1A 3MWCA 3C56A 4LUYA 3CLWA 3F4CA 4JIEA 1RALA 3VXGA 1D9EA 3QFEA 4TSFG 5CPTA 4GQGA 1PJ9A 1VP8A 2WJFA 1HP5A 2HV5A 2PF0A 1GYMA 2XPKA 1LOQA 1KFEA 5G2HA 2P50A 2GGHA 1OG0A 4EP8C 2Z2BA 1NF0A 2VCAA 4YLWA 3TX9A 3ZSSA 4HB7A 1QJWA 3HBLA 3GFYA 4XX6A 5LZLA 2EO7A 4PFMA 3MKVA 3QR3A 8XIMA 4S3CA 4AWTA 3I7RA 1QXLA 3U48A 4EAYA 5CPSA 2CLOA 3WKZA 4PMNA 1P7TB 4NAFB 1VFTA 3NGJA 3NOYA 4ZQOA 1TWIA 1OJXA 2V2CA 5C2CA 4PODA 2PDUA 4DF0A 5CBJA 4B2DA 2B7PA 3VMNA 4AEOA 2Z1BA 3CUJA 1GW1A 3T40A 4XAZA 2RGLA 5HINA 3DFNA 1GVYA 1ZS2A 1IF2A 2WZHA 4Y9OA 4KW2A 1L6WA 4WCJA 5HMEA 1JPKA 1V93A 2UY3A 4ICCX 4ZE5A 3GBEA 5A6TC 3TSMA 3GDMA 1RXOB 1EZ2A 4IH3A 4NHVA 1UP3A 2FYMA 4HSOA 2WBGA 3Q2DA 3UCDA 1JXKA 3GFZA 2QCEA 4PMQA 3SR7A 1EZWA 4PULA 3STPA 1N8FA 2WMFA 4C6QA 3HM7A 1LLOA 3E0LA 4H7ZA 2WJZA 5FL1A 2CBUA 3W1PA 1J0JA 1Q63A 4O0QA 1E6QM 4P2VA 1CEOA 5M3WA 1ZRQA 2GSHA 3STCA 1O7AA 3LG3A 4GNVA 4D6DA 4B5SA 2PWEA 1RPKA 5FEZA 2XWEA 2E1DA 5F2IA 3WQFA 4Q8VA 1A5KC 4WXZA 2V69A 3EX6A 4E0CA 1EQPA 4BCEA 5IXEA 4K2SA 1S2AA 3R10A 5DANA 3WUFA 3UERA 4KQNA 1AD4A 3VA8A 4PBGA 5E0CA 2ZRVA 1H61A 3WDPP 3BZGA 1GYLA 4AW7A 1YPXA 2R1PA 3FVDA 1YNPA 2BMBA 2ZA1A 1D7KA 4O1EA 2NLIA 1WKDA 2XM2A 3L68A 4W5UA 1W1ZA 2X1TA 4QITA 3TSDA 4MJZA 1V3MA 1XRTA 4O1AA 4R7WA 4QEEA 6TAAA 4H8UA 4BWLA 3AJ7A 1T40A 1H1ZA 2AAMA 1CLVA 2GGEA 3ERPA 3D0CA 4L80A 4PTMA 1U33A 1V5XA 2XFWA 3N2CA 5CGTA 1O6IA 1C8QA 3VGEA 2X05A 4DXXA 3TQ0A 1BF2A 2HWGA 3B4UA 2C71A 2WMGA 3SIZA 3WEOA 3OZMA 3NYDA 1ZJBA 1S2TA 2X30A 3GWQA 2IMRA 3W2NA 4AISA 4KGJA 3TA6A 3EWYA 3BLPX 4DRSA 3PZVA 3HU7A 3GH7A 4UNKA 1C8YA 4XTDA 3T07A 1BXBA 4HZ8A 3CGTA 4O17A 1GQJA 5FOOA 1ZJIA 3H54A 5BRQA 1M41A 1W1YA 8CGTA 2XH0A 3TXVA 2OU4A 4UQDA 4O11A 3LDVA 4UXDA 2EHHA 3U2ZA 1VIZA 4J28A 1XYAA 5DFAA 1I2RA 4JTEA 3S5OA 3O6DA 1FWDC 4KEZA 3GTXA 1BSIA 3T8LA 1PDYA 3GXTA 1ME9A 4FLSA 2CLEA 3WZ0E 4LRTA 5LYRA 3A23A 3L5MA 5CCZA 3UR8A 2Z4GA 3H2AA 2HEJA 3UG3A 1HZYA 3EKZA 3STGA 2YA0A 2CZ5A 4IPJA 4O1BA 1GCYA 4MUPA 1GNXA 4JXCA 3R94A 2RAGA 4MFDA 3R43A 3RO6A 1RP9A 1UUMA 1DJXA 4PL2A 1PTGA 4IXXA 1X6NA 1OFAA 3KXQA 2HK0A 3GXMA 1ZAHA 5AKQA 4QROA 4GGHA 5CGQA 3HGJA 4OE7A 1L6GA 4W7WA 4HHMA 1EL3A 4GWEA 1JCYA 1DJQA 5DCBA 3U9IA 4RDZA 3UXDA 4R88A 3L2MA 3WMBA 4QNWA 3PAOA 1UR0A 1U2YA 2H6RA 2FJUB 3CAVA 1TPH1 3GG7A 3R89A 5DLCA 1OC6A 3KVMA 3TC7A 1UH4A 2CZFA 2F7FA 1ICPA 1TUFA 3H2EA 2HXUA 3LHUA 2EG8A 2VI0A 2YR1A 3F4WA 2PRMA 2XSAA 2PZ0A 4XD5A 2ISWA 4DPPA 1SUXA 4PFHA 3TCSA 5AYBA 3IIXA 4G7EA 4DO4A 3ABOA 1E5JA 1RJPA 4RE2A 4UFLA 4CD8A 1H7RA 1VHCA 3W1AA 1V0MA 2X7VA 3PANA 3M5ZA 1XSIA 3TU9A 2DZPA 1EJXC 4Q8QA 1S5VA 5B7YA 1NAL1 1OQFA 2HNEA 1RCXB 3V5CA 3WNOA 3KLKA 1RJRA 2HS8A 2J8GA 3K46A 3TLLA 3UPMA 3T4CA 3DFQA 1FWRA 2DQXA 1WP6A 4M6UA 4JR5A 2ZZ2A 1Y8BA 1WYIA 3PTDA 5MKGB 3B8VA 1ZHAA 1R5YA 5H8UA 3UZYA 4IMAA 3W2MA 3IJ8A 3ITTA 4C6BA 4A8IA 2QF7A 3QOKA 5D05A 4GC4A 4Q6XA 1VR6A 4BF5A 4L9ZA 2ISVA 1B0IA 4NZ1A 3RPMA 3MKCA 1Q6DA 4TX6A 4CCDA 2KAUC 4QDPA 2ISFA 5LHFA 2DJXA 1LQ2A 3CXOA 3VKBA 3ES8A 4REQB 2FZMA 5CZTA 4BHYA 5J8LA 1MSSA 3DUGA 4E3VA 4NZCA 1EX1A 4LC6A 4MWAB 1R3SA 3HB9A 1GOWA 2XG9A 2GOUA 4EXQA 5I3IA 4IPPA 1CWYA 4DF2A 3GXNA 3AUOA 4LYQA 4QBXA 2CBVA 1L2QA 1EJSC 3OVQA 1WOAA 4KWSA 4H2HA 3VKJA 3G77A 3AC0A 1E9IA 4X22A 3UZJA 2FZ8A 3GR4A 2DH2A 5HJYA 4JN6A 3MSGA 3ANUA 4PTDA 3F5KA 3G8RA 4FNQA 3TJIA 1B9BA 4GZJA 5G4HC 3H4WA 1H7WA 1QNRA 4QQUA 3RPDA 3L5LA 3KLLA 3GR7A 4C1NA 2WVUA 4CNPA 3AOFA 4H8VA 4KBXA 3ZM8A 4EWJA 2REQA 4CNUA 1JUKA 4ZO7A 3RXZA 3VOIA 5EYWA 1HJVA 4GHRA 1L8PA 1UIPA 4EF9A 1NDVA 3GLCA 2RDUA 3WJWA 3W76A 3K4WA 3BPWA 2A21A 3TTYA 3O16A 3S1UA 1SZGA 2W92A 3ZR5A 2QPUA 3SRKA 4H19A 4AHQA 3GW3A 3TTEA 4RE4A 4Q8PA 4OBRA 3TXZA 3EA3A 4A3RA 1F4HA 4XB3A 3NPVA 4ZOBA 1MZRA 1IXOA 1OX4A 2OQHA 3OGVA 4NQ1A 1UWUA 4M5PA 3M0VA 3CV1A 2VXNA 3FHAA 3R7MA 3RM9A 1LT7A 5A6LA 3S6OA 3WBWA 1OEPA 4FX8A 3KL0A 3FXGA 4LV4A 3P8IA 3W7MA 3R4IA 1FCQA 1G67A 5E6YA 1WA3A 3NZQA 4KCVA 3SCSA 3UG4A 3TN6A 3SRDA 4P7LA 5J5RA 2YKKA 2VRQA 4H9ZA 4M1RA 2CNCA 2QDHA 5FF2A 3TYDA 1REQB 2I16A 5BXPA 2EPOA 3PPCA 5G1TA 3ID7A 1PZ2A 3BW3A 1SGJA 2WNNA 3N29A 3L0NA 4H9UA 3RITA 1HGYA 8RUCA 3CNYA 1QI2A 1JPHA 2A3BA 3UFYA 3AZTA 4PN2A 3OIXA 3LMZA 4KMQA 3EKGA 5D2VA 2ACUA 2PB1A 2ATSA 2XH4A 5BCAA 4HN4A 1LORA 1US2A 3EB4A 3VDHA 4O0ZA 1UKQA 4KESA 1J5TA 3EAUA 2PDWA 1SPQA 2ZX8A 5CAHA 3MMUA 4C91A 4EACA 5CGMA 2PDPA 2XVLA 2Y24A 3G6LA 2O92A 1RV8A 3LQGA 3HIJA 2WW5A 1SJDA 1EDQA 5GJMA 5H1WA 2GFTA 3ZJ8A 4X61A 1YW1A 1AG1O 1XBVA 2RHGA 4PTXA 5HXMA 3UA3A 3OGRA 5BW6A 4FS9A 1G94A 3B9AA 2ZZ3A 5D32A 1OZMA 5D03A 3S47A 1E9YB 4MAVA 3FGCB 4CQCA 3WELA 3EWXA 3G1SA 3EPOA 3CWNA 2NXGA 4BQ3A 3PAJA 3ZQ9A 3L4XA 4QSHA 4QXIA 3HQ1A 2ZXBA 1EF3A 2MUCA 5CSSA 2J6VA 2JBMA 2XJ7A 1DV7A 1T8XA 2GK1A 1K7XA 2ZBTA 1XDLA 1QT1A 3FKKA 2VEMA 5CLWA 2GDQA 2EPHA 3WL1A 1OADA 2NUWA 4C7DA 3ARZA 1R3RA 2BHYA 4HIBA 2Z29A 2PP1A 1HXJA 1DPMA 3LRMA 1Q5MA 2V6AA 3WMCA 4F0SA 1XFBA 2C0HA 1BVWA 2XIJA 4MJ4A 2NX9A 4QIUA 3V0UA 3CAQA 3TNOA 3VNZA 4MYAA 3CH0A 1R3WA 1IEXA 3TFCA 4M6VA 2OYMA 5CBIA 4LS0A 4CN1A 1WOBA 3K8MA 3LPGA 3UQNA 1I1WA 4GINA 4IZGA 2C18A 4WR3A 1XLMA 3K4AA 3FJNA 1C91A 4MJMA 2BVYA 4HJFA 1OSEA 2FVMA 3GDKA 4L4PA 3G1FA 1PAMA 3FGCA 4LNYA 3WDRA 1XIJA 3GDLA 1EO5A 1OGBA 4K8HA 1FHDA 2WHLA 3WH8A 4X3ZA 2G3FA 2DIEA 1V77A 5CG0A 4GZEA 4Y90A 1KM4A 1XP3A 1Y7VA 4XVDA 1S2UA 2WC7A 1TFVA 3LX9A 1SR0A 1DE6A 2WZEA 4GA8A 4O8AA 3UJEA 1GOXA 1F05A 4YHEA 1N82A 1PDZA 4WQ6A 4HN8A 5HQLA 1M6JA 4ATDA 4B92A 4WK9A 3AXXA 1TPDA 1GVSA 3NQ6A 3BV4A 1EB3A 1ZUAX 1UJPA 6CGTA 3MMDA 2XVGA 2PGWA 4HZ6A 4KRZA 3GK0A 2J88A 4QJ5B 4CN6A 4AF0B 1BXNA 3PUGA 3NQFA 4IX0A 3PZIA 4HGXA 4Y9NA 1V6UA 3RCMA 3EZ4A 3KOFA 2PDXA 3AO0A 2R1NA 1SMDA 2DVUA 3EDFA 4REQA 4KRTA 4ZOEA 3VI2A 3VGHA 3JU2A 3GVVA 3FAXA 4W4QA 4UQEA 3SY1A 5F2GA 2C0AA 4B5UA 3T8QA 3CUFA 4OGZA 3QPZA 4OVXA 3ZMRA 3MP4A 3W6YA 1OFRA 4FNUA 4U4MA 1HKMA 3LGEA 3NL3A 2X41A 5FJTA 2PFHA 5DN1A 4IMFA 2QZRA 5C55A 3CMJA 4JTCA 2F61A 2HPIA 2DV0A 1DWJM 4O28A 4JICA 3PZGA 4Q22A 1RBLA 3CEUA 4C6FA 5LXXA 3HPFA 5E93A 1FHLA 1Q8AA 1O68A 1JPDX 5EGRA 3SCRA 4LCRA 3F7JA 3MVIA 1L8NA 5C9XA 1ZAJA 5HQEA 2WZMA 1FHVA 4LGXA 2ACQA 2BXZA 1GWJA 4UMAA 4JTUA 2GGGA 2X1UA 4IQJA 1J18A 1NFPA 2D22A 2VRJA 5K9DA 3OLGA 3VDGA 3USZA 1V7AA 2F6XA 2J7GA 5MHBA 3B8DA 2QULA 4WSJA 1QFEA 1ITUA 4AY7A 1MMFA 4HHPA 1H2JA 1JULA 3BH4A 1XYLA 4FF5A 3QRHA 3EX2A 2TSYA 1S5MA 3NA8A 2F84A 4IL0A 3TTSA 1W9XA 4LUJA 2J66A 1XX1A 2Y62A 1UH3A 4LNCA 4LJ3A 1J2BA 3WF2A 3ENLA 3SCWA 3BAKA 3ISIX 4IIEA 3KZSA 4NAEB 5G1MA 1I1XA 1TV2A 5BRBA 1VFSA 3CIXA 1A3HA 3PZUA 3AAGA 4G1NA 3E5PA 4QR6A 3VDBA 2YCLA 2XIBA 1XIDA 3ARTA 3TWBA 2XSXA 3IV3A 3FYPA 4AWEA 4G6CA 1F6PA 2E5BA 3LB0A 4JTFA 1E4MM 1E1CB 1MEHA 2QAPA 2CHRA 2Z28A 3ARXA 1HJUA 1B1YA 1MQQA 3P2VA 2QF8A 1J4EA 3H7VA 3C86A 1XJBA 2QMKA 3P93A 3W7DA 3ABRA 4P8UA 3EWCA 4XBSA 4ZO8A 2R1KA 3V0SA 3SGGA 1KXQA 1QR7A 4FHAA 4M29A 1JAKA 2E5CA 2G96A 5TBOA 4CCZA 2AMGA 3F2CA 1A4LA 3WO8A 4KWVA 2Q01A 4L6OA 3C4UA 3VOCA 2YDSA 1QDSA 4WKFA 5I6SA 1OD0A 3PZTA 3LERA 4MLRA 5FF4A 2XFRA 3LS9A 1PWLA 3MDWA 1XBXA 2E1WA 2JFEX 4JIPA 4K38A 3M46A 4HA0A 4ADTA 1NVMA 5FEXA 2Y89A 3URQA 3FW6A 3QR1A 4YIWA 1JDCA 5CZJA 3OYXA 3GHUA 3A22A 5FAGA 2W5FA 3G1AA 4NAEA 3EB3A 1GG1A 4RL3A 4BQ4A 2CLIA 3SUWA 1JI1A 4JL2A 1BSLA 1LDCA 5D2TA 3VE9A 4HK7A 4BF7A 6REQB 3SN4A 3WQEA 4D6JA 1W1TA 1CENA 4MOZA 5BXSA 2XWDA 3OEEG 1UHVA 3P5YA 4F0RA 5I77A 3DENA 2C13A 2DSVA 2J74A 3K30A 3WMSA 1VBGA 4XO7A 1FP8A 2GK1B 1EGMA 5HAOA 2O9PA 4UTIA 3VNJA 1QVBA 1EJRC 3MUY1 2DSWA 4XO6A 2ABBA 3UJRA 1YXYA 1LROA 3NDYA 1E9ZB 3UP8A 1Q45A 1NTHA 3W4RA 3KRSA 3W02A 2JIZG 3EDDA 2Z1SA 3SGUA 3W07A 2NV2A 2WCGA 1GZGA 4Y8FA 3WLMA 1KR1A 3SZ8A 1W1A1 2NUXA 5FI8A 1ZCCA 1K8YA 3PR2A 3IUDA 4QJ3B 2VEGA 2X0HA 2HVMA 4LW7A 4O12A 2UY4A 1TUXA 3B0YA 3IJ6A 5IHSA 2W9MA 2XSBA 1EJVC 3HJEA 3QV7A 4AZCA 2Y2WA 2H8ZA 2ZRXA 4CU6A 3VIGA 4WHBA 2O9TA 5FL0A 2XDFA 3R2GA 3EXRA 4AHPA 3QN3A 5AY7A 4X9SA 2NX3A 1M7OA 5FF7A 1XWYA 3PUOA 4BI5A 3WD1A 4HPJA 1GONA 1TVPA 4L64A 3W28A 1FP9A 4CCCA 4AD3A 3ABSA 2FQIA 4X0VA 4I7VA 3O3RA 4C6NA 1ECQA 1ZENA 4HTYA 4Z2JA 4MZ1A 1HT6A 3S9IA 2QIWA 4N7QA 1R6WA 1PZ3A 1NF7A 2G4JA 3BSHA 1J5SA 2YCLB 1W3TA 1FUYA 2VX5A 2QKFA 2QGHA 3OU8A 1V3KA 1V0KA 2W62A 3CIVA 1HW6A 3L23A 2BVWA 2D3LA 2J79A 2ZWZA 4ROPA 3SCUA 4LUTB 4L4MA 3MUAA 5I24A 3HV9A 3N6JA 3S8HA 1I2QA 1TPB1 2NSXA 2FH6A 5AHFA 3THCA 4ZQNA 1FHUA 2DU2A 4B5NA 4FX6M 4QAWA 5EMYA 3WD3A 1UWSA 2ANUA 1GQKA 1H1NA 2E9MA 2EGZA 2BSLA 5JMUA 4OECA 4MSSA 4J3UA 4AMAA 4ADUA 5EB8A 4A21A 4AYGA 2PWHA 2V7QG 5AFDA 2IQTA 3PJWA 4GI6A 2IPJA 3PJUA 2WANA 5AC8A 4QQ3A 2XU2A 1LL7A 3MHGA 4LTSA 3NPXA 3B9NA 1B3OA 4UFKA 3B06A 3W72A 4NJHA 3HPZA 1TV4A 2DZUA 2XIMA 1EXBA 1YLVA 3ZWTA 2WMJA 3NO3A 4MHBA 5KINA 1EWEA 5DO8A 1EP2A 3MYOA 4UCGA 4HK5A 2YLLA 4MNMA 2DGAA 3MUIA 5REQB 3P8JA 4GIYA 1GTEA 3LTYA 3LXAA 1TMHA 4A3QA 3W23A 4FF7A 2GQ9A 5I5RA 3VIKA 4GKLA 3ZJ7A 1D3GA 3F4VA 3UWUA 3GX9A 4BK9A 4TMCA 2JEPA 1KWGA 3UCCA 3BLLA 3LBMA 1V3JA 2X09A 3BTNA 3P82A 4PMYA 4YU1A 2NVCA 3BCDA 3CPGA 1JNEA 2WJDA 4PUMA 3VIPA 4R85A 4IWWA 1L6FA 1DIDA 4INFA 3M1ZA 1JZ2A 3Q45A 4HJWA 3CHDA 1KBIA 3C8FA 1EJTC 1UWTA 2UBPC 4FXRA 1K03A 4XK2A 4AIEA 3RHGA 1XYZA 1XPGA 4C5ZA 3BAIA 4UTJA 2VEKA 3NEHA 2VMFA 5AYXA 4K39A 4B5VA 2ZRUA 3N1AA 4PB4A 1RD5A 4FEZA 4RDVA 5HJLA 2CW6A 4EF8A 2JIEA 3P84A 1I60A 4O54A 1JCLA 3SO7A 2YW3A 1KBBA 1QCWA 3QSRA 3MSDA 2GLKA 3OTRA 2RH9A 3T4WA 4XZIA 5IBXA 3D6NA 3VNDA 2XGZA 4JTAA 5F1VA 3V75A 2NQ9A 1PX8A 4I5RA 2FVLA 3L7RA 3SGZA 3GYCA 2Z7KA 1L2UA 3M64A 1UBPC 3RAOA 3DC8A 3AWNA 1JYVA 1EIXA 4C6DA 4MKVA 3ONCA 3BGJA 3N15A 5FF3A 2DW6A 3DOPA 2QV5A 4GX9A 4EIVA 3URAA 1OCQA 3QQ0A 4GY7A 2PD5A 3QYQA 5E5CA 3U4FA 3S83A 4UUIA 5K7JA 4QS5A 2WAGA 3I65A 1XD1A 2ZRYA 4MYXA 3D3FA 3SADA 3VILA 3BV7A 3N19B 1LWJA 1E79G 3SCTA 2PBGA 1X39A 1ISYA 4I9TA 1FWAC 1X38A 4BEUA 4DBEA 4R3UA 3RK8A 2OQYA 4YYCA 2WNWA 2QQ6A 3IWPA 2WJEA 4WKHA 1AJ2A 3A5VA 1QBBA 1NWTA 1H7XA 4DZ5A 4JIQA 3I6TA 1IV8A 3WBEA 1ZP4A 2Z2AA 3SDOA 3VU2A 5JU6A 3BJFA 2X1RA 3CJPA 3MI3A 2XVKA 2AKMA 4UCFA 2XFFA 4JX5A 5EBUA 2YL6A 1W17A 1RUSA 6REQA 4S3FA 1QATA 3VZZA 3F5JA 1VGAA 3CQKA 4J3SA 3QW4B 1I75A 1XRVA 2GUYA 3SEPA 2DIKA 3VD5A 1RQHA 1DP0A 1I9CB 1FY6A 4GBDA 1DL3A 3S2LA 3W1NA 1BRLA 3O06A 3GIQA 1BEUA 2V5BA 3FLUA 1P1XA 1OIFA 4FLQA 4FK9A 3BJSA 4XBKA 4CU8A 2RFGA 1IZCA 3FJ4A 3WLSA 4DXKA 4PMXA 2OLAA 1B57A 1F3XA 3UXAA 2HXTA 4J4KA 4NSBA 3GIPA 1XGDA 3LTPA 4HBKA 4KCWA 5C71A 3WENA 4XUGA 1A5SA 3B04A 3AMDA 5I79A 1L9WA 4P8XA 2VEFA 3HURA 1J0KA 1P4CA 3W2JA 2XZ7A 2XUCA 4YL2A 1SO5A 2TYSA 4AXKA 4QTGA 3A3HA 3WUEA 1KM1A 4P7QA 2P8BA 2Z0IA 3CMGA 2J8TA 2VZTA 2OWCA 4Q8TA 5EMUA 4S2BA 3VZXA 1IYXA 4I7UA 2EEXA 2PPGA 1F3WA 3KCOA 1FWJC 2JJ1G 1O5XA 5C9RA 3KOXA 1KFCA 3C2VA 3GR8A 2V30A 5CZSA 3GTHA 1JFHA 3ONBA 4DAFA 4ZBCA 3ZVIA 2I56A 4AEFA 1OHLA 1A0DA 3W26A 2J27A 1BRLB 4L7ZA 4GD0A 3HFTA 4OKDA 2XGBA 4FLOA 4O50A 1RVGA 1E6ZA 3UEQA 3QLLA 3E0WA 3T05A 4W8BA 2V2DA 3UZXA 4W84A 3M41A 4QP0A 3INPA 2W6RA 1KM3A 2VL4A 1H09A 3HPAA 1TJRA 4FX7A 3W7CA 4MZ8A 4PSRA 4JX6A 1UA3A 3OLDA 3AUJA 1OC7A 1NH6A 1S5WA 4CEXC 2ZWYA 4KEMA 3RG6A 4GQQA 3KOWA 5TIMA 2RUSA 4GISA 3II1A 1W1PA 2CITA 2PLCA 3NZ1A 3K2GA 4Z1DA 1NOWA 1MDRA 1E6SM 2EPKX 3EOLA 3UPWA 5HR6A 2W4XA 2P53A 3QZEA 3QOMA 2Z00A 4HA3A 1T6MA 3G0UA 5MF5A 4QJ1A 1HF6A 1XW8A 4JTGA 1AMYA 2V5JA 1F76A 2E9BA 2EKCA 1GKPA 2FFIA 2DSUA 1BQGA 1FWGC 1MRQA 3EDKA 3IARA 3R8HA 5F4WA 4LH8A 3CH9A 3LZ5A 2HBXA 1JRBA 2QCDB 2V5KA 2PSNA 1SFLA 1K3UA 2J75A 4X63A 5CQ1A 3WDQA 1WDSA 3OB8A 1B2YA 4CNSA 2O55A 4IQLA 2Z1KA 3UWEA 2ZUUA 2X0SA 3WLPA 4M24A 4RZ4A 3AQUA 3LLDA 3SCQA 1H51A 3FYOA 4TVDA 1K9TA 3GAKA 5A3HA 2VT0A 4FOJA 4XSMA 5U4NA 3OBEA 3GY1A 3AHXA 3B0PA 1U1HA 4AZGA 4QE5A 4DWSA 3CUIA 3VUSA 1YMYA 2YCIX 3RU8X 4HU4A 2G0WA 1B90A 2HVOA 2TRSA 1GKQA 3JZEA 3VVGA 1KQZA 3TR2A 3GXDA 2CEQA 2OT1A 2FGZA 1R8LA 4RE0A 4B15A 4DM1A 3N2BA 5I3GA 1W9PA 1NDZA 3AISA 7XIMA 1EP3A 3MCNA 2OT0A 2IPWA 4JTLA 4QCEA 3AS0A 4ZB0A 3TYUA 5CLTA 3G5EA 3V7PA 3H7RA 2DVXA 1UC4A 1M7JA 4F3HA 2WHKA 3U4AA 4RZ5A 5XINA 4ZVJA 1T8QA 2Z1WA 3KDOA 4V28A 3PK7A 4FSAA 3NQGA 4AZ7A 1V6XA 3MYPA 4FI4A 1HX0A 3FV9A 3PUDA 1CGWA 1TWZA 1X96A 1MNSA 5LNUA 1UOZA 2PE4A 1H8EG 1DEDA 1WXYA 3THQA 1DJZA 2PWGA 3LCWA 3KP0A 3KBSA 3GTFA 3QXBA 2A6LA 4K7VA 4MB1A 3TP4A 4WSKA 5A8MA 3GHTA 4XAFA 3H6OA 4ZSUA 1EKOA 3WCZA 3ITGA 1NP2A 3U2EA 4HHHA 3PNUA 4GCAA 4YVPA 4JDBA 3I3EA 4A8RA 1TJPA 5C9WA 3TSBA 2Z26A 3K5XA 4IIFA 2P3EA 2P10A 4BKNA 4O4VA 3UWZA 3VD9A 4CD4A 2GSEA 4W86A 2V3GA 3S4TA 1HJSA 4US6A 1EP1A 1TR9A 4RNFA 2DT2A 3VCCA 4WDTA 1ADDA 3WQOA 3APYA 3NSMA 4KWWA 5JQ9A 1K4HA 5AB3A 1PCWA 4LAZA 1OBAA 4B3ZA 3DCPA 2GJPA 3PWIA 1VFLA 1K1DA 4UNLA 1E0VA 4PRTA 3SJNA 1JUBA 3Q67A 3G22A 2OEJA 1NIUA 4ZB2A 3EOUA 3VPLA 4F9DA 3BDKA 1XYBA 3A3XA 1QHOA 1AL7A 2WMIB 3GH5A 4E8CA 5LHEA 3W7QA 5DY2A 2WV8A 1ZGDA 2DY3A 3C2OA 1ZZMA 4HVXA 5DMYA 2FDSA 3KHJA 2EG6A 3NVDA 4GPNA 1FBAA 4LFYA 4F79A 2ZTJA 4UQ9A 1KLYA 4G2DA 2DZVA 2W3ZA 5D02A 4DYEA 1GQIA 1Y5WA 3NSNA 4CD7A 1K9DA 4DJDA 1HKWA 1Y5VA 1IEWA 1D8WA 4XD4A 3VTRA 2DT3A 1UIOA 1SFJA 4NRSA 4EK7A 1Z7AA 1JCTA 3H55A 1VYRA 4ASTA 1QPOA 4LUSB 2CWNA 3VABA 1JF5A 1J8VA 3WF0A 5AC4A 2A7NA 4KCTA 1Y0EA 4QLLA 4R9XA 3CZ8A 3OVGA 4MB5A 3W83A 4J3VA 3V1HA 3OAAG 3M0ZA 1JFXA 3KL3A 4JYFA 3RLGA 2D69A 4N0RA 3O63A 5BU9A 3CT2A 2WVVB 3N14A 1W5PA 3BVJA 3BQ5A 2DQWA 3VCNA 1V51A 1YX1A 5IM51 3B97A 4GUIA 1SFSA 2PDMA 3PTQA 3L4TA 2HRWA 3ZT7A 4H8HA 3FYYA 1W9UA 3FKRA 3IGHX 2GL5A 1C8VA 4JNYA 1VJIA 5EBAA 2DZWA 3PWAA 3WLKX 1BG9A 3G1DA 4FNPA 4TR9A 1TX0A 3CZLA 4P7OA 1CIUA 3FNDA 4LANA 4POCA 4HOWA 4BI6A 2CZVA 1X7FA 3FJLA 5D04C 2J77A 2GQ8A 2YW4A 1PWMA 5FIPA 3IVSA 1R30A 2BP1A 3S1WA 1KFWA 4ZO6A 2O56A 1QOXA 3AIQA 1BYDA 2ZKMX 3DN5A 2Y4SA 4D71A 1P6CA 4AD2A 4LUSA 4PMOA 1ZCOA 3MCMA 3WBAA 4GIEA 4A2RA 1DIEA 1Q4WA 3SIMA 2ZICA 3TE9A 4LRSA 1VBUA 3IANA 1Q6CA 3RO8A 2PBOA 4DJED 5EFDA 4ROQA 4QJ4B 2PS2A 4GMEA 1EF2A 4HNVA 2QUMA 3EX3A 1IEQA 1KB3A 3JUGA 1Z9AA 2YBVA 2IKJA 1WXZA 3TONA 4HU3A 3GXIA 3MZ2A 5JXQA 2CETA 1UW9A 1W56A 4AZ6A 2EQDA 4PUKA 3QFWA 3E38A 2TODA 2VC6A 2AGTA 3BSGA 4GRSA 1HJWA 2P88A 3WNPA 3I3DA 4WXYA 1XLEA 4ZO9A 1JG9A 2E7FA 5HQMA 3QZAA 1J79A 3VGFA 2WNZA 2GJXB 3C3NA 4AD0A 3NXLA 3UJFA 4C6PA 2NXHA 3SY8A 3NIYA 4DWSB 2ZXQA 5D9MA 1DIOA 2CZDA 1BWVA 2Z25A 4GI9A 1MXDA 1JVNA 3UESA 7REQB 2VVNA 3RLVA 3COTA 5G4WA 1NWSA 3BCFA 4GOAA 4JTKA 4JQ3A 4O14A 3WYZA 1F07A 1ZAIA 2NQHA 1VRXA 2HVNA 1YADA 3BAXA 1XKYA 2CERA 2IPFA 4Q8OA 1CXIA 1K9EA 3C8NA 3STFA 1R3VA 2WSSG 3MS8A 3BXWA 1MW3A 3DG3A 3OBKA 3R0KA 3WLLA 1SO4A 4W87A 2OGYA 1NARA 3KW3A 3AU2A 1TV7A 5K3VA 4IJRA 3F4DA 2BX7A 2CIPA 2J7CA 1JDAA 1W8GA 3GU1A 2CBJA 3EX1A 4IJBA 3CC1A 1XCFA 4YMZA 1NELA 5PTDA 1TJ2A 3UD6A 4GVGA 3NYZA 4JTRA 1GGOA 4IMGA 4NZJA 3EB2A 3N13A 4FA3A 1CXEA 5F7UA 4OZOA 3TAOA 2O4QA 3LZ3A 2HDJA 3SFKA 3T2OA 4E2DA 3NZGA 5DRCA 4XV0A 3PPFA 1QPNA 4JX4A 3ORWA 2HCVA 1IXNA 7REQA 2R9RA 3GDBA 1R0MA 4S3AA 2DORA 3AS3A 5JBEA 4LBSA 5AECA 4AIOA 1W9DM 3DHDA 5U7SA 1IIHA 2YA1A 3VGDA 3CV6A 2A7PA 2CYGA 5T9BG 5C8BB 3V35A 3AIBA 5AN7A 3WSUA 3K8KA 4Z2LA 4KCUA 4L1WA 5E1QA 3CHVA 3ZT6A 1RK6A 3PB0A 4W89A 4JN8A 4ZTYA 1TVLA 3ABZA 2YX0A 1GHSA 2D1ZA 1V79A 3T2PA 2HMCA 1YYAA 1C93A 4IIHA 4CCEA 4DBWA 1IT7A 3LHTA 5A8QA 4IL2A 2X42A 1Z89A 2XIIA 4PMJA 3NR0A 4JHMA 3OBAA 1QRQA 4TQTA 5DX7A 3RR4A 3BOXA 1J6PA 2WXDM 1SJBA 3PBVA 3A13A 3GFXA 3MVTA 2C3ZA 3BMVA 1KBJA 4U28A 4JFUA 1XHGA 3EKLA 1R87A 2OZ8A 4FIQA 5I09A 3UWYA 1WXJA 2BVDA 1IZJA 3C0QA 3LOTA 3C2EA 5C0QA 4PYSA 3O2LA 2H3BA 3OVRA 1Z48A 4NJKA 3POHA 4M51A 1C7TA 1UH2A 2WKGA 1FCVA 1A3WA 3S3GA 4WGXA 2BTMA 3O6CA 2E3ZA 3W0KA 1QNVA 4HA1A 3H12A 2Q09A 5CSRA 4GVHA 1P1MA 5LIYX 1XLFA 2HQAA 1AZ2A 1R47A 5HNNA 3U6WA 2GJXA 2ZQ0A 3GG8A 4YTQA 4US5D 2NQLA 2ZX6A 1ZTVA 3GUGA 1UYQA 1XPYA 1V02A 3CWHA 4JOMA 3W1XA 4QLJA 3OE7G 4RPQA 3BL3A 2O7QA 1TV3A 4KPLA 3NCOA 1E4NA 2V9DA 4GH3A 3KHDA 1BLIA 3WQDA 1F61A 1XDJA 3AS1A 5B7ZA 2OX1A 5M2FX 1QW8A 4IXHA 4EPBC 3G2GA 2Q71A 3AICA 1UP2A 2P0IA 3GE7A 4EKJA 1DKWA 1AMKA 3WDJA 3WH9A 4B3LA 3QKZA 3ANVA 1N8WA 3T42A 4RZ6A 4G5DA 3UNTA 4NVTA 3TN4A 1F7BA 4LY8A 1EA0A 3NL5A 4IGMA 1NU5A 4DNMA 4ZE4A 1ME7A 1R2RA 2AOSA 2IW0A 3FAWA 1MUMA 4QS6A 1MNZA 3U5UA 1YKWA 4UWMA 4TTGA 1CNVA 1W5OA 4C6CA 2VX7A 3ZXWA 5D8WA 4AZIA 1E71M 2PTYA 3GHSA 2W91A 1HQTA 5AZ0A 1RJQA 4NZ4A 2POTA 2PGRA 2GQ3A 4KETA 2WSRA 1IR2A 1OINA 1YHTA 1BFNA 1JDDA 1KM5A 1H11A 5HNRA 3DFPA 4H41A 1EYWA 2FMOA 2Y8UA 2OEMA 1PKYA 3VIJA 1KGXA 4JTIA 2I14A 3NQMA 3KVJA 2A6NA 2CWXA 4JAWA 1J2WA 1TG7A 1W9BM 1AD1A 3OJGA 5KZ6A 3BGGA 3B8UA 1UWAA 3QVQA 2J7FA 4HZ7A 3QPEA 1G9HA 3WMLA 3M0IA 1H0GA 3MO4A 4ONVA 2D0FA 3UR7A 3FXYA 2BGQA 2IUZA 4KH2A 4NY2A 1F6YA 4JKKA 5KEZA 3QZ6A 3WEZA 1O95A 4JD4A 4JFTA 4YTSA 1AW2A 1HP4A 4ZL1A 3FK4A 1JPMA 3KBVA 2VUYA 5KMYA 3LM7A 4Z0JA 2X7WA 3GNOA 3OEXA 5TAOA 4MPQA 2WO5A 2W27A 3LN3A 2FH8A 4IQDA 3WH5A 3L2IA 4Y6GA 2B7OA 3OZYA 1CXKA 4BZYA 4DIAA 2IPGA 4IQEA 1THFD 4FR6A 3IJDA 1D8CA 2FB3A 5C70A 3T0AA 1VLWA 4O16A 2WMKA 3GKAA 1LRTA 5HANA 1C29A 3RX2A 6XIMA 1V3HA 4JKLA 1HL9A 2XM1A 5CPOA 1ISZA 4TOQA 1DTNA 3IGXA 1RLDA 3UXKA 1Q85A 3VOHA 2QJGA 1EFZA 2DZTA 2E6DA 3UZ5A 3IJ9A 3BGAA 1S3TC 4RV8A 2AQVA 4HK6A 3EOOA 1P0EA 5D2WA 1YPIA 3NQ8A 4GO8A 3ARSA 4IIDA 4F40A 4DEFA 3T0DA 3NEVA 1HNYA 4PB5A 3SUSA 2VR2A 4IUGA 1CXLA 3FS2A 1XBZA 3TMLA 1IZKA 1QPKA 4U5KA 1S1RA 5FSDC 3TW9A 3UW6A 1CLKA 2VCBA 4YN5A 2DUZA 3GQYA 3TWAA 4CLMA 3RRXA 7CGTA 3LEPA 3P14A 3PSWA 1PE1A 5FJRA 4US5A 1ZFJA 5BWAA 2I5QA 3LSCA 3VUPA 1LRQA 1RBAA 5EMKA 2VURA 4A3YA 3MA8A 5A6MA 3G8EA 3QBUA 1ENUA 1Z6KA 2E68A 2V68A 4BQ2A 3I10A 1EJWC 2VWTA 3QYSA 5CAKA 2YSWA 3KTSA 1IEVA 4J7RA 1UBSA 2QUTA 3SCPA 2WKLA 4QSFA 4CGTA 1GQNA 4BY3A 5F2LA 3QQWA 4AH7A 3HQOA 3E49A 1JIBA 1KFJA 1QO5A 1HJXA 2VFGA 1GOQA 4RJEA 1JRCA 5BMWA 1A5OC 1KRMA 4H9YA 4FOUA 2FLIA 1PIIA 3JS3A 3S6TA 1TELA 4IMDA 1W0MA 3PTMA 2C91A 5LGXA 3S1XA 3G0SA 5E0KA 5CJ5A 4FB7A 4MMWA 4UQAA 3W7PA 2P76A 3OZPA 3WLTA 4HA4A 1JDFA 2ZYFA 3OODA 3E3HA 4UR7A 5DXXA 3GVQA 3MANA 3FJ6A 3CUZA 4X0NA 3CK5A 2CKSA 4GI4A 1W32A 4A4AA 3AHYA 3C0LA 4OV9A 2XTKA 1MXGA 3GDRA 2XNDG 5M03A 3CTTA 4Q4QA 3H26A 5D2XA 1UR9A 1EXPA 4FXSA 4M80A 2GWGA 4O52A 4GACA 4G9PA 4DLMA 2DW7A 3VC5A 2JF7A 4HKPA 3HQNA 3M16A 2VCCA 4H4IA 4ORIA 1M04A 3M0LA 3E02A 5E0FA 1S5NA 3LHZA 1QOQA 4I9JA 2OWXA 1WKYA 2OKOA 3SI9A 1GOMA 2J13A 2J9XA 4JIIX 3AXMA 1CGYA 3LHYA 5I00A 4RV3A 5FJIA 3IJ7A 1ME8A 2RDXA 1S38A 3HG3A 2QXWA 2QJJA 3WBYA 1PZ0A 3DGRA 4RX0A 3VX1A 1VBJA 3PZQA 4QG6A 1E70M 3GBDA 4RNIA 1F8MA 3RNDA 4HZMA 3UY8A 3R8RA 3VM5A 4YNGA 3CZJA 3WK0A 4ASUG 1NM9A 4R53A 4AX6A 5HR7A 3TC3A 4K37A 2PTXA 4IOTA 3EDEA 1LBFA 4OV4A 4M7SA 3W2UA 2PWVA 4HU8A 4DZHA 2VUNA 1S2WA 1TTIA 1ZP3A 2V5CA 4CNTA 3TIMA 3HG4A 3Q37A 3U7VA 4K8GA 1H60A 3I6RA 5JBFA 1Q8JA 3TYBA 4C7FA 3IAPA 1S5TA 5E9AA 3Q58A 1RQEA 2WNQA 1TWDA 3C5QA 3FHQA 4Q32A 1LQ0A 1W54A 4OUIA 4JY8A 4EE9A 3I7QA 3GDTA 1BYAA 1VCGA 1K02A 5D38A 3ARVA 1V03A 4FMVA 1PIFA 4F8XA 1V3LA 3UXIA 3VKKA 1KXTA 2FHFA 2Y8VA 4AXNA 1UA7A 4J1OA 5FEPA 1QI3A 1XLGA 1CZ1A 5K4ZA 5A1AA 4D6CA 2ZC8A 4O53A 3BAWA 1Q6LA 1DWHM 1PHQA 1O1ZA 3EEZA 1OCNA 1YQ2A 3JVAA 3G1YA 3DFYA 3UY7A 3UWWA 1WAWA 1FXPA 1VQTA 1V0LA 1ZPTA 5CC7A 1V3IA 2WWCA 3E1F1 1OC5A 1ZALA 3CLMA 3W7NA 3KRUA 3WLHA 3NQEA 3CT7A 2ADAA 3LPFA 3VCRA 4FP1A 1UWIA 5BXRA 4V27A 4GXWA 1YDNA 4CNNA 4O1DA 1B3XA 2XVPA 4NKCA 4M0XA 1LBMA 5H8PA 1E6RA 4IG2B 4QCFA 1Z8AA 3PS7A 3LY0A 4TU1A 1MDLA 1O4UA 2I7GA 1ESWA 3L4YA 4IPIA 4UB9A 1C92A 1CDGA 3N17A 3I6EA 1W3HA 4R7JA 2ZUMA 3STEA 4Q8WA 1F4AA 1OT2A 2BDQA 3LGGA 5BNKA 3T78A 4AX7A 4QISA 2QDGA 4OFCA 3SQMA 2DIJA 3OHIA 1KWKA 2VEIA 3G1VA 3N9RA 3DU0A 5I3DA 2IXUA 2W0UA 1SW0A 2OO6A 2OTDA 4MDOA 4MTVA 1PTDA 5TQLA 3ICJA 1F3TA 1H62A 3KDNA 1BQCA 3C6CA 3VMPA 5GNYA 4OWGA 2V3FA 5CXPA 4WDXA 1QMLA 3R0DA 1J6OA 1XCWA 2R24A 1TZZA 1VBHA 3RCNA 2W6JG 3AU6A 1E9LA 1ECEA 1PZ1A 4AYSA 4CEUC 3U7BA 4PCTA 2Q3RA 1F73A 1NDWA 3RR1A 2VX6A 1VFHA 2XYLA 1EA9C 2W66A 1P5BA 3MWAA 1XC6A 4UNIA 2C1HA 4G7EB 3CMFA 3VKCA 2VD9A 1JGMA 4AD4A 3LCIA 5BOFA 1U1JA 2CC0A 1WUFA 1HL2A 5C6MA 3RYSA 1BF6A 4HNNA 2DZAA 1U5VA 4CQ8A 2CLFA 4GYPC 3N18A 1K8ZA 3TAKA 1TVNA 3QMRA 4TV5A 1JD7A 4ZTXA 1K4GA 2UY2A 4Q4SA 4V1YA 1GZJA 1OD8A 4Q3MA 2CLLA 2VZSA 5CZKA 3NWRA 5SWUA 1XLCA 2PDJA 2PI6A 1DTUA 1VYSX 4ACZB 4X9YA 4RCXA 1C3FA 4YS1A 1EC7A 5RUBA 3HPXA 4IMEA 1BWLA 1KM2A 4WOQA 3H70A 1R7OA 4Z1YA 2DJLA 3KTXA 3L4WA 2D2JA 2HPMA 3NZRA 3GNNA 3MBFA 2FVKA 2A1YA 4LWWA 1ZLPA 1IGSA 4WJEA 4M6QA 1OFQA 2VZOA 1M7XA 2J7HA 3NGFA 3W1TA 4KFPA 1XYCA 1V6YA 1GKRA 3PBMA 5FJUA 3IV8A 1OK6A 5E9XA 4C6MA 2YDQA 1TKKA 4M1BA 1EOKA 1X1OA 3GO2A 3WDHA 3C2FA 3A9BA 1W6TA 4FAMA 4DJEC 1NEYA 1YTDA 1J93A 4PUUA 4DBDA 3NUKA 1DVJA 2G50A 4N6EA 4IP7A 3M0MA 5DRIA 3AHZA 4C1NB 2CFFA 3PM6A 3P3BA 2NVDA 3OFNG 5GNXA 3SSZA 4EANA 2REQB 3GUWA 3W1LA 4GVIA 1QW7A 3UJSA 3UWVA 1AQHA 3WD2A 3U8GA 3KBMA 2CCRA 2E09A 5LNVA 1TZ9A 5IDZA 3PZ9A 2ZVIA 1CT5A 5JBDA 2BASA 1JQVA 6PTDA 3P6LA 3N04A 3MO7A 3DKJA 5BU6A 2J7DA 1DQWA 3E2QA 3VINA 1KO0A 1EPVA 4H00A 3B8TA 5LNSA 2NQJA 2PCQA 4Q4RA 4JTHA 2QJMA 3W53A 2QDEA 2Q8XA 3G0XA 2QUNA 4AVOA 3M0KA 6ENLA 2Y7EA 2JGYA 2B0MA 2CKRA 4XZLX 4O0KA 3CUGA 4BFAA 4PGLA 5DELA 5BXTA 1FWEC 1LWHA 2E6AA 2PDQA 1RLCL 4X2RA 2YPIA 1VCVA 2HZGA 2IQ0A 3W00A 1VJZA 2BVTA 2VZVA 4NT0A 1HTIA 3CZKA 4IMCA 3S9ZA 1B31A 2FFCA 1A0EA 5A6BD 4WLCA 1H1YA 3H53A 4RNHA 1WZLA 4S39A 4C1LA 4E2VA 4QG8A 1RD6A 1E43A 7ODCA 1O1HA 2E8ZA 5LNWA 2G4FA 2I5GA 3DERA 5IOBA 3C52A 5IHRA 5BOOA 3L66A 3KFTA 4DJDC 4XAYA 2XVNA 3N73A 1B9ZA 4ATLA 2QDDA 1QNPA 4IFRA 1IWPA 1LBLA 4N9CA 1ALDA 3K1GA 1XLIA 4OOUA 3GM8A 1SJCA 3AYVA 1XIEA 4JPGA 1KCKA 4L9XA 1J0ZA 3AZRA 5EMMA 1ONWA 1HG3A 4UMBA 3TQPA 3AMGA 1FWNA 4QGCA 3CHFA 1CYGA 4PMRA 5F4XA 3VAVA 1QNSA 1MWOA 2JQXA 3PG8A 4IG2A 2ZDRA 3LXCA 4ZFCA 2CESA 1JZ4A 3B40A 4XISA 1MUWA 2A3CA 4D72A 3Q4DA 1ZJAA 3DECA 4MG4A 3C3UA 5FKYA 3HMJG 1R3QA 2P3ZA 3SBFA 2YYTA 2YZRA 2AL1A 1EIBA 4YCOA 1IQ8A 1W91A 4JKMA 2VDGA 3HGRA 2UV8G 2PURA 4PR4A 1XICA 4FO4A 2VX4A 3ZIZA 3TTOA 2R91A 3R0UA 5C7HA 1LM1A 1FXQA 1AL8A 4JHZA 4BJHA 4LBRA 3JZUA 5LA0A 5AYIA 4IP4A 3N9KA 4PZVA 4H6EA 4W9TA 5T8GA 1TPVA 2WOQA 3LQLA 1K7FA 2VFDA 3ARQA 5I3KA 1UWRA 4A2SA 4O4WA 1LWIA 1DJHA 1Z41A 2G97A 1DWFM 2GGIA 4HNUA 1QNQA 1ZBCA 4S3EA 3RUBL 2DVTA 3A4JA 4E3TA 2RDTA 3TYZA 2C7FA 4JN7A 1TRDA 1XUZA 4GJJA 3VIOA 4XAGA 1GVRA 2A0NA 1XIIA 3YPIA 1TMLA 3KBNA 2VC7A 3W29A 4L6DA 1JCMP 4JQ4A 2VGGA 1HKVA 9RUBA 4B9YA 1D2KA 4EVZA 2OGJA 4D1IA 3GC2A 5I2UA 4LC8A 2XOKG 4M6PA 4W7VA 1W3JA 4XTIA 5D9PA 1CGTA 4WIWA 1V6TA 3RCYA 4K8EA 4PC8A 3CHCA 3SAZA 2OKTA 4IPNB 1R38A 4YWIA 2Z24A 3EMCA 1GEHA 1PCKA 3CO8A 2JKAA 2QCCA 1GK8A 4OHQA 3QY7A 5DY3A 3TZNA 5CC6A 1B4EA 2GVGA 5D2YA 4JYEA 3SSJA 3R8GA 3M7WA 3PN8A 3ZT5A 4H01A 3W71A 8A3HA 4UOJA 2O4MA 1EDTA 1VFUA 4P8VA 7A3HA 3UYIA 4CD5A 3LNMA 5I0DA 1TE6A 2YCJA 3WLJA 3MP5A 4P7NA 4U10A 3W1QA 5HBFA 1BWKA 1DHKA 4Q4PA 3W1UA 2DZSA 4GKTA 3MCOA 4EWND 3LHVA 4RNJA 3REQA 2QCNA 2OPJA 2WPBA 2IKGA 5DF0A 3AXIA 1LRNA 3CO4A 3ZLFA 4AC1X 2PDHA 5K4XA 1XLHA 3ZJKA 4E38A 1VFOA 4XAPA 4CN4A 4IJCA 2QEZA 5I23A 4O1CA 5AHEA 3DFSA 3B4YA 1RCQA 2SFPA 3TZFA 3BANA 4AZBA 4AIBA 4IHCA 3H22A 2X2YA 1Z69A 4CNOA 2QS8A 1OX6A 3EGJA 3VO0A 4QE4A 2YL9A 4ALDA 3FSTA 3GU2A 4AY1A 4WOZA 1QW9A 4TO8A 3L67A 1UP0A 2FZBA 3QGVA 2G3IA 4MB3A 2A3HA 1WKEA 2AKZA 1S46A 3AMKA 4CVUA 4FLRA 3AMCA 3MBDA 3NDZA 4MM1A 3M6DA 3IGSA 3W7RA 4LYPA 1G69A 4ZENA 4TMBA 4J3WA 3F1QA 1FQ0A 3A6OA 4ZSTA 5BWFA 3DYMA 3SECA 4XZNX 5LIWX 4AZ5A 4W85A 2GVLA 3M6YA 3RF9A 1IHIA 3L0GA 4DF1A 3TJXA 4B91A 4MWAC 4FNRA 1PYMA 2INFA 1KD0A 1E51A 1K7EA 3URNA 1UROA 3LNPA 1QI5A 4DWSC 3DC0A 5A6JA 3ZLGA 1GG0A 4KWUA 3TVAA 2BY2A 1IEIA 4ML9A 3E2RA 1ODUA 1UMYA 2G3MA 1BXCA 3LPOA 3ME3A 5KZMA 1QI0A 3DYOA 3PG9A 1Q2SA 4UOZA 1ICSA 1FDZA 3B0VC 4Y7EA 5EL1A 1R46A 1G7VA 2A5HA 5F1UA 4HYWA 4K36A 2GDUA 4ERIA 2VYOA 3P80A 4B4FA 3O7UA 1MFUA 3NQBA 1SVDA 3PY2A 5EMLA 4QAIA 2ZA3A 4DM2A 4ZR8A 3MP3A 2PDCA 4GZ7A 3RPTA 5EMJA 2P0OA 1W9VA 2G5WA 1NQKA 5H2ZA 1UR8A 4KT2A 2PGEA 2YB1A 2TAAA 1EEXA 4PUDA 3W2LA 1LYXA 2CXGA 2Y7DA 1WO2A 1AODA 1E0UA 4KFNA 2XINA 3VIMA 4FPSA 4C65A 2DUAA 4LQ1A 1D7FA 3CPRA 4LVFA 3A47A 3ZYZA 1CXHA 2BZNA 4TX9A 1T96A 1OG6A 2QVNA 4CU7A 1OX4B 3OQ8A 2XH2A 3N4FA