4KCVA

Pyruvate kinase (pyk) from trypanosoma brucei soaked with 2-oxoglutaric acid
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
498
structure length
498
Chain Sequence
SQLEHNIGLSIFEPVAKHRANRIVCTIGPSTQSVEALKNLMKSGMSVARMNFSHGSHEYHQTTINNVRAAAAELGLHIGIALDTKGPEIRTGLFKDGEVSFAPGDIVCVTTDPAYEKVGTKEKFYIDYPQLTNAVRPGGSIYVDDGVMTLRVVSKEDDRTLKCHVNNHHRLTDRRGINLPGCEVDLPAVSEKDRKDLEFGVAQGVDMIFASFIRTAEQVREVRAALGEKGKDILIISKIENHQGVQNIDSIIEASNGIMVARGDLGVEIPAEKVCVAQMCIISKCNVVGKPVICATQMLESMTSNPRPTRAEVSDVANAVLNGADCVMLSGETAKGKYPNEVVQYMARICVEAQSATHDTVMFNSIKNLQKIPMCPEEAVCSSAVASAFEVQAKAMLVLSNTGRSARLISKYRPNCPIICVTTRLQTCRQLNVTRSVVSVFYDAAKSGEDKDKEKRVKLGLDFAKKEKYASTGDVVVVVHADHSVKGYPNQTRLIYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pyruvate kinases have an intrinsic and conserved decarboxylase activity.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
molecule keywords Pyruvate kinase 1
total genus 180
structure length 498
sequence length 498
chains with identical sequence B
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4kcvA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 4kcvA01
1XG3A 1OQFA 2HJPA 2HWGA 2VGFA 4KCWA 4B5TA 1GGOA 1KC7A 1PKNA 3QV7A 4HYWA 3E0WA 1IZCA 3KHDA 1S2UA 1XG4A 2HRWA 1PYMA 1O66A 3T0TA 4RPPA 1F3XA 1U5VA 4G1NA 3HQNA 3OQ8A 3R4IA 3GR4A 4B5UA 2VWTA 3U2ZA 3BJTA 1A5UA 3KTXA 3QZ6A 1E0UA 4MG4A 1PKYA 3T05A 4B5SA 1F8IA 2KX9A 1UJQA 3IS4A 2VGIA 1M1BA 4JPGA 4L80A 2OLSA 4DRSA 3G2GA 1ZLPA 1MUMA 4IQDA 1O5QA 1S2TA 1SGJA 3GQYA 4L7ZA 2DIKA 2XDFA 1A49A 1VP8A 1A3XA 3PP7A 1VBHA 3QV8A 4TV6A 4FXJA 1VBGA 2XZ9A 2R82A 4IMAA 3SRKA 3SRFA 3H6OA 4KRZA 3MA8A 4TV5A 3LYEA 4FXFA 3PUGA 3P0XA 1S2VA 4KCTA 3M0JA 4KCUA 3B8IA 3E0VA 3FA3A 4HYVA 4KCVA 4QG9A 3HQPA 1Z6KA 2XZ7A 1PKMA 3OYZA 2WQDA 1M3UA 3QV9A 4QG6A 4B5WA 1DQUA 1ZJHA 3EOOA 4ROQA 1F8MA 3QV6A 3BJFA 3FA4A 4WJ8A 3SRDA 1U5HA 2BG5A 1T57A 3N25A 3HQOA 2QIWA 4IP7A 4L9ZA 2X0SA 1F61A 2HROA 3T07A 1JDEA 3GG8A 1KBLA 1IGWA 1O68A 3SRHA 3EZ4A 2V5JA 2G50A 2VGBA 4MF4A 5JVLA 1AQFA 1E0TA 2E28A 4B5VA 4LSBA 1OY0A 1DIKA 2V5KA 1A3WA 1T5AA 2VGGA 3EOLA 3QTGA 1PKLA 2L5HA 3QLLA 3I4EA 3LG3A 4YNGA 4L9YA 4QGCA 3VAVA 4B2DA 4IQEA 5TAOA 1DXFA 4B5XA 1DXEA 2DUAA 1F3WA 3EOEA 3OYXA 2ZE3A 1S2WA 4B2DD 3QQWA 4YJ5A 4QG8A 2VWSA 4KS0A 3M0KA 3ME3A 3E5BA
chains in the Genus database with same CATH superfamily
1YDNA 4NNAA 5G2HA 4PL1A 3LN3A 4ZQMA 3W27A 2RAGA 2J7BA 2BX7A 3RITA 1JPIA 3TFCA 3S9ZA 2W92A 4LWWA 2ZDRA 4Z0SA 1LZOA 1K9TA 2X41A 2V38A 4EWJA 5DMLA 4TTGA 2WANA 5F1VA 4IH3A 5C7VA 4GRSA 4Z1CA 4AD1A 3WNOA 5CZSA 3M07A 3W7CA 7REQA 4E5TA 3BZJA 4IMAA 2ZC8A 5D9PA 6PTDA 1B9ZA 4LAMA 3BOFA 3H53A 5A8MA 2J9XA 4MKNA 4EPBC 3DIPA 3A4JA 3WMCA 1TWWA 1WKDA 4HN4A 4CCDA 4W5ZA 1LQ2A 5LA2A 4GY1A 1GG1A 2Q02A 4R53A 2CNCA 3WD1A 3STGA 3FN9A 1JGMA 4I7WA 4AF0A 3QKZA 1UW9A 2NT0A 1WDSA 2FZDA 3QBUA 1NTHA 3PN8A 4C1KA 2E4TA 3WBWA 4REQB 4QIUA 3PB2A 1TPC1 2CESA 1RZMA 1QHOA 1JNDA 4AVNA 3HF3A 2WC3A 4F40A 1J0KA 1MMFA 4ZFCA 5JH1A 2QNEA 3SGZA 2GQ3A 1DJXA 3BLEA 1VFTA 1XIMA 1Y5WA 3EX2A 4TX9A 4UTIA 5TBOA 4MWAA 4S2BA 1SO3A 4LFYA 1KA9F 4MAZA 4NSBA 1MRAA 3ZLFA 1SO4A 1E6SM 1GW1A 3ZJ7A 1F8IA 2NWSA 2CLFA 1EJSC 1QVBA 1L2UA 2CZEA 1M1BA 2FHBA 4GVIA 3H2CA 4OBRA 3IJQA 1XSJA 5I0DA 4ZR8A 3ZS4A 4H8NA 1B3WA 1MYRA 1YDYA 4UZUA 4L1WA 4B4FA 3SRKA 3VUPA 1WDDA 4ADTA 4P7RA 2DH3A 3G1HA 1W3JA 5IHSA 4MWAE 3JRKA 4JN6A 3WFZA 3ZR5A 4MNLA 2NX3A 3B8TA 1V08A 1IXOA 1EPXA 1GKRA 5FA5A 4HK7A 1VPXA 2EPNA 2VFHA 3CK5A 2Z1KA 3ITYA 1FH7A 1XUZA 2XIIA 3RU6A 4AZGA 4PMOA 4JTJA 3CT2A 1GYLA 4FNSA 2VFDA 1UP0A 9RUBA 4HSOA 3HPXA 2D2JA 4MGGA 1FH9A 2IKIA 5EYWA 4O11A 1PTDA 2QMKA 3T42A 1M04A 2V67A 3GKAA 3UERA 1UA7A 3UD6A 1MDRA 3FY1A 4BWLC 3ZM8A 4IJCA 3T6CA 4HNTA 1REQB 4JFWA 4ENLA 1OC5A 1VRXA 4DAIA 1KC7A 1PKNA 1KM6A 2VOMA 1OX6A 3C3UA 4NAEB 4JYFA 4UC5A 1WZKA 2VDGA 4JTDA 3W2JA 3ONCA 2GVGA 4GNVA 2Z6JA 9XIAA 5HQEA 3T05A 2XM2A 2VCAA 3N3MA 2E09A 5JUVA 5DO8A 2NLYA 3W1AA 2YXOA 2FGZA 3BLKA 4AX6A 1YPXA 2QVHA 3OGSA 4XWUA 4PMYA 1A3XA 2ZWZA 3NQAA 1RXOB 4MDPA 2REQA 3PPGA 1K4GA 2BY2A 4L4LA 4XVDA 3WD3A 4D72A 1A5AA 5DN6G 3MHUA 3G1YA 2WHKA 4QISA 3WYZA 3ARUA 3G1AA 1QI2A 4IICA 5MKGA 3EPMA 3NG3A 2OSXA 4PRWA 4XX6A 2JEQA 2GQAA 2OQHA 2ZUNA 2V68A 4HJFA 2W79A 3UCQA 2WBGA 4OE7A 4GO8A 2HNHA 3MMTA 4QHRA 4G1KA 3K8LA 2WNWA 1UH4A 3G5EA 2L5HA 1TPH1 2AKMA 4CQCA 1C91A 2I7GA 2A79A 1K3UA 2PTZA 4IPLA 2ZUTA 5I23A 1OC6A 4JKLA 4L61A 3U57A 4E4UA 3LZ5A 2Q8ZA 4ZTXA 4DLMA 1NFGA 3O06A 3TQ0A 3TSBA 1GZJA 2RDUA 3AXXA 2B7QA 3A13A 1UD3A 1TA3A 1IEQA 4OHQA 1P6BA 1QPKA 3TXZA 5BXSA 3SM0A 5AFDA 1PZ0A 3CO8A 3KRUA 3P3BA 3QFWA 1GHRA 1G6CA 5FI8A 4Q33A 1VJIA 3OVPA 2OO6A 2WMHA 3ENLA 5EL1A 3CMGA 5FF3A 3QZ6A 2FKPA 1YPFA 3BLDA 3TN6A 4F0LA 3VOJA 4UOJA 3TE9A 1RSCA 3Q45A 1E0WA 2QZRA 2VEKA 2B7NA 2ONEA 4DXVA 5LNSA 3FKRA 2D2GA 1GZGA 3KX6A 3SCPA 1UH2A 4LAZA 3M6DA 3CV1A 1PX8A 4HCDA 1B0IA 1YYAA 3W3OA 1QNVA 3K1DA 4J7RA 3NGJA 3K4AA 1WUFA 3NQEA 3K1GA 3VKKA 2DPEA 4BR1A 3R0KA 2CHRA 3PZ9A 4RUBA 1MZHA 1H5VA 3GBEA 2WZHA 1AD1A 5CGTA 5LZLA 4ML4A 3UFYA 1F61A 2ZQ0A 3VZYA 3TYCA 4BQ3A 3R8HA 1UIPA 2YL9A 1VH7A 2GWGA 2VCBA 4IGSA 3MWCA 3GHUA 4LYRA 2OKTA 2VZUA 1M7PA 3RRXA 3VCCA 3CC1A 4Q6JA 4S3BA 2Y8UA 2DVUA 4R5EA 3LCLA 3L12A 4WOQA 4DF0A 4E2VA 1NU5A 1LBMA 4WR3A 1MQQA 2OZ0A 1E40A 2H8ZA 3UZXA 3IIVA 2BVYA 3N3TA 3CQJA 4M24A 3VIFA 3W7JA 1SPQA 2WJFA 3N9SA 3O07A 4LYKA 4IQDA 5D33A 2RDXA 2XISA 5BRBA 4ZCWA 3UG4A 1B3VA 4P2VA 1B30A 4N6EA 3TTQA 4KEUA 1DKWA 2G3FA 1WV2A 3UZWA 2DVTA 3VE9A 2REQB 5JBDA 2JFEX 2ZRYA 1J2BA 4LQ1A 2V9DA 3R79A 1J93A 1QOQA 1RCOB 2BTMA 2V5DA 3OA3A 3WNLA 1W1YA 2V5BA 3BJFA 3E0LA 4X63A 2ALDA 3IJ6A 3IV8A 3KS6A 3SW6A 2VENA 3BMVA 1E9LA 2E8ZA 1XGEA 4WK9A 4IX0A 3P74A 3WK2A 1RJRA 2WVTA 1LLZA 2AQOA 2GGHA 4JQ4A 1UH3A 4PMXA 1CGVA 2HSAA 3GU2A 1WYIA 3AS0A 4J28A 1WDPA 3M0LA 1TR9A 2C8NA 4ZQOA 1W9XA 1U2YA 2AGTA 3VCNA 2W6IG 1DE6A 3HG5A 3LUTA 1PDYA 3PC0A 2E0PA 3OZOA 3INPA 3U0HA 3V5OA 3ARZA 1V0NA 1BRLA 5DY3A 3SSZA 1H7PA 3PAJA 4GACA 3T8LA 1Z44A 1SZRA 4TO8A 3OO2A 4PRTA 2WZMA 4NNBA 4M6QA 3IARA 1EUNA 3SGUA 3IEBA 5CPTA 4GXMA 3BW4A 2ZUUA 4UR9A 1Q6CA 4FF5A 5KZEA 4UQEA 2I9EA 4XZWA 4W7WA 1VPQA 1DWGM 4DZAA 4R7OA 1W31A 4C90A 2ZTKA 3GFYA 2ZADA 3IGHX 2NV9A 3CZ8A 1SZNA 1LRQA 4C5YA 3QKEA 5FIPA 1GK8A 1GVRA 5D9OA 3H23A 4J4KA 1V02A 3FV9A 4CVWA 3POHA 5A2AA 3KTCA 4A35A 3FDGA 5H8MA 3PVFA 4MZ8A 1IGSA 2B81A 3TTSA 3WUGA 4MWAB 1FWDC 1GEHA 3G6LA 2G8ZA 3E2QA 1KRCC 2HPMA 4GVHA 3AISA 4NXSA 4D6CA 2I16A 2PTDA 4P7NA 1MVYA 1XWYA 4EVZA 3TQKA 5A69A 1NM9A 4LGXA 3BL3A 3FX4A 3C2FA 5CZTA 4GJJA 2WLZA 2PDHA 4R3UA 3RCNA 3ECQA 3P67A 3FOKA 5IHRA 1R5YA 3GG0A 1XX1A 1ML1A 4Z1AA 4CNTA 2D3LA 1A50A 3NR0A 1H1YA 1LORA 4WDTA 1KM2A 5D05A 4Q32A 3NZPA 2H90A 3CHVA 1UUMA 2RGLA 5RUBA 3QN3A 1N82A 2IUZA 1HNYA 4RDYA 1PWLA 1LLWA 2UWFA 1WX0A 2Y24A 3FS2A 4HN8A 3MV01 4JR5A 3WDJA 2FZBA 4JEQA 2HS8A 2FH6A 3QV8A 3RR1A 3RPTA 3B9DA 5D9MA 3GXFA 3UZZA 3W70A 1BWVA 4IPIA 1W54A 4K1WA 4C7GA 4TX6A 1RP8A 1IT7A 1JD9A 4KCVA 5DX7A 3LTYA 4H7ZA 5C2XA 4B4HA 3E38A 2PLJA 3VU2A 3LM3A 2BGNE 4K3ZA 1UZHA 2P76A 3SGGA 1KKOA 4U4MA 4HA3A 3UW6A 1NOFA 3O3RA 3W7PA 4GGHA 2EPKX 3APTA 1W0JG 3D3FA 2JDIG 3ELFA 1LG2A 5LHFA 1TTPA 3EWWA 3L2LA 2WSRA 3QEZA 1Q8JA 4FF7A 4H9ZA 1ONWA 2D73A 3K30A 3M43A 3SSJA 2YCLA 1ISYA 5E93A 4MY9A 4DN1A 1NOWA 2P1FA 2BV9A 1UP2A 3ZSSA 1QDSA 1ISWA 3L23A 3I4KA 3BMXA 1GWJA 1OZMA 1E0UA 5C9UA 4RNFA 1JDFA 2F38A 2PUZA 4RW3A 5BOEA 2XFFA 1A47A 3UWZA 4GCAA 3KRZA 2XH2A 3N29A 3L66A 1OF8A 4CN6A 1LBFA 5EGRA 3P60A 4Q6XA 1UUOA 2PF0A 3PZVA 5E6ZA 4DJEA 1EJWC 4P8XA 1I9CB 4XKYA 2FHCA 4DPPA 2WMIB 4JTFA 3GG1A 1DIOA 3L5AA 4QSHA 4GXPA 2XZ7A 4Q8QA 3H2MA 4ZOAA 3GIYA 1EBHA 3NAVA 1KR1A 4DB7A 5TD4A 1L0PA 1A5BA 4DJEC 1FA2A 1OG6A 3L2IA 4X9SA 1AW2A 5A2BA 2V8ZA 4D8AA 1UR4A 4FHAA 4GGBA 2INEA 4JY8A 4TU1A 2VRQA 2C14A 4JTIA 1LUCA 3OHIA 1X97A 4R33A 4QGCA 1OM0A 4RE0A 5DEZA 4PC8A 2ZC1A 2YPIA 3AFBA 1GUVA 1F73A 1RQHA 5TIMA 1X8CA 5CBJA 4M51A 1VKFA 3FHQA 4XAGA 2E8YA 2O4MA 3SAZA 3WMSA 1UKPA 1BXNA 1S2UA 2IKHA 3BPWA 1EP3A 1E70M 1SU5A 1GVIA 4GIYA 2NVDA 3WLQA 4FB7A 4GNKB 4AWSA 1YEYA 4YVVA 4R9OA 3ITXA 4IISA 4E4PA 1KV8A 3ZXWA 4DRSA 5TNVA 3PUDA 4O0ZA 1G9HA 3RX2A 3TYBA 3I6RA 3W2LA 1H60A 1RBLA 1SGJA 3N19B 3VDGA 3RFAA 5A6JA 3BVJA 1JCNA 2VFIA 1I45A 3GTHA 3LCWA 1V8EA 1VBGA 1ZJAA 3AS3A 2R82A 4FNPA 2GQ9A 4PUWA 2X40A 2WHJA 4IPJA 1ADOA 2BZNA 4GZEA 3VILA 2DZBA 4EF9A 3AIUA 3CNYA 2WQDA 3OLDA 1J0HA 4NILA 1XLMA 4AD4A 4DVOA 1IEIA 1UROA 1KGUA 1D9EA 4JQ2A 4KESA 3T44A 2C3ZA 1OGBA 1R46A 1JDEA 1UIOA 2EHHA 1L6SA 2HTMA 1ONRA 1O60A 3QHNA 3QPEA 3WF4A 4Q8NA 5FJRA 1WPCA 4FXRA 4ZGYA 4GNJA 3S2LA 3L2MA 2QCLA 5E0KA 3IVTA 1XHGA 1G01A 4XTIA 5EFFA 3BSMA 5AZ1A 1E3XA 1FKWA 1W0MA 5FCZA 1BVWA 3C2OA 3NO3A 4JHOA 3VGFA 1JDDA 2HNEA 2HDJA 5I3GA 5HBFA 1GJPA 4Z17A 1ZBVA 3W26A 2WWDA 1PZ3A 5C2CA 4C65A 2AKZA 2IS7A 4MG4A 4F79A 1AMKA 5HR6A 1GQKA 1EO7A 1UCWA 1FDJA 3GC5A 3CHCA 3ZIAG 2YXGA 5BCAA 1Q6OA 1YMYA 4C6CA 1K6AA 2CEQA 3W22A 1W8SA 2VYOA 3GR7A 3VGGA 1YTDA 4O1EA 3LRLA 3TQVA 1VEPA 3MJMA 3KL5A 5AHIA 2OZ8A 4AYSA 4B9ZA 4GI8A 3N15A 4O8RA 3GDBA 5G1TA 5KMYA 5I77A 1L6GA 5FJUA 4BF7A 2EPOA 2PI6A 4OIFA 2WJEA 3USBA 2A4AA 4AHPA 2WPDG 5CH9A 3EB2A 3PBVA 3QZAA 2B4GA 2VEGA 3NQCA 3R8GA 1M41A 2R8WA 2ZOXA 4A3YA 3PJUA 3SURA 3TP4A 3AWNA 4EANA 3HO8A 2D0FA 3Q2DA 3QLLA 4L9YA 5K9DA 2WB5A 4B92A 5TAOA 5DN1A 3KDOA 1EC9A 5G4HC 4MPKA 4ZO7A 1C3FA 3KEHA 4Y7EA 2OYKA 3NFUA 3OZPA 4F9DA 2Y4SA 4KIEA 1FWIC 3ZVHB 2ZZ5A 1B3XA 3P7YA 1EZWA 4IHCA 4LF2A 4GVFA 1FOBA 4XD6A 4WZHA 3KCJA 2E6YA 4O1CA 2PDYA 2MNRA 7A3HA 1RA0A 4US5A 4UNIA 2J4GA 3FXYA 4AWEA 3WMBA 3MMDA 2E77A 1MFUA 2F6XA 3KL0A 2J7HA 3UPWA 4B5SA 3IS4A 1XIHA 3L0GA 2CWXA 3VI2A 1TA3B 3OEXA 1V3LA 1Z3NA 1HJUA 2EQDA 4ROPA 3W1QA 4P5UA 3UZ5A 2C0AA 3VM7A 1JG9A 4QRNA 3LB0A 3T2PA 1UWRA 3STPA 2G4FA 4KRZA 4KW2A 1XR2A 2PBGA 4IZGA 3EX3A 2GOUA 4DWSD 3P62A 3E0VA 3ORWA 5HUPA 4RX0A 4XZLX 4NZCA 1HL2A 2A2IA 3B4UA 1U1JA 3O63A 2YDQA 4RZ4A 2DP3A 3SCQA 1XYBA 3ERPA 3MUAA 1YNYA 3VO0A 3ITTA 3GZAA 3TJ4A 5AYBA 2WKGA 4PUMA 1NEYA 3TSMA 1XD1A 4ZOEA 5E0FA 2UZ9A 2H3DA 1XLLA 1ZTVA 3EWXA 2CKRA 4JAWA 4IMFA 4Z2LA 4JCLA 3A12A 4UTWA 4UTFA 1K8ZA 5I24A 1EJXC 5CC5A 4U2YA 2HK0A 3RMEA 3LBCA 2YL5A 2WVSA 1FWWA 2SFPA 4JQ3A 1ISZA 3WBAA 1K8YA 3KXQA 1A3HA 3LERA 1W3IA 4LS0A 2QGHA 2OLSA 3FFSA 3U2EA 3KLKA 2OG9A 2R6OA 4Z0JA 5HWNA 4P7OA 2Z4GA 1L6YA 4EX4A 1PAMA 1W3KA 5CAKA 1H51A 1P6CA 4NF7A 1E72M 3RN6A 4CNOA 1MEHA 4IXHA 1QATA 3MMUA 3W75A 1RLDA 5B7ZA 2R1LA 5TQLA 5C71A 3A4WA 2P53A 1DJWA 2JIEA 4M5PA 4JNZA 4PTMA 4WKHA 3G1DA 3C2EA 5D2XA 2VX5A 3UXIA 1FCBA 3RO8A 4UQAA 4M3PA 5C9RA 3Q58A 3UXAA 2J9ZA 1FXPA 4MYAA 2QLYA 4JHZA 4HKPA 4O4VA 1XRSA 1UR3M 4A8LA 2QW5A 3K4DA 4HQVA 2HK1A 2ZWYA 4GOAA 1TVLA 3ABSA 3KCLA 5CSYA 1P5BA 3G0XA 3WFLA 3QR1A 2OT0A 1OC7A 1KRMA 3DFSA 4CCCA 5C9XA 2XINA 1OFOA 3AZTA 4TR9A 4NYUA 4PCFA 4W8LA 2YCKX 3VKDA 4J2PA 1FVPA 3VIGA 4M6PA 4KWWA 2J13A 3MW7A 3CIVA 1U1UA 3GUWA 2D22A 3TLQA 4QE1A 3UVIA 1R3SA 2QF7A 2VMFA 2E3ZA 1O4UA 1K9FA 4L5ZA 4O28A 1HN1A 4UMAA 3ARWA 1LL6A 2RFGA 2JF6A 2XPKA 4RW5A 3CV7A 2Q8LA 1Z42A 4MUPA 3C8NA 3CZKA 1H63A 3NYDA 3CJPA 4NNCA 1K9DA 2OPJA 4TVUA 4S2CA 1UD4A 3F2BA 3CGTA 1P6WA 2R9RA 4PFHA 3WNNA 4PZVA 4PN2A 5I5RA 2YCIX 5HMDA 2PLMA 3L4YA 3UJFA 4W86A 4Y9PA 3UWVA 3ONBA 3EA2A 1DIKA 3JZEA 3I4EA 3W6MA 2Z2AA 4IF2A 1E5JA 2DW7A 4J2MA 5HPOA 4HU0A 4X2PA 4QM1A 1JZ2A 5CPLA 4ZQCA 1FS0G 1R9XA 2WNZA 2DT3A 3WKZA 4ES4A 6A3HA 2RGMA 4LNCA 1E5NA 4KWUA 3USZA 2G37A 1S5WA 1SJCA 1XH2A 3WIJA 1XGZA 3A5FA 3B8WA 3KBNA 2XYLA 4BQ5A 2W3ZA 2W9MA 3VD5A 1H7OA 3MUZ1 4MAVA 1JRCA 4CEXC 2WNQA 3ISIX 2VFFA 3G2GA 4H2CA 1TV8A 2P8CA 3BOXA 2VR2A 3FGCB 3VA8A 4GUIA 3HV9A 3SQSA 3H6OA 1RVGA 3LHUA 3N6QA 2C15A 4XK2A 4YVXA 1FWFC 3EB4A 2BMBA 2NSXA 3RM9A 1GJWA 3CMFA 3PNZA 1LOLA 3S1WA 1KGWA 1E4IA 4LJ3A 2GFTA 2O92A 3V35A 4I9TA 3WBYA 3MMWA 2EF9A 4D2JA 1EL3A 3BE7A 4AIOA 4D8LA 2W62A 1XL9A 1EP1A 3B0UX 3EPOA 1TELA 5CPSA 4ACZA 4B5VA 3L5MA 1C93A 1M7JA 4Z1DA 5DMNA 4Z1BA 1EF3A 3VXGA 1VD6A 4W9TA 1YLVA 4PCNA 3LHVA 1BKSA 4J3ZA 4HTBA 5K2ZA 2AL2B 1DJGA 1KCKA 1S5TA 2ZA3A 3RLHA 2UY4A 3NQ2A 5CSRA 1JF5A 2Y6ZA 2D2HA 4U5KA 1XV8A 4DZIA 2J6XA 2J77A 2IKJA 3KVLA 2PGWA 3NEHA 3V36A 1DJHA 3TZFA 3AMLA 3SN0A 2HVNA 3MANA 4Q4PA 1JCTA 4O50A 4AC7C 2FYMA 5AHLA 4JFTA 3ANVA 4YWSA 2A3EA 3VDCA 3AUOA 3QHOA 4GPNA 3N11A 3EDEA 4H4IA 4NU7A 1LL7A 6TAAA 1PSCA 3T4WA 3NQ8A 1UKQA 4AMAA 1I0BA 1HG3A 4J9JA 4RXGA 1YIXA 3NSXA 5D03A 2BXZA 4GI9A 1GW9A 1VHNA 4QDMA 2A3CA 4WVXA 1A5SA 3GBDA 4LS2A 4PMDA 2ZA1A 3ABZA 3SY1A 3FJNA 2AAAA 1W9BM 2HMCA 3QTGA 3N34A 2Z26A 4MB1A 2DIEA 3VMOA 1TE1A 3ATZA 1JDCA 4UZSA 1RK6A 3UG5A 3UR2A 1S2WA 1KBKA 1OFEA 3GY1A 4X60A 5CZKA 2HJPA 2VXNA 1ICQA 3QV7A 2GGGA 4OJYA 2FVKA 1VLWA 4LU0A 2RKXA 4V1XA 1KWKA 2C1IA 1TMLA 4UUIA 8XIAA 3BLLA 1RCXB 1UOKA 2VELA 4HB7A 3TWBA 4L80A 3T40A 1QBBA 5A6TC 1YHTA 3APGA 3A3WA 3NPWA 4PODA 1M53A 1HJQA 3PUOA 4MJMA 4EPDC 4PB4A 1MWOA 1TPFA 1HX0A 2VC7A 5LXEA 3NZ1A 3EPNA 4KEMA 3B03A 3L7RA 3WK1A 3P8IA 3VNYA 3OVRA 1ZBCA 1ADSA 1FWCC 1EIBA 1W3NA 5T26A 2QIIA 4HOZA 1K77A 2IMRA 3DYMA 4IMEA 3ZWTA 5JIWA 3ALGA 1HKKA 1GVYA 3B0XA 1XIGA 3OVGA 4LB4A 1DJQA 3UG8A 3K5XA 1E0TA 2BNJA 3RIKA 3VD9A 3DKJA 3AZSA 4XZMX 1AH3A 1QWGA 2CKSA 3R2GA 3S47A 4MB5A 3B8DA 3DENA 3FVMA 5D32A 4NZJA 1JYNA 3ITLA 4WJXA 2PCEA 4LOCA 2A6LA 7ODCA 3CIWA 3VK5A 3RYSA 3QQ1A 5EBUA 1A5MC 1E6QM 3OAAG 1XLDA 1F6KA 1GYNA 3WFAA 3KTXA 5F2IA 4JTTA 2VGIA 1H8EG 4V33A 3RHGA 3LXAA 2Z0IA 2VFEA 2ZRWA 1TVPA 5F7UA 1XUUA 5JBEA 5A6LA 4JNYA 4Y9MA 4DJED 4O1FA 4MKSA 3MSYA 2PSNA 1V6WA 3QMSA 3V7PA 3O05A 3ARQA 2W4XA 4FLRA 4N4PA 1VGAA 2WSSG 1ZJBA 2OU4A 2OCZA 2DSWA 1RP9A 3PZUA 5LNWA 1HKMA 4KRUA 1NDVA 3HJZA 4ZA0A 5G5IA 4B5WA 3BAWA 4OBSA 1JPDX 2YSWA 1EDGA 1T57A 4G5DA 2QJGA 3TTOA 1KB3A 3OOQA 4G9PA 5I00A 3URQA 1JCJA 1P7TA 4NAEA 3MVIA 1K70A 5JH2A 4M29A 3WK0A 4PMNA 1C90A 3MKCA 1A4LA 5KEZA 2R91A 2QULA 3VOIA 1SZEA 4ML9A 3QPYA 1FWGC 3VIMA 4NUWA 3GU1A 1VBRA 3RO6A 5CXPA 5HUOA 4C6PA 3WLJA 3A4AA 1CW2A 3VUSA 4A4AA 5DQPA 1QMLA 5DRCA 2FJUB 1W5PA 1XYMA 1E73M 3D3AA 1MI3A 2A21A 2QDHA 1BXCA 4UTWC 3HIJA 1IQ8A 1WXZA 5LXXA 1TKKA 1GQLA 4AYGA 4HOXA 1NF7A 3H2EA 1E4LA 4XAZA 1TCMA 3S1UA 4LALA 1S2AA 3CYVA 3UWEA 1R2SA 2JKEA 5HWJA 4DJFA 3H7VA 3GX9A 3CB3A 4JFUA 5C5YA 3M0IA 2WCSA 1BF6A 1FWJC 3TNBA 3EDJA 1E71M 2WC7A 2DZUA 1TV7A 1Z8AA 3ARVA 3C8FA 1NIUA 1ZU8A 4BS0A 3S6TA 2WMIA 5C55A 3REQA 1EJRC 1HGYA 2VVNA 2BVWA 3NQGA 3VKCA 4OQVA 1AW1A 3D5HA 2DORA 4QG8A 3GXDA 4PA8A 1OADA 5A95A 4Z2JA 2Y1HA 3T0BA 2JK2A 2ZFAA 2CERA 3K13A 4ZQRA 1SVDA 5A6AA 3UU0A 1UA3A 1VHCA 1OFQA 1HZYA 3ZOAA 3VOFA 4H9TA 2ZIDA 4W8AA 1DORA 5DMMA 2WWCA 1DBTA 1VYSX 3UZJA 4JCMA 3TJXA 3HTWA 2AAMA 3M5VA 1EDQA 4JPGA 3MKKA 4M7SA 1LP6A 3PJTA 3N04A 1EQPA 1FDZA 4KBXA 4W4QA 2VR4A 1ITUA 3CV2A 1AJ0A 2CBJA 4A8IA 4QR6A 4HA4A 1V0LA 2C1GA 2EG7A 1KM0A 2C1HA 4IXXA 3QFEA 5XINA 3W2UA 5LIYX 4LCQA 3OLGA 4LEFA 1RPKA 3CUJA 4Y9NA 3OBKA 2WMKA 4XAYA 4QE5A 2I5GA 4E3VA 2PWGA 3DYPA 4L1XA 3N25A 4RNIA 2V2HA 1IT8A 3SUSA 2WVUA 2CLHA 3ES7A 2XSXA 1PIFA 3NPXA 2XH7A 4A3QA 1IWAA 3W25A 3GTNA 1JUBA 1BYAA 4S3CA 4PTWA 3PBUA 3LPGA 1YXYA 3I7QA 3DFQA 1K9EA 4UTJA 5AC4A 4UTHA 1AQ0A 1J9YA 2XVNA 4UNLA 3MO7A 3GNNA 2CXGA 3UCCA 3U7BA 2GDUA 2VDIA 1QOXA 1O6IA 1LDCA 1OG0A 2OYMA 3WL1A 2OB3A 4MJZA 1PX4A 1KQYA 4MLJA 4PUJA 1XYAA 1I4NA 1C29A 3BOLA 1KFCA 1Y5VA 2WMJA 3DFYA 2DV0A 4MNMA 3NM3A 3M7SA 4D9PA 1VBHA 2XNDG 1W56A 1RK5A 3A64A 1E9IA 1DJNA 4UR7A 1A5OC 1NY1A 4HA0A 4JTCA 4BKNA 3LLDA 3TV8A 2J79A 4WF7A 4F2TA 5JXQA 3QR0A 1VJZA 4LT9A 4HYVA 3HQPA 3TW6A 4MHBA 3CHEA 1TUXA 3U5UA 1OWQA 3T9PA 4A29A 4ROQA 4PMZA 5G2WA 4XIMA 5GNYA 3JUGA 5EMUA 4LX4A 3OTRA 5KINA 4KEZA 3AMGA 5C0QA 4W93A 1AQFA 3F5KA 3DGBA 2YLLA 1VIZA 2B7OA 1BQGA 3MCNA 2PEVA 3SADA 2AQWA 1FWSA 3MDWA 4KH2A 1PHQA 2C91A 3G0SA 3GZ3A 3VTRA 1V3JA 2QEZA 4M19A 4BHYA 2ZZ6A 4L64A 1OIMA 2RDWA 3PWIA 1KLZA 4OFCA 3DC8A 1RY8A 2G3NA 4WIWA 4IQLA 1V6XA 1UB3A 3LU2A 3UWYA 1KBJA 4Q8TA 5E9AA 2PC8A 3WLOA 4KRTA 3LBMA 2HPIA 3SN1A 1DL3A 3VDHA 1VIWA 4UWMA 2ZXDA 2BS9A 4AVFA 5A8QA 5T9CE 3NSMA 2ZUWA 1R87A 4Y90A 1TWIA 4RDVA 3OIHA 5BXRA 4MTVA 2J7DA 2WW5A 2IPFA 3GHSA 3EYPA 4MIMA 3GNPA 4EKJA 5REQB 2ZTJA 1REQA 1MQRA 3P0WA 2PTYA 1FWTA 3BWWA 1ME8A 2NQ9A 4Y96A 4Q8VA 1MXSA 2XH4A 4GC4A 5A1AA 1N8IA 2Y7DA 1DV7A 4GIRA 5FKYA 3WNPA 5HATA 3MO4A 1H41A 1P1MA 3LV6A 2DFAA 2J88A 3L65A 4A8NA 1UYQA 1T8QA 2O55A 5BU6A 3S1GA 5LYRA 4ILSA 3LGDA 1RVKA 2PLKA 1FWAC 4MY1A 2R1KA 3U8GA 4DXKA 3MB9A 3I68A 1JF6A 1CWYA 2J75A 1H5YA 1TUFA 4LY4A 3CH0A 4J5NA 4L9XA 1EJUC 4MPQA 1W8GA 3PSWA 4H7CA 4CQBA 4IOTA 4PTNA 4UR8A 3QGVA 3T0AA 3S2JA 4PTXA 2FTWA 2A6NA 1I1WA 1GOXA 2QGYA 3AJXA 3SI9A 3YPIA 4J35A 4RZBA 2TRSA 3DGRA 1EBGA 3GDRA 2D2OA 5DRIA 3MSRA 3PG8A 4IFRA 2IXUA 1OABA 2GSJA 1WDRA 3GVGA 2CZFA 3UZYA 1MO0A 4JN7A 4IJRA 2NQJA 2GYIA 1BG4A 3IJDA 4D8ZA 1ZS2A 1QNPA 1TMHA 5KITA 4KWOA 3CAWA 1X1ZA 4LRTA 2DJLA 4IWWA 5XIMA 3WQEA 2V81A 4BFAA 2VZSA 3AXKA 4BEUA 4ZQPA 5FF4A 1SO6A 3QW4B 1DQWA 1QNSA 3OZYA 3KRBA 2XIOA 3U3HA 3W2KA 1TRIA 2J62A 3CWNA 3WL0A 1MFVA 4MB3A 1HKJA 4DYKA 3AXMA 1XIEA 2QMJA 4UCGA 3IPWA 3A3XA 5LKYA 3LCFA 5K9CA 2Y8KA 4GHRA 3IWPA 3AHYA 4C6FA 1Q7ZA 1TPEA 2DW6A 3KUMA 1J6OA 3QC3A 3C0LA 1XDLA 4AWUA 3GNXA 2YCJA 4NZ1A 4LVBA 3LX9A 4YPJA 1OB0A 1F3XA 2A7RA 1QTWA 3PPCA 1PCWA 1TQJA 8RUCA 3TN4A 3QYQA 1W9UA 1QASA 1RUSA 1W1PA 5DF0A 1JPHA 3W7IA 1Z9AA 1J0IA 4I5RA 1Q63A 1XSKA 1J8VA 1BD0A 1XLKA 5AVHA 2J8TA 5IFTA 5I6SA 2J47A 4AG0A 3BZGA 3W1MA 4O1AA 3NNTA 4E6MA 1F4AA 4AUBA 1Y0EA 4DO5A 3DC0A 5I79A 4Q4SA 4CCZA 1B57A 2ZZ4A 3SCWA 4YU1A 5BROA 1Y65A 1EXPA 1BFNA 3W1PA 1PE1A 1BWLA 4NZ5A 4FOUA 1FDYA 2H9AA 3LBOA 1A80A 2XHYA 3V1PA 3IVSA 4AIBA 1MW2A 3QYSA 2Q6ZA 2PDLA 4ATWA 3RCYA 4B5XA 2XFRA 3ZYZA 4M6VA 1IIGA 4QS5A 2V5CA 5I06A 5DANA 3OQEA 3E5BA 2HLDG 1LUCB 1BRLB 4PMRA 4OWGA 4GFSA 1RAKA 1ZQ5A 3OZMA 4H8VA 4R27A 3KL3A 4DWSA 1E6RA 3WDHA 1DXIA 4NASA 3EDDA 3WH7A 2YL6A 2ZRUA 4RNJA 4C6BA 3UCDA 3WQ8A 5F4SA 1QO5A 5D38A 3M47A 5HNRA 1DPMA 1KFKA 3WQOA 4MWAD 4DJFC 1X6NA 6ENLA 4HTYA 3HA1A 3ZMRA 4I8YA 4I5XA 3BH4A 2E6DA 3WQDA 3CUIA 3LDVA 3QMRA 4PUDA 2PGEA 4JKKA 3RJYA 1ZALA 1IWBA 1UWIA 3MZNA 5BU9A 4XB3A 3R0DA 4AEFA 4YYFA 4CUCA 4B3ZA 4G8TA 4ECLA 1AZ1A 4PYSA 2VC6A 3SJ3A 1E43A 2PFHA 1HGWA 2DZWA 4C6DA 1SW3A 3EOOA 1UPMB 5I3FA 4RZ5A 2PDXA 3W01A 4H7VA 1HKIA 5C6MA 1EJ7L 3H2OA 1POJA 3M0ZA 5BWAA 5F2GA 1JYVA 5T8GA 4MSSA 1IR2A 2V5JA 3GD6A 3M0HA 5GVJA 4LYQA 1L8NA 1NDWA 5BZAA 1MZRA 2NUXA 2VX4A 3P81A 4GJIA 4JIRA 3H12A 3DX5A 4OUEA 4IGHA 3DN5A 1TMQA 5G4WA 5DCEA 1WDQA 4EPEC 3B8VA 2D3NA 5LIWX 1OCNA 1UWAA 3VOCA 3N2XA 1S2CA 3RNDA 2J25A 2CLMA 1P4CA 4YTTA 4NJGA 1S3HA 4IUOA 3W7QA 4ERGA 4WY0B 3GDKA 2XGBA 1XS2A 4I6KA 5CPOA 1WBJA 2NVAA 4H04A 4AIEA 1T6MA 2FPTA 5HQMA 1CCWB 2TODA 3GIQA 5ABTA 2ZVIA 1CIUA 4UTTC 2XUCA 2WVVB 3UJSA 3O0KA 3KVKA 1CZ1A 1JYWA 1O94A 3MI2A 1OINA 4YWIA 4WRHA 3CHDA 4E2BA 3EWBX 3WJZA 4R85A 3URAA 5HNUA 4A22A 3N2BA 1Q85A 3WSUA 5K4XA 4KGLA 2GL5A 1GCYA 2BY3A 2X1RA 2X42A 1XCXA 4LEQA 1DWJM 5D4YA 1YX1A 3OBAA 4L9ZA 1K1DA 1TPUA 4X0NA 4XD4A 4EIVA 4U33A 3KBMA 3HURA 5E70A 4Q22A 3AYTA 2G4JA 4N02A 3B05A 3PBWA 1AK5A 1X96A 4GYKA 3SQMA 3WH8A 4GUJA 3STEA 1XCWA 2Z24A 4HHLA 3AHVA 5BYWA 3W02A 2OWCA 3WZ0E 1ICSA 4ZSTA 4LW7A 1W3TA 3KHDA 3PB0A 3H8AA 2ZX7A 2BSLA 2XWEA 3UNTA 1GVOA 4AD2A 1TX2A 1JFHA 5EY5A 1UWTA 1D3HA 3VFCA 3M5XA 4BY3A 3TONA 2CXEA 4K7YA 2ASHA 3V3WA 1MEIA 8XIMA 3C2RA 2QCEA 2YOCA 3HPAA 1YKWA 3P5ZA 3AMCA 4ZEPA 1PBGA 1Z41A 3THQA 3MY9A 5CPQA 2X2YA 1YDOA 2D20A 5HK4A 4DO7A 5FEWA 1KBIA 4HOWA 4FR6A 5GJPA 1VFSA 1PPIA 2ZKMX 2GWNA 3VCRA 4M1RA 4J27A 4QG9A 1US2A 2BWGA 2FMNA 3PTMA 4GIEA 3W1XA 4G2DA 1VFUA 4QXIA 3WG6A 4NXKA 2W0UA 3AS2A 3FA4A 4GI4A 4G6CA 1VFMA 3TA6A 3GAKA 3ZJ6A 1AJZA 1XIIA 4L6DA 2PS2A 3QHMA 3G22A 4Q8WA 3T07A 4HPHA 1OD8A 1A0EA 3BSGA 4V15A 1BLIA 1OT1A 3A4XA 5FSEC 5C7HA 4JICA 3VVGA 1K02A 3SIZA 1XC6A 1WE5A 3CL8A 2E68A 4UQDA 5I7GA 1R3QA 4C60A 1L9WA 1BWKA 2VQUA 1Q8AA 3MQTA 2DJXA 1SFTA 1XM3A 5A5WA 1SSDA 1ELSA 1MSSA 2ISWA 3VGDA 4QCFA 3VDBA 2RHGA 3SFKA 4CD6A 5AC6A 3L68A 3KM8A 1HXJA 3LSCA 2KX9A 4DIAA 2QPSA 3GH4A 3GVQA 3FIGA 5LA1A 1HVQA 1TG7A 1W5QA 1LYXA 1V03A 4FP1A 3RUBL 1ODZA 3BW3A 4MFDA 3IK4A 4HU4A 3ZT7A 5M3WA 3ZT5A 3FW6A 1DWIM 2H3BA 1UBSA 1HKVA 3NL6A 5CSUA 4FS9A 1VYPX 3R58A 1L6FA 3WF2A 4GQRA 3EEZA 1VF8A 4S3KA 3NQFA 2EG8A 1Q6DA 2X7WA 1E6XM 1TPWA 3W23A 3SCTA 2FZ8A 4KT2A 3R11A 3TTYA 2PP3A 2GJLA 2IPJA 2BOFX 3FGCA 4FI4A 4N2YA 4FX6M 1S5VA 3AS1A 3QVQA 2NW0A 3TROA 4MF4A 1WNOA 2DSUA 2F6KA 4QEHA 1Z32X 1CI1A 2VCCA 4O17A 3O6YX 2PRLA 3PZOA 3VZXA 3A24A 4Q4RA 1W1ZA 1WUEA 3U6WA 1R3TA 3W83A 4A2SA 1WB0A 1DP0A 5D04C 5H8UA 1XINA 3L0KA 4AFYA 4RDZA 3UESA 1O95A 3RR4A 1LLOA 3P6LA 1RALA 4AISA 2FVMA 5LNRA 1MUCA 3H54A 3SUVA 6ALDA 1XF0A 2R94A 2WJZA 4Q8UA 1YXDA 1HP5A 2ZVRA 4YCOA 1JFXA 4Z1MG 3BUVA 1RBOB 4HMEA 5HPCA 1UR9A 5B80A 3W4RA 4ASTA 2WMFA 4KFOA 2DZXA 1M9HA 1CGTA 1UD8A 1TRDA 3BAJA 1Q66A 4F0RA 1MQPA 2PDUA 4O18A 1F4HA 3CMJA 4TXEA 4DM2A 3GDMA 3G1SA 5M17A 4IPNB 4GZJA 3KOYA 1TWZA 3L4UA 3IAPA 3RGTA 1JVNA 2F2KA 1YTEA 2WKJA 3O0FA 4QTGA 3QGAC 4I8DA 2QVNA 3ZO9A 3DG6A 5BOOA 4GBUA 3BV7A 1KM3A 3SCRA 5AZ0A 2Q71A 4GISA 4ZB2A 3GNOA 4GX9A 2VI0A 3O1NA 3F4CA 3QQWA 2HE5A 2E9BA 3IACA 1EXBA 3AXIA 3BCDA 2QXWA 2Y5EA 1D7KA 4BEQA 3NVDA 1KQZA 4Q7NA 5DXYA 1SSGA 1V93A 1PYMA 3ABQA 1KFEA 1KXHA 3WLTA 3AHZA 2Y8VA 3OQ8A 3ARXA 4BF9A 1D8CA 1FCVA 3IGSA 2EAWA 1AODA 3HPFA 5DMYA 3DDMA 1H50A 3F2DA 2ZZ2A 3BURA 1W1TA 2UY3A 2Y89A 1IE7C 3FYOA 4LVFA 2DUZA 5C8BB 5EMMA 1RCQA 2F6UA 4GCXA 2QJNA 1GQNA 3W1NA 1U22A 3FAWA 4XO6A 1M7XA 3IJ9A 2V3FA 3KFTA 5FAJA 4LAOA 3V16A 3SY8A 1F07A 2FDSA 5FAGA 2QAPA 2VUYA 4QAWA 2WZEA 1GTEA 1H62A 4I9JA 5FESA 4HZ8A 1GOOA 3NO1A 3EKZA 1VZWA 3CWOX 3B9AA 2PWEA 3OB8A 2I14A 5M03A 5IM51 4G7EB 2DZVA 2FHFA 1PVNA 2P0OA 2F2HA 1P0BA 2VC5A 3S5YA 1XLBA 1J0ZA 3STFA 3W24A 4X3ZA 1KO0A 4A21A 3VMNA 3M9YA 3PFRA 4FEZA 4LYPA 3W76A 4M1BA 4F0HA 3N2TA 1LT7A 3TIMA 4B5UA 3U2ZA 1QHZA 1R47A 3E5PA 1A5UA 4BJHA 7PTDA 1JCXA 1JPKA 5AC8A 2DT2A 3UG3A 1ECEA 2O4QA 3FJ6A 1XLGA 4PUKA 1QNRA 4FLOA 5H91A 4IP5A 2BGQA 1R3YA 4TMCA 3K2GA 4E38A 3WD2A 3LI0A 3BC9A 1SUXA 4Y6GA 3VABA 4N9DA 1JULA 1FUYA 4ZOCA 4K37A 3WLPA 4OVXA 1EQCA 3R89A 5FF0A 4BK9A 5DT7A 2QUTA 4QBXA 1B3OA 2DZPA 4XBSA 2WNNA 4JKMA 1MXDA 2PU0A 4ORMA 5KETA 2QJJA 3GXNA 5ABFB 4X0VA 1SR0A 3VD7A 4C6IA 4JEJA 3SN4A 1W9VA 3IV3A 2BP1A 6XIMA 4LAUA 2WCAA 4TVCA 1OFPA 1VBJA 4TTUA 1DXFA 1CGWA 3UQNA 3F1QA 1HF6A 1QI0A 4AAJA 4UFLA 1VCGA 4L6OA 2CYGA 4UTTA 3AIQA 2CLKA 1TTQA 3C5QA 1MW3A 4IMCA 2VEMA 3GK0A 5BXPA 1TTIA 2G41A 4HIBA 4RPPA 3WELA 3IIZA 3LOTA 3W73A 2X1SA 4RZ6A 4WXZA 1EC8A 2ADAA 1GYMA 3GM8A 2EXOA 2DT1A 3S0CA 3C61A 4O1DA 1Q6LA 1XYLA 2XIQA 2NX1A 1J0YA 3GQYA 4L7ZA 3E49A 1I2QA 4H6RA 3BV4A 4O0QA 4OV4A 4JTLA 4P8WA 2YFNA 1JZ4A 1FHVA 2X1UA 1D7FA 4YXWG 2AL1A 1VRDA 4CQ8A 2X16A 5D37A 4S3EA 3HFYA 2CPUA 1TX0A 3XISA 4M82A 1XISA 4DO6A 1C7SA 1XPYA 4FX8A 3CPGA 3M6YA 1XRFA 1E9YB 1H2JA 1J6PA 3QV6A 4YLWA 3ARPA 3S42A 3TOYA 3GWQA 1L2QA 3UYIA 4FXSA 4JD4A 1U1HA 2B0MA 1TJRA 1XP3A 3QM3A 4TVDA 2UV8G 7TIMA 3SO7A 3STCA 4W84A 5C9WA 4NAFA 3OHMB 4PEKA 3FKSG 1I2RA 4Q3MA 3ME3A 4NJHA 4B5TA 4CU8A 3BK0A 3LTPA 2NVCA 4FZIA 4V1YA 2X7VA 3GAYA 5ABGA 3B0VC 3F4DA 1IHIA 1XICA 1AG1O 4LXFA 1UR2A 1PUDA 3B06A 2ODOA 3OGRA 3L5LA 4N9CA 3HG2A 3MBFA 3E2SA 3EMQA 5A2CA 1PEZA 1SMDA 3B3DA 1F5ZA 4HJWA 1JYXA 4NT0A 4Q4OA 1DIEA 2ISVA 3NQ7A 3SUUA 2OLHA 4UBPC 4PGLA 1BSLA 4RE4A 3J7HA 1HUVA 2HQAA 1JNEA 5EB8A 1XH0A 4RDWA 3E6EA 4L4MA 3GXPA 4FPSA 1QPRA 1WBHA 5G1YA 3ZIZA 2XN2A 3U4AA 2OELA 3GG7A 3ITCA 1ITXA 3TC7A 5AYXA 1VLIA 1W1A1 5AYYA 3MC5A 1WZMA 1THFD 1AZ2A 4W87A 2Y5SA 5TF0A 3R8RA 2ZUMA 1B54A 2X05A 3MUY1 1WZLA 2ACQA 2VL4A 3V18A 2ZX5A 4LBRA 2BY1A 4Y9AA 3IJIA 4WGHA 4D6FA 4WKAA 4KMQA 3RG6A 1S38A 2D69A 4LUTB 5SWUA 5AHMA 2YDAA 1P1XA 4ZVJA 1OGGA 3IIOA 1WXJA 4HSNA 3UR7A 1H1NA 4UFHA 3QPZA 1V3HA 4X61A 1LWJA 1HVXA 2YW4A 1S2TA 4AY8A 2Z1VA 4XD5A 1IV8A 3LHYA 1PTGA 5I3DA 3IIXA 2WPBA 5AHNA 4F0KA 3WLLA 4R7WA 2BVTA 2VRKA 3KE0A 1UUQA 2Z25A 4QX4A 2IQ0A 3LYEA 4OT7A 4KWSA 2AL2A 2JBMA 5BMXA 5EU9A 3BJSA 4WKFA 1HL8A 3SRDA 2W6JG 4GH3A 2YA0A 1HTIA 2VD9A 2XG9A 3GXIA 2OSYA 1VCFA 3JU2A 3QMTA 1UASA 4PL2A 2GGEA 1T7LA 1W37A 4HHMA 4RCXA 4S3AA 2YDRA 3TR9A 3UP8A 1TWSA 1K7EA 1SZGA 1R7AA 3IK2A 4ADUA 1V77A 1GT8A 2VT0A 2ATMA 4QSFA 2DUXA 3KBVA 2I5IA 4AEOA 4R34A 3RAOA 5KZMA 3UJEA 3BO9A 4GK8A 2WC4A 5M5DA 1XLFA 3CTTA 3WN6A 3T7VA 3WDQA 5GQBA 1XLAA 2VD8A 2GDVA 3VNIA 4UFJA 2BXVA 3TK7A 3KVJA 2FPVA 1BYBA 2XTKA 1BVZA 2W6RA 3BCFA 2PAJA 1N8WA 1GOKA 1WP6A 4DJDD 1ZFJA 4LVGA 3EWDA 2ACRA 3LENA 2QPUA 3LHTA 3O2LA 4JX4A 2ZX6A 4J3XA 2X8RA 3TW9A 5BOFA 3U5YA 3OG2A 1IT0A 1EDTA 4OZOA 4GQGA 2G95A 3NQBA 1UR8A 2GUYA 3VIHA 1TO3A 1GORA 4C5ZA 3AJ7A 3ZZ1A 3S5ZA 3KOXA 3WDRA 4IT1A 4CU6A 3CUFA 2YLAA 3FCPA 4XQ6A 3H4GA 4RL3A 5A6BD 4XTDA 3HQ1A 1UZ4A 1Q3NA 4H3DA 3TYEA 1QBAA 4IX2A 4XAFA 3THDA 2EO7A 4WGXA 3FAXA 3GTFA 3GVWA 4REQA 1B4EA 3LCXA 1MW1A 3LNPA 4PB5A 1P0KA 5M2FX 2J78A 2HROA 3BGGA 4AEEA 3UJRA 3Q37A 2Y5JA 3CPRA 3R94A 5JVLA 3VNKA 3WLNA 1M03A 4AF0B 4C6LA 3DESA 3GW0A 3TEVA 1HIZA 1CB7B 3C4UA 3NPVA 4PBFA 3AC0A 3EXRA 3KBJA 3M5YA 1Q45A 2EPHA 3EOEA 3AIRA 3VC6A 4GI6A 2YX0A 1DJZA 2FH8A 3URNA 5E09A 2Z1WA 1TZZA 1VC4A 4B3LA 3BAXA 2XSAA 1VR6A 2R1PA 1J11A 1F3TA 4PMUA 2OFJA 1UD2A 3NQMA 5LNUA 3W72A 4ZE5A 1UKTA 3W7HA 3VD3A 4Q8MA 4ZO6A 4DZ5A 3KVMA 4LCRA 2G0WA 3TA9A 4XSLA 1D2KA 1YE6A 3BLIA 4IIHA 3WBXA 3RXZA 5L9FA 2JGYA 4WDUA 3TZNA 1X1OA 2IXVA 3DBPA 3WCZA 1EFZA 3LMYA 4ICMA 2V7QG 2WSYA 4HU8A 1UMLA 3RM8A 3Q65A 1A4MA 3AMKA 2QDDA 3LLFA 1EC7A 3LA4A 3MP4A 3G0UA 4TV6A 2FVLA 3TN5A 3FYYA 1EA9C 2A3BA 3T0DA 3BAIA 3O8AA 1W3LA 4RJEA 4PB3A 5J8LA 4O16A 3L9CA 3CPUA 1LBLA 3CQKA 1ICPA 1HJVA 1DQUA 3C0JA 2HV5A 1XLJA 1JR1A 2BHUA 2CFFA 2PTWA 5G1MA 5HWMA 2GJXB 1J5SA 1XD0A 2GVYA 3E0IA 2PDCA 3TDFA 1VAHA 4NRRA 1R3WA 1UPPA 2NSOA 1PKLA 2EBNA 2YA1A 3T09A 2QKFA 2CBVA 4MKVA 3VIJA 3V0UA 3S4TA 1GVSA 4HNOA 3T78A 1OZQA 1ZSXA 4O13A 3VNZA 3GFXA 4C1LA 2HRWA 3WX7A 4Q7IA 3TJIA 4JTKA 3LS9A 3T0CA 1JQXA 1V3KA 3DEQA 3AIEA 4YTQA 3BXWA 3KWSA 2DQXA 1DHKA 4LC6A 2XFWA 3U2CA 3WENA 3SUTA 4OOUA 5E5CA 2ZYFA 1VS1A 2VURA 1YBQB 2J7CA 4NZ4A 3SCSA 1W3HA 4DLFA 2ISSA 2Y0FA 4JTSA 3PP7A 1P0EA 3OLEA 1MNSA 1CXIA 3W2MA 1XYFA 1US0A 3R12A 3S3GA 3ITOA 1R3VA 3MP3A 4C6NA 1X7IA 3VE7A 4BCEA 3RU8X 3E02A 4NRSA 2I1OA 3UGRA 4JIPA 2HBVA 1RA5A 4H9UA 2O9OA 2PDJA 1LRNA 2OEMA 1QFEA 3VGBA 4RV8A 4JYDA 3VIKA 1AQHA 4XISA 3SB0A 3TWAA 1JUKA 3PPHA 4KEVA 2GOKA 3GHTA 5CBIA 1WKEA 2NV2A 1VEOA 1BYDA 2WYSA 3CZEA 2POTA 2E28A 4B9YA 3TJLA 3PTKA 4EXQA 1W6TA 2ZUSA 3BTNA 2O9PA 2V6AA 4DELA 3OEEG 1NP0A 5FJOA 4Y8FA 4HNCA 4DQWA 5HAOA 4NJKA 1K6WA 3HGRA 1G94A 5IRPA 3FVDA 4MM1A 1HFBA 4MJ4A 4GQ0A 4UQ9A 5IFPA 3WQWA 7XIMA 3KRSA 3K8KA 3UXKA 2BLEA 3E74A 2FZNA 3F4VA 1WAUA 1OFDA 5EMJA 2KZHA 4MADA 3W7EA 2GJXA 1G7VA 1E0XA 3R4IA 2FGBA 2O9RA 1B3YA 3FK4A 3FSTA 1LQ0A 1EIXA 4AH7A 3ITVA 3M0MA 3LRKA 5ENLA 4QS6A 3VZZA 2QJIA 2YDSA 3MUXA 4AHOA 1BSIA 2OT1A 4H8HA 4MDOA 1I8JA 4O57A 1P0NA 3PZGA 4DNMA 5IDZA 3HG3A 1DOSA 1XGDA 2VTFA 5D2VA 4D6EA 3SRFA 4FLQA 3EMZA 4TV5A 4A3RA 3PUGA 2JALA 3PZMA 5I3HA 4BF5A 2E9LA 4I6VA 3FA3A 3DFTA 3B9OA 1Q5MA 3UPMA 3GYEA 1GOQA 4ALDA 1JQVA 3GC2A 3DOPA 4B90A 1FH8A 1K7XA 3EX6A 5CAHA 4EPKA 1V5XA 2IQDA 1CXFA 1R3RA 1YNPA 2OJPA 1JL8A 1A0DA 1Q7QA 1B3ZA 2VX7A 1OFRA 4CQDA 4ORIA 1F74A 1OT2A 5DELA 1BQCA 1AFSA 3GNDA 3D46A 2Q3RA 1FY6A 1NWRA 1H4PA 4UNKA 1CX9A 2V2CA 1B5TA 5HMFA 4JTQA 4PULA 1T0OA 4ZBCA 4QDPA 4DI8A 1J79A 2PURA 2FTYA 4I5UA 2V3DA 1V3IA 2OOFA 4DWSC 3BLFA 3AIBA 1OYBA 3ZWSA 3ZT6A 1JZ6A 2YKKA 1KV5A 3RF9A 3D6NA 2ALRA 3W1UA 4XG1A 4ZB0A 3MZ2A 1TWDA 4AW7A 3FYPA 4M0XA 2P3ZA 2DVXA 4N9BA 1C9DA 3HV8A 2J24A 2PDBA 3EKLA 3UWWA 1C8XA 3EDKA 5GNXA 1KXVA 4DBDA 3E3HA 3VC5A 3CAKA 2CZVA 2PPGA 2RJGA 3CBWA 3KS5A 2OODA 3VKJA 4D6GA 1F9CA 4LB3A 4UQBA 3QC0A 4QNEA 1NQ6A 3QGKC 4HPXA 1RQBA 3A47A 1NWSA 3A3HA 2I57A 1I0DA 3UPBA 1GZ1A 5AECA 4CD8A 4Y9OA 6TIMA 4AY1A 3P82A 3EWCA 5HANA 3H70A 4TIMA 2YZRA 1X38A 1IXNA 4A6GA 5I09A 1JD7A 2DEPA 2QCMA 3WEZA 5J5RA 4GUHA 3VKBA 2V0TA 4AZ6A 2INFA 3LSBA 1GHSA 3EWYA 1X6UA 3C52A 4GQQA 1Q13A 4HNVA 2VWSA 1KTBA 3IJ8A 3GTIA 3TXVA 4GQBA 3WQVA 2VGFA 1XPGA 3SCNA 4JOMA 2OTDA 4IJBA 4O10A 2EJAA 5T91A 5E0CA 1EPVA 5H2ZA 2QCDA 3UEQA 4LBUA 4LUSA 1TVNA 4EWND 4H1ZA 1DTNA 1VFOA 4GYPC 3W9ZA 2VZOA 4GVGA 1SJAA 1E51A 3L4ZA 1ME7A 1LRTA 3ZR6A 4NX0A 2XVPA 2NXIA 1TJ2A 4YIWA 1OK4A 1XKYA 2B7PA 2CLPA 1FTXA 3B4YA 3I3BA 3KCOA 4H9YA 2A0NA 2XZ9A 3HG4A 1HQTA 1IR1A 4IMDA 3EOSA 3TMLA 3QY8A 1S3TC 2E1DA 4DNHA 3BAYA 2JF7A 3M1ZA 1PL9A 1VFHA 4DUWA 3AHXA 5EBAA 1V6YA 2ACSA 4LANA 2RH9A 2CETA 2VP8A 3AOFA 3APYA 3PM6A 3PTDA 1CLXA 3MYPA 1TZ9A 1C8QA 1A5CA 3IVUA 2ZA2A 4F9JA 2P0IA 1V0MA 4XKMA 2F61A 3W6YA 4LSBA 2FMOA 2Y7EA 3LZ3A 1CGXA 3CUZA 1K8CA 3PWGA 1V4YA 3ID7A 1IXQA 1B1YA 1BAGA 3GS6A 3N4AA 1QK2A 3U9IA 3L67A 3KW3A 1AA1B 2V82A 4MMWA 3VD4A 1NFBA 3UETA 1SJDA 3FEMA 3W0KA 1EHAA 3NPUA 3UJ2A 4PH6A 1E0VA 4LC8A 3HMCA 3M46A 5BMWA 2W66A 4H19A 3NURA 3LHWA 4OBTA 5FJJA 4OV9A 4QEEA 5MF5A 1IYXA 4YTSA 3CT7A 1TV3A 1EH9A 3H22A 5JIPA 1AW5A 1E55A 4PR4A 2VR5A 3PY2A 3W85A 3WUFA 1SM9A 1LF1A 1FRBA 4M81A 1JRBA 4I90A 3ZVHA 1FFRA 2GGIA 3VGEA 4A8RA 4C7FA 5A6BA 2NX9A 4C6MA 4RK8A 3WK3A 1Y5XA 4S38A 1O1HA 4F2BA 5DCBA 5FD0A 4HHHA 3LCHA 1KTNA 5I3IA 1AUSL 1OFAA 2ZZ1A 1O5RA 1X1NA 3W7LA 3BLOA 1FP9A 1IXPA 3A21A 6REQA 2P50A 1OBAA 3TX9A 4K7VA 3FJLA 3PR2A 1EA0A 3FDKA 3ATYA 4HNNA 7REQB 2ESCA 2ZBTA 2FLIA 1KBLA 1O68A 1ZAJA 3FHAA 3F03K 3W86A 2Z7KA 4U5IA 1S1RA 2EG6A 1KM1A 1MEWA 4OUIA 1FFQA 4PMQA 1KCXA 2GSEA 1C9WA 3GW3A 3P84A 4PCTA 1A5LC 3DCPA 3TR2A 3KOWA 2XN1A 1BGGA 3ANYA 4PUNA 4E2OA 1FCQA 1ISXA 4JXCA 2G3MA 2TSYA 3HGJA 4TMBA 3W7NA 3LXCA 2YXXA 1F7BA 1YRRA 2E5BA 3V1HA 3H21A 2YYUA 3CTLA 4EACA 1R86A 2WM1A 1E6NA 1U5JA 3CV6A 4QDWA 1ITCA 4L4PA 2FIQA 5HMEA 1IEVA 5B7YA 1M7OA 5EMLA 1PB0A 1PTAA 3THCA 3DU0A 4S1FA 5CPNA 4HU3A 2XU2A 3S2MA 1H7XA 3UWUA 3BG9A 4JHMA 4PSRA 1XQLA 2I9UA 4DBSA 2Z1SA 1S2VA 4BQ4A 3MI3A 2WM0A 4JFVA 2INZA 1CGUA 1FHDA 4HYRA 3W07A 4HZ6A 4IM4A 1S39A 2BY0A 4IPPA 4U3CA 1QI5A 1R0MA 4H9MA 1ONXA 2NXHA 4US6A 1Q6FA 1VENA 3WBEA 3HGSA 1QRQA 3N9KA 1PWMA 1J18A 4JDYA 1FCUA 2QCHA 4P8UA 1XIFA 1EHNA 1ZP4A 1TR1A 3C2VA 3MHFA 3LD5A 1E4MM 3M4HA 2W67A 2KAUC 1QW9A 2XGZA 3AIWA 1TQXA 3QOMA 2ATSA 4CD7A 4GJ1A 2FPYA 5ECVA 5D2WA 1NOUA 4IIEA 4NJIA 3SBFA 3GR4A 1UC5A 5CC3A 1JAKA 4FK9A 4XO7A 2JKAA 1OCBA 2VC9A 3ABXA 3NGFA 4ZO9A 4B16A 3SR7A 3W38A 1I2OA 3MTWA 4PEEA 1S46A 5EMKA 5CG7A 3M41A 4CKQA 4C1NA 1M6JA 4NY2A 4GY7A 3WH5A 3LPPA 1GOMA 3ARYA 4YVPA 1KM5A 1T8XA 1EP2A 1OGSA 1XYCA 2W91A 1R2TA 1O5XA 1J2WA 4DX3A 2CK3G 4DAFA 2VZVA 1H7NA 5D02A 2Q09A 3E9AA 4HNUA 1QO2A 3BANA 4B3KA 2JJ1G 2OKOA 3UY8A 4AXKA 3CL7A 3HQOA 1YTKA 4S3GA 1OD0A 2OQYA 1RLCL 3VYLA 2GVEA 4N7QA 5AY7A 4YS1A 4S23A 4DUXA 1OYCA 2PWDA 4KF1A 4AXNA 1ECQA 1A5KC 3WDPP 1NF0A 2VGGA 3VIIA 3PTQA 2PDFA 4BA0A 1SFJA 4ACYA 3F5JA 3URBA 1KGXA 4C6KA 2JGQA 3LMZA 3SCVA 4LUSB 2ZRZA 2CBUA 2XVKA 1CECA 4HSHA 1IIHA 1X8FA 3A5VA 4G7EA 4EK7A 5HJYA 4FIQA 4RE2A 5AN7A 3CU2A 1QHPA 3PG9A 5EMYA 4S39A 1Z69A 2A85A 1H11A 1PKYA 5EA9A 3W28A 4KETA 4Z2KA 1T96A 3CQ0A 1LG1A 4WD0A 3T81A 3GLCA 3ZFHA 3F4WA 2D24A 1HT6A 3W29A 1C7TA 2XDFA 3THAA 1JGIA 1XSIA 4NZ3A 4EE9A 4FXJA 1KWGA 4IL0A 3G8EA 4JX5A 3M7WA 1TE6A 3MYOA 5JU6A 4Z1YA 2A1YA 4GA8A 1F76A 3LCIA 3M0JA 3THUA 4AZ7A 4D1IA 1T41A 4WQ6A 3RLGA 2VDHA 3S83A 1PKMA 1OX5A 4KIRA 1LQAA 2NXGA 1TTJA 2CLEA 3E2RA 4IGNA 4YCPA 2VX6A 4KERA 4GIAA 1AL7A 1FWHC 3W7GA 4M7TA 1I2NA 4JYEA 4CQAA 5AC5A 5CC6A 3RJXA 4HNLA 2P8BA 1A3WA 1B90A 4IFOA 3LY0A 2Z1XA 1V0KA 3UYCA 2VRJA 2CW6A 4ZODA 1EEPA 3T8QA 2HXTA 3WJSA 3TH6A 3P61A 4BI6A 1K7FA 4AZCB 4PRRA 2WOQA 1E56A 5I07A 2WO5A 2V69A 5FJTA 6XIAA 1JZ3A 4CNNA 5DBTA 3P2VA 4LUIA 3OE7G 3RILA 1QI3A 2P10A 1XRTA 3C56A 3S8HA 2P3EA 1U5VA 1EF2A 3MKVA 4HGXA 3RX3A 4UTLA 1PO9A 1LOQA 4PFMA 4CU7A 4DBEA 1GPWA 4PBEA 2DZAA 4QQ3A 2C71A 4K6AA 1TSIA 1E4NA 4MUZA 1YNQA 1OCQA 3NSNA 3PBMA 1X39A 2QUUA 2VFGA 3LRMA 2R24A 3AZRA 2WV8A 1KW1A 2JKPA 3HB9A 5LNVA 1MXGA 2OLAA 1XDMA 4Q4KA 4NKCA 2OWXA 1V7YA 1JZ8A 5CJMA 3JW7A 5DCDA 4TOQA 2I56A 2OX4A 3G3DA 1K03A 1Z6KA 2CU0A 3L4XA 4FNRA 1C8YA 2ISFA 4XVEA 3MCOA 5D8WA 1A0CA 4JX6A 3K8MA 1MRQA 3IJ7A 4JIIX 4US5D 4XAPA 1JCLA 4LRSA 3TYDA 4S3FA 3O15A 2VUNA 4GZ7A 3WQFA 3MVTA 1EOKA 3VX1A 4F0MA 2HXUA 5I2UA 4H2HA 3S6DA 5DBUA 4W8BA 4JL2A 2DQWA 4L56A 4NVTA 4IFKA 2YCEA 3B8SA 1DXEA 4NHVA 3DKLA 3A6OA 1QPOA 1SW7A 2PTXA 5JMUA 1Q6GA 3M0KA 2OGYA 2HBXA 2Q8XA 3BAKA 4FMVA 1TJ0A 3TUUA 3U7VA 4J3WA 2J7FA 4IIFA 5CJ5A 5KZDA 3NYZA 1RD5A 4K1GA 5CQ1A 3T0TA 3W53A 3NL5A 4QITA 1R8LA 2ZZ3A 1UKSA 3LPFA 1W17A 4AD5A 1KR0A 1QW8A 2VWTA 2C19A 3MS8A 1XJBA 2JE8A 3U2OA 4MB4A 2Y7GA 2GLKA 4E2DA 3VNDA 3AU2A 3DZ1A 5HJXA 4GKLA 3S5NA 5FL7G 1ZGDA 3W71A 3CWHA 4IGMA 2DDXA 4PTVA 3S9IA 1G0CA 1TPVA 3KBSA 3NQVA 2V30A 3ARTA 2WLYA 3GRIA 1JZ7A 1UZDA 3E2VA 3H24A 3DUGA 3R7MA 3K4WA 4A3UA 1M01A 1LM1A 3GIPA 1TIMA 4UMCA 1SJBA 1W91A 3VDAA 5K4ZA 4I7UA 1IGWA 4E8CA 5L6UA 1W2PA 3TOPA 4YXGA 3GO2A 1M68A 5F4XA 3POCA 1HO1A 1R9ZA 5J5DA 2E7FA 1PIGA 3SUWA 3VNLA 5EPDA 1OEPA 1Q6RA 1F3EA 4KPLA 3SZ8A 1POKA 3BMWA 3CL6A 3QJAA 1S5MA 5GPRA 3LM7A 5K9XA 4DWSB 3T4CA 2BGSA 3B40A 1WOBA 1GGOA 1UQZA 4HYWA 1HJWA 3CLWA 5CBBA 4FO4A 1HKWA 2YR1A 5HINA 2J74A 1V6UA 3FXGA 3G18A 2OZTA 1JJKA 4XZIA 3SECA 3UR8A 2HS6A 3NXFA 4XSMA 3V5FA 3W81A 5MHBA 1O5QA 1UBPC 1GKPA 2H9AB 2YFOA 3H7UA 4MZYA 2A3AA 4Q7BA 2PZNA 2YBUA 2WAGA 4IFKB 1DHPA 1E1CB 1DWHM 3IJLA 4HK6A 3RRAA 3Q67A 3VPLA 2VNCA 4QJ1A 1WCGA 3RLVA 3ARRA 3OYZA 1FWBC 4A05A 2E5CA 2OXNA 1RH9A 3RLUA 2PDNA 5CGMA 4Q4QA 5AKQA 3N9RA 1BPLB 4QFUA 4XBJA 2J7GA 3BGAA 3MV11 4O8AA 4MJ2A 2RDTA 2QPXA 3OBEA 1HP4A 2V5KA 3GR8A 1HW6A 1WZAA 4TQTA 1QT1A 4IQEA 3DYOA 1DE5A 3WLSA 3I7RA 1B31A 1MNZA 1V51A 4ERIA 3CYJA 8TIMA 2HCVA 4YTRA 3TAOA 5FEZA 1EWEA 1OQFA 3C3NA 3VNJA 3EXSA 5IDIA 5BRQA 4UIOA 4BI7A 3NCOA 1D8WA 1H09A 4WJEA 3ZLHA 1BVNP 1F05A 2O7QA 2YW3A 3KWXA 4HHPA 3H4XA 3HQNA 1IEWA 4UCFA 3BG3A 4M56A 1UWUA 2UY5A 4LUYA 3S46A 4H9XA 3AMDA 4NX5A 4DF1A 3B9NA 5XIAA 2ZUVA 2Y63A 1NVMA 2CCRA 1XW8A 1FBAA 4QP0A 4Z42C 1Q2RA 4PCSA 4CN4A 4KKXA 2Y62A 4OECA 4Q8PA 2DZTA 4H8UA 4U28A 5FF2A 1RJPA 2ISDA 2DSKA 3UY7A 4CVUA 2HISA 4KCTA 3AYSA 3DECA 5H6HA 3CZJA 4R7JA 1VEMA 4ADSA 1EO5A 4BQ2A 1AMYA 2OMAA 3CB8A 1SYTA 4TUFA 1ZNNA 1RR2A 4ZZ9A 1KNWA 1E15A 5F1UA 2BFGA 4Q8OA 3ZLGA 3TNOA 3I6TA 4RE3A 3IANA 1R6WA 3ABRA 2J8GA 3LPOA 4YL2A 3EB3A 4DXXA 3TCEA 3W6LA 2WKLA 3KHJA 3PWAA 1P43A 5K7JA 2GK1A 2BHYA 4H00A 4XZNX 1KRAC 3C86A 2IPGA 5A6MA 1AQMA 1XG4A 4IQJA 3TKFA 1XFCA 2YYTA 3N4FA 4JTEA 3WQ5A 3E12A 3T2OA 2J8FA 3E1F1 1CT5A 4JBRA 4E8DA 3COTA 4GFIA 2Q01A 1NP2A 4RLIA 1TJ1A 1EUAA 1VP5A 4M6UA 8A3HA 1OCJA 4HBKA 5E1QA 4O1BA 2H6RA 2PGFA 2QDGA 3BW2A 4C6JA 4ZO8A 3VMPA 3C2YA 3V0TA 4GG9A 4INFA 1UR1A 4FXFA 4YTUA 4D1JA 3GXTA 4OOZA 1LT8A 4L4OA 3NA8A 4M8UA 4GC3A 4YHEA 2QCFA 2G96A 1XCFA 3B97A 2GVLA 3QF0A 4GYFA 3P80A 1IF2A 2GJNA 3OLIA 4E3TA 3T1GA 4ZOBA 4EP8C 4WSKA 1OIFA 3NM1A 1J10A 1CPUA 3OG3A 1DJIA 3II1A 1SQ7A 1I75A 3WMLA 1RBAA 4JGDA 2P88A 3H7RA 3O16A 2GK1B 4YMZA 3QH2A 4I9AA 4D6IA 5A3HA 1XBZA 1R38A 2TAAA 1Q4NX 4C1NB 3A9BA 4LUTA 1KCLA 3MT1A 3OGVA 3S9YA 4JIEA 2V3EA 3KZSA 3PZTA 1XG3A 1V79A 1RV8A 1RY0A 4DZHA 1CXLA 1KXQA 5IBXC 3RDKA 3W88A 3MUIA 5LGZA 5CKSA 4NYYA 2VM8A 1OX4A 1S5NA 3GFZA 5HA7A 5U7SA 2BVDA 2A7PA 1IEXA 2QV4A 3UNDA 4PSPA 4LBSA 4MY8A 3ZVIA 1UD5A 5I03A 2MANA 2WSQA 2AMXA 1H0GA 4PMVA 2PODA 1CBGA 2PU1A 3W74A 5D9NA 1JUEA 2Y70A 5E9XA 2OX1A 1TZ7A 3CQHA 4U10A 3OA5A 3AQUA 4MOZA 1L6WA 3XIMA 4CNPA 2JEPA 3DAQA 1XBVA 3NUKA 4HT3A 1WA3A 4ATDA 1BHGA 1G4EA 1ITQA 4URIA 1TPDA 5C70A 2GVJA 2DY3A 5AOUA 1J4EA 4JTGA 4WXYA 1WQ5A 3FEQA 4NI3A 2NV1A 2NQZA 1HJXA 3GYCA 3W82A 3GNRA 5AB3A 4DM1A 2BDQA 1RPXA 3RM4A 1QPNA 2WK2A 3WDIA 2WJDA 3P5YA 1XKJA 3V75A 1LL4A 4LF1A 3ZJ8A 5I3KA 5AVNA 5EKYA 2GUBA 3ALFA 4C6QA 3U48A 1DTUA 2QT3A 3AWOA 2WCGA 2PWHA 3EXTA 4TT3G 4AZCA 5A94A 1N7KA 3PS7A 3KTSA 3WF1A 3S2CA 4GWEA 1WAWA 4XV0A 2J7EA 2J66A 2NT1A 3GDLA 2VOTA 4TSFG 4PBGA 2PCQA 3NVTA 2RUSA 2FDMA 2QDEA 1UZ1A 4H83A 1CXEA 4HMNA 4AB4A 3QY7A 3P14A 2Y7FA 3AI0A 3BQ5A 3E96A 3TMQA 1QI4A 3F4NA 2AQVA 4B15A 1CXHA 4GXWA 1XI3A 5LGXA 4L1GA 4W5UA 3AXHA 2Z6IA 3UWQA 1LWHA 3V5CA 1UJPA 4ZSUA 2W61A 2O56A 3DERA 4IP7A 2X0SA 3F5LA 2DT0A 3S6OA 1TYGA 1EOMA 1BTCA 2E6FA 3TW7A 1LROA 1E9ZB 2A3LA 1GEQA 3DHPA 3HM7A 1UQYA 1OHLA 3ZR4A 5T9BG 3OVQA 4AY7A 4JS3A 3CH9A 2DUAA 1F3WA 3QRHA 4F0SA 3LQGA 1TJPA 2WHMA 3QXBA 4K36A 1X6LA 3CZLA 4CNUA 1HO4A 1IZCA 4GH1A 1F6YA 3O9NA 2ZZ7A 4RXFA 1Z89A 3BLPX 1QAPA 3TC3A 5AYIA 2D0GA 1EX1A 1Q7MA 4C6OA 1MDLA 4MFEA 3REQB 4GLEA 2UY2A 4WEVX 1KCZA 4ZL1A 1V6TA 3GC4A 1JPMA 3TVAA 5K3VA 4IMGA 2PDPA 4XZBA 3SCUA 2F8QA 3L4TA 3DFOA 1SFSA 1ZL1A 4BI5A 2YB4A 2XIJA 5F2LA 3AU6A 3M0YA 4ZENA 1BGAA 5DLCA 4AZBA 3SQLA 4GYPA 2X0YA 3AALA 4WUIA 3PSVA 2A5HA 2DIJA 3N17A 3LQLA 4GUFA 5CJNA 1DJYA 2VVSA 3SJNA 3BQ6A 1G5AA 1RD6A 4UXDA 1QOPA 1SZFA 3TQPA 4ZXOA 3RPDA 3EBVA 1G7UA 4QJ3B 3F2CA 4EAYA 1CTNA 3WNMA 4F48A 4J1OA 1ZB5A 3NWRA 4FNUA 1DVJA 4XKYB 4CLMA 2NUYA 3G6MA 4HK5A 2JQXA 5CSSA 2R1NA 1UMYA 3C6CA 4Q4MA 4MZ1A 2Z7GA 2PA6A 5HNNA 4DJDA 4GMEA 4W85A 4W89A 1DEDA 4HPNA 3HZ3A 1P7TB 1OJXA 1VYRA 1FXQA 4LTSA 1Q6EA 1ESWA 3CASA 4HP5A 1WOAA 2VJXA 3BICA 3DXIA 4NQ1A 3AROA 3Q94A 4H41A 3PZNA 4KQNA 2C7FA 1BEUA 1PDZA 3CQIA 5HMSA 2QCGA 1GKQA 1JXKA 1ZCOA 3B8IA 3S2NA 3GUGA 3FSUA 5F2MA 4QG6A 3RCMA 1GOIA 3HJEA 4WJ8A 1UHVA 3CEUA 1XDJA 3JZUA 4EAMA 1XLEA 3GH7A 4JQ1A 3WLHA 1O12A 3N2MA 3GG8A 1OVDA 1SMAA 3GVRA 2QQ6A 5CG0A 5DT5A 4IIBA 4JN8A 2E5DA 3KP0A 2BBFA 4HA1A 1QR7A 5LIKX 1H1ZA 4LUJA 1WXYA 3SDOA 1PJ9A 5H8PA 2ZE3A 4JIHA 4YJ5A 5FJIA 2CLLA 2PP1A 3EKGA 1AVAA 3EMCA 3V4BA 1ENUA 2DSVA 3WF0A 4Z2HA 3ITGA 2BHZA 3D0CA 1H0IA 2DU2A 2WBKA 1AJ2A 3FJ4A 4NZFA 3VX0A 3H4WA 4D71A 2ZRXA 1QCWA 3TU9A 1U33A 4HCLA 4I7VA 3JR2A 4P8VA 2EKCA 4ATLA 3R5EA 2WHLA 1EYEA 1JEZA 3PZIA 1XQKA 4ASUG 3R10A 1H49A 3HPSA 1GONA 4G7FA 3WNKA 4D6JA 2OSWA 3I3DA 3Q4DA 3AICA 2BB0A 1FP8A 3DI1A 4HD5A 4WX2A 3N18A 3EA1A 1NDZA 3RMJA 5FL1A 1O5KA 4FNTA 4WSJA 1KM4A 3CIXA 4GKTA 4HZ7A 3KBWA 2ZXBA 3KLLA 5F4WA 2B31A 4U3AA 3MP5A 1H7RA 1HL9A 1TV2A 3SY5A 1M3UA 4QLJA 5BNKA 3AAGA 5GJNA 1NSJA 1VFLA 3WF3A 2FB3A 4R88A 3LNMA 4F4RA 5H1WA 1PHWA 1XC4A 2XIBA 5LA0A 3QOKA 3KOFA 2VKZG 2XSBA 2QE7G 4U2ZA 1YADA 2GQ8A 1EGMA 3B0PA 4DUOA 4F8XA 2YIHA 1W1VA 4RNHA 1Q2SA 3GXMA 3UXLA 4DI9A 2ZDSA 3QZEA 2X1IA 4C6EA 3NOYA 3TN3A 4OGZA 3EAUA 1V02E 3I10A 3K46A 1F6PA 1OX4B 4C91A 3S1XA 4WY0A 1EGVA 4Y2WA 1T40A 4N42A 1WO2A 3BJTA 4S3JA 4JDBA 1TB3A 1XBYA 1W5MA 4ZB5A 3EDFA 2Q3OA 3QSTA 2DIKA 1JAEA 2EPMX 4WHBA 4JTRA 3N6JA 2E6AA 3XINA 5HQLA 2OQLA 4GBDA 2OYLA 3AAMA 4N0RA 1UOZA 4I3GA 1CLVA 1NQKA 4J3VA 2QS8A 2PDMA 3FA5A 5FJPA 1G1YA 1OK6A 4HPGA 4X9YA 4XUGA 1GG0A 2J27A 1YQ2A 3IAQA 4UMBA 3OP2A 4ZQNA 2FTPA 2NLIA 3TC6A 2C79A 4FALA 2J6VA 1SW0A 2PDGA 3W1TA 2Z27A 4DHGA 4ZMGA 3WY1A 3WUBA 3SRHA 1ZJIA 3VIOA 1EJVC 3QQ0A 3CEPA 4IG2A 1KFJA 1ZBKA 4HCHA 3HU7A 2BXYA 1V3MA 1CB2A 4Z08A 3NIYA 1JI2A 1QU4A 3DHUA 3B04A 3NZGA 3NDZA 3C0QA 3N73A 5CLWA 1FWEC 5CPMA 3A22A 4KS0A 3PBYA 3HPZA 9CGTA 2HWGA 1YBQA 2ON3A 5EFDA 3M0VA 3IUDA 1PV8A 1RHCA 2WSPA 2YL8A 3WLKX 1W2VA 1J0JA 2E1WA 1W9PA 2FQIA 4F2UA 2P5NA 3ZJKA 2GZXA 2OO0A 4QJ4B 4HMDA 3WJWA 2QUMA 3O6DA 4NP7A 4M80A 1D3GA 4XZHA 4GABA 4PUUA 3CXOA 2G97A 2FZMA 5GNZA 2JIWA 2J9YA 3W1LA 3G1XA 1CDGA 4RPQA 1IWPA 2OVLA 2YB1A 2R1MA 2PDIA 4CD4A 2QHAA 1V7AA 4YYCA 2CLIA 3LTSA 4AD3A 1J5TA 1UWSA 4UFKA 1VB9A 1VQTA 3O6AA 5D8ZA 1FHLA 1RJQA 4KFPA 2PBOA 2PDWA 2PWFA 3PJWA 1W9DM 3V0SA 1TCDA 3KAOA 1YE4A 3IRSA 3AO0A 2LLEA 4XUYA 4QAIA 2QAFA 4UTUA 2X2GA 5CZ0A 2YGYA 1NARA 4V27A 3QW3A 4QLLA 1PIIA 1AH0A 2ZRVA 5D30A 3H55A 3HFTA 2JIZG 1ZPTA 1GVQA 4EOUA 4V28A 1G67A 4QLKA 3GB6A 1JCMP 2PC4A 1SO5A 1W5OA 3HGOA 3WH6A 4O54A 1VCVA 3G1RA 2H8XA 3IUIA 3W87A 4P61A 4QROA 1R30A 3ARSA 3N14A 3R43A 4FLSA 2EEXA 5LIUX 1TV4A 1XLHA 1LWIA 3LI1A 1BKHA 1PCKA 5FOOA 1SFLA 4V2XA 2X0HA 3H2NA 4IUGA 4L6HA 4GUGA 4O14A 2ICSA 1Q4WA 2I5QA 1W32A 5A8NA 3T55A 3OFNG 5IXEA 1EKOA 3G1FA 2YZ5A 3MHGA 1R2RA 5ABHA 2OZ3A 3GU9A 1CENA 1A49A 1VP8A 2R14A 2QF8A 4S3DA 3I7SA 2DH2A 3H26A 1BF2A 2HZGA 4X2RA 1KRBC 3TFXA 2PWUA 4GYJA 3M5ZA 2F84A 1BXBA 3HBLA 1MUWA 2YJQA 1YPIA 1Z48A 2DZSA 1QXLA 3MUCA 2NWRA 4OTKA 3QR3A 4L65A 4E8GA 5AHFA 4NAFB 1JIBA 1KLYA 4QCEA 4RKAA 3UA3A 4RR4A 1XLIA 2QIWA 4DJDC 1ZUAX 1N55A 2XN0A 2WVVA 2Z29A 2PMQA 1Q6QA 5A8PA 1OY0A 3PFMA 2WSKA 1GNXA 4WY0F 4YNGA 5G4EA 1LTDA 4B2DA 3SFWA 1PZ2A 2XFYA 4NL1A 2V3GA 1DWFM 1SR9A 3N2CA 2VO5A 4IIGA 2IW0A 2A3HA 1GPFA 1G4TA 2HVOA 3CUXA 2D23A 2PP0A 4F66A 3L0NA 1NWUA 3W7RA 1X98A 4Z2GA 4XZ9A 2OWWA 3ZSTA 1ZY9A 3VINA 1J96A 2HEJA 4AC1X 4UQCA 1ZENA 3LGEA 4DO4A 4EF8A 1UR0A 1ME9A 3GHRA 2DGAA 1DQXA 4B91A 3VFLA 1O7AA 4AVOA 1A5NC 3UR5A 4IL2A 2EJ1A 4P7LA 1ALDA 2VEFA 3LV5A 2PF8A 3LLXA 4AX7A 4J40A 5MKGB 3NJ3A 2PRHA 3M16A 3PPFA 4DEFA 1W1B1 3EX1A 2FGLA 3OIXA 2HVMA 2CIPA 2EGZA 2WXDM 5D2TA 1QK0A 3UXDA 2IPWA 3WQPA 2MUCA 1U30A 1JCYA 2DSZA 1K4HA 2EPLX 1ZHAA 2ZCGA 4JZ5A 4BWLA 3ABOA 2G5WA 4UOZA 1CEOA 3T08A 3MSDA 3P8JA 3TYUA 3QLDA 5BWFA 3WQ6A 1ZJHA 1WKYA 2IKGA 1H3GA 1UG6A 3T2QA 1J01A 1XYZA 3NL3A 1BYCA 5HXMA 3ES8A 3PUEA 1YXCA 4IG2B 2VGBA 3CAVA 3GH5A 2FZ9A 3F7JA 1I1XA 2XVGA 4NJJA 1PXGA 4C7DA 1BTMA 4NIRA 3I3EA 3AYRA 5DXXA 4NI8A 1PYFA 3EA3A 2V63A 1E3ZA 2BOEX 4UFMA 1R7OA 2CHNA 5CLTA 3DG7A 4K68A 1ODUA 2D0HA 2OR2A 1TPB1 3JS3A 1B2YA 4LV9A 2CC0A 4UTMA 4FOJA 3RX4A 4ACZB 2POZA 3IGUA 3AIVA 3B9EA 4ZXLA 4G1NA 1B9BA 2PRMA 3PJXA 3OPSA 4PTDA 1XIJA 2NUWA 1PX3A 2W27A 1WKFA 1ZCCA 2PD5A 1B4KA 2CHOA 4J3TA 3EOUA 1S1PA 1MUMA 5C2GA 4XBKA 5FL0A 2X30A 4LS1A 4YN5A 3PK7A 4UFIA 3I6EA 2O9TA 3DFHA 3QTPA 3UA4A 4AU0A 2OGJA 3UBPC 1GVFA 5BXTA 3MA8A 3RPMA 4W7VA 3DFPA 1UD6A 1XXXA 4ONVA 2PE4A 5HDRA 3KP1A 4W7UA 3MSGA 2C13A 3VNMA 3TSDA 3M0XA 3OU8A 3W00A 2BOGX