4KCVA

Pyruvate kinase (pyk) from trypanosoma brucei soaked with 2-oxoglutaric acid
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
498
structure length
498
Chain Sequence
SQLEHNIGLSIFEPVAKHRANRIVCTIGPSTQSVEALKNLMKSGMSVARMNFSHGSHEYHQTTINNVRAAAAELGLHIGIALDTKGPEIRTGLFKDGEVSFAPGDIVCVTTDPAYEKVGTKEKFYIDYPQLTNAVRPGGSIYVDDGVMTLRVVSKEDDRTLKCHVNNHHRLTDRRGINLPGCEVDLPAVSEKDRKDLEFGVAQGVDMIFASFIRTAEQVREVRAALGEKGKDILIISKIENHQGVQNIDSIIEASNGIMVARGDLGVEIPAEKVCVAQMCIISKCNVVGKPVICATQMLESMTSNPRPTRAEVSDVANAVLNGADCVMLSGETAKGKYPNEVVQYMARICVEAQSATHDTVMFNSIKNLQKIPMCPEEAVCSSAVASAFEVQAKAMLVLSNTGRSARLISKYRPNCPIICVTTRLQTCRQLNVTRSVVSVFYDAAKSGEDKDKEKRVKLGLDFAKKEKYASTGDVVVVVHADHSVKGYPNQTRLIYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Pyruvate kinase 1
publication title Pyruvate kinases have an intrinsic and conserved decarboxylase activity.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 180
structure length 498
sequence length 498
chains with identical sequence B
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4kcvA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 4kcvA01
1S2UA 1DXEA 1F8IA 2XZ7A 2R82A 2G50A 1PYMA 1U5HA 1DXFA 2V5KA 1VP8A 1A49A 3GG8A 4L7ZA 3I4EA 1O66A 3OQ8A 1M3UA 4ROQA 1IZCA 1O68A 2HROA 1OY0A 1DQUA 1SGJA 1E0TA 4KS0A 3QV8A 1S2TA 4KCWA 4IQEA 1VBHA 5JVLA 1F61A 3BJTA 3MA8A 4KCVA 1ZJHA 3E0WA 3HQNA 4KCUA 2KX9A 1PKNA 1ZLPA 3QV7A 1F3WA 3SRDA 1DIKA 3E5BA 3G2GA 2VGGA 3T07A 3N25A 1KBLA 2XDFA 3SRFA 2ZE3A 4B5XA 4FXFA 1T5AA 2E28A 3FA4A 2VWSA 3GR4A 1S2VA 1PKLA 5TAOA 3EOLA 3OYXA 3OYZA 3E0VA 4HYVA 1S2WA 2HWGA 4B5SA 2V5JA 2VWTA 2VGIA 2X0SA 1Z6KA 3QV6A 4KRZA 4B5UA 1F8MA 3T0TA 3H6OA 4B5WA 4LSBA 4MF4A 4JPGA 1VBGA 3B8IA 3EZ4A 1A3XA 3ME3A 3SRHA 1U5VA 2HJPA 4IQDA 1A5UA 4G1NA 2DIKA 4IMAA 4B2DD 3P0XA 3VAVA 1XG4A 2VGBA 3EOEA 4B5TA 2VGFA 3FA3A 3QLLA 4IP7A 1JDEA 4QG9A 4TV5A 4KCTA 4L9YA 4MG4A 4RPPA 4YJ5A 3EOOA 3R4IA 3M0JA 4TV6A 1F3XA 3IS4A 3T05A 1M1BA 4QG8A 1KC7A 1E0UA 2OLSA 4DRSA 3KHDA 3HQOA 4WJ8A 1PKYA 1UJQA 3GQYA 2DUAA 4FXJA 3QQWA 2XZ9A 1OQFA 3SRKA 3BJFA 2L5HA 4HYWA 2WQDA 2BG5A 4QG6A 4B5VA 1MUMA 1O5QA 3HQPA 3LYEA 4QGCA 3PUGA 1A3WA 3PP7A 1PKMA 1T57A 2HRWA 3U2ZA 4B2DA 1AQFA 3KTXA 4YNGA 2QIWA 3LG3A 4L80A 3QTGA 1GGOA 1IGWA 3M0KA 3QZ6A 3QV9A 1XG3A 4L9ZA
chains in the Genus database with same CATH superfamily
1F3TA 2WMIA 3A3HA 4FLSA 1OCQA 1Z9AA 1CXIA 4HMCA 3WQCA 2ZWZA 4F2UA 3EWUA 2WNNA 3NPXA 4PB3A 4LYQA 3W2NA 1I2PA 2PBOA 1EGMA 3DFYA 3T08A 1KV8A 3SUUA 3W1TA 4KRUA 2VGGA 4FZIA 3LB0A 4LNCA 3UW6A 3S2LA 3PZNA 5CPTA 3DFSA 1KM5A 3QKEA 3WF2A 5A8MA 2QYGA 1TIWA 4NT0A 1AL8A 2QJIA 2A21A 5CSRA 1FS0G 3PNZA 3T0TA 1IT8A 4ZQOA 3H23A 1QI0A 2OTDA 1P7TB 3MHUA 4QBXA 2H3BA 2E7FA 4LWWA 2HPIA 2I17A 4GQQA 1V0MA 1UR8A 4NYYA 4D6GA 1IZJA 3NQFA 1A0EA 1NEYA 1TV8A 1T96A 3MV01 1TV7A 3JU2A 1X6NA 1LQ2A 3MVIA 4NRSA 4R9XA 4S2BA 3CYJA 5CBIA 1TVLA 2ZA1A 4GZIA 2CZDA 2B7PA 1ICQA 5HINA 1KTBA 3H7UA 2WVVB 3JRKA 3VIJA 1G5AA 2PE4A 3OE7G 5LZLA 1C7SA 1M04A 2C13A 4JYEA 3WEMA 2TRSA 4FA3A 2WKLA 2F8QA 1CX9A 3TW9A 3VNLA 1GOWA 3P5ZA 1JDCA 3D6NA 4AYGA 3GWQA 5HULA 4A3UA 1TPDA 2PA6A 1E4NA 1SO3A 4Q22A 5ABEA 4KQNA 1ZPTA 5A8OA 3UA3A 5HWMA 1RAKA 3QOMA 2I1OA 3GB6A 2BFGA 1OG6A 2NWSA 2VZTA 2XISA 5AZ1A 2OEMA 5C0QA 1AW5A 1HGYA 4WRHA 3IJLA 4IGHA 2OPJA 1XYLA 1W8GA 3WQPA 4O57A 3LLFA 3MUAA 3ARSA 3ITGA 3KEHA 2BWGA 3G18A 4MMWA 2VEMA 4V27A 2A2IA 2Z29A 3JUGA 4DJDD 5CZKA 5J8LA 4HNTA 1P7TA 4Y9PA 3HJEA 1RQEA 1CLXA 1XR2A 2BB0A 4LJ3A 1J2BA 4DEFA 4QJ1A 5I3IA 3F2CA 4MWAD 5EA9A 4A05A 5E70A 4X9SA 3ARXA 3AU2A 1KXQA 4LC8A 4O8AA 5EYWA 3TTSA 3EXTA 3E2VA 4C1LA 3CL8A 4D1JA 2QIIA 3FVDA 4IUGA 3QGKC 2J8GA 4LU0A 2Y5JA 1H7WA 5D03A 1NJJA 2ZC8A 4G2DA 4QJ5B 2CBJA 1DOSA 4EWJA 2J8TA 3TA6A 3RM9A 2CWNA 1VJIA 2CWXA 1K70A 1SFSA 1VENA 1CENA 3G1VA 4JYFA 2VI0A 4ZB0A 1H7OA 3W1RA 1XLMA 2V9DA 3I6RA 2WLZA 5TAOA 5DCEA 2YDRA 4H19A 4K8HA 5LIYX 1PZ2A 3KM8A 3TAKA 3BAJA 3KWXA 3LGDA 6REQA 2VCBA 4J3WA 2EAWA 4GH3A 1PZ0A 1YXDA 4IM4A 3W7DA 1R9YA 2CLHA 3IUHA 1KRBC 4XKYB 4ZO8A 3VC5A 5CJNA 4BI7A 3VCCA 1ZAHA 1W17A 4IP7A 2PB1A 2ZUVA 4NXKA 4MB5A 4PUMA 4ACZA 2Z1XA 3GVRA 3B4UA 2HK1A 5HK4A 2XJ7A 4IFKA 1H3GA 4TT3G 3H22A 3KXQA 2CYGA 3URNA 4LPCA 3I7QA 1WX0A 2E77A 4CEXC 1LOLA 1NOWA 1V51A 4G1KA 3CT2A 1YDOA 1YE6A 5H91A 3LNMA 3M47A 1GG0A 1QI3A 4BY3A 5CBJA 1ZBCA 2OYMA 1X6UA 3FGCB 4D8AA 2J78A 4GI9A 1VP8A 1K77A 3EEZA 3RJYA 1B3XA 4IJCA 2V5KA 3G1FA 3XINA 1ONRA 2XIBA 3CJPA 1ZZMA 3GG1A 3QZAA 2A6NA 1P0EA 1BTCA 2QUMA 2WMKA 3GRIA 5FJTA 3B97A 3RRAA 2P0IA 1ZSXA 3B8VA 3N2TA 4DBUA 4HA1A 4IIHA 1KM3A 1VEPA 2DJXA 1SUXA 2VGIA 1X8CA 1R3SA 3QPZA 2PD9A 3W22A 4FNRA 4PUUA 2GK1A 4C1KA 3NPWA 2J4GA 5AB3A 1M03A 2D24A 3Q37A 1RCXB 1XWYA 3GXIA 1M68A 3JS3A 5EU9A 3EWDA 4M81A 3NGJA 2BVTA 4XG1A 5G2HA 3CUXA 3C0SA 3CAKA 2R6OA 5F2MA 1FHDA 1HN1A 4XKYA 1XFCA 1B4KA 3CUIA 4O1EA 4IHCA 2X1UA 1V4YA 4DNHA 5C55A 4UTMA 1MEHA 1EDGA 1RD5A 4AC7C 4H83A 4DM1A 5AZ0A 5K3VA 3ZLGA 1XD0A 3M16A 2UY2A 1PDZA 1PIFA 2AL2A 3FHQA 4GI4A 3IIVA 4AWUA 1JGMA 1OZMA 4KWUA 1ZNNA 1JJKA 1DJIA 3P60A 2VC7A 2D0FA 3S1WA 3UR8A 4EAMA 1H0IA 2VOTA 3FGCA 2A4AA 4NNAA 3SO7A 3W37A 4RNJA 4KS0A 1FWDC 3E74A 1WZLA 3RIKA 4FB7A 3SRDA 5JU6A 1E55A 3WQFA 3ID7A 4C6JA 4PL1A 4ERAA 2UWFA 2DZUA 3HPXA 4TUFA 4JCMA 1IWAA 3HGOA 2YCLB 3HPSA 3T2PA 2VEIA 4IQJA 1VAHA 4C6OA 2OELA 4IF2A 4LY4A 5DELA 1OWQA 3UXAA 3AS2A 3W4RA 2XUCA 4P61A 3UPWA 1GUVA 2CC0A 1TWIA 3W7JA 3TW7A 4C91A 3M64A 3O7UA 3SGZA 3O9NA 4CN4A 1OIMA 1SZGA 3DFNA 5XIMA 3BLDA 3GDLA 4J3SA 4WKAA 3MHGA 5I03A 3VCNA 3GBDA 4MKNA 5A5WA 3CH9A 2QUVA 1EWEA 1OABA 4MYAA 3GNRA 4HCHA 3B0PA 1ISVA 1B3VA 3DECA 2DIJA 4Z2IA 4H9MA 3C4UA 1O1HA 4EIVA 2JE8A 3MP4A 4TX9A 4Q7NA 1DWFM 3FK4A 3KTCA 3OEXA 2XVPA 2Y62A 1YPFA 1F07A 3W9ZA 3UG5A 5BXSA 3B8TA 5E0CA 5FSDC 4J3UA 1TJ0A 3PR2A 4JY9A 2KAUC 2DUXA 4FXRA 1TV5A 2CPUA 3SDOA 4RDZA 3TROA 5MHBA 5AYYA 1HTIA 5FCZA 2Q8ZA 1NQKA 3N25A 2UY3A 5FD0A 3T40A 3HO8A 3CU2A 1EJUC 1V3MA 1FCVA 3L0NA 1RR2A 3CB3A 4XB3A 3CQ0A 5E0FA 2E5BA 4N02A 3VXGA 1E9ZB 1JQXA 4TOQA 4YS1A 3GDTA 2E6YA 2I16A 3IV3A 1XGEA 2DU2A 1V03A 2VUNA 1JPIA 3WD2A 1OCJA 1A5CA 1PEZA 4GC4A 1O5RA 5BYWA 4CKQA 1ZBWA 2A1YA 3S5OA 4B3ZA 3CUFA 4JTAA 4ZCWA 7ENLA 3S3GA 3ZVIA 3PJWA 3ES7A 4TV6A 1ICPA 4DO4A 3WQVA 4XZMX 1OJXA 2I56A 5BRPA 2VVSA 3BOXA 2DZVA 3PPFA 3A4WA 3HTWA 1GVOA 4EPEC 3NL2A 4WX2A 3OLDA 3GFZA 1XPYA 1MEWA 3IK4A 5FACA 1LCOA 4UCGA 4H6KA 1NDYA 4FLQA 4MWAB 3CV6A 4US5D 3CZJA 2HNEA 1M7JA 1T7LA 3FDGA 4JAWA 3N4EA 1EIXA 3FX4A 7TIMA 1RY8A 2HNHA 4HYRA 2BP1A 1KA9F 4NJHA 2BY1A 3FYYA 2ZXQA 1EF2A 2YZRA 3WK2A 1GVRA 1HL8A 4DYJA 3P2VA 2WKGA 5IDZA 2IQ0A 5LGZA 4HCLA 1Q85A 3O6YX 4ZTXA 4NRRA 4JTRA 4LAOA 3ORWA 1KM2A 1HKJA 5BMWA 4M1BA 3GZAA 4CEUC 3S2MA 1PL9A 4HJWA 3WQ4A 3ZFHA 3QKZA 2VUYA 3EWWA 2Z28A 4NJGA 2BGSA 2VL4A 3UT0A 1Q6DA 3AUJA 2A3EA 1VFTA 3QLLA 3FA3A 1SJCA 4ZR8A 1WBHA 2YXGA 2PLKA 1F5ZA 2PWGA 1LRNA 2MUCA 4E4FA 3O0KA 3S47A 5H8PA 1XIJA 3N3TA 3MMUA 4F48A 1WDDA 1R3RA 1UWUA 1C3FA 3U2OA 3EA2A 2F7FA 2QPUA 1GT8A 1AMYA 4ZQNA 1E79G 3LK6A 3OZPA 2V8ZA 3N2XA 1EXPA 3IIZA 1BVZA 4MY8A 3TAOA 2CHNA 3IVUA 4V33A 2HE5A 4GD0A 3UR5A 4JDBA 3QLDA 4P2VA 1VCGA 3W6MA 1CECA 3IVTA 1FWEC 4B9YA 1YDVA 2AKMA 3LTPA 5CZSA 4JTGA 1E1EA 1TZZA 3GO2A 1UBSA 4FSAA 2P5NA 1YNPA 5AC6A 4QJ3B 3SGUA 4MWAA 5I0DA 5HMEA 3O8AA 4QRNA 4PBFA 5D33A 4Z1BA 1AODA 4EX4A 4RNHA 4FLRA 2PP3A 4O15A 1QW7A 3WEZA 3BGGA 2W9MA 2Y61A 3OIHA 4MJMA 1BG4A 3W27A 1XISA 1ADDA 4ZOEA 1UG6A 2O9PA 2BY2A 2V67A 1Q6LA 4BQ4A 1QOPA 3VD5A 1AD4A 5D02A 3USBA 5A3HA 4A29A 5C9UA 4JFUA 1B57A 1TMQA 1PHQA 2NUWA 5TF0A 3NL5A 2C1HA 3F2BA 3OZYA 2ALRA 4NIRA 4L6HA 1RVGA 4GJJA 4UC5A 5D8ZA 3Q2DA 4XD5A 4I7UA 3N13A 2YA2A 4AD1A 4QCFA 4L61A 2NV9A 4LBSA 2GOKA 3G6LA 2D2JA 3URBA 3AAMA 5DT5A 4ECLA 3T4CA 2PZNA 1ALDA 4QIUA 2DEPA 1KXTA 4JFWA 3VZZA 1CGVA 3DYMA 1V6YA 5LKYA 3BMXA 5F2LA 2V38A 1BSIA 1IXOA 2QAFA 3L7RA 1XH1A 3B05A 4C6QA 3GVVA 4QDMA 5CPLA 4QDPA 2PLJA 3WJWA 4N0RA 4L1XA 1SQ7A 5EL1A 2XFRA 2GOUA 4AD2A 1P0KA 2HROA 6TIMA 3BV7A 1JDFA 1KRCC 4E0CA 1SPQA 3BQ6A 2HMCA 2QGHA 3D0CA 4UFHA 3R8HA 3ZR6A 2EG7A 2RDUA 3VDAA 4DY1A 4UQEA 2QV5A 3DU0A 4NU7A 3TW6A 3PUDA 2O9OA 1EDQA 3VGGA 2OMAA 4XSLA 3JW7A 2XSXA 3EX6A 3AXKA 1AUSL 4J3XA 4J2PA 8XIAA 1UP2A 4JNZA 3B40A 3ATZA 4KPLA 5KEZA 3SCUA 4NX0A 3LMYA 1KM6A 1PUDA 4Z1AA 4JCLA 3S6OA 3TH6A 1HG3A 3EMQA 1FHUA 1JL8A 2FHCA 2GUYA 4XBKA 3QY8A 1FBAA 2IW0A 5CC7A 3QR1A 1OFOA 3LHUA 3WUFA 1TX0A 4AFYA 4HPNA 5LNSA 1UA7A 4JQ2A 4DJFD 2ZTJA 3OLGA 2PLMA 2BHUA 3AO0A 1R5YA 5FJOA 1IIGA 3QFWA 5KITA 3OHMB 3V16A 3GAYA 4XQ6A 2GWGA 1KGUA 2NQHA 4UWMA 3S0CA 2X0YA 3WEOA 2ISFA 1X96A 3LM7A 3T9PA 3TZNA 4I6VA 3G24A 2BSLA 2P0OA 3CS2A 3S9YA 3DC8A 3CTLA 5BU6A 1BHGA 3W24A 2G0WA 4UNLA 4CQBA 1JPDX 3GVQA 2E28A 3PZIA 3D47A 4PUKA 4R7JA 2VCAA 3NVTA 1W3KA 4HHHA 4X22A 1H49A 4BQ3A 4NNBA 2VNCA 3DBNA 2PAJA 1CLKA 4RZ4A 4J27A 3M0HA 1QT1A 2FB3A 4E6MA 5TIMA 1J5SA 2DPEA 1PIGA 1R7AA 1CXLA 1IT0A 2OG9A 4HMDA 3MDUA 5LYRA 3AROA 3W85A 4GJ1A 1CYGA 4JL1A 4C6BA 5LGXA 3M7WA 2OYLA 4R53A 1IXQA 1NP2A 3N9KA 3HGRA 4AY8A 2GVYA 3KFTA 1AD1A 2WMFA 3CZKA 4PMYA 5I3HA 3FEQA 3E0LA 2EG8A 4GY7A 1Q3NA 1BXNA 5LIWX 3K8LA 4OOUA 4PMZA 5DX7A 3WNLA 3LSCA 1C90A 1A3WA 2WSSG 1W5MA 4C6EA 4WGHA 1XG3A 4UR8A 4OTKA 2GJRA 3SY5A 3VIMA 1F4HA 3TQVA 5A8QA 5FF4A 4A8NA 4GLEA 4M29A 1XM3A 1KRMA 3WBWA 5KSWA 5TBOA 2GJNA 4GABA 4TX6A 1K7EA 4LTSA 4ZSUA 3H2NA 1VR6A 1FCBA 1J01A 2QV4A 4QAIA 3PBGA 3LV6A 2Z2UA 1E9IA 2CBIA 2WSPA 3TTOA 5F1UA 3A24A 3U57A 2MANA 3ZT6A 3LEPA 1VJSA 3B9EA 1W1VA 2VDIA 1NWRA 4N4PA 2GYIA 4Q4RA 4GBUA 2WAGA 4XAPA 3P67A 2NT0A 4H8VA 2FVMA 2BTMA 3I68A 4WCJA 2FJKA 1A3XA 3OG2A 3I6TA 2I5GA 4J2MA 1XRVA 4NUWA 2QJJA 3G0XA 1VBJA 3GIYA 4AZ7A 4JX6A 4M6VA 2FVLA 5C71A 4YCOA 2FYMA 3TR2A 2WJEA 3GTXA 1CWYA 2J74A 3W75A 5EBAA 4EP8C 1R85A 3N4AA 1UWSA 3URQA 4LF1A 4LS0A 1DWGM 3UF9A 2PDQA 2IKHA 4UXDA 4BK9A 2BG5A 2XGZA 4GK8A 5DQPA 1I2RA 4L80A 3DENA 1UC4A 5HAOA 2WB5A 1XYMA 3TDFA 4UMCA 2W0UA 1MSSA 1HVXA 1K03A 4F0LA 3W1LA 2W91A 4Z42C 1E9YB 3OIXA 3F7JA 3MBFA 1EX1A 7PTDA 3B9NA 5HOSA 1CXKA 4HKPA 4CQAA 1ZLPA 1GQJA 1XI3A 3M7SA 1ONEA 3E5BA 3N9RA 4GGHA 4B4FA 2WCGA 1HF6A 3G3DA 2PDCA 2V2HA 2R8WA 4MGGA 4HZ8A 4HB7A 3EXSA 5DRCA 3RM8A 3CNYA 3KL0A 3TWBA 3H12A 4US5A 3V75A 2Z0IA 4ORIA 2Z6IA 3NQBA 3KE0A 5CPQA 1ZGDA 3WD3A 1Q6EA 3OHIA 4XSMA 3VX1A 2ZXAA 1KCZA 1OINA 3GK0A 2DVUA 1KBKA 2NV1A 4U31A 1E9LA 4DPPA 4M6UA 1FWFC 5H2ZA 4XD4A 2C19A 2VVNA 1Q63A 4YTQA 1GOMA 1B54A 4MKVA 4F40A 1G01A 4RCXA 1S3HA 4ZOAA 3JR2A 1YTEA 1ZQ5A 1KFCA 5I7GA 3M5ZA 1NOFA 2BOFX 3SN1A 4H9ZA 1UQYA 2EKGA 4KIRA 3V5OA 4E8GA 1MQQA 1R2SA 1JCNA 4AWSA 3UZYA 2E09A 1QATA 2HVNA 3STPA 1N8WA 3AYVA 1XLIA 3W1UA 1R46A 4JIQA 3DGRA 4B4HA 2P3ZA 3OO2A 1VPYA 2TMDA 3WDRA 3QTPA 5FI8A 4M80A 1EQCA 3MYOA 1OFEA 1H7PA 3RAOA 1WO2A 1JYVA 1C8QA 4RUBA 1A5BA 1CXHA 1PX8A 1SU5A 3QHNA 3KTSA 4OJYA 1OHLA 5CPNA 3KOWA 2GWNA 1JZ6A 1EP2A 3AC0A 2W6JG 1Z6KA 3MB9A 4TXEA 3OBAA 2Y7GA 1OC5A 3O6DA 4LSBA 3LTYA 2OWWA 3U4FA 3KCOA 4AVFA 4UMAA 1U5VA 5I00A 1OYCA 3UWQA 3S2NA 1G67A 4Z2GA 4AIOA 1TWZA 1OX6A 2JKEA 1V7AA 2Z1BA 4J3TA 1CDGA 1C9WA 4C1NB 1G4PA 3TYZA 1UWTA 4F2BA 3HOJA 1SJDA 3K8KA 1DE6A 5KZ6A 3V7PA 1V7YA 4JQ1A 3EX2A 3LQGA 5D9NA 4GYJA 2VOMA 2V68A 4FMVA 2P10A 1GONA 3MCOA 1T57A 4GQGA 1TWDA 4Q33A 4LGXA 4R3UA 3NAVA 3PJUA 2Q02A 3LMZA 4PMOA 1UOZA 3PZTA 3UR2A 2ZBTA 4UQDA 1UIPA 1SO4A 2R82A 2G50A 4GNKB 5CKSA 2PEVA 4LCRA 3EMCA 4S39A 2QUTA 4ZB2A 2GLKA 3I7SA 2PRMA 1FWWA 3RCNA 1C29A 2OQYA 4E4PA 1PDYA 1QVBA 4Z1DA 2NX1A 3W7RA 4FIQA 2D69A 3PBVA 2RDTA 2ZTKA 4PCSA 1MDLA 2WNWA 4GUGA 2OU4A 3L67A 2Z7GA 3TLLA 3P84A 5FEWA 4IGSA 1PBGA 3GY1A 4DQWA 1V3KA 2PGRA 4IIGA 2QVHA 2FPVA 1JCJA 4FX8A 3HPAA 1AK5A 3M0LA 4S3FA 1MNSA 1VP5A 2QDHA 3LHYA 2VKZG 3RLGA 1JDEA 4GVHA 2PDFA 4KCTA 5G1YA 1K4GA 1R3WA 1LORA 4C6LA 1QWGA 2VFEA 1F74A 2QDGA 4YTUA 1UP0A 3C0QA 1KFEA 4GYKA 3F5JA 4Q8OA 3L0KA 3OPSA 1D8WA 3DUGA 2E8ZA 2PF0A 2WNQA 4UTWA 3RLHA 2NQJA 1Z7AA 3BLKA 3FLUA 4HN4A 3FYPA 1J4EA 2Z25A 2Z7KA 1AMKA 2YGYA 3U7VA 4A3RA 5GNYA 3E2RA 1F6KA 2V30A 3S46A 2G37A 1OB0A 3LXBA 1N8IA 4IIBA 2FZNA 2E9MA 2YYTA 1RA0A 1QDSA 4KH2A 2ATMA 4NG3A 5XINA 1QNQA 8RUCA 4DJFA 4WDWA 2WPGA 5FL7G 3UVAA 1XD1A 2EG6A 3T07A 1Q7MA 3C56A 1VH7A 2V3GA 3HBLA 1JZ4A 4PH6A 1J0YA 4D9PA 2V5BA 4XWUA 1OCBA 3WD0A 2FZBA 4GOAA 1VPQA 1UC5A 3S5ZA 1XKJA 3QHOA 4C5ZA 4RL3A 3PUOA 3R94A 3SCRA 4MM1A 4TSFG 4WZHA 1HUVA 2PP0A 3AHYA 1RXOB 2V69A 3SM0A 4M7SA 4ZVJA 2ZUUA 3S1XA 4QHRA 3VNKA 3R4IA 3LCIA 1GQLA 1TV2A 4DBSA 3W88A 3FSUA 2J25A 2JK2A 5KTLA 1O95A 1VPXA 3AS0A 4PTNA 2AKZA 5D2YA 2QAPA 3UG8A 4PMDA 3VK5A 3FW6A 1JAEA 1DWHM 4XK2A 3ZQ9A 2OZ3A 1E6ZA 1NQ6A 1R3QA 2E1WA 3FDKA 4LUTA 1YLVA 2WZHA 2X30A 3OGSA 3PNUA 4C90A 1UKPA 3RM4A 4GX8A 4JTCA 1P6BA 3RR1A 4EWND 3UG3A 2J7HA 1DJNA 3EOLA 3WUEA 3BICA 4OBRA 4Q8VA 1E1FA 3KX6A 1ITQA 1N7KA 1PYFA 4Q7BA 5HA7A 3HG4A 4POCA 3NR0A 3OW1A 2BZNA 5FJUA 3NZRA 3NSXA 2DIKA 4IL0A 3T44A 1ADSA 5JBFA 5CZJA 2YBUA 1LRTA 1DP0A 1XDLA 1LF1A 3E0IA 5I5RA 1F76A 3LNPA 2DQXA 4I8DA 4MFEA 1XBYA 5EBUA 3EYPA 3UP8A 3GIQA 2WVTA 2J7CA 3O1NA 3TWAA 2Z4GA 3F4NA 5FJPA 2INEA 1Z32X 1T6MA 2OSXA 1CI1A 4A2SA 5BXTA 5JUVA 3NOYA 4INFA 4PTDA 3QZ6A 1GOQA 1SW0A 4JQAA 1S2UA 4Z17A 2XZ7A 3MP5A 4HA4A 5FEXA 1ZRQA 4IXXA 1W0MA 3QJAA 3EKLA 3UPBA 1MXGA 4GE8A 1EP1A 5CLTA 1U5JA 4NZJA 1DJXA 1F4AA 5H1WA 3BJTA 4IP5A 3QC3A 4H2HA 2QCHA 4WIWA 2XFFA 4S3CA 5G1TA 2Y89A 1PZ3A 2OZ8A 1D3GA 1J11A 3TYBA 3K13A 1U1UA 5E09A 2ZRWA 3O16A 3TV8A 4WQ6A 1ICSA 1WUEA 4O0KA 3W6YA 3W38A 3W25A 3Q58A 2IPJA 3QV6A 2NQ9A 4WY0B 2VD9A 1DHKA 2PDMA 1W1YA 1R38A 1EJTC 4RNFA 3WL0A 3VGHA 1OGBA 2R14A 3OLEA 1NDZA 3EXRA 5CGTA 2E9LA 3P3BA 3S5SA 4MZ8A 3W7GA 4A3QA 3UXIA 4WDUA 4EVZA 4UFIA 2QZRA 3QW3A 5AHNA 2GQ8A 2PWHA 3ZWTA 4P8XA 3L65A 4TQTA 4KT2A 3WQEA 2YCEA 3EX1A 4WR3A 3KLLA 1QPQA 3MZ2A 1A5OC 3WG6A 4V2XA 4CGTA 2E67A 4PMRA 1ME9A 5IBXA 3QQ1A 2IQTA 4NKCA 1RJQA 1EX5A 5D04C 3H2OA 1O68A 1P0DA 3KVMA 5H6HA 4O13A 1ZALA 4DO7A 2EHHA 2C79A 1PPIA 4IQEA 1XIDA 3P81A 4Y7EA 4D8ZA 3F4WA 1H41A 5LA1A 1X97A 4B5XA 4XAGA 1Q66A 2FVKA 3FOKA 4JR5A 2RUSA 3UCCA 1JYNA 1IYXA 2V5DA 2Q01A 5E6ZA 4XZHA 2PMQA 5E6YA 2DZWA 3THAA 1FH7A 1NF7A 1W2PA 1E56A 1VFMA 4UTFA 3ZM8A 2CZVA 3MKKA 3FXYA 4AF0B 2I5IA 1U30A 2XHYA 4EPKA 3QOKA 4JY8A 2A3CA 3G1HA 4AUBA 4I8YA 3BOFA 4X0NA 3OJGA 4PMJA 3PK7A 4JTJA 2DH3A 2GJLA 1EOMA 2QLYA 2YB1A 3N29A 1XICA 1DBTA 1W9PA 3H4WA 2HV5A 4UR9A 1XXXA 3LV5A 2XPKA 4ZFMA 1XLHA 5CSSA 4LQ1A 4KGJA 1AH0A 3NQ7A 1PCKA 1H7NA 1UR9A 1GVQA 1S5NA 2POTA 4HCDA 5EY5A 1J0ZA 1Q2SA 4KW2A 3A4XA 2VJXA 3G0SA 3MUZ1 3KL5A 3BCJA 2X41A 3O0FA 4FOJA 1V3IA 1O66A 1XIBA 3PZVA 1W31A 3LENA 5DT7A 3NDYA 3KAOA 2A6LA 1I2OA 2W3ZA 1J96A 1IT7A 1GVSA 4O0ZA 4DZAA 4KESA 1ONXA 2NWRA 3CHFA 4O54A 1JYXA 4GUHA 3PBMA 4GMEA 2EPHA 4LS2A 3B04A 2O7QA 3E38A 3U0HA 3AI0A 3EWZA 4HPXA 4XZLX 4DELA 4FNQA 2XWEA 3EZ4A 1J0IA 5C2GA 4EPBC 3C61A 3GTHA 4W9TA 1I1WA 1ODUA 4ATDA 4UNIA 3BK0A 1QBBA 4HZ6A 4OV9A 3VFLA 4L9YA 4E2BA 3MKVA 5FJRA 1PVNA 3LPOA 1TJPA 2Z1VA 1N55A 4JKLA 2G3NA 2P8BA 3LQLA 3SW6A 2D3LA 2OB3A 2VRKA 1Q7QA 3ZJ8A 4TTUA 3SGGA 2WBKA 4HK7A 4UTLA 3VNMA 3QMRA 3UJRA 3KDOA 1MRQA 4KKXA 1EJWC 2WQDA 4B5VA 1TCDA 3H53A 2YX0A 1G69A 5HNRA 3DAQA 4LFYA 3QC0A 2IKJA 2WM1A 3FHAA 4GZEA 5C9ZA 2QCMA 2OWXA 3C2FA 2ZKMX 4D6JA 1EC8A 3FSTA 1JPMA 3SUWA 2VQUA 4JXCA 2Y0FA 4JYDA 4RV3A 3IRDA 3PZQA 2OT1A 1EUNA 1R2RA 4B16A 3R0KA 1KBJA 4H9VA 5CJMA 1K9TA 3U9IA 1QNOA 2YCIX 1DPMA 4CU6A 5ABTA 5LA2A 1J2WA 4XKMA 1C8XA 3EEGA 1RZMA 1LQAA 3CUZA 2G97A 1PSCA 3KOFA 3MMWA 2A0NA 4FNPA 4GIRA 3P6LA 2XN2A 4JPGA 3RG6A 2X0HA 2FQIA 1KGXA 1Y5VA 2VZUA 2GGIA 2H3DA 4ML9A 3LBOA 4W4QA 2ZQ0A 3OA3A 1YX1A 2XOKG 1XIGA 2D73A 1QOXA 3C2EA 1HNYA 5AYZA 1MUWA 1L6GA 5HBFA 2CIPA 3A3WA 2WPBA 2PSNA 3G0UA 3HPFA 3LTSA 5HWNA 3NQVA 3DG6A 1P5BA 1EZ2A 1HFBA 4AH7A 3NG3A 3SRKA 1BD0A 5A94A 1QJWA 1QPKA 4N42A 3AOFA 4IOTA 3RDKA 3NQGA 3R0UA 4CD7A 2WWCA 1LG1A 2I5QA 1W1A1 3P8JA 1G94A 4D2JA 4XTDA 2UZ9A 3F5LA 3LERA 4GVIA 4UFMA 1PO9A 1WZKA 3UD6A 3W07A 3VFCA 4HD5A 3WLIA 2G5WA 3ALFA 3VKBA 5I24A 3GVWA 1SR9A 4HQVA 4HOWA 2D2HA 2Y7EA 3B9OA 2QCCA 4ZOBA 3LCGA 4NYUA 2J27A 4JN7A 1XSIA 3AIVA 4MNLA 2F6KA 3LX9A 4YWIA 5I3GA 3KL3A 4JKKA 4UNKA 1F6YA 4C6CA 4UQ9A 3DIPA 4FX7A 4HP5A 3PBUA 3UZJA 4X2PA 2PDUA 1JCXA 3H6OA 1WAUA 1UD3A 4E3VA 3II1A 4F2TA 5LHEA 1BAGA 3R8RA 4LVGA 2NLYA 5DANA 1W91A 2QCEA 1GTHA 5DN1A 2WM0A 4IX0A 2Y85A 3ABSA 3HA1A 1GQIA 5HUPA 4ONVA 4LYPA 3WH5A 3KHDA 1XGZA 3U48A 4JBRA 3ZT7A 4S3DA 1RH9A 1HO4A 1UUMA 2JKPA 4FIRA 2WLYA 2ALDA 2L5HA 1W3LA 2FB2A 2VFHA 4JTLA 4QTGA 2VTFA 1UUOA 3UPMA 1OVDA 4LYKA 1UYQA 1EJXC 2Y24A 3HV9A 3ITTA 1KFLA 4YU1A 1HJSA 3D3FA 3GHTA 4GI8A 4PEEA 2CU0A 3TZFA 3VE7A 2WJZA 4M5PA 1KQYA 3CHEA 3EWBX 4JHMA 4UOJA 4TVCA 2RGMA 3APTA 4M8UA 5KMYA 3FKRA 3I4KA 3V1HA 4YCPA 1X8FA 3W2KA 1EZWA 5T91A 4DN1A 5CAKA 5U4NA 4Q8QA 1BYBA 4E2VA 3HG2A 2E5CA 2DSWA 4ML4A 3S4TA 3C8NA 1FWHC 5AYXA 5CC5A 1A4LA 2BASA 2DP3A 3WLJA 3RN6A 2DFAA 5C70A 2BGQA 2D20A 5KZMA 1AJZA 1B3WA 2VFFA 4JTUA 3S83A 4TV5A 2XH7A 1WXZA 3W86A 4WKFA 2JIZG 3OVGA 4K8EA 4HOZA 4XX6A 4JTQA 4R9OA 3TKFA 4H8UA 1GEHA 2Z00A 1TMHA 4RNIA 4H4IA 3W29A 2V3EA 3IACA 1L6FA 5ECVA 3CIVA 2ZRXA 3APGA 4LOCA 1FWBC 3GXDA 2YFOA 3VIIA 3H4XA 5CXPA 2JJ1G 3V4BA 1K02A 4O19A 4OBSA 1UWIA 4TIMA 1B4EA 1E0WA 2Q8LA 3W7IA 4TO8A 4IIFA 1IZCA 2J13A 2QDDA 3LPGA 4W7UA 1OX4B 1YPIA 4JIEA 1NOUA 4AMCA 4BF5A 3WMLA 4JTEA 3THDA 4AHQA 3VIGA 1F3WA 5T8GA 3WQGA 2E1DA 2H9AA 3GC2A 1IQ8A 2RDXA 1BYCA 1SW3A 2JEPA 2VEKA 4FOKA 1V3LA 4I9JA 3AHTA 1EUAA 1NAL1 2ZC1A 4MY1A 1U83A 4Z0JA 3WYZA 4GZ7A 3T8QA 1R3TA 4XAFA 4H6QA 1H61A 5AC8A 1IGSA 3CWHA 1KGWA 5G2WA 1A5AA 2FPYA 3ME3A 2OJPA 1RSCA 3F03K 4HSNA 3CAWA 3GXFA 2DUZA 4GIAA 3BLIA 3E49A 2Y1HA 4OECA 2WHJA 4QJ4B 2HZGA 2Y7DA 2DZTA 3LHVA 3WF1A 4CNSA 1VKFA 2C0HA 4HTBA 4C60A 3QH2A 5CPSA 5ECUA 2R1PA 2PD5A 4HJFA 2VR5A 3VO0A 1UZHA 1P6WA 1QOQA 3VMPA 1ZP3A 1OC6A 1XL9A 4UTJA 3SJNA 3WENA 1TZ9A 1XIEA 1KD0A 5HDRA 4CVWA 2XVGA 3LBMA 2A7PA 2BDQA 2QVNA 3E9AA 4Q8UA 1OSEA 1WDWA 4PRWA 2GVLA 1XUZA 4O8RA 1A50A 3IPWA 2F84A 1W9VA 1GEQA 2E4TA 5M03A 3LRMA 1P4CA 3GUGA 3N2CA 3CBWA 1YBQB 1OX4A 3NDZA 3N2MA 3OQEA 5E5CA 3UY8A 1KNWA 1LOSA 4S38A 3RLVA 3ONCA 5FEPA 4M1RA 2I9UA 2ASHA 3N15A 1HVQA 4AC1X 4UR7A 4N7QA 4MADA 2V2CA 3TMQA 5FKYA 4FF7A 1E6NA 3IUDA 3E02A 3WBAA 2PDHA 3CEUA 4H7ZA 2WPDG 1XYAA 3HMCA 2ZUNA 1MRAA 4I7VA 1FWTA 1W6TA 4PCNA 4UTTA 3RCYA 2IQDA 4HA0A 1WKDA 3VILA 4RPQA 4FF5A 3MBDA 5CH9A 3FJ6A 3ZLFA 1TIMA 2YBVA 1JXKA 3GE7A 4F9JA 3CL6A 3OZMA 1HJXA 3ARTA 2FPTA 2B0MA 3TP4A 1A80A 3MC5A 2IKGA 4MJ4A 5TD4A 3N12A 4ZTYA 1HKVA 1FX6A 4WOQA 4PUNA 4QSFA 3F1QA 4G8TA 1MUMA 2ZZ1A 3ITLA 4W5ZA 3IJDA 1OFQA 3UEQA 2PBGA 4AWEA 1NVMA 3QVQA 1TV3A 4O17A 2OVLA 1ITCA 1XCFA 1V3JA 5DXYA 3WD4A 4H8HA 1FVPA 1NFPA 2GDVA 4MWAC 1RK6A 2V82A 3GDMA 1E0TA 1R87A 3R89A 3T0BA 3GYEA 1TPUA 1W3TA 1DIKA 1HKMA 1XLKA 1TWSA 5A6SA 3AXXA 1JAKA 5M5DA 1RY0A 2A3BA 2JGYA 1AG1O 4I9MA 2HTMA 2DDXA 3C86A 1W2VA 5JMUA 3NQAA 1O60A 5FOOA 2HJPA 3BURA 4IL2A 2CERA 2WXDM 1QHOA 2E9BA 1IWBA 4A3YA 3S2CA 1KTCA 3LSBA 3S6TA 1DKWA 2WMJA 4O18A 1JPKA 4XAZA 1F3XA 3WNMA 3O6CA 4BS0A 3MCNA 3FJ4A 8A3HA 1NSJA 1U22A 5FA5A 5J5RA 3CLWA 2EKCA 3AZTA 4XZIA 1PTAA 1BWKA 2JKAA 1GTEA 3UWEA 3NGFA 1PKMA 5G4WA 3ANUA 3CL7A 3K46A 1CGXA 3PZMA 1MFVA 4PR4A 3MSDA 2OLAA 1J6OA 4HMNA 1TFVA 3TTEA 1R6WA 3NPUA 4W8LA 1BWLA 4CQ8A 2X1IA 3T1GA 4KCVA 1ZJHA 1XLJA 3UVIA 1UB3A 3B03A 1HGWA 3BLLA 2ZX7A 3L5LA 2FH8A 3CT7A 1B0IA 1E1CA 2DQWA 2D22A 3MPGA 4Q4KA 4O12A 1PV8A 1GHSA 3IVSA 1JYWA 3LHZA 3LI1A 3CZEA 2MNRA 3L2IA 1LLZA 4GFIA 2CLIA 2OSWA 1W8SA 2A3AA 2ZX8A 3GU1A 1ME8A 3NM1A 1DJGA 1KFBA 2HDJA 1M01A 4C6MA 3NZGA 4XIAA 1F6PA 1XF0A 3KLKA 3EA3A 5HANA 2QXWA 1FY6A 2B7OA 1BQGA 1CB7B 1XYZA 3MYPA 2VP8A 3SJ3A 1FHVA 4Z1CA 1WDQA 4Y8FA 2VD8A 5BRQA 4HN8A 4B92A 2DGAA 2O0TA 5AECA 1UW9A 2XIIA 5JBEA 4AISA 1KC7A 3TCEA 4V1YA 3N6HA 3ENLA 1PWLA 2JBMA 3B4YA 2PWFA 4I5XA 3N4FA 4IMCA 4L1WA 4RLIA 3C0LA 3TYEA 1KFJA 4J40A 3WH7A 1T8XA 2P76A 2XZ9A 4REQB 1OFDA 1H09A 3H8AA 3KVJA 4GCAA 4P7RA 3P5YA 3VYLA 3QV9A 1I0BA 4NL1A 3UFYA 2ZDRA 3CLMA 1KM1A 4GISA 2W5FA 3I4EA 2R1KA 1IF2A 3C3NA 1WKFA 1ODZA 1BQCA 4YVVA 4L6OA 2OEKA 1M7PA 1CGUA 1SJBA 3UY7A 4XO7A 2QPSA 3COTA 1JNEA 1QK2A 3NNTA 1UMLA 4IFOA 2GQ9A 2VC6A 1M65A 4Q4MA 4CQCA 3IJ7A 2V3DA 5BMXA 3VMOA 2C7FA 2VX4A 1JQVA 2NUYA 1XSKA 3QF0A 2ZRZA 3TJIA 2QUNA 1KKOA 1KRAC 5HQEA 1KXVA 4ZFCA 1WOAA 4DBWA 2QCDA 4HIBA 4QAWA 1BGAA 1UOKA 1OFPA 2EQDA 3M4HA 5BWAA 2W27A 5U7SA 3LUTA 1HO1A 2EPNA 1E3XA 4L4PA 1NM9A 2IKIA 4FR1A 3W2UA 1TUXA 2CCRA 1EEPA 4QG9A 3VIPA 3FY1A 2R94A 1E70M 3VIOA 3N3MA 5A8GA 1KWKA 2B7NA 4E8DA 1QFEA 4DBDA 2FHBA 4MPQA 1OFAA 4ICMA 4ZXOA 4EF9A 3LDVA 4M82A 1RV8A 3P82A 2YL6A 2OQLA 1WAWA 1W9DM 1ISYA 2GGHA 4FOUA 3LBCA 2ZZ6A 5FF0A 2CHRA 3K4WA 3LI0A 1DWIM 1XPGA 3WLOA 4REQA 1MWOA 3I6EA 4AD4A 1GPWA 1BWVA 2HCVA 4W87A 1GJPA 3W53A 5JQ9A 2BY3A 4AZIA 3W74A 4IFRA 1L6SA 1I45A 3HN3A 4GG9A 1IXPA 1Q6QA 1HP4A 3UETA 3SRFA 5KINA 1R86A 3QPEA 1M41A 1CIUA 3CV7A 3CH0A 1JCYA 1H5YA 2FTYA 4RZ6A 1D3HA 5AC5A 4M19A 2Y8VA 3R13A 5LSMA 4C65A 3W7PA 2DY3A 1RP9A 2X8RA 4IJBA 1A5UA 1ZFJA 1OEPA 1ESWA 1PE1A 3G22A 4LT9A 1EBGA 4M51A 4MSSA 3EB3A 4AHOA 2WO5A 4NSBA 3N04A 4NAEA 3S6DA 3VD7A 1Q5MA 3BVJA 4J28A 3K8MA 3TJ4A 1FFRA 3E96A 4B3KA 3S9IA 3WLSA 2ZUSA 1ZP4A 3MS8A 1RQBA 4AD5A 3TFXA 3TU9A 3NL6A 4AVOA 3LG3A 1KB3A 1MQPA 1BVNP 4HZMA 3P62A 1OGSA 3TK7A 2Z1SA 3GG8A 2YYUA 1Q8AA 3WLTA 4A8LA 3C5QA 4DUXA 1DQUA 3MI2A 3BSGA 5DY3A 4LRTA 3S8HA 3W83A 4YXWG 3WO8A 3A9IA 1YQ2A 4JFTA 5A6TC 5IXEA 1GZ1A 4ZB5A 5B7YA 1JXJA 4MWAE 1YHTA 3GNNA 1IEXA 2DSUA 2C6QA 1DJWA 1VLIA 3MUCA 1EGZA 2PDJA 3BTNA 3GXTA 3O3RA 2FMNA 4J1OA 1PZ1A 2PUZA 3T6CA 2HPMA 4H6RA 4JNYA 6ALDA 4BI5A 5CC3A 3R1ZA 4ZODA 3R43A 5I3KA 1XRTA 2RGLA 4LRSA 1JCLA 3BXWA 2Y4SA 3STGA 3W7EA 4HPJA 1WPCA 3M0JA 3IGUA 3WLLA 4GUJA 4MJZA 1S5MA 2RDWA 4F0RA 5D2VA 1FFQA 2WVVA 3HV8A 2QJHA 1UR2A 4PRRA 1W9XA 3RR4A 1SFLA 5K2ZA 3U5YA 2EBNA 3A21A 2PF8A 2Y70A 4OVXA 3UZWA 4J5NA 1O5XA 1EJVC 4JS3A 3M46A 2XM2A 4DXXA 4RKAA 2GDUA 1EWDA 3QSRA 3W1QA 3NXFA 5F4WA 3HGSA 2D3NA 4J3VA 5T26A 1O5KA 5BRBA 2YFNA 2QQ6A 1ISXA 3RO6A 2ZUWA 5AC4A 1OY0A 4XZ9A 5LIXX 2QPXA 4HBKA 3AMGA 1P43A 4A8IA 1T0OA 3GNDA 2TYSA 3E0WA 2IPWA 3IJ6A 2PDLA 4QXIA 2PRLA 4L4MA 1ML1A 5FF7A 1KBLA 2OFJA 4Q4OA 1LZOA 4HK6A 4W7WA 2HLDG 1YXCA 4Q4PA 2HWGA 4B5SA 1FA2A 3W0KA 1E4MM 3RPDA 1WDPA 5HNTA 1IZKA 3EPNA 3R11A 1I2NA 2WYSA 5IM51 3ZZ1A 2C18A 1HJWA 4NJJA 1Q65A 3HPZA 3CUGA 4MDOA 3GLCA 3DG3A 2VGBA 1JRBA 3EMZA 1V6XA 1UH3A 3K2GA 3I3DA 4DPQA 5CG7A 4LVDA 3GG0A 5HPOA 4BQ5A 1GVFA 1DIDA 3AXMA 4X60A 4JEQA 2ANUA 3OBKA 3AZRA 1ZAJA 1V3HA 3I7RA 2YW4A 1TZ7A 1XW8A 4F3HA 4LEQA 1L0PA 4ZBCA 3LN3A 1A4MA 3W76A 3CO8A 4K6AA 4ALDA 1Z41A 4PTMA 1XLEA 1NY1A 4IPJA 3VI2A 2BX7A 3NSNA 1DTUA 4Y9NA 4DXKA 1MUCA 3VM5A 2GJPA 3W3OA 1E3ZA 1JG9A 2XSBA 3F5KA 3Q94A 2XGBA 1LLWA 1WYIA 1W5NA 2OR2A 3TJLA 3EKZA 4JFSA 4NJIA 1MNZA 1GYLA 1S1RA 5G5IA 4WXZA 3T0CA 4O10A 4PN2A 2OX1A 3KDNA 4L4OA 1SO5A 4F0SA 4AZCB 4DO5A 3W7KA 4QS6A 2WCAA 3WLPA 3W2LA 3VOIA 3L12A 3VUSA 1KCLA 1M7OA 3A64A 1OYAA 1P0BA 2J8FA 3UCDA 1Y65A 3VE9A 3GD6A 4L5ZA 4CNOA 3DOPA 3PWIA 4HPHA 5CAHA 1ZENA 1RCOB 1ZTVA 1B30A 3DFPA 4IGNA 1GZGA 4AIEA 3L4YA 1UD5A 3FJNA 2ZVIA 3REQB 3WDPP 4PMNA 2XM1A 1UKTA 1OT2A 2FLIA 1O4UA 1CLVA 4IP4A 1JZ8A 4X63A 4ROPA 1QW8A 3E12A 4UTWC 2ZDSA 3O2LA 2WC7A 5C6MA 4XBJA 4ZZ9A 3UZZA 4RZBA 4AX6A 3WH6A 4JTSA 2IXVA 1EBHA 3W1PA 4O50A 3PP7A 1N2VA 3PBYA 1J8VA 2I57A 3CQJA 2V2DA 1BEUA 2GZXA 2NXHA 1KM0A 4N2YA 2PDWA 4RR4A 4X0VA 2AQWA 3FNDA 3FN9A 3H2CA 3P7YA 3KRUA 4W5UA 2G4FA 3ARWA 1OFBA 3STCA 1WBJA 4DJFC 2O9TA 1AA1B 3ZT5A 4D6HA 1A3HA 4WDXA 1CXFA 2GSJA 3SCNA 4GBDA 3GS6A 1L8NA 3NYZA 3W72A 4KBXA 1OK4A 3U3HA 5I23A 2EPMX 5DBTA 4IMGA 3VKAA 1YKWA 1S39A 1LJYA 4AW7A 3WDIA 3LRKA 4IMFA 1W32A 4IICA 4EE9A 3U2EA 4YVPA 3FKSG 2FFIA 4ATLA 1XUUA 1QXLA 4KFOA 4IMAA 1B9BA 1QNVA 1E71M 4IG2B 1KBBA 3OU8A 4UOQA 1EF3A 4IPNB 3DI1A 1JUKA 2QDEA 1Q13A 1QNPA 3NQDA 1XKYA 3OP2A 1RLDA 2PGFA 2AGTA 4H7VA 4DRSA 4K7VA 5D2TA 1G7UA 2DUAA 5A69A 2OO6A 4S3KA 5E93A 3U5UA 3W1AA 1EPVA 1EJRC 3C0JA 3AJXA 1DWAM 4JN8A 4LUJA 4FPSA 4K39A 4X2RA 1GW1A 3KBSA 2OZ0A 1TE6A 3LYEA 1D8CA 2NXGA 3B8WA 3CYVA 3CEPA 4J4KA 4L9ZA 4OGZA 3SI9A 2OQHA 4KWOA 4Q4QA 5FAGA 3N2BA 2VX6A 4A8RA 4YLWA 5LIUX 2WQPA 3GR8A 1VFOA 3NCOA 2CLKA 1FXQA 3VOFA 3TLQA 2GFTA 3GTIA 4GA8A 1EA9C 3CMFA 4DI8A 1XYFA 3BUVA 2YCLA 4I9AA 4S3GA 2YPIA 1LL7A 4D8LA 4RE4A 3VTRA 1VBUA 2VC5A 3ABZA 1I4NA 2JGQA 4QQ3A 5G2IA 4D6FA 1XC4A 3SADA 3ZVHB 4KFPA 4GFSA 5L9FA 3WMCA 3PHAA 1OGGA 5AY7A 3MSRA 3RJXA 4I3GA 3GIPA 3GHRA 3W7CA 4B2DD 3TNBA 4ZO6A 1JFXA 3AJ7A 1V0NA 3B3DA 4TVDA 3SECA 1NFGA 4LCQA 3BLPX 3USZA 4IPLA 5EB8A 1TREA 2JDIG 4Y2WA 4ZMGA 1M1BA 4D6CA 1OBAA 1C8VA 4UMBA 4O52A 3GUWA 3QW4B 1M5WA 3W7HA 1V93A 3LS9A 3AZSA 4GXWA 3WJSA 1JF5A 2PWDA 4M6QA 3MO7A 1TMLA 1J79A 2TPSA 4K38A 1THFD 3ANYA 4BZYA 3CAQA 1IEWA 2R9RA 3WK0A 3QXBA 2BNJA 1E15A 2ZRUA 3OVRA 1CXEA 6CGTA 3EX4A 5DEZA 3STFA 3LCHA 4DUVA 4ZGYA 1NWSA 4F8XA 3I65A 3V0UA 1SM9A 1DEDA 4E4UA 1HIZA 2J9ZA 1R3YA 3TC7A 2XIMA 1NDWA 2KX9A 4YHEA 3G1RA 3UJ2A 4DXVA 1YE4A 3A13A 3G2GA 5B7ZA 1ZL1A 4TVUA 4AQLA 2OKOA 4GRSA 2E5DA 4EANA 3VOJA 2B4GA 4WUIA 3F4DA 1T41A 3KBVA 3TXZA 2FGZA 5D2XA 2PPGA 1TPFA 2ESCA 3TOYA 3ZIZA 3OZOA 1ECEA 1QHPA 2XFWA 3W1XA 5HQMA 1UIOA 1Z89A 1YYAA 3CK5A 1YADA 3EBVA 4KEZA 2TSYA 4ZXLA 3SCQA 1DVJA 1HKWA 2NX9A 4F9DA 5A1AA 4E3TA 3Q45A 2ACSA 1WA3A 2UY4A 4DJDA 2XNDG 4K1WA 1QNSA 4HU8A 3R7MA 1EGVA 3MMDA 1FCQA 4YIWA 3MQTA 3UCQA 1FWGC 1VGAA 3T4WA 2A7NA 3NQCA 1VS1A 3M6DA 1MW2A 5IBXC 2WVSA 3DCPA 2P3EA 4UQCA 1RA5A 1EQPA 1PYMA 1DXIA 3FAXA 1I8JA 3S1GA 3E5PA 5D37A 3KOXA 1VEMA 1K9EA 1UA3A 1FDZA 4QEEA 1C7TA 3WQWA 2W79A 4PB5A 3GBEA 3O07A 3ITYA 4IUOA 5HMDA 2PGEA 3L9CA 1Z8AA 1U1HA 2ZRVA 3L0GA 3M9YA 4DJED 1T5AA 1TPVA 4LAMA 4PEKA 1R3VA 5TNVA 3UXKA 8TIMA 1VQTA 1IR2A 5SWUA 2DZBA 1WP6A 5ABGA 2D1ZA 2ZA2A 3CZLA 1GQNA 3NA8A 4W93A 1ITUA 2AOSA 4EOUA 4GJIA 3P0XA 4W88A 3V5FA 3UNTA 1BRLB 2XG9A 4C6DA 3TYCA 4S3AA 1AW1A 1YPXA 1PWMA 1VYSX 1UD4A 1XV8A 4MLRA 1UZ4A 1E6PA 4AEEA 4MIMA 3O6AA 3M0XA 3GDRA 4UB9A 1TRIA 3Q65A 5I79A 4MNKA 5IFTA 3GH7A 3M0VA 2WJDA 2CW6A 1VFSA 2EO7A 5CZTA 3G1AA 3N6JA 3H21A 1S2CA 1PS9A 3BANA 1LYXA 4MDPA 1SFTA 3WJZA 1KFKA 3DERA 5G1MA 5I09A 1V6VA 3CO4A 3WH8A 5KZEA 1S5TA 1HP5A 4FLOA 1W1B1 3EDDA 3W02A 1YNYA 3VNYA 3MMTA 3MUY1 4JKMA 4H1ZA 3LOTA 1ZJIA 5A95A 2VT0A 3VC6A 3RX4A 1ECQA 2DIEA 3L68A 4PGLA 1JZ2A 3W81A 3MA8A 3DEQA 5K7JA 3QEZA 5CPMA 3H54A 2OLHA 3GZ3A 4I6KA 3TOPA 4LV9A 3GU2A 3BW2A 5EFFA 3THCA 5HMSA 1YXYA 4AEOA 4J7RA 1QHZA 1LTDA 3GAKA 1IWPA 1PIIA 1AVAA 1MZRA 1UR3M 1VBGA 7REQB 3SURA 5GJMA 4KETA 4M0XA 3CAVA 4OKDA 5FEZA 1TKKA 4QR6A 5HNUA 3PG8A 3SQSA 3E6EA 2QJNA 1LG2A 5F1VA 4IGMA 4BI6A 3NJ3A 1VHNA 1E43A 4O53A 4QX4A 1VIWA 1PCWA 3MSGA 3IEBA 4AIUA 6XIMA 2C8NA 3W71A 3CXOA 3AAGA 4PUEA 3T2QA 3PPHA 4BR1A 2DT1A 1JVNA 2OODA 4DWSD 2OT0A 2E3ZA 3THQA 2XVLA 3K30A 2GL5A 1SVDA 3A5FA 1B3ZA 2YA0A 1KCXA 4QISA 3WZ0E 4QLLA 2WANA 3OEEG 1WXJA 4NAFB 1C92A 1QNRA 3GG7A 4PSRA 2VXNA 1DXFA 2BXZA 3BAKA 5C7VA 3N9SA 2NVDA 3W01A 3AHVA 2WMIB 1JF6A 1S2TA 2X40A 1VYPX 2YLAA 4A3HA 1GVIA 2V63A 1MXDA 3TVAA 3T55A 2YW3A 1P48A 3G3MA 3AYRA 2QHAA 5AHIA 5BU9A 3NXLA 3G6MA 3F4CA 3HM7A 3QFEA 3GDBA 4XVDA 4K3ZA 2FDMA 4Y6GA 4CD6A 1HJUA 3MO4A 4UQAA 4V15A 5BXPA 2JFEX 4DX3A 1LBFA 1LDCA 3QBUA 5M3WA 3HB9A 2NQZA 3RU6A 1RHCA 3WQDA 4LUIA 4F0HA 3R10A 4HHMA 3UZXA 1UKQA 7REQA 1I0DA 1EHNA 4PTWA 4DAFA 3GYCA 1QI2A 2QUUA 2QULA 1JGIA 1GJUA 4RK8A 3VKCA 4BCEA 3W70A 5BXRA 2FKPA 1VFLA 5HWJA 1L2UA 1UJQA 1QO5A 3TCSA 4Y9MA 4AG0A 4Z2JA 4PMXA 1US0A 4CQDA 1MO0A 2VEFA 1L2QA 4MYXA 4Z0SA 1B31A 2YCJA 4JQ3A 5KETA 2WZTA 4N4QA 2PTDA 2QEZA 4CNPA 5LNRA 3KZPA 4JIRA 2YJQA 2J7DA 1YMYA 1E5NA 3J7HA 3G1DA 3FEMA 4HHPA 2FIQA 2VRQA 5FJJA 2CESA 3TXVA 2CKSA 2REQB 1OZQA 2HBXA 3PFMA 2RH9A 1VBHA 2DW6A 1FH9A 3UXDA 3RRXA 4LV4A 1GK8A 1OX5A 1PKNA 2VEPA 2XFYA 1Q7ZA 4RW5A 3BLEA 4NZ4A 3W7QA 4EAYA 5D9PA 4Z2HA 1UBPC 2VWSA 1LWHA 3AMDA 3T7VA 1X1NA 1K8YA 1XH2A 4RZ5A 1UKSA 2WOQA 1J0KA 4NXSA 3CQHA 2VCCA 2E6AA 3PPGA 3WLRA 3WD1A 3NO3A 1GWJA 4A2RA 2D0GA 3QGAC 1FWAC 4AMAA 4Y8EA 4MKSA 4GPNA 4KMQA 4Q8NA 3OBEA 2OSYA 1W3JA 2IPFA 1X1ZA 2ON3A 6PTDA 1QR7A 4QS5A 4DUWA 3WLMA 3FXGA 3ARQA 3IJIA 5FL1A 1AZ1A 2I7GA 4GO8A 4M56A 3VOHA 4GYPA 4AY7A 3WELA 1EC9A 1Q6FA 4FNSA 4WJEA 1YIXA 2X1SA 3HU7A 2QS8A 4ASUG 3W2MA 4B2DA 1LP6A 1K7FA 3BAWA 5FESA 3PAJA 3WKZA 2ZOXA 1ADOA 1H4PA 1V0KA 4WLCA 5ABHA 1UD2A 3A4AA 1U5HA 3QY7A 1AFSA 3RFAA 1ZBVA 3C2VA 1M3UA 4LF2A 4LUYA 1IHIA 4JOMA 2X7VA 4WSKA 5LHFA 4QFUA 3GHSA 3VMNA 5AYBA 4GXMA 2REQA 2VDHA 2ISSA 3O63A 1VZWA 3N73A 1PX4A 1D9EA 1Z3NA 3IANA 3OYXA 3E0VA 4S1FA 4F0KA 1B1YA 3JVAA 4X9YA 1Q6GA 2WHLA 4UCFA 2DZPA 4HTYA 4FALA 1RP8A 1V5XA 3IGSA 3EPOA 5AN7A 4B5WA 3AHZA 3CC1A 2ZFAA 4WVXA 2PRHA 3M0MA 1C91A 9XIAA 5BNKA 4IPPA 6REQB 1O94A 2ACUA 1TB3A 4AAJA 4EK7A 4HSHA 1QUMA 1DYSA 2WZIA 3SZ8A 4B90A 3EA1A 1VRDA 1QW9A 4NX5A 1E40A 1UWAA 2YSWA 4ACZB 4N9EA 1IIHA 1K6WA 1RQHA 4IFKB 4K36A 4HNUA 3IIPA 1MW1A 4JGDA 2AAMA 3IARA 9XIMA 1G4EA 4MB3A 1GORA 2CZ5A 3CHVA 4G6CA 5E0KA 3POHA 1UPPA 2FGBA 1ME7A 1UPMB 5A6KA 3DZ1A 1IGWA 5GQBA 5EMLA 3SSZA 3JZEA 1X38A 2V7QG 1QWKA 1CEOA 3BL3A 3DDMA 2R91A 3WH9A 2W67A 4LEFA 3C2YA 4HPGA 2Z1WA 2X7WA 3R12A 1H0GA 5HJLA 4LBUA 3VM7A 5D9OA 2X16A 4QLKA 1Q4NX 2DZSA 2WK2A 3M41A 5MKGB 2DZXA 2ZUTA 3WQ6A 2GQ3A 3W1NA 1S2WA 2FZ9A 3KUMA 1UASA 4DO6A 3SB0A 3VIFA 1SZEA 5I06A 3FV9A 4RE3A 3FA5A 1NWTA 4H3DA 3NQ2A 4MF4A 3LM3A 3RXZA 4ZSTA 2PU1A 5AOUA 3W82A 3CHCA 2GK1B 1OD0A 1X39A 3VAVA 4R5EA 1XYBA 3RCMA 2GDQA 2UV8G 4FI4A 1TCMA 4DJEA 2QNEA 1AH4A 5FJIA 3T05A 1UZDA 1E0UA 2OLSA 4R88A 3KBNA 4NILA 4C6PA 3DHUA 4HZ7A 1GOOA 2P88A 3PTDA 3G1YA 2AAAA 3QY6A 1LRQA 3ELFA 2JQXA 4KERA 4PULA 1EPXA 1MZHA 3GXNA 1AJ0A 2ISDA 2AL2B 3R58A 4CCCA 4H7CA 4IQLA 4JDYA 2YIHA 4XAYA 2Z24A 1QU4A 1JIBA 3CHDA 4DB7A 2NQLA 1WUFA 3SUSA 3ABQA 2XU2A 1T8QA 4EXBA 2WJFA 4DWSB 4QSHA 5JVLA 4JQ4A 2F2HA 1V02A 3RX2A 1VFHA 3ZMRA 4XD3A 3RILA 4WSHA 4CCDA 1DTNA 4YL2A 4RV8A 5C2CA 5FF2A 5MKGA 1QBAA 5I02A 4JD4A 1LM1A 1V8EA 4ZQPA 2RFGA 1GJWA 4EF8A 2F6UA 6ENLA 1ZJAA 3EDEA 1WDSA 4UTTC 2C16A 4HNNA 5ENLA 4C1NA 3IJ9A 2Q8XA 4WEVX 1XS2A 2W92A 4JEJA 2J9YA 1AQ0A 2PDGA 3ITXA 4LX4A 1W5QA 1QAPA 3S5NA 4WJ8A 3QMSA 4RDWA 1VC4A 1W1ZA 1XLGA 2QCFA 3ECQA 2VM8A 2WKJA 1XCWA 3QR3A 1RCQA 1DJZA 1AQFA 3EAUA 1BXCA 2GGEA 1H62A 2X2GA 3W7OA 2CXEA 3WNOA 3N1AA 2FGLA 1SYTA 3UBPC 3NUKA 4KEMA 3TQKA 3RPTA 2RJHA 3NFUA 3GC5A 3E0FA 2X1TA 3PC0A 3S1UA 1BTMA 3L23A 4IMDA 1VD6A 4PCPA 1UR1A 1F61A 4HA3A 1BVWA 4O4VA 5LXEA 2QKFA 3VDGA 9CGTA 4DWSA 2I14A 1A5KC 3ZIAG 3GNPA 4AY1A 1O1ZA 4H9TA 3SIMA 1HQTA 2J9XA 2WZMA 4NP7A 2R1MA 1DJQA 1S5WA 3CPGA 1Q4WA 3G8EA 1ZUAX 2ZZ3A 3IWPA 1H11A 2BHYA 1XQKA 4NJKA 4HU0A 3L66A 4PA8A 4G1NA 3S1VA 1BG9A 1IEQA 2CETA 3AXIA 2ZUMA 5JIWA 1K6AA 1R8LA 4IMEA 4PRTA 1D3CA 3HFYA 2NW0A 4F0MA 3W7MA 1LBLA 1CGYA 1Q45A 4IIEA 1JR1A 1JDAA 2CLMA 4EKJA 2Z27A 3W7NA 4TX8A 2JEQA 2NXIA 1XGDA 4CVUA 4KF1A 4UTKA 3MZNA 2FMOA 1GQKA 4PL2A 1R47A 4FAMA 1BKSA 2UBPC 1FQ0A 2QJMA 4UTHA 4S2CA 4YNGA 1V77A 1FUYA 2OO0A 2E8YA 4N9DA 2V5LA 3TFCA 4WJXA 3LCXA 3RNDA 1FHLA 3V3WA 1G9HA 3NZPA 1J12A 1A0DA 2ADAA 2CLLA 2B7QA 1KO0A 3EDJA 1TJRA 1RPKA 3QYSA 4Q8TA 3VX0A 2PWUA 3U4AA 4Z1YA 4TR9A 4R33A 4KCWA 1KFWA 2FH6A 1OCNA 2OCZA 2QGYA 3PB2A 3VOGA 4HT3A 3ARRA 2PC8A 3CIXA 5D2WA 2NVAA 4QE5A 5BCAA 4PFHA 4GY0A 1PXGA 3ABXA 3CUHA 2TODA 4UUIA 2Q3RA 4XZBA 3PFRA 4CUCA 4AZ5A 2VMFA 4LAKA 2FDSA 1XHGA 3HJZA 2Q3OA 3EKGA 3UWZA 3BW4A 4P7QA 2PLCA 2O92A 4IT1A 3VABA 5JH2A 5J5DA 1K8CA 1RD6A 4AZHA 1FCUA 3PWAA 2ISWA 3T78A 4RW3A 3LU2A 3WQOA 3KWSA 3H2FA 3ARPA 5AKQA 4B3LA 1A5SA 4GCXA 3GW3A 2OWCA 3E3HA 1FWRA 4XZWA 1GNXA 3EGJA 3N11A 1DJHA 4U2ZA 3H4GA 3UWVA 4O1CA 5FIPA 3HQOA 2Z2BA 3V1PA 4YHGA 1D7FA 1F7BA 4V1XA 1AH3A 3UWWA 3WX7A 4P8WA 4NNCA 3SQMA 1MI3A 2Z6JA 1GKQA 3EX3A 3IIOA 2EPLX 1Z42A 4D6IA 3RMEA 3BG3A 2O4QA 3AIRA 3DGBA 2DT0A 1FKWA 2J6XA 1W3HA 2KZHA 4C7DA 2HBVA 2ACRA 1JDDA 3DESA 1US2A 1XP3A 2VRJA 3AWOA 1YTDA 3HQNA 1T40A 1VRXA 4MZ1A 2GJXB 2AL1A 4BWLA 5LA0A 1TQJA 2HXTA 1U2YA 4WDTA 1FTXA 2PTWA 3WDQA 1HL9A 1J93A 2XH2A 5DCBA 4RE0A 4HU4A 3OYZA 3VCRA 2WWDA 3AMCA 3U2CA 1CTNA 3WF3A 2ATSA 5EMMA 1L6WA 4WK9A 3GH5A 1TELA 4QROA 3SY1A 3TSBA 1DQWA 3VVGA 5EMKA 1WOBA 4ADSA 1BGGA 4ORMA 4UFKA 4DYEA 2PU0A 4JZ5A 1DIOA 4MAVA 1V08A 1A5LC 7ODCA 1ZCOA 2G96A 1FRBA 3KCLA 5CZ0A 3AYSA 1WKEA 2JF6A 4CNNA 3PZ9A 2H90A 1DORA 2EJ1A 5BWFA 3BJFA 3P14A 3PY2A 2EGZA 4GH1A 5D09A 4LALA 4XISA 4LUSB 2YL5A 1E4LA 3WFZA 3ZJ6A 5EMYA 3ICJA 1MYRA 3R6IA 3T0AA 4ACYA 1CCWB 3R25A 1U1JA 4P7LA 3T42A 3DKJA 3T81A 3R5EA 5BZAA 3CMJA 3TC3A 5EGRA 3MI6A 1W9BM 2POZA 2GSEA 1DV7A 2NQ5A 1UKOA 5HPCA 2ZZ4A 4PB4A 4DAIA 2HVOA 2YBTA 4WY0A 3PBWA 3ZO9A 2V5JA 3AHXA 3VZXA 5EKYA 1FWNA 3MWAA 4S3BA 2GJXA 3C2OA 3ARYA 2F2KA 4OBTA 1F73A 5IHRA 2H6RA 4UOZA 2VFDA 2YKKA 5BOFA 3GTFA 4UZUA 3HFTA 1R30A 2WV8A 3ARUA 3GFYA 2Y2WA 3UESA 2P53A 4M6PA 3GKAA 1EYEA 4Z2KA 3TIMA 2ZX5A 3E2SA 2YR1A 3QHMA 4YTTA 1E0VA 2PS2A 1RLCL 4W89A 7XIMA 1Y5XA 4P5UA 1FWIC 2XIQA 3BV4A 1O6IA 1TPC1 3WF4A 4Q32A 3DHDA 3CV2A 1NF0A 2OZTA 4OIFA 2Y6ZA 2BGNE 3WFLA 1XIIA 3FJLA 1KCKA 3VINA 3SCSA 4D6DA 3SFKA 2HRWA 3DKLA 3V5CA 4B91A 3SCVA 3EB2A 1SMAA 1T99A 2QF8A 3MVTA 1YDNA 3WBEA 5C9WA 2WZEA 1QK0A 3A12A 4LUSA 5CC6A 2DW7A 3RPMA 5AHFA 2ZWYA 4EACA 2X2YA 2VX7A 2J75A 4XIMA 1WNOA 1XYCA 3CIWA 4FXFA 4M7TA 3OFNG 2EXOA 1ZJBA 3FA4A 1YDYA 4JNMA 5HNNA 7A3HA 4AF0A 2EF9A 2HE8A 2VENA 2Y8KA 3LCFA 4CD5A 2GVEA 3P93A 4LH8A 3QGVA 1Q6CA 4WY0F 3UGVA 1OADA 4ES4A 1X98A 3LHWA 5A6LA 3DXIA 3A47A 1QMLA 3BWWA 4QCEA 3BG9A 3UU0A 2ZXDA 4MJ2A 2GQAA 2G3JA 6TAAA 3BARA 4RXFA 3WSUA 1WQ5A 8XIMA 4M24A 3ZSTA 5AHLA 4ZOCA 2BVWA 3LLXA 5D05A 4ICNA 2FZ8A 1F9CA 2PWVA 3MDWA 3VIHA 3M43A 3VD3A 2VHLA 1HJQA 1KBIA 5AFDA 2F9RA 2SFPA 3KCJA 3B0VC 1OT1A 2VZVA 3N34A 3UG4A 1BPLB 1H1YA 4ROQA 4NZFA 1MVYA 2E6FA 4MY9A 2NZLA 3GFXA 3MCMA 4MNMA 7CGTA 5H8MA 3GNOA 5D32A 2ZXBA 1Z44A 2XGIA 1J5TA 2YOCA 4LYRA 1OF6A 4UTUA 5KZDA 3S5YA 1EH9A 2UY5A 1BYDA 1Y7VA 4HHLA 1A47A 1J0JA 4BHYA 2J88A 2Z1KA 2CKRA 5I3FA 1CB2A 4A6GA 2O4MA 4ZL1A 4BA0A 3TTQA 3NYDA 1CT5A 3MJMA 4JTFA 1G4SA 2DZAA 4UIOA 3BAIA 4BF9A 3RK8A 4MG4A 3UGRA 3L4VA 1E72M 2NV2A 2VYOA 3SCTA 3CTTA 1ZY9A 3PANA 4IXHA 4BFAA 4NY2A 5CQ1A 2PDBA 4KIEA 3WJYA 4DF1A 3C8FA 1TR1A 3B8UA 3DFQA 4U28A 3WBXA 2PZ0A 1J0HA 2Q71A 1UH4A 3AQUA 3WK3A 3PSWA 1EHAA 2ZCGA 4QGCA 1XC6A 1KQZA 5A6BD 4E2DA 1CPUA 2XVNA 4Q6JA 3HQ1A 2WSRA 2XTKA 4ZQRA 3UXLA 1MW0A 3WBYA 4L7ZA 1R0MA 1GCYA 5FAJA 3WK1A 4XV0A 1UD8A 3QV8A 3BMWA 3WNPA 1J9YA 3W26A 3BMVA 4A4AA 1TTPA 4URIA 1IEVA 2Y88A 2CBVA 3FKKA 1JUEA 3KVKA 3JZUA 4JFVA 4PMVA 3N2OA 2X0SA 3TYAA 2ACQA 1XBXA 2GPTA 2C71A 1KV5A 3SN4A 3B06A 2RHGA 3BSMA 3UA4A 4GACA 3OODA 1K9DA 3P80A 4J9JA 3TA9A 3SRHA 2QJGA 1E73M 4NZ3A 2WCSA 3VDBA 1JD9A 3CQIA 3FFSA 1TSIA 1ZU8A 3MKCA 3I3BA 2CFFA 3CZ8A 3IS4A 3WQ5A 5A2CA 2JALA 3QMTA 1L6YA 3HG5A 5A6JA 3DYPA 1WKYA 1XH0A 1ZHAA 3C2RA 1HKIA 1H51A 2DH2A 4JTTA 2IS7A 4HK5A 3N6QA 3M5XA 3KOYA 2XN1A 3GVGA 4JN6A 4EXQA 3OOQA 4OUEA 3CMGA 4E5TA 3G77A 2D2OA 2XIJA 2WNZA 2CLPA 3G8RA 2EEXA 3IJQA 1JNDA 1VCVA 1PTGA 2J62A 2PDNA 3QPYA 4Y96A 4D1IA 3VIKA 2PTZA 1C9DA 1MW3A 3BLFA 3V18A 1TVNA 3BW3A 4O1FA 2BOGX 2E6DA 3VA8A 5GPRA 1M9HA 2LLEA 4QITA 3AYTA 3L4UA 5RUBA 4OUIA 4LAZA 4U3AA 2ZA3A 3K1GA 1NDVA 1XIHA 5DBUA 3B0UX 3OG3A 4H9YA 3PF3A 3ZJ7A 3WLNA 4Q8MA 4CQ9A 1XFBA 3B8IA 5I07A 3EWCA 1DJYA 4BQ2A 2E0PA 2QMJA 1TO3A 3PS7A 1BXBA 4GQ0A 4Y90A 2J7BA 5D38A 5AVNA 3LGEA 2PGWA 2XWDA 3U6WA 1JZ3A 3OTRA 4Q8PA 4XVEA 3N18A 5LIKX 3G5EA 3H2EA 3BDKA 3M0YA 4OZOA 5HUOA 2BODX 5JH1A 3VD9A 2BV9A 4GUFA 2C14A 4GNJA 3W00A 1H8EG 2F61A 1H1NA 3VUPA 3KBMA 3CB8A 3C3UA 4XTIA 3HMJG 5IFPA 1QPRA 1RPXA 5EFDA 3GDKA 2OEJA 2FFCA 3OLIA 3O05A 4LBRA 3NEVA 3UWUA 3F4VA 4QP0A 1FWCC 2XVKA 3L4WA 3KBJA 1H2JA 4H00A 1SGJA 4ZO9A 4HU3A 3VKJA 3CASA 3D46A 5DN6G 4FK9A 2QCGA 4OOZA 1JRCA 1AQHA 2BXVA 3VNIA 3NURA 3GR4A 4GVGA 2G4JA 2QF7A 2YXOA 2Z2AA 4LXFA 1D7KA 3W73A 2J24A 2W66A 3TN5A 4GGBA 1FP9A 1UR0A 1RVKA 3CWOX 3LD5A 2J66A 3WJXA 4B5TA 1R2TA 4K2SA 3Q67A 3K4AA 2R1NA 2BVYA 2HK0A 3STEA 1E0XA 4CN6A 3THUA 1E51A 3ZR4A 3SUVA 3PTKA 2J7GA 4O11A 4P8VA 1BF6A 3VGBA 1Q8JA 3M1ZA 2VFGA 1OQFA 1TG7A 3SCWA 4FS9A 3AIBA 4IJRA 4CLMA 4DHGA 5M17A 4I9TA 2YL9A 3DHFA 1V79A 3VDHA 1SZFA 3K1DA 4ZA0A 2WSQA 3ATYA 2OKTA 3A5VA 5AHEA 3KS6A 3DG7A 1E6RA 2YLLA 5E1QA 4GX9A 4YMZA 4XUYA 1TJ1A 5XIAA 4H9XA 2V6AA 3WNNA 4LCSA 1XSJA 2FZMA 1WE5A 3GR7A 4MLJA 3CV1A 3BZJA 3L4TA 3P61A 2GUUA 4D72A 1I1XA 1PJ9A 4CN1A 1W54A 2VWTA 4KFNA 2VO5A 4HNLA 1E6SM 4FNUA 1DL3A 3ZYZA 4B15A 3EDFA 3IRSA 2ZADA 4PBEA 3NDOA 2WHKA 5ABFB 4MTVA 1ZBKA 3LZ5A 1A5NC 3TSDA 2ZZ5A 4WOZA 5LNWA 3GX9A 5CEWA 2JIWA 4HNVA 1LLOA 1JCMP 2PCQA 1W3IA 4LANA 4NI3A 4C6IA 2GSHA 4DJDC 3FS2A 3GW0A 2R1LA 3B9AA 4KGLA 2DVXA 2W62A 5I3JA 4HYWA 3R2GA 4ADTA 3EOUA 2AQOA 2CNCA 1FKXA 2PODA 3GTNA 2DT3A 4TMCA 2A85A 1JPHA 2NVCA 3NQMA 3RITA 3V0SA 1KXHA 5GJNA 4OV4A 3UYCA 4GKTA 1UQZA 3VDCA 1LWIA 1TR9A 1UMYA 3NQEA 3GNXA 1YBQA 1BKHA 1GVEA 4O1BA 4LUTB 3W2JA 4KEVA 4UTIA 1UZ1A 1HL2A 3M5YA 4OT7A 4TTGA 1KW1A 4LB4A 4D6EA 5D9MA 1YW1A 4K1GA 2PC4A 1LQ0A 2HISA 4O1AA 1J18A 1H63A 2HSAA 1UWQA 3S42A 4S23A 2C15A 1NARA 2YL8A 1N82A 3W28A 1W5OA 3BAXA 3EOEA 2ZZ2A 3W1MA 1DQXA 2G3IA 3KRBA 5DMNA 3OEHG 1RALA 5PTDA 1ZS2A 2ABAA 5ABFA 3AU6A 2PDYA 1TTIA 1YEYA 2DV0A 1LL6A 3MU7A 1IV8A 5EMJA 4AZBA 1UHVA 4W8BA 4JIPA 4YTSA 5A2BA 2CK3G 1P1XA 1XLCA 4MVAA 1W37A 2INFA 1FWJC 1W3NA 1Y5WA 1XJBA 2CZEA 4ILSA 3OAAG 3LPPA 2NLIA 5DCDA 3WLHA 2Q09A 1RJRA 4LNYA 3D5HA 1JULA 1RBLA 3MANA 3ABOA 4PSPA 3WQ8A 1BYAA 4L65A 3P74A 1EC7A 4HNCA 2WSYA 3AIEA 4M3PA 2CZFA 3RUBL 5MF5A 2WC3A 3H7VA 3DI0A 1OIFA 1J10A 3ALGA 4BF7A 4U3CA 5IOBA 3M6YA 5A6BA 4H01A 2X05A 5AYIA 1XLAA 2GVGA 2HXUA 3ES8A 3PN8A 1EDTA 1GOIA 2CEQA 3CQKA 3TTYA 1I2QA 4HGXA 1P0NA 5DFAA 5HQLA 4OHQA 1F8MA 1W9UA 2DORA 2DT2A 3OA5A 2DSZA 1YRRA 2ZICA 3M44A 1LBMA 4ZENA 3DC0A 4CD4A 5L6UA 4ADUA 3RLUA 2Z26A 5D30A 5DMLA 3WMBA 3BCDA 5HXMA 3AS1A 3RU8X 2J79A 1POKA 1OM0A 1PKYA 3SEPA 2JJ2G 3MHFA 4I7WA 2YCKX 3IAPA 2C1IA 4CNUA 4J35A 5GVJA 1W56A 3SY8A 3PM6A 3ITOA 2PCEA 2AMGA 1SO6A 2Y63A 2W63A 5BROA 5M2FX 3O06A 4KEUA 5CCZA 1LUCB 2V3FA 2O9RA 4N6EA 3SQLA 2WHMA 3L4ZA 4LVAA 3P0WA 2ODOA 3VNZA 2B31A 1E6QM 1FXPA 4NQ1A 3KHJA 4D71A 1SZRA 1TPWA 1XLDA 4K7YA 4L56A 4TU1A 5CGMA 4GWEA 2FTWA 3MI3A 5T9CE 3UJFA 4OFCA 1TUFA 2VEGA 4YYCA 1CW2A 1I75A 1EOKA 3TQ0A 3WN6A 3EOSA 1S38A 4JTIA 4OU1A 1XDJA 3KRZA 3AIWA 3WNKA 2OGJA 3GC4A 5CSUA 3U8GA 2X1RA 3L21A 3IV8A 4NASA 1WCGA 3PZOA 3SR7A 1EEXA 3N19B 1R9ZA 1A5MC 3XISA 2XN0A 3U7BA 4G56A 5AC7A 3MUIA 3ZSSA 5EPDA 3TYUA 4RDVA 5CJ5A 3BPWA 3TONA 3PUEA 3KOZA 1MQRA 6A3HA 2QCLA 1SFJA 4KWVA 5D8WA 3BG5A 2ZIDA 3HF3A 4QLJA 1QO2A 2V0TA 3VNDA 2YB4A 4QQUA 4HVXA 1SW7A 4YYFA 3GQYA 4KWWA 4N9CA 4JHZA 4CD8A 1UH2A 3IAQA 3PWGA 4JTHA 5I3DA 2W6RA 3TJXA 3WLKX 2BHZA 3PUGA 3U2ZA 2PI6A 4UFLA 3M0ZA 4AB4A 1XIMA 1DXEA 2YDQA 3TSMA 4Q7IA 4NF7A 3CM4A 3OQ8A 2V81A 1LUCA 4QM1A 3ZS4A 1NIUA 1JCTA 1NELA 1B2YA 1KR0A 2NSOA 3EPMA 4W85A 1A53A 4F66A 3V35A 1L8PA 1KLYA 1XDMA 5JBDA 1RJPA 1H50A 3H70A 3DFOA 1S2VA 1ISZA 1C8YA 3HZ3A 1J6PA 4ZEPA 1AW2A 3WF0A 4WGXA 1JUBA 3KP1A 3PTQA 2XINA 2Y7FA 4PE8A 3ZWSA 2P8CA 4FEZA 3M07A 1CGWA 2V5CA 1EP3A 4AD0A 2VC9A 1V6TA 4Z08A 1JI2A 1S1PA 4N6FA 3RO8A 4L64A 4GQBA 4AEFA 4UBPC 2D23A 2ZX6A 3W7LA 4ERGA 3PJTA 4UFJA 3ITVA 2J77A 3MTWA 4W8AA 2FZDA 1DHPA 1P1MA 5E9AA 4DVOA 1WXYA 1SSGA 3OVQA 4GYPC 4CCZA 2PWEA 3SAZA 1XBZA 3ABRA 1L9WA 2PP1A 4W7VA 1R9XA 2J47A 4RDYA 2C3ZA 1KWGA 1DIEA 1TJ2A 1QASA 1NWUA 1UJPA 3T2OA 5DMMA 4GIYA 1YNQA 2A3HA 5JXQA 2CLEA 3DFTA 1F05A 4LC6A 1A49A 2YDSA 2EPOA 4H41A 4DZ5A 3CGTA 4H9UA 3V36A 4UQBA 2IMRA 2CLFA 1DWJM 1FOBA 2RKXA 3QYQA 2ZE0A 5A8NA 4OQVA 4PFMA 2FHFA 5A6MA 1KKRA 1RUSA 3AFBA 1VJZA 4YWSA 1O7AA 4GNVA 3BOLA 3TR9A 2JF7A 3WIJA 4KRZA 3BO9A 3ZXWA 1EO7A 3NO5A 1FH8A 3G1SA 3CPUA 4E38A 2P50A 1VYRA 4BEQA 1VBRA 2PDPA 3KVLA 3SN0A 1K1DA 3VD4A 5FSEC 4JICA 5DMYA 3RYSA 1B9ZA 4NI8A 2CITA 5IHSA 2O56A 3WMSA 2E40A 4QG8A 4DLFA 4MUPA 3OGVA 4P7OA 1TWWA 1Z48A 1H60A 4PMQA 2IXUA 3ERPA 3MY9A 4R34A 4E8CA 1XRSA 1TA3B 1G6CA 5AVHA 4AXKA 1C93A 1JI1A 5K9XA 1S3TC 2VELA 5I77A 1HX0A 3F2DA 3NQ6A 1GG1A 3VGDA 3NZ1A 1LROA 1HJVA 1UCWA 4NZ5A 1F8IA 2HS8A 1X1OA 1XX1A 5B80A 3TN6A 4JTDA 3WDJA 3BC9A 3W6LA 1OFRA 4JIHA 1LT8A 1OD8A 4TMBA 3AXHA 1UD6A 4WHBA 1HZYA 3N17A 5H8UA 2HEJA 1ZCCA 3QN3A 5C5YA 3KP0A 1P6CA 2WMGA 1ITXA 4ZE5A 1JZ5A 5IRPA 2G3MA 5F2GA 3L2MA 3N14A 4C7GA 2DSKA 1PHWA 2W4XA 3GU9A 1V6WA 1CBGA 4O1DA 3GM8A 2W61A 4GIEA 1TX2A 4P7NA 1KLZA 4L4LA 3S9ZA 2H8XA 1XLFA 3NVDA 4AZGA 1BSLA 3E2QA 2D0HA 3T0DA 2YA1A 3M5VA 4DJEC 1TE1A 4G9PA 1OYBA 3POCA 1DE5A 1UR4A 4GC3A 1EO5A 4C6FA 4GO9A 1HXJA 2E25A 3BQ5A 2VDGA 3NSMA 4GINA 3TMLA 1EL3A 4IH3A 4S3EA 3IGHX 3W87A 4FO4A 3BE7A 1BLIA 1FDJA 1REQB 4G7FA 4U5IA 1B5TA 2WVUA 3QZEA 3AALA 5AHMA 5E9XA 3TC6A 1VLWA 2ISVA 4YXGA 3BSHA 4AX7A 5LNVA 3VKDA 4L1GA 1EYWA 2CXGA 2VZSA 3KTXA 4K8GA 1TA3A 1NFBA 3PJXA 2QIWA 9RUBA 3APYA 1Q6OA 4WSJA 1K9FA 1JZ7A 2AQVA 1OK6A 4MZYA 4K37A 5A8PA 3BCFA 3EWYA 4ENLA 3CWNA 4HOXA 3KS5A 4QE4A 3MWCA 3B8SA 3NEHA 1W1PA 1FDYA 4F79A 1W5PA 3DYOA 3L2LA 3PG9A 2J7EA 5C2XA 5HJXA 3HGJA 5A2AA 3ZOAA 5BOOA 4HMEA 2E68A 2XDFA 1GVYA 3QQ0A 4A21A 3TN4A 3GXPA 2JIEA 3YPIA 5I2UA 1WZMA 2PDKA 1LL4A 3NOEA 3XIMA 3E1F1 4NVTA 3TN3A 4WF7A 2O7SA 2P1FA 1MEIA 3NZQA 3H2MA 4Z1MG 1KR1A 1M7XA 4DM2A 1XLBA 2WC4A 3T8LA 4G7EB 2XSAA 4IQDA 4W86A 2VR4A 5F4XA 3FCPA 3SUTA 1E4IA 5C9RA 3VKKA 3PPCA 1B3OA 1Y8BA 4GQRA 3A3XA 4MOZA 1H7RA 1TV4A 3SIZA 5M1TA 4LVFA 3QR0A 2NSXA 4DI9A 2BXYA 2IPGA 2XH4A 3VU2A 2F6XA 3MT1A 4MHBA 4PBGA 3VGFA 3AUOA 1JFHA 4FX6M 3ONBA 4JX4A 5I6SA 1X6LA 3INPA 3AICA 1NH6A 2QT3A 5HMFA 3AISA 2WBGA 2CLOA 2FTPA 3LCWA 3V0TA 4R7OA 1UROA 1PB0A 2OGYA 3GHUA 5JIPA 4N9BA 1REQA 3SCOA 3RX3A 1U33A