4KCVA

Pyruvate kinase (pyk) from trypanosoma brucei soaked with 2-oxoglutaric acid
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
498
structure length
498
Chain Sequence
SQLEHNIGLSIFEPVAKHRANRIVCTIGPSTQSVEALKNLMKSGMSVARMNFSHGSHEYHQTTINNVRAAAAELGLHIGIALDTKGPEIRTGLFKDGEVSFAPGDIVCVTTDPAYEKVGTKEKFYIDYPQLTNAVRPGGSIYVDDGVMTLRVVSKEDDRTLKCHVNNHHRLTDRRGINLPGCEVDLPAVSEKDRKDLEFGVAQGVDMIFASFIRTAEQVREVRAALGEKGKDILIISKIENHQGVQNIDSIIEASNGIMVARGDLGVEIPAEKVCVAQMCIISKCNVVGKPVICATQMLESMTSNPRPTRAEVSDVANAVLNGADCVMLSGETAKGKYPNEVVQYMARICVEAQSATHDTVMFNSIKNLQKIPMCPEEAVCSSAVASAFEVQAKAMLVLSNTGRSARLISKYRPNCPIICVTTRLQTCRQLNVTRSVVSVFYDAAKSGEDKDKEKRVKLGLDFAKKEKYASTGDVVVVVHADHSVKGYPNQTRLIYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pyruvate kinase 1
publication title Pyruvate kinases have an intrinsic and conserved decarboxylase activity.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
total genus 180
structure length 498
sequence length 498
chains with identical sequence B
ec nomenclature ec 2.7.1.40: Pyruvate kinase.
pdb deposition date 2013-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00224 PK Pyruvate kinase, barrel domain
A PF02887 PK_C Pyruvate kinase, alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4kcvA02
3.40.1380.20 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate kinase, C-terminal domain 4kcvA01
1PYMA 2G50A 3E0VA 1O66A 4YNGA 1PKLA 1VBGA 2VGIA 4KRZA 3E5BA 1DXEA 3BJFA 3E0WA 3OYZA 3OYXA 4IMAA 2V5JA 1S2VA 5TAOA 4YJ5A 3VAVA 2VWSA 1M1BA 3KHDA 4KCVA 4ROQA 3N25A 1KC7A 3FA4A 4IQEA 4B2DD 1DQUA 4B5WA 2HJPA 2OLSA 1VP8A 2VGGA 4L80A 1OQFA 1T5AA 3OQ8A 4L9YA 4TV5A 1SGJA 4B5UA 2L5HA 1GGOA 4RPPA 1F61A 1JDEA 4IP7A 1A49A 2X0SA 3GG8A 1F8IA 4MF4A 3EZ4A 4KCUA 3G2GA 3GQYA 1T57A 3HQNA 4LSBA 3QTGA 3GR4A 3QV6A 2VGFA 2XDFA 4B5SA 4QG9A 3HQOA 2KX9A 2WQDA 1A5UA 1MUMA 3KTXA 3FA3A 4B5VA 1PKNA 4G1NA 3LG3A 1IGWA 2DUAA 4HYWA 4B5TA 1O5QA 3QQWA 2E28A 3HQPA 3M0KA 3EOLA 3SRFA 3SRKA 1XG3A 4TV6A 1E0TA 3ME3A 1DIKA 2VWTA 1XG4A 1PKYA 3M0JA 4QGCA 1IZCA 3SRHA 3B8IA 1UJQA 4B2DA 4QG8A 1S2UA 1S2TA 4HYVA 1U5VA 2HRWA 1Z6KA 1DXFA 1F3XA 4KCWA 3SRDA 3T05A 1KBLA 2DIKA 2V5KA 3QV9A 3IS4A 3P0XA 3EOEA 2XZ7A 3QV8A 3T0TA 4JPGA 3BJTA 4KS0A 4L7ZA 3QLLA 3QZ6A 3MA8A 2QIWA 1AQFA 2HWGA 3T07A 2XZ9A 3I4EA 3PP7A 1ZJHA 4DRSA 3PUGA 3H6OA 1F8MA 3LYEA 1F3WA 3R4IA 3QV7A 4WJ8A 2ZE3A 1OY0A 1A3XA 1VBHA 2VGBA 3EOOA 1A3WA 4L9ZA 3U2ZA 1O68A 4FXFA 2HROA 1U5HA 4KCTA 2BG5A 1ZLPA 4QG6A 2R82A 4MG4A 4FXJA 4IQDA 1PKMA 1S2WA 5JVLA 1M3UA 1E0UA 4B5XA
chains in the Genus database with same CATH superfamily
3DYMA 3T1GA 4UTFA 4JS3A 1DIOA 2PDLA 1EP1A 1MQRA 1Z9AA 4W88A 2QUTA 3SADA 1ICPA 1Y5WA 3FA5A 3LMZA 3CQJA 3QLDA 1V5XA 4FALA 1GUVA 2BXVA 3EMCA 2GPTA 3OBKA 2YL8A 2DSKA 4JIPA 3FHAA 5AC5A 1A4LA 1G94A 1QFEA 4A8NA 2DUZA 1MVYA 2PRHA 1UQZA 1NTHA 1N7KA 1RD6A 3MCMA 3LXCA 3AMCA 3A4AA 3ANYA 4R33A 1J10A 1SSGA 1OFPA 4CN4A 1UPPA 3RPDA 3T2OA 4LYKA 1E0TA 1W3JA 4ZA0A 3P82A 4L56A 2Y63A 1SJBA 4H8HA 1E72M 4O52A 1V6YA 2DVUA 1KBLA 1NFPA 4NXSA 3EWWA 1TMHA 2CHNA 1AA1B 1HKJA 3NQBA 1WB0A 3Q4DA 1ESWA 2Y8KA 2ZTKA 5ABFB 4IG2A 3OW1A 4ACYA 3IV8A 1FWTA 4YCPA 2YXXA 4WLCA 1FS0G 3G24A 3CZKA 4FXJA 2OJPA 1SW7A 4BZYA 1Q7MA 3OJGA 1DEDA 2OB3A 1XYBA 2J8FA 8TIMA 2J7FA 2LLEA 2Y88A 4HCDA 1KKRA 4J3TA 3PG9A 5C0QA 5JUVA 1MEHA 2XG9A 3UR5A 4A05A 2V5CA 4UQEA 3BCFA 4CU7A 2XUCA 4MVAA 3GC5A 1ONXA 4HMCA 4ADTA 3ABRA 1JD9A 2NT1A 5D37A 1WYIA 2CLMA 1XXXA 3TSDA 3EXRA 4C6NA 1X8CA 3P67A 3QPZA 4NNCA 2W27A 5FL1A 2W6RA 4ERAA 2YB4A 4C60A 4LCSA 3TU9A 4UZSA 3VE7A 4KERA 1M7OA 3BLKA 3ZT7A 2SFPA 2Y7FA 3IJQA 3GH7A 4IT1A 1CGWA 4XSMA 1TIWA 3SECA 5AHNA 3SRHA 3FSUA 2IKJA 1DJIA 2RGLA 4HYVA 1SJDA 2QPXA 1PHWA 4FMVA 4RK8A 3UPBA 2PAJA 3O6CA 1P6WA 2Y70A 1D7FA 1JPMA 3N14A 3R25A 4Z2KA 3NR0A 4WQ6A 1LYXA 1ISYA 2HV5A 5DO8A 4D6FA 4D72A 2NSOA 3RITA 3VGHA 3IIOA 4O0ZA 3RU6A 3SCRA 1KFBA 1KM2A 1FCUA 2HE5A 3KWXA 2A6LA 1UJPA 1JCJA 2PFHA 4GE8A 4JKMA 5LGXA 5A2AA 2D73A 1XLEA 3W75A 5EBAA 4HYRA 3W6YA 3WLIA 2IPGA 4DYKA 4BY3A 3EKZA 1BTMA 5FJUA 1SO3A 1VCFA 4O54A 3TV8A 1XIEA 4DQWA 5GQBA 4E8CA 3DGRA 4GG9A 3IIZA 1S3HA 5A6KA 3W1RA 4DY1A 4ADSA 4L80A 3LLFA 3W7PA 1JCLA 1O5KA 1TWZA 3S0CA 1XLKA 2ZFAA 3LPPA 2WJDA 2IQ0A 3E49A 3SURA 5LIXX 2Q3OA 2ZZ2A 2NVDA 4AHPA 2D3NA 3UJFA 3TZNA 1GVEA 1XC4A 1V0LA 1X6LA 4G1NA 4IPIA 4M7SA 4IQLA 1R47A 3D3AA 2IS7A 3MU7A 1ZJBA 4HIBA 1RZMA 2ZZ3A 2A3HA 3TTQA 1W17A 3GZ3A 5FD0A 1UB3A 3IJ6A 1XGDA 4UOJA 1LOSA 2E8ZA 3W1AA 3W86A 3GXMA 5EFDA 1P43A 1OCQA 2WW5A 5LA0A 1UYQA 4ZTYA 2PD5A 3T08A 2A85A 1R85A 3B0VC 1QPQA 4AHOA 2XVNA 4W4QA 1R2TA 1TSIA 2PDNA 3SGZA 3OO2A 4FXFA 1QW7A 1FHLA 4PR4A 3CH9A 2CLIA 2ACQA 5BOFA 1A50A 3TR9A 4D8LA 3UZZA 4M29A 1JYVA 2XISA 1G9HA 5LNUA 1UWAA 3O05A 4DZIA 4WSKA 1DIEA 2OVLA 5I7GA 1JZ5A 4B4FA 2CEQA 4INFA 2ZC1A 2AMGA 3RLHA 4LUTA 1ZP3A 3W6LA 3EEZA 3STCA 5FSEC 1XS2A 1TMQA 2XH2A 4N4QA 4R27A 3RM9A 4PUMA 5JH2A 3S5SA 4C6BA 1W3IA 2V69A 1TJ1A 2WSYA 2A6NA 5HJLA 4L65A 3I4KA 3KEHA 3T2PA 3VKJA 4O0QA 2I16A 3DFSA 3W7JA 4AF0B 3LHUA 2G41A 1V6UA 3UA4A 3M07A 5I3FA 3ITLA 1W3KA 3WZ0E 2MUCA 4Y8FA 5D2VA 3GX9A 3KOZA 1EJ7L 4JNYA 3EX3A 5GNXA 1VCGA 4JY8A 3EDDA 1WAWA 2YDSA 4RNHA 4TQTA 1TR9A 3BCDA 4DIAA 3PFMA 4U2ZA 2QCDB 3W7NA 1TWDA 3R8HA 1W1YA 2D2JA 2E6FA 3LQGA 3WUGA 3A4XA 2WZIA 4XZLX 5DRIA 3AMDA 3H2NA 1J93A 3VIJA 1GOXA 3BLOA 1C8QA 3N2CA 1AW1A 1VYPX 4XKYB 4JZ5A 4K8HA 4U2YA 2FFCA 4PUDA 4UQ9A 4I5RA 5BMXA 3WQGA 4HQVA 7TIMA 3P6LA 3GNNA 1UR3M 1REQA 1E1CA 4NF7A 1BGAA 1YDVA 4UZUA 4ICNA 1BWVA 4JX4A 2IPFA 2CZDA 3H2FA 1IZKA 1DXIA 2Z7KA 3F03K 3GR7A 3CL7A 1BSIA 2ABAA 2VEKA 2ZA3A 3EAUA 1OFBA 1TPWA 2O7QA 1OF6A 4O4WA 1XLJA 4NG3A 3MZNA 3A21A 2GVJA 1ZAJA 3O6YX 3PB0A 5C55A 4Q4OA 4LVAA 2VUNA 4GYPC 3K8MA 3RR4A 1ZGDA 4DBDA 3H53A 3OG2A 4AH7A 2B0MA 4J40A 1DJGA 1YXDA 2ZBTA 3W1XA 3F5LA 1YEYA 4LGXA 1GJUA 4AIOA 4QJ5B 1ME9A 1GKRA 1F5ZA 4TTUA 1KXQA 1XLGA 2R1KA 1LRQA 3SZ8A 1NOFA 4R9XA 1VD6A 2B7QA 2FTYA 2I5GA 3P84A 2O9TA 3E2VA 1RA0A 3NDOA 3RCNA 3CHVA 3ABSA 1M7XA 2VFIA 3DFYA 2JFEX 1A3WA 2I5IA 4NZ1A 3SJNA 3UG3A 3N73A 4LYQA 1XCXA 2WHKA 3RDKA 2ZE0A 3W3OA 1H7XA 2DW7A 3DFNA 4W84A 1JCTA 1H2JA 3AU6A 3NL6A 3B05A 3CM4A 1W8SA 4Q8TA 4KEZA 1EF3A 3O2LA 4J3ZA 3OZPA 1FWGC 2TSYA 4B5WA 4S38A 2OLSA 3CHEA 4CQCA 4HK5A 3EWZA 1WDQA 2DIEA 2ZTJA 2A3AA 3WF3A 4N9CA 1EUAA 2VHLA 4ILSA 3AHYA 2Z4GA 4AWTA 4EOUA 3WF2A 3S5NA 3LCXA 4WY0B 4DJDD 4I7WA 3NZ1A 3KZPA 3QMTA 6PTDA 3WLKX 2VOMA 4OV9A 2WANA 3DECA 2UY4A 5I3KA 3M5ZA 2BVDA 4HMDA 5AC7A 1XBZA 4U5IA 1BQGA 3EX1A 4GXMA 3PPFA 4M81A 4GCAA 1HKWA 2GQ9A 4EVZA 3PVFA 2DU2A 3URBA 4Y8EA 3H26A 4NASA 1U2YA 1XLIA 4NNAA 1D3CA 2O56A 4IL2A 1MDRA 3QQ1A 1R2SA 3W7HA 4BFAA 4L9XA 3WLTA 1CXKA 4IFKA 3H2MA 1JRBA 1PX4A 4UMAA 2XWDA 3DG7A 3KS6A 2PA6A 2YBUA 3REQB 4O1FA 3DEQA 2CZFA 1W2VA 5FOOA 3SUWA 4HPXA 1VP8A 4TR9A 5HUPA 1GZGA 2WVVA 3VZXA 4FA3A 4HVXA 1GJWA 3KOYA 4MF4A 4FX6M 2RAGA 3GTXA 1ENUA 4WIWA 3NYZA 1BYCA 5E6ZA 4GYPA 6REQB 9XIMA 1OGBA 4GY7A 5DF0A 3PPCA 4GX9A 1AL8A 2OGJA 2YBTA 3NWRA 4GC4A 3E96A 1KRBC 1ITQA 4HJFA 3DG3A 2OZTA 2WMIB 3K13A 1TKKA 5FA5A 2BY2A 1WKEA 1XSIA 1H1ZA 3OHIA 3CO4A 4R7WA 2CZ5A 2O0TA 3C6CA 3BG3A 1CECA 4NYUA 1EJSC 4US5D 4C5ZA 3PUDA 3BVJA 3L0KA 3VIFA 4U3CA 4QSFA 4ZMGA 1ZS2A 1BWKA 2YL9A 1B30A 2FGZA 4K68A 3HMCA 4AXNA 2W6JG 3PTQA 4PUKA 1X7FA 4QJ3B 3OEEG 3GAYA 3H23A 4GO9A 3PJXA 3N9KA 5CCZA 4KEVA 1FTXA 1NJJA 2J13A 2WPBA 4HA1A 3LY0A 4CNUA 3NVDA 4OV4A 1A0CA 3GHUA 1WBJA 3QFWA 1CB2A 2QNEA 1RQBA 2DFAA 4CD4A 4UFHA 2Y0FA 4NAFB 4H8NA 2WM1A 2VZSA 2I57A 2INFA 5HATA 3UXLA 1X38A 4M6UA 3MTWA 1IEXA 2BWGA 4KWVA 4PTNA 1NQ6A 4EACA 3V5OA 1KWKA 3MKKA 4XAYA 4PUEA 3R7MA 3LEPA 1C3FA 4F8XA 5A8PA 4M82A 5CSSA 5DANA 4KQNA 4QG8A 3BURA 3R94A 1F3XA 3OAAG 1M53A 1CNVA 3DX5A 1HVXA 2PB1A 3A3XA 3WJXA 3RRAA 4DLFA 3V5CA 4GIAA 2BHUA 4AMAA 1KBBA 3CL6A 2VT0A 5DMMA 1E6NA 1OZMA 1UUQA 1WZMA 4WX2A 1XLCA 3K46A 5G2IA 2BV9A 2JIWA 3N13A 5D9NA 3AS1A 1BQCA 2BY0A 1FDYA 2GYIA 1XFCA 1W1B1 3GNXA 4GXWA 5DELA 5CG7A 1JZ7A 2VC7A 1U1JA 5CAHA 4FPSA 3ATYA 1KFWA 3L7RA 5D2TA 5LIYX 2HXTA 3F4DA 5C2XA 4IJBA 2DJLA 2DW6A 1VYSX 4ZQOA 2OU4A 1JDFA 3EWDA 3T0AA 4XD5A 2WXDM 4DUVA 3KBSA 4I7UA 4PCTA 3L0NA 1E70M 2PBOA 2VXNA 3GNPA 1XDJA 3C0QA 4TV5A 3BOLA 1TWIA 2GVLA 3PPGA 3TMLA 2WKLA 3EWXA 5G2HA 3M0HA 4B5NA 1T96A 5EYWA 4EXBA 1D2KA 3E2SA 1TZ7A 4K2SA 2VVNA 6XIAA 1XW8A 1ZL1A 2FJUB 3F2DA 3L2MA 2PF0A 3JZUA 4Y9MA 3KDOA 1F73A 4LU0A 2CBUA 5ABFA 1V6TA 4HOXA 1HNYA 4ZL1A 3VOFA 3IS4A 1DJNA 3BLLA 1AJ2A 3W7QA 4EWJA 1JCXA 5H1WA 1DKWA 3OHMB 1YE6A 4JYDA 3AMLA 4RPQA 2YXOA 1VFLA 3ZSSA 1A3XA 1KM0A 2ZRVA 1SO5A 3EPOA 2Y5SA 3VKDA 3TYCA 3G1DA 2CLPA 4V1XA 4AB4A 1JPHA 1VPYA 3AUJA 3NM3A 3VGBA 3C0LA 3GXPA 3BSHA 3O7UA 5GPRA 4IMAA 4YJ5A 2Q01A 3ZO9A 1L8NA 3OQEA 5M3WA 3B9NA 3L68A 4I8DA 2CESA 3TKFA 2HJPA 3LB0A 3HM7A 2WCSA 1WDDA 2ODOA 1B54A 1OFQA 3CHFA 1RJPA 1KTBA 2WJZA 3FYPA 4L1XA 4HK7A 3MP5A 1BKHA 2P0IA 2KX9A 3L0GA 1LLWA 4GO8A 3FIGA 1HXJA 1Q45A 2P10A 5H91A 1UC4A 1KCKA 1R30A 5EMJA 1ECQA 3QQ0A 4P61A 4PL1A 1SR0A 5A6JA 4IX0A 5A6MA 4HNNA 3KAOA 4H4IA 1UUOA 1PIGA 4GX8A 4JY9A 5IFPA 5AB3A 2VJXA 5BRBA 1GYLA 4YYCA 4ML4A 5CC5A 1GQKA 1HJUA 5A2CA 2VUYA 2X7VA 3AICA 1E0XA 2VGBA 4MYXA 3IGSA 3FJ6A 1K9DA 2G8ZA 3R10A 1DVJA 1Z41A 2WK2A 1M3UA 4FNSA 4DUXA 1AODA 2R1PA 1RLDA 4MWAC 2JK2A 2ZRZA 1PCKA 1E1EA 1R3SA 3OYZA 3W71A 3IAPA 3NZQA 4MJ4A 3B9OA 3S2CA 1ITXA 1J6PA 3SBFA 2TRSA 1X6NA 1O5RA 4IQEA 1DQUA 4ATLA 1W5QA 3WLSA 4U33A 1BVNP 3U8GA 3I3EA 2OZ0A 2JJ1G 2E5DA 1VIWA 1DJWA 3I6EA 1QBBA 4OKDA 5DFAA 1ZTVA 3U2CA 1G0CA 3RX3A 3CPUA 5DRCA 4WRHA 3GR4A 4A2SA 3UJRA 5CG0A 3AUOA 3ARYA 3G18A 2PZ0A 2XVLA 3WFLA 1UCWA 3SY1A 4ZZ9A 1RBOB 2F2KA 3ITTA 4ZO8A 3RHGA 2VX6A 2POZA 3M5VA 4PC8A 3HG5A 3D0CA 1DBTA 1XRVA 3HV9A 2DVXA 3AQUA 1X98A 2WMFA 4P7OA 3FHQA 3DU0A 1MDLA 1M7PA 2J7GA 4O50A 3PAOA 3TYBA 1RCQA 1KWGA 1FXPA 4QNWA 3I7SA 1MUCA 2YJQA 2FLIA 3CWNA 3UR8A 4AC7C 5FF3A 3B03A 3BAWA 4QX4A 2CLOA 1A0DA 2WHLA 1OBAA 2BVTA 3WMSA 4UTHA 3B0UX 3BQ5A 1I2OA 1UZ4A 4AVNA 2HPMA 1XYFA 4NQ1A 4GRSA 4UNKA 4NVTA 3H7VA 4YHGA 1QJWA 2O92A 3B8VA 4FB7A 5FL7G 1Y65A 2GJXB 1PB0A 1AZ2A 3UBPC 4GVFA 3DH7A 4JTTA 1OGSA 3NQDA 3UZWA 3GHRA 3PSVA 3U48A 3TYUA 4AF0A 1HL2A 3WDHA 4EPEC 2FGBA 2IPJA 4IJCA 3W88A 2FZNA 1XP3A 4Y9OA 2QYGA 2V8ZA 3TSMA 3G1XA 2NQLA 5I24A 3OE7G 2DQXA 2CXGA 1GNXA 1G6CA 1PTDA 5DMNA 3LV6A 1XRTA 3P80A 3P8JA 1V7YA 2PGWA 3BDKA 2QCDA 5JIPA 1EOKA 2HK0A 4QISA 1SW3A 2CC0A 5IBXA 3GE7A 3KXQA 1E0WA 1QUMA 3W73A 4UTTC 4FLOA 4XKYA 1G4EA 1ISVA 4QXIA 4D1JA 1WOBA 3TW6A 4ROPA 3T42A 1F6PA 1BLIA 4L5ZA 2CK3G 2Y7EA 1Q6OA 4ZOAA 4DJDC 3KZSA 4UFIA 3S9ZA 4MSSA 1QI5A 3KL5A 4XAZA 1LORA 4CQ8A 1GHSA 2VFEA 3V0TA 4GFIA 2HROA 1S5TA 2A3BA 1ZBWA 4C6CA 5A6LA 4QR6A 4AAJA 3QHMA 4V2XA 1XISA 4O1BA 2DZTA 4N02A 1W9UA 5HMSA 1BSLA 4QM1A 3LK6A 5D9PA 2OSWA 2EQDA 4PMUA 3W1MA 1LROA 2ZVIA 3LV5A 1XIIA 3OVGA 4Q6JA 4Q7IA 5K9XA 1KC7A 3MQTA 1C9WA 5DY3A 2B81A 4UOQA 5B7YA 4EPBC 4C90A 4S3BA 2KAUC 3W0KA 1A49A 1POKA 2VD8A 4TX6A 4G5DA 4C5YA 3CIXA 1A5MC 3IGHX 3MMDA 4AZ6A 5T9BG 3IVSA 2RDWA 2XFWA 2G96A 3ARTA 2JF6A 4JTIA 3UJ2A 4DUOA 3UVAA 2PCEA 4E4UA 3QQWA 3P5ZA 1IF2A 1L6SA 3ID7A 1EA9C 4QE5A 1KCXA 3GH5A 5AHMA 1OD0A 3UP8A 1I2RA 1NDYA 3K4AA 3PANA 2GVGA 4JTDA 1PWLA 1B4KA 2D20A 4BWLC 2XH0A 4NZCA 1YE4A 4AG0A 2DZBA 2PLCA 4L1GA 2CLKA 5JH1A 4BQ3A 3VZYA 3LDVA 4PMOA 3UZ5A 1T40A 3MC5A 3SN0A 3TW7A 2ZZ6A 2C1HA 1FWWA 2X7WA 4W93A 1FQ0A 1V0KA 4LBRA 2W66A 5A6BD 4MKNA 3T55A 3WJZA 1EFZA 2CKSA 1TVLA 2XGZA 3T8QA 3VIPA 4CGTA 4EE9A 1IR1A 2PU0A 4LEQA 2GUBA 5I3DA 3PZTA 4HSNA 2V67A 1VR6A 3BGJA 1E9IA 2A4AA 5IHSA 1T8XA 1OX5A 4WY0A 3W1LA 1UR8A 4B9YA 2CW6A 2ZADA 3G1FA 3M16A 3WLJA 1QNOA 2EG6A 1YMYA 1MXGA 1M9HA 3BZJA 2Y2WA 1I0BA 1JF6A 4NAEB 1ZCOA 3TN3A 5MKGB 5A95A 2YCIX 5DT5A 3IJ9A 3UY8A 2ZYFA 3GW3A 2DT2A 1WCGA 1RLCL 4NNBA 3WNOA 3W02A 2DIJA 3W74A 4J2PA 1S5WA 4M8UA 1R8LA 2F7FA 4LTSA 4LUYA 4UQDA 3B8DA 2DEPA 4UTTA 3WY1A 4ASTA 2ICSA 4MZ8A 3KFTA 3C5QA 4LJ3A 4E6MA 5I79A 3N4FA 1XBXA 4PRRA 4AY1A 1TFVA 2PODA 4DJDA 1FWBC 1V51A 2F61A 1Y5XA 2AMXA 4DRSA 3TWAA 3CC1A 2D0GA 3QY7A 3H7UA 1RA5A 2QXWA 4KEUA 1RV8A 3REQA 4M3PA 3UERA 3CPGA 3V0SA 5CSRA 3G6MA 1VAHA 2QW5A 1TV7A 4GBDA 1K9EA 2GVYA 4PB3A 4DHGA 4J27A 3EGJA 5AOUA 5CQ1A 3TOYA 3KHDA 4KH2A 2OYLA 3RR1A 5EKYA 2Q6ZA 2F6XA 2ZUUA 2TYSA 3TFCA 2FB3A 6REQA 1TPFA 8XIMA 1PIFA 2ZA2A 3BO9A 2WMIA 3NEHA 4QLKA 4D9PA 4I8YA 2CCRA 4E2DA 4L6HA 3GVGA 4QCFA 4CCZA 5G5IA 3A5FA 1R3YA 1RR2A 3H2OA 3OBAA 3QKEA 1H5VA 1M03A 4QEHA 3RM8A 3MCNA 3GH4A 2CIPA 5CJMA 1AZ1A 1WZKA 4ZB2A 1JR1A 5LNSA 1C9DA 1ZENA 2YX0A 1D3GA 1UH3A 4TO8A 4FI4A 3DBNA 4QQ3A 5I06A 2YZ5A 3WH5A 5AVHA 2QJMA 1K77A 4Z17A 1Z48A 4ERIA 5G4HC 1NOWA 3L4XA 4PBEA 4JD4A 1LJYA 3W83A 2XIQA 1IT8A 3W7OA 1E9LA 3HMJG 4JTGA 2R82A 5FSDC 1JJKA 1KR0A 1W5PA 1W1PA 2DSZA 3GIPA 4LVGA 4JL2A 4JBRA 2WCGA 2VEMA 3MSDA 4GXPA 1RUSA 1XICA 4NAFA 4AD1A 5HK4A 5TAOA 3PZNA 3F4WA 3FKKA 1VJSA 4DZAA 3URAA 1B5TA 5J8LA 3NOEA 4BF7A 3LUTA 3N19B 3I65A 1YX1A 1OQFA 5BCAA 3N29A 1SSDA 3WD3A 3OP2A 4DPPA 2E9MA 1OEPA 4PMDA 4I5XA 1WX0A 2PRMA 2HQAA 1H50A 4G9PA 2QCNA 3HGSA 4L6DA 5A3HA 3GWQA 1B4EA 3JU2A 1TUFA 4TX8A 2YFNA 3CB3A 1KFJA 1N8FA 3R12A 1KBIA 3PWGA 4UTWA 3VKKA 1FWEC 4ZTXA 1YQ2A 1JF5A 1CLXA 3ZT5A 4MDPA 3A6OA 6ENLA 5DLCA 5DXYA 3TLQA 4A3UA 1BXBA 3N11A 1O6IA 1HKKA 3LTYA 2JIEA 3Q58A 3PZOA 2ABBA 4N6FA 3TN4A 4NRRA 1R3RA 3M46A 1KFLA 2PTZA 4X22A 3AXXA 3VIHA 4QRNA 3M0IA 3C0SA 3LA4A 5HXMA 4IMDA 1RP8A 1MYRA 4MUPA 3ANUA 3GTFA 3NQFA 4ZQRA 3ZT6A 1KM5A 5K9DA 4XAFA 2PWGA 1PIIA 3MO4A 1E6QM 5A6SA 1EJXC 1QW9A 2B7OA 4R3UA 3KTCA 3AYSA 2BGQA 3M41A 4RZ5A 3T81A 4Y96A 1AFSA 5U7SA 1N8WA 2ZXQA 1TA3B 1G7UA 1EC8A 2A21A 4MHBA 1VFOA 1LOLA 1SZRA 2XPKA 1QTWA 1XDMA 1JL8A 4GK8A 4L61A 4X0NA 5HQLA 5DMLA 1A5CA 3AHXA 2J88A 3DI0A 4LYPA 4B91A 4NY2A 1EJVC 3E6EA 1V3MA 4C6OA 2JQXA 2PDHA 1XI3A 4AD5A 5K3VA 1Q6DA 1W37A 1UUMA 4HTBA 1EHNA 5T9CE 1OFAA 1B3XA 4GQQA 5CGQA 1TTIA 3BXWA 4LC6A 2IKIA 2PLKA 4WJEA 3HGJA 3UCCA 3LOTA 4S3AA 5D32A 1MW0A 1FOBA 3W2KA 2XN1A 4YTSA 1QI4A 1ICQA 1TCDA 1V3LA 3BLPX 2WJEA 1PPIA 1BF2A 1JQXA 3S1VA 2F8QA 4Y2WA 2RJHA 3VUSA 2Q71A 2WZMA 1SUXA 1F6KA 3B06A 3STEA 1OT1A 5BZAA 5JVLA 1VRDA 2Q8XA 1QR7A 3K2GA 3CIVA 2WNQA 4L4LA 5FJTA 1NARA 2ZUNA 1NWRA 3FKRA 2ZVRA 1UC5A 4Q4RA 1P6BA 3EMQA 5FF4A 2BOFX 3H24A 4H3DA 1H49A 4E4FA 4LUSB 3LCGA 4M6QA 3FYOA 3EYPA 4GI4A 1XQKA 4GKTA 3BZGA 1ZSXA 4GMEA 2PWHA 3TFXA 1B3OA 5C7VA 1Z32X 1QASA 4K37A 1YDNA 2YDAA 3QXBA 3CZEA 1QT1A 3LRLA 1UPMB 1I60A 2TPSA 1TPEA 4JHMA 1EQPA 4OOUA 2DV0A 1XSJA 4NZFA 1W8GA 4D6GA 3VK5A 9XIAA 5DN6G 2WQDA 4JEQA 3MW7A 3LI0A 4QLLA 3KM8A 4LS1A 2V63A 3T09A 2Z1WA 2OFJA 3QMRA 2ZZ7A 8RUCA 1KM3A 3M0JA 1L0PA 1RSCA 3DESA 4ZQMA 2FZDA 4HA4A 4LANA 3W6MA 1JZ3A 4NX0A 3IGXA 5FJJA 1BFNA 2BNJA 3VDGA 1IR2A 3LXBA 3NL3A 1LF1A 2WBGA 3KWSA 4YVVA 3LGGA 3R13A 3UA3A 3PZUA 1OM0A 1WXJA 5JBEA 5EMMA 4IF2A 2NQ9A 3KL3A 1MQPA 2D23A 3NDZA 2IPWA 2RKXA 4GINA 3ARUA 4EX4A 1DPMA 5HINA 1E5JA 3KW3A 2XM1A 3HB9A 3W2JA 3BANA 2WC3A 4PCNA 3A12A 1AMKA 3W38A 1LM1A 3E2QA 1XDLA 4GWEA 4LRTA 5EPDA 2ON3A 3ZIAG 4HK6A 4JOMA 3NO1A 3OYXA 3PK7A 2QJGA 1XCWA 1XIDA 3TE9A 1H4PA 2YYTA 1EP3A 5C5YA 4D6DA 3VD4A 3SM0A 1SMDA 3PZVA 4L4PA 4EF9A 4PMRA 5BRQA 2Y1HA 3MUIA 4HBKA 4V28A 3CH0A 5E1QA 4I7VA 4YTQA 3EA3A 3TJIA 4OU1A 4WJXA 4GZIA 1E3ZA 1KNWA 2IMRA 1H0GA 5C9XA 3U3HA 2PGEA 3QPYA 3KVJA 3IJDA 1XG3A 4I90A 5DQPA 2PP1A 1AH0A 1AW5A 2I1OA 5FAJA 3B8IA 4S3DA 3GBEA 1U5JA 1E4LA 3L4ZA 2UBPC 3W01A 1OFOA 4XZBA 3ZLHA 1KW1A 3WL1A 1O1HA 1JXJA 3CUGA 3QZ6A 1W0MA 2QIWA 3BMWA 1NELA 3ITOA 3HPSA 2PDKA 3AROA 3Q94A 2P0OA 2GJXA 4IICA 4DWSC 1X1OA 4H04A 3DZ1A 2F6KA 1FRBA 3L5LA 3ZJKA 3WNPA 1E1FA 4N0RA 3PBWA 1TPB1 3E0VA 2YCJA 3FV9A 3R11A 2YBVA 2GWGA 4LNYA 3EWUA 1PV8A 1KFCA 3PWIA 3C8FA 4H00A 4NIRA 3BLEA 4G7EB 4PB4A 1XRSA 2GOUA 1SPQA 3WK2A 2WHMA 4FZIA 2HCVA 3G1HA 4BI7A 3A3WA 4BJHA 1W1A1 5C71A 3EWBX 1W56A 4J3UA 3RYSA 1AJ0A 1XH2A 2VQUA 4RPPA 4PSRA 2QVNA 2DORA 1FWCC 3W27A 4LWWA 3UVIA 3W1PA 4IXXA 3VNMA 3UETA 2NLIA 1MZRA 1FH7A 1JDAA 4ZCWA 3E02A 3EOUA 1SZGA 2X05A 1E6XM 1TCMA 2C19A 4QJ1A 2UY2A 4LB3A 3F5JA 5LZLA 5HULA 1G69A 1V6XA 4PEEA 2OKOA 4IIBA 3GB6A 3LXAA 1HKIA 2GL5A 3A9BA 4K8GA 3PULA 4LB4A 2X0YA 1TZ9A 1KGUA 1JUBA 2GK1B 2ALRA 1V79A 4N9EA 3GYEA 2J7DA 1OX4B 3VXGA 3CEPA 3WK0A 4DJFD 3SCWA 2J24A 3GKAA 4YXWG 2JF7A 1GVOA 5AVNA 1GQLA 1G4SA 1U5HA 5I09A 4WSHA 5F4SA 3BOFA 3VIGA 4V15A 1M41A 3TNOA 1PWMA 1OK4A 4RW5A 4EKJA 3UCDA 4HU3A 1YHTA 1GOQA 3DENA 3AISA 4UTIA 4F0HA 2PDJA 4W86A 1HO1A 4HD5A 7A3HA 4JTRA 4H01A 4HOWA 3M5XA 1EXBA 1LZOA 2X1IA 5I0DA 4JX6A 1E4NA 3P60A 4JAWA 1CIUA 3SRFA 2PDPA 1R3QA 4HU0A 2V68A 3FAXA 3R0DA 2PDYA 1MO0A 2DZWA 1GW9A 4CQAA 1QNQA 1V77A 3TOPA 1IYXA 2HZGA 1GVRA 2PUZA 3U0HA 1FDZA 1B3VA 1GZJA 3QW4B 1PX8A 2V3GA 3WH6A 2VR5A 5D38A 4QG6A 4Y9AA 3A5VA 2X0HA 3N2OA 1PUDA 2QGHA 3FGCB 3NSXA 1VENA 2VFGA 2P8BA 2ONEA 3T0DA 1SU5A 3E0WA 5E09A 4UTLA 1QNRA 1CXEA 3A23A 1CEOA 3CBWA 4FR1A 3WQWA 3WUEA 3ARSA 3AXIA 4NAEA 1DV7A 3W07A 3EDEA 5MKGA 5FJPA 1JNDA 2CLEA 2EKGA 3HJEA 2JBMA 3P14A 2R1MA 2E7FA 5CC3A 4JQ2A 2UY3A 2C14A 2PDUA 3C2EA 3MHFA 1LBFA 4LPCA 3S2LA 3QTGA 1QI0A 4I9JA 1TV3A 3WD4A 3GAKA 3IGUA 3EOSA 3ONCA 1PDZA 4PE8A 3UR2A 3GFYA 4R53A 3WH8A 4B16A 1EF2A 2UV8G 3LSBA 4G2DA 3W7CA 2CBIA 1EEXA 1LL6A 4HNCA 1K8CA 1EWDA 1X7IA 3J7HA 1XR2A 1OJXA 4C6FA 1KO0A 3U5YA 1W9PA 2AAAA 4AEEA 1J0KA 4JXCA 1FXQA 3OEXA 2XN0A 4G56A 1ZJHA 2ACRA 4CQBA 5CC6A 3GUWA 2GGGA 1ZBCA 3FOKA 1FX6A 3W2MA 1QOQA 1H7WA 3DUGA 3CYVA 2Z7GA 3V1PA 3HZ3A 3W2UA 2GFTA 1O66A 2YCEA 1QWGA 1MRQA 1WDWA 3P0WA 2BTMA 3VGFA 2VNCA 2ZRXA 4H8UA 4NZ4A 4TVDA 4RLIA 4WDWA 2BX7A 1TIMA 3KOWA 3AWNA 3V7PA 4D6IA 4RDVA 3KBWA 4A3QA 3VA8A 1JYNA 1T5AA 1VHNA 1R9YA 5AKQA 2BZNA 3MUCA 4A3HA 1V93A 3W7DA 3WNNA 3T0CA 3UZJA 4ZENA 1LCOA 1PZ1A 1HJQA 1SVDA 2G95A 2A5HA 3CIWA 4L6OA 2R6OA 1S46A 4D6CA 3IVTA 3KOXA 3LNMA 5K9CA 4MAZA 1YXCA 3G1VA 4UQCA 1EXPA 4DUWA 1OD8A 3ME3A 2OCZA 2ZX8A 4CQ9A 1ISZA 3MB9A 2PRLA 3VC6A 1RCXB 1P4CA 2ZKMX 4Z1CA 2FKPA 2QCEA 3SCSA 1V7AA 3UF9A 1BAGA 1EDGA 3SSJA 4WKHA 1EBGA 1RP9A 3S1GA 4A29A 1R0MA 4WJ8A 3IPWA 4OBSA 2YCLB 5HUOA 4WVXA 3NIYA 1YADA 2FMOA 1Q5MA 2OYMA 4O12A 3VMNA 3G3DA 1YRRA 2VGIA 1DXEA 3VC5A 3NZPA 3CTLA 3AHZA 4IIFA 1JZ6A 1ISWA 3O63A 2QHAA 4FNQA 4S3KA 5CPMA 3R5EA 2J62A 1UQYA 1F2JA 4K7YA 3QSTA 1RBAA 2DP3A 2VCCA 4TVCA 3V18A 3TA9A 3W28A 2DSUA 3P74A 3W1TA 4XZ9A 4M6PA 3WLMA 4R88A 4XBJA 3T44A 4CNTA 4M6VA 3RLVA 1EUNA 1LRTA 2C1IA 3B9EA 3ATZA 1P1XA 2J7HA 4XVEA 4IJRA 3GY1A 1F07A 1F3EA 3UPWA 5GNZA 1A5BA 1QO2A 1W0JG 2J78A 1JDDA 4XV0A 2P50A 4L64A 3GDBA 1HF6A 3BAKA 3KLLA 3WLPA 1JAKA 3BG9A 1GKQA 3B0YA 4GUHA 3EDFA 4W89A 1XFBA 2ISDA 3FW6A 3C2VA 5HWNA 1DWIM 2HWGA 3IIPA 2G3MA 3M0YA 4GIYA 3IARA 3GG0A 1XIHA 3PWAA 5TF0A 4R34A 3MBDA 4FIQA 3E9AA 3VD7A 2NX3A 3BSGA 1ZNNA 4PUJA 5LHFA 2PDBA 2R1NA 2H3BA 3TP4A 1TA3A 4QE4A 3GXFA 3PZIA 5CPQA 3HPFA 3VDBA 1UKSA 4KFPA 3C2FA 1EIXA 4UR9A 3DFPA 5A8OA 3CNYA 3TXZA 3LZ5A 6CGTA 1A3HA 2O9OA 1GOOA 2XIBA 2G37A 3GDTA 1SQ7A 1F9CA 4MIMA 2FFIA 1S38A 4J3WA 1I45A 1C8VA 3ITGA 3LPGA 4HT3A 3PM6A 4B3ZA 3DCPA 4E4PA 5U4NA 1UA7A 2WNNA 5CZTA 1R87A 4AD3A 3H22A 5KZMA 3LG3A 3CMGA 4Q3MA 4GZ7A 2O4QA 3M0ZA 4GYKA 2V5DA 1JZ2A 3T8LA 4ATWA 4NRSA 1QAPA 5J5DA 4WDXA 1RY0A 4PODA 2NLYA 5B7ZA 3DI1A 1E55A 3ZIZA 3PPHA 1UZ1A 1DWAM 1CENA 2C18A 4F0RA 1AQFA 1I2PA 1VQTA 4UCGA 5CGMA 5ABHA 3BSMA 1K6WA 1L2UA 5CAKA 1VFSA 1K7EA 1EPXA 4HHLA 1NWUA 1ZFJA 1I4NA 1Q6FA 6XIMA 2GSHA 4RE4A 4C7GA 4B3KA 2VDHA 4HA3A 4ECLA 3QR1A 1ADSA 3ERPA 1Y8BA 1LWHA 4C7FA 1PE1A 2OZ8A 2Y7DA 3DERA 5AYYA 2XSBA 1B9BA 4CVUA 4TMCA 5EFFA 2QULA 2ZUVA 3PTKA 3O8AA 3ICJA 4NJHA 1KLZA 2VC5A 4O28A 1V0NA 3QPEA 5FEWA 3VGGA 1E73M 5IM51 2XJ7A 4OVXA 3AJ7A 3GQYA 5LNRA 4O15A 3W72A 3TUUA 1H7OA 4M5PA 2ZQ0A 4ALDA 2GWNA 3CQHA 3QRHA 4Y7EA 3UZYA 2W62A 4HKPA 1VKFA 5DMYA 5JMUA 4IPJA 3W2NA 1EEPA 5GVJA 3W76A 2NT0A 2Y89A 1WKFA 1DTUA 3P5YA 1DXFA 3W7IA 1RQEA 3POHA 4JFWA 2V9DA 5G4EA 3NYDA 3VUPA 4UIOA 1MUWA 4A8IA 1V02A 1H0IA 2WWDA 1LP6A 3GO2A 2YSWA 1SFTA 2G4FA 2QJIA 3GDMA 3LPFA 3INPA 3BK0A 1HIZA 4DEFA 2E4TA 2FVLA 1OADA 3PJTA 1ZB5A 3DFTA 3CK5A 1GVYA 3SGUA 1RAKA 1IEIA 3GW0A 5T91A 1IIGA 3ZM8A 2MANA 1GTEA 2TAAA 1QPKA 1SJAA 1VF8A 3D5HA 4RUBA 3OA3A 3SDOA 4ES4A 3CHDA 1JQVA 6A3HA 5DXXA 3I7QA 1CGYA 1NFBA 3DFHA 3O0FA 3M1ZA 1XBYA 3RIKA 3ANVA 4KWSA 1VJZA 4JFVA 2ZZ5A 3WQVA 4XAGA 1DTNA 1E79G 2WQPA 1V03A 5TD4A 3PTDA 5EB8A 3ZR6A 3GTIA 3ONBA 3QH2A 3M0XA 4O57A 5ENLA 3NFUA 2W67A 1RVGA 1TRDA 1EGVA 4I3GA 5F2IA 3MY9A 2DVTA 1TREA 4LYRA 2DJXA 4MADA 4ICMA 1QNVA 1C93A 4Q4SA 4LAOA 2X16A 3R79A 2CLHA 5FAGA 4XVDA 3V36A 4XBSA 4O14A 2C79A 3TCEA 4A8LA 4GQRA 3WDIA 5MF5A 4O1CA 2O4MA 3MDWA 3AHTA 4B90A 3RK8A 3ALGA 3DN5A 1QOXA 1H1YA 1MW3A 2I9UA 4NHVA 4U3AA 1ONEA 4EF8A 4JQ1A 5FJRA 2ZDSA 4ZFCA 4H9UA 1IV8A 2WZTA 3VGDA 3IJIA 2A7NA 4UXDA 2WSKA 4OE7A 2QMJA 3N2XA 5IDIA 4F2BA 2POTA 3PN8A 4H6EA 3CASA 2RH9A 4G7EA 4NYYA 1H5YA 2ZWZA 3NDYA 5I6SA 5D05A 5CEWA 3W22A 1JGIA 1KV8A 3HG4A 1QHPA 3BGGA 4GUJA 1K4HA 4MFDA 3UWWA 4F0KA 3WBWA 4AVFA 5CJ5A 1SR9A 3DG6A 3B97A 1LL7A 3N12A 3NPXA 2OG9A 2W9MA 1EPVA 3SB0A 4DI9A 3N1AA 3VIOA 4AD0A 1P0KA 3GU2A 1MW1A 4GVHA 4LW7A 4AX7A 4B4HA 3QZAA 4HNOA 4H83A 1H7NA 1NH6A 3GG7A 3OQ8A 3EXSA 4L9YA 1E3XA 3SQLA 3WSUA 4D8AA 1GEHA 3GG8A 3PBGA 3I68A 1IWPA 4KCUA 3M5YA 3R89A 2VURA 4LV9A 1OC5A 2XINA 1P0BA 1F4HA 3KRZA 5K7JA 4C6LA 3LZ3A 2WC4A 3GXTA 3PBVA 1KBJA 2J9XA 3VOGA 5C8BB 2G0WA 4HMNA 3S1WA 3IWPA 2GK1A 1PTAA 1SW0A 1S2UA 3PFRA 3NQ2A 4IP4A 1OX4A 1CTNA 3AAMA 1GQJA 2PC4A 3UYIA 1XHGA 4BKNA 3F7JA 3SR7A 5HWMA 4XTIA 5D30A 1UR0A 4JTAA 1UWQA 4Z1AA 1S3TC 3OPSA 1AQMA 1K4GA 5C9UA 3AJXA 1NDVA 3UFYA 4C6EA 4R7JA 4AIUA 2WSRA 4X0VA 2PDCA 1JVNA 4U5KA 3WMCA 3EA1A 3AXHA 3L4WA 3MV11 3SSZA 1Q7QA 1WDRA 4FO4A 5CLTA 2GGHA 1VBRA 4DPQA 4Z0JA 2PDWA 3WBEA 2PLJA 2WMKA 1B3WA 3GM8A 3ITYA 4ROQA 5LXXA 3HO8A 4FOJA 2WBKA 5KTLA 1FFQA 3QW3A 5E5CA 4DJFA 2WLZA 4S3CA 4GIEA 2OO0A 4Q4MA 3TH6A 1TV2A 2Y62A 2C8NA 1Q7ZA 3RM4A 2YYUA 3DXIA 4RCXA 4Q6XA 4OBRA 3VTRA 1VFTA 5IDZA 1OVDA 3WX7A 2QDEA 3B0XA 1LG2A 1HGWA 1F4AA 4WDTA 5XINA 1V6WA 1T8QA 4M24A 1UROA 2DH3A 3O16A 3V3WA 4QAIA 1OFDA 1FCVA 1PJ9A 2G5WA 3UG4A 1SZFA 5AY7A 4QFUA 4FIRA 1QDSA 1R3WA 4RZ4A 4JQAA 1DOSA 4S2CA 2CFFA 3VX0A 3CQ0A 5KZEA 3THDA 4DBSA 1RPKA 3FGCA 4UOZA 1PSCA 5G1YA 3LYEA 4HPJA 4JFSA 3W82A 3AIVA 4XWUA 3W53A 1IWAA 4GY0A 9CGTA 3NG3A 1OSEA 5FI8A 4MG4A 2DH2A 1UBPC 5CBJA 2WKJA 3HPAA 2HEJA 1MWOA 4XUYA 4W8BA 2D2OA 4O1EA 3URQA 4ZODA 3STPA 4AMCA 2VM8A 2PP3A 4HZ8A 2GJPA 2FQIA 2IXVA 2Z2AA 2GOKA 1XLAA 1YNYA 5IHRA 4UFJA 4XZHA 1CT5A 4U28A 2D0HA 4AZIA 1H7PA 4HNLA 3TEVA 1BWLA 3C4UA 3B9AA 2ZXAA 3ARWA 4HCLA 4IOTA 3S42A 1EZ2A 4IFOA 3W85A 1LL4A 1M6JA 5CLWA 2J9ZA 1Q2SA 1UZDA 1VZWA 3WH9A 3C2YA 1KM4A 2WYSA 2G97A 3T0BA 4GIRA 4UTMA 5M1TA 3S1UA 4CLMA 3CAWA 4IMEA 3M43A 3MHUA 1CW2A 3P2VA 1R9XA 2G4JA 3OLEA 3WF1A 2CWNA 4HHHA 2C91A 2FIQA 4IPPA 2I5QA 3BICA 4Q4PA 3LHTA 4IMGA 3TONA 2EAWA 4CUCA 3L4VA 2HS8A 1A5LC 2GSEA 4FXSA 3ELFA 1B31A 3I10A 5IOBA 2OSXA 3M0VA 3IRSA 4XIMA 1VCVA 3NXLA 1VEMA 1WBHA 4O13A 4TXEA 1BVWA 3DIPA 3L23A 2VRKA 4PMQA 2XIOA 5CZJA 3V1HA 1I2QA 5AHFA 2Y24A 4MWAD 4LOCA 2V82A 1BYBA 3LCHA 1TYGA 5EGRA 1RK5A 4LXFA 3LM3A 3HQNA 4LSBA 3RG6A 4WOQA 1IT0A 1HJWA 2F9RA 4BK9A 3HA1A 4IPLA 3WJSA 5FL0A 4BEUA 2I17A 2HSAA 4KFOA 4JTSA 2WM0A 4TV6A 3S9IA 4FNTA 4JDBA 3WMLA 2AOSA 4ZE4A 4Z1DA 4GYFA 4LCRA 2KZHA 1ZBKA 2CBJA 3H12A 2YCLA 4C6DA 3CUXA 1EGZA 1VLIA 2WVTA 1FH9A 1YKWA 5KEZA 3ENLA 3P81A 3M6DA 3G22A 2PGRA 1OB0A 4DBUA 4J1OA 4DN1A 2EPLX 2OR2A 3OLIA 3OBEA 1E0VA 4MWAB 4ZB5A 4IUGA 2JGYA 1X8FA 1OCJA 1TTQA 2D2HA 1RHCA 1EH9A 1LG1A 1EX1A 1TG7A 4TX9A 5CSYA 2BS9A 1BVZA 3RX2A 4MB1A 1OYCA 5I3GA 3W7MA 1EOMA 1ZPTA 2BHZA 2EPNA 4O19A 3UCQA 5HBFA 2Y8UA 2YB1A 1AMYA 1XWYA 3VMPA 3H54A 4LVFA 4AZGA 4QIUA 5JBFA 1OFEA 3P8IA 4XKMA 4LFYA 3Q65A 2PMQA 2BB0A 2RDXA 3CAQA 3NVTA 3U7VA 4F9JA 3VFLA 4F0LA 2ZCGA 2FH6A 4HNTA 3SUSA 3GU1A 4WKAA 1MSSA 4JCMA 3B04A 4IZGA 3DAQA 2P88A 5AHIA 4GFSA 2OEKA 2O7SA 5EA9A 4BI6A 4GCXA 1N2VA 3N6JA 2DT0A 3KOFA 4XB3A 2BBFA 2JEPA 4KS0A 1A53A 1ZZMA 2DZUA 3JW7A 5C2GA 1O7AA 3LQLA 1JD7A 3O07A 3UXDA 1EHAA 3CPRA 1EJRC 2EF9A 1QI3A 3LERA 5CZ0A 1M68A 2Q09A 4J28A 3NURA 3CMFA 4Z2GA 4IQDA 1KFKA 2GJLA 1CLKA 1FKXA 3TN6A 3ZJ6A 3NO3A 2F84A 4CNSA 3FXYA 1ITCA 3LENA 1KGXA 1HKMA 1UMLA 1QCWA 4M56A 4AY7A 3K5XA 4AW7A 3MKCA 3THAA 4JTEA 1G1YA 3FA4A 2TMDA 4MWAE 4ZE5A 4PFHA 1R7OA 4JYFA 1OX6A 4J7RA 3BAYA 3TNBA 3U2EA 1A80A 4DBEA 2XVGA 5ABEA 3G2GA 2RUSA 1YDYA 3ZS4A 2QEZA 3BW4A 4R7OA 3MSGA 3WQCA 2IKGA 1E56A 1GKPA 3LCWA 4XTDA 5E6YA 3QYSA 1CGVA 3QKZA 1UIOA 2WHJA 3ZFHA 4HTYA 3WUBA 3F2CA 3D6NA 2FYMA 5KITA 2BOEX 3GNOA 1DIKA 2ZC8A 4MB4A 4F66A 1EYEA 4L4MA 3ZR4A 4Z0SA 2VYOA 1C91A 5HJYA 2VKZG 5A5WA 1ZALA 4JL1A 1XQLA 1S1RA 3VNZA 1DWJM 2WPDG 1Y7VA 3U9IA 4PTWA 4KGLA 3DGBA 3BGAA 4KCTA 2BHYA 3CAVA 3M64A 4S23A 2XN2A 5A8MA 5KETA 3UY7A 4XO7A 2D69A 2YIHA 2EJAA 4DXKA 1X1NA 3O15A 4PBFA 1LWIA 3H4WA 3KL0A 1PTGA 2FTPA 3QC0A 3XISA 4MFEA 3I6RA 1R86A 3L12A 1ISXA 4TU1A 7ENLA 1XLBA 4AZCB 4NILA 1GOKA 3B40A 1BF6A 3AMKA 2QDHA 2OTDA 1VFUA 4YTRA 3S2JA 4GUGA 4MM1A 2V2HA 1MEWA 3DHFA 4HOZA 2VCAA 3BV7A 1OHLA 3MPGA 5I03A 1XPYA 3TAOA 3WCZA 7XIMA 4FNPA 1W5OA 4HPGA 1KXTA 1JFXA 3SCOA 4QNEA 3VI2A 4S39A 4DXXA 4W9TA 4F4RA 1BPLB 4N9BA 3ITXA 1UD6A 1F74A 1FWFC 3M0KA 4UFMA 1S5MA 3PR2A 4GQGA 1DHKA 3GS6A 2Z28A 1KCLA 3K4DA 3B8UA 2J27A 4KPLA 3HFTA 3UR7A 2BMBA 2BP1A 3GTHA 3OGSA 5A94A 5I07A 5HPCA 5CBIA 1XIJA 1SZNA 1LOQA 3AAGA 4ERGA 3LU2A 6ALDA 1QRQA 2H3DA 2XFRA 4ZSUA 4PFMA 2RDTA 1VPQA 9RUBA 3SUVA 3S4TA 4UR8A 4O1DA 4PCPA 2NVCA 3U7BA 3WQ5A 4PUUA 3WDRA 1ODUA 3TC6A 4UFLA 3IANA 1VYRA 3EA2A 4IH3A 1HL9A 4W85A 1M1BA 4UB9A 3N4EA 1MXDA 2EKCA 3KRBA 2A3LA 2YGYA 1US2A 4OJYA 3L66A 1UD5A 1VH7A 5D9OA 4K1WA 2FDSA 5HA7A 4NJGA 4M19A 4MLJA 3GDKA 2WWCA 1OYAA 1PEZA 2PTYA 4ZFMA 1J6OA 4ZOEA 1VP5A 1QO5A 4Q4QA 2G3FA 1O5QA 3L4UA 4MOZA 4RL3A 5TBOA 3MV01 2H90A 3P62A 2NWSA 4MNKA 3ABXA 2VZUA 3LI1A 2AL1A 3USZA 4H7CA 5H6HA 3HQ1A 3M47A 3NA8A 4MMWA 4C6JA 4C65A 4JHZA 1GPWA 3HOJA 1DE5A 4MYAA 2NV2A 3SUTA 1CGXA 3WLQA 1BKSA 1AK5A 2BLEA 3AIBA 1UASA 1F3WA 1UH2A 1HP4A 2RDUA 1J11A 2PPGA 3MVTA 3SFWA 1R3VA 3FVDA 4GI8A 4QEEA 1W31A 3G5EA 1K70A 1S2WA 4QJ4B 1TX2A 4RNJA 5PTDA 1PKLA 2FDMA 2QJJA 2JJ2G 3S3GA 3IRDA 4IFRA 3SIZA 2OEMA 4MUZA 4KWWA 1YYAA 3WYZA 3G1YA 2J25A 3VAVA 2WOQA 1XCFA 3R58A 4KWUA 3GFZA 1MW2A 1RVKA 4B2DD 4WR3A 5DCBA 3MI3A 2YDQA 4AD2A 3W00A 4KIRA 5E70A 2Y5JA 4B5UA 1C7SA 1F61A 1QNPA 5XIMA 4JN6A 3GK0A 3VNYA 5D2XA 5AZ1A 4K3ZA 3QY8A 4Z1YA 2VGFA 2XDFA 4YIWA 7CGTA 3BUVA 4Q7BA 4C6QA 5CKSA 4LAZA 2YDRA 2E28A 1S1PA 2W3ZA 4LUIA 4E0CA 1EWEA 1VFFA 1WXYA 1XX1A 2VENA 1DJXA 1EX5A 2ACSA 3IUDA 3VOJA 2QR6A 3RO6A 1RD5A 3E5PA 1K03A 3RGTA 4EXAA 2GJNA 1MNZA 3KE0A 3BTNA 1GVSA 1QPOA 1EC9A 1TMLA 3OU8A 1GOIA 1KB3A 4JTQA 2ZE3A 3N9SA 3T6CA 1IZJA 1XYMA 1D7KA 3L21A 3STGA 2Z1VA 1LT8A 1TZZA 4MB3A 1NM9A 4Q8WA 5M2FX 2QUMA 3FS2A 3MMTA 4FOKA 1L2QA 5FIPA 1J0IA 3WEMA 2IQDA 2DPEA 2VWSA 3WENA 1K8YA 1DQWA 4WEVX 3VDCA 3BW3A 1KRMA 2H9AB 2WAGA 3R8GA 4DXVA 4PMYA 1UD4A 2O9PA 3PUEA 2QQ6A 3AFBA 2VRQA 3BLIA 3H21A 2DQWA 1W1IE 1BHGA 5A69A 1GG0A 3QOKA 3IJ8A 1L6YA 1NEYA 2Z26A 4Z2HA 4CEXC 4OIFA 4OHQA 3TCSA 4MPKA 3RX4A 1IGWA 1KTCA 2YLAA 1UKOA 2EBNA 4UUIA 3OLGA 2NV1A 2CXEA 1GT8A 4Y6GA 3BG5A 5LYRA 4C7DA 3NQ6A 4MJMA 4X60A 1PKYA 1IZCA 4Q8UA 2EGZA 4KCWA 1W2PA 3QV8A 1HTIA 5HNNA 3QYQA 4JQ4A 1ADDA 5DBTA 3GSMA 2RGMA 3GZAA 3ISIX 3PG8A 3SIMA 2EJ1A 5HMDA 1NSJA 4LVBA 4LVDA 4AIBA 1F8MA 3II1A 1UD8A 3QGAC 1ZBVA 1F05A 3CV7A 5D03A 3EWYA 1F6YA 3ZLGA 4OQVA 3GFXA 2VEFA 1LDCA 1TWWA 1U22A 3PNZA 4CU6A 2XIJA 3BJFA 4PMVA 1P5BA 1S5VA 1JUKA 2FHFA 3V4BA 1CZ1A 4F9DA 2XFFA 3P93A 1PZ3A 3F4NA 2NUYA 3V75A 1QW8A 3W2LA 2R9RA 5LGZA 3BAXA 2AKZA 3PZMA 2FHBA 4EPDC 3VIMA 1MEIA 1G5AA 3O6AA 1GEQA 1R38A 4WGHA 2D1ZA 2Y8VA 3BMVA 5REQB 3DFOA 2PEVA 3DC0A 4OGZA 3UG8A 3W4RA 4BS0A 4ICCX 3E0LA 4RE2A 3FA3A 2QS8A 4IMFA 3W81A 1GHRA 3MANA 1OT2A 2Z6JA 3DOPA 3U4AA 1Q13A 3BH4A 3NPVA 3VDAA 1TVNA 5TNVA 4C6IA 5F2GA 1QI2A 3NEVA 1TTPA 1TQJA 1D8WA 1P48A 3SFKA 4WXZA 3RO8A 4Z2JA 5EMKA 5CXPA 3PUOA 4FF7A 4GNVA 2ADAA 5BXSA 2E25A 4LNCA 4GKLA 4EPKA 4ZO7A 4N7QA 1Q66A 3CAKA 3PP7A 5LA2A 4DX3A 2XIMA 3AS2A 1XL9A 3C0JA 2QMKA 2HNHA 4ENLA 3CZGA 1KTNA 3GRIA 2P76A 1J0YA 2OODA 1SM9A 1O4UA 2Z24A 4XZIA 3AIWA 3GIQA 1E9ZB 1KV5A 3MYPA 2NSXA 3Q67A 2VX5A 2XVKA 1U1HA 5ECVA 2GSJA 2D3LA 1YBQB 1US0A 5B80A 3AOFA 4TSFG 4UTJA 2V2CA 3N17A 3ZMRA 2QKFA 3AMGA 2W6IG 3AYTA 4GJIA 2NUXA 5F4XA 4F48A 1VFMA 3FJ4A 4UWMA 3AYRA 5G1MA 2EEXA 4JNMA 3ZVIA 1FHVA 2OOGA 1BXCA 4DF1A 3A24A 4FOUA 3C61A 2NZLA 4IIDA 2ZX9A 3MP3A 2DGAA 1FWAC 4HHPA 4AYSA 1K7FA 1J5TA 3H70A 4DJEC 1QNSA 1R6WA 1S2TA 1U5VA 2PWDA 2EPKX 6TIMA 4I6KA 1TPVA 3MCOA 1LQAA 3DYPA 3NNTA 4MWAA 4KBXA 1EJWC 3I3DA 1VB9A 3HV8A 1XIFA 4MAVA 4UR7A 8A3HA 1F76A 1WKDA 5KZ6A 4FR6A 3WFAA 2XZ9A 5LXEA 5DY2A 2OXNA 4O18A 4K7VA 1FWNA 4ZBCA 5AC8A 3MKVA 1MFVA 4QITA 2OWXA 3RRXA 1DJZA 4ZEPA 3B0PA 3GDRA 1U33A 4PBGA 4LEFA 1IEVA 3W7RA 2JKAA 4WD0A 4AFYA 2XHYA 2OX1A 3MVIA 4M80A 4FP1A 3AC0A 4LT9A 2OGYA 4RV8A 3R1ZA 2WSQA 3NTYA 1JEZA 1W9BM 3ARZA 1O60A 2P1FA 2PD9A 3CZ8A 4DWSD 1VGAA 3KVKA 2CKRA 1WZLA 1W3LA 1NFGA 4H2HA 2WZEA 1NAL1 3WEOA 2PS2A 4H1ZA 3G77A 4RZ6A 2R94A 2HXUA 4CNPA 3IK4A 4LF1A 1FFRA 3AXKA 1XYZA 4M0XA 4H9TA 5CZSA 1EJUC 2PP0A 3CV2A 3VIIA 2XWEA 3AS0A 1P1MA 4UNLA 3UNTA 3KTXA 3KX6A 4JR5A 1OWQA 2DUAA 4ZGYA 5BWFA 3WLHA 1O5XA 1Q4NX 3DKJA 4YVPA 4Z2IA 4HMEA 3JZEA 3FJNA 2QGYA 3ZZ1A 3VIKA 2IUZA 5LA1A 5EMYA 3C2OA 4HPHA 3PAJA 2YOCA 1YLVA 4F79A 3CQKA 3PZQA 4CNNA 1VJIA 1WE5A 1Z42A 4DWSB 4O1AA 3MUZ1 1AJZA 5F7UA 3UNDA 1G4TA 3H2EA 2A79A 4PL2A 4ORIA 1L6GA 1IXPA 2NV9A 5CC7A 4E8GA 5I78A 3SCQA 3N3MA 3VX1A 2ZX5A 4YL2A 1UR2A 3E3HA 2E77A 2Y6ZA 4UQBA 3GIYA 3ZJ8A 4YTUA 5C70A 1XV8A 1FCQA 1QK2A 3VCCA 4TOQA 3W87A 2V3FA 4PMXA 1K8XA 2CITA 3HGRA 3FEMA 3CUFA 3LBCA 1NF0A 4E38A 3W26A 4CCEA 2A3EA 1JZ8A 3AO0A 4GQ0A 3RILA 5CPTA 2VMFA 1OYBA 4UC5A 1L8PA 3PC0A 1RQHA 4E5TA 3RFAA 2P8CA 3B3DA 4JN8A 1DP0A 4RE0A 1H1NA 3H2AA 1KCZA 4N4PA 3ZR5A 3QN3A 3E38A 7REQB 1D8CA 3WKZA 4B5VA 3WN6A 1HUVA 5G4WA 3FVMA 4DO6A 4DJEA 1GG1A 2GDUA 1GYMA 1NQKA 2VX7A 1H41A 1QU4A 1BTCA 4PRTA 2C71A 3T05A 1ZP4A 3G0SA 4PTVA 2FZ8A 3ZYZA 4G7FA 1WA3A 3HIJA 4H6KA 5CH9A 3VOIA 3WBYA 5RUBA 1CXIA 1KQZA 4BF9A 2YW3A 4DM1A 4GVGA 4UCFA 1WO2A 2X40A 4RW3A 1C8XA 2YZRA 2PE4A 2IXUA 5F1UA 4B92A 1DHPA 2YA2A 3SEPA 5M5DA 5LKYA 1UP0A 2ESCA 2J8TA 4AZCA 2W4XA 5EMUA 1N82A 4AHQA 5FESA 1TV4A 2YW4A 1YPIA 1XH1A 3K4WA 5HQEA 1KLYA 3A9IA 4BEQA 2Q8LA 3VPLA 1E4MM 1QVBA 3BJSA 3CV1A 4LY4A 3TVAA 1QPRA 1KQYA 3APGA 3NQGA 4KRUA 1MZHA 3WQPA 2QVHA 3OA5A 3QC3A 4AQLA 1EL3A 1PL9A 3JS3A 4XBKA 1ME7A 4BWLA 5G2WA 4U31A 3KRUA 3MUY1 2Y61A 3R0UA 3WJYA 3CLMA 3B9DA 1S39A 2CETA 5CPNA 3UZXA 1S2CA 1BG9A 2FTWA 1TPH1 1THFD 3SN1A 4H41A 1PBGA 1S5NA 3LHWA 4LX4A 2GUYA 1VEOA 3C52A 3M4HA 1L9WA 2I56A 3LLDA 4O16A 1QHOA 3AHVA 5C9RA 4DNHA 3NQ8A 1KFEA 1EIBA 2GLKA 3AU2A 3CU2A 3LN3A 4JPGA 3ZOAA 1CCWB 3TYDA 5C9ZA 1LUCB 3CT7A 2UY5A 1J0HA 1V08A 4RNFA 1GVFA 4K39A 1AD1A 1SMAA 2C16A 4J3SA 1UWRA 5HNUA 2BGSA 2BDQA 3GBDA 3VNJA 3AWOA 1ITUA 3VMOA 1ADOA 1XYLA 3AYVA 4J4KA 2J9YA 3FAWA 4D71A 3CUIA 3KTSA 5C54A 3A4JA 3NZGA 5D9MA 1KXVA 3KP0A 1XIBA 4IIHA 4F2UA 2P53A 4MNMA 1HJVA 1ODZA 3OOQA 4I9TA 1GPFA 4P8XA 4RXFA 5DX7A 3VKCA 4OECA 3KRSA 3RUBL 4FNRA 4Z08A 1GTHA 2WSSG 3WBXA 4Q33A 3PHAA 3JUGA 2D0FA 1EA0A 4K8EA 4QS6A 4KKXA 1R3TA 1J5SA 4B5TA 2V30A 1A5OC 3BLFA 3MUXA 2GQ3A 2JKPA 3WQ8A 1GQNA 1WZAA 2Z00A 5DEZA 2NXHA 4Z42C 4D6JA 2PWVA 2CNCA 5BWAA 1RJRA 3A64A 4O8RA 2YR1A 3H7RA 2DDXA 2FVKA 1E40A 4FF5A 3WK1A 1XF0A 4C6MA 3KVMA 2OQLA 2QCCA 2DZXA 3B8SA 3GVQA 4XX6A 3OODA 4DI8A 3WL0A 3QV7A 4RDWA 3HGOA 1IGSA 3AIUA 1O95A 4FK9A 4GH1A 3GYCA 4QDMA 1V0MA 2E09A 1FUYA 4RR4A 5HR7A 1POJA 4GABA 1C7TA 4NL1A 4FLRA 4BHYA 2DY3A 4ZSTA 1F7BA 2FPVA 3GUGA 2AL2B 3ITVA 4FLSA 3S46A 1DWHM 2VO5A 3CGTA 1V3KA 1SGJA 5CZKA 3V5FA 2YL5A 3MJMA 5A8GA 2X0SA 3GC4A 2B7PA 3S1XA 4PA8A 3VNIA 4LCQA 1GWJA 4OUEA 5LIUX 4B5SA 1SFLA 3HN3A 4TT3G 2YCKX 3O6DA 1EP2A 1AL7A 4XIAA 2FMNA 2AGTA 2H8ZA 4ZQNA 3UG5A 1AQHA 1K6AA 4WHBA 3UYCA 4B2DA 2WCAA 2VZTA 2VQTA 2OWWA 4WY0F 2NX1A 2EHHA 3W7LA 3NQMA 1VIZA 2XM2A 3OEHG 1DYSA 4J9JA 5HWJA 2OYKA 1H51A 3KCLA 3JR2A 3WQ6A 3OFNG 4LRSA 5K4ZA 1BXNA 2TODA 5F2MA 3WD0A 1FP8A 4XZNX 2BG5A 1Q63A 4ZOBA 3RXZA 1O94A 1H7RA 4UMBA 4OTKA 3PZGA 2H9AA 4MGGA 5F2LA 3UWZA 2BGNE 1KXHA 2PF8A 3B4YA 3E5BA 1E6PA 4PCSA 3OZOA 4JNZA 2GDVA 2QCLA 3NL5A 1J12A 1HZYA 4IX2A 2VZOA 3RJYA 7TAAA 1UKPA 1UWIA 1L6WA 1J01A 2VELA 4C91A 4CEUC 4H9ZA 2VDIA 3NQVA 4GJ1A 3NQCA 1PHQA 4P8WA 4IP7A 3BE7A 2CZVA 1TB3A 3IJ7A 3LM7A 4MDOA 4O10A 1TRIA 4WK9A 3NQ7A 3HU7A 1A5UA 3TROA 2V6AA 4BQ5A 4GNKB 4ZVJA 4N6EA 5CPSA 4Q4KA 3LTPA 2PWEA 3HQPA 1K02A 3QJAA 1B0IA 3CLWA 3UGRA 4FX8A 5AYXA 2IKHA 4V1YA 2W0UA 2ZWYA 4GC3A 4H9YA 2V5KA 3PB2A 3TTEA 3VD5A 1B3YA 1W3HA 2E40A 4NI8A 3AIEA 1S2AA 3OG3A 2JE8A 3S5OA 2WNWA 4LS2A 4FAMA 4DO4A 2DZSA 5CJNA 1MMFA 3W7GA 4A35A 3EDJA 2OOFA 4NZJA 2V81A 4PRWA 2Z1XA 4KIEA 2V5LA 2ZX6A 1FWDC 1PKMA 3DHPA 1X1ZA 1FVPA 1HJSA 2CBVA 4WXYA 5JIWA 3MMWA 5GJNA 2RHGA 3TZFA 2ISWA 1J4EA 4DZHA 3MO7A 1ZAHA 5L6UA 5AC4A 5AN7A 3VOHA 1EO5A 3HF3A 4YS1A 4QQUA 3CL8A 3KBMA 1MXSA 4O8AA 3QVQA 4GGHA 5REQA 4FNUA 1XRFA 2NQZA 3POCA 2EO7A 4F0SA 3EBVA 3IEBA 3UJEA 1Q65A 1JPDX 4S1FA 2Z0IA 3G1AA 3PBUA 3SGGA 1KRCC 1OIMA 3F4CA 3EWCA 1FHDA 4OOZA 4ZR8A 3GDLA 2QDGA 3AS3A 2R8WA 3UXIA 4AZHA 1O12A 2VEPA 3ES8A 4GD0A 4WGXA 3I3BA 1WP6A 4CN6A 1GVIA 4N42A 2PBGA 4NI3A 3C3UA 3TJLA 3ARXA 4A2RA 2J47A 2HLDG 1FP9A 4PSPA 1H3GA 5FKYA 1AVAA 2ATSA 4K38A 3AZSA 1Z3NA 2FHCA 3IV3A 1W1VA 4P8UA 2H6RA 3VOCA 3A13A 2XSAA 3TN5A 1SO4A 4A3RA 3QV9A 1OF8A 3BARA 5AECA 3R6IA 1V3JA 3NCOA 2BODX 2WLYA 4AWEA 1NWTA 4ML9A 3MP4A 2GQAA 4JYEA 1JRCA 2QV4A 1ZAIA 2VP8A 3BLDA 1DE6A 2J66A 1UW9A 1K9FA 3QGVA 3VKAA 4EWND 1OY0A 2NW0A 3N6HA 3WNMA 4D2JA 1IEQA 4BI5A 4MLRA 1ZLPA 3RLGA 5AYZA 1V02E 4JIHA 2EPHA 5HMEA 2ZUSA 4HU4A 4MNLA 2ZXDA 2GVEA 1Q6QA 1YXYA 3ZLFA 1YBQA 4HGXA 2HPIA 4LS0A 4X2PA 3VM5A 3TW9A 2OELA 4B9ZA 2QCMA 3VNKA 3OTRA 3FFSA 4LAUA 3Q45A 3W1QA 1I1WA 2HDJA 2GGIA 1RALA 3U4FA 1X96A 4C6PA 5L9FA 1UD3A 2OWCA 3R2GA 4PGLA 3UXKA 2XSXA 4GNJA 4XK2A 5DCDA 4U4MA 3D47A 2PCQA 2BXYA 2ZA1A 3WLLA 5FACA 4HZMA 4DF0A 1G67A 1EYWA 2Z29A 1W1ZA 1XJBA 3G1RA 2GJRA 5M17A 3FKSG 3SRKA 1V3IA 3HG2A 5H8UA 3MDUA 3N15A 2YPIA 4IGNA 2YA0A 4E2VA 3WK3A 3CS2A 3T4WA 4JCLA 4F0MA 1UWTA 4QSHA 3L4YA 5EL1A 1SYTA 1J2BA 4IQJA 1TPDA 3RF9A 5I77A 3VYLA 4JQ3A 1B3ZA 1C92A 3AIRA 1UKQA 3F4VA 5D8WA 3TJXA 3QSRA 3I4EA 2FGLA 5LNWA 4JTHA 4P8VA 2E9LA 4WSJA 4H19A 1F3TA 2HVOA 1C8YA 2I9EA 1KBKA 1BG4A 3MZ2A 3IACA 4MY9A 5IBXC 2OLHA 3H55A 3NM1A 2VDGA 2VFHA 4REQB 1E9YB 2OO6A 3O0KA 4NX5A 1ONRA 4EXQA 4H6RA 4DAIA 4P7LA 1Q6RA 3M9YA 1VHCA 2QCFA 1T6MA 4X61A 2FZ9A 3CUHA 3VO0A 4EAYA 3C56A 3ALFA 1ZRQA 1RCOB 3G8RA 1W9DM 1UZHA 1E4IA 3G3MA 1GGOA 3VZZA 4JFTA 3C8NA 3KUMA 4MZYA 1NWSA 2X1TA 2ZX7A 3M6YA 5A8QA 2C6QA 2BY1A 1FDJA 1UG6A 3UWVA 2E6DA 1WNOA 3L2IA 4R85A 4PUNA 4WOZA 5DN1A 1PAMA 1JAEA 4DWSA 1PYFA 1WOAA 2ZOXA 1PX3A 5GJMA 3FEQA 4TVUA 2PTDA 1P0EA 3LBMA 2C0AA 4AEOA 4FSAA 4GBUA 4ZXLA 3OLDA 1U83A 2QF7A 3N34A 4WZHA 3OGRA 3H4XA 1OGGA 2PDFA 4XD3A 1TX0A 3MT1A 3UWQA 3QHNA 4JEJA 3SQMA 4WKFA 1UOZA 3GNRA 4L9ZA 3CQIA 5H8PA 1JFHA 4ASUG 5BU6A 4IIEA 5D09A 2E3ZA 2IW0A 1H8EG 1MFUA 3FY1A 1DQXA 4HZ6A 2XH4A 5CBBA 2GZXA 4S3FA 3LGEA 3LTSA 3UQNA 2J6XA 4Q32A 3VU2A 1TUXA 4GGBA 4B15A 3NPWA 4GISA 3LHVA 3VDHA 4CQDA 4FXRA 1Q6CA 1EO7A 2Q3RA 3EEGA 1R5YA 3WIJA 1LBMA 5FEZA 2VGGA 1GCYA 7REQA 4QTGA 4OWGA 1GORA 1VBUA 4X63A 3DYOA 2REQB 2VR2A 2ATMA 4IIGA 2QT3A 4IISA 3WF0A 2VC9A 1GOWA 4KMQA 4XG1A 1IIHA 3GU9A 4I5UA 2Z6IA 3N6QA 1TJRA 3W24A 1J96A 4PULA 1CDGA 4ZB0A 3OZYA 4DAFA 2MNRA 2PDXA 1T0OA 1EGMA 4CCCA 2HE8A 5I23A 4CU8A 3T2QA 5EY5A 1JGMA 5HNTA 2E67A 1XYCA 2NX9A 4HCHA 1CPUA 2A7PA 4W8LA 1OK6A 3WQ4A 1DORA 3W1UA 5I5RA 1IQ8A 2B4GA 5A8NA 1H62A 2BXZA 4JICA 3NXFA 5AC6A 1EDTA 4DO5A 3GTNA 1HW6A 3WNKA 4JX5A 1A5NC 5LSMA 2P3EA 3S8HA 2QUNA 1TE6A 4CD6A 3N9RA 3URNA 3GVWA 3WO8A 1TO3A 5AFDA 1PYMA 1TPUA 2HK1A 2YXGA 1GONA 1CWYA 1ZY9A 3PBMA 1M65A 3WDQA 3FXGA 1WV2A 1E6SM 4CN1A 1KR1A 4OZOA 3WG6A 5K2ZA 1I0DA 4ORMA 3DC8A 4GACA 3SW6A 1GZ1A 1I75A 1VS1A 3VCRA 1HFBA 3EX4A 3L4TA 1R7AA 4IPNB 3MHGA 4JIRA 1NIUA 1WKYA 3RCYA 3MI2A 5FEPA 3UT0A 3THCA 1C29A 4KGJA 1DWGM 1V8EA 3HTWA 1PKNA 4O53A 1J79A 2C7FA 2EPOA 4HYWA 3A4WA 3HBLA 3PJUA 2CLFA 1WUEA 3BWWA 2O9RA 1AUSL 1TV5A 5BW6A 3E0FA 4D6EA 5FJOA 3VFCA 2B31A 1N8IA 2W91A 2J7EA 1VBJA 3SRDA 1LUCA 2ZIDA 2J8GA 1QBAA 1OCNA 3TTSA 3P0XA 1XUUA 1Q6GA 2A2IA 3GNDA 1JULA 3TTYA 5E0CA 3MA8A 4P7NA 3MWCA 1MI3A 4V33A 3ARVA 4JN7A 3SCPA 3ZVHB 4YU1A 5E9AA 1IWBA 3KS5A 4WF7A 3D3FA 1GVQA 1T7LA 3EPMA 4Q8PA 3VNLA 2E9BA 4GI9A 4UMCA 3UESA 5BXPA 3PZ9A 1E51A 3R43A 5HDRA 3NOYA 4DYJA 1E71M 2V0TA 4P2VA 4AISA 1M01A 3APTA 1TELA 3FDGA 3TMQA 1KA9F 2GGJA 1JIBA 1AH3A 1KGWA 2CLLA 4AEFA 3EKGA 4Y9NA 4JTLA 1KM1A 1QHZA 3VGEA 3VABA 3CB8A 4QBXA 3AIQA 1CGUA 4GA8A 1UWUA 2BOGX 4H7VA 2XOKG 1KKOA 1AG1O 2QIIA 2XYLA 3ZWSA 4BA0A 3PSWA 3WQEA 1FA2A 3LNPA 4RDZA 4RX0A 3WMBA 1UA3A 3CZJA 4PUWA 3TYEA 4Q8MA 3TR2A 3OB8A 3EXTA 3ABZA 1AH4A 3NL2A 2NVAA 3TIMA 3MMUA 4Q7NA 5GJPA 1PVNA 4UNIA 1I8JA 5BXTA 2J79A 3EB2A 3TYAA 5LHEA 3V35A 3UPMA 3OVRA 4C6KA 4EP8C 3NPUA 4R9OA 1W91A 1ML1A 3EX6A 4UTWC 1RPXA 2BASA 2ISVA 3CMJA 3DHDA 2AGKA 1RBLA 3S5ZA 4MKVA 4YYFA 1Z69A 2A1YA 4JFUA 3F5KA 1IEWA 2AL2A 2CERA 1M04A 3MSYA 4ZQCA 1W1TA 4GUIA 4KRZA 1W6TA 1CX9A 2VTFA 5D04C 2NQJA 1UHVA 2PWFA 4QHRA 2XVPA 4YTTA 2V5JA 5AYBA 3B4UA 3TK7A 1EZWA 4JTKA 2BVYA 1WAUA 4O17A 4HPNA 3NO5A 3QFEA 4O4VA 4K1GA 1LLZA 1WPCA 2X2YA 5C7HA 1H60A 2DT1A 1H09A 5BRPA 1QATA 1UR1A 4CD5A 3JVAA 5BYWA 2X41A 4XD6A 4FEZA 5ECUA 4QAWA 1JDCA 3ITCA 2XU2A 5XIAA 1XM3A 3LPOA 2E8YA 1UKTA 3MSRA 1LLOA 4M7TA 2QZRA 2NXGA 3AALA 4CKQA 1VRXA 2FZBA 3NGJA 1Z89A 3U5UA 5DBUA 3ZXWA 2QJHA 4HN4A 4NP7A 3SUUA 4PN2A 1XH0A 1XLLA 1I9CB 2FZMA 4DF2A 1YNQA 3EPNA 4GZJA 4LALA 3ABQA 4DELA 1Z7AA 2VX4A 1HX0A 1W9XA 4IP5A 1DL3A 1P6CA 1UD2A 3QHOA 2WO5A 1JI1A 5A6TC 3PY2A 3OZMA 2FH8A 2E68A 4W5ZA 4JKKA 4K6AA 2E5BA 2QF8A 1ZU8A 1CYGA 4URIA 1HP5A 2GDQA 3T7VA 3P61A 3HJZA 4RDYA 5HOSA 3LHYA 3WLOA 1BGGA 3WBAA 3NUKA 5HAOA 1FWJC 3R0KA 4XISA 3K8LA 1OIFA 3N4AA 2JEQA 2CU0A 5I02A 1GQIA 4AUBA 5MHBA 3N18A 1LBLA 2HTMA 4YWIA 2EXOA 4NJIA 3LX9A 4F40A 2JIZG 3C2RA 2P3ZA 4ZXOA 4S3EA 1ZQ5A 3H8AA 4KWOA 3S2NA 2X2GA 2O55A 4NKCA 5A2BA 4US5A 3QV6A 4O0KA 3XIMA 2W61A 4HNVA 4UFKA 4ZOCA 4E8DA 1E5NA 3BV4A 2J6VA 4YCOA 2V7QG 1YPXA 2V5BA 3DBPA 4M1RA 4E3TA 1W32A 2VWTA 7ODCA 4W5UA 4XZWA 4AVOA 4Y90A 4A21A 3OVPA 5H8MA 2PWUA 3ZQ9A 2OEJA 1GK8A 1HN1A 1OINA 3HG3A 2XZ7A 3C3NA 2D2GA 3BJTA 4L7ZA 2VFDA 2HS6A 4GYJA 3VINA 5KINA 3T9PA 2ALDA 3WD2A 4GVIA 3H2CA 2DSVA 1JZ4A 3S83A 2J75A 3UXAA 2F6UA 4WUIA 1TJ2A 2W79A 2ASHA 2ZUWA 2OZ3A 6TAAA 4KFNA 2GGEA 4H8VA 4RJEA 3SY8A 3UWEA 2ZDRA 5J5RA 1LRNA 4XSLA 2YLLA 5JXQA 2NQ5A 1IXNA 4M51A 4KEMA 4AYGA 2X1RA 4AC1X 1UIPA 3LMYA 1BEUA 3QOMA 3G8EA 3VILA 3OVQA 4FLQA 3H4GA 1JPIA 1NOUA 1IXOA 3WELA 3GKFA 4MY8A 2X09A 3TQKA 4LAMA 1YNPA 4ZQPA 2VFFA 1YTKA 4LBSA 3CXOA 3KP1A 1DIDA 4H9XA 1GYNA 3GG1A 4I6VA 3NSNA 1ME8A 1HL8A 4HZ7A 2PGFA 4US6A 1Y0EA 4J3VA 4FS9A 4GPNA 3W7KA 3LSCA 3N2TA 3UEQA 3BC9A 1SFSA 3E1F1 4AWSA 3S6TA 4Q22A 1O1ZA 1IXQA 2QAFA 3N2MA 1G01A 4IGMA 2WJFA 1EJTC 1HO4A 4K36A 4POCA 1XKYA 4P5UA 3T78A 4RZBA 1PDYA 2Z1BA 2HVMA 1JPKA 4MNJA 1OCBA 2QUUA 3THQA 1BD0A 4NZ3A 1D3HA 5C9WA 3VD3A 2I7GA 1VFHA 2Z2UA 3SCNA 1CXFA 4MTVA 2A3CA 2DSWA 1BYDA 2X42A 4H6QA 1EBHA 2C1GA 3LS9A 5CPOA 4HSOA 1FH8A 1D9EA 1CBGA 4YPJA 1EC7A 4MPQA 3QEZA 1XIGA 3VVGA 4DB7A 3G6LA 2XGIA 2OQYA 3DDMA 5IFTA 3GHSA 1OFRA 2PSNA 1CGTA 3VKBA 1B90A 3PF3A 4PMJA 3KHJA 2V3DA 3GLCA 1AW2A 2CHRA 3OIXA 1H11A 1UR4A 2WV8A 1YDOA 4FX7A 4W87A 4HU8A 2WKGA 2G3NA 4DYEA 1I6NA 1Q6LA 3SJ3A 3FLUA 4QROA 1DJQA 4YMZA 2QPUA 1JYWA 3P3BA 1BRLB 3NGFA 4GOAA 1E6ZA 2VC6A 1IHIA 2DIKA 1WUFA 4H7ZA 1TJ0A 3ZSTA 4GH3A 1FCBA 1OABA 5JU6A 1ZUAX 2VEGA 1A5SA 3R8RA 4Q8NA 4REQA 1V4YA 3WLNA 2PDGA 3KVLA 1ZHAA 3PUGA 3AZTA 3R4IA 3YPIA 4V27A 4C1NB 2YL6A 3EOOA 3LHZA 1UOKA 4C1LA 2OQHA 3IIVA 4M1BA 4KT2A 2ZRUA 4X9YA 2XFYA 2FJKA 3TC7A 1T41A 2FB2A 2YFOA 3LD5A 3D46A 4ADUA 5M03A 1OC6A 3N04A 3PNUA 1FY6A 3HPZA 3MYOA 4NZ5A 2JDIG 2V3EA 1VPXA 1P7TB 3FNDA 5HR6A 5F4WA 4Q8OA 2ZRYA 1ELSA 5TQLA 1J2WA 3MI6A 5H2ZA 3V16A 3SCVA 4ATDA 2J7BA 2NXIA 3MBFA 1XIMA 4DO7A 3AI0A 1YIXA 1UP3A 2PDQA 5AHEA 3CZLA 4N2YA 3ZWTA 1JI2A 3GR8A 4GZEA 4Q8QA 4DBWA 1SFJA 3N2BA 3WNLA 1JG9A 5E0KA 3LGDA 3APYA 5AHLA 2WMJA 4GHRA 3WQFA 1P0DA 4IWWA 4PMNA 5JQ9A 4Z1MG 2HISA 1HVQA 4ACZB 4AZBA 8CGTA 4EIVA 1Z8AA 4DNMA 1M7JA 1MRAA 3SCTA 2WNZA 2ZRWA 3B8WA 3RN6A 3W37A 1X39A 2J77A 5C2CA 4XO6A 4Y9PA 1LQ2A 3EDKA 2A7RA 4LAKA 4ZO6A 2DZVA 1MNSA 1G4PA 3TTOA 2WMHA 1ZJAA 1CB7B 3NQAA 1Q8JA 2E1DA 3WFZA 2R24A 3Q37A 3O1NA 1UMYA 3U2ZA 1O68A 5FJIA 1MQQA 3B8TA 2Y85A 4NJJA 4G1KA 1VLWA 1JUEA 4WDUA 1CI1A 4XZMX 1W9VA 3T4CA 5A1AA 2H8XA 4JKLA 2G50A 5HJXA 4I9AA 4KESA 3OIHA 2Z2BA 3VNDA 4F3HA 4UTUA 1NF7A 2REQA 3BCJA 3LLXA 3RPMA 5I3HA 1FKWA 8XIAA 1K3UA 2PDIA 4J2MA 5EMLA 1L6FA 3TYZA 1HQTA 1RXOB 4X3ZA 1YW1A 3K30A 2XNDG 1XUZA 2QPSA 3BL3A 3STFA 4AXKA 2VR4A 1HT6A 4KETA 5G1TA 3CTTA 1M5WA 2VOTA 2ZZ1A 2Z25A 1ICSA 5HMFA 4GY1A 4P7RA 4AIEA 1KD0A 3RCMA 2QE7G 2GQ8A 2RFGA 3KBVA 5E0FA 4PTXA 5D4YA 4JIEA 3TQ0A 3KCOA 1B1YA 4PTDA 4A4AA 1SZEA 3QGKC 3W7EA 1I2NA 1PS9A 3OGVA 3TXVA 5EU9A 2F38A 4DM2A 1Q8AA 1WXZA 3LRMA 3MUAA 4AX6A 5HPOA 3GVVA 2WB5A 1PZ0A 4XAPA 1QK0A 4ONVA 4IG2B 3QF0A 3GD6A 5LNVA 2XGBA 3LBOA 5LIKX 3AXMA 1RH9A 3L67A 2C0HA 2NWRA 3S5YA 2QCHA 4KCVA 3WEZA 3L65A 1PZ2A 4RE3A 5DT7A 1UH4A 2DZAA 1YTDA 3W23A 3EKLA 5BXRA 3TAKA 1PO9A 3CWHA 1W5NA 3NAVA 1JDEA 4UBPC 1F8IA 3ZJ7A 4JTCA 5HNRA 2ISFA 1IT7A 5AZ0A 2W92A 1TPC1 3HQOA 1V3HA 3QBUA 1MUMA 1GJPA 3TJ4A 2R91A 1W5MA 2QCGA 3QR0A 1ZCCA 3TLLA 4LV4A 3QR3A 2EG8A 1RK6A 4MJ2A 2OMAA 5BMWA 3GC2A 2X8RA 5BNKA 4CNOA 5I3JA 1WDPA 3ZVHA 1XLHA 2EG7A 3N3TA 2IQTA 1Y5VA 2OSYA 4ZO9A 3WDJA 1K9TA 3L9CA 3EOEA 2PU1A 3I6TA 1E6RA 2INZA 2PURA